data_2PRF
# 
_entry.id   2PRF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PRF         
WWPDB D_1000178496 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2PRF 
_pdbx_database_status.recvd_initial_deposition_date   1994-01-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Archer, S.J.'  1 
'Vinson, V.K.'  2 
'Pollard, T.D.' 3 
'Lattman, E.E.' 4 
'Torchia, D.A.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Three-dimensional solution structure of Acanthamoeba profilin-I.' 'J.Cell Biol.' 122 1277 1283 1993 JCLBA3 US 0021-9525 
2019 ? 8397216 10.1083/jcb.122.6.1277 
1       
'Secondary Structure and Topology of Acanthamoeba Profilin I as Determined by Heteronuclear Nuclear Magnetic Resonance Spectroscopy' 
Biochemistry   32  6680 ?    1993 BICHAW US 0006-2960 0033 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vinson, V.K.'  1 
primary 'Archer, S.J.'  2 
primary 'Lattman, E.E.' 3 
primary 'Pollard, T.D.' 4 
primary 'Torchia, D.A.' 5 
1       'Archer, S.J.'  6 
1       'Vinson, V.K.'  7 
1       'Pollard, T.D.' 8 
1       'Torchia, D.A.' 9 
# 
_cell.entry_id           2PRF 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2PRF 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROFILIN IA' 
_entity.formula_weight             12962.446 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGK
KGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGK
KGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TRP n 
1 3   GLN n 
1 4   THR n 
1 5   TYR n 
1 6   VAL n 
1 7   ASP n 
1 8   THR n 
1 9   ASN n 
1 10  LEU n 
1 11  VAL n 
1 12  GLY n 
1 13  THR n 
1 14  GLY n 
1 15  ALA n 
1 16  VAL n 
1 17  THR n 
1 18  GLN n 
1 19  ALA n 
1 20  ALA n 
1 21  ILE n 
1 22  LEU n 
1 23  GLY n 
1 24  LEU n 
1 25  ASP n 
1 26  GLY n 
1 27  ASN n 
1 28  THR n 
1 29  TRP n 
1 30  ALA n 
1 31  THR n 
1 32  SER n 
1 33  ALA n 
1 34  GLY n 
1 35  PHE n 
1 36  ALA n 
1 37  VAL n 
1 38  THR n 
1 39  PRO n 
1 40  ALA n 
1 41  GLN n 
1 42  GLY n 
1 43  GLN n 
1 44  THR n 
1 45  LEU n 
1 46  ALA n 
1 47  SER n 
1 48  ALA n 
1 49  PHE n 
1 50  ASN n 
1 51  ASN n 
1 52  ALA n 
1 53  ASP n 
1 54  PRO n 
1 55  ILE n 
1 56  ARG n 
1 57  ALA n 
1 58  SER n 
1 59  GLY n 
1 60  PHE n 
1 61  ASP n 
1 62  LEU n 
1 63  ALA n 
1 64  GLY n 
1 65  VAL n 
1 66  HIS n 
1 67  TYR n 
1 68  VAL n 
1 69  THR n 
1 70  LEU n 
1 71  ARG n 
1 72  ALA n 
1 73  ASP n 
1 74  ASP n 
1 75  ARG n 
1 76  SER n 
1 77  ILE n 
1 78  TYR n 
1 79  GLY n 
1 80  LYS n 
1 81  LYS n 
1 82  GLY n 
1 83  SER n 
1 84  ALA n 
1 85  GLY n 
1 86  VAL n 
1 87  ILE n 
1 88  THR n 
1 89  VAL n 
1 90  LYS n 
1 91  THR n 
1 92  SER n 
1 93  LYS n 
1 94  SER n 
1 95  ILE n 
1 96  LEU n 
1 97  VAL n 
1 98  GLY n 
1 99  VAL n 
1 100 TYR n 
1 101 ASN n 
1 102 GLU n 
1 103 LYS n 
1 104 ILE n 
1 105 GLN n 
1 106 PRO n 
1 107 GLY n 
1 108 THR n 
1 109 ALA n 
1 110 ALA n 
1 111 ASN n 
1 112 VAL n 
1 113 VAL n 
1 114 GLU n 
1 115 LYS n 
1 116 LEU n 
1 117 ALA n 
1 118 ASP n 
1 119 TYR n 
1 120 LEU n 
1 121 ILE n 
1 122 GLY n 
1 123 GLN n 
1 124 GLY n 
1 125 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Acanthamoeba 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Acanthamoeba sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5756 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRO1_ACACA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P07763 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGK
KGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2PRF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07763 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             2PRF 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    19 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          2PRF 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2PRF 
_struct.title                     'THREE DIMENSIONAL SOLUTION STRUCTURE OF ACANTHAMOEBA PROFILIN I' 
_struct.pdbx_descriptor           'PROFILIN IA (NMR, 19 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PRF 
_struct_keywords.pdbx_keywords   ACTIN-BINDING 
_struct_keywords.text            ACTIN-BINDING 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 GLN A 3   ? ASP A 7   ? GLN A 3   ASP A 7   1 'THIS HELIX MAY INCLUDE T8-V11' 5  
HELX_P HELX_P2 H2 ALA A 40  ? PHE A 49  ? ALA A 40  PHE A 49  1 'D53-R56 FORM A HELICAL TURN'   10 
HELX_P HELX_P3 H3 ALA A 109 ? ILE A 121 ? ALA A 109 ILE A 121 1 ?                               13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 5 ? 
S2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S1 2 3 ? anti-parallel 
S1 3 4 ? anti-parallel 
S1 4 5 ? anti-parallel 
S2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 ALA A 30 ? ALA A 33  ? ALA A 30 ALA A 33  
S1 2 GLN A 18 ? LEU A 22  ? GLN A 18 LEU A 22  
S1 3 SER A 94 ? ASN A 101 ? SER A 94 ASN A 101 
S1 4 ALA A 84 ? THR A 91  ? ALA A 84 THR A 91  
S1 5 SER A 76 ? LYS A 81  ? SER A 76 LYS A 81  
S2 1 PHE A 60 ? LEU A 62  ? PHE A 60 LEU A 62  
S2 2 VAL A 65 ? VAL A 68  ? VAL A 65 VAL A 68  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 N SER A 32 ? N SER A 32 O ALA A 19 ? O ALA A 19 
S1 2 3 N ALA A 20 ? N ALA A 20 O VAL A 97 ? O VAL A 97 
S1 3 4 N GLY A 98 ? N GLY A 98 O ILE A 87 ? O ILE A 87 
S1 4 5 N VAL A 86 ? N VAL A 86 O GLY A 79 ? O GLY A 79 
S2 1 2 O PHE A 60 ? O PHE A 60 N TYR A 67 ? N TYR A 67 
# 
_database_PDB_matrix.entry_id          2PRF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2PRF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? 8.486   7.770   0.079   1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? 9.643   6.906   0.448   1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? 9.885   5.874   -0.655  1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? 11.004  5.641   -1.066  1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? 9.341   6.186   1.762   1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? 10.270  5.125   1.941   1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? 7.963   7.333   -0.706  1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? 7.856   7.874   0.900   1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? 8.832   8.704   -0.215  1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? 10.525  7.518   0.568   1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? 9.431   6.878   2.582   1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? 8.332   5.794   1.733   1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? 11.084  5.366   1.493   1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . TRP A 1 2   ? 8.844   5.254   -1.140  1.00 0.00 ? 2   TRP A N    1  
ATOM 15    C CA   . TRP A 1 2   ? 9.016   4.241   -2.219  1.00 0.00 ? 2   TRP A CA   1  
ATOM 16    C C    . TRP A 1 2   ? 9.296   4.953   -3.544  1.00 0.00 ? 2   TRP A C    1  
ATOM 17    O O    . TRP A 1 2   ? 9.480   4.326   -4.565  1.00 0.00 ? 2   TRP A O    1  
ATOM 18    C CB   . TRP A 1 2   ? 7.734   3.416   -2.359  1.00 0.00 ? 2   TRP A CB   1  
ATOM 19    C CG   . TRP A 1 2   ? 7.771   2.246   -1.428  1.00 0.00 ? 2   TRP A CG   1  
ATOM 20    C CD1  . TRP A 1 2   ? 7.778   0.948   -1.814  1.00 0.00 ? 2   TRP A CD1  1  
ATOM 21    C CD2  . TRP A 1 2   ? 7.798   2.238   0.029   1.00 0.00 ? 2   TRP A CD2  1  
ATOM 22    N NE1  . TRP A 1 2   ? 7.808   0.146   -0.687  1.00 0.00 ? 2   TRP A NE1  1  
ATOM 23    C CE2  . TRP A 1 2   ? 7.821   0.894   0.473   1.00 0.00 ? 2   TRP A CE2  1  
ATOM 24    C CE3  . TRP A 1 2   ? 7.804   3.257   0.999   1.00 0.00 ? 2   TRP A CE3  1  
ATOM 25    C CZ2  . TRP A 1 2   ? 7.849   0.573   1.832   1.00 0.00 ? 2   TRP A CZ2  1  
ATOM 26    C CZ3  . TRP A 1 2   ? 7.833   2.937   2.366   1.00 0.00 ? 2   TRP A CZ3  1  
ATOM 27    C CH2  . TRP A 1 2   ? 7.855   1.598   2.782   1.00 0.00 ? 2   TRP A CH2  1  
ATOM 28    H H    . TRP A 1 2   ? 7.949   5.457   -0.796  1.00 0.00 ? 2   TRP A H    1  
ATOM 29    H HA   . TRP A 1 2   ? 9.841   3.588   -1.976  1.00 0.00 ? 2   TRP A HA   1  
ATOM 30    H HB2  . TRP A 1 2   ? 6.881   4.035   -2.121  1.00 0.00 ? 2   TRP A HB2  1  
ATOM 31    H HB3  . TRP A 1 2   ? 7.646   3.062   -3.375  1.00 0.00 ? 2   TRP A HB3  1  
ATOM 32    H HD1  . TRP A 1 2   ? 7.763   0.597   -2.835  1.00 0.00 ? 2   TRP A HD1  1  
ATOM 33    H HE1  . TRP A 1 2   ? 7.819   -0.834  -0.691  1.00 0.00 ? 2   TRP A HE1  1  
ATOM 34    H HE3  . TRP A 1 2   ? 7.788   4.291   0.691   1.00 0.00 ? 2   TRP A HE3  1  
ATOM 35    H HZ2  . TRP A 1 2   ? 7.864   -0.461  2.147   1.00 0.00 ? 2   TRP A HZ2  1  
ATOM 36    H HZ3  . TRP A 1 2   ? 7.839   3.727   3.102   1.00 0.00 ? 2   TRP A HZ3  1  
ATOM 37    H HH2  . TRP A 1 2   ? 7.878   1.358   3.835   1.00 0.00 ? 2   TRP A HH2  1  
ATOM 38    N N    . GLN A 1 3   ? 9.311   6.258   -3.543  1.00 0.00 ? 3   GLN A N    1  
ATOM 39    C CA   . GLN A 1 3   ? 9.564   6.999   -4.812  1.00 0.00 ? 3   GLN A CA   1  
ATOM 40    C C    . GLN A 1 3   ? 10.873  6.514   -5.436  1.00 0.00 ? 3   GLN A C    1  
ATOM 41    O O    . GLN A 1 3   ? 10.886  5.901   -6.486  1.00 0.00 ? 3   GLN A O    1  
ATOM 42    C CB   . GLN A 1 3   ? 9.665   8.497   -4.517  1.00 0.00 ? 3   GLN A CB   1  
ATOM 43    C CG   . GLN A 1 3   ? 9.649   9.278   -5.832  1.00 0.00 ? 3   GLN A CG   1  
ATOM 44    C CD   . GLN A 1 3   ? 11.008  9.945   -6.047  1.00 0.00 ? 3   GLN A CD   1  
ATOM 45    O OE1  . GLN A 1 3   ? 11.983  9.283   -6.342  1.00 0.00 ? 3   GLN A OE1  1  
ATOM 46    N NE2  . GLN A 1 3   ? 11.116  11.238  -5.912  1.00 0.00 ? 3   GLN A NE2  1  
ATOM 47    H H    . GLN A 1 3   ? 9.145   6.751   -2.712  1.00 0.00 ? 3   GLN A H    1  
ATOM 48    H HA   . GLN A 1 3   ? 8.751   6.823   -5.500  1.00 0.00 ? 3   GLN A HA   1  
ATOM 49    H HB2  . GLN A 1 3   ? 8.827   8.800   -3.905  1.00 0.00 ? 3   GLN A HB2  1  
ATOM 50    H HB3  . GLN A 1 3   ? 10.586  8.699   -3.991  1.00 0.00 ? 3   GLN A HB3  1  
ATOM 51    H HG2  . GLN A 1 3   ? 9.447   8.601   -6.650  1.00 0.00 ? 3   GLN A HG2  1  
ATOM 52    H HG3  . GLN A 1 3   ? 8.881   10.036  -5.792  1.00 0.00 ? 3   GLN A HG3  1  
ATOM 53    H HE21 . GLN A 1 3   ? 10.330  11.774  -5.674  1.00 0.00 ? 3   GLN A HE21 1  
ATOM 54    H HE22 . GLN A 1 3   ? 11.983  11.674  -6.049  1.00 0.00 ? 3   GLN A HE22 1  
ATOM 55    N N    . THR A 1 4   ? 11.977  6.786   -4.798  1.00 0.00 ? 4   THR A N    1  
ATOM 56    C CA   . THR A 1 4   ? 13.284  6.343   -5.354  1.00 0.00 ? 4   THR A CA   1  
ATOM 57    C C    . THR A 1 4   ? 13.352  4.816   -5.345  1.00 0.00 ? 4   THR A C    1  
ATOM 58    O O    . THR A 1 4   ? 13.985  4.214   -6.184  1.00 0.00 ? 4   THR A O    1  
ATOM 59    C CB   . THR A 1 4   ? 14.421  6.909   -4.499  1.00 0.00 ? 4   THR A CB   1  
ATOM 60    O OG1  . THR A 1 4   ? 14.072  8.214   -4.055  1.00 0.00 ? 4   THR A OG1  1  
ATOM 61    C CG2  . THR A 1 4   ? 15.702  6.974   -5.330  1.00 0.00 ? 4   THR A CG2  1  
ATOM 62    H H    . THR A 1 4   ? 11.946  7.283   -3.954  1.00 0.00 ? 4   THR A H    1  
ATOM 63    H HA   . THR A 1 4   ? 13.384  6.700   -6.371  1.00 0.00 ? 4   THR A HA   1  
ATOM 64    H HB   . THR A 1 4   ? 14.583  6.269   -3.646  1.00 0.00 ? 4   THR A HB   1  
ATOM 65    H HG1  . THR A 1 4   ? 14.884  8.690   -3.866  1.00 0.00 ? 4   THR A HG1  1  
ATOM 66    H HG21 . THR A 1 4   ? 15.580  6.385   -6.227  1.00 0.00 ? 4   THR A HG21 1  
ATOM 67    H HG22 . THR A 1 4   ? 15.906  8.000   -5.599  1.00 0.00 ? 4   THR A HG22 1  
ATOM 68    H HG23 . THR A 1 4   ? 16.527  6.583   -4.752  1.00 0.00 ? 4   THR A HG23 1  
ATOM 69    N N    . TYR A 1 5   ? 12.707  4.183   -4.404  1.00 0.00 ? 5   TYR A N    1  
ATOM 70    C CA   . TYR A 1 5   ? 12.742  2.693   -4.353  1.00 0.00 ? 5   TYR A CA   1  
ATOM 71    C C    . TYR A 1 5   ? 11.714  2.124   -5.338  1.00 0.00 ? 5   TYR A C    1  
ATOM 72    O O    . TYR A 1 5   ? 11.600  0.928   -5.515  1.00 0.00 ? 5   TYR A O    1  
ATOM 73    C CB   . TYR A 1 5   ? 12.407  2.222   -2.935  1.00 0.00 ? 5   TYR A CB   1  
ATOM 74    C CG   . TYR A 1 5   ? 13.257  2.961   -1.928  1.00 0.00 ? 5   TYR A CG   1  
ATOM 75    C CD1  . TYR A 1 5   ? 14.473  3.535   -2.317  1.00 0.00 ? 5   TYR A CD1  1  
ATOM 76    C CD2  . TYR A 1 5   ? 12.827  3.067   -0.599  1.00 0.00 ? 5   TYR A CD2  1  
ATOM 77    C CE1  . TYR A 1 5   ? 15.259  4.214   -1.379  1.00 0.00 ? 5   TYR A CE1  1  
ATOM 78    C CE2  . TYR A 1 5   ? 13.613  3.747   0.339   1.00 0.00 ? 5   TYR A CE2  1  
ATOM 79    C CZ   . TYR A 1 5   ? 14.829  4.320   -0.051  1.00 0.00 ? 5   TYR A CZ   1  
ATOM 80    O OH   . TYR A 1 5   ? 15.605  4.990   0.874   1.00 0.00 ? 5   TYR A OH   1  
ATOM 81    H H    . TYR A 1 5   ? 12.199  4.686   -3.733  1.00 0.00 ? 5   TYR A H    1  
ATOM 82    H HA   . TYR A 1 5   ? 13.729  2.346   -4.624  1.00 0.00 ? 5   TYR A HA   1  
ATOM 83    H HB2  . TYR A 1 5   ? 11.363  2.410   -2.730  1.00 0.00 ? 5   TYR A HB2  1  
ATOM 84    H HB3  . TYR A 1 5   ? 12.602  1.165   -2.853  1.00 0.00 ? 5   TYR A HB3  1  
ATOM 85    H HD1  . TYR A 1 5   ? 14.806  3.453   -3.342  1.00 0.00 ? 5   TYR A HD1  1  
ATOM 86    H HD2  . TYR A 1 5   ? 11.888  2.624   -0.298  1.00 0.00 ? 5   TYR A HD2  1  
ATOM 87    H HE1  . TYR A 1 5   ? 16.198  4.657   -1.679  1.00 0.00 ? 5   TYR A HE1  1  
ATOM 88    H HE2  . TYR A 1 5   ? 13.281  3.828   1.364   1.00 0.00 ? 5   TYR A HE2  1  
ATOM 89    H HH   . TYR A 1 5   ? 16.361  5.361   0.413   1.00 0.00 ? 5   TYR A HH   1  
ATOM 90    N N    . VAL A 1 6   ? 10.965  2.972   -5.984  1.00 0.00 ? 6   VAL A N    1  
ATOM 91    C CA   . VAL A 1 6   ? 9.947   2.484   -6.954  1.00 0.00 ? 6   VAL A CA   1  
ATOM 92    C C    . VAL A 1 6   ? 10.633  2.219   -8.298  1.00 0.00 ? 6   VAL A C    1  
ATOM 93    O O    . VAL A 1 6   ? 10.344  1.254   -8.978  1.00 0.00 ? 6   VAL A O    1  
ATOM 94    C CB   . VAL A 1 6   ? 8.840   3.555   -7.102  1.00 0.00 ? 6   VAL A CB   1  
ATOM 95    C CG1  . VAL A 1 6   ? 8.438   3.741   -8.572  1.00 0.00 ? 6   VAL A CG1  1  
ATOM 96    C CG2  . VAL A 1 6   ? 7.605   3.129   -6.303  1.00 0.00 ? 6   VAL A CG2  1  
ATOM 97    H H    . VAL A 1 6   ? 11.074  3.932   -5.833  1.00 0.00 ? 6   VAL A H    1  
ATOM 98    H HA   . VAL A 1 6   ? 9.512   1.567   -6.586  1.00 0.00 ? 6   VAL A HA   1  
ATOM 99    H HB   . VAL A 1 6   ? 9.206   4.495   -6.716  1.00 0.00 ? 6   VAL A HB   1  
ATOM 100   H HG11 . VAL A 1 6   ? 8.182   2.783   -9.000  1.00 0.00 ? 6   VAL A HG11 1  
ATOM 101   H HG12 . VAL A 1 6   ? 7.585   4.401   -8.632  1.00 0.00 ? 6   VAL A HG12 1  
ATOM 102   H HG13 . VAL A 1 6   ? 9.264   4.171   -9.120  1.00 0.00 ? 6   VAL A HG13 1  
ATOM 103   H HG21 . VAL A 1 6   ? 7.872   2.999   -5.266  1.00 0.00 ? 6   VAL A HG21 1  
ATOM 104   H HG22 . VAL A 1 6   ? 6.843   3.892   -6.385  1.00 0.00 ? 6   VAL A HG22 1  
ATOM 105   H HG23 . VAL A 1 6   ? 7.222   2.200   -6.696  1.00 0.00 ? 6   VAL A HG23 1  
ATOM 106   N N    . ASP A 1 7   ? 11.523  3.084   -8.692  1.00 0.00 ? 7   ASP A N    1  
ATOM 107   C CA   . ASP A 1 7   ? 12.211  2.901   -10.000 1.00 0.00 ? 7   ASP A CA   1  
ATOM 108   C C    . ASP A 1 7   ? 13.496  2.083   -9.838  1.00 0.00 ? 7   ASP A C    1  
ATOM 109   O O    . ASP A 1 7   ? 14.535  2.454   -10.347 1.00 0.00 ? 7   ASP A O    1  
ATOM 110   C CB   . ASP A 1 7   ? 12.564  4.273   -10.571 1.00 0.00 ? 7   ASP A CB   1  
ATOM 111   C CG   . ASP A 1 7   ? 12.478  4.230   -12.098 1.00 0.00 ? 7   ASP A CG   1  
ATOM 112   O OD1  . ASP A 1 7   ? 13.363  3.650   -12.705 1.00 0.00 ? 7   ASP A OD1  1  
ATOM 113   O OD2  . ASP A 1 7   ? 11.528  4.775   -12.634 1.00 0.00 ? 7   ASP A OD2  1  
ATOM 114   H H    . ASP A 1 7   ? 11.728  3.865   -8.134  1.00 0.00 ? 7   ASP A H    1  
ATOM 115   H HA   . ASP A 1 7   ? 11.547  2.392   -10.682 1.00 0.00 ? 7   ASP A HA   1  
ATOM 116   H HB2  . ASP A 1 7   ? 11.871  5.010   -10.188 1.00 0.00 ? 7   ASP A HB2  1  
ATOM 117   H HB3  . ASP A 1 7   ? 13.568  4.535   -10.275 1.00 0.00 ? 7   ASP A HB3  1  
ATOM 118   N N    . THR A 1 8   ? 13.448  0.971   -9.154  1.00 0.00 ? 8   THR A N    1  
ATOM 119   C CA   . THR A 1 8   ? 14.689  0.158   -9.005  1.00 0.00 ? 8   THR A CA   1  
ATOM 120   C C    . THR A 1 8   ? 14.360  -1.248  -8.487  1.00 0.00 ? 8   THR A C    1  
ATOM 121   O O    . THR A 1 8   ? 14.030  -2.135  -9.250  1.00 0.00 ? 8   THR A O    1  
ATOM 122   C CB   . THR A 1 8   ? 15.653  0.857   -8.044  1.00 0.00 ? 8   THR A CB   1  
ATOM 123   O OG1  . THR A 1 8   ? 16.532  -0.102  -7.472  1.00 0.00 ? 8   THR A OG1  1  
ATOM 124   C CG2  . THR A 1 8   ? 14.864  1.556   -6.940  1.00 0.00 ? 8   THR A CG2  1  
ATOM 125   H H    . THR A 1 8   ? 12.607  0.672   -8.753  1.00 0.00 ? 8   THR A H    1  
ATOM 126   H HA   . THR A 1 8   ? 15.164  0.070   -9.971  1.00 0.00 ? 8   THR A HA   1  
ATOM 127   H HB   . THR A 1 8   ? 16.228  1.591   -8.587  1.00 0.00 ? 8   THR A HB   1  
ATOM 128   H HG1  . THR A 1 8   ? 17.219  0.372   -6.996  1.00 0.00 ? 8   THR A HG1  1  
ATOM 129   H HG21 . THR A 1 8   ? 13.825  1.268   -7.000  1.00 0.00 ? 8   THR A HG21 1  
ATOM 130   H HG22 . THR A 1 8   ? 15.263  1.274   -5.977  1.00 0.00 ? 8   THR A HG22 1  
ATOM 131   H HG23 . THR A 1 8   ? 14.949  2.623   -7.066  1.00 0.00 ? 8   THR A HG23 1  
ATOM 132   N N    . ASN A 1 9   ? 14.472  -1.471  -7.205  1.00 0.00 ? 9   ASN A N    1  
ATOM 133   C CA   . ASN A 1 9   ? 14.192  -2.833  -6.658  1.00 0.00 ? 9   ASN A CA   1  
ATOM 134   C C    . ASN A 1 9   ? 12.805  -2.890  -6.019  1.00 0.00 ? 9   ASN A C    1  
ATOM 135   O O    . ASN A 1 9   ? 11.927  -3.555  -6.513  1.00 0.00 ? 9   ASN A O    1  
ATOM 136   C CB   . ASN A 1 9   ? 15.244  -3.181  -5.603  1.00 0.00 ? 9   ASN A CB   1  
ATOM 137   C CG   . ASN A 1 9   ? 15.792  -4.583  -5.876  1.00 0.00 ? 9   ASN A CG   1  
ATOM 138   O OD1  . ASN A 1 9   ? 15.193  -5.568  -5.491  1.00 0.00 ? 9   ASN A OD1  1  
ATOM 139   N ND2  . ASN A 1 9   ? 16.915  -4.715  -6.528  1.00 0.00 ? 9   ASN A ND2  1  
ATOM 140   H H    . ASN A 1 9   ? 14.754  -0.752  -6.606  1.00 0.00 ? 9   ASN A H    1  
ATOM 141   H HA   . ASN A 1 9   ? 14.243  -3.557  -7.459  1.00 0.00 ? 9   ASN A HA   1  
ATOM 142   H HB2  . ASN A 1 9   ? 16.050  -2.462  -5.649  1.00 0.00 ? 9   ASN A HB2  1  
ATOM 143   H HB3  . ASN A 1 9   ? 14.793  -3.155  -4.621  1.00 0.00 ? 9   ASN A HB3  1  
ATOM 144   H HD21 . ASN A 1 9   ? 17.398  -3.921  -6.837  1.00 0.00 ? 9   ASN A HD21 1  
ATOM 145   H HD22 . ASN A 1 9   ? 17.273  -5.609  -6.710  1.00 0.00 ? 9   ASN A HD22 1  
ATOM 146   N N    . LEU A 1 10  ? 12.628  -2.215  -4.911  1.00 0.00 ? 10  LEU A N    1  
ATOM 147   C CA   . LEU A 1 10  ? 11.317  -2.222  -4.180  1.00 0.00 ? 10  LEU A CA   1  
ATOM 148   C C    . LEU A 1 10  ? 10.145  -2.581  -5.101  1.00 0.00 ? 10  LEU A C    1  
ATOM 149   O O    . LEU A 1 10  ? 9.276   -3.341  -4.729  1.00 0.00 ? 10  LEU A O    1  
ATOM 150   C CB   . LEU A 1 10  ? 11.074  -0.839  -3.578  1.00 0.00 ? 10  LEU A CB   1  
ATOM 151   C CG   . LEU A 1 10  ? 10.943  -0.955  -2.059  1.00 0.00 ? 10  LEU A CG   1  
ATOM 152   C CD1  . LEU A 1 10  ? 10.690  0.429   -1.458  1.00 0.00 ? 10  LEU A CD1  1  
ATOM 153   C CD2  . LEU A 1 10  ? 9.771   -1.876  -1.717  1.00 0.00 ? 10  LEU A CD2  1  
ATOM 154   H H    . LEU A 1 10  ? 13.378  -1.707  -4.538  1.00 0.00 ? 10  LEU A H    1  
ATOM 155   H HA   . LEU A 1 10  ? 11.367  -2.945  -3.380  1.00 0.00 ? 10  LEU A HA   1  
ATOM 156   H HB2  . LEU A 1 10  ? 11.906  -0.198  -3.818  1.00 0.00 ? 10  LEU A HB2  1  
ATOM 157   H HB3  . LEU A 1 10  ? 10.166  -0.421  -3.987  1.00 0.00 ? 10  LEU A HB3  1  
ATOM 158   H HG   . LEU A 1 10  ? 11.856  -1.363  -1.650  1.00 0.00 ? 10  LEU A HG   1  
ATOM 159   H HD11 . LEU A 1 10  ? 10.187  1.051   -2.183  1.00 0.00 ? 10  LEU A HD11 1  
ATOM 160   H HD12 . LEU A 1 10  ? 10.071  0.331   -0.578  1.00 0.00 ? 10  LEU A HD12 1  
ATOM 161   H HD13 . LEU A 1 10  ? 11.632  0.881   -1.187  1.00 0.00 ? 10  LEU A HD13 1  
ATOM 162   H HD21 . LEU A 1 10  ? 8.897   -1.569  -2.272  1.00 0.00 ? 10  LEU A HD21 1  
ATOM 163   H HD22 . LEU A 1 10  ? 10.024  -2.893  -1.978  1.00 0.00 ? 10  LEU A HD22 1  
ATOM 164   H HD23 . LEU A 1 10  ? 9.564   -1.817  -0.658  1.00 0.00 ? 10  LEU A HD23 1  
ATOM 165   N N    . VAL A 1 11  ? 10.095  -2.041  -6.287  1.00 0.00 ? 11  VAL A N    1  
ATOM 166   C CA   . VAL A 1 11  ? 8.951   -2.367  -7.188  1.00 0.00 ? 11  VAL A CA   1  
ATOM 167   C C    . VAL A 1 11  ? 9.288   -3.562  -8.085  1.00 0.00 ? 11  VAL A C    1  
ATOM 168   O O    . VAL A 1 11  ? 8.563   -4.536  -8.108  1.00 0.00 ? 11  VAL A O    1  
ATOM 169   C CB   . VAL A 1 11  ? 8.619   -1.152  -8.056  1.00 0.00 ? 11  VAL A CB   1  
ATOM 170   C CG1  . VAL A 1 11  ? 7.653   -1.561  -9.170  1.00 0.00 ? 11  VAL A CG1  1  
ATOM 171   C CG2  . VAL A 1 11  ? 7.966   -0.075  -7.190  1.00 0.00 ? 11  VAL A CG2  1  
ATOM 172   H H    . VAL A 1 11  ? 10.794  -1.420  -6.579  1.00 0.00 ? 11  VAL A H    1  
ATOM 173   H HA   . VAL A 1 11  ? 8.094   -2.623  -6.578  1.00 0.00 ? 11  VAL A HA   1  
ATOM 174   H HB   . VAL A 1 11  ? 9.528   -0.761  -8.494  1.00 0.00 ? 11  VAL A HB   1  
ATOM 175   H HG11 . VAL A 1 11  ? 6.780   -2.026  -8.736  1.00 0.00 ? 11  VAL A HG11 1  
ATOM 176   H HG12 . VAL A 1 11  ? 7.354   -0.686  -9.728  1.00 0.00 ? 11  VAL A HG12 1  
ATOM 177   H HG13 . VAL A 1 11  ? 8.142   -2.261  -9.832  1.00 0.00 ? 11  VAL A HG13 1  
ATOM 178   H HG21 . VAL A 1 11  ? 8.417   -0.080  -6.208  1.00 0.00 ? 11  VAL A HG21 1  
ATOM 179   H HG22 . VAL A 1 11  ? 8.113   0.891   -7.649  1.00 0.00 ? 11  VAL A HG22 1  
ATOM 180   H HG23 . VAL A 1 11  ? 6.908   -0.275  -7.101  1.00 0.00 ? 11  VAL A HG23 1  
ATOM 181   N N    . GLY A 1 12  ? 10.365  -3.498  -8.831  1.00 0.00 ? 12  GLY A N    1  
ATOM 182   C CA   . GLY A 1 12  ? 10.720  -4.647  -9.724  1.00 0.00 ? 12  GLY A CA   1  
ATOM 183   C C    . GLY A 1 12  ? 10.437  -5.949  -8.980  1.00 0.00 ? 12  GLY A C    1  
ATOM 184   O O    . GLY A 1 12  ? 9.799   -6.851  -9.486  1.00 0.00 ? 12  GLY A O    1  
ATOM 185   H H    . GLY A 1 12  ? 10.935  -2.701  -8.805  1.00 0.00 ? 12  GLY A H    1  
ATOM 186   H HA2  . GLY A 1 12  ? 10.122  -4.602  -10.623 1.00 0.00 ? 12  GLY A HA2  1  
ATOM 187   H HA3  . GLY A 1 12  ? 11.767  -4.600  -9.980  1.00 0.00 ? 12  GLY A HA3  1  
ATOM 188   N N    . THR A 1 13  ? 10.888  -6.030  -7.764  1.00 0.00 ? 13  THR A N    1  
ATOM 189   C CA   . THR A 1 13  ? 10.643  -7.235  -6.935  1.00 0.00 ? 13  THR A CA   1  
ATOM 190   C C    . THR A 1 13  ? 11.605  -7.222  -5.754  1.00 0.00 ? 13  THR A C    1  
ATOM 191   O O    . THR A 1 13  ? 12.136  -8.236  -5.348  1.00 0.00 ? 13  THR A O    1  
ATOM 192   C CB   . THR A 1 13  ? 10.845  -8.503  -7.756  1.00 0.00 ? 13  THR A CB   1  
ATOM 193   O OG1  . THR A 1 13  ? 11.200  -9.582  -6.903  1.00 0.00 ? 13  THR A OG1  1  
ATOM 194   C CG2  . THR A 1 13  ? 11.947  -8.283  -8.797  1.00 0.00 ? 13  THR A CG2  1  
ATOM 195   H H    . THR A 1 13  ? 11.378  -5.279  -7.384  1.00 0.00 ? 13  THR A H    1  
ATOM 196   H HA   . THR A 1 13  ? 9.618   -7.204  -6.568  1.00 0.00 ? 13  THR A HA   1  
ATOM 197   H HB   . THR A 1 13  ? 9.926   -8.735  -8.247  1.00 0.00 ? 13  THR A HB   1  
ATOM 198   H HG1  . THR A 1 13  ? 10.652  -10.336 -7.136  1.00 0.00 ? 13  THR A HG1  1  
ATOM 199   H HG21 . THR A 1 13  ? 12.482  -7.372  -8.569  1.00 0.00 ? 13  THR A HG21 1  
ATOM 200   H HG22 . THR A 1 13  ? 12.634  -9.116  -8.778  1.00 0.00 ? 13  THR A HG22 1  
ATOM 201   H HG23 . THR A 1 13  ? 11.505  -8.203  -9.779  1.00 0.00 ? 13  THR A HG23 1  
ATOM 202   N N    . GLY A 1 14  ? 11.805  -6.079  -5.167  1.00 0.00 ? 14  GLY A N    1  
ATOM 203   C CA   . GLY A 1 14  ? 12.697  -6.009  -3.982  1.00 0.00 ? 14  GLY A CA   1  
ATOM 204   C C    . GLY A 1 14  ? 11.846  -6.306  -2.750  1.00 0.00 ? 14  GLY A C    1  
ATOM 205   O O    . GLY A 1 14  ? 12.175  -5.928  -1.643  1.00 0.00 ? 14  GLY A O    1  
ATOM 206   H H    . GLY A 1 14  ? 11.344  -5.274  -5.487  1.00 0.00 ? 14  GLY A H    1  
ATOM 207   H HA2  . GLY A 1 14  ? 13.486  -6.742  -4.073  1.00 0.00 ? 14  GLY A HA2  1  
ATOM 208   H HA3  . GLY A 1 14  ? 13.120  -5.020  -3.898  1.00 0.00 ? 14  GLY A HA3  1  
ATOM 209   N N    . ALA A 1 15  ? 10.735  -6.973  -2.958  1.00 0.00 ? 15  ALA A N    1  
ATOM 210   C CA   . ALA A 1 15  ? 9.809   -7.306  -1.843  1.00 0.00 ? 15  ALA A CA   1  
ATOM 211   C C    . ALA A 1 15  ? 8.425   -7.454  -2.458  1.00 0.00 ? 15  ALA A C    1  
ATOM 212   O O    . ALA A 1 15  ? 7.625   -8.271  -2.049  1.00 0.00 ? 15  ALA A O    1  
ATOM 213   C CB   . ALA A 1 15  ? 9.795   -6.181  -0.804  1.00 0.00 ? 15  ALA A CB   1  
ATOM 214   H H    . ALA A 1 15  ? 10.495  -7.253  -3.875  1.00 0.00 ? 15  ALA A H    1  
ATOM 215   H HA   . ALA A 1 15  ? 10.108  -8.236  -1.382  1.00 0.00 ? 15  ALA A HA   1  
ATOM 216   H HB1  . ALA A 1 15  ? 10.180  -5.275  -1.248  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 217   H HB2  . ALA A 1 15  ? 8.783   -6.014  -0.466  1.00 0.00 ? 15  ALA A HB2  1  
ATOM 218   H HB3  . ALA A 1 15  ? 10.413  -6.461  0.037   1.00 0.00 ? 15  ALA A HB3  1  
ATOM 219   N N    . VAL A 1 16  ? 8.157   -6.672  -3.468  1.00 0.00 ? 16  VAL A N    1  
ATOM 220   C CA   . VAL A 1 16  ? 6.852   -6.754  -4.161  1.00 0.00 ? 16  VAL A CA   1  
ATOM 221   C C    . VAL A 1 16  ? 7.124   -6.744  -5.665  1.00 0.00 ? 16  VAL A C    1  
ATOM 222   O O    . VAL A 1 16  ? 7.953   -5.994  -6.143  1.00 0.00 ? 16  VAL A O    1  
ATOM 223   C CB   . VAL A 1 16  ? 5.974   -5.549  -3.784  1.00 0.00 ? 16  VAL A CB   1  
ATOM 224   C CG1  . VAL A 1 16  ? 4.905   -5.987  -2.784  1.00 0.00 ? 16  VAL A CG1  1  
ATOM 225   C CG2  . VAL A 1 16  ? 6.829   -4.447  -3.149  1.00 0.00 ? 16  VAL A CG2  1  
ATOM 226   H H    . VAL A 1 16  ? 8.834   -6.032  -3.790  1.00 0.00 ? 16  VAL A H    1  
ATOM 227   H HA   . VAL A 1 16  ? 6.352   -7.672  -3.888  1.00 0.00 ? 16  VAL A HA   1  
ATOM 228   H HB   . VAL A 1 16  ? 5.495   -5.166  -4.673  1.00 0.00 ? 16  VAL A HB   1  
ATOM 229   H HG11 . VAL A 1 16  ? 5.187   -6.933  -2.345  1.00 0.00 ? 16  VAL A HG11 1  
ATOM 230   H HG12 . VAL A 1 16  ? 4.811   -5.243  -2.008  1.00 0.00 ? 16  VAL A HG12 1  
ATOM 231   H HG13 . VAL A 1 16  ? 3.961   -6.095  -3.296  1.00 0.00 ? 16  VAL A HG13 1  
ATOM 232   H HG21 . VAL A 1 16  ? 7.399   -4.860  -2.330  1.00 0.00 ? 16  VAL A HG21 1  
ATOM 233   H HG22 . VAL A 1 16  ? 7.502   -4.043  -3.889  1.00 0.00 ? 16  VAL A HG22 1  
ATOM 234   H HG23 . VAL A 1 16  ? 6.186   -3.661  -2.780  1.00 0.00 ? 16  VAL A HG23 1  
ATOM 235   N N    . THR A 1 17  ? 6.443   -7.559  -6.420  1.00 0.00 ? 17  THR A N    1  
ATOM 236   C CA   . THR A 1 17  ? 6.685   -7.569  -7.891  1.00 0.00 ? 17  THR A CA   1  
ATOM 237   C C    . THR A 1 17  ? 5.972   -6.369  -8.518  1.00 0.00 ? 17  THR A C    1  
ATOM 238   O O    . THR A 1 17  ? 5.992   -6.172  -9.717  1.00 0.00 ? 17  THR A O    1  
ATOM 239   C CB   . THR A 1 17  ? 6.133   -8.864  -8.493  1.00 0.00 ? 17  THR A CB   1  
ATOM 240   O OG1  . THR A 1 17  ? 4.738   -8.947  -8.236  1.00 0.00 ? 17  THR A OG1  1  
ATOM 241   C CG2  . THR A 1 17  ? 6.842   -10.063 -7.864  1.00 0.00 ? 17  THR A CG2  1  
ATOM 242   H H    . THR A 1 17  ? 5.775   -8.157  -6.024  1.00 0.00 ? 17  THR A H    1  
ATOM 243   H HA   . THR A 1 17  ? 7.746   -7.502  -8.084  1.00 0.00 ? 17  THR A HA   1  
ATOM 244   H HB   . THR A 1 17  ? 6.305   -8.868  -9.558  1.00 0.00 ? 17  THR A HB   1  
ATOM 245   H HG1  . THR A 1 17  ? 4.280   -8.952  -9.080  1.00 0.00 ? 17  THR A HG1  1  
ATOM 246   H HG21 . THR A 1 17  ? 7.702   -9.722  -7.307  1.00 0.00 ? 17  THR A HG21 1  
ATOM 247   H HG22 . THR A 1 17  ? 6.163   -10.577 -7.200  1.00 0.00 ? 17  THR A HG22 1  
ATOM 248   H HG23 . THR A 1 17  ? 7.164   -10.739 -8.643  1.00 0.00 ? 17  THR A HG23 1  
ATOM 249   N N    . GLN A 1 18  ? 5.353   -5.561  -7.701  1.00 0.00 ? 18  GLN A N    1  
ATOM 250   C CA   . GLN A 1 18  ? 4.634   -4.355  -8.202  1.00 0.00 ? 18  GLN A CA   1  
ATOM 251   C C    . GLN A 1 18  ? 4.422   -3.404  -7.022  1.00 0.00 ? 18  GLN A C    1  
ATOM 252   O O    . GLN A 1 18  ? 4.317   -3.831  -5.890  1.00 0.00 ? 18  GLN A O    1  
ATOM 253   C CB   . GLN A 1 18  ? 3.266   -4.749  -8.776  1.00 0.00 ? 18  GLN A CB   1  
ATOM 254   C CG   . GLN A 1 18  ? 3.314   -6.175  -9.329  1.00 0.00 ? 18  GLN A CG   1  
ATOM 255   C CD   . GLN A 1 18  ? 1.906   -6.608  -9.738  1.00 0.00 ? 18  GLN A CD   1  
ATOM 256   O OE1  . GLN A 1 18  ? 0.933   -5.982  -9.367  1.00 0.00 ? 18  GLN A OE1  1  
ATOM 257   N NE2  . GLN A 1 18  ? 1.755   -7.661  -10.493 1.00 0.00 ? 18  GLN A NE2  1  
ATOM 258   H H    . GLN A 1 18  ? 5.370   -5.744  -6.741  1.00 0.00 ? 18  GLN A H    1  
ATOM 259   H HA   . GLN A 1 18  ? 5.225   -3.868  -8.964  1.00 0.00 ? 18  GLN A HA   1  
ATOM 260   H HB2  . GLN A 1 18  ? 2.522   -4.693  -7.995  1.00 0.00 ? 18  GLN A HB2  1  
ATOM 261   H HB3  . GLN A 1 18  ? 3.002   -4.067  -9.570  1.00 0.00 ? 18  GLN A HB3  1  
ATOM 262   H HG2  . GLN A 1 18  ? 3.963   -6.205  -10.191 1.00 0.00 ? 18  GLN A HG2  1  
ATOM 263   H HG3  . GLN A 1 18  ? 3.688   -6.844  -8.569  1.00 0.00 ? 18  GLN A HG3  1  
ATOM 264   H HE21 . GLN A 1 18  ? 2.540   -8.166  -10.791 1.00 0.00 ? 18  GLN A HE21 1  
ATOM 265   H HE22 . GLN A 1 18  ? 0.857   -7.945  -10.764 1.00 0.00 ? 18  GLN A HE22 1  
ATOM 266   N N    . ALA A 1 19  ? 4.358   -2.125  -7.265  1.00 0.00 ? 19  ALA A N    1  
ATOM 267   C CA   . ALA A 1 19  ? 4.152   -1.175  -6.134  1.00 0.00 ? 19  ALA A CA   1  
ATOM 268   C C    . ALA A 1 19  ? 3.705   0.184   -6.669  1.00 0.00 ? 19  ALA A C    1  
ATOM 269   O O    . ALA A 1 19  ? 4.085   0.595   -7.747  1.00 0.00 ? 19  ALA A O    1  
ATOM 270   C CB   . ALA A 1 19  ? 5.460   -1.009  -5.360  1.00 0.00 ? 19  ALA A CB   1  
ATOM 271   H H    . ALA A 1 19  ? 4.444   -1.790  -8.182  1.00 0.00 ? 19  ALA A H    1  
ATOM 272   H HA   . ALA A 1 19  ? 3.393   -1.567  -5.473  1.00 0.00 ? 19  ALA A HA   1  
ATOM 273   H HB1  . ALA A 1 19  ? 6.245   -1.558  -5.858  1.00 0.00 ? 19  ALA A HB1  1  
ATOM 274   H HB2  . ALA A 1 19  ? 5.723   0.038   -5.319  1.00 0.00 ? 19  ALA A HB2  1  
ATOM 275   H HB3  . ALA A 1 19  ? 5.335   -1.389  -4.357  1.00 0.00 ? 19  ALA A HB3  1  
ATOM 276   N N    . ALA A 1 20  ? 2.903   0.886   -5.918  1.00 0.00 ? 20  ALA A N    1  
ATOM 277   C CA   . ALA A 1 20  ? 2.432   2.222   -6.373  1.00 0.00 ? 20  ALA A CA   1  
ATOM 278   C C    . ALA A 1 20  ? 2.380   3.167   -5.171  1.00 0.00 ? 20  ALA A C    1  
ATOM 279   O O    . ALA A 1 20  ? 2.199   2.745   -4.048  1.00 0.00 ? 20  ALA A O    1  
ATOM 280   C CB   . ALA A 1 20  ? 1.037   2.090   -6.987  1.00 0.00 ? 20  ALA A CB   1  
ATOM 281   H H    . ALA A 1 20  ? 2.613   0.536   -5.050  1.00 0.00 ? 20  ALA A H    1  
ATOM 282   H HA   . ALA A 1 20  ? 3.118   2.615   -7.110  1.00 0.00 ? 20  ALA A HA   1  
ATOM 283   H HB1  . ALA A 1 20  ? 1.050   1.320   -7.744  1.00 0.00 ? 20  ALA A HB1  1  
ATOM 284   H HB2  . ALA A 1 20  ? 0.327   1.827   -6.218  1.00 0.00 ? 20  ALA A HB2  1  
ATOM 285   H HB3  . ALA A 1 20  ? 0.751   3.030   -7.436  1.00 0.00 ? 20  ALA A HB3  1  
ATOM 286   N N    . ILE A 1 21  ? 2.542   4.439   -5.395  1.00 0.00 ? 21  ILE A N    1  
ATOM 287   C CA   . ILE A 1 21  ? 2.509   5.400   -4.258  1.00 0.00 ? 21  ILE A CA   1  
ATOM 288   C C    . ILE A 1 21  ? 1.395   6.419   -4.479  1.00 0.00 ? 21  ILE A C    1  
ATOM 289   O O    . ILE A 1 21  ? 1.521   7.339   -5.273  1.00 0.00 ? 21  ILE A O    1  
ATOM 290   C CB   . ILE A 1 21  ? 3.855   6.109   -4.153  1.00 0.00 ? 21  ILE A CB   1  
ATOM 291   C CG1  . ILE A 1 21  ? 4.966   5.062   -4.183  1.00 0.00 ? 21  ILE A CG1  1  
ATOM 292   C CG2  . ILE A 1 21  ? 3.923   6.884   -2.836  1.00 0.00 ? 21  ILE A CG2  1  
ATOM 293   C CD1  . ILE A 1 21  ? 6.287   5.707   -3.774  1.00 0.00 ? 21  ILE A CD1  1  
ATOM 294   H H    . ILE A 1 21  ? 2.689   4.761   -6.307  1.00 0.00 ? 21  ILE A H    1  
ATOM 295   H HA   . ILE A 1 21  ? 2.319   4.859   -3.342  1.00 0.00 ? 21  ILE A HA   1  
ATOM 296   H HB   . ILE A 1 21  ? 3.973   6.790   -4.983  1.00 0.00 ? 21  ILE A HB   1  
ATOM 297   H HG12 . ILE A 1 21  ? 4.726   4.265   -3.494  1.00 0.00 ? 21  ILE A HG12 1  
ATOM 298   H HG13 . ILE A 1 21  ? 5.057   4.661   -5.181  1.00 0.00 ? 21  ILE A HG13 1  
ATOM 299   H HG21 . ILE A 1 21  ? 2.956   6.863   -2.355  1.00 0.00 ? 21  ILE A HG21 1  
ATOM 300   H HG22 . ILE A 1 21  ? 4.657   6.429   -2.188  1.00 0.00 ? 21  ILE A HG22 1  
ATOM 301   H HG23 . ILE A 1 21  ? 4.203   7.908   -3.034  1.00 0.00 ? 21  ILE A HG23 1  
ATOM 302   H HD11 . ILE A 1 21  ? 6.348   6.700   -4.192  1.00 0.00 ? 21  ILE A HD11 1  
ATOM 303   H HD12 . ILE A 1 21  ? 6.341   5.765   -2.696  1.00 0.00 ? 21  ILE A HD12 1  
ATOM 304   H HD13 . ILE A 1 21  ? 7.101   5.109   -4.145  1.00 0.00 ? 21  ILE A HD13 1  
ATOM 305   N N    . LEU A 1 22  ? 0.306   6.242   -3.776  1.00 0.00 ? 22  LEU A N    1  
ATOM 306   C CA   . LEU A 1 22  ? -0.860  7.163   -3.907  1.00 0.00 ? 22  LEU A CA   1  
ATOM 307   C C    . LEU A 1 22  ? -1.401  7.484   -2.509  1.00 0.00 ? 22  LEU A C    1  
ATOM 308   O O    . LEU A 1 22  ? -1.088  6.810   -1.547  1.00 0.00 ? 22  LEU A O    1  
ATOM 309   C CB   . LEU A 1 22  ? -1.962  6.478   -4.725  1.00 0.00 ? 22  LEU A CB   1  
ATOM 310   C CG   . LEU A 1 22  ? -1.767  4.956   -4.689  1.00 0.00 ? 22  LEU A CG   1  
ATOM 311   C CD1  . LEU A 1 22  ? -3.082  4.255   -5.031  1.00 0.00 ? 22  LEU A CD1  1  
ATOM 312   C CD2  . LEU A 1 22  ? -0.697  4.556   -5.709  1.00 0.00 ? 22  LEU A CD2  1  
ATOM 313   H H    . LEU A 1 22  ? 0.253   5.485   -3.156  1.00 0.00 ? 22  LEU A H    1  
ATOM 314   H HA   . LEU A 1 22  ? -0.553  8.075   -4.398  1.00 0.00 ? 22  LEU A HA   1  
ATOM 315   H HB2  . LEU A 1 22  ? -2.926  6.726   -4.303  1.00 0.00 ? 22  LEU A HB2  1  
ATOM 316   H HB3  . LEU A 1 22  ? -1.918  6.821   -5.746  1.00 0.00 ? 22  LEU A HB3  1  
ATOM 317   H HG   . LEU A 1 22  ? -1.450  4.660   -3.700  1.00 0.00 ? 22  LEU A HG   1  
ATOM 318   H HD11 . LEU A 1 22  ? -3.910  4.850   -4.676  1.00 0.00 ? 22  LEU A HD11 1  
ATOM 319   H HD12 . LEU A 1 22  ? -3.157  4.133   -6.101  1.00 0.00 ? 22  LEU A HD12 1  
ATOM 320   H HD13 . LEU A 1 22  ? -3.106  3.285   -4.556  1.00 0.00 ? 22  LEU A HD13 1  
ATOM 321   H HD21 . LEU A 1 22  ? -0.538  5.368   -6.402  1.00 0.00 ? 22  LEU A HD21 1  
ATOM 322   H HD22 . LEU A 1 22  ? 0.227   4.336   -5.194  1.00 0.00 ? 22  LEU A HD22 1  
ATOM 323   H HD23 . LEU A 1 22  ? -1.024  3.680   -6.249  1.00 0.00 ? 22  LEU A HD23 1  
ATOM 324   N N    . GLY A 1 23  ? -2.207  8.503   -2.383  1.00 0.00 ? 23  GLY A N    1  
ATOM 325   C CA   . GLY A 1 23  ? -2.755  8.851   -1.040  1.00 0.00 ? 23  GLY A CA   1  
ATOM 326   C C    . GLY A 1 23  ? -2.602  10.350  -0.799  1.00 0.00 ? 23  GLY A C    1  
ATOM 327   O O    . GLY A 1 23  ? -1.974  11.042  -1.574  1.00 0.00 ? 23  GLY A O    1  
ATOM 328   H H    . GLY A 1 23  ? -2.449  9.039   -3.167  1.00 0.00 ? 23  GLY A H    1  
ATOM 329   H HA2  . GLY A 1 23  ? -3.800  8.580   -0.993  1.00 0.00 ? 23  GLY A HA2  1  
ATOM 330   H HA3  . GLY A 1 23  ? -2.207  8.314   -0.283  1.00 0.00 ? 23  GLY A HA3  1  
ATOM 331   N N    . LEU A 1 24  ? -3.158  10.863  0.270   1.00 0.00 ? 24  LEU A N    1  
ATOM 332   C CA   . LEU A 1 24  ? -3.029  12.293  0.544   1.00 0.00 ? 24  LEU A CA   1  
ATOM 333   C C    . LEU A 1 24  ? -3.660  13.061  -0.608  1.00 0.00 ? 24  LEU A C    1  
ATOM 334   O O    . LEU A 1 24  ? -3.303  12.903  -1.759  1.00 0.00 ? 24  LEU A O    1  
ATOM 335   C CB   . LEU A 1 24  ? -1.554  12.616  0.701   1.00 0.00 ? 24  LEU A CB   1  
ATOM 336   C CG   . LEU A 1 24  ? -1.116  12.240  2.121   1.00 0.00 ? 24  LEU A CG   1  
ATOM 337   C CD1  . LEU A 1 24  ? -0.353  10.913  2.096   1.00 0.00 ? 24  LEU A CD1  1  
ATOM 338   C CD2  . LEU A 1 24  ? -0.209  13.333  2.696   1.00 0.00 ? 24  LEU A CD2  1  
ATOM 339   H H    . LEU A 1 24  ? -3.649  10.315  0.886   1.00 0.00 ? 24  LEU A H    1  
ATOM 340   H HA   . LEU A 1 24  ? -3.550  12.530  1.460   1.00 0.00 ? 24  LEU A HA   1  
ATOM 341   H HB2  . LEU A 1 24  ? -0.990  12.039  -0.015  1.00 0.00 ? 24  LEU A HB2  1  
ATOM 342   H HB3  . LEU A 1 24  ? -1.395  13.665  0.538   1.00 0.00 ? 24  LEU A HB3  1  
ATOM 343   H HG   . LEU A 1 24  ? -1.994  12.132  2.743   1.00 0.00 ? 24  LEU A HG   1  
ATOM 344   H HD11 . LEU A 1 24  ? 0.152   10.804  1.149   1.00 0.00 ? 24  LEU A HD11 1  
ATOM 345   H HD12 . LEU A 1 24  ? 0.376   10.901  2.894   1.00 0.00 ? 24  LEU A HD12 1  
ATOM 346   H HD13 . LEU A 1 24  ? -1.047  10.096  2.231   1.00 0.00 ? 24  LEU A HD13 1  
ATOM 347   H HD21 . LEU A 1 24  ? 0.295   13.845  1.891   1.00 0.00 ? 24  LEU A HD21 1  
ATOM 348   H HD22 . LEU A 1 24  ? -0.804  14.039  3.256   1.00 0.00 ? 24  LEU A HD22 1  
ATOM 349   H HD23 . LEU A 1 24  ? 0.524   12.883  3.352   1.00 0.00 ? 24  LEU A HD23 1  
ATOM 350   N N    . ASP A 1 25  ? -4.635  13.854  -0.299  1.00 0.00 ? 25  ASP A N    1  
ATOM 351   C CA   . ASP A 1 25  ? -5.359  14.622  -1.357  1.00 0.00 ? 25  ASP A CA   1  
ATOM 352   C C    . ASP A 1 25  ? -4.551  15.846  -1.815  1.00 0.00 ? 25  ASP A C    1  
ATOM 353   O O    . ASP A 1 25  ? -5.104  16.894  -2.084  1.00 0.00 ? 25  ASP A O    1  
ATOM 354   C CB   . ASP A 1 25  ? -6.703  15.092  -0.799  1.00 0.00 ? 25  ASP A CB   1  
ATOM 355   C CG   . ASP A 1 25  ? -7.750  13.993  -0.989  1.00 0.00 ? 25  ASP A CG   1  
ATOM 356   O OD1  . ASP A 1 25  ? -7.593  13.204  -1.907  1.00 0.00 ? 25  ASP A OD1  1  
ATOM 357   O OD2  . ASP A 1 25  ? -8.692  13.960  -0.215  1.00 0.00 ? 25  ASP A OD2  1  
ATOM 358   H H    . ASP A 1 25  ? -4.917  13.912  0.635   1.00 0.00 ? 25  ASP A H    1  
ATOM 359   H HA   . ASP A 1 25  ? -5.536  13.978  -2.205  1.00 0.00 ? 25  ASP A HA   1  
ATOM 360   H HB2  . ASP A 1 25  ? -6.597  15.311  0.255   1.00 0.00 ? 25  ASP A HB2  1  
ATOM 361   H HB3  . ASP A 1 25  ? -7.019  15.983  -1.322  1.00 0.00 ? 25  ASP A HB3  1  
ATOM 362   N N    . GLY A 1 26  ? -3.256  15.720  -1.940  1.00 0.00 ? 26  GLY A N    1  
ATOM 363   C CA   . GLY A 1 26  ? -2.438  16.868  -2.417  1.00 0.00 ? 26  GLY A CA   1  
ATOM 364   C C    . GLY A 1 26  ? -2.014  16.585  -3.859  1.00 0.00 ? 26  GLY A C    1  
ATOM 365   O O    . GLY A 1 26  ? -1.885  17.479  -4.672  1.00 0.00 ? 26  GLY A O    1  
ATOM 366   H H    . GLY A 1 26  ? -2.825  14.869  -1.744  1.00 0.00 ? 26  GLY A H    1  
ATOM 367   H HA2  . GLY A 1 26  ? -3.026  17.775  -2.377  1.00 0.00 ? 26  GLY A HA2  1  
ATOM 368   H HA3  . GLY A 1 26  ? -1.560  16.973  -1.798  1.00 0.00 ? 26  GLY A HA3  1  
ATOM 369   N N    . ASN A 1 27  ? -1.809  15.333  -4.178  1.00 0.00 ? 27  ASN A N    1  
ATOM 370   C CA   . ASN A 1 27  ? -1.405  14.957  -5.564  1.00 0.00 ? 27  ASN A CA   1  
ATOM 371   C C    . ASN A 1 27  ? -0.826  13.536  -5.552  1.00 0.00 ? 27  ASN A C    1  
ATOM 372   O O    . ASN A 1 27  ? -0.860  12.853  -4.548  1.00 0.00 ? 27  ASN A O    1  
ATOM 373   C CB   . ASN A 1 27  ? -0.345  15.934  -6.077  1.00 0.00 ? 27  ASN A CB   1  
ATOM 374   C CG   . ASN A 1 27  ? -0.903  16.715  -7.267  1.00 0.00 ? 27  ASN A CG   1  
ATOM 375   O OD1  . ASN A 1 27  ? -0.694  17.907  -7.379  1.00 0.00 ? 27  ASN A OD1  1  
ATOM 376   N ND2  . ASN A 1 27  ? -1.609  16.088  -8.169  1.00 0.00 ? 27  ASN A ND2  1  
ATOM 377   H H    . ASN A 1 27  ? -1.930  14.635  -3.502  1.00 0.00 ? 27  ASN A H    1  
ATOM 378   H HA   . ASN A 1 27  ? -2.273  14.991  -6.209  1.00 0.00 ? 27  ASN A HA   1  
ATOM 379   H HB2  . ASN A 1 27  ? -0.075  16.622  -5.288  1.00 0.00 ? 27  ASN A HB2  1  
ATOM 380   H HB3  . ASN A 1 27  ? 0.530   15.384  -6.389  1.00 0.00 ? 27  ASN A HB3  1  
ATOM 381   H HD21 . ASN A 1 27  ? -1.777  15.127  -8.078  1.00 0.00 ? 27  ASN A HD21 1  
ATOM 382   H HD22 . ASN A 1 27  ? -1.971  16.579  -8.935  1.00 0.00 ? 27  ASN A HD22 1  
ATOM 383   N N    . THR A 1 28  ? -0.285  13.088  -6.656  1.00 0.00 ? 28  THR A N    1  
ATOM 384   C CA   . THR A 1 28  ? 0.304   11.718  -6.696  1.00 0.00 ? 28  THR A CA   1  
ATOM 385   C C    . THR A 1 28  ? 1.818   11.834  -6.511  1.00 0.00 ? 28  THR A C    1  
ATOM 386   O O    . THR A 1 28  ? 2.337   12.906  -6.269  1.00 0.00 ? 28  THR A O    1  
ATOM 387   C CB   . THR A 1 28  ? 0.001   11.071  -8.050  1.00 0.00 ? 28  THR A CB   1  
ATOM 388   O OG1  . THR A 1 28  ? -1.276  11.501  -8.500  1.00 0.00 ? 28  THR A OG1  1  
ATOM 389   C CG2  . THR A 1 28  ? 0.007   9.549   -7.904  1.00 0.00 ? 28  THR A CG2  1  
ATOM 390   H H    . THR A 1 28  ? -0.256  13.654  -7.456  1.00 0.00 ? 28  THR A H    1  
ATOM 391   H HA   . THR A 1 28  ? -0.116  11.112  -5.903  1.00 0.00 ? 28  THR A HA   1  
ATOM 392   H HB   . THR A 1 28  ? 0.754   11.364  -8.766  1.00 0.00 ? 28  THR A HB   1  
ATOM 393   H HG1  . THR A 1 28  ? -1.624  10.830  -9.090  1.00 0.00 ? 28  THR A HG1  1  
ATOM 394   H HG21 . THR A 1 28  ? -0.233  9.284   -6.885  1.00 0.00 ? 28  THR A HG21 1  
ATOM 395   H HG22 . THR A 1 28  ? -0.727  9.120   -8.570  1.00 0.00 ? 28  THR A HG22 1  
ATOM 396   H HG23 . THR A 1 28  ? 0.986   9.167   -8.154  1.00 0.00 ? 28  THR A HG23 1  
ATOM 397   N N    . TRP A 1 29  ? 2.535   10.751  -6.625  1.00 0.00 ? 29  TRP A N    1  
ATOM 398   C CA   . TRP A 1 29  ? 4.012   10.832  -6.453  1.00 0.00 ? 29  TRP A CA   1  
ATOM 399   C C    . TRP A 1 29  ? 4.704   9.886   -7.431  1.00 0.00 ? 29  TRP A C    1  
ATOM 400   O O    . TRP A 1 29  ? 5.559   10.294  -8.192  1.00 0.00 ? 29  TRP A O    1  
ATOM 401   C CB   . TRP A 1 29  ? 4.387   10.454  -5.021  1.00 0.00 ? 29  TRP A CB   1  
ATOM 402   C CG   . TRP A 1 29  ? 3.526   11.220  -4.073  1.00 0.00 ? 29  TRP A CG   1  
ATOM 403   C CD1  . TRP A 1 29  ? 3.557   12.561  -3.900  1.00 0.00 ? 29  TRP A CD1  1  
ATOM 404   C CD2  . TRP A 1 29  ? 2.508   10.713  -3.169  1.00 0.00 ? 29  TRP A CD2  1  
ATOM 405   N NE1  . TRP A 1 29  ? 2.617   12.909  -2.947  1.00 0.00 ? 29  TRP A NE1  1  
ATOM 406   C CE2  . TRP A 1 29  ? 1.945   11.803  -2.466  1.00 0.00 ? 29  TRP A CE2  1  
ATOM 407   C CE3  . TRP A 1 29  ? 2.023   9.424   -2.896  1.00 0.00 ? 29  TRP A CE3  1  
ATOM 408   C CZ2  . TRP A 1 29  ? 0.936   11.619  -1.524  1.00 0.00 ? 29  TRP A CZ2  1  
ATOM 409   C CZ3  . TRP A 1 29  ? 1.009   9.235   -1.947  1.00 0.00 ? 29  TRP A CZ3  1  
ATOM 410   C CH2  . TRP A 1 29  ? 0.467   10.330  -1.264  1.00 0.00 ? 29  TRP A CH2  1  
ATOM 411   H H    . TRP A 1 29  ? 2.106   9.893   -6.823  1.00 0.00 ? 29  TRP A H    1  
ATOM 412   H HA   . TRP A 1 29  ? 4.336   11.843  -6.649  1.00 0.00 ? 29  TRP A HA   1  
ATOM 413   H HB2  . TRP A 1 29  ? 4.232   9.395   -4.875  1.00 0.00 ? 29  TRP A HB2  1  
ATOM 414   H HB3  . TRP A 1 29  ? 5.424   10.697  -4.843  1.00 0.00 ? 29  TRP A HB3  1  
ATOM 415   H HD1  . TRP A 1 29  ? 4.209   13.247  -4.421  1.00 0.00 ? 29  TRP A HD1  1  
ATOM 416   H HE1  . TRP A 1 29  ? 2.437   13.821  -2.638  1.00 0.00 ? 29  TRP A HE1  1  
ATOM 417   H HE3  . TRP A 1 29  ? 2.434   8.575   -3.419  1.00 0.00 ? 29  TRP A HE3  1  
ATOM 418   H HZ2  . TRP A 1 29  ? 0.518   12.464  -1.001  1.00 0.00 ? 29  TRP A HZ2  1  
ATOM 419   H HZ3  . TRP A 1 29  ? 0.647   8.240   -1.741  1.00 0.00 ? 29  TRP A HZ3  1  
ATOM 420   H HH2  . TRP A 1 29  ? -0.311  10.178  -0.534  1.00 0.00 ? 29  TRP A HH2  1  
ATOM 421   N N    . ALA A 1 30  ? 4.358   8.625   -7.429  1.00 0.00 ? 30  ALA A N    1  
ATOM 422   C CA   . ALA A 1 30  ? 5.037   7.698   -8.381  1.00 0.00 ? 30  ALA A CA   1  
ATOM 423   C C    . ALA A 1 30  ? 4.444   6.296   -8.275  1.00 0.00 ? 30  ALA A C    1  
ATOM 424   O O    . ALA A 1 30  ? 4.242   5.776   -7.197  1.00 0.00 ? 30  ALA A O    1  
ATOM 425   C CB   . ALA A 1 30  ? 6.529   7.638   -8.052  1.00 0.00 ? 30  ALA A CB   1  
ATOM 426   H H    . ALA A 1 30  ? 3.667   8.293   -6.811  1.00 0.00 ? 30  ALA A H    1  
ATOM 427   H HA   . ALA A 1 30  ? 4.909   8.064   -9.389  1.00 0.00 ? 30  ALA A HA   1  
ATOM 428   H HB1  . ALA A 1 30  ? 6.886   8.629   -7.814  1.00 0.00 ? 30  ALA A HB1  1  
ATOM 429   H HB2  . ALA A 1 30  ? 6.685   6.986   -7.205  1.00 0.00 ? 30  ALA A HB2  1  
ATOM 430   H HB3  . ALA A 1 30  ? 7.071   7.256   -8.905  1.00 0.00 ? 30  ALA A HB3  1  
ATOM 431   N N    . THR A 1 31  ? 4.177   5.678   -9.392  1.00 0.00 ? 31  THR A N    1  
ATOM 432   C CA   . THR A 1 31  ? 3.607   4.304   -9.371  1.00 0.00 ? 31  THR A CA   1  
ATOM 433   C C    . THR A 1 31  ? 4.344   3.440   -10.397 1.00 0.00 ? 31  THR A C    1  
ATOM 434   O O    . THR A 1 31  ? 4.932   3.941   -11.334 1.00 0.00 ? 31  THR A O    1  
ATOM 435   C CB   . THR A 1 31  ? 2.119   4.366   -9.725  1.00 0.00 ? 31  THR A CB   1  
ATOM 436   O OG1  . THR A 1 31  ? 1.642   3.057   -9.995  1.00 0.00 ? 31  THR A OG1  1  
ATOM 437   C CG2  . THR A 1 31  ? 1.921   5.241   -10.962 1.00 0.00 ? 31  THR A CG2  1  
ATOM 438   H H    . THR A 1 31  ? 4.359   6.118   -10.248 1.00 0.00 ? 31  THR A H    1  
ATOM 439   H HA   . THR A 1 31  ? 3.729   3.877   -8.386  1.00 0.00 ? 31  THR A HA   1  
ATOM 440   H HB   . THR A 1 31  ? 1.569   4.789   -8.899  1.00 0.00 ? 31  THR A HB   1  
ATOM 441   H HG1  . THR A 1 31  ? 1.639   2.567   -9.172  1.00 0.00 ? 31  THR A HG1  1  
ATOM 442   H HG21 . THR A 1 31  ? 2.704   5.035   -11.677 1.00 0.00 ? 31  THR A HG21 1  
ATOM 443   H HG22 . THR A 1 31  ? 0.961   5.022   -11.406 1.00 0.00 ? 31  THR A HG22 1  
ATOM 444   H HG23 . THR A 1 31  ? 1.957   6.282   -10.678 1.00 0.00 ? 31  THR A HG23 1  
ATOM 445   N N    . SER A 1 32  ? 4.319   2.147   -10.228 1.00 0.00 ? 32  SER A N    1  
ATOM 446   C CA   . SER A 1 32  ? 5.023   1.257   -11.195 1.00 0.00 ? 32  SER A CA   1  
ATOM 447   C C    . SER A 1 32  ? 4.456   -0.160  -11.095 1.00 0.00 ? 32  SER A C    1  
ATOM 448   O O    . SER A 1 32  ? 4.795   -0.913  -10.204 1.00 0.00 ? 32  SER A O    1  
ATOM 449   C CB   . SER A 1 32  ? 6.516   1.232   -10.869 1.00 0.00 ? 32  SER A CB   1  
ATOM 450   O OG   . SER A 1 32  ? 7.122   2.427   -11.345 1.00 0.00 ? 32  SER A OG   1  
ATOM 451   H H    . SER A 1 32  ? 3.841   1.761   -9.466  1.00 0.00 ? 32  SER A H    1  
ATOM 452   H HA   . SER A 1 32  ? 4.880   1.632   -12.199 1.00 0.00 ? 32  SER A HA   1  
ATOM 453   H HB2  . SER A 1 32  ? 6.653   1.165   -9.804  1.00 0.00 ? 32  SER A HB2  1  
ATOM 454   H HB3  . SER A 1 32  ? 6.972   0.372   -11.342 1.00 0.00 ? 32  SER A HB3  1  
ATOM 455   H HG   . SER A 1 32  ? 6.895   2.526   -12.272 1.00 0.00 ? 32  SER A HG   1  
ATOM 456   N N    . ALA A 1 33  ? 3.595   -0.528  -12.003 1.00 0.00 ? 33  ALA A N    1  
ATOM 457   C CA   . ALA A 1 33  ? 3.006   -1.896  -11.964 1.00 0.00 ? 33  ALA A CA   1  
ATOM 458   C C    . ALA A 1 33  ? 2.239   -2.150  -13.264 1.00 0.00 ? 33  ALA A C    1  
ATOM 459   O O    . ALA A 1 33  ? 2.402   -1.442  -14.239 1.00 0.00 ? 33  ALA A O    1  
ATOM 460   C CB   . ALA A 1 33  ? 2.051   -2.007  -10.775 1.00 0.00 ? 33  ALA A CB   1  
ATOM 461   H H    . ALA A 1 33  ? 3.336   0.096   -12.712 1.00 0.00 ? 33  ALA A H    1  
ATOM 462   H HA   . ALA A 1 33  ? 3.796   -2.625  -11.863 1.00 0.00 ? 33  ALA A HA   1  
ATOM 463   H HB1  . ALA A 1 33  ? 2.535   -1.627  -9.887  1.00 0.00 ? 33  ALA A HB1  1  
ATOM 464   H HB2  . ALA A 1 33  ? 1.159   -1.430  -10.973 1.00 0.00 ? 33  ALA A HB2  1  
ATOM 465   H HB3  . ALA A 1 33  ? 1.783   -3.043  -10.623 1.00 0.00 ? 33  ALA A HB3  1  
ATOM 466   N N    . GLY A 1 34  ? 1.405   -3.153  -13.291 1.00 0.00 ? 34  GLY A N    1  
ATOM 467   C CA   . GLY A 1 34  ? 0.633   -3.445  -14.533 1.00 0.00 ? 34  GLY A CA   1  
ATOM 468   C C    . GLY A 1 34  ? -0.864  -3.307  -14.252 1.00 0.00 ? 34  GLY A C    1  
ATOM 469   O O    . GLY A 1 34  ? -1.676  -4.033  -14.791 1.00 0.00 ? 34  GLY A O    1  
ATOM 470   H H    . GLY A 1 34  ? 1.286   -3.714  -12.497 1.00 0.00 ? 34  GLY A H    1  
ATOM 471   H HA2  . GLY A 1 34  ? 0.922   -2.747  -15.307 1.00 0.00 ? 34  GLY A HA2  1  
ATOM 472   H HA3  . GLY A 1 34  ? 0.843   -4.452  -14.860 1.00 0.00 ? 34  GLY A HA3  1  
ATOM 473   N N    . PHE A 1 35  ? -1.238  -2.379  -13.414 1.00 0.00 ? 35  PHE A N    1  
ATOM 474   C CA   . PHE A 1 35  ? -2.684  -2.196  -13.101 1.00 0.00 ? 35  PHE A CA   1  
ATOM 475   C C    . PHE A 1 35  ? -2.993  -0.702  -12.970 1.00 0.00 ? 35  PHE A C    1  
ATOM 476   O O    . PHE A 1 35  ? -2.385  0.000   -12.188 1.00 0.00 ? 35  PHE A O    1  
ATOM 477   C CB   . PHE A 1 35  ? -3.019  -2.907  -11.785 1.00 0.00 ? 35  PHE A CB   1  
ATOM 478   C CG   . PHE A 1 35  ? -2.465  -2.114  -10.623 1.00 0.00 ? 35  PHE A CG   1  
ATOM 479   C CD1  . PHE A 1 35  ? -1.083  -2.057  -10.411 1.00 0.00 ? 35  PHE A CD1  1  
ATOM 480   C CD2  . PHE A 1 35  ? -3.334  -1.434  -9.762  1.00 0.00 ? 35  PHE A CD2  1  
ATOM 481   C CE1  . PHE A 1 35  ? -0.569  -1.319  -9.338  1.00 0.00 ? 35  PHE A CE1  1  
ATOM 482   C CE2  . PHE A 1 35  ? -2.821  -0.695  -8.690  1.00 0.00 ? 35  PHE A CE2  1  
ATOM 483   C CZ   . PHE A 1 35  ? -1.438  -0.638  -8.477  1.00 0.00 ? 35  PHE A CZ   1  
ATOM 484   H H    . PHE A 1 35  ? -0.568  -1.802  -12.990 1.00 0.00 ? 35  PHE A H    1  
ATOM 485   H HA   . PHE A 1 35  ? -3.280  -2.616  -13.898 1.00 0.00 ? 35  PHE A HA   1  
ATOM 486   H HB2  . PHE A 1 35  ? -4.091  -2.990  -11.684 1.00 0.00 ? 35  PHE A HB2  1  
ATOM 487   H HB3  . PHE A 1 35  ? -2.580  -3.893  -11.788 1.00 0.00 ? 35  PHE A HB3  1  
ATOM 488   H HD1  . PHE A 1 35  ? -0.412  -2.583  -11.075 1.00 0.00 ? 35  PHE A HD1  1  
ATOM 489   H HD2  . PHE A 1 35  ? -4.401  -1.477  -9.926  1.00 0.00 ? 35  PHE A HD2  1  
ATOM 490   H HE1  . PHE A 1 35  ? 0.497   -1.275  -9.175  1.00 0.00 ? 35  PHE A HE1  1  
ATOM 491   H HE2  . PHE A 1 35  ? -3.491  -0.171  -8.025  1.00 0.00 ? 35  PHE A HE2  1  
ATOM 492   H HZ   . PHE A 1 35  ? -1.043  -0.067  -7.651  1.00 0.00 ? 35  PHE A HZ   1  
ATOM 493   N N    . ALA A 1 36  ? -3.936  -0.212  -13.727 1.00 0.00 ? 36  ALA A N    1  
ATOM 494   C CA   . ALA A 1 36  ? -4.282  1.235   -13.640 1.00 0.00 ? 36  ALA A CA   1  
ATOM 495   C C    . ALA A 1 36  ? -5.442  1.423   -12.661 1.00 0.00 ? 36  ALA A C    1  
ATOM 496   O O    . ALA A 1 36  ? -6.536  0.946   -12.882 1.00 0.00 ? 36  ALA A O    1  
ATOM 497   C CB   . ALA A 1 36  ? -4.693  1.747   -15.021 1.00 0.00 ? 36  ALA A CB   1  
ATOM 498   H H    . ALA A 1 36  ? -4.417  -0.794  -14.351 1.00 0.00 ? 36  ALA A H    1  
ATOM 499   H HA   . ALA A 1 36  ? -3.424  1.790   -13.291 1.00 0.00 ? 36  ALA A HA   1  
ATOM 500   H HB1  . ALA A 1 36  ? -4.042  1.322   -15.770 1.00 0.00 ? 36  ALA A HB1  1  
ATOM 501   H HB2  . ALA A 1 36  ? -5.713  1.457   -15.224 1.00 0.00 ? 36  ALA A HB2  1  
ATOM 502   H HB3  . ALA A 1 36  ? -4.614  2.824   -15.043 1.00 0.00 ? 36  ALA A HB3  1  
ATOM 503   N N    . VAL A 1 37  ? -5.211  2.113   -11.578 1.00 0.00 ? 37  VAL A N    1  
ATOM 504   C CA   . VAL A 1 37  ? -6.299  2.327   -10.582 1.00 0.00 ? 37  VAL A CA   1  
ATOM 505   C C    . VAL A 1 37  ? -7.193  3.487   -11.032 1.00 0.00 ? 37  VAL A C    1  
ATOM 506   O O    . VAL A 1 37  ? -6.730  4.461   -11.592 1.00 0.00 ? 37  VAL A O    1  
ATOM 507   C CB   . VAL A 1 37  ? -5.681  2.659   -9.222  1.00 0.00 ? 37  VAL A CB   1  
ATOM 508   C CG1  . VAL A 1 37  ? -6.728  2.470   -8.124  1.00 0.00 ? 37  VAL A CG1  1  
ATOM 509   C CG2  . VAL A 1 37  ? -4.497  1.725   -8.959  1.00 0.00 ? 37  VAL A CG2  1  
ATOM 510   H H    . VAL A 1 37  ? -4.320  2.487   -11.418 1.00 0.00 ? 37  VAL A H    1  
ATOM 511   H HA   . VAL A 1 37  ? -6.892  1.429   -10.497 1.00 0.00 ? 37  VAL A HA   1  
ATOM 512   H HB   . VAL A 1 37  ? -5.341  3.684   -9.223  1.00 0.00 ? 37  VAL A HB   1  
ATOM 513   H HG11 . VAL A 1 37  ? -7.455  1.736   -8.441  1.00 0.00 ? 37  VAL A HG11 1  
ATOM 514   H HG12 . VAL A 1 37  ? -6.244  2.129   -7.221  1.00 0.00 ? 37  VAL A HG12 1  
ATOM 515   H HG13 . VAL A 1 37  ? -7.224  3.410   -7.933  1.00 0.00 ? 37  VAL A HG13 1  
ATOM 516   H HG21 . VAL A 1 37  ? -4.820  0.699   -9.052  1.00 0.00 ? 37  VAL A HG21 1  
ATOM 517   H HG22 . VAL A 1 37  ? -3.715  1.923   -9.678  1.00 0.00 ? 37  VAL A HG22 1  
ATOM 518   H HG23 . VAL A 1 37  ? -4.120  1.895   -7.962  1.00 0.00 ? 37  VAL A HG23 1  
ATOM 519   N N    . THR A 1 38  ? -8.472  3.390   -10.787 1.00 0.00 ? 38  THR A N    1  
ATOM 520   C CA   . THR A 1 38  ? -9.398  4.486   -11.196 1.00 0.00 ? 38  THR A CA   1  
ATOM 521   C C    . THR A 1 38  ? -8.861  5.825   -10.683 1.00 0.00 ? 38  THR A C    1  
ATOM 522   O O    . THR A 1 38  ? -8.052  5.858   -9.778  1.00 0.00 ? 38  THR A O    1  
ATOM 523   C CB   . THR A 1 38  ? -10.782 4.227   -10.596 1.00 0.00 ? 38  THR A CB   1  
ATOM 524   O OG1  . THR A 1 38  ? -10.639 3.840   -9.236  1.00 0.00 ? 38  THR A OG1  1  
ATOM 525   C CG2  . THR A 1 38  ? -11.475 3.110   -11.377 1.00 0.00 ? 38  THR A CG2  1  
ATOM 526   H H    . THR A 1 38  ? -8.824  2.597   -10.332 1.00 0.00 ? 38  THR A H    1  
ATOM 527   H HA   . THR A 1 38  ? -9.472  4.514   -12.273 1.00 0.00 ? 38  THR A HA   1  
ATOM 528   H HB   . THR A 1 38  ? -11.376 5.125   -10.655 1.00 0.00 ? 38  THR A HB   1  
ATOM 529   H HG1  . THR A 1 38  ? -10.097 4.498   -8.795  1.00 0.00 ? 38  THR A HG1  1  
ATOM 530   H HG21 . THR A 1 38  ? -10.751 2.600   -11.994 1.00 0.00 ? 38  THR A HG21 1  
ATOM 531   H HG22 . THR A 1 38  ? -11.918 2.408   -10.687 1.00 0.00 ? 38  THR A HG22 1  
ATOM 532   H HG23 . THR A 1 38  ? -12.246 3.535   -12.004 1.00 0.00 ? 38  THR A HG23 1  
ATOM 533   N N    . PRO A 1 39  ? -9.329  6.893   -11.279 1.00 0.00 ? 39  PRO A N    1  
ATOM 534   C CA   . PRO A 1 39  ? -8.905  8.253   -10.898 1.00 0.00 ? 39  PRO A CA   1  
ATOM 535   C C    . PRO A 1 39  ? -9.234  8.523   -9.426  1.00 0.00 ? 39  PRO A C    1  
ATOM 536   O O    . PRO A 1 39  ? -8.688  9.419   -8.814  1.00 0.00 ? 39  PRO A O    1  
ATOM 537   C CB   . PRO A 1 39  ? -9.711  9.187   -11.813 1.00 0.00 ? 39  PRO A CB   1  
ATOM 538   C CG   . PRO A 1 39  ? -10.589 8.302   -12.735 1.00 0.00 ? 39  PRO A CG   1  
ATOM 539   C CD   . PRO A 1 39  ? -10.312 6.834   -12.377 1.00 0.00 ? 39  PRO A CD   1  
ATOM 540   H HA   . PRO A 1 39  ? -7.851  8.384   -11.079 1.00 0.00 ? 39  PRO A HA   1  
ATOM 541   H HB2  . PRO A 1 39  ? -10.338 9.833   -11.214 1.00 0.00 ? 39  PRO A HB2  1  
ATOM 542   H HB3  . PRO A 1 39  ? -9.039  9.779   -12.415 1.00 0.00 ? 39  PRO A HB3  1  
ATOM 543   H HG2  . PRO A 1 39  ? -11.633 8.530   -12.573 1.00 0.00 ? 39  PRO A HG2  1  
ATOM 544   H HG3  . PRO A 1 39  ? -10.330 8.478   -13.767 1.00 0.00 ? 39  PRO A HG3  1  
ATOM 545   H HD2  . PRO A 1 39  ? -11.220 6.351   -12.047 1.00 0.00 ? 39  PRO A HD2  1  
ATOM 546   H HD3  . PRO A 1 39  ? -9.892  6.312   -13.223 1.00 0.00 ? 39  PRO A HD3  1  
ATOM 547   N N    . ALA A 1 40  ? -10.122 7.757   -8.853  1.00 0.00 ? 40  ALA A N    1  
ATOM 548   C CA   . ALA A 1 40  ? -10.482 7.974   -7.423  1.00 0.00 ? 40  ALA A CA   1  
ATOM 549   C C    . ALA A 1 40  ? -9.547  7.153   -6.529  1.00 0.00 ? 40  ALA A C    1  
ATOM 550   O O    . ALA A 1 40  ? -9.987  6.429   -5.659  1.00 0.00 ? 40  ALA A O    1  
ATOM 551   C CB   . ALA A 1 40  ? -11.928 7.528   -7.191  1.00 0.00 ? 40  ALA A CB   1  
ATOM 552   H H    . ALA A 1 40  ? -10.552 7.040   -9.364  1.00 0.00 ? 40  ALA A H    1  
ATOM 553   H HA   . ALA A 1 40  ? -10.388 9.023   -7.182  1.00 0.00 ? 40  ALA A HA   1  
ATOM 554   H HB1  . ALA A 1 40  ? -12.208 6.808   -7.945  1.00 0.00 ? 40  ALA A HB1  1  
ATOM 555   H HB2  . ALA A 1 40  ? -12.012 7.076   -6.213  1.00 0.00 ? 40  ALA A HB2  1  
ATOM 556   H HB3  . ALA A 1 40  ? -12.582 8.385   -7.250  1.00 0.00 ? 40  ALA A HB3  1  
ATOM 557   N N    . GLN A 1 41  ? -8.260  7.255   -6.736  1.00 0.00 ? 41  GLN A N    1  
ATOM 558   C CA   . GLN A 1 41  ? -7.308  6.473   -5.897  1.00 0.00 ? 41  GLN A CA   1  
ATOM 559   C C    . GLN A 1 41  ? -7.136  7.154   -4.535  1.00 0.00 ? 41  GLN A C    1  
ATOM 560   O O    . GLN A 1 41  ? -7.326  6.548   -3.499  1.00 0.00 ? 41  GLN A O    1  
ATOM 561   C CB   . GLN A 1 41  ? -5.949  6.403   -6.596  1.00 0.00 ? 41  GLN A CB   1  
ATOM 562   C CG   . GLN A 1 41  ? -6.150  6.114   -8.084  1.00 0.00 ? 41  GLN A CG   1  
ATOM 563   C CD   . GLN A 1 41  ? -4.787  5.986   -8.766  1.00 0.00 ? 41  GLN A CD   1  
ATOM 564   O OE1  . GLN A 1 41  ? -3.766  5.944   -8.108  1.00 0.00 ? 41  GLN A OE1  1  
ATOM 565   N NE2  . GLN A 1 41  ? -4.726  5.923   -10.068 1.00 0.00 ? 41  GLN A NE2  1  
ATOM 566   H H    . GLN A 1 41  ? -7.920  7.840   -7.445  1.00 0.00 ? 41  GLN A H    1  
ATOM 567   H HA   . GLN A 1 41  ? -7.690  5.473   -5.754  1.00 0.00 ? 41  GLN A HA   1  
ATOM 568   H HB2  . GLN A 1 41  ? -5.436  7.347   -6.479  1.00 0.00 ? 41  GLN A HB2  1  
ATOM 569   H HB3  . GLN A 1 41  ? -5.357  5.615   -6.155  1.00 0.00 ? 41  GLN A HB3  1  
ATOM 570   H HG2  . GLN A 1 41  ? -6.700  5.191   -8.199  1.00 0.00 ? 41  GLN A HG2  1  
ATOM 571   H HG3  . GLN A 1 41  ? -6.703  6.923   -8.537  1.00 0.00 ? 41  GLN A HG3  1  
ATOM 572   H HE21 . GLN A 1 41  ? -5.549  5.958   -10.599 1.00 0.00 ? 41  GLN A HE21 1  
ATOM 573   H HE22 . GLN A 1 41  ? -3.858  5.839   -10.515 1.00 0.00 ? 41  GLN A HE22 1  
ATOM 574   N N    . GLY A 1 42  ? -6.767  8.407   -4.530  1.00 0.00 ? 42  GLY A N    1  
ATOM 575   C CA   . GLY A 1 42  ? -6.571  9.123   -3.237  1.00 0.00 ? 42  GLY A CA   1  
ATOM 576   C C    . GLY A 1 42  ? -7.927  9.412   -2.589  1.00 0.00 ? 42  GLY A C    1  
ATOM 577   O O    . GLY A 1 42  ? -8.011  9.698   -1.411  1.00 0.00 ? 42  GLY A O    1  
ATOM 578   H H    . GLY A 1 42  ? -6.613  8.874   -5.377  1.00 0.00 ? 42  GLY A H    1  
ATOM 579   H HA2  . GLY A 1 42  ? -5.979  8.508   -2.575  1.00 0.00 ? 42  GLY A HA2  1  
ATOM 580   H HA3  . GLY A 1 42  ? -6.057  10.054  -3.417  1.00 0.00 ? 42  GLY A HA3  1  
ATOM 581   N N    . GLN A 1 43  ? -8.988  9.342   -3.344  1.00 0.00 ? 43  GLN A N    1  
ATOM 582   C CA   . GLN A 1 43  ? -10.333 9.615   -2.762  1.00 0.00 ? 43  GLN A CA   1  
ATOM 583   C C    . GLN A 1 43  ? -10.931 8.313   -2.227  1.00 0.00 ? 43  GLN A C    1  
ATOM 584   O O    . GLN A 1 43  ? -11.851 8.321   -1.434  1.00 0.00 ? 43  GLN A O    1  
ATOM 585   C CB   . GLN A 1 43  ? -11.251 10.189  -3.842  1.00 0.00 ? 43  GLN A CB   1  
ATOM 586   C CG   . GLN A 1 43  ? -12.529 10.725  -3.193  1.00 0.00 ? 43  GLN A CG   1  
ATOM 587   C CD   . GLN A 1 43  ? -13.694 10.595  -4.177  1.00 0.00 ? 43  GLN A CD   1  
ATOM 588   O OE1  . GLN A 1 43  ? -14.314 9.555   -4.268  1.00 0.00 ? 43  GLN A OE1  1  
ATOM 589   N NE2  . GLN A 1 43  ? -14.020 11.616  -4.922  1.00 0.00 ? 43  GLN A NE2  1  
ATOM 590   H H    . GLN A 1 43  ? -8.901  9.111   -4.292  1.00 0.00 ? 43  GLN A H    1  
ATOM 591   H HA   . GLN A 1 43  ? -10.238 10.325  -1.954  1.00 0.00 ? 43  GLN A HA   1  
ATOM 592   H HB2  . GLN A 1 43  ? -10.744 10.992  -4.357  1.00 0.00 ? 43  GLN A HB2  1  
ATOM 593   H HB3  . GLN A 1 43  ? -11.507 9.413   -4.547  1.00 0.00 ? 43  GLN A HB3  1  
ATOM 594   H HG2  . GLN A 1 43  ? -12.745 10.157  -2.300  1.00 0.00 ? 43  GLN A HG2  1  
ATOM 595   H HG3  . GLN A 1 43  ? -12.393 11.764  -2.935  1.00 0.00 ? 43  GLN A HG3  1  
ATOM 596   H HE21 . GLN A 1 43  ? -13.520 12.456  -4.848  1.00 0.00 ? 43  GLN A HE21 1  
ATOM 597   H HE22 . GLN A 1 43  ? -14.762 11.542  -5.558  1.00 0.00 ? 43  GLN A HE22 1  
ATOM 598   N N    . THR A 1 44  ? -10.418 7.194   -2.658  1.00 0.00 ? 44  THR A N    1  
ATOM 599   C CA   . THR A 1 44  ? -10.960 5.893   -2.176  1.00 0.00 ? 44  THR A CA   1  
ATOM 600   C C    . THR A 1 44  ? -10.210 5.461   -0.915  1.00 0.00 ? 44  THR A C    1  
ATOM 601   O O    . THR A 1 44  ? -10.727 4.731   -0.094  1.00 0.00 ? 44  THR A O    1  
ATOM 602   C CB   . THR A 1 44  ? -10.786 4.832   -3.266  1.00 0.00 ? 44  THR A CB   1  
ATOM 603   O OG1  . THR A 1 44  ? -11.583 5.180   -4.393  1.00 0.00 ? 44  THR A OG1  1  
ATOM 604   C CG2  . THR A 1 44  ? -11.222 3.468   -2.725  1.00 0.00 ? 44  THR A CG2  1  
ATOM 605   H H    . THR A 1 44  ? -9.677  7.208   -3.299  1.00 0.00 ? 44  THR A H    1  
ATOM 606   H HA   . THR A 1 44  ? -12.009 6.005   -1.947  1.00 0.00 ? 44  THR A HA   1  
ATOM 607   H HB   . THR A 1 44  ? -9.749  4.783   -3.560  1.00 0.00 ? 44  THR A HB   1  
ATOM 608   H HG1  . THR A 1 44  ? -12.076 4.402   -4.665  1.00 0.00 ? 44  THR A HG1  1  
ATOM 609   H HG21 . THR A 1 44  ? -11.772 3.605   -1.805  1.00 0.00 ? 44  THR A HG21 1  
ATOM 610   H HG22 . THR A 1 44  ? -11.853 2.978   -3.452  1.00 0.00 ? 44  THR A HG22 1  
ATOM 611   H HG23 . THR A 1 44  ? -10.350 2.860   -2.536  1.00 0.00 ? 44  THR A HG23 1  
ATOM 612   N N    . LEU A 1 45  ? -8.993  5.903   -0.756  1.00 0.00 ? 45  LEU A N    1  
ATOM 613   C CA   . LEU A 1 45  ? -8.212  5.512   0.452   1.00 0.00 ? 45  LEU A CA   1  
ATOM 614   C C    . LEU A 1 45  ? -8.606  6.400   1.634   1.00 0.00 ? 45  LEU A C    1  
ATOM 615   O O    . LEU A 1 45  ? -8.839  5.924   2.727   1.00 0.00 ? 45  LEU A O    1  
ATOM 616   C CB   . LEU A 1 45  ? -6.719  5.676   0.168   1.00 0.00 ? 45  LEU A CB   1  
ATOM 617   C CG   . LEU A 1 45  ? -6.142  4.342   -0.306  1.00 0.00 ? 45  LEU A CG   1  
ATOM 618   C CD1  . LEU A 1 45  ? -4.665  4.518   -0.658  1.00 0.00 ? 45  LEU A CD1  1  
ATOM 619   C CD2  . LEU A 1 45  ? -6.280  3.304   0.811   1.00 0.00 ? 45  LEU A CD2  1  
ATOM 620   H H    . LEU A 1 45  ? -8.592  6.490   -1.430  1.00 0.00 ? 45  LEU A H    1  
ATOM 621   H HA   . LEU A 1 45  ? -8.419  4.481   0.694   1.00 0.00 ? 45  LEU A HA   1  
ATOM 622   H HB2  . LEU A 1 45  ? -6.579  6.424   -0.599  1.00 0.00 ? 45  LEU A HB2  1  
ATOM 623   H HB3  . LEU A 1 45  ? -6.213  5.985   1.069   1.00 0.00 ? 45  LEU A HB3  1  
ATOM 624   H HG   . LEU A 1 45  ? -6.683  4.007   -1.180  1.00 0.00 ? 45  LEU A HG   1  
ATOM 625   H HD11 . LEU A 1 45  ? -4.440  5.570   -0.756  1.00 0.00 ? 45  LEU A HD11 1  
ATOM 626   H HD12 . LEU A 1 45  ? -4.055  4.091   0.125   1.00 0.00 ? 45  LEU A HD12 1  
ATOM 627   H HD13 . LEU A 1 45  ? -4.454  4.017   -1.591  1.00 0.00 ? 45  LEU A HD13 1  
ATOM 628   H HD21 . LEU A 1 45  ? -6.827  3.735   1.637   1.00 0.00 ? 45  LEU A HD21 1  
ATOM 629   H HD22 . LEU A 1 45  ? -6.813  2.442   0.438   1.00 0.00 ? 45  LEU A HD22 1  
ATOM 630   H HD23 . LEU A 1 45  ? -5.299  3.004   1.147   1.00 0.00 ? 45  LEU A HD23 1  
ATOM 631   N N    . ALA A 1 46  ? -8.679  7.687   1.429   1.00 0.00 ? 46  ALA A N    1  
ATOM 632   C CA   . ALA A 1 46  ? -9.053  8.596   2.548   1.00 0.00 ? 46  ALA A CA   1  
ATOM 633   C C    . ALA A 1 46  ? -10.485 8.293   2.994   1.00 0.00 ? 46  ALA A C    1  
ATOM 634   O O    . ALA A 1 46  ? -10.802 8.335   4.166   1.00 0.00 ? 46  ALA A O    1  
ATOM 635   C CB   . ALA A 1 46  ? -8.960  10.050  2.081   1.00 0.00 ? 46  ALA A CB   1  
ATOM 636   H H    . ALA A 1 46  ? -8.485  8.054   0.542   1.00 0.00 ? 46  ALA A H    1  
ATOM 637   H HA   . ALA A 1 46  ? -8.379  8.440   3.378   1.00 0.00 ? 46  ALA A HA   1  
ATOM 638   H HB1  . ALA A 1 46  ? -9.426  10.147  1.111   1.00 0.00 ? 46  ALA A HB1  1  
ATOM 639   H HB2  . ALA A 1 46  ? -9.467  10.689  2.789   1.00 0.00 ? 46  ALA A HB2  1  
ATOM 640   H HB3  . ALA A 1 46  ? -7.922  10.340  2.013   1.00 0.00 ? 46  ALA A HB3  1  
ATOM 641   N N    . SER A 1 47  ? -11.353 7.984   2.069   1.00 0.00 ? 47  SER A N    1  
ATOM 642   C CA   . SER A 1 47  ? -12.762 7.677   2.443   1.00 0.00 ? 47  SER A CA   1  
ATOM 643   C C    . SER A 1 47  ? -12.840 6.259   3.011   1.00 0.00 ? 47  SER A C    1  
ATOM 644   O O    . SER A 1 47  ? -13.554 5.999   3.960   1.00 0.00 ? 47  SER A O    1  
ATOM 645   C CB   . SER A 1 47  ? -13.652 7.780   1.204   1.00 0.00 ? 47  SER A CB   1  
ATOM 646   O OG   . SER A 1 47  ? -13.433 9.035   0.573   1.00 0.00 ? 47  SER A OG   1  
ATOM 647   H H    . SER A 1 47  ? -11.078 7.953   1.128   1.00 0.00 ? 47  SER A H    1  
ATOM 648   H HA   . SER A 1 47  ? -13.098 8.382   3.188   1.00 0.00 ? 47  SER A HA   1  
ATOM 649   H HB2  . SER A 1 47  ? -13.407 6.989   0.516   1.00 0.00 ? 47  SER A HB2  1  
ATOM 650   H HB3  . SER A 1 47  ? -14.689 7.689   1.500   1.00 0.00 ? 47  SER A HB3  1  
ATOM 651   H HG   . SER A 1 47  ? -14.122 9.636   0.864   1.00 0.00 ? 47  SER A HG   1  
ATOM 652   N N    . ALA A 1 48  ? -12.110 5.341   2.440   1.00 0.00 ? 48  ALA A N    1  
ATOM 653   C CA   . ALA A 1 48  ? -12.141 3.942   2.951   1.00 0.00 ? 48  ALA A CA   1  
ATOM 654   C C    . ALA A 1 48  ? -11.763 3.938   4.433   1.00 0.00 ? 48  ALA A C    1  
ATOM 655   O O    . ALA A 1 48  ? -12.207 3.103   5.195   1.00 0.00 ? 48  ALA A O    1  
ATOM 656   C CB   . ALA A 1 48  ? -11.145 3.086   2.165   1.00 0.00 ? 48  ALA A CB   1  
ATOM 657   H H    . ALA A 1 48  ? -11.540 5.572   1.678   1.00 0.00 ? 48  ALA A H    1  
ATOM 658   H HA   . ALA A 1 48  ? -13.136 3.538   2.833   1.00 0.00 ? 48  ALA A HA   1  
ATOM 659   H HB1  . ALA A 1 48  ? -10.159 3.519   2.240   1.00 0.00 ? 48  ALA A HB1  1  
ATOM 660   H HB2  . ALA A 1 48  ? -11.131 2.086   2.572   1.00 0.00 ? 48  ALA A HB2  1  
ATOM 661   H HB3  . ALA A 1 48  ? -11.443 3.047   1.128   1.00 0.00 ? 48  ALA A HB3  1  
ATOM 662   N N    . PHE A 1 49  ? -10.950 4.871   4.849   1.00 0.00 ? 49  PHE A N    1  
ATOM 663   C CA   . PHE A 1 49  ? -10.547 4.925   6.283   1.00 0.00 ? 49  PHE A CA   1  
ATOM 664   C C    . PHE A 1 49  ? -11.573 5.743   7.070   1.00 0.00 ? 49  PHE A C    1  
ATOM 665   O O    . PHE A 1 49  ? -11.269 6.791   7.603   1.00 0.00 ? 49  PHE A O    1  
ATOM 666   C CB   . PHE A 1 49  ? -9.173  5.586   6.405   1.00 0.00 ? 49  PHE A CB   1  
ATOM 667   C CG   . PHE A 1 49  ? -8.139  4.730   5.716   1.00 0.00 ? 49  PHE A CG   1  
ATOM 668   C CD1  . PHE A 1 49  ? -8.135  3.344   5.909   1.00 0.00 ? 49  PHE A CD1  1  
ATOM 669   C CD2  . PHE A 1 49  ? -7.185  5.324   4.883   1.00 0.00 ? 49  PHE A CD2  1  
ATOM 670   C CE1  . PHE A 1 49  ? -7.176  2.551   5.268   1.00 0.00 ? 49  PHE A CE1  1  
ATOM 671   C CE2  . PHE A 1 49  ? -6.225  4.531   4.242   1.00 0.00 ? 49  PHE A CE2  1  
ATOM 672   C CZ   . PHE A 1 49  ? -6.221  3.144   4.435   1.00 0.00 ? 49  PHE A CZ   1  
ATOM 673   H H    . PHE A 1 49  ? -10.606 5.538   4.218   1.00 0.00 ? 49  PHE A H    1  
ATOM 674   H HA   . PHE A 1 49  ? -10.502 3.923   6.682   1.00 0.00 ? 49  PHE A HA   1  
ATOM 675   H HB2  . PHE A 1 49  ? -9.201  6.561   5.943   1.00 0.00 ? 49  PHE A HB2  1  
ATOM 676   H HB3  . PHE A 1 49  ? -8.916  5.689   7.449   1.00 0.00 ? 49  PHE A HB3  1  
ATOM 677   H HD1  . PHE A 1 49  ? -8.873  2.886   6.552   1.00 0.00 ? 49  PHE A HD1  1  
ATOM 678   H HD2  . PHE A 1 49  ? -7.189  6.393   4.734   1.00 0.00 ? 49  PHE A HD2  1  
ATOM 679   H HE1  . PHE A 1 49  ? -7.173  1.481   5.417   1.00 0.00 ? 49  PHE A HE1  1  
ATOM 680   H HE2  . PHE A 1 49  ? -5.489  4.989   3.599   1.00 0.00 ? 49  PHE A HE2  1  
ATOM 681   H HZ   . PHE A 1 49  ? -5.481  2.533   3.941   1.00 0.00 ? 49  PHE A HZ   1  
ATOM 682   N N    . ASN A 1 50  ? -12.787 5.271   7.150   1.00 0.00 ? 50  ASN A N    1  
ATOM 683   C CA   . ASN A 1 50  ? -13.830 6.021   7.906   1.00 0.00 ? 50  ASN A CA   1  
ATOM 684   C C    . ASN A 1 50  ? -14.018 5.376   9.279   1.00 0.00 ? 50  ASN A C    1  
ATOM 685   O O    . ASN A 1 50  ? -13.661 5.937   10.296  1.00 0.00 ? 50  ASN A O    1  
ATOM 686   C CB   . ASN A 1 50  ? -15.151 5.975   7.135   1.00 0.00 ? 50  ASN A CB   1  
ATOM 687   C CG   . ASN A 1 50  ? -16.025 7.166   7.538   1.00 0.00 ? 50  ASN A CG   1  
ATOM 688   O OD1  . ASN A 1 50  ? -16.946 7.523   6.831   1.00 0.00 ? 50  ASN A OD1  1  
ATOM 689   N ND2  . ASN A 1 50  ? -15.774 7.802   8.650   1.00 0.00 ? 50  ASN A ND2  1  
ATOM 690   H H    . ASN A 1 50  ? -13.013 4.423   6.714   1.00 0.00 ? 50  ASN A H    1  
ATOM 691   H HA   . ASN A 1 50  ? -13.519 7.048   8.029   1.00 0.00 ? 50  ASN A HA   1  
ATOM 692   H HB2  . ASN A 1 50  ? -14.950 6.018   6.074   1.00 0.00 ? 50  ASN A HB2  1  
ATOM 693   H HB3  . ASN A 1 50  ? -15.670 5.056   7.366   1.00 0.00 ? 50  ASN A HB3  1  
ATOM 694   H HD21 . ASN A 1 50  ? -15.030 7.518   9.222   1.00 0.00 ? 50  ASN A HD21 1  
ATOM 695   H HD22 . ASN A 1 50  ? -16.333 8.561   8.916   1.00 0.00 ? 50  ASN A HD22 1  
ATOM 696   N N    . ASN A 1 51  ? -14.574 4.197   9.315   1.00 0.00 ? 51  ASN A N    1  
ATOM 697   C CA   . ASN A 1 51  ? -14.786 3.508   10.618  1.00 0.00 ? 51  ASN A CA   1  
ATOM 698   C C    . ASN A 1 51  ? -14.450 2.023   10.459  1.00 0.00 ? 51  ASN A C    1  
ATOM 699   O O    . ASN A 1 51  ? -15.051 1.169   11.080  1.00 0.00 ? 51  ASN A O    1  
ATOM 700   C CB   . ASN A 1 51  ? -16.249 3.662   11.041  1.00 0.00 ? 51  ASN A CB   1  
ATOM 701   C CG   . ASN A 1 51  ? -16.494 2.890   12.338  1.00 0.00 ? 51  ASN A CG   1  
ATOM 702   O OD1  . ASN A 1 51  ? -17.246 1.935   12.358  1.00 0.00 ? 51  ASN A OD1  1  
ATOM 703   N ND2  . ASN A 1 51  ? -15.887 3.265   13.431  1.00 0.00 ? 51  ASN A ND2  1  
ATOM 704   H H    . ASN A 1 51  ? -14.852 3.762   8.482   1.00 0.00 ? 51  ASN A H    1  
ATOM 705   H HA   . ASN A 1 51  ? -14.144 3.946   11.369  1.00 0.00 ? 51  ASN A HA   1  
ATOM 706   H HB2  . ASN A 1 51  ? -16.468 4.708   11.197  1.00 0.00 ? 51  ASN A HB2  1  
ATOM 707   H HB3  . ASN A 1 51  ? -16.890 3.272   10.266  1.00 0.00 ? 51  ASN A HB3  1  
ATOM 708   H HD21 . ASN A 1 51  ? -15.280 4.034   13.414  1.00 0.00 ? 51  ASN A HD21 1  
ATOM 709   H HD22 . ASN A 1 51  ? -16.040 2.778   14.268  1.00 0.00 ? 51  ASN A HD22 1  
ATOM 710   N N    . ALA A 1 52  ? -13.493 1.710   9.626   1.00 0.00 ? 52  ALA A N    1  
ATOM 711   C CA   . ALA A 1 52  ? -13.118 0.282   9.421   1.00 0.00 ? 52  ALA A CA   1  
ATOM 712   C C    . ALA A 1 52  ? -14.378 -0.547  9.164   1.00 0.00 ? 52  ALA A C    1  
ATOM 713   O O    . ALA A 1 52  ? -14.397 -1.742  9.375   1.00 0.00 ? 52  ALA A O    1  
ATOM 714   C CB   . ALA A 1 52  ? -12.407 -0.243  10.671  1.00 0.00 ? 52  ALA A CB   1  
ATOM 715   H H    . ALA A 1 52  ? -13.023 2.416   9.134   1.00 0.00 ? 52  ALA A H    1  
ATOM 716   H HA   . ALA A 1 52  ? -12.455 0.202   8.571   1.00 0.00 ? 52  ALA A HA   1  
ATOM 717   H HB1  . ALA A 1 52  ? -12.227 0.574   11.353  1.00 0.00 ? 52  ALA A HB1  1  
ATOM 718   H HB2  . ALA A 1 52  ? -13.028 -0.984  11.153  1.00 0.00 ? 52  ALA A HB2  1  
ATOM 719   H HB3  . ALA A 1 52  ? -11.466 -0.691  10.389  1.00 0.00 ? 52  ALA A HB3  1  
ATOM 720   N N    . ASP A 1 53  ? -15.436 0.078   8.721   1.00 0.00 ? 53  ASP A N    1  
ATOM 721   C CA   . ASP A 1 53  ? -16.695 -0.679  8.464   1.00 0.00 ? 53  ASP A CA   1  
ATOM 722   C C    . ASP A 1 53  ? -16.713 -1.229  7.029   1.00 0.00 ? 53  ASP A C    1  
ATOM 723   O O    . ASP A 1 53  ? -16.855 -2.419  6.835   1.00 0.00 ? 53  ASP A O    1  
ATOM 724   C CB   . ASP A 1 53  ? -17.900 0.241   8.678   1.00 0.00 ? 53  ASP A CB   1  
ATOM 725   C CG   . ASP A 1 53  ? -18.643 -0.178  9.948   1.00 0.00 ? 53  ASP A CG   1  
ATOM 726   O OD1  . ASP A 1 53  ? -19.157 -1.284  9.972   1.00 0.00 ? 53  ASP A OD1  1  
ATOM 727   O OD2  . ASP A 1 53  ? -18.686 0.615   10.875  1.00 0.00 ? 53  ASP A OD2  1  
ATOM 728   H H    . ASP A 1 53  ? -15.404 1.045   8.569   1.00 0.00 ? 53  ASP A H    1  
ATOM 729   H HA   . ASP A 1 53  ? -16.755 -1.505  9.157   1.00 0.00 ? 53  ASP A HA   1  
ATOM 730   H HB2  . ASP A 1 53  ? -17.561 1.262   8.778   1.00 0.00 ? 53  ASP A HB2  1  
ATOM 731   H HB3  . ASP A 1 53  ? -18.566 0.163   7.832   1.00 0.00 ? 53  ASP A HB3  1  
ATOM 732   N N    . PRO A 1 54  ? -16.588 -0.351  6.061   1.00 0.00 ? 54  PRO A N    1  
ATOM 733   C CA   . PRO A 1 54  ? -16.609 -0.749  4.640   1.00 0.00 ? 54  PRO A CA   1  
ATOM 734   C C    . PRO A 1 54  ? -15.395 -1.618  4.295   1.00 0.00 ? 54  PRO A C    1  
ATOM 735   O O    . PRO A 1 54  ? -15.501 -2.589  3.572   1.00 0.00 ? 54  PRO A O    1  
ATOM 736   C CB   . PRO A 1 54  ? -16.553 0.571   3.861   1.00 0.00 ? 54  PRO A CB   1  
ATOM 737   C CG   . PRO A 1 54  ? -16.396 1.719   4.890   1.00 0.00 ? 54  PRO A CG   1  
ATOM 738   C CD   . PRO A 1 54  ? -16.415 1.095   6.294   1.00 0.00 ? 54  PRO A CD   1  
ATOM 739   H HA   . PRO A 1 54  ? -17.523 -1.270  4.409   1.00 0.00 ? 54  PRO A HA   1  
ATOM 740   H HB2  . PRO A 1 54  ? -15.708 0.562   3.186   1.00 0.00 ? 54  PRO A HB2  1  
ATOM 741   H HB3  . PRO A 1 54  ? -17.467 0.708   3.305   1.00 0.00 ? 54  PRO A HB3  1  
ATOM 742   H HG2  . PRO A 1 54  ? -15.457 2.229   4.727   1.00 0.00 ? 54  PRO A HG2  1  
ATOM 743   H HG3  . PRO A 1 54  ? -17.214 2.416   4.791   1.00 0.00 ? 54  PRO A HG3  1  
ATOM 744   H HD2  . PRO A 1 54  ? -15.479 1.290   6.795   1.00 0.00 ? 54  PRO A HD2  1  
ATOM 745   H HD3  . PRO A 1 54  ? -17.241 1.485   6.864   1.00 0.00 ? 54  PRO A HD3  1  
ATOM 746   N N    . ILE A 1 55  ? -14.242 -1.273  4.797   1.00 0.00 ? 55  ILE A N    1  
ATOM 747   C CA   . ILE A 1 55  ? -13.025 -2.085  4.480   1.00 0.00 ? 55  ILE A CA   1  
ATOM 748   C C    . ILE A 1 55  ? -13.048 -3.388  5.282   1.00 0.00 ? 55  ILE A C    1  
ATOM 749   O O    . ILE A 1 55  ? -12.643 -4.428  4.803   1.00 0.00 ? 55  ILE A O    1  
ATOM 750   C CB   . ILE A 1 55  ? -11.734 -1.314  4.814   1.00 0.00 ? 55  ILE A CB   1  
ATOM 751   C CG1  . ILE A 1 55  ? -12.022 -0.151  5.769   1.00 0.00 ? 55  ILE A CG1  1  
ATOM 752   C CG2  . ILE A 1 55  ? -11.122 -0.765  3.527   1.00 0.00 ? 55  ILE A CG2  1  
ATOM 753   C CD1  . ILE A 1 55  ? -10.703 0.509   6.176   1.00 0.00 ? 55  ILE A CD1  1  
ATOM 754   H H    . ILE A 1 55  ? -14.181 -0.486  5.372   1.00 0.00 ? 55  ILE A H    1  
ATOM 755   H HA   . ILE A 1 55  ? -13.029 -2.324  3.426   1.00 0.00 ? 55  ILE A HA   1  
ATOM 756   H HB   . ILE A 1 55  ? -11.031 -1.991  5.277   1.00 0.00 ? 55  ILE A HB   1  
ATOM 757   H HG12 . ILE A 1 55  ? -12.651 0.575   5.273   1.00 0.00 ? 55  ILE A HG12 1  
ATOM 758   H HG13 . ILE A 1 55  ? -12.524 -0.522  6.649   1.00 0.00 ? 55  ILE A HG13 1  
ATOM 759   H HG21 . ILE A 1 55  ? -11.340 -1.437  2.710   1.00 0.00 ? 55  ILE A HG21 1  
ATOM 760   H HG22 . ILE A 1 55  ? -11.539 0.207   3.315   1.00 0.00 ? 55  ILE A HG22 1  
ATOM 761   H HG23 . ILE A 1 55  ? -10.052 -0.680  3.647   1.00 0.00 ? 55  ILE A HG23 1  
ATOM 762   H HD11 . ILE A 1 55  ? -10.126 0.736   5.292   1.00 0.00 ? 55  ILE A HD11 1  
ATOM 763   H HD12 . ILE A 1 55  ? -10.909 1.423   6.715   1.00 0.00 ? 55  ILE A HD12 1  
ATOM 764   H HD13 . ILE A 1 55  ? -10.144 -0.164  6.809   1.00 0.00 ? 55  ILE A HD13 1  
ATOM 765   N N    . ARG A 1 56  ? -13.512 -3.341  6.499   1.00 0.00 ? 56  ARG A N    1  
ATOM 766   C CA   . ARG A 1 56  ? -13.550 -4.579  7.330   1.00 0.00 ? 56  ARG A CA   1  
ATOM 767   C C    . ARG A 1 56  ? -14.593 -5.551  6.770   1.00 0.00 ? 56  ARG A C    1  
ATOM 768   O O    . ARG A 1 56  ? -14.266 -6.618  6.288   1.00 0.00 ? 56  ARG A O    1  
ATOM 769   C CB   . ARG A 1 56  ? -13.922 -4.211  8.769   1.00 0.00 ? 56  ARG A CB   1  
ATOM 770   C CG   . ARG A 1 56  ? -14.044 -5.483  9.614   1.00 0.00 ? 56  ARG A CG   1  
ATOM 771   C CD   . ARG A 1 56  ? -15.339 -5.433  10.431  1.00 0.00 ? 56  ARG A CD   1  
ATOM 772   N NE   . ARG A 1 56  ? -15.071 -5.883  11.828  1.00 0.00 ? 56  ARG A NE   1  
ATOM 773   C CZ   . ARG A 1 56  ? -15.941 -5.640  12.774  1.00 0.00 ? 56  ARG A CZ   1  
ATOM 774   N NH1  . ARG A 1 56  ? -17.044 -4.995  12.502  1.00 0.00 ? 56  ARG A NH1  1  
ATOM 775   N NH2  . ARG A 1 56  ? -15.706 -6.040  13.994  1.00 0.00 ? 56  ARG A NH2  1  
ATOM 776   H H    . ARG A 1 56  ? -13.829 -2.492  6.870   1.00 0.00 ? 56  ARG A H    1  
ATOM 777   H HA   . ARG A 1 56  ? -12.577 -5.049  7.317   1.00 0.00 ? 56  ARG A HA   1  
ATOM 778   H HB2  . ARG A 1 56  ? -13.157 -3.573  9.187   1.00 0.00 ? 56  ARG A HB2  1  
ATOM 779   H HB3  . ARG A 1 56  ? -14.867 -3.689  8.772   1.00 0.00 ? 56  ARG A HB3  1  
ATOM 780   H HG2  . ARG A 1 56  ? -14.060 -6.345  8.963   1.00 0.00 ? 56  ARG A HG2  1  
ATOM 781   H HG3  . ARG A 1 56  ? -13.201 -5.552  10.283  1.00 0.00 ? 56  ARG A HG3  1  
ATOM 782   H HD2  . ARG A 1 56  ? -15.715 -4.421  10.446  1.00 0.00 ? 56  ARG A HD2  1  
ATOM 783   H HD3  . ARG A 1 56  ? -16.074 -6.083  9.979   1.00 0.00 ? 56  ARG A HD3  1  
ATOM 784   H HE   . ARG A 1 56  ? -14.243 -6.364  12.037  1.00 0.00 ? 56  ARG A HE   1  
ATOM 785   H HH11 . ARG A 1 56  ? -17.228 -4.688  11.569  1.00 0.00 ? 56  ARG A HH11 1  
ATOM 786   H HH12 . ARG A 1 56  ? -17.706 -4.810  13.228  1.00 0.00 ? 56  ARG A HH12 1  
ATOM 787   H HH21 . ARG A 1 56  ? -14.863 -6.534  14.204  1.00 0.00 ? 56  ARG A HH21 1  
ATOM 788   H HH22 . ARG A 1 56  ? -16.371 -5.853  14.718  1.00 0.00 ? 56  ARG A HH22 1  
ATOM 789   N N    . ALA A 1 57  ? -15.846 -5.197  6.843   1.00 0.00 ? 57  ALA A N    1  
ATOM 790   C CA   . ALA A 1 57  ? -16.913 -6.104  6.330   1.00 0.00 ? 57  ALA A CA   1  
ATOM 791   C C    . ALA A 1 57  ? -16.969 -6.039  4.800   1.00 0.00 ? 57  ALA A C    1  
ATOM 792   O O    . ALA A 1 57  ? -17.098 -4.978  4.221   1.00 0.00 ? 57  ALA A O    1  
ATOM 793   C CB   . ALA A 1 57  ? -18.263 -5.674  6.910   1.00 0.00 ? 57  ALA A CB   1  
ATOM 794   H H    . ALA A 1 57  ? -16.088 -4.336  7.243   1.00 0.00 ? 57  ALA A H    1  
ATOM 795   H HA   . ALA A 1 57  ? -16.699 -7.118  6.636   1.00 0.00 ? 57  ALA A HA   1  
ATOM 796   H HB1  . ALA A 1 57  ? -18.153 -4.723  7.409   1.00 0.00 ? 57  ALA A HB1  1  
ATOM 797   H HB2  . ALA A 1 57  ? -18.985 -5.581  6.112   1.00 0.00 ? 57  ALA A HB2  1  
ATOM 798   H HB3  . ALA A 1 57  ? -18.602 -6.415  7.618   1.00 0.00 ? 57  ALA A HB3  1  
ATOM 799   N N    . SER A 1 58  ? -16.880 -7.172  4.150   1.00 0.00 ? 58  SER A N    1  
ATOM 800   C CA   . SER A 1 58  ? -16.934 -7.206  2.657   1.00 0.00 ? 58  SER A CA   1  
ATOM 801   C C    . SER A 1 58  ? -15.554 -6.889  2.071   1.00 0.00 ? 58  SER A C    1  
ATOM 802   O O    . SER A 1 58  ? -15.112 -7.518  1.130   1.00 0.00 ? 58  SER A O    1  
ATOM 803   C CB   . SER A 1 58  ? -17.949 -6.181  2.150   1.00 0.00 ? 58  SER A CB   1  
ATOM 804   O OG   . SER A 1 58  ? -18.376 -6.551  0.845   1.00 0.00 ? 58  SER A OG   1  
ATOM 805   H H    . SER A 1 58  ? -16.782 -8.010  4.650   1.00 0.00 ? 58  SER A H    1  
ATOM 806   H HA   . SER A 1 58  ? -17.236 -8.193  2.336   1.00 0.00 ? 58  SER A HA   1  
ATOM 807   H HB2  . SER A 1 58  ? -18.801 -6.158  2.809   1.00 0.00 ? 58  SER A HB2  1  
ATOM 808   H HB3  . SER A 1 58  ? -17.488 -5.202  2.125   1.00 0.00 ? 58  SER A HB3  1  
ATOM 809   H HG   . SER A 1 58  ? -19.333 -6.488  0.817   1.00 0.00 ? 58  SER A HG   1  
ATOM 810   N N    . GLY A 1 59  ? -14.871 -5.916  2.610   1.00 0.00 ? 59  GLY A N    1  
ATOM 811   C CA   . GLY A 1 59  ? -13.527 -5.563  2.071   1.00 0.00 ? 59  GLY A CA   1  
ATOM 812   C C    . GLY A 1 59  ? -13.668 -4.412  1.073   1.00 0.00 ? 59  GLY A C    1  
ATOM 813   O O    . GLY A 1 59  ? -14.722 -3.826  0.933   1.00 0.00 ? 59  GLY A O    1  
ATOM 814   H H    . GLY A 1 59  ? -15.242 -5.415  3.363   1.00 0.00 ? 59  GLY A H    1  
ATOM 815   H HA2  . GLY A 1 59  ? -12.882 -5.261  2.885   1.00 0.00 ? 59  GLY A HA2  1  
ATOM 816   H HA3  . GLY A 1 59  ? -13.101 -6.419  1.571   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 817   N N    . PHE A 1 60  ? -12.614 -4.083  0.376   1.00 0.00 ? 60  PHE A N    1  
ATOM 818   C CA   . PHE A 1 60  ? -12.695 -2.968  -0.611  1.00 0.00 ? 60  PHE A CA   1  
ATOM 819   C C    . PHE A 1 60  ? -12.218 -3.460  -1.980  1.00 0.00 ? 60  PHE A C    1  
ATOM 820   O O    . PHE A 1 60  ? -11.589 -4.494  -2.094  1.00 0.00 ? 60  PHE A O    1  
ATOM 821   C CB   . PHE A 1 60  ? -11.811 -1.809  -0.144  1.00 0.00 ? 60  PHE A CB   1  
ATOM 822   C CG   . PHE A 1 60  ? -10.359 -2.212  -0.230  1.00 0.00 ? 60  PHE A CG   1  
ATOM 823   C CD1  . PHE A 1 60  ? -9.644  -1.997  -1.413  1.00 0.00 ? 60  PHE A CD1  1  
ATOM 824   C CD2  . PHE A 1 60  ? -9.727  -2.799  0.873   1.00 0.00 ? 60  PHE A CD2  1  
ATOM 825   C CE1  . PHE A 1 60  ? -8.297  -2.368  -1.495  1.00 0.00 ? 60  PHE A CE1  1  
ATOM 826   C CE2  . PHE A 1 60  ? -8.380  -3.170  0.792   1.00 0.00 ? 60  PHE A CE2  1  
ATOM 827   C CZ   . PHE A 1 60  ? -7.665  -2.955  -0.392  1.00 0.00 ? 60  PHE A CZ   1  
ATOM 828   H H    . PHE A 1 60  ? -11.772 -4.567  0.503   1.00 0.00 ? 60  PHE A H    1  
ATOM 829   H HA   . PHE A 1 60  ? -13.718 -2.631  -0.687  1.00 0.00 ? 60  PHE A HA   1  
ATOM 830   H HB2  . PHE A 1 60  ? -11.985 -0.949  -0.773  1.00 0.00 ? 60  PHE A HB2  1  
ATOM 831   H HB3  . PHE A 1 60  ? -12.054 -1.561  0.879   1.00 0.00 ? 60  PHE A HB3  1  
ATOM 832   H HD1  . PHE A 1 60  ? -10.131 -1.544  -2.264  1.00 0.00 ? 60  PHE A HD1  1  
ATOM 833   H HD2  . PHE A 1 60  ? -10.279 -2.964  1.787   1.00 0.00 ? 60  PHE A HD2  1  
ATOM 834   H HE1  . PHE A 1 60  ? -7.745  -2.202  -2.408  1.00 0.00 ? 60  PHE A HE1  1  
ATOM 835   H HE2  . PHE A 1 60  ? -7.892  -3.623  1.642   1.00 0.00 ? 60  PHE A HE2  1  
ATOM 836   H HZ   . PHE A 1 60  ? -6.625  -3.241  -0.455  1.00 0.00 ? 60  PHE A HZ   1  
ATOM 837   N N    . ASP A 1 61  ? -12.515 -2.730  -3.024  1.00 0.00 ? 61  ASP A N    1  
ATOM 838   C CA   . ASP A 1 61  ? -12.080 -3.162  -4.383  1.00 0.00 ? 61  ASP A CA   1  
ATOM 839   C C    . ASP A 1 61  ? -11.353 -2.014  -5.086  1.00 0.00 ? 61  ASP A C    1  
ATOM 840   O O    . ASP A 1 61  ? -11.462 -0.866  -4.702  1.00 0.00 ? 61  ASP A O    1  
ATOM 841   C CB   . ASP A 1 61  ? -13.306 -3.565  -5.205  1.00 0.00 ? 61  ASP A CB   1  
ATOM 842   C CG   . ASP A 1 61  ? -14.087 -4.649  -4.459  1.00 0.00 ? 61  ASP A CG   1  
ATOM 843   O OD1  . ASP A 1 61  ? -13.452 -5.504  -3.863  1.00 0.00 ? 61  ASP A OD1  1  
ATOM 844   O OD2  . ASP A 1 61  ? -15.305 -4.605  -4.495  1.00 0.00 ? 61  ASP A OD2  1  
ATOM 845   H H    . ASP A 1 61  ? -13.025 -1.901  -2.913  1.00 0.00 ? 61  ASP A H    1  
ATOM 846   H HA   . ASP A 1 61  ? -11.415 -4.007  -4.296  1.00 0.00 ? 61  ASP A HA   1  
ATOM 847   H HB2  . ASP A 1 61  ? -13.939 -2.702  -5.353  1.00 0.00 ? 61  ASP A HB2  1  
ATOM 848   H HB3  . ASP A 1 61  ? -12.988 -3.948  -6.162  1.00 0.00 ? 61  ASP A HB3  1  
ATOM 849   N N    . LEU A 1 62  ? -10.612 -2.317  -6.118  1.00 0.00 ? 62  LEU A N    1  
ATOM 850   C CA   . LEU A 1 62  ? -9.876  -1.249  -6.854  1.00 0.00 ? 62  LEU A CA   1  
ATOM 851   C C    . LEU A 1 62  ? -10.015 -1.490  -8.360  1.00 0.00 ? 62  LEU A C    1  
ATOM 852   O O    . LEU A 1 62  ? -11.023 -1.980  -8.827  1.00 0.00 ? 62  LEU A O    1  
ATOM 853   C CB   . LEU A 1 62  ? -8.398  -1.281  -6.455  1.00 0.00 ? 62  LEU A CB   1  
ATOM 854   C CG   . LEU A 1 62  ? -8.273  -1.091  -4.942  1.00 0.00 ? 62  LEU A CG   1  
ATOM 855   C CD1  . LEU A 1 62  ? -6.829  -1.358  -4.510  1.00 0.00 ? 62  LEU A CD1  1  
ATOM 856   C CD2  . LEU A 1 62  ? -8.653  0.347   -4.579  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 857   H H    . LEU A 1 62  ? -10.540 -3.249  -6.411  1.00 0.00 ? 62  LEU A H    1  
ATOM 858   H HA   . LEU A 1 62  ? -10.296 -0.286  -6.605  1.00 0.00 ? 62  LEU A HA   1  
ATOM 859   H HB2  . LEU A 1 62  ? -7.969  -2.232  -6.736  1.00 0.00 ? 62  LEU A HB2  1  
ATOM 860   H HB3  . LEU A 1 62  ? -7.870  -0.485  -6.958  1.00 0.00 ? 62  LEU A HB3  1  
ATOM 861   H HG   . LEU A 1 62  ? -8.933  -1.779  -4.436  1.00 0.00 ? 62  LEU A HG   1  
ATOM 862   H HD11 . LEU A 1 62  ? -6.157  -0.777  -5.124  1.00 0.00 ? 62  LEU A HD11 1  
ATOM 863   H HD12 . LEU A 1 62  ? -6.705  -1.075  -3.476  1.00 0.00 ? 62  LEU A HD12 1  
ATOM 864   H HD13 . LEU A 1 62  ? -6.607  -2.408  -4.626  1.00 0.00 ? 62  LEU A HD13 1  
ATOM 865   H HD21 . LEU A 1 62  ? -8.060  1.034   -5.164  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 866   H HD22 . LEU A 1 62  ? -9.700  0.506   -4.788  1.00 0.00 ? 62  LEU A HD22 1  
ATOM 867   H HD23 . LEU A 1 62  ? -8.466  0.514   -3.529  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 868   N N    . ALA A 1 63  ? -9.015  -1.148  -9.125  1.00 0.00 ? 63  ALA A N    1  
ATOM 869   C CA   . ALA A 1 63  ? -9.102  -1.360  -10.596 1.00 0.00 ? 63  ALA A CA   1  
ATOM 870   C C    . ALA A 1 63  ? -9.454  -2.821  -10.885 1.00 0.00 ? 63  ALA A C    1  
ATOM 871   O O    . ALA A 1 63  ? -10.409 -3.114  -11.576 1.00 0.00 ? 63  ALA A O    1  
ATOM 872   C CB   . ALA A 1 63  ? -7.759  -1.020  -11.243 1.00 0.00 ? 63  ALA A CB   1  
ATOM 873   H H    . ALA A 1 63  ? -8.210  -0.753  -8.735  1.00 0.00 ? 63  ALA A H    1  
ATOM 874   H HA   . ALA A 1 63  ? -9.870  -0.719  -11.005 1.00 0.00 ? 63  ALA A HA   1  
ATOM 875   H HB1  . ALA A 1 63  ? -7.148  -0.473  -10.540 1.00 0.00 ? 63  ALA A HB1  1  
ATOM 876   H HB2  . ALA A 1 63  ? -7.253  -1.931  -11.527 1.00 0.00 ? 63  ALA A HB2  1  
ATOM 877   H HB3  . ALA A 1 63  ? -7.927  -0.414  -12.121 1.00 0.00 ? 63  ALA A HB3  1  
ATOM 878   N N    . GLY A 1 64  ? -8.690  -3.743  -10.363 1.00 0.00 ? 64  GLY A N    1  
ATOM 879   C CA   . GLY A 1 64  ? -8.987  -5.182  -10.614 1.00 0.00 ? 64  GLY A CA   1  
ATOM 880   C C    . GLY A 1 64  ? -8.444  -6.035  -9.466  1.00 0.00 ? 64  GLY A C    1  
ATOM 881   O O    . GLY A 1 64  ? -8.242  -7.225  -9.606  1.00 0.00 ? 64  GLY A O    1  
ATOM 882   H H    . GLY A 1 64  ? -7.923  -3.489  -9.808  1.00 0.00 ? 64  GLY A H    1  
ATOM 883   H HA2  . GLY A 1 64  ? -10.057 -5.319  -10.688 1.00 0.00 ? 64  GLY A HA2  1  
ATOM 884   H HA3  . GLY A 1 64  ? -8.521  -5.489  -11.538 1.00 0.00 ? 64  GLY A HA3  1  
ATOM 885   N N    . VAL A 1 65  ? -8.208  -5.439  -8.330  1.00 0.00 ? 65  VAL A N    1  
ATOM 886   C CA   . VAL A 1 65  ? -7.680  -6.218  -7.174  1.00 0.00 ? 65  VAL A CA   1  
ATOM 887   C C    . VAL A 1 65  ? -8.436  -5.818  -5.905  1.00 0.00 ? 65  VAL A C    1  
ATOM 888   O O    . VAL A 1 65  ? -8.878  -4.695  -5.763  1.00 0.00 ? 65  VAL A O    1  
ATOM 889   C CB   . VAL A 1 65  ? -6.189  -5.923  -6.997  1.00 0.00 ? 65  VAL A CB   1  
ATOM 890   C CG1  . VAL A 1 65  ? -5.693  -6.559  -5.698  1.00 0.00 ? 65  VAL A CG1  1  
ATOM 891   C CG2  . VAL A 1 65  ? -5.411  -6.505  -8.179  1.00 0.00 ? 65  VAL A CG2  1  
ATOM 892   H H    . VAL A 1 65  ? -8.378  -4.478  -8.236  1.00 0.00 ? 65  VAL A H    1  
ATOM 893   H HA   . VAL A 1 65  ? -7.819  -7.273  -7.359  1.00 0.00 ? 65  VAL A HA   1  
ATOM 894   H HB   . VAL A 1 65  ? -6.037  -4.854  -6.955  1.00 0.00 ? 65  VAL A HB   1  
ATOM 895   H HG11 . VAL A 1 65  ? -5.923  -7.615  -5.703  1.00 0.00 ? 65  VAL A HG11 1  
ATOM 896   H HG12 . VAL A 1 65  ? -4.624  -6.424  -5.616  1.00 0.00 ? 65  VAL A HG12 1  
ATOM 897   H HG13 . VAL A 1 65  ? -6.180  -6.089  -4.857  1.00 0.00 ? 65  VAL A HG13 1  
ATOM 898   H HG21 . VAL A 1 65  ? -6.105  -6.869  -8.922  1.00 0.00 ? 65  VAL A HG21 1  
ATOM 899   H HG22 . VAL A 1 65  ? -4.789  -5.737  -8.614  1.00 0.00 ? 65  VAL A HG22 1  
ATOM 900   H HG23 . VAL A 1 65  ? -4.791  -7.320  -7.836  1.00 0.00 ? 65  VAL A HG23 1  
ATOM 901   N N    . HIS A 1 66  ? -8.593  -6.726  -4.981  1.00 0.00 ? 66  HIS A N    1  
ATOM 902   C CA   . HIS A 1 66  ? -9.324  -6.387  -3.728  1.00 0.00 ? 66  HIS A CA   1  
ATOM 903   C C    . HIS A 1 66  ? -8.845  -7.287  -2.588  1.00 0.00 ? 66  HIS A C    1  
ATOM 904   O O    . HIS A 1 66  ? -8.275  -8.338  -2.807  1.00 0.00 ? 66  HIS A O    1  
ATOM 905   C CB   . HIS A 1 66  ? -10.825 -6.591  -3.943  1.00 0.00 ? 66  HIS A CB   1  
ATOM 906   C CG   . HIS A 1 66  ? -11.067 -7.954  -4.529  1.00 0.00 ? 66  HIS A CG   1  
ATOM 907   N ND1  . HIS A 1 66  ? -10.559 -8.328  -5.763  1.00 0.00 ? 66  HIS A ND1  1  
ATOM 908   C CD2  . HIS A 1 66  ? -11.761 -9.044  -4.063  1.00 0.00 ? 66  HIS A CD2  1  
ATOM 909   C CE1  . HIS A 1 66  ? -10.950 -9.595  -5.996  1.00 0.00 ? 66  HIS A CE1  1  
ATOM 910   N NE2  . HIS A 1 66  ? -11.685 -10.078 -4.991  1.00 0.00 ? 66  HIS A NE2  1  
ATOM 911   H H    . HIS A 1 66  ? -8.233  -7.628  -5.111  1.00 0.00 ? 66  HIS A H    1  
ATOM 912   H HA   . HIS A 1 66  ? -9.135  -5.356  -3.471  1.00 0.00 ? 66  HIS A HA   1  
ATOM 913   H HB2  . HIS A 1 66  ? -11.339 -6.507  -2.997  1.00 0.00 ? 66  HIS A HB2  1  
ATOM 914   H HB3  . HIS A 1 66  ? -11.196 -5.838  -4.622  1.00 0.00 ? 66  HIS A HB3  1  
ATOM 915   H HD1  . HIS A 1 66  ? -10.014 -7.772  -6.357  1.00 0.00 ? 66  HIS A HD1  1  
ATOM 916   H HD2  . HIS A 1 66  ? -12.284 -9.091  -3.119  1.00 0.00 ? 66  HIS A HD2  1  
ATOM 917   H HE1  . HIS A 1 66  ? -10.701 -10.151 -6.887  1.00 0.00 ? 66  HIS A HE1  1  
ATOM 918   N N    . TYR A 1 67  ? -9.073  -6.879  -1.369  1.00 0.00 ? 67  TYR A N    1  
ATOM 919   C CA   . TYR A 1 67  ? -8.633  -7.702  -0.208  1.00 0.00 ? 67  TYR A CA   1  
ATOM 920   C C    . TYR A 1 67  ? -9.713  -7.674  0.876   1.00 0.00 ? 67  TYR A C    1  
ATOM 921   O O    . TYR A 1 67  ? -10.729 -7.021  0.737   1.00 0.00 ? 67  TYR A O    1  
ATOM 922   C CB   . TYR A 1 67  ? -7.333  -7.129  0.361   1.00 0.00 ? 67  TYR A CB   1  
ATOM 923   C CG   . TYR A 1 67  ? -6.307  -7.018  -0.739  1.00 0.00 ? 67  TYR A CG   1  
ATOM 924   C CD1  . TYR A 1 67  ? -6.302  -5.899  -1.579  1.00 0.00 ? 67  TYR A CD1  1  
ATOM 925   C CD2  . TYR A 1 67  ? -5.360  -8.033  -0.919  1.00 0.00 ? 67  TYR A CD2  1  
ATOM 926   C CE1  . TYR A 1 67  ? -5.350  -5.794  -2.600  1.00 0.00 ? 67  TYR A CE1  1  
ATOM 927   C CE2  . TYR A 1 67  ? -4.408  -7.930  -1.940  1.00 0.00 ? 67  TYR A CE2  1  
ATOM 928   C CZ   . TYR A 1 67  ? -4.403  -6.810  -2.781  1.00 0.00 ? 67  TYR A CZ   1  
ATOM 929   O OH   . TYR A 1 67  ? -3.465  -6.706  -3.789  1.00 0.00 ? 67  TYR A OH   1  
ATOM 930   H H    . TYR A 1 67  ? -9.535  -6.027  -1.217  1.00 0.00 ? 67  TYR A H    1  
ATOM 931   H HA   . TYR A 1 67  ? -8.469  -8.720  -0.529  1.00 0.00 ? 67  TYR A HA   1  
ATOM 932   H HB2  . TYR A 1 67  ? -7.524  -6.150  0.776   1.00 0.00 ? 67  TYR A HB2  1  
ATOM 933   H HB3  . TYR A 1 67  ? -6.960  -7.782  1.135   1.00 0.00 ? 67  TYR A HB3  1  
ATOM 934   H HD1  . TYR A 1 67  ? -7.033  -5.116  -1.440  1.00 0.00 ? 67  TYR A HD1  1  
ATOM 935   H HD2  . TYR A 1 67  ? -5.365  -8.896  -0.269  1.00 0.00 ? 67  TYR A HD2  1  
ATOM 936   H HE1  . TYR A 1 67  ? -5.347  -4.931  -3.248  1.00 0.00 ? 67  TYR A HE1  1  
ATOM 937   H HE2  . TYR A 1 67  ? -3.678  -8.713  -2.078  1.00 0.00 ? 67  TYR A HE2  1  
ATOM 938   H HH   . TYR A 1 67  ? -2.594  -6.802  -3.395  1.00 0.00 ? 67  TYR A HH   1  
ATOM 939   N N    . VAL A 1 68  ? -9.500  -8.373  1.956   1.00 0.00 ? 68  VAL A N    1  
ATOM 940   C CA   . VAL A 1 68  ? -10.510 -8.383  3.050   1.00 0.00 ? 68  VAL A CA   1  
ATOM 941   C C    . VAL A 1 68  ? -10.174 -7.281  4.055   1.00 0.00 ? 68  VAL A C    1  
ATOM 942   O O    . VAL A 1 68  ? -11.040 -6.729  4.704   1.00 0.00 ? 68  VAL A O    1  
ATOM 943   C CB   . VAL A 1 68  ? -10.485 -9.744  3.747   1.00 0.00 ? 68  VAL A CB   1  
ATOM 944   C CG1  . VAL A 1 68  ? -9.248  -9.848  4.643   1.00 0.00 ? 68  VAL A CG1  1  
ATOM 945   C CG2  . VAL A 1 68  ? -11.747 -9.904  4.597   1.00 0.00 ? 68  VAL A CG2  1  
ATOM 946   H H    . VAL A 1 68  ? -8.672  -8.890  2.050   1.00 0.00 ? 68  VAL A H    1  
ATOM 947   H HA   . VAL A 1 68  ? -11.493 -8.206  2.637   1.00 0.00 ? 68  VAL A HA   1  
ATOM 948   H HB   . VAL A 1 68  ? -10.450 -10.523 3.002   1.00 0.00 ? 68  VAL A HB   1  
ATOM 949   H HG11 . VAL A 1 68  ? -8.365  -9.627  4.063   1.00 0.00 ? 68  VAL A HG11 1  
ATOM 950   H HG12 . VAL A 1 68  ? -9.331  -9.142  5.457   1.00 0.00 ? 68  VAL A HG12 1  
ATOM 951   H HG13 . VAL A 1 68  ? -9.176  -10.849 5.042   1.00 0.00 ? 68  VAL A HG13 1  
ATOM 952   H HG21 . VAL A 1 68  ? -12.507 -9.222  4.244   1.00 0.00 ? 68  VAL A HG21 1  
ATOM 953   H HG22 . VAL A 1 68  ? -12.109 -10.919 4.516   1.00 0.00 ? 68  VAL A HG22 1  
ATOM 954   H HG23 . VAL A 1 68  ? -11.517 -9.684  5.629   1.00 0.00 ? 68  VAL A HG23 1  
ATOM 955   N N    . THR A 1 69  ? -8.918  -6.959  4.181   1.00 0.00 ? 69  THR A N    1  
ATOM 956   C CA   . THR A 1 69  ? -8.508  -5.893  5.135   1.00 0.00 ? 69  THR A CA   1  
ATOM 957   C C    . THR A 1 69  ? -8.841  -6.330  6.562   1.00 0.00 ? 69  THR A C    1  
ATOM 958   O O    . THR A 1 69  ? -9.990  -6.390  6.952   1.00 0.00 ? 69  THR A O    1  
ATOM 959   C CB   . THR A 1 69  ? -9.257  -4.602  4.805   1.00 0.00 ? 69  THR A CB   1  
ATOM 960   O OG1  . THR A 1 69  ? -8.922  -4.186  3.488   1.00 0.00 ? 69  THR A OG1  1  
ATOM 961   C CG2  . THR A 1 69  ? -8.867  -3.511  5.802   1.00 0.00 ? 69  THR A CG2  1  
ATOM 962   H H    . THR A 1 69  ? -8.244  -7.419  3.645   1.00 0.00 ? 69  THR A H    1  
ATOM 963   H HA   . THR A 1 69  ? -7.446  -5.723  5.050   1.00 0.00 ? 69  THR A HA   1  
ATOM 964   H HB   . THR A 1 69  ? -10.317 -4.780  4.868   1.00 0.00 ? 69  THR A HB   1  
ATOM 965   H HG1  . THR A 1 69  ? -9.112  -4.911  2.889   1.00 0.00 ? 69  THR A HG1  1  
ATOM 966   H HG21 . THR A 1 69  ? -7.824  -3.618  6.064   1.00 0.00 ? 69  THR A HG21 1  
ATOM 967   H HG22 . THR A 1 69  ? -9.028  -2.541  5.356   1.00 0.00 ? 69  THR A HG22 1  
ATOM 968   H HG23 . THR A 1 69  ? -9.473  -3.603  6.691   1.00 0.00 ? 69  THR A HG23 1  
ATOM 969   N N    . LEU A 1 70  ? -7.843  -6.636  7.344   1.00 0.00 ? 70  LEU A N    1  
ATOM 970   C CA   . LEU A 1 70  ? -8.095  -7.071  8.747   1.00 0.00 ? 70  LEU A CA   1  
ATOM 971   C C    . LEU A 1 70  ? -8.107  -5.849  9.666   1.00 0.00 ? 70  LEU A C    1  
ATOM 972   O O    . LEU A 1 70  ? -9.127  -5.483  10.214  1.00 0.00 ? 70  LEU A O    1  
ATOM 973   C CB   . LEU A 1 70  ? -6.984  -8.028  9.184   1.00 0.00 ? 70  LEU A CB   1  
ATOM 974   C CG   . LEU A 1 70  ? -6.944  -9.227  8.236   1.00 0.00 ? 70  LEU A CG   1  
ATOM 975   C CD1  . LEU A 1 70  ? -5.576  -9.904  8.325   1.00 0.00 ? 70  LEU A CD1  1  
ATOM 976   C CD2  . LEU A 1 70  ? -8.030  -10.227 8.634   1.00 0.00 ? 70  LEU A CD2  1  
ATOM 977   H H    . LEU A 1 70  ? -6.924  -6.580  7.008   1.00 0.00 ? 70  LEU A H    1  
ATOM 978   H HA   . LEU A 1 70  ? -9.047  -7.576  8.803   1.00 0.00 ? 70  LEU A HA   1  
ATOM 979   H HB2  . LEU A 1 70  ? -6.035  -7.512  9.156   1.00 0.00 ? 70  LEU A HB2  1  
ATOM 980   H HB3  . LEU A 1 70  ? -7.178  -8.371  10.189  1.00 0.00 ? 70  LEU A HB3  1  
ATOM 981   H HG   . LEU A 1 70  ? -7.114  -8.891  7.223   1.00 0.00 ? 70  LEU A HG   1  
ATOM 982   H HD11 . LEU A 1 70  ? -4.991  -9.433  9.101   1.00 0.00 ? 70  LEU A HD11 1  
ATOM 983   H HD12 . LEU A 1 70  ? -5.707  -10.950 8.559   1.00 0.00 ? 70  LEU A HD12 1  
ATOM 984   H HD13 . LEU A 1 70  ? -5.064  -9.809  7.379   1.00 0.00 ? 70  LEU A HD13 1  
ATOM 985   H HD21 . LEU A 1 70  ? -8.992  -9.735  8.631   1.00 0.00 ? 70  LEU A HD21 1  
ATOM 986   H HD22 . LEU A 1 70  ? -8.042  -11.045 7.929   1.00 0.00 ? 70  LEU A HD22 1  
ATOM 987   H HD23 . LEU A 1 70  ? -7.824  -10.608 9.623   1.00 0.00 ? 70  LEU A HD23 1  
ATOM 988   N N    . ARG A 1 71  ? -6.979  -5.215  9.837   1.00 0.00 ? 71  ARG A N    1  
ATOM 989   C CA   . ARG A 1 71  ? -6.924  -4.015  10.719  1.00 0.00 ? 71  ARG A CA   1  
ATOM 990   C C    . ARG A 1 71  ? -6.649  -2.773  9.867   1.00 0.00 ? 71  ARG A C    1  
ATOM 991   O O    . ARG A 1 71  ? -5.825  -2.793  8.974   1.00 0.00 ? 71  ARG A O    1  
ATOM 992   C CB   . ARG A 1 71  ? -5.804  -4.190  11.747  1.00 0.00 ? 71  ARG A CB   1  
ATOM 993   C CG   . ARG A 1 71  ? -4.526  -4.646  11.038  1.00 0.00 ? 71  ARG A CG   1  
ATOM 994   C CD   . ARG A 1 71  ? -3.318  -3.937  11.653  1.00 0.00 ? 71  ARG A CD   1  
ATOM 995   N NE   . ARG A 1 71  ? -2.552  -4.897  12.498  1.00 0.00 ? 71  ARG A NE   1  
ATOM 996   C CZ   . ARG A 1 71  ? -1.333  -4.612  12.875  1.00 0.00 ? 71  ARG A CZ   1  
ATOM 997   N NH1  . ARG A 1 71  ? -0.782  -3.483  12.517  1.00 0.00 ? 71  ARG A NH1  1  
ATOM 998   N NH2  . ARG A 1 71  ? -0.666  -5.459  13.610  1.00 0.00 ? 71  ARG A NH2  1  
ATOM 999   H H    . ARG A 1 71  ? -6.168  -5.528  9.383   1.00 0.00 ? 71  ARG A H    1  
ATOM 1000  H HA   . ARG A 1 71  ? -7.869  -3.900  11.230  1.00 0.00 ? 71  ARG A HA   1  
ATOM 1001  H HB2  . ARG A 1 71  ? -5.624  -3.249  12.247  1.00 0.00 ? 71  ARG A HB2  1  
ATOM 1002  H HB3  . ARG A 1 71  ? -6.094  -4.934  12.473  1.00 0.00 ? 71  ARG A HB3  1  
ATOM 1003  H HG2  . ARG A 1 71  ? -4.414  -5.715  11.151  1.00 0.00 ? 71  ARG A HG2  1  
ATOM 1004  H HG3  . ARG A 1 71  ? -4.590  -4.399  9.989   1.00 0.00 ? 71  ARG A HG3  1  
ATOM 1005  H HD2  . ARG A 1 71  ? -2.680  -3.564  10.865  1.00 0.00 ? 71  ARG A HD2  1  
ATOM 1006  H HD3  . ARG A 1 71  ? -3.656  -3.112  12.263  1.00 0.00 ? 71  ARG A HD3  1  
ATOM 1007  H HE   . ARG A 1 71  ? -2.962  -5.744  12.771  1.00 0.00 ? 71  ARG A HE   1  
ATOM 1008  H HH11 . ARG A 1 71  ? -1.291  -2.832  11.954  1.00 0.00 ? 71  ARG A HH11 1  
ATOM 1009  H HH12 . ARG A 1 71  ? 0.151   -3.269  12.806  1.00 0.00 ? 71  ARG A HH12 1  
ATOM 1010  H HH21 . ARG A 1 71  ? -1.088  -6.324  13.884  1.00 0.00 ? 71  ARG A HH21 1  
ATOM 1011  H HH22 . ARG A 1 71  ? 0.267   -5.244  13.900  1.00 0.00 ? 71  ARG A HH22 1  
ATOM 1012  N N    . ALA A 1 72  ? -7.333  -1.694  10.132  1.00 0.00 ? 72  ALA A N    1  
ATOM 1013  C CA   . ALA A 1 72  ? -7.110  -0.456  9.332   1.00 0.00 ? 72  ALA A CA   1  
ATOM 1014  C C    . ALA A 1 72  ? -7.601  0.760   10.123  1.00 0.00 ? 72  ALA A C    1  
ATOM 1015  O O    . ALA A 1 72  ? -8.753  1.138   10.045  1.00 0.00 ? 72  ALA A O    1  
ATOM 1016  C CB   . ALA A 1 72  ? -7.885  -0.557  8.015   1.00 0.00 ? 72  ALA A CB   1  
ATOM 1017  H H    . ALA A 1 72  ? -7.995  -1.698  10.855  1.00 0.00 ? 72  ALA A H    1  
ATOM 1018  H HA   . ALA A 1 72  ? -6.056  -0.348  9.123   1.00 0.00 ? 72  ALA A HA   1  
ATOM 1019  H HB1  . ALA A 1 72  ? -7.649  -1.492  7.528   1.00 0.00 ? 72  ALA A HB1  1  
ATOM 1020  H HB2  . ALA A 1 72  ? -8.945  -0.516  8.217   1.00 0.00 ? 72  ALA A HB2  1  
ATOM 1021  H HB3  . ALA A 1 72  ? -7.610  0.264   7.369   1.00 0.00 ? 72  ALA A HB3  1  
ATOM 1022  N N    . ASP A 1 73  ? -6.735  1.377   10.885  1.00 0.00 ? 73  ASP A N    1  
ATOM 1023  C CA   . ASP A 1 73  ? -7.154  2.568   11.680  1.00 0.00 ? 73  ASP A CA   1  
ATOM 1024  C C    . ASP A 1 73  ? -5.974  3.069   12.516  1.00 0.00 ? 73  ASP A C    1  
ATOM 1025  O O    . ASP A 1 73  ? -5.848  4.248   12.782  1.00 0.00 ? 73  ASP A O    1  
ATOM 1026  C CB   . ASP A 1 73  ? -8.306  2.186   12.612  1.00 0.00 ? 73  ASP A CB   1  
ATOM 1027  C CG   . ASP A 1 73  ? -8.926  3.455   13.203  1.00 0.00 ? 73  ASP A CG   1  
ATOM 1028  O OD1  . ASP A 1 73  ? -8.631  4.526   12.699  1.00 0.00 ? 73  ASP A OD1  1  
ATOM 1029  O OD2  . ASP A 1 73  ? -9.685  3.333   14.150  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 1030  H H    . ASP A 1 73  ? -5.810  1.057   10.933  1.00 0.00 ? 73  ASP A H    1  
ATOM 1031  H HA   . ASP A 1 73  ? -7.477  3.351   11.010  1.00 0.00 ? 73  ASP A HA   1  
ATOM 1032  H HB2  . ASP A 1 73  ? -9.055  1.644   12.055  1.00 0.00 ? 73  ASP A HB2  1  
ATOM 1033  H HB3  . ASP A 1 73  ? -7.931  1.565   13.411  1.00 0.00 ? 73  ASP A HB3  1  
ATOM 1034  N N    . ASP A 1 74  ? -5.111  2.186   12.938  1.00 0.00 ? 74  ASP A N    1  
ATOM 1035  C CA   . ASP A 1 74  ? -3.946  2.622   13.759  1.00 0.00 ? 74  ASP A CA   1  
ATOM 1036  C C    . ASP A 1 74  ? -3.020  3.491   12.906  1.00 0.00 ? 74  ASP A C    1  
ATOM 1037  O O    . ASP A 1 74  ? -3.201  4.688   12.804  1.00 0.00 ? 74  ASP A O    1  
ATOM 1038  C CB   . ASP A 1 74  ? -3.185  1.392   14.261  1.00 0.00 ? 74  ASP A CB   1  
ATOM 1039  C CG   . ASP A 1 74  ? -3.557  1.123   15.721  1.00 0.00 ? 74  ASP A CG   1  
ATOM 1040  O OD1  . ASP A 1 74  ? -3.213  1.940   16.560  1.00 0.00 ? 74  ASP A OD1  1  
ATOM 1041  O OD2  . ASP A 1 74  ? -4.177  0.104   15.975  1.00 0.00 ? 74  ASP A OD2  1  
ATOM 1042  H H    . ASP A 1 74  ? -5.228  1.238   12.716  1.00 0.00 ? 74  ASP A H    1  
ATOM 1043  H HA   . ASP A 1 74  ? -4.297  3.196   14.604  1.00 0.00 ? 74  ASP A HA   1  
ATOM 1044  H HB2  . ASP A 1 74  ? -3.448  0.536   13.657  1.00 0.00 ? 74  ASP A HB2  1  
ATOM 1045  H HB3  . ASP A 1 74  ? -2.123  1.571   14.190  1.00 0.00 ? 74  ASP A HB3  1  
ATOM 1046  N N    . ARG A 1 75  ? -2.030  2.905   12.291  1.00 0.00 ? 75  ARG A N    1  
ATOM 1047  C CA   . ARG A 1 75  ? -1.101  3.709   11.449  1.00 0.00 ? 75  ARG A CA   1  
ATOM 1048  C C    . ARG A 1 75  ? -0.779  2.946   10.162  1.00 0.00 ? 75  ARG A C    1  
ATOM 1049  O O    . ARG A 1 75  ? -0.946  3.456   9.072   1.00 0.00 ? 75  ARG A O    1  
ATOM 1050  C CB   . ARG A 1 75  ? 0.189   3.978   12.227  1.00 0.00 ? 75  ARG A CB   1  
ATOM 1051  C CG   . ARG A 1 75  ? -0.154  4.318   13.680  1.00 0.00 ? 75  ARG A CG   1  
ATOM 1052  C CD   . ARG A 1 75  ? -0.923  5.638   13.726  1.00 0.00 ? 75  ARG A CD   1  
ATOM 1053  N NE   . ARG A 1 75  ? -0.108  6.670   14.440  1.00 0.00 ? 75  ARG A NE   1  
ATOM 1054  C CZ   . ARG A 1 75  ? 0.439   6.418   15.602  1.00 0.00 ? 75  ARG A CZ   1  
ATOM 1055  N NH1  . ARG A 1 75  ? 0.137   5.329   16.260  1.00 0.00 ? 75  ARG A NH1  1  
ATOM 1056  N NH2  . ARG A 1 75  ? 1.249   7.290   16.137  1.00 0.00 ? 75  ARG A NH2  1  
ATOM 1057  H H    . ARG A 1 75  ? -1.897  1.938   12.381  1.00 0.00 ? 75  ARG A H    1  
ATOM 1058  H HA   . ARG A 1 75  ? -1.570  4.649   11.199  1.00 0.00 ? 75  ARG A HA   1  
ATOM 1059  H HB2  . ARG A 1 75  ? 0.816   3.098   12.200  1.00 0.00 ? 75  ARG A HB2  1  
ATOM 1060  H HB3  . ARG A 1 75  ? 0.713   4.809   11.779  1.00 0.00 ? 75  ARG A HB3  1  
ATOM 1061  H HG2  . ARG A 1 75  ? -0.763  3.530   14.099  1.00 0.00 ? 75  ARG A HG2  1  
ATOM 1062  H HG3  . ARG A 1 75  ? 0.756   4.414   14.253  1.00 0.00 ? 75  ARG A HG3  1  
ATOM 1063  H HD2  . ARG A 1 75  ? -1.099  5.983   12.723  1.00 0.00 ? 75  ARG A HD2  1  
ATOM 1064  H HD3  . ARG A 1 75  ? -1.877  5.481   14.222  1.00 0.00 ? 75  ARG A HD3  1  
ATOM 1065  H HE   . ARG A 1 75  ? 0.061   7.532   14.006  1.00 0.00 ? 75  ARG A HE   1  
ATOM 1066  H HH11 . ARG A 1 75  ? -0.519  4.679   15.885  1.00 0.00 ? 75  ARG A HH11 1  
ATOM 1067  H HH12 . ARG A 1 75  ? 0.567   5.148   17.145  1.00 0.00 ? 75  ARG A HH12 1  
ATOM 1068  H HH21 . ARG A 1 75  ? 1.449   8.145   15.659  1.00 0.00 ? 75  ARG A HH21 1  
ATOM 1069  H HH22 . ARG A 1 75  ? 1.669   7.103   17.025  1.00 0.00 ? 75  ARG A HH22 1  
ATOM 1070  N N    . SER A 1 76  ? -0.322  1.729   10.274  1.00 0.00 ? 76  SER A N    1  
ATOM 1071  C CA   . SER A 1 76  ? 0.004   0.944   9.049   1.00 0.00 ? 76  SER A CA   1  
ATOM 1072  C C    . SER A 1 76  ? -1.234  0.166   8.599   1.00 0.00 ? 76  SER A C    1  
ATOM 1073  O O    . SER A 1 76  ? -2.171  -0.012  9.351   1.00 0.00 ? 76  SER A O    1  
ATOM 1074  C CB   . SER A 1 76  ? 1.136   -0.034  9.353   1.00 0.00 ? 76  SER A CB   1  
ATOM 1075  O OG   . SER A 1 76  ? 2.365   0.677   9.420   1.00 0.00 ? 76  SER A OG   1  
ATOM 1076  H H    . SER A 1 76  ? -0.193  1.331   11.161  1.00 0.00 ? 76  SER A H    1  
ATOM 1077  H HA   . SER A 1 76  ? 0.311   1.617   8.263   1.00 0.00 ? 76  SER A HA   1  
ATOM 1078  H HB2  . SER A 1 76  ? 0.954   -0.518  10.298  1.00 0.00 ? 76  SER A HB2  1  
ATOM 1079  H HB3  . SER A 1 76  ? 1.182   -0.779  8.571   1.00 0.00 ? 76  SER A HB3  1  
ATOM 1080  H HG   . SER A 1 76  ? 2.383   1.306   8.695   1.00 0.00 ? 76  SER A HG   1  
ATOM 1081  N N    . ILE A 1 77  ? -1.250  -0.297  7.376   1.00 0.00 ? 77  ILE A N    1  
ATOM 1082  C CA   . ILE A 1 77  ? -2.437  -1.056  6.890   1.00 0.00 ? 77  ILE A CA   1  
ATOM 1083  C C    . ILE A 1 77  ? -2.025  -2.034  5.786   1.00 0.00 ? 77  ILE A C    1  
ATOM 1084  O O    . ILE A 1 77  ? -2.153  -1.744  4.613   1.00 0.00 ? 77  ILE A O    1  
ATOM 1085  C CB   . ILE A 1 77  ? -3.470  -0.079  6.323   1.00 0.00 ? 77  ILE A CB   1  
ATOM 1086  C CG1  . ILE A 1 77  ? -4.054  0.768   7.456   1.00 0.00 ? 77  ILE A CG1  1  
ATOM 1087  C CG2  . ILE A 1 77  ? -4.596  -0.863  5.645   1.00 0.00 ? 77  ILE A CG2  1  
ATOM 1088  C CD1  . ILE A 1 77  ? -3.242  2.056   7.601   1.00 0.00 ? 77  ILE A CD1  1  
ATOM 1089  H H    . ILE A 1 77  ? -0.487  -0.143  6.781   1.00 0.00 ? 77  ILE A H    1  
ATOM 1090  H HA   . ILE A 1 77  ? -2.875  -1.603  7.711   1.00 0.00 ? 77  ILE A HA   1  
ATOM 1091  H HB   . ILE A 1 77  ? -2.994  0.565   5.598   1.00 0.00 ? 77  ILE A HB   1  
ATOM 1092  H HG12 . ILE A 1 77  ? -5.081  1.013   7.228   1.00 0.00 ? 77  ILE A HG12 1  
ATOM 1093  H HG13 . ILE A 1 77  ? -4.013  0.212   8.380   1.00 0.00 ? 77  ILE A HG13 1  
ATOM 1094  H HG21 . ILE A 1 77  ? -4.360  -1.916  5.658   1.00 0.00 ? 77  ILE A HG21 1  
ATOM 1095  H HG22 . ILE A 1 77  ? -5.522  -0.694  6.174   1.00 0.00 ? 77  ILE A HG22 1  
ATOM 1096  H HG23 . ILE A 1 77  ? -4.700  -0.530  4.622   1.00 0.00 ? 77  ILE A HG23 1  
ATOM 1097  H HD11 . ILE A 1 77  ? -2.461  2.076   6.855   1.00 0.00 ? 77  ILE A HD11 1  
ATOM 1098  H HD12 . ILE A 1 77  ? -3.891  2.908   7.464   1.00 0.00 ? 77  ILE A HD12 1  
ATOM 1099  H HD13 . ILE A 1 77  ? -2.800  2.095   8.586   1.00 0.00 ? 77  ILE A HD13 1  
ATOM 1100  N N    . TYR A 1 78  ? -1.554  -3.199  6.143   1.00 0.00 ? 78  TYR A N    1  
ATOM 1101  C CA   . TYR A 1 78  ? -1.168  -4.190  5.097   1.00 0.00 ? 78  TYR A CA   1  
ATOM 1102  C C    . TYR A 1 78  ? -2.317  -5.190  4.938   1.00 0.00 ? 78  TYR A C    1  
ATOM 1103  O O    . TYR A 1 78  ? -2.465  -6.108  5.719   1.00 0.00 ? 78  TYR A O    1  
ATOM 1104  C CB   . TYR A 1 78  ? 0.112   -4.940  5.500   1.00 0.00 ? 78  TYR A CB   1  
ATOM 1105  C CG   . TYR A 1 78  ? 0.833   -4.208  6.608   1.00 0.00 ? 78  TYR A CG   1  
ATOM 1106  C CD1  . TYR A 1 78  ? 0.478   -4.440  7.942   1.00 0.00 ? 78  TYR A CD1  1  
ATOM 1107  C CD2  . TYR A 1 78  ? 1.863   -3.305  6.302   1.00 0.00 ? 78  TYR A CD2  1  
ATOM 1108  C CE1  . TYR A 1 78  ? 1.148   -3.770  8.971   1.00 0.00 ? 78  TYR A CE1  1  
ATOM 1109  C CE2  . TYR A 1 78  ? 2.533   -2.637  7.334   1.00 0.00 ? 78  TYR A CE2  1  
ATOM 1110  C CZ   . TYR A 1 78  ? 2.176   -2.870  8.668   1.00 0.00 ? 78  TYR A CZ   1  
ATOM 1111  O OH   . TYR A 1 78  ? 2.837   -2.209  9.684   1.00 0.00 ? 78  TYR A OH   1  
ATOM 1112  H H    . TYR A 1 78  ? -1.473  -3.427  7.093   1.00 0.00 ? 78  TYR A H    1  
ATOM 1113  H HA   . TYR A 1 78  ? -1.007  -3.676  4.159   1.00 0.00 ? 78  TYR A HA   1  
ATOM 1114  H HB2  . TYR A 1 78  ? -0.148  -5.931  5.840   1.00 0.00 ? 78  TYR A HB2  1  
ATOM 1115  H HB3  . TYR A 1 78  ? 0.764   -5.018  4.642   1.00 0.00 ? 78  TYR A HB3  1  
ATOM 1116  H HD1  . TYR A 1 78  ? -0.315  -5.134  8.176   1.00 0.00 ? 78  TYR A HD1  1  
ATOM 1117  H HD2  . TYR A 1 78  ? 2.139   -3.125  5.272   1.00 0.00 ? 78  TYR A HD2  1  
ATOM 1118  H HE1  . TYR A 1 78  ? 0.873   -3.950  10.000  1.00 0.00 ? 78  TYR A HE1  1  
ATOM 1119  H HE2  . TYR A 1 78  ? 3.326   -1.941  7.100   1.00 0.00 ? 78  TYR A HE2  1  
ATOM 1120  H HH   . TYR A 1 78  ? 3.100   -2.860  10.340  1.00 0.00 ? 78  TYR A HH   1  
ATOM 1121  N N    . GLY A 1 79  ? -3.147  -5.006  3.946   1.00 0.00 ? 79  GLY A N    1  
ATOM 1122  C CA   . GLY A 1 79  ? -4.302  -5.931  3.757   1.00 0.00 ? 79  GLY A CA   1  
ATOM 1123  C C    . GLY A 1 79  ? -3.871  -7.184  2.991   1.00 0.00 ? 79  GLY A C    1  
ATOM 1124  O O    . GLY A 1 79  ? -2.807  -7.238  2.407   1.00 0.00 ? 79  GLY A O    1  
ATOM 1125  H H    . GLY A 1 79  ? -3.021  -4.248  3.337   1.00 0.00 ? 79  GLY A H    1  
ATOM 1126  H HA2  . GLY A 1 79  ? -4.690  -6.219  4.723   1.00 0.00 ? 79  GLY A HA2  1  
ATOM 1127  H HA3  . GLY A 1 79  ? -5.076  -5.425  3.199   1.00 0.00 ? 79  GLY A HA3  1  
ATOM 1128  N N    . LYS A 1 80  ? -4.704  -8.192  2.990   1.00 0.00 ? 80  LYS A N    1  
ATOM 1129  C CA   . LYS A 1 80  ? -4.371  -9.451  2.264   1.00 0.00 ? 80  LYS A CA   1  
ATOM 1130  C C    . LYS A 1 80  ? -5.671  -10.109 1.788   1.00 0.00 ? 80  LYS A C    1  
ATOM 1131  O O    . LYS A 1 80  ? -6.747  -9.755  2.225   1.00 0.00 ? 80  LYS A O    1  
ATOM 1132  C CB   . LYS A 1 80  ? -3.629  -10.402 3.203   1.00 0.00 ? 80  LYS A CB   1  
ATOM 1133  C CG   . LYS A 1 80  ? -4.537  -10.773 4.376   1.00 0.00 ? 80  LYS A CG   1  
ATOM 1134  C CD   . LYS A 1 80  ? -5.377  -11.997 4.003   1.00 0.00 ? 80  LYS A CD   1  
ATOM 1135  C CE   . LYS A 1 80  ? -5.761  -12.760 5.272   1.00 0.00 ? 80  LYS A CE   1  
ATOM 1136  N NZ   . LYS A 1 80  ? -7.220  -13.063 5.248   1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1137  H H    . LYS A 1 80  ? -5.558  -8.117  3.466   1.00 0.00 ? 80  LYS A H    1  
ATOM 1138  H HA   . LYS A 1 80  ? -3.748  -9.222  1.411   1.00 0.00 ? 80  LYS A HA   1  
ATOM 1139  H HB2  . LYS A 1 80  ? -3.353  -11.297 2.663   1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1140  H HB3  . LYS A 1 80  ? -2.739  -9.918  3.577   1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1141  H HG2  . LYS A 1 80  ? -3.932  -11.000 5.241   1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1142  H HG3  . LYS A 1 80  ? -5.192  -9.944  4.601   1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1143  H HD2  . LYS A 1 80  ? -6.272  -11.677 3.490   1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1144  H HD3  . LYS A 1 80  ? -4.803  -12.644 3.356   1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1145  H HE2  . LYS A 1 80  ? -5.202  -13.683 5.318   1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1146  H HE3  . LYS A 1 80  ? -5.532  -12.157 6.138   1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1147  H HZ1  . LYS A 1 80  ? -7.556  -13.077 4.264   1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1148  H HZ2  . LYS A 1 80  ? -7.387  -13.993 5.685   1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1149  H HZ3  . LYS A 1 80  ? -7.736  -12.332 5.777   1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1150  N N    . LYS A 1 81  ? -5.588  -11.059 0.894   1.00 0.00 ? 81  LYS A N    1  
ATOM 1151  C CA   . LYS A 1 81  ? -6.833  -11.717 0.400   1.00 0.00 ? 81  LYS A CA   1  
ATOM 1152  C C    . LYS A 1 81  ? -6.692  -13.243 0.462   1.00 0.00 ? 81  LYS A C    1  
ATOM 1153  O O    . LYS A 1 81  ? -7.647  -13.967 0.260   1.00 0.00 ? 81  LYS A O    1  
ATOM 1154  C CB   . LYS A 1 81  ? -7.092  -11.290 -1.047  1.00 0.00 ? 81  LYS A CB   1  
ATOM 1155  C CG   . LYS A 1 81  ? -5.780  -11.328 -1.834  1.00 0.00 ? 81  LYS A CG   1  
ATOM 1156  C CD   . LYS A 1 81  ? -6.053  -10.996 -3.303  1.00 0.00 ? 81  LYS A CD   1  
ATOM 1157  C CE   . LYS A 1 81  ? -6.403  -12.278 -4.062  1.00 0.00 ? 81  LYS A CE   1  
ATOM 1158  N NZ   . LYS A 1 81  ? -6.888  -11.930 -5.427  1.00 0.00 ? 81  LYS A NZ   1  
ATOM 1159  H H    . LYS A 1 81  ? -4.714  -11.331 0.544   1.00 0.00 ? 81  LYS A H    1  
ATOM 1160  H HA   . LYS A 1 81  ? -7.666  -11.410 1.016   1.00 0.00 ? 81  LYS A HA   1  
ATOM 1161  H HB2  . LYS A 1 81  ? -7.805  -11.965 -1.499  1.00 0.00 ? 81  LYS A HB2  1  
ATOM 1162  H HB3  . LYS A 1 81  ? -7.489  -10.286 -1.061  1.00 0.00 ? 81  LYS A HB3  1  
ATOM 1163  H HG2  . LYS A 1 81  ? -5.093  -10.603 -1.422  1.00 0.00 ? 81  LYS A HG2  1  
ATOM 1164  H HG3  . LYS A 1 81  ? -5.347  -12.314 -1.765  1.00 0.00 ? 81  LYS A HG3  1  
ATOM 1165  H HD2  . LYS A 1 81  ? -6.878  -10.301 -3.368  1.00 0.00 ? 81  LYS A HD2  1  
ATOM 1166  H HD3  . LYS A 1 81  ? -5.172  -10.550 -3.741  1.00 0.00 ? 81  LYS A HD3  1  
ATOM 1167  H HE2  . LYS A 1 81  ? -5.524  -12.901 -4.139  1.00 0.00 ? 81  LYS A HE2  1  
ATOM 1168  H HE3  . LYS A 1 81  ? -7.177  -12.811 -3.530  1.00 0.00 ? 81  LYS A HE3  1  
ATOM 1169  H HZ1  . LYS A 1 81  ? -7.209  -10.940 -5.438  1.00 0.00 ? 81  LYS A HZ1  1  
ATOM 1170  H HZ2  . LYS A 1 81  ? -6.115  -12.051 -6.111  1.00 0.00 ? 81  LYS A HZ2  1  
ATOM 1171  H HZ3  . LYS A 1 81  ? -7.677  -12.555 -5.685  1.00 0.00 ? 81  LYS A HZ3  1  
ATOM 1172  N N    . GLY A 1 82  ? -5.517  -13.741 0.733   1.00 0.00 ? 82  GLY A N    1  
ATOM 1173  C CA   . GLY A 1 82  ? -5.335  -15.220 0.797   1.00 0.00 ? 82  GLY A CA   1  
ATOM 1174  C C    . GLY A 1 82  ? -4.353  -15.658 -0.290  1.00 0.00 ? 82  GLY A C    1  
ATOM 1175  O O    . GLY A 1 82  ? -3.722  -16.692 -0.195  1.00 0.00 ? 82  GLY A O    1  
ATOM 1176  H H    . GLY A 1 82  ? -4.755  -13.147 0.891   1.00 0.00 ? 82  GLY A H    1  
ATOM 1177  H HA2  . GLY A 1 82  ? -4.948  -15.495 1.768   1.00 0.00 ? 82  GLY A HA2  1  
ATOM 1178  H HA3  . GLY A 1 82  ? -6.285  -15.708 0.636   1.00 0.00 ? 82  GLY A HA3  1  
ATOM 1179  N N    . SER A 1 83  ? -4.216  -14.873 -1.323  1.00 0.00 ? 83  SER A N    1  
ATOM 1180  C CA   . SER A 1 83  ? -3.272  -15.232 -2.417  1.00 0.00 ? 83  SER A CA   1  
ATOM 1181  C C    . SER A 1 83  ? -2.310  -14.066 -2.645  1.00 0.00 ? 83  SER A C    1  
ATOM 1182  O O    . SER A 1 83  ? -1.112  -14.198 -2.493  1.00 0.00 ? 83  SER A O    1  
ATOM 1183  C CB   . SER A 1 83  ? -4.057  -15.506 -3.700  1.00 0.00 ? 83  SER A CB   1  
ATOM 1184  O OG   . SER A 1 83  ? -5.378  -15.908 -3.364  1.00 0.00 ? 83  SER A OG   1  
ATOM 1185  H H    . SER A 1 83  ? -4.733  -14.042 -1.377  1.00 0.00 ? 83  SER A H    1  
ATOM 1186  H HA   . SER A 1 83  ? -2.713  -16.113 -2.139  1.00 0.00 ? 83  SER A HA   1  
ATOM 1187  H HB2  . SER A 1 83  ? -4.099  -14.611 -4.297  1.00 0.00 ? 83  SER A HB2  1  
ATOM 1188  H HB3  . SER A 1 83  ? -3.564  -16.288 -4.262  1.00 0.00 ? 83  SER A HB3  1  
ATOM 1189  H HG   . SER A 1 83  ? -5.989  -15.388 -3.892  1.00 0.00 ? 83  SER A HG   1  
ATOM 1190  N N    . ALA A 1 84  ? -2.828  -12.921 -2.996  1.00 0.00 ? 84  ALA A N    1  
ATOM 1191  C CA   . ALA A 1 84  ? -1.947  -11.741 -3.221  1.00 0.00 ? 84  ALA A CA   1  
ATOM 1192  C C    . ALA A 1 84  ? -1.985  -10.851 -1.977  1.00 0.00 ? 84  ALA A C    1  
ATOM 1193  O O    . ALA A 1 84  ? -2.507  -11.233 -0.949  1.00 0.00 ? 84  ALA A O    1  
ATOM 1194  C CB   . ALA A 1 84  ? -2.445  -10.950 -4.433  1.00 0.00 ? 84  ALA A CB   1  
ATOM 1195  H H    . ALA A 1 84  ? -3.798  -12.834 -3.104  1.00 0.00 ? 84  ALA A H    1  
ATOM 1196  H HA   . ALA A 1 84  ? -0.935  -12.075 -3.397  1.00 0.00 ? 84  ALA A HA   1  
ATOM 1197  H HB1  . ALA A 1 84  ? -3.194  -11.527 -4.957  1.00 0.00 ? 84  ALA A HB1  1  
ATOM 1198  H HB2  . ALA A 1 84  ? -2.877  -10.017 -4.102  1.00 0.00 ? 84  ALA A HB2  1  
ATOM 1199  H HB3  . ALA A 1 84  ? -1.618  -10.748 -5.097  1.00 0.00 ? 84  ALA A HB3  1  
ATOM 1200  N N    . GLY A 1 85  ? -1.440  -9.668  -2.057  1.00 0.00 ? 85  GLY A N    1  
ATOM 1201  C CA   . GLY A 1 85  ? -1.456  -8.768  -0.870  1.00 0.00 ? 85  GLY A CA   1  
ATOM 1202  C C    . GLY A 1 85  ? -1.064  -7.350  -1.287  1.00 0.00 ? 85  GLY A C    1  
ATOM 1203  O O    . GLY A 1 85  ? -0.345  -7.148  -2.246  1.00 0.00 ? 85  GLY A O    1  
ATOM 1204  H H    . GLY A 1 85  ? -1.023  -9.373  -2.893  1.00 0.00 ? 85  GLY A H    1  
ATOM 1205  H HA2  . GLY A 1 85  ? -2.448  -8.755  -0.442  1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1206  H HA3  . GLY A 1 85  ? -0.754  -9.129  -0.136  1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1207  N N    . VAL A 1 86  ? -1.528  -6.365  -0.567  1.00 0.00 ? 86  VAL A N    1  
ATOM 1208  C CA   . VAL A 1 86  ? -1.181  -4.957  -0.908  1.00 0.00 ? 86  VAL A CA   1  
ATOM 1209  C C    . VAL A 1 86  ? -0.810  -4.211  0.376   1.00 0.00 ? 86  VAL A C    1  
ATOM 1210  O O    . VAL A 1 86  ? -1.661  -3.854  1.167   1.00 0.00 ? 86  VAL A O    1  
ATOM 1211  C CB   . VAL A 1 86  ? -2.382  -4.275  -1.570  1.00 0.00 ? 86  VAL A CB   1  
ATOM 1212  C CG1  . VAL A 1 86  ? -3.539  -4.184  -0.574  1.00 0.00 ? 86  VAL A CG1  1  
ATOM 1213  C CG2  . VAL A 1 86  ? -1.983  -2.867  -2.016  1.00 0.00 ? 86  VAL A CG2  1  
ATOM 1214  H H    . VAL A 1 86  ? -2.102  -6.553  0.205   1.00 0.00 ? 86  VAL A H    1  
ATOM 1215  H HA   . VAL A 1 86  ? -0.340  -4.947  -1.586  1.00 0.00 ? 86  VAL A HA   1  
ATOM 1216  H HB   . VAL A 1 86  ? -2.693  -4.852  -2.430  1.00 0.00 ? 86  VAL A HB   1  
ATOM 1217  H HG11 . VAL A 1 86  ? -3.496  -5.022  0.106   1.00 0.00 ? 86  VAL A HG11 1  
ATOM 1218  H HG12 . VAL A 1 86  ? -3.461  -3.263  -0.015  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 1219  H HG13 . VAL A 1 86  ? -4.477  -4.202  -1.109  1.00 0.00 ? 86  VAL A HG13 1  
ATOM 1220  H HG21 . VAL A 1 86  ? -1.666  -2.294  -1.157  1.00 0.00 ? 86  VAL A HG21 1  
ATOM 1221  H HG22 . VAL A 1 86  ? -1.171  -2.930  -2.726  1.00 0.00 ? 86  VAL A HG22 1  
ATOM 1222  H HG23 . VAL A 1 86  ? -2.829  -2.383  -2.480  1.00 0.00 ? 86  VAL A HG23 1  
ATOM 1223  N N    . ILE A 1 87  ? 0.456   -3.981  0.595   1.00 0.00 ? 87  ILE A N    1  
ATOM 1224  C CA   . ILE A 1 87  ? 0.880   -3.268  1.833   1.00 0.00 ? 87  ILE A CA   1  
ATOM 1225  C C    . ILE A 1 87  ? 0.669   -1.762  1.659   1.00 0.00 ? 87  ILE A C    1  
ATOM 1226  O O    . ILE A 1 87  ? 1.391   -1.102  0.939   1.00 0.00 ? 87  ILE A O    1  
ATOM 1227  C CB   . ILE A 1 87  ? 2.362   -3.558  2.101   1.00 0.00 ? 87  ILE A CB   1  
ATOM 1228  C CG1  . ILE A 1 87  ? 2.503   -4.965  2.686   1.00 0.00 ? 87  ILE A CG1  1  
ATOM 1229  C CG2  . ILE A 1 87  ? 2.924   -2.539  3.096   1.00 0.00 ? 87  ILE A CG2  1  
ATOM 1230  C CD1  . ILE A 1 87  ? 3.425   -5.799  1.795   1.00 0.00 ? 87  ILE A CD1  1  
ATOM 1231  H H    . ILE A 1 87  ? 1.127   -4.284  -0.051  1.00 0.00 ? 87  ILE A H    1  
ATOM 1232  H HA   . ILE A 1 87  ? 0.290   -3.618  2.667   1.00 0.00 ? 87  ILE A HA   1  
ATOM 1233  H HB   . ILE A 1 87  ? 2.913   -3.496  1.174   1.00 0.00 ? 87  ILE A HB   1  
ATOM 1234  H HG12 . ILE A 1 87  ? 2.922   -4.901  3.680   1.00 0.00 ? 87  ILE A HG12 1  
ATOM 1235  H HG13 . ILE A 1 87  ? 1.532   -5.434  2.734   1.00 0.00 ? 87  ILE A HG13 1  
ATOM 1236  H HG21 . ILE A 1 87  ? 2.110   -2.007  3.566   1.00 0.00 ? 87  ILE A HG21 1  
ATOM 1237  H HG22 . ILE A 1 87  ? 3.501   -3.053  3.851   1.00 0.00 ? 87  ILE A HG22 1  
ATOM 1238  H HG23 . ILE A 1 87  ? 3.558   -1.838  2.573   1.00 0.00 ? 87  ILE A HG23 1  
ATOM 1239  H HD11 . ILE A 1 87  ? 3.359   -5.444  0.777   1.00 0.00 ? 87  ILE A HD11 1  
ATOM 1240  H HD12 . ILE A 1 87  ? 4.443   -5.707  2.143   1.00 0.00 ? 87  ILE A HD12 1  
ATOM 1241  H HD13 . ILE A 1 87  ? 3.123   -6.834  1.835   1.00 0.00 ? 87  ILE A HD13 1  
ATOM 1242  N N    . THR A 1 88  ? -0.313  -1.214  2.320   1.00 0.00 ? 88  THR A N    1  
ATOM 1243  C CA   . THR A 1 88  ? -0.566  0.249   2.198   1.00 0.00 ? 88  THR A CA   1  
ATOM 1244  C C    . THR A 1 88  ? -0.240  0.933   3.529   1.00 0.00 ? 88  THR A C    1  
ATOM 1245  O O    . THR A 1 88  ? -1.033  0.930   4.450   1.00 0.00 ? 88  THR A O    1  
ATOM 1246  C CB   . THR A 1 88  ? -2.037  0.491   1.849   1.00 0.00 ? 88  THR A CB   1  
ATOM 1247  O OG1  . THR A 1 88  ? -2.861  -0.139  2.819   1.00 0.00 ? 88  THR A OG1  1  
ATOM 1248  C CG2  . THR A 1 88  ? -2.341  -0.089  0.466   1.00 0.00 ? 88  THR A CG2  1  
ATOM 1249  H H    . THR A 1 88  ? -0.881  -1.763  2.899   1.00 0.00 ? 88  THR A H    1  
ATOM 1250  H HA   . THR A 1 88  ? 0.062   0.658   1.420   1.00 0.00 ? 88  THR A HA   1  
ATOM 1251  H HB   . THR A 1 88  ? -2.235  1.551   1.840   1.00 0.00 ? 88  THR A HB   1  
ATOM 1252  H HG1  . THR A 1 88  ? -3.740  0.240   2.752   1.00 0.00 ? 88  THR A HG1  1  
ATOM 1253  H HG21 . THR A 1 88  ? -2.099  -1.141  0.454   1.00 0.00 ? 88  THR A HG21 1  
ATOM 1254  H HG22 . THR A 1 88  ? -3.390  0.041   0.244   1.00 0.00 ? 88  THR A HG22 1  
ATOM 1255  H HG23 . THR A 1 88  ? -1.750  0.425   -0.278  1.00 0.00 ? 88  THR A HG23 1  
ATOM 1256  N N    . VAL A 1 89  ? 0.921   1.518   3.638   1.00 0.00 ? 89  VAL A N    1  
ATOM 1257  C CA   . VAL A 1 89  ? 1.292   2.202   4.910   1.00 0.00 ? 89  VAL A CA   1  
ATOM 1258  C C    . VAL A 1 89  ? 1.698   3.645   4.610   1.00 0.00 ? 89  VAL A C    1  
ATOM 1259  O O    . VAL A 1 89  ? 2.003   3.993   3.488   1.00 0.00 ? 89  VAL A O    1  
ATOM 1260  C CB   . VAL A 1 89  ? 2.464   1.470   5.564   1.00 0.00 ? 89  VAL A CB   1  
ATOM 1261  C CG1  . VAL A 1 89  ? 2.133   -0.018  5.692   1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1262  C CG2  . VAL A 1 89  ? 3.715   1.642   4.701   1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1263  H H    . VAL A 1 89  ? 1.547   1.511   2.884   1.00 0.00 ? 89  VAL A H    1  
ATOM 1264  H HA   . VAL A 1 89  ? 0.446   2.199   5.580   1.00 0.00 ? 89  VAL A HA   1  
ATOM 1265  H HB   . VAL A 1 89  ? 2.643   1.883   6.546   1.00 0.00 ? 89  VAL A HB   1  
ATOM 1266  H HG11 . VAL A 1 89  ? 1.557   -0.334  4.835   1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1267  H HG12 . VAL A 1 89  ? 3.049   -0.588  5.741   1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1268  H HG13 . VAL A 1 89  ? 1.559   -0.183  6.592   1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1269  H HG21 . VAL A 1 89  ? 3.439   2.080   3.753   1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1270  H HG22 . VAL A 1 89  ? 4.416   2.289   5.207   1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1271  H HG23 . VAL A 1 89  ? 4.172   0.678   4.532   1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1272  N N    . LYS A 1 90  ? 1.703   4.489   5.605   1.00 0.00 ? 90  LYS A N    1  
ATOM 1273  C CA   . LYS A 1 90  ? 2.085   5.910   5.375   1.00 0.00 ? 90  LYS A CA   1  
ATOM 1274  C C    . LYS A 1 90  ? 3.567   6.104   5.702   1.00 0.00 ? 90  LYS A C    1  
ATOM 1275  O O    . LYS A 1 90  ? 4.138   5.384   6.496   1.00 0.00 ? 90  LYS A O    1  
ATOM 1276  C CB   . LYS A 1 90  ? 1.243   6.814   6.280   1.00 0.00 ? 90  LYS A CB   1  
ATOM 1277  C CG   . LYS A 1 90  ? 0.195   7.550   5.442   1.00 0.00 ? 90  LYS A CG   1  
ATOM 1278  C CD   . LYS A 1 90  ? -1.201  7.247   5.990   1.00 0.00 ? 90  LYS A CD   1  
ATOM 1279  C CE   . LYS A 1 90  ? -2.203  8.258   5.429   1.00 0.00 ? 90  LYS A CE   1  
ATOM 1280  N NZ   . LYS A 1 90  ? -3.080  8.750   6.529   1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1281  H H    . LYS A 1 90  ? 1.453   4.188   6.503   1.00 0.00 ? 90  LYS A H    1  
ATOM 1282  H HA   . LYS A 1 90  ? 1.907   6.169   4.342   1.00 0.00 ? 90  LYS A HA   1  
ATOM 1283  H HB2  . LYS A 1 90  ? 0.747   6.211   7.028   1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1284  H HB3  . LYS A 1 90  ? 1.883   7.534   6.766   1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1285  H HG2  . LYS A 1 90  ? 0.379   8.613   5.489   1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1286  H HG3  . LYS A 1 90  ? 0.256   7.219   4.416   1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1287  H HD2  . LYS A 1 90  ? -1.494  6.249   5.698   1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1288  H HD3  . LYS A 1 90  ? -1.188  7.318   7.067   1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1289  H HE2  . LYS A 1 90  ? -1.670  9.091   4.993   1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1290  H HE3  . LYS A 1 90  ? -2.809  7.782   4.672   1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1291  H HZ1  . LYS A 1 90  ? -3.444  7.939   7.071   1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1292  H HZ2  . LYS A 1 90  ? -2.533  9.372   7.157   1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1293  H HZ3  . LYS A 1 90  ? -3.876  9.283   6.125   1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1294  N N    . THR A 1 91  ? 4.193   7.075   5.096   1.00 0.00 ? 91  THR A N    1  
ATOM 1295  C CA   . THR A 1 91  ? 5.635   7.323   5.371   1.00 0.00 ? 91  THR A CA   1  
ATOM 1296  C C    . THR A 1 91  ? 5.917   8.822   5.264   1.00 0.00 ? 91  THR A C    1  
ATOM 1297  O O    . THR A 1 91  ? 5.772   9.559   6.217   1.00 0.00 ? 91  THR A O    1  
ATOM 1298  C CB   . THR A 1 91  ? 6.489   6.566   4.352   1.00 0.00 ? 91  THR A CB   1  
ATOM 1299  O OG1  . THR A 1 91  ? 5.744   6.382   3.156   1.00 0.00 ? 91  THR A OG1  1  
ATOM 1300  C CG2  . THR A 1 91  ? 6.884   5.205   4.926   1.00 0.00 ? 91  THR A CG2  1  
ATOM 1301  H H    . THR A 1 91  ? 3.712   7.645   4.461   1.00 0.00 ? 91  THR A H    1  
ATOM 1302  H HA   . THR A 1 91  ? 5.875   6.982   6.368   1.00 0.00 ? 91  THR A HA   1  
ATOM 1303  H HB   . THR A 1 91  ? 7.382   7.133   4.137   1.00 0.00 ? 91  THR A HB   1  
ATOM 1304  H HG1  . THR A 1 91  ? 5.189   7.154   3.031   1.00 0.00 ? 91  THR A HG1  1  
ATOM 1305  H HG21 . THR A 1 91  ? 6.417   5.073   5.891   1.00 0.00 ? 91  THR A HG21 1  
ATOM 1306  H HG22 . THR A 1 91  ? 6.554   4.424   4.257   1.00 0.00 ? 91  THR A HG22 1  
ATOM 1307  H HG23 . THR A 1 91  ? 7.957   5.158   5.035   1.00 0.00 ? 91  THR A HG23 1  
ATOM 1308  N N    . SER A 1 92  ? 6.313   9.281   4.108   1.00 0.00 ? 92  SER A N    1  
ATOM 1309  C CA   . SER A 1 92  ? 6.595   10.734  3.943   1.00 0.00 ? 92  SER A CA   1  
ATOM 1310  C C    . SER A 1 92  ? 5.381   11.410  3.306   1.00 0.00 ? 92  SER A C    1  
ATOM 1311  O O    . SER A 1 92  ? 5.435   11.884  2.189   1.00 0.00 ? 92  SER A O    1  
ATOM 1312  C CB   . SER A 1 92  ? 7.814   10.919  3.040   1.00 0.00 ? 92  SER A CB   1  
ATOM 1313  O OG   . SER A 1 92  ? 7.698   10.062  1.913   1.00 0.00 ? 92  SER A OG   1  
ATOM 1314  H H    . SER A 1 92  ? 6.418   8.672   3.348   1.00 0.00 ? 92  SER A H    1  
ATOM 1315  H HA   . SER A 1 92  ? 6.789   11.177  4.909   1.00 0.00 ? 92  SER A HA   1  
ATOM 1316  H HB2  . SER A 1 92  ? 7.865   11.941  2.704   1.00 0.00 ? 92  SER A HB2  1  
ATOM 1317  H HB3  . SER A 1 92  ? 8.711   10.680  3.596   1.00 0.00 ? 92  SER A HB3  1  
ATOM 1318  H HG   . SER A 1 92  ? 8.553   10.027  1.478   1.00 0.00 ? 92  SER A HG   1  
ATOM 1319  N N    . LYS A 1 93  ? 4.281   11.449  4.007   1.00 0.00 ? 93  LYS A N    1  
ATOM 1320  C CA   . LYS A 1 93  ? 3.061   12.083  3.441   1.00 0.00 ? 93  LYS A CA   1  
ATOM 1321  C C    . LYS A 1 93  ? 2.598   11.276  2.228   1.00 0.00 ? 93  LYS A C    1  
ATOM 1322  O O    . LYS A 1 93  ? 1.985   11.800  1.319   1.00 0.00 ? 93  LYS A O    1  
ATOM 1323  C CB   . LYS A 1 93  ? 3.378   13.517  3.008   1.00 0.00 ? 93  LYS A CB   1  
ATOM 1324  C CG   . LYS A 1 93  ? 4.162   14.227  4.115   1.00 0.00 ? 93  LYS A CG   1  
ATOM 1325  C CD   . LYS A 1 93  ? 4.107   15.741  3.895   1.00 0.00 ? 93  LYS A CD   1  
ATOM 1326  C CE   . LYS A 1 93  ? 5.370   16.200  3.162   1.00 0.00 ? 93  LYS A CE   1  
ATOM 1327  N NZ   . LYS A 1 93  ? 5.945   17.386  3.858   1.00 0.00 ? 93  LYS A NZ   1  
ATOM 1328  H H    . LYS A 1 93  ? 4.257   11.055  4.903   1.00 0.00 ? 93  LYS A H    1  
ATOM 1329  H HA   . LYS A 1 93  ? 2.280   12.094  4.187   1.00 0.00 ? 93  LYS A HA   1  
ATOM 1330  H HB2  . LYS A 1 93  ? 3.967   13.497  2.103   1.00 0.00 ? 93  LYS A HB2  1  
ATOM 1331  H HB3  . LYS A 1 93  ? 2.456   14.049  2.826   1.00 0.00 ? 93  LYS A HB3  1  
ATOM 1332  H HG2  . LYS A 1 93  ? 3.726   13.987  5.074   1.00 0.00 ? 93  LYS A HG2  1  
ATOM 1333  H HG3  . LYS A 1 93  ? 5.190   13.899  4.095   1.00 0.00 ? 93  LYS A HG3  1  
ATOM 1334  H HD2  . LYS A 1 93  ? 3.237   15.988  3.304   1.00 0.00 ? 93  LYS A HD2  1  
ATOM 1335  H HD3  . LYS A 1 93  ? 4.047   16.242  4.850   1.00 0.00 ? 93  LYS A HD3  1  
ATOM 1336  H HE2  . LYS A 1 93  ? 6.094   15.399  3.158   1.00 0.00 ? 93  LYS A HE2  1  
ATOM 1337  H HE3  . LYS A 1 93  ? 5.120   16.465  2.146   1.00 0.00 ? 93  LYS A HE3  1  
ATOM 1338  H HZ1  . LYS A 1 93  ? 5.669   17.368  4.860   1.00 0.00 ? 93  LYS A HZ1  1  
ATOM 1339  H HZ2  . LYS A 1 93  ? 6.983   17.362  3.783   1.00 0.00 ? 93  LYS A HZ2  1  
ATOM 1340  H HZ3  . LYS A 1 93  ? 5.585   18.256  3.417   1.00 0.00 ? 93  LYS A HZ3  1  
ATOM 1341  N N    . SER A 1 94  ? 2.891   10.002  2.203   1.00 0.00 ? 94  SER A N    1  
ATOM 1342  C CA   . SER A 1 94  ? 2.469   9.164   1.045   1.00 0.00 ? 94  SER A CA   1  
ATOM 1343  C C    . SER A 1 94  ? 2.149   7.745   1.517   1.00 0.00 ? 94  SER A C    1  
ATOM 1344  O O    . SER A 1 94  ? 2.734   7.243   2.457   1.00 0.00 ? 94  SER A O    1  
ATOM 1345  C CB   . SER A 1 94  ? 3.596   9.114   0.013   1.00 0.00 ? 94  SER A CB   1  
ATOM 1346  O OG   . SER A 1 94  ? 4.763   8.576   0.618   1.00 0.00 ? 94  SER A OG   1  
ATOM 1347  H H    . SER A 1 94  ? 3.390   9.598   2.945   1.00 0.00 ? 94  SER A H    1  
ATOM 1348  H HA   . SER A 1 94  ? 1.591   9.596   0.597   1.00 0.00 ? 94  SER A HA   1  
ATOM 1349  H HB2  . SER A 1 94  ? 3.303   8.487   -0.812  1.00 0.00 ? 94  SER A HB2  1  
ATOM 1350  H HB3  . SER A 1 94  ? 3.794   10.114  -0.351  1.00 0.00 ? 94  SER A HB3  1  
ATOM 1351  H HG   . SER A 1 94  ? 5.511   8.772   0.047   1.00 0.00 ? 94  SER A HG   1  
ATOM 1352  N N    . ILE A 1 95  ? 1.225   7.091   0.865   1.00 0.00 ? 95  ILE A N    1  
ATOM 1353  C CA   . ILE A 1 95  ? 0.867   5.703   1.270   1.00 0.00 ? 95  ILE A CA   1  
ATOM 1354  C C    . ILE A 1 95  ? 1.438   4.712   0.257   1.00 0.00 ? 95  ILE A C    1  
ATOM 1355  O O    . ILE A 1 95  ? 0.826   4.427   -0.753  1.00 0.00 ? 95  ILE A O    1  
ATOM 1356  C CB   . ILE A 1 95  ? -0.656  5.541   1.309   1.00 0.00 ? 95  ILE A CB   1  
ATOM 1357  C CG1  . ILE A 1 95  ? -1.321  6.893   1.578   1.00 0.00 ? 95  ILE A CG1  1  
ATOM 1358  C CG2  . ILE A 1 95  ? -1.034  4.559   2.420   1.00 0.00 ? 95  ILE A CG2  1  
ATOM 1359  C CD1  . ILE A 1 95  ? -2.826  6.778   1.329   1.00 0.00 ? 95  ILE A CD1  1  
ATOM 1360  H H    . ILE A 1 95  ? 0.769   7.513   0.107   1.00 0.00 ? 95  ILE A H    1  
ATOM 1361  H HA   . ILE A 1 95  ? 1.276   5.497   2.247   1.00 0.00 ? 95  ILE A HA   1  
ATOM 1362  H HB   . ILE A 1 95  ? -0.997  5.154   0.358   1.00 0.00 ? 95  ILE A HB   1  
ATOM 1363  H HG12 . ILE A 1 95  ? -1.146  7.184   2.604   1.00 0.00 ? 95  ILE A HG12 1  
ATOM 1364  H HG13 . ILE A 1 95  ? -0.905  7.638   0.916   1.00 0.00 ? 95  ILE A HG13 1  
ATOM 1365  H HG21 . ILE A 1 95  ? -0.556  3.607   2.237   1.00 0.00 ? 95  ILE A HG21 1  
ATOM 1366  H HG22 . ILE A 1 95  ? -0.707  4.948   3.372   1.00 0.00 ? 95  ILE A HG22 1  
ATOM 1367  H HG23 . ILE A 1 95  ? -2.106  4.426   2.435   1.00 0.00 ? 95  ILE A HG23 1  
ATOM 1368  H HD11 . ILE A 1 95  ? -2.997  6.388   0.335   1.00 0.00 ? 95  ILE A HD11 1  
ATOM 1369  H HD12 . ILE A 1 95  ? -3.263  6.111   2.056   1.00 0.00 ? 95  ILE A HD12 1  
ATOM 1370  H HD13 . ILE A 1 95  ? -3.281  7.754   1.414   1.00 0.00 ? 95  ILE A HD13 1  
ATOM 1371  N N    . LEU A 1 96  ? 2.598   4.174   0.513   1.00 0.00 ? 96  LEU A N    1  
ATOM 1372  C CA   . LEU A 1 96  ? 3.179   3.197   -0.447  1.00 0.00 ? 96  LEU A CA   1  
ATOM 1373  C C    . LEU A 1 96  ? 2.177   2.061   -0.653  1.00 0.00 ? 96  LEU A C    1  
ATOM 1374  O O    . LEU A 1 96  ? 1.345   1.796   0.193   1.00 0.00 ? 96  LEU A O    1  
ATOM 1375  C CB   . LEU A 1 96  ? 4.486   2.635   0.113   1.00 0.00 ? 96  LEU A CB   1  
ATOM 1376  C CG   . LEU A 1 96  ? 4.295   2.274   1.585   1.00 0.00 ? 96  LEU A CG   1  
ATOM 1377  C CD1  . LEU A 1 96  ? 4.910   0.900   1.856   1.00 0.00 ? 96  LEU A CD1  1  
ATOM 1378  C CD2  . LEU A 1 96  ? 4.986   3.323   2.457   1.00 0.00 ? 96  LEU A CD2  1  
ATOM 1379  H H    . LEU A 1 96  ? 3.080   4.406   1.335   1.00 0.00 ? 96  LEU A H    1  
ATOM 1380  H HA   . LEU A 1 96  ? 3.370   3.687   -1.391  1.00 0.00 ? 96  LEU A HA   1  
ATOM 1381  H HB2  . LEU A 1 96  ? 4.765   1.751   -0.442  1.00 0.00 ? 96  LEU A HB2  1  
ATOM 1382  H HB3  . LEU A 1 96  ? 5.265   3.378   0.026   1.00 0.00 ? 96  LEU A HB3  1  
ATOM 1383  H HG   . LEU A 1 96  ? 3.240   2.248   1.815   1.00 0.00 ? 96  LEU A HG   1  
ATOM 1384  H HD11 . LEU A 1 96  ? 5.560   0.629   1.037   1.00 0.00 ? 96  LEU A HD11 1  
ATOM 1385  H HD12 . LEU A 1 96  ? 5.480   0.936   2.772   1.00 0.00 ? 96  LEU A HD12 1  
ATOM 1386  H HD13 . LEU A 1 96  ? 4.123   0.166   1.949   1.00 0.00 ? 96  LEU A HD13 1  
ATOM 1387  H HD21 . LEU A 1 96  ? 5.621   3.942   1.841   1.00 0.00 ? 96  LEU A HD21 1  
ATOM 1388  H HD22 . LEU A 1 96  ? 4.240   3.938   2.939   1.00 0.00 ? 96  LEU A HD22 1  
ATOM 1389  H HD23 . LEU A 1 96  ? 5.585   2.829   3.208   1.00 0.00 ? 96  LEU A HD23 1  
ATOM 1390  N N    . VAL A 1 97  ? 2.241   1.390   -1.769  1.00 0.00 ? 97  VAL A N    1  
ATOM 1391  C CA   . VAL A 1 97  ? 1.280   0.280   -2.018  1.00 0.00 ? 97  VAL A CA   1  
ATOM 1392  C C    . VAL A 1 97  ? 2.021   -0.933  -2.580  1.00 0.00 ? 97  VAL A C    1  
ATOM 1393  O O    . VAL A 1 97  ? 2.084   -1.137  -3.776  1.00 0.00 ? 97  VAL A O    1  
ATOM 1394  C CB   . VAL A 1 97  ? 0.220   0.742   -3.019  1.00 0.00 ? 97  VAL A CB   1  
ATOM 1395  C CG1  . VAL A 1 97  ? -0.649  -0.448  -3.430  1.00 0.00 ? 97  VAL A CG1  1  
ATOM 1396  C CG2  . VAL A 1 97  ? -0.659  1.813   -2.368  1.00 0.00 ? 97  VAL A CG2  1  
ATOM 1397  H H    . VAL A 1 97  ? 2.915   1.619   -2.442  1.00 0.00 ? 97  VAL A H    1  
ATOM 1398  H HA   . VAL A 1 97  ? 0.800   0.008   -1.090  1.00 0.00 ? 97  VAL A HA   1  
ATOM 1399  H HB   . VAL A 1 97  ? 0.704   1.152   -3.893  1.00 0.00 ? 97  VAL A HB   1  
ATOM 1400  H HG11 . VAL A 1 97  ? -0.018  -1.294  -3.660  1.00 0.00 ? 97  VAL A HG11 1  
ATOM 1401  H HG12 . VAL A 1 97  ? -1.314  -0.705  -2.619  1.00 0.00 ? 97  VAL A HG12 1  
ATOM 1402  H HG13 . VAL A 1 97  ? -1.230  -0.185  -4.302  1.00 0.00 ? 97  VAL A HG13 1  
ATOM 1403  H HG21 . VAL A 1 97  ? -0.526  1.785   -1.297  1.00 0.00 ? 97  VAL A HG21 1  
ATOM 1404  H HG22 . VAL A 1 97  ? -0.375  2.786   -2.741  1.00 0.00 ? 97  VAL A HG22 1  
ATOM 1405  H HG23 . VAL A 1 97  ? -1.695  1.624   -2.607  1.00 0.00 ? 97  VAL A HG23 1  
ATOM 1406  N N    . GLY A 1 98  ? 2.578   -1.743  -1.724  1.00 0.00 ? 98  GLY A N    1  
ATOM 1407  C CA   . GLY A 1 98  ? 3.308   -2.948  -2.205  1.00 0.00 ? 98  GLY A CA   1  
ATOM 1408  C C    . GLY A 1 98  ? 2.321   -3.909  -2.867  1.00 0.00 ? 98  GLY A C    1  
ATOM 1409  O O    . GLY A 1 98  ? 1.723   -4.745  -2.219  1.00 0.00 ? 98  GLY A O    1  
ATOM 1410  H H    . GLY A 1 98  ? 2.511   -1.562  -0.764  1.00 0.00 ? 98  GLY A H    1  
ATOM 1411  H HA2  . GLY A 1 98  ? 4.061   -2.651  -2.921  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1412  H HA3  . GLY A 1 98  ? 3.779   -3.442  -1.368  1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1413  N N    . VAL A 1 99  ? 2.152   -3.801  -4.156  1.00 0.00 ? 99  VAL A N    1  
ATOM 1414  C CA   . VAL A 1 99  ? 1.208   -4.716  -4.863  1.00 0.00 ? 99  VAL A CA   1  
ATOM 1415  C C    . VAL A 1 99  ? 1.993   -5.938  -5.351  1.00 0.00 ? 99  VAL A C    1  
ATOM 1416  O O    . VAL A 1 99  ? 2.791   -5.848  -6.262  1.00 0.00 ? 99  VAL A O    1  
ATOM 1417  C CB   . VAL A 1 99  ? 0.551   -4.005  -6.064  1.00 0.00 ? 99  VAL A CB   1  
ATOM 1418  C CG1  . VAL A 1 99  ? -0.967  -3.991  -5.875  1.00 0.00 ? 99  VAL A CG1  1  
ATOM 1419  C CG2  . VAL A 1 99  ? 1.043   -2.555  -6.179  1.00 0.00 ? 99  VAL A CG2  1  
ATOM 1420  H H    . VAL A 1 99  ? 2.652   -3.126  -4.657  1.00 0.00 ? 99  VAL A H    1  
ATOM 1421  H HA   . VAL A 1 99  ? 0.441   -5.039  -4.173  1.00 0.00 ? 99  VAL A HA   1  
ATOM 1422  H HB   . VAL A 1 99  ? 0.792   -4.541  -6.971  1.00 0.00 ? 99  VAL A HB   1  
ATOM 1423  H HG11 . VAL A 1 99  ? -1.200  -3.757  -4.847  1.00 0.00 ? 99  VAL A HG11 1  
ATOM 1424  H HG12 . VAL A 1 99  ? -1.403  -3.242  -6.522  1.00 0.00 ? 99  VAL A HG12 1  
ATOM 1425  H HG13 . VAL A 1 99  ? -1.370  -4.961  -6.125  1.00 0.00 ? 99  VAL A HG13 1  
ATOM 1426  H HG21 . VAL A 1 99  ? 0.880   -2.043  -5.242  1.00 0.00 ? 99  VAL A HG21 1  
ATOM 1427  H HG22 . VAL A 1 99  ? 2.097   -2.550  -6.413  1.00 0.00 ? 99  VAL A HG22 1  
ATOM 1428  H HG23 . VAL A 1 99  ? 0.498   -2.050  -6.964  1.00 0.00 ? 99  VAL A HG23 1  
ATOM 1429  N N    . TYR A 1 100 ? 1.788   -7.079  -4.743  1.00 0.00 ? 100 TYR A N    1  
ATOM 1430  C CA   . TYR A 1 100 ? 2.545   -8.293  -5.171  1.00 0.00 ? 100 TYR A CA   1  
ATOM 1431  C C    . TYR A 1 100 ? 1.590   -9.473  -5.368  1.00 0.00 ? 100 TYR A C    1  
ATOM 1432  O O    . TYR A 1 100 ? 0.418   -9.401  -5.056  1.00 0.00 ? 100 TYR A O    1  
ATOM 1433  C CB   . TYR A 1 100 ? 3.582   -8.657  -4.102  1.00 0.00 ? 100 TYR A CB   1  
ATOM 1434  C CG   . TYR A 1 100 ? 2.900   -8.841  -2.767  1.00 0.00 ? 100 TYR A CG   1  
ATOM 1435  C CD1  . TYR A 1 100 ? 2.348   -7.739  -2.101  1.00 0.00 ? 100 TYR A CD1  1  
ATOM 1436  C CD2  . TYR A 1 100 ? 2.823   -10.115 -2.192  1.00 0.00 ? 100 TYR A CD2  1  
ATOM 1437  C CE1  . TYR A 1 100 ? 1.721   -7.911  -0.862  1.00 0.00 ? 100 TYR A CE1  1  
ATOM 1438  C CE2  . TYR A 1 100 ? 2.197   -10.287 -0.951  1.00 0.00 ? 100 TYR A CE2  1  
ATOM 1439  C CZ   . TYR A 1 100 ? 1.646   -9.184  -0.286  1.00 0.00 ? 100 TYR A CZ   1  
ATOM 1440  O OH   . TYR A 1 100 ? 1.030   -9.353  0.937   1.00 0.00 ? 100 TYR A OH   1  
ATOM 1441  H H    . TYR A 1 100 ? 1.148   -7.133  -4.002  1.00 0.00 ? 100 TYR A H    1  
ATOM 1442  H HA   . TYR A 1 100 ? 3.051   -8.087  -6.102  1.00 0.00 ? 100 TYR A HA   1  
ATOM 1443  H HB2  . TYR A 1 100 ? 4.078   -9.576  -4.380  1.00 0.00 ? 100 TYR A HB2  1  
ATOM 1444  H HB3  . TYR A 1 100 ? 4.312   -7.866  -4.026  1.00 0.00 ? 100 TYR A HB3  1  
ATOM 1445  H HD1  . TYR A 1 100 ? 2.405   -6.756  -2.544  1.00 0.00 ? 100 TYR A HD1  1  
ATOM 1446  H HD2  . TYR A 1 100 ? 3.248   -10.965 -2.705  1.00 0.00 ? 100 TYR A HD2  1  
ATOM 1447  H HE1  . TYR A 1 100 ? 1.296   -7.061  -0.350  1.00 0.00 ? 100 TYR A HE1  1  
ATOM 1448  H HE2  . TYR A 1 100 ? 2.139   -11.270 -0.508  1.00 0.00 ? 100 TYR A HE2  1  
ATOM 1449  H HH   . TYR A 1 100 ? 1.098   -10.280 1.178   1.00 0.00 ? 100 TYR A HH   1  
ATOM 1450  N N    . ASN A 1 101 ? 2.094   -10.559 -5.889  1.00 0.00 ? 101 ASN A N    1  
ATOM 1451  C CA   . ASN A 1 101 ? 1.235   -11.755 -6.118  1.00 0.00 ? 101 ASN A CA   1  
ATOM 1452  C C    . ASN A 1 101 ? 1.504   -12.798 -5.028  1.00 0.00 ? 101 ASN A C    1  
ATOM 1453  O O    . ASN A 1 101 ? 2.120   -12.512 -4.021  1.00 0.00 ? 101 ASN A O    1  
ATOM 1454  C CB   . ASN A 1 101 ? 1.561   -12.349 -7.491  1.00 0.00 ? 101 ASN A CB   1  
ATOM 1455  C CG   . ASN A 1 101 ? 3.078   -12.396 -7.673  1.00 0.00 ? 101 ASN A CG   1  
ATOM 1456  O OD1  . ASN A 1 101 ? 3.814   -12.457 -6.709  1.00 0.00 ? 101 ASN A OD1  1  
ATOM 1457  N ND2  . ASN A 1 101 ? 3.582   -12.368 -8.877  1.00 0.00 ? 101 ASN A ND2  1  
ATOM 1458  H H    . ASN A 1 101 ? 3.042   -10.587 -6.132  1.00 0.00 ? 101 ASN A H    1  
ATOM 1459  H HA   . ASN A 1 101 ? 0.196   -11.463 -6.089  1.00 0.00 ? 101 ASN A HA   1  
ATOM 1460  H HB2  . ASN A 1 101 ? 1.158   -13.348 -7.558  1.00 0.00 ? 101 ASN A HB2  1  
ATOM 1461  H HB3  . ASN A 1 101 ? 1.127   -11.732 -8.263  1.00 0.00 ? 101 ASN A HB3  1  
ATOM 1462  H HD21 . ASN A 1 101 ? 2.988   -12.316 -9.654  1.00 0.00 ? 101 ASN A HD21 1  
ATOM 1463  H HD22 . ASN A 1 101 ? 4.553   -12.397 -9.002  1.00 0.00 ? 101 ASN A HD22 1  
ATOM 1464  N N    . GLU A 1 102 ? 1.044   -14.005 -5.221  1.00 0.00 ? 102 GLU A N    1  
ATOM 1465  C CA   . GLU A 1 102 ? 1.266   -15.065 -4.197  1.00 0.00 ? 102 GLU A CA   1  
ATOM 1466  C C    . GLU A 1 102 ? 2.749   -15.450 -4.158  1.00 0.00 ? 102 GLU A C    1  
ATOM 1467  O O    . GLU A 1 102 ? 3.228   -16.002 -3.187  1.00 0.00 ? 102 GLU A O    1  
ATOM 1468  C CB   . GLU A 1 102 ? 0.430   -16.297 -4.554  1.00 0.00 ? 102 GLU A CB   1  
ATOM 1469  C CG   . GLU A 1 102 ? 0.945   -16.898 -5.863  1.00 0.00 ? 102 GLU A CG   1  
ATOM 1470  C CD   . GLU A 1 102 ? 0.049   -18.067 -6.279  1.00 0.00 ? 102 GLU A CD   1  
ATOM 1471  O OE1  . GLU A 1 102 ? -0.520  -18.694 -5.400  1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1472  O OE2  . GLU A 1 102 ? -0.052  -18.316 -7.469  1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1473  H H    . GLU A 1 102 ? 0.546   -14.214 -6.039  1.00 0.00 ? 102 GLU A H    1  
ATOM 1474  H HA   . GLU A 1 102 ? 0.965   -14.697 -3.227  1.00 0.00 ? 102 GLU A HA   1  
ATOM 1475  H HB2  . GLU A 1 102 ? 0.510   -17.029 -3.763  1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1476  H HB3  . GLU A 1 102 ? -0.602  -16.007 -4.675  1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1477  H HG2  . GLU A 1 102 ? 0.932   -16.142 -6.635  1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1478  H HG3  . GLU A 1 102 ? 1.955   -17.253 -5.724  1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1479  N N    . LYS A 1 103 ? 3.480   -15.167 -5.201  1.00 0.00 ? 103 LYS A N    1  
ATOM 1480  C CA   . LYS A 1 103 ? 4.928   -15.525 -5.210  1.00 0.00 ? 103 LYS A CA   1  
ATOM 1481  C C    . LYS A 1 103 ? 5.601   -14.959 -3.958  1.00 0.00 ? 103 LYS A C    1  
ATOM 1482  O O    . LYS A 1 103 ? 6.422   -15.603 -3.337  1.00 0.00 ? 103 LYS A O    1  
ATOM 1483  C CB   . LYS A 1 103 ? 5.594   -14.941 -6.458  1.00 0.00 ? 103 LYS A CB   1  
ATOM 1484  C CG   . LYS A 1 103 ? 5.127   -15.713 -7.692  1.00 0.00 ? 103 LYS A CG   1  
ATOM 1485  C CD   . LYS A 1 103 ? 5.315   -14.848 -8.942  1.00 0.00 ? 103 LYS A CD   1  
ATOM 1486  C CE   . LYS A 1 103 ? 6.024   -15.664 -10.025 1.00 0.00 ? 103 LYS A CE   1  
ATOM 1487  N NZ   . LYS A 1 103 ? 7.469   -15.795 -9.684  1.00 0.00 ? 103 LYS A NZ   1  
ATOM 1488  H H    . LYS A 1 103 ? 3.079   -14.723 -5.977  1.00 0.00 ? 103 LYS A H    1  
ATOM 1489  H HA   . LYS A 1 103 ? 5.032   -16.601 -5.218  1.00 0.00 ? 103 LYS A HA   1  
ATOM 1490  H HB2  . LYS A 1 103 ? 5.322   -13.901 -6.558  1.00 0.00 ? 103 LYS A HB2  1  
ATOM 1491  H HB3  . LYS A 1 103 ? 6.667   -15.025 -6.368  1.00 0.00 ? 103 LYS A HB3  1  
ATOM 1492  H HG2  . LYS A 1 103 ? 5.710   -16.618 -7.790  1.00 0.00 ? 103 LYS A HG2  1  
ATOM 1493  H HG3  . LYS A 1 103 ? 4.083   -15.966 -7.585  1.00 0.00 ? 103 LYS A HG3  1  
ATOM 1494  H HD2  . LYS A 1 103 ? 4.349   -14.528 -9.305  1.00 0.00 ? 103 LYS A HD2  1  
ATOM 1495  H HD3  . LYS A 1 103 ? 5.913   -13.984 -8.695  1.00 0.00 ? 103 LYS A HD3  1  
ATOM 1496  H HE2  . LYS A 1 103 ? 5.579   -16.646 -10.085 1.00 0.00 ? 103 LYS A HE2  1  
ATOM 1497  H HE3  . LYS A 1 103 ? 5.922   -15.164 -10.976 1.00 0.00 ? 103 LYS A HE3  1  
ATOM 1498  H HZ1  . LYS A 1 103 ? 7.614   -15.542 -8.686  1.00 0.00 ? 103 LYS A HZ1  1  
ATOM 1499  H HZ2  . LYS A 1 103 ? 7.774   -16.778 -9.841  1.00 0.00 ? 103 LYS A HZ2  1  
ATOM 1500  H HZ3  . LYS A 1 103 ? 8.027   -15.157 -10.286 1.00 0.00 ? 103 LYS A HZ3  1  
ATOM 1501  N N    . ILE A 1 104 ? 5.258   -13.758 -3.583  1.00 0.00 ? 104 ILE A N    1  
ATOM 1502  C CA   . ILE A 1 104 ? 5.873   -13.147 -2.371  1.00 0.00 ? 104 ILE A CA   1  
ATOM 1503  C C    . ILE A 1 104 ? 5.002   -13.464 -1.152  1.00 0.00 ? 104 ILE A C    1  
ATOM 1504  O O    . ILE A 1 104 ? 3.790   -13.396 -1.209  1.00 0.00 ? 104 ILE A O    1  
ATOM 1505  C CB   . ILE A 1 104 ? 5.972   -11.629 -2.569  1.00 0.00 ? 104 ILE A CB   1  
ATOM 1506  C CG1  . ILE A 1 104 ? 7.193   -11.310 -3.433  1.00 0.00 ? 104 ILE A CG1  1  
ATOM 1507  C CG2  . ILE A 1 104 ? 6.116   -10.926 -1.216  1.00 0.00 ? 104 ILE A CG2  1  
ATOM 1508  C CD1  . ILE A 1 104 ? 6.741   -10.617 -4.720  1.00 0.00 ? 104 ILE A CD1  1  
ATOM 1509  H H    . ILE A 1 104 ? 4.592   -13.256 -4.098  1.00 0.00 ? 104 ILE A H    1  
ATOM 1510  H HA   . ILE A 1 104 ? 6.861   -13.558 -2.224  1.00 0.00 ? 104 ILE A HA   1  
ATOM 1511  H HB   . ILE A 1 104 ? 5.080   -11.274 -3.064  1.00 0.00 ? 104 ILE A HB   1  
ATOM 1512  H HG12 . ILE A 1 104 ? 7.859   -10.658 -2.885  1.00 0.00 ? 104 ILE A HG12 1  
ATOM 1513  H HG13 . ILE A 1 104 ? 7.709   -12.226 -3.681  1.00 0.00 ? 104 ILE A HG13 1  
ATOM 1514  H HG21 . ILE A 1 104 ? 6.860   -11.435 -0.623  1.00 0.00 ? 104 ILE A HG21 1  
ATOM 1515  H HG22 . ILE A 1 104 ? 6.419   -9.902  -1.374  1.00 0.00 ? 104 ILE A HG22 1  
ATOM 1516  H HG23 . ILE A 1 104 ? 5.168   -10.944 -0.699  1.00 0.00 ? 104 ILE A HG23 1  
ATOM 1517  H HD11 . ILE A 1 104 ? 5.982   -11.215 -5.202  1.00 0.00 ? 104 ILE A HD11 1  
ATOM 1518  H HD12 . ILE A 1 104 ? 6.337   -9.645  -4.481  1.00 0.00 ? 104 ILE A HD12 1  
ATOM 1519  H HD13 . ILE A 1 104 ? 7.586   -10.504 -5.383  1.00 0.00 ? 104 ILE A HD13 1  
ATOM 1520  N N    . GLN A 1 105 ? 5.611   -13.810 -0.051  1.00 0.00 ? 105 GLN A N    1  
ATOM 1521  C CA   . GLN A 1 105 ? 4.820   -14.132 1.170   1.00 0.00 ? 105 GLN A CA   1  
ATOM 1522  C C    . GLN A 1 105 ? 4.418   -12.833 1.878   1.00 0.00 ? 105 GLN A C    1  
ATOM 1523  O O    . GLN A 1 105 ? 5.127   -11.848 1.814   1.00 0.00 ? 105 GLN A O    1  
ATOM 1524  C CB   . GLN A 1 105 ? 5.663   -14.993 2.114   1.00 0.00 ? 105 GLN A CB   1  
ATOM 1525  C CG   . GLN A 1 105 ? 5.338   -16.470 1.880   1.00 0.00 ? 105 GLN A CG   1  
ATOM 1526  C CD   . GLN A 1 105 ? 6.624   -17.235 1.564   1.00 0.00 ? 105 GLN A CD   1  
ATOM 1527  O OE1  . GLN A 1 105 ? 7.280   -16.961 0.578   1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1528  N NE2  . GLN A 1 105 ? 7.015   -18.191 2.362   1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1529  H H    . GLN A 1 105 ? 6.589   -13.860 -0.028  1.00 0.00 ? 105 GLN A H    1  
ATOM 1530  H HA   . GLN A 1 105 ? 3.931   -14.675 0.887   1.00 0.00 ? 105 GLN A HA   1  
ATOM 1531  H HB2  . GLN A 1 105 ? 6.712   -14.818 1.921   1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1532  H HB3  . GLN A 1 105 ? 5.436   -14.734 3.137   1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1533  H HG2  . GLN A 1 105 ? 4.881   -16.882 2.769   1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1534  H HG3  . GLN A 1 105 ? 4.654   -16.560 1.049   1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1535  H HE21 . GLN A 1 105 ? 6.486   -18.413 3.156   1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1536  H HE22 . GLN A 1 105 ? 7.839   -18.684 2.168   1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1537  N N    . PRO A 1 106 ? 3.284   -12.875 2.532   1.00 0.00 ? 106 PRO A N    1  
ATOM 1538  C CA   . PRO A 1 106 ? 2.752   -11.710 3.264   1.00 0.00 ? 106 PRO A CA   1  
ATOM 1539  C C    . PRO A 1 106 ? 3.686   -11.324 4.417   1.00 0.00 ? 106 PRO A C    1  
ATOM 1540  O O    . PRO A 1 106 ? 3.502   -10.311 5.061   1.00 0.00 ? 106 PRO A O    1  
ATOM 1541  C CB   . PRO A 1 106 ? 1.396   -12.180 3.811   1.00 0.00 ? 106 PRO A CB   1  
ATOM 1542  C CG   . PRO A 1 106 ? 1.219   -13.670 3.424   1.00 0.00 ? 106 PRO A CG   1  
ATOM 1543  C CD   . PRO A 1 106 ? 2.441   -14.083 2.590   1.00 0.00 ? 106 PRO A CD   1  
ATOM 1544  H HA   . PRO A 1 106 ? 2.608   -10.876 2.597   1.00 0.00 ? 106 PRO A HA   1  
ATOM 1545  H HB2  . PRO A 1 106 ? 1.379   -12.073 4.887   1.00 0.00 ? 106 PRO A HB2  1  
ATOM 1546  H HB3  . PRO A 1 106 ? 0.601   -11.596 3.372   1.00 0.00 ? 106 PRO A HB3  1  
ATOM 1547  H HG2  . PRO A 1 106 ? 1.162   -14.276 4.317   1.00 0.00 ? 106 PRO A HG2  1  
ATOM 1548  H HG3  . PRO A 1 106 ? 0.322   -13.795 2.838   1.00 0.00 ? 106 PRO A HG3  1  
ATOM 1549  H HD2  . PRO A 1 106 ? 2.970   -14.891 3.074   1.00 0.00 ? 106 PRO A HD2  1  
ATOM 1550  H HD3  . PRO A 1 106 ? 2.137   -14.371 1.595   1.00 0.00 ? 106 PRO A HD3  1  
ATOM 1551  N N    . GLY A 1 107 ? 4.680   -12.126 4.692   1.00 0.00 ? 107 GLY A N    1  
ATOM 1552  C CA   . GLY A 1 107 ? 5.610   -11.801 5.812   1.00 0.00 ? 107 GLY A CA   1  
ATOM 1553  C C    . GLY A 1 107 ? 6.926   -11.243 5.262   1.00 0.00 ? 107 GLY A C    1  
ATOM 1554  O O    . GLY A 1 107 ? 7.501   -10.328 5.819   1.00 0.00 ? 107 GLY A O    1  
ATOM 1555  H H    . GLY A 1 107 ? 4.810   -12.944 4.170   1.00 0.00 ? 107 GLY A H    1  
ATOM 1556  H HA2  . GLY A 1 107 ? 5.150   -11.065 6.456   1.00 0.00 ? 107 GLY A HA2  1  
ATOM 1557  H HA3  . GLY A 1 107 ? 5.812   -12.697 6.379   1.00 0.00 ? 107 GLY A HA3  1  
ATOM 1558  N N    . THR A 1 108 ? 7.415   -11.789 4.182   1.00 0.00 ? 108 THR A N    1  
ATOM 1559  C CA   . THR A 1 108 ? 8.700   -11.288 3.615   1.00 0.00 ? 108 THR A CA   1  
ATOM 1560  C C    . THR A 1 108 ? 8.531   -9.842  3.139   1.00 0.00 ? 108 THR A C    1  
ATOM 1561  O O    . THR A 1 108 ? 9.472   -9.074  3.117   1.00 0.00 ? 108 THR A O    1  
ATOM 1562  C CB   . THR A 1 108 ? 9.117   -12.169 2.435   1.00 0.00 ? 108 THR A CB   1  
ATOM 1563  O OG1  . THR A 1 108 ? 8.376   -13.381 2.465   1.00 0.00 ? 108 THR A OG1  1  
ATOM 1564  C CG2  . THR A 1 108 ? 10.612  -12.480 2.531   1.00 0.00 ? 108 THR A CG2  1  
ATOM 1565  H H    . THR A 1 108 ? 6.944   -12.531 3.750   1.00 0.00 ? 108 THR A H    1  
ATOM 1566  H HA   . THR A 1 108 ? 9.466   -11.327 4.376   1.00 0.00 ? 108 THR A HA   1  
ATOM 1567  H HB   . THR A 1 108 ? 8.921   -11.649 1.510   1.00 0.00 ? 108 THR A HB   1  
ATOM 1568  H HG1  . THR A 1 108 ? 8.810   -14.008 1.882   1.00 0.00 ? 108 THR A HG1  1  
ATOM 1569  H HG21 . THR A 1 108 ? 11.002  -12.091 3.460   1.00 0.00 ? 108 THR A HG21 1  
ATOM 1570  H HG22 . THR A 1 108 ? 10.760  -13.549 2.498   1.00 0.00 ? 108 THR A HG22 1  
ATOM 1571  H HG23 . THR A 1 108 ? 11.130  -12.019 1.702   1.00 0.00 ? 108 THR A HG23 1  
ATOM 1572  N N    . ALA A 1 109 ? 7.343   -9.464  2.754   1.00 0.00 ? 109 ALA A N    1  
ATOM 1573  C CA   . ALA A 1 109 ? 7.123   -8.068  2.276   1.00 0.00 ? 109 ALA A CA   1  
ATOM 1574  C C    . ALA A 1 109 ? 6.805   -7.160  3.466   1.00 0.00 ? 109 ALA A C    1  
ATOM 1575  O O    . ALA A 1 109 ? 7.181   -6.005  3.496   1.00 0.00 ? 109 ALA A O    1  
ATOM 1576  C CB   . ALA A 1 109 ? 5.952   -8.045  1.292   1.00 0.00 ? 109 ALA A CB   1  
ATOM 1577  H H    . ALA A 1 109 ? 6.595   -10.098 2.775   1.00 0.00 ? 109 ALA A H    1  
ATOM 1578  H HA   . ALA A 1 109 ? 8.015   -7.713  1.782   1.00 0.00 ? 109 ALA A HA   1  
ATOM 1579  H HB1  . ALA A 1 109 ? 5.541   -9.039  1.199   1.00 0.00 ? 109 ALA A HB1  1  
ATOM 1580  H HB2  . ALA A 1 109 ? 5.190   -7.372  1.656   1.00 0.00 ? 109 ALA A HB2  1  
ATOM 1581  H HB3  . ALA A 1 109 ? 6.300   -7.707  0.327   1.00 0.00 ? 109 ALA A HB3  1  
ATOM 1582  N N    . ALA A 1 110 ? 6.113   -7.671  4.446   1.00 0.00 ? 110 ALA A N    1  
ATOM 1583  C CA   . ALA A 1 110 ? 5.769   -6.836  5.632   1.00 0.00 ? 110 ALA A CA   1  
ATOM 1584  C C    . ALA A 1 110 ? 7.027   -6.578  6.465   1.00 0.00 ? 110 ALA A C    1  
ATOM 1585  O O    . ALA A 1 110 ? 7.083   -5.653  7.250   1.00 0.00 ? 110 ALA A O    1  
ATOM 1586  C CB   . ALA A 1 110 ? 4.736   -7.575  6.486   1.00 0.00 ? 110 ALA A CB   1  
ATOM 1587  H H    . ALA A 1 110 ? 5.818   -8.604  4.403   1.00 0.00 ? 110 ALA A H    1  
ATOM 1588  H HA   . ALA A 1 110 ? 5.355   -5.895  5.303   1.00 0.00 ? 110 ALA A HA   1  
ATOM 1589  H HB1  . ALA A 1 110 ? 4.128   -8.203  5.851   1.00 0.00 ? 110 ALA A HB1  1  
ATOM 1590  H HB2  . ALA A 1 110 ? 5.244   -8.186  7.217   1.00 0.00 ? 110 ALA A HB2  1  
ATOM 1591  H HB3  . ALA A 1 110 ? 4.106   -6.858  6.991   1.00 0.00 ? 110 ALA A HB3  1  
ATOM 1592  N N    . ASN A 1 111 ? 8.035   -7.390  6.303   1.00 0.00 ? 111 ASN A N    1  
ATOM 1593  C CA   . ASN A 1 111 ? 9.285   -7.193  7.089   1.00 0.00 ? 111 ASN A CA   1  
ATOM 1594  C C    . ASN A 1 111 ? 10.120  -6.076  6.459   1.00 0.00 ? 111 ASN A C    1  
ATOM 1595  O O    . ASN A 1 111 ? 10.673  -5.239  7.144   1.00 0.00 ? 111 ASN A O    1  
ATOM 1596  C CB   . ASN A 1 111 ? 10.090  -8.493  7.091   1.00 0.00 ? 111 ASN A CB   1  
ATOM 1597  C CG   . ASN A 1 111 ? 9.611   -9.387  8.237   1.00 0.00 ? 111 ASN A CG   1  
ATOM 1598  O OD1  . ASN A 1 111 ? 10.381  -10.140 8.799   1.00 0.00 ? 111 ASN A OD1  1  
ATOM 1599  N ND2  . ASN A 1 111 ? 8.361   -9.336  8.609   1.00 0.00 ? 111 ASN A ND2  1  
ATOM 1600  H H    . ASN A 1 111 ? 7.969   -8.132  5.667   1.00 0.00 ? 111 ASN A H    1  
ATOM 1601  H HA   . ASN A 1 111 ? 9.033   -6.924  8.104   1.00 0.00 ? 111 ASN A HA   1  
ATOM 1602  H HB2  . ASN A 1 111 ? 9.948   -9.005  6.150   1.00 0.00 ? 111 ASN A HB2  1  
ATOM 1603  H HB3  . ASN A 1 111 ? 11.138  -8.269  7.226   1.00 0.00 ? 111 ASN A HB3  1  
ATOM 1604  H HD21 . ASN A 1 111 ? 7.739   -8.728  8.156   1.00 0.00 ? 111 ASN A HD21 1  
ATOM 1605  H HD22 . ASN A 1 111 ? 8.044   -9.905  9.341   1.00 0.00 ? 111 ASN A HD22 1  
ATOM 1606  N N    . VAL A 1 112 ? 10.216  -6.057  5.158   1.00 0.00 ? 112 VAL A N    1  
ATOM 1607  C CA   . VAL A 1 112 ? 11.016  -4.996  4.484   1.00 0.00 ? 112 VAL A CA   1  
ATOM 1608  C C    . VAL A 1 112 ? 10.276  -3.659  4.566   1.00 0.00 ? 112 VAL A C    1  
ATOM 1609  O O    . VAL A 1 112 ? 10.876  -2.615  4.728   1.00 0.00 ? 112 VAL A O    1  
ATOM 1610  C CB   . VAL A 1 112 ? 11.227  -5.369  3.026   1.00 0.00 ? 112 VAL A CB   1  
ATOM 1611  C CG1  . VAL A 1 112 ? 12.184  -4.370  2.373   1.00 0.00 ? 112 VAL A CG1  1  
ATOM 1612  C CG2  . VAL A 1 112 ? 11.819  -6.779  2.935   1.00 0.00 ? 112 VAL A CG2  1  
ATOM 1613  H H    . VAL A 1 112 ? 9.762   -6.741  4.623   1.00 0.00 ? 112 VAL A H    1  
ATOM 1614  H HA   . VAL A 1 112 ? 11.967  -4.907  4.962   1.00 0.00 ? 112 VAL A HA   1  
ATOM 1615  H HB   . VAL A 1 112 ? 10.284  -5.340  2.526   1.00 0.00 ? 112 VAL A HB   1  
ATOM 1616  H HG11 . VAL A 1 112 ? 12.534  -3.669  3.115   1.00 0.00 ? 112 VAL A HG11 1  
ATOM 1617  H HG12 . VAL A 1 112 ? 13.026  -4.900  1.953   1.00 0.00 ? 112 VAL A HG12 1  
ATOM 1618  H HG13 . VAL A 1 112 ? 11.667  -3.836  1.589   1.00 0.00 ? 112 VAL A HG13 1  
ATOM 1619  H HG21 . VAL A 1 112 ? 12.274  -7.041  3.879   1.00 0.00 ? 112 VAL A HG21 1  
ATOM 1620  H HG22 . VAL A 1 112 ? 11.035  -7.486  2.705   1.00 0.00 ? 112 VAL A HG22 1  
ATOM 1621  H HG23 . VAL A 1 112 ? 12.566  -6.805  2.156   1.00 0.00 ? 112 VAL A HG23 1  
ATOM 1622  N N    . VAL A 1 113 ? 8.976   -3.682  4.453   1.00 0.00 ? 113 VAL A N    1  
ATOM 1623  C CA   . VAL A 1 113 ? 8.199   -2.413  4.522   1.00 0.00 ? 113 VAL A CA   1  
ATOM 1624  C C    . VAL A 1 113 ? 8.150   -1.921  5.969   1.00 0.00 ? 113 VAL A C    1  
ATOM 1625  O O    . VAL A 1 113 ? 7.794   -0.792  6.239   1.00 0.00 ? 113 VAL A O    1  
ATOM 1626  C CB   . VAL A 1 113 ? 6.776   -2.662  4.021   1.00 0.00 ? 113 VAL A CB   1  
ATOM 1627  C CG1  . VAL A 1 113 ? 5.954   -1.377  4.145   1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1628  C CG2  . VAL A 1 113 ? 6.825   -3.094  2.555   1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1629  H H    . VAL A 1 113 ? 8.511   -4.534  4.322   1.00 0.00 ? 113 VAL A H    1  
ATOM 1630  H HA   . VAL A 1 113 ? 8.673   -1.665  3.903   1.00 0.00 ? 113 VAL A HA   1  
ATOM 1631  H HB   . VAL A 1 113 ? 6.319   -3.441  4.614   1.00 0.00 ? 113 VAL A HB   1  
ATOM 1632  H HG11 . VAL A 1 113 ? 6.604   -0.557  4.414   1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1633  H HG12 . VAL A 1 113 ? 5.477   -1.163  3.200   1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1634  H HG13 . VAL A 1 113 ? 5.200   -1.504  4.908   1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1635  H HG21 . VAL A 1 113 ? 7.847   -3.067  2.206   1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1636  H HG22 . VAL A 1 113 ? 6.439   -4.098  2.462   1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1637  H HG23 . VAL A 1 113 ? 6.225   -2.421  1.962   1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1638  N N    . GLU A 1 114 ? 8.504   -2.760  6.904   1.00 0.00 ? 114 GLU A N    1  
ATOM 1639  C CA   . GLU A 1 114 ? 8.475   -2.336  8.332   1.00 0.00 ? 114 GLU A CA   1  
ATOM 1640  C C    . GLU A 1 114 ? 9.785   -1.628  8.684   1.00 0.00 ? 114 GLU A C    1  
ATOM 1641  O O    . GLU A 1 114 ? 9.808   -0.707  9.477   1.00 0.00 ? 114 GLU A O    1  
ATOM 1642  C CB   . GLU A 1 114 ? 8.304   -3.565  9.227   1.00 0.00 ? 114 GLU A CB   1  
ATOM 1643  C CG   . GLU A 1 114 ? 6.831   -3.710  9.615   1.00 0.00 ? 114 GLU A CG   1  
ATOM 1644  C CD   . GLU A 1 114 ? 6.624   -3.187  11.038  1.00 0.00 ? 114 GLU A CD   1  
ATOM 1645  O OE1  . GLU A 1 114 ? 6.917   -2.025  11.269  1.00 0.00 ? 114 GLU A OE1  1  
ATOM 1646  O OE2  . GLU A 1 114 ? 6.177   -3.957  11.871  1.00 0.00 ? 114 GLU A OE2  1  
ATOM 1647  H H    . GLU A 1 114 ? 8.787   -3.668  6.666   1.00 0.00 ? 114 GLU A H    1  
ATOM 1648  H HA   . GLU A 1 114 ? 7.648   -1.660  8.489   1.00 0.00 ? 114 GLU A HA   1  
ATOM 1649  H HB2  . GLU A 1 114 ? 8.626   -4.447  8.693   1.00 0.00 ? 114 GLU A HB2  1  
ATOM 1650  H HB3  . GLU A 1 114 ? 8.899   -3.446  10.120  1.00 0.00 ? 114 GLU A HB3  1  
ATOM 1651  H HG2  . GLU A 1 114 ? 6.220   -3.140  8.929   1.00 0.00 ? 114 GLU A HG2  1  
ATOM 1652  H HG3  . GLU A 1 114 ? 6.548   -4.750  9.571   1.00 0.00 ? 114 GLU A HG3  1  
ATOM 1653  N N    . LYS A 1 115 ? 10.877  -2.048  8.105   1.00 0.00 ? 115 LYS A N    1  
ATOM 1654  C CA   . LYS A 1 115 ? 12.181  -1.395  8.413   1.00 0.00 ? 115 LYS A CA   1  
ATOM 1655  C C    . LYS A 1 115 ? 12.278  -0.067  7.657   1.00 0.00 ? 115 LYS A C    1  
ATOM 1656  O O    . LYS A 1 115 ? 12.555  0.965   8.235   1.00 0.00 ? 115 LYS A O    1  
ATOM 1657  C CB   . LYS A 1 115 ? 13.329  -2.315  7.990   1.00 0.00 ? 115 LYS A CB   1  
ATOM 1658  C CG   . LYS A 1 115 ? 13.673  -3.262  9.142   1.00 0.00 ? 115 LYS A CG   1  
ATOM 1659  C CD   . LYS A 1 115 ? 15.192  -3.414  9.246   1.00 0.00 ? 115 LYS A CD   1  
ATOM 1660  C CE   . LYS A 1 115 ? 15.554  -3.987  10.617  1.00 0.00 ? 115 LYS A CE   1  
ATOM 1661  N NZ   . LYS A 1 115 ? 15.981  -2.882  11.521  1.00 0.00 ? 115 LYS A NZ   1  
ATOM 1662  H H    . LYS A 1 115 ? 10.840  -2.793  7.469   1.00 0.00 ? 115 LYS A H    1  
ATOM 1663  H HA   . LYS A 1 115 ? 12.244  -1.206  9.474   1.00 0.00 ? 115 LYS A HA   1  
ATOM 1664  H HB2  . LYS A 1 115 ? 13.029  -2.891  7.126   1.00 0.00 ? 115 LYS A HB2  1  
ATOM 1665  H HB3  . LYS A 1 115 ? 14.196  -1.720  7.743   1.00 0.00 ? 115 LYS A HB3  1  
ATOM 1666  H HG2  . LYS A 1 115 ? 13.288  -2.857  10.067  1.00 0.00 ? 115 LYS A HG2  1  
ATOM 1667  H HG3  . LYS A 1 115 ? 13.229  -4.228  8.959   1.00 0.00 ? 115 LYS A HG3  1  
ATOM 1668  H HD2  . LYS A 1 115 ? 15.540  -4.083  8.472   1.00 0.00 ? 115 LYS A HD2  1  
ATOM 1669  H HD3  . LYS A 1 115 ? 15.661  -2.448  9.126   1.00 0.00 ? 115 LYS A HD3  1  
ATOM 1670  H HE2  . LYS A 1 115 ? 14.692  -4.483  11.039  1.00 0.00 ? 115 LYS A HE2  1  
ATOM 1671  H HE3  . LYS A 1 115 ? 16.362  -4.697  10.510  1.00 0.00 ? 115 LYS A HE3  1  
ATOM 1672  H HZ1  . LYS A 1 115 ? 15.381  -2.049  11.358  1.00 0.00 ? 115 LYS A HZ1  1  
ATOM 1673  H HZ2  . LYS A 1 115 ? 15.884  -3.187  12.510  1.00 0.00 ? 115 LYS A HZ2  1  
ATOM 1674  H HZ3  . LYS A 1 115 ? 16.974  -2.641  11.327  1.00 0.00 ? 115 LYS A HZ3  1  
ATOM 1675  N N    . LEU A 1 116 ? 12.047  -0.080  6.372   1.00 0.00 ? 116 LEU A N    1  
ATOM 1676  C CA   . LEU A 1 116 ? 12.123  1.190   5.595   1.00 0.00 ? 116 LEU A CA   1  
ATOM 1677  C C    . LEU A 1 116 ? 11.261  2.243   6.287   1.00 0.00 ? 116 LEU A C    1  
ATOM 1678  O O    . LEU A 1 116 ? 11.689  3.358   6.518   1.00 0.00 ? 116 LEU A O    1  
ATOM 1679  C CB   . LEU A 1 116 ? 11.607  0.958   4.171   1.00 0.00 ? 116 LEU A CB   1  
ATOM 1680  C CG   . LEU A 1 116 ? 12.769  1.069   3.182   1.00 0.00 ? 116 LEU A CG   1  
ATOM 1681  C CD1  . LEU A 1 116 ? 13.642  -0.184  3.276   1.00 0.00 ? 116 LEU A CD1  1  
ATOM 1682  C CD2  . LEU A 1 116 ? 12.220  1.198   1.760   1.00 0.00 ? 116 LEU A CD2  1  
ATOM 1683  H H    . LEU A 1 116 ? 11.819  -0.919  5.921   1.00 0.00 ? 116 LEU A H    1  
ATOM 1684  H HA   . LEU A 1 116 ? 13.148  1.533   5.559   1.00 0.00 ? 116 LEU A HA   1  
ATOM 1685  H HB2  . LEU A 1 116 ? 11.169  -0.028  4.104   1.00 0.00 ? 116 LEU A HB2  1  
ATOM 1686  H HB3  . LEU A 1 116 ? 10.861  1.701   3.933   1.00 0.00 ? 116 LEU A HB3  1  
ATOM 1687  H HG   . LEU A 1 116 ? 13.363  1.940   3.422   1.00 0.00 ? 116 LEU A HG   1  
ATOM 1688  H HD11 . LEU A 1 116 ? 13.519  -0.637  4.248   1.00 0.00 ? 116 LEU A HD11 1  
ATOM 1689  H HD12 . LEU A 1 116 ? 13.346  -0.887  2.511   1.00 0.00 ? 116 LEU A HD12 1  
ATOM 1690  H HD13 . LEU A 1 116 ? 14.678  0.088   3.134   1.00 0.00 ? 116 LEU A HD13 1  
ATOM 1691  H HD21 . LEU A 1 116 ? 11.273  0.682   1.691   1.00 0.00 ? 116 LEU A HD21 1  
ATOM 1692  H HD22 . LEU A 1 116 ? 12.079  2.242   1.521   1.00 0.00 ? 116 LEU A HD22 1  
ATOM 1693  H HD23 . LEU A 1 116 ? 12.919  0.760   1.063   1.00 0.00 ? 116 LEU A HD23 1  
ATOM 1694  N N    . ALA A 1 117 ? 10.051  1.899   6.636   1.00 0.00 ? 117 ALA A N    1  
ATOM 1695  C CA   . ALA A 1 117 ? 9.183   2.886   7.327   1.00 0.00 ? 117 ALA A CA   1  
ATOM 1696  C C    . ALA A 1 117 ? 9.836   3.256   8.653   1.00 0.00 ? 117 ALA A C    1  
ATOM 1697  O O    . ALA A 1 117 ? 9.962   4.413   8.981   1.00 0.00 ? 117 ALA A O    1  
ATOM 1698  C CB   . ALA A 1 117 ? 7.801   2.284   7.589   1.00 0.00 ? 117 ALA A CB   1  
ATOM 1699  H H    . ALA A 1 117 ? 9.723   0.994   6.454   1.00 0.00 ? 117 ALA A H    1  
ATOM 1700  H HA   . ALA A 1 117 ? 9.084   3.770   6.715   1.00 0.00 ? 117 ALA A HA   1  
ATOM 1701  H HB1  . ALA A 1 117 ? 7.665   1.409   6.972   1.00 0.00 ? 117 ALA A HB1  1  
ATOM 1702  H HB2  . ALA A 1 117 ? 7.720   2.008   8.630   1.00 0.00 ? 117 ALA A HB2  1  
ATOM 1703  H HB3  . ALA A 1 117 ? 7.041   3.015   7.352   1.00 0.00 ? 117 ALA A HB3  1  
ATOM 1704  N N    . ASP A 1 118 ? 10.261  2.272   9.408   1.00 0.00 ? 118 ASP A N    1  
ATOM 1705  C CA   . ASP A 1 118 ? 10.920  2.551   10.720  1.00 0.00 ? 118 ASP A CA   1  
ATOM 1706  C C    . ASP A 1 118 ? 11.815  3.786   10.595  1.00 0.00 ? 118 ASP A C    1  
ATOM 1707  O O    . ASP A 1 118 ? 12.019  4.518   11.542  1.00 0.00 ? 118 ASP A O    1  
ATOM 1708  C CB   . ASP A 1 118 ? 11.768  1.345   11.126  1.00 0.00 ? 118 ASP A CB   1  
ATOM 1709  C CG   . ASP A 1 118 ? 11.062  0.581   12.247  1.00 0.00 ? 118 ASP A CG   1  
ATOM 1710  O OD1  . ASP A 1 118 ? 9.844   0.637   12.300  1.00 0.00 ? 118 ASP A OD1  1  
ATOM 1711  O OD2  . ASP A 1 118 ? 11.750  -0.048  13.033  1.00 0.00 ? 118 ASP A OD2  1  
ATOM 1712  H H    . ASP A 1 118 ? 10.152  1.345   9.107   1.00 0.00 ? 118 ASP A H    1  
ATOM 1713  H HA   . ASP A 1 118 ? 10.165  2.728   11.471  1.00 0.00 ? 118 ASP A HA   1  
ATOM 1714  H HB2  . ASP A 1 118 ? 11.900  0.694   10.273  1.00 0.00 ? 118 ASP A HB2  1  
ATOM 1715  H HB3  . ASP A 1 118 ? 12.732  1.682   11.475  1.00 0.00 ? 118 ASP A HB3  1  
ATOM 1716  N N    . TYR A 1 119 ? 12.344  4.025   9.428   1.00 0.00 ? 119 TYR A N    1  
ATOM 1717  C CA   . TYR A 1 119 ? 13.217  5.214   9.236   1.00 0.00 ? 119 TYR A CA   1  
ATOM 1718  C C    . TYR A 1 119 ? 12.351  6.478   9.198   1.00 0.00 ? 119 TYR A C    1  
ATOM 1719  O O    . TYR A 1 119 ? 12.633  7.455   9.862   1.00 0.00 ? 119 TYR A O    1  
ATOM 1720  C CB   . TYR A 1 119 ? 13.973  5.080   7.908   1.00 0.00 ? 119 TYR A CB   1  
ATOM 1721  C CG   . TYR A 1 119 ? 15.049  4.018   8.009   1.00 0.00 ? 119 TYR A CG   1  
ATOM 1722  C CD1  . TYR A 1 119 ? 15.562  3.631   9.257   1.00 0.00 ? 119 TYR A CD1  1  
ATOM 1723  C CD2  . TYR A 1 119 ? 15.541  3.423   6.839   1.00 0.00 ? 119 TYR A CD2  1  
ATOM 1724  C CE1  . TYR A 1 119 ? 16.561  2.652   9.330   1.00 0.00 ? 119 TYR A CE1  1  
ATOM 1725  C CE2  . TYR A 1 119 ? 16.539  2.446   6.914   1.00 0.00 ? 119 TYR A CE2  1  
ATOM 1726  C CZ   . TYR A 1 119 ? 17.049  2.060   8.159   1.00 0.00 ? 119 TYR A CZ   1  
ATOM 1727  O OH   . TYR A 1 119 ? 18.034  1.097   8.233   1.00 0.00 ? 119 TYR A OH   1  
ATOM 1728  H H    . TYR A 1 119 ? 12.163  3.425   8.676   1.00 0.00 ? 119 TYR A H    1  
ATOM 1729  H HA   . TYR A 1 119 ? 13.918  5.289   10.050  1.00 0.00 ? 119 TYR A HA   1  
ATOM 1730  H HB2  . TYR A 1 119 ? 13.277  4.803   7.130   1.00 0.00 ? 119 TYR A HB2  1  
ATOM 1731  H HB3  . TYR A 1 119 ? 14.428  6.026   7.658   1.00 0.00 ? 119 TYR A HB3  1  
ATOM 1732  H HD1  . TYR A 1 119 ? 15.192  4.083   10.162  1.00 0.00 ? 119 TYR A HD1  1  
ATOM 1733  H HD2  . TYR A 1 119 ? 15.148  3.719   5.878   1.00 0.00 ? 119 TYR A HD2  1  
ATOM 1734  H HE1  . TYR A 1 119 ? 16.955  2.354   10.290  1.00 0.00 ? 119 TYR A HE1  1  
ATOM 1735  H HE2  . TYR A 1 119 ? 16.917  1.988   6.011   1.00 0.00 ? 119 TYR A HE2  1  
ATOM 1736  H HH   . TYR A 1 119 ? 18.737  1.432   8.794   1.00 0.00 ? 119 TYR A HH   1  
ATOM 1737  N N    . LEU A 1 120 ? 11.315  6.473   8.405   1.00 0.00 ? 120 LEU A N    1  
ATOM 1738  C CA   . LEU A 1 120 ? 10.447  7.681   8.298   1.00 0.00 ? 120 LEU A CA   1  
ATOM 1739  C C    . LEU A 1 120 ? 9.443   7.769   9.460   1.00 0.00 ? 120 LEU A C    1  
ATOM 1740  O O    . LEU A 1 120 ? 8.703   8.727   9.559   1.00 0.00 ? 120 LEU A O    1  
ATOM 1741  C CB   . LEU A 1 120 ? 9.685   7.626   6.976   1.00 0.00 ? 120 LEU A CB   1  
ATOM 1742  C CG   . LEU A 1 120 ? 10.420  8.468   5.933   1.00 0.00 ? 120 LEU A CG   1  
ATOM 1743  C CD1  . LEU A 1 120 ? 10.224  7.852   4.548   1.00 0.00 ? 120 LEU A CD1  1  
ATOM 1744  C CD2  . LEU A 1 120 ? 9.862   9.892   5.943   1.00 0.00 ? 120 LEU A CD2  1  
ATOM 1745  H H    . LEU A 1 120 ? 11.120  5.682   7.860   1.00 0.00 ? 120 LEU A H    1  
ATOM 1746  H HA   . LEU A 1 120 ? 11.071  8.562   8.305   1.00 0.00 ? 120 LEU A HA   1  
ATOM 1747  H HB2  . LEU A 1 120 ? 9.625   6.601   6.638   1.00 0.00 ? 120 LEU A HB2  1  
ATOM 1748  H HB3  . LEU A 1 120 ? 8.690   8.018   7.117   1.00 0.00 ? 120 LEU A HB3  1  
ATOM 1749  H HG   . LEU A 1 120 ? 11.475  8.491   6.169   1.00 0.00 ? 120 LEU A HG   1  
ATOM 1750  H HD11 . LEU A 1 120 ? 9.491   7.062   4.605   1.00 0.00 ? 120 LEU A HD11 1  
ATOM 1751  H HD12 . LEU A 1 120 ? 9.881   8.612   3.860   1.00 0.00 ? 120 LEU A HD12 1  
ATOM 1752  H HD13 . LEU A 1 120 ? 11.163  7.448   4.198   1.00 0.00 ? 120 LEU A HD13 1  
ATOM 1753  H HD21 . LEU A 1 120 ? 8.826   9.871   6.248   1.00 0.00 ? 120 LEU A HD21 1  
ATOM 1754  H HD22 . LEU A 1 120 ? 10.429  10.496  6.636   1.00 0.00 ? 120 LEU A HD22 1  
ATOM 1755  H HD23 . LEU A 1 120 ? 9.938   10.315  4.953   1.00 0.00 ? 120 LEU A HD23 1  
ATOM 1756  N N    . ILE A 1 121 ? 9.397   6.806   10.345  1.00 0.00 ? 121 ILE A N    1  
ATOM 1757  C CA   . ILE A 1 121 ? 8.421   6.912   11.473  1.00 0.00 ? 121 ILE A CA   1  
ATOM 1758  C C    . ILE A 1 121 ? 8.964   7.895   12.510  1.00 0.00 ? 121 ILE A C    1  
ATOM 1759  O O    . ILE A 1 121 ? 8.227   8.665   13.093  1.00 0.00 ? 121 ILE A O    1  
ATOM 1760  C CB   . ILE A 1 121 ? 8.206   5.552   12.149  1.00 0.00 ? 121 ILE A CB   1  
ATOM 1761  C CG1  . ILE A 1 121 ? 8.273   4.424   11.121  1.00 0.00 ? 121 ILE A CG1  1  
ATOM 1762  C CG2  . ILE A 1 121 ? 6.833   5.534   12.822  1.00 0.00 ? 121 ILE A CG2  1  
ATOM 1763  C CD1  . ILE A 1 121 ? 7.473   4.806   9.872   1.00 0.00 ? 121 ILE A CD1  1  
ATOM 1764  H H    . ILE A 1 121 ? 9.996   6.035   10.275  1.00 0.00 ? 121 ILE A H    1  
ATOM 1765  H HA   . ILE A 1 121 ? 7.475   7.280   11.093  1.00 0.00 ? 121 ILE A HA   1  
ATOM 1766  H HB   . ILE A 1 121 ? 8.971   5.402   12.898  1.00 0.00 ? 121 ILE A HB   1  
ATOM 1767  H HG12 . ILE A 1 121 ? 9.300   4.248   10.856  1.00 0.00 ? 121 ILE A HG12 1  
ATOM 1768  H HG13 . ILE A 1 121 ? 7.855   3.525   11.550  1.00 0.00 ? 121 ILE A HG13 1  
ATOM 1769  H HG21 . ILE A 1 121 ? 6.688   6.454   13.367  1.00 0.00 ? 121 ILE A HG21 1  
ATOM 1770  H HG22 . ILE A 1 121 ? 6.065   5.436   12.070  1.00 0.00 ? 121 ILE A HG22 1  
ATOM 1771  H HG23 . ILE A 1 121 ? 6.778   4.699   13.505  1.00 0.00 ? 121 ILE A HG23 1  
ATOM 1772  H HD11 . ILE A 1 121 ? 6.635   5.424   10.156  1.00 0.00 ? 121 ILE A HD11 1  
ATOM 1773  H HD12 . ILE A 1 121 ? 8.106   5.351   9.189   1.00 0.00 ? 121 ILE A HD12 1  
ATOM 1774  H HD13 . ILE A 1 121 ? 7.110   3.910   9.389   1.00 0.00 ? 121 ILE A HD13 1  
ATOM 1775  N N    . GLY A 1 122 ? 10.250  7.871   12.744  1.00 0.00 ? 122 GLY A N    1  
ATOM 1776  C CA   . GLY A 1 122 ? 10.850  8.800   13.745  1.00 0.00 ? 122 GLY A CA   1  
ATOM 1777  C C    . GLY A 1 122 ? 10.213  10.182  13.604  1.00 0.00 ? 122 GLY A C    1  
ATOM 1778  O O    . GLY A 1 122 ? 9.955   10.861  14.578  1.00 0.00 ? 122 GLY A O    1  
ATOM 1779  H H    . GLY A 1 122 ? 10.822  7.237   12.262  1.00 0.00 ? 122 GLY A H    1  
ATOM 1780  H HA2  . GLY A 1 122 ? 10.674  8.419   14.741  1.00 0.00 ? 122 GLY A HA2  1  
ATOM 1781  H HA3  . GLY A 1 122 ? 11.913  8.878   13.571  1.00 0.00 ? 122 GLY A HA3  1  
ATOM 1782  N N    . GLN A 1 123 ? 9.952   10.601  12.397  1.00 0.00 ? 123 GLN A N    1  
ATOM 1783  C CA   . GLN A 1 123 ? 9.324   11.935  12.189  1.00 0.00 ? 123 GLN A CA   1  
ATOM 1784  C C    . GLN A 1 123 ? 7.806   11.802  12.327  1.00 0.00 ? 123 GLN A C    1  
ATOM 1785  O O    . GLN A 1 123 ? 7.192   12.425  13.170  1.00 0.00 ? 123 GLN A O    1  
ATOM 1786  C CB   . GLN A 1 123 ? 9.668   12.448  10.788  1.00 0.00 ? 123 GLN A CB   1  
ATOM 1787  C CG   . GLN A 1 123 ? 10.989  13.220  10.835  1.00 0.00 ? 123 GLN A CG   1  
ATOM 1788  C CD   . GLN A 1 123 ? 10.765  14.576  11.507  1.00 0.00 ? 123 GLN A CD   1  
ATOM 1789  O OE1  . GLN A 1 123 ? 9.732   14.808  12.103  1.00 0.00 ? 123 GLN A OE1  1  
ATOM 1790  N NE2  . GLN A 1 123 ? 11.696  15.488  11.437  1.00 0.00 ? 123 GLN A NE2  1  
ATOM 1791  H H    . GLN A 1 123 ? 10.164  10.035  11.626  1.00 0.00 ? 123 GLN A H    1  
ATOM 1792  H HA   . GLN A 1 123 ? 9.695   12.629  12.930  1.00 0.00 ? 123 GLN A HA   1  
ATOM 1793  H HB2  . GLN A 1 123 ? 9.764   11.610  10.112  1.00 0.00 ? 123 GLN A HB2  1  
ATOM 1794  H HB3  . GLN A 1 123 ? 8.884   13.103  10.441  1.00 0.00 ? 123 GLN A HB3  1  
ATOM 1795  H HG2  . GLN A 1 123 ? 11.716  12.653  11.399  1.00 0.00 ? 123 GLN A HG2  1  
ATOM 1796  H HG3  . GLN A 1 123 ? 11.353  13.374  9.831   1.00 0.00 ? 123 GLN A HG3  1  
ATOM 1797  H HE21 . GLN A 1 123 ? 12.529  15.302  10.956  1.00 0.00 ? 123 GLN A HE21 1  
ATOM 1798  H HE22 . GLN A 1 123 ? 11.561  16.360  11.865  1.00 0.00 ? 123 GLN A HE22 1  
ATOM 1799  N N    . GLY A 1 124 ? 7.198   10.989  11.507  1.00 0.00 ? 124 GLY A N    1  
ATOM 1800  C CA   . GLY A 1 124 ? 5.721   10.809  11.593  1.00 0.00 ? 124 GLY A CA   1  
ATOM 1801  C C    . GLY A 1 124 ? 5.024   11.786  10.646  1.00 0.00 ? 124 GLY A C    1  
ATOM 1802  O O    . GLY A 1 124 ? 4.948   12.970  10.907  1.00 0.00 ? 124 GLY A O    1  
ATOM 1803  H H    . GLY A 1 124 ? 7.712   10.492  10.837  1.00 0.00 ? 124 GLY A H    1  
ATOM 1804  H HA2  . GLY A 1 124 ? 5.467   9.795   11.319  1.00 0.00 ? 124 GLY A HA2  1  
ATOM 1805  H HA3  . GLY A 1 124 ? 5.395   11.001  12.604  1.00 0.00 ? 124 GLY A HA3  1  
ATOM 1806  N N    . PHE A 1 125 ? 4.503   11.301  9.550   1.00 0.00 ? 125 PHE A N    1  
ATOM 1807  C CA   . PHE A 1 125 ? 3.800   12.210  8.598   1.00 0.00 ? 125 PHE A CA   1  
ATOM 1808  C C    . PHE A 1 125 ? 2.323   11.820  8.520   1.00 0.00 ? 125 PHE A C    1  
ATOM 1809  O O    . PHE A 1 125 ? 1.496   12.634  8.894   1.00 0.00 ? 125 PHE A O    1  
ATOM 1810  C CB   . PHE A 1 125 ? 4.422   12.105  7.202   1.00 0.00 ? 125 PHE A CB   1  
ATOM 1811  C CG   . PHE A 1 125 ? 5.928   12.211  7.300   1.00 0.00 ? 125 PHE A CG   1  
ATOM 1812  C CD1  . PHE A 1 125 ? 6.666   11.217  7.955   1.00 0.00 ? 125 PHE A CD1  1  
ATOM 1813  C CD2  . PHE A 1 125 ? 6.586   13.307  6.728   1.00 0.00 ? 125 PHE A CD2  1  
ATOM 1814  C CE1  . PHE A 1 125 ? 8.061   11.321  8.038   1.00 0.00 ? 125 PHE A CE1  1  
ATOM 1815  C CE2  . PHE A 1 125 ? 7.979   13.410  6.811   1.00 0.00 ? 125 PHE A CE2  1  
ATOM 1816  C CZ   . PHE A 1 125 ? 8.717   12.417  7.466   1.00 0.00 ? 125 PHE A CZ   1  
ATOM 1817  O OXT  . PHE A 1 125 ? 2.046   10.713  8.089   1.00 0.00 ? 125 PHE A OXT  1  
ATOM 1818  H H    . PHE A 1 125 ? 4.568   10.340  9.360   1.00 0.00 ? 125 PHE A H    1  
ATOM 1819  H HA   . PHE A 1 125 ? 3.882   13.228  8.950   1.00 0.00 ? 125 PHE A HA   1  
ATOM 1820  H HB2  . PHE A 1 125 ? 4.150   11.159  6.755   1.00 0.00 ? 125 PHE A HB2  1  
ATOM 1821  H HB3  . PHE A 1 125 ? 4.048   12.909  6.586   1.00 0.00 ? 125 PHE A HB3  1  
ATOM 1822  H HD1  . PHE A 1 125 ? 6.162   10.370  8.396   1.00 0.00 ? 125 PHE A HD1  1  
ATOM 1823  H HD2  . PHE A 1 125 ? 6.017   14.074  6.223   1.00 0.00 ? 125 PHE A HD2  1  
ATOM 1824  H HE1  . PHE A 1 125 ? 8.631   10.556  8.542   1.00 0.00 ? 125 PHE A HE1  1  
ATOM 1825  H HE2  . PHE A 1 125 ? 8.485   14.256  6.370   1.00 0.00 ? 125 PHE A HE2  1  
ATOM 1826  H HZ   . PHE A 1 125 ? 9.793   12.496  7.530   1.00 0.00 ? 125 PHE A HZ   1  
ATOM 1827  N N    . SER A 1 1   ? 6.203   1.353   -3.474  1.00 0.00 ? 1   SER A N    2  
ATOM 1828  C CA   . SER A 1 1   ? 6.441   1.305   -2.005  1.00 0.00 ? 1   SER A CA   2  
ATOM 1829  C C    . SER A 1 1   ? 7.033   2.640   -1.544  1.00 0.00 ? 1   SER A C    2  
ATOM 1830  O O    . SER A 1 1   ? 6.580   3.231   -0.587  1.00 0.00 ? 1   SER A O    2  
ATOM 1831  C CB   . SER A 1 1   ? 7.416   0.171   -1.682  1.00 0.00 ? 1   SER A CB   2  
ATOM 1832  O OG   . SER A 1 1   ? 6.748   -1.076  -1.825  1.00 0.00 ? 1   SER A OG   2  
ATOM 1833  H H1   . SER A 1 1   ? 6.253   2.338   -3.803  1.00 0.00 ? 1   SER A H1   2  
ATOM 1834  H H2   . SER A 1 1   ? 6.928   0.789   -3.962  1.00 0.00 ? 1   SER A H2   2  
ATOM 1835  H H3   . SER A 1 1   ? 5.261   0.965   -3.685  1.00 0.00 ? 1   SER A H3   2  
ATOM 1836  H HA   . SER A 1 1   ? 5.505   1.132   -1.495  1.00 0.00 ? 1   SER A HA   2  
ATOM 1837  H HB2  . SER A 1 1   ? 8.251   0.207   -2.363  1.00 0.00 ? 1   SER A HB2  2  
ATOM 1838  H HB3  . SER A 1 1   ? 7.777   0.285   -0.668  1.00 0.00 ? 1   SER A HB3  2  
ATOM 1839  H HG   . SER A 1 1   ? 6.049   -0.964  -2.473  1.00 0.00 ? 1   SER A HG   2  
ATOM 1840  N N    . TRP A 1 2   ? 8.038   3.121   -2.220  1.00 0.00 ? 2   TRP A N    2  
ATOM 1841  C CA   . TRP A 1 2   ? 8.653   4.419   -1.819  1.00 0.00 ? 2   TRP A CA   2  
ATOM 1842  C C    . TRP A 1 2   ? 9.274   5.078   -3.051  1.00 0.00 ? 2   TRP A C    2  
ATOM 1843  O O    . TRP A 1 2   ? 9.839   4.416   -3.893  1.00 0.00 ? 2   TRP A O    2  
ATOM 1844  C CB   . TRP A 1 2   ? 9.713   4.167   -0.747  1.00 0.00 ? 2   TRP A CB   2  
ATOM 1845  C CG   . TRP A 1 2   ? 9.227   3.080   0.160   1.00 0.00 ? 2   TRP A CG   2  
ATOM 1846  C CD1  . TRP A 1 2   ? 9.570   1.775   0.067   1.00 0.00 ? 2   TRP A CD1  2  
ATOM 1847  C CD2  . TRP A 1 2   ? 8.301   3.180   1.281   1.00 0.00 ? 2   TRP A CD2  2  
ATOM 1848  N NE1  . TRP A 1 2   ? 8.920   1.070   1.066   1.00 0.00 ? 2   TRP A NE1  2  
ATOM 1849  C CE2  . TRP A 1 2   ? 8.126   1.891   1.839   1.00 0.00 ? 2   TRP A CE2  2  
ATOM 1850  C CE3  . TRP A 1 2   ? 7.606   4.254   1.863   1.00 0.00 ? 2   TRP A CE3  2  
ATOM 1851  C CZ2  . TRP A 1 2   ? 7.290   1.676   2.936   1.00 0.00 ? 2   TRP A CZ2  2  
ATOM 1852  C CZ3  . TRP A 1 2   ? 6.763   4.042   2.966   1.00 0.00 ? 2   TRP A CZ3  2  
ATOM 1853  C CH2  . TRP A 1 2   ? 6.606   2.755   3.502   1.00 0.00 ? 2   TRP A CH2  2  
ATOM 1854  H H    . TRP A 1 2   ? 8.389   2.631   -2.993  1.00 0.00 ? 2   TRP A H    2  
ATOM 1855  H HA   . TRP A 1 2   ? 7.889   5.068   -1.417  1.00 0.00 ? 2   TRP A HA   2  
ATOM 1856  H HB2  . TRP A 1 2   ? 10.639  3.870   -1.213  1.00 0.00 ? 2   TRP A HB2  2  
ATOM 1857  H HB3  . TRP A 1 2   ? 9.871   5.070   -0.176  1.00 0.00 ? 2   TRP A HB3  2  
ATOM 1858  H HD1  . TRP A 1 2   ? 10.241  1.353   -0.663  1.00 0.00 ? 2   TRP A HD1  2  
ATOM 1859  H HE1  . TRP A 1 2   ? 8.999   0.106   1.219   1.00 0.00 ? 2   TRP A HE1  2  
ATOM 1860  H HE3  . TRP A 1 2   ? 7.718   5.250   1.456   1.00 0.00 ? 2   TRP A HE3  2  
ATOM 1861  H HZ2  . TRP A 1 2   ? 7.170   0.681   3.343   1.00 0.00 ? 2   TRP A HZ2  2  
ATOM 1862  H HZ3  . TRP A 1 2   ? 6.232   4.874   3.404   1.00 0.00 ? 2   TRP A HZ3  2  
ATOM 1863  H HH2  . TRP A 1 2   ? 5.956   2.599   4.351   1.00 0.00 ? 2   TRP A HH2  2  
ATOM 1864  N N    . GLN A 1 3   ? 9.139   6.373   -3.169  1.00 0.00 ? 3   GLN A N    2  
ATOM 1865  C CA   . GLN A 1 3   ? 9.682   7.104   -4.357  1.00 0.00 ? 3   GLN A CA   2  
ATOM 1866  C C    . GLN A 1 3   ? 10.962  6.445   -4.887  1.00 0.00 ? 3   GLN A C    2  
ATOM 1867  O O    . GLN A 1 3   ? 10.934  5.697   -5.846  1.00 0.00 ? 3   GLN A O    2  
ATOM 1868  C CB   . GLN A 1 3   ? 9.986   8.552   -3.968  1.00 0.00 ? 3   GLN A CB   2  
ATOM 1869  C CG   . GLN A 1 3   ? 8.971   9.484   -4.634  1.00 0.00 ? 3   GLN A CG   2  
ATOM 1870  C CD   . GLN A 1 3   ? 9.576   10.883  -4.774  1.00 0.00 ? 3   GLN A CD   2  
ATOM 1871  O OE1  . GLN A 1 3   ? 9.431   11.521  -5.798  1.00 0.00 ? 3   GLN A OE1  2  
ATOM 1872  N NE2  . GLN A 1 3   ? 10.254  11.389  -3.781  1.00 0.00 ? 3   GLN A NE2  2  
ATOM 1873  H H    . GLN A 1 3   ? 8.654   6.871   -2.478  1.00 0.00 ? 3   GLN A H    2  
ATOM 1874  H HA   . GLN A 1 3   ? 8.937   7.101   -5.140  1.00 0.00 ? 3   GLN A HA   2  
ATOM 1875  H HB2  . GLN A 1 3   ? 9.923   8.659   -2.895  1.00 0.00 ? 3   GLN A HB2  2  
ATOM 1876  H HB3  . GLN A 1 3   ? 10.980  8.813   -4.298  1.00 0.00 ? 3   GLN A HB3  2  
ATOM 1877  H HG2  . GLN A 1 3   ? 8.720   9.101   -5.613  1.00 0.00 ? 3   GLN A HG2  2  
ATOM 1878  H HG3  . GLN A 1 3   ? 8.079   9.539   -4.029  1.00 0.00 ? 3   GLN A HG3  2  
ATOM 1879  H HE21 . GLN A 1 3   ? 10.370  10.876  -2.955  1.00 0.00 ? 3   GLN A HE21 2  
ATOM 1880  H HE22 . GLN A 1 3   ? 10.647  12.283  -3.861  1.00 0.00 ? 3   GLN A HE22 2  
ATOM 1881  N N    . THR A 1 4   ? 12.085  6.735   -4.293  1.00 0.00 ? 4   THR A N    2  
ATOM 1882  C CA   . THR A 1 4   ? 13.365  6.144   -4.786  1.00 0.00 ? 4   THR A CA   2  
ATOM 1883  C C    . THR A 1 4   ? 13.360  4.621   -4.626  1.00 0.00 ? 4   THR A C    2  
ATOM 1884  O O    . THR A 1 4   ? 13.919  3.910   -5.438  1.00 0.00 ? 4   THR A O    2  
ATOM 1885  C CB   . THR A 1 4   ? 14.532  6.735   -3.995  1.00 0.00 ? 4   THR A CB   2  
ATOM 1886  O OG1  . THR A 1 4   ? 14.212  8.061   -3.598  1.00 0.00 ? 4   THR A OG1  2  
ATOM 1887  C CG2  . THR A 1 4   ? 15.784  6.750   -4.873  1.00 0.00 ? 4   THR A CG2  2  
ATOM 1888  H H    . THR A 1 4   ? 12.092  7.356   -3.535  1.00 0.00 ? 4   THR A H    2  
ATOM 1889  H HA   . THR A 1 4   ? 13.486  6.389   -5.833  1.00 0.00 ? 4   THR A HA   2  
ATOM 1890  H HB   . THR A 1 4   ? 14.718  6.130   -3.121  1.00 0.00 ? 4   THR A HB   2  
ATOM 1891  H HG1  . THR A 1 4   ? 14.653  8.235   -2.763  1.00 0.00 ? 4   THR A HG1  2  
ATOM 1892  H HG21 . THR A 1 4   ? 15.520  7.065   -5.872  1.00 0.00 ? 4   THR A HG21 2  
ATOM 1893  H HG22 . THR A 1 4   ? 16.507  7.438   -4.459  1.00 0.00 ? 4   THR A HG22 2  
ATOM 1894  H HG23 . THR A 1 4   ? 16.211  5.759   -4.909  1.00 0.00 ? 4   THR A HG23 2  
ATOM 1895  N N    . TYR A 1 5   ? 12.749  4.104   -3.595  1.00 0.00 ? 5   TYR A N    2  
ATOM 1896  C CA   . TYR A 1 5   ? 12.740  2.621   -3.415  1.00 0.00 ? 5   TYR A CA   2  
ATOM 1897  C C    . TYR A 1 5   ? 11.730  1.988   -4.376  1.00 0.00 ? 5   TYR A C    2  
ATOM 1898  O O    . TYR A 1 5   ? 11.518  0.792   -4.364  1.00 0.00 ? 5   TYR A O    2  
ATOM 1899  C CB   . TYR A 1 5   ? 12.358  2.264   -1.976  1.00 0.00 ? 5   TYR A CB   2  
ATOM 1900  C CG   . TYR A 1 5   ? 13.009  3.231   -1.013  1.00 0.00 ? 5   TYR A CG   2  
ATOM 1901  C CD1  . TYR A 1 5   ? 14.178  3.909   -1.382  1.00 0.00 ? 5   TYR A CD1  2  
ATOM 1902  C CD2  . TYR A 1 5   ? 12.444  3.447   0.252   1.00 0.00 ? 5   TYR A CD2  2  
ATOM 1903  C CE1  . TYR A 1 5   ? 14.781  4.803   -0.490  1.00 0.00 ? 5   TYR A CE1  2  
ATOM 1904  C CE2  . TYR A 1 5   ? 13.049  4.343   1.144   1.00 0.00 ? 5   TYR A CE2  2  
ATOM 1905  C CZ   . TYR A 1 5   ? 14.217  5.020   0.773   1.00 0.00 ? 5   TYR A CZ   2  
ATOM 1906  O OH   . TYR A 1 5   ? 14.814  5.901   1.651   1.00 0.00 ? 5   TYR A OH   2  
ATOM 1907  H H    . TYR A 1 5   ? 12.305  4.684   -2.941  1.00 0.00 ? 5   TYR A H    2  
ATOM 1908  H HA   . TYR A 1 5   ? 13.724  2.233   -3.628  1.00 0.00 ? 5   TYR A HA   2  
ATOM 1909  H HB2  . TYR A 1 5   ? 11.287  2.309   -1.869  1.00 0.00 ? 5   TYR A HB2  2  
ATOM 1910  H HB3  . TYR A 1 5   ? 12.697  1.264   -1.760  1.00 0.00 ? 5   TYR A HB3  2  
ATOM 1911  H HD1  . TYR A 1 5   ? 14.614  3.742   -2.357  1.00 0.00 ? 5   TYR A HD1  2  
ATOM 1912  H HD2  . TYR A 1 5   ? 11.542  2.925   0.540   1.00 0.00 ? 5   TYR A HD2  2  
ATOM 1913  H HE1  . TYR A 1 5   ? 15.682  5.326   -0.777  1.00 0.00 ? 5   TYR A HE1  2  
ATOM 1914  H HE2  . TYR A 1 5   ? 12.615  4.509   2.119   1.00 0.00 ? 5   TYR A HE2  2  
ATOM 1915  H HH   . TYR A 1 5   ? 14.184  6.599   1.843   1.00 0.00 ? 5   TYR A HH   2  
ATOM 1916  N N    . VAL A 1 6   ? 11.110  2.776   -5.210  1.00 0.00 ? 6   VAL A N    2  
ATOM 1917  C CA   . VAL A 1 6   ? 10.126  2.208   -6.170  1.00 0.00 ? 6   VAL A CA   2  
ATOM 1918  C C    . VAL A 1 6   ? 10.855  1.896   -7.476  1.00 0.00 ? 6   VAL A C    2  
ATOM 1919  O O    . VAL A 1 6   ? 10.701  0.841   -8.058  1.00 0.00 ? 6   VAL A O    2  
ATOM 1920  C CB   . VAL A 1 6   ? 8.975   3.222   -6.391  1.00 0.00 ? 6   VAL A CB   2  
ATOM 1921  C CG1  . VAL A 1 6   ? 8.786   3.547   -7.881  1.00 0.00 ? 6   VAL A CG1  2  
ATOM 1922  C CG2  . VAL A 1 6   ? 7.670   2.635   -5.844  1.00 0.00 ? 6   VAL A CG2  2  
ATOM 1923  H H    . VAL A 1 6   ? 11.297  3.735   -5.211  1.00 0.00 ? 6   VAL A H    2  
ATOM 1924  H HA   . VAL A 1 6   ? 9.728   1.295   -5.762  1.00 0.00 ? 6   VAL A HA   2  
ATOM 1925  H HB   . VAL A 1 6   ? 9.204   4.133   -5.861  1.00 0.00 ? 6   VAL A HB   2  
ATOM 1926  H HG11 . VAL A 1 6   ? 8.818   2.634   -8.456  1.00 0.00 ? 6   VAL A HG11 2  
ATOM 1927  H HG12 . VAL A 1 6   ? 7.831   4.030   -8.026  1.00 0.00 ? 6   VAL A HG12 2  
ATOM 1928  H HG13 . VAL A 1 6   ? 9.576   4.207   -8.208  1.00 0.00 ? 6   VAL A HG13 2  
ATOM 1929  H HG21 . VAL A 1 6   ? 7.879   2.048   -4.962  1.00 0.00 ? 6   VAL A HG21 2  
ATOM 1930  H HG22 . VAL A 1 6   ? 6.990   3.436   -5.590  1.00 0.00 ? 6   VAL A HG22 2  
ATOM 1931  H HG23 . VAL A 1 6   ? 7.214   2.004   -6.596  1.00 0.00 ? 6   VAL A HG23 2  
ATOM 1932  N N    . ASP A 1 7   ? 11.644  2.813   -7.942  1.00 0.00 ? 7   ASP A N    2  
ATOM 1933  C CA   . ASP A 1 7   ? 12.378  2.577   -9.210  1.00 0.00 ? 7   ASP A CA   2  
ATOM 1934  C C    . ASP A 1 7   ? 13.748  1.958   -8.922  1.00 0.00 ? 7   ASP A C    2  
ATOM 1935  O O    . ASP A 1 7   ? 14.763  2.459   -9.365  1.00 0.00 ? 7   ASP A O    2  
ATOM 1936  C CB   . ASP A 1 7   ? 12.568  3.909   -9.931  1.00 0.00 ? 7   ASP A CB   2  
ATOM 1937  C CG   . ASP A 1 7   ? 12.295  3.726   -11.426 1.00 0.00 ? 7   ASP A CG   2  
ATOM 1938  O OD1  . ASP A 1 7   ? 13.025  2.977   -12.054 1.00 0.00 ? 7   ASP A OD1  2  
ATOM 1939  O OD2  . ASP A 1 7   ? 11.360  4.338   -11.915 1.00 0.00 ? 7   ASP A OD2  2  
ATOM 1940  H H    . ASP A 1 7   ? 11.748  3.661   -7.461  1.00 0.00 ? 7   ASP A H    2  
ATOM 1941  H HA   . ASP A 1 7   ? 11.806  1.909   -9.834  1.00 0.00 ? 7   ASP A HA   2  
ATOM 1942  H HB2  . ASP A 1 7   ? 11.881  4.636   -9.523  1.00 0.00 ? 7   ASP A HB2  2  
ATOM 1943  H HB3  . ASP A 1 7   ? 13.582  4.251   -9.788  1.00 0.00 ? 7   ASP A HB3  2  
ATOM 1944  N N    . THR A 1 8   ? 13.801  0.875   -8.193  1.00 0.00 ? 8   THR A N    2  
ATOM 1945  C CA   . THR A 1 8   ? 15.130  0.258   -7.911  1.00 0.00 ? 8   THR A CA   2  
ATOM 1946  C C    . THR A 1 8   ? 14.987  -1.113  -7.234  1.00 0.00 ? 8   THR A C    2  
ATOM 1947  O O    . THR A 1 8   ? 14.913  -2.131  -7.891  1.00 0.00 ? 8   THR A O    2  
ATOM 1948  C CB   . THR A 1 8   ? 15.942  1.190   -7.008  1.00 0.00 ? 8   THR A CB   2  
ATOM 1949  O OG1  . THR A 1 8   ? 15.069  2.122   -6.385  1.00 0.00 ? 8   THR A OG1  2  
ATOM 1950  C CG2  . THR A 1 8   ? 16.982  1.938   -7.847  1.00 0.00 ? 8   THR A CG2  2  
ATOM 1951  H H    . THR A 1 8   ? 12.981  0.475   -7.841  1.00 0.00 ? 8   THR A H    2  
ATOM 1952  H HA   . THR A 1 8   ? 15.660  0.132   -8.844  1.00 0.00 ? 8   THR A HA   2  
ATOM 1953  H HB   . THR A 1 8   ? 16.448  0.610   -6.253  1.00 0.00 ? 8   THR A HB   2  
ATOM 1954  H HG1  . THR A 1 8   ? 15.112  2.946   -6.878  1.00 0.00 ? 8   THR A HG1  2  
ATOM 1955  H HG21 . THR A 1 8   ? 16.761  1.804   -8.896  1.00 0.00 ? 8   THR A HG21 2  
ATOM 1956  H HG22 . THR A 1 8   ? 16.952  2.990   -7.604  1.00 0.00 ? 8   THR A HG22 2  
ATOM 1957  H HG23 . THR A 1 8   ? 17.965  1.546   -7.634  1.00 0.00 ? 8   THR A HG23 2  
ATOM 1958  N N    . ASN A 1 9   ? 15.001  -1.153  -5.925  1.00 0.00 ? 9   ASN A N    2  
ATOM 1959  C CA   . ASN A 1 9   ? 14.923  -2.467  -5.213  1.00 0.00 ? 9   ASN A CA   2  
ATOM 1960  C C    . ASN A 1 9   ? 13.517  -2.752  -4.678  1.00 0.00 ? 9   ASN A C    2  
ATOM 1961  O O    . ASN A 1 9   ? 12.725  -3.401  -5.324  1.00 0.00 ? 9   ASN A O    2  
ATOM 1962  C CB   . ASN A 1 9   ? 15.909  -2.448  -4.042  1.00 0.00 ? 9   ASN A CB   2  
ATOM 1963  C CG   . ASN A 1 9   ? 17.286  -2.919  -4.518  1.00 0.00 ? 9   ASN A CG   2  
ATOM 1964  O OD1  . ASN A 1 9   ? 17.888  -2.301  -5.371  1.00 0.00 ? 9   ASN A OD1  2  
ATOM 1965  N ND2  . ASN A 1 9   ? 17.811  -3.993  -3.997  1.00 0.00 ? 9   ASN A ND2  2  
ATOM 1966  H H    . ASN A 1 9   ? 15.096  -0.325  -5.411  1.00 0.00 ? 9   ASN A H    2  
ATOM 1967  H HA   . ASN A 1 9   ? 15.204  -3.257  -5.895  1.00 0.00 ? 9   ASN A HA   2  
ATOM 1968  H HB2  . ASN A 1 9   ? 15.988  -1.441  -3.658  1.00 0.00 ? 9   ASN A HB2  2  
ATOM 1969  H HB3  . ASN A 1 9   ? 15.556  -3.103  -3.258  1.00 0.00 ? 9   ASN A HB3  2  
ATOM 1970  H HD21 . ASN A 1 9   ? 17.325  -4.492  -3.307  1.00 0.00 ? 9   ASN A HD21 2  
ATOM 1971  H HD22 . ASN A 1 9   ? 18.694  -4.300  -4.294  1.00 0.00 ? 9   ASN A HD22 2  
ATOM 1972  N N    . LEU A 1 10  ? 13.241  -2.303  -3.478  1.00 0.00 ? 10  LEU A N    2  
ATOM 1973  C CA   . LEU A 1 10  ? 11.919  -2.552  -2.811  1.00 0.00 ? 10  LEU A CA   2  
ATOM 1974  C C    . LEU A 1 10  ? 10.810  -2.893  -3.808  1.00 0.00 ? 10  LEU A C    2  
ATOM 1975  O O    . LEU A 1 10  ? 10.025  -3.793  -3.583  1.00 0.00 ? 10  LEU A O    2  
ATOM 1976  C CB   . LEU A 1 10  ? 11.511  -1.310  -2.024  1.00 0.00 ? 10  LEU A CB   2  
ATOM 1977  C CG   . LEU A 1 10  ? 11.460  -1.657  -0.537  1.00 0.00 ? 10  LEU A CG   2  
ATOM 1978  C CD1  . LEU A 1 10  ? 11.808  -0.420  0.286   1.00 0.00 ? 10  LEU A CD1  2  
ATOM 1979  C CD2  . LEU A 1 10  ? 10.053  -2.134  -0.173  1.00 0.00 ? 10  LEU A CD2  2  
ATOM 1980  H H    . LEU A 1 10  ? 13.931  -1.813  -2.986  1.00 0.00 ? 10  LEU A H    2  
ATOM 1981  H HA   . LEU A 1 10  ? 12.029  -3.376  -2.122  1.00 0.00 ? 10  LEU A HA   2  
ATOM 1982  H HB2  . LEU A 1 10  ? 12.232  -0.523  -2.191  1.00 0.00 ? 10  LEU A HB2  2  
ATOM 1983  H HB3  . LEU A 1 10  ? 10.536  -0.981  -2.349  1.00 0.00 ? 10  LEU A HB3  2  
ATOM 1984  H HG   . LEU A 1 10  ? 12.174  -2.440  -0.327  1.00 0.00 ? 10  LEU A HG   2  
ATOM 1985  H HD11 . LEU A 1 10  ? 11.821  0.447   -0.356  1.00 0.00 ? 10  LEU A HD11 2  
ATOM 1986  H HD12 . LEU A 1 10  ? 11.068  -0.283  1.061   1.00 0.00 ? 10  LEU A HD12 2  
ATOM 1987  H HD13 . LEU A 1 10  ? 12.781  -0.549  0.735   1.00 0.00 ? 10  LEU A HD13 2  
ATOM 1988  H HD21 . LEU A 1 10  ? 9.405   -2.032  -1.030  1.00 0.00 ? 10  LEU A HD21 2  
ATOM 1989  H HD22 . LEU A 1 10  ? 10.093  -3.171  0.128   1.00 0.00 ? 10  LEU A HD22 2  
ATOM 1990  H HD23 . LEU A 1 10  ? 9.670   -1.538  0.642   1.00 0.00 ? 10  LEU A HD23 2  
ATOM 1991  N N    . VAL A 1 11  ? 10.715  -2.186  -4.894  1.00 0.00 ? 11  VAL A N    2  
ATOM 1992  C CA   . VAL A 1 11  ? 9.626   -2.493  -5.862  1.00 0.00 ? 11  VAL A CA   2  
ATOM 1993  C C    . VAL A 1 11  ? 10.132  -3.443  -6.947  1.00 0.00 ? 11  VAL A C    2  
ATOM 1994  O O    . VAL A 1 11  ? 9.446   -4.372  -7.323  1.00 0.00 ? 11  VAL A O    2  
ATOM 1995  C CB   . VAL A 1 11  ? 9.117   -1.195  -6.479  1.00 0.00 ? 11  VAL A CB   2  
ATOM 1996  C CG1  . VAL A 1 11  ? 8.247   -1.512  -7.694  1.00 0.00 ? 11  VAL A CG1  2  
ATOM 1997  C CG2  . VAL A 1 11  ? 8.283   -0.451  -5.437  1.00 0.00 ? 11  VAL A CG2  2  
ATOM 1998  H H    . VAL A 1 11  ? 11.344  -1.453  -5.065  1.00 0.00 ? 11  VAL A H    2  
ATOM 1999  H HA   . VAL A 1 11  ? 8.815   -2.972  -5.332  1.00 0.00 ? 11  VAL A HA   2  
ATOM 2000  H HB   . VAL A 1 11  ? 9.954   -0.585  -6.782  1.00 0.00 ? 11  VAL A HB   2  
ATOM 2001  H HG11 . VAL A 1 11  ? 8.118   -2.581  -7.777  1.00 0.00 ? 11  VAL A HG11 2  
ATOM 2002  H HG12 . VAL A 1 11  ? 7.282   -1.043  -7.575  1.00 0.00 ? 11  VAL A HG12 2  
ATOM 2003  H HG13 . VAL A 1 11  ? 8.724   -1.136  -8.587  1.00 0.00 ? 11  VAL A HG13 2  
ATOM 2004  H HG21 . VAL A 1 11  ? 7.631   -1.148  -4.936  1.00 0.00 ? 11  VAL A HG21 2  
ATOM 2005  H HG22 . VAL A 1 11  ? 8.939   0.008   -4.713  1.00 0.00 ? 11  VAL A HG22 2  
ATOM 2006  H HG23 . VAL A 1 11  ? 7.693   0.309   -5.924  1.00 0.00 ? 11  VAL A HG23 2  
ATOM 2007  N N    . GLY A 1 12  ? 11.322  -3.238  -7.448  1.00 0.00 ? 12  GLY A N    2  
ATOM 2008  C CA   . GLY A 1 12  ? 11.842  -4.166  -8.493  1.00 0.00 ? 12  GLY A CA   2  
ATOM 2009  C C    . GLY A 1 12  ? 11.558  -5.595  -8.039  1.00 0.00 ? 12  GLY A C    2  
ATOM 2010  O O    . GLY A 1 12  ? 11.148  -6.441  -8.809  1.00 0.00 ? 12  GLY A O    2  
ATOM 2011  H H    . GLY A 1 12  ? 11.872  -2.492  -7.129  1.00 0.00 ? 12  GLY A H    2  
ATOM 2012  H HA2  . GLY A 1 12  ? 11.345  -3.971  -9.433  1.00 0.00 ? 12  GLY A HA2  2  
ATOM 2013  H HA3  . GLY A 1 12  ? 12.907  -4.030  -8.607  1.00 0.00 ? 12  GLY A HA3  2  
ATOM 2014  N N    . THR A 1 13  ? 11.753  -5.849  -6.774  1.00 0.00 ? 13  THR A N    2  
ATOM 2015  C CA   . THR A 1 13  ? 11.482  -7.199  -6.206  1.00 0.00 ? 13  THR A CA   2  
ATOM 2016  C C    . THR A 1 13  ? 12.279  -7.377  -4.921  1.00 0.00 ? 13  THR A C    2  
ATOM 2017  O O    . THR A 1 13  ? 12.756  -8.449  -4.610  1.00 0.00 ? 13  THR A O    2  
ATOM 2018  C CB   . THR A 1 13  ? 11.868  -8.291  -7.195  1.00 0.00 ? 13  THR A CB   2  
ATOM 2019  O OG1  . THR A 1 13  ? 12.099  -9.510  -6.502  1.00 0.00 ? 13  THR A OG1  2  
ATOM 2020  C CG2  . THR A 1 13  ? 13.132  -7.884  -7.958  1.00 0.00 ? 13  THR A CG2  2  
ATOM 2021  H H    . THR A 1 13  ? 12.064  -5.135  -6.186  1.00 0.00 ? 13  THR A H    2  
ATOM 2022  H HA   . THR A 1 13  ? 10.420  -7.278  -5.985  1.00 0.00 ? 13  THR A HA   2  
ATOM 2023  H HB   . THR A 1 13  ? 11.060  -8.426  -7.877  1.00 0.00 ? 13  THR A HB   2  
ATOM 2024  H HG1  . THR A 1 13  ? 11.521  -10.178 -6.877  1.00 0.00 ? 13  THR A HG1  2  
ATOM 2025  H HG21 . THR A 1 13  ? 13.579  -7.024  -7.478  1.00 0.00 ? 13  THR A HG21 2  
ATOM 2026  H HG22 . THR A 1 13  ? 13.835  -8.703  -7.954  1.00 0.00 ? 13  THR A HG22 2  
ATOM 2027  H HG23 . THR A 1 13  ? 12.875  -7.632  -8.976  1.00 0.00 ? 13  THR A HG23 2  
ATOM 2028  N N    . GLY A 1 14  ? 12.396  -6.345  -4.140  1.00 0.00 ? 14  GLY A N    2  
ATOM 2029  C CA   . GLY A 1 14  ? 13.121  -6.485  -2.854  1.00 0.00 ? 14  GLY A CA   2  
ATOM 2030  C C    . GLY A 1 14  ? 12.126  -7.005  -1.820  1.00 0.00 ? 14  GLY A C    2  
ATOM 2031  O O    . GLY A 1 14  ? 12.320  -6.872  -0.628  1.00 0.00 ? 14  GLY A O    2  
ATOM 2032  H H    . GLY A 1 14  ? 11.979  -5.493  -4.381  1.00 0.00 ? 14  GLY A H    2  
ATOM 2033  H HA2  . GLY A 1 14  ? 13.938  -7.186  -2.969  1.00 0.00 ? 14  GLY A HA2  2  
ATOM 2034  H HA3  . GLY A 1 14  ? 13.500  -5.525  -2.539  1.00 0.00 ? 14  GLY A HA3  2  
ATOM 2035  N N    . ALA A 1 15  ? 11.045  -7.590  -2.284  1.00 0.00 ? 15  ALA A N    2  
ATOM 2036  C CA   . ALA A 1 15  ? 10.007  -8.112  -1.357  1.00 0.00 ? 15  ALA A CA   2  
ATOM 2037  C C    . ALA A 1 15  ? 8.703   -8.233  -2.139  1.00 0.00 ? 15  ALA A C    2  
ATOM 2038  O O    . ALA A 1 15  ? 7.842   -9.027  -1.825  1.00 0.00 ? 15  ALA A O    2  
ATOM 2039  C CB   . ALA A 1 15  ? 9.818   -7.139  -0.193  1.00 0.00 ? 15  ALA A CB   2  
ATOM 2040  H H    . ALA A 1 15  ? 10.908  -7.678  -3.260  1.00 0.00 ? 15  ALA A H    2  
ATOM 2041  H HA   . ALA A 1 15  ? 10.303  -9.083  -0.983  1.00 0.00 ? 15  ALA A HA   2  
ATOM 2042  H HB1  . ALA A 1 15  ? 10.300  -6.202  -0.426  1.00 0.00 ? 15  ALA A HB1  2  
ATOM 2043  H HB2  . ALA A 1 15  ? 8.764   -6.971  -0.031  1.00 0.00 ? 15  ALA A HB2  2  
ATOM 2044  H HB3  . ALA A 1 15  ? 10.258  -7.558  0.701   1.00 0.00 ? 15  ALA A HB3  2  
ATOM 2045  N N    . VAL A 1 16  ? 8.564   -7.446  -3.171  1.00 0.00 ? 16  VAL A N    2  
ATOM 2046  C CA   . VAL A 1 16  ? 7.334   -7.501  -4.001  1.00 0.00 ? 16  VAL A CA   2  
ATOM 2047  C C    . VAL A 1 16  ? 7.728   -7.334  -5.468  1.00 0.00 ? 16  VAL A C    2  
ATOM 2048  O O    . VAL A 1 16  ? 8.500   -6.463  -5.815  1.00 0.00 ? 16  VAL A O    2  
ATOM 2049  C CB   . VAL A 1 16  ? 6.391   -6.366  -3.597  1.00 0.00 ? 16  VAL A CB   2  
ATOM 2050  C CG1  . VAL A 1 16  ? 5.773   -6.674  -2.232  1.00 0.00 ? 16  VAL A CG1  2  
ATOM 2051  C CG2  . VAL A 1 16  ? 7.180   -5.057  -3.519  1.00 0.00 ? 16  VAL A CG2  2  
ATOM 2052  H H    . VAL A 1 16  ? 9.279   -6.818  -3.404  1.00 0.00 ? 16  VAL A H    2  
ATOM 2053  H HA   . VAL A 1 16  ? 6.841   -8.452  -3.862  1.00 0.00 ? 16  VAL A HA   2  
ATOM 2054  H HB   . VAL A 1 16  ? 5.606   -6.272  -4.335  1.00 0.00 ? 16  VAL A HB   2  
ATOM 2055  H HG11 . VAL A 1 16  ? 6.469   -7.253  -1.645  1.00 0.00 ? 16  VAL A HG11 2  
ATOM 2056  H HG12 . VAL A 1 16  ? 5.554   -5.748  -1.722  1.00 0.00 ? 16  VAL A HG12 2  
ATOM 2057  H HG13 . VAL A 1 16  ? 4.860   -7.234  -2.369  1.00 0.00 ? 16  VAL A HG13 2  
ATOM 2058  H HG21 . VAL A 1 16  ? 8.083   -5.144  -4.104  1.00 0.00 ? 16  VAL A HG21 2  
ATOM 2059  H HG22 . VAL A 1 16  ? 6.575   -4.249  -3.905  1.00 0.00 ? 16  VAL A HG22 2  
ATOM 2060  H HG23 . VAL A 1 16  ? 7.436   -4.853  -2.489  1.00 0.00 ? 16  VAL A HG23 2  
ATOM 2061  N N    . THR A 1 17  ? 7.199   -8.151  -6.336  1.00 0.00 ? 17  THR A N    2  
ATOM 2062  C CA   . THR A 1 17  ? 7.546   -8.022  -7.780  1.00 0.00 ? 17  THR A CA   2  
ATOM 2063  C C    . THR A 1 17  ? 6.725   -6.889  -8.400  1.00 0.00 ? 17  THR A C    2  
ATOM 2064  O O    . THR A 1 17  ? 6.703   -6.712  -9.602  1.00 0.00 ? 17  THR A O    2  
ATOM 2065  C CB   . THR A 1 17  ? 7.231   -9.337  -8.497  1.00 0.00 ? 17  THR A CB   2  
ATOM 2066  O OG1  . THR A 1 17  ? 5.935   -9.781  -8.123  1.00 0.00 ? 17  THR A OG1  2  
ATOM 2067  C CG2  . THR A 1 17  ? 8.267   -10.393 -8.106  1.00 0.00 ? 17  THR A CG2  2  
ATOM 2068  H H    . THR A 1 17  ? 6.572   -8.843  -6.041  1.00 0.00 ? 17  THR A H    2  
ATOM 2069  H HA   . THR A 1 17  ? 8.599   -7.800  -7.878  1.00 0.00 ? 17  THR A HA   2  
ATOM 2070  H HB   . THR A 1 17  ? 7.266   -9.184  -9.564  1.00 0.00 ? 17  THR A HB   2  
ATOM 2071  H HG1  . THR A 1 17  ? 5.599   -10.343 -8.825  1.00 0.00 ? 17  THR A HG1  2  
ATOM 2072  H HG21 . THR A 1 17  ? 9.104   -9.914  -7.620  1.00 0.00 ? 17  THR A HG21 2  
ATOM 2073  H HG22 . THR A 1 17  ? 7.819   -11.106 -7.431  1.00 0.00 ? 17  THR A HG22 2  
ATOM 2074  H HG23 . THR A 1 17  ? 8.611   -10.904 -8.993  1.00 0.00 ? 17  THR A HG23 2  
ATOM 2075  N N    . GLN A 1 18  ? 6.054   -6.118  -7.585  1.00 0.00 ? 18  GLN A N    2  
ATOM 2076  C CA   . GLN A 1 18  ? 5.231   -4.991  -8.109  1.00 0.00 ? 18  GLN A CA   2  
ATOM 2077  C C    . GLN A 1 18  ? 4.930   -4.023  -6.965  1.00 0.00 ? 18  GLN A C    2  
ATOM 2078  O O    . GLN A 1 18  ? 5.114   -4.345  -5.808  1.00 0.00 ? 18  GLN A O    2  
ATOM 2079  C CB   . GLN A 1 18  ? 3.907   -5.525  -8.663  1.00 0.00 ? 18  GLN A CB   2  
ATOM 2080  C CG   . GLN A 1 18  ? 4.174   -6.461  -9.841  1.00 0.00 ? 18  GLN A CG   2  
ATOM 2081  C CD   . GLN A 1 18  ? 2.845   -6.865  -10.484 1.00 0.00 ? 18  GLN A CD   2  
ATOM 2082  O OE1  . GLN A 1 18  ? 1.880   -7.137  -9.795  1.00 0.00 ? 18  GLN A OE1  2  
ATOM 2083  N NE2  . GLN A 1 18  ? 2.755   -6.915  -11.784 1.00 0.00 ? 18  GLN A NE2  2  
ATOM 2084  H H    . GLN A 1 18  ? 6.095   -6.278  -6.620  1.00 0.00 ? 18  GLN A H    2  
ATOM 2085  H HA   . GLN A 1 18  ? 5.771   -4.475  -8.890  1.00 0.00 ? 18  GLN A HA   2  
ATOM 2086  H HB2  . GLN A 1 18  ? 3.386   -6.064  -7.885  1.00 0.00 ? 18  GLN A HB2  2  
ATOM 2087  H HB3  . GLN A 1 18  ? 3.298   -4.698  -8.995  1.00 0.00 ? 18  GLN A HB3  2  
ATOM 2088  H HG2  . GLN A 1 18  ? 4.789   -5.955  -10.571 1.00 0.00 ? 18  GLN A HG2  2  
ATOM 2089  H HG3  . GLN A 1 18  ? 4.684   -7.345  -9.490  1.00 0.00 ? 18  GLN A HG3  2  
ATOM 2090  H HE21 . GLN A 1 18  ? 3.533   -6.696  -12.338 1.00 0.00 ? 18  GLN A HE21 2  
ATOM 2091  H HE22 . GLN A 1 18  ? 1.908   -7.170  -12.207 1.00 0.00 ? 18  GLN A HE22 2  
ATOM 2092  N N    . ALA A 1 19  ? 4.459   -2.845  -7.271  1.00 0.00 ? 19  ALA A N    2  
ATOM 2093  C CA   . ALA A 1 19  ? 4.143   -1.879  -6.182  1.00 0.00 ? 19  ALA A CA   2  
ATOM 2094  C C    . ALA A 1 19  ? 3.620   -0.573  -6.775  1.00 0.00 ? 19  ALA A C    2  
ATOM 2095  O O    . ALA A 1 19  ? 3.739   -0.325  -7.958  1.00 0.00 ? 19  ALA A O    2  
ATOM 2096  C CB   . ALA A 1 19  ? 5.406   -1.588  -5.373  1.00 0.00 ? 19  ALA A CB   2  
ATOM 2097  H H    . ALA A 1 19  ? 4.309   -2.600  -8.211  1.00 0.00 ? 19  ALA A H    2  
ATOM 2098  H HA   . ALA A 1 19  ? 3.393   -2.305  -5.532  1.00 0.00 ? 19  ALA A HA   2  
ATOM 2099  H HB1  . ALA A 1 19  ? 5.931   -2.511  -5.179  1.00 0.00 ? 19  ALA A HB1  2  
ATOM 2100  H HB2  . ALA A 1 19  ? 6.045   -0.921  -5.934  1.00 0.00 ? 19  ALA A HB2  2  
ATOM 2101  H HB3  . ALA A 1 19  ? 5.136   -1.124  -4.437  1.00 0.00 ? 19  ALA A HB3  2  
ATOM 2102  N N    . ALA A 1 20  ? 3.049   0.267   -5.957  1.00 0.00 ? 20  ALA A N    2  
ATOM 2103  C CA   . ALA A 1 20  ? 2.525   1.562   -6.467  1.00 0.00 ? 20  ALA A CA   2  
ATOM 2104  C C    . ALA A 1 20  ? 2.256   2.497   -5.290  1.00 0.00 ? 20  ALA A C    2  
ATOM 2105  O O    . ALA A 1 20  ? 1.545   2.157   -4.366  1.00 0.00 ? 20  ALA A O    2  
ATOM 2106  C CB   . ALA A 1 20  ? 1.216   1.326   -7.224  1.00 0.00 ? 20  ALA A CB   2  
ATOM 2107  H H    . ALA A 1 20  ? 2.967   0.047   -5.004  1.00 0.00 ? 20  ALA A H    2  
ATOM 2108  H HA   . ALA A 1 20  ? 3.253   2.012   -7.127  1.00 0.00 ? 20  ALA A HA   2  
ATOM 2109  H HB1  . ALA A 1 20  ? 0.795   0.377   -6.926  1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2110  H HB2  . ALA A 1 20  ? 0.518   2.118   -6.990  1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2111  H HB3  . ALA A 1 20  ? 1.408   1.317   -8.286  1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2112  N N    . ILE A 1 21  ? 2.808   3.677   -5.319  1.00 0.00 ? 21  ILE A N    2  
ATOM 2113  C CA   . ILE A 1 21  ? 2.563   4.629   -4.206  1.00 0.00 ? 21  ILE A CA   2  
ATOM 2114  C C    . ILE A 1 21  ? 1.345   5.480   -4.553  1.00 0.00 ? 21  ILE A C    2  
ATOM 2115  O O    . ILE A 1 21  ? 1.391   6.328   -5.425  1.00 0.00 ? 21  ILE A O    2  
ATOM 2116  C CB   . ILE A 1 21  ? 3.784   5.523   -4.001  1.00 0.00 ? 21  ILE A CB   2  
ATOM 2117  C CG1  . ILE A 1 21  ? 5.050   4.656   -4.025  1.00 0.00 ? 21  ILE A CG1  2  
ATOM 2118  C CG2  . ILE A 1 21  ? 3.663   6.233   -2.648  1.00 0.00 ? 21  ILE A CG2  2  
ATOM 2119  C CD1  . ILE A 1 21  ? 6.208   5.403   -3.359  1.00 0.00 ? 21  ILE A CD1  2  
ATOM 2120  H H    . ILE A 1 21  ? 3.371   3.938   -6.074  1.00 0.00 ? 21  ILE A H    2  
ATOM 2121  H HA   . ILE A 1 21  ? 2.364   4.077   -3.303  1.00 0.00 ? 21  ILE A HA   2  
ATOM 2122  H HB   . ILE A 1 21  ? 3.830   6.259   -4.792  1.00 0.00 ? 21  ILE A HB   2  
ATOM 2123  H HG12 . ILE A 1 21  ? 4.864   3.736   -3.491  1.00 0.00 ? 21  ILE A HG12 2  
ATOM 2124  H HG13 . ILE A 1 21  ? 5.311   4.432   -5.047  1.00 0.00 ? 21  ILE A HG13 2  
ATOM 2125  H HG21 . ILE A 1 21  ? 3.604   5.496   -1.860  1.00 0.00 ? 21  ILE A HG21 2  
ATOM 2126  H HG22 . ILE A 1 21  ? 4.528   6.859   -2.491  1.00 0.00 ? 21  ILE A HG22 2  
ATOM 2127  H HG23 . ILE A 1 21  ? 2.771   6.842   -2.640  1.00 0.00 ? 21  ILE A HG23 2  
ATOM 2128  H HD11 . ILE A 1 21  ? 6.006   6.464   -3.366  1.00 0.00 ? 21  ILE A HD11 2  
ATOM 2129  H HD12 . ILE A 1 21  ? 6.311   5.064   -2.339  1.00 0.00 ? 21  ILE A HD12 2  
ATOM 2130  H HD13 . ILE A 1 21  ? 7.120   5.206   -3.899  1.00 0.00 ? 21  ILE A HD13 2  
ATOM 2131  N N    . LEU A 1 22  ? 0.255   5.245   -3.882  1.00 0.00 ? 22  LEU A N    2  
ATOM 2132  C CA   . LEU A 1 22  ? -0.985  6.016   -4.165  1.00 0.00 ? 22  LEU A CA   2  
ATOM 2133  C C    . LEU A 1 22  ? -1.061  7.201   -3.198  1.00 0.00 ? 22  LEU A C    2  
ATOM 2134  O O    . LEU A 1 22  ? -1.409  7.054   -2.044  1.00 0.00 ? 22  LEU A O    2  
ATOM 2135  C CB   . LEU A 1 22  ? -2.221  5.109   -3.996  1.00 0.00 ? 22  LEU A CB   2  
ATOM 2136  C CG   . LEU A 1 22  ? -1.802  3.626   -3.943  1.00 0.00 ? 22  LEU A CG   2  
ATOM 2137  C CD1  . LEU A 1 22  ? -3.043  2.738   -3.851  1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2138  C CD2  . LEU A 1 22  ? -1.017  3.256   -5.208  1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2139  H H    . LEU A 1 22  ? 0.251   4.552   -3.192  1.00 0.00 ? 22  LEU A H    2  
ATOM 2140  H HA   . LEU A 1 22  ? -0.949  6.388   -5.181  1.00 0.00 ? 22  LEU A HA   2  
ATOM 2141  H HB2  . LEU A 1 22  ? -2.730  5.367   -3.080  1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2142  H HB3  . LEU A 1 22  ? -2.890  5.258   -4.831  1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2143  H HG   . LEU A 1 22  ? -1.185  3.460   -3.073  1.00 0.00 ? 22  LEU A HG   2  
ATOM 2144  H HD11 . LEU A 1 22  ? -3.914  3.300   -4.151  1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2145  H HD12 . LEU A 1 22  ? -2.923  1.884   -4.503  1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2146  H HD13 . LEU A 1 22  ? -3.165  2.397   -2.834  1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2147  H HD21 . LEU A 1 22  ? -1.356  3.861   -6.035  1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2148  H HD22 . LEU A 1 22  ? 0.036   3.427   -5.045  1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2149  H HD23 . LEU A 1 22  ? -1.178  2.212   -5.436  1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2150  N N    . GLY A 1 23  ? -0.714  8.371   -3.663  1.00 0.00 ? 23  GLY A N    2  
ATOM 2151  C CA   . GLY A 1 23  ? -0.739  9.577   -2.784  1.00 0.00 ? 23  GLY A CA   2  
ATOM 2152  C C    . GLY A 1 23  ? -2.007  9.587   -1.928  1.00 0.00 ? 23  GLY A C    2  
ATOM 2153  O O    . GLY A 1 23  ? -2.922  8.816   -2.141  1.00 0.00 ? 23  GLY A O    2  
ATOM 2154  H H    . GLY A 1 23  ? -0.423  8.457   -4.595  1.00 0.00 ? 23  GLY A H    2  
ATOM 2155  H HA2  . GLY A 1 23  ? 0.128   9.565   -2.139  1.00 0.00 ? 23  GLY A HA2  2  
ATOM 2156  H HA3  . GLY A 1 23  ? -0.718  10.466  -3.396  1.00 0.00 ? 23  GLY A HA3  2  
ATOM 2157  N N    . LEU A 1 24  ? -2.066  10.463  -0.961  1.00 0.00 ? 24  LEU A N    2  
ATOM 2158  C CA   . LEU A 1 24  ? -3.267  10.537  -0.087  1.00 0.00 ? 24  LEU A CA   2  
ATOM 2159  C C    . LEU A 1 24  ? -3.894  11.929  -0.200  1.00 0.00 ? 24  LEU A C    2  
ATOM 2160  O O    . LEU A 1 24  ? -5.037  12.137  0.159   1.00 0.00 ? 24  LEU A O    2  
ATOM 2161  C CB   . LEU A 1 24  ? -2.870  10.269  1.370   1.00 0.00 ? 24  LEU A CB   2  
ATOM 2162  C CG   . LEU A 1 24  ? -1.539  10.955  1.708   1.00 0.00 ? 24  LEU A CG   2  
ATOM 2163  C CD1  . LEU A 1 24  ? -1.767  12.451  1.941   1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2164  C CD2  . LEU A 1 24  ? -0.963  10.334  2.983   1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2165  H H    . LEU A 1 24  ? -1.320  11.076  -0.813  1.00 0.00 ? 24  LEU A H    2  
ATOM 2166  H HA   . LEU A 1 24  ? -3.985  9.794   -0.405  1.00 0.00 ? 24  LEU A HA   2  
ATOM 2167  H HB2  . LEU A 1 24  ? -3.639  10.649  2.022   1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2168  H HB3  . LEU A 1 24  ? -2.767  9.207   1.519   1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2169  H HG   . LEU A 1 24  ? -0.842  10.817  0.896   1.00 0.00 ? 24  LEU A HG   2  
ATOM 2170  H HD11 . LEU A 1 24  ? -2.779  12.710  1.672   1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2171  H HD12 . LEU A 1 24  ? -1.605  12.680  2.984   1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2172  H HD13 . LEU A 1 24  ? -1.076  13.020  1.336   1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2173  H HD21 . LEU A 1 24  ? -1.758  9.874   3.550   1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2174  H HD22 . LEU A 1 24  ? -0.229  9.586   2.719   1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2175  H HD23 . LEU A 1 24  ? -0.494  11.103  3.577   1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2176  N N    . ASP A 1 25  ? -3.153  12.882  -0.695  1.00 0.00 ? 25  ASP A N    2  
ATOM 2177  C CA   . ASP A 1 25  ? -3.700  14.263  -0.829  1.00 0.00 ? 25  ASP A CA   2  
ATOM 2178  C C    . ASP A 1 25  ? -3.558  14.729  -2.282  1.00 0.00 ? 25  ASP A C    2  
ATOM 2179  O O    . ASP A 1 25  ? -4.015  15.794  -2.648  1.00 0.00 ? 25  ASP A O    2  
ATOM 2180  C CB   . ASP A 1 25  ? -2.919  15.207  0.088   1.00 0.00 ? 25  ASP A CB   2  
ATOM 2181  C CG   . ASP A 1 25  ? -3.640  15.324  1.432   1.00 0.00 ? 25  ASP A CG   2  
ATOM 2182  O OD1  . ASP A 1 25  ? -4.777  15.766  1.436   1.00 0.00 ? 25  ASP A OD1  2  
ATOM 2183  O OD2  . ASP A 1 25  ? -3.043  14.970  2.436   1.00 0.00 ? 25  ASP A OD2  2  
ATOM 2184  H H    . ASP A 1 25  ? -2.235  12.692  -0.977  1.00 0.00 ? 25  ASP A H    2  
ATOM 2185  H HA   . ASP A 1 25  ? -4.742  14.267  -0.549  1.00 0.00 ? 25  ASP A HA   2  
ATOM 2186  H HB2  . ASP A 1 25  ? -1.925  14.815  0.245   1.00 0.00 ? 25  ASP A HB2  2  
ATOM 2187  H HB3  . ASP A 1 25  ? -2.855  16.183  -0.369  1.00 0.00 ? 25  ASP A HB3  2  
ATOM 2188  N N    . GLY A 1 26  ? -2.930  13.939  -3.111  1.00 0.00 ? 26  GLY A N    2  
ATOM 2189  C CA   . GLY A 1 26  ? -2.760  14.336  -4.538  1.00 0.00 ? 26  GLY A CA   2  
ATOM 2190  C C    . GLY A 1 26  ? -3.465  13.320  -5.439  1.00 0.00 ? 26  GLY A C    2  
ATOM 2191  O O    . GLY A 1 26  ? -4.634  13.453  -5.743  1.00 0.00 ? 26  GLY A O    2  
ATOM 2192  H H    . GLY A 1 26  ? -2.569  13.084  -2.796  1.00 0.00 ? 26  GLY A H    2  
ATOM 2193  H HA2  . GLY A 1 26  ? -3.190  15.316  -4.693  1.00 0.00 ? 26  GLY A HA2  2  
ATOM 2194  H HA3  . GLY A 1 26  ? -1.709  14.361  -4.783  1.00 0.00 ? 26  GLY A HA3  2  
ATOM 2195  N N    . ASN A 1 27  ? -2.764  12.305  -5.865  1.00 0.00 ? 27  ASN A N    2  
ATOM 2196  C CA   . ASN A 1 27  ? -3.397  11.282  -6.745  1.00 0.00 ? 27  ASN A CA   2  
ATOM 2197  C C    . ASN A 1 27  ? -2.441  10.101  -6.935  1.00 0.00 ? 27  ASN A C    2  
ATOM 2198  O O    . ASN A 1 27  ? -2.830  8.954   -6.839  1.00 0.00 ? 27  ASN A O    2  
ATOM 2199  C CB   . ASN A 1 27  ? -3.715  11.906  -8.105  1.00 0.00 ? 27  ASN A CB   2  
ATOM 2200  C CG   . ASN A 1 27  ? -5.043  11.348  -8.620  1.00 0.00 ? 27  ASN A CG   2  
ATOM 2201  O OD1  . ASN A 1 27  ? -5.198  10.152  -8.765  1.00 0.00 ? 27  ASN A OD1  2  
ATOM 2202  N ND2  . ASN A 1 27  ? -6.016  12.170  -8.902  1.00 0.00 ? 27  ASN A ND2  2  
ATOM 2203  H H    . ASN A 1 27  ? -1.824  12.216  -5.608  1.00 0.00 ? 27  ASN A H    2  
ATOM 2204  H HA   . ASN A 1 27  ? -4.312  10.933  -6.288  1.00 0.00 ? 27  ASN A HA   2  
ATOM 2205  H HB2  . ASN A 1 27  ? -3.790  12.978  -8.000  1.00 0.00 ? 27  ASN A HB2  2  
ATOM 2206  H HB3  . ASN A 1 27  ? -2.929  11.666  -8.805  1.00 0.00 ? 27  ASN A HB3  2  
ATOM 2207  H HD21 . ASN A 1 27  ? -5.893  13.134  -8.784  1.00 0.00 ? 27  ASN A HD21 2  
ATOM 2208  H HD22 . ASN A 1 27  ? -6.871  11.823  -9.234  1.00 0.00 ? 27  ASN A HD22 2  
ATOM 2209  N N    . THR A 1 28  ? -1.194  10.374  -7.204  1.00 0.00 ? 28  THR A N    2  
ATOM 2210  C CA   . THR A 1 28  ? -0.215  9.269   -7.399  1.00 0.00 ? 28  THR A CA   2  
ATOM 2211  C C    . THR A 1 28  ? 1.204   9.839   -7.355  1.00 0.00 ? 28  THR A C    2  
ATOM 2212  O O    . THR A 1 28  ? 1.517   10.804  -8.024  1.00 0.00 ? 28  THR A O    2  
ATOM 2213  C CB   . THR A 1 28  ? -0.455  8.602   -8.756  1.00 0.00 ? 28  THR A CB   2  
ATOM 2214  O OG1  . THR A 1 28  ? -1.761  8.036   -8.778  1.00 0.00 ? 28  THR A OG1  2  
ATOM 2215  C CG2  . THR A 1 28  ? 0.593   7.507   -8.977  1.00 0.00 ? 28  THR A CG2  2  
ATOM 2216  H H    . THR A 1 28  ? -0.902  11.307  -7.277  1.00 0.00 ? 28  THR A H    2  
ATOM 2217  H HA   . THR A 1 28  ? -0.334  8.538   -6.612  1.00 0.00 ? 28  THR A HA   2  
ATOM 2218  H HB   . THR A 1 28  ? -0.369  9.339   -9.540  1.00 0.00 ? 28  THR A HB   2  
ATOM 2219  H HG1  . THR A 1 28  ? -1.690  7.125   -9.073  1.00 0.00 ? 28  THR A HG1  2  
ATOM 2220  H HG21 . THR A 1 28  ? 1.132   7.333   -8.057  1.00 0.00 ? 28  THR A HG21 2  
ATOM 2221  H HG22 . THR A 1 28  ? 0.103   6.595   -9.284  1.00 0.00 ? 28  THR A HG22 2  
ATOM 2222  H HG23 . THR A 1 28  ? 1.285   7.819   -9.745  1.00 0.00 ? 28  THR A HG23 2  
ATOM 2223  N N    . TRP A 1 29  ? 2.066   9.252   -6.570  1.00 0.00 ? 29  TRP A N    2  
ATOM 2224  C CA   . TRP A 1 29  ? 3.462   9.764   -6.483  1.00 0.00 ? 29  TRP A CA   2  
ATOM 2225  C C    . TRP A 1 29  ? 4.366   8.951   -7.413  1.00 0.00 ? 29  TRP A C    2  
ATOM 2226  O O    . TRP A 1 29  ? 5.170   9.494   -8.144  1.00 0.00 ? 29  TRP A O    2  
ATOM 2227  C CB   . TRP A 1 29  ? 3.962   9.634   -5.045  1.00 0.00 ? 29  TRP A CB   2  
ATOM 2228  C CG   . TRP A 1 29  ? 3.386   10.739  -4.216  1.00 0.00 ? 29  TRP A CG   2  
ATOM 2229  C CD1  . TRP A 1 29  ? 2.180   11.315  -4.420  1.00 0.00 ? 29  TRP A CD1  2  
ATOM 2230  C CD2  . TRP A 1 29  ? 3.970   11.410  -3.063  1.00 0.00 ? 29  TRP A CD2  2  
ATOM 2231  N NE1  . TRP A 1 29  ? 1.985   12.295  -3.462  1.00 0.00 ? 29  TRP A NE1  2  
ATOM 2232  C CE2  . TRP A 1 29  ? 3.062   12.391  -2.603  1.00 0.00 ? 29  TRP A CE2  2  
ATOM 2233  C CE3  . TRP A 1 29  ? 5.188   11.262  -2.376  1.00 0.00 ? 29  TRP A CE3  2  
ATOM 2234  C CZ2  . TRP A 1 29  ? 3.350   13.199  -1.501  1.00 0.00 ? 29  TRP A CZ2  2  
ATOM 2235  C CZ3  . TRP A 1 29  ? 5.483   12.072  -1.268  1.00 0.00 ? 29  TRP A CZ3  2  
ATOM 2236  C CH2  . TRP A 1 29  ? 4.567   13.039  -0.831  1.00 0.00 ? 29  TRP A CH2  2  
ATOM 2237  H H    . TRP A 1 29  ? 1.795   8.475   -6.038  1.00 0.00 ? 29  TRP A H    2  
ATOM 2238  H HA   . TRP A 1 29  ? 3.484   10.803  -6.779  1.00 0.00 ? 29  TRP A HA   2  
ATOM 2239  H HB2  . TRP A 1 29  ? 3.652   8.682   -4.641  1.00 0.00 ? 29  TRP A HB2  2  
ATOM 2240  H HB3  . TRP A 1 29  ? 5.040   9.698   -5.032  1.00 0.00 ? 29  TRP A HB3  2  
ATOM 2241  H HD1  . TRP A 1 29  ? 1.482   11.053  -5.202  1.00 0.00 ? 29  TRP A HD1  2  
ATOM 2242  H HE1  . TRP A 1 29  ? 1.188   12.861  -3.387  1.00 0.00 ? 29  TRP A HE1  2  
ATOM 2243  H HE3  . TRP A 1 29  ? 5.902   10.520  -2.705  1.00 0.00 ? 29  TRP A HE3  2  
ATOM 2244  H HZ2  . TRP A 1 29  ? 2.640   13.941  -1.169  1.00 0.00 ? 29  TRP A HZ2  2  
ATOM 2245  H HZ3  . TRP A 1 29  ? 6.422   11.950  -0.749  1.00 0.00 ? 29  TRP A HZ3  2  
ATOM 2246  H HH2  . TRP A 1 29  ? 4.800   13.658  0.022   1.00 0.00 ? 29  TRP A HH2  2  
ATOM 2247  N N    . ALA A 1 30  ? 4.240   7.653   -7.391  1.00 0.00 ? 30  ALA A N    2  
ATOM 2248  C CA   . ALA A 1 30  ? 5.095   6.811   -8.276  1.00 0.00 ? 30  ALA A CA   2  
ATOM 2249  C C    . ALA A 1 30  ? 4.456   5.432   -8.439  1.00 0.00 ? 30  ALA A C    2  
ATOM 2250  O O    . ALA A 1 30  ? 3.495   5.103   -7.775  1.00 0.00 ? 30  ALA A O    2  
ATOM 2251  C CB   . ALA A 1 30  ? 6.484   6.659   -7.652  1.00 0.00 ? 30  ALA A CB   2  
ATOM 2252  H H    . ALA A 1 30  ? 3.585   7.232   -6.795  1.00 0.00 ? 30  ALA A H    2  
ATOM 2253  H HA   . ALA A 1 30  ? 5.185   7.282   -9.244  1.00 0.00 ? 30  ALA A HA   2  
ATOM 2254  H HB1  . ALA A 1 30  ? 6.628   7.422   -6.902  1.00 0.00 ? 30  ALA A HB1  2  
ATOM 2255  H HB2  . ALA A 1 30  ? 6.569   5.684   -7.195  1.00 0.00 ? 30  ALA A HB2  2  
ATOM 2256  H HB3  . ALA A 1 30  ? 7.236   6.763   -8.421  1.00 0.00 ? 30  ALA A HB3  2  
ATOM 2257  N N    . THR A 1 31  ? 4.980   4.623   -9.318  1.00 0.00 ? 31  THR A N    2  
ATOM 2258  C CA   . THR A 1 31  ? 4.399   3.266   -9.518  1.00 0.00 ? 31  THR A CA   2  
ATOM 2259  C C    . THR A 1 31  ? 5.424   2.366   -10.209 1.00 0.00 ? 31  THR A C    2  
ATOM 2260  O O    . THR A 1 31  ? 6.488   2.806   -10.599 1.00 0.00 ? 31  THR A O    2  
ATOM 2261  C CB   . THR A 1 31  ? 3.143   3.368   -10.384 1.00 0.00 ? 31  THR A CB   2  
ATOM 2262  O OG1  . THR A 1 31  ? 2.853   2.097   -10.946 1.00 0.00 ? 31  THR A OG1  2  
ATOM 2263  C CG2  . THR A 1 31  ? 3.375   4.385   -11.501 1.00 0.00 ? 31  THR A CG2  2  
ATOM 2264  H H    . THR A 1 31  ? 5.756   4.907   -9.846  1.00 0.00 ? 31  THR A H    2  
ATOM 2265  H HA   . THR A 1 31  ? 4.140   2.842   -8.558  1.00 0.00 ? 31  THR A HA   2  
ATOM 2266  H HB   . THR A 1 31  ? 2.311   3.692   -9.776  1.00 0.00 ? 31  THR A HB   2  
ATOM 2267  H HG1  . THR A 1 31  ? 2.432   1.562   -10.268 1.00 0.00 ? 31  THR A HG1  2  
ATOM 2268  H HG21 . THR A 1 31  ? 3.692   5.324   -11.074 1.00 0.00 ? 31  THR A HG21 2  
ATOM 2269  H HG22 . THR A 1 31  ? 4.140   4.017   -12.169 1.00 0.00 ? 31  THR A HG22 2  
ATOM 2270  H HG23 . THR A 1 31  ? 2.457   4.531   -12.052 1.00 0.00 ? 31  THR A HG23 2  
ATOM 2271  N N    . SER A 1 32  ? 5.113   1.109   -10.366 1.00 0.00 ? 32  SER A N    2  
ATOM 2272  C CA   . SER A 1 32  ? 6.068   0.182   -11.035 1.00 0.00 ? 32  SER A CA   2  
ATOM 2273  C C    . SER A 1 32  ? 5.324   -1.068  -11.506 1.00 0.00 ? 32  SER A C    2  
ATOM 2274  O O    . SER A 1 32  ? 4.520   -1.632  -10.785 1.00 0.00 ? 32  SER A O    2  
ATOM 2275  C CB   . SER A 1 32  ? 7.165   -0.216  -10.049 1.00 0.00 ? 32  SER A CB   2  
ATOM 2276  O OG   . SER A 1 32  ? 8.328   0.562   -10.299 1.00 0.00 ? 32  SER A OG   2  
ATOM 2277  H H    . SER A 1 32  ? 4.249   0.773   -10.045 1.00 0.00 ? 32  SER A H    2  
ATOM 2278  H HA   . SER A 1 32  ? 6.514   0.678   -11.886 1.00 0.00 ? 32  SER A HA   2  
ATOM 2279  H HB2  . SER A 1 32  ? 6.827   -0.034  -9.044  1.00 0.00 ? 32  SER A HB2  2  
ATOM 2280  H HB3  . SER A 1 32  ? 7.390   -1.267  -10.167 1.00 0.00 ? 32  SER A HB3  2  
ATOM 2281  H HG   . SER A 1 32  ? 9.092   0.051   -10.020 1.00 0.00 ? 32  SER A HG   2  
ATOM 2282  N N    . ALA A 1 33  ? 5.590   -1.495  -12.717 1.00 0.00 ? 33  ALA A N    2  
ATOM 2283  C CA   . ALA A 1 33  ? 4.912   -2.703  -13.278 1.00 0.00 ? 33  ALA A CA   2  
ATOM 2284  C C    . ALA A 1 33  ? 3.593   -2.289  -13.932 1.00 0.00 ? 33  ALA A C    2  
ATOM 2285  O O    . ALA A 1 33  ? 3.020   -3.022  -14.713 1.00 0.00 ? 33  ALA A O    2  
ATOM 2286  C CB   . ALA A 1 33  ? 4.643   -3.729  -12.173 1.00 0.00 ? 33  ALA A CB   2  
ATOM 2287  H H    . ALA A 1 33  ? 6.241   -1.010  -13.266 1.00 0.00 ? 33  ALA A H    2  
ATOM 2288  H HA   . ALA A 1 33  ? 5.552   -3.150  -14.028 1.00 0.00 ? 33  ALA A HA   2  
ATOM 2289  H HB1  . ALA A 1 33  ? 5.448   -3.704  -11.455 1.00 0.00 ? 33  ALA A HB1  2  
ATOM 2290  H HB2  . ALA A 1 33  ? 3.713   -3.492  -11.681 1.00 0.00 ? 33  ALA A HB2  2  
ATOM 2291  H HB3  . ALA A 1 33  ? 4.579   -4.717  -12.607 1.00 0.00 ? 33  ALA A HB3  2  
ATOM 2292  N N    . GLY A 1 34  ? 3.108   -1.115  -13.630 1.00 0.00 ? 34  GLY A N    2  
ATOM 2293  C CA   . GLY A 1 34  ? 1.829   -0.661  -14.249 1.00 0.00 ? 34  GLY A CA   2  
ATOM 2294  C C    . GLY A 1 34  ? 0.849   -0.212  -13.162 1.00 0.00 ? 34  GLY A C    2  
ATOM 2295  O O    . GLY A 1 34  ? 0.816   0.942   -12.781 1.00 0.00 ? 34  GLY A O    2  
ATOM 2296  H H    . GLY A 1 34  ? 3.585   -0.531  -13.004 1.00 0.00 ? 34  GLY A H    2  
ATOM 2297  H HA2  . GLY A 1 34  ? 2.029   0.165   -14.918 1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2298  H HA3  . GLY A 1 34  ? 1.393   -1.474  -14.807 1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2299  N N    . PHE A 1 35  ? 0.043   -1.114  -12.668 1.00 0.00 ? 35  PHE A N    2  
ATOM 2300  C CA   . PHE A 1 35  ? -0.944  -0.740  -11.615 1.00 0.00 ? 35  PHE A CA   2  
ATOM 2301  C C    . PHE A 1 35  ? -1.903  0.308   -12.178 1.00 0.00 ? 35  PHE A C    2  
ATOM 2302  O O    . PHE A 1 35  ? -1.489  1.331   -12.686 1.00 0.00 ? 35  PHE A O    2  
ATOM 2303  C CB   . PHE A 1 35  ? -0.217  -0.164  -10.399 1.00 0.00 ? 35  PHE A CB   2  
ATOM 2304  C CG   . PHE A 1 35  ? -0.757  -0.809  -9.145  1.00 0.00 ? 35  PHE A CG   2  
ATOM 2305  C CD1  . PHE A 1 35  ? -1.951  -0.346  -8.578  1.00 0.00 ? 35  PHE A CD1  2  
ATOM 2306  C CD2  . PHE A 1 35  ? -0.067  -1.872  -8.553  1.00 0.00 ? 35  PHE A CD2  2  
ATOM 2307  C CE1  . PHE A 1 35  ? -2.453  -0.946  -7.417  1.00 0.00 ? 35  PHE A CE1  2  
ATOM 2308  C CE2  . PHE A 1 35  ? -0.568  -2.472  -7.393  1.00 0.00 ? 35  PHE A CE2  2  
ATOM 2309  C CZ   . PHE A 1 35  ? -1.761  -2.010  -6.824  1.00 0.00 ? 35  PHE A CZ   2  
ATOM 2310  H H    . PHE A 1 35  ? 0.082   -2.036  -12.996 1.00 0.00 ? 35  PHE A H    2  
ATOM 2311  H HA   . PHE A 1 35  ? -1.503  -1.615  -11.320 1.00 0.00 ? 35  PHE A HA   2  
ATOM 2312  H HB2  . PHE A 1 35  ? 0.841   -0.365  -10.482 1.00 0.00 ? 35  PHE A HB2  2  
ATOM 2313  H HB3  . PHE A 1 35  ? -0.379  0.903   -10.352 1.00 0.00 ? 35  PHE A HB3  2  
ATOM 2314  H HD1  . PHE A 1 35  ? -2.484  0.475   -9.034  1.00 0.00 ? 35  PHE A HD1  2  
ATOM 2315  H HD2  . PHE A 1 35  ? 0.853   -2.229  -8.991  1.00 0.00 ? 35  PHE A HD2  2  
ATOM 2316  H HE1  . PHE A 1 35  ? -3.374  -0.590  -6.980  1.00 0.00 ? 35  PHE A HE1  2  
ATOM 2317  H HE2  . PHE A 1 35  ? -0.035  -3.292  -6.935  1.00 0.00 ? 35  PHE A HE2  2  
ATOM 2318  H HZ   . PHE A 1 35  ? -2.149  -2.473  -5.928  1.00 0.00 ? 35  PHE A HZ   2  
ATOM 2319  N N    . ALA A 1 36  ? -3.181  0.063   -12.097 1.00 0.00 ? 36  ALA A N    2  
ATOM 2320  C CA   . ALA A 1 36  ? -4.159  1.048   -12.636 1.00 0.00 ? 36  ALA A CA   2  
ATOM 2321  C C    . ALA A 1 36  ? -5.320  1.218   -11.654 1.00 0.00 ? 36  ALA A C    2  
ATOM 2322  O O    . ALA A 1 36  ? -6.272  0.464   -11.667 1.00 0.00 ? 36  ALA A O    2  
ATOM 2323  C CB   . ALA A 1 36  ? -4.696  0.549   -13.977 1.00 0.00 ? 36  ALA A CB   2  
ATOM 2324  H H    . ALA A 1 36  ? -3.498  -0.769  -11.687 1.00 0.00 ? 36  ALA A H    2  
ATOM 2325  H HA   . ALA A 1 36  ? -3.667  1.999   -12.778 1.00 0.00 ? 36  ALA A HA   2  
ATOM 2326  H HB1  . ALA A 1 36  ? -4.772  -0.528  -13.956 1.00 0.00 ? 36  ALA A HB1  2  
ATOM 2327  H HB2  . ALA A 1 36  ? -5.672  0.976   -14.156 1.00 0.00 ? 36  ALA A HB2  2  
ATOM 2328  H HB3  . ALA A 1 36  ? -4.022  0.845   -14.768 1.00 0.00 ? 36  ALA A HB3  2  
ATOM 2329  N N    . VAL A 1 37  ? -5.253  2.210   -10.808 1.00 0.00 ? 37  VAL A N    2  
ATOM 2330  C CA   . VAL A 1 37  ? -6.356  2.436   -9.831  1.00 0.00 ? 37  VAL A CA   2  
ATOM 2331  C C    . VAL A 1 37  ? -7.183  3.641   -10.285 1.00 0.00 ? 37  VAL A C    2  
ATOM 2332  O O    . VAL A 1 37  ? -6.872  4.774   -9.976  1.00 0.00 ? 37  VAL A O    2  
ATOM 2333  C CB   . VAL A 1 37  ? -5.765  2.700   -8.447  1.00 0.00 ? 37  VAL A CB   2  
ATOM 2334  C CG1  . VAL A 1 37  ? -6.850  2.510   -7.384  1.00 0.00 ? 37  VAL A CG1  2  
ATOM 2335  C CG2  . VAL A 1 37  ? -4.622  1.714   -8.192  1.00 0.00 ? 37  VAL A CG2  2  
ATOM 2336  H H    . VAL A 1 37  ? -4.479  2.810   -10.818 1.00 0.00 ? 37  VAL A H    2  
ATOM 2337  H HA   . VAL A 1 37  ? -6.989  1.560   -9.792  1.00 0.00 ? 37  VAL A HA   2  
ATOM 2338  H HB   . VAL A 1 37  ? -5.389  3.711   -8.402  1.00 0.00 ? 37  VAL A HB   2  
ATOM 2339  H HG11 . VAL A 1 37  ? -7.780  2.923   -7.743  1.00 0.00 ? 37  VAL A HG11 2  
ATOM 2340  H HG12 . VAL A 1 37  ? -6.976  1.456   -7.184  1.00 0.00 ? 37  VAL A HG12 2  
ATOM 2341  H HG13 . VAL A 1 37  ? -6.557  3.016   -6.476  1.00 0.00 ? 37  VAL A HG13 2  
ATOM 2342  H HG21 . VAL A 1 37  ? -4.782  0.819   -8.776  1.00 0.00 ? 37  VAL A HG21 2  
ATOM 2343  H HG22 . VAL A 1 37  ? -3.684  2.168   -8.479  1.00 0.00 ? 37  VAL A HG22 2  
ATOM 2344  H HG23 . VAL A 1 37  ? -4.592  1.459   -7.143  1.00 0.00 ? 37  VAL A HG23 2  
ATOM 2345  N N    . THR A 1 38  ? -8.221  3.400   -11.038 1.00 0.00 ? 38  THR A N    2  
ATOM 2346  C CA   . THR A 1 38  ? -9.062  4.523   -11.546 1.00 0.00 ? 38  THR A CA   2  
ATOM 2347  C C    . THR A 1 38  ? -10.266 4.828   -10.628 1.00 0.00 ? 38  THR A C    2  
ATOM 2348  O O    . THR A 1 38  ? -10.615 5.981   -10.467 1.00 0.00 ? 38  THR A O    2  
ATOM 2349  C CB   . THR A 1 38  ? -9.579  4.163   -12.940 1.00 0.00 ? 38  THR A CB   2  
ATOM 2350  O OG1  . THR A 1 38  ? -9.098  2.877   -13.305 1.00 0.00 ? 38  THR A OG1  2  
ATOM 2351  C CG2  . THR A 1 38  ? -9.087  5.200   -13.953 1.00 0.00 ? 38  THR A CG2  2  
ATOM 2352  H H    . THR A 1 38  ? -8.435  2.477   -11.289 1.00 0.00 ? 38  THR A H    2  
ATOM 2353  H HA   . THR A 1 38  ? -8.450  5.408   -11.624 1.00 0.00 ? 38  THR A HA   2  
ATOM 2354  H HB   . THR A 1 38  ? -10.658 4.157   -12.935 1.00 0.00 ? 38  THR A HB   2  
ATOM 2355  H HG1  . THR A 1 38  ? -8.911  2.884   -14.247 1.00 0.00 ? 38  THR A HG1  2  
ATOM 2356  H HG21 . THR A 1 38  ? -9.230  6.192   -13.552 1.00 0.00 ? 38  THR A HG21 2  
ATOM 2357  H HG22 . THR A 1 38  ? -8.036  5.040   -14.150 1.00 0.00 ? 38  THR A HG22 2  
ATOM 2358  H HG23 . THR A 1 38  ? -9.643  5.099   -14.872 1.00 0.00 ? 38  THR A HG23 2  
ATOM 2359  N N    . PRO A 1 39  ? -10.898 3.812   -10.076 1.00 0.00 ? 39  PRO A N    2  
ATOM 2360  C CA   . PRO A 1 39  ? -12.082 4.017   -9.217  1.00 0.00 ? 39  PRO A CA   2  
ATOM 2361  C C    . PRO A 1 39  ? -11.788 4.982   -8.063  1.00 0.00 ? 39  PRO A C    2  
ATOM 2362  O O    . PRO A 1 39  ? -12.237 6.111   -8.065  1.00 0.00 ? 39  PRO A O    2  
ATOM 2363  C CB   . PRO A 1 39  ? -12.437 2.621   -8.692  1.00 0.00 ? 39  PRO A CB   2  
ATOM 2364  C CG   . PRO A 1 39  ? -11.542 1.603   -9.440  1.00 0.00 ? 39  PRO A CG   2  
ATOM 2365  C CD   . PRO A 1 39  ? -10.501 2.398   -10.241 1.00 0.00 ? 39  PRO A CD   2  
ATOM 2366  H HA   . PRO A 1 39  ? -12.901 4.393   -9.809  1.00 0.00 ? 39  PRO A HA   2  
ATOM 2367  H HB2  . PRO A 1 39  ? -12.246 2.569   -7.629  1.00 0.00 ? 39  PRO A HB2  2  
ATOM 2368  H HB3  . PRO A 1 39  ? -13.475 2.405   -8.892  1.00 0.00 ? 39  PRO A HB3  2  
ATOM 2369  H HG2  . PRO A 1 39  ? -11.047 0.960   -8.727  1.00 0.00 ? 39  PRO A HG2  2  
ATOM 2370  H HG3  . PRO A 1 39  ? -12.143 1.010   -10.113 1.00 0.00 ? 39  PRO A HG3  2  
ATOM 2371  H HD2  . PRO A 1 39  ? -9.519  2.228   -9.826  1.00 0.00 ? 39  PRO A HD2  2  
ATOM 2372  H HD3  . PRO A 1 39  ? -10.528 2.122   -11.283 1.00 0.00 ? 39  PRO A HD3  2  
ATOM 2373  N N    . ALA A 1 40  ? -11.060 4.554   -7.069  1.00 0.00 ? 40  ALA A N    2  
ATOM 2374  C CA   . ALA A 1 40  ? -10.780 5.465   -5.922  1.00 0.00 ? 40  ALA A CA   2  
ATOM 2375  C C    . ALA A 1 40  ? -9.462  5.060   -5.233  1.00 0.00 ? 40  ALA A C    2  
ATOM 2376  O O    . ALA A 1 40  ? -9.481  4.392   -4.217  1.00 0.00 ? 40  ALA A O    2  
ATOM 2377  C CB   . ALA A 1 40  ? -11.921 5.351   -4.910  1.00 0.00 ? 40  ALA A CB   2  
ATOM 2378  H H    . ALA A 1 40  ? -10.715 3.637   -7.068  1.00 0.00 ? 40  ALA A H    2  
ATOM 2379  H HA   . ALA A 1 40  ? -10.728 6.487   -6.273  1.00 0.00 ? 40  ALA A HA   2  
ATOM 2380  H HB1  . ALA A 1 40  ? -12.378 4.375   -4.993  1.00 0.00 ? 40  ALA A HB1  2  
ATOM 2381  H HB2  . ALA A 1 40  ? -11.532 5.482   -3.912  1.00 0.00 ? 40  ALA A HB2  2  
ATOM 2382  H HB3  . ALA A 1 40  ? -12.659 6.112   -5.114  1.00 0.00 ? 40  ALA A HB3  2  
ATOM 2383  N N    . GLN A 1 41  ? -8.315  5.451   -5.749  1.00 0.00 ? 41  GLN A N    2  
ATOM 2384  C CA   . GLN A 1 41  ? -7.043  5.063   -5.068  1.00 0.00 ? 41  GLN A CA   2  
ATOM 2385  C C    . GLN A 1 41  ? -6.870  5.932   -3.824  1.00 0.00 ? 41  GLN A C    2  
ATOM 2386  O O    . GLN A 1 41  ? -6.865  5.448   -2.708  1.00 0.00 ? 41  GLN A O    2  
ATOM 2387  C CB   . GLN A 1 41  ? -5.816  5.263   -5.984  1.00 0.00 ? 41  GLN A CB   2  
ATOM 2388  C CG   . GLN A 1 41  ? -6.226  5.740   -7.382  1.00 0.00 ? 41  GLN A CG   2  
ATOM 2389  C CD   . GLN A 1 41  ? -6.513  7.243   -7.346  1.00 0.00 ? 41  GLN A CD   2  
ATOM 2390  O OE1  . GLN A 1 41  ? -5.723  8.013   -6.836  1.00 0.00 ? 41  GLN A OE1  2  
ATOM 2391  N NE2  . GLN A 1 41  ? -7.619  7.697   -7.871  1.00 0.00 ? 41  GLN A NE2  2  
ATOM 2392  H H    . GLN A 1 41  ? -8.293  5.995   -6.558  1.00 0.00 ? 41  GLN A H    2  
ATOM 2393  H HA   . GLN A 1 41  ? -7.102  4.026   -4.770  1.00 0.00 ? 41  GLN A HA   2  
ATOM 2394  H HB2  . GLN A 1 41  ? -5.163  5.999   -5.540  1.00 0.00 ? 41  GLN A HB2  2  
ATOM 2395  H HB3  . GLN A 1 41  ? -5.285  4.327   -6.070  1.00 0.00 ? 41  GLN A HB3  2  
ATOM 2396  H HG2  . GLN A 1 41  ? -5.421  5.545   -8.075  1.00 0.00 ? 41  GLN A HG2  2  
ATOM 2397  H HG3  . GLN A 1 41  ? -7.111  5.211   -7.701  1.00 0.00 ? 41  GLN A HG3  2  
ATOM 2398  H HE21 . GLN A 1 41  ? -8.256  7.077   -8.282  1.00 0.00 ? 41  GLN A HE21 2  
ATOM 2399  H HE22 . GLN A 1 41  ? -7.812  8.658   -7.852  1.00 0.00 ? 41  GLN A HE22 2  
ATOM 2400  N N    . GLY A 1 42  ? -6.736  7.214   -4.010  1.00 0.00 ? 42  GLY A N    2  
ATOM 2401  C CA   . GLY A 1 42  ? -6.568  8.126   -2.844  1.00 0.00 ? 42  GLY A CA   2  
ATOM 2402  C C    . GLY A 1 42  ? -7.941  8.633   -2.395  1.00 0.00 ? 42  GLY A C    2  
ATOM 2403  O O    . GLY A 1 42  ? -8.072  9.278   -1.373  1.00 0.00 ? 42  GLY A O    2  
ATOM 2404  H H    . GLY A 1 42  ? -6.750  7.578   -4.921  1.00 0.00 ? 42  GLY A H    2  
ATOM 2405  H HA2  . GLY A 1 42  ? -6.095  7.590   -2.034  1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2406  H HA3  . GLY A 1 42  ? -5.953  8.965   -3.130  1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2407  N N    . GLN A 1 43  ? -8.965  8.344   -3.151  1.00 0.00 ? 43  GLN A N    2  
ATOM 2408  C CA   . GLN A 1 43  ? -10.330 8.807   -2.771  1.00 0.00 ? 43  GLN A CA   2  
ATOM 2409  C C    . GLN A 1 43  ? -10.910 7.868   -1.709  1.00 0.00 ? 43  GLN A C    2  
ATOM 2410  O O    . GLN A 1 43  ? -11.503 8.300   -0.741  1.00 0.00 ? 43  GLN A O    2  
ATOM 2411  C CB   . GLN A 1 43  ? -11.232 8.794   -4.007  1.00 0.00 ? 43  GLN A CB   2  
ATOM 2412  C CG   . GLN A 1 43  ? -12.358 9.815   -3.830  1.00 0.00 ? 43  GLN A CG   2  
ATOM 2413  C CD   . GLN A 1 43  ? -13.447 9.227   -2.932  1.00 0.00 ? 43  GLN A CD   2  
ATOM 2414  O OE1  . GLN A 1 43  ? -13.669 9.701   -1.835  1.00 0.00 ? 43  GLN A OE1  2  
ATOM 2415  N NE2  . GLN A 1 43  ? -14.142 8.204   -3.353  1.00 0.00 ? 43  GLN A NE2  2  
ATOM 2416  H H    . GLN A 1 43  ? -8.838  7.822   -3.969  1.00 0.00 ? 43  GLN A H    2  
ATOM 2417  H HA   . GLN A 1 43  ? -10.274 9.810   -2.375  1.00 0.00 ? 43  GLN A HA   2  
ATOM 2418  H HB2  . GLN A 1 43  ? -10.648 9.048   -4.880  1.00 0.00 ? 43  GLN A HB2  2  
ATOM 2419  H HB3  . GLN A 1 43  ? -11.658 7.810   -4.132  1.00 0.00 ? 43  GLN A HB3  2  
ATOM 2420  H HG2  . GLN A 1 43  ? -11.962 10.713  -3.378  1.00 0.00 ? 43  GLN A HG2  2  
ATOM 2421  H HG3  . GLN A 1 43  ? -12.780 10.054  -4.795  1.00 0.00 ? 43  GLN A HG3  2  
ATOM 2422  H HE21 . GLN A 1 43  ? -13.962 7.820   -4.236  1.00 0.00 ? 43  GLN A HE21 2  
ATOM 2423  H HE22 . GLN A 1 43  ? -14.844 7.821   -2.786  1.00 0.00 ? 43  GLN A HE22 2  
ATOM 2424  N N    . THR A 1 44  ? -10.744 6.586   -1.886  1.00 0.00 ? 44  THR A N    2  
ATOM 2425  C CA   . THR A 1 44  ? -11.285 5.618   -0.891  1.00 0.00 ? 44  THR A CA   2  
ATOM 2426  C C    . THR A 1 44  ? -10.388 5.602   0.348   1.00 0.00 ? 44  THR A C    2  
ATOM 2427  O O    . THR A 1 44  ? -10.848 5.739   1.463   1.00 0.00 ? 44  THR A O    2  
ATOM 2428  C CB   . THR A 1 44  ? -11.325 4.218   -1.509  1.00 0.00 ? 44  THR A CB   2  
ATOM 2429  O OG1  . THR A 1 44  ? -12.353 4.165   -2.487  1.00 0.00 ? 44  THR A OG1  2  
ATOM 2430  C CG2  . THR A 1 44  ? -11.601 3.181   -0.419  1.00 0.00 ? 44  THR A CG2  2  
ATOM 2431  H H    . THR A 1 44  ? -10.264 6.258   -2.675  1.00 0.00 ? 44  THR A H    2  
ATOM 2432  H HA   . THR A 1 44  ? -12.284 5.914   -0.607  1.00 0.00 ? 44  THR A HA   2  
ATOM 2433  H HB   . THR A 1 44  ? -10.375 4.002   -1.972  1.00 0.00 ? 44  THR A HB   2  
ATOM 2434  H HG1  . THR A 1 44  ? -12.616 3.249   -2.591  1.00 0.00 ? 44  THR A HG1  2  
ATOM 2435  H HG21 . THR A 1 44  ? -10.840 3.250   0.344   1.00 0.00 ? 44  THR A HG21 2  
ATOM 2436  H HG22 . THR A 1 44  ? -12.568 3.372   0.021   1.00 0.00 ? 44  THR A HG22 2  
ATOM 2437  H HG23 . THR A 1 44  ? -11.590 2.192   -0.851  1.00 0.00 ? 44  THR A HG23 2  
ATOM 2438  N N    . LEU A 1 45  ? -9.107  5.436   0.161   1.00 0.00 ? 45  LEU A N    2  
ATOM 2439  C CA   . LEU A 1 45  ? -8.182  5.412   1.329   1.00 0.00 ? 45  LEU A CA   2  
ATOM 2440  C C    . LEU A 1 45  ? -8.307  6.724   2.107   1.00 0.00 ? 45  LEU A C    2  
ATOM 2441  O O    . LEU A 1 45  ? -8.076  6.776   3.298   1.00 0.00 ? 45  LEU A O    2  
ATOM 2442  C CB   . LEU A 1 45  ? -6.743  5.247   0.832   1.00 0.00 ? 45  LEU A CB   2  
ATOM 2443  C CG   . LEU A 1 45  ? -6.481  3.776   0.504   1.00 0.00 ? 45  LEU A CG   2  
ATOM 2444  C CD1  . LEU A 1 45  ? -5.213  3.657   -0.343  1.00 0.00 ? 45  LEU A CD1  2  
ATOM 2445  C CD2  . LEU A 1 45  ? -6.302  2.987   1.803   1.00 0.00 ? 45  LEU A CD2  2  
ATOM 2446  H H    . LEU A 1 45  ? -8.754  5.327   -0.748  1.00 0.00 ? 45  LEU A H    2  
ATOM 2447  H HA   . LEU A 1 45  ? -8.437  4.584   1.974   1.00 0.00 ? 45  LEU A HA   2  
ATOM 2448  H HB2  . LEU A 1 45  ? -6.599  5.846   -0.056  1.00 0.00 ? 45  LEU A HB2  2  
ATOM 2449  H HB3  . LEU A 1 45  ? -6.057  5.570   1.600   1.00 0.00 ? 45  LEU A HB3  2  
ATOM 2450  H HG   . LEU A 1 45  ? -7.320  3.377   -0.048  1.00 0.00 ? 45  LEU A HG   2  
ATOM 2451  H HD11 . LEU A 1 45  ? -4.520  4.437   -0.066  1.00 0.00 ? 45  LEU A HD11 2  
ATOM 2452  H HD12 . LEU A 1 45  ? -4.757  2.693   -0.173  1.00 0.00 ? 45  LEU A HD12 2  
ATOM 2453  H HD13 . LEU A 1 45  ? -5.467  3.756   -1.388  1.00 0.00 ? 45  LEU A HD13 2  
ATOM 2454  H HD21 . LEU A 1 45  ? -6.145  3.673   2.622   1.00 0.00 ? 45  LEU A HD21 2  
ATOM 2455  H HD22 . LEU A 1 45  ? -7.187  2.398   1.991   1.00 0.00 ? 45  LEU A HD22 2  
ATOM 2456  H HD23 . LEU A 1 45  ? -5.447  2.333   1.712   1.00 0.00 ? 45  LEU A HD23 2  
ATOM 2457  N N    . ALA A 1 46  ? -8.672  7.785   1.440   1.00 0.00 ? 46  ALA A N    2  
ATOM 2458  C CA   . ALA A 1 46  ? -8.812  9.095   2.136   1.00 0.00 ? 46  ALA A CA   2  
ATOM 2459  C C    . ALA A 1 46  ? -9.987  9.039   3.115   1.00 0.00 ? 46  ALA A C    2  
ATOM 2460  O O    . ALA A 1 46  ? -9.899  9.516   4.230   1.00 0.00 ? 46  ALA A O    2  
ATOM 2461  C CB   . ALA A 1 46  ? -9.065  10.193  1.101   1.00 0.00 ? 46  ALA A CB   2  
ATOM 2462  H H    . ALA A 1 46  ? -8.853  7.720   0.479   1.00 0.00 ? 46  ALA A H    2  
ATOM 2463  H HA   . ALA A 1 46  ? -7.903  9.315   2.676   1.00 0.00 ? 46  ALA A HA   2  
ATOM 2464  H HB1  . ALA A 1 46  ? -9.885  9.902   0.461   1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2465  H HB2  . ALA A 1 46  ? -9.314  11.114  1.607   1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2466  H HB3  . ALA A 1 46  ? -8.177  10.339  0.506   1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2467  N N    . SER A 1 47  ? -11.086 8.463   2.711   1.00 0.00 ? 47  SER A N    2  
ATOM 2468  C CA   . SER A 1 47  ? -12.263 8.382   3.623   1.00 0.00 ? 47  SER A CA   2  
ATOM 2469  C C    . SER A 1 47  ? -12.210 7.074   4.415   1.00 0.00 ? 47  SER A C    2  
ATOM 2470  O O    . SER A 1 47  ? -13.043 6.818   5.263   1.00 0.00 ? 47  SER A O    2  
ATOM 2471  C CB   . SER A 1 47  ? -13.551 8.422   2.799   1.00 0.00 ? 47  SER A CB   2  
ATOM 2472  O OG   . SER A 1 47  ? -14.643 8.740   3.651   1.00 0.00 ? 47  SER A OG   2  
ATOM 2473  H H    . SER A 1 47  ? -11.138 8.085   1.809   1.00 0.00 ? 47  SER A H    2  
ATOM 2474  H HA   . SER A 1 47  ? -12.247 9.217   4.308   1.00 0.00 ? 47  SER A HA   2  
ATOM 2475  H HB2  . SER A 1 47  ? -13.468 9.176   2.034   1.00 0.00 ? 47  SER A HB2  2  
ATOM 2476  H HB3  . SER A 1 47  ? -13.712 7.457   2.335   1.00 0.00 ? 47  SER A HB3  2  
ATOM 2477  H HG   . SER A 1 47  ? -14.860 9.667   3.521   1.00 0.00 ? 47  SER A HG   2  
ATOM 2478  N N    . ALA A 1 48  ? -11.240 6.243   4.146   1.00 0.00 ? 48  ALA A N    2  
ATOM 2479  C CA   . ALA A 1 48  ? -11.140 4.953   4.885   1.00 0.00 ? 48  ALA A CA   2  
ATOM 2480  C C    . ALA A 1 48  ? -10.307 5.150   6.152   1.00 0.00 ? 48  ALA A C    2  
ATOM 2481  O O    . ALA A 1 48  ? -10.297 4.315   7.035   1.00 0.00 ? 48  ALA A O    2  
ATOM 2482  C CB   . ALA A 1 48  ? -10.470 3.907   3.992   1.00 0.00 ? 48  ALA A CB   2  
ATOM 2483  H H    . ALA A 1 48  ? -10.579 6.467   3.459   1.00 0.00 ? 48  ALA A H    2  
ATOM 2484  H HA   . ALA A 1 48  ? -12.129 4.615   5.154   1.00 0.00 ? 48  ALA A HA   2  
ATOM 2485  H HB1  . ALA A 1 48  ? -11.054 3.775   3.093   1.00 0.00 ? 48  ALA A HB1  2  
ATOM 2486  H HB2  . ALA A 1 48  ? -9.476  4.240   3.731   1.00 0.00 ? 48  ALA A HB2  2  
ATOM 2487  H HB3  . ALA A 1 48  ? -10.409 2.968   4.522   1.00 0.00 ? 48  ALA A HB3  2  
ATOM 2488  N N    . PHE A 1 49  ? -9.603  6.245   6.249   1.00 0.00 ? 49  PHE A N    2  
ATOM 2489  C CA   . PHE A 1 49  ? -8.770  6.485   7.460   1.00 0.00 ? 49  PHE A CA   2  
ATOM 2490  C C    . PHE A 1 49  ? -9.611  7.165   8.544   1.00 0.00 ? 49  PHE A C    2  
ATOM 2491  O O    . PHE A 1 49  ? -9.120  7.502   9.602   1.00 0.00 ? 49  PHE A O    2  
ATOM 2492  C CB   . PHE A 1 49  ? -7.584  7.383   7.093   1.00 0.00 ? 49  PHE A CB   2  
ATOM 2493  C CG   . PHE A 1 49  ? -6.713  6.695   6.063   1.00 0.00 ? 49  PHE A CG   2  
ATOM 2494  C CD1  . PHE A 1 49  ? -6.871  5.326   5.800   1.00 0.00 ? 49  PHE A CD1  2  
ATOM 2495  C CD2  . PHE A 1 49  ? -5.746  7.431   5.369   1.00 0.00 ? 49  PHE A CD2  2  
ATOM 2496  C CE1  . PHE A 1 49  ? -6.061  4.697   4.846   1.00 0.00 ? 49  PHE A CE1  2  
ATOM 2497  C CE2  . PHE A 1 49  ? -4.936  6.801   4.415   1.00 0.00 ? 49  PHE A CE2  2  
ATOM 2498  C CZ   . PHE A 1 49  ? -5.093  5.435   4.154   1.00 0.00 ? 49  PHE A CZ   2  
ATOM 2499  H H    . PHE A 1 49  ? -9.620  6.905   5.525   1.00 0.00 ? 49  PHE A H    2  
ATOM 2500  H HA   . PHE A 1 49  ? -8.400  5.542   7.834   1.00 0.00 ? 49  PHE A HA   2  
ATOM 2501  H HB2  . PHE A 1 49  ? -7.952  8.314   6.688   1.00 0.00 ? 49  PHE A HB2  2  
ATOM 2502  H HB3  . PHE A 1 49  ? -7.000  7.585   7.980   1.00 0.00 ? 49  PHE A HB3  2  
ATOM 2503  H HD1  . PHE A 1 49  ? -7.618  4.756   6.334   1.00 0.00 ? 49  PHE A HD1  2  
ATOM 2504  H HD2  . PHE A 1 49  ? -5.624  8.484   5.568   1.00 0.00 ? 49  PHE A HD2  2  
ATOM 2505  H HE1  . PHE A 1 49  ? -6.182  3.643   4.645   1.00 0.00 ? 49  PHE A HE1  2  
ATOM 2506  H HE2  . PHE A 1 49  ? -4.190  7.370   3.881   1.00 0.00 ? 49  PHE A HE2  2  
ATOM 2507  H HZ   . PHE A 1 49  ? -4.469  4.950   3.417   1.00 0.00 ? 49  PHE A HZ   2  
ATOM 2508  N N    . ASN A 1 50  ? -10.877 7.365   8.295   1.00 0.00 ? 50  ASN A N    2  
ATOM 2509  C CA   . ASN A 1 50  ? -11.740 8.018   9.319   1.00 0.00 ? 50  ASN A CA   2  
ATOM 2510  C C    . ASN A 1 50  ? -12.258 6.958   10.292  1.00 0.00 ? 50  ASN A C    2  
ATOM 2511  O O    . ASN A 1 50  ? -12.308 7.170   11.488  1.00 0.00 ? 50  ASN A O    2  
ATOM 2512  C CB   . ASN A 1 50  ? -12.922 8.705   8.632   1.00 0.00 ? 50  ASN A CB   2  
ATOM 2513  C CG   . ASN A 1 50  ? -13.035 10.147  9.131   1.00 0.00 ? 50  ASN A CG   2  
ATOM 2514  O OD1  . ASN A 1 50  ? -13.144 11.067  8.346   1.00 0.00 ? 50  ASN A OD1  2  
ATOM 2515  N ND2  . ASN A 1 50  ? -13.014 10.385  10.414  1.00 0.00 ? 50  ASN A ND2  2  
ATOM 2516  H H    . ASN A 1 50  ? -11.259 7.085   7.437   1.00 0.00 ? 50  ASN A H    2  
ATOM 2517  H HA   . ASN A 1 50  ? -11.162 8.752   9.861   1.00 0.00 ? 50  ASN A HA   2  
ATOM 2518  H HB2  . ASN A 1 50  ? -12.768 8.704   7.562   1.00 0.00 ? 50  ASN A HB2  2  
ATOM 2519  H HB3  . ASN A 1 50  ? -13.833 8.173   8.865   1.00 0.00 ? 50  ASN A HB3  2  
ATOM 2520  H HD21 . ASN A 1 50  ? -12.927 9.643   11.049  1.00 0.00 ? 50  ASN A HD21 2  
ATOM 2521  H HD22 . ASN A 1 50  ? -13.081 11.306  10.743  1.00 0.00 ? 50  ASN A HD22 2  
ATOM 2522  N N    . ASN A 1 51  ? -12.644 5.818   9.789   1.00 0.00 ? 51  ASN A N    2  
ATOM 2523  C CA   . ASN A 1 51  ? -13.158 4.741   10.682  1.00 0.00 ? 51  ASN A CA   2  
ATOM 2524  C C    . ASN A 1 51  ? -12.872 3.377   10.047  1.00 0.00 ? 51  ASN A C    2  
ATOM 2525  O O    . ASN A 1 51  ? -12.889 3.228   8.842   1.00 0.00 ? 51  ASN A O    2  
ATOM 2526  C CB   . ASN A 1 51  ? -14.671 4.906   10.884  1.00 0.00 ? 51  ASN A CB   2  
ATOM 2527  C CG   . ASN A 1 51  ? -15.274 5.694   9.718   1.00 0.00 ? 51  ASN A CG   2  
ATOM 2528  O OD1  . ASN A 1 51  ? -15.988 6.656   9.924   1.00 0.00 ? 51  ASN A OD1  2  
ATOM 2529  N ND2  . ASN A 1 51  ? -15.016 5.326   8.493   1.00 0.00 ? 51  ASN A ND2  2  
ATOM 2530  H H    . ASN A 1 51  ? -12.593 5.669   8.822   1.00 0.00 ? 51  ASN A H    2  
ATOM 2531  H HA   . ASN A 1 51  ? -12.660 4.801   11.639  1.00 0.00 ? 51  ASN A HA   2  
ATOM 2532  H HB2  . ASN A 1 51  ? -15.133 3.932   10.936  1.00 0.00 ? 51  ASN A HB2  2  
ATOM 2533  H HB3  . ASN A 1 51  ? -14.853 5.437   11.807  1.00 0.00 ? 51  ASN A HB3  2  
ATOM 2534  H HD21 . ASN A 1 51  ? -14.439 4.551   8.326   1.00 0.00 ? 51  ASN A HD21 2  
ATOM 2535  H HD22 . ASN A 1 51  ? -15.400 5.822   7.740   1.00 0.00 ? 51  ASN A HD22 2  
ATOM 2536  N N    . ALA A 1 52  ? -12.604 2.383   10.849  1.00 0.00 ? 52  ALA A N    2  
ATOM 2537  C CA   . ALA A 1 52  ? -12.311 1.032   10.290  1.00 0.00 ? 52  ALA A CA   2  
ATOM 2538  C C    . ALA A 1 52  ? -13.608 0.236   10.146  1.00 0.00 ? 52  ALA A C    2  
ATOM 2539  O O    . ALA A 1 52  ? -13.612 -0.974  10.223  1.00 0.00 ? 52  ALA A O    2  
ATOM 2540  C CB   . ALA A 1 52  ? -11.363 0.285   11.231  1.00 0.00 ? 52  ALA A CB   2  
ATOM 2541  H H    . ALA A 1 52  ? -12.589 2.524   11.819  1.00 0.00 ? 52  ALA A H    2  
ATOM 2542  H HA   . ALA A 1 52  ? -11.844 1.138   9.321   1.00 0.00 ? 52  ALA A HA   2  
ATOM 2543  H HB1  . ALA A 1 52  ? -10.490 0.892   11.420  1.00 0.00 ? 52  ALA A HB1  2  
ATOM 2544  H HB2  . ALA A 1 52  ? -11.868 0.079   12.162  1.00 0.00 ? 52  ALA A HB2  2  
ATOM 2545  H HB3  . ALA A 1 52  ? -11.061 -0.646  10.773  1.00 0.00 ? 52  ALA A HB3  2  
ATOM 2546  N N    . ASP A 1 53  ? -14.711 0.900   9.939   1.00 0.00 ? 53  ASP A N    2  
ATOM 2547  C CA   . ASP A 1 53  ? -15.999 0.164   9.794   1.00 0.00 ? 53  ASP A CA   2  
ATOM 2548  C C    . ASP A 1 53  ? -16.200 -0.293  8.339   1.00 0.00 ? 53  ASP A C    2  
ATOM 2549  O O    . ASP A 1 53  ? -16.597 -1.418  8.108   1.00 0.00 ? 53  ASP A O    2  
ATOM 2550  C CB   . ASP A 1 53  ? -17.168 1.057   10.223  1.00 0.00 ? 53  ASP A CB   2  
ATOM 2551  C CG   . ASP A 1 53  ? -16.859 1.691   11.581  1.00 0.00 ? 53  ASP A CG   2  
ATOM 2552  O OD1  . ASP A 1 53  ? -15.727 2.100   11.780  1.00 0.00 ? 53  ASP A OD1  2  
ATOM 2553  O OD2  . ASP A 1 53  ? -17.761 1.757   12.401  1.00 0.00 ? 53  ASP A OD2  2  
ATOM 2554  H H    . ASP A 1 53  ? -14.694 1.878   9.883   1.00 0.00 ? 53  ASP A H    2  
ATOM 2555  H HA   . ASP A 1 53  ? -15.974 -0.709  10.431  1.00 0.00 ? 53  ASP A HA   2  
ATOM 2556  H HB2  . ASP A 1 53  ? -17.322 1.832   9.489   1.00 0.00 ? 53  ASP A HB2  2  
ATOM 2557  H HB3  . ASP A 1 53  ? -18.063 0.459   10.306  1.00 0.00 ? 53  ASP A HB3  2  
ATOM 2558  N N    . PRO A 1 54  ? -15.936 0.582   7.392   1.00 0.00 ? 54  PRO A N    2  
ATOM 2559  C CA   . PRO A 1 54  ? -16.108 0.252   5.964   1.00 0.00 ? 54  PRO A CA   2  
ATOM 2560  C C    . PRO A 1 54  ? -15.071 -0.789  5.524   1.00 0.00 ? 54  PRO A C    2  
ATOM 2561  O O    . PRO A 1 54  ? -15.386 -1.943  5.314   1.00 0.00 ? 54  PRO A O    2  
ATOM 2562  C CB   . PRO A 1 54  ? -15.879 1.577   5.223   1.00 0.00 ? 54  PRO A CB   2  
ATOM 2563  C CG   . PRO A 1 54  ? -15.464 2.638   6.274   1.00 0.00 ? 54  PRO A CG   2  
ATOM 2564  C CD   . PRO A 1 54  ? -15.458 1.955   7.650   1.00 0.00 ? 54  PRO A CD   2  
ATOM 2565  H HA   . PRO A 1 54  ? -17.106 -0.105  5.775   1.00 0.00 ? 54  PRO A HA   2  
ATOM 2566  H HB2  . PRO A 1 54  ? -15.093 1.456   4.491   1.00 0.00 ? 54  PRO A HB2  2  
ATOM 2567  H HB3  . PRO A 1 54  ? -16.790 1.888   4.737   1.00 0.00 ? 54  PRO A HB3  2  
ATOM 2568  H HG2  . PRO A 1 54  ? -14.476 3.014   6.044   1.00 0.00 ? 54  PRO A HG2  2  
ATOM 2569  H HG3  . PRO A 1 54  ? -16.174 3.449   6.277   1.00 0.00 ? 54  PRO A HG3  2  
ATOM 2570  H HD2  . PRO A 1 54  ? -14.452 1.937   8.049   1.00 0.00 ? 54  PRO A HD2  2  
ATOM 2571  H HD3  . PRO A 1 54  ? -16.124 2.464   8.324   1.00 0.00 ? 54  PRO A HD3  2  
ATOM 2572  N N    . ILE A 1 55  ? -13.840 -0.382  5.373   1.00 0.00 ? 55  ILE A N    2  
ATOM 2573  C CA   . ILE A 1 55  ? -12.779 -1.336  4.935   1.00 0.00 ? 55  ILE A CA   2  
ATOM 2574  C C    . ILE A 1 55  ? -12.948 -2.674  5.658   1.00 0.00 ? 55  ILE A C    2  
ATOM 2575  O O    . ILE A 1 55  ? -12.884 -3.727  5.055   1.00 0.00 ? 55  ILE A O    2  
ATOM 2576  C CB   . ILE A 1 55  ? -11.392 -0.762  5.253   1.00 0.00 ? 55  ILE A CB   2  
ATOM 2577  C CG1  . ILE A 1 55  ? -11.485 0.221   6.425   1.00 0.00 ? 55  ILE A CG1  2  
ATOM 2578  C CG2  . ILE A 1 55  ? -10.850 -0.037  4.022   1.00 0.00 ? 55  ILE A CG2  2  
ATOM 2579  C CD1  . ILE A 1 55  ? -10.084 0.499   6.974   1.00 0.00 ? 55  ILE A CD1  2  
ATOM 2580  H H    . ILE A 1 55  ? -13.614 0.555   5.542   1.00 0.00 ? 55  ILE A H    2  
ATOM 2581  H HA   . ILE A 1 55  ? -12.862 -1.494  3.870   1.00 0.00 ? 55  ILE A HA   2  
ATOM 2582  H HB   . ILE A 1 55  ? -10.723 -1.571  5.514   1.00 0.00 ? 55  ILE A HB   2  
ATOM 2583  H HG12 . ILE A 1 55  ? -11.928 1.146   6.084   1.00 0.00 ? 55  ILE A HG12 2  
ATOM 2584  H HG13 . ILE A 1 55  ? -12.097 -0.205  7.205   1.00 0.00 ? 55  ILE A HG13 2  
ATOM 2585  H HG21 . ILE A 1 55  ? -11.533 0.750   3.738   1.00 0.00 ? 55  ILE A HG21 2  
ATOM 2586  H HG22 . ILE A 1 55  ? -9.884  0.388   4.251   1.00 0.00 ? 55  ILE A HG22 2  
ATOM 2587  H HG23 . ILE A 1 55  ? -10.751 -0.738  3.207   1.00 0.00 ? 55  ILE A HG23 2  
ATOM 2588  H HD11 . ILE A 1 55  ? -9.396  0.636   6.151   1.00 0.00 ? 55  ILE A HD11 2  
ATOM 2589  H HD12 . ILE A 1 55  ? -10.104 1.394   7.578   1.00 0.00 ? 55  ILE A HD12 2  
ATOM 2590  H HD13 . ILE A 1 55  ? -9.762  -0.336  7.577   1.00 0.00 ? 55  ILE A HD13 2  
ATOM 2591  N N    . ARG A 1 56  ? -13.159 -2.644  6.943   1.00 0.00 ? 56  ARG A N    2  
ATOM 2592  C CA   . ARG A 1 56  ? -13.327 -3.919  7.698   1.00 0.00 ? 56  ARG A CA   2  
ATOM 2593  C C    . ARG A 1 56  ? -14.274 -4.847  6.936   1.00 0.00 ? 56  ARG A C    2  
ATOM 2594  O O    . ARG A 1 56  ? -13.942 -5.977  6.637   1.00 0.00 ? 56  ARG A O    2  
ATOM 2595  C CB   . ARG A 1 56  ? -13.908 -3.625  9.081   1.00 0.00 ? 56  ARG A CB   2  
ATOM 2596  C CG   . ARG A 1 56  ? -13.998 -4.926  9.880   1.00 0.00 ? 56  ARG A CG   2  
ATOM 2597  C CD   . ARG A 1 56  ? -15.029 -4.773  11.000  1.00 0.00 ? 56  ARG A CD   2  
ATOM 2598  N NE   . ARG A 1 56  ? -14.471 -5.324  12.267  1.00 0.00 ? 56  ARG A NE   2  
ATOM 2599  C CZ   . ARG A 1 56  ? -15.030 -5.036  13.410  1.00 0.00 ? 56  ARG A CZ   2  
ATOM 2600  N NH1  . ARG A 1 56  ? -16.081 -4.262  13.452  1.00 0.00 ? 56  ARG A NH1  2  
ATOM 2601  N NH2  . ARG A 1 56  ? -14.536 -5.524  14.515  1.00 0.00 ? 56  ARG A NH2  2  
ATOM 2602  H H    . ARG A 1 56  ? -13.206 -1.784  7.412   1.00 0.00 ? 56  ARG A H    2  
ATOM 2603  H HA   . ARG A 1 56  ? -12.365 -4.399  7.807   1.00 0.00 ? 56  ARG A HA   2  
ATOM 2604  H HB2  . ARG A 1 56  ? -13.267 -2.928  9.600   1.00 0.00 ? 56  ARG A HB2  2  
ATOM 2605  H HB3  . ARG A 1 56  ? -14.895 -3.200  8.977   1.00 0.00 ? 56  ARG A HB3  2  
ATOM 2606  H HG2  . ARG A 1 56  ? -14.294 -5.730  9.224   1.00 0.00 ? 56  ARG A HG2  2  
ATOM 2607  H HG3  . ARG A 1 56  ? -13.034 -5.151  10.312  1.00 0.00 ? 56  ARG A HG3  2  
ATOM 2608  H HD2  . ARG A 1 56  ? -15.265 -3.728  11.132  1.00 0.00 ? 56  ARG A HD2  2  
ATOM 2609  H HD3  . ARG A 1 56  ? -15.927 -5.315  10.739  1.00 0.00 ? 56  ARG A HD3  2  
ATOM 2610  H HE   . ARG A 1 56  ? -13.681 -5.904  12.242  1.00 0.00 ? 56  ARG A HE   2  
ATOM 2611  H HH11 . ARG A 1 56  ? -16.459 -3.886  12.608  1.00 0.00 ? 56  ARG A HH11 2  
ATOM 2612  H HH12 . ARG A 1 56  ? -16.507 -4.043  14.331  1.00 0.00 ? 56  ARG A HH12 2  
ATOM 2613  H HH21 . ARG A 1 56  ? -13.730 -6.115  14.484  1.00 0.00 ? 56  ARG A HH21 2  
ATOM 2614  H HH22 . ARG A 1 56  ? -14.961 -5.305  15.393  1.00 0.00 ? 56  ARG A HH22 2  
ATOM 2615  N N    . ALA A 1 57  ? -15.454 -4.385  6.624   1.00 0.00 ? 57  ALA A N    2  
ATOM 2616  C CA   . ALA A 1 57  ? -16.418 -5.250  5.888   1.00 0.00 ? 57  ALA A CA   2  
ATOM 2617  C C    . ALA A 1 57  ? -16.170 -5.139  4.381   1.00 0.00 ? 57  ALA A C    2  
ATOM 2618  O O    . ALA A 1 57  ? -15.377 -5.866  3.817   1.00 0.00 ? 57  ALA A O    2  
ATOM 2619  C CB   . ALA A 1 57  ? -17.847 -4.804  6.202   1.00 0.00 ? 57  ALA A CB   2  
ATOM 2620  H H    . ALA A 1 57  ? -15.705 -3.473  6.877   1.00 0.00 ? 57  ALA A H    2  
ATOM 2621  H HA   . ALA A 1 57  ? -16.287 -6.276  6.197   1.00 0.00 ? 57  ALA A HA   2  
ATOM 2622  H HB1  . ALA A 1 57  ? -17.835 -3.791  6.576   1.00 0.00 ? 57  ALA A HB1  2  
ATOM 2623  H HB2  . ALA A 1 57  ? -18.443 -4.849  5.303   1.00 0.00 ? 57  ALA A HB2  2  
ATOM 2624  H HB3  . ALA A 1 57  ? -18.272 -5.458  6.949   1.00 0.00 ? 57  ALA A HB3  2  
ATOM 2625  N N    . SER A 1 58  ? -16.847 -4.237  3.723   1.00 0.00 ? 58  SER A N    2  
ATOM 2626  C CA   . SER A 1 58  ? -16.653 -4.085  2.252   1.00 0.00 ? 58  SER A CA   2  
ATOM 2627  C C    . SER A 1 58  ? -15.161 -4.146  1.918   1.00 0.00 ? 58  SER A C    2  
ATOM 2628  O O    . SER A 1 58  ? -14.665 -5.142  1.429   1.00 0.00 ? 58  SER A O    2  
ATOM 2629  C CB   . SER A 1 58  ? -17.219 -2.738  1.803   1.00 0.00 ? 58  SER A CB   2  
ATOM 2630  O OG   . SER A 1 58  ? -16.596 -2.351  0.585   1.00 0.00 ? 58  SER A OG   2  
ATOM 2631  H H    . SER A 1 58  ? -17.485 -3.661  4.194   1.00 0.00 ? 58  SER A H    2  
ATOM 2632  H HA   . SER A 1 58  ? -17.170 -4.881  1.736   1.00 0.00 ? 58  SER A HA   2  
ATOM 2633  H HB2  . SER A 1 58  ? -18.281 -2.826  1.644   1.00 0.00 ? 58  SER A HB2  2  
ATOM 2634  H HB3  . SER A 1 58  ? -17.031 -1.997  2.568   1.00 0.00 ? 58  SER A HB3  2  
ATOM 2635  H HG   . SER A 1 58  ? -16.888 -2.954  -0.102  1.00 0.00 ? 58  SER A HG   2  
ATOM 2636  N N    . GLY A 1 59  ? -14.443 -3.087  2.172   1.00 0.00 ? 59  GLY A N    2  
ATOM 2637  C CA   . GLY A 1 59  ? -12.985 -3.081  1.861   1.00 0.00 ? 59  GLY A CA   2  
ATOM 2638  C C    . GLY A 1 59  ? -12.684 -1.937  0.893   1.00 0.00 ? 59  GLY A C    2  
ATOM 2639  O O    . GLY A 1 59  ? -13.139 -0.825  1.075   1.00 0.00 ? 59  GLY A O    2  
ATOM 2640  H H    . GLY A 1 59  ? -14.864 -2.293  2.561   1.00 0.00 ? 59  GLY A H    2  
ATOM 2641  H HA2  . GLY A 1 59  ? -12.422 -2.944  2.774   1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2642  H HA3  . GLY A 1 59  ? -12.709 -4.018  1.404   1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2643  N N    . PHE A 1 60  ? -11.929 -2.195  -0.139  1.00 0.00 ? 60  PHE A N    2  
ATOM 2644  C CA   . PHE A 1 60  ? -11.619 -1.110  -1.113  1.00 0.00 ? 60  PHE A CA   2  
ATOM 2645  C C    . PHE A 1 60  ? -11.555 -1.694  -2.527  1.00 0.00 ? 60  PHE A C    2  
ATOM 2646  O O    . PHE A 1 60  ? -11.280 -2.862  -2.717  1.00 0.00 ? 60  PHE A O    2  
ATOM 2647  C CB   . PHE A 1 60  ? -10.280 -0.452  -0.759  1.00 0.00 ? 60  PHE A CB   2  
ATOM 2648  C CG   . PHE A 1 60  ? -9.273  -1.504  -0.352  1.00 0.00 ? 60  PHE A CG   2  
ATOM 2649  C CD1  . PHE A 1 60  ? -9.455  -2.236  0.829   1.00 0.00 ? 60  PHE A CD1  2  
ATOM 2650  C CD2  . PHE A 1 60  ? -8.152  -1.742  -1.155  1.00 0.00 ? 60  PHE A CD2  2  
ATOM 2651  C CE1  . PHE A 1 60  ? -8.516  -3.205  1.204   1.00 0.00 ? 60  PHE A CE1  2  
ATOM 2652  C CE2  . PHE A 1 60  ? -7.214  -2.712  -0.781  1.00 0.00 ? 60  PHE A CE2  2  
ATOM 2653  C CZ   . PHE A 1 60  ? -7.397  -3.442  0.399   1.00 0.00 ? 60  PHE A CZ   2  
ATOM 2654  H H    . PHE A 1 60  ? -11.573 -3.100  -0.275  1.00 0.00 ? 60  PHE A H    2  
ATOM 2655  H HA   . PHE A 1 60  ? -12.401 -0.367  -1.073  1.00 0.00 ? 60  PHE A HA   2  
ATOM 2656  H HB2  . PHE A 1 60  ? -9.909  0.085   -1.618  1.00 0.00 ? 60  PHE A HB2  2  
ATOM 2657  H HB3  . PHE A 1 60  ? -10.427 0.238   0.059   1.00 0.00 ? 60  PHE A HB3  2  
ATOM 2658  H HD1  . PHE A 1 60  ? -10.319 -2.052  1.449   1.00 0.00 ? 60  PHE A HD1  2  
ATOM 2659  H HD2  . PHE A 1 60  ? -8.012  -1.178  -2.064  1.00 0.00 ? 60  PHE A HD2  2  
ATOM 2660  H HE1  . PHE A 1 60  ? -8.656  -3.768  2.115   1.00 0.00 ? 60  PHE A HE1  2  
ATOM 2661  H HE2  . PHE A 1 60  ? -6.351  -2.895  -1.402  1.00 0.00 ? 60  PHE A HE2  2  
ATOM 2662  H HZ   . PHE A 1 60  ? -6.673  -4.190  0.689   1.00 0.00 ? 60  PHE A HZ   2  
ATOM 2663  N N    . ASP A 1 61  ? -11.821 -0.888  -3.520  1.00 0.00 ? 61  ASP A N    2  
ATOM 2664  C CA   . ASP A 1 61  ? -11.790 -1.393  -4.921  1.00 0.00 ? 61  ASP A CA   2  
ATOM 2665  C C    . ASP A 1 61  ? -10.427 -1.110  -5.551  1.00 0.00 ? 61  ASP A C    2  
ATOM 2666  O O    . ASP A 1 61  ? -9.943  0.005   -5.537  1.00 0.00 ? 61  ASP A O    2  
ATOM 2667  C CB   . ASP A 1 61  ? -12.878 -0.694  -5.738  1.00 0.00 ? 61  ASP A CB   2  
ATOM 2668  C CG   . ASP A 1 61  ? -14.255 -1.122  -5.228  1.00 0.00 ? 61  ASP A CG   2  
ATOM 2669  O OD1  . ASP A 1 61  ? -14.575 -0.792  -4.098  1.00 0.00 ? 61  ASP A OD1  2  
ATOM 2670  O OD2  . ASP A 1 61  ? -14.968 -1.771  -5.976  1.00 0.00 ? 61  ASP A OD2  2  
ATOM 2671  H H    . ASP A 1 61  ? -12.048 0.048   -3.342  1.00 0.00 ? 61  ASP A H    2  
ATOM 2672  H HA   . ASP A 1 61  ? -11.969 -2.456  -4.925  1.00 0.00 ? 61  ASP A HA   2  
ATOM 2673  H HB2  . ASP A 1 61  ? -12.771 0.377   -5.639  1.00 0.00 ? 61  ASP A HB2  2  
ATOM 2674  H HB3  . ASP A 1 61  ? -12.781 -0.970  -6.778  1.00 0.00 ? 61  ASP A HB3  2  
ATOM 2675  N N    . LEU A 1 62  ? -9.813  -2.111  -6.118  1.00 0.00 ? 62  LEU A N    2  
ATOM 2676  C CA   . LEU A 1 62  ? -8.491  -1.906  -6.769  1.00 0.00 ? 62  LEU A CA   2  
ATOM 2677  C C    . LEU A 1 62  ? -8.680  -1.975  -8.283  1.00 0.00 ? 62  LEU A C    2  
ATOM 2678  O O    . LEU A 1 62  ? -8.075  -2.781  -8.961  1.00 0.00 ? 62  LEU A O    2  
ATOM 2679  C CB   . LEU A 1 62  ? -7.520  -3.002  -6.320  1.00 0.00 ? 62  LEU A CB   2  
ATOM 2680  C CG   . LEU A 1 62  ? -7.033  -2.706  -4.901  1.00 0.00 ? 62  LEU A CG   2  
ATOM 2681  C CD1  . LEU A 1 62  ? -6.331  -1.346  -4.874  1.00 0.00 ? 62  LEU A CD1  2  
ATOM 2682  C CD2  . LEU A 1 62  ? -8.229  -2.679  -3.949  1.00 0.00 ? 62  LEU A CD2  2  
ATOM 2683  H H    . LEU A 1 62  ? -10.229 -2.998  -6.127  1.00 0.00 ? 62  LEU A H    2  
ATOM 2684  H HA   . LEU A 1 62  ? -8.098  -0.937  -6.496  1.00 0.00 ? 62  LEU A HA   2  
ATOM 2685  H HB2  . LEU A 1 62  ? -8.023  -3.958  -6.336  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 2686  H HB3  . LEU A 1 62  ? -6.674  -3.031  -6.990  1.00 0.00 ? 62  LEU A HB3  2  
ATOM 2687  H HG   . LEU A 1 62  ? -6.340  -3.474  -4.590  1.00 0.00 ? 62  LEU A HG   2  
ATOM 2688  H HD11 . LEU A 1 62  ? -6.250  -0.963  -5.880  1.00 0.00 ? 62  LEU A HD11 2  
ATOM 2689  H HD12 . LEU A 1 62  ? -6.904  -0.657  -4.271  1.00 0.00 ? 62  LEU A HD12 2  
ATOM 2690  H HD13 . LEU A 1 62  ? -5.343  -1.460  -4.452  1.00 0.00 ? 62  LEU A HD13 2  
ATOM 2691  H HD21 . LEU A 1 62  ? -9.049  -3.228  -4.385  1.00 0.00 ? 62  LEU A HD21 2  
ATOM 2692  H HD22 . LEU A 1 62  ? -7.951  -3.135  -3.010  1.00 0.00 ? 62  LEU A HD22 2  
ATOM 2693  H HD23 . LEU A 1 62  ? -8.531  -1.657  -3.776  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 2694  N N    . ALA A 1 63  ? -9.529  -1.137  -8.815  1.00 0.00 ? 63  ALA A N    2  
ATOM 2695  C CA   . ALA A 1 63  ? -9.774  -1.151  -10.281 1.00 0.00 ? 63  ALA A CA   2  
ATOM 2696  C C    . ALA A 1 63  ? -10.081 -2.581  -10.732 1.00 0.00 ? 63  ALA A C    2  
ATOM 2697  O O    . ALA A 1 63  ? -9.846  -2.948  -11.866 1.00 0.00 ? 63  ALA A O    2  
ATOM 2698  C CB   . ALA A 1 63  ? -8.531  -0.640  -11.008 1.00 0.00 ? 63  ALA A CB   2  
ATOM 2699  H H    . ALA A 1 63  ? -10.008 -0.501  -8.246  1.00 0.00 ? 63  ALA A H    2  
ATOM 2700  H HA   . ALA A 1 63  ? -10.614 -0.513  -10.512 1.00 0.00 ? 63  ALA A HA   2  
ATOM 2701  H HB1  . ALA A 1 63  ? -7.946  -0.033  -10.333 1.00 0.00 ? 63  ALA A HB1  2  
ATOM 2702  H HB2  . ALA A 1 63  ? -7.940  -1.480  -11.342 1.00 0.00 ? 63  ALA A HB2  2  
ATOM 2703  H HB3  . ALA A 1 63  ? -8.831  -0.049  -11.860 1.00 0.00 ? 63  ALA A HB3  2  
ATOM 2704  N N    . GLY A 1 64  ? -10.603 -3.393  -9.852  1.00 0.00 ? 64  GLY A N    2  
ATOM 2705  C CA   . GLY A 1 64  ? -10.918 -4.799  -10.237 1.00 0.00 ? 64  GLY A CA   2  
ATOM 2706  C C    . GLY A 1 64  ? -11.970 -5.386  -9.288  1.00 0.00 ? 64  GLY A C    2  
ATOM 2707  O O    . GLY A 1 64  ? -13.156 -5.193  -9.465  1.00 0.00 ? 64  GLY A O    2  
ATOM 2708  H H    . GLY A 1 64  ? -10.783 -3.079  -8.942  1.00 0.00 ? 64  GLY A H    2  
ATOM 2709  H HA2  . GLY A 1 64  ? -11.299 -4.814  -11.248 1.00 0.00 ? 64  GLY A HA2  2  
ATOM 2710  H HA3  . GLY A 1 64  ? -10.020 -5.394  -10.183 1.00 0.00 ? 64  GLY A HA3  2  
ATOM 2711  N N    . VAL A 1 65  ? -11.544 -6.118  -8.290  1.00 0.00 ? 65  VAL A N    2  
ATOM 2712  C CA   . VAL A 1 65  ? -12.518 -6.732  -7.341  1.00 0.00 ? 65  VAL A CA   2  
ATOM 2713  C C    . VAL A 1 65  ? -12.375 -6.093  -5.957  1.00 0.00 ? 65  VAL A C    2  
ATOM 2714  O O    . VAL A 1 65  ? -11.455 -5.343  -5.700  1.00 0.00 ? 65  VAL A O    2  
ATOM 2715  C CB   . VAL A 1 65  ? -12.238 -8.233  -7.236  1.00 0.00 ? 65  VAL A CB   2  
ATOM 2716  C CG1  . VAL A 1 65  ? -13.328 -8.903  -6.397  1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2717  C CG2  . VAL A 1 65  ? -12.227 -8.848  -8.637  1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2718  H H    . VAL A 1 65  ? -10.583 -6.271  -8.173  1.00 0.00 ? 65  VAL A H    2  
ATOM 2719  H HA   . VAL A 1 65  ? -13.522 -6.579  -7.707  1.00 0.00 ? 65  VAL A HA   2  
ATOM 2720  H HB   . VAL A 1 65  ? -11.278 -8.387  -6.766  1.00 0.00 ? 65  VAL A HB   2  
ATOM 2721  H HG11 . VAL A 1 65  ? -14.277 -8.426  -6.594  1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2722  H HG12 . VAL A 1 65  ? -13.391 -9.949  -6.657  1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2723  H HG13 . VAL A 1 65  ? -13.087 -8.806  -5.349  1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2724  H HG21 . VAL A 1 65  ? -13.049 -8.449  -9.212  1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2725  H HG22 . VAL A 1 65  ? -11.296 -8.610  -9.127  1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2726  H HG23 . VAL A 1 65  ? -12.330 -9.921  -8.558  1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2727  N N    . HIS A 1 66  ? -13.284 -6.385  -5.064  1.00 0.00 ? 66  HIS A N    2  
ATOM 2728  C CA   . HIS A 1 66  ? -13.209 -5.800  -3.697  1.00 0.00 ? 66  HIS A CA   2  
ATOM 2729  C C    . HIS A 1 66  ? -12.297 -6.658  -2.817  1.00 0.00 ? 66  HIS A C    2  
ATOM 2730  O O    . HIS A 1 66  ? -12.411 -7.866  -2.776  1.00 0.00 ? 66  HIS A O    2  
ATOM 2731  C CB   . HIS A 1 66  ? -14.609 -5.762  -3.083  1.00 0.00 ? 66  HIS A CB   2  
ATOM 2732  C CG   . HIS A 1 66  ? -15.494 -4.867  -3.907  1.00 0.00 ? 66  HIS A CG   2  
ATOM 2733  N ND1  . HIS A 1 66  ? -16.051 -5.284  -5.106  1.00 0.00 ? 66  HIS A ND1  2  
ATOM 2734  C CD2  . HIS A 1 66  ? -15.929 -3.580  -3.717  1.00 0.00 ? 66  HIS A CD2  2  
ATOM 2735  C CE1  . HIS A 1 66  ? -16.784 -4.263  -5.588  1.00 0.00 ? 66  HIS A CE1  2  
ATOM 2736  N NE2  . HIS A 1 66  ? -16.744 -3.200  -4.780  1.00 0.00 ? 66  HIS A NE2  2  
ATOM 2737  H H    . HIS A 1 66  ? -14.017 -6.990  -5.294  1.00 0.00 ? 66  HIS A H    2  
ATOM 2738  H HA   . HIS A 1 66  ? -12.814 -4.799  -3.753  1.00 0.00 ? 66  HIS A HA   2  
ATOM 2739  H HB2  . HIS A 1 66  ? -15.021 -6.759  -3.066  1.00 0.00 ? 66  HIS A HB2  2  
ATOM 2740  H HB3  . HIS A 1 66  ? -14.551 -5.378  -2.075  1.00 0.00 ? 66  HIS A HB3  2  
ATOM 2741  H HD1  . HIS A 1 66  ? -15.933 -6.161  -5.527  1.00 0.00 ? 66  HIS A HD1  2  
ATOM 2742  H HD2  . HIS A 1 66  ? -15.679 -2.956  -2.873  1.00 0.00 ? 66  HIS A HD2  2  
ATOM 2743  H HE1  . HIS A 1 66  ? -17.337 -4.299  -6.514  1.00 0.00 ? 66  HIS A HE1  2  
ATOM 2744  N N    . TYR A 1 67  ? -11.395 -6.037  -2.105  1.00 0.00 ? 67  TYR A N    2  
ATOM 2745  C CA   . TYR A 1 67  ? -10.479 -6.811  -1.220  1.00 0.00 ? 67  TYR A CA   2  
ATOM 2746  C C    . TYR A 1 67  ? -10.876 -6.574  0.239   1.00 0.00 ? 67  TYR A C    2  
ATOM 2747  O O    . TYR A 1 67  ? -11.678 -5.709  0.539   1.00 0.00 ? 67  TYR A O    2  
ATOM 2748  C CB   . TYR A 1 67  ? -9.037  -6.356  -1.453  1.00 0.00 ? 67  TYR A CB   2  
ATOM 2749  C CG   . TYR A 1 67  ? -8.569  -6.877  -2.793  1.00 0.00 ? 67  TYR A CG   2  
ATOM 2750  C CD1  . TYR A 1 67  ? -8.704  -8.236  -3.098  1.00 0.00 ? 67  TYR A CD1  2  
ATOM 2751  C CD2  . TYR A 1 67  ? -8.008  -6.001  -3.730  1.00 0.00 ? 67  TYR A CD2  2  
ATOM 2752  C CE1  . TYR A 1 67  ? -8.278  -8.720  -4.340  1.00 0.00 ? 67  TYR A CE1  2  
ATOM 2753  C CE2  . TYR A 1 67  ? -7.583  -6.486  -4.974  1.00 0.00 ? 67  TYR A CE2  2  
ATOM 2754  C CZ   . TYR A 1 67  ? -7.718  -7.844  -5.279  1.00 0.00 ? 67  TYR A CZ   2  
ATOM 2755  O OH   . TYR A 1 67  ? -7.299  -8.320  -6.504  1.00 0.00 ? 67  TYR A OH   2  
ATOM 2756  H H    . TYR A 1 67  ? -11.324 -5.060  -2.149  1.00 0.00 ? 67  TYR A H    2  
ATOM 2757  H HA   . TYR A 1 67  ? -10.567 -7.862  -1.448  1.00 0.00 ? 67  TYR A HA   2  
ATOM 2758  H HB2  . TYR A 1 67  ? -8.994  -5.276  -1.448  1.00 0.00 ? 67  TYR A HB2  2  
ATOM 2759  H HB3  . TYR A 1 67  ? -8.403  -6.747  -0.673  1.00 0.00 ? 67  TYR A HB3  2  
ATOM 2760  H HD1  . TYR A 1 67  ? -9.135  -8.911  -2.374  1.00 0.00 ? 67  TYR A HD1  2  
ATOM 2761  H HD2  . TYR A 1 67  ? -7.903  -4.952  -3.495  1.00 0.00 ? 67  TYR A HD2  2  
ATOM 2762  H HE1  . TYR A 1 67  ? -8.381  -9.769  -4.576  1.00 0.00 ? 67  TYR A HE1  2  
ATOM 2763  H HE2  . TYR A 1 67  ? -7.151  -5.811  -5.698  1.00 0.00 ? 67  TYR A HE2  2  
ATOM 2764  H HH   . TYR A 1 67  ? -7.902  -9.016  -6.775  1.00 0.00 ? 67  TYR A HH   2  
ATOM 2765  N N    . VAL A 1 68  ? -10.334 -7.337  1.150   1.00 0.00 ? 68  VAL A N    2  
ATOM 2766  C CA   . VAL A 1 68  ? -10.701 -7.154  2.583   1.00 0.00 ? 68  VAL A CA   2  
ATOM 2767  C C    . VAL A 1 68  ? -9.523  -6.558  3.353   1.00 0.00 ? 68  VAL A C    2  
ATOM 2768  O O    . VAL A 1 68  ? -8.440  -6.389  2.826   1.00 0.00 ? 68  VAL A O    2  
ATOM 2769  C CB   . VAL A 1 68  ? -11.073 -8.508  3.191   1.00 0.00 ? 68  VAL A CB   2  
ATOM 2770  C CG1  . VAL A 1 68  ? -12.014 -8.297  4.377   1.00 0.00 ? 68  VAL A CG1  2  
ATOM 2771  C CG2  . VAL A 1 68  ? -11.773 -9.366  2.136   1.00 0.00 ? 68  VAL A CG2  2  
ATOM 2772  H H    . VAL A 1 68  ? -9.693  -8.034  0.891   1.00 0.00 ? 68  VAL A H    2  
ATOM 2773  H HA   . VAL A 1 68  ? -11.547 -6.487  2.652   1.00 0.00 ? 68  VAL A HA   2  
ATOM 2774  H HB   . VAL A 1 68  ? -10.177 -9.009  3.527   1.00 0.00 ? 68  VAL A HB   2  
ATOM 2775  H HG11 . VAL A 1 68  ? -12.233 -7.243  4.480   1.00 0.00 ? 68  VAL A HG11 2  
ATOM 2776  H HG12 . VAL A 1 68  ? -12.934 -8.839  4.208   1.00 0.00 ? 68  VAL A HG12 2  
ATOM 2777  H HG13 . VAL A 1 68  ? -11.544 -8.657  5.280   1.00 0.00 ? 68  VAL A HG13 2  
ATOM 2778  H HG21 . VAL A 1 68  ? -12.067 -8.744  1.303   1.00 0.00 ? 68  VAL A HG21 2  
ATOM 2779  H HG22 . VAL A 1 68  ? -11.098 -10.134 1.789   1.00 0.00 ? 68  VAL A HG22 2  
ATOM 2780  H HG23 . VAL A 1 68  ? -12.649 -9.826  2.569   1.00 0.00 ? 68  VAL A HG23 2  
ATOM 2781  N N    . THR A 1 69  ? -9.730  -6.237  4.599   1.00 0.00 ? 69  THR A N    2  
ATOM 2782  C CA   . THR A 1 69  ? -8.634  -5.649  5.416   1.00 0.00 ? 69  THR A CA   2  
ATOM 2783  C C    . THR A 1 69  ? -8.282  -6.608  6.557   1.00 0.00 ? 69  THR A C    2  
ATOM 2784  O O    . THR A 1 69  ? -9.149  -7.147  7.216   1.00 0.00 ? 69  THR A O    2  
ATOM 2785  C CB   . THR A 1 69  ? -9.096  -4.313  5.997   1.00 0.00 ? 69  THR A CB   2  
ATOM 2786  O OG1  . THR A 1 69  ? -10.384 -3.996  5.486   1.00 0.00 ? 69  THR A OG1  2  
ATOM 2787  C CG2  . THR A 1 69  ? -8.105  -3.215  5.608   1.00 0.00 ? 69  THR A CG2  2  
ATOM 2788  H H    . THR A 1 69  ? -10.613 -6.382  5.001   1.00 0.00 ? 69  THR A H    2  
ATOM 2789  H HA   . THR A 1 69  ? -7.763  -5.492  4.796   1.00 0.00 ? 69  THR A HA   2  
ATOM 2790  H HB   . THR A 1 69  ? -9.144  -4.384  7.074   1.00 0.00 ? 69  THR A HB   2  
ATOM 2791  H HG1  . THR A 1 69  ? -10.968 -3.831  6.231   1.00 0.00 ? 69  THR A HG1  2  
ATOM 2792  H HG21 . THR A 1 69  ? -8.018  -3.173  4.532   1.00 0.00 ? 69  THR A HG21 2  
ATOM 2793  H HG22 . THR A 1 69  ? -8.458  -2.263  5.977   1.00 0.00 ? 69  THR A HG22 2  
ATOM 2794  H HG23 . THR A 1 69  ? -7.139  -3.432  6.039   1.00 0.00 ? 69  THR A HG23 2  
ATOM 2795  N N    . LEU A 1 70  ? -7.017  -6.824  6.797   1.00 0.00 ? 70  LEU A N    2  
ATOM 2796  C CA   . LEU A 1 70  ? -6.615  -7.746  7.896   1.00 0.00 ? 70  LEU A CA   2  
ATOM 2797  C C    . LEU A 1 70  ? -6.467  -6.947  9.193   1.00 0.00 ? 70  LEU A C    2  
ATOM 2798  O O    . LEU A 1 70  ? -7.092  -7.246  10.192  1.00 0.00 ? 70  LEU A O    2  
ATOM 2799  C CB   . LEU A 1 70  ? -5.279  -8.407  7.546   1.00 0.00 ? 70  LEU A CB   2  
ATOM 2800  C CG   . LEU A 1 70  ? -5.014  -9.569  8.506   1.00 0.00 ? 70  LEU A CG   2  
ATOM 2801  C CD1  . LEU A 1 70  ? -5.781  -10.806 8.035   1.00 0.00 ? 70  LEU A CD1  2  
ATOM 2802  C CD2  . LEU A 1 70  ? -3.516  -9.879  8.528   1.00 0.00 ? 70  LEU A CD2  2  
ATOM 2803  H H    . LEU A 1 70  ? -6.332  -6.379  6.255   1.00 0.00 ? 70  LEU A H    2  
ATOM 2804  H HA   . LEU A 1 70  ? -7.372  -8.506  8.024   1.00 0.00 ? 70  LEU A HA   2  
ATOM 2805  H HB2  . LEU A 1 70  ? -5.317  -8.779  6.531   1.00 0.00 ? 70  LEU A HB2  2  
ATOM 2806  H HB3  . LEU A 1 70  ? -4.485  -7.684  7.634   1.00 0.00 ? 70  LEU A HB3  2  
ATOM 2807  H HG   . LEU A 1 70  ? -5.344  -9.299  9.499   1.00 0.00 ? 70  LEU A HG   2  
ATOM 2808  H HD11 . LEU A 1 70  ? -6.617  -10.500 7.423   1.00 0.00 ? 70  LEU A HD11 2  
ATOM 2809  H HD12 . LEU A 1 70  ? -5.124  -11.438 7.455   1.00 0.00 ? 70  LEU A HD12 2  
ATOM 2810  H HD13 . LEU A 1 70  ? -6.143  -11.354 8.891   1.00 0.00 ? 70  LEU A HD13 2  
ATOM 2811  H HD21 . LEU A 1 70  ? -2.957  -8.955  8.542   1.00 0.00 ? 70  LEU A HD21 2  
ATOM 2812  H HD22 . LEU A 1 70  ? -3.281  -10.456 9.411   1.00 0.00 ? 70  LEU A HD22 2  
ATOM 2813  H HD23 . LEU A 1 70  ? -3.252  -10.447 7.648   1.00 0.00 ? 70  LEU A HD23 2  
ATOM 2814  N N    . ARG A 1 71  ? -5.650  -5.930  9.186   1.00 0.00 ? 71  ARG A N    2  
ATOM 2815  C CA   . ARG A 1 71  ? -5.470  -5.110  10.419  1.00 0.00 ? 71  ARG A CA   2  
ATOM 2816  C C    . ARG A 1 71  ? -5.450  -3.628  10.035  1.00 0.00 ? 71  ARG A C    2  
ATOM 2817  O O    . ARG A 1 71  ? -4.410  -2.998  10.001  1.00 0.00 ? 71  ARG A O    2  
ATOM 2818  C CB   . ARG A 1 71  ? -4.150  -5.473  11.118  1.00 0.00 ? 71  ARG A CB   2  
ATOM 2819  C CG   . ARG A 1 71  ? -3.618  -6.813  10.595  1.00 0.00 ? 71  ARG A CG   2  
ATOM 2820  C CD   . ARG A 1 71  ? -2.648  -6.559  9.439   1.00 0.00 ? 71  ARG A CD   2  
ATOM 2821  N NE   . ARG A 1 71  ? -1.500  -7.515  9.521   1.00 0.00 ? 71  ARG A NE   2  
ATOM 2822  C CZ   . ARG A 1 71  ? -0.823  -7.674  10.630  1.00 0.00 ? 71  ARG A CZ   2  
ATOM 2823  N NH1  . ARG A 1 71  ? -1.009  -6.874  11.646  1.00 0.00 ? 71  ARG A NH1  2  
ATOM 2824  N NH2  . ARG A 1 71  ? 0.086   -8.607  10.701  1.00 0.00 ? 71  ARG A NH2  2  
ATOM 2825  H H    . ARG A 1 71  ? -5.158  -5.702  8.370   1.00 0.00 ? 71  ARG A H    2  
ATOM 2826  H HA   . ARG A 1 71  ? -6.295  -5.293  11.092  1.00 0.00 ? 71  ARG A HA   2  
ATOM 2827  H HB2  . ARG A 1 71  ? -3.420  -4.700  10.926  1.00 0.00 ? 71  ARG A HB2  2  
ATOM 2828  H HB3  . ARG A 1 71  ? -4.320  -5.549  12.181  1.00 0.00 ? 71  ARG A HB3  2  
ATOM 2829  H HG2  . ARG A 1 71  ? -3.107  -7.331  11.391  1.00 0.00 ? 71  ARG A HG2  2  
ATOM 2830  H HG3  . ARG A 1 71  ? -4.440  -7.416  10.246  1.00 0.00 ? 71  ARG A HG3  2  
ATOM 2831  H HD2  . ARG A 1 71  ? -3.155  -6.726  8.507   1.00 0.00 ? 71  ARG A HD2  2  
ATOM 2832  H HD3  . ARG A 1 71  ? -2.306  -5.528  9.477   1.00 0.00 ? 71  ARG A HD3  2  
ATOM 2833  H HE   . ARG A 1 71  ? -1.282  -8.069  8.743   1.00 0.00 ? 71  ARG A HE   2  
ATOM 2834  H HH11 . ARG A 1 71  ? -1.668  -6.126  11.584  1.00 0.00 ? 71  ARG A HH11 2  
ATOM 2835  H HH12 . ARG A 1 71  ? -0.491  -7.012  12.490  1.00 0.00 ? 71  ARG A HH12 2  
ATOM 2836  H HH21 . ARG A 1 71  ? 0.262   -9.195  9.911   1.00 0.00 ? 71  ARG A HH21 2  
ATOM 2837  H HH22 . ARG A 1 71  ? 0.607   -8.734  11.545  1.00 0.00 ? 71  ARG A HH22 2  
ATOM 2838  N N    . ALA A 1 72  ? -6.591  -3.068  9.741   1.00 0.00 ? 72  ALA A N    2  
ATOM 2839  C CA   . ALA A 1 72  ? -6.641  -1.629  9.353   1.00 0.00 ? 72  ALA A CA   2  
ATOM 2840  C C    . ALA A 1 72  ? -7.124  -0.795  10.541  1.00 0.00 ? 72  ALA A C    2  
ATOM 2841  O O    . ALA A 1 72  ? -8.284  -0.443  10.632  1.00 0.00 ? 72  ALA A O    2  
ATOM 2842  C CB   . ALA A 1 72  ? -7.609  -1.450  8.180   1.00 0.00 ? 72  ALA A CB   2  
ATOM 2843  H H    . ALA A 1 72  ? -7.417  -3.595  9.771   1.00 0.00 ? 72  ALA A H    2  
ATOM 2844  H HA   . ALA A 1 72  ? -5.656  -1.299  9.060   1.00 0.00 ? 72  ALA A HA   2  
ATOM 2845  H HB1  . ALA A 1 72  ? -8.444  -2.125  8.296   1.00 0.00 ? 72  ALA A HB1  2  
ATOM 2846  H HB2  . ALA A 1 72  ? -7.969  -0.432  8.161   1.00 0.00 ? 72  ALA A HB2  2  
ATOM 2847  H HB3  . ALA A 1 72  ? -7.096  -1.668  7.255   1.00 0.00 ? 72  ALA A HB3  2  
ATOM 2848  N N    . ASP A 1 73  ? -6.246  -0.472  11.452  1.00 0.00 ? 73  ASP A N    2  
ATOM 2849  C CA   . ASP A 1 73  ? -6.659  0.341   12.631  1.00 0.00 ? 73  ASP A CA   2  
ATOM 2850  C C    . ASP A 1 73  ? -5.462  0.537   13.565  1.00 0.00 ? 73  ASP A C    2  
ATOM 2851  O O    . ASP A 1 73  ? -5.247  1.608   14.100  1.00 0.00 ? 73  ASP A O    2  
ATOM 2852  C CB   . ASP A 1 73  ? -7.777  -0.381  13.386  1.00 0.00 ? 73  ASP A CB   2  
ATOM 2853  C CG   . ASP A 1 73  ? -8.396  0.571   14.412  1.00 0.00 ? 73  ASP A CG   2  
ATOM 2854  O OD1  . ASP A 1 73  ? -9.050  1.514   13.996  1.00 0.00 ? 73  ASP A OD1  2  
ATOM 2855  O OD2  . ASP A 1 73  ? -8.206  0.341   15.594  1.00 0.00 ? 73  ASP A OD2  2  
ATOM 2856  H H    . ASP A 1 73  ? -5.315  -0.764  11.359  1.00 0.00 ? 73  ASP A H    2  
ATOM 2857  H HA   . ASP A 1 73  ? -7.016  1.304   12.296  1.00 0.00 ? 73  ASP A HA   2  
ATOM 2858  H HB2  . ASP A 1 73  ? -8.536  -0.702  12.689  1.00 0.00 ? 73  ASP A HB2  2  
ATOM 2859  H HB3  . ASP A 1 73  ? -7.370  -1.240  13.897  1.00 0.00 ? 73  ASP A HB3  2  
ATOM 2860  N N    . ASP A 1 74  ? -4.685  -0.490  13.771  1.00 0.00 ? 74  ASP A N    2  
ATOM 2861  C CA   . ASP A 1 74  ? -3.507  -0.369  14.677  1.00 0.00 ? 74  ASP A CA   2  
ATOM 2862  C C    . ASP A 1 74  ? -2.560  0.716   14.155  1.00 0.00 ? 74  ASP A C    2  
ATOM 2863  O O    . ASP A 1 74  ? -2.573  1.838   14.619  1.00 0.00 ? 74  ASP A O    2  
ATOM 2864  C CB   . ASP A 1 74  ? -2.770  -1.708  14.734  1.00 0.00 ? 74  ASP A CB   2  
ATOM 2865  C CG   . ASP A 1 74  ? -3.045  -2.388  16.077  1.00 0.00 ? 74  ASP A CG   2  
ATOM 2866  O OD1  . ASP A 1 74  ? -4.155  -2.860  16.265  1.00 0.00 ? 74  ASP A OD1  2  
ATOM 2867  O OD2  . ASP A 1 74  ? -2.141  -2.427  16.895  1.00 0.00 ? 74  ASP A OD2  2  
ATOM 2868  H H    . ASP A 1 74  ? -4.879  -1.346  13.334  1.00 0.00 ? 74  ASP A H    2  
ATOM 2869  H HA   . ASP A 1 74  ? -3.843  -0.103  15.669  1.00 0.00 ? 74  ASP A HA   2  
ATOM 2870  H HB2  . ASP A 1 74  ? -3.115  -2.343  13.931  1.00 0.00 ? 74  ASP A HB2  2  
ATOM 2871  H HB3  . ASP A 1 74  ? -1.708  -1.540  14.630  1.00 0.00 ? 74  ASP A HB3  2  
ATOM 2872  N N    . ARG A 1 75  ? -1.736  0.391   13.195  1.00 0.00 ? 75  ARG A N    2  
ATOM 2873  C CA   . ARG A 1 75  ? -0.788  1.408   12.648  1.00 0.00 ? 75  ARG A CA   2  
ATOM 2874  C C    . ARG A 1 75  ? -0.605  1.184   11.146  1.00 0.00 ? 75  ARG A C    2  
ATOM 2875  O O    . ARG A 1 75  ? -0.690  2.104   10.357  1.00 0.00 ? 75  ARG A O    2  
ATOM 2876  C CB   . ARG A 1 75  ? 0.582   1.297   13.341  1.00 0.00 ? 75  ARG A CB   2  
ATOM 2877  C CG   . ARG A 1 75  ? 0.606   0.109   14.310  1.00 0.00 ? 75  ARG A CG   2  
ATOM 2878  C CD   . ARG A 1 75  ? 2.050   -0.356  14.513  1.00 0.00 ? 75  ARG A CD   2  
ATOM 2879  N NE   . ARG A 1 75  ? 2.179   -1.777  14.081  1.00 0.00 ? 75  ARG A NE   2  
ATOM 2880  C CZ   . ARG A 1 75  ? 3.361   -2.301  13.892  1.00 0.00 ? 75  ARG A CZ   2  
ATOM 2881  N NH1  . ARG A 1 75  ? 4.436   -1.590  14.102  1.00 0.00 ? 75  ARG A NH1  2  
ATOM 2882  N NH2  . ARG A 1 75  ? 3.468   -3.541  13.498  1.00 0.00 ? 75  ARG A NH2  2  
ATOM 2883  H H    . ARG A 1 75  ? -1.739  -0.521  12.835  1.00 0.00 ? 75  ARG A H    2  
ATOM 2884  H HA   . ARG A 1 75  ? -1.192  2.395   12.813  1.00 0.00 ? 75  ARG A HA   2  
ATOM 2885  H HB2  . ARG A 1 75  ? 1.349   1.160   12.593  1.00 0.00 ? 75  ARG A HB2  2  
ATOM 2886  H HB3  . ARG A 1 75  ? 0.778   2.207   13.889  1.00 0.00 ? 75  ARG A HB3  2  
ATOM 2887  H HG2  . ARG A 1 75  ? 0.188   0.411   15.260  1.00 0.00 ? 75  ARG A HG2  2  
ATOM 2888  H HG3  . ARG A 1 75  ? 0.024   -0.703  13.901  1.00 0.00 ? 75  ARG A HG3  2  
ATOM 2889  H HD2  . ARG A 1 75  ? 2.712   0.259   13.923  1.00 0.00 ? 75  ARG A HD2  2  
ATOM 2890  H HD3  . ARG A 1 75  ? 2.315   -0.271  15.556  1.00 0.00 ? 75  ARG A HD3  2  
ATOM 2891  H HE   . ARG A 1 75  ? 1.374   -2.317  13.933  1.00 0.00 ? 75  ARG A HE   2  
ATOM 2892  H HH11 . ARG A 1 75  ? 4.358   -0.642  14.409  1.00 0.00 ? 75  ARG A HH11 2  
ATOM 2893  H HH12 . ARG A 1 75  ? 5.338   -1.994  13.954  1.00 0.00 ? 75  ARG A HH12 2  
ATOM 2894  H HH21 . ARG A 1 75  ? 2.647   -4.090  13.341  1.00 0.00 ? 75  ARG A HH21 2  
ATOM 2895  H HH22 . ARG A 1 75  ? 4.373   -3.942  13.352  1.00 0.00 ? 75  ARG A HH22 2  
ATOM 2896  N N    . SER A 1 76  ? -0.346  -0.031  10.743  1.00 0.00 ? 76  SER A N    2  
ATOM 2897  C CA   . SER A 1 76  ? -0.149  -0.311  9.291   1.00 0.00 ? 76  SER A CA   2  
ATOM 2898  C C    . SER A 1 76  ? -1.489  -0.676  8.649   1.00 0.00 ? 76  SER A C    2  
ATOM 2899  O O    . SER A 1 76  ? -2.533  -0.539  9.254   1.00 0.00 ? 76  SER A O    2  
ATOM 2900  C CB   . SER A 1 76  ? 0.827   -1.473  9.127   1.00 0.00 ? 76  SER A CB   2  
ATOM 2901  O OG   . SER A 1 76  ? 1.750   -1.469  10.207  1.00 0.00 ? 76  SER A OG   2  
ATOM 2902  H H    . SER A 1 76  ? -0.276  -0.759  11.396  1.00 0.00 ? 76  SER A H    2  
ATOM 2903  H HA   . SER A 1 76  ? 0.252   0.567   8.808   1.00 0.00 ? 76  SER A HA   2  
ATOM 2904  H HB2  . SER A 1 76  ? 0.285   -2.404  9.127   1.00 0.00 ? 76  SER A HB2  2  
ATOM 2905  H HB3  . SER A 1 76  ? 1.354   -1.368  8.187   1.00 0.00 ? 76  SER A HB3  2  
ATOM 2906  H HG   . SER A 1 76  ? 1.971   -0.555  10.405  1.00 0.00 ? 76  SER A HG   2  
ATOM 2907  N N    . ILE A 1 77  ? -1.473  -1.136  7.423   1.00 0.00 ? 77  ILE A N    2  
ATOM 2908  C CA   . ILE A 1 77  ? -2.758  -1.498  6.755   1.00 0.00 ? 77  ILE A CA   2  
ATOM 2909  C C    . ILE A 1 77  ? -2.484  -2.383  5.532   1.00 0.00 ? 77  ILE A C    2  
ATOM 2910  O O    . ILE A 1 77  ? -2.772  -2.009  4.413   1.00 0.00 ? 77  ILE A O    2  
ATOM 2911  C CB   . ILE A 1 77  ? -3.497  -0.229  6.295   1.00 0.00 ? 77  ILE A CB   2  
ATOM 2912  C CG1  . ILE A 1 77  ? -2.841  1.022   6.891   1.00 0.00 ? 77  ILE A CG1  2  
ATOM 2913  C CG2  . ILE A 1 77  ? -4.954  -0.297  6.757   1.00 0.00 ? 77  ILE A CG2  2  
ATOM 2914  C CD1  . ILE A 1 77  ? -3.409  2.270   6.212   1.00 0.00 ? 77  ILE A CD1  2  
ATOM 2915  H H    . ILE A 1 77  ? -0.623  -1.238  6.945   1.00 0.00 ? 77  ILE A H    2  
ATOM 2916  H HA   . ILE A 1 77  ? -3.381  -2.039  7.452   1.00 0.00 ? 77  ILE A HA   2  
ATOM 2917  H HB   . ILE A 1 77  ? -3.470  -0.172  5.216   1.00 0.00 ? 77  ILE A HB   2  
ATOM 2918  H HG12 . ILE A 1 77  ? -3.043  1.064   7.951   1.00 0.00 ? 77  ILE A HG12 2  
ATOM 2919  H HG13 . ILE A 1 77  ? -1.775  0.981   6.729   1.00 0.00 ? 77  ILE A HG13 2  
ATOM 2920  H HG21 . ILE A 1 77  ? -5.318  -1.307  6.651   1.00 0.00 ? 77  ILE A HG21 2  
ATOM 2921  H HG22 . ILE A 1 77  ? -5.016  0.002   7.793   1.00 0.00 ? 77  ILE A HG22 2  
ATOM 2922  H HG23 . ILE A 1 77  ? -5.555  0.368   6.154   1.00 0.00 ? 77  ILE A HG23 2  
ATOM 2923  H HD11 . ILE A 1 77  ? -3.785  2.011   5.234   1.00 0.00 ? 77  ILE A HD11 2  
ATOM 2924  H HD12 . ILE A 1 77  ? -4.214  2.672   6.812   1.00 0.00 ? 77  ILE A HD12 2  
ATOM 2925  H HD13 . ILE A 1 77  ? -2.630  3.012   6.113   1.00 0.00 ? 77  ILE A HD13 2  
ATOM 2926  N N    . TYR A 1 78  ? -1.948  -3.560  5.730   1.00 0.00 ? 78  TYR A N    2  
ATOM 2927  C CA   . TYR A 1 78  ? -1.687  -4.456  4.563   1.00 0.00 ? 78  TYR A CA   2  
ATOM 2928  C C    . TYR A 1 78  ? -2.900  -5.370  4.353   1.00 0.00 ? 78  TYR A C    2  
ATOM 2929  O O    . TYR A 1 78  ? -3.220  -6.190  5.191   1.00 0.00 ? 78  TYR A O    2  
ATOM 2930  C CB   . TYR A 1 78  ? -0.446  -5.326  4.806   1.00 0.00 ? 78  TYR A CB   2  
ATOM 2931  C CG   . TYR A 1 78  ? 0.423   -4.733  5.891   1.00 0.00 ? 78  TYR A CG   2  
ATOM 2932  C CD1  . TYR A 1 78  ? 1.398   -3.773  5.574   1.00 0.00 ? 78  TYR A CD1  2  
ATOM 2933  C CD2  . TYR A 1 78  ? 0.266   -5.160  7.215   1.00 0.00 ? 78  TYR A CD2  2  
ATOM 2934  C CE1  . TYR A 1 78  ? 2.211   -3.246  6.584   1.00 0.00 ? 78  TYR A CE1  2  
ATOM 2935  C CE2  . TYR A 1 78  ? 1.078   -4.629  8.222   1.00 0.00 ? 78  TYR A CE2  2  
ATOM 2936  C CZ   . TYR A 1 78  ? 2.051   -3.673  7.906   1.00 0.00 ? 78  TYR A CZ   2  
ATOM 2937  O OH   . TYR A 1 78  ? 2.854   -3.154  8.900   1.00 0.00 ? 78  TYR A OH   2  
ATOM 2938  H H    . TYR A 1 78  ? -1.732  -3.857  6.638   1.00 0.00 ? 78  TYR A H    2  
ATOM 2939  H HA   . TYR A 1 78  ? -1.538  -3.855  3.678   1.00 0.00 ? 78  TYR A HA   2  
ATOM 2940  H HB2  . TYR A 1 78  ? -0.760  -6.315  5.105   1.00 0.00 ? 78  TYR A HB2  2  
ATOM 2941  H HB3  . TYR A 1 78  ? 0.124   -5.397  3.894   1.00 0.00 ? 78  TYR A HB3  2  
ATOM 2942  H HD1  . TYR A 1 78  ? 1.522   -3.438  4.555   1.00 0.00 ? 78  TYR A HD1  2  
ATOM 2943  H HD2  . TYR A 1 78  ? -0.484  -5.898  7.458   1.00 0.00 ? 78  TYR A HD2  2  
ATOM 2944  H HE1  . TYR A 1 78  ? 2.962   -2.509  6.342   1.00 0.00 ? 78  TYR A HE1  2  
ATOM 2945  H HE2  . TYR A 1 78  ? 0.955   -4.958  9.243   1.00 0.00 ? 78  TYR A HE2  2  
ATOM 2946  H HH   . TYR A 1 78  ? 2.574   -3.536  9.735   1.00 0.00 ? 78  TYR A HH   2  
ATOM 2947  N N    . GLY A 1 79  ? -3.580  -5.236  3.246   1.00 0.00 ? 79  GLY A N    2  
ATOM 2948  C CA   . GLY A 1 79  ? -4.771  -6.099  2.993   1.00 0.00 ? 79  GLY A CA   2  
ATOM 2949  C C    . GLY A 1 79  ? -4.364  -7.293  2.124   1.00 0.00 ? 79  GLY A C    2  
ATOM 2950  O O    . GLY A 1 79  ? -3.206  -7.659  2.062   1.00 0.00 ? 79  GLY A O    2  
ATOM 2951  H H    . GLY A 1 79  ? -3.309  -4.568  2.583   1.00 0.00 ? 79  GLY A H    2  
ATOM 2952  H HA2  . GLY A 1 79  ? -5.163  -6.455  3.936   1.00 0.00 ? 79  GLY A HA2  2  
ATOM 2953  H HA3  . GLY A 1 79  ? -5.529  -5.526  2.481   1.00 0.00 ? 79  GLY A HA3  2  
ATOM 2954  N N    . LYS A 1 80  ? -5.303  -7.903  1.451   1.00 0.00 ? 80  LYS A N    2  
ATOM 2955  C CA   . LYS A 1 80  ? -4.960  -9.070  0.589   1.00 0.00 ? 80  LYS A CA   2  
ATOM 2956  C C    . LYS A 1 80  ? -5.482  -8.832  -0.829  1.00 0.00 ? 80  LYS A C    2  
ATOM 2957  O O    . LYS A 1 80  ? -6.380  -8.043  -1.047  1.00 0.00 ? 80  LYS A O    2  
ATOM 2958  C CB   . LYS A 1 80  ? -5.603  -10.338 1.157   1.00 0.00 ? 80  LYS A CB   2  
ATOM 2959  C CG   . LYS A 1 80  ? -7.098  -10.098 1.372   1.00 0.00 ? 80  LYS A CG   2  
ATOM 2960  C CD   . LYS A 1 80  ? -7.819  -11.440 1.516   1.00 0.00 ? 80  LYS A CD   2  
ATOM 2961  C CE   . LYS A 1 80  ? -7.787  -12.187 0.180   1.00 0.00 ? 80  LYS A CE   2  
ATOM 2962  N NZ   . LYS A 1 80  ? -9.089  -12.002 -0.522  1.00 0.00 ? 80  LYS A NZ   2  
ATOM 2963  H H    . LYS A 1 80  ? -6.234  -7.595  1.513   1.00 0.00 ? 80  LYS A H    2  
ATOM 2964  H HA   . LYS A 1 80  ? -3.886  -9.193  0.561   1.00 0.00 ? 80  LYS A HA   2  
ATOM 2965  H HB2  . LYS A 1 80  ? -5.463  -11.153 0.462   1.00 0.00 ? 80  LYS A HB2  2  
ATOM 2966  H HB3  . LYS A 1 80  ? -5.139  -10.586 2.101   1.00 0.00 ? 80  LYS A HB3  2  
ATOM 2967  H HG2  . LYS A 1 80  ? -7.244  -9.513  2.268   1.00 0.00 ? 80  LYS A HG2  2  
ATOM 2968  H HG3  . LYS A 1 80  ? -7.503  -9.565  0.525   1.00 0.00 ? 80  LYS A HG3  2  
ATOM 2969  H HD2  . LYS A 1 80  ? -7.326  -12.034 2.273   1.00 0.00 ? 80  LYS A HD2  2  
ATOM 2970  H HD3  . LYS A 1 80  ? -8.845  -11.268 1.804   1.00 0.00 ? 80  LYS A HD3  2  
ATOM 2971  H HE2  . LYS A 1 80  ? -6.989  -11.796 -0.433  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 2972  H HE3  . LYS A 1 80  ? -7.622  -13.239 0.360   1.00 0.00 ? 80  LYS A HE3  2  
ATOM 2973  H HZ1  . LYS A 1 80  ? -9.558  -11.147 -0.162  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 2974  H HZ2  . LYS A 1 80  ? -8.920  -11.902 -1.544  1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 2975  H HZ3  . LYS A 1 80  ? -9.697  -12.827 -0.349  1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 2976  N N    . LYS A 1 81  ? -4.928  -9.514  -1.794  1.00 0.00 ? 81  LYS A N    2  
ATOM 2977  C CA   . LYS A 1 81  ? -5.392  -9.337  -3.198  1.00 0.00 ? 81  LYS A CA   2  
ATOM 2978  C C    . LYS A 1 81  ? -5.812  -10.694 -3.765  1.00 0.00 ? 81  LYS A C    2  
ATOM 2979  O O    . LYS A 1 81  ? -5.761  -11.701 -3.087  1.00 0.00 ? 81  LYS A O    2  
ATOM 2980  C CB   . LYS A 1 81  ? -4.256  -8.762  -4.046  1.00 0.00 ? 81  LYS A CB   2  
ATOM 2981  C CG   . LYS A 1 81  ? -4.159  -7.252  -3.823  1.00 0.00 ? 81  LYS A CG   2  
ATOM 2982  C CD   . LYS A 1 81  ? -3.539  -6.593  -5.058  1.00 0.00 ? 81  LYS A CD   2  
ATOM 2983  C CE   . LYS A 1 81  ? -4.612  -6.417  -6.134  1.00 0.00 ? 81  LYS A CE   2  
ATOM 2984  N NZ   . LYS A 1 81  ? -4.074  -6.858  -7.453  1.00 0.00 ? 81  LYS A NZ   2  
ATOM 2985  H H    . LYS A 1 81  ? -4.207  -10.148 -1.594  1.00 0.00 ? 81  LYS A H    2  
ATOM 2986  H HA   . LYS A 1 81  ? -6.234  -8.660  -3.216  1.00 0.00 ? 81  LYS A HA   2  
ATOM 2987  H HB2  . LYS A 1 81  ? -3.323  -9.229  -3.761  1.00 0.00 ? 81  LYS A HB2  2  
ATOM 2988  H HB3  . LYS A 1 81  ? -4.451  -8.957  -5.090  1.00 0.00 ? 81  LYS A HB3  2  
ATOM 2989  H HG2  . LYS A 1 81  ? -5.147  -6.848  -3.655  1.00 0.00 ? 81  LYS A HG2  2  
ATOM 2990  H HG3  . LYS A 1 81  ? -3.538  -7.053  -2.963  1.00 0.00 ? 81  LYS A HG3  2  
ATOM 2991  H HD2  . LYS A 1 81  ? -3.137  -5.628  -4.787  1.00 0.00 ? 81  LYS A HD2  2  
ATOM 2992  H HD3  . LYS A 1 81  ? -2.747  -7.219  -5.441  1.00 0.00 ? 81  LYS A HD3  2  
ATOM 2993  H HE2  . LYS A 1 81  ? -5.476  -7.012  -5.880  1.00 0.00 ? 81  LYS A HE2  2  
ATOM 2994  H HE3  . LYS A 1 81  ? -4.896  -5.376  -6.191  1.00 0.00 ? 81  LYS A HE3  2  
ATOM 2995  H HZ1  . LYS A 1 81  ? -3.096  -6.521  -7.557  1.00 0.00 ? 81  LYS A HZ1  2  
ATOM 2996  H HZ2  . LYS A 1 81  ? -4.092  -7.896  -7.504  1.00 0.00 ? 81  LYS A HZ2  2  
ATOM 2997  H HZ3  . LYS A 1 81  ? -4.661  -6.465  -8.215  1.00 0.00 ? 81  LYS A HZ3  2  
ATOM 2998  N N    . GLY A 1 82  ? -6.222  -10.734 -5.004  1.00 0.00 ? 82  GLY A N    2  
ATOM 2999  C CA   . GLY A 1 82  ? -6.636  -12.033 -5.607  1.00 0.00 ? 82  GLY A CA   2  
ATOM 3000  C C    . GLY A 1 82  ? -5.427  -12.967 -5.665  1.00 0.00 ? 82  GLY A C    2  
ATOM 3001  O O    . GLY A 1 82  ? -4.536  -12.793 -6.474  1.00 0.00 ? 82  GLY A O    2  
ATOM 3002  H H    . GLY A 1 82  ? -6.253  -9.912  -5.537  1.00 0.00 ? 82  GLY A H    2  
ATOM 3003  H HA2  . GLY A 1 82  ? -7.412  -12.480 -5.002  1.00 0.00 ? 82  GLY A HA2  2  
ATOM 3004  H HA3  . GLY A 1 82  ? -7.007  -11.865 -6.606  1.00 0.00 ? 82  GLY A HA3  2  
ATOM 3005  N N    . SER A 1 83  ? -5.381  -13.953 -4.812  1.00 0.00 ? 83  SER A N    2  
ATOM 3006  C CA   . SER A 1 83  ? -4.220  -14.886 -4.819  1.00 0.00 ? 83  SER A CA   2  
ATOM 3007  C C    . SER A 1 83  ? -2.934  -14.077 -4.658  1.00 0.00 ? 83  SER A C    2  
ATOM 3008  O O    . SER A 1 83  ? -1.855  -14.526 -4.992  1.00 0.00 ? 83  SER A O    2  
ATOM 3009  C CB   . SER A 1 83  ? -4.182  -15.648 -6.145  1.00 0.00 ? 83  SER A CB   2  
ATOM 3010  O OG   . SER A 1 83  ? -5.466  -15.596 -6.754  1.00 0.00 ? 83  SER A OG   2  
ATOM 3011  H H    . SER A 1 83  ? -6.105  -14.074 -4.163  1.00 0.00 ? 83  SER A H    2  
ATOM 3012  H HA   . SER A 1 83  ? -4.313  -15.585 -4.000  1.00 0.00 ? 83  SER A HA   2  
ATOM 3013  H HB2  . SER A 1 83  ? -3.460  -15.196 -6.801  1.00 0.00 ? 83  SER A HB2  2  
ATOM 3014  H HB3  . SER A 1 83  ? -3.903  -16.677 -5.958  1.00 0.00 ? 83  SER A HB3  2  
ATOM 3015  H HG   . SER A 1 83  ? -5.351  -15.717 -7.700  1.00 0.00 ? 83  SER A HG   2  
ATOM 3016  N N    . ALA A 1 84  ? -3.044  -12.881 -4.147  1.00 0.00 ? 84  ALA A N    2  
ATOM 3017  C CA   . ALA A 1 84  ? -1.837  -12.028 -3.960  1.00 0.00 ? 84  ALA A CA   2  
ATOM 3018  C C    . ALA A 1 84  ? -1.897  -11.361 -2.584  1.00 0.00 ? 84  ALA A C    2  
ATOM 3019  O O    . ALA A 1 84  ? -2.658  -11.760 -1.724  1.00 0.00 ? 84  ALA A O    2  
ATOM 3020  C CB   . ALA A 1 84  ? -1.803  -10.952 -5.049  1.00 0.00 ? 84  ALA A CB   2  
ATOM 3021  H H    . ALA A 1 84  ? -3.925  -12.541 -3.886  1.00 0.00 ? 84  ALA A H    2  
ATOM 3022  H HA   . ALA A 1 84  ? -0.948  -12.639 -4.026  1.00 0.00 ? 84  ALA A HA   2  
ATOM 3023  H HB1  . ALA A 1 84  ? -2.777  -10.876 -5.509  1.00 0.00 ? 84  ALA A HB1  2  
ATOM 3024  H HB2  . ALA A 1 84  ? -1.536  -10.003 -4.612  1.00 0.00 ? 84  ALA A HB2  2  
ATOM 3025  H HB3  . ALA A 1 84  ? -1.073  -11.220 -5.798  1.00 0.00 ? 84  ALA A HB3  2  
ATOM 3026  N N    . GLY A 1 85  ? -1.105  -10.348 -2.369  1.00 0.00 ? 85  GLY A N    2  
ATOM 3027  C CA   . GLY A 1 85  ? -1.122  -9.657  -1.050  1.00 0.00 ? 85  GLY A CA   2  
ATOM 3028  C C    . GLY A 1 85  ? -0.812  -8.174  -1.253  1.00 0.00 ? 85  GLY A C    2  
ATOM 3029  O O    . GLY A 1 85  ? 0.135   -7.813  -1.924  1.00 0.00 ? 85  GLY A O    2  
ATOM 3030  H H    . GLY A 1 85  ? -0.498  -10.041 -3.076  1.00 0.00 ? 85  GLY A H    2  
ATOM 3031  H HA2  . GLY A 1 85  ? -2.099  -9.764  -0.601  1.00 0.00 ? 85  GLY A HA2  2  
ATOM 3032  H HA3  . GLY A 1 85  ? -0.376  -10.093 -0.404  1.00 0.00 ? 85  GLY A HA3  2  
ATOM 3033  N N    . VAL A 1 86  ? -1.604  -7.310  -0.682  1.00 0.00 ? 86  VAL A N    2  
ATOM 3034  C CA   . VAL A 1 86  ? -1.354  -5.852  -0.845  1.00 0.00 ? 86  VAL A CA   2  
ATOM 3035  C C    . VAL A 1 86  ? -0.749  -5.293  0.442   1.00 0.00 ? 86  VAL A C    2  
ATOM 3036  O O    . VAL A 1 86  ? -1.239  -5.535  1.527   1.00 0.00 ? 86  VAL A O    2  
ATOM 3037  C CB   . VAL A 1 86  ? -2.673  -5.140  -1.141  1.00 0.00 ? 86  VAL A CB   2  
ATOM 3038  C CG1  . VAL A 1 86  ? -3.727  -5.587  -0.129  1.00 0.00 ? 86  VAL A CG1  2  
ATOM 3039  C CG2  . VAL A 1 86  ? -2.470  -3.626  -1.032  1.00 0.00 ? 86  VAL A CG2  2  
ATOM 3040  H H    . VAL A 1 86  ? -2.364  -7.620  -0.146  1.00 0.00 ? 86  VAL A H    2  
ATOM 3041  H HA   . VAL A 1 86  ? -0.667  -5.694  -1.665  1.00 0.00 ? 86  VAL A HA   2  
ATOM 3042  H HB   . VAL A 1 86  ? -3.002  -5.391  -2.140  1.00 0.00 ? 86  VAL A HB   2  
ATOM 3043  H HG11 . VAL A 1 86  ? -3.286  -5.623  0.857   1.00 0.00 ? 86  VAL A HG11 2  
ATOM 3044  H HG12 . VAL A 1 86  ? -4.548  -4.886  -0.130  1.00 0.00 ? 86  VAL A HG12 2  
ATOM 3045  H HG13 . VAL A 1 86  ? -4.090  -6.568  -0.397  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 3046  H HG21 . VAL A 1 86  ? -1.425  -3.415  -0.859  1.00 0.00 ? 86  VAL A HG21 2  
ATOM 3047  H HG22 . VAL A 1 86  ? -2.786  -3.154  -1.951  1.00 0.00 ? 86  VAL A HG22 2  
ATOM 3048  H HG23 . VAL A 1 86  ? -3.056  -3.244  -0.210  1.00 0.00 ? 86  VAL A HG23 2  
ATOM 3049  N N    . ILE A 1 87  ? 0.313   -4.546  0.331   1.00 0.00 ? 87  ILE A N    2  
ATOM 3050  C CA   . ILE A 1 87  ? 0.950   -3.969  1.545   1.00 0.00 ? 87  ILE A CA   2  
ATOM 3051  C C    . ILE A 1 87  ? 0.834   -2.446  1.498   1.00 0.00 ? 87  ILE A C    2  
ATOM 3052  O O    . ILE A 1 87  ? 1.571   -1.783  0.800   1.00 0.00 ? 87  ILE A O    2  
ATOM 3053  C CB   . ILE A 1 87  ? 2.426   -4.367  1.585   1.00 0.00 ? 87  ILE A CB   2  
ATOM 3054  C CG1  . ILE A 1 87  ? 2.544   -5.894  1.560   1.00 0.00 ? 87  ILE A CG1  2  
ATOM 3055  C CG2  . ILE A 1 87  ? 3.068   -3.827  2.863   1.00 0.00 ? 87  ILE A CG2  2  
ATOM 3056  C CD1  . ILE A 1 87  ? 1.898   -6.481  2.816   1.00 0.00 ? 87  ILE A CD1  2  
ATOM 3057  H H    . ILE A 1 87  ? 0.690   -4.362  -0.554  1.00 0.00 ? 87  ILE A H    2  
ATOM 3058  H HA   . ILE A 1 87  ? 0.450   -4.340  2.426   1.00 0.00 ? 87  ILE A HA   2  
ATOM 3059  H HB   . ILE A 1 87  ? 2.933   -3.951  0.726   1.00 0.00 ? 87  ILE A HB   2  
ATOM 3060  H HG12 . ILE A 1 87  ? 2.041   -6.277  0.683   1.00 0.00 ? 87  ILE A HG12 2  
ATOM 3061  H HG13 . ILE A 1 87  ? 3.585   -6.175  1.528   1.00 0.00 ? 87  ILE A HG13 2  
ATOM 3062  H HG21 . ILE A 1 87  ? 2.706   -2.827  3.052   1.00 0.00 ? 87  ILE A HG21 2  
ATOM 3063  H HG22 . ILE A 1 87  ? 2.807   -4.466  3.694   1.00 0.00 ? 87  ILE A HG22 2  
ATOM 3064  H HG23 . ILE A 1 87  ? 4.141   -3.806  2.748   1.00 0.00 ? 87  ILE A HG23 2  
ATOM 3065  H HD11 . ILE A 1 87  ? 2.033   -5.799  3.642   1.00 0.00 ? 87  ILE A HD11 2  
ATOM 3066  H HD12 . ILE A 1 87  ? 0.842   -6.631  2.642   1.00 0.00 ? 87  ILE A HD12 2  
ATOM 3067  H HD13 . ILE A 1 87  ? 2.361   -7.428  3.052   1.00 0.00 ? 87  ILE A HD13 2  
ATOM 3068  N N    . THR A 1 88  ? -0.087  -1.883  2.229   1.00 0.00 ? 88  THR A N    2  
ATOM 3069  C CA   . THR A 1 88  ? -0.240  -0.401  2.212   1.00 0.00 ? 88  THR A CA   2  
ATOM 3070  C C    . THR A 1 88  ? 0.034   0.159   3.608   1.00 0.00 ? 88  THR A C    2  
ATOM 3071  O O    . THR A 1 88  ? -0.265  -0.464  4.607   1.00 0.00 ? 88  THR A O    2  
ATOM 3072  C CB   . THR A 1 88  ? -1.667  -0.041  1.790   1.00 0.00 ? 88  THR A CB   2  
ATOM 3073  O OG1  . THR A 1 88  ? -2.543  -0.215  2.893   1.00 0.00 ? 88  THR A OG1  2  
ATOM 3074  C CG2  . THR A 1 88  ? -2.106  -0.946  0.639   1.00 0.00 ? 88  THR A CG2  2  
ATOM 3075  H H    . THR A 1 88  ? -0.676  -2.432  2.788   1.00 0.00 ? 88  THR A H    2  
ATOM 3076  H HA   . THR A 1 88  ? 0.461   0.025   1.509   1.00 0.00 ? 88  THR A HA   2  
ATOM 3077  H HB   . THR A 1 88  ? -1.696  0.987   1.463   1.00 0.00 ? 88  THR A HB   2  
ATOM 3078  H HG1  . THR A 1 88  ? -2.936  0.637   3.095   1.00 0.00 ? 88  THR A HG1  2  
ATOM 3079  H HG21 . THR A 1 88  ? -1.850  -1.970  0.868   1.00 0.00 ? 88  THR A HG21 2  
ATOM 3080  H HG22 . THR A 1 88  ? -3.173  -0.863  0.503   1.00 0.00 ? 88  THR A HG22 2  
ATOM 3081  H HG23 . THR A 1 88  ? -1.603  -0.644  -0.266  1.00 0.00 ? 88  THR A HG23 2  
ATOM 3082  N N    . VAL A 1 89  ? 0.600   1.332   3.687   1.00 0.00 ? 89  VAL A N    2  
ATOM 3083  C CA   . VAL A 1 89  ? 0.890   1.926   5.022   1.00 0.00 ? 89  VAL A CA   2  
ATOM 3084  C C    . VAL A 1 89  ? 0.752   3.450   4.952   1.00 0.00 ? 89  VAL A C    2  
ATOM 3085  O O    . VAL A 1 89  ? 1.123   4.073   3.976   1.00 0.00 ? 89  VAL A O    2  
ATOM 3086  C CB   . VAL A 1 89  ? 2.317   1.564   5.442   1.00 0.00 ? 89  VAL A CB   2  
ATOM 3087  C CG1  . VAL A 1 89  ? 2.436   1.647   6.964   1.00 0.00 ? 89  VAL A CG1  2  
ATOM 3088  C CG2  . VAL A 1 89  ? 2.642   0.139   4.985   1.00 0.00 ? 89  VAL A CG2  2  
ATOM 3089  H H    . VAL A 1 89  ? 0.834   1.822   2.870   1.00 0.00 ? 89  VAL A H    2  
ATOM 3090  H HA   . VAL A 1 89  ? 0.192   1.535   5.748   1.00 0.00 ? 89  VAL A HA   2  
ATOM 3091  H HB   . VAL A 1 89  ? 3.012   2.256   4.989   1.00 0.00 ? 89  VAL A HB   2  
ATOM 3092  H HG11 . VAL A 1 89  ? 1.453   1.757   7.397   1.00 0.00 ? 89  VAL A HG11 2  
ATOM 3093  H HG12 . VAL A 1 89  ? 2.896   0.745   7.339   1.00 0.00 ? 89  VAL A HG12 2  
ATOM 3094  H HG13 . VAL A 1 89  ? 3.045   2.498   7.232   1.00 0.00 ? 89  VAL A HG13 2  
ATOM 3095  H HG21 . VAL A 1 89  ? 1.849   -0.528  5.291   1.00 0.00 ? 89  VAL A HG21 2  
ATOM 3096  H HG22 . VAL A 1 89  ? 2.736   0.117   3.910   1.00 0.00 ? 89  VAL A HG22 2  
ATOM 3097  H HG23 . VAL A 1 89  ? 3.572   -0.180  5.433   1.00 0.00 ? 89  VAL A HG23 2  
ATOM 3098  N N    . LYS A 1 90  ? 0.224   4.052   5.984   1.00 0.00 ? 90  LYS A N    2  
ATOM 3099  C CA   . LYS A 1 90  ? 0.067   5.535   5.986   1.00 0.00 ? 90  LYS A CA   2  
ATOM 3100  C C    . LYS A 1 90  ? 1.315   6.166   6.608   1.00 0.00 ? 90  LYS A C    2  
ATOM 3101  O O    . LYS A 1 90  ? 1.694   5.848   7.718   1.00 0.00 ? 90  LYS A O    2  
ATOM 3102  C CB   . LYS A 1 90  ? -1.166  5.919   6.809   1.00 0.00 ? 90  LYS A CB   2  
ATOM 3103  C CG   . LYS A 1 90  ? -2.194  6.611   5.909   1.00 0.00 ? 90  LYS A CG   2  
ATOM 3104  C CD   . LYS A 1 90  ? -2.373  8.063   6.357   1.00 0.00 ? 90  LYS A CD   2  
ATOM 3105  C CE   . LYS A 1 90  ? -2.920  8.097   7.785   1.00 0.00 ? 90  LYS A CE   2  
ATOM 3106  N NZ   . LYS A 1 90  ? -2.295  9.227   8.528   1.00 0.00 ? 90  LYS A NZ   2  
ATOM 3107  H H    . LYS A 1 90  ? -0.063  3.531   6.761   1.00 0.00 ? 90  LYS A H    2  
ATOM 3108  H HA   . LYS A 1 90  ? -0.050  5.888   4.972   1.00 0.00 ? 90  LYS A HA   2  
ATOM 3109  H HB2  . LYS A 1 90  ? -1.605  5.028   7.237   1.00 0.00 ? 90  LYS A HB2  2  
ATOM 3110  H HB3  . LYS A 1 90  ? -0.875  6.593   7.603   1.00 0.00 ? 90  LYS A HB3  2  
ATOM 3111  H HG2  . LYS A 1 90  ? -1.849  6.588   4.886   1.00 0.00 ? 90  LYS A HG2  2  
ATOM 3112  H HG3  . LYS A 1 90  ? -3.141  6.096   5.982   1.00 0.00 ? 90  LYS A HG3  2  
ATOM 3113  H HD2  . LYS A 1 90  ? -1.419  8.568   6.325   1.00 0.00 ? 90  LYS A HD2  2  
ATOM 3114  H HD3  . LYS A 1 90  ? -3.067  8.561   5.697   1.00 0.00 ? 90  LYS A HD3  2  
ATOM 3115  H HE2  . LYS A 1 90  ? -3.991  8.233   7.757   1.00 0.00 ? 90  LYS A HE2  2  
ATOM 3116  H HE3  . LYS A 1 90  ? -2.688  7.166   8.282   1.00 0.00 ? 90  LYS A HE3  2  
ATOM 3117  H HZ1  . LYS A 1 90  ? -1.434  9.534   8.033   1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 3118  H HZ2  . LYS A 1 90  ? -2.966  10.020  8.581   1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 3119  H HZ3  . LYS A 1 90  ? -2.046  8.917   9.489   1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 3120  N N    . THR A 1 91  ? 1.963   7.051   5.902   1.00 0.00 ? 91  THR A N    2  
ATOM 3121  C CA   . THR A 1 91  ? 3.190   7.690   6.456   1.00 0.00 ? 91  THR A CA   2  
ATOM 3122  C C    . THR A 1 91  ? 2.865   9.107   6.930   1.00 0.00 ? 91  THR A C    2  
ATOM 3123  O O    . THR A 1 91  ? 3.021   9.435   8.090   1.00 0.00 ? 91  THR A O    2  
ATOM 3124  C CB   . THR A 1 91  ? 4.267   7.750   5.371   1.00 0.00 ? 91  THR A CB   2  
ATOM 3125  O OG1  . THR A 1 91  ? 3.656   7.626   4.095   1.00 0.00 ? 91  THR A OG1  2  
ATOM 3126  C CG2  . THR A 1 91  ? 5.266   6.609   5.573   1.00 0.00 ? 91  THR A CG2  2  
ATOM 3127  H H    . THR A 1 91  ? 1.646   7.292   5.006   1.00 0.00 ? 91  THR A H    2  
ATOM 3128  H HA   . THR A 1 91  ? 3.554   7.108   7.289   1.00 0.00 ? 91  THR A HA   2  
ATOM 3129  H HB   . THR A 1 91  ? 4.787   8.692   5.433   1.00 0.00 ? 91  THR A HB   2  
ATOM 3130  H HG1  . THR A 1 91  ? 2.936   8.259   4.049   1.00 0.00 ? 91  THR A HG1  2  
ATOM 3131  H HG21 . THR A 1 91  ? 4.733   5.672   5.639   1.00 0.00 ? 91  THR A HG21 2  
ATOM 3132  H HG22 . THR A 1 91  ? 5.950   6.577   4.739   1.00 0.00 ? 91  THR A HG22 2  
ATOM 3133  H HG23 . THR A 1 91  ? 5.819   6.774   6.486   1.00 0.00 ? 91  THR A HG23 2  
ATOM 3134  N N    . SER A 1 92  ? 2.416   9.950   6.043   1.00 0.00 ? 92  SER A N    2  
ATOM 3135  C CA   . SER A 1 92  ? 2.087   11.346  6.445   1.00 0.00 ? 92  SER A CA   2  
ATOM 3136  C C    . SER A 1 92  ? 1.322   12.035  5.313   1.00 0.00 ? 92  SER A C    2  
ATOM 3137  O O    . SER A 1 92  ? 0.161   12.369  5.448   1.00 0.00 ? 92  SER A O    2  
ATOM 3138  C CB   . SER A 1 92  ? 3.381   12.110  6.726   1.00 0.00 ? 92  SER A CB   2  
ATOM 3139  O OG   . SER A 1 92  ? 3.080   13.484  6.937   1.00 0.00 ? 92  SER A OG   2  
ATOM 3140  H H    . SER A 1 92  ? 2.301   9.667   5.112   1.00 0.00 ? 92  SER A H    2  
ATOM 3141  H HA   . SER A 1 92  ? 1.476   11.330  7.334   1.00 0.00 ? 92  SER A HA   2  
ATOM 3142  H HB2  . SER A 1 92  ? 3.851   11.711  7.609   1.00 0.00 ? 92  SER A HB2  2  
ATOM 3143  H HB3  . SER A 1 92  ? 4.051   12.003  5.884   1.00 0.00 ? 92  SER A HB3  2  
ATOM 3144  H HG   . SER A 1 92  ? 2.389   13.537  7.600   1.00 0.00 ? 92  SER A HG   2  
ATOM 3145  N N    . LYS A 1 93  ? 1.962   12.254  4.199   1.00 0.00 ? 93  LYS A N    2  
ATOM 3146  C CA   . LYS A 1 93  ? 1.273   12.923  3.061   1.00 0.00 ? 93  LYS A CA   2  
ATOM 3147  C C    . LYS A 1 93  ? 1.285   11.999  1.844   1.00 0.00 ? 93  LYS A C    2  
ATOM 3148  O O    . LYS A 1 93  ? 1.046   12.424  0.730   1.00 0.00 ? 93  LYS A O    2  
ATOM 3149  C CB   . LYS A 1 93  ? 2.005   14.221  2.719   1.00 0.00 ? 93  LYS A CB   2  
ATOM 3150  C CG   . LYS A 1 93  ? 1.153   15.419  3.142   1.00 0.00 ? 93  LYS A CG   2  
ATOM 3151  C CD   . LYS A 1 93  ? 2.016   16.401  3.936   1.00 0.00 ? 93  LYS A CD   2  
ATOM 3152  C CE   . LYS A 1 93  ? 1.353   16.692  5.284   1.00 0.00 ? 93  LYS A CE   2  
ATOM 3153  N NZ   . LYS A 1 93  ? 2.311   17.420  6.163   1.00 0.00 ? 93  LYS A NZ   2  
ATOM 3154  H H    . LYS A 1 93  ? 2.899   11.978  4.110   1.00 0.00 ? 93  LYS A H    2  
ATOM 3155  H HA   . LYS A 1 93  ? 0.252   13.145  3.337   1.00 0.00 ? 93  LYS A HA   2  
ATOM 3156  H HB2  . LYS A 1 93  ? 2.949   14.248  3.244   1.00 0.00 ? 93  LYS A HB2  2  
ATOM 3157  H HB3  . LYS A 1 93  ? 2.183   14.265  1.655   1.00 0.00 ? 93  LYS A HB3  2  
ATOM 3158  H HG2  . LYS A 1 93  ? 0.762   15.910  2.263   1.00 0.00 ? 93  LYS A HG2  2  
ATOM 3159  H HG3  . LYS A 1 93  ? 0.334   15.080  3.758   1.00 0.00 ? 93  LYS A HG3  2  
ATOM 3160  H HD2  . LYS A 1 93  ? 2.993   15.969  4.101   1.00 0.00 ? 93  LYS A HD2  2  
ATOM 3161  H HD3  . LYS A 1 93  ? 2.118   17.321  3.382   1.00 0.00 ? 93  LYS A HD3  2  
ATOM 3162  H HE2  . LYS A 1 93  ? 0.474   17.301  5.129   1.00 0.00 ? 93  LYS A HE2  2  
ATOM 3163  H HE3  . LYS A 1 93  ? 1.068   15.762  5.755   1.00 0.00 ? 93  LYS A HE3  2  
ATOM 3164  H HZ1  . LYS A 1 93  ? 2.952   17.994  5.578   1.00 0.00 ? 93  LYS A HZ1  2  
ATOM 3165  H HZ2  . LYS A 1 93  ? 1.786   18.040  6.812   1.00 0.00 ? 93  LYS A HZ2  2  
ATOM 3166  H HZ3  . LYS A 1 93  ? 2.868   16.735  6.711   1.00 0.00 ? 93  LYS A HZ3  2  
ATOM 3167  N N    . SER A 1 94  ? 1.564   10.739  2.041   1.00 0.00 ? 94  SER A N    2  
ATOM 3168  C CA   . SER A 1 94  ? 1.593   9.801   0.885   1.00 0.00 ? 94  SER A CA   2  
ATOM 3169  C C    . SER A 1 94  ? 1.303   8.375   1.360   1.00 0.00 ? 94  SER A C    2  
ATOM 3170  O O    . SER A 1 94  ? 1.542   8.026   2.499   1.00 0.00 ? 94  SER A O    2  
ATOM 3171  C CB   . SER A 1 94  ? 2.975   9.846   0.232   1.00 0.00 ? 94  SER A CB   2  
ATOM 3172  O OG   . SER A 1 94  ? 2.830   10.067  -1.163  1.00 0.00 ? 94  SER A OG   2  
ATOM 3173  H H    . SER A 1 94  ? 1.757   10.414  2.946   1.00 0.00 ? 94  SER A H    2  
ATOM 3174  H HA   . SER A 1 94  ? 0.847   10.097  0.164   1.00 0.00 ? 94  SER A HA   2  
ATOM 3175  H HB2  . SER A 1 94  ? 3.551   10.649  0.660   1.00 0.00 ? 94  SER A HB2  2  
ATOM 3176  H HB3  . SER A 1 94  ? 3.485   8.908   0.408   1.00 0.00 ? 94  SER A HB3  2  
ATOM 3177  H HG   . SER A 1 94  ? 2.190   9.435   -1.499  1.00 0.00 ? 94  SER A HG   2  
ATOM 3178  N N    . ILE A 1 95  ? 0.795   7.550   0.488   1.00 0.00 ? 95  ILE A N    2  
ATOM 3179  C CA   . ILE A 1 95  ? 0.493   6.144   0.871   1.00 0.00 ? 95  ILE A CA   2  
ATOM 3180  C C    . ILE A 1 95  ? 1.197   5.208   -0.110  1.00 0.00 ? 95  ILE A C    2  
ATOM 3181  O O    . ILE A 1 95  ? 1.225   5.453   -1.299  1.00 0.00 ? 95  ILE A O    2  
ATOM 3182  C CB   . ILE A 1 95  ? -1.020  5.915   0.815   1.00 0.00 ? 95  ILE A CB   2  
ATOM 3183  C CG1  . ILE A 1 95  ? -1.725  6.988   1.648   1.00 0.00 ? 95  ILE A CG1  2  
ATOM 3184  C CG2  . ILE A 1 95  ? -1.350  4.533   1.379   1.00 0.00 ? 95  ILE A CG2  2  
ATOM 3185  C CD1  . ILE A 1 95  ? -3.236  6.896   1.431   1.00 0.00 ? 95  ILE A CD1  2  
ATOM 3186  H H    . ILE A 1 95  ? 0.616   7.854   -0.426  1.00 0.00 ? 95  ILE A H    2  
ATOM 3187  H HA   . ILE A 1 95  ? 0.851   5.955   1.873   1.00 0.00 ? 95  ILE A HA   2  
ATOM 3188  H HB   . ILE A 1 95  ? -1.354  5.974   -0.212  1.00 0.00 ? 95  ILE A HB   2  
ATOM 3189  H HG12 . ILE A 1 95  ? -1.501  6.837   2.693   1.00 0.00 ? 95  ILE A HG12 2  
ATOM 3190  H HG13 . ILE A 1 95  ? -1.379  7.965   1.343   1.00 0.00 ? 95  ILE A HG13 2  
ATOM 3191  H HG21 . ILE A 1 95  ? -0.891  4.422   2.351   1.00 0.00 ? 95  ILE A HG21 2  
ATOM 3192  H HG22 . ILE A 1 95  ? -2.421  4.430   1.474   1.00 0.00 ? 95  ILE A HG22 2  
ATOM 3193  H HG23 . ILE A 1 95  ? -0.972  3.772   0.714   1.00 0.00 ? 95  ILE A HG23 2  
ATOM 3194  H HD11 . ILE A 1 95  ? -3.573  5.898   1.668   1.00 0.00 ? 95  ILE A HD11 2  
ATOM 3195  H HD12 . ILE A 1 95  ? -3.736  7.607   2.074   1.00 0.00 ? 95  ILE A HD12 2  
ATOM 3196  H HD13 . ILE A 1 95  ? -3.467  7.119   0.400   1.00 0.00 ? 95  ILE A HD13 2  
ATOM 3197  N N    . LEU A 1 96  ? 1.778   4.143   0.370   1.00 0.00 ? 96  LEU A N    2  
ATOM 3198  C CA   . LEU A 1 96  ? 2.482   3.215   -0.560  1.00 0.00 ? 96  LEU A CA   2  
ATOM 3199  C C    . LEU A 1 96  ? 1.737   1.882   -0.630  1.00 0.00 ? 96  LEU A C    2  
ATOM 3200  O O    . LEU A 1 96  ? 0.863   1.608   0.170   1.00 0.00 ? 96  LEU A O    2  
ATOM 3201  C CB   . LEU A 1 96  ? 3.940   2.984   -0.125  1.00 0.00 ? 96  LEU A CB   2  
ATOM 3202  C CG   . LEU A 1 96  ? 4.142   3.227   1.381   1.00 0.00 ? 96  LEU A CG   2  
ATOM 3203  C CD1  . LEU A 1 96  ? 3.939   4.709   1.709   1.00 0.00 ? 96  LEU A CD1  2  
ATOM 3204  C CD2  . LEU A 1 96  ? 3.160   2.377   2.191   1.00 0.00 ? 96  LEU A CD2  2  
ATOM 3205  H H    . LEU A 1 96  ? 1.751   3.960   1.332   1.00 0.00 ? 96  LEU A H    2  
ATOM 3206  H HA   . LEU A 1 96  ? 2.482   3.656   -1.543  1.00 0.00 ? 96  LEU A HA   2  
ATOM 3207  H HB2  . LEU A 1 96  ? 4.221   1.967   -0.356  1.00 0.00 ? 96  LEU A HB2  2  
ATOM 3208  H HB3  . LEU A 1 96  ? 4.574   3.658   -0.678  1.00 0.00 ? 96  LEU A HB3  2  
ATOM 3209  H HG   . LEU A 1 96  ? 5.153   2.948   1.645   1.00 0.00 ? 96  LEU A HG   2  
ATOM 3210  H HD11 . LEU A 1 96  ? 3.722   5.253   0.801   1.00 0.00 ? 96  LEU A HD11 2  
ATOM 3211  H HD12 . LEU A 1 96  ? 3.115   4.816   2.398   1.00 0.00 ? 96  LEU A HD12 2  
ATOM 3212  H HD13 . LEU A 1 96  ? 4.838   5.104   2.158   1.00 0.00 ? 96  LEU A HD13 2  
ATOM 3213  H HD21 . LEU A 1 96  ? 2.275   2.191   1.606   1.00 0.00 ? 96  LEU A HD21 2  
ATOM 3214  H HD22 . LEU A 1 96  ? 3.626   1.439   2.451   1.00 0.00 ? 96  LEU A HD22 2  
ATOM 3215  H HD23 . LEU A 1 96  ? 2.888   2.905   3.094   1.00 0.00 ? 96  LEU A HD23 2  
ATOM 3216  N N    . VAL A 1 97  ? 2.057   1.058   -1.593  1.00 0.00 ? 97  VAL A N    2  
ATOM 3217  C CA   . VAL A 1 97  ? 1.338   -0.239  -1.714  1.00 0.00 ? 97  VAL A CA   2  
ATOM 3218  C C    . VAL A 1 97  ? 2.261   -1.336  -2.252  1.00 0.00 ? 97  VAL A C    2  
ATOM 3219  O O    . VAL A 1 97  ? 2.175   -1.714  -3.402  1.00 0.00 ? 97  VAL A O    2  
ATOM 3220  C CB   . VAL A 1 97  ? 0.169   -0.071  -2.684  1.00 0.00 ? 97  VAL A CB   2  
ATOM 3221  C CG1  . VAL A 1 97  ? -0.821  -1.222  -2.500  1.00 0.00 ? 97  VAL A CG1  2  
ATOM 3222  C CG2  . VAL A 1 97  ? -0.535  1.258   -2.404  1.00 0.00 ? 97  VAL A CG2  2  
ATOM 3223  H H    . VAL A 1 97  ? 2.752   1.301   -2.240  1.00 0.00 ? 97  VAL A H    2  
ATOM 3224  H HA   . VAL A 1 97  ? 0.957   -0.531  -0.749  1.00 0.00 ? 97  VAL A HA   2  
ATOM 3225  H HB   . VAL A 1 97  ? 0.545   -0.076  -3.699  1.00 0.00 ? 97  VAL A HB   2  
ATOM 3226  H HG11 . VAL A 1 97  ? -0.406  -1.948  -1.817  1.00 0.00 ? 97  VAL A HG11 2  
ATOM 3227  H HG12 . VAL A 1 97  ? -1.748  -0.839  -2.100  1.00 0.00 ? 97  VAL A HG12 2  
ATOM 3228  H HG13 . VAL A 1 97  ? -1.008  -1.690  -3.454  1.00 0.00 ? 97  VAL A HG13 2  
ATOM 3229  H HG21 . VAL A 1 97  ? -0.623  1.402   -1.338  1.00 0.00 ? 97  VAL A HG21 2  
ATOM 3230  H HG22 . VAL A 1 97  ? 0.040   2.067   -2.830  1.00 0.00 ? 97  VAL A HG22 2  
ATOM 3231  H HG23 . VAL A 1 97  ? -1.521  1.245   -2.848  1.00 0.00 ? 97  VAL A HG23 2  
ATOM 3232  N N    . GLY A 1 98  ? 3.120   -1.881  -1.434  1.00 0.00 ? 98  GLY A N    2  
ATOM 3233  C CA   . GLY A 1 98  ? 3.996   -2.982  -1.926  1.00 0.00 ? 98  GLY A CA   2  
ATOM 3234  C C    . GLY A 1 98  ? 3.088   -4.160  -2.283  1.00 0.00 ? 98  GLY A C    2  
ATOM 3235  O O    . GLY A 1 98  ? 2.530   -4.803  -1.417  1.00 0.00 ? 98  GLY A O    2  
ATOM 3236  H H    . GLY A 1 98  ? 3.169   -1.589  -0.500  1.00 0.00 ? 98  GLY A H    2  
ATOM 3237  H HA2  . GLY A 1 98  ? 4.540   -2.654  -2.801  1.00 0.00 ? 98  GLY A HA2  2  
ATOM 3238  H HA3  . GLY A 1 98  ? 4.685   -3.280  -1.152  1.00 0.00 ? 98  GLY A HA3  2  
ATOM 3239  N N    . VAL A 1 99  ? 2.899   -4.431  -3.545  1.00 0.00 ? 99  VAL A N    2  
ATOM 3240  C CA   . VAL A 1 99  ? 1.985   -5.547  -3.925  1.00 0.00 ? 99  VAL A CA   2  
ATOM 3241  C C    . VAL A 1 99  ? 2.766   -6.661  -4.630  1.00 0.00 ? 99  VAL A C    2  
ATOM 3242  O O    . VAL A 1 99  ? 3.671   -6.412  -5.402  1.00 0.00 ? 99  VAL A O    2  
ATOM 3243  C CB   . VAL A 1 99  ? 0.884   -5.017  -4.859  1.00 0.00 ? 99  VAL A CB   2  
ATOM 3244  C CG1  . VAL A 1 99  ? -0.448  -5.686  -4.513  1.00 0.00 ? 99  VAL A CG1  2  
ATOM 3245  C CG2  . VAL A 1 99  ? 0.729   -3.500  -4.689  1.00 0.00 ? 99  VAL A CG2  2  
ATOM 3246  H H    . VAL A 1 99  ? 3.336   -3.892  -4.239  1.00 0.00 ? 99  VAL A H    2  
ATOM 3247  H HA   . VAL A 1 99  ? 1.528   -5.946  -3.031  1.00 0.00 ? 99  VAL A HA   2  
ATOM 3248  H HB   . VAL A 1 99  ? 1.143   -5.242  -5.884  1.00 0.00 ? 99  VAL A HB   2  
ATOM 3249  H HG11 . VAL A 1 99  ? -0.260  -6.631  -4.026  1.00 0.00 ? 99  VAL A HG11 2  
ATOM 3250  H HG12 . VAL A 1 99  ? -1.010  -5.044  -3.850  1.00 0.00 ? 99  VAL A HG12 2  
ATOM 3251  H HG13 . VAL A 1 99  ? -1.013  -5.852  -5.419  1.00 0.00 ? 99  VAL A HG13 2  
ATOM 3252  H HG21 . VAL A 1 99  ? 0.794   -3.248  -3.642  1.00 0.00 ? 99  VAL A HG21 2  
ATOM 3253  H HG22 . VAL A 1 99  ? 1.513   -2.991  -5.231  1.00 0.00 ? 99  VAL A HG22 2  
ATOM 3254  H HG23 . VAL A 1 99  ? -0.233  -3.189  -5.073  1.00 0.00 ? 99  VAL A HG23 2  
ATOM 3255  N N    . TYR A 1 100 ? 2.406   -7.890  -4.369  1.00 0.00 ? 100 TYR A N    2  
ATOM 3256  C CA   . TYR A 1 100 ? 3.099   -9.041  -5.019  1.00 0.00 ? 100 TYR A CA   2  
ATOM 3257  C C    . TYR A 1 100 ? 2.038   -9.959  -5.629  1.00 0.00 ? 100 TYR A C    2  
ATOM 3258  O O    . TYR A 1 100 ? 0.858   -9.782  -5.403  1.00 0.00 ? 100 TYR A O    2  
ATOM 3259  C CB   . TYR A 1 100 ? 3.905   -9.813  -3.970  1.00 0.00 ? 100 TYR A CB   2  
ATOM 3260  C CG   . TYR A 1 100 ? 2.958   -10.503 -3.019  1.00 0.00 ? 100 TYR A CG   2  
ATOM 3261  C CD1  . TYR A 1 100 ? 2.293   -11.671 -3.415  1.00 0.00 ? 100 TYR A CD1  2  
ATOM 3262  C CD2  . TYR A 1 100 ? 2.742   -9.973  -1.743  1.00 0.00 ? 100 TYR A CD2  2  
ATOM 3263  C CE1  . TYR A 1 100 ? 1.413   -12.308 -2.532  1.00 0.00 ? 100 TYR A CE1  2  
ATOM 3264  C CE2  . TYR A 1 100 ? 1.862   -10.609 -0.860  1.00 0.00 ? 100 TYR A CE2  2  
ATOM 3265  C CZ   . TYR A 1 100 ? 1.197   -11.776 -1.255  1.00 0.00 ? 100 TYR A CZ   2  
ATOM 3266  O OH   . TYR A 1 100 ? 0.327   -12.401 -0.386  1.00 0.00 ? 100 TYR A OH   2  
ATOM 3267  H H    . TYR A 1 100 ? 1.667   -8.058  -3.748  1.00 0.00 ? 100 TYR A H    2  
ATOM 3268  H HA   . TYR A 1 100 ? 3.759   -8.679  -5.795  1.00 0.00 ? 100 TYR A HA   2  
ATOM 3269  H HB2  . TYR A 1 100 ? 4.524   -10.551 -4.460  1.00 0.00 ? 100 TYR A HB2  2  
ATOM 3270  H HB3  . TYR A 1 100 ? 4.530   -9.128  -3.418  1.00 0.00 ? 100 TYR A HB3  2  
ATOM 3271  H HD1  . TYR A 1 100 ? 2.461   -12.081 -4.400  1.00 0.00 ? 100 TYR A HD1  2  
ATOM 3272  H HD2  . TYR A 1 100 ? 3.255   -9.073  -1.438  1.00 0.00 ? 100 TYR A HD2  2  
ATOM 3273  H HE1  . TYR A 1 100 ? 0.900   -13.209 -2.836  1.00 0.00 ? 100 TYR A HE1  2  
ATOM 3274  H HE2  . TYR A 1 100 ? 1.695   -10.201 0.124   1.00 0.00 ? 100 TYR A HE2  2  
ATOM 3275  H HH   . TYR A 1 100 ? -0.552  -12.048 -0.543  1.00 0.00 ? 100 TYR A HH   2  
ATOM 3276  N N    . ASN A 1 101 ? 2.430   -10.940 -6.401  1.00 0.00 ? 101 ASN A N    2  
ATOM 3277  C CA   . ASN A 1 101 ? 1.404   -11.839 -7.000  1.00 0.00 ? 101 ASN A CA   2  
ATOM 3278  C C    . ASN A 1 101 ? 1.961   -13.245 -7.217  1.00 0.00 ? 101 ASN A C    2  
ATOM 3279  O O    . ASN A 1 101 ? 2.856   -13.463 -8.010  1.00 0.00 ? 101 ASN A O    2  
ATOM 3280  C CB   . ASN A 1 101 ? 0.938   -11.277 -8.338  1.00 0.00 ? 101 ASN A CB   2  
ATOM 3281  C CG   . ASN A 1 101 ? 2.146   -11.042 -9.248  1.00 0.00 ? 101 ASN A CG   2  
ATOM 3282  O OD1  . ASN A 1 101 ? 2.530   -11.913 -10.001 1.00 0.00 ? 101 ASN A OD1  2  
ATOM 3283  N ND2  . ASN A 1 101 ? 2.764   -9.893  -9.210  1.00 0.00 ? 101 ASN A ND2  2  
ATOM 3284  H H    . ASN A 1 101 ? 3.383   -11.081 -6.582  1.00 0.00 ? 101 ASN A H    2  
ATOM 3285  H HA   . ASN A 1 101 ? 0.559   -11.899 -6.333  1.00 0.00 ? 101 ASN A HA   2  
ATOM 3286  H HB2  . ASN A 1 101 ? 0.266   -11.984 -8.804  1.00 0.00 ? 101 ASN A HB2  2  
ATOM 3287  H HB3  . ASN A 1 101 ? 0.422   -10.345 -8.173  1.00 0.00 ? 101 ASN A HB3  2  
ATOM 3288  H HD21 . ASN A 1 101 ? 2.455   -9.189  -8.603  1.00 0.00 ? 101 ASN A HD21 2  
ATOM 3289  H HD22 . ASN A 1 101 ? 3.538   -9.734  -9.791  1.00 0.00 ? 101 ASN A HD22 2  
ATOM 3290  N N    . GLU A 1 102 ? 1.411   -14.196 -6.518  1.00 0.00 ? 102 GLU A N    2  
ATOM 3291  C CA   . GLU A 1 102 ? 1.854   -15.613 -6.656  1.00 0.00 ? 102 GLU A CA   2  
ATOM 3292  C C    . GLU A 1 102 ? 3.367   -15.656 -6.811  1.00 0.00 ? 102 GLU A C    2  
ATOM 3293  O O    . GLU A 1 102 ? 3.914   -16.517 -7.473  1.00 0.00 ? 102 GLU A O    2  
ATOM 3294  C CB   . GLU A 1 102 ? 1.192   -16.242 -7.885  1.00 0.00 ? 102 GLU A CB   2  
ATOM 3295  C CG   . GLU A 1 102 ? 1.494   -15.399 -9.128  1.00 0.00 ? 102 GLU A CG   2  
ATOM 3296  C CD   . GLU A 1 102 ? 0.907   -16.085 -10.362 1.00 0.00 ? 102 GLU A CD   2  
ATOM 3297  O OE1  . GLU A 1 102 ? 0.187   -17.055 -10.191 1.00 0.00 ? 102 GLU A OE1  2  
ATOM 3298  O OE2  . GLU A 1 102 ? 1.185   -15.628 -11.458 1.00 0.00 ? 102 GLU A OE2  2  
ATOM 3299  H H    . GLU A 1 102 ? 0.692   -13.974 -5.903  1.00 0.00 ? 102 GLU A H    2  
ATOM 3300  H HA   . GLU A 1 102 ? 1.568   -16.165 -5.773  1.00 0.00 ? 102 GLU A HA   2  
ATOM 3301  H HB2  . GLU A 1 102 ? 1.575   -17.241 -8.026  1.00 0.00 ? 102 GLU A HB2  2  
ATOM 3302  H HB3  . GLU A 1 102 ? 0.123   -16.285 -7.734  1.00 0.00 ? 102 GLU A HB3  2  
ATOM 3303  H HG2  . GLU A 1 102 ? 1.052   -14.420 -9.016  1.00 0.00 ? 102 GLU A HG2  2  
ATOM 3304  H HG3  . GLU A 1 102 ? 2.563   -15.303 -9.247  1.00 0.00 ? 102 GLU A HG3  2  
ATOM 3305  N N    . LYS A 1 103 ? 4.048   -14.727 -6.211  1.00 0.00 ? 103 LYS A N    2  
ATOM 3306  C CA   . LYS A 1 103 ? 5.533   -14.712 -6.334  1.00 0.00 ? 103 LYS A CA   2  
ATOM 3307  C C    . LYS A 1 103 ? 6.188   -14.511 -4.963  1.00 0.00 ? 103 LYS A C    2  
ATOM 3308  O O    . LYS A 1 103 ? 7.315   -14.910 -4.747  1.00 0.00 ? 103 LYS A O    2  
ATOM 3309  C CB   . LYS A 1 103 ? 5.952   -13.578 -7.271  1.00 0.00 ? 103 LYS A CB   2  
ATOM 3310  C CG   . LYS A 1 103 ? 6.273   -14.154 -8.652  1.00 0.00 ? 103 LYS A CG   2  
ATOM 3311  C CD   . LYS A 1 103 ? 7.540   -15.010 -8.567  1.00 0.00 ? 103 LYS A CD   2  
ATOM 3312  C CE   . LYS A 1 103 ? 7.304   -16.345 -9.276  1.00 0.00 ? 103 LYS A CE   2  
ATOM 3313  N NZ   . LYS A 1 103 ? 8.277   -16.492 -10.396 1.00 0.00 ? 103 LYS A NZ   2  
ATOM 3314  H H    . LYS A 1 103 ? 3.577   -14.037 -5.691  1.00 0.00 ? 103 LYS A H    2  
ATOM 3315  H HA   . LYS A 1 103 ? 5.863   -15.652 -6.750  1.00 0.00 ? 103 LYS A HA   2  
ATOM 3316  H HB2  . LYS A 1 103 ? 5.144   -12.864 -7.357  1.00 0.00 ? 103 LYS A HB2  2  
ATOM 3317  H HB3  . LYS A 1 103 ? 6.827   -13.086 -6.875  1.00 0.00 ? 103 LYS A HB3  2  
ATOM 3318  H HG2  . LYS A 1 103 ? 5.447   -14.765 -8.986  1.00 0.00 ? 103 LYS A HG2  2  
ATOM 3319  H HG3  . LYS A 1 103 ? 6.432   -13.348 -9.352  1.00 0.00 ? 103 LYS A HG3  2  
ATOM 3320  H HD2  . LYS A 1 103 ? 8.358   -14.488 -9.042  1.00 0.00 ? 103 LYS A HD2  2  
ATOM 3321  H HD3  . LYS A 1 103 ? 7.782   -15.192 -7.531  1.00 0.00 ? 103 LYS A HD3  2  
ATOM 3322  H HE2  . LYS A 1 103 ? 7.438   -17.156 -8.574  1.00 0.00 ? 103 LYS A HE2  2  
ATOM 3323  H HE3  . LYS A 1 103 ? 6.298   -16.373 -9.667  1.00 0.00 ? 103 LYS A HE3  2  
ATOM 3324  H HZ1  . LYS A 1 103 ? 9.223   -16.204 -10.073 1.00 0.00 ? 103 LYS A HZ1  2  
ATOM 3325  H HZ2  . LYS A 1 103 ? 8.303   -17.484 -10.706 1.00 0.00 ? 103 LYS A HZ2  2  
ATOM 3326  H HZ3  . LYS A 1 103 ? 7.986   -15.887 -11.190 1.00 0.00 ? 103 LYS A HZ3  2  
ATOM 3327  N N    . ILE A 1 104 ? 5.507   -13.897 -4.036  1.00 0.00 ? 104 ILE A N    2  
ATOM 3328  C CA   . ILE A 1 104 ? 6.121   -13.680 -2.696  1.00 0.00 ? 104 ILE A CA   2  
ATOM 3329  C C    . ILE A 1 104 ? 5.094   -13.962 -1.597  1.00 0.00 ? 104 ILE A C    2  
ATOM 3330  O O    . ILE A 1 104 ? 3.907   -13.773 -1.772  1.00 0.00 ? 104 ILE A O    2  
ATOM 3331  C CB   . ILE A 1 104 ? 6.614   -12.231 -2.596  1.00 0.00 ? 104 ILE A CB   2  
ATOM 3332  C CG1  . ILE A 1 104 ? 7.965   -12.109 -3.305  1.00 0.00 ? 104 ILE A CG1  2  
ATOM 3333  C CG2  . ILE A 1 104 ? 6.779   -11.833 -1.125  1.00 0.00 ? 104 ILE A CG2  2  
ATOM 3334  C CD1  . ILE A 1 104 ? 7.742   -11.987 -4.814  1.00 0.00 ? 104 ILE A CD1  2  
ATOM 3335  H H    . ILE A 1 104 ? 4.601   -13.574 -4.220  1.00 0.00 ? 104 ILE A H    2  
ATOM 3336  H HA   . ILE A 1 104 ? 6.961   -14.350 -2.579  1.00 0.00 ? 104 ILE A HA   2  
ATOM 3337  H HB   . ILE A 1 104 ? 5.898   -11.575 -3.067  1.00 0.00 ? 104 ILE A HB   2  
ATOM 3338  H HG12 . ILE A 1 104 ? 8.484   -11.233 -2.944  1.00 0.00 ? 104 ILE A HG12 2  
ATOM 3339  H HG13 . ILE A 1 104 ? 8.559   -12.988 -3.101  1.00 0.00 ? 104 ILE A HG13 2  
ATOM 3340  H HG21 . ILE A 1 104 ? 5.838   -11.961 -0.612  1.00 0.00 ? 104 ILE A HG21 2  
ATOM 3341  H HG22 . ILE A 1 104 ? 7.528   -12.459 -0.665  1.00 0.00 ? 104 ILE A HG22 2  
ATOM 3342  H HG23 . ILE A 1 104 ? 7.085   -10.801 -1.064  1.00 0.00 ? 104 ILE A HG23 2  
ATOM 3343  H HD11 . ILE A 1 104 ? 6.684   -11.899 -5.015  1.00 0.00 ? 104 ILE A HD11 2  
ATOM 3344  H HD12 . ILE A 1 104 ? 8.253   -11.111 -5.184  1.00 0.00 ? 104 ILE A HD12 2  
ATOM 3345  H HD13 . ILE A 1 104 ? 8.130   -12.866 -5.306  1.00 0.00 ? 104 ILE A HD13 2  
ATOM 3346  N N    . GLN A 1 105 ? 5.553   -14.413 -0.459  1.00 0.00 ? 105 GLN A N    2  
ATOM 3347  C CA   . GLN A 1 105 ? 4.637   -14.711 0.662   1.00 0.00 ? 105 GLN A CA   2  
ATOM 3348  C C    . GLN A 1 105 ? 4.658   -13.541 1.656   1.00 0.00 ? 105 GLN A C    2  
ATOM 3349  O O    . GLN A 1 105 ? 5.685   -12.925 1.859   1.00 0.00 ? 105 GLN A O    2  
ATOM 3350  C CB   . GLN A 1 105 ? 5.137   -15.969 1.357   1.00 0.00 ? 105 GLN A CB   2  
ATOM 3351  C CG   . GLN A 1 105 ? 6.637   -15.837 1.628   1.00 0.00 ? 105 GLN A CG   2  
ATOM 3352  C CD   . GLN A 1 105 ? 7.417   -16.768 0.697   1.00 0.00 ? 105 GLN A CD   2  
ATOM 3353  O OE1  . GLN A 1 105 ? 7.220   -16.751 -0.502  1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3354  N NE2  . GLN A 1 105 ? 8.301   -17.582 1.203   1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3355  H H    . GLN A 1 105 ? 6.509   -14.561 -0.339  1.00 0.00 ? 105 GLN A H    2  
ATOM 3356  H HA   . GLN A 1 105 ? 3.636   -14.868 0.291   1.00 0.00 ? 105 GLN A HA   2  
ATOM 3357  H HB2  . GLN A 1 105 ? 4.619   -16.085 2.285   1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3358  H HB3  . GLN A 1 105 ? 4.959   -16.829 0.730   1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3359  H HG2  . GLN A 1 105 ? 6.944   -14.815 1.457   1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3360  H HG3  . GLN A 1 105 ? 6.841   -16.106 2.654   1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3361  H HE21 . GLN A 1 105 ? 8.461   -17.593 2.170   1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3362  H HE22 . GLN A 1 105 ? 8.808   -18.182 0.616   1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3363  N N    . PRO A 1 106 ? 3.522   -13.271 2.249   1.00 0.00 ? 106 PRO A N    2  
ATOM 3364  C CA   . PRO A 1 106 ? 3.391   -12.178 3.231   1.00 0.00 ? 106 PRO A CA   2  
ATOM 3365  C C    . PRO A 1 106 ? 4.212   -12.496 4.486   1.00 0.00 ? 106 PRO A C    2  
ATOM 3366  O O    . PRO A 1 106 ? 4.805   -13.551 4.602   1.00 0.00 ? 106 PRO A O    2  
ATOM 3367  C CB   . PRO A 1 106 ? 1.895   -12.134 3.570   1.00 0.00 ? 106 PRO A CB   2  
ATOM 3368  C CG   . PRO A 1 106 ? 1.209   -13.306 2.822   1.00 0.00 ? 106 PRO A CG   2  
ATOM 3369  C CD   . PRO A 1 106 ? 2.282   -14.023 1.988   1.00 0.00 ? 106 PRO A CD   2  
ATOM 3370  H HA   . PRO A 1 106 ? 3.700   -11.240 2.801   1.00 0.00 ? 106 PRO A HA   2  
ATOM 3371  H HB2  . PRO A 1 106 ? 1.759   -12.245 4.638   1.00 0.00 ? 106 PRO A HB2  2  
ATOM 3372  H HB3  . PRO A 1 106 ? 1.472   -11.198 3.241   1.00 0.00 ? 106 PRO A HB3  2  
ATOM 3373  H HG2  . PRO A 1 106 ? 0.777   -13.993 3.537   1.00 0.00 ? 106 PRO A HG2  2  
ATOM 3374  H HG3  . PRO A 1 106 ? 0.439   -12.924 2.171   1.00 0.00 ? 106 PRO A HG3  2  
ATOM 3375  H HD2  . PRO A 1 106 ? 2.386   -15.049 2.312   1.00 0.00 ? 106 PRO A HD2  2  
ATOM 3376  H HD3  . PRO A 1 106 ? 2.034   -13.980 0.939   1.00 0.00 ? 106 PRO A HD3  2  
ATOM 3377  N N    . GLY A 1 107 ? 4.246   -11.594 5.431   1.00 0.00 ? 107 GLY A N    2  
ATOM 3378  C CA   . GLY A 1 107 ? 5.020   -11.846 6.681   1.00 0.00 ? 107 GLY A CA   2  
ATOM 3379  C C    . GLY A 1 107 ? 6.512   -11.619 6.428   1.00 0.00 ? 107 GLY A C    2  
ATOM 3380  O O    . GLY A 1 107 ? 7.328   -11.764 7.316   1.00 0.00 ? 107 GLY A O    2  
ATOM 3381  H H    . GLY A 1 107 ? 3.757   -10.751 5.320   1.00 0.00 ? 107 GLY A H    2  
ATOM 3382  H HA2  . GLY A 1 107 ? 4.679   -11.174 7.455   1.00 0.00 ? 107 GLY A HA2  2  
ATOM 3383  H HA3  . GLY A 1 107 ? 4.865   -12.867 6.999   1.00 0.00 ? 107 GLY A HA3  2  
ATOM 3384  N N    . THR A 1 108 ? 6.878   -11.262 5.228   1.00 0.00 ? 108 THR A N    2  
ATOM 3385  C CA   . THR A 1 108 ? 8.320   -11.029 4.932   1.00 0.00 ? 108 THR A CA   2  
ATOM 3386  C C    . THR A 1 108 ? 8.497   -9.647  4.301   1.00 0.00 ? 108 THR A C    2  
ATOM 3387  O O    . THR A 1 108 ? 9.382   -8.896  4.663   1.00 0.00 ? 108 THR A O    2  
ATOM 3388  C CB   . THR A 1 108 ? 8.821   -12.100 3.960   1.00 0.00 ? 108 THR A CB   2  
ATOM 3389  O OG1  . THR A 1 108 ? 8.736   -13.375 4.580   1.00 0.00 ? 108 THR A OG1  2  
ATOM 3390  C CG2  . THR A 1 108 ? 10.275  -11.808 3.581   1.00 0.00 ? 108 THR A CG2  2  
ATOM 3391  H H    . THR A 1 108 ? 6.206   -11.149 4.523   1.00 0.00 ? 108 THR A H    2  
ATOM 3392  H HA   . THR A 1 108 ? 8.888   -11.081 5.848   1.00 0.00 ? 108 THR A HA   2  
ATOM 3393  H HB   . THR A 1 108 ? 8.212   -12.091 3.069   1.00 0.00 ? 108 THR A HB   2  
ATOM 3394  H HG1  . THR A 1 108 ? 9.283   -13.985 4.078   1.00 0.00 ? 108 THR A HG1  2  
ATOM 3395  H HG21 . THR A 1 108 ? 10.460  -10.746 3.656   1.00 0.00 ? 108 THR A HG21 2  
ATOM 3396  H HG22 . THR A 1 108 ? 10.935  -12.337 4.253   1.00 0.00 ? 108 THR A HG22 2  
ATOM 3397  H HG23 . THR A 1 108 ? 10.454  -12.135 2.569   1.00 0.00 ? 108 THR A HG23 2  
ATOM 3398  N N    . ALA A 1 109 ? 7.662   -9.306  3.358   1.00 0.00 ? 109 ALA A N    2  
ATOM 3399  C CA   . ALA A 1 109 ? 7.782   -7.974  2.702   1.00 0.00 ? 109 ALA A CA   2  
ATOM 3400  C C    . ALA A 1 109 ? 7.147   -6.905  3.593   1.00 0.00 ? 109 ALA A C    2  
ATOM 3401  O O    . ALA A 1 109 ? 7.662   -5.813  3.731   1.00 0.00 ? 109 ALA A O    2  
ATOM 3402  C CB   . ALA A 1 109 ? 7.059   -8.005  1.356   1.00 0.00 ? 109 ALA A CB   2  
ATOM 3403  H H    . ALA A 1 109 ? 6.957   -9.925  3.080   1.00 0.00 ? 109 ALA A H    2  
ATOM 3404  H HA   . ALA A 1 109 ? 8.825   -7.742  2.546   1.00 0.00 ? 109 ALA A HA   2  
ATOM 3405  H HB1  . ALA A 1 109 ? 6.193   -8.646  1.428   1.00 0.00 ? 109 ALA A HB1  2  
ATOM 3406  H HB2  . ALA A 1 109 ? 6.745   -7.006  1.093   1.00 0.00 ? 109 ALA A HB2  2  
ATOM 3407  H HB3  . ALA A 1 109 ? 7.726   -8.385  0.597   1.00 0.00 ? 109 ALA A HB3  2  
ATOM 3408  N N    . ALA A 1 110 ? 6.028   -7.208  4.192   1.00 0.00 ? 110 ALA A N    2  
ATOM 3409  C CA   . ALA A 1 110 ? 5.358   -6.206  5.068   1.00 0.00 ? 110 ALA A CA   2  
ATOM 3410  C C    . ALA A 1 110 ? 6.321   -5.754  6.167   1.00 0.00 ? 110 ALA A C    2  
ATOM 3411  O O    . ALA A 1 110 ? 6.118   -4.741  6.806   1.00 0.00 ? 110 ALA A O    2  
ATOM 3412  C CB   . ALA A 1 110 ? 4.118   -6.840  5.703   1.00 0.00 ? 110 ALA A CB   2  
ATOM 3413  H H    . ALA A 1 110 ? 5.627   -8.092  4.064   1.00 0.00 ? 110 ALA A H    2  
ATOM 3414  H HA   . ALA A 1 110 ? 5.063   -5.352  4.477   1.00 0.00 ? 110 ALA A HA   2  
ATOM 3415  H HB1  . ALA A 1 110 ? 3.629   -7.474  4.979   1.00 0.00 ? 110 ALA A HB1  2  
ATOM 3416  H HB2  . ALA A 1 110 ? 4.412   -7.429  6.558   1.00 0.00 ? 110 ALA A HB2  2  
ATOM 3417  H HB3  . ALA A 1 110 ? 3.437   -6.062  6.017   1.00 0.00 ? 110 ALA A HB3  2  
ATOM 3418  N N    . ASN A 1 111 ? 7.368   -6.498  6.395   1.00 0.00 ? 111 ASN A N    2  
ATOM 3419  C CA   . ASN A 1 111 ? 8.340   -6.110  7.455   1.00 0.00 ? 111 ASN A CA   2  
ATOM 3420  C C    . ASN A 1 111 ? 9.249   -4.990  6.938   1.00 0.00 ? 111 ASN A C    2  
ATOM 3421  O O    . ASN A 1 111 ? 9.494   -4.014  7.619   1.00 0.00 ? 111 ASN A O    2  
ATOM 3422  C CB   . ASN A 1 111 ? 9.193   -7.322  7.832   1.00 0.00 ? 111 ASN A CB   2  
ATOM 3423  C CG   . ASN A 1 111 ? 8.634   -7.966  9.102   1.00 0.00 ? 111 ASN A CG   2  
ATOM 3424  O OD1  . ASN A 1 111 ? 7.945   -8.966  9.040   1.00 0.00 ? 111 ASN A OD1  2  
ATOM 3425  N ND2  . ASN A 1 111 ? 8.902   -7.431  10.262  1.00 0.00 ? 111 ASN A ND2  2  
ATOM 3426  H H    . ASN A 1 111 ? 7.514   -7.313  5.872   1.00 0.00 ? 111 ASN A H    2  
ATOM 3427  H HA   . ASN A 1 111 ? 7.804   -5.764  8.326   1.00 0.00 ? 111 ASN A HA   2  
ATOM 3428  H HB2  . ASN A 1 111 ? 9.175   -8.040  7.024   1.00 0.00 ? 111 ASN A HB2  2  
ATOM 3429  H HB3  . ASN A 1 111 ? 10.210  -7.005  8.009   1.00 0.00 ? 111 ASN A HB3  2  
ATOM 3430  H HD21 . ASN A 1 111 ? 9.456   -6.624  10.312  1.00 0.00 ? 111 ASN A HD21 2  
ATOM 3431  H HD22 . ASN A 1 111 ? 8.549   -7.834  11.083  1.00 0.00 ? 111 ASN A HD22 2  
ATOM 3432  N N    . VAL A 1 112 ? 9.755   -5.124  5.742   1.00 0.00 ? 112 VAL A N    2  
ATOM 3433  C CA   . VAL A 1 112 ? 10.651  -4.067  5.191   1.00 0.00 ? 112 VAL A CA   2  
ATOM 3434  C C    . VAL A 1 112 ? 9.835   -2.818  4.854   1.00 0.00 ? 112 VAL A C    2  
ATOM 3435  O O    . VAL A 1 112 ? 10.359  -1.723  4.785   1.00 0.00 ? 112 VAL A O    2  
ATOM 3436  C CB   . VAL A 1 112 ? 11.340  -4.585  3.926   1.00 0.00 ? 112 VAL A CB   2  
ATOM 3437  C CG1  . VAL A 1 112 ? 10.303  -4.787  2.819   1.00 0.00 ? 112 VAL A CG1  2  
ATOM 3438  C CG2  . VAL A 1 112 ? 12.385  -3.567  3.465   1.00 0.00 ? 112 VAL A CG2  2  
ATOM 3439  H H    . VAL A 1 112 ? 9.550   -5.920  5.209   1.00 0.00 ? 112 VAL A H    2  
ATOM 3440  H HA   . VAL A 1 112 ? 11.400  -3.815  5.928   1.00 0.00 ? 112 VAL A HA   2  
ATOM 3441  H HB   . VAL A 1 112 ? 11.823  -5.528  4.141   1.00 0.00 ? 112 VAL A HB   2  
ATOM 3442  H HG11 . VAL A 1 112 ? 9.369   -4.332  3.114   1.00 0.00 ? 112 VAL A HG11 2  
ATOM 3443  H HG12 . VAL A 1 112 ? 10.656  -4.327  1.908   1.00 0.00 ? 112 VAL A HG12 2  
ATOM 3444  H HG13 . VAL A 1 112 ? 10.154  -5.843  2.655   1.00 0.00 ? 112 VAL A HG13 2  
ATOM 3445  H HG21 . VAL A 1 112 ? 12.491  -2.796  4.214   1.00 0.00 ? 112 VAL A HG21 2  
ATOM 3446  H HG22 . VAL A 1 112 ? 13.334  -4.064  3.323   1.00 0.00 ? 112 VAL A HG22 2  
ATOM 3447  H HG23 . VAL A 1 112 ? 12.068  -3.123  2.533   1.00 0.00 ? 112 VAL A HG23 2  
ATOM 3448  N N    . VAL A 1 113 ? 8.556   -2.967  4.641   1.00 0.00 ? 113 VAL A N    2  
ATOM 3449  C CA   . VAL A 1 113 ? 7.717   -1.782  4.306   1.00 0.00 ? 113 VAL A CA   2  
ATOM 3450  C C    . VAL A 1 113 ? 7.557   -0.900  5.545   1.00 0.00 ? 113 VAL A C    2  
ATOM 3451  O O    . VAL A 1 113 ? 7.473   0.309   5.452   1.00 0.00 ? 113 VAL A O    2  
ATOM 3452  C CB   . VAL A 1 113 ? 6.339   -2.248  3.832   1.00 0.00 ? 113 VAL A CB   2  
ATOM 3453  C CG1  . VAL A 1 113 ? 5.607   -1.083  3.165   1.00 0.00 ? 113 VAL A CG1  2  
ATOM 3454  C CG2  . VAL A 1 113 ? 6.507   -3.388  2.826   1.00 0.00 ? 113 VAL A CG2  2  
ATOM 3455  H H    . VAL A 1 113 ? 8.149   -3.857  4.699   1.00 0.00 ? 113 VAL A H    2  
ATOM 3456  H HA   . VAL A 1 113 ? 8.193   -1.215  3.520   1.00 0.00 ? 113 VAL A HA   2  
ATOM 3457  H HB   . VAL A 1 113 ? 5.764   -2.596  4.680   1.00 0.00 ? 113 VAL A HB   2  
ATOM 3458  H HG11 . VAL A 1 113 ? 5.563   -0.248  3.847   1.00 0.00 ? 113 VAL A HG11 2  
ATOM 3459  H HG12 . VAL A 1 113 ? 6.137   -0.789  2.271   1.00 0.00 ? 113 VAL A HG12 2  
ATOM 3460  H HG13 . VAL A 1 113 ? 4.605   -1.390  2.905   1.00 0.00 ? 113 VAL A HG13 2  
ATOM 3461  H HG21 . VAL A 1 113 ? 7.535   -3.430  2.498   1.00 0.00 ? 113 VAL A HG21 2  
ATOM 3462  H HG22 . VAL A 1 113 ? 6.239   -4.323  3.293   1.00 0.00 ? 113 VAL A HG22 2  
ATOM 3463  H HG23 . VAL A 1 113 ? 5.864   -3.214  1.975   1.00 0.00 ? 113 VAL A HG23 2  
ATOM 3464  N N    . GLU A 1 114 ? 7.509   -1.492  6.706   1.00 0.00 ? 114 GLU A N    2  
ATOM 3465  C CA   . GLU A 1 114 ? 7.349   -0.685  7.946   1.00 0.00 ? 114 GLU A CA   2  
ATOM 3466  C C    . GLU A 1 114 ? 8.699   -0.089  8.358   1.00 0.00 ? 114 GLU A C    2  
ATOM 3467  O O    . GLU A 1 114 ? 8.763   0.834   9.144   1.00 0.00 ? 114 GLU A O    2  
ATOM 3468  C CB   . GLU A 1 114 ? 6.818   -1.576  9.071   1.00 0.00 ? 114 GLU A CB   2  
ATOM 3469  C CG   . GLU A 1 114 ? 5.631   -0.887  9.745   1.00 0.00 ? 114 GLU A CG   2  
ATOM 3470  C CD   . GLU A 1 114 ? 6.141   0.209   10.682  1.00 0.00 ? 114 GLU A CD   2  
ATOM 3471  O OE1  . GLU A 1 114 ? 7.332   0.229   10.943  1.00 0.00 ? 114 GLU A OE1  2  
ATOM 3472  O OE2  . GLU A 1 114 ? 5.333   1.010   11.120  1.00 0.00 ? 114 GLU A OE2  2  
ATOM 3473  H H    . GLU A 1 114 ? 7.576   -2.469  6.761   1.00 0.00 ? 114 GLU A H    2  
ATOM 3474  H HA   . GLU A 1 114 ? 6.647   0.115   7.763   1.00 0.00 ? 114 GLU A HA   2  
ATOM 3475  H HB2  . GLU A 1 114 ? 6.501   -2.524  8.660   1.00 0.00 ? 114 GLU A HB2  2  
ATOM 3476  H HB3  . GLU A 1 114 ? 7.598   -1.740  9.798   1.00 0.00 ? 114 GLU A HB3  2  
ATOM 3477  H HG2  . GLU A 1 114 ? 4.994   -0.449  8.989   1.00 0.00 ? 114 GLU A HG2  2  
ATOM 3478  H HG3  . GLU A 1 114 ? 5.069   -1.612  10.314  1.00 0.00 ? 114 GLU A HG3  2  
ATOM 3479  N N    . LYS A 1 115 ? 9.778   -0.609  7.837   1.00 0.00 ? 115 LYS A N    2  
ATOM 3480  C CA   . LYS A 1 115 ? 11.116  -0.066  8.209   1.00 0.00 ? 115 LYS A CA   2  
ATOM 3481  C C    . LYS A 1 115 ? 11.460  1.122   7.306   1.00 0.00 ? 115 LYS A C    2  
ATOM 3482  O O    . LYS A 1 115 ? 11.685  2.222   7.774   1.00 0.00 ? 115 LYS A O    2  
ATOM 3483  C CB   . LYS A 1 115 ? 12.178  -1.158  8.046   1.00 0.00 ? 115 LYS A CB   2  
ATOM 3484  C CG   . LYS A 1 115 ? 12.825  -1.450  9.401   1.00 0.00 ? 115 LYS A CG   2  
ATOM 3485  C CD   . LYS A 1 115 ? 13.934  -2.492  9.231   1.00 0.00 ? 115 LYS A CD   2  
ATOM 3486  C CE   . LYS A 1 115 ? 13.962  -3.416  10.451  1.00 0.00 ? 115 LYS A CE   2  
ATOM 3487  N NZ   . LYS A 1 115 ? 12.930  -4.479  10.295  1.00 0.00 ? 115 LYS A NZ   2  
ATOM 3488  H H    . LYS A 1 115 ? 9.709   -1.356  7.206   1.00 0.00 ? 115 LYS A H    2  
ATOM 3489  H HA   . LYS A 1 115 ? 11.096  0.261   9.237   1.00 0.00 ? 115 LYS A HA   2  
ATOM 3490  H HB2  . LYS A 1 115 ? 11.713  -2.058  7.667   1.00 0.00 ? 115 LYS A HB2  2  
ATOM 3491  H HB3  . LYS A 1 115 ? 12.935  -0.826  7.352   1.00 0.00 ? 115 LYS A HB3  2  
ATOM 3492  H HG2  . LYS A 1 115 ? 13.245  -0.538  9.802   1.00 0.00 ? 115 LYS A HG2  2  
ATOM 3493  H HG3  . LYS A 1 115 ? 12.078  -1.831  10.083  1.00 0.00 ? 115 LYS A HG3  2  
ATOM 3494  H HD2  . LYS A 1 115 ? 13.745  -3.076  8.341   1.00 0.00 ? 115 LYS A HD2  2  
ATOM 3495  H HD3  . LYS A 1 115 ? 14.887  -1.993  9.138   1.00 0.00 ? 115 LYS A HD3  2  
ATOM 3496  H HE2  . LYS A 1 115 ? 14.938  -3.871  10.534  1.00 0.00 ? 115 LYS A HE2  2  
ATOM 3497  H HE3  . LYS A 1 115 ? 13.756  -2.841  11.341  1.00 0.00 ? 115 LYS A HE3  2  
ATOM 3498  H HZ1  . LYS A 1 115 ? 12.032  -4.049  9.995   1.00 0.00 ? 115 LYS A HZ1  2  
ATOM 3499  H HZ2  . LYS A 1 115 ? 13.241  -5.162  9.576   1.00 0.00 ? 115 LYS A HZ2  2  
ATOM 3500  H HZ3  . LYS A 1 115 ? 12.796  -4.967  11.203  1.00 0.00 ? 115 LYS A HZ3  2  
ATOM 3501  N N    . LEU A 1 116 ? 11.511  0.914   6.019   1.00 0.00 ? 116 LEU A N    2  
ATOM 3502  C CA   . LEU A 1 116 ? 11.847  2.040   5.097   1.00 0.00 ? 116 LEU A CA   2  
ATOM 3503  C C    . LEU A 1 116 ? 10.992  3.259   5.454   1.00 0.00 ? 116 LEU A C    2  
ATOM 3504  O O    . LEU A 1 116 ? 11.438  4.386   5.371   1.00 0.00 ? 116 LEU A O    2  
ATOM 3505  C CB   . LEU A 1 116 ? 11.562  1.622   3.650   1.00 0.00 ? 116 LEU A CB   2  
ATOM 3506  C CG   . LEU A 1 116 ? 12.848  1.120   2.982   1.00 0.00 ? 116 LEU A CG   2  
ATOM 3507  C CD1  . LEU A 1 116 ? 13.964  2.152   3.156   1.00 0.00 ? 116 LEU A CD1  2  
ATOM 3508  C CD2  . LEU A 1 116 ? 13.274  -0.205  3.618   1.00 0.00 ? 116 LEU A CD2  2  
ATOM 3509  H H    . LEU A 1 116 ? 11.332  0.022   5.658   1.00 0.00 ? 116 LEU A H    2  
ATOM 3510  H HA   . LEU A 1 116 ? 12.891  2.292   5.204   1.00 0.00 ? 116 LEU A HA   2  
ATOM 3511  H HB2  . LEU A 1 116 ? 10.825  0.832   3.644   1.00 0.00 ? 116 LEU A HB2  2  
ATOM 3512  H HB3  . LEU A 1 116 ? 11.182  2.470   3.101   1.00 0.00 ? 116 LEU A HB3  2  
ATOM 3513  H HG   . LEU A 1 116 ? 12.667  0.971   1.930   1.00 0.00 ? 116 LEU A HG   2  
ATOM 3514  H HD11 . LEU A 1 116 ? 13.529  3.127   3.318   1.00 0.00 ? 116 LEU A HD11 2  
ATOM 3515  H HD12 . LEU A 1 116 ? 14.573  1.883   4.006   1.00 0.00 ? 116 LEU A HD12 2  
ATOM 3516  H HD13 . LEU A 1 116 ? 14.575  2.172   2.267   1.00 0.00 ? 116 LEU A HD13 2  
ATOM 3517  H HD21 . LEU A 1 116 ? 12.510  -0.539  4.303   1.00 0.00 ? 116 LEU A HD21 2  
ATOM 3518  H HD22 . LEU A 1 116 ? 13.414  -0.947  2.844   1.00 0.00 ? 116 LEU A HD22 2  
ATOM 3519  H HD23 . LEU A 1 116 ? 14.203  -0.066  4.153   1.00 0.00 ? 116 LEU A HD23 2  
ATOM 3520  N N    . ALA A 1 117 ? 9.769   3.045   5.854   1.00 0.00 ? 117 ALA A N    2  
ATOM 3521  C CA   . ALA A 1 117 ? 8.893   4.196   6.217   1.00 0.00 ? 117 ALA A CA   2  
ATOM 3522  C C    . ALA A 1 117 ? 9.410   4.845   7.501   1.00 0.00 ? 117 ALA A C    2  
ATOM 3523  O O    . ALA A 1 117 ? 9.396   6.047   7.644   1.00 0.00 ? 117 ALA A O    2  
ATOM 3524  C CB   . ALA A 1 117 ? 7.461   3.707   6.442   1.00 0.00 ? 117 ALA A CB   2  
ATOM 3525  H H    . ALA A 1 117 ? 9.426   2.129   5.917   1.00 0.00 ? 117 ALA A H    2  
ATOM 3526  H HA   . ALA A 1 117 ? 8.905   4.924   5.417   1.00 0.00 ? 117 ALA A HA   2  
ATOM 3527  H HB1  . ALA A 1 117 ? 7.383   2.672   6.147   1.00 0.00 ? 117 ALA A HB1  2  
ATOM 3528  H HB2  . ALA A 1 117 ? 7.208   3.804   7.487   1.00 0.00 ? 117 ALA A HB2  2  
ATOM 3529  H HB3  . ALA A 1 117 ? 6.779   4.303   5.851   1.00 0.00 ? 117 ALA A HB3  2  
ATOM 3530  N N    . ASP A 1 118 ? 9.859   4.056   8.439   1.00 0.00 ? 118 ASP A N    2  
ATOM 3531  C CA   . ASP A 1 118 ? 10.372  4.631   9.715   1.00 0.00 ? 118 ASP A CA   2  
ATOM 3532  C C    . ASP A 1 118 ? 11.427  5.698   9.409   1.00 0.00 ? 118 ASP A C    2  
ATOM 3533  O O    . ASP A 1 118 ? 11.550  6.682   10.110  1.00 0.00 ? 118 ASP A O    2  
ATOM 3534  C CB   . ASP A 1 118 ? 11.005  3.521   10.554  1.00 0.00 ? 118 ASP A CB   2  
ATOM 3535  C CG   . ASP A 1 118 ? 10.347  3.488   11.935  1.00 0.00 ? 118 ASP A CG   2  
ATOM 3536  O OD1  . ASP A 1 118 ? 9.766   4.490   12.316  1.00 0.00 ? 118 ASP A OD1  2  
ATOM 3537  O OD2  . ASP A 1 118 ? 10.437  2.461   12.586  1.00 0.00 ? 118 ASP A OD2  2  
ATOM 3538  H H    . ASP A 1 118 ? 9.856   3.086   8.305   1.00 0.00 ? 118 ASP A H    2  
ATOM 3539  H HA   . ASP A 1 118 ? 9.557   5.078   10.263  1.00 0.00 ? 118 ASP A HA   2  
ATOM 3540  H HB2  . ASP A 1 118 ? 10.858  2.571   10.062  1.00 0.00 ? 118 ASP A HB2  2  
ATOM 3541  H HB3  . ASP A 1 118 ? 12.062  3.711   10.665  1.00 0.00 ? 118 ASP A HB3  2  
ATOM 3542  N N    . TYR A 1 119 ? 12.187  5.510   8.366   1.00 0.00 ? 119 TYR A N    2  
ATOM 3543  C CA   . TYR A 1 119 ? 13.231  6.512   8.013   1.00 0.00 ? 119 TYR A CA   2  
ATOM 3544  C C    . TYR A 1 119 ? 12.558  7.740   7.399   1.00 0.00 ? 119 TYR A C    2  
ATOM 3545  O O    . TYR A 1 119 ? 12.687  8.844   7.889   1.00 0.00 ? 119 TYR A O    2  
ATOM 3546  C CB   . TYR A 1 119 ? 14.196  5.900   6.996   1.00 0.00 ? 119 TYR A CB   2  
ATOM 3547  C CG   . TYR A 1 119 ? 14.661  4.553   7.491   1.00 0.00 ? 119 TYR A CG   2  
ATOM 3548  C CD1  . TYR A 1 119 ? 13.909  3.410   7.201   1.00 0.00 ? 119 TYR A CD1  2  
ATOM 3549  C CD2  . TYR A 1 119 ? 15.842  4.446   8.232   1.00 0.00 ? 119 TYR A CD2  2  
ATOM 3550  C CE1  . TYR A 1 119 ? 14.341  2.157   7.655   1.00 0.00 ? 119 TYR A CE1  2  
ATOM 3551  C CE2  . TYR A 1 119 ? 16.274  3.195   8.686   1.00 0.00 ? 119 TYR A CE2  2  
ATOM 3552  C CZ   . TYR A 1 119 ? 15.522  2.050   8.397   1.00 0.00 ? 119 TYR A CZ   2  
ATOM 3553  O OH   . TYR A 1 119 ? 15.948  0.815   8.843   1.00 0.00 ? 119 TYR A OH   2  
ATOM 3554  H H    . TYR A 1 119 ? 12.068  4.711   7.812   1.00 0.00 ? 119 TYR A H    2  
ATOM 3555  H HA   . TYR A 1 119 ? 13.773  6.800   8.901   1.00 0.00 ? 119 TYR A HA   2  
ATOM 3556  H HB2  . TYR A 1 119 ? 13.692  5.779   6.049   1.00 0.00 ? 119 TYR A HB2  2  
ATOM 3557  H HB3  . TYR A 1 119 ? 15.049  6.549   6.871   1.00 0.00 ? 119 TYR A HB3  2  
ATOM 3558  H HD1  . TYR A 1 119 ? 12.993  3.496   6.630   1.00 0.00 ? 119 TYR A HD1  2  
ATOM 3559  H HD2  . TYR A 1 119 ? 16.421  5.330   8.455   1.00 0.00 ? 119 TYR A HD2  2  
ATOM 3560  H HE1  . TYR A 1 119 ? 13.766  1.273   7.432   1.00 0.00 ? 119 TYR A HE1  2  
ATOM 3561  H HE2  . TYR A 1 119 ? 17.186  3.111   9.258   1.00 0.00 ? 119 TYR A HE2  2  
ATOM 3562  H HH   . TYR A 1 119 ? 15.235  0.422   9.353   1.00 0.00 ? 119 TYR A HH   2  
ATOM 3563  N N    . LEU A 1 120 ? 11.839  7.551   6.327   1.00 0.00 ? 120 LEU A N    2  
ATOM 3564  C CA   . LEU A 1 120 ? 11.151  8.681   5.664   1.00 0.00 ? 120 LEU A CA   2  
ATOM 3565  C C    . LEU A 1 120 ? 9.954   9.149   6.507   1.00 0.00 ? 120 LEU A C    2  
ATOM 3566  O O    . LEU A 1 120 ? 9.232   10.048  6.122   1.00 0.00 ? 120 LEU A O    2  
ATOM 3567  C CB   . LEU A 1 120 ? 10.669  8.195   4.301   1.00 0.00 ? 120 LEU A CB   2  
ATOM 3568  C CG   . LEU A 1 120 ? 9.717   7.010   4.477   1.00 0.00 ? 120 LEU A CG   2  
ATOM 3569  C CD1  . LEU A 1 120 ? 8.330   7.518   4.859   1.00 0.00 ? 120 LEU A CD1  2  
ATOM 3570  C CD2  . LEU A 1 120 ? 9.628   6.231   3.164   1.00 0.00 ? 120 LEU A CD2  2  
ATOM 3571  H H    . LEU A 1 120 ? 11.754  6.655   5.945   1.00 0.00 ? 120 LEU A H    2  
ATOM 3572  H HA   . LEU A 1 120 ? 11.841  9.500   5.531   1.00 0.00 ? 120 LEU A HA   2  
ATOM 3573  H HB2  . LEU A 1 120 ? 10.160  8.993   3.795   1.00 0.00 ? 120 LEU A HB2  2  
ATOM 3574  H HB3  . LEU A 1 120 ? 11.521  7.876   3.720   1.00 0.00 ? 120 LEU A HB3  2  
ATOM 3575  H HG   . LEU A 1 120 ? 10.085  6.362   5.257   1.00 0.00 ? 120 LEU A HG   2  
ATOM 3576  H HD11 . LEU A 1 120 ? 8.339   8.596   4.893   1.00 0.00 ? 120 LEU A HD11 2  
ATOM 3577  H HD12 . LEU A 1 120 ? 7.611   7.185   4.126   1.00 0.00 ? 120 LEU A HD12 2  
ATOM 3578  H HD13 . LEU A 1 120 ? 8.062   7.129   5.828   1.00 0.00 ? 120 LEU A HD13 2  
ATOM 3579  H HD21 . LEU A 1 120 ? 10.615  6.136   2.735   1.00 0.00 ? 120 LEU A HD21 2  
ATOM 3580  H HD22 . LEU A 1 120 ? 9.221   5.249   3.353   1.00 0.00 ? 120 LEU A HD22 2  
ATOM 3581  H HD23 . LEU A 1 120 ? 8.986   6.759   2.474   1.00 0.00 ? 120 LEU A HD23 2  
ATOM 3582  N N    . ILE A 1 121 ? 9.743   8.558   7.651   1.00 0.00 ? 121 ILE A N    2  
ATOM 3583  C CA   . ILE A 1 121 ? 8.601   8.980   8.510   1.00 0.00 ? 121 ILE A CA   2  
ATOM 3584  C C    . ILE A 1 121 ? 9.068   10.108  9.436   1.00 0.00 ? 121 ILE A C    2  
ATOM 3585  O O    . ILE A 1 121 ? 8.280   10.902  9.909   1.00 0.00 ? 121 ILE A O    2  
ATOM 3586  C CB   . ILE A 1 121 ? 8.108   7.773   9.332   1.00 0.00 ? 121 ILE A CB   2  
ATOM 3587  C CG1  . ILE A 1 121 ? 7.052   7.013   8.525   1.00 0.00 ? 121 ILE A CG1  2  
ATOM 3588  C CG2  . ILE A 1 121 ? 7.487   8.238   10.655  1.00 0.00 ? 121 ILE A CG2  2  
ATOM 3589  C CD1  . ILE A 1 121 ? 6.780   5.655   9.177   1.00 0.00 ? 121 ILE A CD1  2  
ATOM 3590  H H    . ILE A 1 121 ? 10.337  7.842   7.950   1.00 0.00 ? 121 ILE A H    2  
ATOM 3591  H HA   . ILE A 1 121 ? 7.797   9.341   7.884   1.00 0.00 ? 121 ILE A HA   2  
ATOM 3592  H HB   . ILE A 1 121 ? 8.942   7.118   9.540   1.00 0.00 ? 121 ILE A HB   2  
ATOM 3593  H HG12 . ILE A 1 121 ? 6.138   7.589   8.498   1.00 0.00 ? 121 ILE A HG12 2  
ATOM 3594  H HG13 . ILE A 1 121 ? 7.409   6.860   7.520   1.00 0.00 ? 121 ILE A HG13 2  
ATOM 3595  H HG21 . ILE A 1 121 ? 6.745   8.998   10.458  1.00 0.00 ? 121 ILE A HG21 2  
ATOM 3596  H HG22 . ILE A 1 121 ? 7.021   7.398   11.150  1.00 0.00 ? 121 ILE A HG22 2  
ATOM 3597  H HG23 . ILE A 1 121 ? 8.258   8.646   11.292  1.00 0.00 ? 121 ILE A HG23 2  
ATOM 3598  H HD11 . ILE A 1 121 ? 6.711   5.777   10.247  1.00 0.00 ? 121 ILE A HD11 2  
ATOM 3599  H HD12 . ILE A 1 121 ? 5.850   5.256   8.799   1.00 0.00 ? 121 ILE A HD12 2  
ATOM 3600  H HD13 . ILE A 1 121 ? 7.585   4.975   8.943   1.00 0.00 ? 121 ILE A HD13 2  
ATOM 3601  N N    . GLY A 1 122 ? 10.344  10.186  9.693   1.00 0.00 ? 122 GLY A N    2  
ATOM 3602  C CA   . GLY A 1 122 ? 10.855  11.263  10.584  1.00 0.00 ? 122 GLY A CA   2  
ATOM 3603  C C    . GLY A 1 122 ? 10.404  12.620  10.043  1.00 0.00 ? 122 GLY A C    2  
ATOM 3604  O O    . GLY A 1 122 ? 10.198  13.560  10.786  1.00 0.00 ? 122 GLY A O    2  
ATOM 3605  H H    . GLY A 1 122 ? 10.965  9.537   9.301   1.00 0.00 ? 122 GLY A H    2  
ATOM 3606  H HA2  . GLY A 1 122 ? 10.464  11.121  11.581  1.00 0.00 ? 122 GLY A HA2  2  
ATOM 3607  H HA3  . GLY A 1 122 ? 11.934  11.230  10.610  1.00 0.00 ? 122 GLY A HA3  2  
ATOM 3608  N N    . GLN A 1 123 ? 10.246  12.727  8.752   1.00 0.00 ? 123 GLN A N    2  
ATOM 3609  C CA   . GLN A 1 123 ? 9.809   14.020  8.158   1.00 0.00 ? 123 GLN A CA   2  
ATOM 3610  C C    . GLN A 1 123 ? 8.285   14.031  8.026   1.00 0.00 ? 123 GLN A C    2  
ATOM 3611  O O    . GLN A 1 123 ? 7.591   14.673  8.789   1.00 0.00 ? 123 GLN A O    2  
ATOM 3612  C CB   . GLN A 1 123 ? 10.443  14.179  6.774   1.00 0.00 ? 123 GLN A CB   2  
ATOM 3613  C CG   . GLN A 1 123 ? 11.786  14.901  6.904   1.00 0.00 ? 123 GLN A CG   2  
ATOM 3614  C CD   . GLN A 1 123 ? 11.541  16.396  7.119   1.00 0.00 ? 123 GLN A CD   2  
ATOM 3615  O OE1  . GLN A 1 123 ? 11.808  16.922  8.180   1.00 0.00 ? 123 GLN A OE1  2  
ATOM 3616  N NE2  . GLN A 1 123 ? 11.038  17.107  6.147   1.00 0.00 ? 123 GLN A NE2  2  
ATOM 3617  H H    . GLN A 1 123 ? 10.417  11.955  8.173   1.00 0.00 ? 123 GLN A H    2  
ATOM 3618  H HA   . GLN A 1 123 ? 10.123  14.834  8.794   1.00 0.00 ? 123 GLN A HA   2  
ATOM 3619  H HB2  . GLN A 1 123 ? 10.600  13.203  6.336   1.00 0.00 ? 123 GLN A HB2  2  
ATOM 3620  H HB3  . GLN A 1 123 ? 9.787   14.756  6.140   1.00 0.00 ? 123 GLN A HB3  2  
ATOM 3621  H HG2  . GLN A 1 123 ? 12.330  14.498  7.748   1.00 0.00 ? 123 GLN A HG2  2  
ATOM 3622  H HG3  . GLN A 1 123 ? 12.361  14.759  6.002   1.00 0.00 ? 123 GLN A HG3  2  
ATOM 3623  H HE21 . GLN A 1 123 ? 10.821  16.683  5.291   1.00 0.00 ? 123 GLN A HE21 2  
ATOM 3624  H HE22 . GLN A 1 123 ? 10.875  18.065  6.275   1.00 0.00 ? 123 GLN A HE22 2  
ATOM 3625  N N    . GLY A 1 124 ? 7.760   13.325  7.063   1.00 0.00 ? 124 GLY A N    2  
ATOM 3626  C CA   . GLY A 1 124 ? 6.281   13.296  6.881   1.00 0.00 ? 124 GLY A CA   2  
ATOM 3627  C C    . GLY A 1 124 ? 5.945   13.531  5.408   1.00 0.00 ? 124 GLY A C    2  
ATOM 3628  O O    . GLY A 1 124 ? 4.972   14.181  5.079   1.00 0.00 ? 124 GLY A O    2  
ATOM 3629  H H    . GLY A 1 124 ? 8.338   12.815  6.459   1.00 0.00 ? 124 GLY A H    2  
ATOM 3630  H HA2  . GLY A 1 124 ? 5.899   12.332  7.189   1.00 0.00 ? 124 GLY A HA2  2  
ATOM 3631  H HA3  . GLY A 1 124 ? 5.828   14.072  7.479   1.00 0.00 ? 124 GLY A HA3  2  
ATOM 3632  N N    . PHE A 1 125 ? 6.746   13.009  4.519   1.00 0.00 ? 125 PHE A N    2  
ATOM 3633  C CA   . PHE A 1 125 ? 6.481   13.200  3.066   1.00 0.00 ? 125 PHE A CA   2  
ATOM 3634  C C    . PHE A 1 125 ? 6.061   14.649  2.809   1.00 0.00 ? 125 PHE A C    2  
ATOM 3635  O O    . PHE A 1 125 ? 5.387   14.884  1.819   1.00 0.00 ? 125 PHE A O    2  
ATOM 3636  C CB   . PHE A 1 125 ? 5.365   12.253  2.617   1.00 0.00 ? 125 PHE A CB   2  
ATOM 3637  C CG   . PHE A 1 125 ? 5.954   10.895  2.320   1.00 0.00 ? 125 PHE A CG   2  
ATOM 3638  C CD1  . PHE A 1 125 ? 6.978   10.769  1.374   1.00 0.00 ? 125 PHE A CD1  2  
ATOM 3639  C CD2  . PHE A 1 125 ? 5.477   9.762   2.990   1.00 0.00 ? 125 PHE A CD2  2  
ATOM 3640  C CE1  . PHE A 1 125 ? 7.527   9.511   1.098   1.00 0.00 ? 125 PHE A CE1  2  
ATOM 3641  C CE2  . PHE A 1 125 ? 6.025   8.504   2.712   1.00 0.00 ? 125 PHE A CE2  2  
ATOM 3642  C CZ   . PHE A 1 125 ? 7.049   8.378   1.768   1.00 0.00 ? 125 PHE A CZ   2  
ATOM 3643  O OXT  . PHE A 1 125 ? 6.419   15.498  3.608   1.00 0.00 ? 125 PHE A OXT  2  
ATOM 3644  H H    . PHE A 1 125 ? 7.525   12.489  4.808   1.00 0.00 ? 125 PHE A H    2  
ATOM 3645  H HA   . PHE A 1 125 ? 7.380   12.984  2.506   1.00 0.00 ? 125 PHE A HA   2  
ATOM 3646  H HB2  . PHE A 1 125 ? 4.627   12.164  3.404   1.00 0.00 ? 125 PHE A HB2  2  
ATOM 3647  H HB3  . PHE A 1 125 ? 4.897   12.644  1.726   1.00 0.00 ? 125 PHE A HB3  2  
ATOM 3648  H HD1  . PHE A 1 125 ? 7.347   11.644  0.859   1.00 0.00 ? 125 PHE A HD1  2  
ATOM 3649  H HD2  . PHE A 1 125 ? 4.688   9.858   3.719   1.00 0.00 ? 125 PHE A HD2  2  
ATOM 3650  H HE1  . PHE A 1 125 ? 8.318   9.415   0.369   1.00 0.00 ? 125 PHE A HE1  2  
ATOM 3651  H HE2  . PHE A 1 125 ? 5.657   7.630   3.229   1.00 0.00 ? 125 PHE A HE2  2  
ATOM 3652  H HZ   . PHE A 1 125 ? 7.472   7.408   1.555   1.00 0.00 ? 125 PHE A HZ   2  
ATOM 3653  N N    . SER A 1 1   ? 7.821   -0.151  -3.290  1.00 0.00 ? 1   SER A N    3  
ATOM 3654  C CA   . SER A 1 1   ? 7.341   1.257   -3.202  1.00 0.00 ? 1   SER A CA   3  
ATOM 3655  C C    . SER A 1 1   ? 8.530   2.188   -2.947  1.00 0.00 ? 1   SER A C    3  
ATOM 3656  O O    . SER A 1 1   ? 9.641   1.918   -3.358  1.00 0.00 ? 1   SER A O    3  
ATOM 3657  C CB   . SER A 1 1   ? 6.344   1.380   -2.053  1.00 0.00 ? 1   SER A CB   3  
ATOM 3658  O OG   . SER A 1 1   ? 7.033   1.233   -0.819  1.00 0.00 ? 1   SER A OG   3  
ATOM 3659  H H1   . SER A 1 1   ? 8.531   -0.230  -4.044  1.00 0.00 ? 1   SER A H1   3  
ATOM 3660  H H2   . SER A 1 1   ? 8.247   -0.428  -2.381  1.00 0.00 ? 1   SER A H2   3  
ATOM 3661  H H3   . SER A 1 1   ? 7.020   -0.778  -3.503  1.00 0.00 ? 1   SER A H3   3  
ATOM 3662  H HA   . SER A 1 1   ? 6.860   1.532   -4.129  1.00 0.00 ? 1   SER A HA   3  
ATOM 3663  H HB2  . SER A 1 1   ? 5.873   2.348   -2.085  1.00 0.00 ? 1   SER A HB2  3  
ATOM 3664  H HB3  . SER A 1 1   ? 5.590   0.610   -2.150  1.00 0.00 ? 1   SER A HB3  3  
ATOM 3665  H HG   . SER A 1 1   ? 7.327   2.103   -0.538  1.00 0.00 ? 1   SER A HG   3  
ATOM 3666  N N    . TRP A 1 2   ? 8.306   3.282   -2.271  1.00 0.00 ? 2   TRP A N    3  
ATOM 3667  C CA   . TRP A 1 2   ? 9.427   4.226   -1.992  1.00 0.00 ? 2   TRP A CA   3  
ATOM 3668  C C    . TRP A 1 2   ? 9.982   4.746   -3.319  1.00 0.00 ? 2   TRP A C    3  
ATOM 3669  O O    . TRP A 1 2   ? 9.837   4.119   -4.346  1.00 0.00 ? 2   TRP A O    3  
ATOM 3670  C CB   . TRP A 1 2   ? 10.517  3.504   -1.205  1.00 0.00 ? 2   TRP A CB   3  
ATOM 3671  C CG   . TRP A 1 2   ? 9.880   2.499   -0.301  1.00 0.00 ? 2   TRP A CG   3  
ATOM 3672  C CD1  . TRP A 1 2   ? 9.938   1.156   -0.457  1.00 0.00 ? 2   TRP A CD1  3  
ATOM 3673  C CD2  . TRP A 1 2   ? 9.074   2.738   0.883   1.00 0.00 ? 2   TRP A CD2  3  
ATOM 3674  N NE1  . TRP A 1 2   ? 9.233   0.558   0.571   1.00 0.00 ? 2   TRP A NE1  3  
ATOM 3675  C CE2  . TRP A 1 2   ? 8.679   1.492   1.420   1.00 0.00 ? 2   TRP A CE2  3  
ATOM 3676  C CE3  . TRP A 1 2   ? 8.655   3.908   1.539   1.00 0.00 ? 2   TRP A CE3  3  
ATOM 3677  C CZ2  . TRP A 1 2   ? 7.897   1.406   2.570   1.00 0.00 ? 2   TRP A CZ2  3  
ATOM 3678  C CZ3  . TRP A 1 2   ? 7.865   3.828   2.697   1.00 0.00 ? 2   TRP A CZ3  3  
ATOM 3679  C CH2  . TRP A 1 2   ? 7.488   2.578   3.213   1.00 0.00 ? 2   TRP A CH2  3  
ATOM 3680  H H    . TRP A 1 2   ? 7.402   3.483   -1.948  1.00 0.00 ? 2   TRP A H    3  
ATOM 3681  H HA   . TRP A 1 2   ? 9.055   5.058   -1.410  1.00 0.00 ? 2   TRP A HA   3  
ATOM 3682  H HB2  . TRP A 1 2   ? 11.186  3.010   -1.886  1.00 0.00 ? 2   TRP A HB2  3  
ATOM 3683  H HB3  . TRP A 1 2   ? 11.069  4.220   -0.615  1.00 0.00 ? 2   TRP A HB3  3  
ATOM 3684  H HD1  . TRP A 1 2   ? 10.460  0.638   -1.246  1.00 0.00 ? 2   TRP A HD1  3  
ATOM 3685  H HE1  . TRP A 1 2   ? 9.126   -0.409  0.695   1.00 0.00 ? 2   TRP A HE1  3  
ATOM 3686  H HE3  . TRP A 1 2   ? 8.940   4.874   1.147   1.00 0.00 ? 2   TRP A HE3  3  
ATOM 3687  H HZ2  . TRP A 1 2   ? 7.610   0.441   2.959   1.00 0.00 ? 2   TRP A HZ2  3  
ATOM 3688  H HZ3  . TRP A 1 2   ? 7.549   4.731   3.196   1.00 0.00 ? 2   TRP A HZ3  3  
ATOM 3689  H HH2  . TRP A 1 2   ? 6.880   2.522   4.102   1.00 0.00 ? 2   TRP A HH2  3  
ATOM 3690  N N    . GLN A 1 3   ? 10.582  5.904   -3.315  1.00 0.00 ? 3   GLN A N    3  
ATOM 3691  C CA   . GLN A 1 3   ? 11.107  6.482   -4.587  1.00 0.00 ? 3   GLN A CA   3  
ATOM 3692  C C    . GLN A 1 3   ? 12.275  5.655   -5.136  1.00 0.00 ? 3   GLN A C    3  
ATOM 3693  O O    . GLN A 1 3   ? 12.116  4.868   -6.047  1.00 0.00 ? 3   GLN A O    3  
ATOM 3694  C CB   . GLN A 1 3   ? 11.574  7.915   -4.331  1.00 0.00 ? 3   GLN A CB   3  
ATOM 3695  C CG   . GLN A 1 3   ? 10.375  8.860   -4.418  1.00 0.00 ? 3   GLN A CG   3  
ATOM 3696  C CD   . GLN A 1 3   ? 10.423  9.858   -3.261  1.00 0.00 ? 3   GLN A CD   3  
ATOM 3697  O OE1  . GLN A 1 3   ? 11.470  10.098  -2.692  1.00 0.00 ? 3   GLN A OE1  3  
ATOM 3698  N NE2  . GLN A 1 3   ? 9.325   10.456  -2.886  1.00 0.00 ? 3   GLN A NE2  3  
ATOM 3699  H H    . GLN A 1 3   ? 10.663  6.408   -2.479  1.00 0.00 ? 3   GLN A H    3  
ATOM 3700  H HA   . GLN A 1 3   ? 10.312  6.499   -5.321  1.00 0.00 ? 3   GLN A HA   3  
ATOM 3701  H HB2  . GLN A 1 3   ? 12.013  7.979   -3.345  1.00 0.00 ? 3   GLN A HB2  3  
ATOM 3702  H HB3  . GLN A 1 3   ? 12.306  8.195   -5.072  1.00 0.00 ? 3   GLN A HB3  3  
ATOM 3703  H HG2  . GLN A 1 3   ? 10.404  9.392   -5.359  1.00 0.00 ? 3   GLN A HG2  3  
ATOM 3704  H HG3  . GLN A 1 3   ? 9.461   8.287   -4.358  1.00 0.00 ? 3   GLN A HG3  3  
ATOM 3705  H HE21 . GLN A 1 3   ? 8.481   10.264  -3.346  1.00 0.00 ? 3   GLN A HE21 3  
ATOM 3706  H HE22 . GLN A 1 3   ? 9.345   11.097  -2.146  1.00 0.00 ? 3   GLN A HE22 3  
ATOM 3707  N N    . THR A 1 4   ? 13.454  5.853   -4.615  1.00 0.00 ? 4   THR A N    3  
ATOM 3708  C CA   . THR A 1 4   ? 14.639  5.105   -5.131  1.00 0.00 ? 4   THR A CA   3  
ATOM 3709  C C    . THR A 1 4   ? 14.394  3.594   -5.098  1.00 0.00 ? 4   THR A C    3  
ATOM 3710  O O    . THR A 1 4   ? 15.023  2.846   -5.818  1.00 0.00 ? 4   THR A O    3  
ATOM 3711  C CB   . THR A 1 4   ? 15.859  5.437   -4.274  1.00 0.00 ? 4   THR A CB   3  
ATOM 3712  O OG1  . THR A 1 4   ? 15.749  6.773   -3.795  1.00 0.00 ? 4   THR A OG1  3  
ATOM 3713  C CG2  . THR A 1 4   ? 17.127  5.290   -5.119  1.00 0.00 ? 4   THR A CG2  3  
ATOM 3714  H H    . THR A 1 4   ? 13.568  6.512   -3.899  1.00 0.00 ? 4   THR A H    3  
ATOM 3715  H HA   . THR A 1 4   ? 14.832  5.408   -6.150  1.00 0.00 ? 4   THR A HA   3  
ATOM 3716  H HB   . THR A 1 4   ? 15.909  4.757   -3.437  1.00 0.00 ? 4   THR A HB   3  
ATOM 3717  H HG1  . THR A 1 4   ? 16.576  7.225   -3.975  1.00 0.00 ? 4   THR A HG1  3  
ATOM 3718  H HG21 . THR A 1 4   ? 17.023  5.866   -6.028  1.00 0.00 ? 4   THR A HG21 3  
ATOM 3719  H HG22 . THR A 1 4   ? 17.977  5.651   -4.560  1.00 0.00 ? 4   THR A HG22 3  
ATOM 3720  H HG23 . THR A 1 4   ? 17.274  4.249   -5.368  1.00 0.00 ? 4   THR A HG23 3  
ATOM 3721  N N    . TYR A 1 5   ? 13.500  3.126   -4.272  1.00 0.00 ? 5   TYR A N    3  
ATOM 3722  C CA   . TYR A 1 5   ? 13.255  1.655   -4.216  1.00 0.00 ? 5   TYR A CA   3  
ATOM 3723  C C    . TYR A 1 5   ? 12.202  1.262   -5.259  1.00 0.00 ? 5   TYR A C    3  
ATOM 3724  O O    . TYR A 1 5   ? 12.162  0.138   -5.720  1.00 0.00 ? 5   TYR A O    3  
ATOM 3725  C CB   . TYR A 1 5   ? 12.773  1.266   -2.817  1.00 0.00 ? 5   TYR A CB   3  
ATOM 3726  C CG   . TYR A 1 5   ? 13.603  1.980   -1.768  1.00 0.00 ? 5   TYR A CG   3  
ATOM 3727  C CD1  . TYR A 1 5   ? 14.876  2.470   -2.093  1.00 0.00 ? 5   TYR A CD1  3  
ATOM 3728  C CD2  . TYR A 1 5   ? 13.103  2.149   -0.467  1.00 0.00 ? 5   TYR A CD2  3  
ATOM 3729  C CE1  . TYR A 1 5   ? 15.644  3.126   -1.125  1.00 0.00 ? 5   TYR A CE1  3  
ATOM 3730  C CE2  . TYR A 1 5   ? 13.874  2.804   0.500   1.00 0.00 ? 5   TYR A CE2  3  
ATOM 3731  C CZ   . TYR A 1 5   ? 15.143  3.292   0.172   1.00 0.00 ? 5   TYR A CZ   3  
ATOM 3732  O OH   . TYR A 1 5   ? 15.901  3.937   1.127   1.00 0.00 ? 5   TYR A OH   3  
ATOM 3733  H H    . TYR A 1 5   ? 13.000  3.734   -3.688  1.00 0.00 ? 5   TYR A H    3  
ATOM 3734  H HA   . TYR A 1 5   ? 14.177  1.136   -4.431  1.00 0.00 ? 5   TYR A HA   3  
ATOM 3735  H HB2  . TYR A 1 5   ? 11.734  1.535   -2.707  1.00 0.00 ? 5   TYR A HB2  3  
ATOM 3736  H HB3  . TYR A 1 5   ? 12.882  0.202   -2.691  1.00 0.00 ? 5   TYR A HB3  3  
ATOM 3737  H HD1  . TYR A 1 5   ? 15.264  2.342   -3.093  1.00 0.00 ? 5   TYR A HD1  3  
ATOM 3738  H HD2  . TYR A 1 5   ? 12.126  1.772   -0.209  1.00 0.00 ? 5   TYR A HD2  3  
ATOM 3739  H HE1  . TYR A 1 5   ? 16.624  3.502   -1.377  1.00 0.00 ? 5   TYR A HE1  3  
ATOM 3740  H HE2  . TYR A 1 5   ? 13.486  2.936   1.502   1.00 0.00 ? 5   TYR A HE2  3  
ATOM 3741  H HH   . TYR A 1 5   ? 16.590  4.429   0.676   1.00 0.00 ? 5   TYR A HH   3  
ATOM 3742  N N    . VAL A 1 6   ? 11.357  2.177   -5.638  1.00 0.00 ? 6   VAL A N    3  
ATOM 3743  C CA   . VAL A 1 6   ? 10.313  1.863   -6.655  1.00 0.00 ? 6   VAL A CA   3  
ATOM 3744  C C    . VAL A 1 6   ? 10.999  1.520   -7.982  1.00 0.00 ? 6   VAL A C    3  
ATOM 3745  O O    . VAL A 1 6   ? 10.454  0.835   -8.824  1.00 0.00 ? 6   VAL A O    3  
ATOM 3746  C CB   . VAL A 1 6   ? 9.409   3.103   -6.833  1.00 0.00 ? 6   VAL A CB   3  
ATOM 3747  C CG1  . VAL A 1 6   ? 9.119   3.380   -8.316  1.00 0.00 ? 6   VAL A CG1  3  
ATOM 3748  C CG2  . VAL A 1 6   ? 8.077   2.881   -6.106  1.00 0.00 ? 6   VAL A CG2  3  
ATOM 3749  H H    . VAL A 1 6   ? 11.411  3.078   -5.257  1.00 0.00 ? 6   VAL A H    3  
ATOM 3750  H HA   . VAL A 1 6   ? 9.724   1.027   -6.319  1.00 0.00 ? 6   VAL A HA   3  
ATOM 3751  H HB   . VAL A 1 6   ? 9.914   3.957   -6.412  1.00 0.00 ? 6   VAL A HB   3  
ATOM 3752  H HG11 . VAL A 1 6   ? 9.055   2.445   -8.848  1.00 0.00 ? 6   VAL A HG11 3  
ATOM 3753  H HG12 . VAL A 1 6   ? 8.185   3.914   -8.407  1.00 0.00 ? 6   VAL A HG12 3  
ATOM 3754  H HG13 . VAL A 1 6   ? 9.918   3.977   -8.731  1.00 0.00 ? 6   VAL A HG13 3  
ATOM 3755  H HG21 . VAL A 1 6   ? 8.125   1.970   -5.528  1.00 0.00 ? 6   VAL A HG21 3  
ATOM 3756  H HG22 . VAL A 1 6   ? 7.880   3.715   -5.450  1.00 0.00 ? 6   VAL A HG22 3  
ATOM 3757  H HG23 . VAL A 1 6   ? 7.281   2.802   -6.834  1.00 0.00 ? 6   VAL A HG23 3  
ATOM 3758  N N    . ASP A 1 7   ? 12.168  2.041   -8.187  1.00 0.00 ? 7   ASP A N    3  
ATOM 3759  C CA   . ASP A 1 7   ? 12.878  1.799   -9.474  1.00 0.00 ? 7   ASP A CA   3  
ATOM 3760  C C    . ASP A 1 7   ? 12.982  0.302   -9.800  1.00 0.00 ? 7   ASP A C    3  
ATOM 3761  O O    . ASP A 1 7   ? 12.623  -0.119  -10.881 1.00 0.00 ? 7   ASP A O    3  
ATOM 3762  C CB   . ASP A 1 7   ? 14.276  2.432   -9.419  1.00 0.00 ? 7   ASP A CB   3  
ATOM 3763  C CG   . ASP A 1 7   ? 15.267  1.481   -8.742  1.00 0.00 ? 7   ASP A CG   3  
ATOM 3764  O OD1  . ASP A 1 7   ? 15.156  1.295   -7.541  1.00 0.00 ? 7   ASP A OD1  3  
ATOM 3765  O OD2  . ASP A 1 7   ? 16.124  0.959   -9.436  1.00 0.00 ? 7   ASP A OD2  3  
ATOM 3766  H H    . ASP A 1 7   ? 12.561  2.629   -7.507  1.00 0.00 ? 7   ASP A H    3  
ATOM 3767  H HA   . ASP A 1 7   ? 12.313  2.271   -10.258 1.00 0.00 ? 7   ASP A HA   3  
ATOM 3768  H HB2  . ASP A 1 7   ? 14.613  2.641   -10.424 1.00 0.00 ? 7   ASP A HB2  3  
ATOM 3769  H HB3  . ASP A 1 7   ? 14.229  3.354   -8.859  1.00 0.00 ? 7   ASP A HB3  3  
ATOM 3770  N N    . THR A 1 8   ? 13.477  -0.508  -8.904  1.00 0.00 ? 8   THR A N    3  
ATOM 3771  C CA   . THR A 1 8   ? 13.594  -1.963  -9.233  1.00 0.00 ? 8   THR A CA   3  
ATOM 3772  C C    . THR A 1 8   ? 13.796  -2.801  -7.966  1.00 0.00 ? 8   THR A C    3  
ATOM 3773  O O    . THR A 1 8   ? 13.439  -3.962  -7.927  1.00 0.00 ? 8   THR A O    3  
ATOM 3774  C CB   . THR A 1 8   ? 14.785  -2.177  -10.172 1.00 0.00 ? 8   THR A CB   3  
ATOM 3775  O OG1  . THR A 1 8   ? 14.954  -3.567  -10.408 1.00 0.00 ? 8   THR A OG1  3  
ATOM 3776  C CG2  . THR A 1 8   ? 16.054  -1.611  -9.534  1.00 0.00 ? 8   THR A CG2  3  
ATOM 3777  H H    . THR A 1 8   ? 13.772  -0.167  -8.039  1.00 0.00 ? 8   THR A H    3  
ATOM 3778  H HA   . THR A 1 8   ? 12.693  -2.286  -9.730  1.00 0.00 ? 8   THR A HA   3  
ATOM 3779  H HB   . THR A 1 8   ? 14.601  -1.672  -11.108 1.00 0.00 ? 8   THR A HB   3  
ATOM 3780  H HG1  . THR A 1 8   ? 15.450  -3.935  -9.674  1.00 0.00 ? 8   THR A HG1  3  
ATOM 3781  H HG21 . THR A 1 8   ? 15.792  -1.033  -8.660  1.00 0.00 ? 8   THR A HG21 3  
ATOM 3782  H HG22 . THR A 1 8   ? 16.706  -2.423  -9.246  1.00 0.00 ? 8   THR A HG22 3  
ATOM 3783  H HG23 . THR A 1 8   ? 16.563  -0.976  -10.246 1.00 0.00 ? 8   THR A HG23 3  
ATOM 3784  N N    . ASN A 1 9   ? 14.371  -2.249  -6.938  1.00 0.00 ? 9   ASN A N    3  
ATOM 3785  C CA   . ASN A 1 9   ? 14.583  -3.054  -5.705  1.00 0.00 ? 9   ASN A CA   3  
ATOM 3786  C C    . ASN A 1 9   ? 13.233  -3.438  -5.100  1.00 0.00 ? 9   ASN A C    3  
ATOM 3787  O O    . ASN A 1 9   ? 12.700  -4.482  -5.397  1.00 0.00 ? 9   ASN A O    3  
ATOM 3788  C CB   . ASN A 1 9   ? 15.392  -2.241  -4.692  1.00 0.00 ? 9   ASN A CB   3  
ATOM 3789  C CG   . ASN A 1 9   ? 16.876  -2.593  -4.818  1.00 0.00 ? 9   ASN A CG   3  
ATOM 3790  O OD1  . ASN A 1 9   ? 17.468  -3.115  -3.894  1.00 0.00 ? 9   ASN A OD1  3  
ATOM 3791  N ND2  . ASN A 1 9   ? 17.506  -2.328  -5.930  1.00 0.00 ? 9   ASN A ND2  3  
ATOM 3792  H H    . ASN A 1 9   ? 14.669  -1.318  -6.975  1.00 0.00 ? 9   ASN A H    3  
ATOM 3793  H HA   . ASN A 1 9   ? 15.120  -3.959  -5.961  1.00 0.00 ? 9   ASN A HA   3  
ATOM 3794  H HB2  . ASN A 1 9   ? 15.256  -1.186  -4.888  1.00 0.00 ? 9   ASN A HB2  3  
ATOM 3795  H HB3  . ASN A 1 9   ? 15.053  -2.468  -3.692  1.00 0.00 ? 9   ASN A HB3  3  
ATOM 3796  H HD21 . ASN A 1 9   ? 17.029  -1.905  -6.675  1.00 0.00 ? 9   ASN A HD21 3  
ATOM 3797  H HD22 . ASN A 1 9   ? 18.455  -2.552  -6.020  1.00 0.00 ? 9   ASN A HD22 3  
ATOM 3798  N N    . LEU A 1 10  ? 12.681  -2.614  -4.248  1.00 0.00 ? 10  LEU A N    3  
ATOM 3799  C CA   . LEU A 1 10  ? 11.369  -2.959  -3.624  1.00 0.00 ? 10  LEU A CA   3  
ATOM 3800  C C    . LEU A 1 10  ? 10.297  -3.132  -4.703  1.00 0.00 ? 10  LEU A C    3  
ATOM 3801  O O    . LEU A 1 10  ? 9.306   -3.805  -4.496  1.00 0.00 ? 10  LEU A O    3  
ATOM 3802  C CB   . LEU A 1 10  ? 10.943  -1.849  -2.662  1.00 0.00 ? 10  LEU A CB   3  
ATOM 3803  C CG   . LEU A 1 10  ? 11.232  -2.284  -1.223  1.00 0.00 ? 10  LEU A CG   3  
ATOM 3804  C CD1  . LEU A 1 10  ? 11.991  -1.174  -0.490  1.00 0.00 ? 10  LEU A CD1  3  
ATOM 3805  C CD2  . LEU A 1 10  ? 9.912   -2.558  -0.500  1.00 0.00 ? 10  LEU A CD2  3  
ATOM 3806  H H    . LEU A 1 10  ? 13.132  -1.778  -4.012  1.00 0.00 ? 10  LEU A H    3  
ATOM 3807  H HA   . LEU A 1 10  ? 11.468  -3.882  -3.075  1.00 0.00 ? 10  LEU A HA   3  
ATOM 3808  H HB2  . LEU A 1 10  ? 11.491  -0.949  -2.888  1.00 0.00 ? 10  LEU A HB2  3  
ATOM 3809  H HB3  . LEU A 1 10  ? 9.885   -1.664  -2.773  1.00 0.00 ? 10  LEU A HB3  3  
ATOM 3810  H HG   . LEU A 1 10  ? 11.832  -3.182  -1.232  1.00 0.00 ? 10  LEU A HG   3  
ATOM 3811  H HD11 . LEU A 1 10  ? 12.050  -0.301  -1.121  1.00 0.00 ? 10  LEU A HD11 3  
ATOM 3812  H HD12 . LEU A 1 10  ? 11.471  -0.925  0.424   1.00 0.00 ? 10  LEU A HD12 3  
ATOM 3813  H HD13 . LEU A 1 10  ? 12.988  -1.515  -0.256  1.00 0.00 ? 10  LEU A HD13 3  
ATOM 3814  H HD21 . LEU A 1 10  ? 9.185   -1.812  -0.783  1.00 0.00 ? 10  LEU A HD21 3  
ATOM 3815  H HD22 . LEU A 1 10  ? 9.549   -3.537  -0.774  1.00 0.00 ? 10  LEU A HD22 3  
ATOM 3816  H HD23 . LEU A 1 10  ? 10.071  -2.519  0.568   1.00 0.00 ? 10  LEU A HD23 3  
ATOM 3817  N N    . VAL A 1 11  ? 10.475  -2.538  -5.851  1.00 0.00 ? 11  VAL A N    3  
ATOM 3818  C CA   . VAL A 1 11  ? 9.448   -2.690  -6.922  1.00 0.00 ? 11  VAL A CA   3  
ATOM 3819  C C    . VAL A 1 11  ? 9.786   -3.921  -7.765  1.00 0.00 ? 11  VAL A C    3  
ATOM 3820  O O    . VAL A 1 11  ? 9.012   -4.854  -7.849  1.00 0.00 ? 11  VAL A O    3  
ATOM 3821  C CB   . VAL A 1 11  ? 9.413   -1.416  -7.799  1.00 0.00 ? 11  VAL A CB   3  
ATOM 3822  C CG1  . VAL A 1 11  ? 9.123   -1.763  -9.265  1.00 0.00 ? 11  VAL A CG1  3  
ATOM 3823  C CG2  . VAL A 1 11  ? 8.305   -0.494  -7.288  1.00 0.00 ? 11  VAL A CG2  3  
ATOM 3824  H H    . VAL A 1 11  ? 11.279  -1.999  -6.009  1.00 0.00 ? 11  VAL A H    3  
ATOM 3825  H HA   . VAL A 1 11  ? 8.480   -2.842  -6.457  1.00 0.00 ? 11  VAL A HA   3  
ATOM 3826  H HB   . VAL A 1 11  ? 10.366  -0.902  -7.735  1.00 0.00 ? 11  VAL A HB   3  
ATOM 3827  H HG11 . VAL A 1 11  ? 8.274   -2.426  -9.318  1.00 0.00 ? 11  VAL A HG11 3  
ATOM 3828  H HG12 . VAL A 1 11  ? 8.906   -0.856  -9.812  1.00 0.00 ? 11  VAL A HG12 3  
ATOM 3829  H HG13 . VAL A 1 11  ? 9.986   -2.245  -9.698  1.00 0.00 ? 11  VAL A HG13 3  
ATOM 3830  H HG21 . VAL A 1 11  ? 8.324   -0.471  -6.208  1.00 0.00 ? 11  VAL A HG21 3  
ATOM 3831  H HG22 . VAL A 1 11  ? 8.462   0.503   -7.672  1.00 0.00 ? 11  VAL A HG22 3  
ATOM 3832  H HG23 . VAL A 1 11  ? 7.348   -0.864  -7.623  1.00 0.00 ? 11  VAL A HG23 3  
ATOM 3833  N N    . GLY A 1 12  ? 10.935  -3.931  -8.384  1.00 0.00 ? 12  GLY A N    3  
ATOM 3834  C CA   . GLY A 1 12  ? 11.318  -5.109  -9.210  1.00 0.00 ? 12  GLY A CA   3  
ATOM 3835  C C    . GLY A 1 12  ? 10.960  -6.373  -8.435  1.00 0.00 ? 12  GLY A C    3  
ATOM 3836  O O    . GLY A 1 12  ? 10.512  -7.353  -8.997  1.00 0.00 ? 12  GLY A O    3  
ATOM 3837  H H    . GLY A 1 12  ? 11.543  -3.170  -8.300  1.00 0.00 ? 12  GLY A H    3  
ATOM 3838  H HA2  . GLY A 1 12  ? 10.777  -5.086  -10.146 1.00 0.00 ? 12  GLY A HA2  3  
ATOM 3839  H HA3  . GLY A 1 12  ? 12.378  -5.092  -9.400  1.00 0.00 ? 12  GLY A HA3  3  
ATOM 3840  N N    . THR A 1 13  ? 11.133  -6.337  -7.139  1.00 0.00 ? 13  THR A N    3  
ATOM 3841  C CA   . THR A 1 13  ? 10.788  -7.515  -6.297  1.00 0.00 ? 13  THR A CA   3  
ATOM 3842  C C    . THR A 1 13  ? 11.541  -7.451  -4.972  1.00 0.00 ? 13  THR A C    3  
ATOM 3843  O O    . THR A 1 13  ? 12.072  -8.435  -4.498  1.00 0.00 ? 13  THR A O    3  
ATOM 3844  C CB   . THR A 1 13  ? 11.178  -8.794  -7.012  1.00 0.00 ? 13  THR A CB   3  
ATOM 3845  O OG1  . THR A 1 13  ? 11.282  -9.860  -6.078  1.00 0.00 ? 13  THR A OG1  3  
ATOM 3846  C CG2  . THR A 1 13  ? 12.521  -8.581  -7.715  1.00 0.00 ? 13  THR A CG2  3  
ATOM 3847  H H    . THR A 1 13  ? 11.477  -5.523  -6.719  1.00 0.00 ? 13  THR A H    3  
ATOM 3848  H HA   . THR A 1 13  ? 9.715   -7.515  -6.112  1.00 0.00 ? 13  THR A HA   3  
ATOM 3849  H HB   . THR A 1 13  ? 10.424  -9.027  -7.729  1.00 0.00 ? 13  THR A HB   3  
ATOM 3850  H HG1  . THR A 1 13  ? 11.560  -10.646 -6.554  1.00 0.00 ? 13  THR A HG1  3  
ATOM 3851  H HG21 . THR A 1 13  ? 13.050  -7.767  -7.236  1.00 0.00 ? 13  THR A HG21 3  
ATOM 3852  H HG22 . THR A 1 13  ? 13.112  -9.481  -7.647  1.00 0.00 ? 13  THR A HG22 3  
ATOM 3853  H HG23 . THR A 1 13  ? 12.352  -8.335  -8.752  1.00 0.00 ? 13  THR A HG23 3  
ATOM 3854  N N    . GLY A 1 14  ? 11.554  -6.323  -4.337  1.00 0.00 ? 14  GLY A N    3  
ATOM 3855  C CA   . GLY A 1 14  ? 12.225  -6.245  -3.015  1.00 0.00 ? 14  GLY A CA   3  
ATOM 3856  C C    . GLY A 1 14  ? 11.148  -6.519  -1.972  1.00 0.00 ? 14  GLY A C    3  
ATOM 3857  O O    . GLY A 1 14  ? 11.245  -6.117  -0.829  1.00 0.00 ? 14  GLY A O    3  
ATOM 3858  H H    . GLY A 1 14  ? 11.086  -5.545  -4.703  1.00 0.00 ? 14  GLY A H    3  
ATOM 3859  H HA2  . GLY A 1 14  ? 13.005  -6.994  -2.953  1.00 0.00 ? 14  GLY A HA2  3  
ATOM 3860  H HA3  . GLY A 1 14  ? 12.641  -5.263  -2.862  1.00 0.00 ? 14  GLY A HA3  3  
ATOM 3861  N N    . ALA A 1 15  ? 10.105  -7.193  -2.395  1.00 0.00 ? 15  ALA A N    3  
ATOM 3862  C CA   . ALA A 1 15  ? 8.965   -7.508  -1.497  1.00 0.00 ? 15  ALA A CA   3  
ATOM 3863  C C    . ALA A 1 15  ? 7.745   -7.672  -2.394  1.00 0.00 ? 15  ALA A C    3  
ATOM 3864  O O    . ALA A 1 15  ? 6.827   -8.412  -2.102  1.00 0.00 ? 15  ALA A O    3  
ATOM 3865  C CB   . ALA A 1 15  ? 8.732   -6.358  -0.515  1.00 0.00 ? 15  ALA A CB   3  
ATOM 3866  H H    . ALA A 1 15  ? 10.060  -7.490  -3.337  1.00 0.00 ? 15  ALA A H    3  
ATOM 3867  H HA   . ALA A 1 15  ? 9.158   -8.426  -0.960  1.00 0.00 ? 15  ALA A HA   3  
ATOM 3868  H HB1  . ALA A 1 15  ? 8.948   -5.419  -1.003  1.00 0.00 ? 15  ALA A HB1  3  
ATOM 3869  H HB2  . ALA A 1 15  ? 7.703   -6.365  -0.189  1.00 0.00 ? 15  ALA A HB2  3  
ATOM 3870  H HB3  . ALA A 1 15  ? 9.383   -6.476  0.339   1.00 0.00 ? 15  ALA A HB3  3  
ATOM 3871  N N    . VAL A 1 16  ? 7.752   -6.984  -3.506  1.00 0.00 ? 16  VAL A N    3  
ATOM 3872  C CA   . VAL A 1 16  ? 6.628   -7.081  -4.465  1.00 0.00 ? 16  VAL A CA   3  
ATOM 3873  C C    . VAL A 1 16  ? 7.187   -6.876  -5.874  1.00 0.00 ? 16  VAL A C    3  
ATOM 3874  O O    . VAL A 1 16  ? 8.030   -6.030  -6.092  1.00 0.00 ? 16  VAL A O    3  
ATOM 3875  C CB   . VAL A 1 16  ? 5.600   -5.993  -4.153  1.00 0.00 ? 16  VAL A CB   3  
ATOM 3876  C CG1  . VAL A 1 16  ? 4.921   -6.299  -2.816  1.00 0.00 ? 16  VAL A CG1  3  
ATOM 3877  C CG2  . VAL A 1 16  ? 6.309   -4.639  -4.065  1.00 0.00 ? 16  VAL A CG2  3  
ATOM 3878  H H    . VAL A 1 16  ? 8.516   -6.397  -3.719  1.00 0.00 ? 16  VAL A H    3  
ATOM 3879  H HA   . VAL A 1 16  ? 6.169   -8.055  -4.390  1.00 0.00 ? 16  VAL A HA   3  
ATOM 3880  H HB   . VAL A 1 16  ? 4.855   -5.963  -4.935  1.00 0.00 ? 16  VAL A HB   3  
ATOM 3881  H HG11 . VAL A 1 16  ? 4.692   -7.352  -2.761  1.00 0.00 ? 16  VAL A HG11 3  
ATOM 3882  H HG12 . VAL A 1 16  ? 5.585   -6.032  -2.006  1.00 0.00 ? 16  VAL A HG12 3  
ATOM 3883  H HG13 . VAL A 1 16  ? 4.008   -5.727  -2.734  1.00 0.00 ? 16  VAL A HG13 3  
ATOM 3884  H HG21 . VAL A 1 16  ? 7.375   -4.787  -4.153  1.00 0.00 ? 16  VAL A HG21 3  
ATOM 3885  H HG22 . VAL A 1 16  ? 5.967   -4.000  -4.864  1.00 0.00 ? 16  VAL A HG22 3  
ATOM 3886  H HG23 . VAL A 1 16  ? 6.088   -4.178  -3.114  1.00 0.00 ? 16  VAL A HG23 3  
ATOM 3887  N N    . THR A 1 17  ? 6.726   -7.629  -6.836  1.00 0.00 ? 17  THR A N    3  
ATOM 3888  C CA   . THR A 1 17  ? 7.247   -7.449  -8.224  1.00 0.00 ? 17  THR A CA   3  
ATOM 3889  C C    . THR A 1 17  ? 6.563   -6.237  -8.863  1.00 0.00 ? 17  THR A C    3  
ATOM 3890  O O    . THR A 1 17  ? 6.746   -5.948  -10.029 1.00 0.00 ? 17  THR A O    3  
ATOM 3891  C CB   . THR A 1 17  ? 6.951   -8.699  -9.054  1.00 0.00 ? 17  THR A CB   3  
ATOM 3892  O OG1  . THR A 1 17  ? 7.438   -8.512  -10.375 1.00 0.00 ? 17  THR A OG1  3  
ATOM 3893  C CG2  . THR A 1 17  ? 5.442   -8.945  -9.094  1.00 0.00 ? 17  THR A CG2  3  
ATOM 3894  H H    . THR A 1 17  ? 6.043   -8.306  -6.648  1.00 0.00 ? 17  THR A H    3  
ATOM 3895  H HA   . THR A 1 17  ? 8.314   -7.284  -8.189  1.00 0.00 ? 17  THR A HA   3  
ATOM 3896  H HB   . THR A 1 17  ? 7.439   -9.552  -8.608  1.00 0.00 ? 17  THR A HB   3  
ATOM 3897  H HG1  . THR A 1 17  ? 8.351   -8.808  -10.400 1.00 0.00 ? 17  THR A HG1  3  
ATOM 3898  H HG21 . THR A 1 17  ? 5.001   -8.640  -8.156  1.00 0.00 ? 17  THR A HG21 3  
ATOM 3899  H HG22 . THR A 1 17  ? 5.007   -8.374  -9.899  1.00 0.00 ? 17  THR A HG22 3  
ATOM 3900  H HG23 . THR A 1 17  ? 5.254   -9.996  -9.255  1.00 0.00 ? 17  THR A HG23 3  
ATOM 3901  N N    . GLN A 1 18  ? 5.786   -5.523  -8.098  1.00 0.00 ? 18  GLN A N    3  
ATOM 3902  C CA   . GLN A 1 18  ? 5.091   -4.318  -8.633  1.00 0.00 ? 18  GLN A CA   3  
ATOM 3903  C C    . GLN A 1 18  ? 4.673   -3.441  -7.456  1.00 0.00 ? 18  GLN A C    3  
ATOM 3904  O O    . GLN A 1 18  ? 4.504   -3.917  -6.351  1.00 0.00 ? 18  GLN A O    3  
ATOM 3905  C CB   . GLN A 1 18  ? 3.844   -4.729  -9.417  1.00 0.00 ? 18  GLN A CB   3  
ATOM 3906  C CG   . GLN A 1 18  ? 4.234   -5.652  -10.572 1.00 0.00 ? 18  GLN A CG   3  
ATOM 3907  C CD   . GLN A 1 18  ? 2.988   -5.999  -11.389 1.00 0.00 ? 18  GLN A CD   3  
ATOM 3908  O OE1  . GLN A 1 18  ? 2.651   -5.308  -12.329 1.00 0.00 ? 18  GLN A OE1  3  
ATOM 3909  N NE2  . GLN A 1 18  ? 2.283   -7.049  -11.065 1.00 0.00 ? 18  GLN A NE2  3  
ATOM 3910  H H    . GLN A 1 18  ? 5.666   -5.775  -7.158  1.00 0.00 ? 18  GLN A H    3  
ATOM 3911  H HA   . GLN A 1 18  ? 5.762   -3.767  -9.276  1.00 0.00 ? 18  GLN A HA   3  
ATOM 3912  H HB2  . GLN A 1 18  ? 3.162   -5.244  -8.757  1.00 0.00 ? 18  GLN A HB2  3  
ATOM 3913  H HB3  . GLN A 1 18  ? 3.363   -3.847  -9.812  1.00 0.00 ? 18  GLN A HB3  3  
ATOM 3914  H HG2  . GLN A 1 18  ? 4.953   -5.151  -11.206 1.00 0.00 ? 18  GLN A HG2  3  
ATOM 3915  H HG3  . GLN A 1 18  ? 4.668   -6.558  -10.180 1.00 0.00 ? 18  GLN A HG3  3  
ATOM 3916  H HE21 . GLN A 1 18  ? 2.554   -7.606  -10.306 1.00 0.00 ? 18  GLN A HE21 3  
ATOM 3917  H HE22 . GLN A 1 18  ? 1.483   -7.279  -11.582 1.00 0.00 ? 18  GLN A HE22 3  
ATOM 3918  N N    . ALA A 1 19  ? 4.501   -2.168  -7.672  1.00 0.00 ? 19  ALA A N    3  
ATOM 3919  C CA   . ALA A 1 19  ? 4.095   -1.287  -6.541  1.00 0.00 ? 19  ALA A CA   3  
ATOM 3920  C C    . ALA A 1 19  ? 3.685   0.088   -7.062  1.00 0.00 ? 19  ALA A C    3  
ATOM 3921  O O    . ALA A 1 19  ? 3.786   0.378   -8.238  1.00 0.00 ? 19  ALA A O    3  
ATOM 3922  C CB   . ALA A 1 19  ? 5.269   -1.131  -5.574  1.00 0.00 ? 19  ALA A CB   3  
ATOM 3923  H H    . ALA A 1 19  ? 4.638   -1.796  -8.568  1.00 0.00 ? 19  ALA A H    3  
ATOM 3924  H HA   . ALA A 1 19  ? 3.263   -1.735  -6.019  1.00 0.00 ? 19  ALA A HA   3  
ATOM 3925  H HB1  . ALA A 1 19  ? 5.841   -2.046  -5.551  1.00 0.00 ? 19  ALA A HB1  3  
ATOM 3926  H HB2  . ALA A 1 19  ? 5.900   -0.320  -5.904  1.00 0.00 ? 19  ALA A HB2  3  
ATOM 3927  H HB3  . ALA A 1 19  ? 4.893   -0.915  -4.585  1.00 0.00 ? 19  ALA A HB3  3  
ATOM 3928  N N    . ALA A 1 20  ? 3.226   0.939   -6.186  1.00 0.00 ? 20  ALA A N    3  
ATOM 3929  C CA   . ALA A 1 20  ? 2.808   2.301   -6.611  1.00 0.00 ? 20  ALA A CA   3  
ATOM 3930  C C    . ALA A 1 20  ? 2.670   3.191   -5.378  1.00 0.00 ? 20  ALA A C    3  
ATOM 3931  O O    . ALA A 1 20  ? 1.812   2.981   -4.545  1.00 0.00 ? 20  ALA A O    3  
ATOM 3932  C CB   . ALA A 1 20  ? 1.456   2.222   -7.330  1.00 0.00 ? 20  ALA A CB   3  
ATOM 3933  H H    . ALA A 1 20  ? 3.157   0.680   -5.244  1.00 0.00 ? 20  ALA A H    3  
ATOM 3934  H HA   . ALA A 1 20  ? 3.554   2.717   -7.274  1.00 0.00 ? 20  ALA A HA   3  
ATOM 3935  H HB1  . ALA A 1 20  ? 0.878   1.407   -6.918  1.00 0.00 ? 20  ALA A HB1  3  
ATOM 3936  H HB2  . ALA A 1 20  ? 0.917   3.148   -7.191  1.00 0.00 ? 20  ALA A HB2  3  
ATOM 3937  H HB3  . ALA A 1 20  ? 1.615   2.053   -8.385  1.00 0.00 ? 20  ALA A HB3  3  
ATOM 3938  N N    . ILE A 1 21  ? 3.498   4.187   -5.251  1.00 0.00 ? 21  ILE A N    3  
ATOM 3939  C CA   . ILE A 1 21  ? 3.393   5.079   -4.067  1.00 0.00 ? 21  ILE A CA   3  
ATOM 3940  C C    . ILE A 1 21  ? 2.258   6.074   -4.298  1.00 0.00 ? 21  ILE A C    3  
ATOM 3941  O O    . ILE A 1 21  ? 2.475   7.206   -4.682  1.00 0.00 ? 21  ILE A O    3  
ATOM 3942  C CB   . ILE A 1 21  ? 4.707   5.831   -3.867  1.00 0.00 ? 21  ILE A CB   3  
ATOM 3943  C CG1  . ILE A 1 21  ? 5.855   4.824   -3.816  1.00 0.00 ? 21  ILE A CG1  3  
ATOM 3944  C CG2  . ILE A 1 21  ? 4.653   6.610   -2.550  1.00 0.00 ? 21  ILE A CG2  3  
ATOM 3945  C CD1  . ILE A 1 21  ? 7.156   5.550   -3.488  1.00 0.00 ? 21  ILE A CD1  3  
ATOM 3946  H H    . ILE A 1 21  ? 4.185   4.349   -5.932  1.00 0.00 ? 21  ILE A H    3  
ATOM 3947  H HA   . ILE A 1 21  ? 3.180   4.486   -3.190  1.00 0.00 ? 21  ILE A HA   3  
ATOM 3948  H HB   . ILE A 1 21  ? 4.860   6.518   -4.687  1.00 0.00 ? 21  ILE A HB   3  
ATOM 3949  H HG12 . ILE A 1 21  ? 5.652   4.086   -3.053  1.00 0.00 ? 21  ILE A HG12 3  
ATOM 3950  H HG13 . ILE A 1 21  ? 5.948   4.335   -4.774  1.00 0.00 ? 21  ILE A HG13 3  
ATOM 3951  H HG21 . ILE A 1 21  ? 3.631   6.666   -2.207  1.00 0.00 ? 21  ILE A HG21 3  
ATOM 3952  H HG22 . ILE A 1 21  ? 5.255   6.104   -1.809  1.00 0.00 ? 21  ILE A HG22 3  
ATOM 3953  H HG23 . ILE A 1 21  ? 5.036   7.607   -2.706  1.00 0.00 ? 21  ILE A HG23 3  
ATOM 3954  H HD11 . ILE A 1 21  ? 7.009   6.614   -3.579  1.00 0.00 ? 21  ILE A HD11 3  
ATOM 3955  H HD12 . ILE A 1 21  ? 7.455   5.313   -2.478  1.00 0.00 ? 21  ILE A HD12 3  
ATOM 3956  H HD13 . ILE A 1 21  ? 7.923   5.234   -4.177  1.00 0.00 ? 21  ILE A HD13 3  
ATOM 3957  N N    . LEU A 1 22  ? 1.044   5.653   -4.070  1.00 0.00 ? 22  LEU A N    3  
ATOM 3958  C CA   . LEU A 1 22  ? -0.113  6.570   -4.280  1.00 0.00 ? 22  LEU A CA   3  
ATOM 3959  C C    . LEU A 1 22  ? 0.041   7.784   -3.358  1.00 0.00 ? 22  LEU A C    3  
ATOM 3960  O O    . LEU A 1 22  ? 1.141   8.184   -3.027  1.00 0.00 ? 22  LEU A O    3  
ATOM 3961  C CB   . LEU A 1 22  ? -1.430  5.838   -3.969  1.00 0.00 ? 22  LEU A CB   3  
ATOM 3962  C CG   . LEU A 1 22  ? -1.307  4.345   -4.311  1.00 0.00 ? 22  LEU A CG   3  
ATOM 3963  C CD1  . LEU A 1 22  ? -2.697  3.702   -4.339  1.00 0.00 ? 22  LEU A CD1  3  
ATOM 3964  C CD2  . LEU A 1 22  ? -0.648  4.173   -5.684  1.00 0.00 ? 22  LEU A CD2  3  
ATOM 3965  H H    . LEU A 1 22  ? 0.896   4.737   -3.763  1.00 0.00 ? 22  LEU A H    3  
ATOM 3966  H HA   . LEU A 1 22  ? -0.121  6.901   -5.309  1.00 0.00 ? 22  LEU A HA   3  
ATOM 3967  H HB2  . LEU A 1 22  ? -1.659  5.947   -2.919  1.00 0.00 ? 22  LEU A HB2  3  
ATOM 3968  H HB3  . LEU A 1 22  ? -2.225  6.273   -4.555  1.00 0.00 ? 22  LEU A HB3  3  
ATOM 3969  H HG   . LEU A 1 22  ? -0.706  3.854   -3.560  1.00 0.00 ? 22  LEU A HG   3  
ATOM 3970  H HD11 . LEU A 1 22  ? -3.360  4.301   -4.946  1.00 0.00 ? 22  LEU A HD11 3  
ATOM 3971  H HD12 . LEU A 1 22  ? -2.626  2.708   -4.759  1.00 0.00 ? 22  LEU A HD12 3  
ATOM 3972  H HD13 . LEU A 1 22  ? -3.087  3.640   -3.334  1.00 0.00 ? 22  LEU A HD13 3  
ATOM 3973  H HD21 . LEU A 1 22  ? -0.947  4.983   -6.333  1.00 0.00 ? 22  LEU A HD21 3  
ATOM 3974  H HD22 . LEU A 1 22  ? 0.426   4.180   -5.572  1.00 0.00 ? 22  LEU A HD22 3  
ATOM 3975  H HD23 . LEU A 1 22  ? -0.957  3.232   -6.117  1.00 0.00 ? 22  LEU A HD23 3  
ATOM 3976  N N    . GLY A 1 23  ? -1.042  8.379   -2.941  1.00 0.00 ? 23  GLY A N    3  
ATOM 3977  C CA   . GLY A 1 23  ? -0.938  9.567   -2.043  1.00 0.00 ? 23  GLY A CA   3  
ATOM 3978  C C    . GLY A 1 23  ? -2.242  9.741   -1.263  1.00 0.00 ? 23  GLY A C    3  
ATOM 3979  O O    . GLY A 1 23  ? -3.322  9.656   -1.814  1.00 0.00 ? 23  GLY A O    3  
ATOM 3980  H H    . GLY A 1 23  ? -1.923  8.048   -3.217  1.00 0.00 ? 23  GLY A H    3  
ATOM 3981  H HA2  . GLY A 1 23  ? -0.120  9.424   -1.351  1.00 0.00 ? 23  GLY A HA2  3  
ATOM 3982  H HA3  . GLY A 1 23  ? -0.757  10.453  -2.636  1.00 0.00 ? 23  GLY A HA3  3  
ATOM 3983  N N    . LEU A 1 24  ? -2.152  9.984   0.016   1.00 0.00 ? 24  LEU A N    3  
ATOM 3984  C CA   . LEU A 1 24  ? -3.387  10.163  0.831   1.00 0.00 ? 24  LEU A CA   3  
ATOM 3985  C C    . LEU A 1 24  ? -3.918  11.588  0.651   1.00 0.00 ? 24  LEU A C    3  
ATOM 3986  O O    . LEU A 1 24  ? -4.872  11.988  1.288   1.00 0.00 ? 24  LEU A O    3  
ATOM 3987  C CB   . LEU A 1 24  ? -3.065  9.922   2.307   1.00 0.00 ? 24  LEU A CB   3  
ATOM 3988  C CG   . LEU A 1 24  ? -1.810  10.707  2.693   1.00 0.00 ? 24  LEU A CG   3  
ATOM 3989  C CD1  . LEU A 1 24  ? -2.135  11.655  3.846   1.00 0.00 ? 24  LEU A CD1  3  
ATOM 3990  C CD2  . LEU A 1 24  ? -0.714  9.732   3.131   1.00 0.00 ? 24  LEU A CD2  3  
ATOM 3991  H H    . LEU A 1 24  ? -1.271  10.049  0.442   1.00 0.00 ? 24  LEU A H    3  
ATOM 3992  H HA   . LEU A 1 24  ? -4.137  9.457   0.506   1.00 0.00 ? 24  LEU A HA   3  
ATOM 3993  H HB2  . LEU A 1 24  ? -3.896  10.251  2.915   1.00 0.00 ? 24  LEU A HB2  3  
ATOM 3994  H HB3  . LEU A 1 24  ? -2.894  8.869   2.470   1.00 0.00 ? 24  LEU A HB3  3  
ATOM 3995  H HG   . LEU A 1 24  ? -1.468  11.279  1.842   1.00 0.00 ? 24  LEU A HG   3  
ATOM 3996  H HD11 . LEU A 1 24  ? -3.042  11.329  4.335   1.00 0.00 ? 24  LEU A HD11 3  
ATOM 3997  H HD12 . LEU A 1 24  ? -1.322  11.651  4.556   1.00 0.00 ? 24  LEU A HD12 3  
ATOM 3998  H HD13 . LEU A 1 24  ? -2.274  12.655  3.462   1.00 0.00 ? 24  LEU A HD13 3  
ATOM 3999  H HD21 . LEU A 1 24  ? -0.885  8.769   2.674   1.00 0.00 ? 24  LEU A HD21 3  
ATOM 4000  H HD22 . LEU A 1 24  ? 0.249   10.112  2.821   1.00 0.00 ? 24  LEU A HD22 3  
ATOM 4001  H HD23 . LEU A 1 24  ? -0.732  9.630   4.206   1.00 0.00 ? 24  LEU A HD23 3  
ATOM 4002  N N    . ASP A 1 25  ? -3.309  12.357  -0.211  1.00 0.00 ? 25  ASP A N    3  
ATOM 4003  C CA   . ASP A 1 25  ? -3.781  13.754  -0.425  1.00 0.00 ? 25  ASP A CA   3  
ATOM 4004  C C    . ASP A 1 25  ? -4.353  13.891  -1.838  1.00 0.00 ? 25  ASP A C    3  
ATOM 4005  O O    . ASP A 1 25  ? -5.016  14.857  -2.159  1.00 0.00 ? 25  ASP A O    3  
ATOM 4006  C CB   . ASP A 1 25  ? -2.606  14.719  -0.256  1.00 0.00 ? 25  ASP A CB   3  
ATOM 4007  C CG   . ASP A 1 25  ? -1.357  14.118  -0.906  1.00 0.00 ? 25  ASP A CG   3  
ATOM 4008  O OD1  . ASP A 1 25  ? -0.682  13.348  -0.243  1.00 0.00 ? 25  ASP A OD1  3  
ATOM 4009  O OD2  . ASP A 1 25  ? -1.098  14.439  -2.054  1.00 0.00 ? 25  ASP A OD2  3  
ATOM 4010  H H    . ASP A 1 25  ? -2.541  12.016  -0.716  1.00 0.00 ? 25  ASP A H    3  
ATOM 4011  H HA   . ASP A 1 25  ? -4.547  13.990  0.298   1.00 0.00 ? 25  ASP A HA   3  
ATOM 4012  H HB2  . ASP A 1 25  ? -2.842  15.661  -0.730  1.00 0.00 ? 25  ASP A HB2  3  
ATOM 4013  H HB3  . ASP A 1 25  ? -2.420  14.880  0.794   1.00 0.00 ? 25  ASP A HB3  3  
ATOM 4014  N N    . GLY A 1 26  ? -4.099  12.931  -2.686  1.00 0.00 ? 26  GLY A N    3  
ATOM 4015  C CA   . GLY A 1 26  ? -4.626  13.008  -4.078  1.00 0.00 ? 26  GLY A CA   3  
ATOM 4016  C C    . GLY A 1 26  ? -3.546  13.577  -4.999  1.00 0.00 ? 26  GLY A C    3  
ATOM 4017  O O    . GLY A 1 26  ? -3.536  14.752  -5.307  1.00 0.00 ? 26  GLY A O    3  
ATOM 4018  H H    . GLY A 1 26  ? -3.561  12.162  -2.408  1.00 0.00 ? 26  GLY A H    3  
ATOM 4019  H HA2  . GLY A 1 26  ? -4.904  12.019  -4.413  1.00 0.00 ? 26  GLY A HA2  3  
ATOM 4020  H HA3  . GLY A 1 26  ? -5.491  13.654  -4.102  1.00 0.00 ? 26  GLY A HA3  3  
ATOM 4021  N N    . ASN A 1 27  ? -2.631  12.755  -5.435  1.00 0.00 ? 27  ASN A N    3  
ATOM 4022  C CA   . ASN A 1 27  ? -1.549  13.256  -6.328  1.00 0.00 ? 27  ASN A CA   3  
ATOM 4023  C C    . ASN A 1 27  ? -0.451  12.190  -6.448  1.00 0.00 ? 27  ASN A C    3  
ATOM 4024  O O    . ASN A 1 27  ? 0.695   12.461  -6.156  1.00 0.00 ? 27  ASN A O    3  
ATOM 4025  C CB   . ASN A 1 27  ? -0.950  14.526  -5.722  1.00 0.00 ? 27  ASN A CB   3  
ATOM 4026  C CG   . ASN A 1 27  ? -1.075  15.681  -6.719  1.00 0.00 ? 27  ASN A CG   3  
ATOM 4027  O OD1  . ASN A 1 27  ? -1.929  15.665  -7.583  1.00 0.00 ? 27  ASN A OD1  3  
ATOM 4028  N ND2  . ASN A 1 27  ? -0.254  16.692  -6.633  1.00 0.00 ? 27  ASN A ND2  3  
ATOM 4029  H H    . ASN A 1 27  ? -2.653  11.811  -5.171  1.00 0.00 ? 27  ASN A H    3  
ATOM 4030  H HA   . ASN A 1 27  ? -1.955  13.481  -7.306  1.00 0.00 ? 27  ASN A HA   3  
ATOM 4031  H HB2  . ASN A 1 27  ? -1.480  14.776  -4.815  1.00 0.00 ? 27  ASN A HB2  3  
ATOM 4032  H HB3  . ASN A 1 27  ? 0.092   14.361  -5.496  1.00 0.00 ? 27  ASN A HB3  3  
ATOM 4033  H HD21 . ASN A 1 27  ? 0.434   16.707  -5.934  1.00 0.00 ? 27  ASN A HD21 3  
ATOM 4034  H HD22 . ASN A 1 27  ? -0.323  17.436  -7.268  1.00 0.00 ? 27  ASN A HD22 3  
ATOM 4035  N N    . THR A 1 28  ? -0.805  10.987  -6.862  1.00 0.00 ? 28  THR A N    3  
ATOM 4036  C CA   . THR A 1 28  ? 0.197   9.873   -7.002  1.00 0.00 ? 28  THR A CA   3  
ATOM 4037  C C    . THR A 1 28  ? 1.624   10.418  -7.112  1.00 0.00 ? 28  THR A C    3  
ATOM 4038  O O    . THR A 1 28  ? 1.903   11.309  -7.891  1.00 0.00 ? 28  THR A O    3  
ATOM 4039  C CB   . THR A 1 28  ? -0.127  9.058   -8.257  1.00 0.00 ? 28  THR A CB   3  
ATOM 4040  O OG1  . THR A 1 28  ? -1.332  8.332   -8.049  1.00 0.00 ? 28  THR A OG1  3  
ATOM 4041  C CG2  . THR A 1 28  ? 1.016   8.084   -8.545  1.00 0.00 ? 28  THR A CG2  3  
ATOM 4042  H H    . THR A 1 28  ? -1.744  10.808  -7.076  1.00 0.00 ? 28  THR A H    3  
ATOM 4043  H HA   . THR A 1 28  ? 0.131   9.228   -6.137  1.00 0.00 ? 28  THR A HA   3  
ATOM 4044  H HB   . THR A 1 28  ? -0.248  9.724   -9.097  1.00 0.00 ? 28  THR A HB   3  
ATOM 4045  H HG1  . THR A 1 28  ? -2.067  8.938   -8.163  1.00 0.00 ? 28  THR A HG1  3  
ATOM 4046  H HG21 . THR A 1 28  ? 1.241   7.520   -7.652  1.00 0.00 ? 28  THR A HG21 3  
ATOM 4047  H HG22 . THR A 1 28  ? 0.724   7.408   -9.334  1.00 0.00 ? 28  THR A HG22 3  
ATOM 4048  H HG23 . THR A 1 28  ? 1.891   8.638   -8.851  1.00 0.00 ? 28  THR A HG23 3  
ATOM 4049  N N    . TRP A 1 29  ? 2.527   9.892   -6.329  1.00 0.00 ? 29  TRP A N    3  
ATOM 4050  C CA   . TRP A 1 29  ? 3.934   10.381  -6.377  1.00 0.00 ? 29  TRP A CA   3  
ATOM 4051  C C    . TRP A 1 29  ? 4.712   9.590   -7.428  1.00 0.00 ? 29  TRP A C    3  
ATOM 4052  O O    . TRP A 1 29  ? 5.444   10.149  -8.222  1.00 0.00 ? 29  TRP A O    3  
ATOM 4053  C CB   . TRP A 1 29  ? 4.590   10.189  -5.007  1.00 0.00 ? 29  TRP A CB   3  
ATOM 4054  C CG   . TRP A 1 29  ? 3.950   11.100  -4.005  1.00 0.00 ? 29  TRP A CG   3  
ATOM 4055  C CD1  . TRP A 1 29  ? 2.699   11.610  -4.101  1.00 0.00 ? 29  TRP A CD1  3  
ATOM 4056  C CD2  . TRP A 1 29  ? 4.506   11.617  -2.760  1.00 0.00 ? 29  TRP A CD2  3  
ATOM 4057  N NE1  . TRP A 1 29  ? 2.452   12.402  -2.995  1.00 0.00 ? 29  TRP A NE1  3  
ATOM 4058  C CE2  . TRP A 1 29  ? 3.534   12.438  -2.140  1.00 0.00 ? 29  TRP A CE2  3  
ATOM 4059  C CE3  . TRP A 1 29  ? 5.744   11.455  -2.112  1.00 0.00 ? 29  TRP A CE3  3  
ATOM 4060  C CZ2  . TRP A 1 29  ? 3.780   13.075  -0.925  1.00 0.00 ? 29  TRP A CZ2  3  
ATOM 4061  C CZ3  . TRP A 1 29  ? 5.995   12.096  -0.887  1.00 0.00 ? 29  TRP A CZ3  3  
ATOM 4062  C CH2  . TRP A 1 29  ? 5.014   12.904  -0.295  1.00 0.00 ? 29  TRP A CH2  3  
ATOM 4063  H H    . TRP A 1 29  ? 2.278   9.179   -5.705  1.00 0.00 ? 29  TRP A H    3  
ATOM 4064  H HA   . TRP A 1 29  ? 3.942   11.429  -6.637  1.00 0.00 ? 29  TRP A HA   3  
ATOM 4065  H HB2  . TRP A 1 29  ? 4.467   9.163   -4.691  1.00 0.00 ? 29  TRP A HB2  3  
ATOM 4066  H HB3  . TRP A 1 29  ? 5.643   10.419  -5.079  1.00 0.00 ? 29  TRP A HB3  3  
ATOM 4067  H HD1  . TRP A 1 29  ? 2.005   11.429  -4.904  1.00 0.00 ? 29  TRP A HD1  3  
ATOM 4068  H HE1  . TRP A 1 29  ? 1.618   12.887  -2.820  1.00 0.00 ? 29  TRP A HE1  3  
ATOM 4069  H HE3  . TRP A 1 29  ? 6.507   10.835  -2.560  1.00 0.00 ? 29  TRP A HE3  3  
ATOM 4070  H HZ2  . TRP A 1 29  ? 3.019   13.695  -0.474  1.00 0.00 ? 29  TRP A HZ2  3  
ATOM 4071  H HZ3  . TRP A 1 29  ? 6.950   11.966  -0.398  1.00 0.00 ? 29  TRP A HZ3  3  
ATOM 4072  H HH2  . TRP A 1 29  ? 5.213   13.393  0.646   1.00 0.00 ? 29  TRP A HH2  3  
ATOM 4073  N N    . ALA A 1 30  ? 4.564   8.294   -7.442  1.00 0.00 ? 30  ALA A N    3  
ATOM 4074  C CA   . ALA A 1 30  ? 5.301   7.476   -8.445  1.00 0.00 ? 30  ALA A CA   3  
ATOM 4075  C C    . ALA A 1 30  ? 4.714   6.063   -8.496  1.00 0.00 ? 30  ALA A C    3  
ATOM 4076  O O    . ALA A 1 30  ? 3.989   5.644   -7.615  1.00 0.00 ? 30  ALA A O    3  
ATOM 4077  C CB   . ALA A 1 30  ? 6.778   7.396   -8.050  1.00 0.00 ? 30  ALA A CB   3  
ATOM 4078  H H    . ALA A 1 30  ? 3.972   7.860   -6.793  1.00 0.00 ? 30  ALA A H    3  
ATOM 4079  H HA   . ALA A 1 30  ? 5.215   7.936   -9.417  1.00 0.00 ? 30  ALA A HA   3  
ATOM 4080  H HB1  . ALA A 1 30  ? 7.091   8.341   -7.632  1.00 0.00 ? 30  ALA A HB1  3  
ATOM 4081  H HB2  . ALA A 1 30  ? 6.913   6.616   -7.315  1.00 0.00 ? 30  ALA A HB2  3  
ATOM 4082  H HB3  . ALA A 1 30  ? 7.373   7.174   -8.924  1.00 0.00 ? 30  ALA A HB3  3  
ATOM 4083  N N    . THR A 1 31  ? 5.032   5.324   -9.525  1.00 0.00 ? 31  THR A N    3  
ATOM 4084  C CA   . THR A 1 31  ? 4.510   3.933   -9.649  1.00 0.00 ? 31  THR A CA   3  
ATOM 4085  C C    . THR A 1 31  ? 5.428   3.141   -10.583 1.00 0.00 ? 31  THR A C    3  
ATOM 4086  O O    . THR A 1 31  ? 6.377   3.674   -11.123 1.00 0.00 ? 31  THR A O    3  
ATOM 4087  C CB   . THR A 1 31  ? 3.090   3.959   -10.223 1.00 0.00 ? 31  THR A CB   3  
ATOM 4088  O OG1  . THR A 1 31  ? 2.667   2.630   -10.496 1.00 0.00 ? 31  THR A OG1  3  
ATOM 4089  C CG2  . THR A 1 31  ? 3.071   4.776   -11.515 1.00 0.00 ? 31  THR A CG2  3  
ATOM 4090  H H    . THR A 1 31  ? 5.623   5.685   -10.219 1.00 0.00 ? 31  THR A H    3  
ATOM 4091  H HA   . THR A 1 31  ? 4.499   3.465   -8.676  1.00 0.00 ? 31  THR A HA   3  
ATOM 4092  H HB   . THR A 1 31  ? 2.421   4.409   -9.507  1.00 0.00 ? 31  THR A HB   3  
ATOM 4093  H HG1  . THR A 1 31  ? 1.725   2.576   -10.320 1.00 0.00 ? 31  THR A HG1  3  
ATOM 4094  H HG21 . THR A 1 31  ? 4.050   5.197   -11.689 1.00 0.00 ? 31  THR A HG21 3  
ATOM 4095  H HG22 . THR A 1 31  ? 2.802   4.136   -12.343 1.00 0.00 ? 31  THR A HG22 3  
ATOM 4096  H HG23 . THR A 1 31  ? 2.348   5.573   -11.426 1.00 0.00 ? 31  THR A HG23 3  
ATOM 4097  N N    . SER A 1 32  ? 5.162   1.876   -10.779 1.00 0.00 ? 32  SER A N    3  
ATOM 4098  C CA   . SER A 1 32  ? 6.040   1.073   -11.680 1.00 0.00 ? 32  SER A CA   3  
ATOM 4099  C C    . SER A 1 32  ? 5.378   -0.265  -12.015 1.00 0.00 ? 32  SER A C    3  
ATOM 4100  O O    . SER A 1 32  ? 5.157   -1.089  -11.149 1.00 0.00 ? 32  SER A O    3  
ATOM 4101  C CB   . SER A 1 32  ? 7.371   0.806   -10.982 1.00 0.00 ? 32  SER A CB   3  
ATOM 4102  O OG   . SER A 1 32  ? 7.903   2.033   -10.509 1.00 0.00 ? 32  SER A OG   3  
ATOM 4103  H H    . SER A 1 32  ? 4.396   1.457   -10.334 1.00 0.00 ? 32  SER A H    3  
ATOM 4104  H HA   . SER A 1 32  ? 6.219   1.624   -12.591 1.00 0.00 ? 32  SER A HA   3  
ATOM 4105  H HB2  . SER A 1 32  ? 7.216   0.140   -10.149 1.00 0.00 ? 32  SER A HB2  3  
ATOM 4106  H HB3  . SER A 1 32  ? 8.058   0.350   -11.683 1.00 0.00 ? 32  SER A HB3  3  
ATOM 4107  H HG   . SER A 1 32  ? 7.417   2.280   -9.717  1.00 0.00 ? 32  SER A HG   3  
ATOM 4108  N N    . ALA A 1 33  ? 5.088   -0.487  -13.272 1.00 0.00 ? 33  ALA A N    3  
ATOM 4109  C CA   . ALA A 1 33  ? 4.461   -1.775  -13.701 1.00 0.00 ? 33  ALA A CA   3  
ATOM 4110  C C    . ALA A 1 33  ? 3.511   -2.295  -12.621 1.00 0.00 ? 33  ALA A C    3  
ATOM 4111  O O    . ALA A 1 33  ? 3.906   -3.029  -11.736 1.00 0.00 ? 33  ALA A O    3  
ATOM 4112  C CB   . ALA A 1 33  ? 5.560   -2.809  -13.948 1.00 0.00 ? 33  ALA A CB   3  
ATOM 4113  H H    . ALA A 1 33  ? 5.297   0.195   -13.943 1.00 0.00 ? 33  ALA A H    3  
ATOM 4114  H HA   . ALA A 1 33  ? 3.910   -1.616  -14.615 1.00 0.00 ? 33  ALA A HA   3  
ATOM 4115  H HB1  . ALA A 1 33  ? 6.474   -2.304  -14.223 1.00 0.00 ? 33  ALA A HB1  3  
ATOM 4116  H HB2  . ALA A 1 33  ? 5.723   -3.383  -13.047 1.00 0.00 ? 33  ALA A HB2  3  
ATOM 4117  H HB3  . ALA A 1 33  ? 5.260   -3.470  -14.747 1.00 0.00 ? 33  ALA A HB3  3  
ATOM 4118  N N    . GLY A 1 34  ? 2.263   -1.927  -12.685 1.00 0.00 ? 34  GLY A N    3  
ATOM 4119  C CA   . GLY A 1 34  ? 1.298   -2.411  -11.660 1.00 0.00 ? 34  GLY A CA   3  
ATOM 4120  C C    . GLY A 1 34  ? -0.122  -2.341  -12.220 1.00 0.00 ? 34  GLY A C    3  
ATOM 4121  O O    . GLY A 1 34  ? -0.653  -3.312  -12.722 1.00 0.00 ? 34  GLY A O    3  
ATOM 4122  H H    . GLY A 1 34  ? 1.960   -1.337  -13.406 1.00 0.00 ? 34  GLY A H    3  
ATOM 4123  H HA2  . GLY A 1 34  ? 1.533   -3.433  -11.399 1.00 0.00 ? 34  GLY A HA2  3  
ATOM 4124  H HA3  . GLY A 1 34  ? 1.365   -1.789  -10.781 1.00 0.00 ? 34  GLY A HA3  3  
ATOM 4125  N N    . PHE A 1 35  ? -0.743  -1.197  -12.131 1.00 0.00 ? 35  PHE A N    3  
ATOM 4126  C CA   . PHE A 1 35  ? -2.132  -1.061  -12.648 1.00 0.00 ? 35  PHE A CA   3  
ATOM 4127  C C    . PHE A 1 35  ? -2.554  0.408   -12.587 1.00 0.00 ? 35  PHE A C    3  
ATOM 4128  O O    . PHE A 1 35  ? -1.996  1.193   -11.848 1.00 0.00 ? 35  PHE A O    3  
ATOM 4129  C CB   . PHE A 1 35  ? -3.078  -1.889  -11.776 1.00 0.00 ? 35  PHE A CB   3  
ATOM 4130  C CG   . PHE A 1 35  ? -3.002  -1.393  -10.352 1.00 0.00 ? 35  PHE A CG   3  
ATOM 4131  C CD1  . PHE A 1 35  ? -1.811  -1.525  -9.629  1.00 0.00 ? 35  PHE A CD1  3  
ATOM 4132  C CD2  . PHE A 1 35  ? -4.118  -0.791  -9.756  1.00 0.00 ? 35  PHE A CD2  3  
ATOM 4133  C CE1  . PHE A 1 35  ? -1.735  -1.061  -8.313  1.00 0.00 ? 35  PHE A CE1  3  
ATOM 4134  C CE2  . PHE A 1 35  ? -4.040  -0.325  -8.436  1.00 0.00 ? 35  PHE A CE2  3  
ATOM 4135  C CZ   . PHE A 1 35  ? -2.846  -0.461  -7.716  1.00 0.00 ? 35  PHE A CZ   3  
ATOM 4136  H H    . PHE A 1 35  ? -0.297  -0.430  -11.718 1.00 0.00 ? 35  PHE A H    3  
ATOM 4137  H HA   . PHE A 1 35  ? -2.178  -1.411  -13.668 1.00 0.00 ? 35  PHE A HA   3  
ATOM 4138  H HB2  . PHE A 1 35  ? -4.090  -1.786  -12.143 1.00 0.00 ? 35  PHE A HB2  3  
ATOM 4139  H HB3  . PHE A 1 35  ? -2.786  -2.928  -11.812 1.00 0.00 ? 35  PHE A HB3  3  
ATOM 4140  H HD1  . PHE A 1 35  ? -0.951  -1.990  -10.085 1.00 0.00 ? 35  PHE A HD1  3  
ATOM 4141  H HD2  . PHE A 1 35  ? -5.037  -0.687  -10.312 1.00 0.00 ? 35  PHE A HD2  3  
ATOM 4142  H HE1  . PHE A 1 35  ? -0.815  -1.160  -7.760  1.00 0.00 ? 35  PHE A HE1  3  
ATOM 4143  H HE2  . PHE A 1 35  ? -4.900  0.138   -7.975  1.00 0.00 ? 35  PHE A HE2  3  
ATOM 4144  H HZ   . PHE A 1 35  ? -2.781  -0.104  -6.699  1.00 0.00 ? 35  PHE A HZ   3  
ATOM 4145  N N    . ALA A 1 36  ? -3.543  0.782   -13.350 1.00 0.00 ? 36  ALA A N    3  
ATOM 4146  C CA   . ALA A 1 36  ? -4.007  2.196   -13.322 1.00 0.00 ? 36  ALA A CA   3  
ATOM 4147  C C    . ALA A 1 36  ? -5.144  2.320   -12.309 1.00 0.00 ? 36  ALA A C    3  
ATOM 4148  O O    . ALA A 1 36  ? -6.193  1.728   -12.463 1.00 0.00 ? 36  ALA A O    3  
ATOM 4149  C CB   . ALA A 1 36  ? -4.509  2.602   -14.709 1.00 0.00 ? 36  ALA A CB   3  
ATOM 4150  H H    . ALA A 1 36  ? -3.987  0.131   -13.934 1.00 0.00 ? 36  ALA A H    3  
ATOM 4151  H HA   . ALA A 1 36  ? -3.189  2.839   -13.029 1.00 0.00 ? 36  ALA A HA   3  
ATOM 4152  H HB1  . ALA A 1 36  ? -3.819  2.248   -15.459 1.00 0.00 ? 36  ALA A HB1  3  
ATOM 4153  H HB2  . ALA A 1 36  ? -5.482  2.167   -14.880 1.00 0.00 ? 36  ALA A HB2  3  
ATOM 4154  H HB3  . ALA A 1 36  ? -4.580  3.679   -14.763 1.00 0.00 ? 36  ALA A HB3  3  
ATOM 4155  N N    . VAL A 1 37  ? -4.944  3.078   -11.267 1.00 0.00 ? 37  VAL A N    3  
ATOM 4156  C CA   . VAL A 1 37  ? -6.013  3.228   -10.243 1.00 0.00 ? 37  VAL A CA   3  
ATOM 4157  C C    . VAL A 1 37  ? -7.057  4.232   -10.735 1.00 0.00 ? 37  VAL A C    3  
ATOM 4158  O O    . VAL A 1 37  ? -6.811  5.420   -10.795 1.00 0.00 ? 37  VAL A O    3  
ATOM 4159  C CB   . VAL A 1 37  ? -5.396  3.729   -8.935  1.00 0.00 ? 37  VAL A CB   3  
ATOM 4160  C CG1  . VAL A 1 37  ? -6.498  3.913   -7.891  1.00 0.00 ? 37  VAL A CG1  3  
ATOM 4161  C CG2  . VAL A 1 37  ? -4.379  2.704   -8.425  1.00 0.00 ? 37  VAL A CG2  3  
ATOM 4162  H H    . VAL A 1 37  ? -4.088  3.544   -11.156 1.00 0.00 ? 37  VAL A H    3  
ATOM 4163  H HA   . VAL A 1 37  ? -6.485  2.272   -10.074 1.00 0.00 ? 37  VAL A HA   3  
ATOM 4164  H HB   . VAL A 1 37  ? -4.903  4.674   -9.109  1.00 0.00 ? 37  VAL A HB   3  
ATOM 4165  H HG11 . VAL A 1 37  ? -7.445  3.609   -8.310  1.00 0.00 ? 37  VAL A HG11 3  
ATOM 4166  H HG12 . VAL A 1 37  ? -6.276  3.306   -7.024  1.00 0.00 ? 37  VAL A HG12 3  
ATOM 4167  H HG13 . VAL A 1 37  ? -6.549  4.951   -7.599  1.00 0.00 ? 37  VAL A HG13 3  
ATOM 4168  H HG21 . VAL A 1 37  ? -4.008  2.118   -9.254  1.00 0.00 ? 37  VAL A HG21 3  
ATOM 4169  H HG22 . VAL A 1 37  ? -3.556  3.217   -7.951  1.00 0.00 ? 37  VAL A HG22 3  
ATOM 4170  H HG23 . VAL A 1 37  ? -4.855  2.050   -7.709  1.00 0.00 ? 37  VAL A HG23 3  
ATOM 4171  N N    . THR A 1 38  ? -8.222  3.763   -11.090 1.00 0.00 ? 38  THR A N    3  
ATOM 4172  C CA   . THR A 1 38  ? -9.280  4.691   -11.579 1.00 0.00 ? 38  THR A CA   3  
ATOM 4173  C C    . THR A 1 38  ? -9.400  5.879   -10.614 1.00 0.00 ? 38  THR A C    3  
ATOM 4174  O O    . THR A 1 38  ? -9.337  5.703   -9.413  1.00 0.00 ? 38  THR A O    3  
ATOM 4175  C CB   . THR A 1 38  ? -10.618 3.949   -11.644 1.00 0.00 ? 38  THR A CB   3  
ATOM 4176  O OG1  . THR A 1 38  ? -10.428 2.687   -12.269 1.00 0.00 ? 38  THR A OG1  3  
ATOM 4177  C CG2  . THR A 1 38  ? -11.622 4.774   -12.452 1.00 0.00 ? 38  THR A CG2  3  
ATOM 4178  H H    . THR A 1 38  ? -8.401  2.800   -11.036 1.00 0.00 ? 38  THR A H    3  
ATOM 4179  H HA   . THR A 1 38  ? -9.016  5.046   -12.564 1.00 0.00 ? 38  THR A HA   3  
ATOM 4180  H HB   . THR A 1 38  ? -10.999 3.804   -10.647 1.00 0.00 ? 38  THR A HB   3  
ATOM 4181  H HG1  . THR A 1 38  ? -9.685  2.764   -12.872 1.00 0.00 ? 38  THR A HG1  3  
ATOM 4182  H HG21 . THR A 1 38  ? -11.222 4.964   -13.438 1.00 0.00 ? 38  THR A HG21 3  
ATOM 4183  H HG22 . THR A 1 38  ? -12.548 4.227   -12.540 1.00 0.00 ? 38  THR A HG22 3  
ATOM 4184  H HG23 . THR A 1 38  ? -11.804 5.713   -11.950 1.00 0.00 ? 38  THR A HG23 3  
ATOM 4185  N N    . PRO A 1 39  ? -9.568  7.055   -11.167 1.00 0.00 ? 39  PRO A N    3  
ATOM 4186  C CA   . PRO A 1 39  ? -9.696  8.288   -10.366 1.00 0.00 ? 39  PRO A CA   3  
ATOM 4187  C C    . PRO A 1 39  ? -10.960 8.234   -9.502  1.00 0.00 ? 39  PRO A C    3  
ATOM 4188  O O    . PRO A 1 39  ? -11.815 7.391   -9.691  1.00 0.00 ? 39  PRO A O    3  
ATOM 4189  C CB   . PRO A 1 39  ? -9.804  9.418   -11.399 1.00 0.00 ? 39  PRO A CB   3  
ATOM 4190  C CG   . PRO A 1 39  ? -9.785  8.773   -12.809 1.00 0.00 ? 39  PRO A CG   3  
ATOM 4191  C CD   . PRO A 1 39  ? -9.640  7.253   -12.626 1.00 0.00 ? 39  PRO A CD   3  
ATOM 4192  H HA   . PRO A 1 39  ? -8.822  8.433   -9.752  1.00 0.00 ? 39  PRO A HA   3  
ATOM 4193  H HB2  . PRO A 1 39  ? -10.729 9.959   -11.254 1.00 0.00 ? 39  PRO A HB2  3  
ATOM 4194  H HB3  . PRO A 1 39  ? -8.965  10.089  -11.299 1.00 0.00 ? 39  PRO A HB3  3  
ATOM 4195  H HG2  . PRO A 1 39  ? -10.709 8.995   -13.325 1.00 0.00 ? 39  PRO A HG2  3  
ATOM 4196  H HG3  . PRO A 1 39  ? -8.948  9.150   -13.375 1.00 0.00 ? 39  PRO A HG3  3  
ATOM 4197  H HD2  . PRO A 1 39  ? -10.499 6.744   -13.035 1.00 0.00 ? 39  PRO A HD2  3  
ATOM 4198  H HD3  . PRO A 1 39  ? -8.733  6.903   -13.094 1.00 0.00 ? 39  PRO A HD3  3  
ATOM 4199  N N    . ALA A 1 40  ? -11.081 9.137   -8.560  1.00 0.00 ? 40  ALA A N    3  
ATOM 4200  C CA   . ALA A 1 40  ? -12.287 9.164   -7.676  1.00 0.00 ? 40  ALA A CA   3  
ATOM 4201  C C    . ALA A 1 40  ? -12.133 8.152   -6.536  1.00 0.00 ? 40  ALA A C    3  
ATOM 4202  O O    . ALA A 1 40  ? -12.478 8.427   -5.403  1.00 0.00 ? 40  ALA A O    3  
ATOM 4203  C CB   . ALA A 1 40  ? -13.537 8.828   -8.493  1.00 0.00 ? 40  ALA A CB   3  
ATOM 4204  H H    . ALA A 1 40  ? -10.375 9.805   -8.437  1.00 0.00 ? 40  ALA A H    3  
ATOM 4205  H HA   . ALA A 1 40  ? -12.395 10.154  -7.258  1.00 0.00 ? 40  ALA A HA   3  
ATOM 4206  H HB1  . ALA A 1 40  ? -13.466 9.289   -9.467  1.00 0.00 ? 40  ALA A HB1  3  
ATOM 4207  H HB2  . ALA A 1 40  ? -13.613 7.755   -8.607  1.00 0.00 ? 40  ALA A HB2  3  
ATOM 4208  H HB3  . ALA A 1 40  ? -14.412 9.198   -7.980  1.00 0.00 ? 40  ALA A HB3  3  
ATOM 4209  N N    . GLN A 1 41  ? -11.625 6.984   -6.820  1.00 0.00 ? 41  GLN A N    3  
ATOM 4210  C CA   . GLN A 1 41  ? -11.460 5.963   -5.745  1.00 0.00 ? 41  GLN A CA   3  
ATOM 4211  C C    . GLN A 1 41  ? -10.365 6.408   -4.773  1.00 0.00 ? 41  GLN A C    3  
ATOM 4212  O O    . GLN A 1 41  ? -10.404 6.102   -3.598  1.00 0.00 ? 41  GLN A O    3  
ATOM 4213  C CB   . GLN A 1 41  ? -11.066 4.625   -6.374  1.00 0.00 ? 41  GLN A CB   3  
ATOM 4214  C CG   . GLN A 1 41  ? -12.325 3.846   -6.758  1.00 0.00 ? 41  GLN A CG   3  
ATOM 4215  C CD   . GLN A 1 41  ? -12.049 2.348   -6.644  1.00 0.00 ? 41  GLN A CD   3  
ATOM 4216  O OE1  . GLN A 1 41  ? -11.110 1.940   -5.989  1.00 0.00 ? 41  GLN A OE1  3  
ATOM 4217  N NE2  . GLN A 1 41  ? -12.833 1.504   -7.258  1.00 0.00 ? 41  GLN A NE2  3  
ATOM 4218  H H    . GLN A 1 41  ? -11.356 6.775   -7.738  1.00 0.00 ? 41  GLN A H    3  
ATOM 4219  H HA   . GLN A 1 41  ? -12.392 5.848   -5.211  1.00 0.00 ? 41  GLN A HA   3  
ATOM 4220  H HB2  . GLN A 1 41  ? -10.469 4.803   -7.257  1.00 0.00 ? 41  GLN A HB2  3  
ATOM 4221  H HB3  . GLN A 1 41  ? -10.493 4.049   -5.663  1.00 0.00 ? 41  GLN A HB3  3  
ATOM 4222  H HG2  . GLN A 1 41  ? -13.132 4.118   -6.094  1.00 0.00 ? 41  GLN A HG2  3  
ATOM 4223  H HG3  . GLN A 1 41  ? -12.599 4.083   -7.776  1.00 0.00 ? 41  GLN A HG3  3  
ATOM 4224  H HE21 . GLN A 1 41  ? -13.589 1.833   -7.787  1.00 0.00 ? 41  GLN A HE21 3  
ATOM 4225  H HE22 . GLN A 1 41  ? -12.666 0.541   -7.187  1.00 0.00 ? 41  GLN A HE22 3  
ATOM 4226  N N    . GLY A 1 42  ? -9.386  7.122   -5.255  1.00 0.00 ? 42  GLY A N    3  
ATOM 4227  C CA   . GLY A 1 42  ? -8.285  7.580   -4.361  1.00 0.00 ? 42  GLY A CA   3  
ATOM 4228  C C    . GLY A 1 42  ? -8.868  8.292   -3.138  1.00 0.00 ? 42  GLY A C    3  
ATOM 4229  O O    . GLY A 1 42  ? -8.379  8.152   -2.035  1.00 0.00 ? 42  GLY A O    3  
ATOM 4230  H H    . GLY A 1 42  ? -9.372  7.354   -6.207  1.00 0.00 ? 42  GLY A H    3  
ATOM 4231  H HA2  . GLY A 1 42  ? -7.706  6.726   -4.038  1.00 0.00 ? 42  GLY A HA2  3  
ATOM 4232  H HA3  . GLY A 1 42  ? -7.646  8.264   -4.899  1.00 0.00 ? 42  GLY A HA3  3  
ATOM 4233  N N    . GLN A 1 43  ? -9.906  9.060   -3.324  1.00 0.00 ? 43  GLN A N    3  
ATOM 4234  C CA   . GLN A 1 43  ? -10.514 9.786   -2.172  1.00 0.00 ? 43  GLN A CA   3  
ATOM 4235  C C    . GLN A 1 43  ? -11.067 8.781   -1.154  1.00 0.00 ? 43  GLN A C    3  
ATOM 4236  O O    . GLN A 1 43  ? -11.015 9.004   0.039   1.00 0.00 ? 43  GLN A O    3  
ATOM 4237  C CB   . GLN A 1 43  ? -11.650 10.677  -2.676  1.00 0.00 ? 43  GLN A CB   3  
ATOM 4238  C CG   . GLN A 1 43  ? -11.699 11.960  -1.846  1.00 0.00 ? 43  GLN A CG   3  
ATOM 4239  C CD   . GLN A 1 43  ? -13.136 12.479  -1.791  1.00 0.00 ? 43  GLN A CD   3  
ATOM 4240  O OE1  . GLN A 1 43  ? -14.031 11.886  -2.361  1.00 0.00 ? 43  GLN A OE1  3  
ATOM 4241  N NE2  . GLN A 1 43  ? -13.400 13.568  -1.122  1.00 0.00 ? 43  GLN A NE2  3  
ATOM 4242  H H    . GLN A 1 43  ? -10.284 9.164   -4.222  1.00 0.00 ? 43  GLN A H    3  
ATOM 4243  H HA   . GLN A 1 43  ? -9.763  10.399  -1.698  1.00 0.00 ? 43  GLN A HA   3  
ATOM 4244  H HB2  . GLN A 1 43  ? -11.479 10.926  -3.714  1.00 0.00 ? 43  GLN A HB2  3  
ATOM 4245  H HB3  . GLN A 1 43  ? -12.590 10.154  -2.581  1.00 0.00 ? 43  GLN A HB3  3  
ATOM 4246  H HG2  . GLN A 1 43  ? -11.351 11.753  -0.844  1.00 0.00 ? 43  GLN A HG2  3  
ATOM 4247  H HG3  . GLN A 1 43  ? -11.066 12.707  -2.300  1.00 0.00 ? 43  GLN A HG3  3  
ATOM 4248  H HE21 . GLN A 1 43  ? -12.678 14.046  -0.661  1.00 0.00 ? 43  GLN A HE21 3  
ATOM 4249  H HE22 . GLN A 1 43  ? -14.317 13.909  -1.082  1.00 0.00 ? 43  GLN A HE22 3  
ATOM 4250  N N    . THR A 1 44  ? -11.596 7.681   -1.614  1.00 0.00 ? 44  THR A N    3  
ATOM 4251  C CA   . THR A 1 44  ? -12.153 6.670   -0.670  1.00 0.00 ? 44  THR A CA   3  
ATOM 4252  C C    . THR A 1 44  ? -11.073 6.242   0.328   1.00 0.00 ? 44  THR A C    3  
ATOM 4253  O O    . THR A 1 44  ? -11.346 6.010   1.491   1.00 0.00 ? 44  THR A O    3  
ATOM 4254  C CB   . THR A 1 44  ? -12.630 5.447   -1.457  1.00 0.00 ? 44  THR A CB   3  
ATOM 4255  O OG1  . THR A 1 44  ? -13.679 5.830   -2.337  1.00 0.00 ? 44  THR A OG1  3  
ATOM 4256  C CG2  . THR A 1 44  ? -13.138 4.380   -0.487  1.00 0.00 ? 44  THR A CG2  3  
ATOM 4257  H H    . THR A 1 44  ? -11.632 7.520   -2.580  1.00 0.00 ? 44  THR A H    3  
ATOM 4258  H HA   . THR A 1 44  ? -12.988 7.099   -0.135  1.00 0.00 ? 44  THR A HA   3  
ATOM 4259  H HB   . THR A 1 44  ? -11.807 5.045   -2.030  1.00 0.00 ? 44  THR A HB   3  
ATOM 4260  H HG1  . THR A 1 44  ? -13.574 6.763   -2.535  1.00 0.00 ? 44  THR A HG1  3  
ATOM 4261  H HG21 . THR A 1 44  ? -13.950 4.785   0.099   1.00 0.00 ? 44  THR A HG21 3  
ATOM 4262  H HG22 . THR A 1 44  ? -13.488 3.524   -1.045  1.00 0.00 ? 44  THR A HG22 3  
ATOM 4263  H HG23 . THR A 1 44  ? -12.335 4.079   0.169   1.00 0.00 ? 44  THR A HG23 3  
ATOM 4264  N N    . LEU A 1 45  ? -9.851  6.130   -0.115  1.00 0.00 ? 45  LEU A N    3  
ATOM 4265  C CA   . LEU A 1 45  ? -8.757  5.711   0.809   1.00 0.00 ? 45  LEU A CA   3  
ATOM 4266  C C    . LEU A 1 45  ? -8.555  6.777   1.892   1.00 0.00 ? 45  LEU A C    3  
ATOM 4267  O O    . LEU A 1 45  ? -8.321  6.469   3.044   1.00 0.00 ? 45  LEU A O    3  
ATOM 4268  C CB   . LEU A 1 45  ? -7.461  5.538   0.014   1.00 0.00 ? 45  LEU A CB   3  
ATOM 4269  C CG   . LEU A 1 45  ? -6.714  4.300   0.511   1.00 0.00 ? 45  LEU A CG   3  
ATOM 4270  C CD1  . LEU A 1 45  ? -7.303  3.049   -0.143  1.00 0.00 ? 45  LEU A CD1  3  
ATOM 4271  C CD2  . LEU A 1 45  ? -5.234  4.415   0.139   1.00 0.00 ? 45  LEU A CD2  3  
ATOM 4272  H H    . LEU A 1 45  ? -9.651  6.317   -1.055  1.00 0.00 ? 45  LEU A H    3  
ATOM 4273  H HA   . LEU A 1 45  ? -9.020  4.773   1.275   1.00 0.00 ? 45  LEU A HA   3  
ATOM 4274  H HB2  . LEU A 1 45  ? -7.696  5.419   -1.034  1.00 0.00 ? 45  LEU A HB2  3  
ATOM 4275  H HB3  . LEU A 1 45  ? -6.837  6.409   0.145   1.00 0.00 ? 45  LEU A HB3  3  
ATOM 4276  H HG   . LEU A 1 45  ? -6.813  4.226   1.585   1.00 0.00 ? 45  LEU A HG   3  
ATOM 4277  H HD11 . LEU A 1 45  ? -8.143  3.328   -0.762  1.00 0.00 ? 45  LEU A HD11 3  
ATOM 4278  H HD12 . LEU A 1 45  ? -6.550  2.573   -0.753  1.00 0.00 ? 45  LEU A HD12 3  
ATOM 4279  H HD13 . LEU A 1 45  ? -7.633  2.363   0.623   1.00 0.00 ? 45  LEU A HD13 3  
ATOM 4280  H HD21 . LEU A 1 45  ? -5.139  4.925   -0.808  1.00 0.00 ? 45  LEU A HD21 3  
ATOM 4281  H HD22 . LEU A 1 45  ? -4.713  4.974   0.902   1.00 0.00 ? 45  LEU A HD22 3  
ATOM 4282  H HD23 . LEU A 1 45  ? -4.804  3.428   0.061   1.00 0.00 ? 45  LEU A HD23 3  
ATOM 4283  N N    . ALA A 1 46  ? -8.637  8.028   1.529   1.00 0.00 ? 46  ALA A N    3  
ATOM 4284  C CA   . ALA A 1 46  ? -8.441  9.112   2.536   1.00 0.00 ? 46  ALA A CA   3  
ATOM 4285  C C    . ALA A 1 46  ? -9.630  9.151   3.501   1.00 0.00 ? 46  ALA A C    3  
ATOM 4286  O O    . ALA A 1 46  ? -9.510  9.589   4.628   1.00 0.00 ? 46  ALA A O    3  
ATOM 4287  C CB   . ALA A 1 46  ? -8.325  10.457  1.818   1.00 0.00 ? 46  ALA A CB   3  
ATOM 4288  H H    . ALA A 1 46  ? -8.821  8.257   0.595   1.00 0.00 ? 46  ALA A H    3  
ATOM 4289  H HA   . ALA A 1 46  ? -7.535  8.924   3.092   1.00 0.00 ? 46  ALA A HA   3  
ATOM 4290  H HB1  . ALA A 1 46  ? -7.603  10.378  1.018   1.00 0.00 ? 46  ALA A HB1  3  
ATOM 4291  H HB2  . ALA A 1 46  ? -9.286  10.732  1.409   1.00 0.00 ? 46  ALA A HB2  3  
ATOM 4292  H HB3  . ALA A 1 46  ? -8.003  11.213  2.519   1.00 0.00 ? 46  ALA A HB3  3  
ATOM 4293  N N    . SER A 1 47  ? -10.776 8.701   3.071   1.00 0.00 ? 47  SER A N    3  
ATOM 4294  C CA   . SER A 1 47  ? -11.965 8.722   3.969   1.00 0.00 ? 47  SER A CA   3  
ATOM 4295  C C    . SER A 1 47  ? -12.016 7.432   4.791   1.00 0.00 ? 47  SER A C    3  
ATOM 4296  O O    . SER A 1 47  ? -12.687 7.354   5.801   1.00 0.00 ? 47  SER A O    3  
ATOM 4297  C CB   . SER A 1 47  ? -13.237 8.840   3.130   1.00 0.00 ? 47  SER A CB   3  
ATOM 4298  O OG   . SER A 1 47  ? -14.334 8.316   3.866   1.00 0.00 ? 47  SER A OG   3  
ATOM 4299  H H    . SER A 1 47  ? -10.856 8.354   2.158   1.00 0.00 ? 47  SER A H    3  
ATOM 4300  H HA   . SER A 1 47  ? -11.897 9.568   4.637   1.00 0.00 ? 47  SER A HA   3  
ATOM 4301  H HB2  . SER A 1 47  ? -13.425 9.877   2.902   1.00 0.00 ? 47  SER A HB2  3  
ATOM 4302  H HB3  . SER A 1 47  ? -13.111 8.288   2.207   1.00 0.00 ? 47  SER A HB3  3  
ATOM 4303  H HG   . SER A 1 47  ? -14.215 7.365   3.938   1.00 0.00 ? 47  SER A HG   3  
ATOM 4304  N N    . ALA A 1 48  ? -11.315 6.418   4.367   1.00 0.00 ? 48  ALA A N    3  
ATOM 4305  C CA   . ALA A 1 48  ? -11.327 5.137   5.127   1.00 0.00 ? 48  ALA A CA   3  
ATOM 4306  C C    . ALA A 1 48  ? -10.514 5.297   6.415   1.00 0.00 ? 48  ALA A C    3  
ATOM 4307  O O    . ALA A 1 48  ? -10.789 4.666   7.416   1.00 0.00 ? 48  ALA A O    3  
ATOM 4308  C CB   . ALA A 1 48  ? -10.713 4.029   4.268   1.00 0.00 ? 48  ALA A CB   3  
ATOM 4309  H H    . ALA A 1 48  ? -10.781 6.497   3.549   1.00 0.00 ? 48  ALA A H    3  
ATOM 4310  H HA   . ALA A 1 48  ? -12.347 4.876   5.375   1.00 0.00 ? 48  ALA A HA   3  
ATOM 4311  H HB1  . ALA A 1 48  ? -10.087 4.470   3.506   1.00 0.00 ? 48  ALA A HB1  3  
ATOM 4312  H HB2  . ALA A 1 48  ? -10.116 3.379   4.892   1.00 0.00 ? 48  ALA A HB2  3  
ATOM 4313  H HB3  . ALA A 1 48  ? -11.500 3.456   3.801   1.00 0.00 ? 48  ALA A HB3  3  
ATOM 4314  N N    . PHE A 1 49  ? -9.512  6.132   6.395   1.00 0.00 ? 49  PHE A N    3  
ATOM 4315  C CA   . PHE A 1 49  ? -8.680  6.326   7.618   1.00 0.00 ? 49  PHE A CA   3  
ATOM 4316  C C    . PHE A 1 49  ? -9.573  6.712   8.801   1.00 0.00 ? 49  PHE A C    3  
ATOM 4317  O O    . PHE A 1 49  ? -9.455  6.167   9.880   1.00 0.00 ? 49  PHE A O    3  
ATOM 4318  C CB   . PHE A 1 49  ? -7.652  7.434   7.370   1.00 0.00 ? 49  PHE A CB   3  
ATOM 4319  C CG   . PHE A 1 49  ? -6.778  7.070   6.190   1.00 0.00 ? 49  PHE A CG   3  
ATOM 4320  C CD1  . PHE A 1 49  ? -6.614  5.729   5.824   1.00 0.00 ? 49  PHE A CD1  3  
ATOM 4321  C CD2  . PHE A 1 49  ? -6.130  8.077   5.464   1.00 0.00 ? 49  PHE A CD2  3  
ATOM 4322  C CE1  . PHE A 1 49  ? -5.803  5.395   4.733   1.00 0.00 ? 49  PHE A CE1  3  
ATOM 4323  C CE2  . PHE A 1 49  ? -5.319  7.744   4.373   1.00 0.00 ? 49  PHE A CE2  3  
ATOM 4324  C CZ   . PHE A 1 49  ? -5.155  6.402   4.007   1.00 0.00 ? 49  PHE A CZ   3  
ATOM 4325  H H    . PHE A 1 49  ? -9.304  6.630   5.576   1.00 0.00 ? 49  PHE A H    3  
ATOM 4326  H HA   . PHE A 1 49  ? -8.164  5.406   7.848   1.00 0.00 ? 49  PHE A HA   3  
ATOM 4327  H HB2  . PHE A 1 49  ? -8.166  8.362   7.163   1.00 0.00 ? 49  PHE A HB2  3  
ATOM 4328  H HB3  . PHE A 1 49  ? -7.035  7.554   8.248   1.00 0.00 ? 49  PHE A HB3  3  
ATOM 4329  H HD1  . PHE A 1 49  ? -7.112  4.951   6.382   1.00 0.00 ? 49  PHE A HD1  3  
ATOM 4330  H HD2  . PHE A 1 49  ? -6.255  9.112   5.746   1.00 0.00 ? 49  PHE A HD2  3  
ATOM 4331  H HE1  . PHE A 1 49  ? -5.676  4.360   4.451   1.00 0.00 ? 49  PHE A HE1  3  
ATOM 4332  H HE2  . PHE A 1 49  ? -4.819  8.521   3.814   1.00 0.00 ? 49  PHE A HE2  3  
ATOM 4333  H HZ   . PHE A 1 49  ? -4.529  6.145   3.166   1.00 0.00 ? 49  PHE A HZ   3  
ATOM 4334  N N    . ASN A 1 50  ? -10.465 7.649   8.614   1.00 0.00 ? 50  ASN A N    3  
ATOM 4335  C CA   . ASN A 1 50  ? -11.356 8.059   9.738   1.00 0.00 ? 50  ASN A CA   3  
ATOM 4336  C C    . ASN A 1 50  ? -12.493 7.046   9.882   1.00 0.00 ? 50  ASN A C    3  
ATOM 4337  O O    . ASN A 1 50  ? -12.799 6.592   10.968  1.00 0.00 ? 50  ASN A O    3  
ATOM 4338  C CB   . ASN A 1 50  ? -11.938 9.446   9.451   1.00 0.00 ? 50  ASN A CB   3  
ATOM 4339  C CG   . ASN A 1 50  ? -12.839 9.377   8.217   1.00 0.00 ? 50  ASN A CG   3  
ATOM 4340  O OD1  . ASN A 1 50  ? -13.969 8.938   8.299   1.00 0.00 ? 50  ASN A OD1  3  
ATOM 4341  N ND2  . ASN A 1 50  ? -12.383 9.795   7.068   1.00 0.00 ? 50  ASN A ND2  3  
ATOM 4342  H H    . ASN A 1 50  ? -10.547 8.081   7.738   1.00 0.00 ? 50  ASN A H    3  
ATOM 4343  H HA   . ASN A 1 50  ? -10.785 8.091   10.654  1.00 0.00 ? 50  ASN A HA   3  
ATOM 4344  H HB2  . ASN A 1 50  ? -12.517 9.776   10.303  1.00 0.00 ? 50  ASN A HB2  3  
ATOM 4345  H HB3  . ASN A 1 50  ? -11.135 10.144  9.271   1.00 0.00 ? 50  ASN A HB3  3  
ATOM 4346  H HD21 . ASN A 1 50  ? -11.472 10.148  7.001   1.00 0.00 ? 50  ASN A HD21 3  
ATOM 4347  H HD22 . ASN A 1 50  ? -12.953 9.754   6.271   1.00 0.00 ? 50  ASN A HD22 3  
ATOM 4348  N N    . ASN A 1 51  ? -13.117 6.681   8.796   1.00 0.00 ? 51  ASN A N    3  
ATOM 4349  C CA   . ASN A 1 51  ? -14.228 5.689   8.869   1.00 0.00 ? 51  ASN A CA   3  
ATOM 4350  C C    . ASN A 1 51  ? -13.744 4.361   8.285   1.00 0.00 ? 51  ASN A C    3  
ATOM 4351  O O    . ASN A 1 51  ? -13.493 4.248   7.102   1.00 0.00 ? 51  ASN A O    3  
ATOM 4352  C CB   . ASN A 1 51  ? -15.424 6.203   8.063   1.00 0.00 ? 51  ASN A CB   3  
ATOM 4353  C CG   . ASN A 1 51  ? -16.722 5.670   8.673   1.00 0.00 ? 51  ASN A CG   3  
ATOM 4354  O OD1  . ASN A 1 51  ? -17.252 6.249   9.600   1.00 0.00 ? 51  ASN A OD1  3  
ATOM 4355  N ND2  . ASN A 1 51  ? -17.262 4.587   8.187   1.00 0.00 ? 51  ASN A ND2  3  
ATOM 4356  H H    . ASN A 1 51  ? -12.850 7.055   7.931   1.00 0.00 ? 51  ASN A H    3  
ATOM 4357  H HA   . ASN A 1 51  ? -14.518 5.547   9.899   1.00 0.00 ? 51  ASN A HA   3  
ATOM 4358  H HB2  . ASN A 1 51  ? -15.433 7.284   8.083   1.00 0.00 ? 51  ASN A HB2  3  
ATOM 4359  H HB3  . ASN A 1 51  ? -15.342 5.864   7.041   1.00 0.00 ? 51  ASN A HB3  3  
ATOM 4360  H HD21 . ASN A 1 51  ? -16.836 4.120   7.438   1.00 0.00 ? 51  ASN A HD21 3  
ATOM 4361  H HD22 . ASN A 1 51  ? -18.093 4.239   8.572   1.00 0.00 ? 51  ASN A HD22 3  
ATOM 4362  N N    . ALA A 1 52  ? -13.601 3.355   9.105   1.00 0.00 ? 52  ALA A N    3  
ATOM 4363  C CA   . ALA A 1 52  ? -13.122 2.042   8.592   1.00 0.00 ? 52  ALA A CA   3  
ATOM 4364  C C    . ALA A 1 52  ? -14.270 1.030   8.601   1.00 0.00 ? 52  ALA A C    3  
ATOM 4365  O O    . ALA A 1 52  ? -14.061 -0.155  8.767   1.00 0.00 ? 52  ALA A O    3  
ATOM 4366  C CB   . ALA A 1 52  ? -11.989 1.529   9.483   1.00 0.00 ? 52  ALA A CB   3  
ATOM 4367  H H    . ALA A 1 52  ? -13.800 3.467   10.058  1.00 0.00 ? 52  ALA A H    3  
ATOM 4368  H HA   . ALA A 1 52  ? -12.757 2.164   7.583   1.00 0.00 ? 52  ALA A HA   3  
ATOM 4369  H HB1  . ALA A 1 52  ? -11.646 2.327   10.124  1.00 0.00 ? 52  ALA A HB1  3  
ATOM 4370  H HB2  . ALA A 1 52  ? -12.349 0.710   10.089  1.00 0.00 ? 52  ALA A HB2  3  
ATOM 4371  H HB3  . ALA A 1 52  ? -11.172 1.187   8.865   1.00 0.00 ? 52  ALA A HB3  3  
ATOM 4372  N N    . ASP A 1 53  ? -15.481 1.483   8.423   1.00 0.00 ? 53  ASP A N    3  
ATOM 4373  C CA   . ASP A 1 53  ? -16.634 0.540   8.423   1.00 0.00 ? 53  ASP A CA   3  
ATOM 4374  C C    . ASP A 1 53  ? -16.622 -0.293  7.135   1.00 0.00 ? 53  ASP A C    3  
ATOM 4375  O O    . ASP A 1 53  ? -16.624 -1.507  7.189   1.00 0.00 ? 53  ASP A O    3  
ATOM 4376  C CB   . ASP A 1 53  ? -17.944 1.325   8.518   1.00 0.00 ? 53  ASP A CB   3  
ATOM 4377  C CG   . ASP A 1 53  ? -18.774 0.790   9.684   1.00 0.00 ? 53  ASP A CG   3  
ATOM 4378  O OD1  . ASP A 1 53  ? -18.300 0.863   10.805  1.00 0.00 ? 53  ASP A OD1  3  
ATOM 4379  O OD2  . ASP A 1 53  ? -19.871 0.316   9.437   1.00 0.00 ? 53  ASP A OD2  3  
ATOM 4380  H H    . ASP A 1 53  ? -15.631 2.442   8.291   1.00 0.00 ? 53  ASP A H    3  
ATOM 4381  H HA   . ASP A 1 53  ? -16.553 -0.121  9.274   1.00 0.00 ? 53  ASP A HA   3  
ATOM 4382  H HB2  . ASP A 1 53  ? -17.726 2.371   8.678   1.00 0.00 ? 53  ASP A HB2  3  
ATOM 4383  H HB3  . ASP A 1 53  ? -18.500 1.209   7.600   1.00 0.00 ? 53  ASP A HB3  3  
ATOM 4384  N N    . PRO A 1 54  ? -16.613 0.382   6.010   1.00 0.00 ? 54  PRO A N    3  
ATOM 4385  C CA   . PRO A 1 54  ? -16.603 -0.288  4.696   1.00 0.00 ? 54  PRO A CA   3  
ATOM 4386  C C    . PRO A 1 54  ? -15.328 -1.122  4.533   1.00 0.00 ? 54  PRO A C    3  
ATOM 4387  O O    . PRO A 1 54  ? -15.209 -1.919  3.623   1.00 0.00 ? 54  PRO A O    3  
ATOM 4388  C CB   . PRO A 1 54  ? -16.635 0.854   3.672   1.00 0.00 ? 54  PRO A CB   3  
ATOM 4389  C CG   . PRO A 1 54  ? -16.632 2.190   4.455   1.00 0.00 ? 54  PRO A CG   3  
ATOM 4390  C CD   . PRO A 1 54  ? -16.614 1.856   5.954   1.00 0.00 ? 54  PRO A CD   3  
ATOM 4391  H HA   . PRO A 1 54  ? -17.477 -0.908  4.582   1.00 0.00 ? 54  PRO A HA   3  
ATOM 4392  H HB2  . PRO A 1 54  ? -15.762 0.797   3.034   1.00 0.00 ? 54  PRO A HB2  3  
ATOM 4393  H HB3  . PRO A 1 54  ? -17.530 0.788   3.076   1.00 0.00 ? 54  PRO A HB3  3  
ATOM 4394  H HG2  . PRO A 1 54  ? -15.754 2.765   4.196   1.00 0.00 ? 54  PRO A HG2  3  
ATOM 4395  H HG3  . PRO A 1 54  ? -17.522 2.754   4.220   1.00 0.00 ? 54  PRO A HG3  3  
ATOM 4396  H HD2  . PRO A 1 54  ? -15.722 2.255   6.413   1.00 0.00 ? 54  PRO A HD2  3  
ATOM 4397  H HD3  . PRO A 1 54  ? -17.496 2.247   6.435   1.00 0.00 ? 54  PRO A HD3  3  
ATOM 4398  N N    . ILE A 1 55  ? -14.374 -0.948  5.408   1.00 0.00 ? 55  ILE A N    3  
ATOM 4399  C CA   . ILE A 1 55  ? -13.109 -1.734  5.301   1.00 0.00 ? 55  ILE A CA   3  
ATOM 4400  C C    . ILE A 1 55  ? -13.050 -2.749  6.443   1.00 0.00 ? 55  ILE A C    3  
ATOM 4401  O O    . ILE A 1 55  ? -12.299 -3.701  6.403   1.00 0.00 ? 55  ILE A O    3  
ATOM 4402  C CB   . ILE A 1 55  ? -11.885 -0.805  5.384   1.00 0.00 ? 55  ILE A CB   3  
ATOM 4403  C CG1  . ILE A 1 55  ? -12.312 0.609   5.807   1.00 0.00 ? 55  ILE A CG1  3  
ATOM 4404  C CG2  . ILE A 1 55  ? -11.198 -0.741  4.019   1.00 0.00 ? 55  ILE A CG2  3  
ATOM 4405  C CD1  . ILE A 1 55  ? -13.114 1.273   4.683   1.00 0.00 ? 55  ILE A CD1  3  
ATOM 4406  H H    . ILE A 1 55  ? -14.489 -0.302  6.135   1.00 0.00 ? 55  ILE A H    3  
ATOM 4407  H HA   . ILE A 1 55  ? -13.096 -2.260  4.357   1.00 0.00 ? 55  ILE A HA   3  
ATOM 4408  H HB   . ILE A 1 55  ? -11.190 -1.202  6.111   1.00 0.00 ? 55  ILE A HB   3  
ATOM 4409  H HG12 . ILE A 1 55  ? -12.922 0.546   6.695   1.00 0.00 ? 55  ILE A HG12 3  
ATOM 4410  H HG13 . ILE A 1 55  ? -11.433 1.201   6.017   1.00 0.00 ? 55  ILE A HG13 3  
ATOM 4411  H HG21 . ILE A 1 55  ? -11.739 -1.358  3.316   1.00 0.00 ? 55  ILE A HG21 3  
ATOM 4412  H HG22 . ILE A 1 55  ? -11.188 0.280   3.668   1.00 0.00 ? 55  ILE A HG22 3  
ATOM 4413  H HG23 . ILE A 1 55  ? -10.184 -1.103  4.109   1.00 0.00 ? 55  ILE A HG23 3  
ATOM 4414  H HD11 . ILE A 1 55  ? -12.994 0.711   3.769   1.00 0.00 ? 55  ILE A HD11 3  
ATOM 4415  H HD12 . ILE A 1 55  ? -14.160 1.298   4.953   1.00 0.00 ? 55  ILE A HD12 3  
ATOM 4416  H HD13 . ILE A 1 55  ? -12.758 2.282   4.534   1.00 0.00 ? 55  ILE A HD13 3  
ATOM 4417  N N    . ARG A 1 56  ? -13.838 -2.553  7.464   1.00 0.00 ? 56  ARG A N    3  
ATOM 4418  C CA   . ARG A 1 56  ? -13.826 -3.507  8.607   1.00 0.00 ? 56  ARG A CA   3  
ATOM 4419  C C    . ARG A 1 56  ? -14.839 -4.624  8.352   1.00 0.00 ? 56  ARG A C    3  
ATOM 4420  O O    . ARG A 1 56  ? -14.786 -5.675  8.958   1.00 0.00 ? 56  ARG A O    3  
ATOM 4421  C CB   . ARG A 1 56  ? -14.204 -2.763  9.888   1.00 0.00 ? 56  ARG A CB   3  
ATOM 4422  C CG   . ARG A 1 56  ? -13.948 -3.663  11.098  1.00 0.00 ? 56  ARG A CG   3  
ATOM 4423  C CD   . ARG A 1 56  ? -14.522 -3.006  12.354  1.00 0.00 ? 56  ARG A CD   3  
ATOM 4424  N NE   . ARG A 1 56  ? -13.559 -3.158  13.481  1.00 0.00 ? 56  ARG A NE   3  
ATOM 4425  C CZ   . ARG A 1 56  ? -13.691 -2.429  14.558  1.00 0.00 ? 56  ARG A CZ   3  
ATOM 4426  N NH1  . ARG A 1 56  ? -14.668 -1.567  14.653  1.00 0.00 ? 56  ARG A NH1  3  
ATOM 4427  N NH2  . ARG A 1 56  ? -12.847 -2.565  15.543  1.00 0.00 ? 56  ARG A NH2  3  
ATOM 4428  H H    . ARG A 1 56  ? -14.437 -1.778  7.478   1.00 0.00 ? 56  ARG A H    3  
ATOM 4429  H HA   . ARG A 1 56  ? -12.839 -3.931  8.712   1.00 0.00 ? 56  ARG A HA   3  
ATOM 4430  H HB2  . ARG A 1 56  ? -13.608 -1.866  9.971   1.00 0.00 ? 56  ARG A HB2  3  
ATOM 4431  H HB3  . ARG A 1 56  ? -15.250 -2.499  9.854   1.00 0.00 ? 56  ARG A HB3  3  
ATOM 4432  H HG2  . ARG A 1 56  ? -14.425 -4.620  10.941  1.00 0.00 ? 56  ARG A HG2  3  
ATOM 4433  H HG3  . ARG A 1 56  ? -12.885 -3.806  11.222  1.00 0.00 ? 56  ARG A HG3  3  
ATOM 4434  H HD2  . ARG A 1 56  ? -14.691 -1.955  12.165  1.00 0.00 ? 56  ARG A HD2  3  
ATOM 4435  H HD3  . ARG A 1 56  ? -15.457 -3.479  12.613  1.00 0.00 ? 56  ARG A HD3  3  
ATOM 4436  H HE   . ARG A 1 56  ? -12.828 -3.805  13.416  1.00 0.00 ? 56  ARG A HE   3  
ATOM 4437  H HH11 . ARG A 1 56  ? -15.320 -1.462  13.903  1.00 0.00 ? 56  ARG A HH11 3  
ATOM 4438  H HH12 . ARG A 1 56  ? -14.763 -1.009  15.478  1.00 0.00 ? 56  ARG A HH12 3  
ATOM 4439  H HH21 . ARG A 1 56  ? -12.101 -3.227  15.473  1.00 0.00 ? 56  ARG A HH21 3  
ATOM 4440  H HH22 . ARG A 1 56  ? -12.945 -2.006  16.366  1.00 0.00 ? 56  ARG A HH22 3  
ATOM 4441  N N    . ALA A 1 57  ? -15.764 -4.402  7.458   1.00 0.00 ? 57  ALA A N    3  
ATOM 4442  C CA   . ALA A 1 57  ? -16.781 -5.449  7.165   1.00 0.00 ? 57  ALA A CA   3  
ATOM 4443  C C    . ALA A 1 57  ? -16.389 -6.196  5.889   1.00 0.00 ? 57  ALA A C    3  
ATOM 4444  O O    . ALA A 1 57  ? -17.213 -6.463  5.037   1.00 0.00 ? 57  ALA A O    3  
ATOM 4445  C CB   . ALA A 1 57  ? -18.148 -4.789  6.971   1.00 0.00 ? 57  ALA A CB   3  
ATOM 4446  H H    . ALA A 1 57  ? -15.789 -3.547  6.982   1.00 0.00 ? 57  ALA A H    3  
ATOM 4447  H HA   . ALA A 1 57  ? -16.830 -6.145  7.989   1.00 0.00 ? 57  ALA A HA   3  
ATOM 4448  H HB1  . ALA A 1 57  ? -18.012 -3.774  6.628   1.00 0.00 ? 57  ALA A HB1  3  
ATOM 4449  H HB2  . ALA A 1 57  ? -18.714 -5.345  6.236   1.00 0.00 ? 57  ALA A HB2  3  
ATOM 4450  H HB3  . ALA A 1 57  ? -18.681 -4.784  7.909   1.00 0.00 ? 57  ALA A HB3  3  
ATOM 4451  N N    . SER A 1 58  ? -15.136 -6.532  5.749   1.00 0.00 ? 58  SER A N    3  
ATOM 4452  C CA   . SER A 1 58  ? -14.692 -7.260  4.528   1.00 0.00 ? 58  SER A CA   3  
ATOM 4453  C C    . SER A 1 58  ? -15.025 -6.425  3.289   1.00 0.00 ? 58  SER A C    3  
ATOM 4454  O O    . SER A 1 58  ? -15.790 -6.835  2.440   1.00 0.00 ? 58  SER A O    3  
ATOM 4455  C CB   . SER A 1 58  ? -15.415 -8.605  4.445   1.00 0.00 ? 58  SER A CB   3  
ATOM 4456  O OG   . SER A 1 58  ? -14.466 -9.655  4.581   1.00 0.00 ? 58  SER A OG   3  
ATOM 4457  H H    . SER A 1 58  ? -14.487 -6.306  6.448   1.00 0.00 ? 58  SER A H    3  
ATOM 4458  H HA   . SER A 1 58  ? -13.625 -7.426  4.574   1.00 0.00 ? 58  SER A HA   3  
ATOM 4459  H HB2  . SER A 1 58  ? -16.139 -8.678  5.238   1.00 0.00 ? 58  SER A HB2  3  
ATOM 4460  H HB3  . SER A 1 58  ? -15.919 -8.684  3.490   1.00 0.00 ? 58  SER A HB3  3  
ATOM 4461  H HG   . SER A 1 58  ? -13.879 -9.624  3.822   1.00 0.00 ? 58  SER A HG   3  
ATOM 4462  N N    . GLY A 1 59  ? -14.459 -5.253  3.182   1.00 0.00 ? 59  GLY A N    3  
ATOM 4463  C CA   . GLY A 1 59  ? -14.749 -4.394  1.999   1.00 0.00 ? 59  GLY A CA   3  
ATOM 4464  C C    . GLY A 1 59  ? -13.456 -3.757  1.491   1.00 0.00 ? 59  GLY A C    3  
ATOM 4465  O O    . GLY A 1 59  ? -13.322 -2.550  1.448   1.00 0.00 ? 59  GLY A O    3  
ATOM 4466  H H    . GLY A 1 59  ? -13.847 -4.938  3.879   1.00 0.00 ? 59  GLY A H    3  
ATOM 4467  H HA2  . GLY A 1 59  ? -15.184 -4.999  1.215   1.00 0.00 ? 59  GLY A HA2  3  
ATOM 4468  H HA3  . GLY A 1 59  ? -15.443 -3.617  2.281   1.00 0.00 ? 59  GLY A HA3  3  
ATOM 4469  N N    . PHE A 1 60  ? -12.504 -4.557  1.098   1.00 0.00 ? 60  PHE A N    3  
ATOM 4470  C CA   . PHE A 1 60  ? -11.226 -3.994  0.582   1.00 0.00 ? 60  PHE A CA   3  
ATOM 4471  C C    . PHE A 1 60  ? -11.150 -4.238  -0.923  1.00 0.00 ? 60  PHE A C    3  
ATOM 4472  O O    . PHE A 1 60  ? -10.715 -5.278  -1.375  1.00 0.00 ? 60  PHE A O    3  
ATOM 4473  C CB   . PHE A 1 60  ? -10.049 -4.678  1.272   1.00 0.00 ? 60  PHE A CB   3  
ATOM 4474  C CG   . PHE A 1 60  ? -8.952  -3.669  1.511   1.00 0.00 ? 60  PHE A CG   3  
ATOM 4475  C CD1  . PHE A 1 60  ? -9.236  -2.479  2.189   1.00 0.00 ? 60  PHE A CD1  3  
ATOM 4476  C CD2  . PHE A 1 60  ? -7.652  -3.923  1.057   1.00 0.00 ? 60  PHE A CD2  3  
ATOM 4477  C CE1  . PHE A 1 60  ? -8.222  -1.542  2.412   1.00 0.00 ? 60  PHE A CE1  3  
ATOM 4478  C CE2  . PHE A 1 60  ? -6.637  -2.985  1.281   1.00 0.00 ? 60  PHE A CE2  3  
ATOM 4479  C CZ   . PHE A 1 60  ? -6.922  -1.795  1.959   1.00 0.00 ? 60  PHE A CZ   3  
ATOM 4480  H H    . PHE A 1 60  ? -12.634 -5.526  1.133   1.00 0.00 ? 60  PHE A H    3  
ATOM 4481  H HA   . PHE A 1 60  ? -11.193 -2.932  0.779   1.00 0.00 ? 60  PHE A HA   3  
ATOM 4482  H HB2  . PHE A 1 60  ? -10.377 -5.084  2.217   1.00 0.00 ? 60  PHE A HB2  3  
ATOM 4483  H HB3  . PHE A 1 60  ? -9.676  -5.474  0.645   1.00 0.00 ? 60  PHE A HB3  3  
ATOM 4484  H HD1  . PHE A 1 60  ? -10.239 -2.283  2.540   1.00 0.00 ? 60  PHE A HD1  3  
ATOM 4485  H HD2  . PHE A 1 60  ? -7.431  -4.841  0.535   1.00 0.00 ? 60  PHE A HD2  3  
ATOM 4486  H HE1  . PHE A 1 60  ? -8.442  -0.624  2.935   1.00 0.00 ? 60  PHE A HE1  3  
ATOM 4487  H HE2  . PHE A 1 60  ? -5.635  -3.180  0.930   1.00 0.00 ? 60  PHE A HE2  3  
ATOM 4488  H HZ   . PHE A 1 60  ? -6.140  -1.071  2.133   1.00 0.00 ? 60  PHE A HZ   3  
ATOM 4489  N N    . ASP A 1 61  ? -11.583 -3.290  -1.701  1.00 0.00 ? 61  ASP A N    3  
ATOM 4490  C CA   . ASP A 1 61  ? -11.550 -3.466  -3.178  1.00 0.00 ? 61  ASP A CA   3  
ATOM 4491  C C    . ASP A 1 61  ? -11.019 -2.192  -3.838  1.00 0.00 ? 61  ASP A C    3  
ATOM 4492  O O    . ASP A 1 61  ? -11.511 -1.107  -3.603  1.00 0.00 ? 61  ASP A O    3  
ATOM 4493  C CB   . ASP A 1 61  ? -12.964 -3.751  -3.687  1.00 0.00 ? 61  ASP A CB   3  
ATOM 4494  C CG   . ASP A 1 61  ? -13.348 -5.195  -3.357  1.00 0.00 ? 61  ASP A CG   3  
ATOM 4495  O OD1  . ASP A 1 61  ? -13.234 -5.567  -2.200  1.00 0.00 ? 61  ASP A OD1  3  
ATOM 4496  O OD2  . ASP A 1 61  ? -13.749 -5.903  -4.265  1.00 0.00 ? 61  ASP A OD2  3  
ATOM 4497  H H    . ASP A 1 61  ? -11.936 -2.464  -1.313  1.00 0.00 ? 61  ASP A H    3  
ATOM 4498  H HA   . ASP A 1 61  ? -10.904 -4.296  -3.428  1.00 0.00 ? 61  ASP A HA   3  
ATOM 4499  H HB2  . ASP A 1 61  ? -13.660 -3.074  -3.211  1.00 0.00 ? 61  ASP A HB2  3  
ATOM 4500  H HB3  . ASP A 1 61  ? -12.998 -3.607  -4.757  1.00 0.00 ? 61  ASP A HB3  3  
ATOM 4501  N N    . LEU A 1 62  ? -10.020 -2.320  -4.667  1.00 0.00 ? 62  LEU A N    3  
ATOM 4502  C CA   . LEU A 1 62  ? -9.457  -1.122  -5.349  1.00 0.00 ? 62  LEU A CA   3  
ATOM 4503  C C    . LEU A 1 62  ? -10.092 -0.985  -6.733  1.00 0.00 ? 62  LEU A C    3  
ATOM 4504  O O    . LEU A 1 62  ? -11.081 -1.622  -7.036  1.00 0.00 ? 62  LEU A O    3  
ATOM 4505  C CB   . LEU A 1 62  ? -7.943  -1.290  -5.495  1.00 0.00 ? 62  LEU A CB   3  
ATOM 4506  C CG   . LEU A 1 62  ? -7.226  -0.410  -4.469  1.00 0.00 ? 62  LEU A CG   3  
ATOM 4507  C CD1  . LEU A 1 62  ? -7.317  1.056   -4.898  1.00 0.00 ? 62  LEU A CD1  3  
ATOM 4508  C CD2  . LEU A 1 62  ? -7.886  -0.581  -3.098  1.00 0.00 ? 62  LEU A CD2  3  
ATOM 4509  H H    . LEU A 1 62  ? -9.643  -3.206  -4.844  1.00 0.00 ? 62  LEU A H    3  
ATOM 4510  H HA   . LEU A 1 62  ? -9.669  -0.239  -4.765  1.00 0.00 ? 62  LEU A HA   3  
ATOM 4511  H HB2  . LEU A 1 62  ? -7.680  -2.325  -5.328  1.00 0.00 ? 62  LEU A HB2  3  
ATOM 4512  H HB3  . LEU A 1 62  ? -7.642  -0.997  -6.489  1.00 0.00 ? 62  LEU A HB3  3  
ATOM 4513  H HG   . LEU A 1 62  ? -6.187  -0.702  -4.410  1.00 0.00 ? 62  LEU A HG   3  
ATOM 4514  H HD11 . LEU A 1 62  ? -7.986  1.142   -5.742  1.00 0.00 ? 62  LEU A HD11 3  
ATOM 4515  H HD12 . LEU A 1 62  ? -7.693  1.649   -4.078  1.00 0.00 ? 62  LEU A HD12 3  
ATOM 4516  H HD13 . LEU A 1 62  ? -6.335  1.410   -5.179  1.00 0.00 ? 62  LEU A HD13 3  
ATOM 4517  H HD21 . LEU A 1 62  ? -8.065  -1.630  -2.914  1.00 0.00 ? 62  LEU A HD21 3  
ATOM 4518  H HD22 . LEU A 1 62  ? -7.234  -0.187  -2.333  1.00 0.00 ? 62  LEU A HD22 3  
ATOM 4519  H HD23 . LEU A 1 62  ? -8.824  -0.046  -3.082  1.00 0.00 ? 62  LEU A HD23 3  
ATOM 4520  N N    . ALA A 1 63  ? -9.533  -0.162  -7.578  1.00 0.00 ? 63  ALA A N    3  
ATOM 4521  C CA   . ALA A 1 63  ? -10.112 0.002   -8.940  1.00 0.00 ? 63  ALA A CA   3  
ATOM 4522  C C    . ALA A 1 63  ? -10.280 -1.375  -9.580  1.00 0.00 ? 63  ALA A C    3  
ATOM 4523  O O    . ALA A 1 63  ? -9.379  -1.894  -10.208 1.00 0.00 ? 63  ALA A O    3  
ATOM 4524  C CB   . ALA A 1 63  ? -9.176  0.855   -9.797  1.00 0.00 ? 63  ALA A CB   3  
ATOM 4525  H H    . ALA A 1 63  ? -8.734  0.341   -7.318  1.00 0.00 ? 63  ALA A H    3  
ATOM 4526  H HA   . ALA A 1 63  ? -11.076 0.485   -8.867  1.00 0.00 ? 63  ALA A HA   3  
ATOM 4527  H HB1  . ALA A 1 63  ? -8.326  1.159   -9.207  1.00 0.00 ? 63  ALA A HB1  3  
ATOM 4528  H HB2  . ALA A 1 63  ? -8.839  0.278   -10.646 1.00 0.00 ? 63  ALA A HB2  3  
ATOM 4529  H HB3  . ALA A 1 63  ? -9.706  1.731   -10.144 1.00 0.00 ? 63  ALA A HB3  3  
ATOM 4530  N N    . GLY A 1 64  ? -11.426 -1.972  -9.418  1.00 0.00 ? 64  GLY A N    3  
ATOM 4531  C CA   . GLY A 1 64  ? -11.655 -3.320  -10.008 1.00 0.00 ? 64  GLY A CA   3  
ATOM 4532  C C    . GLY A 1 64  ? -10.660 -4.312  -9.402  1.00 0.00 ? 64  GLY A C    3  
ATOM 4533  O O    . GLY A 1 64  ? -9.964  -5.016  -10.107 1.00 0.00 ? 64  GLY A O    3  
ATOM 4534  H H    . GLY A 1 64  ? -12.135 -1.534  -8.903  1.00 0.00 ? 64  GLY A H    3  
ATOM 4535  H HA2  . GLY A 1 64  ? -12.665 -3.641  -9.792  1.00 0.00 ? 64  GLY A HA2  3  
ATOM 4536  H HA3  . GLY A 1 64  ? -11.510 -3.277  -11.075 1.00 0.00 ? 64  GLY A HA3  3  
ATOM 4537  N N    . VAL A 1 65  ? -10.585 -4.371  -8.101  1.00 0.00 ? 65  VAL A N    3  
ATOM 4538  C CA   . VAL A 1 65  ? -9.629  -5.315  -7.455  1.00 0.00 ? 65  VAL A CA   3  
ATOM 4539  C C    . VAL A 1 65  ? -10.278 -5.933  -6.215  1.00 0.00 ? 65  VAL A C    3  
ATOM 4540  O O    . VAL A 1 65  ? -10.641 -5.241  -5.285  1.00 0.00 ? 65  VAL A O    3  
ATOM 4541  C CB   . VAL A 1 65  ? -8.367  -4.556  -7.042  1.00 0.00 ? 65  VAL A CB   3  
ATOM 4542  C CG1  . VAL A 1 65  ? -7.227  -5.547  -6.810  1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4543  C CG2  . VAL A 1 65  ? -7.972  -3.578  -8.150  1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4544  H H    . VAL A 1 65  ? -11.153 -3.794  -7.549  1.00 0.00 ? 65  VAL A H    3  
ATOM 4545  H HA   . VAL A 1 65  ? -9.369  -6.096  -8.152  1.00 0.00 ? 65  VAL A HA   3  
ATOM 4546  H HB   . VAL A 1 65  ? -8.560  -4.011  -6.131  1.00 0.00 ? 65  VAL A HB   3  
ATOM 4547  H HG11 . VAL A 1 65  ? -7.501  -6.513  -7.208  1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4548  H HG12 . VAL A 1 65  ? -6.337  -5.193  -7.307  1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4549  H HG13 . VAL A 1 65  ? -7.038  -5.635  -5.750  1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4550  H HG21 . VAL A 1 65  ? -8.857  -3.086  -8.528  1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4551  H HG22 . VAL A 1 65  ? -7.293  -2.840  -7.752  1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4552  H HG23 . VAL A 1 65  ? -7.490  -4.118  -8.952  1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4553  N N    . HIS A 1 66  ? -10.424 -7.230  -6.190  1.00 0.00 ? 66  HIS A N    3  
ATOM 4554  C CA   . HIS A 1 66  ? -11.045 -7.886  -5.005  1.00 0.00 ? 66  HIS A CA   3  
ATOM 4555  C C    . HIS A 1 66  ? -10.004 -8.011  -3.892  1.00 0.00 ? 66  HIS A C    3  
ATOM 4556  O O    . HIS A 1 66  ? -8.940  -8.563  -4.085  1.00 0.00 ? 66  HIS A O    3  
ATOM 4557  C CB   . HIS A 1 66  ? -11.545 -9.278  -5.393  1.00 0.00 ? 66  HIS A CB   3  
ATOM 4558  C CG   . HIS A 1 66  ? -12.584 -9.155  -6.473  1.00 0.00 ? 66  HIS A CG   3  
ATOM 4559  N ND1  . HIS A 1 66  ? -12.536 -9.909  -7.634  1.00 0.00 ? 66  HIS A ND1  3  
ATOM 4560  C CD2  . HIS A 1 66  ? -13.704 -8.369  -6.581  1.00 0.00 ? 66  HIS A CD2  3  
ATOM 4561  C CE1  . HIS A 1 66  ? -13.597 -9.563  -8.385  1.00 0.00 ? 66  HIS A CE1  3  
ATOM 4562  N NE2  . HIS A 1 66  ? -14.343 -8.628  -7.789  1.00 0.00 ? 66  HIS A NE2  3  
ATOM 4563  H H    . HIS A 1 66  ? -10.121 -7.772  -6.949  1.00 0.00 ? 66  HIS A H    3  
ATOM 4564  H HA   . HIS A 1 66  ? -11.876 -7.288  -4.658  1.00 0.00 ? 66  HIS A HA   3  
ATOM 4565  H HB2  . HIS A 1 66  ? -10.718 -9.870  -5.754  1.00 0.00 ? 66  HIS A HB2  3  
ATOM 4566  H HB3  . HIS A 1 66  ? -11.980 -9.758  -4.529  1.00 0.00 ? 66  HIS A HB3  3  
ATOM 4567  H HD1  . HIS A 1 66  ? -11.853 -10.572 -7.865  1.00 0.00 ? 66  HIS A HD1  3  
ATOM 4568  H HD2  . HIS A 1 66  ? -14.038 -7.657  -5.840  1.00 0.00 ? 66  HIS A HD2  3  
ATOM 4569  H HE1  . HIS A 1 66  ? -13.819 -9.990  -9.351  1.00 0.00 ? 66  HIS A HE1  3  
ATOM 4570  N N    . TYR A 1 67  ? -10.298 -7.501  -2.726  1.00 0.00 ? 67  TYR A N    3  
ATOM 4571  C CA   . TYR A 1 67  ? -9.315  -7.592  -1.610  1.00 0.00 ? 67  TYR A CA   3  
ATOM 4572  C C    . TYR A 1 67  ? -10.052 -7.648  -0.268  1.00 0.00 ? 67  TYR A C    3  
ATOM 4573  O O    . TYR A 1 67  ? -11.232 -7.371  -0.184  1.00 0.00 ? 67  TYR A O    3  
ATOM 4574  C CB   . TYR A 1 67  ? -8.405  -6.364  -1.635  1.00 0.00 ? 67  TYR A CB   3  
ATOM 4575  C CG   . TYR A 1 67  ? -7.027  -6.768  -2.098  1.00 0.00 ? 67  TYR A CG   3  
ATOM 4576  C CD1  . TYR A 1 67  ? -6.794  -7.035  -3.451  1.00 0.00 ? 67  TYR A CD1  3  
ATOM 4577  C CD2  . TYR A 1 67  ? -5.983  -6.876  -1.173  1.00 0.00 ? 67  TYR A CD2  3  
ATOM 4578  C CE1  . TYR A 1 67  ? -5.516  -7.411  -3.880  1.00 0.00 ? 67  TYR A CE1  3  
ATOM 4579  C CE2  . TYR A 1 67  ? -4.705  -7.252  -1.601  1.00 0.00 ? 67  TYR A CE2  3  
ATOM 4580  C CZ   . TYR A 1 67  ? -4.472  -7.519  -2.955  1.00 0.00 ? 67  TYR A CZ   3  
ATOM 4581  O OH   . TYR A 1 67  ? -3.212  -7.888  -3.377  1.00 0.00 ? 67  TYR A OH   3  
ATOM 4582  H H    . TYR A 1 67  ? -11.160 -7.056  -2.587  1.00 0.00 ? 67  TYR A H    3  
ATOM 4583  H HA   . TYR A 1 67  ? -8.719  -8.484  -1.729  1.00 0.00 ? 67  TYR A HA   3  
ATOM 4584  H HB2  . TYR A 1 67  ? -8.811  -5.628  -2.314  1.00 0.00 ? 67  TYR A HB2  3  
ATOM 4585  H HB3  . TYR A 1 67  ? -8.341  -5.944  -0.644  1.00 0.00 ? 67  TYR A HB3  3  
ATOM 4586  H HD1  . TYR A 1 67  ? -7.600  -6.952  -4.165  1.00 0.00 ? 67  TYR A HD1  3  
ATOM 4587  H HD2  . TYR A 1 67  ? -6.164  -6.670  -0.129  1.00 0.00 ? 67  TYR A HD2  3  
ATOM 4588  H HE1  . TYR A 1 67  ? -5.336  -7.618  -4.925  1.00 0.00 ? 67  TYR A HE1  3  
ATOM 4589  H HE2  . TYR A 1 67  ? -3.899  -7.335  -0.887  1.00 0.00 ? 67  TYR A HE2  3  
ATOM 4590  H HH   . TYR A 1 67  ? -3.121  -7.632  -4.297  1.00 0.00 ? 67  TYR A HH   3  
ATOM 4591  N N    . VAL A 1 68  ? -9.359  -8.000  0.782   1.00 0.00 ? 68  VAL A N    3  
ATOM 4592  C CA   . VAL A 1 68  ? -10.012 -8.070  2.121   1.00 0.00 ? 68  VAL A CA   3  
ATOM 4593  C C    . VAL A 1 68  ? -9.376  -7.026  3.041   1.00 0.00 ? 68  VAL A C    3  
ATOM 4594  O O    . VAL A 1 68  ? -8.523  -6.264  2.631   1.00 0.00 ? 68  VAL A O    3  
ATOM 4595  C CB   . VAL A 1 68  ? -9.817  -9.465  2.724   1.00 0.00 ? 68  VAL A CB   3  
ATOM 4596  C CG1  . VAL A 1 68  ? -11.037 -9.830  3.570   1.00 0.00 ? 68  VAL A CG1  3  
ATOM 4597  C CG2  . VAL A 1 68  ? -9.649  -10.496 1.604   1.00 0.00 ? 68  VAL A CG2  3  
ATOM 4598  H H    . VAL A 1 68  ? -8.408  -8.215  0.690   1.00 0.00 ? 68  VAL A H    3  
ATOM 4599  H HA   . VAL A 1 68  ? -11.068 -7.866  2.019   1.00 0.00 ? 68  VAL A HA   3  
ATOM 4600  H HB   . VAL A 1 68  ? -8.935  -9.465  3.350   1.00 0.00 ? 68  VAL A HB   3  
ATOM 4601  H HG11 . VAL A 1 68  ? -11.917 -9.362  3.153   1.00 0.00 ? 68  VAL A HG11 3  
ATOM 4602  H HG12 . VAL A 1 68  ? -11.168 -10.903 3.572   1.00 0.00 ? 68  VAL A HG12 3  
ATOM 4603  H HG13 . VAL A 1 68  ? -10.892 -9.484  4.582   1.00 0.00 ? 68  VAL A HG13 3  
ATOM 4604  H HG21 . VAL A 1 68  ? -10.428 -10.356 0.868   1.00 0.00 ? 68  VAL A HG21 3  
ATOM 4605  H HG22 . VAL A 1 68  ? -8.684  -10.366 1.137   1.00 0.00 ? 68  VAL A HG22 3  
ATOM 4606  H HG23 . VAL A 1 68  ? -9.720  -11.491 2.017   1.00 0.00 ? 68  VAL A HG23 3  
ATOM 4607  N N    . THR A 1 69  ? -9.780  -6.981  4.280   1.00 0.00 ? 69  THR A N    3  
ATOM 4608  C CA   . THR A 1 69  ? -9.189  -5.982  5.213   1.00 0.00 ? 69  THR A CA   3  
ATOM 4609  C C    . THR A 1 69  ? -8.826  -6.664  6.532   1.00 0.00 ? 69  THR A C    3  
ATOM 4610  O O    . THR A 1 69  ? -9.684  -7.047  7.301   1.00 0.00 ? 69  THR A O    3  
ATOM 4611  C CB   . THR A 1 69  ? -10.202 -4.866  5.478   1.00 0.00 ? 69  THR A CB   3  
ATOM 4612  O OG1  . THR A 1 69  ? -11.181 -4.862  4.446   1.00 0.00 ? 69  THR A OG1  3  
ATOM 4613  C CG2  . THR A 1 69  ? -9.479  -3.518  5.503   1.00 0.00 ? 69  THR A CG2  3  
ATOM 4614  H H    . THR A 1 69  ? -10.469 -7.603  4.597   1.00 0.00 ? 69  THR A H    3  
ATOM 4615  H HA   . THR A 1 69  ? -8.299  -5.560  4.769   1.00 0.00 ? 69  THR A HA   3  
ATOM 4616  H HB   . THR A 1 69  ? -10.682 -5.032  6.432   1.00 0.00 ? 69  THR A HB   3  
ATOM 4617  H HG1  . THR A 1 69  ? -12.008 -5.178  4.819   1.00 0.00 ? 69  THR A HG1  3  
ATOM 4618  H HG21 . THR A 1 69  ? -8.419  -3.681  5.622   1.00 0.00 ? 69  THR A HG21 3  
ATOM 4619  H HG22 . THR A 1 69  ? -9.661  -2.995  4.576   1.00 0.00 ? 69  THR A HG22 3  
ATOM 4620  H HG23 . THR A 1 69  ? -9.847  -2.927  6.329   1.00 0.00 ? 69  THR A HG23 3  
ATOM 4621  N N    . LEU A 1 70  ? -7.558  -6.815  6.800   1.00 0.00 ? 70  LEU A N    3  
ATOM 4622  C CA   . LEU A 1 70  ? -7.137  -7.466  8.071   1.00 0.00 ? 70  LEU A CA   3  
ATOM 4623  C C    . LEU A 1 70  ? -6.699  -6.390  9.065   1.00 0.00 ? 70  LEU A C    3  
ATOM 4624  O O    . LEU A 1 70  ? -6.749  -6.579  10.265  1.00 0.00 ? 70  LEU A O    3  
ATOM 4625  C CB   . LEU A 1 70  ? -5.969  -8.416  7.797   1.00 0.00 ? 70  LEU A CB   3  
ATOM 4626  C CG   . LEU A 1 70  ? -6.427  -9.860  7.996   1.00 0.00 ? 70  LEU A CG   3  
ATOM 4627  C CD1  . LEU A 1 70  ? -7.618  -10.148 7.080   1.00 0.00 ? 70  LEU A CD1  3  
ATOM 4628  C CD2  . LEU A 1 70  ? -5.279  -10.810 7.651   1.00 0.00 ? 70  LEU A CD2  3  
ATOM 4629  H H    . LEU A 1 70  ? -6.882  -6.496  6.166   1.00 0.00 ? 70  LEU A H    3  
ATOM 4630  H HA   . LEU A 1 70  ? -7.966  -8.024  8.484   1.00 0.00 ? 70  LEU A HA   3  
ATOM 4631  H HB2  . LEU A 1 70  ? -5.628  -8.281  6.781   1.00 0.00 ? 70  LEU A HB2  3  
ATOM 4632  H HB3  . LEU A 1 70  ? -5.161  -8.198  8.481   1.00 0.00 ? 70  LEU A HB3  3  
ATOM 4633  H HG   . LEU A 1 70  ? -6.721  -10.006 9.026   1.00 0.00 ? 70  LEU A HG   3  
ATOM 4634  H HD11 . LEU A 1 70  ? -8.180  -9.240  6.924   1.00 0.00 ? 70  LEU A HD11 3  
ATOM 4635  H HD12 . LEU A 1 70  ? -7.260  -10.519 6.130   1.00 0.00 ? 70  LEU A HD12 3  
ATOM 4636  H HD13 . LEU A 1 70  ? -8.253  -10.891 7.539   1.00 0.00 ? 70  LEU A HD13 3  
ATOM 4637  H HD21 . LEU A 1 70  ? -4.888  -10.562 6.675   1.00 0.00 ? 70  LEU A HD21 3  
ATOM 4638  H HD22 . LEU A 1 70  ? -4.495  -10.713 8.388   1.00 0.00 ? 70  LEU A HD22 3  
ATOM 4639  H HD23 . LEU A 1 70  ? -5.644  -11.826 7.645   1.00 0.00 ? 70  LEU A HD23 3  
ATOM 4640  N N    . ARG A 1 71  ? -6.274  -5.260  8.572   1.00 0.00 ? 71  ARG A N    3  
ATOM 4641  C CA   . ARG A 1 71  ? -5.834  -4.164  9.480   1.00 0.00 ? 71  ARG A CA   3  
ATOM 4642  C C    . ARG A 1 71  ? -6.117  -2.816  8.815   1.00 0.00 ? 71  ARG A C    3  
ATOM 4643  O O    . ARG A 1 71  ? -5.576  -2.502  7.773   1.00 0.00 ? 71  ARG A O    3  
ATOM 4644  C CB   . ARG A 1 71  ? -4.332  -4.295  9.750   1.00 0.00 ? 71  ARG A CB   3  
ATOM 4645  C CG   . ARG A 1 71  ? -4.111  -4.986  11.098  1.00 0.00 ? 71  ARG A CG   3  
ATOM 4646  C CD   . ARG A 1 71  ? -3.627  -3.957  12.122  1.00 0.00 ? 71  ARG A CD   3  
ATOM 4647  N NE   . ARG A 1 71  ? -4.336  -4.173  13.416  1.00 0.00 ? 71  ARG A NE   3  
ATOM 4648  C CZ   . ARG A 1 71  ? -3.889  -3.618  14.510  1.00 0.00 ? 71  ARG A CZ   3  
ATOM 4649  N NH1  . ARG A 1 71  ? -2.820  -2.867  14.476  1.00 0.00 ? 71  ARG A NH1  3  
ATOM 4650  N NH2  . ARG A 1 71  ? -4.512  -3.815  15.641  1.00 0.00 ? 71  ARG A NH2  3  
ATOM 4651  H H    . ARG A 1 71  ? -6.245  -5.130  7.601   1.00 0.00 ? 71  ARG A H    3  
ATOM 4652  H HA   . ARG A 1 71  ? -6.375  -4.228  10.413  1.00 0.00 ? 71  ARG A HA   3  
ATOM 4653  H HB2  . ARG A 1 71  ? -3.877  -4.882  8.965   1.00 0.00 ? 71  ARG A HB2  3  
ATOM 4654  H HB3  . ARG A 1 71  ? -3.884  -3.314  9.773   1.00 0.00 ? 71  ARG A HB3  3  
ATOM 4655  H HG2  . ARG A 1 71  ? -5.040  -5.424  11.435  1.00 0.00 ? 71  ARG A HG2  3  
ATOM 4656  H HG3  . ARG A 1 71  ? -3.366  -5.759  10.988  1.00 0.00 ? 71  ARG A HG3  3  
ATOM 4657  H HD2  . ARG A 1 71  ? -2.564  -4.069  12.270  1.00 0.00 ? 71  ARG A HD2  3  
ATOM 4658  H HD3  . ARG A 1 71  ? -3.838  -2.962  11.758  1.00 0.00 ? 71  ARG A HD3  3  
ATOM 4659  H HE   . ARG A 1 71  ? -5.139  -4.734  13.445  1.00 0.00 ? 71  ARG A HE   3  
ATOM 4660  H HH11 . ARG A 1 71  ? -2.341  -2.715  13.612  1.00 0.00 ? 71  ARG A HH11 3  
ATOM 4661  H HH12 . ARG A 1 71  ? -2.480  -2.444  15.317  1.00 0.00 ? 71  ARG A HH12 3  
ATOM 4662  H HH21 . ARG A 1 71  ? -5.329  -4.389  15.668  1.00 0.00 ? 71  ARG A HH21 3  
ATOM 4663  H HH22 . ARG A 1 71  ? -4.171  -3.390  16.480  1.00 0.00 ? 71  ARG A HH22 3  
ATOM 4664  N N    . ALA A 1 72  ? -6.963  -2.014  9.404   1.00 0.00 ? 72  ALA A N    3  
ATOM 4665  C CA   . ALA A 1 72  ? -7.276  -0.689  8.798   1.00 0.00 ? 72  ALA A CA   3  
ATOM 4666  C C    . ALA A 1 72  ? -7.874  0.238   9.857   1.00 0.00 ? 72  ALA A C    3  
ATOM 4667  O O    . ALA A 1 72  ? -9.061  0.496   9.871   1.00 0.00 ? 72  ALA A O    3  
ATOM 4668  C CB   . ALA A 1 72  ? -8.281  -0.874  7.659   1.00 0.00 ? 72  ALA A CB   3  
ATOM 4669  H H    . ALA A 1 72  ? -7.392  -2.284  10.244  1.00 0.00 ? 72  ALA A H    3  
ATOM 4670  H HA   . ALA A 1 72  ? -6.371  -0.251  8.407   1.00 0.00 ? 72  ALA A HA   3  
ATOM 4671  H HB1  . ALA A 1 72  ? -7.868  -1.542  6.919   1.00 0.00 ? 72  ALA A HB1  3  
ATOM 4672  H HB2  . ALA A 1 72  ? -9.196  -1.291  8.051   1.00 0.00 ? 72  ALA A HB2  3  
ATOM 4673  H HB3  . ALA A 1 72  ? -8.488  0.084   7.204   1.00 0.00 ? 72  ALA A HB3  3  
ATOM 4674  N N    . ASP A 1 73  ? -7.060  0.746   10.744  1.00 0.00 ? 73  ASP A N    3  
ATOM 4675  C CA   . ASP A 1 73  ? -7.584  1.660   11.797  1.00 0.00 ? 73  ASP A CA   3  
ATOM 4676  C C    . ASP A 1 73  ? -6.438  2.095   12.710  1.00 0.00 ? 73  ASP A C    3  
ATOM 4677  O O    . ASP A 1 73  ? -6.395  3.217   13.175  1.00 0.00 ? 73  ASP A O    3  
ATOM 4678  C CB   . ASP A 1 73  ? -8.646  0.934   12.625  1.00 0.00 ? 73  ASP A CB   3  
ATOM 4679  C CG   . ASP A 1 73  ? -9.380  1.944   13.510  1.00 0.00 ? 73  ASP A CG   3  
ATOM 4680  O OD1  . ASP A 1 73  ? -10.044 2.809   12.962  1.00 0.00 ? 73  ASP A OD1  3  
ATOM 4681  O OD2  . ASP A 1 73  ? -9.267  1.835   14.720  1.00 0.00 ? 73  ASP A OD2  3  
ATOM 4682  H H    . ASP A 1 73  ? -6.105  0.529   10.713  1.00 0.00 ? 73  ASP A H    3  
ATOM 4683  H HA   . ASP A 1 73  ? -8.024  2.531   11.331  1.00 0.00 ? 73  ASP A HA   3  
ATOM 4684  H HB2  . ASP A 1 73  ? -9.352  0.452   11.965  1.00 0.00 ? 73  ASP A HB2  3  
ATOM 4685  H HB3  . ASP A 1 73  ? -8.170  0.192   13.249  1.00 0.00 ? 73  ASP A HB3  3  
ATOM 4686  N N    . ASP A 1 74  ? -5.513  1.216   12.979  1.00 0.00 ? 74  ASP A N    3  
ATOM 4687  C CA   . ASP A 1 74  ? -4.377  1.578   13.870  1.00 0.00 ? 74  ASP A CA   3  
ATOM 4688  C C    . ASP A 1 74  ? -3.391  2.480   13.123  1.00 0.00 ? 74  ASP A C    3  
ATOM 4689  O O    . ASP A 1 74  ? -3.443  3.690   13.227  1.00 0.00 ? 74  ASP A O    3  
ATOM 4690  C CB   . ASP A 1 74  ? -3.661  0.305   14.329  1.00 0.00 ? 74  ASP A CB   3  
ATOM 4691  C CG   . ASP A 1 74  ? -4.223  -0.132  15.683  1.00 0.00 ? 74  ASP A CG   3  
ATOM 4692  O OD1  . ASP A 1 74  ? -4.534  0.737   16.482  1.00 0.00 ? 74  ASP A OD1  3  
ATOM 4693  O OD2  . ASP A 1 74  ? -4.334  -1.328  15.898  1.00 0.00 ? 74  ASP A OD2  3  
ATOM 4694  H H    . ASP A 1 74  ? -5.570  0.314   12.599  1.00 0.00 ? 74  ASP A H    3  
ATOM 4695  H HA   . ASP A 1 74  ? -4.756  2.104   14.734  1.00 0.00 ? 74  ASP A HA   3  
ATOM 4696  H HB2  . ASP A 1 74  ? -3.818  -0.479  13.601  1.00 0.00 ? 74  ASP A HB2  3  
ATOM 4697  H HB3  . ASP A 1 74  ? -2.604  0.501   14.426  1.00 0.00 ? 74  ASP A HB3  3  
ATOM 4698  N N    . ARG A 1 75  ? -2.483  1.907   12.378  1.00 0.00 ? 75  ARG A N    3  
ATOM 4699  C CA   . ARG A 1 75  ? -1.493  2.743   11.643  1.00 0.00 ? 75  ARG A CA   3  
ATOM 4700  C C    . ARG A 1 75  ? -1.301  2.211   10.221  1.00 0.00 ? 75  ARG A C    3  
ATOM 4701  O O    . ARG A 1 75  ? -1.557  2.896   9.250   1.00 0.00 ? 75  ARG A O    3  
ATOM 4702  C CB   . ARG A 1 75  ? -0.148  2.692   12.372  1.00 0.00 ? 75  ARG A CB   3  
ATOM 4703  C CG   . ARG A 1 75  ? -0.219  3.526   13.653  1.00 0.00 ? 75  ARG A CG   3  
ATOM 4704  C CD   . ARG A 1 75  ? 1.134   4.198   13.919  1.00 0.00 ? 75  ARG A CD   3  
ATOM 4705  N NE   . ARG A 1 75  ? 2.237   3.447   13.227  1.00 0.00 ? 75  ARG A NE   3  
ATOM 4706  C CZ   . ARG A 1 75  ? 2.389   2.157   13.382  1.00 0.00 ? 75  ARG A CZ   3  
ATOM 4707  N NH1  . ARG A 1 75  ? 1.696   1.507   14.276  1.00 0.00 ? 75  ARG A NH1  3  
ATOM 4708  N NH2  . ARG A 1 75  ? 3.278   1.522   12.666  1.00 0.00 ? 75  ARG A NH2  3  
ATOM 4709  H H    . ARG A 1 75  ? -2.448  0.930   12.311  1.00 0.00 ? 75  ARG A H    3  
ATOM 4710  H HA   . ARG A 1 75  ? -1.840  3.765   11.603  1.00 0.00 ? 75  ARG A HA   3  
ATOM 4711  H HB2  . ARG A 1 75  ? 0.084   1.668   12.622  1.00 0.00 ? 75  ARG A HB2  3  
ATOM 4712  H HB3  . ARG A 1 75  ? 0.623   3.089   11.729  1.00 0.00 ? 75  ARG A HB3  3  
ATOM 4713  H HG2  . ARG A 1 75  ? -0.978  4.287   13.539  1.00 0.00 ? 75  ARG A HG2  3  
ATOM 4714  H HG3  . ARG A 1 75  ? -0.475  2.889   14.486  1.00 0.00 ? 75  ARG A HG3  3  
ATOM 4715  H HD2  . ARG A 1 75  ? 1.117   5.195   13.520  1.00 0.00 ? 75  ARG A HD2  3  
ATOM 4716  H HD3  . ARG A 1 75  ? 1.304   4.249   14.990  1.00 0.00 ? 75  ARG A HD3  3  
ATOM 4717  H HE   . ARG A 1 75  ? 2.826   3.928   12.609  1.00 0.00 ? 75  ARG A HE   3  
ATOM 4718  H HH11 . ARG A 1 75  ? 1.046   1.993   14.855  1.00 0.00 ? 75  ARG A HH11 3  
ATOM 4719  H HH12 . ARG A 1 75  ? 1.817   0.521   14.381  1.00 0.00 ? 75  ARG A HH12 3  
ATOM 4720  H HH21 . ARG A 1 75  ? 3.838   2.022   12.007  1.00 0.00 ? 75  ARG A HH21 3  
ATOM 4721  H HH22 . ARG A 1 75  ? 3.397   0.535   12.778  1.00 0.00 ? 75  ARG A HH22 3  
ATOM 4722  N N    . SER A 1 76  ? -0.828  1.004   10.094  1.00 0.00 ? 76  SER A N    3  
ATOM 4723  C CA   . SER A 1 76  ? -0.590  0.433   8.738   1.00 0.00 ? 76  SER A CA   3  
ATOM 4724  C C    . SER A 1 76  ? -1.838  -0.295  8.237   1.00 0.00 ? 76  SER A C    3  
ATOM 4725  O O    . SER A 1 76  ? -2.731  -0.620  8.995   1.00 0.00 ? 76  SER A O    3  
ATOM 4726  C CB   . SER A 1 76  ? 0.566   -0.558  8.809   1.00 0.00 ? 76  SER A CB   3  
ATOM 4727  O OG   . SER A 1 76  ? 1.469   -0.156  9.833   1.00 0.00 ? 76  SER A OG   3  
ATOM 4728  H H    . SER A 1 76  ? -0.610  0.477   10.892  1.00 0.00 ? 76  SER A H    3  
ATOM 4729  H HA   . SER A 1 76  ? -0.338  1.228   8.053   1.00 0.00 ? 76  SER A HA   3  
ATOM 4730  H HB2  . SER A 1 76  ? 0.183   -1.537  9.040   1.00 0.00 ? 76  SER A HB2  3  
ATOM 4731  H HB3  . SER A 1 76  ? 1.076   -0.586  7.855   1.00 0.00 ? 76  SER A HB3  3  
ATOM 4732  H HG   . SER A 1 76  ? 1.194   -0.575  10.652  1.00 0.00 ? 76  SER A HG   3  
ATOM 4733  N N    . ILE A 1 77  ? -1.895  -0.559  6.958   1.00 0.00 ? 77  ILE A N    3  
ATOM 4734  C CA   . ILE A 1 77  ? -3.071  -1.270  6.384   1.00 0.00 ? 77  ILE A CA   3  
ATOM 4735  C C    . ILE A 1 77  ? -2.600  -2.214  5.272   1.00 0.00 ? 77  ILE A C    3  
ATOM 4736  O O    . ILE A 1 77  ? -2.858  -1.982  4.108   1.00 0.00 ? 77  ILE A O    3  
ATOM 4737  C CB   . ILE A 1 77  ? -4.047  -0.251  5.786   1.00 0.00 ? 77  ILE A CB   3  
ATOM 4738  C CG1  . ILE A 1 77  ? -4.536  0.706   6.875   1.00 0.00 ? 77  ILE A CG1  3  
ATOM 4739  C CG2  . ILE A 1 77  ? -5.247  -0.984  5.184   1.00 0.00 ? 77  ILE A CG2  3  
ATOM 4740  C CD1  . ILE A 1 77  ? -4.168  2.141   6.494   1.00 0.00 ? 77  ILE A CD1  3  
ATOM 4741  H H    . ILE A 1 77  ? -1.157  -0.290  6.373   1.00 0.00 ? 77  ILE A H    3  
ATOM 4742  H HA   . ILE A 1 77  ? -3.566  -1.838  7.158   1.00 0.00 ? 77  ILE A HA   3  
ATOM 4743  H HB   . ILE A 1 77  ? -3.546  0.310   5.011   1.00 0.00 ? 77  ILE A HB   3  
ATOM 4744  H HG12 . ILE A 1 77  ? -5.608  0.623   6.970   1.00 0.00 ? 77  ILE A HG12 3  
ATOM 4745  H HG13 . ILE A 1 77  ? -4.070  0.455   7.815   1.00 0.00 ? 77  ILE A HG13 3  
ATOM 4746  H HG21 . ILE A 1 77  ? -5.178  -2.037  5.412   1.00 0.00 ? 77  ILE A HG21 3  
ATOM 4747  H HG22 . ILE A 1 77  ? -6.160  -0.585  5.602   1.00 0.00 ? 77  ILE A HG22 3  
ATOM 4748  H HG23 . ILE A 1 77  ? -5.252  -0.847  4.112   1.00 0.00 ? 77  ILE A HG23 3  
ATOM 4749  H HD11 . ILE A 1 77  ? -3.812  2.162   5.476   1.00 0.00 ? 77  ILE A HD11 3  
ATOM 4750  H HD12 . ILE A 1 77  ? -5.040  2.771   6.584   1.00 0.00 ? 77  ILE A HD12 3  
ATOM 4751  H HD13 . ILE A 1 77  ? -3.393  2.502   7.155   1.00 0.00 ? 77  ILE A HD13 3  
ATOM 4752  N N    . TYR A 1 78  ? -1.925  -3.282  5.606   1.00 0.00 ? 78  TYR A N    3  
ATOM 4753  C CA   . TYR A 1 78  ? -1.468  -4.217  4.535   1.00 0.00 ? 78  TYR A CA   3  
ATOM 4754  C C    . TYR A 1 78  ? -2.561  -5.254  4.283   1.00 0.00 ? 78  TYR A C    3  
ATOM 4755  O O    . TYR A 1 78  ? -2.744  -6.177  5.051   1.00 0.00 ? 78  TYR A O    3  
ATOM 4756  C CB   . TYR A 1 78  ? -0.177  -4.945  4.943   1.00 0.00 ? 78  TYR A CB   3  
ATOM 4757  C CG   . TYR A 1 78  ? 0.497   -4.258  6.107   1.00 0.00 ? 78  TYR A CG   3  
ATOM 4758  C CD1  . TYR A 1 78  ? 0.124   -4.582  7.418   1.00 0.00 ? 78  TYR A CD1  3  
ATOM 4759  C CD2  . TYR A 1 78  ? 1.511   -3.317  5.881   1.00 0.00 ? 78  TYR A CD2  3  
ATOM 4760  C CE1  . TYR A 1 78  ? 0.761   -3.963  8.500   1.00 0.00 ? 78  TYR A CE1  3  
ATOM 4761  C CE2  . TYR A 1 78  ? 2.149   -2.701  6.964   1.00 0.00 ? 78  TYR A CE2  3  
ATOM 4762  C CZ   . TYR A 1 78  ? 1.774   -3.025  8.273   1.00 0.00 ? 78  TYR A CZ   3  
ATOM 4763  O OH   . TYR A 1 78  ? 2.402   -2.415  9.341   1.00 0.00 ? 78  TYR A OH   3  
ATOM 4764  H H    . TYR A 1 78  ? -1.727  -3.469  6.546   1.00 0.00 ? 78  TYR A H    3  
ATOM 4765  H HA   . TYR A 1 78  ? -1.293  -3.658  3.628   1.00 0.00 ? 78  TYR A HA   3  
ATOM 4766  H HB2  . TYR A 1 78  ? -0.417  -5.959  5.222   1.00 0.00 ? 78  TYR A HB2  3  
ATOM 4767  H HB3  . TYR A 1 78  ? 0.500   -4.960  4.100   1.00 0.00 ? 78  TYR A HB3  3  
ATOM 4768  H HD1  . TYR A 1 78  ? -0.656  -5.306  7.593   1.00 0.00 ? 78  TYR A HD1  3  
ATOM 4769  H HD2  . TYR A 1 78  ? 1.802   -3.064  4.870   1.00 0.00 ? 78  TYR A HD2  3  
ATOM 4770  H HE1  . TYR A 1 78  ? 0.472   -4.212  9.511   1.00 0.00 ? 78  TYR A HE1  3  
ATOM 4771  H HE2  . TYR A 1 78  ? 2.930   -1.976  6.790   1.00 0.00 ? 78  TYR A HE2  3  
ATOM 4772  H HH   . TYR A 1 78  ? 1.838   -2.513  10.113  1.00 0.00 ? 78  TYR A HH   3  
ATOM 4773  N N    . GLY A 1 79  ? -3.289  -5.109  3.210   1.00 0.00 ? 79  GLY A N    3  
ATOM 4774  C CA   . GLY A 1 79  ? -4.372  -6.086  2.908   1.00 0.00 ? 79  GLY A CA   3  
ATOM 4775  C C    . GLY A 1 79  ? -3.756  -7.452  2.602   1.00 0.00 ? 79  GLY A C    3  
ATOM 4776  O O    . GLY A 1 79  ? -2.559  -7.581  2.435   1.00 0.00 ? 79  GLY A O    3  
ATOM 4777  H H    . GLY A 1 79  ? -3.125  -4.356  2.605   1.00 0.00 ? 79  GLY A H    3  
ATOM 4778  H HA2  . GLY A 1 79  ? -5.031  -6.168  3.760   1.00 0.00 ? 79  GLY A HA2  3  
ATOM 4779  H HA3  . GLY A 1 79  ? -4.932  -5.749  2.050   1.00 0.00 ? 79  GLY A HA3  3  
ATOM 4780  N N    . LYS A 1 80  ? -4.565  -8.472  2.526   1.00 0.00 ? 80  LYS A N    3  
ATOM 4781  C CA   . LYS A 1 80  ? -4.028  -9.829  2.231   1.00 0.00 ? 80  LYS A CA   3  
ATOM 4782  C C    . LYS A 1 80  ? -5.076  -10.631 1.456   1.00 0.00 ? 80  LYS A C    3  
ATOM 4783  O O    . LYS A 1 80  ? -6.265  -10.457 1.636   1.00 0.00 ? 80  LYS A O    3  
ATOM 4784  C CB   . LYS A 1 80  ? -3.707  -10.548 3.541   1.00 0.00 ? 80  LYS A CB   3  
ATOM 4785  C CG   . LYS A 1 80  ? -2.812  -11.755 3.256   1.00 0.00 ? 80  LYS A CG   3  
ATOM 4786  C CD   . LYS A 1 80  ? -2.391  -12.404 4.575   1.00 0.00 ? 80  LYS A CD   3  
ATOM 4787  C CE   . LYS A 1 80  ? -1.429  -13.558 4.292   1.00 0.00 ? 80  LYS A CE   3  
ATOM 4788  N NZ   . LYS A 1 80  ? -2.142  -14.627 3.535   1.00 0.00 ? 80  LYS A NZ   3  
ATOM 4789  H H    . LYS A 1 80  ? -5.526  -8.344  2.665   1.00 0.00 ? 80  LYS A H    3  
ATOM 4790  H HA   . LYS A 1 80  ? -3.129  -9.742  1.636   1.00 0.00 ? 80  LYS A HA   3  
ATOM 4791  H HB2  . LYS A 1 80  ? -3.196  -9.869  4.209   1.00 0.00 ? 80  LYS A HB2  3  
ATOM 4792  H HB3  . LYS A 1 80  ? -4.624  -10.884 4.001   1.00 0.00 ? 80  LYS A HB3  3  
ATOM 4793  H HG2  . LYS A 1 80  ? -3.356  -12.472 2.658   1.00 0.00 ? 80  LYS A HG2  3  
ATOM 4794  H HG3  . LYS A 1 80  ? -1.933  -11.432 2.718   1.00 0.00 ? 80  LYS A HG3  3  
ATOM 4795  H HD2  . LYS A 1 80  ? -1.901  -11.669 5.197   1.00 0.00 ? 80  LYS A HD2  3  
ATOM 4796  H HD3  . LYS A 1 80  ? -3.265  -12.782 5.085   1.00 0.00 ? 80  LYS A HD3  3  
ATOM 4797  H HE2  . LYS A 1 80  ? -0.598  -13.197 3.706   1.00 0.00 ? 80  LYS A HE2  3  
ATOM 4798  H HE3  . LYS A 1 80  ? -1.065  -13.960 5.226   1.00 0.00 ? 80  LYS A HE3  3  
ATOM 4799  H HZ1  . LYS A 1 80  ? -2.536  -14.229 2.660   1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 4800  H HZ2  . LYS A 1 80  ? -1.475  -15.387 3.299   1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 4801  H HZ3  . LYS A 1 80  ? -2.913  -15.012 4.120   1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 4802  N N    . LYS A 1 81  ? -4.643  -11.504 0.591   1.00 0.00 ? 81  LYS A N    3  
ATOM 4803  C CA   . LYS A 1 81  ? -5.613  -12.314 -0.200  1.00 0.00 ? 81  LYS A CA   3  
ATOM 4804  C C    . LYS A 1 81  ? -5.183  -13.784 -0.202  1.00 0.00 ? 81  LYS A C    3  
ATOM 4805  O O    . LYS A 1 81  ? -6.002  -14.679 -0.286  1.00 0.00 ? 81  LYS A O    3  
ATOM 4806  C CB   . LYS A 1 81  ? -5.647  -11.797 -1.639  1.00 0.00 ? 81  LYS A CB   3  
ATOM 4807  C CG   . LYS A 1 81  ? -7.022  -11.199 -1.939  1.00 0.00 ? 81  LYS A CG   3  
ATOM 4808  C CD   . LYS A 1 81  ? -7.268  -11.218 -3.449  1.00 0.00 ? 81  LYS A CD   3  
ATOM 4809  C CE   . LYS A 1 81  ? -8.400  -12.197 -3.771  1.00 0.00 ? 81  LYS A CE   3  
ATOM 4810  N NZ   . LYS A 1 81  ? -8.834  -12.005 -5.184  1.00 0.00 ? 81  LYS A NZ   3  
ATOM 4811  H H    . LYS A 1 81  ? -3.681  -11.623 0.459   1.00 0.00 ? 81  LYS A H    3  
ATOM 4812  H HA   . LYS A 1 81  ? -6.596  -12.226 0.236   1.00 0.00 ? 81  LYS A HA   3  
ATOM 4813  H HB2  . LYS A 1 81  ? -4.889  -11.037 -1.765  1.00 0.00 ? 81  LYS A HB2  3  
ATOM 4814  H HB3  . LYS A 1 81  ? -5.455  -12.613 -2.320  1.00 0.00 ? 81  LYS A HB3  3  
ATOM 4815  H HG2  . LYS A 1 81  ? -7.784  -11.779 -1.440  1.00 0.00 ? 81  LYS A HG2  3  
ATOM 4816  H HG3  . LYS A 1 81  ? -7.056  -10.179 -1.584  1.00 0.00 ? 81  LYS A HG3  3  
ATOM 4817  H HD2  . LYS A 1 81  ? -7.543  -10.226 -3.779  1.00 0.00 ? 81  LYS A HD2  3  
ATOM 4818  H HD3  . LYS A 1 81  ? -6.369  -11.530 -3.956  1.00 0.00 ? 81  LYS A HD3  3  
ATOM 4819  H HE2  . LYS A 1 81  ? -8.049  -13.210 -3.637  1.00 0.00 ? 81  LYS A HE2  3  
ATOM 4820  H HE3  . LYS A 1 81  ? -9.235  -12.013 -3.110  1.00 0.00 ? 81  LYS A HE3  3  
ATOM 4821  H HZ1  . LYS A 1 81  ? -8.011  -11.747 -5.767  1.00 0.00 ? 81  LYS A HZ1  3  
ATOM 4822  H HZ2  . LYS A 1 81  ? -9.250  -12.888 -5.542  1.00 0.00 ? 81  LYS A HZ2  3  
ATOM 4823  H HZ3  . LYS A 1 81  ? -9.543  -11.247 -5.228  1.00 0.00 ? 81  LYS A HZ3  3  
ATOM 4824  N N    . GLY A 1 82  ? -3.907  -14.042 -0.124  1.00 0.00 ? 82  GLY A N    3  
ATOM 4825  C CA   . GLY A 1 82  ? -3.422  -15.450 -0.136  1.00 0.00 ? 82  GLY A CA   3  
ATOM 4826  C C    . GLY A 1 82  ? -2.432  -15.610 -1.288  1.00 0.00 ? 82  GLY A C    3  
ATOM 4827  O O    . GLY A 1 82  ? -1.251  -15.806 -1.084  1.00 0.00 ? 82  GLY A O    3  
ATOM 4828  H H    . GLY A 1 82  ? -3.262  -13.308 -0.068  1.00 0.00 ? 82  GLY A H    3  
ATOM 4829  H HA2  . GLY A 1 82  ? -2.932  -15.674 0.803   1.00 0.00 ? 82  GLY A HA2  3  
ATOM 4830  H HA3  . GLY A 1 82  ? -4.254  -16.121 -0.282  1.00 0.00 ? 82  GLY A HA3  3  
ATOM 4831  N N    . SER A 1 83  ? -2.904  -15.507 -2.500  1.00 0.00 ? 83  SER A N    3  
ATOM 4832  C CA   . SER A 1 83  ? -1.993  -15.629 -3.669  1.00 0.00 ? 83  SER A CA   3  
ATOM 4833  C C    . SER A 1 83  ? -1.410  -14.247 -3.975  1.00 0.00 ? 83  SER A C    3  
ATOM 4834  O O    . SER A 1 83  ? -0.402  -14.114 -4.640  1.00 0.00 ? 83  SER A O    3  
ATOM 4835  C CB   . SER A 1 83  ? -2.777  -16.134 -4.882  1.00 0.00 ? 83  SER A CB   3  
ATOM 4836  O OG   . SER A 1 83  ? -3.146  -15.028 -5.696  1.00 0.00 ? 83  SER A OG   3  
ATOM 4837  H H    . SER A 1 83  ? -3.858  -15.334 -2.640  1.00 0.00 ? 83  SER A H    3  
ATOM 4838  H HA   . SER A 1 83  ? -1.193  -16.318 -3.438  1.00 0.00 ? 83  SER A HA   3  
ATOM 4839  H HB2  . SER A 1 83  ? -2.164  -16.808 -5.456  1.00 0.00 ? 83  SER A HB2  3  
ATOM 4840  H HB3  . SER A 1 83  ? -3.662  -16.658 -4.544  1.00 0.00 ? 83  SER A HB3  3  
ATOM 4841  H HG   . SER A 1 83  ? -3.435  -15.366 -6.546  1.00 0.00 ? 83  SER A HG   3  
ATOM 4842  N N    . ALA A 1 84  ? -2.046  -13.218 -3.483  1.00 0.00 ? 84  ALA A N    3  
ATOM 4843  C CA   . ALA A 1 84  ? -1.549  -11.834 -3.727  1.00 0.00 ? 84  ALA A CA   3  
ATOM 4844  C C    . ALA A 1 84  ? -1.878  -10.968 -2.508  1.00 0.00 ? 84  ALA A C    3  
ATOM 4845  O O    . ALA A 1 84  ? -2.657  -11.350 -1.659  1.00 0.00 ? 84  ALA A O    3  
ATOM 4846  C CB   . ALA A 1 84  ? -2.233  -11.255 -4.968  1.00 0.00 ? 84  ALA A CB   3  
ATOM 4847  H H    . ALA A 1 84  ? -2.856  -13.356 -2.949  1.00 0.00 ? 84  ALA A H    3  
ATOM 4848  H HA   . ALA A 1 84  ? -0.479  -11.856 -3.878  1.00 0.00 ? 84  ALA A HA   3  
ATOM 4849  H HB1  . ALA A 1 84  ? -2.865  -12.008 -5.414  1.00 0.00 ? 84  ALA A HB1  3  
ATOM 4850  H HB2  . ALA A 1 84  ? -2.832  -10.403 -4.684  1.00 0.00 ? 84  ALA A HB2  3  
ATOM 4851  H HB3  . ALA A 1 84  ? -1.483  -10.946 -5.680  1.00 0.00 ? 84  ALA A HB3  3  
ATOM 4852  N N    . GLY A 1 85  ? -1.292  -9.805  -2.409  1.00 0.00 ? 85  GLY A N    3  
ATOM 4853  C CA   . GLY A 1 85  ? -1.578  -8.929  -1.236  1.00 0.00 ? 85  GLY A CA   3  
ATOM 4854  C C    . GLY A 1 85  ? -1.186  -7.485  -1.558  1.00 0.00 ? 85  GLY A C    3  
ATOM 4855  O O    . GLY A 1 85  ? -0.463  -7.222  -2.497  1.00 0.00 ? 85  GLY A O    3  
ATOM 4856  H H    . GLY A 1 85  ? -0.663  -9.511  -3.099  1.00 0.00 ? 85  GLY A H    3  
ATOM 4857  H HA2  . GLY A 1 85  ? -2.633  -8.974  -1.005  1.00 0.00 ? 85  GLY A HA2  3  
ATOM 4858  H HA3  . GLY A 1 85  ? -1.009  -9.271  -0.385  1.00 0.00 ? 85  GLY A HA3  3  
ATOM 4859  N N    . VAL A 1 86  ? -1.658  -6.546  -0.780  1.00 0.00 ? 86  VAL A N    3  
ATOM 4860  C CA   . VAL A 1 86  ? -1.312  -5.120  -1.037  1.00 0.00 ? 86  VAL A CA   3  
ATOM 4861  C C    . VAL A 1 86  ? -0.817  -4.473  0.260   1.00 0.00 ? 86  VAL A C    3  
ATOM 4862  O O    . VAL A 1 86  ? -1.587  -4.165  1.148   1.00 0.00 ? 86  VAL A O    3  
ATOM 4863  C CB   . VAL A 1 86  ? -2.548  -4.372  -1.549  1.00 0.00 ? 86  VAL A CB   3  
ATOM 4864  C CG1  . VAL A 1 86  ? -3.594  -4.267  -0.435  1.00 0.00 ? 86  VAL A CG1  3  
ATOM 4865  C CG2  . VAL A 1 86  ? -2.143  -2.966  -1.997  1.00 0.00 ? 86  VAL A CG2  3  
ATOM 4866  H H    . VAL A 1 86  ? -2.238  -6.781  -0.026  1.00 0.00 ? 86  VAL A H    3  
ATOM 4867  H HA   . VAL A 1 86  ? -0.530  -5.071  -1.782  1.00 0.00 ? 86  VAL A HA   3  
ATOM 4868  H HB   . VAL A 1 86  ? -2.970  -4.909  -2.386  1.00 0.00 ? 86  VAL A HB   3  
ATOM 4869  H HG11 . VAL A 1 86  ? -3.597  -5.178  0.145   1.00 0.00 ? 86  VAL A HG11 3  
ATOM 4870  H HG12 . VAL A 1 86  ? -3.353  -3.432  0.206   1.00 0.00 ? 86  VAL A HG12 3  
ATOM 4871  H HG13 . VAL A 1 86  ? -4.570  -4.115  -0.872  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 4872  H HG21 . VAL A 1 86  ? -1.312  -2.622  -1.398  1.00 0.00 ? 86  VAL A HG21 3  
ATOM 4873  H HG22 . VAL A 1 86  ? -1.851  -2.989  -3.037  1.00 0.00 ? 86  VAL A HG22 3  
ATOM 4874  H HG23 . VAL A 1 86  ? -2.979  -2.294  -1.872  1.00 0.00 ? 86  VAL A HG23 3  
ATOM 4875  N N    . ILE A 1 87  ? 0.466   -4.262  0.377   1.00 0.00 ? 87  ILE A N    3  
ATOM 4876  C CA   . ILE A 1 87  ? 1.007   -3.634  1.614   1.00 0.00 ? 87  ILE A CA   3  
ATOM 4877  C C    . ILE A 1 87  ? 0.808   -2.119  1.532   1.00 0.00 ? 87  ILE A C    3  
ATOM 4878  O O    . ILE A 1 87  ? 1.612   -1.407  0.963   1.00 0.00 ? 87  ILE A O    3  
ATOM 4879  C CB   . ILE A 1 87  ? 2.499   -3.956  1.737   1.00 0.00 ? 87  ILE A CB   3  
ATOM 4880  C CG1  . ILE A 1 87  ? 2.675   -5.446  2.043   1.00 0.00 ? 87  ILE A CG1  3  
ATOM 4881  C CG2  . ILE A 1 87  ? 3.116   -3.130  2.868   1.00 0.00 ? 87  ILE A CG2  3  
ATOM 4882  C CD1  . ILE A 1 87  ? 3.709   -6.047  1.090   1.00 0.00 ? 87  ILE A CD1  3  
ATOM 4883  H H    . ILE A 1 87  ? 1.072   -4.517  -0.350  1.00 0.00 ? 87  ILE A H    3  
ATOM 4884  H HA   . ILE A 1 87  ? 0.483   -4.020  2.476   1.00 0.00 ? 87  ILE A HA   3  
ATOM 4885  H HB   . ILE A 1 87  ? 2.996   -3.718  0.807   1.00 0.00 ? 87  ILE A HB   3  
ATOM 4886  H HG12 . ILE A 1 87  ? 3.011   -5.566  3.063   1.00 0.00 ? 87  ILE A HG12 3  
ATOM 4887  H HG13 . ILE A 1 87  ? 1.731   -5.954  1.913   1.00 0.00 ? 87  ILE A HG13 3  
ATOM 4888  H HG21 . ILE A 1 87  ? 2.396   -2.407  3.220   1.00 0.00 ? 87  ILE A HG21 3  
ATOM 4889  H HG22 . ILE A 1 87  ? 3.392   -3.786  3.681   1.00 0.00 ? 87  ILE A HG22 3  
ATOM 4890  H HG23 . ILE A 1 87  ? 3.993   -2.619  2.505   1.00 0.00 ? 87  ILE A HG23 3  
ATOM 4891  H HD11 . ILE A 1 87  ? 4.129   -5.264  0.476   1.00 0.00 ? 87  ILE A HD11 3  
ATOM 4892  H HD12 . ILE A 1 87  ? 4.496   -6.517  1.662   1.00 0.00 ? 87  ILE A HD12 3  
ATOM 4893  H HD13 . ILE A 1 87  ? 3.233   -6.782  0.458   1.00 0.00 ? 87  ILE A HD13 3  
ATOM 4894  N N    . THR A 1 88  ? -0.264  -1.622  2.086   1.00 0.00 ? 88  THR A N    3  
ATOM 4895  C CA   . THR A 1 88  ? -0.524  -0.157  2.029   1.00 0.00 ? 88  THR A CA   3  
ATOM 4896  C C    . THR A 1 88  ? -0.164  0.495   3.366   1.00 0.00 ? 88  THR A C    3  
ATOM 4897  O O    . THR A 1 88  ? -0.875  0.368   4.343   1.00 0.00 ? 88  THR A O    3  
ATOM 4898  C CB   . THR A 1 88  ? -2.005  0.082   1.724   1.00 0.00 ? 88  THR A CB   3  
ATOM 4899  O OG1  . THR A 1 88  ? -2.756  0.010   2.927   1.00 0.00 ? 88  THR A OG1  3  
ATOM 4900  C CG2  . THR A 1 88  ? -2.501  -0.983  0.745   1.00 0.00 ? 88  THR A CG2  3  
ATOM 4901  H H    . THR A 1 88  ? -0.903  -2.215  2.533   1.00 0.00 ? 88  THR A H    3  
ATOM 4902  H HA   . THR A 1 88  ? 0.073   0.278   1.247   1.00 0.00 ? 88  THR A HA   3  
ATOM 4903  H HB   . THR A 1 88  ? -2.128  1.057   1.280   1.00 0.00 ? 88  THR A HB   3  
ATOM 4904  H HG1  . THR A 1 88  ? -3.619  -0.356  2.716   1.00 0.00 ? 88  THR A HG1  3  
ATOM 4905  H HG21 . THR A 1 88  ? -1.659  -1.543  0.366   1.00 0.00 ? 88  THR A HG21 3  
ATOM 4906  H HG22 . THR A 1 88  ? -3.180  -1.651  1.253   1.00 0.00 ? 88  THR A HG22 3  
ATOM 4907  H HG23 . THR A 1 88  ? -3.015  -0.505  -0.076  1.00 0.00 ? 88  THR A HG23 3  
ATOM 4908  N N    . VAL A 1 89  ? 0.931   1.207   3.412   1.00 0.00 ? 89  VAL A N    3  
ATOM 4909  C CA   . VAL A 1 89  ? 1.331   1.883   4.679   1.00 0.00 ? 89  VAL A CA   3  
ATOM 4910  C C    . VAL A 1 89  ? 1.329   3.397   4.455   1.00 0.00 ? 89  VAL A C    3  
ATOM 4911  O O    . VAL A 1 89  ? 1.572   3.872   3.364   1.00 0.00 ? 89  VAL A O    3  
ATOM 4912  C CB   . VAL A 1 89  ? 2.732   1.427   5.094   1.00 0.00 ? 89  VAL A CB   3  
ATOM 4913  C CG1  . VAL A 1 89  ? 3.063   1.995   6.475   1.00 0.00 ? 89  VAL A CG1  3  
ATOM 4914  C CG2  . VAL A 1 89  ? 2.776   -0.102  5.150   1.00 0.00 ? 89  VAL A CG2  3  
ATOM 4915  H H    . VAL A 1 89  ? 1.484   1.305   2.608   1.00 0.00 ? 89  VAL A H    3  
ATOM 4916  H HA   . VAL A 1 89  ? 0.626   1.634   5.457   1.00 0.00 ? 89  VAL A HA   3  
ATOM 4917  H HB   . VAL A 1 89  ? 3.455   1.783   4.375   1.00 0.00 ? 89  VAL A HB   3  
ATOM 4918  H HG11 . VAL A 1 89  ? 2.694   3.008   6.547   1.00 0.00 ? 89  VAL A HG11 3  
ATOM 4919  H HG12 . VAL A 1 89  ? 2.594   1.386   7.234   1.00 0.00 ? 89  VAL A HG12 3  
ATOM 4920  H HG13 . VAL A 1 89  ? 4.133   1.989   6.620   1.00 0.00 ? 89  VAL A HG13 3  
ATOM 4921  H HG21 . VAL A 1 89  ? 2.030   -0.457  5.847   1.00 0.00 ? 89  VAL A HG21 3  
ATOM 4922  H HG22 . VAL A 1 89  ? 2.574   -0.506  4.169   1.00 0.00 ? 89  VAL A HG22 3  
ATOM 4923  H HG23 . VAL A 1 89  ? 3.754   -0.422  5.477   1.00 0.00 ? 89  VAL A HG23 3  
ATOM 4924  N N    . LYS A 1 90  ? 1.045   4.158   5.475   1.00 0.00 ? 90  LYS A N    3  
ATOM 4925  C CA   . LYS A 1 90  ? 1.016   5.639   5.311   1.00 0.00 ? 90  LYS A CA   3  
ATOM 4926  C C    . LYS A 1 90  ? 2.421   6.215   5.498   1.00 0.00 ? 90  LYS A C    3  
ATOM 4927  O O    . LYS A 1 90  ? 3.242   5.665   6.205   1.00 0.00 ? 90  LYS A O    3  
ATOM 4928  C CB   . LYS A 1 90  ? 0.072   6.245   6.352   1.00 0.00 ? 90  LYS A CB   3  
ATOM 4929  C CG   . LYS A 1 90  ? -1.373  6.110   5.871   1.00 0.00 ? 90  LYS A CG   3  
ATOM 4930  C CD   . LYS A 1 90  ? -2.319  6.634   6.952   1.00 0.00 ? 90  LYS A CD   3  
ATOM 4931  C CE   . LYS A 1 90  ? -2.208  8.157   7.036   1.00 0.00 ? 90  LYS A CE   3  
ATOM 4932  N NZ   . LYS A 1 90  ? -3.537  8.733   7.387   1.00 0.00 ? 90  LYS A NZ   3  
ATOM 4933  H H    . LYS A 1 90  ? 0.843   3.756   6.347   1.00 0.00 ? 90  LYS A H    3  
ATOM 4934  H HA   . LYS A 1 90  ? 0.658   5.881   4.322   1.00 0.00 ? 90  LYS A HA   3  
ATOM 4935  H HB2  . LYS A 1 90  ? 0.189   5.723   7.292   1.00 0.00 ? 90  LYS A HB2  3  
ATOM 4936  H HB3  . LYS A 1 90  ? 0.308   7.289   6.488   1.00 0.00 ? 90  LYS A HB3  3  
ATOM 4937  H HG2  . LYS A 1 90  ? -1.505  6.684   4.965   1.00 0.00 ? 90  LYS A HG2  3  
ATOM 4938  H HG3  . LYS A 1 90  ? -1.592  5.071   5.676   1.00 0.00 ? 90  LYS A HG3  3  
ATOM 4939  H HD2  . LYS A 1 90  ? -3.335  6.359   6.704   1.00 0.00 ? 90  LYS A HD2  3  
ATOM 4940  H HD3  . LYS A 1 90  ? -2.052  6.202   7.905   1.00 0.00 ? 90  LYS A HD3  3  
ATOM 4941  H HE2  . LYS A 1 90  ? -1.486  8.424   7.793   1.00 0.00 ? 90  LYS A HE2  3  
ATOM 4942  H HE3  . LYS A 1 90  ? -1.889  8.547   6.081   1.00 0.00 ? 90  LYS A HE3  3  
ATOM 4943  H HZ1  . LYS A 1 90  ? -4.112  8.012   7.868   1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 4944  H HZ2  . LYS A 1 90  ? -3.405  9.547   8.021   1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 4945  H HZ3  . LYS A 1 90  ? -4.021  9.043   6.520   1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 4946  N N    . THR A 1 91  ? 2.700   7.327   4.871   1.00 0.00 ? 91  THR A N    3  
ATOM 4947  C CA   . THR A 1 91  ? 4.046   7.953   5.012   1.00 0.00 ? 91  THR A CA   3  
ATOM 4948  C C    . THR A 1 91  ? 3.896   9.476   4.973   1.00 0.00 ? 91  THR A C    3  
ATOM 4949  O O    . THR A 1 91  ? 2.831   10.006  5.211   1.00 0.00 ? 91  THR A O    3  
ATOM 4950  C CB   . THR A 1 91  ? 4.953   7.501   3.863   1.00 0.00 ? 91  THR A CB   3  
ATOM 4951  O OG1  . THR A 1 91  ? 4.730   8.331   2.732   1.00 0.00 ? 91  THR A OG1  3  
ATOM 4952  C CG2  . THR A 1 91  ? 4.640   6.050   3.503   1.00 0.00 ? 91  THR A CG2  3  
ATOM 4953  H H    . THR A 1 91  ? 2.019   7.756   4.311   1.00 0.00 ? 91  THR A H    3  
ATOM 4954  H HA   . THR A 1 91  ? 4.483   7.658   5.955   1.00 0.00 ? 91  THR A HA   3  
ATOM 4955  H HB   . THR A 1 91  ? 5.985   7.577   4.168   1.00 0.00 ? 91  THR A HB   3  
ATOM 4956  H HG1  . THR A 1 91  ? 5.578   8.684   2.452   1.00 0.00 ? 91  THR A HG1  3  
ATOM 4957  H HG21 . THR A 1 91  ? 3.571   5.923   3.414   1.00 0.00 ? 91  THR A HG21 3  
ATOM 4958  H HG22 . THR A 1 91  ? 5.111   5.803   2.563   1.00 0.00 ? 91  THR A HG22 3  
ATOM 4959  H HG23 . THR A 1 91  ? 5.017   5.397   4.277   1.00 0.00 ? 91  THR A HG23 3  
ATOM 4960  N N    . SER A 1 92  ? 4.953   10.183  4.678   1.00 0.00 ? 92  SER A N    3  
ATOM 4961  C CA   . SER A 1 92  ? 4.861   11.670  4.626   1.00 0.00 ? 92  SER A CA   3  
ATOM 4962  C C    . SER A 1 92  ? 4.009   12.086  3.425   1.00 0.00 ? 92  SER A C    3  
ATOM 4963  O O    . SER A 1 92  ? 4.518   12.373  2.360   1.00 0.00 ? 92  SER A O    3  
ATOM 4964  C CB   . SER A 1 92  ? 6.262   12.265  4.485   1.00 0.00 ? 92  SER A CB   3  
ATOM 4965  O OG   . SER A 1 92  ? 6.193   13.674  4.661   1.00 0.00 ? 92  SER A OG   3  
ATOM 4966  H H    . SER A 1 92  ? 5.805   9.738   4.489   1.00 0.00 ? 92  SER A H    3  
ATOM 4967  H HA   . SER A 1 92  ? 4.404   12.035  5.534   1.00 0.00 ? 92  SER A HA   3  
ATOM 4968  H HB2  . SER A 1 92  ? 6.910   11.847  5.235   1.00 0.00 ? 92  SER A HB2  3  
ATOM 4969  H HB3  . SER A 1 92  ? 6.653   12.032  3.503   1.00 0.00 ? 92  SER A HB3  3  
ATOM 4970  H HG   . SER A 1 92  ? 6.976   13.952  5.142   1.00 0.00 ? 92  SER A HG   3  
ATOM 4971  N N    . LYS A 1 93  ? 2.714   12.124  3.588   1.00 0.00 ? 93  LYS A N    3  
ATOM 4972  C CA   . LYS A 1 93  ? 1.833   12.522  2.457   1.00 0.00 ? 93  LYS A CA   3  
ATOM 4973  C C    . LYS A 1 93  ? 1.991   11.520  1.312   1.00 0.00 ? 93  LYS A C    3  
ATOM 4974  O O    . LYS A 1 93  ? 1.586   11.772  0.194   1.00 0.00 ? 93  LYS A O    3  
ATOM 4975  C CB   . LYS A 1 93  ? 2.226   13.920  1.978   1.00 0.00 ? 93  LYS A CB   3  
ATOM 4976  C CG   . LYS A 1 93  ? 2.269   14.871  3.175   1.00 0.00 ? 93  LYS A CG   3  
ATOM 4977  C CD   . LYS A 1 93  ? 3.714   15.300  3.436   1.00 0.00 ? 93  LYS A CD   3  
ATOM 4978  C CE   . LYS A 1 93  ? 4.236   16.085  2.232   1.00 0.00 ? 93  LYS A CE   3  
ATOM 4979  N NZ   . LYS A 1 93  ? 3.427   17.324  2.060   1.00 0.00 ? 93  LYS A NZ   3  
ATOM 4980  H H    . LYS A 1 93  ? 2.323   11.891  4.457   1.00 0.00 ? 93  LYS A H    3  
ATOM 4981  H HA   . LYS A 1 93  ? 0.805   12.531  2.788   1.00 0.00 ? 93  LYS A HA   3  
ATOM 4982  H HB2  . LYS A 1 93  ? 3.200   13.881  1.511   1.00 0.00 ? 93  LYS A HB2  3  
ATOM 4983  H HB3  . LYS A 1 93  ? 1.498   14.275  1.264   1.00 0.00 ? 93  LYS A HB3  3  
ATOM 4984  H HG2  . LYS A 1 93  ? 1.667   15.744  2.963   1.00 0.00 ? 93  LYS A HG2  3  
ATOM 4985  H HG3  . LYS A 1 93  ? 1.882   14.370  4.048   1.00 0.00 ? 93  LYS A HG3  3  
ATOM 4986  H HD2  . LYS A 1 93  ? 3.751   15.922  4.318   1.00 0.00 ? 93  LYS A HD2  3  
ATOM 4987  H HD3  . LYS A 1 93  ? 4.327   14.424  3.586   1.00 0.00 ? 93  LYS A HD3  3  
ATOM 4988  H HE2  . LYS A 1 93  ? 5.270   16.349  2.396   1.00 0.00 ? 93  LYS A HE2  3  
ATOM 4989  H HE3  . LYS A 1 93  ? 4.157   15.477  1.343   1.00 0.00 ? 93  LYS A HE3  3  
ATOM 4990  H HZ1  . LYS A 1 93  ? 3.426   17.863  2.948   1.00 0.00 ? 93  LYS A HZ1  3  
ATOM 4991  H HZ2  . LYS A 1 93  ? 3.840   17.907  1.304   1.00 0.00 ? 93  LYS A HZ2  3  
ATOM 4992  H HZ3  . LYS A 1 93  ? 2.451   17.068  1.807   1.00 0.00 ? 93  LYS A HZ3  3  
ATOM 4993  N N    . SER A 1 94  ? 2.578   10.386  1.581   1.00 0.00 ? 94  SER A N    3  
ATOM 4994  C CA   . SER A 1 94  ? 2.763   9.368   0.508   1.00 0.00 ? 94  SER A CA   3  
ATOM 4995  C C    . SER A 1 94  ? 2.232   8.016   0.990   1.00 0.00 ? 94  SER A C    3  
ATOM 4996  O O    . SER A 1 94  ? 2.225   7.724   2.170   1.00 0.00 ? 94  SER A O    3  
ATOM 4997  C CB   . SER A 1 94  ? 4.250   9.242   0.173   1.00 0.00 ? 94  SER A CB   3  
ATOM 4998  O OG   . SER A 1 94  ? 4.434   9.411   -1.226  1.00 0.00 ? 94  SER A OG   3  
ATOM 4999  H H    . SER A 1 94  ? 2.898   10.204  2.489   1.00 0.00 ? 94  SER A H    3  
ATOM 5000  H HA   . SER A 1 94  ? 2.220   9.673   -0.374  1.00 0.00 ? 94  SER A HA   3  
ATOM 5001  H HB2  . SER A 1 94  ? 4.805   10.003  0.698   1.00 0.00 ? 94  SER A HB2  3  
ATOM 5002  H HB3  . SER A 1 94  ? 4.606   8.266   0.478   1.00 0.00 ? 94  SER A HB3  3  
ATOM 5003  H HG   . SER A 1 94  ? 3.658   9.064   -1.671  1.00 0.00 ? 94  SER A HG   3  
ATOM 5004  N N    . ILE A 1 95  ? 1.785   7.187   0.086   1.00 0.00 ? 95  ILE A N    3  
ATOM 5005  C CA   . ILE A 1 95  ? 1.255   5.854   0.488   1.00 0.00 ? 95  ILE A CA   3  
ATOM 5006  C C    . ILE A 1 95  ? 1.955   4.763   -0.323  1.00 0.00 ? 95  ILE A C    3  
ATOM 5007  O O    . ILE A 1 95  ? 1.935   4.773   -1.537  1.00 0.00 ? 95  ILE A O    3  
ATOM 5008  C CB   . ILE A 1 95  ? -0.251  5.800   0.220   1.00 0.00 ? 95  ILE A CB   3  
ATOM 5009  C CG1  . ILE A 1 95  ? -0.979  6.677   1.240   1.00 0.00 ? 95  ILE A CG1  3  
ATOM 5010  C CG2  . ILE A 1 95  ? -0.743  4.358   0.344   1.00 0.00 ? 95  ILE A CG2  3  
ATOM 5011  C CD1  . ILE A 1 95  ? -2.481  6.647   0.959   1.00 0.00 ? 95  ILE A CD1  3  
ATOM 5012  H H    . ILE A 1 95  ? 1.799   7.442   -0.860  1.00 0.00 ? 95  ILE A H    3  
ATOM 5013  H HA   . ILE A 1 95  ? 1.440   5.694   1.541   1.00 0.00 ? 95  ILE A HA   3  
ATOM 5014  H HB   . ILE A 1 95  ? -0.450  6.164   -0.777  1.00 0.00 ? 95  ILE A HB   3  
ATOM 5015  H HG12 . ILE A 1 95  ? -0.791  6.303   2.237   1.00 0.00 ? 95  ILE A HG12 3  
ATOM 5016  H HG13 . ILE A 1 95  ? -0.621  7.694   1.163   1.00 0.00 ? 95  ILE A HG13 3  
ATOM 5017  H HG21 . ILE A 1 95  ? -0.144  3.834   1.074   1.00 0.00 ? 95  ILE A HG21 3  
ATOM 5018  H HG22 . ILE A 1 95  ? -1.776  4.356   0.659   1.00 0.00 ? 95  ILE A HG22 3  
ATOM 5019  H HG23 . ILE A 1 95  ? -0.659  3.864   -0.613  1.00 0.00 ? 95  ILE A HG23 3  
ATOM 5020  H HD11 . ILE A 1 95  ? -2.705  5.834   0.285   1.00 0.00 ? 95  ILE A HD11 3  
ATOM 5021  H HD12 . ILE A 1 95  ? -3.019  6.505   1.885   1.00 0.00 ? 95  ILE A HD12 3  
ATOM 5022  H HD13 . ILE A 1 95  ? -2.782  7.581   0.507   1.00 0.00 ? 95  ILE A HD13 3  
ATOM 5023  N N    . LEU A 1 96  ? 2.572   3.820   0.335   1.00 0.00 ? 96  LEU A N    3  
ATOM 5024  C CA   . LEU A 1 96  ? 3.267   2.731   -0.406  1.00 0.00 ? 96  LEU A CA   3  
ATOM 5025  C C    . LEU A 1 96  ? 2.255   1.635   -0.739  1.00 0.00 ? 96  LEU A C    3  
ATOM 5026  O O    . LEU A 1 96  ? 1.517   1.188   0.112   1.00 0.00 ? 96  LEU A O    3  
ATOM 5027  C CB   . LEU A 1 96  ? 4.388   2.135   0.460   1.00 0.00 ? 96  LEU A CB   3  
ATOM 5028  C CG   . LEU A 1 96  ? 5.240   3.235   1.124   1.00 0.00 ? 96  LEU A CG   3  
ATOM 5029  C CD1  . LEU A 1 96  ? 5.119   4.569   0.375   1.00 0.00 ? 96  LEU A CD1  3  
ATOM 5030  C CD2  . LEU A 1 96  ? 4.781   3.416   2.573   1.00 0.00 ? 96  LEU A CD2  3  
ATOM 5031  H H    . LEU A 1 96  ? 2.574   3.826   1.314   1.00 0.00 ? 96  LEU A H    3  
ATOM 5032  H HA   . LEU A 1 96  ? 3.686   3.125   -1.320  1.00 0.00 ? 96  LEU A HA   3  
ATOM 5033  H HB2  . LEU A 1 96  ? 3.948   1.520   1.231   1.00 0.00 ? 96  LEU A HB2  3  
ATOM 5034  H HB3  . LEU A 1 96  ? 5.023   1.521   -0.159  1.00 0.00 ? 96  LEU A HB3  3  
ATOM 5035  H HG   . LEU A 1 96  ? 6.276   2.925   1.120   1.00 0.00 ? 96  LEU A HG   3  
ATOM 5036  H HD11 . LEU A 1 96  ? 4.958   4.380   -0.676  1.00 0.00 ? 96  LEU A HD11 3  
ATOM 5037  H HD12 . LEU A 1 96  ? 4.287   5.132   0.772   1.00 0.00 ? 96  LEU A HD12 3  
ATOM 5038  H HD13 . LEU A 1 96  ? 6.029   5.137   0.503   1.00 0.00 ? 96  LEU A HD13 3  
ATOM 5039  H HD21 . LEU A 1 96  ? 4.566   2.450   3.006   1.00 0.00 ? 96  LEU A HD21 3  
ATOM 5040  H HD22 . LEU A 1 96  ? 5.563   3.898   3.141   1.00 0.00 ? 96  LEU A HD22 3  
ATOM 5041  H HD23 . LEU A 1 96  ? 3.891   4.028   2.596   1.00 0.00 ? 96  LEU A HD23 3  
ATOM 5042  N N    . VAL A 1 97  ? 2.211   1.201   -1.966  1.00 0.00 ? 97  VAL A N    3  
ATOM 5043  C CA   . VAL A 1 97  ? 1.238   0.136   -2.340  1.00 0.00 ? 97  VAL A CA   3  
ATOM 5044  C C    . VAL A 1 97  ? 1.991   -1.065  -2.912  1.00 0.00 ? 97  VAL A C    3  
ATOM 5045  O O    . VAL A 1 97  ? 1.894   -1.368  -4.083  1.00 0.00 ? 97  VAL A O    3  
ATOM 5046  C CB   . VAL A 1 97  ? 0.269   0.679   -3.390  1.00 0.00 ? 97  VAL A CB   3  
ATOM 5047  C CG1  . VAL A 1 97  ? -0.523  -0.474  -4.011  1.00 0.00 ? 97  VAL A CG1  3  
ATOM 5048  C CG2  . VAL A 1 97  ? -0.698  1.660   -2.728  1.00 0.00 ? 97  VAL A CG2  3  
ATOM 5049  H H    . VAL A 1 97  ? 2.814   1.574   -2.642  1.00 0.00 ? 97  VAL A H    3  
ATOM 5050  H HA   . VAL A 1 97  ? 0.685   -0.171  -1.464  1.00 0.00 ? 97  VAL A HA   3  
ATOM 5051  H HB   . VAL A 1 97  ? 0.826   1.186   -4.162  1.00 0.00 ? 97  VAL A HB   3  
ATOM 5052  H HG11 . VAL A 1 97  ? -0.438  -1.349  -3.383  1.00 0.00 ? 97  VAL A HG11 3  
ATOM 5053  H HG12 . VAL A 1 97  ? -1.562  -0.191  -4.097  1.00 0.00 ? 97  VAL A HG12 3  
ATOM 5054  H HG13 . VAL A 1 97  ? -0.128  -0.695  -4.992  1.00 0.00 ? 97  VAL A HG13 3  
ATOM 5055  H HG21 . VAL A 1 97  ? -1.178  1.183   -1.887  1.00 0.00 ? 97  VAL A HG21 3  
ATOM 5056  H HG22 . VAL A 1 97  ? -0.152  2.527   -2.386  1.00 0.00 ? 97  VAL A HG22 3  
ATOM 5057  H HG23 . VAL A 1 97  ? -1.445  1.964   -3.443  1.00 0.00 ? 97  VAL A HG23 3  
ATOM 5058  N N    . GLY A 1 98  ? 2.740   -1.752  -2.096  1.00 0.00 ? 98  GLY A N    3  
ATOM 5059  C CA   . GLY A 1 98  ? 3.492   -2.933  -2.601  1.00 0.00 ? 98  GLY A CA   3  
ATOM 5060  C C    . GLY A 1 98  ? 2.502   -3.980  -3.114  1.00 0.00 ? 98  GLY A C    3  
ATOM 5061  O O    . GLY A 1 98  ? 1.927   -4.729  -2.349  1.00 0.00 ? 98  GLY A O    3  
ATOM 5062  H H    . GLY A 1 98  ? 2.806   -1.493  -1.154  1.00 0.00 ? 98  GLY A H    3  
ATOM 5063  H HA2  . GLY A 1 98  ? 4.147   -2.627  -3.405  1.00 0.00 ? 98  GLY A HA2  3  
ATOM 5064  H HA3  . GLY A 1 98  ? 4.078   -3.357  -1.800  1.00 0.00 ? 98  GLY A HA3  3  
ATOM 5065  N N    . VAL A 1 99  ? 2.297   -4.043  -4.401  1.00 0.00 ? 99  VAL A N    3  
ATOM 5066  C CA   . VAL A 1 99  ? 1.342   -5.049  -4.950  1.00 0.00 ? 99  VAL A CA   3  
ATOM 5067  C C    . VAL A 1 99  ? 2.136   -6.233  -5.518  1.00 0.00 ? 99  VAL A C    3  
ATOM 5068  O O    . VAL A 1 99  ? 3.035   -6.065  -6.322  1.00 0.00 ? 99  VAL A O    3  
ATOM 5069  C CB   . VAL A 1 99  ? 0.469   -4.423  -6.055  1.00 0.00 ? 99  VAL A CB   3  
ATOM 5070  C CG1  . VAL A 1 99  ? -1.006  -4.623  -5.706  1.00 0.00 ? 99  VAL A CG1  3  
ATOM 5071  C CG2  . VAL A 1 99  ? 0.738   -2.918  -6.176  1.00 0.00 ? 99  VAL A CG2  3  
ATOM 5072  H H    . VAL A 1 99  ? 2.770   -3.432  -5.004  1.00 0.00 ? 99  VAL A H    3  
ATOM 5073  H HA   . VAL A 1 99  ? 0.705   -5.402  -4.152  1.00 0.00 ? 99  VAL A HA   3  
ATOM 5074  H HB   . VAL A 1 99  ? 0.683   -4.906  -6.998  1.00 0.00 ? 99  VAL A HB   3  
ATOM 5075  H HG11 . VAL A 1 99  ? -1.161  -5.633  -5.357  1.00 0.00 ? 99  VAL A HG11 3  
ATOM 5076  H HG12 . VAL A 1 99  ? -1.288  -3.927  -4.930  1.00 0.00 ? 99  VAL A HG12 3  
ATOM 5077  H HG13 . VAL A 1 99  ? -1.611  -4.448  -6.583  1.00 0.00 ? 99  VAL A HG13 3  
ATOM 5078  H HG21 . VAL A 1 99  ? 0.516   -2.435  -5.236  1.00 0.00 ? 99  VAL A HG21 3  
ATOM 5079  H HG22 . VAL A 1 99  ? 1.774   -2.754  -6.430  1.00 0.00 ? 99  VAL A HG22 3  
ATOM 5080  H HG23 . VAL A 1 99  ? 0.110   -2.503  -6.948  1.00 0.00 ? 99  VAL A HG23 3  
ATOM 5081  N N    . TYR A 1 100 ? 1.819   -7.429  -5.093  1.00 0.00 ? 100 TYR A N    3  
ATOM 5082  C CA   . TYR A 1 100 ? 2.559   -8.624  -5.593  1.00 0.00 ? 100 TYR A CA   3  
ATOM 5083  C C    . TYR A 1 100 ? 1.586   -9.791  -5.787  1.00 0.00 ? 100 TYR A C    3  
ATOM 5084  O O    . TYR A 1 100 ? 0.392   -9.650  -5.607  1.00 0.00 ? 100 TYR A O    3  
ATOM 5085  C CB   . TYR A 1 100 ? 3.625   -9.018  -4.570  1.00 0.00 ? 100 TYR A CB   3  
ATOM 5086  C CG   . TYR A 1 100 ? 2.968   -9.291  -3.239  1.00 0.00 ? 100 TYR A CG   3  
ATOM 5087  C CD1  . TYR A 1 100 ? 2.359   -8.246  -2.532  1.00 0.00 ? 100 TYR A CD1  3  
ATOM 5088  C CD2  . TYR A 1 100 ? 2.964   -10.588 -2.714  1.00 0.00 ? 100 TYR A CD2  3  
ATOM 5089  C CE1  . TYR A 1 100 ? 1.744   -8.500  -1.300  1.00 0.00 ? 100 TYR A CE1  3  
ATOM 5090  C CE2  . TYR A 1 100 ? 2.348   -10.842 -1.483  1.00 0.00 ? 100 TYR A CE2  3  
ATOM 5091  C CZ   . TYR A 1 100 ? 1.741   -9.798  -0.775  1.00 0.00 ? 100 TYR A CZ   3  
ATOM 5092  O OH   . TYR A 1 100 ? 1.134   -10.050 0.438   1.00 0.00 ? 100 TYR A OH   3  
ATOM 5093  H H    . TYR A 1 100 ? 1.099   -7.538  -4.437  1.00 0.00 ? 100 TYR A H    3  
ATOM 5094  H HA   . TYR A 1 100 ? 3.033   -8.387  -6.535  1.00 0.00 ? 100 TYR A HA   3  
ATOM 5095  H HB2  . TYR A 1 100 ? 4.140   -9.905  -4.909  1.00 0.00 ? 100 TYR A HB2  3  
ATOM 5096  H HB3  . TYR A 1 100 ? 4.333   -8.210  -4.462  1.00 0.00 ? 100 TYR A HB3  3  
ATOM 5097  H HD1  . TYR A 1 100 ? 2.362   -7.245  -2.937  1.00 0.00 ? 100 TYR A HD1  3  
ATOM 5098  H HD2  . TYR A 1 100 ? 3.434   -11.392 -3.259  1.00 0.00 ? 100 TYR A HD2  3  
ATOM 5099  H HE1  . TYR A 1 100 ? 1.275   -7.695  -0.754  1.00 0.00 ? 100 TYR A HE1  3  
ATOM 5100  H HE2  . TYR A 1 100 ? 2.345   -11.842 -1.076  1.00 0.00 ? 100 TYR A HE2  3  
ATOM 5101  H HH   . TYR A 1 100 ? 0.526   -10.783 0.318   1.00 0.00 ? 100 TYR A HH   3  
ATOM 5102  N N    . ASN A 1 101 ? 2.083   -10.946 -6.157  1.00 0.00 ? 101 ASN A N    3  
ATOM 5103  C CA   . ASN A 1 101 ? 1.179   -12.115 -6.364  1.00 0.00 ? 101 ASN A CA   3  
ATOM 5104  C C    . ASN A 1 101 ? 1.813   -13.388 -5.777  1.00 0.00 ? 101 ASN A C    3  
ATOM 5105  O O    . ASN A 1 101 ? 2.012   -13.490 -4.583  1.00 0.00 ? 101 ASN A O    3  
ATOM 5106  C CB   . ASN A 1 101 ? 0.913   -12.291 -7.863  1.00 0.00 ? 101 ASN A CB   3  
ATOM 5107  C CG   . ASN A 1 101 ? 2.231   -12.198 -8.636  1.00 0.00 ? 101 ASN A CG   3  
ATOM 5108  O OD1  . ASN A 1 101 ? 2.720   -13.185 -9.151  1.00 0.00 ? 101 ASN A OD1  3  
ATOM 5109  N ND2  . ASN A 1 101 ? 2.828   -11.045 -8.744  1.00 0.00 ? 101 ASN A ND2  3  
ATOM 5110  H H    . ASN A 1 101 ? 3.048   -11.041 -6.298  1.00 0.00 ? 101 ASN A H    3  
ATOM 5111  H HA   . ASN A 1 101 ? 0.243   -11.929 -5.862  1.00 0.00 ? 101 ASN A HA   3  
ATOM 5112  H HB2  . ASN A 1 101 ? 0.461   -13.257 -8.037  1.00 0.00 ? 101 ASN A HB2  3  
ATOM 5113  H HB3  . ASN A 1 101 ? 0.243   -11.516 -8.204  1.00 0.00 ? 101 ASN A HB3  3  
ATOM 5114  H HD21 . ASN A 1 101 ? 2.433   -10.247 -8.334  1.00 0.00 ? 101 ASN A HD21 3  
ATOM 5115  H HD22 . ASN A 1 101 ? 3.671   -10.975 -9.238  1.00 0.00 ? 101 ASN A HD22 3  
ATOM 5116  N N    . GLU A 1 102 ? 2.119   -14.365 -6.595  1.00 0.00 ? 102 GLU A N    3  
ATOM 5117  C CA   . GLU A 1 102 ? 2.721   -15.624 -6.062  1.00 0.00 ? 102 GLU A CA   3  
ATOM 5118  C C    . GLU A 1 102 ? 4.236   -15.474 -5.935  1.00 0.00 ? 102 GLU A C    3  
ATOM 5119  O O    . GLU A 1 102 ? 4.813   -15.772 -4.909  1.00 0.00 ? 102 GLU A O    3  
ATOM 5120  C CB   . GLU A 1 102 ? 2.420   -16.784 -7.016  1.00 0.00 ? 102 GLU A CB   3  
ATOM 5121  C CG   . GLU A 1 102 ? 1.015   -16.625 -7.600  1.00 0.00 ? 102 GLU A CG   3  
ATOM 5122  C CD   . GLU A 1 102 ? -0.004  -16.577 -6.463  1.00 0.00 ? 102 GLU A CD   3  
ATOM 5123  O OE1  . GLU A 1 102 ? -0.022  -17.505 -5.671  1.00 0.00 ? 102 GLU A OE1  3  
ATOM 5124  O OE2  . GLU A 1 102 ? -0.747  -15.612 -6.402  1.00 0.00 ? 102 GLU A OE2  3  
ATOM 5125  H H    . GLU A 1 102 ? 1.945   -14.278 -7.551  1.00 0.00 ? 102 GLU A H    3  
ATOM 5126  H HA   . GLU A 1 102 ? 2.298   -15.841 -5.092  1.00 0.00 ? 102 GLU A HA   3  
ATOM 5127  H HB2  . GLU A 1 102 ? 3.145   -16.787 -7.817  1.00 0.00 ? 102 GLU A HB2  3  
ATOM 5128  H HB3  . GLU A 1 102 ? 2.478   -17.717 -6.476  1.00 0.00 ? 102 GLU A HB3  3  
ATOM 5129  H HG2  . GLU A 1 102 ? 0.962   -15.710 -8.172  1.00 0.00 ? 102 GLU A HG2  3  
ATOM 5130  H HG3  . GLU A 1 102 ? 0.795   -17.464 -8.243  1.00 0.00 ? 102 GLU A HG3  3  
ATOM 5131  N N    . LYS A 1 103 ? 4.887   -15.034 -6.978  1.00 0.00 ? 103 LYS A N    3  
ATOM 5132  C CA   . LYS A 1 103 ? 6.370   -14.881 -6.935  1.00 0.00 ? 103 LYS A CA   3  
ATOM 5133  C C    . LYS A 1 103 ? 6.817   -14.343 -5.570  1.00 0.00 ? 103 LYS A C    3  
ATOM 5134  O O    . LYS A 1 103 ? 7.928   -14.584 -5.139  1.00 0.00 ? 103 LYS A O    3  
ATOM 5135  C CB   . LYS A 1 103 ? 6.813   -13.912 -8.033  1.00 0.00 ? 103 LYS A CB   3  
ATOM 5136  C CG   . LYS A 1 103 ? 7.443   -14.699 -9.184  1.00 0.00 ? 103 LYS A CG   3  
ATOM 5137  C CD   . LYS A 1 103 ? 8.866   -15.113 -8.805  1.00 0.00 ? 103 LYS A CD   3  
ATOM 5138  C CE   . LYS A 1 103 ? 9.242   -16.395 -9.552  1.00 0.00 ? 103 LYS A CE   3  
ATOM 5139  N NZ   . LYS A 1 103 ? 8.739   -17.578 -8.797  1.00 0.00 ? 103 LYS A NZ   3  
ATOM 5140  H H    . LYS A 1 103 ? 4.398   -14.816 -7.799  1.00 0.00 ? 103 LYS A H    3  
ATOM 5141  H HA   . LYS A 1 103 ? 6.830   -15.843 -7.105  1.00 0.00 ? 103 LYS A HA   3  
ATOM 5142  H HB2  . LYS A 1 103 ? 5.957   -13.363 -8.396  1.00 0.00 ? 103 LYS A HB2  3  
ATOM 5143  H HB3  . LYS A 1 103 ? 7.541   -13.222 -7.631  1.00 0.00 ? 103 LYS A HB3  3  
ATOM 5144  H HG2  . LYS A 1 103 ? 6.851   -15.581 -9.383  1.00 0.00 ? 103 LYS A HG2  3  
ATOM 5145  H HG3  . LYS A 1 103 ? 7.474   -14.080 -10.068 1.00 0.00 ? 103 LYS A HG3  3  
ATOM 5146  H HD2  . LYS A 1 103 ? 9.554   -14.324 -9.074  1.00 0.00 ? 103 LYS A HD2  3  
ATOM 5147  H HD3  . LYS A 1 103 ? 8.919   -15.290 -7.741  1.00 0.00 ? 103 LYS A HD3  3  
ATOM 5148  H HE2  . LYS A 1 103 ? 8.796   -16.381 -10.536 1.00 0.00 ? 103 LYS A HE2  3  
ATOM 5149  H HE3  . LYS A 1 103 ? 10.316  -16.457 -9.644  1.00 0.00 ? 103 LYS A HE3  3  
ATOM 5150  H HZ1  . LYS A 1 103 ? 8.794   -17.389 -7.778  1.00 0.00 ? 103 LYS A HZ1  3  
ATOM 5151  H HZ2  . LYS A 1 103 ? 7.750   -17.764 -9.065  1.00 0.00 ? 103 LYS A HZ2  3  
ATOM 5152  H HZ3  . LYS A 1 103 ? 9.322   -18.408 -9.025  1.00 0.00 ? 103 LYS A HZ3  3  
ATOM 5153  N N    . ILE A 1 104 ? 5.976   -13.615 -4.887  1.00 0.00 ? 104 ILE A N    3  
ATOM 5154  C CA   . ILE A 1 104 ? 6.386   -13.069 -3.561  1.00 0.00 ? 104 ILE A CA   3  
ATOM 5155  C C    . ILE A 1 104 ? 5.345   -13.427 -2.497  1.00 0.00 ? 104 ILE A C    3  
ATOM 5156  O O    . ILE A 1 104 ? 4.165   -13.511 -2.768  1.00 0.00 ? 104 ILE A O    3  
ATOM 5157  C CB   . ILE A 1 104 ? 6.505   -11.549 -3.652  1.00 0.00 ? 104 ILE A CB   3  
ATOM 5158  C CG1  . ILE A 1 104 ? 7.602   -11.183 -4.653  1.00 0.00 ? 104 ILE A CG1  3  
ATOM 5159  C CG2  . ILE A 1 104 ? 6.857   -10.977 -2.277  1.00 0.00 ? 104 ILE A CG2  3  
ATOM 5160  C CD1  . ILE A 1 104 ? 7.212   -9.899  -5.385  1.00 0.00 ? 104 ILE A CD1  3  
ATOM 5161  H H    . ILE A 1 104 ? 5.086   -13.420 -5.247  1.00 0.00 ? 104 ILE A H    3  
ATOM 5162  H HA   . ILE A 1 104 ? 7.342   -13.486 -3.282  1.00 0.00 ? 104 ILE A HA   3  
ATOM 5163  H HB   . ILE A 1 104 ? 5.563   -11.134 -3.982  1.00 0.00 ? 104 ILE A HB   3  
ATOM 5164  H HG12 . ILE A 1 104 ? 8.533   -11.031 -4.127  1.00 0.00 ? 104 ILE A HG12 3  
ATOM 5165  H HG13 . ILE A 1 104 ? 7.718   -11.982 -5.369  1.00 0.00 ? 104 ILE A HG13 3  
ATOM 5166  H HG21 . ILE A 1 104 ? 7.107   -11.784 -1.605  1.00 0.00 ? 104 ILE A HG21 3  
ATOM 5167  H HG22 . ILE A 1 104 ? 7.701   -10.310 -2.368  1.00 0.00 ? 104 ILE A HG22 3  
ATOM 5168  H HG23 . ILE A 1 104 ? 6.010   -10.432 -1.886  1.00 0.00 ? 104 ILE A HG23 3  
ATOM 5169  H HD11 . ILE A 1 104 ? 6.158   -9.710  -5.240  1.00 0.00 ? 104 ILE A HD11 3  
ATOM 5170  H HD12 . ILE A 1 104 ? 7.783   -9.071  -4.990  1.00 0.00 ? 104 ILE A HD12 3  
ATOM 5171  H HD13 . ILE A 1 104 ? 7.418   -10.009 -6.439  1.00 0.00 ? 104 ILE A HD13 3  
ATOM 5172  N N    . GLN A 1 105 ? 5.780   -13.625 -1.282  1.00 0.00 ? 105 GLN A N    3  
ATOM 5173  C CA   . GLN A 1 105 ? 4.827   -13.963 -0.188  1.00 0.00 ? 105 GLN A CA   3  
ATOM 5174  C C    . GLN A 1 105 ? 5.048   -12.995 0.978   1.00 0.00 ? 105 GLN A C    3  
ATOM 5175  O O    . GLN A 1 105 ? 6.135   -12.481 1.152   1.00 0.00 ? 105 GLN A O    3  
ATOM 5176  C CB   . GLN A 1 105 ? 5.075   -15.398 0.282   1.00 0.00 ? 105 GLN A CB   3  
ATOM 5177  C CG   . GLN A 1 105 ? 5.080   -16.339 -0.926  1.00 0.00 ? 105 GLN A CG   3  
ATOM 5178  C CD   . GLN A 1 105 ? 5.200   -17.785 -0.445  1.00 0.00 ? 105 GLN A CD   3  
ATOM 5179  O OE1  . GLN A 1 105 ? 5.657   -18.037 0.653   1.00 0.00 ? 105 GLN A OE1  3  
ATOM 5180  N NE2  . GLN A 1 105 ? 4.808   -18.755 -1.224  1.00 0.00 ? 105 GLN A NE2  3  
ATOM 5181  H H    . GLN A 1 105 ? 6.737   -13.543 -1.087  1.00 0.00 ? 105 GLN A H    3  
ATOM 5182  H HA   . GLN A 1 105 ? 3.814   -13.869 -0.550  1.00 0.00 ? 105 GLN A HA   3  
ATOM 5183  H HB2  . GLN A 1 105 ? 6.029   -15.452 0.784   1.00 0.00 ? 105 GLN A HB2  3  
ATOM 5184  H HB3  . GLN A 1 105 ? 4.292   -15.695 0.963   1.00 0.00 ? 105 GLN A HB3  3  
ATOM 5185  H HG2  . GLN A 1 105 ? 4.160   -16.218 -1.480  1.00 0.00 ? 105 GLN A HG2  3  
ATOM 5186  H HG3  . GLN A 1 105 ? 5.918   -16.101 -1.563  1.00 0.00 ? 105 GLN A HG3  3  
ATOM 5187  H HE21 . GLN A 1 105 ? 4.438   -18.554 -2.109  1.00 0.00 ? 105 GLN A HE21 3  
ATOM 5188  H HE22 . GLN A 1 105 ? 4.887   -19.686 -0.927  1.00 0.00 ? 105 GLN A HE22 3  
ATOM 5189  N N    . PRO A 1 106 ? 4.010   -12.771 1.742   1.00 0.00 ? 106 PRO A N    3  
ATOM 5190  C CA   . PRO A 1 106 ? 4.074   -11.860 2.899   1.00 0.00 ? 106 PRO A CA   3  
ATOM 5191  C C    . PRO A 1 106 ? 5.131   -12.343 3.897   1.00 0.00 ? 106 PRO A C    3  
ATOM 5192  O O    . PRO A 1 106 ? 5.699   -13.405 3.746   1.00 0.00 ? 106 PRO A O    3  
ATOM 5193  C CB   . PRO A 1 106 ? 2.672   -11.915 3.520   1.00 0.00 ? 106 PRO A CB   3  
ATOM 5194  C CG   . PRO A 1 106 ? 1.819   -12.895 2.673   1.00 0.00 ? 106 PRO A CG   3  
ATOM 5195  C CD   . PRO A 1 106 ? 2.699   -13.405 1.520   1.00 0.00 ? 106 PRO A CD   3  
ATOM 5196  H HA   . PRO A 1 106 ? 4.291   -10.855 2.576   1.00 0.00 ? 106 PRO A HA   3  
ATOM 5197  H HB2  . PRO A 1 106 ? 2.736   -12.267 4.541   1.00 0.00 ? 106 PRO A HB2  3  
ATOM 5198  H HB3  . PRO A 1 106 ? 2.222   -10.935 3.498   1.00 0.00 ? 106 PRO A HB3  3  
ATOM 5199  H HG2  . PRO A 1 106 ? 1.499   -13.726 3.287   1.00 0.00 ? 106 PRO A HG2  3  
ATOM 5200  H HG3  . PRO A 1 106 ? 0.958   -12.383 2.273   1.00 0.00 ? 106 PRO A HG3  3  
ATOM 5201  H HD2  . PRO A 1 106 ? 2.785   -14.481 1.560   1.00 0.00 ? 106 PRO A HD2  3  
ATOM 5202  H HD3  . PRO A 1 106 ? 2.292   -13.091 0.569   1.00 0.00 ? 106 PRO A HD3  3  
ATOM 5203  N N    . GLY A 1 107 ? 5.402   -11.566 4.911   1.00 0.00 ? 107 GLY A N    3  
ATOM 5204  C CA   . GLY A 1 107 ? 6.425   -11.978 5.912   1.00 0.00 ? 107 GLY A CA   3  
ATOM 5205  C C    . GLY A 1 107 ? 7.750   -11.283 5.595   1.00 0.00 ? 107 GLY A C    3  
ATOM 5206  O O    . GLY A 1 107 ? 8.358   -10.664 6.444   1.00 0.00 ? 107 GLY A O    3  
ATOM 5207  H H    . GLY A 1 107 ? 4.934   -10.710 5.011   1.00 0.00 ? 107 GLY A H    3  
ATOM 5208  H HA2  . GLY A 1 107 ? 6.096   -11.696 6.902   1.00 0.00 ? 107 GLY A HA2  3  
ATOM 5209  H HA3  . GLY A 1 107 ? 6.564   -13.049 5.868   1.00 0.00 ? 107 GLY A HA3  3  
ATOM 5210  N N    . THR A 1 108 ? 8.197   -11.378 4.373   1.00 0.00 ? 108 THR A N    3  
ATOM 5211  C CA   . THR A 1 108 ? 9.478   -10.720 3.991   1.00 0.00 ? 108 THR A CA   3  
ATOM 5212  C C    . THR A 1 108 ? 9.172   -9.337  3.410   1.00 0.00 ? 108 THR A C    3  
ATOM 5213  O O    . THR A 1 108 ? 9.929   -8.400  3.575   1.00 0.00 ? 108 THR A O    3  
ATOM 5214  C CB   . THR A 1 108 ? 10.195  -11.580 2.941   1.00 0.00 ? 108 THR A CB   3  
ATOM 5215  O OG1  . THR A 1 108 ? 10.829  -12.674 3.585   1.00 0.00 ? 108 THR A OG1  3  
ATOM 5216  C CG2  . THR A 1 108 ? 11.246  -10.743 2.204   1.00 0.00 ? 108 THR A CG2  3  
ATOM 5217  H H    . THR A 1 108 ? 7.687   -11.879 3.703   1.00 0.00 ? 108 THR A H    3  
ATOM 5218  H HA   . THR A 1 108 ? 10.106  -10.616 4.864   1.00 0.00 ? 108 THR A HA   3  
ATOM 5219  H HB   . THR A 1 108 ? 9.473   -11.951 2.229   1.00 0.00 ? 108 THR A HB   3  
ATOM 5220  H HG1  . THR A 1 108 ? 10.698  -13.456 3.043   1.00 0.00 ? 108 THR A HG1  3  
ATOM 5221  H HG21 . THR A 1 108 ? 11.531  -9.901  2.817   1.00 0.00 ? 108 THR A HG21 3  
ATOM 5222  H HG22 . THR A 1 108 ? 12.113  -11.353 2.002   1.00 0.00 ? 108 THR A HG22 3  
ATOM 5223  H HG23 . THR A 1 108 ? 10.831  -10.386 1.273   1.00 0.00 ? 108 THR A HG23 3  
ATOM 5224  N N    . ALA A 1 109 ? 8.067   -9.205  2.731   1.00 0.00 ? 109 ALA A N    3  
ATOM 5225  C CA   . ALA A 1 109 ? 7.709   -7.887  2.137   1.00 0.00 ? 109 ALA A CA   3  
ATOM 5226  C C    . ALA A 1 109 ? 7.085   -6.994  3.210   1.00 0.00 ? 109 ALA A C    3  
ATOM 5227  O O    . ALA A 1 109 ? 7.272   -5.793  3.217   1.00 0.00 ? 109 ALA A O    3  
ATOM 5228  C CB   . ALA A 1 109 ? 6.702   -8.101  1.005   1.00 0.00 ? 109 ALA A CB   3  
ATOM 5229  H H    . ALA A 1 109 ? 7.473   -9.974  2.611   1.00 0.00 ? 109 ALA A H    3  
ATOM 5230  H HA   . ALA A 1 109 ? 8.597   -7.414  1.745   1.00 0.00 ? 109 ALA A HA   3  
ATOM 5231  H HB1  . ALA A 1 109 ? 5.932   -8.782  1.331   1.00 0.00 ? 109 ALA A HB1  3  
ATOM 5232  H HB2  . ALA A 1 109 ? 6.256   -7.154  0.737   1.00 0.00 ? 109 ALA A HB2  3  
ATOM 5233  H HB3  . ALA A 1 109 ? 7.210   -8.515  0.146   1.00 0.00 ? 109 ALA A HB3  3  
ATOM 5234  N N    . ALA A 1 110 ? 6.340   -7.568  4.116   1.00 0.00 ? 110 ALA A N    3  
ATOM 5235  C CA   . ALA A 1 110 ? 5.702   -6.749  5.185   1.00 0.00 ? 110 ALA A CA   3  
ATOM 5236  C C    . ALA A 1 110 ? 6.744   -6.395  6.249   1.00 0.00 ? 110 ALA A C    3  
ATOM 5237  O O    . ALA A 1 110 ? 6.525   -5.543  7.088   1.00 0.00 ? 110 ALA A O    3  
ATOM 5238  C CB   . ALA A 1 110 ? 4.566   -7.546  5.829   1.00 0.00 ? 110 ALA A CB   3  
ATOM 5239  H H    . ALA A 1 110 ? 6.199   -8.537  4.092   1.00 0.00 ? 110 ALA A H    3  
ATOM 5240  H HA   . ALA A 1 110 ? 5.306   -5.841  4.754   1.00 0.00 ? 110 ALA A HA   3  
ATOM 5241  H HB1  . ALA A 1 110 ? 4.700   -8.597  5.619   1.00 0.00 ? 110 ALA A HB1  3  
ATOM 5242  H HB2  . ALA A 1 110 ? 4.574   -7.388  6.897   1.00 0.00 ? 110 ALA A HB2  3  
ATOM 5243  H HB3  . ALA A 1 110 ? 3.620   -7.216  5.424   1.00 0.00 ? 110 ALA A HB3  3  
ATOM 5244  N N    . ASN A 1 111 ? 7.875   -7.043  6.223   1.00 0.00 ? 111 ASN A N    3  
ATOM 5245  C CA   . ASN A 1 111 ? 8.929   -6.747  7.234   1.00 0.00 ? 111 ASN A CA   3  
ATOM 5246  C C    . ASN A 1 111 ? 9.823   -5.612  6.732   1.00 0.00 ? 111 ASN A C    3  
ATOM 5247  O O    . ASN A 1 111 ? 10.183  -4.720  7.474   1.00 0.00 ? 111 ASN A O    3  
ATOM 5248  C CB   . ASN A 1 111 ? 9.777   -7.998  7.462   1.00 0.00 ? 111 ASN A CB   3  
ATOM 5249  C CG   . ASN A 1 111 ? 9.724   -8.391  8.939   1.00 0.00 ? 111 ASN A CG   3  
ATOM 5250  O OD1  . ASN A 1 111 ? 8.674   -8.721  9.454   1.00 0.00 ? 111 ASN A OD1  3  
ATOM 5251  N ND2  . ASN A 1 111 ? 10.819  -8.369  9.647   1.00 0.00 ? 111 ASN A ND2  3  
ATOM 5252  H H    . ASN A 1 111 ? 8.032   -7.726  5.538   1.00 0.00 ? 111 ASN A H    3  
ATOM 5253  H HA   . ASN A 1 111 ? 8.463   -6.455  8.163   1.00 0.00 ? 111 ASN A HA   3  
ATOM 5254  H HB2  . ASN A 1 111 ? 9.392   -8.807  6.859   1.00 0.00 ? 111 ASN A HB2  3  
ATOM 5255  H HB3  . ASN A 1 111 ? 10.800  -7.794  7.183   1.00 0.00 ? 111 ASN A HB3  3  
ATOM 5256  H HD21 . ASN A 1 111 ? 11.665  -8.101  9.232   1.00 0.00 ? 111 ASN A HD21 3  
ATOM 5257  H HD22 . ASN A 1 111 ? 10.795  -8.620  10.594  1.00 0.00 ? 111 ASN A HD22 3  
ATOM 5258  N N    . VAL A 1 112 ? 10.187  -5.642  5.480   1.00 0.00 ? 112 VAL A N    3  
ATOM 5259  C CA   . VAL A 1 112 ? 11.062  -4.568  4.933   1.00 0.00 ? 112 VAL A CA   3  
ATOM 5260  C C    . VAL A 1 112 ? 10.272  -3.260  4.837   1.00 0.00 ? 112 VAL A C    3  
ATOM 5261  O O    . VAL A 1 112 ? 10.828  -2.181  4.913   1.00 0.00 ? 112 VAL A O    3  
ATOM 5262  C CB   . VAL A 1 112 ? 11.553  -4.974  3.542   1.00 0.00 ? 112 VAL A CB   3  
ATOM 5263  C CG1  . VAL A 1 112 ? 10.409  -4.852  2.535   1.00 0.00 ? 112 VAL A CG1  3  
ATOM 5264  C CG2  . VAL A 1 112 ? 12.704  -4.057  3.121   1.00 0.00 ? 112 VAL A CG2  3  
ATOM 5265  H H    . VAL A 1 112 ? 9.888   -6.373  4.901   1.00 0.00 ? 112 VAL A H    3  
ATOM 5266  H HA   . VAL A 1 112 ? 11.911  -4.428  5.586   1.00 0.00 ? 112 VAL A HA   3  
ATOM 5267  H HB   . VAL A 1 112 ? 11.899  -5.998  3.568   1.00 0.00 ? 112 VAL A HB   3  
ATOM 5268  H HG11 . VAL A 1 112 ? 9.538   -5.363  2.918   1.00 0.00 ? 112 VAL A HG11 3  
ATOM 5269  H HG12 . VAL A 1 112 ? 10.175  -3.808  2.382   1.00 0.00 ? 112 VAL A HG12 3  
ATOM 5270  H HG13 . VAL A 1 112 ? 10.704  -5.295  1.597   1.00 0.00 ? 112 VAL A HG13 3  
ATOM 5271  H HG21 . VAL A 1 112 ? 12.956  -3.397  3.939   1.00 0.00 ? 112 VAL A HG21 3  
ATOM 5272  H HG22 . VAL A 1 112 ? 13.565  -4.656  2.865   1.00 0.00 ? 112 VAL A HG22 3  
ATOM 5273  H HG23 . VAL A 1 112 ? 12.405  -3.473  2.264   1.00 0.00 ? 112 VAL A HG23 3  
ATOM 5274  N N    . VAL A 1 113 ? 8.982   -3.344  4.669   1.00 0.00 ? 113 VAL A N    3  
ATOM 5275  C CA   . VAL A 1 113 ? 8.161   -2.105  4.568   1.00 0.00 ? 113 VAL A CA   3  
ATOM 5276  C C    . VAL A 1 113 ? 7.820   -1.602  5.973   1.00 0.00 ? 113 VAL A C    3  
ATOM 5277  O O    . VAL A 1 113 ? 7.486   -0.449  6.165   1.00 0.00 ? 113 VAL A O    3  
ATOM 5278  C CB   . VAL A 1 113 ? 6.868   -2.409  3.807   1.00 0.00 ? 113 VAL A CB   3  
ATOM 5279  C CG1  . VAL A 1 113 ? 6.019   -1.140  3.719   1.00 0.00 ? 113 VAL A CG1  3  
ATOM 5280  C CG2  . VAL A 1 113 ? 7.208   -2.891  2.394   1.00 0.00 ? 113 VAL A CG2  3  
ATOM 5281  H H    . VAL A 1 113 ? 8.552   -4.223  4.609   1.00 0.00 ? 113 VAL A H    3  
ATOM 5282  H HA   . VAL A 1 113 ? 8.719   -1.346  4.040   1.00 0.00 ? 113 VAL A HA   3  
ATOM 5283  H HB   . VAL A 1 113 ? 6.315   -3.175  4.328   1.00 0.00 ? 113 VAL A HB   3  
ATOM 5284  H HG11 . VAL A 1 113 ? 6.464   -0.366  4.326   1.00 0.00 ? 113 VAL A HG11 3  
ATOM 5285  H HG12 . VAL A 1 113 ? 5.972   -0.808  2.691   1.00 0.00 ? 113 VAL A HG12 3  
ATOM 5286  H HG13 . VAL A 1 113 ? 5.022   -1.348  4.075   1.00 0.00 ? 113 VAL A HG13 3  
ATOM 5287  H HG21 . VAL A 1 113 ? 8.273   -2.824  2.237   1.00 0.00 ? 113 VAL A HG21 3  
ATOM 5288  H HG22 . VAL A 1 113 ? 6.889   -3.917  2.276   1.00 0.00 ? 113 VAL A HG22 3  
ATOM 5289  H HG23 . VAL A 1 113 ? 6.698   -2.271  1.671   1.00 0.00 ? 113 VAL A HG23 3  
ATOM 5290  N N    . GLU A 1 114 ? 7.895   -2.457  6.956   1.00 0.00 ? 114 GLU A N    3  
ATOM 5291  C CA   . GLU A 1 114 ? 7.567   -2.029  8.346   1.00 0.00 ? 114 GLU A CA   3  
ATOM 5292  C C    . GLU A 1 114 ? 8.704   -1.172  8.909   1.00 0.00 ? 114 GLU A C    3  
ATOM 5293  O O    . GLU A 1 114 ? 8.475   -0.218  9.625   1.00 0.00 ? 114 GLU A O    3  
ATOM 5294  C CB   . GLU A 1 114 ? 7.377   -3.265  9.226   1.00 0.00 ? 114 GLU A CB   3  
ATOM 5295  C CG   . GLU A 1 114 ? 5.928   -3.329  9.712   1.00 0.00 ? 114 GLU A CG   3  
ATOM 5296  C CD   . GLU A 1 114 ? 5.858   -4.139  11.009  1.00 0.00 ? 114 GLU A CD   3  
ATOM 5297  O OE1  . GLU A 1 114 ? 6.863   -4.206  11.697  1.00 0.00 ? 114 GLU A OE1  3  
ATOM 5298  O OE2  . GLU A 1 114 ? 4.801   -4.676  11.290  1.00 0.00 ? 114 GLU A OE2  3  
ATOM 5299  H H    . GLU A 1 114 ? 8.160   -3.385  6.779   1.00 0.00 ? 114 GLU A H    3  
ATOM 5300  H HA   . GLU A 1 114 ? 6.654   -1.452  8.338   1.00 0.00 ? 114 GLU A HA   3  
ATOM 5301  H HB2  . GLU A 1 114 ? 7.605   -4.153  8.653   1.00 0.00 ? 114 GLU A HB2  3  
ATOM 5302  H HB3  . GLU A 1 114 ? 8.039   -3.207  10.078  1.00 0.00 ? 114 GLU A HB3  3  
ATOM 5303  H HG2  . GLU A 1 114 ? 5.565   -2.328  9.891   1.00 0.00 ? 114 GLU A HG2  3  
ATOM 5304  H HG3  . GLU A 1 114 ? 5.318   -3.806  8.960   1.00 0.00 ? 114 GLU A HG3  3  
ATOM 5305  N N    . LYS A 1 115 ? 9.927   -1.505  8.598   1.00 0.00 ? 115 LYS A N    3  
ATOM 5306  C CA   . LYS A 1 115 ? 11.070  -0.707  9.126   1.00 0.00 ? 115 LYS A CA   3  
ATOM 5307  C C    . LYS A 1 115 ? 11.198  0.597   8.334   1.00 0.00 ? 115 LYS A C    3  
ATOM 5308  O O    . LYS A 1 115 ? 11.416  1.654   8.894   1.00 0.00 ? 115 LYS A O    3  
ATOM 5309  C CB   . LYS A 1 115 ? 12.362  -1.517  8.993   1.00 0.00 ? 115 LYS A CB   3  
ATOM 5310  C CG   . LYS A 1 115 ? 12.577  -1.905  7.530   1.00 0.00 ? 115 LYS A CG   3  
ATOM 5311  C CD   . LYS A 1 115 ? 13.892  -2.674  7.396   1.00 0.00 ? 115 LYS A CD   3  
ATOM 5312  C CE   . LYS A 1 115 ? 15.038  -1.829  7.957   1.00 0.00 ? 115 LYS A CE   3  
ATOM 5313  N NZ   . LYS A 1 115 ? 15.352  -2.274  9.343   1.00 0.00 ? 115 LYS A NZ   3  
ATOM 5314  H H    . LYS A 1 115 ? 10.093  -2.280  8.023   1.00 0.00 ? 115 LYS A H    3  
ATOM 5315  H HA   . LYS A 1 115 ? 10.896  -0.478  10.166  1.00 0.00 ? 115 LYS A HA   3  
ATOM 5316  H HB2  . LYS A 1 115 ? 13.196  -0.920  9.334   1.00 0.00 ? 115 LYS A HB2  3  
ATOM 5317  H HB3  . LYS A 1 115 ? 12.290  -2.411  9.593   1.00 0.00 ? 115 LYS A HB3  3  
ATOM 5318  H HG2  . LYS A 1 115 ? 11.758  -2.527  7.199   1.00 0.00 ? 115 LYS A HG2  3  
ATOM 5319  H HG3  . LYS A 1 115 ? 12.621  -1.013  6.924   1.00 0.00 ? 115 LYS A HG3  3  
ATOM 5320  H HD2  . LYS A 1 115 ? 13.824  -3.601  7.947   1.00 0.00 ? 115 LYS A HD2  3  
ATOM 5321  H HD3  . LYS A 1 115 ? 14.081  -2.888  6.355   1.00 0.00 ? 115 LYS A HD3  3  
ATOM 5322  H HE2  . LYS A 1 115 ? 15.911  -1.946  7.333   1.00 0.00 ? 115 LYS A HE2  3  
ATOM 5323  H HE3  . LYS A 1 115 ? 14.743  -0.789  7.971   1.00 0.00 ? 115 LYS A HE3  3  
ATOM 5324  H HZ1  . LYS A 1 115 ? 14.510  -2.165  9.943   1.00 0.00 ? 115 LYS A HZ1  3  
ATOM 5325  H HZ2  . LYS A 1 115 ? 15.639  -3.273  9.330   1.00 0.00 ? 115 LYS A HZ2  3  
ATOM 5326  H HZ3  . LYS A 1 115 ? 16.129  -1.695  9.725   1.00 0.00 ? 115 LYS A HZ3  3  
ATOM 5327  N N    . LEU A 1 116 ? 11.066  0.537   7.035   1.00 0.00 ? 116 LEU A N    3  
ATOM 5328  C CA   . LEU A 1 116 ? 11.183  1.778   6.218   1.00 0.00 ? 116 LEU A CA   3  
ATOM 5329  C C    . LEU A 1 116 ? 10.244  2.848   6.779   1.00 0.00 ? 116 LEU A C    3  
ATOM 5330  O O    . LEU A 1 116 ? 10.666  3.930   7.137   1.00 0.00 ? 116 LEU A O    3  
ATOM 5331  C CB   . LEU A 1 116 ? 10.805  1.475   4.767   1.00 0.00 ? 116 LEU A CB   3  
ATOM 5332  C CG   . LEU A 1 116 ? 11.956  0.733   4.081   1.00 0.00 ? 116 LEU A CG   3  
ATOM 5333  C CD1  . LEU A 1 116 ? 11.425  -0.007  2.852   1.00 0.00 ? 116 LEU A CD1  3  
ATOM 5334  C CD2  . LEU A 1 116 ? 13.023  1.739   3.645   1.00 0.00 ? 116 LEU A CD2  3  
ATOM 5335  H H    . LEU A 1 116 ? 10.890  -0.324  6.600   1.00 0.00 ? 116 LEU A H    3  
ATOM 5336  H HA   . LEU A 1 116 ? 12.200  2.139   6.257   1.00 0.00 ? 116 LEU A HA   3  
ATOM 5337  H HB2  . LEU A 1 116 ? 9.918   0.859   4.747   1.00 0.00 ? 116 LEU A HB2  3  
ATOM 5338  H HB3  . LEU A 1 116 ? 10.614  2.400   4.243   1.00 0.00 ? 116 LEU A HB3  3  
ATOM 5339  H HG   . LEU A 1 116 ? 12.387  0.022   4.772   1.00 0.00 ? 116 LEU A HG   3  
ATOM 5340  H HD11 . LEU A 1 116 ? 10.345  0.014   2.858   1.00 0.00 ? 116 LEU A HD11 3  
ATOM 5341  H HD12 . LEU A 1 116 ? 11.789  0.474   1.956   1.00 0.00 ? 116 LEU A HD12 3  
ATOM 5342  H HD13 . LEU A 1 116 ? 11.765  -1.033  2.874   1.00 0.00 ? 116 LEU A HD13 3  
ATOM 5343  H HD21 . LEU A 1 116 ? 12.553  2.680   3.401   1.00 0.00 ? 116 LEU A HD21 3  
ATOM 5344  H HD22 . LEU A 1 116 ? 13.729  1.887   4.450   1.00 0.00 ? 116 LEU A HD22 3  
ATOM 5345  H HD23 . LEU A 1 116 ? 13.542  1.360   2.776   1.00 0.00 ? 116 LEU A HD23 3  
ATOM 5346  N N    . ALA A 1 117 ? 8.974   2.557   6.864   1.00 0.00 ? 117 ALA A N    3  
ATOM 5347  C CA   . ALA A 1 117 ? 8.027   3.566   7.409   1.00 0.00 ? 117 ALA A CA   3  
ATOM 5348  C C    . ALA A 1 117 ? 8.367   3.830   8.875   1.00 0.00 ? 117 ALA A C    3  
ATOM 5349  O O    . ALA A 1 117 ? 8.155   4.908   9.380   1.00 0.00 ? 117 ALA A O    3  
ATOM 5350  C CB   . ALA A 1 117 ? 6.592   3.048   7.310   1.00 0.00 ? 117 ALA A CB   3  
ATOM 5351  H H    . ALA A 1 117 ? 8.648   1.679   6.574   1.00 0.00 ? 117 ALA A H    3  
ATOM 5352  H HA   . ALA A 1 117 ? 8.118   4.484   6.848   1.00 0.00 ? 117 ALA A HA   3  
ATOM 5353  H HB1  . ALA A 1 117 ? 6.506   2.119   7.852   1.00 0.00 ? 117 ALA A HB1  3  
ATOM 5354  H HB2  . ALA A 1 117 ? 5.918   3.778   7.737   1.00 0.00 ? 117 ALA A HB2  3  
ATOM 5355  H HB3  . ALA A 1 117 ? 6.337   2.887   6.273   1.00 0.00 ? 117 ALA A HB3  3  
ATOM 5356  N N    . ASP A 1 118 ? 8.897   2.856   9.562   1.00 0.00 ? 118 ASP A N    3  
ATOM 5357  C CA   . ASP A 1 118 ? 9.250   3.069   10.994  1.00 0.00 ? 118 ASP A CA   3  
ATOM 5358  C C    . ASP A 1 118 ? 10.149  4.301   11.112  1.00 0.00 ? 118 ASP A C    3  
ATOM 5359  O O    . ASP A 1 118 ? 10.251  4.913   12.157  1.00 0.00 ? 118 ASP A O    3  
ATOM 5360  C CB   . ASP A 1 118 ? 9.992   1.839   11.524  1.00 0.00 ? 118 ASP A CB   3  
ATOM 5361  C CG   . ASP A 1 118 ? 9.026   0.967   12.329  1.00 0.00 ? 118 ASP A CG   3  
ATOM 5362  O OD1  . ASP A 1 118 ? 8.326   1.511   13.167  1.00 0.00 ? 118 ASP A OD1  3  
ATOM 5363  O OD2  . ASP A 1 118 ? 9.000   -0.229  12.091  1.00 0.00 ? 118 ASP A OD2  3  
ATOM 5364  H H    . ASP A 1 118 ? 9.066   1.990   9.137   1.00 0.00 ? 118 ASP A H    3  
ATOM 5365  H HA   . ASP A 1 118 ? 8.348   3.223   11.569  1.00 0.00 ? 118 ASP A HA   3  
ATOM 5366  H HB2  . ASP A 1 118 ? 10.385  1.270   10.694  1.00 0.00 ? 118 ASP A HB2  3  
ATOM 5367  H HB3  . ASP A 1 118 ? 10.804  2.154   12.163  1.00 0.00 ? 118 ASP A HB3  3  
ATOM 5368  N N    . TYR A 1 119 ? 10.800  4.668   10.043  1.00 0.00 ? 119 TYR A N    3  
ATOM 5369  C CA   . TYR A 1 119 ? 11.697  5.858   10.080  1.00 0.00 ? 119 TYR A CA   3  
ATOM 5370  C C    . TYR A 1 119 ? 10.910  7.114   9.695   1.00 0.00 ? 119 TYR A C    3  
ATOM 5371  O O    . TYR A 1 119 ? 11.204  8.204   10.146  1.00 0.00 ? 119 TYR A O    3  
ATOM 5372  C CB   . TYR A 1 119 ? 12.840  5.654   9.085   1.00 0.00 ? 119 TYR A CB   3  
ATOM 5373  C CG   . TYR A 1 119 ? 14.035  5.078   9.804   1.00 0.00 ? 119 TYR A CG   3  
ATOM 5374  C CD1  . TYR A 1 119 ? 14.089  3.707   10.081  1.00 0.00 ? 119 TYR A CD1  3  
ATOM 5375  C CD2  . TYR A 1 119 ? 15.087  5.912   10.194  1.00 0.00 ? 119 TYR A CD2  3  
ATOM 5376  C CE1  . TYR A 1 119 ? 15.196  3.171   10.748  1.00 0.00 ? 119 TYR A CE1  3  
ATOM 5377  C CE2  . TYR A 1 119 ? 16.195  5.376   10.861  1.00 0.00 ? 119 TYR A CE2  3  
ATOM 5378  C CZ   . TYR A 1 119 ? 16.249  4.005   11.138  1.00 0.00 ? 119 TYR A CZ   3  
ATOM 5379  O OH   . TYR A 1 119 ? 17.342  3.477   11.795  1.00 0.00 ? 119 TYR A OH   3  
ATOM 5380  H H    . TYR A 1 119 ? 10.702  4.157   9.214   1.00 0.00 ? 119 TYR A H    3  
ATOM 5381  H HA   . TYR A 1 119 ? 12.101  5.975   11.074  1.00 0.00 ? 119 TYR A HA   3  
ATOM 5382  H HB2  . TYR A 1 119 ? 12.524  4.973   8.308   1.00 0.00 ? 119 TYR A HB2  3  
ATOM 5383  H HB3  . TYR A 1 119 ? 13.109  6.604   8.646   1.00 0.00 ? 119 TYR A HB3  3  
ATOM 5384  H HD1  . TYR A 1 119 ? 13.275  3.063   9.779   1.00 0.00 ? 119 TYR A HD1  3  
ATOM 5385  H HD2  . TYR A 1 119 ? 15.046  6.971   9.981   1.00 0.00 ? 119 TYR A HD2  3  
ATOM 5386  H HE1  . TYR A 1 119 ? 15.238  2.113   10.961  1.00 0.00 ? 119 TYR A HE1  3  
ATOM 5387  H HE2  . TYR A 1 119 ? 17.008  6.020   11.163  1.00 0.00 ? 119 TYR A HE2  3  
ATOM 5388  H HH   . TYR A 1 119 ? 18.130  3.910   11.456  1.00 0.00 ? 119 TYR A HH   3  
ATOM 5389  N N    . LEU A 1 120 ? 9.919   6.977   8.857   1.00 0.00 ? 120 LEU A N    3  
ATOM 5390  C CA   . LEU A 1 120 ? 9.126   8.162   8.438   1.00 0.00 ? 120 LEU A CA   3  
ATOM 5391  C C    . LEU A 1 120 ? 8.225   8.616   9.590   1.00 0.00 ? 120 LEU A C    3  
ATOM 5392  O O    . LEU A 1 120 ? 8.034   9.794   9.816   1.00 0.00 ? 120 LEU A O    3  
ATOM 5393  C CB   . LEU A 1 120 ? 8.264   7.771   7.243   1.00 0.00 ? 120 LEU A CB   3  
ATOM 5394  C CG   . LEU A 1 120 ? 9.124   7.721   5.980   1.00 0.00 ? 120 LEU A CG   3  
ATOM 5395  C CD1  . LEU A 1 120 ? 9.263   6.269   5.519   1.00 0.00 ? 120 LEU A CD1  3  
ATOM 5396  C CD2  . LEU A 1 120 ? 8.453   8.544   4.877   1.00 0.00 ? 120 LEU A CD2  3  
ATOM 5397  H H    . LEU A 1 120 ? 9.697   6.094   8.494   1.00 0.00 ? 120 LEU A H    3  
ATOM 5398  H HA   . LEU A 1 120 ? 9.792   8.964   8.159   1.00 0.00 ? 120 LEU A HA   3  
ATOM 5399  H HB2  . LEU A 1 120 ? 7.832   6.797   7.421   1.00 0.00 ? 120 LEU A HB2  3  
ATOM 5400  H HB3  . LEU A 1 120 ? 7.482   8.498   7.114   1.00 0.00 ? 120 LEU A HB3  3  
ATOM 5401  H HG   . LEU A 1 120 ? 10.103  8.128   6.194   1.00 0.00 ? 120 LEU A HG   3  
ATOM 5402  H HD11 . LEU A 1 120 ? 9.696   5.680   6.313   1.00 0.00 ? 120 LEU A HD11 3  
ATOM 5403  H HD12 . LEU A 1 120 ? 8.289   5.876   5.271   1.00 0.00 ? 120 LEU A HD12 3  
ATOM 5404  H HD13 . LEU A 1 120 ? 9.902   6.226   4.649   1.00 0.00 ? 120 LEU A HD13 3  
ATOM 5405  H HD21 . LEU A 1 120 ? 7.820   9.296   5.324   1.00 0.00 ? 120 LEU A HD21 3  
ATOM 5406  H HD22 . LEU A 1 120 ? 9.210   9.023   4.273   1.00 0.00 ? 120 LEU A HD22 3  
ATOM 5407  H HD23 . LEU A 1 120 ? 7.855   7.892   4.256   1.00 0.00 ? 120 LEU A HD23 3  
ATOM 5408  N N    . ILE A 1 121 ? 7.668   7.687   10.314  1.00 0.00 ? 121 ILE A N    3  
ATOM 5409  C CA   . ILE A 1 121 ? 6.778   8.049   11.448  1.00 0.00 ? 121 ILE A CA   3  
ATOM 5410  C C    . ILE A 1 121 ? 7.594   8.777   12.518  1.00 0.00 ? 121 ILE A C    3  
ATOM 5411  O O    . ILE A 1 121 ? 7.052   9.403   13.408  1.00 0.00 ? 121 ILE A O    3  
ATOM 5412  C CB   . ILE A 1 121 ? 6.167   6.774   12.038  1.00 0.00 ? 121 ILE A CB   3  
ATOM 5413  C CG1  . ILE A 1 121 ? 5.075   6.247   11.100  1.00 0.00 ? 121 ILE A CG1  3  
ATOM 5414  C CG2  . ILE A 1 121 ? 5.554   7.082   13.407  1.00 0.00 ? 121 ILE A CG2  3  
ATOM 5415  C CD1  . ILE A 1 121 ? 5.701   5.345   10.032  1.00 0.00 ? 121 ILE A CD1  3  
ATOM 5416  H H    . ILE A 1 121 ? 7.837   6.750   10.112  1.00 0.00 ? 121 ILE A H    3  
ATOM 5417  H HA   . ILE A 1 121 ? 5.989   8.697   11.094  1.00 0.00 ? 121 ILE A HA   3  
ATOM 5418  H HB   . ILE A 1 121 ? 6.939   6.026   12.152  1.00 0.00 ? 121 ILE A HB   3  
ATOM 5419  H HG12 . ILE A 1 121 ? 4.355   5.680   11.673  1.00 0.00 ? 121 ILE A HG12 3  
ATOM 5420  H HG13 . ILE A 1 121 ? 4.580   7.079   10.623  1.00 0.00 ? 121 ILE A HG13 3  
ATOM 5421  H HG21 . ILE A 1 121 ? 5.149   8.083   13.403  1.00 0.00 ? 121 ILE A HG21 3  
ATOM 5422  H HG22 . ILE A 1 121 ? 4.764   6.375   13.615  1.00 0.00 ? 121 ILE A HG22 3  
ATOM 5423  H HG23 . ILE A 1 121 ? 6.315   7.005   14.168  1.00 0.00 ? 121 ILE A HG23 3  
ATOM 5424  H HD11 . ILE A 1 121 ? 6.306   4.588   10.507  1.00 0.00 ? 121 ILE A HD11 3  
ATOM 5425  H HD12 . ILE A 1 121 ? 4.919   4.872   9.456   1.00 0.00 ? 121 ILE A HD12 3  
ATOM 5426  H HD13 . ILE A 1 121 ? 6.319   5.940   9.375   1.00 0.00 ? 121 ILE A HD13 3  
ATOM 5427  N N    . GLY A 1 122 ? 8.895   8.701   12.439  1.00 0.00 ? 122 GLY A N    3  
ATOM 5428  C CA   . GLY A 1 122 ? 9.741   9.391   13.451  1.00 0.00 ? 122 GLY A CA   3  
ATOM 5429  C C    . GLY A 1 122 ? 9.209   10.808  13.665  1.00 0.00 ? 122 GLY A C    3  
ATOM 5430  O O    . GLY A 1 122 ? 9.234   11.334  14.760  1.00 0.00 ? 122 GLY A O    3  
ATOM 5431  H H    . GLY A 1 122 ? 9.314   8.192   11.713  1.00 0.00 ? 122 GLY A H    3  
ATOM 5432  H HA2  . GLY A 1 122 ? 9.705   8.845   14.384  1.00 0.00 ? 122 GLY A HA2  3  
ATOM 5433  H HA3  . GLY A 1 122 ? 10.760  9.441   13.100  1.00 0.00 ? 122 GLY A HA3  3  
ATOM 5434  N N    . GLN A 1 123 ? 8.721   11.425  12.625  1.00 0.00 ? 123 GLN A N    3  
ATOM 5435  C CA   . GLN A 1 123 ? 8.178   12.805  12.763  1.00 0.00 ? 123 GLN A CA   3  
ATOM 5436  C C    . GLN A 1 123 ? 6.658   12.761  12.592  1.00 0.00 ? 123 GLN A C    3  
ATOM 5437  O O    . GLN A 1 123 ? 5.912   12.948  13.532  1.00 0.00 ? 123 GLN A O    3  
ATOM 5438  C CB   . GLN A 1 123 ? 8.784   13.722  11.690  1.00 0.00 ? 123 GLN A CB   3  
ATOM 5439  C CG   . GLN A 1 123 ? 10.090  13.123  11.160  1.00 0.00 ? 123 GLN A CG   3  
ATOM 5440  C CD   . GLN A 1 123 ? 10.569  13.931  9.954   1.00 0.00 ? 123 GLN A CD   3  
ATOM 5441  O OE1  . GLN A 1 123 ? 9.923   13.951  8.924   1.00 0.00 ? 123 GLN A OE1  3  
ATOM 5442  N NE2  . GLN A 1 123 ? 11.681  14.609  10.037  1.00 0.00 ? 123 GLN A NE2  3  
ATOM 5443  H H    . GLN A 1 123 ? 8.708   10.978  11.753  1.00 0.00 ? 123 GLN A H    3  
ATOM 5444  H HA   . GLN A 1 123 ? 8.418   13.189  13.742  1.00 0.00 ? 123 GLN A HA   3  
ATOM 5445  H HB2  . GLN A 1 123 ? 8.084   13.831  10.875  1.00 0.00 ? 123 GLN A HB2  3  
ATOM 5446  H HB3  . GLN A 1 123 ? 8.986   14.691  12.121  1.00 0.00 ? 123 GLN A HB3  3  
ATOM 5447  H HG2  . GLN A 1 123 ? 10.841  13.155  11.937  1.00 0.00 ? 123 GLN A HG2  3  
ATOM 5448  H HG3  . GLN A 1 123 ? 9.923   12.100  10.861  1.00 0.00 ? 123 GLN A HG3  3  
ATOM 5449  H HE21 . GLN A 1 123 ? 12.202  14.595  10.867  1.00 0.00 ? 123 GLN A HE21 3  
ATOM 5450  H HE22 . GLN A 1 123 ? 11.996  15.130  9.269   1.00 0.00 ? 123 GLN A HE22 3  
ATOM 5451  N N    . GLY A 1 124 ? 6.195   12.509  11.398  1.00 0.00 ? 124 GLY A N    3  
ATOM 5452  C CA   . GLY A 1 124 ? 4.725   12.445  11.164  1.00 0.00 ? 124 GLY A CA   3  
ATOM 5453  C C    . GLY A 1 124 ? 4.345   11.036  10.702  1.00 0.00 ? 124 GLY A C    3  
ATOM 5454  O O    . GLY A 1 124 ? 3.840   10.236  11.465  1.00 0.00 ? 124 GLY A O    3  
ATOM 5455  H H    . GLY A 1 124 ? 6.816   12.357  10.655  1.00 0.00 ? 124 GLY A H    3  
ATOM 5456  H HA2  . GLY A 1 124 ? 4.203   12.680  12.081  1.00 0.00 ? 124 GLY A HA2  3  
ATOM 5457  H HA3  . GLY A 1 124 ? 4.450   13.156  10.400  1.00 0.00 ? 124 GLY A HA3  3  
ATOM 5458  N N    . PHE A 1 125 ? 4.586   10.729  9.458   1.00 0.00 ? 125 PHE A N    3  
ATOM 5459  C CA   . PHE A 1 125 ? 4.242   9.374   8.943   1.00 0.00 ? 125 PHE A CA   3  
ATOM 5460  C C    . PHE A 1 125 ? 5.357   8.874   8.023   1.00 0.00 ? 125 PHE A C    3  
ATOM 5461  O O    . PHE A 1 125 ? 5.894   7.813   8.300   1.00 0.00 ? 125 PHE A O    3  
ATOM 5462  C CB   . PHE A 1 125 ? 2.929   9.443   8.163   1.00 0.00 ? 125 PHE A CB   3  
ATOM 5463  C CG   . PHE A 1 125 ? 1.924   8.511   8.790   1.00 0.00 ? 125 PHE A CG   3  
ATOM 5464  C CD1  . PHE A 1 125 ? 2.179   7.136   8.824   1.00 0.00 ? 125 PHE A CD1  3  
ATOM 5465  C CD2  . PHE A 1 125 ? 0.739   9.019   9.338   1.00 0.00 ? 125 PHE A CD2  3  
ATOM 5466  C CE1  . PHE A 1 125 ? 1.248   6.266   9.404   1.00 0.00 ? 125 PHE A CE1  3  
ATOM 5467  C CE2  . PHE A 1 125 ? -0.192  8.150   9.918   1.00 0.00 ? 125 PHE A CE2  3  
ATOM 5468  C CZ   . PHE A 1 125 ? 0.063   6.773   9.952   1.00 0.00 ? 125 PHE A CZ   3  
ATOM 5469  O OXT  . PHE A 1 125 ? 5.656   9.560   7.058   1.00 0.00 ? 125 PHE A OXT  3  
ATOM 5470  H H    . PHE A 1 125 ? 4.995   11.389  8.861   1.00 0.00 ? 125 PHE A H    3  
ATOM 5471  H HA   . PHE A 1 125 ? 4.131   8.693   9.774   1.00 0.00 ? 125 PHE A HA   3  
ATOM 5472  H HB2  . PHE A 1 125 ? 2.549   10.454  8.189   1.00 0.00 ? 125 PHE A HB2  3  
ATOM 5473  H HB3  . PHE A 1 125 ? 3.101   9.150   7.139   1.00 0.00 ? 125 PHE A HB3  3  
ATOM 5474  H HD1  . PHE A 1 125 ? 3.096   6.745   8.400   1.00 0.00 ? 125 PHE A HD1  3  
ATOM 5475  H HD2  . PHE A 1 125 ? 0.543   10.081  9.311   1.00 0.00 ? 125 PHE A HD2  3  
ATOM 5476  H HE1  . PHE A 1 125 ? 1.444   5.203   9.430   1.00 0.00 ? 125 PHE A HE1  3  
ATOM 5477  H HE2  . PHE A 1 125 ? -1.106  8.541   10.339  1.00 0.00 ? 125 PHE A HE2  3  
ATOM 5478  H HZ   . PHE A 1 125 ? -0.656  6.102   10.399  1.00 0.00 ? 125 PHE A HZ   3  
ATOM 5479  N N    . SER A 1 1   ? 12.126  9.888   0.380   1.00 0.00 ? 1   SER A N    4  
ATOM 5480  C CA   . SER A 1 1   ? 12.052  8.418   0.152   1.00 0.00 ? 1   SER A CA   4  
ATOM 5481  C C    . SER A 1 1   ? 10.736  8.072   -0.549  1.00 0.00 ? 1   SER A C    4  
ATOM 5482  O O    . SER A 1 1   ? 9.956   8.944   -0.874  1.00 0.00 ? 1   SER A O    4  
ATOM 5483  C CB   . SER A 1 1   ? 12.119  7.689   1.495   1.00 0.00 ? 1   SER A CB   4  
ATOM 5484  O OG   . SER A 1 1   ? 11.015  8.082   2.299   1.00 0.00 ? 1   SER A OG   4  
ATOM 5485  H H1   . SER A 1 1   ? 11.219  10.226  0.760   1.00 0.00 ? 1   SER A H1   4  
ATOM 5486  H H2   . SER A 1 1   ? 12.883  10.096  1.062   1.00 0.00 ? 1   SER A H2   4  
ATOM 5487  H H3   . SER A 1 1   ? 12.326  10.370  -0.521  1.00 0.00 ? 1   SER A H3   4  
ATOM 5488  H HA   . SER A 1 1   ? 12.881  8.107   -0.467  1.00 0.00 ? 1   SER A HA   4  
ATOM 5489  H HB2  . SER A 1 1   ? 12.076  6.625   1.332   1.00 0.00 ? 1   SER A HB2  4  
ATOM 5490  H HB3  . SER A 1 1   ? 13.047  7.937   1.992   1.00 0.00 ? 1   SER A HB3  4  
ATOM 5491  H HG   . SER A 1 1   ? 10.691  7.305   2.760   1.00 0.00 ? 1   SER A HG   4  
ATOM 5492  N N    . TRP A 1 2   ? 10.499  6.801   -0.775  1.00 0.00 ? 2   TRP A N    4  
ATOM 5493  C CA   . TRP A 1 2   ? 9.244   6.343   -1.451  1.00 0.00 ? 2   TRP A CA   4  
ATOM 5494  C C    . TRP A 1 2   ? 9.353   6.538   -2.972  1.00 0.00 ? 2   TRP A C    4  
ATOM 5495  O O    . TRP A 1 2   ? 9.035   5.649   -3.737  1.00 0.00 ? 2   TRP A O    4  
ATOM 5496  C CB   . TRP A 1 2   ? 8.025   7.098   -0.896  1.00 0.00 ? 2   TRP A CB   4  
ATOM 5497  C CG   . TRP A 1 2   ? 7.223   6.171   -0.035  1.00 0.00 ? 2   TRP A CG   4  
ATOM 5498  C CD1  . TRP A 1 2   ? 5.892   6.261   0.181   1.00 0.00 ? 2   TRP A CD1  4  
ATOM 5499  C CD2  . TRP A 1 2   ? 7.684   5.021   0.729   1.00 0.00 ? 2   TRP A CD2  4  
ATOM 5500  N NE1  . TRP A 1 2   ? 5.506   5.233   1.025   1.00 0.00 ? 2   TRP A NE1  4  
ATOM 5501  C CE2  . TRP A 1 2   ? 6.579   4.441   1.392   1.00 0.00 ? 2   TRP A CE2  4  
ATOM 5502  C CE3  . TRP A 1 2   ? 8.944   4.432   0.904   1.00 0.00 ? 2   TRP A CE3  4  
ATOM 5503  C CZ2  . TRP A 1 2   ? 6.721   3.308   2.205   1.00 0.00 ? 2   TRP A CZ2  4  
ATOM 5504  C CZ3  . TRP A 1 2   ? 9.095   3.298   1.718   1.00 0.00 ? 2   TRP A CZ3  4  
ATOM 5505  C CH2  . TRP A 1 2   ? 7.986   2.738   2.366   1.00 0.00 ? 2   TRP A CH2  4  
ATOM 5506  H H    . TRP A 1 2   ? 11.160  6.134   -0.492  1.00 0.00 ? 2   TRP A H    4  
ATOM 5507  H HA   . TRP A 1 2   ? 9.115   5.289   -1.255  1.00 0.00 ? 2   TRP A HA   4  
ATOM 5508  H HB2  . TRP A 1 2   ? 8.352   7.936   -0.302  1.00 0.00 ? 2   TRP A HB2  4  
ATOM 5509  H HB3  . TRP A 1 2   ? 7.414   7.449   -1.712  1.00 0.00 ? 2   TRP A HB3  4  
ATOM 5510  H HD1  . TRP A 1 2   ? 5.236   7.009   -0.238  1.00 0.00 ? 2   TRP A HD1  4  
ATOM 5511  H HE1  . TRP A 1 2   ? 4.593   5.073   1.337   1.00 0.00 ? 2   TRP A HE1  4  
ATOM 5512  H HE3  . TRP A 1 2   ? 9.802   4.855   0.407   1.00 0.00 ? 2   TRP A HE3  4  
ATOM 5513  H HZ2  . TRP A 1 2   ? 5.861   2.871   2.700   1.00 0.00 ? 2   TRP A HZ2  4  
ATOM 5514  H HZ3  . TRP A 1 2   ? 10.072  2.854   1.844   1.00 0.00 ? 2   TRP A HZ3  4  
ATOM 5515  H HH2  . TRP A 1 2   ? 8.109   1.865   2.991   1.00 0.00 ? 2   TRP A HH2  4  
ATOM 5516  N N    . GLN A 1 3   ? 9.808   7.673   -3.426  1.00 0.00 ? 3   GLN A N    4  
ATOM 5517  C CA   . GLN A 1 3   ? 9.933   7.878   -4.897  1.00 0.00 ? 3   GLN A CA   4  
ATOM 5518  C C    . GLN A 1 3   ? 11.024  6.952   -5.437  1.00 0.00 ? 3   GLN A C    4  
ATOM 5519  O O    . GLN A 1 3   ? 10.778  6.118   -6.285  1.00 0.00 ? 3   GLN A O    4  
ATOM 5520  C CB   . GLN A 1 3   ? 10.302  9.333   -5.188  1.00 0.00 ? 3   GLN A CB   4  
ATOM 5521  C CG   . GLN A 1 3   ? 9.333   10.260  -4.455  1.00 0.00 ? 3   GLN A CG   4  
ATOM 5522  C CD   . GLN A 1 3   ? 8.806   11.318  -5.426  1.00 0.00 ? 3   GLN A CD   4  
ATOM 5523  O OE1  . GLN A 1 3   ? 9.259   12.445  -5.418  1.00 0.00 ? 3   GLN A OE1  4  
ATOM 5524  N NE2  . GLN A 1 3   ? 7.864   10.999  -6.269  1.00 0.00 ? 3   GLN A NE2  4  
ATOM 5525  H H    . GLN A 1 3   ? 10.075  8.381   -2.811  1.00 0.00 ? 3   GLN A H    4  
ATOM 5526  H HA   . GLN A 1 3   ? 8.992   7.638   -5.374  1.00 0.00 ? 3   GLN A HA   4  
ATOM 5527  H HB2  . GLN A 1 3   ? 11.311  9.524   -4.848  1.00 0.00 ? 3   GLN A HB2  4  
ATOM 5528  H HB3  . GLN A 1 3   ? 10.238  9.516   -6.250  1.00 0.00 ? 3   GLN A HB3  4  
ATOM 5529  H HG2  . GLN A 1 3   ? 8.507   9.682   -4.067  1.00 0.00 ? 3   GLN A HG2  4  
ATOM 5530  H HG3  . GLN A 1 3   ? 9.847   10.747  -3.640  1.00 0.00 ? 3   GLN A HG3  4  
ATOM 5531  H HE21 . GLN A 1 3   ? 7.499   10.089  -6.275  1.00 0.00 ? 3   GLN A HE21 4  
ATOM 5532  H HE22 . GLN A 1 3   ? 7.521   11.669  -6.897  1.00 0.00 ? 3   GLN A HE22 4  
ATOM 5533  N N    . THR A 1 4   ? 12.225  7.084   -4.944  1.00 0.00 ? 4   THR A N    4  
ATOM 5534  C CA   . THR A 1 4   ? 13.321  6.198   -5.424  1.00 0.00 ? 4   THR A CA   4  
ATOM 5535  C C    . THR A 1 4   ? 13.089  4.791   -4.877  1.00 0.00 ? 4   THR A C    4  
ATOM 5536  O O    . THR A 1 4   ? 13.428  3.805   -5.500  1.00 0.00 ? 4   THR A O    4  
ATOM 5537  C CB   . THR A 1 4   ? 14.669  6.728   -4.924  1.00 0.00 ? 4   THR A CB   4  
ATOM 5538  O OG1  . THR A 1 4   ? 15.653  5.712   -5.060  1.00 0.00 ? 4   THR A OG1  4  
ATOM 5539  C CG2  . THR A 1 4   ? 14.547  7.131   -3.453  1.00 0.00 ? 4   THR A CG2  4  
ATOM 5540  H H    . THR A 1 4   ? 12.403  7.756   -4.253  1.00 0.00 ? 4   THR A H    4  
ATOM 5541  H HA   . THR A 1 4   ? 13.319  6.174   -6.504  1.00 0.00 ? 4   THR A HA   4  
ATOM 5542  H HB   . THR A 1 4   ? 14.956  7.590   -5.506  1.00 0.00 ? 4   THR A HB   4  
ATOM 5543  H HG1  . THR A 1 4   ? 16.222  5.948   -5.796  1.00 0.00 ? 4   THR A HG1  4  
ATOM 5544  H HG21 . THR A 1 4   ? 13.711  6.615   -3.006  1.00 0.00 ? 4   THR A HG21 4  
ATOM 5545  H HG22 . THR A 1 4   ? 15.455  6.866   -2.931  1.00 0.00 ? 4   THR A HG22 4  
ATOM 5546  H HG23 . THR A 1 4   ? 14.390  8.198   -3.385  1.00 0.00 ? 4   THR A HG23 4  
ATOM 5547  N N    . TYR A 1 5   ? 12.499  4.694   -3.717  1.00 0.00 ? 5   TYR A N    4  
ATOM 5548  C CA   . TYR A 1 5   ? 12.225  3.359   -3.113  1.00 0.00 ? 5   TYR A CA   4  
ATOM 5549  C C    . TYR A 1 5   ? 11.396  2.527   -4.100  1.00 0.00 ? 5   TYR A C    4  
ATOM 5550  O O    . TYR A 1 5   ? 11.303  1.321   -3.986  1.00 0.00 ? 5   TYR A O    4  
ATOM 5551  C CB   . TYR A 1 5   ? 11.498  3.583   -1.762  1.00 0.00 ? 5   TYR A CB   4  
ATOM 5552  C CG   . TYR A 1 5   ? 10.197  2.804   -1.638  1.00 0.00 ? 5   TYR A CG   4  
ATOM 5553  C CD1  . TYR A 1 5   ? 9.171   2.952   -2.583  1.00 0.00 ? 5   TYR A CD1  4  
ATOM 5554  C CD2  . TYR A 1 5   ? 10.011  1.951   -0.543  1.00 0.00 ? 5   TYR A CD2  4  
ATOM 5555  C CE1  . TYR A 1 5   ? 7.973   2.243   -2.435  1.00 0.00 ? 5   TYR A CE1  4  
ATOM 5556  C CE2  . TYR A 1 5   ? 8.813   1.246   -0.394  1.00 0.00 ? 5   TYR A CE2  4  
ATOM 5557  C CZ   . TYR A 1 5   ? 7.794   1.391   -1.340  1.00 0.00 ? 5   TYR A CZ   4  
ATOM 5558  O OH   . TYR A 1 5   ? 6.611   0.695   -1.193  1.00 0.00 ? 5   TYR A OH   4  
ATOM 5559  H H    . TYR A 1 5   ? 12.228  5.507   -3.239  1.00 0.00 ? 5   TYR A H    4  
ATOM 5560  H HA   . TYR A 1 5   ? 13.165  2.853   -2.932  1.00 0.00 ? 5   TYR A HA   4  
ATOM 5561  H HB2  . TYR A 1 5   ? 12.156  3.277   -0.962  1.00 0.00 ? 5   TYR A HB2  4  
ATOM 5562  H HB3  . TYR A 1 5   ? 11.290  4.638   -1.650  1.00 0.00 ? 5   TYR A HB3  4  
ATOM 5563  H HD1  . TYR A 1 5   ? 9.309   3.608   -3.430  1.00 0.00 ? 5   TYR A HD1  4  
ATOM 5564  H HD2  . TYR A 1 5   ? 10.795  1.838   0.189   1.00 0.00 ? 5   TYR A HD2  4  
ATOM 5565  H HE1  . TYR A 1 5   ? 7.184   2.355   -3.163  1.00 0.00 ? 5   TYR A HE1  4  
ATOM 5566  H HE2  . TYR A 1 5   ? 8.674   0.592   0.453   1.00 0.00 ? 5   TYR A HE2  4  
ATOM 5567  H HH   . TYR A 1 5   ? 6.813   -0.152  -0.788  1.00 0.00 ? 5   TYR A HH   4  
ATOM 5568  N N    . VAL A 1 6   ? 10.792  3.166   -5.070  1.00 0.00 ? 6   VAL A N    4  
ATOM 5569  C CA   . VAL A 1 6   ? 9.969   2.417   -6.065  1.00 0.00 ? 6   VAL A CA   4  
ATOM 5570  C C    . VAL A 1 6   ? 10.819  2.080   -7.302  1.00 0.00 ? 6   VAL A C    4  
ATOM 5571  O O    . VAL A 1 6   ? 10.823  0.964   -7.777  1.00 0.00 ? 6   VAL A O    4  
ATOM 5572  C CB   . VAL A 1 6   ? 8.753   3.286   -6.461  1.00 0.00 ? 6   VAL A CB   4  
ATOM 5573  C CG1  . VAL A 1 6   ? 8.529   3.280   -7.981  1.00 0.00 ? 6   VAL A CG1  4  
ATOM 5574  C CG2  . VAL A 1 6   ? 7.501   2.737   -5.779  1.00 0.00 ? 6   VAL A CG2  4  
ATOM 5575  H H    . VAL A 1 6   ? 10.876  4.141   -5.141  1.00 0.00 ? 6   VAL A H    4  
ATOM 5576  H HA   . VAL A 1 6   ? 9.621   1.501   -5.614  1.00 0.00 ? 6   VAL A HA   4  
ATOM 5577  H HB   . VAL A 1 6   ? 8.921   4.301   -6.132  1.00 0.00 ? 6   VAL A HB   4  
ATOM 5578  H HG11 . VAL A 1 6   ? 8.656   2.277   -8.360  1.00 0.00 ? 6   VAL A HG11 4  
ATOM 5579  H HG12 . VAL A 1 6   ? 7.529   3.624   -8.199  1.00 0.00 ? 6   VAL A HG12 4  
ATOM 5580  H HG13 . VAL A 1 6   ? 9.247   3.935   -8.452  1.00 0.00 ? 6   VAL A HG13 4  
ATOM 5581  H HG21 . VAL A 1 6   ? 7.785   2.192   -4.893  1.00 0.00 ? 6   VAL A HG21 4  
ATOM 5582  H HG22 . VAL A 1 6   ? 6.853   3.556   -5.506  1.00 0.00 ? 6   VAL A HG22 4  
ATOM 5583  H HG23 . VAL A 1 6   ? 6.982   2.078   -6.458  1.00 0.00 ? 6   VAL A HG23 4  
ATOM 5584  N N    . ASP A 1 7   ? 11.514  3.039   -7.846  1.00 0.00 ? 7   ASP A N    4  
ATOM 5585  C CA   . ASP A 1 7   ? 12.324  2.761   -9.066  1.00 0.00 ? 7   ASP A CA   4  
ATOM 5586  C C    . ASP A 1 7   ? 13.736  2.311   -8.686  1.00 0.00 ? 7   ASP A C    4  
ATOM 5587  O O    . ASP A 1 7   ? 14.708  2.770   -9.251  1.00 0.00 ? 7   ASP A O    4  
ATOM 5588  C CB   . ASP A 1 7   ? 12.411  4.030   -9.915  1.00 0.00 ? 7   ASP A CB   4  
ATOM 5589  C CG   . ASP A 1 7   ? 11.619  3.837   -11.211 1.00 0.00 ? 7   ASP A CG   4  
ATOM 5590  O OD1  . ASP A 1 7   ? 12.059  3.055   -12.039 1.00 0.00 ? 7   ASP A OD1  4  
ATOM 5591  O OD2  . ASP A 1 7   ? 10.589  4.475   -11.353 1.00 0.00 ? 7   ASP A OD2  4  
ATOM 5592  H H    . ASP A 1 7   ? 11.486  3.942   -7.468  1.00 0.00 ? 7   ASP A H    4  
ATOM 5593  H HA   . ASP A 1 7   ? 11.845  1.982   -9.640  1.00 0.00 ? 7   ASP A HA   4  
ATOM 5594  H HB2  . ASP A 1 7   ? 11.999  4.863   -9.363  1.00 0.00 ? 7   ASP A HB2  4  
ATOM 5595  H HB3  . ASP A 1 7   ? 13.444  4.233   -10.155 1.00 0.00 ? 7   ASP A HB3  4  
ATOM 5596  N N    . THR A 1 8   ? 13.869  1.413   -7.747  1.00 0.00 ? 8   THR A N    4  
ATOM 5597  C CA   . THR A 1 8   ? 15.229  0.955   -7.371  1.00 0.00 ? 8   THR A CA   4  
ATOM 5598  C C    . THR A 1 8   ? 15.182  -0.510  -6.913  1.00 0.00 ? 8   THR A C    4  
ATOM 5599  O O    . THR A 1 8   ? 15.081  -1.414  -7.718  1.00 0.00 ? 8   THR A O    4  
ATOM 5600  C CB   . THR A 1 8   ? 15.780  1.847   -6.253  1.00 0.00 ? 8   THR A CB   4  
ATOM 5601  O OG1  . THR A 1 8   ? 14.812  1.967   -5.221  1.00 0.00 ? 8   THR A OG1  4  
ATOM 5602  C CG2  . THR A 1 8   ? 16.101  3.234   -6.814  1.00 0.00 ? 8   THR A CG2  4  
ATOM 5603  H H    . THR A 1 8   ? 13.083  1.041   -7.297  1.00 0.00 ? 8   THR A H    4  
ATOM 5604  H HA   . THR A 1 8   ? 15.876  1.032   -8.233  1.00 0.00 ? 8   THR A HA   4  
ATOM 5605  H HB   . THR A 1 8   ? 16.681  1.409   -5.853  1.00 0.00 ? 8   THR A HB   4  
ATOM 5606  H HG1  . THR A 1 8   ? 15.124  2.626   -4.596  1.00 0.00 ? 8   THR A HG1  4  
ATOM 5607  H HG21 . THR A 1 8   ? 16.608  3.130   -7.762  1.00 0.00 ? 8   THR A HG21 4  
ATOM 5608  H HG22 . THR A 1 8   ? 15.184  3.787   -6.956  1.00 0.00 ? 8   THR A HG22 4  
ATOM 5609  H HG23 . THR A 1 8   ? 16.738  3.764   -6.122  1.00 0.00 ? 8   THR A HG23 4  
ATOM 5610  N N    . ASN A 1 9   ? 15.279  -0.755  -5.635  1.00 0.00 ? 9   ASN A N    4  
ATOM 5611  C CA   . ASN A 1 9   ? 15.264  -2.161  -5.140  1.00 0.00 ? 9   ASN A CA   4  
ATOM 5612  C C    . ASN A 1 9   ? 13.900  -2.523  -4.545  1.00 0.00 ? 9   ASN A C    4  
ATOM 5613  O O    . ASN A 1 9   ? 13.179  -3.343  -5.077  1.00 0.00 ? 9   ASN A O    4  
ATOM 5614  C CB   . ASN A 1 9   ? 16.335  -2.315  -4.060  1.00 0.00 ? 9   ASN A CB   4  
ATOM 5615  C CG   . ASN A 1 9   ? 16.983  -3.695  -4.173  1.00 0.00 ? 9   ASN A CG   4  
ATOM 5616  O OD1  . ASN A 1 9   ? 16.301  -4.696  -4.270  1.00 0.00 ? 9   ASN A OD1  4  
ATOM 5617  N ND2  . ASN A 1 9   ? 18.285  -3.792  -4.166  1.00 0.00 ? 9   ASN A ND2  4  
ATOM 5618  H H    . ASN A 1 9   ? 15.370  -0.019  -5.001  1.00 0.00 ? 9   ASN A H    4  
ATOM 5619  H HA   . ASN A 1 9   ? 15.485  -2.831  -5.955  1.00 0.00 ? 9   ASN A HA   4  
ATOM 5620  H HB2  . ASN A 1 9   ? 17.088  -1.552  -4.193  1.00 0.00 ? 9   ASN A HB2  4  
ATOM 5621  H HB3  . ASN A 1 9   ? 15.882  -2.208  -3.086  1.00 0.00 ? 9   ASN A HB3  4  
ATOM 5622  H HD21 . ASN A 1 9   ? 18.835  -2.985  -4.089  1.00 0.00 ? 9   ASN A HD21 4  
ATOM 5623  H HD22 . ASN A 1 9   ? 18.712  -4.671  -4.240  1.00 0.00 ? 9   ASN A HD22 4  
ATOM 5624  N N    . LEU A 1 10  ? 13.578  -1.936  -3.422  1.00 0.00 ? 10  LEU A N    4  
ATOM 5625  C CA   . LEU A 1 10  ? 12.289  -2.235  -2.720  1.00 0.00 ? 10  LEU A CA   4  
ATOM 5626  C C    . LEU A 1 10  ? 11.194  -2.682  -3.690  1.00 0.00 ? 10  LEU A C    4  
ATOM 5627  O O    . LEU A 1 10  ? 10.477  -3.624  -3.426  1.00 0.00 ? 10  LEU A O    4  
ATOM 5628  C CB   . LEU A 1 10  ? 11.815  -0.987  -1.981  1.00 0.00 ? 10  LEU A CB   4  
ATOM 5629  C CG   . LEU A 1 10  ? 11.847  -1.253  -0.478  1.00 0.00 ? 10  LEU A CG   4  
ATOM 5630  C CD1  . LEU A 1 10  ? 12.245  0.025   0.258   1.00 0.00 ? 10  LEU A CD1  4  
ATOM 5631  C CD2  . LEU A 1 10  ? 10.459  -1.702  -0.011  1.00 0.00 ? 10  LEU A CD2  4  
ATOM 5632  H H    . LEU A 1 10  ? 14.207  -1.304  -3.016  1.00 0.00 ? 10  LEU A H    4  
ATOM 5633  H HA   . LEU A 1 10  ? 12.458  -3.021  -2.000  1.00 0.00 ? 10  LEU A HA   4  
ATOM 5634  H HB2  . LEU A 1 10  ? 12.465  -0.157  -2.218  1.00 0.00 ? 10  LEU A HB2  4  
ATOM 5635  H HB3  . LEU A 1 10  ? 10.805  -0.752  -2.282  1.00 0.00 ? 10  LEU A HB3  4  
ATOM 5636  H HG   . LEU A 1 10  ? 12.568  -2.029  -0.266  1.00 0.00 ? 10  LEU A HG   4  
ATOM 5637  H HD11 . LEU A 1 10  ? 12.258  0.850   -0.438  1.00 0.00 ? 10  LEU A HD11 4  
ATOM 5638  H HD12 . LEU A 1 10  ? 11.533  0.226   1.042   1.00 0.00 ? 10  LEU A HD12 4  
ATOM 5639  H HD13 . LEU A 1 10  ? 13.229  -0.098  0.687   1.00 0.00 ? 10  LEU A HD13 4  
ATOM 5640  H HD21 . LEU A 1 10  ? 9.954   -2.210  -0.819  1.00 0.00 ? 10  LEU A HD21 4  
ATOM 5641  H HD22 . LEU A 1 10  ? 10.561  -2.375  0.829   1.00 0.00 ? 10  LEU A HD22 4  
ATOM 5642  H HD23 . LEU A 1 10  ? 9.882   -0.840  0.287   1.00 0.00 ? 10  LEU A HD23 4  
ATOM 5643  N N    . VAL A 1 11  ? 11.026  -2.014  -4.793  1.00 0.00 ? 11  VAL A N    4  
ATOM 5644  C CA   . VAL A 1 11  ? 9.943   -2.433  -5.722  1.00 0.00 ? 11  VAL A CA   4  
ATOM 5645  C C    . VAL A 1 11  ? 10.505  -3.235  -6.888  1.00 0.00 ? 11  VAL A C    4  
ATOM 5646  O O    . VAL A 1 11  ? 9.811   -4.056  -7.455  1.00 0.00 ? 11  VAL A O    4  
ATOM 5647  C CB   . VAL A 1 11  ? 9.201   -1.208  -6.241  1.00 0.00 ? 11  VAL A CB   4  
ATOM 5648  C CG1  . VAL A 1 11  ? 8.129   -1.642  -7.241  1.00 0.00 ? 11  VAL A CG1  4  
ATOM 5649  C CG2  . VAL A 1 11  ? 8.543   -0.486  -5.065  1.00 0.00 ? 11  VAL A CG2  4  
ATOM 5650  H H    . VAL A 1 11  ? 11.592  -1.239  -5.000  1.00 0.00 ? 11  VAL A H    4  
ATOM 5651  H HA   . VAL A 1 11  ? 9.255   -3.071  -5.175  1.00 0.00 ? 11  VAL A HA   4  
ATOM 5652  H HB   . VAL A 1 11  ? 9.902   -0.547  -6.726  1.00 0.00 ? 11  VAL A HB   4  
ATOM 5653  H HG11 . VAL A 1 11  ? 7.655   -2.547  -6.890  1.00 0.00 ? 11  VAL A HG11 4  
ATOM 5654  H HG12 . VAL A 1 11  ? 7.388   -0.862  -7.337  1.00 0.00 ? 11  VAL A HG12 4  
ATOM 5655  H HG13 . VAL A 1 11  ? 8.586   -1.825  -8.203  1.00 0.00 ? 11  VAL A HG13 4  
ATOM 5656  H HG21 . VAL A 1 11  ? 7.917   -1.178  -4.522  1.00 0.00 ? 11  VAL A HG21 4  
ATOM 5657  H HG22 . VAL A 1 11  ? 9.307   -0.100  -4.406  1.00 0.00 ? 11  VAL A HG22 4  
ATOM 5658  H HG23 . VAL A 1 11  ? 7.942   0.332   -5.435  1.00 0.00 ? 11  VAL A HG23 4  
ATOM 5659  N N    . GLY A 1 12  ? 11.754  -3.048  -7.240  1.00 0.00 ? 12  GLY A N    4  
ATOM 5660  C CA   . GLY A 1 12  ? 12.323  -3.872  -8.354  1.00 0.00 ? 12  GLY A CA   4  
ATOM 5661  C C    . GLY A 1 12  ? 11.891  -5.314  -8.093  1.00 0.00 ? 12  GLY A C    4  
ATOM 5662  O O    . GLY A 1 12  ? 11.707  -6.113  -8.990  1.00 0.00 ? 12  GLY A O    4  
ATOM 5663  H H    . GLY A 1 12  ? 12.314  -2.403  -6.761  1.00 0.00 ? 12  GLY A H    4  
ATOM 5664  H HA2  . GLY A 1 12  ? 11.933  -3.529  -9.303  1.00 0.00 ? 12  GLY A HA2  4  
ATOM 5665  H HA3  . GLY A 1 12  ? 13.400  -3.811  -8.348  1.00 0.00 ? 12  GLY A HA3  4  
ATOM 5666  N N    . THR A 1 13  ? 11.691  -5.608  -6.838  1.00 0.00 ? 13  THR A N    4  
ATOM 5667  C CA   . THR A 1 13  ? 11.225  -6.939  -6.402  1.00 0.00 ? 13  THR A CA   4  
ATOM 5668  C C    . THR A 1 13  ? 10.999  -6.856  -4.905  1.00 0.00 ? 13  THR A C    4  
ATOM 5669  O O    . THR A 1 13  ? 10.000  -7.301  -4.420  1.00 0.00 ? 13  THR A O    4  
ATOM 5670  C CB   . THR A 1 13  ? 12.268  -8.026  -6.688  1.00 0.00 ? 13  THR A CB   4  
ATOM 5671  O OG1  . THR A 1 13  ? 12.157  -9.043  -5.702  1.00 0.00 ? 13  THR A OG1  4  
ATOM 5672  C CG2  . THR A 1 13  ? 13.688  -7.444  -6.652  1.00 0.00 ? 13  THR A CG2  4  
ATOM 5673  H H    . THR A 1 13  ? 11.833  -4.919  -6.159  1.00 0.00 ? 13  THR A H    4  
ATOM 5674  H HA   . THR A 1 13  ? 10.286  -7.178  -6.895  1.00 0.00 ? 13  THR A HA   4  
ATOM 5675  H HB   . THR A 1 13  ? 12.081  -8.453  -7.651  1.00 0.00 ? 13  THR A HB   4  
ATOM 5676  H HG1  . THR A 1 13  ? 11.558  -9.715  -6.034  1.00 0.00 ? 13  THR A HG1  4  
ATOM 5677  H HG21 . THR A 1 13  ? 13.647  -6.367  -6.659  1.00 0.00 ? 13  THR A HG21 4  
ATOM 5678  H HG22 . THR A 1 13  ? 14.188  -7.775  -5.753  1.00 0.00 ? 13  THR A HG22 4  
ATOM 5679  H HG23 . THR A 1 13  ? 14.239  -7.787  -7.514  1.00 0.00 ? 13  THR A HG23 4  
ATOM 5680  N N    . GLY A 1 14  ? 11.942  -6.254  -4.208  1.00 0.00 ? 14  GLY A N    4  
ATOM 5681  C CA   . GLY A 1 14  ? 11.884  -6.069  -2.713  1.00 0.00 ? 14  GLY A CA   4  
ATOM 5682  C C    . GLY A 1 14  ? 10.811  -6.937  -2.049  1.00 0.00 ? 14  GLY A C    4  
ATOM 5683  O O    . GLY A 1 14  ? 10.111  -6.485  -1.165  1.00 0.00 ? 14  GLY A O    4  
ATOM 5684  H H    . GLY A 1 14  ? 12.710  -5.893  -4.689  1.00 0.00 ? 14  GLY A H    4  
ATOM 5685  H HA2  . GLY A 1 14  ? 12.845  -6.327  -2.294  1.00 0.00 ? 14  GLY A HA2  4  
ATOM 5686  H HA3  . GLY A 1 14  ? 11.679  -5.033  -2.496  1.00 0.00 ? 14  GLY A HA3  4  
ATOM 5687  N N    . ALA A 1 15  ? 10.659  -8.161  -2.480  1.00 0.00 ? 15  ALA A N    4  
ATOM 5688  C CA   . ALA A 1 15  ? 9.613   -9.059  -1.895  1.00 0.00 ? 15  ALA A CA   4  
ATOM 5689  C C    . ALA A 1 15  ? 8.301   -8.821  -2.642  1.00 0.00 ? 15  ALA A C    4  
ATOM 5690  O O    . ALA A 1 15  ? 7.510   -9.722  -2.838  1.00 0.00 ? 15  ALA A O    4  
ATOM 5691  C CB   . ALA A 1 15  ? 9.425   -8.769  -0.403  1.00 0.00 ? 15  ALA A CB   4  
ATOM 5692  H H    . ALA A 1 15  ? 11.217  -8.481  -3.221  1.00 0.00 ? 15  ALA A H    4  
ATOM 5693  H HA   . ALA A 1 15  ? 9.913   -10.088 -2.027  1.00 0.00 ? 15  ALA A HA   4  
ATOM 5694  H HB1  . ALA A 1 15  ? 10.379  -8.525  0.040   1.00 0.00 ? 15  ALA A HB1  4  
ATOM 5695  H HB2  . ALA A 1 15  ? 8.747   -7.936  -0.280  1.00 0.00 ? 15  ALA A HB2  4  
ATOM 5696  H HB3  . ALA A 1 15  ? 9.014   -9.641  0.085   1.00 0.00 ? 15  ALA A HB3  4  
ATOM 5697  N N    . VAL A 1 16  ? 8.085   -7.614  -3.091  1.00 0.00 ? 16  VAL A N    4  
ATOM 5698  C CA   . VAL A 1 16  ? 6.853   -7.307  -3.863  1.00 0.00 ? 16  VAL A CA   4  
ATOM 5699  C C    . VAL A 1 16  ? 7.226   -7.266  -5.349  1.00 0.00 ? 16  VAL A C    4  
ATOM 5700  O O    . VAL A 1 16  ? 8.196   -6.643  -5.732  1.00 0.00 ? 16  VAL A O    4  
ATOM 5701  C CB   . VAL A 1 16  ? 6.299   -5.944  -3.435  1.00 0.00 ? 16  VAL A CB   4  
ATOM 5702  C CG1  . VAL A 1 16  ? 5.397   -6.120  -2.214  1.00 0.00 ? 16  VAL A CG1  4  
ATOM 5703  C CG2  . VAL A 1 16  ? 7.456   -5.005  -3.078  1.00 0.00 ? 16  VAL A CG2  4  
ATOM 5704  H H    . VAL A 1 16  ? 8.753   -6.913  -2.944  1.00 0.00 ? 16  VAL A H    4  
ATOM 5705  H HA   . VAL A 1 16  ? 6.113   -8.076  -3.694  1.00 0.00 ? 16  VAL A HA   4  
ATOM 5706  H HB   . VAL A 1 16  ? 5.726   -5.519  -4.247  1.00 0.00 ? 16  VAL A HB   4  
ATOM 5707  H HG11 . VAL A 1 16  ? 5.450   -7.143  -1.871  1.00 0.00 ? 16  VAL A HG11 4  
ATOM 5708  H HG12 . VAL A 1 16  ? 5.727   -5.459  -1.425  1.00 0.00 ? 16  VAL A HG12 4  
ATOM 5709  H HG13 . VAL A 1 16  ? 4.378   -5.882  -2.481  1.00 0.00 ? 16  VAL A HG13 4  
ATOM 5710  H HG21 . VAL A 1 16  ? 8.302   -5.217  -3.715  1.00 0.00 ? 16  VAL A HG21 4  
ATOM 5711  H HG22 . VAL A 1 16  ? 7.146   -3.980  -3.220  1.00 0.00 ? 16  VAL A HG22 4  
ATOM 5712  H HG23 . VAL A 1 16  ? 7.736   -5.156  -2.047  1.00 0.00 ? 16  VAL A HG23 4  
ATOM 5713  N N    . THR A 1 17  ? 6.471   -7.917  -6.191  1.00 0.00 ? 17  THR A N    4  
ATOM 5714  C CA   . THR A 1 17  ? 6.800   -7.902  -7.647  1.00 0.00 ? 17  THR A CA   4  
ATOM 5715  C C    . THR A 1 17  ? 6.168   -6.670  -8.294  1.00 0.00 ? 17  THR A C    4  
ATOM 5716  O O    . THR A 1 17  ? 5.966   -6.613  -9.490  1.00 0.00 ? 17  THR A O    4  
ATOM 5717  C CB   . THR A 1 17  ? 6.252   -9.168  -8.311  1.00 0.00 ? 17  THR A CB   4  
ATOM 5718  O OG1  . THR A 1 17  ? 5.060   -9.568  -7.650  1.00 0.00 ? 17  THR A OG1  4  
ATOM 5719  C CG2  . THR A 1 17  ? 7.293   -10.285 -8.216  1.00 0.00 ? 17  THR A CG2  4  
ATOM 5720  H H    . THR A 1 17  ? 5.690   -8.411  -5.869  1.00 0.00 ? 17  THR A H    4  
ATOM 5721  H HA   . THR A 1 17  ? 7.872   -7.864  -7.772  1.00 0.00 ? 17  THR A HA   4  
ATOM 5722  H HB   . THR A 1 17  ? 6.040   -8.967  -9.350  1.00 0.00 ? 17  THR A HB   4  
ATOM 5723  H HG1  . THR A 1 17  ? 4.608   -8.776  -7.351  1.00 0.00 ? 17  THR A HG1  4  
ATOM 5724  H HG21 . THR A 1 17  ? 8.201   -9.894  -7.783  1.00 0.00 ? 17  THR A HG21 4  
ATOM 5725  H HG22 . THR A 1 17  ? 6.911   -11.082 -7.596  1.00 0.00 ? 17  THR A HG22 4  
ATOM 5726  H HG23 . THR A 1 17  ? 7.501   -10.668 -9.206  1.00 0.00 ? 17  THR A HG23 4  
ATOM 5727  N N    . GLN A 1 18  ? 5.861   -5.684  -7.503  1.00 0.00 ? 18  GLN A N    4  
ATOM 5728  C CA   . GLN A 1 18  ? 5.243   -4.439  -8.040  1.00 0.00 ? 18  GLN A CA   4  
ATOM 5729  C C    . GLN A 1 18  ? 5.070   -3.445  -6.891  1.00 0.00 ? 18  GLN A C    4  
ATOM 5730  O O    . GLN A 1 18  ? 5.349   -3.753  -5.748  1.00 0.00 ? 18  GLN A O    4  
ATOM 5731  C CB   . GLN A 1 18  ? 3.867   -4.757  -8.636  1.00 0.00 ? 18  GLN A CB   4  
ATOM 5732  C CG   . GLN A 1 18  ? 4.006   -5.076  -10.125 1.00 0.00 ? 18  GLN A CG   4  
ATOM 5733  C CD   . GLN A 1 18  ? 3.549   -6.515  -10.381 1.00 0.00 ? 18  GLN A CD   4  
ATOM 5734  O OE1  . GLN A 1 18  ? 4.220   -7.265  -11.061 1.00 0.00 ? 18  GLN A OE1  4  
ATOM 5735  N NE2  . GLN A 1 18  ? 2.427   -6.930  -9.861  1.00 0.00 ? 18  GLN A NE2  4  
ATOM 5736  H H    . GLN A 1 18  ? 6.042   -5.763  -6.545  1.00 0.00 ? 18  GLN A H    4  
ATOM 5737  H HA   . GLN A 1 18  ? 5.881   -4.013  -8.799  1.00 0.00 ? 18  GLN A HA   4  
ATOM 5738  H HB2  . GLN A 1 18  ? 3.443   -5.607  -8.126  1.00 0.00 ? 18  GLN A HB2  4  
ATOM 5739  H HB3  . GLN A 1 18  ? 3.218   -3.903  -8.514  1.00 0.00 ? 18  GLN A HB3  4  
ATOM 5740  H HG2  . GLN A 1 18  ? 3.390   -4.398  -10.697 1.00 0.00 ? 18  GLN A HG2  4  
ATOM 5741  H HG3  . GLN A 1 18  ? 5.038   -4.969  -10.424 1.00 0.00 ? 18  GLN A HG3  4  
ATOM 5742  H HE21 . GLN A 1 18  ? 1.887   -6.324  -9.311  1.00 0.00 ? 18  GLN A HE21 4  
ATOM 5743  H HE22 . GLN A 1 18  ? 2.124   -7.848  -10.020 1.00 0.00 ? 18  GLN A HE22 4  
ATOM 5744  N N    . ALA A 1 19  ? 4.613   -2.257  -7.174  1.00 0.00 ? 19  ALA A N    4  
ATOM 5745  C CA   . ALA A 1 19  ? 4.427   -1.262  -6.080  1.00 0.00 ? 19  ALA A CA   4  
ATOM 5746  C C    . ALA A 1 19  ? 4.019   0.091   -6.664  1.00 0.00 ? 19  ALA A C    4  
ATOM 5747  O O    . ALA A 1 19  ? 4.122   0.326   -7.852  1.00 0.00 ? 19  ALA A O    4  
ATOM 5748  C CB   . ALA A 1 19  ? 5.734   -1.108  -5.306  1.00 0.00 ? 19  ALA A CB   4  
ATOM 5749  H H    . ALA A 1 19  ? 4.390   -2.021  -8.099  1.00 0.00 ? 19  ALA A H    4  
ATOM 5750  H HA   . ALA A 1 19  ? 3.656   -1.606  -5.409  1.00 0.00 ? 19  ALA A HA   4  
ATOM 5751  H HB1  . ALA A 1 19  ? 6.437   -1.858  -5.633  1.00 0.00 ? 19  ALA A HB1  4  
ATOM 5752  H HB2  . ALA A 1 19  ? 6.145   -0.126  -5.484  1.00 0.00 ? 19  ALA A HB2  4  
ATOM 5753  H HB3  . ALA A 1 19  ? 5.543   -1.231  -4.249  1.00 0.00 ? 19  ALA A HB3  4  
ATOM 5754  N N    . ALA A 1 20  ? 3.557   0.980   -5.830  1.00 0.00 ? 20  ALA A N    4  
ATOM 5755  C CA   . ALA A 1 20  ? 3.140   2.324   -6.317  1.00 0.00 ? 20  ALA A CA   4  
ATOM 5756  C C    . ALA A 1 20  ? 3.036   3.274   -5.124  1.00 0.00 ? 20  ALA A C    4  
ATOM 5757  O O    . ALA A 1 20  ? 2.502   2.929   -4.089  1.00 0.00 ? 20  ALA A O    4  
ATOM 5758  C CB   . ALA A 1 20  ? 1.776   2.224   -7.006  1.00 0.00 ? 20  ALA A CB   4  
ATOM 5759  H H    . ALA A 1 20  ? 3.486   0.763   -4.878  1.00 0.00 ? 20  ALA A H    4  
ATOM 5760  H HA   . ALA A 1 20  ? 3.872   2.699   -7.016  1.00 0.00 ? 20  ALA A HA   4  
ATOM 5761  H HB1  . ALA A 1 20  ? 1.430   1.200   -6.977  1.00 0.00 ? 20  ALA A HB1  4  
ATOM 5762  H HB2  . ALA A 1 20  ? 1.066   2.858   -6.494  1.00 0.00 ? 20  ALA A HB2  4  
ATOM 5763  H HB3  . ALA A 1 20  ? 1.867   2.543   -8.034  1.00 0.00 ? 20  ALA A HB3  4  
ATOM 5764  N N    . ILE A 1 21  ? 3.536   4.471   -5.256  1.00 0.00 ? 21  ILE A N    4  
ATOM 5765  C CA   . ILE A 1 21  ? 3.451   5.434   -4.123  1.00 0.00 ? 21  ILE A CA   4  
ATOM 5766  C C    . ILE A 1 21  ? 2.203   6.299   -4.315  1.00 0.00 ? 21  ILE A C    4  
ATOM 5767  O O    . ILE A 1 21  ? 2.288   7.490   -4.543  1.00 0.00 ? 21  ILE A O    4  
ATOM 5768  C CB   . ILE A 1 21  ? 4.698   6.330   -4.084  1.00 0.00 ? 21  ILE A CB   4  
ATOM 5769  C CG1  . ILE A 1 21  ? 5.928   5.556   -4.587  1.00 0.00 ? 21  ILE A CG1  4  
ATOM 5770  C CG2  . ILE A 1 21  ? 4.943   6.795   -2.643  1.00 0.00 ? 21  ILE A CG2  4  
ATOM 5771  C CD1  . ILE A 1 21  ? 6.480   4.654   -3.475  1.00 0.00 ? 21  ILE A CD1  4  
ATOM 5772  H H    . ILE A 1 21  ? 3.957   4.737   -6.099  1.00 0.00 ? 21  ILE A H    4  
ATOM 5773  H HA   . ILE A 1 21  ? 3.368   4.888   -3.194  1.00 0.00 ? 21  ILE A HA   4  
ATOM 5774  H HB   . ILE A 1 21  ? 4.533   7.194   -4.712  1.00 0.00 ? 21  ILE A HB   4  
ATOM 5775  H HG12 . ILE A 1 21  ? 5.650   4.951   -5.435  1.00 0.00 ? 21  ILE A HG12 4  
ATOM 5776  H HG13 . ILE A 1 21  ? 6.691   6.259   -4.885  1.00 0.00 ? 21  ILE A HG13 4  
ATOM 5777  H HG21 . ILE A 1 21  ? 4.055   7.272   -2.262  1.00 0.00 ? 21  ILE A HG21 4  
ATOM 5778  H HG22 . ILE A 1 21  ? 5.186   5.941   -2.026  1.00 0.00 ? 21  ILE A HG22 4  
ATOM 5779  H HG23 . ILE A 1 21  ? 5.766   7.495   -2.627  1.00 0.00 ? 21  ILE A HG23 4  
ATOM 5780  H HD11 . ILE A 1 21  ? 6.701   5.252   -2.603  1.00 0.00 ? 21  ILE A HD11 4  
ATOM 5781  H HD12 . ILE A 1 21  ? 5.744   3.905   -3.219  1.00 0.00 ? 21  ILE A HD12 4  
ATOM 5782  H HD13 . ILE A 1 21  ? 7.383   4.171   -3.817  1.00 0.00 ? 21  ILE A HD13 4  
ATOM 5783  N N    . LEU A 1 22  ? 1.044   5.704   -4.227  1.00 0.00 ? 22  LEU A N    4  
ATOM 5784  C CA   . LEU A 1 22  ? -0.214  6.482   -4.405  1.00 0.00 ? 22  LEU A CA   4  
ATOM 5785  C C    . LEU A 1 22  ? -0.284  7.567   -3.327  1.00 0.00 ? 22  LEU A C    4  
ATOM 5786  O O    . LEU A 1 22  ? -0.462  7.286   -2.158  1.00 0.00 ? 22  LEU A O    4  
ATOM 5787  C CB   . LEU A 1 22  ? -1.420  5.542   -4.281  1.00 0.00 ? 22  LEU A CB   4  
ATOM 5788  C CG   . LEU A 1 22  ? -1.188  4.290   -5.136  1.00 0.00 ? 22  LEU A CG   4  
ATOM 5789  C CD1  . LEU A 1 22  ? -2.458  3.436   -5.163  1.00 0.00 ? 22  LEU A CD1  4  
ATOM 5790  C CD2  . LEU A 1 22  ? -0.830  4.706   -6.565  1.00 0.00 ? 22  LEU A CD2  4  
ATOM 5791  H H    . LEU A 1 22  ? 1.004   4.742   -4.045  1.00 0.00 ? 22  LEU A H    4  
ATOM 5792  H HA   . LEU A 1 22  ? -0.216  6.944   -5.382  1.00 0.00 ? 22  LEU A HA   4  
ATOM 5793  H HB2  . LEU A 1 22  ? -1.546  5.253   -3.248  1.00 0.00 ? 22  LEU A HB2  4  
ATOM 5794  H HB3  . LEU A 1 22  ? -2.309  6.049   -4.624  1.00 0.00 ? 22  LEU A HB3  4  
ATOM 5795  H HG   . LEU A 1 22  ? -0.378  3.713   -4.716  1.00 0.00 ? 22  LEU A HG   4  
ATOM 5796  H HD11 . LEU A 1 22  ? -3.013  3.586   -4.249  1.00 0.00 ? 22  LEU A HD11 4  
ATOM 5797  H HD12 . LEU A 1 22  ? -3.067  3.723   -6.006  1.00 0.00 ? 22  LEU A HD12 4  
ATOM 5798  H HD13 . LEU A 1 22  ? -2.187  2.394   -5.254  1.00 0.00 ? 22  LEU A HD13 4  
ATOM 5799  H HD21 . LEU A 1 22  ? -1.618  5.325   -6.967  1.00 0.00 ? 22  LEU A HD21 4  
ATOM 5800  H HD22 . LEU A 1 22  ? 0.096   5.261   -6.557  1.00 0.00 ? 22  LEU A HD22 4  
ATOM 5801  H HD23 . LEU A 1 22  ? -0.717  3.824   -7.178  1.00 0.00 ? 22  LEU A HD23 4  
ATOM 5802  N N    . GLY A 1 23  ? -0.129  8.806   -3.710  1.00 0.00 ? 23  GLY A N    4  
ATOM 5803  C CA   . GLY A 1 23  ? -0.168  9.914   -2.712  1.00 0.00 ? 23  GLY A CA   4  
ATOM 5804  C C    . GLY A 1 23  ? -1.523  9.943   -1.998  1.00 0.00 ? 23  GLY A C    4  
ATOM 5805  O O    . GLY A 1 23  ? -2.507  9.425   -2.487  1.00 0.00 ? 23  GLY A O    4  
ATOM 5806  H H    . GLY A 1 23  ? 0.025   9.008   -4.657  1.00 0.00 ? 23  GLY A H    4  
ATOM 5807  H HA2  . GLY A 1 23  ? 0.618   9.767   -1.985  1.00 0.00 ? 23  GLY A HA2  4  
ATOM 5808  H HA3  . GLY A 1 23  ? -0.015  10.856  -3.218  1.00 0.00 ? 23  GLY A HA3  4  
ATOM 5809  N N    . LEU A 1 24  ? -1.577  10.558  -0.845  1.00 0.00 ? 24  LEU A N    4  
ATOM 5810  C CA   . LEU A 1 24  ? -2.864  10.639  -0.094  1.00 0.00 ? 24  LEU A CA   4  
ATOM 5811  C C    . LEU A 1 24  ? -3.389  12.075  -0.139  1.00 0.00 ? 24  LEU A C    4  
ATOM 5812  O O    . LEU A 1 24  ? -4.486  12.360  0.302   1.00 0.00 ? 24  LEU A O    4  
ATOM 5813  C CB   . LEU A 1 24  ? -2.638  10.228  1.366   1.00 0.00 ? 24  LEU A CB   4  
ATOM 5814  C CG   . LEU A 1 24  ? -1.892  11.338  2.109   1.00 0.00 ? 24  LEU A CG   4  
ATOM 5815  C CD1  . LEU A 1 24  ? -2.827  11.983  3.134   1.00 0.00 ? 24  LEU A CD1  4  
ATOM 5816  C CD2  . LEU A 1 24  ? -0.680  10.741  2.831   1.00 0.00 ? 24  LEU A CD2  4  
ATOM 5817  H H    . LEU A 1 24  ? -0.770  10.975  -0.476  1.00 0.00 ? 24  LEU A H    4  
ATOM 5818  H HA   . LEU A 1 24  ? -3.587  9.976   -0.546  1.00 0.00 ? 24  LEU A HA   4  
ATOM 5819  H HB2  . LEU A 1 24  ? -3.592  10.054  1.840   1.00 0.00 ? 24  LEU A HB2  4  
ATOM 5820  H HB3  . LEU A 1 24  ? -2.053  9.327   1.398   1.00 0.00 ? 24  LEU A HB3  4  
ATOM 5821  H HG   . LEU A 1 24  ? -1.562  12.087  1.403   1.00 0.00 ? 24  LEU A HG   4  
ATOM 5822  H HD11 . LEU A 1 24  ? -3.719  12.331  2.637   1.00 0.00 ? 24  LEU A HD11 4  
ATOM 5823  H HD12 . LEU A 1 24  ? -3.092  11.256  3.886   1.00 0.00 ? 24  LEU A HD12 4  
ATOM 5824  H HD13 . LEU A 1 24  ? -2.325  12.818  3.602   1.00 0.00 ? 24  LEU A HD13 4  
ATOM 5825  H HD21 . LEU A 1 24  ? -0.660  9.672   2.678   1.00 0.00 ? 24  LEU A HD21 4  
ATOM 5826  H HD22 . LEU A 1 24  ? 0.227   11.178  2.437   1.00 0.00 ? 24  LEU A HD22 4  
ATOM 5827  H HD23 . LEU A 1 24  ? -0.750  10.951  3.888   1.00 0.00 ? 24  LEU A HD23 4  
ATOM 5828  N N    . ASP A 1 25  ? -2.613  12.981  -0.665  1.00 0.00 ? 25  ASP A N    4  
ATOM 5829  C CA   . ASP A 1 25  ? -3.058  14.400  -0.735  1.00 0.00 ? 25  ASP A CA   4  
ATOM 5830  C C    . ASP A 1 25  ? -2.553  15.025  -2.037  1.00 0.00 ? 25  ASP A C    4  
ATOM 5831  O O    . ASP A 1 25  ? -2.212  16.190  -2.087  1.00 0.00 ? 25  ASP A O    4  
ATOM 5832  C CB   . ASP A 1 25  ? -2.480  15.169  0.455   1.00 0.00 ? 25  ASP A CB   4  
ATOM 5833  C CG   . ASP A 1 25  ? -3.560  16.062  1.064   1.00 0.00 ? 25  ASP A CG   4  
ATOM 5834  O OD1  . ASP A 1 25  ? -4.571  16.267  0.411   1.00 0.00 ? 25  ASP A OD1  4  
ATOM 5835  O OD2  . ASP A 1 25  ? -3.361  16.528  2.174   1.00 0.00 ? 25  ASP A OD2  4  
ATOM 5836  H H    . ASP A 1 25  ? -1.732  12.731  -1.011  1.00 0.00 ? 25  ASP A H    4  
ATOM 5837  H HA   . ASP A 1 25  ? -4.137  14.445  -0.706  1.00 0.00 ? 25  ASP A HA   4  
ATOM 5838  H HB2  . ASP A 1 25  ? -2.131  14.466  1.198   1.00 0.00 ? 25  ASP A HB2  4  
ATOM 5839  H HB3  . ASP A 1 25  ? -1.656  15.781  0.122   1.00 0.00 ? 25  ASP A HB3  4  
ATOM 5840  N N    . GLY A 1 26  ? -2.499  14.259  -3.092  1.00 0.00 ? 26  GLY A N    4  
ATOM 5841  C CA   . GLY A 1 26  ? -2.011  14.813  -4.387  1.00 0.00 ? 26  GLY A CA   4  
ATOM 5842  C C    . GLY A 1 26  ? -2.175  13.764  -5.489  1.00 0.00 ? 26  GLY A C    4  
ATOM 5843  O O    . GLY A 1 26  ? -1.420  13.728  -6.440  1.00 0.00 ? 26  GLY A O    4  
ATOM 5844  H H    . GLY A 1 26  ? -2.775  13.322  -3.034  1.00 0.00 ? 26  GLY A H    4  
ATOM 5845  H HA2  . GLY A 1 26  ? -2.584  15.694  -4.640  1.00 0.00 ? 26  GLY A HA2  4  
ATOM 5846  H HA3  . GLY A 1 26  ? -0.968  15.074  -4.297  1.00 0.00 ? 26  GLY A HA3  4  
ATOM 5847  N N    . ASN A 1 27  ? -3.153  12.910  -5.370  1.00 0.00 ? 27  ASN A N    4  
ATOM 5848  C CA   . ASN A 1 27  ? -3.359  11.869  -6.414  1.00 0.00 ? 27  ASN A CA   4  
ATOM 5849  C C    . ASN A 1 27  ? -2.157  10.920  -6.434  1.00 0.00 ? 27  ASN A C    4  
ATOM 5850  O O    . ASN A 1 27  ? -1.580  10.616  -5.409  1.00 0.00 ? 27  ASN A O    4  
ATOM 5851  C CB   . ASN A 1 27  ? -3.509  12.547  -7.777  1.00 0.00 ? 27  ASN A CB   4  
ATOM 5852  C CG   . ASN A 1 27  ? -4.384  13.793  -7.629  1.00 0.00 ? 27  ASN A CG   4  
ATOM 5853  O OD1  . ASN A 1 27  ? -5.355  13.783  -6.898  1.00 0.00 ? 27  ASN A OD1  4  
ATOM 5854  N ND2  . ASN A 1 27  ? -4.079  14.873  -8.293  1.00 0.00 ? 27  ASN A ND2  4  
ATOM 5855  H H    . ASN A 1 27  ? -3.753  12.954  -4.597  1.00 0.00 ? 27  ASN A H    4  
ATOM 5856  H HA   . ASN A 1 27  ? -4.255  11.308  -6.191  1.00 0.00 ? 27  ASN A HA   4  
ATOM 5857  H HB2  . ASN A 1 27  ? -2.535  12.831  -8.147  1.00 0.00 ? 27  ASN A HB2  4  
ATOM 5858  H HB3  . ASN A 1 27  ? -3.974  11.863  -8.472  1.00 0.00 ? 27  ASN A HB3  4  
ATOM 5859  H HD21 . ASN A 1 27  ? -3.296  14.882  -8.881  1.00 0.00 ? 27  ASN A HD21 4  
ATOM 5860  H HD22 . ASN A 1 27  ? -4.634  15.677  -8.202  1.00 0.00 ? 27  ASN A HD22 4  
ATOM 5861  N N    . THR A 1 28  ? -1.778  10.444  -7.589  1.00 0.00 ? 28  THR A N    4  
ATOM 5862  C CA   . THR A 1 28  ? -0.619  9.509   -7.667  1.00 0.00 ? 28  THR A CA   4  
ATOM 5863  C C    . THR A 1 28  ? 0.693   10.290  -7.554  1.00 0.00 ? 28  THR A C    4  
ATOM 5864  O O    . THR A 1 28  ? 0.798   11.420  -7.989  1.00 0.00 ? 28  THR A O    4  
ATOM 5865  C CB   . THR A 1 28  ? -0.652  8.769   -9.006  1.00 0.00 ? 28  THR A CB   4  
ATOM 5866  O OG1  . THR A 1 28  ? -1.919  8.148   -9.172  1.00 0.00 ? 28  THR A OG1  4  
ATOM 5867  C CG2  . THR A 1 28  ? 0.449   7.709   -9.034  1.00 0.00 ? 28  THR A CG2  4  
ATOM 5868  H H    . THR A 1 28  ? -2.258  10.695  -8.405  1.00 0.00 ? 28  THR A H    4  
ATOM 5869  H HA   . THR A 1 28  ? -0.681  8.794   -6.861  1.00 0.00 ? 28  THR A HA   4  
ATOM 5870  H HB   . THR A 1 28  ? -0.488  9.472   -9.809  1.00 0.00 ? 28  THR A HB   4  
ATOM 5871  H HG1  . THR A 1 28  ? -2.062  8.009   -10.111 1.00 0.00 ? 28  THR A HG1  4  
ATOM 5872  H HG21 . THR A 1 28  ? 0.454   7.170   -8.097  1.00 0.00 ? 28  THR A HG21 4  
ATOM 5873  H HG22 . THR A 1 28  ? 0.265   7.019   -9.844  1.00 0.00 ? 28  THR A HG22 4  
ATOM 5874  H HG23 . THR A 1 28  ? 1.407   8.186   -9.178  1.00 0.00 ? 28  THR A HG23 4  
ATOM 5875  N N    . TRP A 1 29  ? 1.698   9.688   -6.979  1.00 0.00 ? 29  TRP A N    4  
ATOM 5876  C CA   . TRP A 1 29  ? 3.011   10.378  -6.841  1.00 0.00 ? 29  TRP A CA   4  
ATOM 5877  C C    . TRP A 1 29  ? 4.046   9.643   -7.695  1.00 0.00 ? 29  TRP A C    4  
ATOM 5878  O O    . TRP A 1 29  ? 4.791   10.241  -8.446  1.00 0.00 ? 29  TRP A O    4  
ATOM 5879  C CB   . TRP A 1 29  ? 3.454   10.349  -5.376  1.00 0.00 ? 29  TRP A CB   4  
ATOM 5880  C CG   . TRP A 1 29  ? 2.876   11.522  -4.650  1.00 0.00 ? 29  TRP A CG   4  
ATOM 5881  C CD1  . TRP A 1 29  ? 1.702   12.123  -4.948  1.00 0.00 ? 29  TRP A CD1  4  
ATOM 5882  C CD2  . TRP A 1 29  ? 3.428   12.243  -3.511  1.00 0.00 ? 29  TRP A CD2  4  
ATOM 5883  N NE1  . TRP A 1 29  ? 1.498   13.168  -4.064  1.00 0.00 ? 29  TRP A NE1  4  
ATOM 5884  C CE2  . TRP A 1 29  ? 2.535   13.282  -3.160  1.00 0.00 ? 29  TRP A CE2  4  
ATOM 5885  C CE3  . TRP A 1 29  ? 4.606   12.097  -2.758  1.00 0.00 ? 29  TRP A CE3  4  
ATOM 5886  C CZ2  . TRP A 1 29  ? 2.801   14.146  -2.096  1.00 0.00 ? 29  TRP A CZ2  4  
ATOM 5887  C CZ3  . TRP A 1 29  ? 4.878   12.964  -1.687  1.00 0.00 ? 29  TRP A CZ3  4  
ATOM 5888  C CH2  . TRP A 1 29  ? 3.978   13.986  -1.358  1.00 0.00 ? 29  TRP A CH2  4  
ATOM 5889  H H    . TRP A 1 29  ? 1.590   8.775   -6.641  1.00 0.00 ? 29  TRP A H    4  
ATOM 5890  H HA   . TRP A 1 29  ? 2.923   11.401  -7.176  1.00 0.00 ? 29  TRP A HA   4  
ATOM 5891  H HB2  . TRP A 1 29  ? 3.107   9.436   -4.916  1.00 0.00 ? 29  TRP A HB2  4  
ATOM 5892  H HB3  . TRP A 1 29  ? 4.532   10.391  -5.327  1.00 0.00 ? 29  TRP A HB3  4  
ATOM 5893  H HD1  . TRP A 1 29  ? 1.033   11.835  -5.746  1.00 0.00 ? 29  TRP A HD1  4  
ATOM 5894  H HE1  . TRP A 1 29  ? 0.719   13.765  -4.063  1.00 0.00 ? 29  TRP A HE1  4  
ATOM 5895  H HE3  . TRP A 1 29  ? 5.305   11.311  -3.004  1.00 0.00 ? 29  TRP A HE3  4  
ATOM 5896  H HZ2  . TRP A 1 29  ? 2.106   14.933  -1.846  1.00 0.00 ? 29  TRP A HZ2  4  
ATOM 5897  H HZ3  . TRP A 1 29  ? 5.786   12.842  -1.114  1.00 0.00 ? 29  TRP A HZ3  4  
ATOM 5898  H HH2  . TRP A 1 29  ? 4.192   14.650  -0.533  1.00 0.00 ? 29  TRP A HH2  4  
ATOM 5899  N N    . ALA A 1 30  ? 4.088   8.342   -7.584  1.00 0.00 ? 30  ALA A N    4  
ATOM 5900  C CA   . ALA A 1 30  ? 5.063   7.547   -8.384  1.00 0.00 ? 30  ALA A CA   4  
ATOM 5901  C C    . ALA A 1 30  ? 4.508   6.132   -8.568  1.00 0.00 ? 30  ALA A C    4  
ATOM 5902  O O    . ALA A 1 30  ? 3.559   5.743   -7.918  1.00 0.00 ? 30  ALA A O    4  
ATOM 5903  C CB   . ALA A 1 30  ? 6.401   7.482   -7.643  1.00 0.00 ? 30  ALA A CB   4  
ATOM 5904  H H    . ALA A 1 30  ? 3.473   7.886   -6.972  1.00 0.00 ? 30  ALA A H    4  
ATOM 5905  H HA   . ALA A 1 30  ? 5.203   8.011   -9.349  1.00 0.00 ? 30  ALA A HA   4  
ATOM 5906  H HB1  . ALA A 1 30  ? 6.414   8.225   -6.860  1.00 0.00 ? 30  ALA A HB1  4  
ATOM 5907  H HB2  . ALA A 1 30  ? 6.525   6.500   -7.212  1.00 0.00 ? 30  ALA A HB2  4  
ATOM 5908  H HB3  . ALA A 1 30  ? 7.206   7.675   -8.337  1.00 0.00 ? 30  ALA A HB3  4  
ATOM 5909  N N    . THR A 1 31  ? 5.083   5.357   -9.446  1.00 0.00 ? 31  THR A N    4  
ATOM 5910  C CA   . THR A 1 31  ? 4.565   3.975   -9.652  1.00 0.00 ? 31  THR A CA   4  
ATOM 5911  C C    . THR A 1 31  ? 5.633   3.109   -10.322 1.00 0.00 ? 31  THR A C    4  
ATOM 5912  O O    . THR A 1 31  ? 6.557   3.604   -10.937 1.00 0.00 ? 31  THR A O    4  
ATOM 5913  C CB   . THR A 1 31  ? 3.321   4.024   -10.542 1.00 0.00 ? 31  THR A CB   4  
ATOM 5914  O OG1  . THR A 1 31  ? 2.806   2.710   -10.707 1.00 0.00 ? 31  THR A OG1  4  
ATOM 5915  C CG2  . THR A 1 31  ? 3.690   4.604   -11.908 1.00 0.00 ? 31  THR A CG2  4  
ATOM 5916  H H    . THR A 1 31  ? 5.847   5.682   -9.967  1.00 0.00 ? 31  THR A H    4  
ATOM 5917  H HA   . THR A 1 31  ? 4.305   3.544   -8.696  1.00 0.00 ? 31  THR A HA   4  
ATOM 5918  H HB   . THR A 1 31  ? 2.572   4.649   -10.081 1.00 0.00 ? 31  THR A HB   4  
ATOM 5919  H HG1  . THR A 1 31  ? 2.127   2.573   -10.042 1.00 0.00 ? 31  THR A HG1  4  
ATOM 5920  H HG21 . THR A 1 31  ? 4.510   4.038   -12.328 1.00 0.00 ? 31  THR A HG21 4  
ATOM 5921  H HG22 . THR A 1 31  ? 2.838   4.543   -12.568 1.00 0.00 ? 31  THR A HG22 4  
ATOM 5922  H HG23 . THR A 1 31  ? 3.985   5.636   -11.794 1.00 0.00 ? 31  THR A HG23 4  
ATOM 5923  N N    . SER A 1 32  ? 5.504   1.816   -10.206 1.00 0.00 ? 32  SER A N    4  
ATOM 5924  C CA   . SER A 1 32  ? 6.498   0.900   -10.832 1.00 0.00 ? 32  SER A CA   4  
ATOM 5925  C C    . SER A 1 32  ? 5.810   -0.420  -11.188 1.00 0.00 ? 32  SER A C    4  
ATOM 5926  O O    . SER A 1 32  ? 5.718   -1.322  -10.376 1.00 0.00 ? 32  SER A O    4  
ATOM 5927  C CB   . SER A 1 32  ? 7.635   0.634   -9.846  1.00 0.00 ? 32  SER A CB   4  
ATOM 5928  O OG   . SER A 1 32  ? 8.807   1.304   -10.291 1.00 0.00 ? 32  SER A OG   4  
ATOM 5929  H H    . SER A 1 32  ? 4.747   1.444   -9.707  1.00 0.00 ? 32  SER A H    4  
ATOM 5930  H HA   . SER A 1 32  ? 6.894   1.354   -11.727 1.00 0.00 ? 32  SER A HA   4  
ATOM 5931  H HB2  . SER A 1 32  ? 7.363   1.005   -8.871  1.00 0.00 ? 32  SER A HB2  4  
ATOM 5932  H HB3  . SER A 1 32  ? 7.817   -0.432  -9.786  1.00 0.00 ? 32  SER A HB3  4  
ATOM 5933  H HG   . SER A 1 32  ? 8.535   2.050   -10.830 1.00 0.00 ? 32  SER A HG   4  
ATOM 5934  N N    . ALA A 1 33  ? 5.322   -0.542  -12.392 1.00 0.00 ? 33  ALA A N    4  
ATOM 5935  C CA   . ALA A 1 33  ? 4.638   -1.803  -12.791 1.00 0.00 ? 33  ALA A CA   4  
ATOM 5936  C C    . ALA A 1 33  ? 3.964   -1.611  -14.149 1.00 0.00 ? 33  ALA A C    4  
ATOM 5937  O O    . ALA A 1 33  ? 4.185   -2.366  -15.076 1.00 0.00 ? 33  ALA A O    4  
ATOM 5938  C CB   . ALA A 1 33  ? 3.582   -2.158  -11.742 1.00 0.00 ? 33  ALA A CB   4  
ATOM 5939  H H    . ALA A 1 33  ? 5.402   0.196   -13.031 1.00 0.00 ? 33  ALA A H    4  
ATOM 5940  H HA   . ALA A 1 33  ? 5.362   -2.603  -12.857 1.00 0.00 ? 33  ALA A HA   4  
ATOM 5941  H HB1  . ALA A 1 33  ? 3.119   -1.253  -11.378 1.00 0.00 ? 33  ALA A HB1  4  
ATOM 5942  H HB2  . ALA A 1 33  ? 2.831   -2.793  -12.189 1.00 0.00 ? 33  ALA A HB2  4  
ATOM 5943  H HB3  . ALA A 1 33  ? 4.052   -2.678  -10.921 1.00 0.00 ? 33  ALA A HB3  4  
ATOM 5944  N N    . GLY A 1 34  ? 3.141   -0.608  -14.274 1.00 0.00 ? 34  GLY A N    4  
ATOM 5945  C CA   . GLY A 1 34  ? 2.452   -0.369  -15.573 1.00 0.00 ? 34  GLY A CA   4  
ATOM 5946  C C    . GLY A 1 34  ? 0.937   -0.408  -15.365 1.00 0.00 ? 34  GLY A C    4  
ATOM 5947  O O    . GLY A 1 34  ? 0.180   -0.592  -16.296 1.00 0.00 ? 34  GLY A O    4  
ATOM 5948  H H    . GLY A 1 34  ? 2.976   -0.012  -13.514 1.00 0.00 ? 34  GLY A H    4  
ATOM 5949  H HA2  . GLY A 1 34  ? 2.739   0.600   -15.958 1.00 0.00 ? 34  GLY A HA2  4  
ATOM 5950  H HA3  . GLY A 1 34  ? 2.735   -1.135  -16.277 1.00 0.00 ? 34  GLY A HA3  4  
ATOM 5951  N N    . PHE A 1 35  ? 0.488   -0.240  -14.152 1.00 0.00 ? 35  PHE A N    4  
ATOM 5952  C CA   . PHE A 1 35  ? -0.979  -0.271  -13.894 1.00 0.00 ? 35  PHE A CA   4  
ATOM 5953  C C    . PHE A 1 35  ? -1.399  1.013   -13.170 1.00 0.00 ? 35  PHE A C    4  
ATOM 5954  O O    . PHE A 1 35  ? -0.756  1.447   -12.235 1.00 0.00 ? 35  PHE A O    4  
ATOM 5955  C CB   . PHE A 1 35  ? -1.320  -1.495  -13.036 1.00 0.00 ? 35  PHE A CB   4  
ATOM 5956  C CG   . PHE A 1 35  ? -0.966  -1.229  -11.591 1.00 0.00 ? 35  PHE A CG   4  
ATOM 5957  C CD1  . PHE A 1 35  ? 0.376   -1.196  -11.191 1.00 0.00 ? 35  PHE A CD1  4  
ATOM 5958  C CD2  . PHE A 1 35  ? -1.982  -1.008  -10.653 1.00 0.00 ? 35  PHE A CD2  4  
ATOM 5959  C CE1  . PHE A 1 35  ? 0.700   -0.945  -9.853  1.00 0.00 ? 35  PHE A CE1  4  
ATOM 5960  C CE2  . PHE A 1 35  ? -1.658  -0.757  -9.316  1.00 0.00 ? 35  PHE A CE2  4  
ATOM 5961  C CZ   . PHE A 1 35  ? -0.317  -0.724  -8.916  1.00 0.00 ? 35  PHE A CZ   4  
ATOM 5962  H H    . PHE A 1 35  ? 1.114   -0.093  -13.411 1.00 0.00 ? 35  PHE A H    4  
ATOM 5963  H HA   . PHE A 1 35  ? -1.504  -0.336  -14.837 1.00 0.00 ? 35  PHE A HA   4  
ATOM 5964  H HB2  . PHE A 1 35  ? -2.376  -1.704  -13.114 1.00 0.00 ? 35  PHE A HB2  4  
ATOM 5965  H HB3  . PHE A 1 35  ? -0.760  -2.348  -13.390 1.00 0.00 ? 35  PHE A HB3  4  
ATOM 5966  H HD1  . PHE A 1 35  ? 1.160   -1.367  -11.914 1.00 0.00 ? 35  PHE A HD1  4  
ATOM 5967  H HD2  . PHE A 1 35  ? -3.017  -1.034  -10.962 1.00 0.00 ? 35  PHE A HD2  4  
ATOM 5968  H HE1  . PHE A 1 35  ? 1.735   -0.921  -9.543  1.00 0.00 ? 35  PHE A HE1  4  
ATOM 5969  H HE2  . PHE A 1 35  ? -2.441  -0.586  -8.592  1.00 0.00 ? 35  PHE A HE2  4  
ATOM 5970  H HZ   . PHE A 1 35  ? -0.066  -0.528  -7.883  1.00 0.00 ? 35  PHE A HZ   4  
ATOM 5971  N N    . ALA A 1 36  ? -2.471  1.623   -13.595 1.00 0.00 ? 36  ALA A N    4  
ATOM 5972  C CA   . ALA A 1 36  ? -2.929  2.876   -12.929 1.00 0.00 ? 36  ALA A CA   4  
ATOM 5973  C C    . ALA A 1 36  ? -4.216  2.594   -12.151 1.00 0.00 ? 36  ALA A C    4  
ATOM 5974  O O    . ALA A 1 36  ? -5.151  2.014   -12.667 1.00 0.00 ? 36  ALA A O    4  
ATOM 5975  C CB   . ALA A 1 36  ? -3.189  3.950   -13.986 1.00 0.00 ? 36  ALA A CB   4  
ATOM 5976  H H    . ALA A 1 36  ? -2.976  1.258   -14.351 1.00 0.00 ? 36  ALA A H    4  
ATOM 5977  H HA   . ALA A 1 36  ? -2.165  3.219   -12.247 1.00 0.00 ? 36  ALA A HA   4  
ATOM 5978  H HB1  . ALA A 1 36  ? -3.700  3.509   -14.830 1.00 0.00 ? 36  ALA A HB1  4  
ATOM 5979  H HB2  . ALA A 1 36  ? -3.803  4.731   -13.562 1.00 0.00 ? 36  ALA A HB2  4  
ATOM 5980  H HB3  . ALA A 1 36  ? -2.249  4.369   -14.312 1.00 0.00 ? 36  ALA A HB3  4  
ATOM 5981  N N    . VAL A 1 37  ? -4.270  3.000   -10.910 1.00 0.00 ? 37  VAL A N    4  
ATOM 5982  C CA   . VAL A 1 37  ? -5.492  2.752   -10.095 1.00 0.00 ? 37  VAL A CA   4  
ATOM 5983  C C    . VAL A 1 37  ? -6.562  3.788   -10.446 1.00 0.00 ? 37  VAL A C    4  
ATOM 5984  O O    . VAL A 1 37  ? -6.303  4.974   -10.495 1.00 0.00 ? 37  VAL A O    4  
ATOM 5985  C CB   . VAL A 1 37  ? -5.144  2.867   -8.609  1.00 0.00 ? 37  VAL A CB   4  
ATOM 5986  C CG1  . VAL A 1 37  ? -6.372  2.517   -7.768  1.00 0.00 ? 37  VAL A CG1  4  
ATOM 5987  C CG2  . VAL A 1 37  ? -4.006  1.898   -8.276  1.00 0.00 ? 37  VAL A CG2  4  
ATOM 5988  H H    . VAL A 1 37  ? -3.503  3.464   -10.514 1.00 0.00 ? 37  VAL A H    4  
ATOM 5989  H HA   . VAL A 1 37  ? -5.869  1.762   -10.301 1.00 0.00 ? 37  VAL A HA   4  
ATOM 5990  H HB   . VAL A 1 37  ? -4.834  3.879   -8.389  1.00 0.00 ? 37  VAL A HB   4  
ATOM 5991  H HG11 . VAL A 1 37  ? -6.959  1.769   -8.282  1.00 0.00 ? 37  VAL A HG11 4  
ATOM 5992  H HG12 . VAL A 1 37  ? -6.055  2.130   -6.810  1.00 0.00 ? 37  VAL A HG12 4  
ATOM 5993  H HG13 . VAL A 1 37  ? -6.970  3.403   -7.618  1.00 0.00 ? 37  VAL A HG13 4  
ATOM 5994  H HG21 . VAL A 1 37  ? -3.648  1.438   -9.185  1.00 0.00 ? 37  VAL A HG21 4  
ATOM 5995  H HG22 . VAL A 1 37  ? -3.199  2.438   -7.803  1.00 0.00 ? 37  VAL A HG22 4  
ATOM 5996  H HG23 . VAL A 1 37  ? -4.369  1.134   -7.604  1.00 0.00 ? 37  VAL A HG23 4  
ATOM 5997  N N    . THR A 1 38  ? -7.766  3.347   -10.690 1.00 0.00 ? 38  THR A N    4  
ATOM 5998  C CA   . THR A 1 38  ? -8.856  4.301   -11.034 1.00 0.00 ? 38  THR A CA   4  
ATOM 5999  C C    . THR A 1 38  ? -8.850  5.453   -10.020 1.00 0.00 ? 38  THR A C    4  
ATOM 6000  O O    . THR A 1 38  ? -8.913  5.219   -8.829  1.00 0.00 ? 38  THR A O    4  
ATOM 6001  C CB   . THR A 1 38  ? -10.201 3.571   -10.972 1.00 0.00 ? 38  THR A CB   4  
ATOM 6002  O OG1  . THR A 1 38  ? -10.072 2.296   -11.585 1.00 0.00 ? 38  THR A OG1  4  
ATOM 6003  C CG2  . THR A 1 38  ? -11.268 4.386   -11.706 1.00 0.00 ? 38  THR A CG2  4  
ATOM 6004  H H    . THR A 1 38  ? -7.953  2.385   -10.643 1.00 0.00 ? 38  THR A H    4  
ATOM 6005  H HA   . THR A 1 38  ? -8.697  4.682   -12.030 1.00 0.00 ? 38  THR A HA   4  
ATOM 6006  H HB   . THR A 1 38  ? -10.496 3.447   -9.942  1.00 0.00 ? 38  THR A HB   4  
ATOM 6007  H HG1  . THR A 1 38  ? -10.947 1.907   -11.650 1.00 0.00 ? 38  THR A HG1  4  
ATOM 6008  H HG21 . THR A 1 38  ? -10.893 5.378   -11.902 1.00 0.00 ? 38  THR A HG21 4  
ATOM 6009  H HG22 . THR A 1 38  ? -11.513 3.901   -12.640 1.00 0.00 ? 38  THR A HG22 4  
ATOM 6010  H HG23 . THR A 1 38  ? -12.156 4.452   -11.093 1.00 0.00 ? 38  THR A HG23 4  
ATOM 6011  N N    . PRO A 1 39  ? -8.775  6.666   -10.512 1.00 0.00 ? 39  PRO A N    4  
ATOM 6012  C CA   . PRO A 1 39  ? -8.759  7.856   -9.643  1.00 0.00 ? 39  PRO A CA   4  
ATOM 6013  C C    . PRO A 1 39  ? -10.026 7.895   -8.787  1.00 0.00 ? 39  PRO A C    4  
ATOM 6014  O O    . PRO A 1 39  ? -9.992  8.241   -7.622  1.00 0.00 ? 39  PRO A O    4  
ATOM 6015  C CB   . PRO A 1 39  ? -8.714  9.049   -10.608 1.00 0.00 ? 39  PRO A CB   4  
ATOM 6016  C CG   . PRO A 1 39  ? -8.673  8.484   -12.051 1.00 0.00 ? 39  PRO A CG   4  
ATOM 6017  C CD   . PRO A 1 39  ? -8.706  6.951   -11.955 1.00 0.00 ? 39  PRO A CD   4  
ATOM 6018  H HA   . PRO A 1 39  ? -7.880  7.855   -9.017  1.00 0.00 ? 39  PRO A HA   4  
ATOM 6019  H HB2  . PRO A 1 39  ? -9.595  9.660   -10.474 1.00 0.00 ? 39  PRO A HB2  4  
ATOM 6020  H HB3  . PRO A 1 39  ? -7.827  9.635   -10.424 1.00 0.00 ? 39  PRO A HB3  4  
ATOM 6021  H HG2  . PRO A 1 39  ? -9.530  8.838   -12.606 1.00 0.00 ? 39  PRO A HG2  4  
ATOM 6022  H HG3  . PRO A 1 39  ? -7.763  8.797   -12.541 1.00 0.00 ? 39  PRO A HG3  4  
ATOM 6023  H HD2  . PRO A 1 39  ? -9.578  6.565   -12.462 1.00 0.00 ? 39  PRO A HD2  4  
ATOM 6024  H HD3  . PRO A 1 39  ? -7.806  6.527   -12.375 1.00 0.00 ? 39  PRO A HD3  4  
ATOM 6025  N N    . ALA A 1 40  ? -11.144 7.537   -9.354  1.00 0.00 ? 40  ALA A N    4  
ATOM 6026  C CA   . ALA A 1 40  ? -12.410 7.547   -8.572  1.00 0.00 ? 40  ALA A CA   4  
ATOM 6027  C C    . ALA A 1 40  ? -12.262 6.620   -7.364  1.00 0.00 ? 40  ALA A C    4  
ATOM 6028  O O    . ALA A 1 40  ? -12.599 6.975   -6.252  1.00 0.00 ? 40  ALA A O    4  
ATOM 6029  C CB   . ALA A 1 40  ? -13.559 7.056   -9.453  1.00 0.00 ? 40  ALA A CB   4  
ATOM 6030  H H    . ALA A 1 40  ? -11.150 7.259   -10.294 1.00 0.00 ? 40  ALA A H    4  
ATOM 6031  H HA   . ALA A 1 40  ? -12.619 8.551   -8.233  1.00 0.00 ? 40  ALA A HA   4  
ATOM 6032  H HB1  . ALA A 1 40  ? -13.238 6.190   -10.014 1.00 0.00 ? 40  ALA A HB1  4  
ATOM 6033  H HB2  . ALA A 1 40  ? -14.402 6.789   -8.830  1.00 0.00 ? 40  ALA A HB2  4  
ATOM 6034  H HB3  . ALA A 1 40  ? -13.850 7.839   -10.136 1.00 0.00 ? 40  ALA A HB3  4  
ATOM 6035  N N    . GLN A 1 41  ? -11.755 5.435   -7.573  1.00 0.00 ? 41  GLN A N    4  
ATOM 6036  C CA   . GLN A 1 41  ? -11.584 4.488   -6.435  1.00 0.00 ? 41  GLN A CA   4  
ATOM 6037  C C    . GLN A 1 41  ? -10.601 5.085   -5.424  1.00 0.00 ? 41  GLN A C    4  
ATOM 6038  O O    . GLN A 1 41  ? -10.583 4.713   -4.268  1.00 0.00 ? 41  GLN A O    4  
ATOM 6039  C CB   . GLN A 1 41  ? -11.035 3.158   -6.955  1.00 0.00 ? 41  GLN A CB   4  
ATOM 6040  C CG   . GLN A 1 41  ? -12.196 2.211   -7.270  1.00 0.00 ? 41  GLN A CG   4  
ATOM 6041  C CD   . GLN A 1 41  ? -12.960 1.892   -5.984  1.00 0.00 ? 41  GLN A CD   4  
ATOM 6042  O OE1  . GLN A 1 41  ? -13.860 2.614   -5.601  1.00 0.00 ? 41  GLN A OE1  4  
ATOM 6043  N NE2  . GLN A 1 41  ? -12.640 0.829   -5.296  1.00 0.00 ? 41  GLN A NE2  4  
ATOM 6044  H H    . GLN A 1 41  ? -11.488 5.169   -8.476  1.00 0.00 ? 41  GLN A H    4  
ATOM 6045  H HA   . GLN A 1 41  ? -12.538 4.323   -5.957  1.00 0.00 ? 41  GLN A HA   4  
ATOM 6046  H HB2  . GLN A 1 41  ? -10.460 3.332   -7.853  1.00 0.00 ? 41  GLN A HB2  4  
ATOM 6047  H HB3  . GLN A 1 41  ? -10.403 2.710   -6.203  1.00 0.00 ? 41  GLN A HB3  4  
ATOM 6048  H HG2  . GLN A 1 41  ? -12.863 2.682   -7.977  1.00 0.00 ? 41  GLN A HG2  4  
ATOM 6049  H HG3  . GLN A 1 41  ? -11.810 1.296   -7.693  1.00 0.00 ? 41  GLN A HG3  4  
ATOM 6050  H HE21 . GLN A 1 41  ? -11.917 0.245   -5.605  1.00 0.00 ? 41  GLN A HE21 4  
ATOM 6051  H HE22 . GLN A 1 41  ? -13.124 0.616   -4.469  1.00 0.00 ? 41  GLN A HE22 4  
ATOM 6052  N N    . GLY A 1 42  ? -9.785  6.010   -5.850  1.00 0.00 ? 42  GLY A N    4  
ATOM 6053  C CA   . GLY A 1 42  ? -8.804  6.631   -4.914  1.00 0.00 ? 42  GLY A CA   4  
ATOM 6054  C C    . GLY A 1 42  ? -9.554  7.299   -3.759  1.00 0.00 ? 42  GLY A C    4  
ATOM 6055  O O    . GLY A 1 42  ? -9.051  7.401   -2.657  1.00 0.00 ? 42  GLY A O    4  
ATOM 6056  H H    . GLY A 1 42  ? -9.816  6.298   -6.787  1.00 0.00 ? 42  GLY A H    4  
ATOM 6057  H HA2  . GLY A 1 42  ? -8.146  5.867   -4.526  1.00 0.00 ? 42  GLY A HA2  4  
ATOM 6058  H HA3  . GLY A 1 42  ? -8.224  7.374   -5.439  1.00 0.00 ? 42  GLY A HA3  4  
ATOM 6059  N N    . GLN A 1 43  ? -10.753 7.756   -4.001  1.00 0.00 ? 43  GLN A N    4  
ATOM 6060  C CA   . GLN A 1 43  ? -11.534 8.418   -2.916  1.00 0.00 ? 43  GLN A CA   4  
ATOM 6061  C C    . GLN A 1 43  ? -11.900 7.385   -1.850  1.00 0.00 ? 43  GLN A C    4  
ATOM 6062  O O    . GLN A 1 43  ? -11.779 7.631   -0.666  1.00 0.00 ? 43  GLN A O    4  
ATOM 6063  C CB   . GLN A 1 43  ? -12.814 9.016   -3.504  1.00 0.00 ? 43  GLN A CB   4  
ATOM 6064  C CG   . GLN A 1 43  ? -12.578 10.485  -3.857  1.00 0.00 ? 43  GLN A CG   4  
ATOM 6065  C CD   . GLN A 1 43  ? -13.291 10.814  -5.170  1.00 0.00 ? 43  GLN A CD   4  
ATOM 6066  O OE1  . GLN A 1 43  ? -12.664 11.203  -6.134  1.00 0.00 ? 43  GLN A OE1  4  
ATOM 6067  N NE2  . GLN A 1 43  ? -14.586 10.670  -5.249  1.00 0.00 ? 43  GLN A NE2  4  
ATOM 6068  H H    . GLN A 1 43  ? -11.139 7.664   -4.896  1.00 0.00 ? 43  GLN A H    4  
ATOM 6069  H HA   . GLN A 1 43  ? -10.941 9.202   -2.470  1.00 0.00 ? 43  GLN A HA   4  
ATOM 6070  H HB2  . GLN A 1 43  ? -13.089 8.470   -4.395  1.00 0.00 ? 43  GLN A HB2  4  
ATOM 6071  H HB3  . GLN A 1 43  ? -13.609 8.945   -2.777  1.00 0.00 ? 43  GLN A HB3  4  
ATOM 6072  H HG2  . GLN A 1 43  ? -12.968 11.112  -3.067  1.00 0.00 ? 43  GLN A HG2  4  
ATOM 6073  H HG3  . GLN A 1 43  ? -11.520 10.664  -3.970  1.00 0.00 ? 43  GLN A HG3  4  
ATOM 6074  H HE21 . GLN A 1 43  ? -15.092 10.354  -4.472  1.00 0.00 ? 43  GLN A HE21 4  
ATOM 6075  H HE22 . GLN A 1 43  ? -15.053 10.878  -6.085  1.00 0.00 ? 43  GLN A HE22 4  
ATOM 6076  N N    . THR A 1 44  ? -12.347 6.229   -2.260  1.00 0.00 ? 44  THR A N    4  
ATOM 6077  C CA   . THR A 1 44  ? -12.721 5.181   -1.270  1.00 0.00 ? 44  THR A CA   4  
ATOM 6078  C C    . THR A 1 44  ? -11.523 4.885   -0.368  1.00 0.00 ? 44  THR A C    4  
ATOM 6079  O O    . THR A 1 44  ? -11.671 4.447   0.755   1.00 0.00 ? 44  THR A O    4  
ATOM 6080  C CB   . THR A 1 44  ? -13.131 3.905   -2.009  1.00 0.00 ? 44  THR A CB   4  
ATOM 6081  O OG1  . THR A 1 44  ? -14.389 4.109   -2.639  1.00 0.00 ? 44  THR A OG1  4  
ATOM 6082  C CG2  . THR A 1 44  ? -13.237 2.749   -1.015  1.00 0.00 ? 44  THR A CG2  4  
ATOM 6083  H H    . THR A 1 44  ? -12.438 6.051   -3.219  1.00 0.00 ? 44  THR A H    4  
ATOM 6084  H HA   . THR A 1 44  ? -13.547 5.531   -0.667  1.00 0.00 ? 44  THR A HA   4  
ATOM 6085  H HB   . THR A 1 44  ? -12.388 3.665   -2.755  1.00 0.00 ? 44  THR A HB   4  
ATOM 6086  H HG1  . THR A 1 44  ? -14.420 5.015   -2.952  1.00 0.00 ? 44  THR A HG1  4  
ATOM 6087  H HG21 . THR A 1 44  ? -13.897 3.028   -0.207  1.00 0.00 ? 44  THR A HG21 4  
ATOM 6088  H HG22 . THR A 1 44  ? -13.633 1.877   -1.517  1.00 0.00 ? 44  THR A HG22 4  
ATOM 6089  H HG23 . THR A 1 44  ? -12.258 2.523   -0.620  1.00 0.00 ? 44  THR A HG23 4  
ATOM 6090  N N    . LEU A 1 45  ? -10.334 5.120   -0.853  1.00 0.00 ? 45  LEU A N    4  
ATOM 6091  C CA   . LEU A 1 45  ? -9.126  4.852   -0.026  1.00 0.00 ? 45  LEU A CA   4  
ATOM 6092  C C    . LEU A 1 45  ? -9.000  5.928   1.056   1.00 0.00 ? 45  LEU A C    4  
ATOM 6093  O O    . LEU A 1 45  ? -8.687  5.643   2.195   1.00 0.00 ? 45  LEU A O    4  
ATOM 6094  C CB   . LEU A 1 45  ? -7.883  4.875   -0.919  1.00 0.00 ? 45  LEU A CB   4  
ATOM 6095  C CG   . LEU A 1 45  ? -6.699  4.277   -0.161  1.00 0.00 ? 45  LEU A CG   4  
ATOM 6096  C CD1  . LEU A 1 45  ? -6.741  2.750   -0.269  1.00 0.00 ? 45  LEU A CD1  4  
ATOM 6097  C CD2  . LEU A 1 45  ? -5.392  4.792   -0.766  1.00 0.00 ? 45  LEU A CD2  4  
ATOM 6098  H H    . LEU A 1 45  ? -10.238 5.473   -1.762  1.00 0.00 ? 45  LEU A H    4  
ATOM 6099  H HA   . LEU A 1 45  ? -9.216  3.881   0.440   1.00 0.00 ? 45  LEU A HA   4  
ATOM 6100  H HB2  . LEU A 1 45  ? -8.072  4.294   -1.810  1.00 0.00 ? 45  LEU A HB2  4  
ATOM 6101  H HB3  . LEU A 1 45  ? -7.655  5.894   -1.193  1.00 0.00 ? 45  LEU A HB3  4  
ATOM 6102  H HG   . LEU A 1 45  ? -6.756  4.565   0.879   1.00 0.00 ? 45  LEU A HG   4  
ATOM 6103  H HD11 . LEU A 1 45  ? -7.768  2.419   -0.275  1.00 0.00 ? 45  LEU A HD11 4  
ATOM 6104  H HD12 . LEU A 1 45  ? -6.258  2.442   -1.183  1.00 0.00 ? 45  LEU A HD12 4  
ATOM 6105  H HD13 . LEU A 1 45  ? -6.226  2.316   0.575   1.00 0.00 ? 45  LEU A HD13 4  
ATOM 6106  H HD21 . LEU A 1 45  ? -5.409  4.649   -1.836  1.00 0.00 ? 45  LEU A HD21 4  
ATOM 6107  H HD22 . LEU A 1 45  ? -5.284  5.845   -0.546  1.00 0.00 ? 45  LEU A HD22 4  
ATOM 6108  H HD23 . LEU A 1 45  ? -4.560  4.249   -0.342  1.00 0.00 ? 45  LEU A HD23 4  
ATOM 6109  N N    . ALA A 1 46  ? -9.247  7.162   0.710   1.00 0.00 ? 46  ALA A N    4  
ATOM 6110  C CA   . ALA A 1 46  ? -9.146  8.252   1.720   1.00 0.00 ? 46  ALA A CA   4  
ATOM 6111  C C    . ALA A 1 46  ? -10.220 8.049   2.789   1.00 0.00 ? 46  ALA A C    4  
ATOM 6112  O O    . ALA A 1 46  ? -9.945  8.064   3.972   1.00 0.00 ? 46  ALA A O    4  
ATOM 6113  C CB   . ALA A 1 46  ? -9.357  9.605   1.035   1.00 0.00 ? 46  ALA A CB   4  
ATOM 6114  H H    . ALA A 1 46  ? -9.503  7.371   -0.212  1.00 0.00 ? 46  ALA A H    4  
ATOM 6115  H HA   . ALA A 1 46  ? -8.169  8.230   2.180   1.00 0.00 ? 46  ALA A HA   4  
ATOM 6116  H HB1  . ALA A 1 46  ? -8.768  9.645   0.130   1.00 0.00 ? 46  ALA A HB1  4  
ATOM 6117  H HB2  . ALA A 1 46  ? -10.401 9.724   0.790   1.00 0.00 ? 46  ALA A HB2  4  
ATOM 6118  H HB3  . ALA A 1 46  ? -9.050  10.397  1.700   1.00 0.00 ? 46  ALA A HB3  4  
ATOM 6119  N N    . SER A 1 47  ? -11.443 7.854   2.380   1.00 0.00 ? 47  SER A N    4  
ATOM 6120  C CA   . SER A 1 47  ? -12.535 7.644   3.372   1.00 0.00 ? 47  SER A CA   4  
ATOM 6121  C C    . SER A 1 47  ? -12.307 6.316   4.097   1.00 0.00 ? 47  SER A C    4  
ATOM 6122  O O    . SER A 1 47  ? -12.875 6.060   5.141   1.00 0.00 ? 47  SER A O    4  
ATOM 6123  C CB   . SER A 1 47  ? -13.882 7.606   2.648   1.00 0.00 ? 47  SER A CB   4  
ATOM 6124  O OG   . SER A 1 47  ? -14.574 8.826   2.879   1.00 0.00 ? 47  SER A OG   4  
ATOM 6125  H H    . SER A 1 47  ? -11.642 7.843   1.420   1.00 0.00 ? 47  SER A H    4  
ATOM 6126  H HA   . SER A 1 47  ? -12.532 8.452   4.089   1.00 0.00 ? 47  SER A HA   4  
ATOM 6127  H HB2  . SER A 1 47  ? -13.722 7.485   1.590   1.00 0.00 ? 47  SER A HB2  4  
ATOM 6128  H HB3  . SER A 1 47  ? -14.465 6.774   3.020   1.00 0.00 ? 47  SER A HB3  4  
ATOM 6129  H HG   . SER A 1 47  ? -15.513 8.661   2.767   1.00 0.00 ? 47  SER A HG   4  
ATOM 6130  N N    . ALA A 1 48  ? -11.475 5.471   3.552   1.00 0.00 ? 48  ALA A N    4  
ATOM 6131  C CA   . ALA A 1 48  ? -11.203 4.160   4.206   1.00 0.00 ? 48  ALA A CA   4  
ATOM 6132  C C    . ALA A 1 48  ? -10.381 4.385   5.476   1.00 0.00 ? 48  ALA A C    4  
ATOM 6133  O O    . ALA A 1 48  ? -10.454 3.620   6.417   1.00 0.00 ? 48  ALA A O    4  
ATOM 6134  C CB   . ALA A 1 48  ? -10.418 3.265   3.246   1.00 0.00 ? 48  ALA A CB   4  
ATOM 6135  H H    . ALA A 1 48  ? -11.027 5.700   2.711   1.00 0.00 ? 48  ALA A H    4  
ATOM 6136  H HA   . ALA A 1 48  ? -12.139 3.682   4.460   1.00 0.00 ? 48  ALA A HA   4  
ATOM 6137  H HB1  . ALA A 1 48  ? -9.964  3.873   2.478   1.00 0.00 ? 48  ALA A HB1  4  
ATOM 6138  H HB2  . ALA A 1 48  ? -9.648  2.741   3.792   1.00 0.00 ? 48  ALA A HB2  4  
ATOM 6139  H HB3  . ALA A 1 48  ? -11.087 2.550   2.791   1.00 0.00 ? 48  ALA A HB3  4  
ATOM 6140  N N    . PHE A 1 49  ? -9.600  5.429   5.509   1.00 0.00 ? 49  PHE A N    4  
ATOM 6141  C CA   . PHE A 1 49  ? -8.775  5.702   6.719   1.00 0.00 ? 49  PHE A CA   4  
ATOM 6142  C C    . PHE A 1 49  ? -9.582  6.546   7.709   1.00 0.00 ? 49  PHE A C    4  
ATOM 6143  O O    . PHE A 1 49  ? -9.033  7.208   8.567   1.00 0.00 ? 49  PHE A O    4  
ATOM 6144  C CB   . PHE A 1 49  ? -7.508  6.460   6.312   1.00 0.00 ? 49  PHE A CB   4  
ATOM 6145  C CG   . PHE A 1 49  ? -6.604  5.540   5.527   1.00 0.00 ? 49  PHE A CG   4  
ATOM 6146  C CD1  . PHE A 1 49  ? -5.926  4.504   6.179   1.00 0.00 ? 49  PHE A CD1  4  
ATOM 6147  C CD2  . PHE A 1 49  ? -6.448  5.721   4.148   1.00 0.00 ? 49  PHE A CD2  4  
ATOM 6148  C CE1  . PHE A 1 49  ? -5.090  3.648   5.452   1.00 0.00 ? 49  PHE A CE1  4  
ATOM 6149  C CE2  . PHE A 1 49  ? -5.612  4.865   3.420   1.00 0.00 ? 49  PHE A CE2  4  
ATOM 6150  C CZ   . PHE A 1 49  ? -4.933  3.828   4.073   1.00 0.00 ? 49  PHE A CZ   4  
ATOM 6151  H H    . PHE A 1 49  ? -9.557  6.033   4.738   1.00 0.00 ? 49  PHE A H    4  
ATOM 6152  H HA   . PHE A 1 49  ? -8.499  4.768   7.185   1.00 0.00 ? 49  PHE A HA   4  
ATOM 6153  H HB2  . PHE A 1 49  ? -7.778  7.309   5.700   1.00 0.00 ? 49  PHE A HB2  4  
ATOM 6154  H HB3  . PHE A 1 49  ? -6.992  6.803   7.197   1.00 0.00 ? 49  PHE A HB3  4  
ATOM 6155  H HD1  . PHE A 1 49  ? -6.047  4.365   7.244   1.00 0.00 ? 49  PHE A HD1  4  
ATOM 6156  H HD2  . PHE A 1 49  ? -6.972  6.521   3.646   1.00 0.00 ? 49  PHE A HD2  4  
ATOM 6157  H HE1  . PHE A 1 49  ? -4.566  2.849   5.955   1.00 0.00 ? 49  PHE A HE1  4  
ATOM 6158  H HE2  . PHE A 1 49  ? -5.492  5.004   2.356   1.00 0.00 ? 49  PHE A HE2  4  
ATOM 6159  H HZ   . PHE A 1 49  ? -4.289  3.168   3.511   1.00 0.00 ? 49  PHE A HZ   4  
ATOM 6160  N N    . ASN A 1 50  ? -10.882 6.525   7.599   1.00 0.00 ? 50  ASN A N    4  
ATOM 6161  C CA   . ASN A 1 50  ? -11.722 7.323   8.535   1.00 0.00 ? 50  ASN A CA   4  
ATOM 6162  C C    . ASN A 1 50  ? -12.445 6.379   9.498   1.00 0.00 ? 50  ASN A C    4  
ATOM 6163  O O    . ASN A 1 50  ? -12.505 6.615   10.689  1.00 0.00 ? 50  ASN A O    4  
ATOM 6164  C CB   . ASN A 1 50  ? -12.753 8.128   7.739   1.00 0.00 ? 50  ASN A CB   4  
ATOM 6165  C CG   . ASN A 1 50  ? -13.219 9.324   8.571   1.00 0.00 ? 50  ASN A CG   4  
ATOM 6166  O OD1  . ASN A 1 50  ? -13.321 9.235   9.779   1.00 0.00 ? 50  ASN A OD1  4  
ATOM 6167  N ND2  . ASN A 1 50  ? -13.515 10.444  7.972   1.00 0.00 ? 50  ASN A ND2  4  
ATOM 6168  H H    . ASN A 1 50  ? -11.307 5.983   6.901   1.00 0.00 ? 50  ASN A H    4  
ATOM 6169  H HA   . ASN A 1 50  ? -11.094 7.997   9.097   1.00 0.00 ? 50  ASN A HA   4  
ATOM 6170  H HB2  . ASN A 1 50  ? -12.302 8.481   6.822   1.00 0.00 ? 50  ASN A HB2  4  
ATOM 6171  H HB3  . ASN A 1 50  ? -13.599 7.500   7.507   1.00 0.00 ? 50  ASN A HB3  4  
ATOM 6172  H HD21 . ASN A 1 50  ? -13.437 10.514  6.997   1.00 0.00 ? 50  ASN A HD21 4  
ATOM 6173  H HD22 . ASN A 1 50  ? -13.812 11.216  8.496   1.00 0.00 ? 50  ASN A HD22 4  
ATOM 6174  N N    . ASN A 1 51  ? -12.996 5.309   8.992   1.00 0.00 ? 51  ASN A N    4  
ATOM 6175  C CA   . ASN A 1 51  ? -13.714 4.349   9.879   1.00 0.00 ? 51  ASN A CA   4  
ATOM 6176  C C    . ASN A 1 51  ? -13.092 2.958   9.735   1.00 0.00 ? 51  ASN A C    4  
ATOM 6177  O O    . ASN A 1 51  ? -12.718 2.543   8.657   1.00 0.00 ? 51  ASN A O    4  
ATOM 6178  C CB   . ASN A 1 51  ? -15.189 4.291   9.477   1.00 0.00 ? 51  ASN A CB   4  
ATOM 6179  C CG   . ASN A 1 51  ? -15.984 5.305   10.303  1.00 0.00 ? 51  ASN A CG   4  
ATOM 6180  O OD1  . ASN A 1 51  ? -15.511 6.391   10.571  1.00 0.00 ? 51  ASN A OD1  4  
ATOM 6181  N ND2  . ASN A 1 51  ? -17.180 4.992   10.719  1.00 0.00 ? 51  ASN A ND2  4  
ATOM 6182  H H    . ASN A 1 51  ? -12.938 5.136   8.029   1.00 0.00 ? 51  ASN A H    4  
ATOM 6183  H HA   . ASN A 1 51  ? -13.632 4.676   10.905  1.00 0.00 ? 51  ASN A HA   4  
ATOM 6184  H HB2  . ASN A 1 51  ? -15.285 4.527   8.427   1.00 0.00 ? 51  ASN A HB2  4  
ATOM 6185  H HB3  . ASN A 1 51  ? -15.573 3.299   9.661   1.00 0.00 ? 51  ASN A HB3  4  
ATOM 6186  H HD21 . ASN A 1 51  ? -17.562 4.115   10.502  1.00 0.00 ? 51  ASN A HD21 4  
ATOM 6187  H HD22 . ASN A 1 51  ? -17.699 5.635   11.248  1.00 0.00 ? 51  ASN A HD22 4  
ATOM 6188  N N    . ALA A 1 52  ? -12.980 2.234   10.815  1.00 0.00 ? 52  ALA A N    4  
ATOM 6189  C CA   . ALA A 1 52  ? -12.383 0.870   10.739  1.00 0.00 ? 52  ALA A CA   4  
ATOM 6190  C C    . ALA A 1 52  ? -13.487 -0.182  10.870  1.00 0.00 ? 52  ALA A C    4  
ATOM 6191  O O    . ALA A 1 52  ? -13.242 -1.369  10.775  1.00 0.00 ? 52  ALA A O    4  
ATOM 6192  C CB   . ALA A 1 52  ? -11.374 0.688   11.875  1.00 0.00 ? 52  ALA A CB   4  
ATOM 6193  H H    . ALA A 1 52  ? -13.288 2.587   11.676  1.00 0.00 ? 52  ALA A H    4  
ATOM 6194  H HA   . ALA A 1 52  ? -11.882 0.749   9.791   1.00 0.00 ? 52  ALA A HA   4  
ATOM 6195  H HB1  . ALA A 1 52  ? -10.888 1.631   12.080  1.00 0.00 ? 52  ALA A HB1  4  
ATOM 6196  H HB2  . ALA A 1 52  ? -11.888 0.349   12.763  1.00 0.00 ? 52  ALA A HB2  4  
ATOM 6197  H HB3  . ALA A 1 52  ? -10.634 -0.043  11.586  1.00 0.00 ? 52  ALA A HB3  4  
ATOM 6198  N N    . ASP A 1 53  ? -14.702 0.240   11.094  1.00 0.00 ? 53  ASP A N    4  
ATOM 6199  C CA   . ASP A 1 53  ? -15.817 -0.737  11.239  1.00 0.00 ? 53  ASP A CA   4  
ATOM 6200  C C    . ASP A 1 53  ? -16.245 -1.264  9.861   1.00 0.00 ? 53  ASP A C    4  
ATOM 6201  O O    . ASP A 1 53  ? -16.271 -2.459  9.645   1.00 0.00 ? 53  ASP A O    4  
ATOM 6202  C CB   . ASP A 1 53  ? -17.008 -0.055  11.918  1.00 0.00 ? 53  ASP A CB   4  
ATOM 6203  C CG   . ASP A 1 53  ? -17.132 -0.554  13.359  1.00 0.00 ? 53  ASP A CG   4  
ATOM 6204  O OD1  . ASP A 1 53  ? -17.715 -1.607  13.552  1.00 0.00 ? 53  ASP A OD1  4  
ATOM 6205  O OD2  . ASP A 1 53  ? -16.641 0.127   14.245  1.00 0.00 ? 53  ASP A OD2  4  
ATOM 6206  H H    . ASP A 1 53  ? -14.879 1.201   11.176  1.00 0.00 ? 53  ASP A H    4  
ATOM 6207  H HA   . ASP A 1 53  ? -15.487 -1.565  11.849  1.00 0.00 ? 53  ASP A HA   4  
ATOM 6208  H HB2  . ASP A 1 53  ? -16.856 1.015   11.919  1.00 0.00 ? 53  ASP A HB2  4  
ATOM 6209  H HB3  . ASP A 1 53  ? -17.914 -0.290  11.380  1.00 0.00 ? 53  ASP A HB3  4  
ATOM 6210  N N    . PRO A 1 54  ? -16.583 -0.360  8.975   1.00 0.00 ? 54  PRO A N    4  
ATOM 6211  C CA   . PRO A 1 54  ? -17.033 -0.724  7.616   1.00 0.00 ? 54  PRO A CA   4  
ATOM 6212  C C    . PRO A 1 54  ? -15.929 -1.456  6.843   1.00 0.00 ? 54  PRO A C    4  
ATOM 6213  O O    . PRO A 1 54  ? -16.165 -1.998  5.781   1.00 0.00 ? 54  PRO A O    4  
ATOM 6214  C CB   . PRO A 1 54  ? -17.363 0.614   6.939   1.00 0.00 ? 54  PRO A CB   4  
ATOM 6215  C CG   . PRO A 1 54  ? -17.060 1.744   7.955   1.00 0.00 ? 54  PRO A CG   4  
ATOM 6216  C CD   . PRO A 1 54  ? -16.546 1.089   9.247   1.00 0.00 ? 54  PRO A CD   4  
ATOM 6217  H HA   . PRO A 1 54  ? -17.921 -1.333  7.667   1.00 0.00 ? 54  PRO A HA   4  
ATOM 6218  H HB2  . PRO A 1 54  ? -16.752 0.737   6.056   1.00 0.00 ? 54  PRO A HB2  4  
ATOM 6219  H HB3  . PRO A 1 54  ? -18.408 0.641   6.670   1.00 0.00 ? 54  PRO A HB3  4  
ATOM 6220  H HG2  . PRO A 1 54  ? -16.307 2.406   7.553   1.00 0.00 ? 54  PRO A HG2  4  
ATOM 6221  H HG3  . PRO A 1 54  ? -17.961 2.299   8.166   1.00 0.00 ? 54  PRO A HG3  4  
ATOM 6222  H HD2  . PRO A 1 54  ? -15.536 1.413   9.452   1.00 0.00 ? 54  PRO A HD2  4  
ATOM 6223  H HD3  . PRO A 1 54  ? -17.196 1.330   10.073  1.00 0.00 ? 54  PRO A HD3  4  
ATOM 6224  N N    . ILE A 1 55  ? -14.729 -1.480  7.357   1.00 0.00 ? 55  ILE A N    4  
ATOM 6225  C CA   . ILE A 1 55  ? -13.629 -2.181  6.628   1.00 0.00 ? 55  ILE A CA   4  
ATOM 6226  C C    . ILE A 1 55  ? -13.325 -3.513  7.315   1.00 0.00 ? 55  ILE A C    4  
ATOM 6227  O O    . ILE A 1 55  ? -12.808 -4.430  6.707   1.00 0.00 ? 55  ILE A O    4  
ATOM 6228  C CB   . ILE A 1 55  ? -12.358 -1.319  6.605   1.00 0.00 ? 55  ILE A CB   4  
ATOM 6229  C CG1  . ILE A 1 55  ? -12.595 0.007   7.338   1.00 0.00 ? 55  ILE A CG1  4  
ATOM 6230  C CG2  . ILE A 1 55  ? -11.975 -1.027  5.153   1.00 0.00 ? 55  ILE A CG2  4  
ATOM 6231  C CD1  . ILE A 1 55  ? -11.404 0.940   7.103   1.00 0.00 ? 55  ILE A CD1  4  
ATOM 6232  H H    . ILE A 1 55  ? -14.551 -1.037  8.212   1.00 0.00 ? 55  ILE A H    4  
ATOM 6233  H HA   . ILE A 1 55  ? -13.947 -2.373  5.613   1.00 0.00 ? 55  ILE A HA   4  
ATOM 6234  H HB   . ILE A 1 55  ? -11.552 -1.858  7.084   1.00 0.00 ? 55  ILE A HB   4  
ATOM 6235  H HG12 . ILE A 1 55  ? -13.495 0.469   6.961   1.00 0.00 ? 55  ILE A HG12 4  
ATOM 6236  H HG13 . ILE A 1 55  ? -12.700 -0.181  8.395   1.00 0.00 ? 55  ILE A HG13 4  
ATOM 6237  H HG21 . ILE A 1 55  ? -12.019 -1.940  4.578   1.00 0.00 ? 55  ILE A HG21 4  
ATOM 6238  H HG22 . ILE A 1 55  ? -12.664 -0.306  4.738   1.00 0.00 ? 55  ILE A HG22 4  
ATOM 6239  H HG23 . ILE A 1 55  ? -10.973 -0.626  5.118   1.00 0.00 ? 55  ILE A HG23 4  
ATOM 6240  H HD11 . ILE A 1 55  ? -10.647 0.422   6.534   1.00 0.00 ? 55  ILE A HD11 4  
ATOM 6241  H HD12 . ILE A 1 55  ? -11.732 1.812   6.556   1.00 0.00 ? 55  ILE A HD12 4  
ATOM 6242  H HD13 . ILE A 1 55  ? -10.994 1.245   8.054   1.00 0.00 ? 55  ILE A HD13 4  
ATOM 6243  N N    . ARG A 1 56  ? -13.642 -3.634  8.576   1.00 0.00 ? 56  ARG A N    4  
ATOM 6244  C CA   . ARG A 1 56  ? -13.367 -4.914  9.289   1.00 0.00 ? 56  ARG A CA   4  
ATOM 6245  C C    . ARG A 1 56  ? -14.489 -5.912  8.991   1.00 0.00 ? 56  ARG A C    4  
ATOM 6246  O O    . ARG A 1 56  ? -14.380 -7.087  9.277   1.00 0.00 ? 56  ARG A O    4  
ATOM 6247  C CB   . ARG A 1 56  ? -13.290 -4.659  10.798  1.00 0.00 ? 56  ARG A CB   4  
ATOM 6248  C CG   . ARG A 1 56  ? -14.666 -4.245  11.329  1.00 0.00 ? 56  ARG A CG   4  
ATOM 6249  C CD   . ARG A 1 56  ? -14.779 -4.630  12.804  1.00 0.00 ? 56  ARG A CD   4  
ATOM 6250  N NE   . ARG A 1 56  ? -15.931 -5.566  12.993  1.00 0.00 ? 56  ARG A NE   4  
ATOM 6251  C CZ   . ARG A 1 56  ? -17.112 -5.300  12.498  1.00 0.00 ? 56  ARG A CZ   4  
ATOM 6252  N NH1  . ARG A 1 56  ? -17.373 -4.127  11.982  1.00 0.00 ? 56  ARG A NH1  4  
ATOM 6253  N NH2  . ARG A 1 56  ? -18.058 -6.196  12.571  1.00 0.00 ? 56  ARG A NH2  4  
ATOM 6254  H H    . ARG A 1 56  ? -14.059 -2.886  9.052   1.00 0.00 ? 56  ARG A H    4  
ATOM 6255  H HA   . ARG A 1 56  ? -12.427 -5.320  8.944   1.00 0.00 ? 56  ARG A HA   4  
ATOM 6256  H HB2  . ARG A 1 56  ? -12.970 -5.561  11.297  1.00 0.00 ? 56  ARG A HB2  4  
ATOM 6257  H HB3  . ARG A 1 56  ? -12.579 -3.869  10.992  1.00 0.00 ? 56  ARG A HB3  4  
ATOM 6258  H HG2  . ARG A 1 56  ? -14.784 -3.177  11.225  1.00 0.00 ? 56  ARG A HG2  4  
ATOM 6259  H HG3  . ARG A 1 56  ? -15.438 -4.748  10.768  1.00 0.00 ? 56  ARG A HG3  4  
ATOM 6260  H HD2  . ARG A 1 56  ? -13.880 -5.137  13.109  1.00 0.00 ? 56  ARG A HD2  4  
ATOM 6261  H HD3  . ARG A 1 56  ? -14.902 -3.732  13.402  1.00 0.00 ? 56  ARG A HD3  4  
ATOM 6262  H HE   . ARG A 1 56  ? -15.785 -6.419  13.456  1.00 0.00 ? 56  ARG A HE   4  
ATOM 6263  H HH11 . ARG A 1 56  ? -16.673 -3.416  11.966  1.00 0.00 ? 56  ARG A HH11 4  
ATOM 6264  H HH12 . ARG A 1 56  ? -18.279 -3.941  11.601  1.00 0.00 ? 56  ARG A HH12 4  
ATOM 6265  H HH21 . ARG A 1 56  ? -17.878 -7.080  13.003  1.00 0.00 ? 56  ARG A HH21 4  
ATOM 6266  H HH22 . ARG A 1 56  ? -18.964 -5.999  12.195  1.00 0.00 ? 56  ARG A HH22 4  
ATOM 6267  N N    . ALA A 1 57  ? -15.566 -5.451  8.417   1.00 0.00 ? 57  ALA A N    4  
ATOM 6268  C CA   . ALA A 1 57  ? -16.694 -6.371  8.100   1.00 0.00 ? 57  ALA A CA   4  
ATOM 6269  C C    . ALA A 1 57  ? -16.683 -6.694  6.603   1.00 0.00 ? 57  ALA A C    4  
ATOM 6270  O O    . ALA A 1 57  ? -16.285 -7.767  6.193   1.00 0.00 ? 57  ALA A O    4  
ATOM 6271  C CB   . ALA A 1 57  ? -18.019 -5.699  8.469   1.00 0.00 ? 57  ALA A CB   4  
ATOM 6272  H H    . ALA A 1 57  ? -15.634 -4.499  8.194   1.00 0.00 ? 57  ALA A H    4  
ATOM 6273  H HA   . ALA A 1 57  ? -16.583 -7.284  8.666   1.00 0.00 ? 57  ALA A HA   4  
ATOM 6274  H HB1  . ALA A 1 57  ? -17.820 -4.798  9.031   1.00 0.00 ? 57  ALA A HB1  4  
ATOM 6275  H HB2  . ALA A 1 57  ? -18.561 -5.451  7.569   1.00 0.00 ? 57  ALA A HB2  4  
ATOM 6276  H HB3  . ALA A 1 57  ? -18.609 -6.374  9.070   1.00 0.00 ? 57  ALA A HB3  4  
ATOM 6277  N N    . SER A 1 58  ? -17.116 -5.774  5.784   1.00 0.00 ? 58  SER A N    4  
ATOM 6278  C CA   . SER A 1 58  ? -17.128 -6.032  4.316   1.00 0.00 ? 58  SER A CA   4  
ATOM 6279  C C    . SER A 1 58  ? -15.759 -5.684  3.728   1.00 0.00 ? 58  SER A C    4  
ATOM 6280  O O    . SER A 1 58  ? -15.250 -6.370  2.864   1.00 0.00 ? 58  SER A O    4  
ATOM 6281  C CB   . SER A 1 58  ? -18.202 -5.170  3.654   1.00 0.00 ? 58  SER A CB   4  
ATOM 6282  O OG   . SER A 1 58  ? -18.180 -5.389  2.249   1.00 0.00 ? 58  SER A OG   4  
ATOM 6283  H H    . SER A 1 58  ? -17.433 -4.915  6.133   1.00 0.00 ? 58  SER A H    4  
ATOM 6284  H HA   . SER A 1 58  ? -17.342 -7.075  4.136   1.00 0.00 ? 58  SER A HA   4  
ATOM 6285  H HB2  . SER A 1 58  ? -19.172 -5.437  4.039   1.00 0.00 ? 58  SER A HB2  4  
ATOM 6286  H HB3  . SER A 1 58  ? -18.008 -4.126  3.869   1.00 0.00 ? 58  SER A HB3  4  
ATOM 6287  H HG   . SER A 1 58  ? -19.088 -5.406  1.938   1.00 0.00 ? 58  SER A HG   4  
ATOM 6288  N N    . GLY A 1 59  ? -15.157 -4.623  4.192   1.00 0.00 ? 59  GLY A N    4  
ATOM 6289  C CA   . GLY A 1 59  ? -13.821 -4.234  3.662   1.00 0.00 ? 59  GLY A CA   4  
ATOM 6290  C C    . GLY A 1 59  ? -13.994 -3.384  2.403   1.00 0.00 ? 59  GLY A C    4  
ATOM 6291  O O    . GLY A 1 59  ? -15.052 -2.844  2.147   1.00 0.00 ? 59  GLY A O    4  
ATOM 6292  H H    . GLY A 1 59  ? -15.583 -4.084  4.890   1.00 0.00 ? 59  GLY A H    4  
ATOM 6293  H HA2  . GLY A 1 59  ? -13.289 -3.665  4.413   1.00 0.00 ? 59  GLY A HA2  4  
ATOM 6294  H HA3  . GLY A 1 59  ? -13.258 -5.122  3.419   1.00 0.00 ? 59  GLY A HA3  4  
ATOM 6295  N N    . PHE A 1 60  ? -12.963 -3.264  1.613   1.00 0.00 ? 60  PHE A N    4  
ATOM 6296  C CA   . PHE A 1 60  ? -13.067 -2.453  0.368   1.00 0.00 ? 60  PHE A CA   4  
ATOM 6297  C C    . PHE A 1 60  ? -12.195 -3.089  -0.716  1.00 0.00 ? 60  PHE A C    4  
ATOM 6298  O O    . PHE A 1 60  ? -11.721 -4.198  -0.568  1.00 0.00 ? 60  PHE A O    4  
ATOM 6299  C CB   . PHE A 1 60  ? -12.606 -1.017  0.655   1.00 0.00 ? 60  PHE A CB   4  
ATOM 6300  C CG   . PHE A 1 60  ? -11.097 -0.934  0.625   1.00 0.00 ? 60  PHE A CG   4  
ATOM 6301  C CD1  . PHE A 1 60  ? -10.337 -1.580  1.607   1.00 0.00 ? 60  PHE A CD1  4  
ATOM 6302  C CD2  . PHE A 1 60  ? -10.459 -0.206  -0.387  1.00 0.00 ? 60  PHE A CD2  4  
ATOM 6303  C CE1  . PHE A 1 60  ? -8.939  -1.498  1.576   1.00 0.00 ? 60  PHE A CE1  4  
ATOM 6304  C CE2  . PHE A 1 60  ? -9.062  -0.124  -0.418  1.00 0.00 ? 60  PHE A CE2  4  
ATOM 6305  C CZ   . PHE A 1 60  ? -8.302  -0.770  0.564   1.00 0.00 ? 60  PHE A CZ   4  
ATOM 6306  H H    . PHE A 1 60  ? -12.120 -3.713  1.838   1.00 0.00 ? 60  PHE A H    4  
ATOM 6307  H HA   . PHE A 1 60  ? -14.093 -2.439  0.033   1.00 0.00 ? 60  PHE A HA   4  
ATOM 6308  H HB2  . PHE A 1 60  ? -13.017 -0.354  -0.093  1.00 0.00 ? 60  PHE A HB2  4  
ATOM 6309  H HB3  . PHE A 1 60  ? -12.960 -0.717  1.630   1.00 0.00 ? 60  PHE A HB3  4  
ATOM 6310  H HD1  . PHE A 1 60  ? -10.828 -2.142  2.387   1.00 0.00 ? 60  PHE A HD1  4  
ATOM 6311  H HD2  . PHE A 1 60  ? -11.046 0.293   -1.144  1.00 0.00 ? 60  PHE A HD2  4  
ATOM 6312  H HE1  . PHE A 1 60  ? -8.352  -1.997  2.333   1.00 0.00 ? 60  PHE A HE1  4  
ATOM 6313  H HE2  . PHE A 1 60  ? -8.572  0.437   -1.199  1.00 0.00 ? 60  PHE A HE2  4  
ATOM 6314  H HZ   . PHE A 1 60  ? -7.224  -0.707  0.540   1.00 0.00 ? 60  PHE A HZ   4  
ATOM 6315  N N    . ASP A 1 61  ? -11.982 -2.408  -1.806  1.00 0.00 ? 61  ASP A N    4  
ATOM 6316  C CA   . ASP A 1 61  ? -11.142 -3.002  -2.884  1.00 0.00 ? 61  ASP A CA   4  
ATOM 6317  C C    . ASP A 1 61  ? -10.614 -1.908  -3.816  1.00 0.00 ? 61  ASP A C    4  
ATOM 6318  O O    . ASP A 1 61  ? -11.172 -0.834  -3.917  1.00 0.00 ? 61  ASP A O    4  
ATOM 6319  C CB   . ASP A 1 61  ? -11.982 -3.991  -3.693  1.00 0.00 ? 61  ASP A CB   4  
ATOM 6320  C CG   . ASP A 1 61  ? -13.216 -3.276  -4.248  1.00 0.00 ? 61  ASP A CG   4  
ATOM 6321  O OD1  . ASP A 1 61  ? -13.144 -2.073  -4.440  1.00 0.00 ? 61  ASP A OD1  4  
ATOM 6322  O OD2  . ASP A 1 61  ? -14.213 -3.943  -4.470  1.00 0.00 ? 61  ASP A OD2  4  
ATOM 6323  H H    . ASP A 1 61  ? -12.375 -1.517  -1.916  1.00 0.00 ? 61  ASP A H    4  
ATOM 6324  H HA   . ASP A 1 61  ? -10.308 -3.522  -2.440  1.00 0.00 ? 61  ASP A HA   4  
ATOM 6325  H HB2  . ASP A 1 61  ? -11.393 -4.380  -4.510  1.00 0.00 ? 61  ASP A HB2  4  
ATOM 6326  H HB3  . ASP A 1 61  ? -12.297 -4.804  -3.056  1.00 0.00 ? 61  ASP A HB3  4  
ATOM 6327  N N    . LEU A 1 62  ? -9.540  -2.188  -4.505  1.00 0.00 ? 62  LEU A N    4  
ATOM 6328  C CA   . LEU A 1 62  ? -8.963  -1.187  -5.444  1.00 0.00 ? 62  LEU A CA   4  
ATOM 6329  C C    . LEU A 1 62  ? -8.852  -1.823  -6.834  1.00 0.00 ? 62  LEU A C    4  
ATOM 6330  O O    . LEU A 1 62  ? -9.511  -2.800  -7.129  1.00 0.00 ? 62  LEU A O    4  
ATOM 6331  C CB   . LEU A 1 62  ? -7.577  -0.763  -4.948  1.00 0.00 ? 62  LEU A CB   4  
ATOM 6332  C CG   . LEU A 1 62  ? -7.720  0.007   -3.634  1.00 0.00 ? 62  LEU A CG   4  
ATOM 6333  C CD1  . LEU A 1 62  ? -6.334  0.308   -3.061  1.00 0.00 ? 62  LEU A CD1  4  
ATOM 6334  C CD2  . LEU A 1 62  ? -8.459  1.322   -3.890  1.00 0.00 ? 62  LEU A CD2  4  
ATOM 6335  H H    . LEU A 1 62  ? -9.114  -3.064  -4.408  1.00 0.00 ? 62  LEU A H    4  
ATOM 6336  H HA   . LEU A 1 62  ? -9.610  -0.322  -5.495  1.00 0.00 ? 62  LEU A HA   4  
ATOM 6337  H HB2  . LEU A 1 62  ? -6.968  -1.642  -4.788  1.00 0.00 ? 62  LEU A HB2  4  
ATOM 6338  H HB3  . LEU A 1 62  ? -7.107  -0.129  -5.684  1.00 0.00 ? 62  LEU A HB3  4  
ATOM 6339  H HG   . LEU A 1 62  ? -8.279  -0.591  -2.927  1.00 0.00 ? 62  LEU A HG   4  
ATOM 6340  H HD11 . LEU A 1 62  ? -5.588  -0.238  -3.619  1.00 0.00 ? 62  LEU A HD11 4  
ATOM 6341  H HD12 . LEU A 1 62  ? -6.137  1.366   -3.136  1.00 0.00 ? 62  LEU A HD12 4  
ATOM 6342  H HD13 . LEU A 1 62  ? -6.300  0.007   -2.025  1.00 0.00 ? 62  LEU A HD13 4  
ATOM 6343  H HD21 . LEU A 1 62  ? -8.143  1.734   -4.837  1.00 0.00 ? 62  LEU A HD21 4  
ATOM 6344  H HD22 . LEU A 1 62  ? -9.523  1.140   -3.914  1.00 0.00 ? 62  LEU A HD22 4  
ATOM 6345  H HD23 . LEU A 1 62  ? -8.233  2.022   -3.099  1.00 0.00 ? 62  LEU A HD23 4  
ATOM 6346  N N    . ALA A 1 63  ? -8.028  -1.283  -7.693  1.00 0.00 ? 63  ALA A N    4  
ATOM 6347  C CA   . ALA A 1 63  ? -7.891  -1.869  -9.058  1.00 0.00 ? 63  ALA A CA   4  
ATOM 6348  C C    . ALA A 1 63  ? -6.862  -3.003  -9.033  1.00 0.00 ? 63  ALA A C    4  
ATOM 6349  O O    . ALA A 1 63  ? -5.671  -2.774  -9.103  1.00 0.00 ? 63  ALA A O    4  
ATOM 6350  C CB   . ALA A 1 63  ? -7.434  -0.785  -10.035 1.00 0.00 ? 63  ALA A CB   4  
ATOM 6351  H H    . ALA A 1 63  ? -7.504  -0.495  -7.445  1.00 0.00 ? 63  ALA A H    4  
ATOM 6352  H HA   . ALA A 1 63  ? -8.847  -2.260  -9.379  1.00 0.00 ? 63  ALA A HA   4  
ATOM 6353  H HB1  . ALA A 1 63  ? -7.254  0.133   -9.496  1.00 0.00 ? 63  ALA A HB1  4  
ATOM 6354  H HB2  . ALA A 1 63  ? -6.521  -1.099  -10.522 1.00 0.00 ? 63  ALA A HB2  4  
ATOM 6355  H HB3  . ALA A 1 63  ? -8.200  -0.623  -10.778 1.00 0.00 ? 63  ALA A HB3  4  
ATOM 6356  N N    . GLY A 1 64  ? -7.311  -4.226  -8.937  1.00 0.00 ? 64  GLY A N    4  
ATOM 6357  C CA   . GLY A 1 64  ? -6.356  -5.372  -8.910  1.00 0.00 ? 64  GLY A CA   4  
ATOM 6358  C C    . GLY A 1 64  ? -6.906  -6.482  -8.013  1.00 0.00 ? 64  GLY A C    4  
ATOM 6359  O O    . GLY A 1 64  ? -7.452  -7.462  -8.484  1.00 0.00 ? 64  GLY A O    4  
ATOM 6360  H H    . GLY A 1 64  ? -8.275  -4.391  -8.883  1.00 0.00 ? 64  GLY A H    4  
ATOM 6361  H HA2  . GLY A 1 64  ? -6.222  -5.751  -9.914  1.00 0.00 ? 64  GLY A HA2  4  
ATOM 6362  H HA3  . GLY A 1 64  ? -5.405  -5.039  -8.521  1.00 0.00 ? 64  GLY A HA3  4  
ATOM 6363  N N    . VAL A 1 65  ? -6.765  -6.340  -6.723  1.00 0.00 ? 65  VAL A N    4  
ATOM 6364  C CA   . VAL A 1 65  ? -7.275  -7.388  -5.793  1.00 0.00 ? 65  VAL A CA   4  
ATOM 6365  C C    . VAL A 1 65  ? -8.227  -6.747  -4.781  1.00 0.00 ? 65  VAL A C    4  
ATOM 6366  O O    . VAL A 1 65  ? -8.215  -5.550  -4.577  1.00 0.00 ? 65  VAL A O    4  
ATOM 6367  C CB   . VAL A 1 65  ? -6.094  -8.021  -5.054  1.00 0.00 ? 65  VAL A CB   4  
ATOM 6368  C CG1  . VAL A 1 65  ? -6.609  -8.899  -3.913  1.00 0.00 ? 65  VAL A CG1  4  
ATOM 6369  C CG2  . VAL A 1 65  ? -5.285  -8.878  -6.030  1.00 0.00 ? 65  VAL A CG2  4  
ATOM 6370  H H    . VAL A 1 65  ? -6.319  -5.545  -6.365  1.00 0.00 ? 65  VAL A H    4  
ATOM 6371  H HA   . VAL A 1 65  ? -7.800  -8.146  -6.354  1.00 0.00 ? 65  VAL A HA   4  
ATOM 6372  H HB   . VAL A 1 65  ? -5.464  -7.240  -4.651  1.00 0.00 ? 65  VAL A HB   4  
ATOM 6373  H HG11 . VAL A 1 65  ? -7.199  -8.301  -3.236  1.00 0.00 ? 65  VAL A HG11 4  
ATOM 6374  H HG12 . VAL A 1 65  ? -7.219  -9.694  -4.315  1.00 0.00 ? 65  VAL A HG12 4  
ATOM 6375  H HG13 . VAL A 1 65  ? -5.770  -9.323  -3.378  1.00 0.00 ? 65  VAL A HG13 4  
ATOM 6376  H HG21 . VAL A 1 65  ? -5.714  -8.799  -7.018  1.00 0.00 ? 65  VAL A HG21 4  
ATOM 6377  H HG22 . VAL A 1 65  ? -4.263  -8.531  -6.052  1.00 0.00 ? 65  VAL A HG22 4  
ATOM 6378  H HG23 . VAL A 1 65  ? -5.309  -9.908  -5.708  1.00 0.00 ? 65  VAL A HG23 4  
ATOM 6379  N N    . HIS A 1 66  ? -9.052  -7.532  -4.143  1.00 0.00 ? 66  HIS A N    4  
ATOM 6380  C CA   . HIS A 1 66  ? -9.999  -6.959  -3.146  1.00 0.00 ? 66  HIS A CA   4  
ATOM 6381  C C    . HIS A 1 66  ? -9.239  -6.624  -1.860  1.00 0.00 ? 66  HIS A C    4  
ATOM 6382  O O    . HIS A 1 66  ? -8.028  -6.684  -1.810  1.00 0.00 ? 66  HIS A O    4  
ATOM 6383  C CB   . HIS A 1 66  ? -11.099 -7.975  -2.841  1.00 0.00 ? 66  HIS A CB   4  
ATOM 6384  C CG   . HIS A 1 66  ? -11.718 -8.444  -4.128  1.00 0.00 ? 66  HIS A CG   4  
ATOM 6385  N ND1  . HIS A 1 66  ? -12.363 -9.665  -4.236  1.00 0.00 ? 66  HIS A ND1  4  
ATOM 6386  C CD2  . HIS A 1 66  ? -11.798 -7.866  -5.371  1.00 0.00 ? 66  HIS A CD2  4  
ATOM 6387  C CE1  . HIS A 1 66  ? -12.798 -9.783  -5.503  1.00 0.00 ? 66  HIS A CE1  4  
ATOM 6388  N NE2  . HIS A 1 66  ? -12.481 -8.713  -6.237  1.00 0.00 ? 66  HIS A NE2  4  
ATOM 6389  H H    . HIS A 1 66  ? -9.048  -8.496  -4.320  1.00 0.00 ? 66  HIS A H    4  
ATOM 6390  H HA   . HIS A 1 66  ? -10.441 -6.061  -3.547  1.00 0.00 ? 66  HIS A HA   4  
ATOM 6391  H HB2  . HIS A 1 66  ? -10.676 -8.818  -2.315  1.00 0.00 ? 66  HIS A HB2  4  
ATOM 6392  H HB3  . HIS A 1 66  ? -11.857 -7.512  -2.226  1.00 0.00 ? 66  HIS A HB3  4  
ATOM 6393  H HD1  . HIS A 1 66  ? -12.481 -10.323 -3.520  1.00 0.00 ? 66  HIS A HD1  4  
ATOM 6394  H HD2  . HIS A 1 66  ? -11.391 -6.902  -5.636  1.00 0.00 ? 66  HIS A HD2  4  
ATOM 6395  H HE1  . HIS A 1 66  ? -13.340 -10.637 -5.880  1.00 0.00 ? 66  HIS A HE1  4  
ATOM 6396  N N    . TYR A 1 67  ? -9.943  -6.271  -0.818  1.00 0.00 ? 67  TYR A N    4  
ATOM 6397  C CA   . TYR A 1 67  ? -9.256  -5.932  0.461   1.00 0.00 ? 67  TYR A CA   4  
ATOM 6398  C C    . TYR A 1 67  ? -10.011 -6.554  1.636   1.00 0.00 ? 67  TYR A C    4  
ATOM 6399  O O    . TYR A 1 67  ? -11.166 -6.256  1.873   1.00 0.00 ? 67  TYR A O    4  
ATOM 6400  C CB   . TYR A 1 67  ? -9.212  -4.413  0.638   1.00 0.00 ? 67  TYR A CB   4  
ATOM 6401  C CG   . TYR A 1 67  ? -7.778  -3.958  0.752   1.00 0.00 ? 67  TYR A CG   4  
ATOM 6402  C CD1  . TYR A 1 67  ? -7.061  -4.193  1.932   1.00 0.00 ? 67  TYR A CD1  4  
ATOM 6403  C CD2  . TYR A 1 67  ? -7.165  -3.301  -0.321  1.00 0.00 ? 67  TYR A CD2  4  
ATOM 6404  C CE1  . TYR A 1 67  ? -5.731  -3.770  2.038   1.00 0.00 ? 67  TYR A CE1  4  
ATOM 6405  C CE2  . TYR A 1 67  ? -5.835  -2.879  -0.214  1.00 0.00 ? 67  TYR A CE2  4  
ATOM 6406  C CZ   . TYR A 1 67  ? -5.117  -3.114  0.965   1.00 0.00 ? 67  TYR A CZ   4  
ATOM 6407  O OH   . TYR A 1 67  ? -3.805  -2.698  1.069   1.00 0.00 ? 67  TYR A OH   4  
ATOM 6408  H H    . TYR A 1 67  ? -10.920 -6.228  -0.878  1.00 0.00 ? 67  TYR A H    4  
ATOM 6409  H HA   . TYR A 1 67  ? -8.248  -6.319  0.439   1.00 0.00 ? 67  TYR A HA   4  
ATOM 6410  H HB2  . TYR A 1 67  ? -9.673  -3.937  -0.213  1.00 0.00 ? 67  TYR A HB2  4  
ATOM 6411  H HB3  . TYR A 1 67  ? -9.747  -4.140  1.537   1.00 0.00 ? 67  TYR A HB3  4  
ATOM 6412  H HD1  . TYR A 1 67  ? -7.534  -4.700  2.760   1.00 0.00 ? 67  TYR A HD1  4  
ATOM 6413  H HD2  . TYR A 1 67  ? -7.718  -3.121  -1.230  1.00 0.00 ? 67  TYR A HD2  4  
ATOM 6414  H HE1  . TYR A 1 67  ? -5.177  -3.951  2.949   1.00 0.00 ? 67  TYR A HE1  4  
ATOM 6415  H HE2  . TYR A 1 67  ? -5.363  -2.371  -1.042  1.00 0.00 ? 67  TYR A HE2  4  
ATOM 6416  H HH   . TYR A 1 67  ? -3.795  -1.739  1.045   1.00 0.00 ? 67  TYR A HH   4  
ATOM 6417  N N    . VAL A 1 68  ? -9.363  -7.406  2.382   1.00 0.00 ? 68  VAL A N    4  
ATOM 6418  C CA   . VAL A 1 68  ? -10.036 -8.036  3.550   1.00 0.00 ? 68  VAL A CA   4  
ATOM 6419  C C    . VAL A 1 68  ? -9.812  -7.156  4.779   1.00 0.00 ? 68  VAL A C    4  
ATOM 6420  O O    . VAL A 1 68  ? -10.583 -7.169  5.718   1.00 0.00 ? 68  VAL A O    4  
ATOM 6421  C CB   . VAL A 1 68  ? -9.443  -9.424  3.796   1.00 0.00 ? 68  VAL A CB   4  
ATOM 6422  C CG1  . VAL A 1 68  ? -10.120 -10.060 5.012   1.00 0.00 ? 68  VAL A CG1  4  
ATOM 6423  C CG2  . VAL A 1 68  ? -9.678  -10.304 2.566   1.00 0.00 ? 68  VAL A CG2  4  
ATOM 6424  H H    . VAL A 1 68  ? -8.429  -7.623  2.178   1.00 0.00 ? 68  VAL A H    4  
ATOM 6425  H HA   . VAL A 1 68  ? -11.095 -8.123  3.354   1.00 0.00 ? 68  VAL A HA   4  
ATOM 6426  H HB   . VAL A 1 68  ? -8.382  -9.335  3.982   1.00 0.00 ? 68  VAL A HB   4  
ATOM 6427  H HG11 . VAL A 1 68  ? -10.807 -9.352  5.452   1.00 0.00 ? 68  VAL A HG11 4  
ATOM 6428  H HG12 . VAL A 1 68  ? -10.660 -10.941 4.702   1.00 0.00 ? 68  VAL A HG12 4  
ATOM 6429  H HG13 . VAL A 1 68  ? -9.370  -10.334 5.739   1.00 0.00 ? 68  VAL A HG13 4  
ATOM 6430  H HG21 . VAL A 1 68  ? -10.737 -10.364 2.364   1.00 0.00 ? 68  VAL A HG21 4  
ATOM 6431  H HG22 . VAL A 1 68  ? -9.172  -9.874  1.715   1.00 0.00 ? 68  VAL A HG22 4  
ATOM 6432  H HG23 . VAL A 1 68  ? -9.290  -11.295 2.752   1.00 0.00 ? 68  VAL A HG23 4  
ATOM 6433  N N    . THR A 1 69  ? -8.762  -6.381  4.767   1.00 0.00 ? 69  THR A N    4  
ATOM 6434  C CA   . THR A 1 69  ? -8.474  -5.482  5.916   1.00 0.00 ? 69  THR A CA   4  
ATOM 6435  C C    . THR A 1 69  ? -8.351  -6.297  7.205   1.00 0.00 ? 69  THR A C    4  
ATOM 6436  O O    . THR A 1 69  ? -9.336  -6.682  7.804   1.00 0.00 ? 69  THR A O    4  
ATOM 6437  C CB   . THR A 1 69  ? -9.610  -4.471  6.061   1.00 0.00 ? 69  THR A CB   4  
ATOM 6438  O OG1  . THR A 1 69  ? -9.720  -3.710  4.867   1.00 0.00 ? 69  THR A OG1  4  
ATOM 6439  C CG2  . THR A 1 69  ? -9.320  -3.538  7.238   1.00 0.00 ? 69  THR A CG2  4  
ATOM 6440  H H    . THR A 1 69  ? -8.165  -6.385  3.993   1.00 0.00 ? 69  THR A H    4  
ATOM 6441  H HA   . THR A 1 69  ? -7.550  -4.957  5.736   1.00 0.00 ? 69  THR A HA   4  
ATOM 6442  H HB   . THR A 1 69  ? -10.534 -4.995  6.241   1.00 0.00 ? 69  THR A HB   4  
ATOM 6443  H HG1  . THR A 1 69  ? -10.058 -2.842  5.098   1.00 0.00 ? 69  THR A HG1  4  
ATOM 6444  H HG21 . THR A 1 69  ? -8.251  -3.457  7.377   1.00 0.00 ? 69  THR A HG21 4  
ATOM 6445  H HG22 . THR A 1 69  ? -9.731  -2.561  7.031   1.00 0.00 ? 69  THR A HG22 4  
ATOM 6446  H HG23 . THR A 1 69  ? -9.770  -3.937  8.133   1.00 0.00 ? 69  THR A HG23 4  
ATOM 6447  N N    . LEU A 1 70  ? -7.148  -6.546  7.643   1.00 0.00 ? 70  LEU A N    4  
ATOM 6448  C CA   . LEU A 1 70  ? -6.959  -7.317  8.903   1.00 0.00 ? 70  LEU A CA   4  
ATOM 6449  C C    . LEU A 1 70  ? -6.560  -6.344  10.014  1.00 0.00 ? 70  LEU A C    4  
ATOM 6450  O O    . LEU A 1 70  ? -6.760  -6.601  11.185  1.00 0.00 ? 70  LEU A O    4  
ATOM 6451  C CB   . LEU A 1 70  ? -5.856  -8.361  8.710   1.00 0.00 ? 70  LEU A CB   4  
ATOM 6452  C CG   . LEU A 1 70  ? -6.061  -9.509  9.702   1.00 0.00 ? 70  LEU A CG   4  
ATOM 6453  C CD1  . LEU A 1 70  ? -6.046  -10.843 8.951   1.00 0.00 ? 70  LEU A CD1  4  
ATOM 6454  C CD2  . LEU A 1 70  ? -4.934  -9.499  10.735  1.00 0.00 ? 70  LEU A CD2  4  
ATOM 6455  H H    . LEU A 1 70  ? -6.369  -6.215  7.150   1.00 0.00 ? 70  LEU A H    4  
ATOM 6456  H HA   . LEU A 1 70  ? -7.883  -7.809  9.168   1.00 0.00 ? 70  LEU A HA   4  
ATOM 6457  H HB2  . LEU A 1 70  ? -5.895  -8.744  7.700   1.00 0.00 ? 70  LEU A HB2  4  
ATOM 6458  H HB3  . LEU A 1 70  ? -4.893  -7.905  8.887   1.00 0.00 ? 70  LEU A HB3  4  
ATOM 6459  H HG   . LEU A 1 70  ? -7.012  -9.389  10.201  1.00 0.00 ? 70  LEU A HG   4  
ATOM 6460  H HD11 . LEU A 1 70  ? -6.065  -10.659 7.888   1.00 0.00 ? 70  LEU A HD11 4  
ATOM 6461  H HD12 . LEU A 1 70  ? -5.149  -11.388 9.206   1.00 0.00 ? 70  LEU A HD12 4  
ATOM 6462  H HD13 . LEU A 1 70  ? -6.912  -11.424 9.233   1.00 0.00 ? 70  LEU A HD13 4  
ATOM 6463  H HD21 . LEU A 1 70  ? -4.019  -9.167  10.267  1.00 0.00 ? 70  LEU A HD21 4  
ATOM 6464  H HD22 . LEU A 1 70  ? -5.190  -8.827  11.541  1.00 0.00 ? 70  LEU A HD22 4  
ATOM 6465  H HD23 . LEU A 1 70  ? -4.797  -10.495 11.129  1.00 0.00 ? 70  LEU A HD23 4  
ATOM 6466  N N    . ARG A 1 71  ? -6.004  -5.220  9.647   1.00 0.00 ? 71  ARG A N    4  
ATOM 6467  C CA   . ARG A 1 71  ? -5.595  -4.212  10.666  1.00 0.00 ? 71  ARG A CA   4  
ATOM 6468  C C    . ARG A 1 71  ? -5.865  -2.812  10.112  1.00 0.00 ? 71  ARG A C    4  
ATOM 6469  O O    . ARG A 1 71  ? -4.955  -2.089  9.759   1.00 0.00 ? 71  ARG A O    4  
ATOM 6470  C CB   . ARG A 1 71  ? -4.099  -4.346  10.973  1.00 0.00 ? 71  ARG A CB   4  
ATOM 6471  C CG   . ARG A 1 71  ? -3.628  -5.770  10.672  1.00 0.00 ? 71  ARG A CG   4  
ATOM 6472  C CD   . ARG A 1 71  ? -2.213  -5.957  11.221  1.00 0.00 ? 71  ARG A CD   4  
ATOM 6473  N NE   . ARG A 1 71  ? -2.290  -6.568  12.578  1.00 0.00 ? 71  ARG A NE   4  
ATOM 6474  C CZ   . ARG A 1 71  ? -1.220  -7.069  13.134  1.00 0.00 ? 71  ARG A CZ   4  
ATOM 6475  N NH1  . ARG A 1 71  ? -0.075  -7.031  12.505  1.00 0.00 ? 71  ARG A NH1  4  
ATOM 6476  N NH2  . ARG A 1 71  ? -1.294  -7.606  14.321  1.00 0.00 ? 71  ARG A NH2  4  
ATOM 6477  H H    . ARG A 1 71  ? -5.861  -5.036  8.695   1.00 0.00 ? 71  ARG A H    4  
ATOM 6478  H HA   . ARG A 1 71  ? -6.166  -4.359  11.571  1.00 0.00 ? 71  ARG A HA   4  
ATOM 6479  H HB2  . ARG A 1 71  ? -3.545  -3.649  10.363  1.00 0.00 ? 71  ARG A HB2  4  
ATOM 6480  H HB3  . ARG A 1 71  ? -3.927  -4.127  12.016  1.00 0.00 ? 71  ARG A HB3  4  
ATOM 6481  H HG2  . ARG A 1 71  ? -4.296  -6.477  11.141  1.00 0.00 ? 71  ARG A HG2  4  
ATOM 6482  H HG3  . ARG A 1 71  ? -3.623  -5.930  9.604   1.00 0.00 ? 71  ARG A HG3  4  
ATOM 6483  H HD2  . ARG A 1 71  ? -1.654  -6.606  10.565  1.00 0.00 ? 71  ARG A HD2  4  
ATOM 6484  H HD3  . ARG A 1 71  ? -1.721  -4.996  11.283  1.00 0.00 ? 71  ARG A HD3  4  
ATOM 6485  H HE   . ARG A 1 71  ? -3.146  -6.594  13.054  1.00 0.00 ? 71  ARG A HE   4  
ATOM 6486  H HH11 . ARG A 1 71  ? -0.014  -6.618  11.597  1.00 0.00 ? 71  ARG A HH11 4  
ATOM 6487  H HH12 . ARG A 1 71  ? 0.742   -7.416  12.934  1.00 0.00 ? 71  ARG A HH12 4  
ATOM 6488  H HH21 . ARG A 1 71  ? -2.170  -7.633  14.803  1.00 0.00 ? 71  ARG A HH21 4  
ATOM 6489  H HH22 . ARG A 1 71  ? -0.475  -7.990  14.749  1.00 0.00 ? 71  ARG A HH22 4  
ATOM 6490  N N    . ALA A 1 72  ? -7.107  -2.426  10.023  1.00 0.00 ? 72  ALA A N    4  
ATOM 6491  C CA   . ALA A 1 72  ? -7.428  -1.077  9.480   1.00 0.00 ? 72  ALA A CA   4  
ATOM 6492  C C    . ALA A 1 72  ? -7.351  -0.035  10.599  1.00 0.00 ? 72  ALA A C    4  
ATOM 6493  O O    . ALA A 1 72  ? -8.268  0.734   10.807  1.00 0.00 ? 72  ALA A O    4  
ATOM 6494  C CB   . ALA A 1 72  ? -8.839  -1.087  8.890   1.00 0.00 ? 72  ALA A CB   4  
ATOM 6495  H H    . ALA A 1 72  ? -7.829  -3.026  10.304  1.00 0.00 ? 72  ALA A H    4  
ATOM 6496  H HA   . ALA A 1 72  ? -6.716  -0.823  8.707   1.00 0.00 ? 72  ALA A HA   4  
ATOM 6497  H HB1  . ALA A 1 72  ? -9.357  -1.978  9.213   1.00 0.00 ? 72  ALA A HB1  4  
ATOM 6498  H HB2  . ALA A 1 72  ? -9.378  -0.215  9.231   1.00 0.00 ? 72  ALA A HB2  4  
ATOM 6499  H HB3  . ALA A 1 72  ? -8.780  -1.076  7.812   1.00 0.00 ? 72  ALA A HB3  4  
ATOM 6500  N N    . ASP A 1 73  ? -6.261  0.003   11.314  1.00 0.00 ? 73  ASP A N    4  
ATOM 6501  C CA   . ASP A 1 73  ? -6.125  1.002   12.407  1.00 0.00 ? 73  ASP A CA   4  
ATOM 6502  C C    . ASP A 1 73  ? -5.870  2.379   11.789  1.00 0.00 ? 73  ASP A C    4  
ATOM 6503  O O    . ASP A 1 73  ? -6.377  2.695   10.732  1.00 0.00 ? 73  ASP A O    4  
ATOM 6504  C CB   . ASP A 1 73  ? -4.948  0.616   13.306  1.00 0.00 ? 73  ASP A CB   4  
ATOM 6505  C CG   . ASP A 1 73  ? -5.269  0.989   14.755  1.00 0.00 ? 73  ASP A CG   4  
ATOM 6506  O OD1  . ASP A 1 73  ? -6.100  0.321   15.348  1.00 0.00 ? 73  ASP A OD1  4  
ATOM 6507  O OD2  . ASP A 1 73  ? -4.677  1.935   15.248  1.00 0.00 ? 73  ASP A OD2  4  
ATOM 6508  H H    . ASP A 1 73  ? -5.530  -0.620  11.126  1.00 0.00 ? 73  ASP A H    4  
ATOM 6509  H HA   . ASP A 1 73  ? -7.034  1.028   12.989  1.00 0.00 ? 73  ASP A HA   4  
ATOM 6510  H HB2  . ASP A 1 73  ? -4.776  -0.449  13.237  1.00 0.00 ? 73  ASP A HB2  4  
ATOM 6511  H HB3  . ASP A 1 73  ? -4.063  1.146   12.988  1.00 0.00 ? 73  ASP A HB3  4  
ATOM 6512  N N    . ASP A 1 74  ? -5.087  3.197   12.434  1.00 0.00 ? 74  ASP A N    4  
ATOM 6513  C CA   . ASP A 1 74  ? -4.801  4.546   11.873  1.00 0.00 ? 74  ASP A CA   4  
ATOM 6514  C C    . ASP A 1 74  ? -3.297  4.681   11.633  1.00 0.00 ? 74  ASP A C    4  
ATOM 6515  O O    . ASP A 1 74  ? -2.727  5.741   11.797  1.00 0.00 ? 74  ASP A O    4  
ATOM 6516  C CB   . ASP A 1 74  ? -5.258  5.618   12.864  1.00 0.00 ? 74  ASP A CB   4  
ATOM 6517  C CG   . ASP A 1 74  ? -6.161  6.625   12.151  1.00 0.00 ? 74  ASP A CG   4  
ATOM 6518  O OD1  . ASP A 1 74  ? -5.772  7.094   11.095  1.00 0.00 ? 74  ASP A OD1  4  
ATOM 6519  O OD2  . ASP A 1 74  ? -7.226  6.909   12.674  1.00 0.00 ? 74  ASP A OD2  4  
ATOM 6520  H H    . ASP A 1 74  ? -4.683  2.925   13.284  1.00 0.00 ? 74  ASP A H    4  
ATOM 6521  H HA   . ASP A 1 74  ? -5.329  4.668   10.939  1.00 0.00 ? 74  ASP A HA   4  
ATOM 6522  H HB2  . ASP A 1 74  ? -5.804  5.153   13.672  1.00 0.00 ? 74  ASP A HB2  4  
ATOM 6523  H HB3  . ASP A 1 74  ? -4.394  6.131   13.261  1.00 0.00 ? 74  ASP A HB3  4  
ATOM 6524  N N    . ARG A 1 75  ? -2.647  3.613   11.257  1.00 0.00 ? 75  ARG A N    4  
ATOM 6525  C CA   . ARG A 1 75  ? -1.178  3.688   11.022  1.00 0.00 ? 75  ARG A CA   4  
ATOM 6526  C C    . ARG A 1 75  ? -0.807  2.933   9.742   1.00 0.00 ? 75  ARG A C    4  
ATOM 6527  O O    . ARG A 1 75  ? -0.023  3.407   8.943   1.00 0.00 ? 75  ARG A O    4  
ATOM 6528  C CB   . ARG A 1 75  ? -0.448  3.063   12.212  1.00 0.00 ? 75  ARG A CB   4  
ATOM 6529  C CG   . ARG A 1 75  ? -1.122  3.504   13.513  1.00 0.00 ? 75  ARG A CG   4  
ATOM 6530  C CD   . ARG A 1 75  ? -0.942  5.011   13.700  1.00 0.00 ? 75  ARG A CD   4  
ATOM 6531  N NE   . ARG A 1 75  ? -2.117  5.565   14.432  1.00 0.00 ? 75  ARG A NE   4  
ATOM 6532  C CZ   . ARG A 1 75  ? -2.061  6.760   14.956  1.00 0.00 ? 75  ARG A CZ   4  
ATOM 6533  N NH1  . ARG A 1 75  ? -0.978  7.480   14.837  1.00 0.00 ? 75  ARG A NH1  4  
ATOM 6534  N NH2  . ARG A 1 75  ? -3.093  7.238   15.598  1.00 0.00 ? 75  ARG A NH2  4  
ATOM 6535  H H    . ARG A 1 75  ? -3.122  2.765   11.137  1.00 0.00 ? 75  ARG A H    4  
ATOM 6536  H HA   . ARG A 1 75  ? -0.883  4.721   10.924  1.00 0.00 ? 75  ARG A HA   4  
ATOM 6537  H HB2  . ARG A 1 75  ? -0.485  1.986   12.132  1.00 0.00 ? 75  ARG A HB2  4  
ATOM 6538  H HB3  . ARG A 1 75  ? 0.581   3.389   12.214  1.00 0.00 ? 75  ARG A HB3  4  
ATOM 6539  H HG2  . ARG A 1 75  ? -2.176  3.269   13.469  1.00 0.00 ? 75  ARG A HG2  4  
ATOM 6540  H HG3  . ARG A 1 75  ? -0.672  2.984   14.345  1.00 0.00 ? 75  ARG A HG3  4  
ATOM 6541  H HD2  . ARG A 1 75  ? -0.045  5.198   14.269  1.00 0.00 ? 75  ARG A HD2  4  
ATOM 6542  H HD3  . ARG A 1 75  ? -0.861  5.487   12.733  1.00 0.00 ? 75  ARG A HD3  4  
ATOM 6543  H HE   . ARG A 1 75  ? -2.932  5.030   14.523  1.00 0.00 ? 75  ARG A HE   4  
ATOM 6544  H HH11 . ARG A 1 75  ? -0.187  7.118   14.345  1.00 0.00 ? 75  ARG A HH11 4  
ATOM 6545  H HH12 . ARG A 1 75  ? -0.939  8.395   15.241  1.00 0.00 ? 75  ARG A HH12 4  
ATOM 6546  H HH21 . ARG A 1 75  ? -3.923  6.688   15.689  1.00 0.00 ? 75  ARG A HH21 4  
ATOM 6547  H HH22 . ARG A 1 75  ? -3.053  8.153   16.000  1.00 0.00 ? 75  ARG A HH22 4  
ATOM 6548  N N    . SER A 1 76  ? -1.346  1.761   9.539   1.00 0.00 ? 76  SER A N    4  
ATOM 6549  C CA   . SER A 1 76  ? -0.998  0.995   8.306   1.00 0.00 ? 76  SER A CA   4  
ATOM 6550  C C    . SER A 1 76  ? -2.208  0.196   7.818   1.00 0.00 ? 76  SER A C    4  
ATOM 6551  O O    . SER A 1 76  ? -3.172  0.003   8.532   1.00 0.00 ? 76  SER A O    4  
ATOM 6552  C CB   . SER A 1 76  ? 0.150   0.033   8.614   1.00 0.00 ? 76  SER A CB   4  
ATOM 6553  O OG   . SER A 1 76  ? 1.206   0.746   9.243   1.00 0.00 ? 76  SER A OG   4  
ATOM 6554  H H    . SER A 1 76  ? -1.971  1.384   10.194  1.00 0.00 ? 76  SER A H    4  
ATOM 6555  H HA   . SER A 1 76  ? -0.689  1.683   7.535   1.00 0.00 ? 76  SER A HA   4  
ATOM 6556  H HB2  . SER A 1 76  ? -0.196  -0.743  9.276   1.00 0.00 ? 76  SER A HB2  4  
ATOM 6557  H HB3  . SER A 1 76  ? 0.501   -0.413  7.693   1.00 0.00 ? 76  SER A HB3  4  
ATOM 6558  H HG   . SER A 1 76  ? 1.238   1.627   8.862   1.00 0.00 ? 76  SER A HG   4  
ATOM 6559  N N    . ILE A 1 77  ? -2.157  -0.277  6.600   1.00 0.00 ? 77  ILE A N    4  
ATOM 6560  C CA   . ILE A 1 77  ? -3.290  -1.071  6.053   1.00 0.00 ? 77  ILE A CA   4  
ATOM 6561  C C    . ILE A 1 77  ? -2.792  -1.853  4.826   1.00 0.00 ? 77  ILE A C    4  
ATOM 6562  O O    . ILE A 1 77  ? -2.725  -1.338  3.727   1.00 0.00 ? 77  ILE A O    4  
ATOM 6563  C CB   . ILE A 1 77  ? -4.456  -0.117  5.694   1.00 0.00 ? 77  ILE A CB   4  
ATOM 6564  C CG1  . ILE A 1 77  ? -5.591  -0.323  6.701   1.00 0.00 ? 77  ILE A CG1  4  
ATOM 6565  C CG2  . ILE A 1 77  ? -4.998  -0.382  4.281   1.00 0.00 ? 77  ILE A CG2  4  
ATOM 6566  C CD1  . ILE A 1 77  ? -6.297  -1.649  6.409   1.00 0.00 ? 77  ILE A CD1  4  
ATOM 6567  H H    . ILE A 1 77  ? -1.365  -0.113  6.044   1.00 0.00 ? 77  ILE A H    4  
ATOM 6568  H HA   . ILE A 1 77  ? -3.625  -1.772  6.806   1.00 0.00 ? 77  ILE A HA   4  
ATOM 6569  H HB   . ILE A 1 77  ? -4.108  0.903   5.756   1.00 0.00 ? 77  ILE A HB   4  
ATOM 6570  H HG12 . ILE A 1 77  ? -5.185  -0.343  7.702   1.00 0.00 ? 77  ILE A HG12 4  
ATOM 6571  H HG13 . ILE A 1 77  ? -6.299  0.487   6.615   1.00 0.00 ? 77  ILE A HG13 4  
ATOM 6572  H HG21 . ILE A 1 77  ? -5.020  -1.445  4.098   1.00 0.00 ? 77  ILE A HG21 4  
ATOM 6573  H HG22 . ILE A 1 77  ? -5.997  0.020   4.200   1.00 0.00 ? 77  ILE A HG22 4  
ATOM 6574  H HG23 . ILE A 1 77  ? -4.357  0.096   3.555   1.00 0.00 ? 77  ILE A HG23 4  
ATOM 6575  H HD11 . ILE A 1 77  ? -5.560  -2.424  6.259   1.00 0.00 ? 77  ILE A HD11 4  
ATOM 6576  H HD12 . ILE A 1 77  ? -6.932  -1.913  7.240   1.00 0.00 ? 77  ILE A HD12 4  
ATOM 6577  H HD13 . ILE A 1 77  ? -6.898  -1.548  5.516   1.00 0.00 ? 77  ILE A HD13 4  
ATOM 6578  N N    . TYR A 1 78  ? -2.439  -3.095  5.011   1.00 0.00 ? 78  TYR A N    4  
ATOM 6579  C CA   . TYR A 1 78  ? -1.951  -3.912  3.861   1.00 0.00 ? 78  TYR A CA   4  
ATOM 6580  C C    . TYR A 1 78  ? -2.949  -5.050  3.621   1.00 0.00 ? 78  TYR A C    4  
ATOM 6581  O O    . TYR A 1 78  ? -3.334  -5.751  4.536   1.00 0.00 ? 78  TYR A O    4  
ATOM 6582  C CB   . TYR A 1 78  ? -0.561  -4.501  4.163   1.00 0.00 ? 78  TYR A CB   4  
ATOM 6583  C CG   . TYR A 1 78  ? 0.061   -3.834  5.375   1.00 0.00 ? 78  TYR A CG   4  
ATOM 6584  C CD1  . TYR A 1 78  ? -0.402  -4.160  6.655   1.00 0.00 ? 78  TYR A CD1  4  
ATOM 6585  C CD2  . TYR A 1 78  ? 1.114   -2.908  5.225   1.00 0.00 ? 78  TYR A CD2  4  
ATOM 6586  C CE1  . TYR A 1 78  ? 0.174   -3.566  7.784   1.00 0.00 ? 78  TYR A CE1  4  
ATOM 6587  C CE2  . TYR A 1 78  ? 1.689   -2.320  6.358   1.00 0.00 ? 78  TYR A CE2  4  
ATOM 6588  C CZ   . TYR A 1 78  ? 1.219   -2.647  7.635   1.00 0.00 ? 78  TYR A CZ   4  
ATOM 6589  O OH   . TYR A 1 78  ? 1.787   -2.064  8.749   1.00 0.00 ? 78  TYR A OH   4  
ATOM 6590  H H    . TYR A 1 78  ? -2.499  -3.493  5.903   1.00 0.00 ? 78  TYR A H    4  
ATOM 6591  H HA   . TYR A 1 78  ? -1.898  -3.291  2.978   1.00 0.00 ? 78  TYR A HA   4  
ATOM 6592  H HB2  . TYR A 1 78  ? -0.659  -5.558  4.355   1.00 0.00 ? 78  TYR A HB2  4  
ATOM 6593  H HB3  . TYR A 1 78  ? 0.081   -4.357  3.310   1.00 0.00 ? 78  TYR A HB3  4  
ATOM 6594  H HD1  . TYR A 1 78  ? -1.208  -4.869  6.773   1.00 0.00 ? 78  TYR A HD1  4  
ATOM 6595  H HD2  . TYR A 1 78  ? 1.481   -2.643  4.238   1.00 0.00 ? 78  TYR A HD2  4  
ATOM 6596  H HE1  . TYR A 1 78  ? -0.188  -3.817  8.770   1.00 0.00 ? 78  TYR A HE1  4  
ATOM 6597  H HE2  . TYR A 1 78  ? 2.498   -1.615  6.248   1.00 0.00 ? 78  TYR A HE2  4  
ATOM 6598  H HH   . TYR A 1 78  ? 2.741   -2.137  8.669   1.00 0.00 ? 78  TYR A HH   4  
ATOM 6599  N N    . GLY A 1 79  ? -3.388  -5.232  2.403   1.00 0.00 ? 79  GLY A N    4  
ATOM 6600  C CA   . GLY A 1 79  ? -4.378  -6.315  2.123   1.00 0.00 ? 79  GLY A CA   4  
ATOM 6601  C C    . GLY A 1 79  ? -3.684  -7.528  1.499   1.00 0.00 ? 79  GLY A C    4  
ATOM 6602  O O    . GLY A 1 79  ? -2.638  -7.417  0.894   1.00 0.00 ? 79  GLY A O    4  
ATOM 6603  H H    . GLY A 1 79  ? -3.079  -4.649  1.678   1.00 0.00 ? 79  GLY A H    4  
ATOM 6604  H HA2  . GLY A 1 79  ? -4.854  -6.610  3.046   1.00 0.00 ? 79  GLY A HA2  4  
ATOM 6605  H HA3  . GLY A 1 79  ? -5.126  -5.944  1.437   1.00 0.00 ? 79  GLY A HA3  4  
ATOM 6606  N N    . LYS A 1 80  ? -4.267  -8.688  1.641   1.00 0.00 ? 80  LYS A N    4  
ATOM 6607  C CA   . LYS A 1 80  ? -3.656  -9.916  1.057   1.00 0.00 ? 80  LYS A CA   4  
ATOM 6608  C C    . LYS A 1 80  ? -4.764  -10.921 0.713   1.00 0.00 ? 80  LYS A C    4  
ATOM 6609  O O    . LYS A 1 80  ? -5.719  -11.070 1.447   1.00 0.00 ? 80  LYS A O    4  
ATOM 6610  C CB   . LYS A 1 80  ? -2.701  -10.542 2.076   1.00 0.00 ? 80  LYS A CB   4  
ATOM 6611  C CG   . LYS A 1 80  ? -3.505  -11.082 3.260   1.00 0.00 ? 80  LYS A CG   4  
ATOM 6612  C CD   . LYS A 1 80  ? -2.623  -11.108 4.510   1.00 0.00 ? 80  LYS A CD   4  
ATOM 6613  C CE   . LYS A 1 80  ? -3.500  -11.324 5.745   1.00 0.00 ? 80  LYS A CE   4  
ATOM 6614  N NZ   . LYS A 1 80  ? -3.390  -12.741 6.193   1.00 0.00 ? 80  LYS A NZ   4  
ATOM 6615  H H    . LYS A 1 80  ? -5.112  -8.750  2.132   1.00 0.00 ? 80  LYS A H    4  
ATOM 6616  H HA   . LYS A 1 80  ? -3.111  -9.657  0.162   1.00 0.00 ? 80  LYS A HA   4  
ATOM 6617  H HB2  . LYS A 1 80  ? -2.155  -11.350 1.609   1.00 0.00 ? 80  LYS A HB2  4  
ATOM 6618  H HB3  . LYS A 1 80  ? -2.006  -9.794  2.427   1.00 0.00 ? 80  LYS A HB3  4  
ATOM 6619  H HG2  . LYS A 1 80  ? -4.359  -10.445 3.434   1.00 0.00 ? 80  LYS A HG2  4  
ATOM 6620  H HG3  . LYS A 1 80  ? -3.842  -12.084 3.038   1.00 0.00 ? 80  LYS A HG3  4  
ATOM 6621  H HD2  . LYS A 1 80  ? -1.908  -11.913 4.429   1.00 0.00 ? 80  LYS A HD2  4  
ATOM 6622  H HD3  . LYS A 1 80  ? -2.101  -10.168 4.601   1.00 0.00 ? 80  LYS A HD3  4  
ATOM 6623  H HE2  . LYS A 1 80  ? -3.172  -10.669 6.539   1.00 0.00 ? 80  LYS A HE2  4  
ATOM 6624  H HE3  . LYS A 1 80  ? -4.528  -11.103 5.499   1.00 0.00 ? 80  LYS A HE3  4  
ATOM 6625  H HZ1  . LYS A 1 80  ? -2.656  -13.225 5.636   1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 6626  H HZ2  . LYS A 1 80  ? -3.136  -12.769 7.200   1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 6627  H HZ3  . LYS A 1 80  ? -4.303  -13.220 6.054   1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 6628  N N    . LYS A 1 81  ? -4.647  -11.618 -0.389  1.00 0.00 ? 81  LYS A N    4  
ATOM 6629  C CA   . LYS A 1 81  ? -5.706  -12.611 -0.750  1.00 0.00 ? 81  LYS A CA   4  
ATOM 6630  C C    . LYS A 1 81  ? -5.570  -13.034 -2.218  1.00 0.00 ? 81  LYS A C    4  
ATOM 6631  O O    . LYS A 1 81  ? -5.245  -12.243 -3.078  1.00 0.00 ? 81  LYS A O    4  
ATOM 6632  C CB   . LYS A 1 81  ? -7.083  -11.980 -0.534  1.00 0.00 ? 81  LYS A CB   4  
ATOM 6633  C CG   . LYS A 1 81  ? -7.718  -12.562 0.729   1.00 0.00 ? 81  LYS A CG   4  
ATOM 6634  C CD   . LYS A 1 81  ? -9.015  -13.284 0.362   1.00 0.00 ? 81  LYS A CD   4  
ATOM 6635  C CE   . LYS A 1 81  ? -8.944  -14.737 0.837   1.00 0.00 ? 81  LYS A CE   4  
ATOM 6636  N NZ   . LYS A 1 81  ? -10.209 -15.092 1.540   1.00 0.00 ? 81  LYS A NZ   4  
ATOM 6637  H H    . LYS A 1 81  ? -3.869  -11.494 -0.972  1.00 0.00 ? 81  LYS A H    4  
ATOM 6638  H HA   . LYS A 1 81  ? -5.610  -13.480 -0.117  1.00 0.00 ? 81  LYS A HA   4  
ATOM 6639  H HB2  . LYS A 1 81  ? -6.975  -10.911 -0.425  1.00 0.00 ? 81  LYS A HB2  4  
ATOM 6640  H HB3  . LYS A 1 81  ? -7.714  -12.194 -1.383  1.00 0.00 ? 81  LYS A HB3  4  
ATOM 6641  H HG2  . LYS A 1 81  ? -7.032  -13.260 1.187   1.00 0.00 ? 81  LYS A HG2  4  
ATOM 6642  H HG3  . LYS A 1 81  ? -7.936  -11.764 1.422   1.00 0.00 ? 81  LYS A HG3  4  
ATOM 6643  H HD2  . LYS A 1 81  ? -9.849  -12.788 0.839   1.00 0.00 ? 81  LYS A HD2  4  
ATOM 6644  H HD3  . LYS A 1 81  ? -9.148  -13.263 -0.708  1.00 0.00 ? 81  LYS A HD3  4  
ATOM 6645  H HE2  . LYS A 1 81  ? -8.810  -15.388 -0.014  1.00 0.00 ? 81  LYS A HE2  4  
ATOM 6646  H HE3  . LYS A 1 81  ? -8.110  -14.855 1.514   1.00 0.00 ? 81  LYS A HE3  4  
ATOM 6647  H HZ1  . LYS A 1 81  ? -10.924 -14.360 1.357   1.00 0.00 ? 81  LYS A HZ1  4  
ATOM 6648  H HZ2  . LYS A 1 81  ? -10.553 -16.009 1.190   1.00 0.00 ? 81  LYS A HZ2  4  
ATOM 6649  H HZ3  . LYS A 1 81  ? -10.032 -15.154 2.562   1.00 0.00 ? 81  LYS A HZ3  4  
ATOM 6650  N N    . GLY A 1 82  ? -5.835  -14.283 -2.508  1.00 0.00 ? 82  GLY A N    4  
ATOM 6651  C CA   . GLY A 1 82  ? -5.741  -14.768 -3.918  1.00 0.00 ? 82  GLY A CA   4  
ATOM 6652  C C    . GLY A 1 82  ? -4.298  -14.669 -4.417  1.00 0.00 ? 82  GLY A C    4  
ATOM 6653  O O    . GLY A 1 82  ? -4.037  -14.153 -5.486  1.00 0.00 ? 82  GLY A O    4  
ATOM 6654  H H    . GLY A 1 82  ? -6.107  -14.901 -1.797  1.00 0.00 ? 82  GLY A H    4  
ATOM 6655  H HA2  . GLY A 1 82  ? -6.066  -15.797 -3.964  1.00 0.00 ? 82  GLY A HA2  4  
ATOM 6656  H HA3  . GLY A 1 82  ? -6.376  -14.163 -4.547  1.00 0.00 ? 82  GLY A HA3  4  
ATOM 6657  N N    . SER A 1 83  ? -3.355  -15.156 -3.656  1.00 0.00 ? 83  SER A N    4  
ATOM 6658  C CA   . SER A 1 83  ? -1.929  -15.086 -4.095  1.00 0.00 ? 83  SER A CA   4  
ATOM 6659  C C    . SER A 1 83  ? -1.617  -13.675 -4.599  1.00 0.00 ? 83  SER A C    4  
ATOM 6660  O O    . SER A 1 83  ? -0.686  -13.466 -5.352  1.00 0.00 ? 83  SER A O    4  
ATOM 6661  C CB   . SER A 1 83  ? -1.693  -16.091 -5.223  1.00 0.00 ? 83  SER A CB   4  
ATOM 6662  O OG   . SER A 1 83  ? -2.944  -16.611 -5.658  1.00 0.00 ? 83  SER A OG   4  
ATOM 6663  H H    . SER A 1 83  ? -3.582  -15.567 -2.795  1.00 0.00 ? 83  SER A H    4  
ATOM 6664  H HA   . SER A 1 83  ? -1.283  -15.322 -3.261  1.00 0.00 ? 83  SER A HA   4  
ATOM 6665  H HB2  . SER A 1 83  ? -1.206  -15.600 -6.050  1.00 0.00 ? 83  SER A HB2  4  
ATOM 6666  H HB3  . SER A 1 83  ? -1.063  -16.893 -4.864  1.00 0.00 ? 83  SER A HB3  4  
ATOM 6667  H HG   . SER A 1 83  ? -2.769  -17.375 -6.213  1.00 0.00 ? 83  SER A HG   4  
ATOM 6668  N N    . ALA A 1 84  ? -2.387  -12.707 -4.189  1.00 0.00 ? 84  ALA A N    4  
ATOM 6669  C CA   . ALA A 1 84  ? -2.141  -11.309 -4.637  1.00 0.00 ? 84  ALA A CA   4  
ATOM 6670  C C    . ALA A 1 84  ? -2.634  -10.351 -3.552  1.00 0.00 ? 84  ALA A C    4  
ATOM 6671  O O    . ALA A 1 84  ? -3.593  -10.626 -2.863  1.00 0.00 ? 84  ALA A O    4  
ATOM 6672  C CB   . ALA A 1 84  ? -2.901  -11.048 -5.940  1.00 0.00 ? 84  ALA A CB   4  
ATOM 6673  H H    . ALA A 1 84  ? -3.128  -12.895 -3.579  1.00 0.00 ? 84  ALA A H    4  
ATOM 6674  H HA   . ALA A 1 84  ? -1.082  -11.162 -4.798  1.00 0.00 ? 84  ALA A HA   4  
ATOM 6675  H HB1  . ALA A 1 84  ? -3.956  -11.211 -5.780  1.00 0.00 ? 84  ALA A HB1  4  
ATOM 6676  H HB2  . ALA A 1 84  ? -2.738  -10.026 -6.252  1.00 0.00 ? 84  ALA A HB2  4  
ATOM 6677  H HB3  . ALA A 1 84  ? -2.543  -11.719 -6.707  1.00 0.00 ? 84  ALA A HB3  4  
ATOM 6678  N N    . GLY A 1 85  ? -1.994  -9.229  -3.394  1.00 0.00 ? 85  GLY A N    4  
ATOM 6679  C CA   . GLY A 1 85  ? -2.444  -8.270  -2.349  1.00 0.00 ? 85  GLY A CA   4  
ATOM 6680  C C    . GLY A 1 85  ? -1.713  -6.942  -2.526  1.00 0.00 ? 85  GLY A C    4  
ATOM 6681  O O    . GLY A 1 85  ? -1.021  -6.728  -3.501  1.00 0.00 ? 85  GLY A O    4  
ATOM 6682  H H    . GLY A 1 85  ? -1.221  -9.017  -3.957  1.00 0.00 ? 85  GLY A H    4  
ATOM 6683  H HA2  . GLY A 1 85  ? -3.509  -8.111  -2.442  1.00 0.00 ? 85  GLY A HA2  4  
ATOM 6684  H HA3  . GLY A 1 85  ? -2.225  -8.670  -1.370  1.00 0.00 ? 85  GLY A HA3  4  
ATOM 6685  N N    . VAL A 1 86  ? -1.863  -6.048  -1.591  1.00 0.00 ? 86  VAL A N    4  
ATOM 6686  C CA   . VAL A 1 86  ? -1.178  -4.734  -1.706  1.00 0.00 ? 86  VAL A CA   4  
ATOM 6687  C C    . VAL A 1 86  ? -0.679  -4.287  -0.332  1.00 0.00 ? 86  VAL A C    4  
ATOM 6688  O O    . VAL A 1 86  ? -1.191  -4.696  0.692   1.00 0.00 ? 86  VAL A O    4  
ATOM 6689  C CB   . VAL A 1 86  ? -2.157  -3.695  -2.253  1.00 0.00 ? 86  VAL A CB   4  
ATOM 6690  C CG1  . VAL A 1 86  ? -3.377  -3.610  -1.336  1.00 0.00 ? 86  VAL A CG1  4  
ATOM 6691  C CG2  . VAL A 1 86  ? -1.467  -2.332  -2.308  1.00 0.00 ? 86  VAL A CG2  4  
ATOM 6692  H H    . VAL A 1 86  ? -2.427  -6.239  -0.814  1.00 0.00 ? 86  VAL A H    4  
ATOM 6693  H HA   . VAL A 1 86  ? -0.341  -4.826  -2.381  1.00 0.00 ? 86  VAL A HA   4  
ATOM 6694  H HB   . VAL A 1 86  ? -2.471  -3.983  -3.245  1.00 0.00 ? 86  VAL A HB   4  
ATOM 6695  H HG11 . VAL A 1 86  ? -3.230  -4.251  -0.480  1.00 0.00 ? 86  VAL A HG11 4  
ATOM 6696  H HG12 . VAL A 1 86  ? -3.507  -2.590  -1.005  1.00 0.00 ? 86  VAL A HG12 4  
ATOM 6697  H HG13 . VAL A 1 86  ? -4.256  -3.927  -1.877  1.00 0.00 ? 86  VAL A HG13 4  
ATOM 6698  H HG21 . VAL A 1 86  ? -0.459  -2.454  -2.675  1.00 0.00 ? 86  VAL A HG21 4  
ATOM 6699  H HG22 . VAL A 1 86  ? -2.013  -1.677  -2.970  1.00 0.00 ? 86  VAL A HG22 4  
ATOM 6700  H HG23 . VAL A 1 86  ? -1.439  -1.900  -1.318  1.00 0.00 ? 86  VAL A HG23 4  
ATOM 6701  N N    . ILE A 1 87  ? 0.310   -3.439  -0.306  1.00 0.00 ? 87  ILE A N    4  
ATOM 6702  C CA   . ILE A 1 87  ? 0.844   -2.944  0.991   1.00 0.00 ? 87  ILE A CA   4  
ATOM 6703  C C    . ILE A 1 87  ? 0.715   -1.424  1.010   1.00 0.00 ? 87  ILE A C    4  
ATOM 6704  O O    . ILE A 1 87  ? 1.563   -0.713  0.509   1.00 0.00 ? 87  ILE A O    4  
ATOM 6705  C CB   . ILE A 1 87  ? 2.316   -3.349  1.125   1.00 0.00 ? 87  ILE A CB   4  
ATOM 6706  C CG1  . ILE A 1 87  ? 2.414   -4.873  1.229   1.00 0.00 ? 87  ILE A CG1  4  
ATOM 6707  C CG2  . ILE A 1 87  ? 2.916   -2.718  2.383   1.00 0.00 ? 87  ILE A CG2  4  
ATOM 6708  C CD1  . ILE A 1 87  ? 3.885   -5.291  1.289   1.00 0.00 ? 87  ILE A CD1  4  
ATOM 6709  H H    . ILE A 1 87  ? 0.697   -3.117  -1.145  1.00 0.00 ? 87  ILE A H    4  
ATOM 6710  H HA   . ILE A 1 87  ? 0.273   -3.367  1.802   1.00 0.00 ? 87  ILE A HA   4  
ATOM 6711  H HB   . ILE A 1 87  ? 2.863   -3.011  0.257   1.00 0.00 ? 87  ILE A HB   4  
ATOM 6712  H HG12 . ILE A 1 87  ? 1.909   -5.205  2.125   1.00 0.00 ? 87  ILE A HG12 4  
ATOM 6713  H HG13 . ILE A 1 87  ? 1.948   -5.324  0.366   1.00 0.00 ? 87  ILE A HG13 4  
ATOM 6714  H HG21 . ILE A 1 87  ? 2.390   -1.804  2.616   1.00 0.00 ? 87  ILE A HG21 4  
ATOM 6715  H HG22 . ILE A 1 87  ? 2.824   -3.407  3.210   1.00 0.00 ? 87  ILE A HG22 4  
ATOM 6716  H HG23 . ILE A 1 87  ? 3.960   -2.499  2.212   1.00 0.00 ? 87  ILE A HG23 4  
ATOM 6717  H HD11 . ILE A 1 87  ? 4.428   -4.609  1.927   1.00 0.00 ? 87  ILE A HD11 4  
ATOM 6718  H HD12 . ILE A 1 87  ? 3.958   -6.292  1.687   1.00 0.00 ? 87  ILE A HD12 4  
ATOM 6719  H HD13 . ILE A 1 87  ? 4.306   -5.267  0.295   1.00 0.00 ? 87  ILE A HD13 4  
ATOM 6720  N N    . THR A 1 88  ? -0.355  -0.916  1.560   1.00 0.00 ? 88  THR A N    4  
ATOM 6721  C CA   . THR A 1 88  ? -0.546  0.558   1.577   1.00 0.00 ? 88  THR A CA   4  
ATOM 6722  C C    . THR A 1 88  ? -0.351  1.109   2.985   1.00 0.00 ? 88  THR A C    4  
ATOM 6723  O O    . THR A 1 88  ? -0.880  0.592   3.949   1.00 0.00 ? 88  THR A O    4  
ATOM 6724  C CB   . THR A 1 88  ? -1.959  0.891   1.091   1.00 0.00 ? 88  THR A CB   4  
ATOM 6725  O OG1  . THR A 1 88  ? -2.890  0.627   2.132   1.00 0.00 ? 88  THR A OG1  4  
ATOM 6726  C CG2  . THR A 1 88  ? -2.294  0.032   -0.127  1.00 0.00 ? 88  THR A CG2  4  
ATOM 6727  H H    . THR A 1 88  ? -1.039  -1.505  1.944   1.00 0.00 ? 88  THR A H    4  
ATOM 6728  H HA   . THR A 1 88  ? 0.170   1.013   0.917   1.00 0.00 ? 88  THR A HA   4  
ATOM 6729  H HB   . THR A 1 88  ? -2.009  1.933   0.817   1.00 0.00 ? 88  THR A HB   4  
ATOM 6730  H HG1  . THR A 1 88  ? -3.265  1.465   2.415   1.00 0.00 ? 88  THR A HG1  4  
ATOM 6731  H HG21 . THR A 1 88  ? -1.585  0.233   -0.915  1.00 0.00 ? 88  THR A HG21 4  
ATOM 6732  H HG22 . THR A 1 88  ? -2.243  -1.013  0.145   1.00 0.00 ? 88  THR A HG22 4  
ATOM 6733  H HG23 . THR A 1 88  ? -3.290  0.265   -0.470  1.00 0.00 ? 88  THR A HG23 4  
ATOM 6734  N N    . VAL A 1 89  ? 0.401   2.165   3.104   1.00 0.00 ? 89  VAL A N    4  
ATOM 6735  C CA   . VAL A 1 89  ? 0.630   2.768   4.449   1.00 0.00 ? 89  VAL A CA   4  
ATOM 6736  C C    . VAL A 1 89  ? 0.871   4.273   4.293   1.00 0.00 ? 89  VAL A C    4  
ATOM 6737  O O    . VAL A 1 89  ? 1.275   4.744   3.250   1.00 0.00 ? 89  VAL A O    4  
ATOM 6738  C CB   . VAL A 1 89  ? 1.840   2.090   5.114   1.00 0.00 ? 89  VAL A CB   4  
ATOM 6739  C CG1  . VAL A 1 89  ? 2.577   3.069   6.035   1.00 0.00 ? 89  VAL A CG1  4  
ATOM 6740  C CG2  . VAL A 1 89  ? 1.353   0.902   5.940   1.00 0.00 ? 89  VAL A CG2  4  
ATOM 6741  H H    . VAL A 1 89  ? 0.810   2.567   2.303   1.00 0.00 ? 89  VAL A H    4  
ATOM 6742  H HA   . VAL A 1 89  ? -0.247  2.612   5.060   1.00 0.00 ? 89  VAL A HA   4  
ATOM 6743  H HB   . VAL A 1 89  ? 2.517   1.738   4.352   1.00 0.00 ? 89  VAL A HB   4  
ATOM 6744  H HG11 . VAL A 1 89  ? 1.887   3.467   6.765   1.00 0.00 ? 89  VAL A HG11 4  
ATOM 6745  H HG12 . VAL A 1 89  ? 3.379   2.553   6.541   1.00 0.00 ? 89  VAL A HG12 4  
ATOM 6746  H HG13 . VAL A 1 89  ? 2.984   3.879   5.447   1.00 0.00 ? 89  VAL A HG13 4  
ATOM 6747  H HG21 . VAL A 1 89  ? 0.332   0.672   5.675   1.00 0.00 ? 89  VAL A HG21 4  
ATOM 6748  H HG22 . VAL A 1 89  ? 1.978   0.048   5.736   1.00 0.00 ? 89  VAL A HG22 4  
ATOM 6749  H HG23 . VAL A 1 89  ? 1.408   1.147   6.989   1.00 0.00 ? 89  VAL A HG23 4  
ATOM 6750  N N    . LYS A 1 90  ? 0.632   5.024   5.331   1.00 0.00 ? 90  LYS A N    4  
ATOM 6751  C CA   . LYS A 1 90  ? 0.851   6.493   5.253   1.00 0.00 ? 90  LYS A CA   4  
ATOM 6752  C C    . LYS A 1 90  ? 2.342   6.789   5.425   1.00 0.00 ? 90  LYS A C    4  
ATOM 6753  O O    . LYS A 1 90  ? 3.032   6.131   6.178   1.00 0.00 ? 90  LYS A O    4  
ATOM 6754  C CB   . LYS A 1 90  ? 0.059   7.187   6.364   1.00 0.00 ? 90  LYS A CB   4  
ATOM 6755  C CG   . LYS A 1 90  ? -1.264  7.704   5.796   1.00 0.00 ? 90  LYS A CG   4  
ATOM 6756  C CD   . LYS A 1 90  ? -2.431  7.068   6.555   1.00 0.00 ? 90  LYS A CD   4  
ATOM 6757  C CE   . LYS A 1 90  ? -2.196  7.201   8.060   1.00 0.00 ? 90  LYS A CE   4  
ATOM 6758  N NZ   . LYS A 1 90  ? -3.509  7.264   8.764   1.00 0.00 ? 90  LYS A NZ   4  
ATOM 6759  H H    . LYS A 1 90  ? 0.311   4.620   6.164   1.00 0.00 ? 90  LYS A H    4  
ATOM 6760  H HA   . LYS A 1 90  ? 0.520   6.858   4.292   1.00 0.00 ? 90  LYS A HA   4  
ATOM 6761  H HB2  . LYS A 1 90  ? -0.139  6.481   7.158   1.00 0.00 ? 90  LYS A HB2  4  
ATOM 6762  H HB3  . LYS A 1 90  ? 0.632   8.015   6.752   1.00 0.00 ? 90  LYS A HB3  4  
ATOM 6763  H HG2  . LYS A 1 90  ? -1.305  8.778   5.904   1.00 0.00 ? 90  LYS A HG2  4  
ATOM 6764  H HG3  . LYS A 1 90  ? -1.333  7.444   4.751   1.00 0.00 ? 90  LYS A HG3  4  
ATOM 6765  H HD2  . LYS A 1 90  ? -3.349  7.570   6.287   1.00 0.00 ? 90  LYS A HD2  4  
ATOM 6766  H HD3  . LYS A 1 90  ? -2.502  6.023   6.294   1.00 0.00 ? 90  LYS A HD3  4  
ATOM 6767  H HE2  . LYS A 1 90  ? -1.638  6.347   8.415   1.00 0.00 ? 90  LYS A HE2  4  
ATOM 6768  H HE3  . LYS A 1 90  ? -1.638  8.104   8.259   1.00 0.00 ? 90  LYS A HE3  4  
ATOM 6769  H HZ1  . LYS A 1 90  ? -4.167  7.857   8.219   1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 6770  H HZ2  . LYS A 1 90  ? -3.900  6.303   8.853   1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 6771  H HZ3  . LYS A 1 90  ? -3.378  7.674   9.709   1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 6772  N N    . THR A 1 91  ? 2.846   7.770   4.731   1.00 0.00 ? 91  THR A N    4  
ATOM 6773  C CA   . THR A 1 91  ? 4.291   8.100   4.853   1.00 0.00 ? 91  THR A CA   4  
ATOM 6774  C C    . THR A 1 91  ? 4.482   9.615   4.681   1.00 0.00 ? 91  THR A C    4  
ATOM 6775  O O    . THR A 1 91  ? 3.743   10.402  5.237   1.00 0.00 ? 91  THR A O    4  
ATOM 6776  C CB   . THR A 1 91  ? 5.075   7.337   3.782   1.00 0.00 ? 91  THR A CB   4  
ATOM 6777  O OG1  . THR A 1 91  ? 4.565   7.670   2.497   1.00 0.00 ? 91  THR A OG1  4  
ATOM 6778  C CG2  . THR A 1 91  ? 4.932   5.832   4.018   1.00 0.00 ? 91  THR A CG2  4  
ATOM 6779  H H    . THR A 1 91  ? 2.274   8.287   4.126   1.00 0.00 ? 91  THR A H    4  
ATOM 6780  H HA   . THR A 1 91  ? 4.643   7.807   5.832   1.00 0.00 ? 91  THR A HA   4  
ATOM 6781  H HB   . THR A 1 91  ? 6.118   7.605   3.836   1.00 0.00 ? 91  THR A HB   4  
ATOM 6782  H HG1  . THR A 1 91  ? 3.969   6.969   2.222   1.00 0.00 ? 91  THR A HG1  4  
ATOM 6783  H HG21 . THR A 1 91  ? 4.909   5.635   5.080   1.00 0.00 ? 91  THR A HG21 4  
ATOM 6784  H HG22 . THR A 1 91  ? 4.015   5.482   3.567   1.00 0.00 ? 91  THR A HG22 4  
ATOM 6785  H HG23 . THR A 1 91  ? 5.771   5.317   3.574   1.00 0.00 ? 91  THR A HG23 4  
ATOM 6786  N N    . SER A 1 92  ? 5.464   10.033  3.924   1.00 0.00 ? 92  SER A N    4  
ATOM 6787  C CA   . SER A 1 92  ? 5.687   11.493  3.738   1.00 0.00 ? 92  SER A CA   4  
ATOM 6788  C C    . SER A 1 92  ? 4.641   12.063  2.776   1.00 0.00 ? 92  SER A C    4  
ATOM 6789  O O    . SER A 1 92  ? 4.905   12.265  1.607   1.00 0.00 ? 92  SER A O    4  
ATOM 6790  C CB   . SER A 1 92  ? 7.084   11.721  3.160   1.00 0.00 ? 92  SER A CB   4  
ATOM 6791  O OG   . SER A 1 92  ? 7.860   12.466  4.088   1.00 0.00 ? 92  SER A OG   4  
ATOM 6792  H H    . SER A 1 92  ? 6.057   9.393   3.485   1.00 0.00 ? 92  SER A H    4  
ATOM 6793  H HA   . SER A 1 92  ? 5.609   11.993  4.692   1.00 0.00 ? 92  SER A HA   4  
ATOM 6794  H HB2  . SER A 1 92  ? 7.561   10.771  2.981   1.00 0.00 ? 92  SER A HB2  4  
ATOM 6795  H HB3  . SER A 1 92  ? 7.002   12.261  2.227   1.00 0.00 ? 92  SER A HB3  4  
ATOM 6796  H HG   . SER A 1 92  ? 7.474   13.342  4.159   1.00 0.00 ? 92  SER A HG   4  
ATOM 6797  N N    . LYS A 1 93  ? 3.459   12.331  3.258   1.00 0.00 ? 93  LYS A N    4  
ATOM 6798  C CA   . LYS A 1 93  ? 2.402   12.895  2.371   1.00 0.00 ? 93  LYS A CA   4  
ATOM 6799  C C    . LYS A 1 93  ? 2.104   11.915  1.233   1.00 0.00 ? 93  LYS A C    4  
ATOM 6800  O O    . LYS A 1 93  ? 1.465   12.260  0.260   1.00 0.00 ? 93  LYS A O    4  
ATOM 6801  C CB   . LYS A 1 93  ? 2.887   14.221  1.779   1.00 0.00 ? 93  LYS A CB   4  
ATOM 6802  C CG   . LYS A 1 93  ? 2.907   15.297  2.866   1.00 0.00 ? 93  LYS A CG   4  
ATOM 6803  C CD   . LYS A 1 93  ? 3.239   16.653  2.237   1.00 0.00 ? 93  LYS A CD   4  
ATOM 6804  C CE   . LYS A 1 93  ? 4.109   17.463  3.199   1.00 0.00 ? 93  LYS A CE   4  
ATOM 6805  N NZ   . LYS A 1 93  ? 3.315   18.596  3.754   1.00 0.00 ? 93  LYS A NZ   4  
ATOM 6806  H H    . LYS A 1 93  ? 3.267   12.166  4.204   1.00 0.00 ? 93  LYS A H    4  
ATOM 6807  H HA   . LYS A 1 93  ? 1.503   13.066  2.945   1.00 0.00 ? 93  LYS A HA   4  
ATOM 6808  H HB2  . LYS A 1 93  ? 3.884   14.092  1.381   1.00 0.00 ? 93  LYS A HB2  4  
ATOM 6809  H HB3  . LYS A 1 93  ? 2.221   14.525  0.985   1.00 0.00 ? 93  LYS A HB3  4  
ATOM 6810  H HG2  . LYS A 1 93  ? 1.938   15.347  3.341   1.00 0.00 ? 93  LYS A HG2  4  
ATOM 6811  H HG3  . LYS A 1 93  ? 3.658   15.051  3.603   1.00 0.00 ? 93  LYS A HG3  4  
ATOM 6812  H HD2  . LYS A 1 93  ? 3.774   16.499  1.310   1.00 0.00 ? 93  LYS A HD2  4  
ATOM 6813  H HD3  . LYS A 1 93  ? 2.325   17.192  2.039   1.00 0.00 ? 93  LYS A HD3  4  
ATOM 6814  H HE2  . LYS A 1 93  ? 4.441   16.828  4.007   1.00 0.00 ? 93  LYS A HE2  4  
ATOM 6815  H HE3  . LYS A 1 93  ? 4.967   17.851  2.670   1.00 0.00 ? 93  LYS A HE3  4  
ATOM 6816  H HZ1  . LYS A 1 93  ? 2.632   18.922  3.043   1.00 0.00 ? 93  LYS A HZ1  4  
ATOM 6817  H HZ2  . LYS A 1 93  ? 2.803   18.278  4.602   1.00 0.00 ? 93  LYS A HZ2  4  
ATOM 6818  H HZ3  . LYS A 1 93  ? 3.955   19.376  4.008   1.00 0.00 ? 93  LYS A HZ3  4  
ATOM 6819  N N    . SER A 1 94  ? 2.566   10.698  1.339   1.00 0.00 ? 94  SER A N    4  
ATOM 6820  C CA   . SER A 1 94  ? 2.307   9.712   0.250   1.00 0.00 ? 94  SER A CA   4  
ATOM 6821  C C    . SER A 1 94  ? 1.945   8.351   0.852   1.00 0.00 ? 94  SER A C    4  
ATOM 6822  O O    . SER A 1 94  ? 2.152   8.105   2.024   1.00 0.00 ? 94  SER A O    4  
ATOM 6823  C CB   . SER A 1 94  ? 3.562   9.570   -0.610  1.00 0.00 ? 94  SER A CB   4  
ATOM 6824  O OG   . SER A 1 94  ? 4.712   9.568   0.227   1.00 0.00 ? 94  SER A OG   4  
ATOM 6825  H H    . SER A 1 94  ? 3.084   10.436  2.128   1.00 0.00 ? 94  SER A H    4  
ATOM 6826  H HA   . SER A 1 94  ? 1.491   10.062  -0.362  1.00 0.00 ? 94  SER A HA   4  
ATOM 6827  H HB2  . SER A 1 94  ? 3.521   8.644   -1.156  1.00 0.00 ? 94  SER A HB2  4  
ATOM 6828  H HB3  . SER A 1 94  ? 3.613   10.395  -1.308  1.00 0.00 ? 94  SER A HB3  4  
ATOM 6829  H HG   . SER A 1 94  ? 4.441   9.287   1.104   1.00 0.00 ? 94  SER A HG   4  
ATOM 6830  N N    . ILE A 1 95  ? 1.408   7.465   0.054   1.00 0.00 ? 95  ILE A N    4  
ATOM 6831  C CA   . ILE A 1 95  ? 1.032   6.119   0.576   1.00 0.00 ? 95  ILE A CA   4  
ATOM 6832  C C    . ILE A 1 95  ? 1.628   5.040   -0.324  1.00 0.00 ? 95  ILE A C    4  
ATOM 6833  O O    . ILE A 1 95  ? 1.240   4.888   -1.464  1.00 0.00 ? 95  ILE A O    4  
ATOM 6834  C CB   . ILE A 1 95  ? -0.492  5.970   0.577   1.00 0.00 ? 95  ILE A CB   4  
ATOM 6835  C CG1  . ILE A 1 95  ? -1.141  7.340   0.765   1.00 0.00 ? 95  ILE A CG1  4  
ATOM 6836  C CG2  . ILE A 1 95  ? -0.915  5.047   1.721   1.00 0.00 ? 95  ILE A CG2  4  
ATOM 6837  C CD1  . ILE A 1 95  ? -2.654  7.224   0.562   1.00 0.00 ? 95  ILE A CD1  4  
ATOM 6838  H H    . ILE A 1 95  ? 1.252   7.685   -0.889  1.00 0.00 ? 95  ILE A H    4  
ATOM 6839  H HA   . ILE A 1 95  ? 1.407   6.003   1.581   1.00 0.00 ? 95  ILE A HA   4  
ATOM 6840  H HB   . ILE A 1 95  ? -0.811  5.546   -0.363  1.00 0.00 ? 95  ILE A HB   4  
ATOM 6841  H HG12 . ILE A 1 95  ? -0.937  7.700   1.764   1.00 0.00 ? 95  ILE A HG12 4  
ATOM 6842  H HG13 . ILE A 1 95  ? -0.736  8.032   0.043   1.00 0.00 ? 95  ILE A HG13 4  
ATOM 6843  H HG21 . ILE A 1 95  ? -0.200  4.243   1.818   1.00 0.00 ? 95  ILE A HG21 4  
ATOM 6844  H HG22 . ILE A 1 95  ? -0.954  5.608   2.643   1.00 0.00 ? 95  ILE A HG22 4  
ATOM 6845  H HG23 . ILE A 1 95  ? -1.891  4.635   1.508   1.00 0.00 ? 95  ILE A HG23 4  
ATOM 6846  H HD11 . ILE A 1 95  ? -2.948  6.187   0.630   1.00 0.00 ? 95  ILE A HD11 4  
ATOM 6847  H HD12 . ILE A 1 95  ? -3.163  7.793   1.326   1.00 0.00 ? 95  ILE A HD12 4  
ATOM 6848  H HD13 . ILE A 1 95  ? -2.916  7.610   -0.410  1.00 0.00 ? 95  ILE A HD13 4  
ATOM 6849  N N    . LEU A 1 96  ? 2.561   4.279   0.179   1.00 0.00 ? 96  LEU A N    4  
ATOM 6850  C CA   . LEU A 1 96  ? 3.160   3.204   -0.658  1.00 0.00 ? 96  LEU A CA   4  
ATOM 6851  C C    . LEU A 1 96  ? 2.061   2.236   -1.074  1.00 0.00 ? 96  LEU A C    4  
ATOM 6852  O O    . LEU A 1 96  ? 0.990   2.224   -0.500  1.00 0.00 ? 96  LEU A O    4  
ATOM 6853  C CB   . LEU A 1 96  ? 4.208   2.442   0.149   1.00 0.00 ? 96  LEU A CB   4  
ATOM 6854  C CG   . LEU A 1 96  ? 3.537   1.754   1.339   1.00 0.00 ? 96  LEU A CG   4  
ATOM 6855  C CD1  . LEU A 1 96  ? 4.286   0.464   1.677   1.00 0.00 ? 96  LEU A CD1  4  
ATOM 6856  C CD2  . LEU A 1 96  ? 3.569   2.690   2.547   1.00 0.00 ? 96  LEU A CD2  4  
ATOM 6857  H H    . LEU A 1 96  ? 2.857   4.407   1.103   1.00 0.00 ? 96  LEU A H    4  
ATOM 6858  H HA   . LEU A 1 96  ? 3.617   3.637   -1.536  1.00 0.00 ? 96  LEU A HA   4  
ATOM 6859  H HB2  . LEU A 1 96  ? 4.676   1.698   -0.480  1.00 0.00 ? 96  LEU A HB2  4  
ATOM 6860  H HB3  . LEU A 1 96  ? 4.953   3.127   0.506   1.00 0.00 ? 96  LEU A HB3  4  
ATOM 6861  H HG   . LEU A 1 96  ? 2.512   1.520   1.091   1.00 0.00 ? 96  LEU A HG   4  
ATOM 6862  H HD11 . LEU A 1 96  ? 5.311   0.697   1.926   1.00 0.00 ? 96  LEU A HD11 4  
ATOM 6863  H HD12 . LEU A 1 96  ? 3.812   -0.017  2.519   1.00 0.00 ? 96  LEU A HD12 4  
ATOM 6864  H HD13 . LEU A 1 96  ? 4.265   -0.198  0.824   1.00 0.00 ? 96  LEU A HD13 4  
ATOM 6865  H HD21 . LEU A 1 96  ? 4.123   3.581   2.298   1.00 0.00 ? 96  LEU A HD21 4  
ATOM 6866  H HD22 . LEU A 1 96  ? 2.560   2.959   2.823   1.00 0.00 ? 96  LEU A HD22 4  
ATOM 6867  H HD23 . LEU A 1 96  ? 4.048   2.189   3.376   1.00 0.00 ? 96  LEU A HD23 4  
ATOM 6868  N N    . VAL A 1 97  ? 2.318   1.417   -2.054  1.00 0.00 ? 97  VAL A N    4  
ATOM 6869  C CA   . VAL A 1 97  ? 1.288   0.440   -2.494  1.00 0.00 ? 97  VAL A CA   4  
ATOM 6870  C C    . VAL A 1 97  ? 1.974   -0.804  -3.066  1.00 0.00 ? 97  VAL A C    4  
ATOM 6871  O O    . VAL A 1 97  ? 1.748   -1.184  -4.198  1.00 0.00 ? 97  VAL A O    4  
ATOM 6872  C CB   . VAL A 1 97  ? 0.396   1.081   -3.560  1.00 0.00 ? 97  VAL A CB   4  
ATOM 6873  C CG1  . VAL A 1 97  ? -0.563  0.031   -4.124  1.00 0.00 ? 97  VAL A CG1  4  
ATOM 6874  C CG2  . VAL A 1 97  ? -0.411  2.215   -2.925  1.00 0.00 ? 97  VAL A CG2  4  
ATOM 6875  H H    . VAL A 1 97  ? 3.193   1.439   -2.496  1.00 0.00 ? 97  VAL A H    4  
ATOM 6876  H HA   . VAL A 1 97  ? 0.682   0.156   -1.647  1.00 0.00 ? 97  VAL A HA   4  
ATOM 6877  H HB   . VAL A 1 97  ? 1.010   1.474   -4.357  1.00 0.00 ? 97  VAL A HB   4  
ATOM 6878  H HG11 . VAL A 1 97  ? -0.281  -0.946  -3.764  1.00 0.00 ? 97  VAL A HG11 4  
ATOM 6879  H HG12 . VAL A 1 97  ? -1.570  0.256   -3.805  1.00 0.00 ? 97  VAL A HG12 4  
ATOM 6880  H HG13 . VAL A 1 97  ? -0.519  0.044   -5.204  1.00 0.00 ? 97  VAL A HG13 4  
ATOM 6881  H HG21 . VAL A 1 97  ? -0.582  1.994   -1.883  1.00 0.00 ? 97  VAL A HG21 4  
ATOM 6882  H HG22 . VAL A 1 97  ? 0.138   3.141   -3.012  1.00 0.00 ? 97  VAL A HG22 4  
ATOM 6883  H HG23 . VAL A 1 97  ? -1.359  2.310   -3.433  1.00 0.00 ? 97  VAL A HG23 4  
ATOM 6884  N N    . GLY A 1 98  ? 2.807   -1.447  -2.291  1.00 0.00 ? 98  GLY A N    4  
ATOM 6885  C CA   . GLY A 1 98  ? 3.496   -2.671  -2.796  1.00 0.00 ? 98  GLY A CA   4  
ATOM 6886  C C    . GLY A 1 98  ? 2.455   -3.597  -3.421  1.00 0.00 ? 98  GLY A C    4  
ATOM 6887  O O    . GLY A 1 98  ? 1.575   -4.094  -2.752  1.00 0.00 ? 98  GLY A O    4  
ATOM 6888  H H    . GLY A 1 98  ? 2.975   -1.130  -1.379  1.00 0.00 ? 98  GLY A H    4  
ATOM 6889  H HA2  . GLY A 1 98  ? 4.232   -2.393  -3.537  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 6890  H HA3  . GLY A 1 98  ? 3.980   -3.181  -1.975  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 6891  N N    . VAL A 1 99  ? 2.534   -3.822  -4.701  1.00 0.00 ? 99  VAL A N    4  
ATOM 6892  C CA   . VAL A 1 99  ? 1.529   -4.702  -5.357  1.00 0.00 ? 99  VAL A CA   4  
ATOM 6893  C C    . VAL A 1 99  ? 2.174   -6.044  -5.721  1.00 0.00 ? 99  VAL A C    4  
ATOM 6894  O O    . VAL A 1 99  ? 3.328   -6.113  -6.103  1.00 0.00 ? 99  VAL A O    4  
ATOM 6895  C CB   . VAL A 1 99  ? 0.995   -4.018  -6.625  1.00 0.00 ? 99  VAL A CB   4  
ATOM 6896  C CG1  . VAL A 1 99  ? -0.478  -4.382  -6.822  1.00 0.00 ? 99  VAL A CG1  4  
ATOM 6897  C CG2  . VAL A 1 99  ? 1.115   -2.495  -6.491  1.00 0.00 ? 99  VAL A CG2  4  
ATOM 6898  H H    . VAL A 1 99  ? 3.244   -3.405  -5.231  1.00 0.00 ? 99  VAL A H    4  
ATOM 6899  H HA   . VAL A 1 99  ? 0.710   -4.875  -4.675  1.00 0.00 ? 99  VAL A HA   4  
ATOM 6900  H HB   . VAL A 1 99  ? 1.565   -4.352  -7.481  1.00 0.00 ? 99  VAL A HB   4  
ATOM 6901  H HG11 . VAL A 1 99  ? -0.988  -4.348  -5.871  1.00 0.00 ? 99  VAL A HG11 4  
ATOM 6902  H HG12 . VAL A 1 99  ? -0.935  -3.675  -7.500  1.00 0.00 ? 99  VAL A HG12 4  
ATOM 6903  H HG13 . VAL A 1 99  ? -0.552  -5.375  -7.236  1.00 0.00 ? 99  VAL A HG13 4  
ATOM 6904  H HG21 . VAL A 1 99  ? 2.104   -2.239  -6.149  1.00 0.00 ? 99  VAL A HG21 4  
ATOM 6905  H HG22 . VAL A 1 99  ? 0.940   -2.035  -7.451  1.00 0.00 ? 99  VAL A HG22 4  
ATOM 6906  H HG23 . VAL A 1 99  ? 0.384   -2.136  -5.782  1.00 0.00 ? 99  VAL A HG23 4  
ATOM 6907  N N    . TYR A 1 100 ? 1.427   -7.111  -5.605  1.00 0.00 ? 100 TYR A N    4  
ATOM 6908  C CA   . TYR A 1 100 ? 1.970   -8.460  -5.945  1.00 0.00 ? 100 TYR A CA   4  
ATOM 6909  C C    . TYR A 1 100 ? 0.862   -9.281  -6.605  1.00 0.00 ? 100 TYR A C    4  
ATOM 6910  O O    . TYR A 1 100 ? -0.309  -9.040  -6.386  1.00 0.00 ? 100 TYR A O    4  
ATOM 6911  C CB   . TYR A 1 100 ? 2.464   -9.171  -4.679  1.00 0.00 ? 100 TYR A CB   4  
ATOM 6912  C CG   . TYR A 1 100 ? 1.847   -8.553  -3.445  1.00 0.00 ? 100 TYR A CG   4  
ATOM 6913  C CD1  . TYR A 1 100 ? 2.257   -7.284  -3.018  1.00 0.00 ? 100 TYR A CD1  4  
ATOM 6914  C CD2  . TYR A 1 100 ? 0.873   -9.254  -2.725  1.00 0.00 ? 100 TYR A CD2  4  
ATOM 6915  C CE1  . TYR A 1 100 ? 1.691   -6.717  -1.871  1.00 0.00 ? 100 TYR A CE1  4  
ATOM 6916  C CE2  . TYR A 1 100 ? 0.308   -8.687  -1.577  1.00 0.00 ? 100 TYR A CE2  4  
ATOM 6917  C CZ   . TYR A 1 100 ? 0.717   -7.418  -1.151  1.00 0.00 ? 100 TYR A CZ   4  
ATOM 6918  O OH   . TYR A 1 100 ? 0.160   -6.858  -0.020  1.00 0.00 ? 100 TYR A OH   4  
ATOM 6919  H H    . TYR A 1 100 ? 0.501   -7.025  -5.297  1.00 0.00 ? 100 TYR A H    4  
ATOM 6920  H HA   . TYR A 1 100 ? 2.792   -8.347  -6.638  1.00 0.00 ? 100 TYR A HA   4  
ATOM 6921  H HB2  . TYR A 1 100 ? 2.192   -10.213 -4.727  1.00 0.00 ? 100 TYR A HB2  4  
ATOM 6922  H HB3  . TYR A 1 100 ? 3.537   -9.083  -4.621  1.00 0.00 ? 100 TYR A HB3  4  
ATOM 6923  H HD1  . TYR A 1 100 ? 3.009   -6.744  -3.574  1.00 0.00 ? 100 TYR A HD1  4  
ATOM 6924  H HD2  . TYR A 1 100 ? 0.558   -10.234 -3.054  1.00 0.00 ? 100 TYR A HD2  4  
ATOM 6925  H HE1  . TYR A 1 100 ? 2.006   -5.739  -1.540  1.00 0.00 ? 100 TYR A HE1  4  
ATOM 6926  H HE2  . TYR A 1 100 ? -0.443  -9.228  -1.021  1.00 0.00 ? 100 TYR A HE2  4  
ATOM 6927  H HH   . TYR A 1 100 ? -0.768  -7.101  0.005   1.00 0.00 ? 100 TYR A HH   4  
ATOM 6928  N N    . ASN A 1 101 ? 1.207   -10.233 -7.434  1.00 0.00 ? 101 ASN A N    4  
ATOM 6929  C CA   . ASN A 1 101 ? 0.138   -11.024 -8.112  1.00 0.00 ? 101 ASN A CA   4  
ATOM 6930  C C    . ASN A 1 101 ? 0.608   -12.446 -8.442  1.00 0.00 ? 101 ASN A C    4  
ATOM 6931  O O    . ASN A 1 101 ? -0.088  -13.188 -9.107  1.00 0.00 ? 101 ASN A O    4  
ATOM 6932  C CB   . ASN A 1 101 ? -0.230  -10.323 -9.415  1.00 0.00 ? 101 ASN A CB   4  
ATOM 6933  C CG   . ASN A 1 101 ? -1.537  -9.547  -9.235  1.00 0.00 ? 101 ASN A CG   4  
ATOM 6934  O OD1  . ASN A 1 101 ? -2.379  -9.927  -8.447  1.00 0.00 ? 101 ASN A OD1  4  
ATOM 6935  N ND2  . ASN A 1 101 ? -1.739  -8.468  -9.939  1.00 0.00 ? 101 ASN A ND2  4  
ATOM 6936  H H    . ASN A 1 101 ? 2.154   -10.411 -7.620  1.00 0.00 ? 101 ASN A H    4  
ATOM 6937  H HA   . ASN A 1 101 ? -0.733  -11.071 -7.477  1.00 0.00 ? 101 ASN A HA   4  
ATOM 6938  H HB2  . ASN A 1 101 ? 0.562   -9.640  -9.684  1.00 0.00 ? 101 ASN A HB2  4  
ATOM 6939  H HB3  . ASN A 1 101 ? -0.352  -11.059 -10.193 1.00 0.00 ? 101 ASN A HB3  4  
ATOM 6940  H HD21 . ASN A 1 101 ? -1.058  -8.162  -10.574 1.00 0.00 ? 101 ASN A HD21 4  
ATOM 6941  H HD22 . ASN A 1 101 ? -2.572  -7.963  -9.834  1.00 0.00 ? 101 ASN A HD22 4  
ATOM 6942  N N    . GLU A 1 102 ? 1.769   -12.840 -8.008  1.00 0.00 ? 102 GLU A N    4  
ATOM 6943  C CA   . GLU A 1 102 ? 2.240   -14.214 -8.336  1.00 0.00 ? 102 GLU A CA   4  
ATOM 6944  C C    . GLU A 1 102 ? 2.025   -15.135 -7.137  1.00 0.00 ? 102 GLU A C    4  
ATOM 6945  O O    . GLU A 1 102 ? 1.092   -15.913 -7.098  1.00 0.00 ? 102 GLU A O    4  
ATOM 6946  C CB   . GLU A 1 102 ? 3.729   -14.180 -8.686  1.00 0.00 ? 102 GLU A CB   4  
ATOM 6947  C CG   . GLU A 1 102 ? 3.952   -13.255 -9.885  1.00 0.00 ? 102 GLU A CG   4  
ATOM 6948  C CD   . GLU A 1 102 ? 4.440   -14.078 -11.079 1.00 0.00 ? 102 GLU A CD   4  
ATOM 6949  O OE1  . GLU A 1 102 ? 3.857   -15.118 -11.334 1.00 0.00 ? 102 GLU A OE1  4  
ATOM 6950  O OE2  . GLU A 1 102 ? 5.389   -13.653 -11.717 1.00 0.00 ? 102 GLU A OE2  4  
ATOM 6951  H H    . GLU A 1 102 ? 2.332   -12.239 -7.481  1.00 0.00 ? 102 GLU A H    4  
ATOM 6952  H HA   . GLU A 1 102 ? 1.683   -14.590 -9.180  1.00 0.00 ? 102 GLU A HA   4  
ATOM 6953  H HB2  . GLU A 1 102 ? 4.291   -13.815 -7.839  1.00 0.00 ? 102 GLU A HB2  4  
ATOM 6954  H HB3  . GLU A 1 102 ? 4.061   -15.175 -8.936  1.00 0.00 ? 102 GLU A HB3  4  
ATOM 6955  H HG2  . GLU A 1 102 ? 3.024   -12.764 -10.140 1.00 0.00 ? 102 GLU A HG2  4  
ATOM 6956  H HG3  . GLU A 1 102 ? 4.696   -12.513 -9.634  1.00 0.00 ? 102 GLU A HG3  4  
ATOM 6957  N N    . LYS A 1 103 ? 2.881   -15.053 -6.161  1.00 0.00 ? 103 LYS A N    4  
ATOM 6958  C CA   . LYS A 1 103 ? 2.738   -15.927 -4.960  1.00 0.00 ? 103 LYS A CA   4  
ATOM 6959  C C    . LYS A 1 103 ? 3.415   -15.257 -3.766  1.00 0.00 ? 103 LYS A C    4  
ATOM 6960  O O    . LYS A 1 103 ? 3.915   -15.915 -2.876  1.00 0.00 ? 103 LYS A O    4  
ATOM 6961  C CB   . LYS A 1 103 ? 3.413   -17.280 -5.220  1.00 0.00 ? 103 LYS A CB   4  
ATOM 6962  C CG   . LYS A 1 103 ? 2.543   -18.143 -6.139  1.00 0.00 ? 103 LYS A CG   4  
ATOM 6963  C CD   . LYS A 1 103 ? 1.253   -18.539 -5.415  1.00 0.00 ? 103 LYS A CD   4  
ATOM 6964  C CE   . LYS A 1 103 ? 0.236   -19.058 -6.432  1.00 0.00 ? 103 LYS A CE   4  
ATOM 6965  N NZ   . LYS A 1 103 ? -0.070  -20.488 -6.143  1.00 0.00 ? 103 LYS A NZ   4  
ATOM 6966  H H    . LYS A 1 103 ? 3.622   -14.411 -6.217  1.00 0.00 ? 103 LYS A H    4  
ATOM 6967  H HA   . LYS A 1 103 ? 1.692   -16.076 -4.745  1.00 0.00 ? 103 LYS A HA   4  
ATOM 6968  H HB2  . LYS A 1 103 ? 4.373   -17.115 -5.690  1.00 0.00 ? 103 LYS A HB2  4  
ATOM 6969  H HB3  . LYS A 1 103 ? 3.558   -17.792 -4.281  1.00 0.00 ? 103 LYS A HB3  4  
ATOM 6970  H HG2  . LYS A 1 103 ? 2.302   -17.590 -7.033  1.00 0.00 ? 103 LYS A HG2  4  
ATOM 6971  H HG3  . LYS A 1 103 ? 3.088   -19.036 -6.408  1.00 0.00 ? 103 LYS A HG3  4  
ATOM 6972  H HD2  . LYS A 1 103 ? 1.467   -19.315 -4.694  1.00 0.00 ? 103 LYS A HD2  4  
ATOM 6973  H HD3  . LYS A 1 103 ? 0.842   -17.681 -4.908  1.00 0.00 ? 103 LYS A HD3  4  
ATOM 6974  H HE2  . LYS A 1 103 ? -0.671  -18.475 -6.364  1.00 0.00 ? 103 LYS A HE2  4  
ATOM 6975  H HE3  . LYS A 1 103 ? 0.645   -18.972 -7.428  1.00 0.00 ? 103 LYS A HE3  4  
ATOM 6976  H HZ1  . LYS A 1 103 ? 0.815   -21.032 -6.106  1.00 0.00 ? 103 LYS A HZ1  4  
ATOM 6977  H HZ2  . LYS A 1 103 ? -0.557  -20.560 -5.228  1.00 0.00 ? 103 LYS A HZ2  4  
ATOM 6978  H HZ3  . LYS A 1 103 ? -0.682  -20.869 -6.894  1.00 0.00 ? 103 LYS A HZ3  4  
ATOM 6979  N N    . ILE A 1 104 ? 3.442   -13.955 -3.741  1.00 0.00 ? 104 ILE A N    4  
ATOM 6980  C CA   . ILE A 1 104 ? 4.094   -13.248 -2.609  1.00 0.00 ? 104 ILE A CA   4  
ATOM 6981  C C    . ILE A 1 104 ? 3.360   -13.576 -1.306  1.00 0.00 ? 104 ILE A C    4  
ATOM 6982  O O    . ILE A 1 104 ? 2.170   -13.820 -1.296  1.00 0.00 ? 104 ILE A O    4  
ATOM 6983  C CB   . ILE A 1 104 ? 4.043   -11.743 -2.866  1.00 0.00 ? 104 ILE A CB   4  
ATOM 6984  C CG1  . ILE A 1 104 ? 4.344   -11.444 -4.345  1.00 0.00 ? 104 ILE A CG1  4  
ATOM 6985  C CG2  . ILE A 1 104 ? 5.071   -11.035 -1.983  1.00 0.00 ? 104 ILE A CG2  4  
ATOM 6986  C CD1  . ILE A 1 104 ? 5.387   -12.418 -4.899  1.00 0.00 ? 104 ILE A CD1  4  
ATOM 6987  H H    . ILE A 1 104 ? 3.037   -13.439 -4.469  1.00 0.00 ? 104 ILE A H    4  
ATOM 6988  H HA   . ILE A 1 104 ? 5.123   -13.565 -2.531  1.00 0.00 ? 104 ILE A HA   4  
ATOM 6989  H HB   . ILE A 1 104 ? 3.054   -11.380 -2.624  1.00 0.00 ? 104 ILE A HB   4  
ATOM 6990  H HG12 . ILE A 1 104 ? 3.436   -11.535 -4.920  1.00 0.00 ? 104 ILE A HG12 4  
ATOM 6991  H HG13 . ILE A 1 104 ? 4.723   -10.437 -4.433  1.00 0.00 ? 104 ILE A HG13 4  
ATOM 6992  H HG21 . ILE A 1 104 ? 5.021   -11.435 -0.981  1.00 0.00 ? 104 ILE A HG21 4  
ATOM 6993  H HG22 . ILE A 1 104 ? 6.060   -11.193 -2.385  1.00 0.00 ? 104 ILE A HG22 4  
ATOM 6994  H HG23 . ILE A 1 104 ? 4.857   -9.977  -1.959  1.00 0.00 ? 104 ILE A HG23 4  
ATOM 6995  H HD11 . ILE A 1 104 ? 6.075   -12.695 -4.115  1.00 0.00 ? 104 ILE A HD11 4  
ATOM 6996  H HD12 . ILE A 1 104 ? 4.890   -13.302 -5.271  1.00 0.00 ? 104 ILE A HD12 4  
ATOM 6997  H HD13 . ILE A 1 104 ? 5.928   -11.944 -5.705  1.00 0.00 ? 104 ILE A HD13 4  
ATOM 6998  N N    . GLN A 1 105 ? 4.064   -13.588 -0.207  1.00 0.00 ? 105 GLN A N    4  
ATOM 6999  C CA   . GLN A 1 105 ? 3.411   -13.902 1.096   1.00 0.00 ? 105 GLN A CA   4  
ATOM 7000  C C    . GLN A 1 105 ? 3.278   -12.616 1.922   1.00 0.00 ? 105 GLN A C    4  
ATOM 7001  O O    . GLN A 1 105 ? 4.164   -11.787 1.915   1.00 0.00 ? 105 GLN A O    4  
ATOM 7002  C CB   . GLN A 1 105 ? 4.269   -14.912 1.860   1.00 0.00 ? 105 GLN A CB   4  
ATOM 7003  C CG   . GLN A 1 105 ? 3.741   -16.327 1.611   1.00 0.00 ? 105 GLN A CG   4  
ATOM 7004  C CD   . GLN A 1 105 ? 4.300   -16.857 0.290   1.00 0.00 ? 105 GLN A CD   4  
ATOM 7005  O OE1  . GLN A 1 105 ? 4.681   -16.091 -0.573  1.00 0.00 ? 105 GLN A OE1  4  
ATOM 7006  N NE2  . GLN A 1 105 ? 4.364   -18.144 0.094   1.00 0.00 ? 105 GLN A NE2  4  
ATOM 7007  H H    . GLN A 1 105 ? 5.023   -13.391 -0.239  1.00 0.00 ? 105 GLN A H    4  
ATOM 7008  H HA   . GLN A 1 105 ? 2.434   -14.324 0.914   1.00 0.00 ? 105 GLN A HA   4  
ATOM 7009  H HB2  . GLN A 1 105 ? 5.292   -14.844 1.520   1.00 0.00 ? 105 GLN A HB2  4  
ATOM 7010  H HB3  . GLN A 1 105 ? 4.226   -14.695 2.916   1.00 0.00 ? 105 GLN A HB3  4  
ATOM 7011  H HG2  . GLN A 1 105 ? 4.051   -16.973 2.419   1.00 0.00 ? 105 GLN A HG2  4  
ATOM 7012  H HG3  . GLN A 1 105 ? 2.663   -16.304 1.560   1.00 0.00 ? 105 GLN A HG3  4  
ATOM 7013  H HE21 . GLN A 1 105 ? 4.057   -18.762 0.791   1.00 0.00 ? 105 GLN A HE21 4  
ATOM 7014  H HE22 . GLN A 1 105 ? 4.719   -18.496 -0.750  1.00 0.00 ? 105 GLN A HE22 4  
ATOM 7015  N N    . PRO A 1 106 ? 2.170   -12.488 2.612   1.00 0.00 ? 106 PRO A N    4  
ATOM 7016  C CA   . PRO A 1 106 ? 1.902   -11.305 3.451   1.00 0.00 ? 106 PRO A CA   4  
ATOM 7017  C C    . PRO A 1 106 ? 2.944   -11.196 4.569   1.00 0.00 ? 106 PRO A C    4  
ATOM 7018  O O    . PRO A 1 106 ? 3.224   -10.124 5.067   1.00 0.00 ? 106 PRO A O    4  
ATOM 7019  C CB   . PRO A 1 106 ? 0.506   -11.549 4.040   1.00 0.00 ? 106 PRO A CB   4  
ATOM 7020  C CG   . PRO A 1 106 ? 0.013   -12.926 3.529   1.00 0.00 ? 106 PRO A CG   4  
ATOM 7021  C CD   . PRO A 1 106 ? 1.103   -13.503 2.612   1.00 0.00 ? 106 PRO A CD   4  
ATOM 7022  H HA   . PRO A 1 106 ? 1.895   -10.409 2.851   1.00 0.00 ? 106 PRO A HA   4  
ATOM 7023  H HB2  . PRO A 1 106 ? 0.561   -11.553 5.120   1.00 0.00 ? 106 PRO A HB2  4  
ATOM 7024  H HB3  . PRO A 1 106 ? -0.172  -10.777 3.710   1.00 0.00 ? 106 PRO A HB3  4  
ATOM 7025  H HG2  . PRO A 1 106 ? -0.151  -13.589 4.367   1.00 0.00 ? 106 PRO A HG2  4  
ATOM 7026  H HG3  . PRO A 1 106 ? -0.904  -12.804 2.972   1.00 0.00 ? 106 PRO A HG3  4  
ATOM 7027  H HD2  . PRO A 1 106 ? 1.470   -14.439 3.009   1.00 0.00 ? 106 PRO A HD2  4  
ATOM 7028  H HD3  . PRO A 1 106 ? 0.720   -13.641 1.612   1.00 0.00 ? 106 PRO A HD3  4  
ATOM 7029  N N    . GLY A 1 107 ? 3.518   -12.299 4.969   1.00 0.00 ? 107 GLY A N    4  
ATOM 7030  C CA   . GLY A 1 107 ? 4.538   -12.255 6.056   1.00 0.00 ? 107 GLY A CA   4  
ATOM 7031  C C    . GLY A 1 107 ? 5.938   -12.192 5.444   1.00 0.00 ? 107 GLY A C    4  
ATOM 7032  O O    . GLY A 1 107 ? 6.874   -12.778 5.950   1.00 0.00 ? 107 GLY A O    4  
ATOM 7033  H H    . GLY A 1 107 ? 3.279   -13.155 4.556   1.00 0.00 ? 107 GLY A H    4  
ATOM 7034  H HA2  . GLY A 1 107 ? 4.373   -11.380 6.669   1.00 0.00 ? 107 GLY A HA2  4  
ATOM 7035  H HA3  . GLY A 1 107 ? 4.454   -13.143 6.664   1.00 0.00 ? 107 GLY A HA3  4  
ATOM 7036  N N    . THR A 1 108 ? 6.089   -11.484 4.358   1.00 0.00 ? 108 THR A N    4  
ATOM 7037  C CA   . THR A 1 108 ? 7.429   -11.382 3.713   1.00 0.00 ? 108 THR A CA   4  
ATOM 7038  C C    . THR A 1 108 ? 7.618   -9.969  3.154   1.00 0.00 ? 108 THR A C    4  
ATOM 7039  O O    . THR A 1 108 ? 8.645   -9.350  3.343   1.00 0.00 ? 108 THR A O    4  
ATOM 7040  C CB   . THR A 1 108 ? 7.528   -12.399 2.574   1.00 0.00 ? 108 THR A CB   4  
ATOM 7041  O OG1  . THR A 1 108 ? 7.084   -13.669 3.033   1.00 0.00 ? 108 THR A OG1  4  
ATOM 7042  C CG2  . THR A 1 108 ? 8.981   -12.504 2.109   1.00 0.00 ? 108 THR A CG2  4  
ATOM 7043  H H    . THR A 1 108 ? 5.321   -11.018 3.967   1.00 0.00 ? 108 THR A H    4  
ATOM 7044  H HA   . THR A 1 108 ? 8.196   -11.585 4.446   1.00 0.00 ? 108 THR A HA   4  
ATOM 7045  H HB   . THR A 1 108 ? 6.914   -12.078 1.749   1.00 0.00 ? 108 THR A HB   4  
ATOM 7046  H HG1  . THR A 1 108 ? 7.852   -14.162 3.332   1.00 0.00 ? 108 THR A HG1  4  
ATOM 7047  H HG21 . THR A 1 108 ? 9.601   -11.861 2.716   1.00 0.00 ? 108 THR A HG21 4  
ATOM 7048  H HG22 . THR A 1 108 ? 9.318   -13.526 2.206   1.00 0.00 ? 108 THR A HG22 4  
ATOM 7049  H HG23 . THR A 1 108 ? 9.050   -12.199 1.075   1.00 0.00 ? 108 THR A HG23 4  
ATOM 7050  N N    . ALA A 1 109 ? 6.632   -9.454  2.470   1.00 0.00 ? 109 ALA A N    4  
ATOM 7051  C CA   . ALA A 1 109 ? 6.756   -8.082  1.904   1.00 0.00 ? 109 ALA A CA   4  
ATOM 7052  C C    . ALA A 1 109 ? 6.320   -7.058  2.953   1.00 0.00 ? 109 ALA A C    4  
ATOM 7053  O O    . ALA A 1 109 ? 6.739   -5.918  2.935   1.00 0.00 ? 109 ALA A O    4  
ATOM 7054  C CB   . ALA A 1 109 ? 5.865   -7.955  0.667   1.00 0.00 ? 109 ALA A CB   4  
ATOM 7055  H H    . ALA A 1 109 ? 5.810   -9.969  2.332   1.00 0.00 ? 109 ALA A H    4  
ATOM 7056  H HA   . ALA A 1 109 ? 7.784   -7.897  1.628   1.00 0.00 ? 109 ALA A HA   4  
ATOM 7057  H HB1  . ALA A 1 109 ? 4.839   -8.150  0.942   1.00 0.00 ? 109 ALA A HB1  4  
ATOM 7058  H HB2  . ALA A 1 109 ? 5.945   -6.955  0.266   1.00 0.00 ? 109 ALA A HB2  4  
ATOM 7059  H HB3  . ALA A 1 109 ? 6.180   -8.669  -0.080  1.00 0.00 ? 109 ALA A HB3  4  
ATOM 7060  N N    . ALA A 1 110 ? 5.483   -7.458  3.871   1.00 0.00 ? 110 ALA A N    4  
ATOM 7061  C CA   . ALA A 1 110 ? 5.021   -6.510  4.924   1.00 0.00 ? 110 ALA A CA   4  
ATOM 7062  C C    . ALA A 1 110 ? 6.086   -6.412  6.018   1.00 0.00 ? 110 ALA A C    4  
ATOM 7063  O O    . ALA A 1 110 ? 6.147   -5.450  6.757   1.00 0.00 ? 110 ALA A O    4  
ATOM 7064  C CB   . ALA A 1 110 ? 3.715   -7.025  5.530   1.00 0.00 ? 110 ALA A CB   4  
ATOM 7065  H H    . ALA A 1 110 ? 5.160   -8.383  3.869   1.00 0.00 ? 110 ALA A H    4  
ATOM 7066  H HA   . ALA A 1 110 ? 4.858   -5.535  4.488   1.00 0.00 ? 110 ALA A HA   4  
ATOM 7067  H HB1  . ALA A 1 110 ? 3.212   -7.661  4.815   1.00 0.00 ? 110 ALA A HB1  4  
ATOM 7068  H HB2  . ALA A 1 110 ? 3.931   -7.591  6.424   1.00 0.00 ? 110 ALA A HB2  4  
ATOM 7069  H HB3  . ALA A 1 110 ? 3.078   -6.190  5.780   1.00 0.00 ? 110 ALA A HB3  4  
ATOM 7070  N N    . ASN A 1 111 ? 6.925   -7.406  6.124   1.00 0.00 ? 111 ASN A N    4  
ATOM 7071  C CA   . ASN A 1 111 ? 7.988   -7.380  7.168   1.00 0.00 ? 111 ASN A CA   4  
ATOM 7072  C C    . ASN A 1 111 ? 9.079   -6.385  6.764   1.00 0.00 ? 111 ASN A C    4  
ATOM 7073  O O    . ASN A 1 111 ? 9.603   -5.658  7.585   1.00 0.00 ? 111 ASN A O    4  
ATOM 7074  C CB   . ASN A 1 111 ? 8.596   -8.777  7.304   1.00 0.00 ? 111 ASN A CB   4  
ATOM 7075  C CG   . ASN A 1 111 ? 8.441   -9.265  8.745   1.00 0.00 ? 111 ASN A CG   4  
ATOM 7076  O OD1  . ASN A 1 111 ? 7.363   -9.645  9.157   1.00 0.00 ? 111 ASN A OD1  4  
ATOM 7077  N ND2  . ASN A 1 111 ? 9.480   -9.273  9.534   1.00 0.00 ? 111 ASN A ND2  4  
ATOM 7078  H H    . ASN A 1 111 ? 6.855   -8.171  5.515   1.00 0.00 ? 111 ASN A H    4  
ATOM 7079  H HA   . ASN A 1 111 ? 7.559   -7.081  8.111   1.00 0.00 ? 111 ASN A HA   4  
ATOM 7080  H HB2  . ASN A 1 111 ? 8.086   -9.457  6.637   1.00 0.00 ? 111 ASN A HB2  4  
ATOM 7081  H HB3  . ASN A 1 111 ? 9.644   -8.740  7.050   1.00 0.00 ? 111 ASN A HB3  4  
ATOM 7082  H HD21 . ASN A 1 111 ? 10.351  -8.969  9.201   1.00 0.00 ? 111 ASN A HD21 4  
ATOM 7083  H HD22 . ASN A 1 111 ? 9.391   -9.582  10.459  1.00 0.00 ? 111 ASN A HD22 4  
ATOM 7084  N N    . VAL A 1 112 ? 9.425   -6.347  5.508   1.00 0.00 ? 112 VAL A N    4  
ATOM 7085  C CA   . VAL A 1 112 ? 10.482  -5.400  5.055   1.00 0.00 ? 112 VAL A CA   4  
ATOM 7086  C C    . VAL A 1 112 ? 9.903   -3.985  4.979   1.00 0.00 ? 112 VAL A C    4  
ATOM 7087  O O    . VAL A 1 112 ? 10.618  -3.006  5.051   1.00 0.00 ? 112 VAL A O    4  
ATOM 7088  C CB   . VAL A 1 112 ? 10.986  -5.820  3.674   1.00 0.00 ? 112 VAL A CB   4  
ATOM 7089  C CG1  . VAL A 1 112 ? 9.827   -5.788  2.676   1.00 0.00 ? 112 VAL A CG1  4  
ATOM 7090  C CG2  . VAL A 1 112 ? 12.080  -4.854  3.214   1.00 0.00 ? 112 VAL A CG2  4  
ATOM 7091  H H    . VAL A 1 112 ? 8.990   -6.943  4.861   1.00 0.00 ? 112 VAL A H    4  
ATOM 7092  H HA   . VAL A 1 112 ? 11.303  -5.415  5.757   1.00 0.00 ? 112 VAL A HA   4  
ATOM 7093  H HB   . VAL A 1 112 ? 11.387  -6.822  3.727   1.00 0.00 ? 112 VAL A HB   4  
ATOM 7094  H HG11 . VAL A 1 112 ? 9.115   -5.032  2.974   1.00 0.00 ? 112 VAL A HG11 4  
ATOM 7095  H HG12 . VAL A 1 112 ? 10.205  -5.559  1.691   1.00 0.00 ? 112 VAL A HG12 4  
ATOM 7096  H HG13 . VAL A 1 112 ? 9.341   -6.752  2.659   1.00 0.00 ? 112 VAL A HG13 4  
ATOM 7097  H HG21 . VAL A 1 112 ? 11.762  -3.838  3.397   1.00 0.00 ? 112 VAL A HG21 4  
ATOM 7098  H HG22 . VAL A 1 112 ? 12.989  -5.051  3.763   1.00 0.00 ? 112 VAL A HG22 4  
ATOM 7099  H HG23 . VAL A 1 112 ? 12.259  -4.990  2.158   1.00 0.00 ? 112 VAL A HG23 4  
ATOM 7100  N N    . VAL A 1 113 ? 8.610   -3.872  4.835   1.00 0.00 ? 113 VAL A N    4  
ATOM 7101  C CA   . VAL A 1 113 ? 7.982   -2.522  4.754   1.00 0.00 ? 113 VAL A CA   4  
ATOM 7102  C C    . VAL A 1 113 ? 7.707   -1.999  6.165   1.00 0.00 ? 113 VAL A C    4  
ATOM 7103  O O    . VAL A 1 113 ? 7.520   -0.816  6.374   1.00 0.00 ? 113 VAL A O    4  
ATOM 7104  C CB   . VAL A 1 113 ? 6.666   -2.625  3.983   1.00 0.00 ? 113 VAL A CB   4  
ATOM 7105  C CG1  . VAL A 1 113 ? 5.937   -1.282  4.037   1.00 0.00 ? 113 VAL A CG1  4  
ATOM 7106  C CG2  . VAL A 1 113 ? 6.959   -2.988  2.527   1.00 0.00 ? 113 VAL A CG2  4  
ATOM 7107  H H    . VAL A 1 113 ? 8.052   -4.675  4.779   1.00 0.00 ? 113 VAL A H    4  
ATOM 7108  H HA   . VAL A 1 113 ? 8.648   -1.844  4.241   1.00 0.00 ? 113 VAL A HA   4  
ATOM 7109  H HB   . VAL A 1 113 ? 6.046   -3.388  4.431   1.00 0.00 ? 113 VAL A HB   4  
ATOM 7110  H HG11 . VAL A 1 113 ? 6.570   -0.547  4.512   1.00 0.00 ? 113 VAL A HG11 4  
ATOM 7111  H HG12 . VAL A 1 113 ? 5.701   -0.960  3.034   1.00 0.00 ? 113 VAL A HG12 4  
ATOM 7112  H HG13 . VAL A 1 113 ? 5.024   -1.390  4.604   1.00 0.00 ? 113 VAL A HG13 4  
ATOM 7113  H HG21 . VAL A 1 113 ? 8.016   -3.173  2.408   1.00 0.00 ? 113 VAL A HG21 4  
ATOM 7114  H HG22 . VAL A 1 113 ? 6.406   -3.876  2.259   1.00 0.00 ? 113 VAL A HG22 4  
ATOM 7115  H HG23 . VAL A 1 113 ? 6.662   -2.171  1.886   1.00 0.00 ? 113 VAL A HG23 4  
ATOM 7116  N N    . GLU A 1 114 ? 7.681   -2.872  7.135   1.00 0.00 ? 114 GLU A N    4  
ATOM 7117  C CA   . GLU A 1 114 ? 7.417   -2.427  8.531   1.00 0.00 ? 114 GLU A CA   4  
ATOM 7118  C C    . GLU A 1 114 ? 8.699   -1.851  9.137   1.00 0.00 ? 114 GLU A C    4  
ATOM 7119  O O    . GLU A 1 114 ? 8.660   -0.962  9.964   1.00 0.00 ? 114 GLU A O    4  
ATOM 7120  C CB   . GLU A 1 114 ? 6.955   -3.623  9.366   1.00 0.00 ? 114 GLU A CB   4  
ATOM 7121  C CG   . GLU A 1 114 ? 5.506   -3.411  9.805   1.00 0.00 ? 114 GLU A CG   4  
ATOM 7122  C CD   . GLU A 1 114 ? 4.822   -4.767  9.981   1.00 0.00 ? 114 GLU A CD   4  
ATOM 7123  O OE1  . GLU A 1 114 ? 4.984   -5.358  11.037  1.00 0.00 ? 114 GLU A OE1  4  
ATOM 7124  O OE2  . GLU A 1 114 ? 4.146   -5.192  9.059   1.00 0.00 ? 114 GLU A OE2  4  
ATOM 7125  H H    . GLU A 1 114 ? 7.834   -3.820  6.944   1.00 0.00 ? 114 GLU A H    4  
ATOM 7126  H HA   . GLU A 1 114 ? 6.646   -1.670  8.530   1.00 0.00 ? 114 GLU A HA   4  
ATOM 7127  H HB2  . GLU A 1 114 ? 7.024   -4.524  8.773   1.00 0.00 ? 114 GLU A HB2  4  
ATOM 7128  H HB3  . GLU A 1 114 ? 7.582   -3.719  10.238  1.00 0.00 ? 114 GLU A HB3  4  
ATOM 7129  H HG2  . GLU A 1 114 ? 5.489   -2.873  10.741  1.00 0.00 ? 114 GLU A HG2  4  
ATOM 7130  H HG3  . GLU A 1 114 ? 4.980   -2.840  9.053   1.00 0.00 ? 114 GLU A HG3  4  
ATOM 7131  N N    . LYS A 1 115 ? 9.835   -2.353  8.736   1.00 0.00 ? 115 LYS A N    4  
ATOM 7132  C CA   . LYS A 1 115 ? 11.116  -1.835  9.295   1.00 0.00 ? 115 LYS A CA   4  
ATOM 7133  C C    . LYS A 1 115 ? 11.544  -0.578  8.535   1.00 0.00 ? 115 LYS A C    4  
ATOM 7134  O O    . LYS A 1 115 ? 11.773  0.462   9.120   1.00 0.00 ? 115 LYS A O    4  
ATOM 7135  C CB   . LYS A 1 115 ? 12.203  -2.903  9.159   1.00 0.00 ? 115 LYS A CB   4  
ATOM 7136  C CG   . LYS A 1 115 ? 13.501  -2.385  9.780   1.00 0.00 ? 115 LYS A CG   4  
ATOM 7137  C CD   . LYS A 1 115 ? 14.390  -3.567  10.170  1.00 0.00 ? 115 LYS A CD   4  
ATOM 7138  C CE   . LYS A 1 115 ? 14.895  -4.264  8.907   1.00 0.00 ? 115 LYS A CE   4  
ATOM 7139  N NZ   . LYS A 1 115 ? 15.377  -3.241  7.936   1.00 0.00 ? 115 LYS A NZ   4  
ATOM 7140  H H    . LYS A 1 115 ? 9.846   -3.073  8.071   1.00 0.00 ? 115 LYS A H    4  
ATOM 7141  H HA   . LYS A 1 115 ? 10.980  -1.593  10.338  1.00 0.00 ? 115 LYS A HA   4  
ATOM 7142  H HB2  . LYS A 1 115 ? 11.890  -3.804  9.669   1.00 0.00 ? 115 LYS A HB2  4  
ATOM 7143  H HB3  . LYS A 1 115 ? 12.367  -3.119  8.113   1.00 0.00 ? 115 LYS A HB3  4  
ATOM 7144  H HG2  . LYS A 1 115 ? 14.020  -1.766  9.062   1.00 0.00 ? 115 LYS A HG2  4  
ATOM 7145  H HG3  . LYS A 1 115 ? 13.272  -1.803  10.659  1.00 0.00 ? 115 LYS A HG3  4  
ATOM 7146  H HD2  . LYS A 1 115 ? 15.231  -3.210  10.745  1.00 0.00 ? 115 LYS A HD2  4  
ATOM 7147  H HD3  . LYS A 1 115 ? 13.820  -4.267  10.762  1.00 0.00 ? 115 LYS A HD3  4  
ATOM 7148  H HE2  . LYS A 1 115 ? 15.706  -4.930  9.161   1.00 0.00 ? 115 LYS A HE2  4  
ATOM 7149  H HE3  . LYS A 1 115 ? 14.091  -4.831  8.461   1.00 0.00 ? 115 LYS A HE3  4  
ATOM 7150  H HZ1  . LYS A 1 115 ? 15.925  -2.515  8.441   1.00 0.00 ? 115 LYS A HZ1  4  
ATOM 7151  H HZ2  . LYS A 1 115 ? 15.980  -3.697  7.222   1.00 0.00 ? 115 LYS A HZ2  4  
ATOM 7152  H HZ3  . LYS A 1 115 ? 14.563  -2.798  7.466   1.00 0.00 ? 115 LYS A HZ3  4  
ATOM 7153  N N    . LEU A 1 116 ? 11.661  -0.665  7.239   1.00 0.00 ? 116 LEU A N    4  
ATOM 7154  C CA   . LEU A 1 116 ? 12.080  0.526   6.450   1.00 0.00 ? 116 LEU A CA   4  
ATOM 7155  C C    . LEU A 1 116 ? 11.088  1.667   6.682   1.00 0.00 ? 116 LEU A C    4  
ATOM 7156  O O    . LEU A 1 116 ? 11.442  2.829   6.645   1.00 0.00 ? 116 LEU A O    4  
ATOM 7157  C CB   . LEU A 1 116 ? 12.109  0.172   4.964   1.00 0.00 ? 116 LEU A CB   4  
ATOM 7158  C CG   . LEU A 1 116 ? 13.250  0.930   4.287   1.00 0.00 ? 116 LEU A CG   4  
ATOM 7159  C CD1  . LEU A 1 116 ? 14.198  -0.064  3.614   1.00 0.00 ? 116 LEU A CD1  4  
ATOM 7160  C CD2  . LEU A 1 116 ? 12.676  1.881   3.235   1.00 0.00 ? 116 LEU A CD2  4  
ATOM 7161  H H    . LEU A 1 116 ? 11.476  -1.514  6.785   1.00 0.00 ? 116 LEU A H    4  
ATOM 7162  H HA   . LEU A 1 116 ? 13.065  0.837   6.764   1.00 0.00 ? 116 LEU A HA   4  
ATOM 7163  H HB2  . LEU A 1 116 ? 12.263  -0.891  4.850   1.00 0.00 ? 116 LEU A HB2  4  
ATOM 7164  H HB3  . LEU A 1 116 ? 11.172  0.452   4.508   1.00 0.00 ? 116 LEU A HB3  4  
ATOM 7165  H HG   . LEU A 1 116 ? 13.793  1.498   5.029   1.00 0.00 ? 116 LEU A HG   4  
ATOM 7166  H HD11 . LEU A 1 116 ? 13.905  -1.070  3.870   1.00 0.00 ? 116 LEU A HD11 4  
ATOM 7167  H HD12 . LEU A 1 116 ? 14.150  0.063   2.542   1.00 0.00 ? 116 LEU A HD12 4  
ATOM 7168  H HD13 . LEU A 1 116 ? 15.207  0.117   3.953   1.00 0.00 ? 116 LEU A HD13 4  
ATOM 7169  H HD21 . LEU A 1 116 ? 11.598  1.806   3.234   1.00 0.00 ? 116 LEU A HD21 4  
ATOM 7170  H HD22 . LEU A 1 116 ? 12.966  2.894   3.469   1.00 0.00 ? 116 LEU A HD22 4  
ATOM 7171  H HD23 . LEU A 1 116 ? 13.057  1.611   2.261   1.00 0.00 ? 116 LEU A HD23 4  
ATOM 7172  N N    . ALA A 1 117 ? 9.847   1.346   6.923   1.00 0.00 ? 117 ALA A N    4  
ATOM 7173  C CA   . ALA A 1 117 ? 8.837   2.413   7.159   1.00 0.00 ? 117 ALA A CA   4  
ATOM 7174  C C    . ALA A 1 117 ? 9.054   3.023   8.545   1.00 0.00 ? 117 ALA A C    4  
ATOM 7175  O O    . ALA A 1 117 ? 8.720   4.164   8.789   1.00 0.00 ? 117 ALA A O    4  
ATOM 7176  C CB   . ALA A 1 117 ? 7.431   1.817   7.080   1.00 0.00 ? 117 ALA A CB   4  
ATOM 7177  H H    . ALA A 1 117 ? 9.581   0.403   6.950   1.00 0.00 ? 117 ALA A H    4  
ATOM 7178  H HA   . ALA A 1 117 ? 8.945   3.181   6.407   1.00 0.00 ? 117 ALA A HA   4  
ATOM 7179  H HB1  . ALA A 1 117 ? 7.345   1.006   7.788   1.00 0.00 ? 117 ALA A HB1  4  
ATOM 7180  H HB2  . ALA A 1 117 ? 6.703   2.579   7.313   1.00 0.00 ? 117 ALA A HB2  4  
ATOM 7181  H HB3  . ALA A 1 117 ? 7.254   1.443   6.082   1.00 0.00 ? 117 ALA A HB3  4  
ATOM 7182  N N    . ASP A 1 118 ? 9.610   2.273   9.457   1.00 0.00 ? 118 ASP A N    4  
ATOM 7183  C CA   . ASP A 1 118 ? 9.844   2.814   10.826  1.00 0.00 ? 118 ASP A CA   4  
ATOM 7184  C C    . ASP A 1 118 ? 10.888  3.931   10.767  1.00 0.00 ? 118 ASP A C    4  
ATOM 7185  O O    . ASP A 1 118 ? 10.910  4.817   11.598  1.00 0.00 ? 118 ASP A O    4  
ATOM 7186  C CB   . ASP A 1 118 ? 10.359  1.696   11.735  1.00 0.00 ? 118 ASP A CB   4  
ATOM 7187  C CG   . ASP A 1 118 ? 10.841  2.296   13.058  1.00 0.00 ? 118 ASP A CG   4  
ATOM 7188  O OD1  . ASP A 1 118 ? 11.976  2.742   13.103  1.00 0.00 ? 118 ASP A OD1  4  
ATOM 7189  O OD2  . ASP A 1 118 ? 10.068  2.303   14.001  1.00 0.00 ? 118 ASP A OD2  4  
ATOM 7190  H H    . ASP A 1 118 ? 9.871   1.351   9.242   1.00 0.00 ? 118 ASP A H    4  
ATOM 7191  H HA   . ASP A 1 118 ? 8.919   3.204   11.224  1.00 0.00 ? 118 ASP A HA   4  
ATOM 7192  H HB2  . ASP A 1 118 ? 9.562   0.992   11.925  1.00 0.00 ? 118 ASP A HB2  4  
ATOM 7193  H HB3  . ASP A 1 118 ? 11.180  1.189   11.252  1.00 0.00 ? 118 ASP A HB3  4  
ATOM 7194  N N    . TYR A 1 119 ? 11.756  3.893   9.794   1.00 0.00 ? 119 TYR A N    4  
ATOM 7195  C CA   . TYR A 1 119 ? 12.800  4.952   9.686   1.00 0.00 ? 119 TYR A CA   4  
ATOM 7196  C C    . TYR A 1 119 ? 12.212  6.184   8.996   1.00 0.00 ? 119 TYR A C    4  
ATOM 7197  O O    . TYR A 1 119 ? 12.305  7.288   9.495   1.00 0.00 ? 119 TYR A O    4  
ATOM 7198  C CB   . TYR A 1 119 ? 13.981  4.420   8.867   1.00 0.00 ? 119 TYR A CB   4  
ATOM 7199  C CG   . TYR A 1 119 ? 15.015  5.508   8.699   1.00 0.00 ? 119 TYR A CG   4  
ATOM 7200  C CD1  . TYR A 1 119 ? 14.766  6.583   7.837   1.00 0.00 ? 119 TYR A CD1  4  
ATOM 7201  C CD2  . TYR A 1 119 ? 16.224  5.440   9.402   1.00 0.00 ? 119 TYR A CD2  4  
ATOM 7202  C CE1  . TYR A 1 119 ? 15.727  7.591   7.679   1.00 0.00 ? 119 TYR A CE1  4  
ATOM 7203  C CE2  . TYR A 1 119 ? 17.184  6.448   9.245   1.00 0.00 ? 119 TYR A CE2  4  
ATOM 7204  C CZ   . TYR A 1 119 ? 16.935  7.523   8.384   1.00 0.00 ? 119 TYR A CZ   4  
ATOM 7205  O OH   . TYR A 1 119 ? 17.882  8.516   8.229   1.00 0.00 ? 119 TYR A OH   4  
ATOM 7206  H H    . TYR A 1 119 ? 11.724  3.167   9.136   1.00 0.00 ? 119 TYR A H    4  
ATOM 7207  H HA   . TYR A 1 119 ? 13.141  5.221   10.675  1.00 0.00 ? 119 TYR A HA   4  
ATOM 7208  H HB2  . TYR A 1 119 ? 14.425  3.579   9.380   1.00 0.00 ? 119 TYR A HB2  4  
ATOM 7209  H HB3  . TYR A 1 119 ? 13.630  4.104   7.895   1.00 0.00 ? 119 TYR A HB3  4  
ATOM 7210  H HD1  . TYR A 1 119 ? 13.834  6.636   7.294   1.00 0.00 ? 119 TYR A HD1  4  
ATOM 7211  H HD2  . TYR A 1 119 ? 16.416  4.610   10.068  1.00 0.00 ? 119 TYR A HD2  4  
ATOM 7212  H HE1  . TYR A 1 119 ? 15.535  8.419   7.015   1.00 0.00 ? 119 TYR A HE1  4  
ATOM 7213  H HE2  . TYR A 1 119 ? 18.115  6.395   9.789   1.00 0.00 ? 119 TYR A HE2  4  
ATOM 7214  H HH   . TYR A 1 119 ? 17.427  9.361   8.218   1.00 0.00 ? 119 TYR A HH   4  
ATOM 7215  N N    . LEU A 1 120 ? 11.613  6.008   7.851   1.00 0.00 ? 120 LEU A N    4  
ATOM 7216  C CA   . LEU A 1 120 ? 11.026  7.166   7.127   1.00 0.00 ? 120 LEU A CA   4  
ATOM 7217  C C    . LEU A 1 120 ? 9.884   7.777   7.954   1.00 0.00 ? 120 LEU A C    4  
ATOM 7218  O O    . LEU A 1 120 ? 9.564   8.942   7.824   1.00 0.00 ? 120 LEU A O    4  
ATOM 7219  C CB   . LEU A 1 120 ? 10.518  6.681   5.760   1.00 0.00 ? 120 LEU A CB   4  
ATOM 7220  C CG   . LEU A 1 120 ? 9.047   6.254   5.845   1.00 0.00 ? 120 LEU A CG   4  
ATOM 7221  C CD1  . LEU A 1 120 ? 8.154   7.459   5.553   1.00 0.00 ? 120 LEU A CD1  4  
ATOM 7222  C CD2  . LEU A 1 120 ? 8.773   5.155   4.813   1.00 0.00 ? 120 LEU A CD2  4  
ATOM 7223  H H    . LEU A 1 120 ? 11.551  5.111   7.462   1.00 0.00 ? 120 LEU A H    4  
ATOM 7224  H HA   . LEU A 1 120 ? 11.792  7.913   6.976   1.00 0.00 ? 120 LEU A HA   4  
ATOM 7225  H HB2  . LEU A 1 120 ? 10.619  7.477   5.042   1.00 0.00 ? 120 LEU A HB2  4  
ATOM 7226  H HB3  . LEU A 1 120 ? 11.114  5.837   5.445   1.00 0.00 ? 120 LEU A HB3  4  
ATOM 7227  H HG   . LEU A 1 120 ? 8.837   5.881   6.838   1.00 0.00 ? 120 LEU A HG   4  
ATOM 7228  H HD11 . LEU A 1 120 ? 8.704   8.369   5.742   1.00 0.00 ? 120 LEU A HD11 4  
ATOM 7229  H HD12 . LEU A 1 120 ? 7.844   7.433   4.520   1.00 0.00 ? 120 LEU A HD12 4  
ATOM 7230  H HD13 . LEU A 1 120 ? 7.283   7.426   6.191   1.00 0.00 ? 120 LEU A HD13 4  
ATOM 7231  H HD21 . LEU A 1 120 ? 9.575   4.433   4.833   1.00 0.00 ? 120 LEU A HD21 4  
ATOM 7232  H HD22 . LEU A 1 120 ? 7.840   4.664   5.050   1.00 0.00 ? 120 LEU A HD22 4  
ATOM 7233  H HD23 . LEU A 1 120 ? 8.707   5.594   3.829   1.00 0.00 ? 120 LEU A HD23 4  
ATOM 7234  N N    . ILE A 1 121 ? 9.271   6.998   8.804   1.00 0.00 ? 121 ILE A N    4  
ATOM 7235  C CA   . ILE A 1 121 ? 8.156   7.530   9.638   1.00 0.00 ? 121 ILE A CA   4  
ATOM 7236  C C    . ILE A 1 121 ? 8.725   8.071   10.954  1.00 0.00 ? 121 ILE A C    4  
ATOM 7237  O O    . ILE A 1 121 ? 8.085   8.835   11.651  1.00 0.00 ? 121 ILE A O    4  
ATOM 7238  C CB   . ILE A 1 121 ? 7.155   6.402   9.923   1.00 0.00 ? 121 ILE A CB   4  
ATOM 7239  C CG1  . ILE A 1 121 ? 6.273   6.185   8.689   1.00 0.00 ? 121 ILE A CG1  4  
ATOM 7240  C CG2  . ILE A 1 121 ? 6.270   6.772   11.118  1.00 0.00 ? 121 ILE A CG2  4  
ATOM 7241  C CD1  . ILE A 1 121 ? 6.246   4.698   8.331   1.00 0.00 ? 121 ILE A CD1  4  
ATOM 7242  H H    . ILE A 1 121 ? 9.547   6.065   8.895   1.00 0.00 ? 121 ILE A H    4  
ATOM 7243  H HA   . ILE A 1 121 ? 7.658   8.328   9.107   1.00 0.00 ? 121 ILE A HA   4  
ATOM 7244  H HB   . ILE A 1 121 ? 7.694   5.492   10.145  1.00 0.00 ? 121 ILE A HB   4  
ATOM 7245  H HG12 . ILE A 1 121 ? 5.269   6.522   8.901   1.00 0.00 ? 121 ILE A HG12 4  
ATOM 7246  H HG13 . ILE A 1 121 ? 6.672   6.745   7.857   1.00 0.00 ? 121 ILE A HG13 4  
ATOM 7247  H HG21 . ILE A 1 121 ? 6.129   7.843   11.144  1.00 0.00 ? 121 ILE A HG21 4  
ATOM 7248  H HG22 . ILE A 1 121 ? 5.311   6.285   11.021  1.00 0.00 ? 121 ILE A HG22 4  
ATOM 7249  H HG23 . ILE A 1 121 ? 6.747   6.449   12.032  1.00 0.00 ? 121 ILE A HG23 4  
ATOM 7250  H HD11 . ILE A 1 121 ? 6.557   4.115   9.186   1.00 0.00 ? 121 ILE A HD11 4  
ATOM 7251  H HD12 . ILE A 1 121 ? 5.244   4.413   8.048   1.00 0.00 ? 121 ILE A HD12 4  
ATOM 7252  H HD13 . ILE A 1 121 ? 6.919   4.514   7.506   1.00 0.00 ? 121 ILE A HD13 4  
ATOM 7253  N N    . GLY A 1 122 ? 9.921   7.680   11.299  1.00 0.00 ? 122 GLY A N    4  
ATOM 7254  C CA   . GLY A 1 122 ? 10.528  8.171   12.568  1.00 0.00 ? 122 GLY A CA   4  
ATOM 7255  C C    . GLY A 1 122 ? 10.597  9.698   12.544  1.00 0.00 ? 122 GLY A C    4  
ATOM 7256  O O    . GLY A 1 122 ? 10.769  10.338  13.562  1.00 0.00 ? 122 GLY A O    4  
ATOM 7257  H H    . GLY A 1 122 ? 10.419  7.064   10.724  1.00 0.00 ? 122 GLY A H    4  
ATOM 7258  H HA2  . GLY A 1 122 ? 9.922   7.849   13.404  1.00 0.00 ? 122 GLY A HA2  4  
ATOM 7259  H HA3  . GLY A 1 122 ? 11.524  7.770   12.670  1.00 0.00 ? 122 GLY A HA3  4  
ATOM 7260  N N    . GLN A 1 123 ? 10.464  10.288  11.388  1.00 0.00 ? 123 GLN A N    4  
ATOM 7261  C CA   . GLN A 1 123 ? 10.523  11.773  11.300  1.00 0.00 ? 123 GLN A CA   4  
ATOM 7262  C C    . GLN A 1 123 ? 9.111   12.345  11.438  1.00 0.00 ? 123 GLN A C    4  
ATOM 7263  O O    . GLN A 1 123 ? 8.823   13.094  12.350  1.00 0.00 ? 123 GLN A O    4  
ATOM 7264  C CB   . GLN A 1 123 ? 11.116  12.179  9.950   1.00 0.00 ? 123 GLN A CB   4  
ATOM 7265  C CG   . GLN A 1 123 ? 12.505  11.553  9.799   1.00 0.00 ? 123 GLN A CG   4  
ATOM 7266  C CD   . GLN A 1 123 ? 13.188  12.115  8.552   1.00 0.00 ? 123 GLN A CD   4  
ATOM 7267  O OE1  . GLN A 1 123 ? 13.293  11.442  7.546   1.00 0.00 ? 123 GLN A OE1  4  
ATOM 7268  N NE2  . GLN A 1 123 ? 13.664  13.330  8.576   1.00 0.00 ? 123 GLN A NE2  4  
ATOM 7269  H H    . GLN A 1 123 ? 10.326  9.754   10.579  1.00 0.00 ? 123 GLN A H    4  
ATOM 7270  H HA   . GLN A 1 123 ? 11.145  12.156  12.095  1.00 0.00 ? 123 GLN A HA   4  
ATOM 7271  H HB2  . GLN A 1 123 ? 10.473  11.830  9.154   1.00 0.00 ? 123 GLN A HB2  4  
ATOM 7272  H HB3  . GLN A 1 123 ? 11.201  13.253  9.901   1.00 0.00 ? 123 GLN A HB3  4  
ATOM 7273  H HG2  . GLN A 1 123 ? 13.099  11.784  10.671  1.00 0.00 ? 123 GLN A HG2  4  
ATOM 7274  H HG3  . GLN A 1 123 ? 12.409  10.482  9.702   1.00 0.00 ? 123 GLN A HG3  4  
ATOM 7275  H HE21 . GLN A 1 123 ? 13.582  13.872  9.389   1.00 0.00 ? 123 GLN A HE21 4  
ATOM 7276  H HE22 . GLN A 1 123 ? 14.104  13.700  7.783   1.00 0.00 ? 123 GLN A HE22 4  
ATOM 7277  N N    . GLY A 1 124 ? 8.224   11.995  10.546  1.00 0.00 ? 124 GLY A N    4  
ATOM 7278  C CA   . GLY A 1 124 ? 6.831   12.518  10.636  1.00 0.00 ? 124 GLY A CA   4  
ATOM 7279  C C    . GLY A 1 124 ? 6.155   12.431  9.266   1.00 0.00 ? 124 GLY A C    4  
ATOM 7280  O O    . GLY A 1 124 ? 6.429   13.213  8.377   1.00 0.00 ? 124 GLY A O    4  
ATOM 7281  H H    . GLY A 1 124 ? 8.473   11.386  9.820   1.00 0.00 ? 124 GLY A H    4  
ATOM 7282  H HA2  . GLY A 1 124 ? 6.273   11.931  11.352  1.00 0.00 ? 124 GLY A HA2  4  
ATOM 7283  H HA3  . GLY A 1 124 ? 6.854   13.548  10.957  1.00 0.00 ? 124 GLY A HA3  4  
ATOM 7284  N N    . PHE A 1 125 ? 5.276   11.479  9.084   1.00 0.00 ? 125 PHE A N    4  
ATOM 7285  C CA   . PHE A 1 125 ? 4.590   11.347  7.758   1.00 0.00 ? 125 PHE A CA   4  
ATOM 7286  C C    . PHE A 1 125 ? 4.126   12.731  7.300   1.00 0.00 ? 125 PHE A C    4  
ATOM 7287  O O    . PHE A 1 125 ? 4.873   13.377  6.584   1.00 0.00 ? 125 PHE A O    4  
ATOM 7288  C CB   . PHE A 1 125 ? 3.364   10.414  7.836   1.00 0.00 ? 125 PHE A CB   4  
ATOM 7289  C CG   . PHE A 1 125 ? 3.163   9.890   9.241   1.00 0.00 ? 125 PHE A CG   4  
ATOM 7290  C CD1  . PHE A 1 125 ? 2.700   10.746  10.249  1.00 0.00 ? 125 PHE A CD1  4  
ATOM 7291  C CD2  . PHE A 1 125 ? 3.440   8.550   9.534   1.00 0.00 ? 125 PHE A CD2  4  
ATOM 7292  C CE1  . PHE A 1 125 ? 2.515   10.258  11.550  1.00 0.00 ? 125 PHE A CE1  4  
ATOM 7293  C CE2  . PHE A 1 125 ? 3.257   8.064   10.834  1.00 0.00 ? 125 PHE A CE2  4  
ATOM 7294  C CZ   . PHE A 1 125 ? 2.793   8.917   11.842  1.00 0.00 ? 125 PHE A CZ   4  
ATOM 7295  O OXT  . PHE A 1 125 ? 3.031   13.121  7.672   1.00 0.00 ? 125 PHE A OXT  4  
ATOM 7296  H H    . PHE A 1 125 ? 5.079   10.858  9.811   1.00 0.00 ? 125 PHE A H    4  
ATOM 7297  H HA   . PHE A 1 125 ? 5.292   10.955  7.036   1.00 0.00 ? 125 PHE A HA   4  
ATOM 7298  H HB2  . PHE A 1 125 ? 2.481   10.957  7.529   1.00 0.00 ? 125 PHE A HB2  4  
ATOM 7299  H HB3  . PHE A 1 125 ? 3.515   9.579   7.166   1.00 0.00 ? 125 PHE A HB3  4  
ATOM 7300  H HD1  . PHE A 1 125 ? 2.485   11.780  10.026  1.00 0.00 ? 125 PHE A HD1  4  
ATOM 7301  H HD2  . PHE A 1 125 ? 3.798   7.890   8.756   1.00 0.00 ? 125 PHE A HD2  4  
ATOM 7302  H HE1  . PHE A 1 125 ? 2.159   10.916  12.328  1.00 0.00 ? 125 PHE A HE1  4  
ATOM 7303  H HE2  . PHE A 1 125 ? 3.471   7.030   11.058  1.00 0.00 ? 125 PHE A HE2  4  
ATOM 7304  H HZ   . PHE A 1 125 ? 2.651   8.541   12.844  1.00 0.00 ? 125 PHE A HZ   4  
ATOM 7305  N N    . SER A 1 1   ? 8.081   -0.468  -3.674  1.00 0.00 ? 1   SER A N    5  
ATOM 7306  C CA   . SER A 1 1   ? 7.439   0.732   -3.065  1.00 0.00 ? 1   SER A CA   5  
ATOM 7307  C C    . SER A 1 1   ? 8.513   1.769   -2.727  1.00 0.00 ? 1   SER A C    5  
ATOM 7308  O O    . SER A 1 1   ? 9.693   1.527   -2.879  1.00 0.00 ? 1   SER A O    5  
ATOM 7309  C CB   . SER A 1 1   ? 6.703   0.326   -1.790  1.00 0.00 ? 1   SER A CB   5  
ATOM 7310  O OG   . SER A 1 1   ? 7.388   -0.759  -1.177  1.00 0.00 ? 1   SER A OG   5  
ATOM 7311  H H1   . SER A 1 1   ? 9.100   -0.461  -3.461  1.00 0.00 ? 1   SER A H1   5  
ATOM 7312  H H2   . SER A 1 1   ? 7.650   -1.328  -3.280  1.00 0.00 ? 1   SER A H2   5  
ATOM 7313  H H3   . SER A 1 1   ? 7.941   -0.452  -4.702  1.00 0.00 ? 1   SER A H3   5  
ATOM 7314  H HA   . SER A 1 1   ? 6.738   1.159   -3.765  1.00 0.00 ? 1   SER A HA   5  
ATOM 7315  H HB2  . SER A 1 1   ? 6.676   1.159   -1.106  1.00 0.00 ? 1   SER A HB2  5  
ATOM 7316  H HB3  . SER A 1 1   ? 5.691   0.033   -2.038  1.00 0.00 ? 1   SER A HB3  5  
ATOM 7317  H HG   . SER A 1 1   ? 7.458   -0.573  -0.237  1.00 0.00 ? 1   SER A HG   5  
ATOM 7318  N N    . TRP A 1 2   ? 8.110   2.922   -2.271  1.00 0.00 ? 2   TRP A N    5  
ATOM 7319  C CA   . TRP A 1 2   ? 9.103   3.980   -1.927  1.00 0.00 ? 2   TRP A CA   5  
ATOM 7320  C C    . TRP A 1 2   ? 9.661   4.590   -3.216  1.00 0.00 ? 2   TRP A C    5  
ATOM 7321  O O    . TRP A 1 2   ? 9.368   4.141   -4.301  1.00 0.00 ? 2   TRP A O    5  
ATOM 7322  C CB   . TRP A 1 2   ? 10.238  3.373   -1.107  1.00 0.00 ? 2   TRP A CB   5  
ATOM 7323  C CG   . TRP A 1 2   ? 9.697   2.277   -0.243  1.00 0.00 ? 2   TRP A CG   5  
ATOM 7324  C CD1  . TRP A 1 2   ? 10.041  0.971   -0.330  1.00 0.00 ? 2   TRP A CD1  5  
ATOM 7325  C CD2  . TRP A 1 2   ? 8.715   2.371   0.826   1.00 0.00 ? 2   TRP A CD2  5  
ATOM 7326  N NE1  . TRP A 1 2   ? 9.344   0.261   0.631   1.00 0.00 ? 2   TRP A NE1  5  
ATOM 7327  C CE2  . TRP A 1 2   ? 8.512   1.080   1.367   1.00 0.00 ? 2   TRP A CE2  5  
ATOM 7328  C CE3  . TRP A 1 2   ? 7.991   3.443   1.375   1.00 0.00 ? 2   TRP A CE3  5  
ATOM 7329  C CZ2  . TRP A 1 2   ? 7.626   0.860   2.419   1.00 0.00 ? 2   TRP A CZ2  5  
ATOM 7330  C CZ3  . TRP A 1 2   ? 7.096   3.225   2.434   1.00 0.00 ? 2   TRP A CZ3  5  
ATOM 7331  C CH2  . TRP A 1 2   ? 6.914   1.935   2.956   1.00 0.00 ? 2   TRP A CH2  5  
ATOM 7332  H H    . TRP A 1 2   ? 7.151   3.096   -2.159  1.00 0.00 ? 2   TRP A H    5  
ATOM 7333  H HA   . TRP A 1 2   ? 8.616   4.752   -1.349  1.00 0.00 ? 2   TRP A HA   5  
ATOM 7334  H HB2  . TRP A 1 2   ? 10.985  2.977   -1.771  1.00 0.00 ? 2   TRP A HB2  5  
ATOM 7335  H HB3  . TRP A 1 2   ? 10.678  4.137   -0.484  1.00 0.00 ? 2   TRP A HB3  5  
ATOM 7336  H HD1  . TRP A 1 2   ? 10.751  0.553   -1.028  1.00 0.00 ? 2   TRP A HD1  5  
ATOM 7337  H HE1  . TRP A 1 2   ? 9.415   -0.704  0.784   1.00 0.00 ? 2   TRP A HE1  5  
ATOM 7338  H HE3  . TRP A 1 2   ? 8.120   4.441   0.976   1.00 0.00 ? 2   TRP A HE3  5  
ATOM 7339  H HZ2  . TRP A 1 2   ? 7.491   -0.136  2.816   1.00 0.00 ? 2   TRP A HZ2  5  
ATOM 7340  H HZ3  . TRP A 1 2   ? 6.547   4.056   2.850   1.00 0.00 ? 2   TRP A HZ3  5  
ATOM 7341  H HH2  . TRP A 1 2   ? 6.225   1.774   3.772   1.00 0.00 ? 2   TRP A HH2  5  
ATOM 7342  N N    . GLN A 1 3   ? 10.449  5.623   -3.109  1.00 0.00 ? 3   GLN A N    5  
ATOM 7343  C CA   . GLN A 1 3   ? 10.999  6.270   -4.336  1.00 0.00 ? 3   GLN A CA   5  
ATOM 7344  C C    . GLN A 1 3   ? 12.229  5.512   -4.856  1.00 0.00 ? 3   GLN A C    5  
ATOM 7345  O O    . GLN A 1 3   ? 12.120  4.613   -5.669  1.00 0.00 ? 3   GLN A O    5  
ATOM 7346  C CB   . GLN A 1 3   ? 11.385  7.714   -4.007  1.00 0.00 ? 3   GLN A CB   5  
ATOM 7347  C CG   . GLN A 1 3   ? 10.144  8.478   -3.546  1.00 0.00 ? 3   GLN A CG   5  
ATOM 7348  C CD   . GLN A 1 3   ? 10.538  9.907   -3.165  1.00 0.00 ? 3   GLN A CD   5  
ATOM 7349  O OE1  . GLN A 1 3   ? 9.958   10.492  -2.273  1.00 0.00 ? 3   GLN A OE1  5  
ATOM 7350  N NE2  . GLN A 1 3   ? 11.507  10.496  -3.811  1.00 0.00 ? 3   GLN A NE2  5  
ATOM 7351  H H    . GLN A 1 3   ? 10.668  5.983   -2.224  1.00 0.00 ? 3   GLN A H    5  
ATOM 7352  H HA   . GLN A 1 3   ? 10.239  6.275   -5.103  1.00 0.00 ? 3   GLN A HA   5  
ATOM 7353  H HB2  . GLN A 1 3   ? 12.122  7.720   -3.218  1.00 0.00 ? 3   GLN A HB2  5  
ATOM 7354  H HB3  . GLN A 1 3   ? 11.791  8.189   -4.887  1.00 0.00 ? 3   GLN A HB3  5  
ATOM 7355  H HG2  . GLN A 1 3   ? 9.418   8.503   -4.345  1.00 0.00 ? 3   GLN A HG2  5  
ATOM 7356  H HG3  . GLN A 1 3   ? 9.717   7.986   -2.686  1.00 0.00 ? 3   GLN A HG3  5  
ATOM 7357  H HE21 . GLN A 1 3   ? 11.975  10.024  -4.532  1.00 0.00 ? 3   GLN A HE21 5  
ATOM 7358  H HE22 . GLN A 1 3   ? 11.767  11.411  -3.576  1.00 0.00 ? 3   GLN A HE22 5  
ATOM 7359  N N    . THR A 1 4   ? 13.401  5.883   -4.413  1.00 0.00 ? 4   THR A N    5  
ATOM 7360  C CA   . THR A 1 4   ? 14.637  5.205   -4.899  1.00 0.00 ? 4   THR A CA   5  
ATOM 7361  C C    . THR A 1 4   ? 14.465  3.686   -4.848  1.00 0.00 ? 4   THR A C    5  
ATOM 7362  O O    . THR A 1 4   ? 14.981  2.967   -5.682  1.00 0.00 ? 4   THR A O    5  
ATOM 7363  C CB   . THR A 1 4   ? 15.819  5.616   -4.019  1.00 0.00 ? 4   THR A CB   5  
ATOM 7364  O OG1  . THR A 1 4   ? 15.521  6.846   -3.372  1.00 0.00 ? 4   THR A OG1  5  
ATOM 7365  C CG2  . THR A 1 4   ? 17.068  5.784   -4.885  1.00 0.00 ? 4   THR A CG2  5  
ATOM 7366  H H    . THR A 1 4   ? 13.470  6.619   -3.772  1.00 0.00 ? 4   THR A H    5  
ATOM 7367  H HA   . THR A 1 4   ? 14.830  5.507   -5.918  1.00 0.00 ? 4   THR A HA   5  
ATOM 7368  H HB   . THR A 1 4   ? 16.001  4.853   -3.278  1.00 0.00 ? 4   THR A HB   5  
ATOM 7369  H HG1  . THR A 1 4   ? 15.660  7.554   -4.005  1.00 0.00 ? 4   THR A HG1  5  
ATOM 7370  H HG21 . THR A 1 4   ? 16.898  5.338   -5.854  1.00 0.00 ? 4   THR A HG21 5  
ATOM 7371  H HG22 . THR A 1 4   ? 17.282  6.836   -5.006  1.00 0.00 ? 4   THR A HG22 5  
ATOM 7372  H HG23 . THR A 1 4   ? 17.907  5.300   -4.407  1.00 0.00 ? 4   THR A HG23 5  
ATOM 7373  N N    . TYR A 1 5   ? 13.755  3.186   -3.876  1.00 0.00 ? 5   TYR A N    5  
ATOM 7374  C CA   . TYR A 1 5   ? 13.569  1.710   -3.774  1.00 0.00 ? 5   TYR A CA   5  
ATOM 7375  C C    . TYR A 1 5   ? 12.641  1.228   -4.901  1.00 0.00 ? 5   TYR A C    5  
ATOM 7376  O O    . TYR A 1 5   ? 12.842  0.178   -5.478  1.00 0.00 ? 5   TYR A O    5  
ATOM 7377  C CB   . TYR A 1 5   ? 12.962  1.370   -2.407  1.00 0.00 ? 5   TYR A CB   5  
ATOM 7378  C CG   . TYR A 1 5   ? 13.670  2.145   -1.311  1.00 0.00 ? 5   TYR A CG   5  
ATOM 7379  C CD1  . TYR A 1 5   ? 14.925  2.724   -1.550  1.00 0.00 ? 5   TYR A CD1  5  
ATOM 7380  C CD2  . TYR A 1 5   ? 13.073  2.276   -0.047  1.00 0.00 ? 5   TYR A CD2  5  
ATOM 7381  C CE1  . TYR A 1 5   ? 15.578  3.431   -0.534  1.00 0.00 ? 5   TYR A CE1  5  
ATOM 7382  C CE2  . TYR A 1 5   ? 13.730  2.983   0.968   1.00 0.00 ? 5   TYR A CE2  5  
ATOM 7383  C CZ   . TYR A 1 5   ? 14.980  3.561   0.724   1.00 0.00 ? 5   TYR A CZ   5  
ATOM 7384  O OH   . TYR A 1 5   ? 15.626  4.255   1.727   1.00 0.00 ? 5   TYR A OH   5  
ATOM 7385  H H    . TYR A 1 5   ? 13.352  3.778   -3.208  1.00 0.00 ? 5   TYR A H    5  
ATOM 7386  H HA   . TYR A 1 5   ? 14.528  1.224   -3.871  1.00 0.00 ? 5   TYR A HA   5  
ATOM 7387  H HB2  . TYR A 1 5   ? 11.917  1.618   -2.409  1.00 0.00 ? 5   TYR A HB2  5  
ATOM 7388  H HB3  . TYR A 1 5   ? 13.076  0.317   -2.216  1.00 0.00 ? 5   TYR A HB3  5  
ATOM 7389  H HD1  . TYR A 1 5   ? 15.388  2.625   -2.521  1.00 0.00 ? 5   TYR A HD1  5  
ATOM 7390  H HD2  . TYR A 1 5   ? 12.108  1.833   0.146   1.00 0.00 ? 5   TYR A HD2  5  
ATOM 7391  H HE1  . TYR A 1 5   ? 16.544  3.876   -0.722  1.00 0.00 ? 5   TYR A HE1  5  
ATOM 7392  H HE2  . TYR A 1 5   ? 13.270  3.082   1.940   1.00 0.00 ? 5   TYR A HE2  5  
ATOM 7393  H HH   . TYR A 1 5   ? 16.350  3.711   2.049   1.00 0.00 ? 5   TYR A HH   5  
ATOM 7394  N N    . VAL A 1 6   ? 11.633  1.996   -5.223  1.00 0.00 ? 6   VAL A N    5  
ATOM 7395  C CA   . VAL A 1 6   ? 10.690  1.600   -6.316  1.00 0.00 ? 6   VAL A CA   5  
ATOM 7396  C C    . VAL A 1 6   ? 11.485  1.251   -7.576  1.00 0.00 ? 6   VAL A C    5  
ATOM 7397  O O    . VAL A 1 6   ? 11.015  0.555   -8.451  1.00 0.00 ? 6   VAL A O    5  
ATOM 7398  C CB   . VAL A 1 6   ? 9.755   2.792   -6.603  1.00 0.00 ? 6   VAL A CB   5  
ATOM 7399  C CG1  . VAL A 1 6   ? 9.582   3.036   -8.111  1.00 0.00 ? 6   VAL A CG1  5  
ATOM 7400  C CG2  . VAL A 1 6   ? 8.378   2.520   -5.991  1.00 0.00 ? 6   VAL A CG2  5  
ATOM 7401  H H    . VAL A 1 6   ? 11.495  2.841   -4.747  1.00 0.00 ? 6   VAL A H    5  
ATOM 7402  H HA   . VAL A 1 6   ? 10.108  0.749   -6.002  1.00 0.00 ? 6   VAL A HA   5  
ATOM 7403  H HB   . VAL A 1 6   ? 10.184  3.673   -6.155  1.00 0.00 ? 6   VAL A HB   5  
ATOM 7404  H HG11 . VAL A 1 6   ? 9.609   2.094   -8.635  1.00 0.00 ? 6   VAL A HG11 5  
ATOM 7405  H HG12 . VAL A 1 6   ? 8.633   3.519   -8.290  1.00 0.00 ? 6   VAL A HG12 5  
ATOM 7406  H HG13 . VAL A 1 6   ? 10.380  3.669   -8.467  1.00 0.00 ? 6   VAL A HG13 5  
ATOM 7407  H HG21 . VAL A 1 6   ? 8.500   2.083   -5.015  1.00 0.00 ? 6   VAL A HG21 5  
ATOM 7408  H HG22 . VAL A 1 6   ? 7.833   3.449   -5.906  1.00 0.00 ? 6   VAL A HG22 5  
ATOM 7409  H HG23 . VAL A 1 6   ? 7.831   1.839   -6.626  1.00 0.00 ? 6   VAL A HG23 5  
ATOM 7410  N N    . ASP A 1 7   ? 12.658  1.777   -7.689  1.00 0.00 ? 7   ASP A N    5  
ATOM 7411  C CA   . ASP A 1 7   ? 13.475  1.529   -8.906  1.00 0.00 ? 7   ASP A CA   5  
ATOM 7412  C C    . ASP A 1 7   ? 13.357  0.076   -9.366  1.00 0.00 ? 7   ASP A C    5  
ATOM 7413  O O    . ASP A 1 7   ? 12.516  -0.255  -10.178 1.00 0.00 ? 7   ASP A O    5  
ATOM 7414  C CB   . ASP A 1 7   ? 14.939  1.873   -8.616  1.00 0.00 ? 7   ASP A CB   5  
ATOM 7415  C CG   . ASP A 1 7   ? 15.785  1.649   -9.872  1.00 0.00 ? 7   ASP A CG   5  
ATOM 7416  O OD1  . ASP A 1 7   ? 15.547  0.668   -10.558 1.00 0.00 ? 7   ASP A OD1  5  
ATOM 7417  O OD2  . ASP A 1 7   ? 16.658  2.461   -10.127 1.00 0.00 ? 7   ASP A OD2  5  
ATOM 7418  H H    . ASP A 1 7   ? 12.993  2.368   -6.985  1.00 0.00 ? 7   ASP A H    5  
ATOM 7419  H HA   . ASP A 1 7   ? 13.111  2.160   -9.692  1.00 0.00 ? 7   ASP A HA   5  
ATOM 7420  H HB2  . ASP A 1 7   ? 15.009  2.909   -8.319  1.00 0.00 ? 7   ASP A HB2  5  
ATOM 7421  H HB3  . ASP A 1 7   ? 15.307  1.246   -7.819  1.00 0.00 ? 7   ASP A HB3  5  
ATOM 7422  N N    . THR A 1 8   ? 14.204  -0.785  -8.890  1.00 0.00 ? 8   THR A N    5  
ATOM 7423  C CA   . THR A 1 8   ? 14.137  -2.205  -9.352  1.00 0.00 ? 8   THR A CA   5  
ATOM 7424  C C    . THR A 1 8   ? 14.473  -3.179  -8.218  1.00 0.00 ? 8   THR A C    5  
ATOM 7425  O O    . THR A 1 8   ? 14.092  -4.332  -8.257  1.00 0.00 ? 8   THR A O    5  
ATOM 7426  C CB   . THR A 1 8   ? 15.135  -2.406  -10.494 1.00 0.00 ? 8   THR A CB   5  
ATOM 7427  O OG1  . THR A 1 8   ? 15.054  -3.745  -10.958 1.00 0.00 ? 8   THR A OG1  5  
ATOM 7428  C CG2  . THR A 1 8   ? 16.550  -2.119  -9.993  1.00 0.00 ? 8   THR A CG2  5  
ATOM 7429  H H    . THR A 1 8   ? 14.889  -0.495  -8.254  1.00 0.00 ? 8   THR A H    5  
ATOM 7430  H HA   . THR A 1 8   ? 13.142  -2.412  -9.715  1.00 0.00 ? 8   THR A HA   5  
ATOM 7431  H HB   . THR A 1 8   ? 14.900  -1.729  -11.302 1.00 0.00 ? 8   THR A HB   5  
ATOM 7432  H HG1  . THR A 1 8   ? 14.739  -3.727  -11.865 1.00 0.00 ? 8   THR A HG1  5  
ATOM 7433  H HG21 . THR A 1 8   ? 16.555  -2.111  -8.913  1.00 0.00 ? 8   THR A HG21 5  
ATOM 7434  H HG22 . THR A 1 8   ? 17.222  -2.887  -10.349 1.00 0.00 ? 8   THR A HG22 5  
ATOM 7435  H HG23 . THR A 1 8   ? 16.875  -1.158  -10.361 1.00 0.00 ? 8   THR A HG23 5  
ATOM 7436  N N    . ASN A 1 9   ? 15.190  -2.750  -7.220  1.00 0.00 ? 9   ASN A N    5  
ATOM 7437  C CA   . ASN A 1 9   ? 15.532  -3.686  -6.115  1.00 0.00 ? 9   ASN A CA   5  
ATOM 7438  C C    . ASN A 1 9   ? 14.309  -3.899  -5.232  1.00 0.00 ? 9   ASN A C    5  
ATOM 7439  O O    . ASN A 1 9   ? 13.882  -5.010  -5.020  1.00 0.00 ? 9   ASN A O    5  
ATOM 7440  C CB   . ASN A 1 9   ? 16.674  -3.104  -5.279  1.00 0.00 ? 9   ASN A CB   5  
ATOM 7441  C CG   . ASN A 1 9   ? 18.015  -3.580  -5.842  1.00 0.00 ? 9   ASN A CG   5  
ATOM 7442  O OD1  . ASN A 1 9   ? 18.703  -2.838  -6.514  1.00 0.00 ? 9   ASN A OD1  5  
ATOM 7443  N ND2  . ASN A 1 9   ? 18.416  -4.798  -5.597  1.00 0.00 ? 9   ASN A ND2  5  
ATOM 7444  H H    . ASN A 1 9   ? 15.506  -1.824  -7.196  1.00 0.00 ? 9   ASN A H    5  
ATOM 7445  H HA   . ASN A 1 9   ? 15.835  -4.637  -6.532  1.00 0.00 ? 9   ASN A HA   5  
ATOM 7446  H HB2  . ASN A 1 9   ? 16.632  -2.024  -5.315  1.00 0.00 ? 9   ASN A HB2  5  
ATOM 7447  H HB3  . ASN A 1 9   ? 16.577  -3.435  -4.256  1.00 0.00 ? 9   ASN A HB3  5  
ATOM 7448  H HD21 . ASN A 1 9   ? 17.860  -5.398  -5.057  1.00 0.00 ? 9   ASN A HD21 5  
ATOM 7449  H HD22 . ASN A 1 9   ? 19.275  -5.112  -5.952  1.00 0.00 ? 9   ASN A HD22 5  
ATOM 7450  N N    . LEU A 1 10  ? 13.742  -2.847  -4.716  1.00 0.00 ? 10  LEU A N    5  
ATOM 7451  C CA   . LEU A 1 10  ? 12.544  -3.000  -3.845  1.00 0.00 ? 10  LEU A CA   5  
ATOM 7452  C C    . LEU A 1 10  ? 11.312  -3.272  -4.702  1.00 0.00 ? 10  LEU A C    5  
ATOM 7453  O O    . LEU A 1 10  ? 10.352  -3.863  -4.253  1.00 0.00 ? 10  LEU A O    5  
ATOM 7454  C CB   . LEU A 1 10  ? 12.327  -1.712  -3.061  1.00 0.00 ? 10  LEU A CB   5  
ATOM 7455  C CG   . LEU A 1 10  ? 12.571  -1.971  -1.574  1.00 0.00 ? 10  LEU A CG   5  
ATOM 7456  C CD1  . LEU A 1 10  ? 11.540  -2.977  -1.057  1.00 0.00 ? 10  LEU A CD1  5  
ATOM 7457  C CD2  . LEU A 1 10  ? 13.979  -2.538  -1.379  1.00 0.00 ? 10  LEU A CD2  5  
ATOM 7458  H H    . LEU A 1 10  ? 14.105  -1.956  -4.899  1.00 0.00 ? 10  LEU A H    5  
ATOM 7459  H HA   . LEU A 1 10  ? 12.695  -3.817  -3.159  1.00 0.00 ? 10  LEU A HA   5  
ATOM 7460  H HB2  . LEU A 1 10  ? 13.014  -0.962  -3.420  1.00 0.00 ? 10  LEU A HB2  5  
ATOM 7461  H HB3  . LEU A 1 10  ? 11.313  -1.370  -3.204  1.00 0.00 ? 10  LEU A HB3  5  
ATOM 7462  H HG   . LEU A 1 10  ? 12.475  -1.044  -1.027  1.00 0.00 ? 10  LEU A HG   5  
ATOM 7463  H HD11 . LEU A 1 10  ? 11.484  -3.816  -1.736  1.00 0.00 ? 10  LEU A HD11 5  
ATOM 7464  H HD12 . LEU A 1 10  ? 11.835  -3.325  -0.078  1.00 0.00 ? 10  LEU A HD12 5  
ATOM 7465  H HD13 . LEU A 1 10  ? 10.573  -2.501  -0.994  1.00 0.00 ? 10  LEU A HD13 5  
ATOM 7466  H HD21 . LEU A 1 10  ? 14.156  -3.319  -2.104  1.00 0.00 ? 10  LEU A HD21 5  
ATOM 7467  H HD22 . LEU A 1 10  ? 14.706  -1.751  -1.513  1.00 0.00 ? 10  LEU A HD22 5  
ATOM 7468  H HD23 . LEU A 1 10  ? 14.068  -2.946  -0.383  1.00 0.00 ? 10  LEU A HD23 5  
ATOM 7469  N N    . VAL A 1 11  ? 11.327  -2.847  -5.933  1.00 0.00 ? 11  VAL A N    5  
ATOM 7470  C CA   . VAL A 1 11  ? 10.147  -3.090  -6.804  1.00 0.00 ? 11  VAL A CA   5  
ATOM 7471  C C    . VAL A 1 11  ? 10.359  -4.397  -7.562  1.00 0.00 ? 11  VAL A C    5  
ATOM 7472  O O    . VAL A 1 11  ? 9.544   -5.296  -7.496  1.00 0.00 ? 11  VAL A O    5  
ATOM 7473  C CB   . VAL A 1 11  ? 9.970   -1.903  -7.777  1.00 0.00 ? 11  VAL A CB   5  
ATOM 7474  C CG1  . VAL A 1 11  ? 9.408   -2.380  -9.123  1.00 0.00 ? 11  VAL A CG1  5  
ATOM 7475  C CG2  . VAL A 1 11  ? 8.990   -0.901  -7.165  1.00 0.00 ? 11  VAL A CG2  5  
ATOM 7476  H H    . VAL A 1 11  ? 12.112  -2.373  -6.283  1.00 0.00 ? 11  VAL A H    5  
ATOM 7477  H HA   . VAL A 1 11  ? 9.266   -3.188  -6.177  1.00 0.00 ? 11  VAL A HA   5  
ATOM 7478  H HB   . VAL A 1 11  ? 10.929  -1.416  -7.941  1.00 0.00 ? 11  VAL A HB   5  
ATOM 7479  H HG11 . VAL A 1 11  ? 10.049  -3.150  -9.528  1.00 0.00 ? 11  VAL A HG11 5  
ATOM 7480  H HG12 . VAL A 1 11  ? 8.415   -2.777  -8.979  1.00 0.00 ? 11  VAL A HG12 5  
ATOM 7481  H HG13 . VAL A 1 11  ? 9.367   -1.549  -9.810  1.00 0.00 ? 11  VAL A HG13 5  
ATOM 7482  H HG21 . VAL A 1 11  ? 9.147   -0.850  -6.098  1.00 0.00 ? 11  VAL A HG21 5  
ATOM 7483  H HG22 . VAL A 1 11  ? 9.153   0.075   -7.601  1.00 0.00 ? 11  VAL A HG22 5  
ATOM 7484  H HG23 . VAL A 1 11  ? 7.978   -1.219  -7.366  1.00 0.00 ? 11  VAL A HG23 5  
ATOM 7485  N N    . GLY A 1 12  ? 11.451  -4.518  -8.270  1.00 0.00 ? 12  GLY A N    5  
ATOM 7486  C CA   . GLY A 1 12  ? 11.710  -5.785  -9.010  1.00 0.00 ? 12  GLY A CA   5  
ATOM 7487  C C    . GLY A 1 12  ? 11.365  -6.949  -8.085  1.00 0.00 ? 12  GLY A C    5  
ATOM 7488  O O    . GLY A 1 12  ? 10.785  -7.935  -8.494  1.00 0.00 ? 12  GLY A O    5  
ATOM 7489  H H    . GLY A 1 12  ? 12.098  -3.785  -8.303  1.00 0.00 ? 12  GLY A H    5  
ATOM 7490  H HA2  . GLY A 1 12  ? 11.092  -5.822  -9.897  1.00 0.00 ? 12  GLY A HA2  5  
ATOM 7491  H HA3  . GLY A 1 12  ? 12.751  -5.841  -9.286  1.00 0.00 ? 12  GLY A HA3  5  
ATOM 7492  N N    . THR A 1 13  ? 11.695  -6.815  -6.825  1.00 0.00 ? 13  THR A N    5  
ATOM 7493  C CA   . THR A 1 13  ? 11.371  -7.884  -5.841  1.00 0.00 ? 13  THR A CA   5  
ATOM 7494  C C    . THR A 1 13  ? 12.256  -7.745  -4.607  1.00 0.00 ? 13  THR A C    5  
ATOM 7495  O O    . THR A 1 13  ? 12.804  -8.705  -4.104  1.00 0.00 ? 13  THR A O    5  
ATOM 7496  C CB   . THR A 1 13  ? 11.594  -9.254  -6.461  1.00 0.00 ? 13  THR A CB   5  
ATOM 7497  O OG1  . THR A 1 13  ? 11.771  -10.226 -5.440  1.00 0.00 ? 13  THR A OG1  5  
ATOM 7498  C CG2  . THR A 1 13  ? 12.833  -9.210  -7.362  1.00 0.00 ? 13  THR A CG2  5  
ATOM 7499  H H    . THR A 1 13  ? 12.141  -5.997  -6.525  1.00 0.00 ? 13  THR A H    5  
ATOM 7500  H HA   . THR A 1 13  ? 10.327  -7.787  -5.551  1.00 0.00 ? 13  THR A HA   5  
ATOM 7501  H HB   . THR A 1 13  ? 10.734  -9.506  -7.040  1.00 0.00 ? 13  THR A HB   5  
ATOM 7502  H HG1  . THR A 1 13  ? 12.710  -10.400 -5.354  1.00 0.00 ? 13  THR A HG1  5  
ATOM 7503  H HG21 . THR A 1 13  ? 13.324  -8.253  -7.250  1.00 0.00 ? 13  THR A HG21 5  
ATOM 7504  H HG22 . THR A 1 13  ? 13.514  -9.997  -7.077  1.00 0.00 ? 13  THR A HG22 5  
ATOM 7505  H HG23 . THR A 1 13  ? 12.537  -9.343  -8.391  1.00 0.00 ? 13  THR A HG23 5  
ATOM 7506  N N    . GLY A 1 14  ? 12.371  -6.565  -4.085  1.00 0.00 ? 14  GLY A N    5  
ATOM 7507  C CA   . GLY A 1 14  ? 13.184  -6.386  -2.856  1.00 0.00 ? 14  GLY A CA   5  
ATOM 7508  C C    . GLY A 1 14  ? 12.242  -6.565  -1.671  1.00 0.00 ? 14  GLY A C    5  
ATOM 7509  O O    . GLY A 1 14  ? 12.501  -6.112  -0.574  1.00 0.00 ? 14  GLY A O    5  
ATOM 7510  H H    . GLY A 1 14  ? 11.901  -5.802  -4.481  1.00 0.00 ? 14  GLY A H    5  
ATOM 7511  H HA2  . GLY A 1 14  ? 13.968  -7.129  -2.824  1.00 0.00 ? 14  GLY A HA2  5  
ATOM 7512  H HA3  . GLY A 1 14  ? 13.609  -5.397  -2.834  1.00 0.00 ? 14  GLY A HA3  5  
ATOM 7513  N N    . ALA A 1 15  ? 11.131  -7.220  -1.909  1.00 0.00 ? 15  ALA A N    5  
ATOM 7514  C CA   . ALA A 1 15  ? 10.124  -7.442  -0.843  1.00 0.00 ? 15  ALA A CA   5  
ATOM 7515  C C    . ALA A 1 15  ? 8.788   -7.668  -1.538  1.00 0.00 ? 15  ALA A C    5  
ATOM 7516  O O    . ALA A 1 15  ? 7.953   -8.428  -1.088  1.00 0.00 ? 15  ALA A O    5  
ATOM 7517  C CB   . ALA A 1 15  ? 10.034  -6.213  0.068   1.00 0.00 ? 15  ALA A CB   5  
ATOM 7518  H H    . ALA A 1 15  ? 10.948  -7.566  -2.819  1.00 0.00 ? 15  ALA A H    5  
ATOM 7519  H HA   . ALA A 1 15  ? 10.388  -8.315  -0.263  1.00 0.00 ? 15  ALA A HA   5  
ATOM 7520  H HB1  . ALA A 1 15  ? 10.126  -5.317  -0.528  1.00 0.00 ? 15  ALA A HB1  5  
ATOM 7521  H HB2  . ALA A 1 15  ? 9.082   -6.212  0.576   1.00 0.00 ? 15  ALA A HB2  5  
ATOM 7522  H HB3  . ALA A 1 15  ? 10.831  -6.246  0.796   1.00 0.00 ? 15  ALA A HB3  5  
ATOM 7523  N N    . VAL A 1 16  ? 8.596   -7.020  -2.657  1.00 0.00 ? 16  VAL A N    5  
ATOM 7524  C CA   . VAL A 1 16  ? 7.339   -7.197  -3.419  1.00 0.00 ? 16  VAL A CA   5  
ATOM 7525  C C    . VAL A 1 16  ? 7.685   -7.192  -4.906  1.00 0.00 ? 16  VAL A C    5  
ATOM 7526  O O    . VAL A 1 16  ? 8.603   -6.518  -5.331  1.00 0.00 ? 16  VAL A O    5  
ATOM 7527  C CB   . VAL A 1 16  ? 6.386   -6.043  -3.106  1.00 0.00 ? 16  VAL A CB   5  
ATOM 7528  C CG1  . VAL A 1 16  ? 5.957   -6.120  -1.640  1.00 0.00 ? 16  VAL A CG1  5  
ATOM 7529  C CG2  . VAL A 1 16  ? 7.103   -4.714  -3.357  1.00 0.00 ? 16  VAL A CG2  5  
ATOM 7530  H H    . VAL A 1 16  ? 9.295   -6.420  -3.010  1.00 0.00 ? 16  VAL A H    5  
ATOM 7531  H HA   . VAL A 1 16  ? 6.877   -8.137  -3.154  1.00 0.00 ? 16  VAL A HA   5  
ATOM 7532  H HB   . VAL A 1 16  ? 5.515   -6.111  -3.742  1.00 0.00 ? 16  VAL A HB   5  
ATOM 7533  H HG11 . VAL A 1 16  ? 5.553   -7.100  -1.434  1.00 0.00 ? 16  VAL A HG11 5  
ATOM 7534  H HG12 . VAL A 1 16  ? 6.812   -5.941  -1.004  1.00 0.00 ? 16  VAL A HG12 5  
ATOM 7535  H HG13 . VAL A 1 16  ? 5.203   -5.371  -1.447  1.00 0.00 ? 16  VAL A HG13 5  
ATOM 7536  H HG21 . VAL A 1 16  ? 7.488   -4.697  -4.366  1.00 0.00 ? 16  VAL A HG21 5  
ATOM 7537  H HG22 . VAL A 1 16  ? 6.408   -3.898  -3.223  1.00 0.00 ? 16  VAL A HG22 5  
ATOM 7538  H HG23 . VAL A 1 16  ? 7.921   -4.608  -2.660  1.00 0.00 ? 16  VAL A HG23 5  
ATOM 7539  N N    . THR A 1 17  ? 6.966   -7.926  -5.707  1.00 0.00 ? 17  THR A N    5  
ATOM 7540  C CA   . THR A 1 17  ? 7.272   -7.939  -7.165  1.00 0.00 ? 17  THR A CA   5  
ATOM 7541  C C    . THR A 1 17  ? 6.656   -6.700  -7.820  1.00 0.00 ? 17  THR A C    5  
ATOM 7542  O O    . THR A 1 17  ? 6.571   -6.598  -9.027  1.00 0.00 ? 17  THR A O    5  
ATOM 7543  C CB   . THR A 1 17  ? 6.690   -9.201  -7.802  1.00 0.00 ? 17  THR A CB   5  
ATOM 7544  O OG1  . THR A 1 17  ? 5.759   -9.797  -6.909  1.00 0.00 ? 17  THR A OG1  5  
ATOM 7545  C CG2  . THR A 1 17  ? 7.820   -10.187 -8.101  1.00 0.00 ? 17  THR A CG2  5  
ATOM 7546  H H    . THR A 1 17  ? 6.226   -8.462  -5.354  1.00 0.00 ? 17  THR A H    5  
ATOM 7547  H HA   . THR A 1 17  ? 8.343   -7.924  -7.306  1.00 0.00 ? 17  THR A HA   5  
ATOM 7548  H HB   . THR A 1 17  ? 6.193   -8.942  -8.723  1.00 0.00 ? 17  THR A HB   5  
ATOM 7549  H HG1  . THR A 1 17  ? 5.076   -9.149  -6.718  1.00 0.00 ? 17  THR A HG1  5  
ATOM 7550  H HG21 . THR A 1 17  ? 8.732   -9.837  -7.639  1.00 0.00 ? 17  THR A HG21 5  
ATOM 7551  H HG22 . THR A 1 17  ? 7.564   -11.158 -7.703  1.00 0.00 ? 17  THR A HG22 5  
ATOM 7552  H HG23 . THR A 1 17  ? 7.961   -10.259 -9.168  1.00 0.00 ? 17  THR A HG23 5  
ATOM 7553  N N    . GLN A 1 18  ? 6.225   -5.761  -7.025  1.00 0.00 ? 18  GLN A N    5  
ATOM 7554  C CA   . GLN A 1 18  ? 5.614   -4.526  -7.577  1.00 0.00 ? 18  GLN A CA   5  
ATOM 7555  C C    . GLN A 1 18  ? 5.317   -3.577  -6.416  1.00 0.00 ? 18  GLN A C    5  
ATOM 7556  O O    . GLN A 1 18  ? 5.605   -3.879  -5.274  1.00 0.00 ? 18  GLN A O    5  
ATOM 7557  C CB   . GLN A 1 18  ? 4.312   -4.876  -8.300  1.00 0.00 ? 18  GLN A CB   5  
ATOM 7558  C CG   . GLN A 1 18  ? 4.515   -4.754  -9.812  1.00 0.00 ? 18  GLN A CG   5  
ATOM 7559  C CD   . GLN A 1 18  ? 3.446   -5.570  -10.542 1.00 0.00 ? 18  GLN A CD   5  
ATOM 7560  O OE1  . GLN A 1 18  ? 2.845   -5.101  -11.487 1.00 0.00 ? 18  GLN A OE1  5  
ATOM 7561  N NE2  . GLN A 1 18  ? 3.182   -6.784  -10.142 1.00 0.00 ? 18  GLN A NE2  5  
ATOM 7562  H H    . GLN A 1 18  ? 6.305   -5.867  -6.058  1.00 0.00 ? 18  GLN A H    5  
ATOM 7563  H HA   . GLN A 1 18  ? 6.300   -4.055  -8.265  1.00 0.00 ? 18  GLN A HA   5  
ATOM 7564  H HB2  . GLN A 1 18  ? 4.027   -5.889  -8.057  1.00 0.00 ? 18  GLN A HB2  5  
ATOM 7565  H HB3  . GLN A 1 18  ? 3.532   -4.200  -7.987  1.00 0.00 ? 18  GLN A HB3  5  
ATOM 7566  H HG2  . GLN A 1 18  ? 4.436   -3.716  -10.102 1.00 0.00 ? 18  GLN A HG2  5  
ATOM 7567  H HG3  . GLN A 1 18  ? 5.494   -5.128  -10.075 1.00 0.00 ? 18  GLN A HG3  5  
ATOM 7568  H HE21 . GLN A 1 18  ? 3.666   -7.165  -9.380  1.00 0.00 ? 18  GLN A HE21 5  
ATOM 7569  H HE22 . GLN A 1 18  ? 2.500   -7.314  -10.604 1.00 0.00 ? 18  GLN A HE22 5  
ATOM 7570  N N    . ALA A 1 19  ? 4.744   -2.443  -6.692  1.00 0.00 ? 19  ALA A N    5  
ATOM 7571  C CA   . ALA A 1 19  ? 4.428   -1.482  -5.597  1.00 0.00 ? 19  ALA A CA   5  
ATOM 7572  C C    . ALA A 1 19  ? 4.202   -0.096  -6.192  1.00 0.00 ? 19  ALA A C    5  
ATOM 7573  O O    . ALA A 1 19  ? 4.791   0.261   -7.194  1.00 0.00 ? 19  ALA A O    5  
ATOM 7574  C CB   . ALA A 1 19  ? 5.592   -1.421  -4.604  1.00 0.00 ? 19  ALA A CB   5  
ATOM 7575  H H    . ALA A 1 19  ? 4.516   -2.223  -7.619  1.00 0.00 ? 19  ALA A H    5  
ATOM 7576  H HA   . ALA A 1 19  ? 3.536   -1.801  -5.084  1.00 0.00 ? 19  ALA A HA   5  
ATOM 7577  H HB1  . ALA A 1 19  ? 6.496   -1.755  -5.090  1.00 0.00 ? 19  ALA A HB1  5  
ATOM 7578  H HB2  . ALA A 1 19  ? 5.719   -0.405  -4.261  1.00 0.00 ? 19  ALA A HB2  5  
ATOM 7579  H HB3  . ALA A 1 19  ? 5.378   -2.062  -3.761  1.00 0.00 ? 19  ALA A HB3  5  
ATOM 7580  N N    . ALA A 1 20  ? 3.356   0.691   -5.591  1.00 0.00 ? 20  ALA A N    5  
ATOM 7581  C CA   . ALA A 1 20  ? 3.107   2.048   -6.135  1.00 0.00 ? 20  ALA A CA   5  
ATOM 7582  C C    . ALA A 1 20  ? 3.042   3.052   -4.988  1.00 0.00 ? 20  ALA A C    5  
ATOM 7583  O O    . ALA A 1 20  ? 2.820   2.699   -3.847  1.00 0.00 ? 20  ALA A O    5  
ATOM 7584  C CB   . ALA A 1 20  ? 1.779   2.057   -6.901  1.00 0.00 ? 20  ALA A CB   5  
ATOM 7585  H H    . ALA A 1 20  ? 2.886   0.392   -4.783  1.00 0.00 ? 20  ALA A H    5  
ATOM 7586  H HA   . ALA A 1 20  ? 3.909   2.318   -6.803  1.00 0.00 ? 20  ALA A HA   5  
ATOM 7587  H HB1  . ALA A 1 20  ? 1.790   1.279   -7.651  1.00 0.00 ? 20  ALA A HB1  5  
ATOM 7588  H HB2  . ALA A 1 20  ? 0.965   1.882   -6.214  1.00 0.00 ? 20  ALA A HB2  5  
ATOM 7589  H HB3  . ALA A 1 20  ? 1.646   3.016   -7.380  1.00 0.00 ? 20  ALA A HB3  5  
ATOM 7590  N N    . ILE A 1 21  ? 3.225   4.303   -5.286  1.00 0.00 ? 21  ILE A N    5  
ATOM 7591  C CA   . ILE A 1 21  ? 3.159   5.344   -4.227  1.00 0.00 ? 21  ILE A CA   5  
ATOM 7592  C C    . ILE A 1 21  ? 2.259   6.463   -4.739  1.00 0.00 ? 21  ILE A C    5  
ATOM 7593  O O    . ILE A 1 21  ? 2.676   7.329   -5.484  1.00 0.00 ? 21  ILE A O    5  
ATOM 7594  C CB   . ILE A 1 21  ? 4.564   5.862   -3.920  1.00 0.00 ? 21  ILE A CB   5  
ATOM 7595  C CG1  . ILE A 1 21  ? 5.403   4.713   -3.363  1.00 0.00 ? 21  ILE A CG1  5  
ATOM 7596  C CG2  . ILE A 1 21  ? 4.491   6.979   -2.877  1.00 0.00 ? 21  ILE A CG2  5  
ATOM 7597  C CD1  . ILE A 1 21  ? 6.879   4.964   -3.661  1.00 0.00 ? 21  ILE A CD1  5  
ATOM 7598  H H    . ILE A 1 21  ? 3.396   4.563   -6.215  1.00 0.00 ? 21  ILE A H    5  
ATOM 7599  H HA   . ILE A 1 21  ? 2.726   4.917   -3.332  1.00 0.00 ? 21  ILE A HA   5  
ATOM 7600  H HB   . ILE A 1 21  ? 5.018   6.239   -4.825  1.00 0.00 ? 21  ILE A HB   5  
ATOM 7601  H HG12 . ILE A 1 21  ? 5.257   4.646   -2.294  1.00 0.00 ? 21  ILE A HG12 5  
ATOM 7602  H HG13 . ILE A 1 21  ? 5.098   3.787   -3.826  1.00 0.00 ? 21  ILE A HG13 5  
ATOM 7603  H HG21 . ILE A 1 21  ? 3.749   6.728   -2.133  1.00 0.00 ? 21  ILE A HG21 5  
ATOM 7604  H HG22 . ILE A 1 21  ? 5.455   7.089   -2.402  1.00 0.00 ? 21  ILE A HG22 5  
ATOM 7605  H HG23 . ILE A 1 21  ? 4.219   7.906   -3.359  1.00 0.00 ? 21  ILE A HG23 5  
ATOM 7606  H HD11 . ILE A 1 21  ? 6.968   5.697   -4.448  1.00 0.00 ? 21  ILE A HD11 5  
ATOM 7607  H HD12 . ILE A 1 21  ? 7.371   5.328   -2.771  1.00 0.00 ? 21  ILE A HD12 5  
ATOM 7608  H HD13 . ILE A 1 21  ? 7.339   4.041   -3.975  1.00 0.00 ? 21  ILE A HD13 5  
ATOM 7609  N N    . LEU A 1 22  ? 1.012   6.417   -4.367  1.00 0.00 ? 22  LEU A N    5  
ATOM 7610  C CA   . LEU A 1 22  ? 0.037   7.437   -4.846  1.00 0.00 ? 22  LEU A CA   5  
ATOM 7611  C C    . LEU A 1 22  ? 0.015   8.620   -3.871  1.00 0.00 ? 22  LEU A C    5  
ATOM 7612  O O    . LEU A 1 22  ? -0.129  8.454   -2.677  1.00 0.00 ? 22  LEU A O    5  
ATOM 7613  C CB   . LEU A 1 22  ? -1.371  6.811   -4.959  1.00 0.00 ? 22  LEU A CB   5  
ATOM 7614  C CG   . LEU A 1 22  ? -1.308  5.273   -4.818  1.00 0.00 ? 22  LEU A CG   5  
ATOM 7615  C CD1  . LEU A 1 22  ? -2.691  4.662   -5.060  1.00 0.00 ? 22  LEU A CD1  5  
ATOM 7616  C CD2  . LEU A 1 22  ? -0.323  4.684   -5.837  1.00 0.00 ? 22  LEU A CD2  5  
ATOM 7617  H H    . LEU A 1 22  ? 0.711   5.691   -3.785  1.00 0.00 ? 22  LEU A H    5  
ATOM 7618  H HA   . LEU A 1 22  ? 0.347   7.790   -5.819  1.00 0.00 ? 22  LEU A HA   5  
ATOM 7619  H HB2  . LEU A 1 22  ? -2.002  7.212   -4.179  1.00 0.00 ? 22  LEU A HB2  5  
ATOM 7620  H HB3  . LEU A 1 22  ? -1.793  7.060   -5.921  1.00 0.00 ? 22  LEU A HB3  5  
ATOM 7621  H HG   . LEU A 1 22  ? -0.984  5.024   -3.819  1.00 0.00 ? 22  LEU A HG   5  
ATOM 7622  H HD11 . LEU A 1 22  ? -3.068  4.991   -6.018  1.00 0.00 ? 22  LEU A HD11 5  
ATOM 7623  H HD12 . LEU A 1 22  ? -2.613  3.584   -5.056  1.00 0.00 ? 22  LEU A HD12 5  
ATOM 7624  H HD13 . LEU A 1 22  ? -3.366  4.975   -4.279  1.00 0.00 ? 22  LEU A HD13 5  
ATOM 7625  H HD21 . LEU A 1 22  ? -0.166  5.388   -6.639  1.00 0.00 ? 22  LEU A HD21 5  
ATOM 7626  H HD22 . LEU A 1 22  ? 0.619   4.475   -5.350  1.00 0.00 ? 22  LEU A HD22 5  
ATOM 7627  H HD23 . LEU A 1 22  ? -0.728  3.766   -6.239  1.00 0.00 ? 22  LEU A HD23 5  
ATOM 7628  N N    . GLY A 1 23  ? 0.176   9.816   -4.379  1.00 0.00 ? 23  GLY A N    5  
ATOM 7629  C CA   . GLY A 1 23  ? 0.185   11.019  -3.495  1.00 0.00 ? 23  GLY A CA   5  
ATOM 7630  C C    . GLY A 1 23  ? -1.214  11.286  -2.935  1.00 0.00 ? 23  GLY A C    5  
ATOM 7631  O O    . GLY A 1 23  ? -2.193  10.715  -3.371  1.00 0.00 ? 23  GLY A O    5  
ATOM 7632  H H    . GLY A 1 23  ? 0.302   9.922   -5.345  1.00 0.00 ? 23  GLY A H    5  
ATOM 7633  H HA2  . GLY A 1 23  ? 0.872   10.852  -2.677  1.00 0.00 ? 23  GLY A HA2  5  
ATOM 7634  H HA3  . GLY A 1 23  ? 0.510   11.878  -4.063  1.00 0.00 ? 23  GLY A HA3  5  
ATOM 7635  N N    . LEU A 1 24  ? -1.305  12.149  -1.956  1.00 0.00 ? 24  LEU A N    5  
ATOM 7636  C CA   . LEU A 1 24  ? -2.622  12.460  -1.344  1.00 0.00 ? 24  LEU A CA   5  
ATOM 7637  C C    . LEU A 1 24  ? -3.463  13.276  -2.328  1.00 0.00 ? 24  LEU A C    5  
ATOM 7638  O O    . LEU A 1 24  ? -4.630  13.527  -2.100  1.00 0.00 ? 24  LEU A O    5  
ATOM 7639  C CB   . LEU A 1 24  ? -2.429  13.291  -0.065  1.00 0.00 ? 24  LEU A CB   5  
ATOM 7640  C CG   . LEU A 1 24  ? -1.061  13.029  0.597   1.00 0.00 ? 24  LEU A CG   5  
ATOM 7641  C CD1  . LEU A 1 24  ? -0.635  11.565  0.438   1.00 0.00 ? 24  LEU A CD1  5  
ATOM 7642  C CD2  . LEU A 1 24  ? 0.000   13.962  -0.003  1.00 0.00 ? 24  LEU A CD2  5  
ATOM 7643  H H    . LEU A 1 24  ? -0.502  12.585  -1.616  1.00 0.00 ? 24  LEU A H    5  
ATOM 7644  H HA   . LEU A 1 24  ? -3.135  11.542  -1.103  1.00 0.00 ? 24  LEU A HA   5  
ATOM 7645  H HB2  . LEU A 1 24  ? -2.502  14.339  -0.315  1.00 0.00 ? 24  LEU A HB2  5  
ATOM 7646  H HB3  . LEU A 1 24  ? -3.214  13.043  0.636   1.00 0.00 ? 24  LEU A HB3  5  
ATOM 7647  H HG   . LEU A 1 24  ? -1.147  13.239  1.634   1.00 0.00 ? 24  LEU A HG   5  
ATOM 7648  H HD11 . LEU A 1 24  ? -1.470  10.984  0.077   1.00 0.00 ? 24  LEU A HD11 5  
ATOM 7649  H HD12 . LEU A 1 24  ? 0.180   11.501  -0.267  1.00 0.00 ? 24  LEU A HD12 5  
ATOM 7650  H HD13 . LEU A 1 24  ? -0.315  11.179  1.395   1.00 0.00 ? 24  LEU A HD13 5  
ATOM 7651  H HD21 . LEU A 1 24  ? -0.367  14.377  -0.930  1.00 0.00 ? 24  LEU A HD21 5  
ATOM 7652  H HD22 . LEU A 1 24  ? 0.208   14.763  0.690   1.00 0.00 ? 24  LEU A HD22 5  
ATOM 7653  H HD23 . LEU A 1 24  ? 0.906   13.404  -0.192  1.00 0.00 ? 24  LEU A HD23 5  
ATOM 7654  N N    . ASP A 1 25  ? -2.880  13.702  -3.413  1.00 0.00 ? 25  ASP A N    5  
ATOM 7655  C CA   . ASP A 1 25  ? -3.648  14.513  -4.399  1.00 0.00 ? 25  ASP A CA   5  
ATOM 7656  C C    . ASP A 1 25  ? -4.524  13.592  -5.247  1.00 0.00 ? 25  ASP A C    5  
ATOM 7657  O O    . ASP A 1 25  ? -5.555  13.992  -5.751  1.00 0.00 ? 25  ASP A O    5  
ATOM 7658  C CB   . ASP A 1 25  ? -2.674  15.263  -5.312  1.00 0.00 ? 25  ASP A CB   5  
ATOM 7659  C CG   . ASP A 1 25  ? -2.089  16.467  -4.568  1.00 0.00 ? 25  ASP A CG   5  
ATOM 7660  O OD1  . ASP A 1 25  ? -2.765  16.985  -3.695  1.00 0.00 ? 25  ASP A OD1  5  
ATOM 7661  O OD2  . ASP A 1 25  ? -0.976  16.851  -4.889  1.00 0.00 ? 25  ASP A OD2  5  
ATOM 7662  H H    . ASP A 1 25  ? -1.935  13.498  -3.576  1.00 0.00 ? 25  ASP A H    5  
ATOM 7663  H HA   . ASP A 1 25  ? -4.271  15.223  -3.874  1.00 0.00 ? 25  ASP A HA   5  
ATOM 7664  H HB2  . ASP A 1 25  ? -1.874  14.600  -5.605  1.00 0.00 ? 25  ASP A HB2  5  
ATOM 7665  H HB3  . ASP A 1 25  ? -3.199  15.607  -6.190  1.00 0.00 ? 25  ASP A HB3  5  
ATOM 7666  N N    . GLY A 1 26  ? -4.124  12.362  -5.412  1.00 0.00 ? 26  GLY A N    5  
ATOM 7667  C CA   . GLY A 1 26  ? -4.935  11.419  -6.231  1.00 0.00 ? 26  GLY A CA   5  
ATOM 7668  C C    . GLY A 1 26  ? -4.228  11.164  -7.564  1.00 0.00 ? 26  GLY A C    5  
ATOM 7669  O O    . GLY A 1 26  ? -4.677  10.382  -8.377  1.00 0.00 ? 26  GLY A O    5  
ATOM 7670  H H    . GLY A 1 26  ? -3.288  12.060  -4.999  1.00 0.00 ? 26  GLY A H    5  
ATOM 7671  H HA2  . GLY A 1 26  ? -5.048  10.486  -5.698  1.00 0.00 ? 26  GLY A HA2  5  
ATOM 7672  H HA3  . GLY A 1 26  ? -5.906  11.848  -6.420  1.00 0.00 ? 26  GLY A HA3  5  
ATOM 7673  N N    . ASN A 1 27  ? -3.122  11.820  -7.795  1.00 0.00 ? 27  ASN A N    5  
ATOM 7674  C CA   . ASN A 1 27  ? -2.385  11.615  -9.073  1.00 0.00 ? 27  ASN A CA   5  
ATOM 7675  C C    . ASN A 1 27  ? -1.316  10.538  -8.869  1.00 0.00 ? 27  ASN A C    5  
ATOM 7676  O O    . ASN A 1 27  ? -1.433  9.696   -8.001  1.00 0.00 ? 27  ASN A O    5  
ATOM 7677  C CB   . ASN A 1 27  ? -1.732  12.933  -9.495  1.00 0.00 ? 27  ASN A CB   5  
ATOM 7678  C CG   . ASN A 1 27  ? -2.818  13.978  -9.759  1.00 0.00 ? 27  ASN A CG   5  
ATOM 7679  O OD1  . ASN A 1 27  ? -3.484  13.933  -10.774 1.00 0.00 ? 27  ASN A OD1  5  
ATOM 7680  N ND2  . ASN A 1 27  ? -3.028  14.922  -8.882  1.00 0.00 ? 27  ASN A ND2  5  
ATOM 7681  H H    . ASN A 1 27  ? -2.774  12.446  -7.126  1.00 0.00 ? 27  ASN A H    5  
ATOM 7682  H HA   . ASN A 1 27  ? -3.077  11.294  -9.838  1.00 0.00 ? 27  ASN A HA   5  
ATOM 7683  H HB2  . ASN A 1 27  ? -1.079  13.281  -8.707  1.00 0.00 ? 27  ASN A HB2  5  
ATOM 7684  H HB3  . ASN A 1 27  ? -1.159  12.781  -10.396 1.00 0.00 ? 27  ASN A HB3  5  
ATOM 7685  H HD21 . ASN A 1 27  ? -2.493  14.957  -8.062  1.00 0.00 ? 27  ASN A HD21 5  
ATOM 7686  H HD22 . ASN A 1 27  ? -3.721  15.596  -9.045  1.00 0.00 ? 27  ASN A HD22 5  
ATOM 7687  N N    . THR A 1 28  ? -0.278  10.545  -9.660  1.00 0.00 ? 28  THR A N    5  
ATOM 7688  C CA   . THR A 1 28  ? 0.780   9.508   -9.498  1.00 0.00 ? 28  THR A CA   5  
ATOM 7689  C C    . THR A 1 28  ? 2.084   10.155  -9.024  1.00 0.00 ? 28  THR A C    5  
ATOM 7690  O O    . THR A 1 28  ? 2.558   11.119  -9.594  1.00 0.00 ? 28  THR A O    5  
ATOM 7691  C CB   . THR A 1 28  ? 1.016   8.809   -10.840 1.00 0.00 ? 28  THR A CB   5  
ATOM 7692  O OG1  . THR A 1 28  ? -0.070  9.087   -11.712 1.00 0.00 ? 28  THR A OG1  5  
ATOM 7693  C CG2  . THR A 1 28  ? 1.122   7.299   -10.618 1.00 0.00 ? 28  THR A CG2  5  
ATOM 7694  H H    . THR A 1 28  ? -0.194  11.225  -10.361 1.00 0.00 ? 28  THR A H    5  
ATOM 7695  H HA   . THR A 1 28  ? 0.458   8.780   -8.770  1.00 0.00 ? 28  THR A HA   5  
ATOM 7696  H HB   . THR A 1 28  ? 1.934   9.170   -11.279 1.00 0.00 ? 28  THR A HB   5  
ATOM 7697  H HG1  . THR A 1 28  ? -0.721  8.389   -11.605 1.00 0.00 ? 28  THR A HG1  5  
ATOM 7698  H HG21 . THR A 1 28  ? 1.007   7.080   -9.567  1.00 0.00 ? 28  THR A HG21 5  
ATOM 7699  H HG22 . THR A 1 28  ? 0.345   6.799   -11.178 1.00 0.00 ? 28  THR A HG22 5  
ATOM 7700  H HG23 . THR A 1 28  ? 2.088   6.952   -10.954 1.00 0.00 ? 28  THR A HG23 5  
ATOM 7701  N N    . TRP A 1 29  ? 2.674   9.621   -7.987  1.00 0.00 ? 29  TRP A N    5  
ATOM 7702  C CA   . TRP A 1 29  ? 3.953   10.191  -7.477  1.00 0.00 ? 29  TRP A CA   5  
ATOM 7703  C C    . TRP A 1 29  ? 5.112   9.322   -7.965  1.00 0.00 ? 29  TRP A C    5  
ATOM 7704  O O    . TRP A 1 29  ? 6.193   9.804   -8.239  1.00 0.00 ? 29  TRP A O    5  
ATOM 7705  C CB   . TRP A 1 29  ? 3.935   10.200  -5.947  1.00 0.00 ? 29  TRP A CB   5  
ATOM 7706  C CG   . TRP A 1 29  ? 3.434   11.521  -5.459  1.00 0.00 ? 29  TRP A CG   5  
ATOM 7707  C CD1  . TRP A 1 29  ? 2.406   12.211  -6.003  1.00 0.00 ? 29  TRP A CD1  5  
ATOM 7708  C CD2  . TRP A 1 29  ? 3.918   12.320  -4.341  1.00 0.00 ? 29  TRP A CD2  5  
ATOM 7709  N NE1  . TRP A 1 29  ? 2.227   13.383  -5.289  1.00 0.00 ? 29  TRP A NE1  5  
ATOM 7710  C CE2  . TRP A 1 29  ? 3.135   13.495  -4.255  1.00 0.00 ? 29  TRP A CE2  5  
ATOM 7711  C CE3  . TRP A 1 29  ? 4.950   12.140  -3.403  1.00 0.00 ? 29  TRP A CE3  5  
ATOM 7712  C CZ2  . TRP A 1 29  ? 3.367   14.459  -3.273  1.00 0.00 ? 29  TRP A CZ2  5  
ATOM 7713  C CZ3  . TRP A 1 29  ? 5.187   13.109  -2.413  1.00 0.00 ? 29  TRP A CZ3  5  
ATOM 7714  C CH2  . TRP A 1 29  ? 4.397   14.265  -2.348  1.00 0.00 ? 29  TRP A CH2  5  
ATOM 7715  H H    . TRP A 1 29  ? 2.278   8.839   -7.550  1.00 0.00 ? 29  TRP A H    5  
ATOM 7716  H HA   . TRP A 1 29  ? 4.074   11.198  -7.844  1.00 0.00 ? 29  TRP A HA   5  
ATOM 7717  H HB2  . TRP A 1 29  ? 3.284   9.416   -5.589  1.00 0.00 ? 29  TRP A HB2  5  
ATOM 7718  H HB3  . TRP A 1 29  ? 4.934   10.035  -5.573  1.00 0.00 ? 29  TRP A HB3  5  
ATOM 7719  H HD1  . TRP A 1 29  ? 1.822   11.898  -6.856  1.00 0.00 ? 29  TRP A HD1  5  
ATOM 7720  H HE1  . TRP A 1 29  ? 1.547   14.062  -5.477  1.00 0.00 ? 29  TRP A HE1  5  
ATOM 7721  H HE3  . TRP A 1 29  ? 5.565   11.253  -3.443  1.00 0.00 ? 29  TRP A HE3  5  
ATOM 7722  H HZ2  . TRP A 1 29  ? 2.755   15.347  -3.228  1.00 0.00 ? 29  TRP A HZ2  5  
ATOM 7723  H HZ3  . TRP A 1 29  ? 5.981   12.960  -1.696  1.00 0.00 ? 29  TRP A HZ3  5  
ATOM 7724  H HH2  . TRP A 1 29  ? 4.584   15.006  -1.585  1.00 0.00 ? 29  TRP A HH2  5  
ATOM 7725  N N    . ALA A 1 30  ? 4.891   8.041   -8.074  1.00 0.00 ? 30  ALA A N    5  
ATOM 7726  C CA   . ALA A 1 30  ? 5.971   7.128   -8.543  1.00 0.00 ? 30  ALA A CA   5  
ATOM 7727  C C    . ALA A 1 30  ? 5.521   5.679   -8.346  1.00 0.00 ? 30  ALA A C    5  
ATOM 7728  O O    . ALA A 1 30  ? 5.697   5.104   -7.289  1.00 0.00 ? 30  ALA A O    5  
ATOM 7729  C CB   . ALA A 1 30  ? 7.243   7.381   -7.732  1.00 0.00 ? 30  ALA A CB   5  
ATOM 7730  H H    . ALA A 1 30  ? 4.008   7.676   -7.843  1.00 0.00 ? 30  ALA A H    5  
ATOM 7731  H HA   . ALA A 1 30  ? 6.166   7.306   -9.589  1.00 0.00 ? 30  ALA A HA   5  
ATOM 7732  H HB1  . ALA A 1 30  ? 7.036   8.096   -6.952  1.00 0.00 ? 30  ALA A HB1  5  
ATOM 7733  H HB2  . ALA A 1 30  ? 7.580   6.454   -7.291  1.00 0.00 ? 30  ALA A HB2  5  
ATOM 7734  H HB3  . ALA A 1 30  ? 8.013   7.769   -8.382  1.00 0.00 ? 30  ALA A HB3  5  
ATOM 7735  N N    . THR A 1 31  ? 4.934   5.084   -9.349  1.00 0.00 ? 31  THR A N    5  
ATOM 7736  C CA   . THR A 1 31  ? 4.470   3.677   -9.203  1.00 0.00 ? 31  THR A CA   5  
ATOM 7737  C C    . THR A 1 31  ? 5.348   2.744   -10.040 1.00 0.00 ? 31  THR A C    5  
ATOM 7738  O O    . THR A 1 31  ? 6.183   3.180   -10.807 1.00 0.00 ? 31  THR A O    5  
ATOM 7739  C CB   . THR A 1 31  ? 3.017   3.568   -9.674  1.00 0.00 ? 31  THR A CB   5  
ATOM 7740  O OG1  . THR A 1 31  ? 2.525   2.267   -9.389  1.00 0.00 ? 31  THR A OG1  5  
ATOM 7741  C CG2  . THR A 1 31  ? 2.945   3.824   -11.181 1.00 0.00 ? 31  THR A CG2  5  
ATOM 7742  H H    . THR A 1 31  ? 4.795   5.563   -10.192 1.00 0.00 ? 31  THR A H    5  
ATOM 7743  H HA   . THR A 1 31  ? 4.531   3.388   -8.165  1.00 0.00 ? 31  THR A HA   5  
ATOM 7744  H HB   . THR A 1 31  ? 2.417   4.301   -9.161  1.00 0.00 ? 31  THR A HB   5  
ATOM 7745  H HG1  . THR A 1 31  ? 1.715   2.140   -9.889  1.00 0.00 ? 31  THR A HG1  5  
ATOM 7746  H HG21 . THR A 1 31  ? 3.694   3.229   -11.683 1.00 0.00 ? 31  THR A HG21 5  
ATOM 7747  H HG22 . THR A 1 31  ? 1.966   3.553   -11.546 1.00 0.00 ? 31  THR A HG22 5  
ATOM 7748  H HG23 . THR A 1 31  ? 3.126   4.870   -11.377 1.00 0.00 ? 31  THR A HG23 5  
ATOM 7749  N N    . SER A 1 32  ? 5.164   1.459   -9.890  1.00 0.00 ? 32  SER A N    5  
ATOM 7750  C CA   . SER A 1 32  ? 5.984   0.486   -10.667 1.00 0.00 ? 32  SER A CA   5  
ATOM 7751  C C    . SER A 1 32  ? 5.230   -0.839  -10.776 1.00 0.00 ? 32  SER A C    5  
ATOM 7752  O O    . SER A 1 32  ? 5.409   -1.733  -9.974  1.00 0.00 ? 32  SER A O    5  
ATOM 7753  C CB   . SER A 1 32  ? 7.311   0.255   -9.948  1.00 0.00 ? 32  SER A CB   5  
ATOM 7754  O OG   . SER A 1 32  ? 7.920   1.509   -9.681  1.00 0.00 ? 32  SER A OG   5  
ATOM 7755  H H    . SER A 1 32  ? 4.486   1.133   -9.263  1.00 0.00 ? 32  SER A H    5  
ATOM 7756  H HA   . SER A 1 32  ? 6.171   0.879   -11.655 1.00 0.00 ? 32  SER A HA   5  
ATOM 7757  H HB2  . SER A 1 32  ? 7.135   -0.259  -9.018  1.00 0.00 ? 32  SER A HB2  5  
ATOM 7758  H HB3  . SER A 1 32  ? 7.958   -0.347  -10.573 1.00 0.00 ? 32  SER A HB3  5  
ATOM 7759  H HG   . SER A 1 32  ? 7.467   1.906   -8.935  1.00 0.00 ? 32  SER A HG   5  
ATOM 7760  N N    . ALA A 1 33  ? 4.388   -0.973  -11.762 1.00 0.00 ? 33  ALA A N    5  
ATOM 7761  C CA   . ALA A 1 33  ? 3.622   -2.240  -11.920 1.00 0.00 ? 33  ALA A CA   5  
ATOM 7762  C C    . ALA A 1 33  ? 2.919   -2.240  -13.279 1.00 0.00 ? 33  ALA A C    5  
ATOM 7763  O O    . ALA A 1 33  ? 3.089   -3.138  -14.079 1.00 0.00 ? 33  ALA A O    5  
ATOM 7764  C CB   . ALA A 1 33  ? 2.582   -2.349  -10.803 1.00 0.00 ? 33  ALA A CB   5  
ATOM 7765  H H    . ALA A 1 33  ? 4.257   -0.240  -12.398 1.00 0.00 ? 33  ALA A H    5  
ATOM 7766  H HA   . ALA A 1 33  ? 4.299   -3.080  -11.866 1.00 0.00 ? 33  ALA A HA   5  
ATOM 7767  H HB1  . ALA A 1 33  ? 2.802   -1.624  -10.034 1.00 0.00 ? 33  ALA A HB1  5  
ATOM 7768  H HB2  . ALA A 1 33  ? 1.598   -2.159  -11.205 1.00 0.00 ? 33  ALA A HB2  5  
ATOM 7769  H HB3  . ALA A 1 33  ? 2.611   -3.342  -10.379 1.00 0.00 ? 33  ALA A HB3  5  
ATOM 7770  N N    . GLY A 1 34  ? 2.130   -1.235  -13.547 1.00 0.00 ? 34  GLY A N    5  
ATOM 7771  C CA   . GLY A 1 34  ? 1.417   -1.176  -14.854 1.00 0.00 ? 34  GLY A CA   5  
ATOM 7772  C C    . GLY A 1 34  ? -0.080  -0.980  -14.609 1.00 0.00 ? 34  GLY A C    5  
ATOM 7773  O O    . GLY A 1 34  ? -0.727  -0.186  -15.264 1.00 0.00 ? 34  GLY A O    5  
ATOM 7774  H H    . GLY A 1 34  ? 2.006   -0.520  -12.889 1.00 0.00 ? 34  GLY A H    5  
ATOM 7775  H HA2  . GLY A 1 34  ? 1.800   -0.350  -15.437 1.00 0.00 ? 34  GLY A HA2  5  
ATOM 7776  H HA3  . GLY A 1 34  ? 1.571   -2.099  -15.392 1.00 0.00 ? 34  GLY A HA3  5  
ATOM 7777  N N    . PHE A 1 35  ? -0.635  -1.698  -13.671 1.00 0.00 ? 35  PHE A N    5  
ATOM 7778  C CA   . PHE A 1 35  ? -2.089  -1.553  -13.386 1.00 0.00 ? 35  PHE A CA   5  
ATOM 7779  C C    . PHE A 1 35  ? -2.442  -0.071  -13.264 1.00 0.00 ? 35  PHE A C    5  
ATOM 7780  O O    . PHE A 1 35  ? -1.582  0.769   -13.081 1.00 0.00 ? 35  PHE A O    5  
ATOM 7781  C CB   . PHE A 1 35  ? -2.426  -2.270  -12.075 1.00 0.00 ? 35  PHE A CB   5  
ATOM 7782  C CG   . PHE A 1 35  ? -1.634  -1.659  -10.941 1.00 0.00 ? 35  PHE A CG   5  
ATOM 7783  C CD1  . PHE A 1 35  ? -1.956  -0.378  -10.473 1.00 0.00 ? 35  PHE A CD1  5  
ATOM 7784  C CD2  . PHE A 1 35  ? -0.581  -2.373  -10.355 1.00 0.00 ? 35  PHE A CD2  5  
ATOM 7785  C CE1  . PHE A 1 35  ? -1.227  0.185   -9.418  1.00 0.00 ? 35  PHE A CE1  5  
ATOM 7786  C CE2  . PHE A 1 35  ? 0.147   -1.808  -9.301  1.00 0.00 ? 35  PHE A CE2  5  
ATOM 7787  C CZ   . PHE A 1 35  ? -0.176  -0.529  -8.832  1.00 0.00 ? 35  PHE A CZ   5  
ATOM 7788  H H    . PHE A 1 35  ? -0.095  -2.332  -13.156 1.00 0.00 ? 35  PHE A H    5  
ATOM 7789  H HA   . PHE A 1 35  ? -2.659  -1.993  -14.192 1.00 0.00 ? 35  PHE A HA   5  
ATOM 7790  H HB2  . PHE A 1 35  ? -3.481  -2.168  -11.872 1.00 0.00 ? 35  PHE A HB2  5  
ATOM 7791  H HB3  . PHE A 1 35  ? -2.176  -3.316  -12.164 1.00 0.00 ? 35  PHE A HB3  5  
ATOM 7792  H HD1  . PHE A 1 35  ? -2.767  0.173   -10.923 1.00 0.00 ? 35  PHE A HD1  5  
ATOM 7793  H HD2  . PHE A 1 35  ? -0.331  -3.360  -10.717 1.00 0.00 ? 35  PHE A HD2  5  
ATOM 7794  H HE1  . PHE A 1 35  ? -1.476  1.172   -9.056  1.00 0.00 ? 35  PHE A HE1  5  
ATOM 7795  H HE2  . PHE A 1 35  ? 0.959   -2.359  -8.849  1.00 0.00 ? 35  PHE A HE2  5  
ATOM 7796  H HZ   . PHE A 1 35  ? 0.385   -0.093  -8.016  1.00 0.00 ? 35  PHE A HZ   5  
ATOM 7797  N N    . ALA A 1 36  ? -3.700  0.260   -13.364 1.00 0.00 ? 36  ALA A N    5  
ATOM 7798  C CA   . ALA A 1 36  ? -4.103  1.689   -13.254 1.00 0.00 ? 36  ALA A CA   5  
ATOM 7799  C C    . ALA A 1 36  ? -5.096  1.852   -12.101 1.00 0.00 ? 36  ALA A C    5  
ATOM 7800  O O    . ALA A 1 36  ? -6.143  1.237   -12.078 1.00 0.00 ? 36  ALA A O    5  
ATOM 7801  C CB   . ALA A 1 36  ? -4.760  2.134   -14.562 1.00 0.00 ? 36  ALA A CB   5  
ATOM 7802  H H    . ALA A 1 36  ? -4.378  -0.432  -13.512 1.00 0.00 ? 36  ALA A H    5  
ATOM 7803  H HA   . ALA A 1 36  ? -3.230  2.296   -13.065 1.00 0.00 ? 36  ALA A HA   5  
ATOM 7804  H HB1  . ALA A 1 36  ? -4.489  1.448   -15.351 1.00 0.00 ? 36  ALA A HB1  5  
ATOM 7805  H HB2  . ALA A 1 36  ? -5.834  2.140   -14.442 1.00 0.00 ? 36  ALA A HB2  5  
ATOM 7806  H HB3  . ALA A 1 36  ? -4.421  3.128   -14.815 1.00 0.00 ? 36  ALA A HB3  5  
ATOM 7807  N N    . VAL A 1 37  ? -4.774  2.678   -11.143 1.00 0.00 ? 37  VAL A N    5  
ATOM 7808  C CA   . VAL A 1 37  ? -5.696  2.883   -9.990  1.00 0.00 ? 37  VAL A CA   5  
ATOM 7809  C C    . VAL A 1 37  ? -6.661  4.029   -10.307 1.00 0.00 ? 37  VAL A C    5  
ATOM 7810  O O    . VAL A 1 37  ? -6.250  5.134   -10.597 1.00 0.00 ? 37  VAL A O    5  
ATOM 7811  C CB   . VAL A 1 37  ? -4.880  3.233   -8.743  1.00 0.00 ? 37  VAL A CB   5  
ATOM 7812  C CG1  . VAL A 1 37  ? -5.825  3.462   -7.562  1.00 0.00 ? 37  VAL A CG1  5  
ATOM 7813  C CG2  . VAL A 1 37  ? -3.924  2.083   -8.417  1.00 0.00 ? 37  VAL A CG2  5  
ATOM 7814  H H    . VAL A 1 37  ? -3.924  3.164   -11.181 1.00 0.00 ? 37  VAL A H    5  
ATOM 7815  H HA   . VAL A 1 37  ? -6.256  1.978   -9.811  1.00 0.00 ? 37  VAL A HA   5  
ATOM 7816  H HB   . VAL A 1 37  ? -4.313  4.134   -8.929  1.00 0.00 ? 37  VAL A HB   5  
ATOM 7817  H HG11 . VAL A 1 37  ? -6.587  2.697   -7.555  1.00 0.00 ? 37  VAL A HG11 5  
ATOM 7818  H HG12 . VAL A 1 37  ? -5.264  3.420   -6.639  1.00 0.00 ? 37  VAL A HG12 5  
ATOM 7819  H HG13 . VAL A 1 37  ? -6.290  4.432   -7.656  1.00 0.00 ? 37  VAL A HG13 5  
ATOM 7820  H HG21 . VAL A 1 37  ? -4.252  1.188   -8.922  1.00 0.00 ? 37  VAL A HG21 5  
ATOM 7821  H HG22 . VAL A 1 37  ? -2.928  2.339   -8.748  1.00 0.00 ? 37  VAL A HG22 5  
ATOM 7822  H HG23 . VAL A 1 37  ? -3.916  1.914   -7.350  1.00 0.00 ? 37  VAL A HG23 5  
ATOM 7823  N N    . THR A 1 38  ? -7.942  3.777   -10.252 1.00 0.00 ? 38  THR A N    5  
ATOM 7824  C CA   . THR A 1 38  ? -8.923  4.857   -10.551 1.00 0.00 ? 38  THR A CA   5  
ATOM 7825  C C    . THR A 1 38  ? -8.786  5.973   -9.502  1.00 0.00 ? 38  THR A C    5  
ATOM 7826  O O    . THR A 1 38  ? -8.831  5.706   -8.317  1.00 0.00 ? 38  THR A O    5  
ATOM 7827  C CB   . THR A 1 38  ? -10.343 4.284   -10.508 1.00 0.00 ? 38  THR A CB   5  
ATOM 7828  O OG1  . THR A 1 38  ? -11.279 5.351   -10.449 1.00 0.00 ? 38  THR A OG1  5  
ATOM 7829  C CG2  . THR A 1 38  ? -10.502 3.395   -9.275  1.00 0.00 ? 38  THR A CG2  5  
ATOM 7830  H H    . THR A 1 38  ? -8.256  2.879   -10.016 1.00 0.00 ? 38  THR A H    5  
ATOM 7831  H HA   . THR A 1 38  ? -8.726  5.251   -11.535 1.00 0.00 ? 38  THR A HA   5  
ATOM 7832  H HB   . THR A 1 38  ? -10.522 3.698   -11.395 1.00 0.00 ? 38  THR A HB   5  
ATOM 7833  H HG1  . THR A 1 38  ? -10.901 6.103   -10.910 1.00 0.00 ? 38  THR A HG1  5  
ATOM 7834  H HG21 . THR A 1 38  ? -9.563  3.338   -8.747  1.00 0.00 ? 38  THR A HG21 5  
ATOM 7835  H HG22 . THR A 1 38  ? -11.256 3.815   -8.624  1.00 0.00 ? 38  THR A HG22 5  
ATOM 7836  H HG23 . THR A 1 38  ? -10.804 2.404   -9.583  1.00 0.00 ? 38  THR A HG23 5  
ATOM 7837  N N    . PRO A 1 39  ? -8.617  7.189   -9.965  1.00 0.00 ? 39  PRO A N    5  
ATOM 7838  C CA   . PRO A 1 39  ? -8.467  8.353   -9.071  1.00 0.00 ? 39  PRO A CA   5  
ATOM 7839  C C    . PRO A 1 39  ? -9.728  8.546   -8.225  1.00 0.00 ? 39  PRO A C    5  
ATOM 7840  O O    . PRO A 1 39  ? -10.745 7.926   -8.464  1.00 0.00 ? 39  PRO A O    5  
ATOM 7841  C CB   . PRO A 1 39  ? -8.264  9.548   -10.011 1.00 0.00 ? 39  PRO A CB   5  
ATOM 7842  C CG   . PRO A 1 39  ? -8.346  9.023   -11.467 1.00 0.00 ? 39  PRO A CG   5  
ATOM 7843  C CD   . PRO A 1 39  ? -8.565  7.503   -11.404 1.00 0.00 ? 39  PRO A CD   5  
ATOM 7844  H HA   . PRO A 1 39  ? -7.601  8.233   -8.439  1.00 0.00 ? 39  PRO A HA   5  
ATOM 7845  H HB2  . PRO A 1 39  ? -9.038  10.284  -9.839  1.00 0.00 ? 39  PRO A HB2  5  
ATOM 7846  H HB3  . PRO A 1 39  ? -7.294  9.989   -9.840  1.00 0.00 ? 39  PRO A HB3  5  
ATOM 7847  H HG2  . PRO A 1 39  ? -9.173  9.493   -11.979 1.00 0.00 ? 39  PRO A HG2  5  
ATOM 7848  H HG3  . PRO A 1 39  ? -7.424  9.235   -11.987 1.00 0.00 ? 39  PRO A HG3  5  
ATOM 7849  H HD2  . PRO A 1 39  ? -9.496  7.238   -11.885 1.00 0.00 ? 39  PRO A HD2  5  
ATOM 7850  H HD3  . PRO A 1 39  ? -7.739  6.985   -11.866 1.00 0.00 ? 39  PRO A HD3  5  
ATOM 7851  N N    . ALA A 1 40  ? -9.661  9.405   -7.239  1.00 0.00 ? 40  ALA A N    5  
ATOM 7852  C CA   . ALA A 1 40  ? -10.847 9.660   -6.365  1.00 0.00 ? 40  ALA A CA   5  
ATOM 7853  C C    . ALA A 1 40  ? -10.939 8.594   -5.267  1.00 0.00 ? 40  ALA A C    5  
ATOM 7854  O O    . ALA A 1 40  ? -11.518 8.820   -4.224  1.00 0.00 ? 40  ALA A O    5  
ATOM 7855  C CB   . ALA A 1 40  ? -12.126 9.635   -7.208  1.00 0.00 ? 40  ALA A CB   5  
ATOM 7856  H H    . ALA A 1 40  ? -8.826  9.890   -7.074  1.00 0.00 ? 40  ALA A H    5  
ATOM 7857  H HA   . ALA A 1 40  ? -10.746 10.632  -5.906  1.00 0.00 ? 40  ALA A HA   5  
ATOM 7858  H HB1  . ALA A 1 40  ? -11.930 10.080  -8.171  1.00 0.00 ? 40  ALA A HB1  5  
ATOM 7859  H HB2  . ALA A 1 40  ? -12.447 8.612   -7.341  1.00 0.00 ? 40  ALA A HB2  5  
ATOM 7860  H HB3  . ALA A 1 40  ? -12.900 10.194  -6.703  1.00 0.00 ? 40  ALA A HB3  5  
ATOM 7861  N N    . GLN A 1 41  ? -10.380 7.435   -5.488  1.00 0.00 ? 41  GLN A N    5  
ATOM 7862  C CA   . GLN A 1 41  ? -10.447 6.369   -4.450  1.00 0.00 ? 41  GLN A CA   5  
ATOM 7863  C C    . GLN A 1 41  ? -9.365  6.612   -3.396  1.00 0.00 ? 41  GLN A C    5  
ATOM 7864  O O    . GLN A 1 41  ? -9.348  5.982   -2.357  1.00 0.00 ? 41  GLN A O    5  
ATOM 7865  C CB   . GLN A 1 41  ? -10.222 5.006   -5.108  1.00 0.00 ? 41  GLN A CB   5  
ATOM 7866  C CG   . GLN A 1 41  ? -11.493 4.165   -4.983  1.00 0.00 ? 41  GLN A CG   5  
ATOM 7867  C CD   . GLN A 1 41  ? -12.663 4.904   -5.634  1.00 0.00 ? 41  GLN A CD   5  
ATOM 7868  O OE1  . GLN A 1 41  ? -12.468 5.724   -6.510  1.00 0.00 ? 41  GLN A OE1  5  
ATOM 7869  N NE2  . GLN A 1 41  ? -13.880 4.649   -5.239  1.00 0.00 ? 41  GLN A NE2  5  
ATOM 7870  H H    . GLN A 1 41  ? -9.918  7.264   -6.332  1.00 0.00 ? 41  GLN A H    5  
ATOM 7871  H HA   . GLN A 1 41  ? -11.419 6.386   -3.980  1.00 0.00 ? 41  GLN A HA   5  
ATOM 7872  H HB2  . GLN A 1 41  ? -9.982  5.145   -6.152  1.00 0.00 ? 41  GLN A HB2  5  
ATOM 7873  H HB3  . GLN A 1 41  ? -9.406  4.498   -4.615  1.00 0.00 ? 41  GLN A HB3  5  
ATOM 7874  H HG2  . GLN A 1 41  ? -11.345 3.216   -5.479  1.00 0.00 ? 41  GLN A HG2  5  
ATOM 7875  H HG3  . GLN A 1 41  ? -11.712 3.995   -3.940  1.00 0.00 ? 41  GLN A HG3  5  
ATOM 7876  H HE21 . GLN A 1 41  ? -14.038 3.991   -4.532  1.00 0.00 ? 41  GLN A HE21 5  
ATOM 7877  H HE22 . GLN A 1 41  ? -14.637 5.117   -5.652  1.00 0.00 ? 41  GLN A HE22 5  
ATOM 7878  N N    . GLY A 1 42  ? -8.462  7.517   -3.653  1.00 0.00 ? 42  GLY A N    5  
ATOM 7879  C CA   . GLY A 1 42  ? -7.384  7.795   -2.663  1.00 0.00 ? 42  GLY A CA   5  
ATOM 7880  C C    . GLY A 1 42  ? -8.009  8.181   -1.321  1.00 0.00 ? 42  GLY A C    5  
ATOM 7881  O O    . GLY A 1 42  ? -7.487  7.869   -0.269  1.00 0.00 ? 42  GLY A O    5  
ATOM 7882  H H    . GLY A 1 42  ? -8.492  8.013   -4.498  1.00 0.00 ? 42  GLY A H    5  
ATOM 7883  H HA2  . GLY A 1 42  ? -6.776  6.910   -2.537  1.00 0.00 ? 42  GLY A HA2  5  
ATOM 7884  H HA3  . GLY A 1 42  ? -6.770  8.608   -3.017  1.00 0.00 ? 42  GLY A HA3  5  
ATOM 7885  N N    . GLN A 1 43  ? -9.123  8.860   -1.348  1.00 0.00 ? 43  GLN A N    5  
ATOM 7886  C CA   . GLN A 1 43  ? -9.780  9.270   -0.075  1.00 0.00 ? 43  GLN A CA   5  
ATOM 7887  C C    . GLN A 1 43  ? -10.359 8.039   0.625   1.00 0.00 ? 43  GLN A C    5  
ATOM 7888  O O    . GLN A 1 43  ? -10.300 7.915   1.833   1.00 0.00 ? 43  GLN A O    5  
ATOM 7889  C CB   . GLN A 1 43  ? -10.903 10.261  -0.379  1.00 0.00 ? 43  GLN A CB   5  
ATOM 7890  C CG   . GLN A 1 43  ? -10.311 11.657  -0.578  1.00 0.00 ? 43  GLN A CG   5  
ATOM 7891  C CD   . GLN A 1 43  ? -10.654 12.535  0.626   1.00 0.00 ? 43  GLN A CD   5  
ATOM 7892  O OE1  . GLN A 1 43  ? -10.999 12.035  1.679   1.00 0.00 ? 43  GLN A OE1  5  
ATOM 7893  N NE2  . GLN A 1 43  ? -10.574 13.832  0.515   1.00 0.00 ? 43  GLN A NE2  5  
ATOM 7894  H H    . GLN A 1 43  ? -9.527  9.103   -2.208  1.00 0.00 ? 43  GLN A H    5  
ATOM 7895  H HA   . GLN A 1 43  ? -9.051  9.739   0.569   1.00 0.00 ? 43  GLN A HA   5  
ATOM 7896  H HB2  . GLN A 1 43  ? -11.419 9.956   -1.277  1.00 0.00 ? 43  GLN A HB2  5  
ATOM 7897  H HB3  . GLN A 1 43  ? -11.599 10.283  0.447   1.00 0.00 ? 43  GLN A HB3  5  
ATOM 7898  H HG2  . GLN A 1 43  ? -9.237  11.580  -0.675  1.00 0.00 ? 43  GLN A HG2  5  
ATOM 7899  H HG3  . GLN A 1 43  ? -10.723 12.100  -1.472  1.00 0.00 ? 43  GLN A HG3  5  
ATOM 7900  H HE21 . GLN A 1 43  ? -10.296 14.235  -0.334  1.00 0.00 ? 43  GLN A HE21 5  
ATOM 7901  H HE22 . GLN A 1 43  ? -10.791 14.404  1.281   1.00 0.00 ? 43  GLN A HE22 5  
ATOM 7902  N N    . THR A 1 44  ? -10.923 7.130   -0.121  1.00 0.00 ? 44  THR A N    5  
ATOM 7903  C CA   . THR A 1 44  ? -11.508 5.910   0.503   1.00 0.00 ? 44  THR A CA   5  
ATOM 7904  C C    . THR A 1 44  ? -10.475 5.263   1.429   1.00 0.00 ? 44  THR A C    5  
ATOM 7905  O O    . THR A 1 44  ? -10.812 4.702   2.453   1.00 0.00 ? 44  THR A O    5  
ATOM 7906  C CB   . THR A 1 44  ? -11.904 4.917   -0.594  1.00 0.00 ? 44  THR A CB   5  
ATOM 7907  O OG1  . THR A 1 44  ? -13.019 5.427   -1.311  1.00 0.00 ? 44  THR A OG1  5  
ATOM 7908  C CG2  . THR A 1 44  ? -12.271 3.576   0.039   1.00 0.00 ? 44  THR A CG2  5  
ATOM 7909  H H    . THR A 1 44  ? -10.962 7.249   -1.093  1.00 0.00 ? 44  THR A H    5  
ATOM 7910  H HA   . THR A 1 44  ? -12.383 6.181   1.074   1.00 0.00 ? 44  THR A HA   5  
ATOM 7911  H HB   . THR A 1 44  ? -11.074 4.776   -1.270  1.00 0.00 ? 44  THR A HB   5  
ATOM 7912  H HG1  . THR A 1 44  ? -12.691 5.840   -2.113  1.00 0.00 ? 44  THR A HG1  5  
ATOM 7913  H HG21 . THR A 1 44  ? -11.486 3.269   0.715   1.00 0.00 ? 44  THR A HG21 5  
ATOM 7914  H HG22 . THR A 1 44  ? -13.197 3.678   0.586   1.00 0.00 ? 44  THR A HG22 5  
ATOM 7915  H HG23 . THR A 1 44  ? -12.391 2.832   -0.735  1.00 0.00 ? 44  THR A HG23 5  
ATOM 7916  N N    . LEU A 1 45  ? -9.221  5.338   1.078   1.00 0.00 ? 45  LEU A N    5  
ATOM 7917  C CA   . LEU A 1 45  ? -8.169  4.729   1.941   1.00 0.00 ? 45  LEU A CA   5  
ATOM 7918  C C    . LEU A 1 45  ? -8.082  5.500   3.260   1.00 0.00 ? 45  LEU A C    5  
ATOM 7919  O O    . LEU A 1 45  ? -8.074  4.922   4.329   1.00 0.00 ? 45  LEU A O    5  
ATOM 7920  C CB   . LEU A 1 45  ? -6.819  4.797   1.221   1.00 0.00 ? 45  LEU A CB   5  
ATOM 7921  C CG   . LEU A 1 45  ? -5.805  3.912   1.948   1.00 0.00 ? 45  LEU A CG   5  
ATOM 7922  C CD1  . LEU A 1 45  ? -6.200  2.443   1.792   1.00 0.00 ? 45  LEU A CD1  5  
ATOM 7923  C CD2  . LEU A 1 45  ? -4.416  4.132   1.346   1.00 0.00 ? 45  LEU A CD2  5  
ATOM 7924  H H    . LEU A 1 45  ? -8.970  5.795   0.249   1.00 0.00 ? 45  LEU A H    5  
ATOM 7925  H HA   . LEU A 1 45  ? -8.418  3.698   2.141   1.00 0.00 ? 45  LEU A HA   5  
ATOM 7926  H HB2  . LEU A 1 45  ? -6.936  4.450   0.204   1.00 0.00 ? 45  LEU A HB2  5  
ATOM 7927  H HB3  . LEU A 1 45  ? -6.465  5.816   1.216   1.00 0.00 ? 45  LEU A HB3  5  
ATOM 7928  H HG   . LEU A 1 45  ? -5.791  4.170   2.997   1.00 0.00 ? 45  LEU A HG   5  
ATOM 7929  H HD11 . LEU A 1 45  ? -6.826  2.329   0.919   1.00 0.00 ? 45  LEU A HD11 5  
ATOM 7930  H HD12 . LEU A 1 45  ? -5.311  1.841   1.678   1.00 0.00 ? 45  LEU A HD12 5  
ATOM 7931  H HD13 . LEU A 1 45  ? -6.743  2.120   2.668   1.00 0.00 ? 45  LEU A HD13 5  
ATOM 7932  H HD21 . LEU A 1 45  ? -4.505  4.287   0.281   1.00 0.00 ? 45  LEU A HD21 5  
ATOM 7933  H HD22 . LEU A 1 45  ? -3.960  4.999   1.800   1.00 0.00 ? 45  LEU A HD22 5  
ATOM 7934  H HD23 . LEU A 1 45  ? -3.803  3.263   1.533   1.00 0.00 ? 45  LEU A HD23 5  
ATOM 7935  N N    . ALA A 1 46  ? -8.017  6.802   3.191   1.00 0.00 ? 46  ALA A N    5  
ATOM 7936  C CA   . ALA A 1 46  ? -7.930  7.610   4.441   1.00 0.00 ? 46  ALA A CA   5  
ATOM 7937  C C    . ALA A 1 46  ? -9.249  7.508   5.212   1.00 0.00 ? 46  ALA A C    5  
ATOM 7938  O O    . ALA A 1 46  ? -9.363  7.976   6.327   1.00 0.00 ? 46  ALA A O    5  
ATOM 7939  C CB   . ALA A 1 46  ? -7.660  9.073   4.083   1.00 0.00 ? 46  ALA A CB   5  
ATOM 7940  H H    . ALA A 1 46  ? -8.024  7.248   2.318   1.00 0.00 ? 46  ALA A H    5  
ATOM 7941  H HA   . ALA A 1 46  ? -7.125  7.236   5.055   1.00 0.00 ? 46  ALA A HA   5  
ATOM 7942  H HB1  . ALA A 1 46  ? -8.081  9.290   3.113   1.00 0.00 ? 46  ALA A HB1  5  
ATOM 7943  H HB2  . ALA A 1 46  ? -8.115  9.713   4.825   1.00 0.00 ? 46  ALA A HB2  5  
ATOM 7944  H HB3  . ALA A 1 46  ? -6.595  9.247   4.061   1.00 0.00 ? 46  ALA A HB3  5  
ATOM 7945  N N    . SER A 1 47  ? -10.248 6.902   4.630   1.00 0.00 ? 47  SER A N    5  
ATOM 7946  C CA   . SER A 1 47  ? -11.555 6.778   5.335   1.00 0.00 ? 47  SER A CA   5  
ATOM 7947  C C    . SER A 1 47  ? -11.597 5.463   6.119   1.00 0.00 ? 47  SER A C    5  
ATOM 7948  O O    . SER A 1 47  ? -12.255 5.357   7.135   1.00 0.00 ? 47  SER A O    5  
ATOM 7949  C CB   . SER A 1 47  ? -12.689 6.796   4.310   1.00 0.00 ? 47  SER A CB   5  
ATOM 7950  O OG   . SER A 1 47  ? -13.305 8.077   4.313   1.00 0.00 ? 47  SER A OG   5  
ATOM 7951  H H    . SER A 1 47  ? -10.139 6.533   3.728   1.00 0.00 ? 47  SER A H    5  
ATOM 7952  H HA   . SER A 1 47  ? -11.675 7.607   6.017   1.00 0.00 ? 47  SER A HA   5  
ATOM 7953  H HB2  . SER A 1 47  ? -12.292 6.596   3.329   1.00 0.00 ? 47  SER A HB2  5  
ATOM 7954  H HB3  . SER A 1 47  ? -13.415 6.035   4.565   1.00 0.00 ? 47  SER A HB3  5  
ATOM 7955  H HG   . SER A 1 47  ? -13.976 8.084   5.000   1.00 0.00 ? 47  SER A HG   5  
ATOM 7956  N N    . ALA A 1 48  ? -10.905 4.458   5.655   1.00 0.00 ? 48  ALA A N    5  
ATOM 7957  C CA   . ALA A 1 48  ? -10.913 3.153   6.374   1.00 0.00 ? 48  ALA A CA   5  
ATOM 7958  C C    . ALA A 1 48  ? -10.050 3.250   7.636   1.00 0.00 ? 48  ALA A C    5  
ATOM 7959  O O    . ALA A 1 48  ? -10.240 2.516   8.586   1.00 0.00 ? 48  ALA A O    5  
ATOM 7960  C CB   . ALA A 1 48  ? -10.353 2.064   5.457   1.00 0.00 ? 48  ALA A CB   5  
ATOM 7961  H H    . ALA A 1 48  ? -10.383 4.562   4.832   1.00 0.00 ? 48  ALA A H    5  
ATOM 7962  H HA   . ALA A 1 48  ? -11.927 2.903   6.651   1.00 0.00 ? 48  ALA A HA   5  
ATOM 7963  H HB1  . ALA A 1 48  ? -10.920 2.042   4.537   1.00 0.00 ? 48  ALA A HB1  5  
ATOM 7964  H HB2  . ALA A 1 48  ? -9.317  2.277   5.236   1.00 0.00 ? 48  ALA A HB2  5  
ATOM 7965  H HB3  . ALA A 1 48  ? -10.427 1.106   5.948   1.00 0.00 ? 48  ALA A HB3  5  
ATOM 7966  N N    . PHE A 1 49  ? -9.102  4.146   7.654   1.00 0.00 ? 49  PHE A N    5  
ATOM 7967  C CA   . PHE A 1 49  ? -8.230  4.283   8.856   1.00 0.00 ? 49  PHE A CA   5  
ATOM 7968  C C    . PHE A 1 49  ? -9.095  4.558   10.088  1.00 0.00 ? 49  PHE A C    5  
ATOM 7969  O O    . PHE A 1 49  ? -8.749  4.198   11.197  1.00 0.00 ? 49  PHE A O    5  
ATOM 7970  C CB   . PHE A 1 49  ? -7.254  5.442   8.649   1.00 0.00 ? 49  PHE A CB   5  
ATOM 7971  C CG   . PHE A 1 49  ? -6.109  4.993   7.772   1.00 0.00 ? 49  PHE A CG   5  
ATOM 7972  C CD1  . PHE A 1 49  ? -5.497  3.753   7.993   1.00 0.00 ? 49  PHE A CD1  5  
ATOM 7973  C CD2  . PHE A 1 49  ? -5.659  5.818   6.734   1.00 0.00 ? 49  PHE A CD2  5  
ATOM 7974  C CE1  . PHE A 1 49  ? -4.436  3.340   7.179   1.00 0.00 ? 49  PHE A CE1  5  
ATOM 7975  C CE2  . PHE A 1 49  ? -4.598  5.405   5.920   1.00 0.00 ? 49  PHE A CE2  5  
ATOM 7976  C CZ   . PHE A 1 49  ? -3.987  4.165   6.143   1.00 0.00 ? 49  PHE A CZ   5  
ATOM 7977  H H    . PHE A 1 49  ? -8.961  4.728   6.878   1.00 0.00 ? 49  PHE A H    5  
ATOM 7978  H HA   . PHE A 1 49  ? -7.676  3.368   9.005   1.00 0.00 ? 49  PHE A HA   5  
ATOM 7979  H HB2  . PHE A 1 49  ? -7.769  6.265   8.175   1.00 0.00 ? 49  PHE A HB2  5  
ATOM 7980  H HB3  . PHE A 1 49  ? -6.868  5.764   9.606   1.00 0.00 ? 49  PHE A HB3  5  
ATOM 7981  H HD1  . PHE A 1 49  ? -5.842  3.115   8.793   1.00 0.00 ? 49  PHE A HD1  5  
ATOM 7982  H HD2  . PHE A 1 49  ? -6.130  6.775   6.563   1.00 0.00 ? 49  PHE A HD2  5  
ATOM 7983  H HE1  . PHE A 1 49  ? -3.964  2.384   7.351   1.00 0.00 ? 49  PHE A HE1  5  
ATOM 7984  H HE2  . PHE A 1 49  ? -4.252  6.043   5.119   1.00 0.00 ? 49  PHE A HE2  5  
ATOM 7985  H HZ   . PHE A 1 49  ? -3.168  3.846   5.513   1.00 0.00 ? 49  PHE A HZ   5  
ATOM 7986  N N    . ASN A 1 50  ? -10.221 5.195   9.906   1.00 0.00 ? 50  ASN A N    5  
ATOM 7987  C CA   . ASN A 1 50  ? -11.106 5.493   11.067  1.00 0.00 ? 50  ASN A CA   5  
ATOM 7988  C C    . ASN A 1 50  ? -12.405 4.695   10.936  1.00 0.00 ? 50  ASN A C    5  
ATOM 7989  O O    . ASN A 1 50  ? -13.144 4.533   11.887  1.00 0.00 ? 50  ASN A O    5  
ATOM 7990  C CB   . ASN A 1 50  ? -11.423 6.989   11.098  1.00 0.00 ? 50  ASN A CB   5  
ATOM 7991  C CG   . ASN A 1 50  ? -11.508 7.463   12.550  1.00 0.00 ? 50  ASN A CG   5  
ATOM 7992  O OD1  . ASN A 1 50  ? -12.570 7.810   13.026  1.00 0.00 ? 50  ASN A OD1  5  
ATOM 7993  N ND2  . ASN A 1 50  ? -10.426 7.492   13.278  1.00 0.00 ? 50  ASN A ND2  5  
ATOM 7994  H H    . ASN A 1 50  ? -10.483 5.477   9.005   1.00 0.00 ? 50  ASN A H    5  
ATOM 7995  H HA   . ASN A 1 50  ? -10.604 5.213   11.981  1.00 0.00 ? 50  ASN A HA   5  
ATOM 7996  H HB2  . ASN A 1 50  ? -10.642 7.533   10.586  1.00 0.00 ? 50  ASN A HB2  5  
ATOM 7997  H HB3  . ASN A 1 50  ? -12.368 7.168   10.607  1.00 0.00 ? 50  ASN A HB3  5  
ATOM 7998  H HD21 . ASN A 1 50  ? -9.569  7.212   12.894  1.00 0.00 ? 50  ASN A HD21 5  
ATOM 7999  H HD22 . ASN A 1 50  ? -10.470 7.794   14.209  1.00 0.00 ? 50  ASN A HD22 5  
ATOM 8000  N N    . ASN A 1 51  ? -12.688 4.193   9.765   1.00 0.00 ? 51  ASN A N    5  
ATOM 8001  C CA   . ASN A 1 51  ? -13.937 3.401   9.574   1.00 0.00 ? 51  ASN A CA   5  
ATOM 8002  C C    . ASN A 1 51  ? -13.570 1.971   9.175   1.00 0.00 ? 51  ASN A C    5  
ATOM 8003  O O    . ASN A 1 51  ? -13.053 1.730   8.103   1.00 0.00 ? 51  ASN A O    5  
ATOM 8004  C CB   . ASN A 1 51  ? -14.784 4.037   8.470   1.00 0.00 ? 51  ASN A CB   5  
ATOM 8005  C CG   . ASN A 1 51  ? -16.266 3.942   8.839   1.00 0.00 ? 51  ASN A CG   5  
ATOM 8006  O OD1  . ASN A 1 51  ? -16.702 2.957   9.402   1.00 0.00 ? 51  ASN A OD1  5  
ATOM 8007  N ND2  . ASN A 1 51  ? -17.066 4.932   8.545   1.00 0.00 ? 51  ASN A ND2  5  
ATOM 8008  H H    . ASN A 1 51  ? -12.078 4.332   9.011   1.00 0.00 ? 51  ASN A H    5  
ATOM 8009  H HA   . ASN A 1 51  ? -14.499 3.385   10.497  1.00 0.00 ? 51  ASN A HA   5  
ATOM 8010  H HB2  . ASN A 1 51  ? -14.508 5.077   8.357   1.00 0.00 ? 51  ASN A HB2  5  
ATOM 8011  H HB3  . ASN A 1 51  ? -14.613 3.516   7.541   1.00 0.00 ? 51  ASN A HB3  5  
ATOM 8012  H HD21 . ASN A 1 51  ? -16.714 5.726   8.093   1.00 0.00 ? 51  ASN A HD21 5  
ATOM 8013  H HD22 . ASN A 1 51  ? -18.017 4.878   8.776   1.00 0.00 ? 51  ASN A HD22 5  
ATOM 8014  N N    . ALA A 1 52  ? -13.829 1.019   10.030  1.00 0.00 ? 52  ALA A N    5  
ATOM 8015  C CA   . ALA A 1 52  ? -13.488 -0.392  9.695   1.00 0.00 ? 52  ALA A CA   5  
ATOM 8016  C C    . ALA A 1 52  ? -14.746 -1.127  9.226   1.00 0.00 ? 52  ALA A C    5  
ATOM 8017  O O    . ALA A 1 52  ? -14.681 -2.245  8.753   1.00 0.00 ? 52  ALA A O    5  
ATOM 8018  C CB   . ALA A 1 52  ? -12.923 -1.086  10.935  1.00 0.00 ? 52  ALA A CB   5  
ATOM 8019  H H    . ALA A 1 52  ? -14.243 1.232   10.891  1.00 0.00 ? 52  ALA A H    5  
ATOM 8020  H HA   . ALA A 1 52  ? -12.749 -0.405  8.909   1.00 0.00 ? 52  ALA A HA   5  
ATOM 8021  H HB1  . ALA A 1 52  ? -12.555 -0.344  11.628  1.00 0.00 ? 52  ALA A HB1  5  
ATOM 8022  H HB2  . ALA A 1 52  ? -13.702 -1.667  11.409  1.00 0.00 ? 52  ALA A HB2  5  
ATOM 8023  H HB3  . ALA A 1 52  ? -12.114 -1.741  10.644  1.00 0.00 ? 52  ALA A HB3  5  
ATOM 8024  N N    . ASP A 1 53  ? -15.888 -0.512  9.355   1.00 0.00 ? 53  ASP A N    5  
ATOM 8025  C CA   . ASP A 1 53  ? -17.147 -1.177  8.918   1.00 0.00 ? 53  ASP A CA   5  
ATOM 8026  C C    . ASP A 1 53  ? -17.125 -1.390  7.399   1.00 0.00 ? 53  ASP A C    5  
ATOM 8027  O O    . ASP A 1 53  ? -17.340 -2.490  6.930   1.00 0.00 ? 53  ASP A O    5  
ATOM 8028  C CB   . ASP A 1 53  ? -18.346 -0.306  9.301   1.00 0.00 ? 53  ASP A CB   5  
ATOM 8029  C CG   . ASP A 1 53  ? -19.164 -1.014  10.382  1.00 0.00 ? 53  ASP A CG   5  
ATOM 8030  O OD1  . ASP A 1 53  ? -19.235 -2.232  10.338  1.00 0.00 ? 53  ASP A OD1  5  
ATOM 8031  O OD2  . ASP A 1 53  ? -19.704 -0.329  11.234  1.00 0.00 ? 53  ASP A OD2  5  
ATOM 8032  H H    . ASP A 1 53  ? -15.920 0.389   9.740   1.00 0.00 ? 53  ASP A H    5  
ATOM 8033  H HA   . ASP A 1 53  ? -17.232 -2.135  9.410   1.00 0.00 ? 53  ASP A HA   5  
ATOM 8034  H HB2  . ASP A 1 53  ? -17.994 0.644   9.679   1.00 0.00 ? 53  ASP A HB2  5  
ATOM 8035  H HB3  . ASP A 1 53  ? -18.966 -0.141  8.432   1.00 0.00 ? 53  ASP A HB3  5  
ATOM 8036  N N    . PRO A 1 54  ? -16.869 -0.328  6.672   1.00 0.00 ? 54  PRO A N    5  
ATOM 8037  C CA   . PRO A 1 54  ? -16.817 -0.378  5.197   1.00 0.00 ? 54  PRO A CA   5  
ATOM 8038  C C    . PRO A 1 54  ? -15.666 -1.270  4.712   1.00 0.00 ? 54  PRO A C    5  
ATOM 8039  O O    . PRO A 1 54  ? -15.516 -1.510  3.530   1.00 0.00 ? 54  PRO A O    5  
ATOM 8040  C CB   . PRO A 1 54  ? -16.587 1.075   4.762   1.00 0.00 ? 54  PRO A CB   5  
ATOM 8041  C CG   . PRO A 1 54  ? -16.480 1.940   6.043   1.00 0.00 ? 54  PRO A CG   5  
ATOM 8042  C CD   . PRO A 1 54  ? -16.616 1.003   7.254   1.00 0.00 ? 54  PRO A CD   5  
ATOM 8043  H HA   . PRO A 1 54  ? -17.757 -0.731  4.801   1.00 0.00 ? 54  PRO A HA   5  
ATOM 8044  H HB2  . PRO A 1 54  ? -15.671 1.144   4.192   1.00 0.00 ? 54  PRO A HB2  5  
ATOM 8045  H HB3  . PRO A 1 54  ? -17.418 1.416   4.164   1.00 0.00 ? 54  PRO A HB3  5  
ATOM 8046  H HG2  . PRO A 1 54  ? -15.521 2.438   6.069   1.00 0.00 ? 54  PRO A HG2  5  
ATOM 8047  H HG3  . PRO A 1 54  ? -17.274 2.670   6.060   1.00 0.00 ? 54  PRO A HG3  5  
ATOM 8048  H HD2  . PRO A 1 54  ? -15.700 1.003   7.825   1.00 0.00 ? 54  PRO A HD2  5  
ATOM 8049  H HD3  . PRO A 1 54  ? -17.448 1.304   7.871   1.00 0.00 ? 54  PRO A HD3  5  
ATOM 8050  N N    . ILE A 1 55  ? -14.854 -1.768  5.607   1.00 0.00 ? 55  ILE A N    5  
ATOM 8051  C CA   . ILE A 1 55  ? -13.723 -2.643  5.175   1.00 0.00 ? 55  ILE A CA   5  
ATOM 8052  C C    . ILE A 1 55  ? -13.744 -3.946  5.977   1.00 0.00 ? 55  ILE A C    5  
ATOM 8053  O O    . ILE A 1 55  ? -12.905 -4.807  5.799   1.00 0.00 ? 55  ILE A O    5  
ATOM 8054  C CB   . ILE A 1 55  ? -12.381 -1.930  5.397   1.00 0.00 ? 55  ILE A CB   5  
ATOM 8055  C CG1  . ILE A 1 55  ? -12.359 -1.260  6.773   1.00 0.00 ? 55  ILE A CG1  5  
ATOM 8056  C CG2  . ILE A 1 55  ? -12.179 -0.869  4.316   1.00 0.00 ? 55  ILE A CG2  5  
ATOM 8057  C CD1  . ILE A 1 55  ? -11.702 -2.196  7.789   1.00 0.00 ? 55  ILE A CD1  5  
ATOM 8058  H H    . ILE A 1 55  ? -14.989 -1.572  6.555   1.00 0.00 ? 55  ILE A H    5  
ATOM 8059  H HA   . ILE A 1 55  ? -13.835 -2.872  4.125   1.00 0.00 ? 55  ILE A HA   5  
ATOM 8060  H HB   . ILE A 1 55  ? -11.581 -2.654  5.337   1.00 0.00 ? 55  ILE A HB   5  
ATOM 8061  H HG12 . ILE A 1 55  ? -11.794 -0.341  6.713   1.00 0.00 ? 55  ILE A HG12 5  
ATOM 8062  H HG13 . ILE A 1 55  ? -13.365 -1.041  7.088   1.00 0.00 ? 55  ILE A HG13 5  
ATOM 8063  H HG21 . ILE A 1 55  ? -12.430 -1.283  3.352   1.00 0.00 ? 55  ILE A HG21 5  
ATOM 8064  H HG22 . ILE A 1 55  ? -12.814 -0.020  4.521   1.00 0.00 ? 55  ILE A HG22 5  
ATOM 8065  H HG23 . ILE A 1 55  ? -11.145 -0.552  4.313   1.00 0.00 ? 55  ILE A HG23 5  
ATOM 8066  H HD11 . ILE A 1 55  ? -11.246 -3.026  7.271   1.00 0.00 ? 55  ILE A HD11 5  
ATOM 8067  H HD12 . ILE A 1 55  ? -10.946 -1.655  8.339   1.00 0.00 ? 55  ILE A HD12 5  
ATOM 8068  H HD13 . ILE A 1 55  ? -12.450 -2.566  8.474   1.00 0.00 ? 55  ILE A HD13 5  
ATOM 8069  N N    . ARG A 1 56  ? -14.695 -4.103  6.856   1.00 0.00 ? 56  ARG A N    5  
ATOM 8070  C CA   . ARG A 1 56  ? -14.761 -5.355  7.659   1.00 0.00 ? 56  ARG A CA   5  
ATOM 8071  C C    . ARG A 1 56  ? -15.778 -6.310  7.031   1.00 0.00 ? 56  ARG A C    5  
ATOM 8072  O O    . ARG A 1 56  ? -15.612 -7.513  7.054   1.00 0.00 ? 56  ARG A O    5  
ATOM 8073  C CB   . ARG A 1 56  ? -15.194 -5.024  9.088   1.00 0.00 ? 56  ARG A CB   5  
ATOM 8074  C CG   . ARG A 1 56  ? -15.333 -6.321  9.890   1.00 0.00 ? 56  ARG A CG   5  
ATOM 8075  C CD   . ARG A 1 56  ? -16.414 -6.148  10.957  1.00 0.00 ? 56  ARG A CD   5  
ATOM 8076  N NE   . ARG A 1 56  ? -16.911 -7.486  11.383  1.00 0.00 ? 56  ARG A NE   5  
ATOM 8077  C CZ   . ARG A 1 56  ? -17.612 -7.606  12.478  1.00 0.00 ? 56  ARG A CZ   5  
ATOM 8078  N NH1  . ARG A 1 56  ? -17.884 -6.553  13.202  1.00 0.00 ? 56  ARG A NH1  5  
ATOM 8079  N NH2  . ARG A 1 56  ? -18.041 -8.780  12.851  1.00 0.00 ? 56  ARG A NH2  5  
ATOM 8080  H H    . ARG A 1 56  ? -15.366 -3.400  6.986   1.00 0.00 ? 56  ARG A H    5  
ATOM 8081  H HA   . ARG A 1 56  ? -13.789 -5.825  7.677   1.00 0.00 ? 56  ARG A HA   5  
ATOM 8082  H HB2  . ARG A 1 56  ? -14.453 -4.389  9.552   1.00 0.00 ? 56  ARG A HB2  5  
ATOM 8083  H HB3  . ARG A 1 56  ? -16.145 -4.514  9.067   1.00 0.00 ? 56  ARG A HB3  5  
ATOM 8084  H HG2  . ARG A 1 56  ? -15.607 -7.127  9.224   1.00 0.00 ? 56  ARG A HG2  5  
ATOM 8085  H HG3  . ARG A 1 56  ? -14.392 -6.552  10.368  1.00 0.00 ? 56  ARG A HG3  5  
ATOM 8086  H HD2  . ARG A 1 56  ? -15.999 -5.630  11.808  1.00 0.00 ? 56  ARG A HD2  5  
ATOM 8087  H HD3  . ARG A 1 56  ? -17.233 -5.573  10.550  1.00 0.00 ? 56  ARG A HD3  5  
ATOM 8088  H HE   . ARG A 1 56  ? -16.710 -8.278  10.842  1.00 0.00 ? 56  ARG A HE   5  
ATOM 8089  H HH11 . ARG A 1 56  ? -17.556 -5.652  12.919  1.00 0.00 ? 56  ARG A HH11 5  
ATOM 8090  H HH12 . ARG A 1 56  ? -18.422 -6.649  14.040  1.00 0.00 ? 56  ARG A HH12 5  
ATOM 8091  H HH21 . ARG A 1 56  ? -17.834 -9.586  12.298  1.00 0.00 ? 56  ARG A HH21 5  
ATOM 8092  H HH22 . ARG A 1 56  ? -18.578 -8.872  13.689  1.00 0.00 ? 56  ARG A HH22 5  
ATOM 8093  N N    . ALA A 1 57  ? -16.833 -5.780  6.475   1.00 0.00 ? 57  ALA A N    5  
ATOM 8094  C CA   . ALA A 1 57  ? -17.864 -6.654  5.850   1.00 0.00 ? 57  ALA A CA   5  
ATOM 8095  C C    . ALA A 1 57  ? -17.280 -7.335  4.610   1.00 0.00 ? 57  ALA A C    5  
ATOM 8096  O O    . ALA A 1 57  ? -17.749 -8.371  4.183   1.00 0.00 ? 57  ALA A O    5  
ATOM 8097  C CB   . ALA A 1 57  ? -19.071 -5.804  5.449   1.00 0.00 ? 57  ALA A CB   5  
ATOM 8098  H H    . ALA A 1 57  ? -16.947 -4.807  6.471   1.00 0.00 ? 57  ALA A H    5  
ATOM 8099  H HA   . ALA A 1 57  ? -18.176 -7.405  6.560   1.00 0.00 ? 57  ALA A HA   5  
ATOM 8100  H HB1  . ALA A 1 57  ? -18.860 -4.762  5.647   1.00 0.00 ? 57  ALA A HB1  5  
ATOM 8101  H HB2  . ALA A 1 57  ? -19.270 -5.935  4.396   1.00 0.00 ? 57  ALA A HB2  5  
ATOM 8102  H HB3  . ALA A 1 57  ? -19.934 -6.111  6.021   1.00 0.00 ? 57  ALA A HB3  5  
ATOM 8103  N N    . SER A 1 58  ? -16.260 -6.765  4.027   1.00 0.00 ? 58  SER A N    5  
ATOM 8104  C CA   . SER A 1 58  ? -15.653 -7.387  2.815   1.00 0.00 ? 58  SER A CA   5  
ATOM 8105  C C    . SER A 1 58  ? -14.346 -6.670  2.467   1.00 0.00 ? 58  SER A C    5  
ATOM 8106  O O    . SER A 1 58  ? -13.380 -7.284  2.057   1.00 0.00 ? 58  SER A O    5  
ATOM 8107  C CB   . SER A 1 58  ? -16.625 -7.269  1.641   1.00 0.00 ? 58  SER A CB   5  
ATOM 8108  O OG   . SER A 1 58  ? -15.946 -7.594  0.435   1.00 0.00 ? 58  SER A OG   5  
ATOM 8109  H H    . SER A 1 58  ? -15.894 -5.930  4.385   1.00 0.00 ? 58  SER A H    5  
ATOM 8110  H HA   . SER A 1 58  ? -15.450 -8.429  3.010   1.00 0.00 ? 58  SER A HA   5  
ATOM 8111  H HB2  . SER A 1 58  ? -17.446 -7.952  1.780   1.00 0.00 ? 58  SER A HB2  5  
ATOM 8112  H HB3  . SER A 1 58  ? -17.005 -6.256  1.589   1.00 0.00 ? 58  SER A HB3  5  
ATOM 8113  H HG   . SER A 1 58  ? -16.503 -7.328  -0.301  1.00 0.00 ? 58  SER A HG   5  
ATOM 8114  N N    . GLY A 1 59  ? -14.309 -5.375  2.621   1.00 0.00 ? 59  GLY A N    5  
ATOM 8115  C CA   . GLY A 1 59  ? -13.066 -4.617  2.293   1.00 0.00 ? 59  GLY A CA   5  
ATOM 8116  C C    . GLY A 1 59  ? -13.429 -3.401  1.441   1.00 0.00 ? 59  GLY A C    5  
ATOM 8117  O O    . GLY A 1 59  ? -14.227 -2.573  1.835   1.00 0.00 ? 59  GLY A O    5  
ATOM 8118  H H    . GLY A 1 59  ? -15.099 -4.899  2.949   1.00 0.00 ? 59  GLY A H    5  
ATOM 8119  H HA2  . GLY A 1 59  ? -12.591 -4.292  3.209   1.00 0.00 ? 59  GLY A HA2  5  
ATOM 8120  H HA3  . GLY A 1 59  ? -12.392 -5.253  1.741   1.00 0.00 ? 59  GLY A HA3  5  
ATOM 8121  N N    . PHE A 1 60  ? -12.854 -3.282  0.276   1.00 0.00 ? 60  PHE A N    5  
ATOM 8122  C CA   . PHE A 1 60  ? -13.181 -2.113  -0.594  1.00 0.00 ? 60  PHE A CA   5  
ATOM 8123  C C    . PHE A 1 60  ? -12.798 -2.425  -2.043  1.00 0.00 ? 60  PHE A C    5  
ATOM 8124  O O    . PHE A 1 60  ? -12.162 -3.420  -2.327  1.00 0.00 ? 60  PHE A O    5  
ATOM 8125  C CB   . PHE A 1 60  ? -12.408 -0.883  -0.112  1.00 0.00 ? 60  PHE A CB   5  
ATOM 8126  C CG   . PHE A 1 60  ? -10.927 -1.173  -0.133  1.00 0.00 ? 60  PHE A CG   5  
ATOM 8127  C CD1  . PHE A 1 60  ? -10.215 -1.094  -1.335  1.00 0.00 ? 60  PHE A CD1  5  
ATOM 8128  C CD2  . PHE A 1 60  ? -10.265 -1.517  1.052   1.00 0.00 ? 60  PHE A CD2  5  
ATOM 8129  C CE1  . PHE A 1 60  ? -8.841  -1.359  -1.354  1.00 0.00 ? 60  PHE A CE1  5  
ATOM 8130  C CE2  . PHE A 1 60  ? -8.890  -1.783  1.033   1.00 0.00 ? 60  PHE A CE2  5  
ATOM 8131  C CZ   . PHE A 1 60  ? -8.179  -1.704  -0.171  1.00 0.00 ? 60  PHE A CZ   5  
ATOM 8132  H H    . PHE A 1 60  ? -12.213 -3.962  -0.029  1.00 0.00 ? 60  PHE A H    5  
ATOM 8133  H HA   . PHE A 1 60  ? -14.241 -1.913  -0.541  1.00 0.00 ? 60  PHE A HA   5  
ATOM 8134  H HB2  . PHE A 1 60  ? -12.620 -0.048  -0.764  1.00 0.00 ? 60  PHE A HB2  5  
ATOM 8135  H HB3  . PHE A 1 60  ? -12.712 -0.639  0.894   1.00 0.00 ? 60  PHE A HB3  5  
ATOM 8136  H HD1  . PHE A 1 60  ? -10.727 -0.829  -2.248  1.00 0.00 ? 60  PHE A HD1  5  
ATOM 8137  H HD2  . PHE A 1 60  ? -10.813 -1.578  1.980   1.00 0.00 ? 60  PHE A HD2  5  
ATOM 8138  H HE1  . PHE A 1 60  ? -8.293  -1.297  -2.283  1.00 0.00 ? 60  PHE A HE1  5  
ATOM 8139  H HE2  . PHE A 1 60  ? -8.378  -2.049  1.945   1.00 0.00 ? 60  PHE A HE2  5  
ATOM 8140  H HZ   . PHE A 1 60  ? -7.118  -1.908  -0.187  1.00 0.00 ? 60  PHE A HZ   5  
ATOM 8141  N N    . ASP A 1 61  ? -13.182 -1.580  -2.965  1.00 0.00 ? 61  ASP A N    5  
ATOM 8142  C CA   . ASP A 1 61  ? -12.842 -1.830  -4.394  1.00 0.00 ? 61  ASP A CA   5  
ATOM 8143  C C    . ASP A 1 61  ? -11.791 -0.818  -4.853  1.00 0.00 ? 61  ASP A C    5  
ATOM 8144  O O    . ASP A 1 61  ? -11.837 0.344   -4.502  1.00 0.00 ? 61  ASP A O    5  
ATOM 8145  C CB   . ASP A 1 61  ? -14.101 -1.691  -5.252  1.00 0.00 ? 61  ASP A CB   5  
ATOM 8146  C CG   . ASP A 1 61  ? -14.422 -3.037  -5.904  1.00 0.00 ? 61  ASP A CG   5  
ATOM 8147  O OD1  . ASP A 1 61  ? -14.688 -3.978  -5.174  1.00 0.00 ? 61  ASP A OD1  5  
ATOM 8148  O OD2  . ASP A 1 61  ? -14.397 -3.104  -7.123  1.00 0.00 ? 61  ASP A OD2  5  
ATOM 8149  H H    . ASP A 1 61  ? -13.695 -0.783  -2.715  1.00 0.00 ? 61  ASP A H    5  
ATOM 8150  H HA   . ASP A 1 61  ? -12.446 -2.828  -4.499  1.00 0.00 ? 61  ASP A HA   5  
ATOM 8151  H HB2  . ASP A 1 61  ? -14.930 -1.385  -4.627  1.00 0.00 ? 61  ASP A HB2  5  
ATOM 8152  H HB3  . ASP A 1 61  ? -13.937 -0.951  -6.019  1.00 0.00 ? 61  ASP A HB3  5  
ATOM 8153  N N    . LEU A 1 62  ? -10.840 -1.253  -5.636  1.00 0.00 ? 62  LEU A N    5  
ATOM 8154  C CA   . LEU A 1 62  ? -9.783  -0.318  -6.115  1.00 0.00 ? 62  LEU A CA   5  
ATOM 8155  C C    . LEU A 1 62  ? -9.318  -0.740  -7.511  1.00 0.00 ? 62  LEU A C    5  
ATOM 8156  O O    . LEU A 1 62  ? -8.757  -1.803  -7.693  1.00 0.00 ? 62  LEU A O    5  
ATOM 8157  C CB   . LEU A 1 62  ? -8.595  -0.356  -5.151  1.00 0.00 ? 62  LEU A CB   5  
ATOM 8158  C CG   . LEU A 1 62  ? -8.539  0.949   -4.356  1.00 0.00 ? 62  LEU A CG   5  
ATOM 8159  C CD1  . LEU A 1 62  ? -7.424  0.864   -3.313  1.00 0.00 ? 62  LEU A CD1  5  
ATOM 8160  C CD2  . LEU A 1 62  ? -8.256  2.113   -5.308  1.00 0.00 ? 62  LEU A CD2  5  
ATOM 8161  H H    . LEU A 1 62  ? -10.820 -2.197  -5.906  1.00 0.00 ? 62  LEU A H    5  
ATOM 8162  H HA   . LEU A 1 62  ? -10.181 0.684   -6.155  1.00 0.00 ? 62  LEU A HA   5  
ATOM 8163  H HB2  . LEU A 1 62  ? -8.709  -1.188  -4.472  1.00 0.00 ? 62  LEU A HB2  5  
ATOM 8164  H HB3  . LEU A 1 62  ? -7.680  -0.472  -5.713  1.00 0.00 ? 62  LEU A HB3  5  
ATOM 8165  H HG   . LEU A 1 62  ? -9.485  1.109   -3.859  1.00 0.00 ? 62  LEU A HG   5  
ATOM 8166  H HD11 . LEU A 1 62  ? -6.680  0.151   -3.639  1.00 0.00 ? 62  LEU A HD11 5  
ATOM 8167  H HD12 . LEU A 1 62  ? -6.965  1.835   -3.196  1.00 0.00 ? 62  LEU A HD12 5  
ATOM 8168  H HD13 . LEU A 1 62  ? -7.838  0.545   -2.369  1.00 0.00 ? 62  LEU A HD13 5  
ATOM 8169  H HD21 . LEU A 1 62  ? -8.024  1.728   -6.290  1.00 0.00 ? 62  LEU A HD21 5  
ATOM 8170  H HD22 . LEU A 1 62  ? -9.126  2.750   -5.367  1.00 0.00 ? 62  LEU A HD22 5  
ATOM 8171  H HD23 . LEU A 1 62  ? -7.417  2.685   -4.938  1.00 0.00 ? 62  LEU A HD23 5  
ATOM 8172  N N    . ALA A 1 63  ? -9.543  0.085   -8.496  1.00 0.00 ? 63  ALA A N    5  
ATOM 8173  C CA   . ALA A 1 63  ? -9.109  -0.264  -9.879  1.00 0.00 ? 63  ALA A CA   5  
ATOM 8174  C C    . ALA A 1 63  ? -10.074 -1.291  -10.481 1.00 0.00 ? 63  ALA A C    5  
ATOM 8175  O O    . ALA A 1 63  ? -9.797  -1.891  -11.501 1.00 0.00 ? 63  ALA A O    5  
ATOM 8176  C CB   . ALA A 1 63  ? -7.698  -0.853  -9.835  1.00 0.00 ? 63  ALA A CB   5  
ATOM 8177  H H    . ALA A 1 63  ? -9.994  0.938   -8.326  1.00 0.00 ? 63  ALA A H    5  
ATOM 8178  H HA   . ALA A 1 63  ? -9.107  0.626   -10.490 1.00 0.00 ? 63  ALA A HA   5  
ATOM 8179  H HB1  . ALA A 1 63  ? -7.285  -0.723  -8.845  1.00 0.00 ? 63  ALA A HB1  5  
ATOM 8180  H HB2  . ALA A 1 63  ? -7.738  -1.906  -10.072 1.00 0.00 ? 63  ALA A HB2  5  
ATOM 8181  H HB3  . ALA A 1 63  ? -7.074  -0.345  -10.556 1.00 0.00 ? 63  ALA A HB3  5  
ATOM 8182  N N    . GLY A 1 64  ? -11.206 -1.495  -9.863  1.00 0.00 ? 64  GLY A N    5  
ATOM 8183  C CA   . GLY A 1 64  ? -12.184 -2.481  -10.406 1.00 0.00 ? 64  GLY A CA   5  
ATOM 8184  C C    . GLY A 1 64  ? -11.856 -3.878  -9.876  1.00 0.00 ? 64  GLY A C    5  
ATOM 8185  O O    . GLY A 1 64  ? -12.119 -4.875  -10.519 1.00 0.00 ? 64  GLY A O    5  
ATOM 8186  H H    . GLY A 1 64  ? -11.413 -1.001  -9.043  1.00 0.00 ? 64  GLY A H    5  
ATOM 8187  H HA2  . GLY A 1 64  ? -13.182 -2.204  -10.098 1.00 0.00 ? 64  GLY A HA2  5  
ATOM 8188  H HA3  . GLY A 1 64  ? -12.129 -2.486  -11.485 1.00 0.00 ? 64  GLY A HA3  5  
ATOM 8189  N N    . VAL A 1 65  ? -11.283 -3.958  -8.707  1.00 0.00 ? 65  VAL A N    5  
ATOM 8190  C CA   . VAL A 1 65  ? -10.938 -5.290  -8.132  1.00 0.00 ? 65  VAL A CA   5  
ATOM 8191  C C    . VAL A 1 65  ? -11.454 -5.366  -6.693  1.00 0.00 ? 65  VAL A C    5  
ATOM 8192  O O    . VAL A 1 65  ? -12.198 -4.514  -6.251  1.00 0.00 ? 65  VAL A O    5  
ATOM 8193  C CB   . VAL A 1 65  ? -9.418  -5.475  -8.146  1.00 0.00 ? 65  VAL A CB   5  
ATOM 8194  C CG1  . VAL A 1 65  ? -9.086  -6.966  -8.246  1.00 0.00 ? 65  VAL A CG1  5  
ATOM 8195  C CG2  . VAL A 1 65  ? -8.826  -4.742  -9.353  1.00 0.00 ? 65  VAL A CG2  5  
ATOM 8196  H H    . VAL A 1 65  ? -11.081 -3.141  -8.204  1.00 0.00 ? 65  VAL A H    5  
ATOM 8197  H HA   . VAL A 1 65  ? -11.402 -6.067  -8.723  1.00 0.00 ? 65  VAL A HA   5  
ATOM 8198  H HB   . VAL A 1 65  ? -8.999  -5.074  -7.236  1.00 0.00 ? 65  VAL A HB   5  
ATOM 8199  H HG11 . VAL A 1 65  ? -9.993  -7.545  -8.155  1.00 0.00 ? 65  VAL A HG11 5  
ATOM 8200  H HG12 . VAL A 1 65  ? -8.623  -7.169  -9.201  1.00 0.00 ? 65  VAL A HG12 5  
ATOM 8201  H HG13 . VAL A 1 65  ? -8.406  -7.236  -7.452  1.00 0.00 ? 65  VAL A HG13 5  
ATOM 8202  H HG21 . VAL A 1 65  ? -9.497  -4.834  -10.195 1.00 0.00 ? 65  VAL A HG21 5  
ATOM 8203  H HG22 . VAL A 1 65  ? -8.693  -3.698  -9.110  1.00 0.00 ? 65  VAL A HG22 5  
ATOM 8204  H HG23 . VAL A 1 65  ? -7.871  -5.177  -9.606  1.00 0.00 ? 65  VAL A HG23 5  
ATOM 8205  N N    . HIS A 1 66  ? -11.074 -6.377  -5.959  1.00 0.00 ? 66  HIS A N    5  
ATOM 8206  C CA   . HIS A 1 66  ? -11.561 -6.491  -4.552  1.00 0.00 ? 66  HIS A CA   5  
ATOM 8207  C C    . HIS A 1 66  ? -10.403 -6.851  -3.620  1.00 0.00 ? 66  HIS A C    5  
ATOM 8208  O O    . HIS A 1 66  ? -9.705  -7.825  -3.822  1.00 0.00 ? 66  HIS A O    5  
ATOM 8209  C CB   . HIS A 1 66  ? -12.649 -7.573  -4.449  1.00 0.00 ? 66  HIS A CB   5  
ATOM 8210  C CG   . HIS A 1 66  ? -12.709 -8.387  -5.716  1.00 0.00 ? 66  HIS A CG   5  
ATOM 8211  N ND1  . HIS A 1 66  ? -13.757 -8.276  -6.617  1.00 0.00 ? 66  HIS A ND1  5  
ATOM 8212  C CD2  . HIS A 1 66  ? -11.861 -9.330  -6.243  1.00 0.00 ? 66  HIS A CD2  5  
ATOM 8213  C CE1  . HIS A 1 66  ? -13.516 -9.130  -7.627  1.00 0.00 ? 66  HIS A CE1  5  
ATOM 8214  N NE2  . HIS A 1 66  ? -12.373 -9.799  -7.450  1.00 0.00 ? 66  HIS A NE2  5  
ATOM 8215  H H    . HIS A 1 66  ? -10.477 -7.058  -6.331  1.00 0.00 ? 66  HIS A H    5  
ATOM 8216  H HA   . HIS A 1 66  ? -11.977 -5.543  -4.246  1.00 0.00 ? 66  HIS A HA   5  
ATOM 8217  H HB2  . HIS A 1 66  ? -12.427 -8.224  -3.617  1.00 0.00 ? 66  HIS A HB2  5  
ATOM 8218  H HB3  . HIS A 1 66  ? -13.607 -7.098  -4.283  1.00 0.00 ? 66  HIS A HB3  5  
ATOM 8219  H HD1  . HIS A 1 66  ? -14.532 -7.682  -6.533  1.00 0.00 ? 66  HIS A HD1  5  
ATOM 8220  H HD2  . HIS A 1 66  ? -10.938 -9.659  -5.790  1.00 0.00 ? 66  HIS A HD2  5  
ATOM 8221  H HE1  . HIS A 1 66  ? -14.169 -9.263  -8.477  1.00 0.00 ? 66  HIS A HE1  5  
ATOM 8222  N N    . TYR A 1 67  ? -10.206 -6.074  -2.589  1.00 0.00 ? 67  TYR A N    5  
ATOM 8223  C CA   . TYR A 1 67  ? -9.106  -6.365  -1.623  1.00 0.00 ? 67  TYR A CA   5  
ATOM 8224  C C    . TYR A 1 67  ? -9.724  -6.757  -0.280  1.00 0.00 ? 67  TYR A C    5  
ATOM 8225  O O    . TYR A 1 67  ? -10.825 -6.352  0.045   1.00 0.00 ? 67  TYR A O    5  
ATOM 8226  C CB   . TYR A 1 67  ? -8.234  -5.118  -1.443  1.00 0.00 ? 67  TYR A CB   5  
ATOM 8227  C CG   . TYR A 1 67  ? -7.519  -4.791  -2.738  1.00 0.00 ? 67  TYR A CG   5  
ATOM 8228  C CD1  . TYR A 1 67  ? -7.363  -5.766  -3.734  1.00 0.00 ? 67  TYR A CD1  5  
ATOM 8229  C CD2  . TYR A 1 67  ? -7.008  -3.503  -2.939  1.00 0.00 ? 67  TYR A CD2  5  
ATOM 8230  C CE1  . TYR A 1 67  ? -6.699  -5.452  -4.924  1.00 0.00 ? 67  TYR A CE1  5  
ATOM 8231  C CE2  . TYR A 1 67  ? -6.343  -3.190  -4.130  1.00 0.00 ? 67  TYR A CE2  5  
ATOM 8232  C CZ   . TYR A 1 67  ? -6.188  -4.165  -5.123  1.00 0.00 ? 67  TYR A CZ   5  
ATOM 8233  O OH   . TYR A 1 67  ? -5.534  -3.856  -6.298  1.00 0.00 ? 67  TYR A OH   5  
ATOM 8234  H H    . TYR A 1 67  ? -10.789 -5.300  -2.443  1.00 0.00 ? 67  TYR A H    5  
ATOM 8235  H HA   . TYR A 1 67  ? -8.505  -7.181  -1.991  1.00 0.00 ? 67  TYR A HA   5  
ATOM 8236  H HB2  . TYR A 1 67  ? -8.858  -4.284  -1.158  1.00 0.00 ? 67  TYR A HB2  5  
ATOM 8237  H HB3  . TYR A 1 67  ? -7.505  -5.301  -0.668  1.00 0.00 ? 67  TYR A HB3  5  
ATOM 8238  H HD1  . TYR A 1 67  ? -7.755  -6.760  -3.585  1.00 0.00 ? 67  TYR A HD1  5  
ATOM 8239  H HD2  . TYR A 1 67  ? -7.126  -2.751  -2.173  1.00 0.00 ? 67  TYR A HD2  5  
ATOM 8240  H HE1  . TYR A 1 67  ? -6.579  -6.204  -5.690  1.00 0.00 ? 67  TYR A HE1  5  
ATOM 8241  H HE2  . TYR A 1 67  ? -5.949  -2.196  -4.283  1.00 0.00 ? 67  TYR A HE2  5  
ATOM 8242  H HH   . TYR A 1 67  ? -5.909  -4.397  -6.997  1.00 0.00 ? 67  TYR A HH   5  
ATOM 8243  N N    . VAL A 1 68  ? -9.035  -7.549  0.501   1.00 0.00 ? 68  VAL A N    5  
ATOM 8244  C CA   . VAL A 1 68  ? -9.604  -7.970  1.813   1.00 0.00 ? 68  VAL A CA   5  
ATOM 8245  C C    . VAL A 1 68  ? -8.953  -7.166  2.940   1.00 0.00 ? 68  VAL A C    5  
ATOM 8246  O O    . VAL A 1 68  ? -7.922  -6.548  2.761   1.00 0.00 ? 68  VAL A O    5  
ATOM 8247  C CB   . VAL A 1 68  ? -9.345  -9.466  2.035   1.00 0.00 ? 68  VAL A CB   5  
ATOM 8248  C CG1  . VAL A 1 68  ? -10.509 -10.072 2.821   1.00 0.00 ? 68  VAL A CG1  5  
ATOM 8249  C CG2  . VAL A 1 68  ? -9.223  -10.178 0.683   1.00 0.00 ? 68  VAL A CG2  5  
ATOM 8250  H H    . VAL A 1 68  ? -8.150  -7.871  0.223   1.00 0.00 ? 68  VAL A H    5  
ATOM 8251  H HA   . VAL A 1 68  ? -10.668 -7.789  1.816   1.00 0.00 ? 68  VAL A HA   5  
ATOM 8252  H HB   . VAL A 1 68  ? -8.430  -9.593  2.593   1.00 0.00 ? 68  VAL A HB   5  
ATOM 8253  H HG11 . VAL A 1 68  ? -11.437 -9.862  2.310   1.00 0.00 ? 68  VAL A HG11 5  
ATOM 8254  H HG12 . VAL A 1 68  ? -10.374 -11.142 2.895   1.00 0.00 ? 68  VAL A HG12 5  
ATOM 8255  H HG13 . VAL A 1 68  ? -10.537 -9.642  3.811   1.00 0.00 ? 68  VAL A HG13 5  
ATOM 8256  H HG21 . VAL A 1 68  ? -10.129 -10.027 0.113   1.00 0.00 ? 68  VAL A HG21 5  
ATOM 8257  H HG22 . VAL A 1 68  ? -8.384  -9.773  0.137   1.00 0.00 ? 68  VAL A HG22 5  
ATOM 8258  H HG23 . VAL A 1 68  ? -9.072  -11.234 0.844   1.00 0.00 ? 68  VAL A HG23 5  
ATOM 8259  N N    . THR A 1 69  ? -9.549  -7.169  4.101   1.00 0.00 ? 69  THR A N    5  
ATOM 8260  C CA   . THR A 1 69  ? -8.970  -6.405  5.240   1.00 0.00 ? 69  THR A CA   5  
ATOM 8261  C C    . THR A 1 69  ? -8.290  -7.372  6.210   1.00 0.00 ? 69  THR A C    5  
ATOM 8262  O O    . THR A 1 69  ? -8.824  -8.411  6.541   1.00 0.00 ? 69  THR A O    5  
ATOM 8263  C CB   . THR A 1 69  ? -10.087 -5.653  5.967   1.00 0.00 ? 69  THR A CB   5  
ATOM 8264  O OG1  . THR A 1 69  ? -10.592 -4.628  5.123   1.00 0.00 ? 69  THR A OG1  5  
ATOM 8265  C CG2  . THR A 1 69  ? -9.535  -5.035  7.252   1.00 0.00 ? 69  THR A CG2  5  
ATOM 8266  H H    . THR A 1 69  ? -10.381 -7.674  4.222   1.00 0.00 ? 69  THR A H    5  
ATOM 8267  H HA   . THR A 1 69  ? -8.246  -5.698  4.867   1.00 0.00 ? 69  THR A HA   5  
ATOM 8268  H HB   . THR A 1 69  ? -10.880 -6.340  6.214   1.00 0.00 ? 69  THR A HB   5  
ATOM 8269  H HG1  . THR A 1 69  ? -10.474 -4.907  4.213   1.00 0.00 ? 69  THR A HG1  5  
ATOM 8270  H HG21 . THR A 1 69  ? -8.498  -5.313  7.369   1.00 0.00 ? 69  THR A HG21 5  
ATOM 8271  H HG22 . THR A 1 69  ? -9.614  -3.960  7.195   1.00 0.00 ? 69  THR A HG22 5  
ATOM 8272  H HG23 . THR A 1 69  ? -10.102 -5.393  8.097   1.00 0.00 ? 69  THR A HG23 5  
ATOM 8273  N N    . LEU A 1 70  ? -7.113  -7.041  6.665   1.00 0.00 ? 70  LEU A N    5  
ATOM 8274  C CA   . LEU A 1 70  ? -6.396  -7.943  7.609   1.00 0.00 ? 70  LEU A CA   5  
ATOM 8275  C C    . LEU A 1 70  ? -6.268  -7.264  8.975   1.00 0.00 ? 70  LEU A C    5  
ATOM 8276  O O    . LEU A 1 70  ? -6.589  -7.837  9.997   1.00 0.00 ? 70  LEU A O    5  
ATOM 8277  C CB   . LEU A 1 70  ? -5.001  -8.246  7.062   1.00 0.00 ? 70  LEU A CB   5  
ATOM 8278  C CG   . LEU A 1 70  ? -4.322  -9.294  7.945   1.00 0.00 ? 70  LEU A CG   5  
ATOM 8279  C CD1  . LEU A 1 70  ? -4.424  -10.667 7.279   1.00 0.00 ? 70  LEU A CD1  5  
ATOM 8280  C CD2  . LEU A 1 70  ? -2.850  -8.924  8.132   1.00 0.00 ? 70  LEU A CD2  5  
ATOM 8281  H H    . LEU A 1 70  ? -6.698  -6.198  6.383   1.00 0.00 ? 70  LEU A H    5  
ATOM 8282  H HA   . LEU A 1 70  ? -6.949  -8.865  7.718   1.00 0.00 ? 70  LEU A HA   5  
ATOM 8283  H HB2  . LEU A 1 70  ? -5.084  -8.623  6.052   1.00 0.00 ? 70  LEU A HB2  5  
ATOM 8284  H HB3  . LEU A 1 70  ? -4.410  -7.342  7.061   1.00 0.00 ? 70  LEU A HB3  5  
ATOM 8285  H HG   . LEU A 1 70  ? -4.813  -9.323  8.908   1.00 0.00 ? 70  LEU A HG   5  
ATOM 8286  H HD11 . LEU A 1 70  ? -4.580  -10.541 6.219   1.00 0.00 ? 70  LEU A HD11 5  
ATOM 8287  H HD12 . LEU A 1 70  ? -3.511  -11.217 7.447   1.00 0.00 ? 70  LEU A HD12 5  
ATOM 8288  H HD13 . LEU A 1 70  ? -5.256  -11.211 7.703   1.00 0.00 ? 70  LEU A HD13 5  
ATOM 8289  H HD21 . LEU A 1 70  ? -2.364  -8.878  7.169   1.00 0.00 ? 70  LEU A HD21 5  
ATOM 8290  H HD22 . LEU A 1 70  ? -2.780  -7.963  8.618   1.00 0.00 ? 70  LEU A HD22 5  
ATOM 8291  H HD23 . LEU A 1 70  ? -2.366  -9.673  8.743   1.00 0.00 ? 70  LEU A HD23 5  
ATOM 8292  N N    . ARG A 1 71  ? -5.796  -6.048  9.001   1.00 0.00 ? 71  ARG A N    5  
ATOM 8293  C CA   . ARG A 1 71  ? -5.641  -5.338  10.300  1.00 0.00 ? 71  ARG A CA   5  
ATOM 8294  C C    . ARG A 1 71  ? -5.973  -3.856  10.120  1.00 0.00 ? 71  ARG A C    5  
ATOM 8295  O O    . ARG A 1 71  ? -5.209  -2.988  10.496  1.00 0.00 ? 71  ARG A O    5  
ATOM 8296  C CB   . ARG A 1 71  ? -4.197  -5.481  10.785  1.00 0.00 ? 71  ARG A CB   5  
ATOM 8297  C CG   . ARG A 1 71  ? -4.186  -5.809  12.280  1.00 0.00 ? 71  ARG A CG   5  
ATOM 8298  C CD   . ARG A 1 71  ? -3.414  -4.725  13.035  1.00 0.00 ? 71  ARG A CD   5  
ATOM 8299  N NE   . ARG A 1 71  ? -3.844  -4.715  14.463  1.00 0.00 ? 71  ARG A NE   5  
ATOM 8300  C CZ   . ARG A 1 71  ? -3.134  -4.079  15.357  1.00 0.00 ? 71  ARG A CZ   5  
ATOM 8301  N NH1  . ARG A 1 71  ? -2.048  -3.443  15.004  1.00 0.00 ? 71  ARG A NH1  5  
ATOM 8302  N NH2  . ARG A 1 71  ? -3.511  -4.080  16.606  1.00 0.00 ? 71  ARG A NH2  5  
ATOM 8303  H H    . ARG A 1 71  ? -5.540  -5.605  8.165   1.00 0.00 ? 71  ARG A H    5  
ATOM 8304  H HA   . ARG A 1 71  ? -6.311  -5.770  11.030  1.00 0.00 ? 71  ARG A HA   5  
ATOM 8305  H HB2  . ARG A 1 71  ? -3.712  -6.277  10.238  1.00 0.00 ? 71  ARG A HB2  5  
ATOM 8306  H HB3  . ARG A 1 71  ? -3.667  -4.555  10.619  1.00 0.00 ? 71  ARG A HB3  5  
ATOM 8307  H HG2  . ARG A 1 71  ? -5.202  -5.850  12.647  1.00 0.00 ? 71  ARG A HG2  5  
ATOM 8308  H HG3  . ARG A 1 71  ? -3.708  -6.764  12.436  1.00 0.00 ? 71  ARG A HG3  5  
ATOM 8309  H HD2  . ARG A 1 71  ? -2.356  -4.933  12.980  1.00 0.00 ? 71  ARG A HD2  5  
ATOM 8310  H HD3  . ARG A 1 71  ? -3.615  -3.762  12.589  1.00 0.00 ? 71  ARG A HD3  5  
ATOM 8311  H HE   . ARG A 1 71  ? -4.658  -5.188  14.732  1.00 0.00 ? 71  ARG A HE   5  
ATOM 8312  H HH11 . ARG A 1 71  ? -1.757  -3.442  14.047  1.00 0.00 ? 71  ARG A HH11 5  
ATOM 8313  H HH12 . ARG A 1 71  ? -1.509  -2.958  15.692  1.00 0.00 ? 71  ARG A HH12 5  
ATOM 8314  H HH21 . ARG A 1 71  ? -4.342  -4.565  16.877  1.00 0.00 ? 71  ARG A HH21 5  
ATOM 8315  H HH22 . ARG A 1 71  ? -2.969  -3.593  17.293  1.00 0.00 ? 71  ARG A HH22 5  
ATOM 8316  N N    . ALA A 1 72  ? -7.108  -3.557  9.550   1.00 0.00 ? 72  ALA A N    5  
ATOM 8317  C CA   . ALA A 1 72  ? -7.486  -2.129  9.351   1.00 0.00 ? 72  ALA A CA   5  
ATOM 8318  C C    . ALA A 1 72  ? -8.018  -1.561  10.667  1.00 0.00 ? 72  ALA A C    5  
ATOM 8319  O O    . ALA A 1 72  ? -9.204  -1.587  10.929  1.00 0.00 ? 72  ALA A O    5  
ATOM 8320  C CB   . ALA A 1 72  ? -8.571  -2.029  8.277   1.00 0.00 ? 72  ALA A CB   5  
ATOM 8321  H H    . ALA A 1 72  ? -7.712  -4.270  9.257   1.00 0.00 ? 72  ALA A H    5  
ATOM 8322  H HA   . ALA A 1 72  ? -6.617  -1.566  9.040   1.00 0.00 ? 72  ALA A HA   5  
ATOM 8323  H HB1  . ALA A 1 72  ? -9.394  -2.679  8.534   1.00 0.00 ? 72  ALA A HB1  5  
ATOM 8324  H HB2  . ALA A 1 72  ? -8.923  -1.010  8.214   1.00 0.00 ? 72  ALA A HB2  5  
ATOM 8325  H HB3  . ALA A 1 72  ? -8.161  -2.327  7.322   1.00 0.00 ? 72  ALA A HB3  5  
ATOM 8326  N N    . ASP A 1 73  ? -7.151  -1.053  11.500  1.00 0.00 ? 73  ASP A N    5  
ATOM 8327  C CA   . ASP A 1 73  ? -7.614  -0.490  12.799  1.00 0.00 ? 73  ASP A CA   5  
ATOM 8328  C C    . ASP A 1 73  ? -6.793  0.753   13.149  1.00 0.00 ? 73  ASP A C    5  
ATOM 8329  O O    . ASP A 1 73  ? -7.331  1.819   13.371  1.00 0.00 ? 73  ASP A O    5  
ATOM 8330  C CB   . ASP A 1 73  ? -7.447  -1.540  13.900  1.00 0.00 ? 73  ASP A CB   5  
ATOM 8331  C CG   . ASP A 1 73  ? -8.810  -2.154  14.229  1.00 0.00 ? 73  ASP A CG   5  
ATOM 8332  O OD1  . ASP A 1 73  ? -9.717  -1.400  14.539  1.00 0.00 ? 73  ASP A OD1  5  
ATOM 8333  O OD2  . ASP A 1 73  ? -8.923  -3.367  14.167  1.00 0.00 ? 73  ASP A OD2  5  
ATOM 8334  H H    . ASP A 1 73  ? -6.197  -1.045  11.273  1.00 0.00 ? 73  ASP A H    5  
ATOM 8335  H HA   . ASP A 1 73  ? -8.657  -0.218  12.718  1.00 0.00 ? 73  ASP A HA   5  
ATOM 8336  H HB2  . ASP A 1 73  ? -6.775  -2.315  13.559  1.00 0.00 ? 73  ASP A HB2  5  
ATOM 8337  H HB3  . ASP A 1 73  ? -7.041  -1.075  14.784  1.00 0.00 ? 73  ASP A HB3  5  
ATOM 8338  N N    . ASP A 1 74  ? -5.493  0.629   13.205  1.00 0.00 ? 74  ASP A N    5  
ATOM 8339  C CA   . ASP A 1 74  ? -4.651  1.810   13.548  1.00 0.00 ? 74  ASP A CA   5  
ATOM 8340  C C    . ASP A 1 74  ? -4.435  2.672   12.298  1.00 0.00 ? 74  ASP A C    5  
ATOM 8341  O O    . ASP A 1 74  ? -5.314  3.399   11.881  1.00 0.00 ? 74  ASP A O    5  
ATOM 8342  C CB   . ASP A 1 74  ? -3.304  1.333   14.099  1.00 0.00 ? 74  ASP A CB   5  
ATOM 8343  C CG   . ASP A 1 74  ? -3.514  0.687   15.470  1.00 0.00 ? 74  ASP A CG   5  
ATOM 8344  O OD1  . ASP A 1 74  ? -4.417  1.113   16.170  1.00 0.00 ? 74  ASP A OD1  5  
ATOM 8345  O OD2  . ASP A 1 74  ? -2.768  -0.221  15.794  1.00 0.00 ? 74  ASP A OD2  5  
ATOM 8346  H H    . ASP A 1 74  ? -5.074  -0.238  13.026  1.00 0.00 ? 74  ASP A H    5  
ATOM 8347  H HA   . ASP A 1 74  ? -5.155  2.397   14.301  1.00 0.00 ? 74  ASP A HA   5  
ATOM 8348  H HB2  . ASP A 1 74  ? -2.875  0.608   13.421  1.00 0.00 ? 74  ASP A HB2  5  
ATOM 8349  H HB3  . ASP A 1 74  ? -2.637  2.175   14.198  1.00 0.00 ? 74  ASP A HB3  5  
ATOM 8350  N N    . ARG A 1 75  ? -3.274  2.608   11.697  1.00 0.00 ? 75  ARG A N    5  
ATOM 8351  C CA   . ARG A 1 75  ? -3.023  3.437   10.483  1.00 0.00 ? 75  ARG A CA   5  
ATOM 8352  C C    . ARG A 1 75  ? -2.349  2.590   9.402   1.00 0.00 ? 75  ARG A C    5  
ATOM 8353  O O    . ARG A 1 75  ? -2.041  3.070   8.330   1.00 0.00 ? 75  ARG A O    5  
ATOM 8354  C CB   . ARG A 1 75  ? -2.106  4.606   10.851  1.00 0.00 ? 75  ARG A CB   5  
ATOM 8355  C CG   . ARG A 1 75  ? -2.927  5.720   11.501  1.00 0.00 ? 75  ARG A CG   5  
ATOM 8356  C CD   . ARG A 1 75  ? -2.233  6.180   12.783  1.00 0.00 ? 75  ARG A CD   5  
ATOM 8357  N NE   . ARG A 1 75  ? -3.243  6.316   13.879  1.00 0.00 ? 75  ARG A NE   5  
ATOM 8358  C CZ   . ARG A 1 75  ? -4.349  6.995   13.703  1.00 0.00 ? 75  ARG A CZ   5  
ATOM 8359  N NH1  . ARG A 1 75  ? -4.519  7.728   12.636  1.00 0.00 ? 75  ARG A NH1  5  
ATOM 8360  N NH2  . ARG A 1 75  ? -5.267  6.983   14.630  1.00 0.00 ? 75  ARG A NH2  5  
ATOM 8361  H H    . ARG A 1 75  ? -2.570  2.024   12.043  1.00 0.00 ? 75  ARG A H    5  
ATOM 8362  H HA   . ARG A 1 75  ? -3.960  3.821   10.109  1.00 0.00 ? 75  ARG A HA   5  
ATOM 8363  H HB2  . ARG A 1 75  ? -1.349  4.265   11.542  1.00 0.00 ? 75  ARG A HB2  5  
ATOM 8364  H HB3  . ARG A 1 75  ? -1.632  4.986   9.957   1.00 0.00 ? 75  ARG A HB3  5  
ATOM 8365  H HG2  . ARG A 1 75  ? -3.010  6.551   10.816  1.00 0.00 ? 75  ARG A HG2  5  
ATOM 8366  H HG3  . ARG A 1 75  ? -3.912  5.349   11.740  1.00 0.00 ? 75  ARG A HG3  5  
ATOM 8367  H HD2  . ARG A 1 75  ? -1.512  5.440   13.083  1.00 0.00 ? 75  ARG A HD2  5  
ATOM 8368  H HD3  . ARG A 1 75  ? -1.723  7.121   12.599  1.00 0.00 ? 75  ARG A HD3  5  
ATOM 8369  H HE   . ARG A 1 75  ? -3.098  5.845   14.726  1.00 0.00 ? 75  ARG A HE   5  
ATOM 8370  H HH11 . ARG A 1 75  ? -3.803  7.785   11.944  1.00 0.00 ? 75  ARG A HH11 5  
ATOM 8371  H HH12 . ARG A 1 75  ? -5.373  8.236   12.512  1.00 0.00 ? 75  ARG A HH12 5  
ATOM 8372  H HH21 . ARG A 1 75  ? -5.124  6.457   15.468  1.00 0.00 ? 75  ARG A HH21 5  
ATOM 8373  H HH22 . ARG A 1 75  ? -6.113  7.500   14.502  1.00 0.00 ? 75  ARG A HH22 5  
ATOM 8374  N N    . SER A 1 76  ? -2.112  1.334   9.671   1.00 0.00 ? 76  SER A N    5  
ATOM 8375  C CA   . SER A 1 76  ? -1.452  0.469   8.653   1.00 0.00 ? 76  SER A CA   5  
ATOM 8376  C C    . SER A 1 76  ? -2.482  -0.485  8.044   1.00 0.00 ? 76  SER A C    5  
ATOM 8377  O O    . SER A 1 76  ? -3.362  -0.981  8.721   1.00 0.00 ? 76  SER A O    5  
ATOM 8378  C CB   . SER A 1 76  ? -0.337  -0.339  9.317   1.00 0.00 ? 76  SER A CB   5  
ATOM 8379  O OG   . SER A 1 76  ? 0.587   0.551   9.929   1.00 0.00 ? 76  SER A OG   5  
ATOM 8380  H H    . SER A 1 76  ? -2.364  0.961   10.541  1.00 0.00 ? 76  SER A H    5  
ATOM 8381  H HA   . SER A 1 76  ? -1.032  1.087   7.875   1.00 0.00 ? 76  SER A HA   5  
ATOM 8382  H HB2  . SER A 1 76  ? -0.758  -0.986  10.070  1.00 0.00 ? 76  SER A HB2  5  
ATOM 8383  H HB3  . SER A 1 76  ? 0.166   -0.938  8.570   1.00 0.00 ? 76  SER A HB3  5  
ATOM 8384  H HG   . SER A 1 76  ? 0.095   1.133   10.514  1.00 0.00 ? 76  SER A HG   5  
ATOM 8385  N N    . ILE A 1 77  ? -2.380  -0.746  6.769   1.00 0.00 ? 77  ILE A N    5  
ATOM 8386  C CA   . ILE A 1 77  ? -3.353  -1.666  6.114   1.00 0.00 ? 77  ILE A CA   5  
ATOM 8387  C C    . ILE A 1 77  ? -2.615  -2.564  5.120   1.00 0.00 ? 77  ILE A C    5  
ATOM 8388  O O    . ILE A 1 77  ? -2.498  -2.245  3.953   1.00 0.00 ? 77  ILE A O    5  
ATOM 8389  C CB   . ILE A 1 77  ? -4.409  -0.847  5.369   1.00 0.00 ? 77  ILE A CB   5  
ATOM 8390  C CG1  . ILE A 1 77  ? -5.314  -0.141  6.381   1.00 0.00 ? 77  ILE A CG1  5  
ATOM 8391  C CG2  . ILE A 1 77  ? -5.254  -1.774  4.492   1.00 0.00 ? 77  ILE A CG2  5  
ATOM 8392  C CD1  . ILE A 1 77  ? -6.416  0.616   5.638   1.00 0.00 ? 77  ILE A CD1  5  
ATOM 8393  H H    . ILE A 1 77  ? -1.663  -0.335  6.241   1.00 0.00 ? 77  ILE A H    5  
ATOM 8394  H HA   . ILE A 1 77  ? -3.833  -2.276  6.865   1.00 0.00 ? 77  ILE A HA   5  
ATOM 8395  H HB   . ILE A 1 77  ? -3.920  -0.112  4.747   1.00 0.00 ? 77  ILE A HB   5  
ATOM 8396  H HG12 . ILE A 1 77  ? -5.760  -0.874  7.038   1.00 0.00 ? 77  ILE A HG12 5  
ATOM 8397  H HG13 . ILE A 1 77  ? -4.730  0.556   6.962   1.00 0.00 ? 77  ILE A HG13 5  
ATOM 8398  H HG21 . ILE A 1 77  ? -4.917  -2.793  4.614   1.00 0.00 ? 77  ILE A HG21 5  
ATOM 8399  H HG22 . ILE A 1 77  ? -6.290  -1.701  4.786   1.00 0.00 ? 77  ILE A HG22 5  
ATOM 8400  H HG23 . ILE A 1 77  ? -5.151  -1.483  3.457   1.00 0.00 ? 77  ILE A HG23 5  
ATOM 8401  H HD11 . ILE A 1 77  ? -5.970  1.337   4.968   1.00 0.00 ? 77  ILE A HD11 5  
ATOM 8402  H HD12 . ILE A 1 77  ? -7.013  -0.082  5.070   1.00 0.00 ? 77  ILE A HD12 5  
ATOM 8403  H HD13 . ILE A 1 77  ? -7.044  1.129   6.351   1.00 0.00 ? 77  ILE A HD13 5  
ATOM 8404  N N    . TYR A 1 78  ? -2.116  -3.686  5.565   1.00 0.00 ? 78  TYR A N    5  
ATOM 8405  C CA   . TYR A 1 78  ? -1.390  -4.593  4.631   1.00 0.00 ? 78  TYR A CA   5  
ATOM 8406  C C    . TYR A 1 78  ? -2.378  -5.583  4.005   1.00 0.00 ? 78  TYR A C    5  
ATOM 8407  O O    . TYR A 1 78  ? -2.309  -6.773  4.236   1.00 0.00 ? 78  TYR A O    5  
ATOM 8408  C CB   . TYR A 1 78  ? -0.304  -5.366  5.386   1.00 0.00 ? 78  TYR A CB   5  
ATOM 8409  C CG   . TYR A 1 78  ? 0.326   -4.479  6.435   1.00 0.00 ? 78  TYR A CG   5  
ATOM 8410  C CD1  . TYR A 1 78  ? -0.258  -4.382  7.703   1.00 0.00 ? 78  TYR A CD1  5  
ATOM 8411  C CD2  . TYR A 1 78  ? 1.497   -3.761  6.145   1.00 0.00 ? 78  TYR A CD2  5  
ATOM 8412  C CE1  . TYR A 1 78  ? 0.324   -3.566  8.681   1.00 0.00 ? 78  TYR A CE1  5  
ATOM 8413  C CE2  . TYR A 1 78  ? 2.077   -2.946  7.125   1.00 0.00 ? 78  TYR A CE2  5  
ATOM 8414  C CZ   . TYR A 1 78  ? 1.490   -2.850  8.392   1.00 0.00 ? 78  TYR A CZ   5  
ATOM 8415  O OH   . TYR A 1 78  ? 2.062   -2.046  9.358   1.00 0.00 ? 78  TYR A OH   5  
ATOM 8416  H H    . TYR A 1 78  ? -2.220  -3.931  6.508   1.00 0.00 ? 78  TYR A H    5  
ATOM 8417  H HA   . TYR A 1 78  ? -0.934  -4.007  3.852   1.00 0.00 ? 78  TYR A HA   5  
ATOM 8418  H HB2  . TYR A 1 78  ? -0.744  -6.229  5.863   1.00 0.00 ? 78  TYR A HB2  5  
ATOM 8419  H HB3  . TYR A 1 78  ? 0.454   -5.690  4.689   1.00 0.00 ? 78  TYR A HB3  5  
ATOM 8420  H HD1  . TYR A 1 78  ? -1.157  -4.934  7.927   1.00 0.00 ? 78  TYR A HD1  5  
ATOM 8421  H HD2  . TYR A 1 78  ? 1.951   -3.833  5.166   1.00 0.00 ? 78  TYR A HD2  5  
ATOM 8422  H HE1  . TYR A 1 78  ? -0.128  -3.492  9.660   1.00 0.00 ? 78  TYR A HE1  5  
ATOM 8423  H HE2  . TYR A 1 78  ? 2.978   -2.393  6.903   1.00 0.00 ? 78  TYR A HE2  5  
ATOM 8424  H HH   . TYR A 1 78  ? 2.881   -2.459  9.641   1.00 0.00 ? 78  TYR A HH   5  
ATOM 8425  N N    . GLY A 1 79  ? -3.295  -5.099  3.209   1.00 0.00 ? 79  GLY A N    5  
ATOM 8426  C CA   . GLY A 1 79  ? -4.284  -6.013  2.565   1.00 0.00 ? 79  GLY A CA   5  
ATOM 8427  C C    . GLY A 1 79  ? -3.557  -7.242  2.017   1.00 0.00 ? 79  GLY A C    5  
ATOM 8428  O O    . GLY A 1 79  ? -2.389  -7.185  1.688   1.00 0.00 ? 79  GLY A O    5  
ATOM 8429  H H    . GLY A 1 79  ? -3.333  -4.135  3.033   1.00 0.00 ? 79  GLY A H    5  
ATOM 8430  H HA2  . GLY A 1 79  ? -5.019  -6.322  3.296   1.00 0.00 ? 79  GLY A HA2  5  
ATOM 8431  H HA3  . GLY A 1 79  ? -4.776  -5.498  1.755   1.00 0.00 ? 79  GLY A HA3  5  
ATOM 8432  N N    . LYS A 1 80  ? -4.232  -8.356  1.914   1.00 0.00 ? 80  LYS A N    5  
ATOM 8433  C CA   . LYS A 1 80  ? -3.561  -9.579  1.387   1.00 0.00 ? 80  LYS A CA   5  
ATOM 8434  C C    . LYS A 1 80  ? -4.590  -10.483 0.705   1.00 0.00 ? 80  LYS A C    5  
ATOM 8435  O O    . LYS A 1 80  ? -5.238  -11.288 1.344   1.00 0.00 ? 80  LYS A O    5  
ATOM 8436  C CB   . LYS A 1 80  ? -2.900  -10.336 2.540   1.00 0.00 ? 80  LYS A CB   5  
ATOM 8437  C CG   . LYS A 1 80  ? -3.910  -10.529 3.672   1.00 0.00 ? 80  LYS A CG   5  
ATOM 8438  C CD   . LYS A 1 80  ? -3.635  -11.857 4.379   1.00 0.00 ? 80  LYS A CD   5  
ATOM 8439  C CE   . LYS A 1 80  ? -2.267  -11.795 5.060   1.00 0.00 ? 80  LYS A CE   5  
ATOM 8440  N NZ   . LYS A 1 80  ? -2.128  -12.946 5.996   1.00 0.00 ? 80  LYS A NZ   5  
ATOM 8441  H H    . LYS A 1 80  ? -5.178  -8.387  2.180   1.00 0.00 ? 80  LYS A H    5  
ATOM 8442  H HA   . LYS A 1 80  ? -2.806  -9.291  0.669   1.00 0.00 ? 80  LYS A HA   5  
ATOM 8443  H HB2  . LYS A 1 80  ? -2.560  -11.299 2.189   1.00 0.00 ? 80  LYS A HB2  5  
ATOM 8444  H HB3  . LYS A 1 80  ? -2.056  -9.769  2.906   1.00 0.00 ? 80  LYS A HB3  5  
ATOM 8445  H HG2  . LYS A 1 80  ? -3.818  -9.717  4.379   1.00 0.00 ? 80  LYS A HG2  5  
ATOM 8446  H HG3  . LYS A 1 80  ? -4.909  -10.540 3.267   1.00 0.00 ? 80  LYS A HG3  5  
ATOM 8447  H HD2  . LYS A 1 80  ? -4.400  -12.037 5.119   1.00 0.00 ? 80  LYS A HD2  5  
ATOM 8448  H HD3  . LYS A 1 80  ? -3.637  -12.658 3.655   1.00 0.00 ? 80  LYS A HD3  5  
ATOM 8449  H HE2  . LYS A 1 80  ? -1.490  -11.843 4.313   1.00 0.00 ? 80  LYS A HE2  5  
ATOM 8450  H HE3  . LYS A 1 80  ? -2.180  -10.871 5.612   1.00 0.00 ? 80  LYS A HE3  5  
ATOM 8451  H HZ1  . LYS A 1 80  ? -2.773  -13.708 5.706   1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 8452  H HZ2  . LYS A 1 80  ? -1.148  -13.294 5.973   1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 8453  H HZ3  . LYS A 1 80  ? -2.367  -12.641 6.960   1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 8454  N N    . LYS A 1 81  ? -4.741  -10.366 -0.584  1.00 0.00 ? 81  LYS A N    5  
ATOM 8455  C CA   . LYS A 1 81  ? -5.725  -11.229 -1.293  1.00 0.00 ? 81  LYS A CA   5  
ATOM 8456  C C    . LYS A 1 81  ? -5.317  -12.696 -1.134  1.00 0.00 ? 81  LYS A C    5  
ATOM 8457  O O    . LYS A 1 81  ? -4.564  -13.045 -0.248  1.00 0.00 ? 81  LYS A O    5  
ATOM 8458  C CB   . LYS A 1 81  ? -5.752  -10.860 -2.778  1.00 0.00 ? 81  LYS A CB   5  
ATOM 8459  C CG   . LYS A 1 81  ? -7.132  -10.309 -3.144  1.00 0.00 ? 81  LYS A CG   5  
ATOM 8460  C CD   . LYS A 1 81  ? -7.765  -11.188 -4.227  1.00 0.00 ? 81  LYS A CD   5  
ATOM 8461  C CE   . LYS A 1 81  ? -7.331  -10.691 -5.608  1.00 0.00 ? 81  LYS A CE   5  
ATOM 8462  N NZ   . LYS A 1 81  ? -6.023  -11.305 -5.968  1.00 0.00 ? 81  LYS A NZ   5  
ATOM 8463  H H    . LYS A 1 81  ? -4.206  -9.715  -1.083  1.00 0.00 ? 81  LYS A H    5  
ATOM 8464  H HA   . LYS A 1 81  ? -6.706  -11.081 -0.867  1.00 0.00 ? 81  LYS A HA   5  
ATOM 8465  H HB2  . LYS A 1 81  ? -4.999  -10.109 -2.975  1.00 0.00 ? 81  LYS A HB2  5  
ATOM 8466  H HB3  . LYS A 1 81  ? -5.548  -11.739 -3.371  1.00 0.00 ? 81  LYS A HB3  5  
ATOM 8467  H HG2  . LYS A 1 81  ? -7.763  -10.310 -2.267  1.00 0.00 ? 81  LYS A HG2  5  
ATOM 8468  H HG3  . LYS A 1 81  ? -7.031  -9.301  -3.515  1.00 0.00 ? 81  LYS A HG3  5  
ATOM 8469  H HD2  . LYS A 1 81  ? -7.443  -12.210 -4.094  1.00 0.00 ? 81  LYS A HD2  5  
ATOM 8470  H HD3  . LYS A 1 81  ? -8.840  -11.135 -4.150  1.00 0.00 ? 81  LYS A HD3  5  
ATOM 8471  H HE2  . LYS A 1 81  ? -8.074  -10.971 -6.341  1.00 0.00 ? 81  LYS A HE2  5  
ATOM 8472  H HE3  . LYS A 1 81  ? -7.232  -9.616  -5.590  1.00 0.00 ? 81  LYS A HE3  5  
ATOM 8473  H HZ1  . LYS A 1 81  ? -5.788  -12.048 -5.278  1.00 0.00 ? 81  LYS A HZ1  5  
ATOM 8474  H HZ2  . LYS A 1 81  ? -6.084  -11.723 -6.918  1.00 0.00 ? 81  LYS A HZ2  5  
ATOM 8475  H HZ3  . LYS A 1 81  ? -5.282  -10.576 -5.960  1.00 0.00 ? 81  LYS A HZ3  5  
ATOM 8476  N N    . GLY A 1 82  ? -5.805  -13.558 -1.983  1.00 0.00 ? 82  GLY A N    5  
ATOM 8477  C CA   . GLY A 1 82  ? -5.435  -14.998 -1.871  1.00 0.00 ? 82  GLY A CA   5  
ATOM 8478  C C    . GLY A 1 82  ? -3.924  -15.117 -1.668  1.00 0.00 ? 82  GLY A C    5  
ATOM 8479  O O    . GLY A 1 82  ? -3.454  -15.410 -0.586  1.00 0.00 ? 82  GLY A O    5  
ATOM 8480  H H    . GLY A 1 82  ? -6.411  -13.261 -2.693  1.00 0.00 ? 82  GLY A H    5  
ATOM 8481  H HA2  . GLY A 1 82  ? -5.950  -15.437 -1.028  1.00 0.00 ? 82  GLY A HA2  5  
ATOM 8482  H HA3  . GLY A 1 82  ? -5.717  -15.516 -2.774  1.00 0.00 ? 82  GLY A HA3  5  
ATOM 8483  N N    . SER A 1 83  ? -3.158  -14.890 -2.699  1.00 0.00 ? 83  SER A N    5  
ATOM 8484  C CA   . SER A 1 83  ? -1.678  -14.988 -2.567  1.00 0.00 ? 83  SER A CA   5  
ATOM 8485  C C    . SER A 1 83  ? -1.059  -13.598 -2.721  1.00 0.00 ? 83  SER A C    5  
ATOM 8486  O O    . SER A 1 83  ? 0.026   -13.334 -2.242  1.00 0.00 ? 83  SER A O    5  
ATOM 8487  C CB   . SER A 1 83  ? -1.129  -15.914 -3.653  1.00 0.00 ? 83  SER A CB   5  
ATOM 8488  O OG   . SER A 1 83  ? -2.077  -16.013 -4.707  1.00 0.00 ? 83  SER A OG   5  
ATOM 8489  H H    . SER A 1 83  ? -3.558  -14.653 -3.563  1.00 0.00 ? 83  SER A H    5  
ATOM 8490  H HA   . SER A 1 83  ? -1.430  -15.389 -1.595  1.00 0.00 ? 83  SER A HA   5  
ATOM 8491  H HB2  . SER A 1 83  ? -0.209  -15.511 -4.041  1.00 0.00 ? 83  SER A HB2  5  
ATOM 8492  H HB3  . SER A 1 83  ? -0.941  -16.892 -3.230  1.00 0.00 ? 83  SER A HB3  5  
ATOM 8493  H HG   . SER A 1 83  ? -2.000  -16.889 -5.093  1.00 0.00 ? 83  SER A HG   5  
ATOM 8494  N N    . ALA A 1 84  ? -1.741  -12.706 -3.387  1.00 0.00 ? 84  ALA A N    5  
ATOM 8495  C CA   . ALA A 1 84  ? -1.191  -11.332 -3.571  1.00 0.00 ? 84  ALA A CA   5  
ATOM 8496  C C    . ALA A 1 84  ? -1.635  -10.453 -2.401  1.00 0.00 ? 84  ALA A C    5  
ATOM 8497  O O    . ALA A 1 84  ? -2.236  -10.923 -1.456  1.00 0.00 ? 84  ALA A O    5  
ATOM 8498  C CB   . ALA A 1 84  ? -1.719  -10.743 -4.881  1.00 0.00 ? 84  ALA A CB   5  
ATOM 8499  H H    . ALA A 1 84  ? -2.614  -12.939 -3.766  1.00 0.00 ? 84  ALA A H    5  
ATOM 8500  H HA   . ALA A 1 84  ? -0.112  -11.376 -3.602  1.00 0.00 ? 84  ALA A HA   5  
ATOM 8501  H HB1  . ALA A 1 84  ? -2.352  -11.467 -5.372  1.00 0.00 ? 84  ALA A HB1  5  
ATOM 8502  H HB2  . ALA A 1 84  ? -2.288  -9.850  -4.671  1.00 0.00 ? 84  ALA A HB2  5  
ATOM 8503  H HB3  . ALA A 1 84  ? -0.888  -10.497 -5.523  1.00 0.00 ? 84  ALA A HB3  5  
ATOM 8504  N N    . GLY A 1 85  ? -1.346  -9.180  -2.452  1.00 0.00 ? 85  GLY A N    5  
ATOM 8505  C CA   . GLY A 1 85  ? -1.761  -8.289  -1.330  1.00 0.00 ? 85  GLY A CA   5  
ATOM 8506  C C    . GLY A 1 85  ? -1.256  -6.865  -1.575  1.00 0.00 ? 85  GLY A C    5  
ATOM 8507  O O    . GLY A 1 85  ? -0.253  -6.652  -2.227  1.00 0.00 ? 85  GLY A O    5  
ATOM 8508  H H    . GLY A 1 85  ? -0.861  -8.814  -3.220  1.00 0.00 ? 85  GLY A H    5  
ATOM 8509  H HA2  . GLY A 1 85  ? -2.839  -8.282  -1.259  1.00 0.00 ? 85  GLY A HA2  5  
ATOM 8510  H HA3  . GLY A 1 85  ? -1.343  -8.659  -0.407  1.00 0.00 ? 85  GLY A HA3  5  
ATOM 8511  N N    . VAL A 1 86  ? -1.946  -5.890  -1.050  1.00 0.00 ? 86  VAL A N    5  
ATOM 8512  C CA   . VAL A 1 86  ? -1.512  -4.475  -1.239  1.00 0.00 ? 86  VAL A CA   5  
ATOM 8513  C C    . VAL A 1 86  ? -1.192  -3.872  0.132   1.00 0.00 ? 86  VAL A C    5  
ATOM 8514  O O    . VAL A 1 86  ? -2.010  -3.884  1.029   1.00 0.00 ? 86  VAL A O    5  
ATOM 8515  C CB   . VAL A 1 86  ? -2.645  -3.683  -1.900  1.00 0.00 ? 86  VAL A CB   5  
ATOM 8516  C CG1  . VAL A 1 86  ? -3.815  -3.553  -0.923  1.00 0.00 ? 86  VAL A CG1  5  
ATOM 8517  C CG2  . VAL A 1 86  ? -2.142  -2.288  -2.278  1.00 0.00 ? 86  VAL A CG2  5  
ATOM 8518  H H    . VAL A 1 86  ? -2.749  -6.087  -0.525  1.00 0.00 ? 86  VAL A H    5  
ATOM 8519  H HA   . VAL A 1 86  ? -0.631  -4.445  -1.868  1.00 0.00 ? 86  VAL A HA   5  
ATOM 8520  H HB   . VAL A 1 86  ? -2.974  -4.202  -2.788  1.00 0.00 ? 86  VAL A HB   5  
ATOM 8521  H HG11 . VAL A 1 86  ? -3.895  -4.455  -0.335  1.00 0.00 ? 86  VAL A HG11 5  
ATOM 8522  H HG12 . VAL A 1 86  ? -3.647  -2.710  -0.271  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 8523  H HG13 . VAL A 1 86  ? -4.730  -3.403  -1.477  1.00 0.00 ? 86  VAL A HG13 5  
ATOM 8524  H HG21 . VAL A 1 86  ? -1.069  -2.249  -2.168  1.00 0.00 ? 86  VAL A HG21 5  
ATOM 8525  H HG22 . VAL A 1 86  ? -2.408  -2.076  -3.303  1.00 0.00 ? 86  VAL A HG22 5  
ATOM 8526  H HG23 . VAL A 1 86  ? -2.597  -1.555  -1.629  1.00 0.00 ? 86  VAL A HG23 5  
ATOM 8527  N N    . ILE A 1 87  ? -0.005  -3.356  0.311   1.00 0.00 ? 87  ILE A N    5  
ATOM 8528  C CA   . ILE A 1 87  ? 0.353   -2.772  1.636   1.00 0.00 ? 87  ILE A CA   5  
ATOM 8529  C C    . ILE A 1 87  ? 0.238   -1.248  1.590   1.00 0.00 ? 87  ILE A C    5  
ATOM 8530  O O    . ILE A 1 87  ? 1.184   -0.554  1.283   1.00 0.00 ? 87  ILE A O    5  
ATOM 8531  C CB   . ILE A 1 87  ? 1.787   -3.162  1.998   1.00 0.00 ? 87  ILE A CB   5  
ATOM 8532  C CG1  . ILE A 1 87  ? 1.842   -4.658  2.320   1.00 0.00 ? 87  ILE A CG1  5  
ATOM 8533  C CG2  . ILE A 1 87  ? 2.238   -2.361  3.221   1.00 0.00 ? 87  ILE A CG2  5  
ATOM 8534  C CD1  . ILE A 1 87  ? 3.294   -5.139  2.267   1.00 0.00 ? 87  ILE A CD1  5  
ATOM 8535  H H    . ILE A 1 87  ? 0.650   -3.360  -0.418  1.00 0.00 ? 87  ILE A H    5  
ATOM 8536  H HA   . ILE A 1 87  ? -0.319  -3.154  2.384   1.00 0.00 ? 87  ILE A HA   5  
ATOM 8537  H HB   . ILE A 1 87  ? 2.441   -2.946  1.166   1.00 0.00 ? 87  ILE A HB   5  
ATOM 8538  H HG12 . ILE A 1 87  ? 1.441   -4.828  3.309   1.00 0.00 ? 87  ILE A HG12 5  
ATOM 8539  H HG13 . ILE A 1 87  ? 1.257   -5.204  1.595   1.00 0.00 ? 87  ILE A HG13 5  
ATOM 8540  H HG21 . ILE A 1 87  ? 1.377   -2.105  3.820   1.00 0.00 ? 87  ILE A HG21 5  
ATOM 8541  H HG22 . ILE A 1 87  ? 2.922   -2.955  3.809   1.00 0.00 ? 87  ILE A HG22 5  
ATOM 8542  H HG23 . ILE A 1 87  ? 2.734   -1.458  2.897   1.00 0.00 ? 87  ILE A HG23 5  
ATOM 8543  H HD11 . ILE A 1 87  ? 3.958   -4.298  2.402   1.00 0.00 ? 87  ILE A HD11 5  
ATOM 8544  H HD12 . ILE A 1 87  ? 3.462   -5.862  3.052   1.00 0.00 ? 87  ILE A HD12 5  
ATOM 8545  H HD13 . ILE A 1 87  ? 3.485   -5.600  1.309   1.00 0.00 ? 87  ILE A HD13 5  
ATOM 8546  N N    . THR A 1 88  ? -0.913  -0.720  1.899   1.00 0.00 ? 88  THR A N    5  
ATOM 8547  C CA   . THR A 1 88  ? -1.076  0.760   1.874   1.00 0.00 ? 88  THR A CA   5  
ATOM 8548  C C    . THR A 1 88  ? -1.022  1.308   3.303   1.00 0.00 ? 88  THR A C    5  
ATOM 8549  O O    . THR A 1 88  ? -1.627  0.772   4.209   1.00 0.00 ? 88  THR A O    5  
ATOM 8550  C CB   . THR A 1 88  ? -2.422  1.117   1.239   1.00 0.00 ? 88  THR A CB   5  
ATOM 8551  O OG1  . THR A 1 88  ? -3.461  0.891   2.181   1.00 0.00 ? 88  THR A OG1  5  
ATOM 8552  C CG2  . THR A 1 88  ? -2.653  0.250   -0.001  1.00 0.00 ? 88  THR A CG2  5  
ATOM 8553  H H    . THR A 1 88  ? -1.666  -1.293  2.151   1.00 0.00 ? 88  THR A H    5  
ATOM 8554  H HA   . THR A 1 88  ? -0.279  1.193   1.295   1.00 0.00 ? 88  THR A HA   5  
ATOM 8555  H HB   . THR A 1 88  ? -2.417  2.156   0.949   1.00 0.00 ? 88  THR A HB   5  
ATOM 8556  H HG1  . THR A 1 88  ? -3.556  1.683   2.715   1.00 0.00 ? 88  THR A HG1  5  
ATOM 8557  H HG21 . THR A 1 88  ? -1.899  -0.520  -0.048  1.00 0.00 ? 88  THR A HG21 5  
ATOM 8558  H HG22 . THR A 1 88  ? -3.631  -0.206  0.056   1.00 0.00 ? 88  THR A HG22 5  
ATOM 8559  H HG23 . THR A 1 88  ? -2.595  0.866   -0.887  1.00 0.00 ? 88  THR A HG23 5  
ATOM 8560  N N    . VAL A 1 89  ? -0.297  2.376   3.511   1.00 0.00 ? 89  VAL A N    5  
ATOM 8561  C CA   . VAL A 1 89  ? -0.202  2.960   4.881   1.00 0.00 ? 89  VAL A CA   5  
ATOM 8562  C C    . VAL A 1 89  ? -0.009  4.475   4.778   1.00 0.00 ? 89  VAL A C    5  
ATOM 8563  O O    . VAL A 1 89  ? 0.473   4.983   3.786   1.00 0.00 ? 89  VAL A O    5  
ATOM 8564  C CB   . VAL A 1 89  ? 0.992   2.349   5.616   1.00 0.00 ? 89  VAL A CB   5  
ATOM 8565  C CG1  . VAL A 1 89  ? 1.043   2.889   7.046   1.00 0.00 ? 89  VAL A CG1  5  
ATOM 8566  C CG2  . VAL A 1 89  ? 0.850   0.826   5.654   1.00 0.00 ? 89  VAL A CG2  5  
ATOM 8567  H H    . VAL A 1 89  ? 0.184   2.793   2.765   1.00 0.00 ? 89  VAL A H    5  
ATOM 8568  H HA   . VAL A 1 89  ? -1.109  2.747   5.427   1.00 0.00 ? 89  VAL A HA   5  
ATOM 8569  H HB   . VAL A 1 89  ? 1.904   2.614   5.102   1.00 0.00 ? 89  VAL A HB   5  
ATOM 8570  H HG11 . VAL A 1 89  ? 0.037   3.065   7.400   1.00 0.00 ? 89  VAL A HG11 5  
ATOM 8571  H HG12 . VAL A 1 89  ? 1.528   2.168   7.686   1.00 0.00 ? 89  VAL A HG12 5  
ATOM 8572  H HG13 . VAL A 1 89  ? 1.597   3.815   7.062   1.00 0.00 ? 89  VAL A HG13 5  
ATOM 8573  H HG21 . VAL A 1 89  ? 0.684   0.455   4.654   1.00 0.00 ? 89  VAL A HG21 5  
ATOM 8574  H HG22 . VAL A 1 89  ? 1.754   0.390   6.054   1.00 0.00 ? 89  VAL A HG22 5  
ATOM 8575  H HG23 . VAL A 1 89  ? 0.014   0.558   6.281   1.00 0.00 ? 89  VAL A HG23 5  
ATOM 8576  N N    . LYS A 1 90  ? -0.377  5.203   5.798   1.00 0.00 ? 90  LYS A N    5  
ATOM 8577  C CA   . LYS A 1 90  ? -0.206  6.682   5.755   1.00 0.00 ? 90  LYS A CA   5  
ATOM 8578  C C    . LYS A 1 90  ? 1.026   7.077   6.571   1.00 0.00 ? 90  LYS A C    5  
ATOM 8579  O O    . LYS A 1 90  ? 1.207   6.639   7.691   1.00 0.00 ? 90  LYS A O    5  
ATOM 8580  C CB   . LYS A 1 90  ? -1.446  7.363   6.340   1.00 0.00 ? 90  LYS A CB   5  
ATOM 8581  C CG   . LYS A 1 90  ? -2.080  8.266   5.280   1.00 0.00 ? 90  LYS A CG   5  
ATOM 8582  C CD   . LYS A 1 90  ? -1.456  9.662   5.361   1.00 0.00 ? 90  LYS A CD   5  
ATOM 8583  C CE   . LYS A 1 90  ? -2.555  10.724  5.285   1.00 0.00 ? 90  LYS A CE   5  
ATOM 8584  N NZ   . LYS A 1 90  ? -1.965  12.015  4.832   1.00 0.00 ? 90  LYS A NZ   5  
ATOM 8585  H H    . LYS A 1 90  ? -0.760  4.775   6.592   1.00 0.00 ? 90  LYS A H    5  
ATOM 8586  H HA   . LYS A 1 90  ? -0.073  6.999   4.731   1.00 0.00 ? 90  LYS A HA   5  
ATOM 8587  H HB2  . LYS A 1 90  ? -2.159  6.610   6.646   1.00 0.00 ? 90  LYS A HB2  5  
ATOM 8588  H HB3  . LYS A 1 90  ? -1.162  7.958   7.194   1.00 0.00 ? 90  LYS A HB3  5  
ATOM 8589  H HG2  . LYS A 1 90  ? -1.905  7.848   4.300   1.00 0.00 ? 90  LYS A HG2  5  
ATOM 8590  H HG3  . LYS A 1 90  ? -3.143  8.339   5.457   1.00 0.00 ? 90  LYS A HG3  5  
ATOM 8591  H HD2  . LYS A 1 90  ? -0.921  9.763   6.294   1.00 0.00 ? 90  LYS A HD2  5  
ATOM 8592  H HD3  . LYS A 1 90  ? -0.770  9.797   4.537   1.00 0.00 ? 90  LYS A HD3  5  
ATOM 8593  H HE2  . LYS A 1 90  ? -3.313  10.409  4.583   1.00 0.00 ? 90  LYS A HE2  5  
ATOM 8594  H HE3  . LYS A 1 90  ? -2.998  10.853  6.260   1.00 0.00 ? 90  LYS A HE3  5  
ATOM 8595  H HZ1  . LYS A 1 90  ? -0.952  11.885  4.634   1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 8596  H HZ2  . LYS A 1 90  ? -2.446  12.332  3.966   1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 8597  H HZ3  . LYS A 1 90  ? -2.083  12.731  5.577   1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 8598  N N    . THR A 1 91  ? 1.876   7.900   6.020   1.00 0.00 ? 91  THR A N    5  
ATOM 8599  C CA   . THR A 1 91  ? 3.097   8.321   6.763   1.00 0.00 ? 91  THR A CA   5  
ATOM 8600  C C    . THR A 1 91  ? 2.943   9.781   7.202   1.00 0.00 ? 91  THR A C    5  
ATOM 8601  O O    . THR A 1 91  ? 2.320   10.073  8.204   1.00 0.00 ? 91  THR A O    5  
ATOM 8602  C CB   . THR A 1 91  ? 4.318   8.177   5.851   1.00 0.00 ? 91  THR A CB   5  
ATOM 8603  O OG1  . THR A 1 91  ? 3.997   8.664   4.557   1.00 0.00 ? 91  THR A OG1  5  
ATOM 8604  C CG2  . THR A 1 91  ? 4.717   6.702   5.757   1.00 0.00 ? 91  THR A CG2  5  
ATOM 8605  H H    . THR A 1 91  ? 1.711   8.240   5.116   1.00 0.00 ? 91  THR A H    5  
ATOM 8606  H HA   . THR A 1 91  ? 3.221   7.695   7.634   1.00 0.00 ? 91  THR A HA   5  
ATOM 8607  H HB   . THR A 1 91  ? 5.141   8.743   6.257   1.00 0.00 ? 91  THR A HB   5  
ATOM 8608  H HG1  . THR A 1 91  ? 4.646   8.317   3.940   1.00 0.00 ? 91  THR A HG1  5  
ATOM 8609  H HG21 . THR A 1 91  ? 3.873   6.122   5.414   1.00 0.00 ? 91  THR A HG21 5  
ATOM 8610  H HG22 . THR A 1 91  ? 5.535   6.594   5.059   1.00 0.00 ? 91  THR A HG22 5  
ATOM 8611  H HG23 . THR A 1 91  ? 5.026   6.350   6.730   1.00 0.00 ? 91  THR A HG23 5  
ATOM 8612  N N    . SER A 1 92  ? 3.500   10.704  6.462   1.00 0.00 ? 92  SER A N    5  
ATOM 8613  C CA   . SER A 1 92  ? 3.374   12.140  6.842   1.00 0.00 ? 92  SER A CA   5  
ATOM 8614  C C    . SER A 1 92  ? 2.897   12.948  5.633   1.00 0.00 ? 92  SER A C    5  
ATOM 8615  O O    . SER A 1 92  ? 2.196   13.930  5.768   1.00 0.00 ? 92  SER A O    5  
ATOM 8616  C CB   . SER A 1 92  ? 4.732   12.669  7.308   1.00 0.00 ? 92  SER A CB   5  
ATOM 8617  O OG   . SER A 1 92  ? 5.472   13.119  6.181   1.00 0.00 ? 92  SER A OG   5  
ATOM 8618  H H    . SER A 1 92  ? 3.996   10.453  5.657   1.00 0.00 ? 92  SER A H    5  
ATOM 8619  H HA   . SER A 1 92  ? 2.657   12.237  7.644   1.00 0.00 ? 92  SER A HA   5  
ATOM 8620  H HB2  . SER A 1 92  ? 4.585   13.493  7.987   1.00 0.00 ? 92  SER A HB2  5  
ATOM 8621  H HB3  . SER A 1 92  ? 5.270   11.879  7.814   1.00 0.00 ? 92  SER A HB3  5  
ATOM 8622  H HG   . SER A 1 92  ? 5.398   12.453  5.494   1.00 0.00 ? 92  SER A HG   5  
ATOM 8623  N N    . LYS A 1 93  ? 3.271   12.540  4.449   1.00 0.00 ? 93  LYS A N    5  
ATOM 8624  C CA   . LYS A 1 93  ? 2.838   13.282  3.233   1.00 0.00 ? 93  LYS A CA   5  
ATOM 8625  C C    . LYS A 1 93  ? 2.876   12.342  2.025   1.00 0.00 ? 93  LYS A C    5  
ATOM 8626  O O    . LYS A 1 93  ? 3.462   12.650  1.006   1.00 0.00 ? 93  LYS A O    5  
ATOM 8627  C CB   . LYS A 1 93  ? 3.785   14.459  2.990   1.00 0.00 ? 93  LYS A CB   5  
ATOM 8628  C CG   . LYS A 1 93  ? 2.999   15.768  3.048   1.00 0.00 ? 93  LYS A CG   5  
ATOM 8629  C CD   . LYS A 1 93  ? 3.359   16.633  1.839   1.00 0.00 ? 93  LYS A CD   5  
ATOM 8630  C CE   . LYS A 1 93  ? 2.841   18.054  2.057   1.00 0.00 ? 93  LYS A CE   5  
ATOM 8631  N NZ   . LYS A 1 93  ? 1.515   18.000  2.735   1.00 0.00 ? 93  LYS A NZ   5  
ATOM 8632  H H    . LYS A 1 93  ? 3.837   11.746  4.360   1.00 0.00 ? 93  LYS A H    5  
ATOM 8633  H HA   . LYS A 1 93  ? 1.832   13.652  3.372   1.00 0.00 ? 93  LYS A HA   5  
ATOM 8634  H HB2  . LYS A 1 93  ? 4.554   14.464  3.750   1.00 0.00 ? 93  LYS A HB2  5  
ATOM 8635  H HB3  . LYS A 1 93  ? 4.241   14.358  2.016   1.00 0.00 ? 93  LYS A HB3  5  
ATOM 8636  H HG2  . LYS A 1 93  ? 1.940   15.553  3.035   1.00 0.00 ? 93  LYS A HG2  5  
ATOM 8637  H HG3  . LYS A 1 93  ? 3.248   16.298  3.954   1.00 0.00 ? 93  LYS A HG3  5  
ATOM 8638  H HD2  . LYS A 1 93  ? 4.434   16.654  1.719   1.00 0.00 ? 93  LYS A HD2  5  
ATOM 8639  H HD3  . LYS A 1 93  ? 2.905   16.218  0.952   1.00 0.00 ? 93  LYS A HD3  5  
ATOM 8640  H HE2  . LYS A 1 93  ? 3.539   18.601  2.675   1.00 0.00 ? 93  LYS A HE2  5  
ATOM 8641  H HE3  . LYS A 1 93  ? 2.738   18.551  1.104   1.00 0.00 ? 93  LYS A HE3  5  
ATOM 8642  H HZ1  . LYS A 1 93  ? 0.951   17.224  2.331   1.00 0.00 ? 93  LYS A HZ1  5  
ATOM 8643  H HZ2  . LYS A 1 93  ? 1.651   17.838  3.753   1.00 0.00 ? 93  LYS A HZ2  5  
ATOM 8644  H HZ3  . LYS A 1 93  ? 1.017   18.901  2.593   1.00 0.00 ? 93  LYS A HZ3  5  
ATOM 8645  N N    . SER A 1 94  ? 2.258   11.196  2.132   1.00 0.00 ? 94  SER A N    5  
ATOM 8646  C CA   . SER A 1 94  ? 2.266   10.239  0.989   1.00 0.00 ? 94  SER A CA   5  
ATOM 8647  C C    . SER A 1 94  ? 1.454   8.994   1.358   1.00 0.00 ? 94  SER A C    5  
ATOM 8648  O O    . SER A 1 94  ? 1.242   8.700   2.517   1.00 0.00 ? 94  SER A O    5  
ATOM 8649  C CB   . SER A 1 94  ? 3.707   9.833   0.679   1.00 0.00 ? 94  SER A CB   5  
ATOM 8650  O OG   . SER A 1 94  ? 3.730   8.486   0.226   1.00 0.00 ? 94  SER A OG   5  
ATOM 8651  H H    . SER A 1 94  ? 1.794   10.965  2.962   1.00 0.00 ? 94  SER A H    5  
ATOM 8652  H HA   . SER A 1 94  ? 1.829   10.709  0.120   1.00 0.00 ? 94  SER A HA   5  
ATOM 8653  H HB2  . SER A 1 94  ? 4.106   10.472  -0.090  1.00 0.00 ? 94  SER A HB2  5  
ATOM 8654  H HB3  . SER A 1 94  ? 4.308   9.933   1.575   1.00 0.00 ? 94  SER A HB3  5  
ATOM 8655  H HG   . SER A 1 94  ? 4.110   8.476   -0.657  1.00 0.00 ? 94  SER A HG   5  
ATOM 8656  N N    . ILE A 1 95  ? 1.001   8.255   0.380   1.00 0.00 ? 95  ILE A N    5  
ATOM 8657  C CA   . ILE A 1 95  ? 0.210   7.028   0.681   1.00 0.00 ? 95  ILE A CA   5  
ATOM 8658  C C    . ILE A 1 95  ? 0.922   5.809   0.089   1.00 0.00 ? 95  ILE A C    5  
ATOM 8659  O O    . ILE A 1 95  ? 1.014   5.653   -1.113  1.00 0.00 ? 95  ILE A O    5  
ATOM 8660  C CB   . ILE A 1 95  ? -1.189  7.155   0.076   1.00 0.00 ? 95  ILE A CB   5  
ATOM 8661  C CG1  . ILE A 1 95  ? -2.008  8.162   0.889   1.00 0.00 ? 95  ILE A CG1  5  
ATOM 8662  C CG2  . ILE A 1 95  ? -1.885  5.793   0.111   1.00 0.00 ? 95  ILE A CG2  5  
ATOM 8663  C CD1  . ILE A 1 95  ? -3.436  8.225   0.343   1.00 0.00 ? 95  ILE A CD1  5  
ATOM 8664  H H    . ILE A 1 95  ? 1.185   8.504   -0.549  1.00 0.00 ? 95  ILE A H    5  
ATOM 8665  H HA   . ILE A 1 95  ? 0.128   6.909   1.753   1.00 0.00 ? 95  ILE A HA   5  
ATOM 8666  H HB   . ILE A 1 95  ? -1.111  7.493   -0.948  1.00 0.00 ? 95  ILE A HB   5  
ATOM 8667  H HG12 . ILE A 1 95  ? -2.031  7.853   1.924   1.00 0.00 ? 95  ILE A HG12 5  
ATOM 8668  H HG13 . ILE A 1 95  ? -1.553  9.139   0.816   1.00 0.00 ? 95  ILE A HG13 5  
ATOM 8669  H HG21 . ILE A 1 95  ? -1.829  5.387   1.111   1.00 0.00 ? 95  ILE A HG21 5  
ATOM 8670  H HG22 . ILE A 1 95  ? -2.920  5.907   -0.173  1.00 0.00 ? 95  ILE A HG22 5  
ATOM 8671  H HG23 . ILE A 1 95  ? -1.394  5.120   -0.577  1.00 0.00 ? 95  ILE A HG23 5  
ATOM 8672  H HD11 . ILE A 1 95  ? -3.725  7.251   -0.024  1.00 0.00 ? 95  ILE A HD11 5  
ATOM 8673  H HD12 . ILE A 1 95  ? -4.109  8.527   1.131   1.00 0.00 ? 95  ILE A HD12 5  
ATOM 8674  H HD13 . ILE A 1 95  ? -3.483  8.942   -0.464  1.00 0.00 ? 95  ILE A HD13 5  
ATOM 8675  N N    . LEU A 1 96  ? 1.429   4.946   0.926   1.00 0.00 ? 96  LEU A N    5  
ATOM 8676  C CA   . LEU A 1 96  ? 2.142   3.738   0.418   1.00 0.00 ? 96  LEU A CA   5  
ATOM 8677  C C    . LEU A 1 96  ? 1.147   2.809   -0.276  1.00 0.00 ? 96  LEU A C    5  
ATOM 8678  O O    . LEU A 1 96  ? -0.027  2.800   0.038   1.00 0.00 ? 96  LEU A O    5  
ATOM 8679  C CB   . LEU A 1 96  ? 2.788   2.988   1.586   1.00 0.00 ? 96  LEU A CB   5  
ATOM 8680  C CG   . LEU A 1 96  ? 3.394   3.981   2.581   1.00 0.00 ? 96  LEU A CG   5  
ATOM 8681  C CD1  . LEU A 1 96  ? 4.213   3.216   3.621   1.00 0.00 ? 96  LEU A CD1  5  
ATOM 8682  C CD2  . LEU A 1 96  ? 4.305   4.960   1.836   1.00 0.00 ? 96  LEU A CD2  5  
ATOM 8683  H H    . LEU A 1 96  ? 1.343   5.094   1.888   1.00 0.00 ? 96  LEU A H    5  
ATOM 8684  H HA   . LEU A 1 96  ? 2.904   4.037   -0.284  1.00 0.00 ? 96  LEU A HA   5  
ATOM 8685  H HB2  . LEU A 1 96  ? 2.039   2.391   2.086   1.00 0.00 ? 96  LEU A HB2  5  
ATOM 8686  H HB3  . LEU A 1 96  ? 3.566   2.341   1.208   1.00 0.00 ? 96  LEU A HB3  5  
ATOM 8687  H HG   . LEU A 1 96  ? 2.605   4.524   3.078   1.00 0.00 ? 96  LEU A HG   5  
ATOM 8688  H HD11 . LEU A 1 96  ? 4.548   2.282   3.196   1.00 0.00 ? 96  LEU A HD11 5  
ATOM 8689  H HD12 . LEU A 1 96  ? 5.067   3.807   3.915   1.00 0.00 ? 96  LEU A HD12 5  
ATOM 8690  H HD13 . LEU A 1 96  ? 3.600   3.017   4.487   1.00 0.00 ? 96  LEU A HD13 5  
ATOM 8691  H HD21 . LEU A 1 96  ? 5.025   4.409   1.251   1.00 0.00 ? 96  LEU A HD21 5  
ATOM 8692  H HD22 . LEU A 1 96  ? 3.709   5.581   1.183   1.00 0.00 ? 96  LEU A HD22 5  
ATOM 8693  H HD23 . LEU A 1 96  ? 4.823   5.583   2.550   1.00 0.00 ? 96  LEU A HD23 5  
ATOM 8694  N N    . VAL A 1 97  ? 1.607   2.020   -1.212  1.00 0.00 ? 97  VAL A N    5  
ATOM 8695  C CA   . VAL A 1 97  ? 0.687   1.085   -1.918  1.00 0.00 ? 97  VAL A CA   5  
ATOM 8696  C C    . VAL A 1 97  ? 1.457   -0.154  -2.371  1.00 0.00 ? 97  VAL A C    5  
ATOM 8697  O O    . VAL A 1 97  ? 1.433   -0.515  -3.528  1.00 0.00 ? 97  VAL A O    5  
ATOM 8698  C CB   . VAL A 1 97  ? 0.081   1.771   -3.141  1.00 0.00 ? 97  VAL A CB   5  
ATOM 8699  C CG1  . VAL A 1 97  ? -0.883  0.810   -3.839  1.00 0.00 ? 97  VAL A CG1  5  
ATOM 8700  C CG2  . VAL A 1 97  ? -0.678  3.021   -2.693  1.00 0.00 ? 97  VAL A CG2  5  
ATOM 8701  H H    . VAL A 1 97  ? 2.559   2.040   -1.445  1.00 0.00 ? 97  VAL A H    5  
ATOM 8702  H HA   . VAL A 1 97  ? -0.104  0.787   -1.247  1.00 0.00 ? 97  VAL A HA   5  
ATOM 8703  H HB   . VAL A 1 97  ? 0.870   2.046   -3.826  1.00 0.00 ? 97  VAL A HB   5  
ATOM 8704  H HG11 . VAL A 1 97  ? -0.739  -0.188  -3.453  1.00 0.00 ? 97  VAL A HG11 5  
ATOM 8705  H HG12 . VAL A 1 97  ? -1.899  1.123   -3.657  1.00 0.00 ? 97  VAL A HG12 5  
ATOM 8706  H HG13 . VAL A 1 97  ? -0.689  0.814   -4.902  1.00 0.00 ? 97  VAL A HG13 5  
ATOM 8707  H HG21 . VAL A 1 97  ? -1.131  2.840   -1.730  1.00 0.00 ? 97  VAL A HG21 5  
ATOM 8708  H HG22 . VAL A 1 97  ? 0.008   3.851   -2.619  1.00 0.00 ? 97  VAL A HG22 5  
ATOM 8709  H HG23 . VAL A 1 97  ? -1.447  3.252   -3.414  1.00 0.00 ? 97  VAL A HG23 5  
ATOM 8710  N N    . GLY A 1 98  ? 2.137   -0.814  -1.473  1.00 0.00 ? 98  GLY A N    5  
ATOM 8711  C CA   . GLY A 1 98  ? 2.893   -2.033  -1.869  1.00 0.00 ? 98  GLY A CA   5  
ATOM 8712  C C    . GLY A 1 98  ? 2.002   -2.895  -2.762  1.00 0.00 ? 98  GLY A C    5  
ATOM 8713  O O    . GLY A 1 98  ? 0.829   -3.068  -2.502  1.00 0.00 ? 98  GLY A O    5  
ATOM 8714  H H    . GLY A 1 98  ? 2.144   -0.510  -0.544  1.00 0.00 ? 98  GLY A H    5  
ATOM 8715  H HA2  . GLY A 1 98  ? 3.784   -1.746  -2.409  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 8716  H HA3  . GLY A 1 98  ? 3.165   -2.594  -0.989  1.00 0.00 ? 98  GLY A HA3  5  
ATOM 8717  N N    . VAL A 1 99  ? 2.543   -3.436  -3.815  1.00 0.00 ? 99  VAL A N    5  
ATOM 8718  C CA   . VAL A 1 99  ? 1.717   -4.281  -4.720  1.00 0.00 ? 99  VAL A CA   5  
ATOM 8719  C C    . VAL A 1 99  ? 2.551   -5.494  -5.156  1.00 0.00 ? 99  VAL A C    5  
ATOM 8720  O O    . VAL A 1 99  ? 3.587   -5.360  -5.781  1.00 0.00 ? 99  VAL A O    5  
ATOM 8721  C CB   . VAL A 1 99  ? 1.288   -3.455  -5.947  1.00 0.00 ? 99  VAL A CB   5  
ATOM 8722  C CG1  . VAL A 1 99  ? 0.058   -4.093  -6.591  1.00 0.00 ? 99  VAL A CG1  5  
ATOM 8723  C CG2  . VAL A 1 99  ? 0.922   -2.025  -5.522  1.00 0.00 ? 99  VAL A CG2  5  
ATOM 8724  H H    . VAL A 1 99  ? 3.493   -3.290  -4.011  1.00 0.00 ? 99  VAL A H    5  
ATOM 8725  H HA   . VAL A 1 99  ? 0.838   -4.620  -4.187  1.00 0.00 ? 99  VAL A HA   5  
ATOM 8726  H HB   . VAL A 1 99  ? 2.096   -3.425  -6.663  1.00 0.00 ? 99  VAL A HB   5  
ATOM 8727  H HG11 . VAL A 1 99  ? -0.371  -4.814  -5.911  1.00 0.00 ? 99  VAL A HG11 5  
ATOM 8728  H HG12 . VAL A 1 99  ? -0.672  -3.325  -6.807  1.00 0.00 ? 99  VAL A HG12 5  
ATOM 8729  H HG13 . VAL A 1 99  ? 0.343   -4.585  -7.507  1.00 0.00 ? 99  VAL A HG13 5  
ATOM 8730  H HG21 . VAL A 1 99  ? 0.447   -2.046  -4.552  1.00 0.00 ? 99  VAL A HG21 5  
ATOM 8731  H HG22 . VAL A 1 99  ? 1.812   -1.417  -5.473  1.00 0.00 ? 99  VAL A HG22 5  
ATOM 8732  H HG23 . VAL A 1 99  ? 0.239   -1.597  -6.245  1.00 0.00 ? 99  VAL A HG23 5  
ATOM 8733  N N    . TYR A 1 100 ? 2.119   -6.681  -4.813  1.00 0.00 ? 100 TYR A N    5  
ATOM 8734  C CA   . TYR A 1 100 ? 2.894   -7.899  -5.193  1.00 0.00 ? 100 TYR A CA   5  
ATOM 8735  C C    . TYR A 1 100 ? 1.935   -8.998  -5.660  1.00 0.00 ? 100 TYR A C    5  
ATOM 8736  O O    . TYR A 1 100 ? 0.744   -8.937  -5.422  1.00 0.00 ? 100 TYR A O    5  
ATOM 8737  C CB   . TYR A 1 100 ? 3.678   -8.397  -3.975  1.00 0.00 ? 100 TYR A CB   5  
ATOM 8738  C CG   . TYR A 1 100 ? 2.816   -8.273  -2.742  1.00 0.00 ? 100 TYR A CG   5  
ATOM 8739  C CD1  . TYR A 1 100 ? 1.929   -9.300  -2.401  1.00 0.00 ? 100 TYR A CD1  5  
ATOM 8740  C CD2  . TYR A 1 100 ? 2.898   -7.125  -1.944  1.00 0.00 ? 100 TYR A CD2  5  
ATOM 8741  C CE1  . TYR A 1 100 ? 1.125   -9.181  -1.262  1.00 0.00 ? 100 TYR A CE1  5  
ATOM 8742  C CE2  . TYR A 1 100 ? 2.095   -7.007  -0.804  1.00 0.00 ? 100 TYR A CE2  5  
ATOM 8743  C CZ   . TYR A 1 100 ? 1.207   -8.034  -0.465  1.00 0.00 ? 100 TYR A CZ   5  
ATOM 8744  O OH   . TYR A 1 100 ? 0.413   -7.917  0.658   1.00 0.00 ? 100 TYR A OH   5  
ATOM 8745  H H    . TYR A 1 100 ? 1.291   -6.769  -4.297  1.00 0.00 ? 100 TYR A H    5  
ATOM 8746  H HA   . TYR A 1 100 ? 3.581   -7.656  -5.990  1.00 0.00 ? 100 TYR A HA   5  
ATOM 8747  H HB2  . TYR A 1 100 ? 3.952   -9.432  -4.122  1.00 0.00 ? 100 TYR A HB2  5  
ATOM 8748  H HB3  . TYR A 1 100 ? 4.571   -7.801  -3.853  1.00 0.00 ? 100 TYR A HB3  5  
ATOM 8749  H HD1  . TYR A 1 100 ? 1.866   -10.185 -3.016  1.00 0.00 ? 100 TYR A HD1  5  
ATOM 8750  H HD2  . TYR A 1 100 ? 3.584   -6.333  -2.206  1.00 0.00 ? 100 TYR A HD2  5  
ATOM 8751  H HE1  . TYR A 1 100 ? 0.440   -9.974  -0.999  1.00 0.00 ? 100 TYR A HE1  5  
ATOM 8752  H HE2  . TYR A 1 100 ? 2.158   -6.122  -0.187  1.00 0.00 ? 100 TYR A HE2  5  
ATOM 8753  H HH   . TYR A 1 100 ? 0.622   -7.082  1.083   1.00 0.00 ? 100 TYR A HH   5  
ATOM 8754  N N    . ASN A 1 101 ? 2.446   -10.003 -6.323  1.00 0.00 ? 101 ASN A N    5  
ATOM 8755  C CA   . ASN A 1 101 ? 1.564   -11.105 -6.806  1.00 0.00 ? 101 ASN A CA   5  
ATOM 8756  C C    . ASN A 1 101 ? 1.855   -12.389 -6.019  1.00 0.00 ? 101 ASN A C    5  
ATOM 8757  O O    . ASN A 1 101 ? 2.155   -12.352 -4.843  1.00 0.00 ? 101 ASN A O    5  
ATOM 8758  C CB   . ASN A 1 101 ? 1.819   -11.344 -8.297  1.00 0.00 ? 101 ASN A CB   5  
ATOM 8759  C CG   . ASN A 1 101 ? 3.219   -11.927 -8.493  1.00 0.00 ? 101 ASN A CG   5  
ATOM 8760  O OD1  . ASN A 1 101 ? 4.204   -11.288 -8.185  1.00 0.00 ? 101 ASN A OD1  5  
ATOM 8761  N ND2  . ASN A 1 101 ? 3.349   -13.125 -8.997  1.00 0.00 ? 101 ASN A ND2  5  
ATOM 8762  H H    . ASN A 1 101 ? 3.408   -10.032 -6.503  1.00 0.00 ? 101 ASN A H    5  
ATOM 8763  H HA   . ASN A 1 101 ? 0.532   -10.826 -6.662  1.00 0.00 ? 101 ASN A HA   5  
ATOM 8764  H HB2  . ASN A 1 101 ? 1.082   -12.035 -8.682  1.00 0.00 ? 101 ASN A HB2  5  
ATOM 8765  H HB3  . ASN A 1 101 ? 1.745   -10.407 -8.829  1.00 0.00 ? 101 ASN A HB3  5  
ATOM 8766  H HD21 . ASN A 1 101 ? 2.555   -13.641 -9.246  1.00 0.00 ? 101 ASN A HD21 5  
ATOM 8767  H HD22 . ASN A 1 101 ? 4.243   -13.507 -9.127  1.00 0.00 ? 101 ASN A HD22 5  
ATOM 8768  N N    . GLU A 1 102 ? 1.757   -13.527 -6.657  1.00 0.00 ? 102 GLU A N    5  
ATOM 8769  C CA   . GLU A 1 102 ? 2.015   -14.812 -5.945  1.00 0.00 ? 102 GLU A CA   5  
ATOM 8770  C C    . GLU A 1 102 ? 3.520   -15.012 -5.749  1.00 0.00 ? 102 GLU A C    5  
ATOM 8771  O O    . GLU A 1 102 ? 3.950   -15.928 -5.077  1.00 0.00 ? 102 GLU A O    5  
ATOM 8772  C CB   . GLU A 1 102 ? 1.459   -15.971 -6.777  1.00 0.00 ? 102 GLU A CB   5  
ATOM 8773  C CG   . GLU A 1 102 ? -0.046  -15.778 -6.982  1.00 0.00 ? 102 GLU A CG   5  
ATOM 8774  C CD   . GLU A 1 102 ? -0.465  -16.409 -8.310  1.00 0.00 ? 102 GLU A CD   5  
ATOM 8775  O OE1  . GLU A 1 102 ? -0.062  -15.895 -9.342  1.00 0.00 ? 102 GLU A OE1  5  
ATOM 8776  O OE2  . GLU A 1 102 ? -1.181  -17.395 -8.276  1.00 0.00 ? 102 GLU A OE2  5  
ATOM 8777  H H    . GLU A 1 102 ? 1.505   -13.538 -7.604  1.00 0.00 ? 102 GLU A H    5  
ATOM 8778  H HA   . GLU A 1 102 ? 1.527   -14.795 -4.983  1.00 0.00 ? 102 GLU A HA   5  
ATOM 8779  H HB2  . GLU A 1 102 ? 1.955   -15.993 -7.737  1.00 0.00 ? 102 GLU A HB2  5  
ATOM 8780  H HB3  . GLU A 1 102 ? 1.634   -16.902 -6.259  1.00 0.00 ? 102 GLU A HB3  5  
ATOM 8781  H HG2  . GLU A 1 102 ? -0.582  -16.252 -6.171  1.00 0.00 ? 102 GLU A HG2  5  
ATOM 8782  H HG3  . GLU A 1 102 ? -0.275  -14.724 -6.997  1.00 0.00 ? 102 GLU A HG3  5  
ATOM 8783  N N    . LYS A 1 103 ? 4.326   -14.168 -6.331  1.00 0.00 ? 103 LYS A N    5  
ATOM 8784  C CA   . LYS A 1 103 ? 5.800   -14.320 -6.176  1.00 0.00 ? 103 LYS A CA   5  
ATOM 8785  C C    . LYS A 1 103 ? 6.216   -13.915 -4.759  1.00 0.00 ? 103 LYS A C    5  
ATOM 8786  O O    . LYS A 1 103 ? 7.299   -14.227 -4.308  1.00 0.00 ? 103 LYS A O    5  
ATOM 8787  C CB   . LYS A 1 103 ? 6.516   -13.424 -7.191  1.00 0.00 ? 103 LYS A CB   5  
ATOM 8788  C CG   . LYS A 1 103 ? 7.305   -14.294 -8.172  1.00 0.00 ? 103 LYS A CG   5  
ATOM 8789  C CD   . LYS A 1 103 ? 6.335   -15.020 -9.107  1.00 0.00 ? 103 LYS A CD   5  
ATOM 8790  C CE   . LYS A 1 103 ? 6.765   -16.481 -9.255  1.00 0.00 ? 103 LYS A CE   5  
ATOM 8791  N NZ   . LYS A 1 103 ? 5.910   -17.341 -8.387  1.00 0.00 ? 103 LYS A NZ   5  
ATOM 8792  H H    . LYS A 1 103 ? 3.962   -13.437 -6.872  1.00 0.00 ? 103 LYS A H    5  
ATOM 8793  H HA   . LYS A 1 103 ? 6.075   -15.349 -6.351  1.00 0.00 ? 103 LYS A HA   5  
ATOM 8794  H HB2  . LYS A 1 103 ? 5.786   -12.840 -7.732  1.00 0.00 ? 103 LYS A HB2  5  
ATOM 8795  H HB3  . LYS A 1 103 ? 7.195   -12.764 -6.672  1.00 0.00 ? 103 LYS A HB3  5  
ATOM 8796  H HG2  . LYS A 1 103 ? 7.966   -13.669 -8.754  1.00 0.00 ? 103 LYS A HG2  5  
ATOM 8797  H HG3  . LYS A 1 103 ? 7.885   -15.021 -7.623  1.00 0.00 ? 103 LYS A HG3  5  
ATOM 8798  H HD2  . LYS A 1 103 ? 5.338   -14.978 -8.695  1.00 0.00 ? 103 LYS A HD2  5  
ATOM 8799  H HD3  . LYS A 1 103 ? 6.345   -14.545 -10.076 1.00 0.00 ? 103 LYS A HD3  5  
ATOM 8800  H HE2  . LYS A 1 103 ? 6.654   -16.787 -10.285 1.00 0.00 ? 103 LYS A HE2  5  
ATOM 8801  H HE3  . LYS A 1 103 ? 7.798   -16.586 -8.958  1.00 0.00 ? 103 LYS A HE3  5  
ATOM 8802  H HZ1  . LYS A 1 103 ? 5.544   -16.778 -7.593  1.00 0.00 ? 103 LYS A HZ1  5  
ATOM 8803  H HZ2  . LYS A 1 103 ? 5.114   -17.710 -8.943  1.00 0.00 ? 103 LYS A HZ2  5  
ATOM 8804  H HZ3  . LYS A 1 103 ? 6.475   -18.133 -8.021  1.00 0.00 ? 103 LYS A HZ3  5  
ATOM 8805  N N    . ILE A 1 104 ? 5.365   -13.221 -4.054  1.00 0.00 ? 104 ILE A N    5  
ATOM 8806  C CA   . ILE A 1 104 ? 5.715   -12.796 -2.668  1.00 0.00 ? 104 ILE A CA   5  
ATOM 8807  C C    . ILE A 1 104 ? 4.504   -13.012 -1.752  1.00 0.00 ? 104 ILE A C    5  
ATOM 8808  O O    . ILE A 1 104 ? 3.375   -12.783 -2.136  1.00 0.00 ? 104 ILE A O    5  
ATOM 8809  C CB   . ILE A 1 104 ? 6.117   -11.314 -2.682  1.00 0.00 ? 104 ILE A CB   5  
ATOM 8810  C CG1  . ILE A 1 104 ? 7.577   -11.192 -3.124  1.00 0.00 ? 104 ILE A CG1  5  
ATOM 8811  C CG2  . ILE A 1 104 ? 5.965   -10.707 -1.285  1.00 0.00 ? 104 ILE A CG2  5  
ATOM 8812  C CD1  . ILE A 1 104 ? 7.637   -10.620 -4.542  1.00 0.00 ? 104 ILE A CD1  5  
ATOM 8813  H H    . ILE A 1 104 ? 4.496   -12.977 -4.435  1.00 0.00 ? 104 ILE A H    5  
ATOM 8814  H HA   . ILE A 1 104 ? 6.545   -13.390 -2.312  1.00 0.00 ? 104 ILE A HA   5  
ATOM 8815  H HB   . ILE A 1 104 ? 5.486   -10.779 -3.377  1.00 0.00 ? 104 ILE A HB   5  
ATOM 8816  H HG12 . ILE A 1 104 ? 8.103   -10.535 -2.448  1.00 0.00 ? 104 ILE A HG12 5  
ATOM 8817  H HG13 . ILE A 1 104 ? 8.040   -12.167 -3.111  1.00 0.00 ? 104 ILE A HG13 5  
ATOM 8818  H HG21 . ILE A 1 104 ? 4.943   -10.818 -0.952  1.00 0.00 ? 104 ILE A HG21 5  
ATOM 8819  H HG22 . ILE A 1 104 ? 6.624   -11.215 -0.598  1.00 0.00 ? 104 ILE A HG22 5  
ATOM 8820  H HG23 . ILE A 1 104 ? 6.219   -9.657  -1.319  1.00 0.00 ? 104 ILE A HG23 5  
ATOM 8821  H HD11 . ILE A 1 104 ? 6.681   -10.751 -5.024  1.00 0.00 ? 104 ILE A HD11 5  
ATOM 8822  H HD12 . ILE A 1 104 ? 7.877   -9.568  -4.495  1.00 0.00 ? 104 ILE A HD12 5  
ATOM 8823  H HD13 . ILE A 1 104 ? 8.399   -11.137 -5.107  1.00 0.00 ? 104 ILE A HD13 5  
ATOM 8824  N N    . GLN A 1 105 ? 4.734   -13.455 -0.545  1.00 0.00 ? 105 GLN A N    5  
ATOM 8825  C CA   . GLN A 1 105 ? 3.600   -13.691 0.394   1.00 0.00 ? 105 GLN A CA   5  
ATOM 8826  C C    . GLN A 1 105 ? 3.513   -12.533 1.395   1.00 0.00 ? 105 GLN A C    5  
ATOM 8827  O O    . GLN A 1 105 ? 4.511   -11.920 1.719   1.00 0.00 ? 105 GLN A O    5  
ATOM 8828  C CB   . GLN A 1 105 ? 3.828   -15.002 1.149   1.00 0.00 ? 105 GLN A CB   5  
ATOM 8829  C CG   . GLN A 1 105 ? 3.944   -16.155 0.150   1.00 0.00 ? 105 GLN A CG   5  
ATOM 8830  C CD   . GLN A 1 105 ? 4.492   -17.395 0.858   1.00 0.00 ? 105 GLN A CD   5  
ATOM 8831  O OE1  . GLN A 1 105 ? 5.145   -17.289 1.877   1.00 0.00 ? 105 GLN A OE1  5  
ATOM 8832  N NE2  . GLN A 1 105 ? 4.253   -18.576 0.356   1.00 0.00 ? 105 GLN A NE2  5  
ATOM 8833  H H    . GLN A 1 105 ? 5.653   -13.637 -0.257  1.00 0.00 ? 105 GLN A H    5  
ATOM 8834  H HA   . GLN A 1 105 ? 2.677   -13.753 -0.164  1.00 0.00 ? 105 GLN A HA   5  
ATOM 8835  H HB2  . GLN A 1 105 ? 4.740   -14.931 1.725   1.00 0.00 ? 105 GLN A HB2  5  
ATOM 8836  H HB3  . GLN A 1 105 ? 2.996   -15.187 1.813   1.00 0.00 ? 105 GLN A HB3  5  
ATOM 8837  H HG2  . GLN A 1 105 ? 2.968   -16.375 -0.260  1.00 0.00 ? 105 GLN A HG2  5  
ATOM 8838  H HG3  . GLN A 1 105 ? 4.614   -15.873 -0.649  1.00 0.00 ? 105 GLN A HG3  5  
ATOM 8839  H HE21 . GLN A 1 105 ? 3.728   -18.662 -0.468  1.00 0.00 ? 105 GLN A HE21 5  
ATOM 8840  H HE22 . GLN A 1 105 ? 4.599   -19.377 0.803   1.00 0.00 ? 105 GLN A HE22 5  
ATOM 8841  N N    . PRO A 1 106 ? 2.313   -12.267 1.851   1.00 0.00 ? 106 PRO A N    5  
ATOM 8842  C CA   . PRO A 1 106 ? 2.061   -11.184 2.818   1.00 0.00 ? 106 PRO A CA   5  
ATOM 8843  C C    . PRO A 1 106 ? 2.804   -11.455 4.131   1.00 0.00 ? 106 PRO A C    5  
ATOM 8844  O O    . PRO A 1 106 ? 3.209   -12.566 4.408   1.00 0.00 ? 106 PRO A O    5  
ATOM 8845  C CB   . PRO A 1 106 ? 0.542   -11.206 3.047   1.00 0.00 ? 106 PRO A CB   5  
ATOM 8846  C CG   . PRO A 1 106 ? -0.043  -12.372 2.208   1.00 0.00 ? 106 PRO A CG   5  
ATOM 8847  C CD   . PRO A 1 106 ? 1.116   -13.024 1.440   1.00 0.00 ? 106 PRO A CD   5  
ATOM 8848  H HA   . PRO A 1 106 ? 2.355   -10.232 2.406   1.00 0.00 ? 106 PRO A HA   5  
ATOM 8849  H HB2  . PRO A 1 106 ? 0.334   -11.364 4.096   1.00 0.00 ? 106 PRO A HB2  5  
ATOM 8850  H HB3  . PRO A 1 106 ? 0.109   -10.275 2.722   1.00 0.00 ? 106 PRO A HB3  5  
ATOM 8851  H HG2  . PRO A 1 106 ? -0.504  -13.098 2.864   1.00 0.00 ? 106 PRO A HG2  5  
ATOM 8852  H HG3  . PRO A 1 106 ? -0.773  -11.991 1.510   1.00 0.00 ? 106 PRO A HG3  5  
ATOM 8853  H HD2  . PRO A 1 106 ? 1.213   -14.064 1.715   1.00 0.00 ? 106 PRO A HD2  5  
ATOM 8854  H HD3  . PRO A 1 106 ? 0.964   -12.927 0.376   1.00 0.00 ? 106 PRO A HD3  5  
ATOM 8855  N N    . GLY A 1 107 ? 2.983   -10.446 4.939   1.00 0.00 ? 107 GLY A N    5  
ATOM 8856  C CA   . GLY A 1 107 ? 3.696   -10.643 6.233   1.00 0.00 ? 107 GLY A CA   5  
ATOM 8857  C C    . GLY A 1 107 ? 5.200   -10.450 6.025   1.00 0.00 ? 107 GLY A C    5  
ATOM 8858  O O    . GLY A 1 107 ? 5.828   -9.641  6.678   1.00 0.00 ? 107 GLY A O    5  
ATOM 8859  H H    . GLY A 1 107 ? 2.647   -9.557  4.697   1.00 0.00 ? 107 GLY A H    5  
ATOM 8860  H HA2  . GLY A 1 107 ? 3.336   -9.923  6.955   1.00 0.00 ? 107 GLY A HA2  5  
ATOM 8861  H HA3  . GLY A 1 107 ? 3.513   -11.642 6.598   1.00 0.00 ? 107 GLY A HA3  5  
ATOM 8862  N N    . THR A 1 108 ? 5.780   -11.189 5.120   1.00 0.00 ? 108 THR A N    5  
ATOM 8863  C CA   . THR A 1 108 ? 7.243   -11.052 4.869   1.00 0.00 ? 108 THR A CA   5  
ATOM 8864  C C    . THR A 1 108 ? 7.533   -9.686  4.242   1.00 0.00 ? 108 THR A C    5  
ATOM 8865  O O    . THR A 1 108 ? 8.581   -9.107  4.451   1.00 0.00 ? 108 THR A O    5  
ATOM 8866  C CB   . THR A 1 108 ? 7.701   -12.160 3.920   1.00 0.00 ? 108 THR A CB   5  
ATOM 8867  O OG1  . THR A 1 108 ? 7.224   -13.413 4.392   1.00 0.00 ? 108 THR A OG1  5  
ATOM 8868  C CG2  . THR A 1 108 ? 9.229   -12.185 3.861   1.00 0.00 ? 108 THR A CG2  5  
ATOM 8869  H H    . THR A 1 108 ? 5.254   -11.836 4.605   1.00 0.00 ? 108 THR A H    5  
ATOM 8870  H HA   . THR A 1 108 ? 7.776   -11.138 5.805   1.00 0.00 ? 108 THR A HA   5  
ATOM 8871  H HB   . THR A 1 108 ? 7.311   -11.974 2.932   1.00 0.00 ? 108 THR A HB   5  
ATOM 8872  H HG1  . THR A 1 108 ? 6.409   -13.615 3.925   1.00 0.00 ? 108 THR A HG1  5  
ATOM 8873  H HG21 . THR A 1 108 ? 9.613   -11.203 4.090   1.00 0.00 ? 108 THR A HG21 5  
ATOM 8874  H HG22 . THR A 1 108 ? 9.605   -12.896 4.583   1.00 0.00 ? 108 THR A HG22 5  
ATOM 8875  H HG23 . THR A 1 108 ? 9.547   -12.476 2.871   1.00 0.00 ? 108 THR A HG23 5  
ATOM 8876  N N    . ALA A 1 109 ? 6.615   -9.166  3.474   1.00 0.00 ? 109 ALA A N    5  
ATOM 8877  C CA   . ALA A 1 109 ? 6.844   -7.838  2.836   1.00 0.00 ? 109 ALA A CA   5  
ATOM 8878  C C    . ALA A 1 109 ? 6.467   -6.727  3.819   1.00 0.00 ? 109 ALA A C    5  
ATOM 8879  O O    . ALA A 1 109 ? 7.105   -5.694  3.878   1.00 0.00 ? 109 ALA A O    5  
ATOM 8880  C CB   . ALA A 1 109 ? 5.979   -7.719  1.581   1.00 0.00 ? 109 ALA A CB   5  
ATOM 8881  H H    . ALA A 1 109 ? 5.776   -9.648  3.318   1.00 0.00 ? 109 ALA A H    5  
ATOM 8882  H HA   . ALA A 1 109 ? 7.884   -7.743  2.567   1.00 0.00 ? 109 ALA A HA   5  
ATOM 8883  H HB1  . ALA A 1 109 ? 5.595   -8.693  1.314   1.00 0.00 ? 109 ALA A HB1  5  
ATOM 8884  H HB2  . ALA A 1 109 ? 5.156   -7.048  1.772   1.00 0.00 ? 109 ALA A HB2  5  
ATOM 8885  H HB3  . ALA A 1 109 ? 6.576   -7.333  0.768   1.00 0.00 ? 109 ALA A HB3  5  
ATOM 8886  N N    . ALA A 1 110 ? 5.436   -6.932  4.592   1.00 0.00 ? 110 ALA A N    5  
ATOM 8887  C CA   . ALA A 1 110 ? 5.018   -5.890  5.572   1.00 0.00 ? 110 ALA A CA   5  
ATOM 8888  C C    . ALA A 1 110 ? 6.135   -5.673  6.594   1.00 0.00 ? 110 ALA A C    5  
ATOM 8889  O O    . ALA A 1 110 ? 6.299   -4.595  7.129   1.00 0.00 ? 110 ALA A O    5  
ATOM 8890  C CB   . ALA A 1 110 ? 3.748   -6.348  6.293   1.00 0.00 ? 110 ALA A CB   5  
ATOM 8891  H H    . ALA A 1 110 ? 4.937   -7.773  4.528   1.00 0.00 ? 110 ALA A H    5  
ATOM 8892  H HA   . ALA A 1 110 ? 4.822   -4.964  5.053   1.00 0.00 ? 110 ALA A HA   5  
ATOM 8893  H HB1  . ALA A 1 110 ? 3.595   -7.402  6.117   1.00 0.00 ? 110 ALA A HB1  5  
ATOM 8894  H HB2  . ALA A 1 110 ? 3.853   -6.171  7.354   1.00 0.00 ? 110 ALA A HB2  5  
ATOM 8895  H HB3  . ALA A 1 110 ? 2.902   -5.793  5.918   1.00 0.00 ? 110 ALA A HB3  5  
ATOM 8896  N N    . ASN A 1 111 ? 6.907   -6.688  6.871   1.00 0.00 ? 111 ASN A N    5  
ATOM 8897  C CA   . ASN A 1 111 ? 8.011   -6.533  7.859   1.00 0.00 ? 111 ASN A CA   5  
ATOM 8898  C C    . ASN A 1 111 ? 8.997   -5.474  7.362   1.00 0.00 ? 111 ASN A C    5  
ATOM 8899  O O    . ASN A 1 111 ? 9.549   -4.714  8.134   1.00 0.00 ? 111 ASN A O    5  
ATOM 8900  C CB   . ASN A 1 111 ? 8.738   -7.868  8.028   1.00 0.00 ? 111 ASN A CB   5  
ATOM 8901  C CG   . ASN A 1 111 ? 9.148   -8.041  9.491   1.00 0.00 ? 111 ASN A CG   5  
ATOM 8902  O OD1  . ASN A 1 111 ? 8.380   -8.530  10.295  1.00 0.00 ? 111 ASN A OD1  5  
ATOM 8903  N ND2  . ASN A 1 111 ? 10.335  -7.656  9.873   1.00 0.00 ? 111 ASN A ND2  5  
ATOM 8904  H H    . ASN A 1 111 ? 6.761   -7.551  6.430   1.00 0.00 ? 111 ASN A H    5  
ATOM 8905  H HA   . ASN A 1 111 ? 7.602   -6.224  8.810   1.00 0.00 ? 111 ASN A HA   5  
ATOM 8906  H HB2  . ASN A 1 111 ? 8.080   -8.675  7.739   1.00 0.00 ? 111 ASN A HB2  5  
ATOM 8907  H HB3  . ASN A 1 111 ? 9.620   -7.879  7.405   1.00 0.00 ? 111 ASN A HB3  5  
ATOM 8908  H HD21 . ASN A 1 111 ? 10.953  -7.259  9.224   1.00 0.00 ? 111 ASN A HD21 5  
ATOM 8909  H HD22 . ASN A 1 111 ? 10.607  -7.763  10.808  1.00 0.00 ? 111 ASN A HD22 5  
ATOM 8910  N N    . VAL A 1 112 ? 9.226   -5.416  6.078   1.00 0.00 ? 112 VAL A N    5  
ATOM 8911  C CA   . VAL A 1 112 ? 10.179  -4.405  5.542   1.00 0.00 ? 112 VAL A CA   5  
ATOM 8912  C C    . VAL A 1 112 ? 9.495   -3.034  5.495   1.00 0.00 ? 112 VAL A C    5  
ATOM 8913  O O    . VAL A 1 112 ? 10.124  -2.010  5.652   1.00 0.00 ? 112 VAL A O    5  
ATOM 8914  C CB   . VAL A 1 112 ? 10.636  -4.827  4.136   1.00 0.00 ? 112 VAL A CB   5  
ATOM 8915  C CG1  . VAL A 1 112 ? 9.658   -4.308  3.074   1.00 0.00 ? 112 VAL A CG1  5  
ATOM 8916  C CG2  . VAL A 1 112 ? 12.030  -4.257  3.866   1.00 0.00 ? 112 VAL A CG2  5  
ATOM 8917  H H    . VAL A 1 112 ? 8.772   -6.037  5.470   1.00 0.00 ? 112 VAL A H    5  
ATOM 8918  H HA   . VAL A 1 112 ? 11.038  -4.348  6.194   1.00 0.00 ? 112 VAL A HA   5  
ATOM 8919  H HB   . VAL A 1 112 ? 10.675  -5.907  4.084   1.00 0.00 ? 112 VAL A HB   5  
ATOM 8920  H HG11 . VAL A 1 112 ? 8.658   -4.294  3.480   1.00 0.00 ? 112 VAL A HG11 5  
ATOM 8921  H HG12 . VAL A 1 112 ? 9.943   -3.308  2.782   1.00 0.00 ? 112 VAL A HG12 5  
ATOM 8922  H HG13 . VAL A 1 112 ? 9.688   -4.956  2.210   1.00 0.00 ? 112 VAL A HG13 5  
ATOM 8923  H HG21 . VAL A 1 112 ? 12.653  -4.400  4.736   1.00 0.00 ? 112 VAL A HG21 5  
ATOM 8924  H HG22 . VAL A 1 112 ? 12.470  -4.765  3.020   1.00 0.00 ? 112 VAL A HG22 5  
ATOM 8925  H HG23 . VAL A 1 112 ? 11.951  -3.201  3.649   1.00 0.00 ? 112 VAL A HG23 5  
ATOM 8926  N N    . VAL A 1 113 ? 8.209   -3.008  5.279   1.00 0.00 ? 113 VAL A N    5  
ATOM 8927  C CA   . VAL A 1 113 ? 7.491   -1.704  5.223   1.00 0.00 ? 113 VAL A CA   5  
ATOM 8928  C C    . VAL A 1 113 ? 7.582   -1.013  6.586   1.00 0.00 ? 113 VAL A C    5  
ATOM 8929  O O    . VAL A 1 113 ? 7.462   0.192   6.691   1.00 0.00 ? 113 VAL A O    5  
ATOM 8930  C CB   . VAL A 1 113 ? 6.023   -1.951  4.870   1.00 0.00 ? 113 VAL A CB   5  
ATOM 8931  C CG1  . VAL A 1 113 ? 5.227   -0.657  5.045   1.00 0.00 ? 113 VAL A CG1  5  
ATOM 8932  C CG2  . VAL A 1 113 ? 5.920   -2.418  3.417   1.00 0.00 ? 113 VAL A CG2  5  
ATOM 8933  H H    . VAL A 1 113 ? 7.715   -3.846  5.153   1.00 0.00 ? 113 VAL A H    5  
ATOM 8934  H HA   . VAL A 1 113 ? 7.944   -1.076  4.470   1.00 0.00 ? 113 VAL A HA   5  
ATOM 8935  H HB   . VAL A 1 113 ? 5.621   -2.711  5.525   1.00 0.00 ? 113 VAL A HB   5  
ATOM 8936  H HG11 . VAL A 1 113 ? 5.431   -0.238  6.020   1.00 0.00 ? 113 VAL A HG11 5  
ATOM 8937  H HG12 . VAL A 1 113 ? 5.517   0.050   4.282   1.00 0.00 ? 113 VAL A HG12 5  
ATOM 8938  H HG13 . VAL A 1 113 ? 4.173   -0.870  4.957   1.00 0.00 ? 113 VAL A HG13 5  
ATOM 8939  H HG21 . VAL A 1 113 ? 6.619   -3.225  3.248   1.00 0.00 ? 113 VAL A HG21 5  
ATOM 8940  H HG22 . VAL A 1 113 ? 4.917   -2.765  3.221   1.00 0.00 ? 113 VAL A HG22 5  
ATOM 8941  H HG23 . VAL A 1 113 ? 6.154   -1.596  2.757   1.00 0.00 ? 113 VAL A HG23 5  
ATOM 8942  N N    . GLU A 1 114 ? 7.790   -1.768  7.630   1.00 0.00 ? 114 GLU A N    5  
ATOM 8943  C CA   . GLU A 1 114 ? 7.884   -1.158  8.988   1.00 0.00 ? 114 GLU A CA   5  
ATOM 8944  C C    . GLU A 1 114 ? 9.260   -0.519  9.172   1.00 0.00 ? 114 GLU A C    5  
ATOM 8945  O O    . GLU A 1 114 ? 9.383   0.579   9.679   1.00 0.00 ? 114 GLU A O    5  
ATOM 8946  C CB   . GLU A 1 114 ? 7.682   -2.245  10.047  1.00 0.00 ? 114 GLU A CB   5  
ATOM 8947  C CG   . GLU A 1 114 ? 6.246   -2.764  9.972   1.00 0.00 ? 114 GLU A CG   5  
ATOM 8948  C CD   . GLU A 1 114 ? 5.523   -2.452  11.282  1.00 0.00 ? 114 GLU A CD   5  
ATOM 8949  O OE1  . GLU A 1 114 ? 5.998   -1.591  12.006  1.00 0.00 ? 114 GLU A OE1  5  
ATOM 8950  O OE2  . GLU A 1 114 ? 4.510   -3.078  11.541  1.00 0.00 ? 114 GLU A OE2  5  
ATOM 8951  H H    . GLU A 1 114 ? 7.883   -2.737  7.522   1.00 0.00 ? 114 GLU A H    5  
ATOM 8952  H HA   . GLU A 1 114 ? 7.119   -0.404  9.097   1.00 0.00 ? 114 GLU A HA   5  
ATOM 8953  H HB2  . GLU A 1 114 ? 8.371   -3.057  9.866   1.00 0.00 ? 114 GLU A HB2  5  
ATOM 8954  H HB3  . GLU A 1 114 ? 7.862   -1.831  11.027  1.00 0.00 ? 114 GLU A HB3  5  
ATOM 8955  H HG2  . GLU A 1 114 ? 5.732   -2.282  9.152   1.00 0.00 ? 114 GLU A HG2  5  
ATOM 8956  H HG3  . GLU A 1 114 ? 6.256   -3.832  9.814   1.00 0.00 ? 114 GLU A HG3  5  
ATOM 8957  N N    . LYS A 1 115 ? 10.298  -1.194  8.763   1.00 0.00 ? 115 LYS A N    5  
ATOM 8958  C CA   . LYS A 1 115 ? 11.664  -0.619  8.914   1.00 0.00 ? 115 LYS A CA   5  
ATOM 8959  C C    . LYS A 1 115 ? 11.923  0.370   7.776   1.00 0.00 ? 115 LYS A C    5  
ATOM 8960  O O    . LYS A 1 115 ? 12.100  1.552   7.994   1.00 0.00 ? 115 LYS A O    5  
ATOM 8961  C CB   . LYS A 1 115 ? 12.700  -1.743  8.860   1.00 0.00 ? 115 LYS A CB   5  
ATOM 8962  C CG   . LYS A 1 115 ? 13.092  -2.145  10.283  1.00 0.00 ? 115 LYS A CG   5  
ATOM 8963  C CD   . LYS A 1 115 ? 14.556  -1.777  10.529  1.00 0.00 ? 115 LYS A CD   5  
ATOM 8964  C CE   . LYS A 1 115 ? 15.449  -2.957  10.145  1.00 0.00 ? 115 LYS A CE   5  
ATOM 8965  N NZ   . LYS A 1 115 ? 16.877  -2.540  10.206  1.00 0.00 ? 115 LYS A NZ   5  
ATOM 8966  H H    . LYS A 1 115 ? 10.180  -2.077  8.355   1.00 0.00 ? 115 LYS A H    5  
ATOM 8967  H HA   . LYS A 1 115 ? 11.737  -0.106  9.862   1.00 0.00 ? 115 LYS A HA   5  
ATOM 8968  H HB2  . LYS A 1 115 ? 12.278  -2.596  8.347   1.00 0.00 ? 115 LYS A HB2  5  
ATOM 8969  H HB3  . LYS A 1 115 ? 13.576  -1.400  8.330   1.00 0.00 ? 115 LYS A HB3  5  
ATOM 8970  H HG2  . LYS A 1 115 ? 12.464  -1.624  10.991  1.00 0.00 ? 115 LYS A HG2  5  
ATOM 8971  H HG3  . LYS A 1 115 ? 12.965  -3.211  10.404  1.00 0.00 ? 115 LYS A HG3  5  
ATOM 8972  H HD2  . LYS A 1 115 ? 14.815  -0.917  9.929   1.00 0.00 ? 115 LYS A HD2  5  
ATOM 8973  H HD3  . LYS A 1 115 ? 14.698  -1.545  11.574  1.00 0.00 ? 115 LYS A HD3  5  
ATOM 8974  H HE2  . LYS A 1 115 ? 15.283  -3.774  10.833  1.00 0.00 ? 115 LYS A HE2  5  
ATOM 8975  H HE3  . LYS A 1 115 ? 15.210  -3.278  9.141   1.00 0.00 ? 115 LYS A HE3  5  
ATOM 8976  H HZ1  . LYS A 1 115 ? 16.976  -1.731  10.851  1.00 0.00 ? 115 LYS A HZ1  5  
ATOM 8977  H HZ2  . LYS A 1 115 ? 17.455  -3.333  10.553  1.00 0.00 ? 115 LYS A HZ2  5  
ATOM 8978  H HZ3  . LYS A 1 115 ? 17.199  -2.265  9.256   1.00 0.00 ? 115 LYS A HZ3  5  
ATOM 8979  N N    . LEU A 1 116 ? 11.944  -0.110  6.563   1.00 0.00 ? 116 LEU A N    5  
ATOM 8980  C CA   . LEU A 1 116 ? 12.188  0.791   5.401   1.00 0.00 ? 116 LEU A CA   5  
ATOM 8981  C C    . LEU A 1 116 ? 11.401  2.093   5.584   1.00 0.00 ? 116 LEU A C    5  
ATOM 8982  O O    . LEU A 1 116 ? 11.789  3.136   5.095   1.00 0.00 ? 116 LEU A O    5  
ATOM 8983  C CB   . LEU A 1 116 ? 11.727  0.094   4.118   1.00 0.00 ? 116 LEU A CB   5  
ATOM 8984  C CG   . LEU A 1 116 ? 12.910  -0.054  3.161   1.00 0.00 ? 116 LEU A CG   5  
ATOM 8985  C CD1  . LEU A 1 116 ? 13.694  -1.322  3.507   1.00 0.00 ? 116 LEU A CD1  5  
ATOM 8986  C CD2  . LEU A 1 116 ? 12.389  -0.155  1.725   1.00 0.00 ? 116 LEU A CD2  5  
ATOM 8987  H H    . LEU A 1 116 ? 11.798  -1.066  6.417   1.00 0.00 ? 116 LEU A H    5  
ATOM 8988  H HA   . LEU A 1 116 ? 13.242  1.013   5.331   1.00 0.00 ? 116 LEU A HA   5  
ATOM 8989  H HB2  . LEU A 1 116 ? 11.335  -0.883  4.361   1.00 0.00 ? 116 LEU A HB2  5  
ATOM 8990  H HB3  . LEU A 1 116 ? 10.956  0.684   3.646   1.00 0.00 ? 116 LEU A HB3  5  
ATOM 8991  H HG   . LEU A 1 116 ? 13.557  0.806   3.252   1.00 0.00 ? 116 LEU A HG   5  
ATOM 8992  H HD11 . LEU A 1 116 ? 13.315  -1.740  4.428   1.00 0.00 ? 116 LEU A HD11 5  
ATOM 8993  H HD12 . LEU A 1 116 ? 13.582  -2.043  2.712   1.00 0.00 ? 116 LEU A HD12 5  
ATOM 8994  H HD13 . LEU A 1 116 ? 14.740  -1.078  3.626   1.00 0.00 ? 116 LEU A HD13 5  
ATOM 8995  H HD21 . LEU A 1 116 ? 11.687  0.644   1.539   1.00 0.00 ? 116 LEU A HD21 5  
ATOM 8996  H HD22 . LEU A 1 116 ? 13.215  -0.076  1.035   1.00 0.00 ? 116 LEU A HD22 5  
ATOM 8997  H HD23 . LEU A 1 116 ? 11.895  -1.107  1.588   1.00 0.00 ? 116 LEU A HD23 5  
ATOM 8998  N N    . ALA A 1 117 ? 10.297  2.041   6.279   1.00 0.00 ? 117 ALA A N    5  
ATOM 8999  C CA   . ALA A 1 117 ? 9.487   3.275   6.486   1.00 0.00 ? 117 ALA A CA   5  
ATOM 9000  C C    . ALA A 1 117 ? 10.187  4.189   7.495   1.00 0.00 ? 117 ALA A C    5  
ATOM 9001  O O    . ALA A 1 117 ? 10.333  5.373   7.276   1.00 0.00 ? 117 ALA A O    5  
ATOM 9002  C CB   . ALA A 1 117 ? 8.106   2.896   7.024   1.00 0.00 ? 117 ALA A CB   5  
ATOM 9003  H H    . ALA A 1 117 ? 9.997   1.190   6.662   1.00 0.00 ? 117 ALA A H    5  
ATOM 9004  H HA   . ALA A 1 117 ? 9.376   3.795   5.547   1.00 0.00 ? 117 ALA A HA   5  
ATOM 9005  H HB1  . ALA A 1 117 ? 8.213   2.165   7.812   1.00 0.00 ? 117 ALA A HB1  5  
ATOM 9006  H HB2  . ALA A 1 117 ? 7.619   3.777   7.417   1.00 0.00 ? 117 ALA A HB2  5  
ATOM 9007  H HB3  . ALA A 1 117 ? 7.508   2.481   6.225   1.00 0.00 ? 117 ALA A HB3  5  
ATOM 9008  N N    . ASP A 1 118 ? 10.615  3.652   8.603   1.00 0.00 ? 118 ASP A N    5  
ATOM 9009  C CA   . ASP A 1 118 ? 11.298  4.495   9.628   1.00 0.00 ? 118 ASP A CA   5  
ATOM 9010  C C    . ASP A 1 118 ? 12.390  5.342   8.967   1.00 0.00 ? 118 ASP A C    5  
ATOM 9011  O O    . ASP A 1 118 ? 12.809  6.350   9.499   1.00 0.00 ? 118 ASP A O    5  
ATOM 9012  C CB   . ASP A 1 118 ? 11.930  3.592   10.691  1.00 0.00 ? 118 ASP A CB   5  
ATOM 9013  C CG   . ASP A 1 118 ? 10.941  3.385   11.840  1.00 0.00 ? 118 ASP A CG   5  
ATOM 9014  O OD1  . ASP A 1 118 ? 9.750   3.482   11.596  1.00 0.00 ? 118 ASP A OD1  5  
ATOM 9015  O OD2  . ASP A 1 118 ? 11.392  3.133   12.946  1.00 0.00 ? 118 ASP A OD2  5  
ATOM 9016  H H    . ASP A 1 118 ? 10.483  2.694   8.766   1.00 0.00 ? 118 ASP A H    5  
ATOM 9017  H HA   . ASP A 1 118 ? 10.574  5.145   10.096  1.00 0.00 ? 118 ASP A HA   5  
ATOM 9018  H HB2  . ASP A 1 118 ? 12.177  2.636   10.251  1.00 0.00 ? 118 ASP A HB2  5  
ATOM 9019  H HB3  . ASP A 1 118 ? 12.828  4.056   11.071  1.00 0.00 ? 118 ASP A HB3  5  
ATOM 9020  N N    . TYR A 1 119 ? 12.860  4.942   7.816   1.00 0.00 ? 119 TYR A N    5  
ATOM 9021  C CA   . TYR A 1 119 ? 13.931  5.727   7.136   1.00 0.00 ? 119 TYR A CA   5  
ATOM 9022  C C    . TYR A 1 119 ? 13.315  6.857   6.302   1.00 0.00 ? 119 TYR A C    5  
ATOM 9023  O O    . TYR A 1 119 ? 13.825  7.960   6.268   1.00 0.00 ? 119 TYR A O    5  
ATOM 9024  C CB   . TYR A 1 119 ? 14.731  4.803   6.214   1.00 0.00 ? 119 TYR A CB   5  
ATOM 9025  C CG   . TYR A 1 119 ? 15.305  3.656   7.011   1.00 0.00 ? 119 TYR A CG   5  
ATOM 9026  C CD1  . TYR A 1 119 ? 15.622  3.829   8.364   1.00 0.00 ? 119 TYR A CD1  5  
ATOM 9027  C CD2  . TYR A 1 119 ? 15.523  2.419   6.393   1.00 0.00 ? 119 TYR A CD2  5  
ATOM 9028  C CE1  . TYR A 1 119 ? 16.157  2.764   9.098   1.00 0.00 ? 119 TYR A CE1  5  
ATOM 9029  C CE2  . TYR A 1 119 ? 16.059  1.354   7.128   1.00 0.00 ? 119 TYR A CE2  5  
ATOM 9030  C CZ   . TYR A 1 119 ? 16.375  1.527   8.481   1.00 0.00 ? 119 TYR A CZ   5  
ATOM 9031  O OH   . TYR A 1 119 ? 16.904  0.477   9.204   1.00 0.00 ? 119 TYR A OH   5  
ATOM 9032  H H    . TYR A 1 119 ? 12.516  4.124   7.403   1.00 0.00 ? 119 TYR A H    5  
ATOM 9033  H HA   . TYR A 1 119 ? 14.592  6.149   7.878   1.00 0.00 ? 119 TYR A HA   5  
ATOM 9034  H HB2  . TYR A 1 119 ? 14.081  4.416   5.442   1.00 0.00 ? 119 TYR A HB2  5  
ATOM 9035  H HB3  . TYR A 1 119 ? 15.536  5.362   5.759   1.00 0.00 ? 119 TYR A HB3  5  
ATOM 9036  H HD1  . TYR A 1 119 ? 15.453  4.784   8.842   1.00 0.00 ? 119 TYR A HD1  5  
ATOM 9037  H HD2  . TYR A 1 119 ? 15.278  2.285   5.350   1.00 0.00 ? 119 TYR A HD2  5  
ATOM 9038  H HE1  . TYR A 1 119 ? 16.402  2.896   10.142  1.00 0.00 ? 119 TYR A HE1  5  
ATOM 9039  H HE2  . TYR A 1 119 ? 16.227  0.399   6.651   1.00 0.00 ? 119 TYR A HE2  5  
ATOM 9040  H HH   . TYR A 1 119 ? 17.626  0.819   9.735   1.00 0.00 ? 119 TYR A HH   5  
ATOM 9041  N N    . LEU A 1 120 ? 12.237  6.591   5.615   1.00 0.00 ? 120 LEU A N    5  
ATOM 9042  C CA   . LEU A 1 120 ? 11.610  7.649   4.771   1.00 0.00 ? 120 LEU A CA   5  
ATOM 9043  C C    . LEU A 1 120 ? 10.802  8.615   5.641   1.00 0.00 ? 120 LEU A C    5  
ATOM 9044  O O    . LEU A 1 120 ? 11.019  9.810   5.616   1.00 0.00 ? 120 LEU A O    5  
ATOM 9045  C CB   . LEU A 1 120 ? 10.690  6.988   3.743   1.00 0.00 ? 120 LEU A CB   5  
ATOM 9046  C CG   . LEU A 1 120 ? 11.443  6.813   2.423   1.00 0.00 ? 120 LEU A CG   5  
ATOM 9047  C CD1  . LEU A 1 120 ? 10.924  5.569   1.700   1.00 0.00 ? 120 LEU A CD1  5  
ATOM 9048  C CD2  . LEU A 1 120 ? 11.221  8.047   1.543   1.00 0.00 ? 120 LEU A CD2  5  
ATOM 9049  H H    . LEU A 1 120 ? 11.846  5.694   5.642   1.00 0.00 ? 120 LEU A H    5  
ATOM 9050  H HA   . LEU A 1 120 ? 12.383  8.197   4.253   1.00 0.00 ? 120 LEU A HA   5  
ATOM 9051  H HB2  . LEU A 1 120 ? 10.380  6.019   4.112   1.00 0.00 ? 120 LEU A HB2  5  
ATOM 9052  H HB3  . LEU A 1 120 ? 9.822   7.608   3.584   1.00 0.00 ? 120 LEU A HB3  5  
ATOM 9053  H HG   . LEU A 1 120 ? 12.498  6.698   2.625   1.00 0.00 ? 120 LEU A HG   5  
ATOM 9054  H HD11 . LEU A 1 120 ? 10.627  4.827   2.428   1.00 0.00 ? 120 LEU A HD11 5  
ATOM 9055  H HD12 . LEU A 1 120 ? 10.074  5.836   1.089   1.00 0.00 ? 120 LEU A HD12 5  
ATOM 9056  H HD13 . LEU A 1 120 ? 11.706  5.165   1.074   1.00 0.00 ? 120 LEU A HD13 5  
ATOM 9057  H HD21 . LEU A 1 120 ? 11.083  8.916   2.169   1.00 0.00 ? 120 LEU A HD21 5  
ATOM 9058  H HD22 . LEU A 1 120 ? 12.082  8.194   0.906   1.00 0.00 ? 120 LEU A HD22 5  
ATOM 9059  H HD23 . LEU A 1 120 ? 10.343  7.900   0.931   1.00 0.00 ? 120 LEU A HD23 5  
ATOM 9060  N N    . ILE A 1 121 ? 9.865   8.110   6.401   1.00 0.00 ? 121 ILE A N    5  
ATOM 9061  C CA   . ILE A 1 121 ? 9.036   8.997   7.269   1.00 0.00 ? 121 ILE A CA   5  
ATOM 9062  C C    . ILE A 1 121 ? 9.915   10.087  7.887   1.00 0.00 ? 121 ILE A C    5  
ATOM 9063  O O    . ILE A 1 121 ? 9.481   11.202  8.098   1.00 0.00 ? 121 ILE A O    5  
ATOM 9064  C CB   . ILE A 1 121 ? 8.395   8.165   8.382   1.00 0.00 ? 121 ILE A CB   5  
ATOM 9065  C CG1  . ILE A 1 121 ? 7.414   7.165   7.765   1.00 0.00 ? 121 ILE A CG1  5  
ATOM 9066  C CG2  . ILE A 1 121 ? 7.642   9.084   9.344   1.00 0.00 ? 121 ILE A CG2  5  
ATOM 9067  C CD1  . ILE A 1 121 ? 7.365   5.900   8.624   1.00 0.00 ? 121 ILE A CD1  5  
ATOM 9068  H H    . ILE A 1 121 ? 9.704   7.144   6.396   1.00 0.00 ? 121 ILE A H    5  
ATOM 9069  H HA   . ILE A 1 121 ? 8.261   9.457   6.675   1.00 0.00 ? 121 ILE A HA   5  
ATOM 9070  H HB   . ILE A 1 121 ? 9.164   7.631   8.920   1.00 0.00 ? 121 ILE A HB   5  
ATOM 9071  H HG12 . ILE A 1 121 ? 6.429   7.609   7.720   1.00 0.00 ? 121 ILE A HG12 5  
ATOM 9072  H HG13 . ILE A 1 121 ? 7.739   6.908   6.768   1.00 0.00 ? 121 ILE A HG13 5  
ATOM 9073  H HG21 . ILE A 1 121 ? 8.191   10.006  9.466   1.00 0.00 ? 121 ILE A HG21 5  
ATOM 9074  H HG22 . ILE A 1 121 ? 6.662   9.300   8.944   1.00 0.00 ? 121 ILE A HG22 5  
ATOM 9075  H HG23 . ILE A 1 121 ? 7.541   8.597   10.303  1.00 0.00 ? 121 ILE A HG23 5  
ATOM 9076  H HD11 . ILE A 1 121 ? 7.393   6.174   9.668   1.00 0.00 ? 121 ILE A HD11 5  
ATOM 9077  H HD12 . ILE A 1 121 ? 6.455   5.360   8.417   1.00 0.00 ? 121 ILE A HD12 5  
ATOM 9078  H HD13 . ILE A 1 121 ? 8.216   5.277   8.393   1.00 0.00 ? 121 ILE A HD13 5  
ATOM 9079  N N    . GLY A 1 122 ? 11.149  9.778   8.174   1.00 0.00 ? 122 GLY A N    5  
ATOM 9080  C CA   . GLY A 1 122 ? 12.052  10.802  8.772   1.00 0.00 ? 122 GLY A CA   5  
ATOM 9081  C C    . GLY A 1 122 ? 12.328  11.897  7.739   1.00 0.00 ? 122 GLY A C    5  
ATOM 9082  O O    . GLY A 1 122 ? 12.171  13.072  8.008   1.00 0.00 ? 122 GLY A O    5  
ATOM 9083  H H    . GLY A 1 122 ? 11.484  8.876   7.993   1.00 0.00 ? 122 GLY A H    5  
ATOM 9084  H HA2  . GLY A 1 122 ? 11.579  11.236  9.642   1.00 0.00 ? 122 GLY A HA2  5  
ATOM 9085  H HA3  . GLY A 1 122 ? 12.983  10.340  9.060   1.00 0.00 ? 122 GLY A HA3  5  
ATOM 9086  N N    . GLN A 1 123 ? 12.739  11.521  6.558   1.00 0.00 ? 123 GLN A N    5  
ATOM 9087  C CA   . GLN A 1 123 ? 13.026  12.540  5.508   1.00 0.00 ? 123 GLN A CA   5  
ATOM 9088  C C    . GLN A 1 123 ? 11.758  13.352  5.224   1.00 0.00 ? 123 GLN A C    5  
ATOM 9089  O O    . GLN A 1 123 ? 11.662  14.512  5.573   1.00 0.00 ? 123 GLN A O    5  
ATOM 9090  C CB   . GLN A 1 123 ? 13.484  11.838  4.227   1.00 0.00 ? 123 GLN A CB   5  
ATOM 9091  C CG   . GLN A 1 123 ? 14.593  10.839  4.565   1.00 0.00 ? 123 GLN A CG   5  
ATOM 9092  C CD   . GLN A 1 123 ? 15.504  10.658  3.348   1.00 0.00 ? 123 GLN A CD   5  
ATOM 9093  O OE1  . GLN A 1 123 ? 15.164  11.062  2.254   1.00 0.00 ? 123 GLN A OE1  5  
ATOM 9094  N NE2  . GLN A 1 123 ? 16.657  10.064  3.493   1.00 0.00 ? 123 GLN A NE2  5  
ATOM 9095  H H    . GLN A 1 123 ? 12.860  10.569  6.361   1.00 0.00 ? 123 GLN A H    5  
ATOM 9096  H HA   . GLN A 1 123 ? 13.806  13.202  5.854   1.00 0.00 ? 123 GLN A HA   5  
ATOM 9097  H HB2  . GLN A 1 123 ? 12.649  11.314  3.785   1.00 0.00 ? 123 GLN A HB2  5  
ATOM 9098  H HB3  . GLN A 1 123 ? 13.862  12.571  3.530   1.00 0.00 ? 123 GLN A HB3  5  
ATOM 9099  H HG2  . GLN A 1 123 ? 15.172  11.212  5.398   1.00 0.00 ? 123 GLN A HG2  5  
ATOM 9100  H HG3  . GLN A 1 123 ? 14.155  9.888   4.827   1.00 0.00 ? 123 GLN A HG3  5  
ATOM 9101  H HE21 . GLN A 1 123 ? 16.933  9.739   4.375   1.00 0.00 ? 123 GLN A HE21 5  
ATOM 9102  H HE22 . GLN A 1 123 ? 17.247  9.942   2.720   1.00 0.00 ? 123 GLN A HE22 5  
ATOM 9103  N N    . GLY A 1 124 ? 10.784  12.754  4.592   1.00 0.00 ? 124 GLY A N    5  
ATOM 9104  C CA   . GLY A 1 124 ? 9.526   13.496  4.291   1.00 0.00 ? 124 GLY A CA   5  
ATOM 9105  C C    . GLY A 1 124 ? 9.167   13.319  2.814   1.00 0.00 ? 124 GLY A C    5  
ATOM 9106  O O    . GLY A 1 124 ? 9.851   13.807  1.937   1.00 0.00 ? 124 GLY A O    5  
ATOM 9107  H H    . GLY A 1 124 ? 10.878  11.818  4.318   1.00 0.00 ? 124 GLY A H    5  
ATOM 9108  H HA2  . GLY A 1 124 ? 8.726   13.111  4.907   1.00 0.00 ? 124 GLY A HA2  5  
ATOM 9109  H HA3  . GLY A 1 124 ? 9.669   14.546  4.500   1.00 0.00 ? 124 GLY A HA3  5  
ATOM 9110  N N    . PHE A 1 125 ? 8.098   12.625  2.531   1.00 0.00 ? 125 PHE A N    5  
ATOM 9111  C CA   . PHE A 1 125 ? 7.699   12.419  1.110   1.00 0.00 ? 125 PHE A CA   5  
ATOM 9112  C C    . PHE A 1 125 ? 7.316   13.763  0.486   1.00 0.00 ? 125 PHE A C    5  
ATOM 9113  O O    . PHE A 1 125 ? 8.194   14.413  -0.058  1.00 0.00 ? 125 PHE A O    5  
ATOM 9114  C CB   . PHE A 1 125 ? 6.505   11.464  1.047   1.00 0.00 ? 125 PHE A CB   5  
ATOM 9115  C CG   . PHE A 1 125 ? 6.871   10.161  1.716   1.00 0.00 ? 125 PHE A CG   5  
ATOM 9116  C CD1  . PHE A 1 125 ? 7.491   9.148   0.976   1.00 0.00 ? 125 PHE A CD1  5  
ATOM 9117  C CD2  . PHE A 1 125 ? 6.593   9.965   3.074   1.00 0.00 ? 125 PHE A CD2  5  
ATOM 9118  C CE1  . PHE A 1 125 ? 7.835   7.939   1.594   1.00 0.00 ? 125 PHE A CE1  5  
ATOM 9119  C CE2  . PHE A 1 125 ? 6.936   8.756   3.691   1.00 0.00 ? 125 PHE A CE2  5  
ATOM 9120  C CZ   . PHE A 1 125 ? 7.557   7.743   2.951   1.00 0.00 ? 125 PHE A CZ   5  
ATOM 9121  O OXT  . PHE A 1 125 ? 6.151   14.119  0.562   1.00 0.00 ? 125 PHE A OXT  5  
ATOM 9122  H H    . PHE A 1 125 ? 7.559   12.239  3.253   1.00 0.00 ? 125 PHE A H    5  
ATOM 9123  H HA   . PHE A 1 125 ? 8.528   11.993  0.564   1.00 0.00 ? 125 PHE A HA   5  
ATOM 9124  H HB2  . PHE A 1 125 ? 5.659   11.907  1.554   1.00 0.00 ? 125 PHE A HB2  5  
ATOM 9125  H HB3  . PHE A 1 125 ? 6.248   11.277  0.015   1.00 0.00 ? 125 PHE A HB3  5  
ATOM 9126  H HD1  . PHE A 1 125 ? 7.706   9.300   -0.071  1.00 0.00 ? 125 PHE A HD1  5  
ATOM 9127  H HD2  . PHE A 1 125 ? 6.112   10.746  3.646   1.00 0.00 ? 125 PHE A HD2  5  
ATOM 9128  H HE1  . PHE A 1 125 ? 8.315   7.158   1.022   1.00 0.00 ? 125 PHE A HE1  5  
ATOM 9129  H HE2  . PHE A 1 125 ? 6.722   8.605   4.739   1.00 0.00 ? 125 PHE A HE2  5  
ATOM 9130  H HZ   . PHE A 1 125 ? 7.822   6.811   3.427   1.00 0.00 ? 125 PHE A HZ   5  
ATOM 9131  N N    . SER A 1 1   ? 13.320  7.686   -0.890  1.00 0.00 ? 1   SER A N    6  
ATOM 9132  C CA   . SER A 1 1   ? 11.940  8.103   -0.513  1.00 0.00 ? 1   SER A CA   6  
ATOM 9133  C C    . SER A 1 1   ? 10.927  7.156   -1.160  1.00 0.00 ? 1   SER A C    6  
ATOM 9134  O O    . SER A 1 1   ? 9.779   7.503   -1.359  1.00 0.00 ? 1   SER A O    6  
ATOM 9135  C CB   . SER A 1 1   ? 11.687  9.528   -1.004  1.00 0.00 ? 1   SER A CB   6  
ATOM 9136  O OG   . SER A 1 1   ? 12.914  10.249  -1.011  1.00 0.00 ? 1   SER A OG   6  
ATOM 9137  H H1   . SER A 1 1   ? 13.376  7.565   -1.922  1.00 0.00 ? 1   SER A H1   6  
ATOM 9138  H H2   . SER A 1 1   ? 13.996  8.418   -0.589  1.00 0.00 ? 1   SER A H2   6  
ATOM 9139  H H3   . SER A 1 1   ? 13.550  6.786   -0.425  1.00 0.00 ? 1   SER A H3   6  
ATOM 9140  H HA   . SER A 1 1   ? 11.833  8.068   0.561   1.00 0.00 ? 1   SER A HA   6  
ATOM 9141  H HB2  . SER A 1 1   ? 11.287  9.501   -2.004  1.00 0.00 ? 1   SER A HB2  6  
ATOM 9142  H HB3  . SER A 1 1   ? 10.976  10.012  -0.348  1.00 0.00 ? 1   SER A HB3  6  
ATOM 9143  H HG   . SER A 1 1   ? 13.000  10.678  -1.865  1.00 0.00 ? 1   SER A HG   6  
ATOM 9144  N N    . TRP A 1 2   ? 11.346  5.966   -1.501  1.00 0.00 ? 2   TRP A N    6  
ATOM 9145  C CA   . TRP A 1 2   ? 10.413  4.997   -2.146  1.00 0.00 ? 2   TRP A CA   6  
ATOM 9146  C C    . TRP A 1 2   ? 10.245  5.359   -3.628  1.00 0.00 ? 2   TRP A C    6  
ATOM 9147  O O    . TRP A 1 2   ? 9.632   4.633   -4.385  1.00 0.00 ? 2   TRP A O    6  
ATOM 9148  C CB   . TRP A 1 2   ? 9.051   5.050   -1.448  1.00 0.00 ? 2   TRP A CB   6  
ATOM 9149  C CG   . TRP A 1 2   ? 8.579   3.663   -1.124  1.00 0.00 ? 2   TRP A CG   6  
ATOM 9150  C CD1  . TRP A 1 2   ? 8.551   2.621   -1.989  1.00 0.00 ? 2   TRP A CD1  6  
ATOM 9151  C CD2  . TRP A 1 2   ? 8.059   3.157   0.140   1.00 0.00 ? 2   TRP A CD2  6  
ATOM 9152  N NE1  . TRP A 1 2   ? 8.042   1.509   -1.333  1.00 0.00 ? 2   TRP A NE1  6  
ATOM 9153  C CE2  . TRP A 1 2   ? 7.726   1.790   -0.018  1.00 0.00 ? 2   TRP A CE2  6  
ATOM 9154  C CE3  . TRP A 1 2   ? 7.848   3.750   1.397   1.00 0.00 ? 2   TRP A CE3  6  
ATOM 9155  C CZ2  . TRP A 1 2   ? 7.196   1.038   1.036   1.00 0.00 ? 2   TRP A CZ2  6  
ATOM 9156  C CZ3  . TRP A 1 2   ? 7.319   2.997   2.458   1.00 0.00 ? 2   TRP A CZ3  6  
ATOM 9157  C CH2  . TRP A 1 2   ? 6.993   1.645   2.278   1.00 0.00 ? 2   TRP A CH2  6  
ATOM 9158  H H    . TRP A 1 2   ? 12.278  5.711   -1.337  1.00 0.00 ? 2   TRP A H    6  
ATOM 9159  H HA   . TRP A 1 2   ? 10.820  3.998   -2.065  1.00 0.00 ? 2   TRP A HA   6  
ATOM 9160  H HB2  . TRP A 1 2   ? 9.140   5.619   -0.536  1.00 0.00 ? 2   TRP A HB2  6  
ATOM 9161  H HB3  . TRP A 1 2   ? 8.336   5.529   -2.099  1.00 0.00 ? 2   TRP A HB3  6  
ATOM 9162  H HD1  . TRP A 1 2   ? 8.869   2.650   -3.019  1.00 0.00 ? 2   TRP A HD1  6  
ATOM 9163  H HE1  . TRP A 1 2   ? 7.915   0.625   -1.735  1.00 0.00 ? 2   TRP A HE1  6  
ATOM 9164  H HE3  . TRP A 1 2   ? 8.095   4.791   1.547   1.00 0.00 ? 2   TRP A HE3  6  
ATOM 9165  H HZ2  . TRP A 1 2   ? 6.942   -0.004  0.892   1.00 0.00 ? 2   TRP A HZ2  6  
ATOM 9166  H HZ3  . TRP A 1 2   ? 7.160   3.464   3.419   1.00 0.00 ? 2   TRP A HZ3  6  
ATOM 9167  H HH2  . TRP A 1 2   ? 6.587   1.073   3.098   1.00 0.00 ? 2   TRP A HH2  6  
ATOM 9168  N N    . GLN A 1 3   ? 10.793  6.470   -4.053  1.00 0.00 ? 3   GLN A N    6  
ATOM 9169  C CA   . GLN A 1 3   ? 10.669  6.859   -5.488  1.00 0.00 ? 3   GLN A CA   6  
ATOM 9170  C C    . GLN A 1 3   ? 11.659  6.033   -6.308  1.00 0.00 ? 3   GLN A C    6  
ATOM 9171  O O    . GLN A 1 3   ? 11.305  5.029   -6.900  1.00 0.00 ? 3   GLN A O    6  
ATOM 9172  C CB   . GLN A 1 3   ? 10.981  8.348   -5.647  1.00 0.00 ? 3   GLN A CB   6  
ATOM 9173  C CG   . GLN A 1 3   ? 11.059  8.698   -7.134  1.00 0.00 ? 3   GLN A CG   6  
ATOM 9174  C CD   . GLN A 1 3   ? 11.732  10.061  -7.301  1.00 0.00 ? 3   GLN A CD   6  
ATOM 9175  O OE1  . GLN A 1 3   ? 12.915  10.201  -7.062  1.00 0.00 ? 3   GLN A OE1  6  
ATOM 9176  N NE2  . GLN A 1 3   ? 11.024  11.080  -7.705  1.00 0.00 ? 3   GLN A NE2  6  
ATOM 9177  H H    . GLN A 1 3   ? 11.294  7.041   -3.435  1.00 0.00 ? 3   GLN A H    6  
ATOM 9178  H HA   . GLN A 1 3   ? 9.663   6.661   -5.829  1.00 0.00 ? 3   GLN A HA   6  
ATOM 9179  H HB2  . GLN A 1 3   ? 10.199  8.931   -5.179  1.00 0.00 ? 3   GLN A HB2  6  
ATOM 9180  H HB3  . GLN A 1 3   ? 11.927  8.570   -5.176  1.00 0.00 ? 3   GLN A HB3  6  
ATOM 9181  H HG2  . GLN A 1 3   ? 11.636  7.945   -7.651  1.00 0.00 ? 3   GLN A HG2  6  
ATOM 9182  H HG3  . GLN A 1 3   ? 10.063  8.738   -7.548  1.00 0.00 ? 3   GLN A HG3  6  
ATOM 9183  H HE21 . GLN A 1 3   ? 10.070  10.968  -7.900  1.00 0.00 ? 3   GLN A HE21 6  
ATOM 9184  H HE22 . GLN A 1 3   ? 11.445  11.958  -7.814  1.00 0.00 ? 3   GLN A HE22 6  
ATOM 9185  N N    . THR A 1 4   ? 12.905  6.426   -6.338  1.00 0.00 ? 4   THR A N    6  
ATOM 9186  C CA   . THR A 1 4   ? 13.899  5.629   -7.105  1.00 0.00 ? 4   THR A CA   6  
ATOM 9187  C C    . THR A 1 4   ? 13.718  4.167   -6.703  1.00 0.00 ? 4   THR A C    6  
ATOM 9188  O O    . THR A 1 4   ? 13.930  3.259   -7.479  1.00 0.00 ? 4   THR A O    6  
ATOM 9189  C CB   . THR A 1 4   ? 15.318  6.092   -6.758  1.00 0.00 ? 4   THR A CB   6  
ATOM 9190  O OG1  . THR A 1 4   ? 16.257  5.135   -7.229  1.00 0.00 ? 4   THR A OG1  6  
ATOM 9191  C CG2  . THR A 1 4   ? 15.457  6.242   -5.242  1.00 0.00 ? 4   THR A CG2  6  
ATOM 9192  H H    . THR A 1 4   ? 13.184  7.227   -5.846  1.00 0.00 ? 4   THR A H    6  
ATOM 9193  H HA   . THR A 1 4   ? 13.722  5.744   -8.164  1.00 0.00 ? 4   THR A HA   6  
ATOM 9194  H HB   . THR A 1 4   ? 15.508  7.044   -7.228  1.00 0.00 ? 4   THR A HB   6  
ATOM 9195  H HG1  . THR A 1 4   ? 17.118  5.365   -6.873  1.00 0.00 ? 4   THR A HG1  6  
ATOM 9196  H HG21 . THR A 1 4   ? 15.087  5.351   -4.757  1.00 0.00 ? 4   THR A HG21 6  
ATOM 9197  H HG22 . THR A 1 4   ? 16.497  6.383   -4.989  1.00 0.00 ? 4   THR A HG22 6  
ATOM 9198  H HG23 . THR A 1 4   ? 14.887  7.097   -4.912  1.00 0.00 ? 4   THR A HG23 6  
ATOM 9199  N N    . TYR A 1 5   ? 13.296  3.951   -5.487  1.00 0.00 ? 5   TYR A N    6  
ATOM 9200  C CA   . TYR A 1 5   ? 13.060  2.568   -4.995  1.00 0.00 ? 5   TYR A CA   6  
ATOM 9201  C C    . TYR A 1 5   ? 12.232  1.802   -6.030  1.00 0.00 ? 5   TYR A C    6  
ATOM 9202  O O    . TYR A 1 5   ? 12.612  0.743   -6.490  1.00 0.00 ? 5   TYR A O    6  
ATOM 9203  C CB   . TYR A 1 5   ? 12.286  2.643   -3.673  1.00 0.00 ? 5   TYR A CB   6  
ATOM 9204  C CG   . TYR A 1 5   ? 13.248  2.706   -2.507  1.00 0.00 ? 5   TYR A CG   6  
ATOM 9205  C CD1  . TYR A 1 5   ? 14.597  3.021   -2.720  1.00 0.00 ? 5   TYR A CD1  6  
ATOM 9206  C CD2  . TYR A 1 5   ? 12.789  2.446   -1.208  1.00 0.00 ? 5   TYR A CD2  6  
ATOM 9207  C CE1  . TYR A 1 5   ? 15.484  3.076   -1.639  1.00 0.00 ? 5   TYR A CE1  6  
ATOM 9208  C CE2  . TYR A 1 5   ? 13.677  2.500   -0.127  1.00 0.00 ? 5   TYR A CE2  6  
ATOM 9209  C CZ   . TYR A 1 5   ? 15.025  2.814   -0.343  1.00 0.00 ? 5   TYR A CZ   6  
ATOM 9210  O OH   . TYR A 1 5   ? 15.900  2.865   0.723   1.00 0.00 ? 5   TYR A OH   6  
ATOM 9211  H H    . TYR A 1 5   ? 13.118  4.712   -4.894  1.00 0.00 ? 5   TYR A H    6  
ATOM 9212  H HA   . TYR A 1 5   ? 14.003  2.068   -4.837  1.00 0.00 ? 5   TYR A HA   6  
ATOM 9213  H HB2  . TYR A 1 5   ? 11.669  3.529   -3.674  1.00 0.00 ? 5   TYR A HB2  6  
ATOM 9214  H HB3  . TYR A 1 5   ? 11.657  1.774   -3.573  1.00 0.00 ? 5   TYR A HB3  6  
ATOM 9215  H HD1  . TYR A 1 5   ? 14.952  3.224   -3.720  1.00 0.00 ? 5   TYR A HD1  6  
ATOM 9216  H HD2  . TYR A 1 5   ? 11.749  2.204   -1.040  1.00 0.00 ? 5   TYR A HD2  6  
ATOM 9217  H HE1  . TYR A 1 5   ? 16.523  3.317   -1.805  1.00 0.00 ? 5   TYR A HE1  6  
ATOM 9218  H HE2  . TYR A 1 5   ? 13.322  2.299   0.873   1.00 0.00 ? 5   TYR A HE2  6  
ATOM 9219  H HH   . TYR A 1 5   ? 15.690  3.641   1.244   1.00 0.00 ? 5   TYR A HH   6  
ATOM 9220  N N    . VAL A 1 6   ? 11.101  2.337   -6.399  1.00 0.00 ? 6   VAL A N    6  
ATOM 9221  C CA   . VAL A 1 6   ? 10.236  1.657   -7.403  1.00 0.00 ? 6   VAL A CA   6  
ATOM 9222  C C    . VAL A 1 6   ? 11.073  1.281   -8.636  1.00 0.00 ? 6   VAL A C    6  
ATOM 9223  O O    . VAL A 1 6   ? 10.863  0.250   -9.245  1.00 0.00 ? 6   VAL A O    6  
ATOM 9224  C CB   . VAL A 1 6   ? 9.088   2.617   -7.789  1.00 0.00 ? 6   VAL A CB   6  
ATOM 9225  C CG1  . VAL A 1 6   ? 8.795   2.563   -9.296  1.00 0.00 ? 6   VAL A CG1  6  
ATOM 9226  C CG2  . VAL A 1 6   ? 7.820   2.226   -7.024  1.00 0.00 ? 6   VAL A CG2  6  
ATOM 9227  H H    . VAL A 1 6   ? 10.818  3.192   -6.013  1.00 0.00 ? 6   VAL A H    6  
ATOM 9228  H HA   . VAL A 1 6   ? 9.820   0.763   -6.966  1.00 0.00 ? 6   VAL A HA   6  
ATOM 9229  H HB   . VAL A 1 6   ? 9.367   3.626   -7.521  1.00 0.00 ? 6   VAL A HB   6  
ATOM 9230  H HG11 . VAL A 1 6   ? 8.950   1.557   -9.657  1.00 0.00 ? 6   VAL A HG11 6  
ATOM 9231  H HG12 . VAL A 1 6   ? 7.771   2.856   -9.473  1.00 0.00 ? 6   VAL A HG12 6  
ATOM 9232  H HG13 . VAL A 1 6   ? 9.457   3.239   -9.817  1.00 0.00 ? 6   VAL A HG13 6  
ATOM 9233  H HG21 . VAL A 1 6   ? 7.777   1.152   -6.922  1.00 0.00 ? 6   VAL A HG21 6  
ATOM 9234  H HG22 . VAL A 1 6   ? 7.834   2.681   -6.045  1.00 0.00 ? 6   VAL A HG22 6  
ATOM 9235  H HG23 . VAL A 1 6   ? 6.950   2.570   -7.568  1.00 0.00 ? 6   VAL A HG23 6  
ATOM 9236  N N    . ASP A 1 7   ? 11.993  2.118   -9.027  1.00 0.00 ? 7   ASP A N    6  
ATOM 9237  C CA   . ASP A 1 7   ? 12.809  1.813   -10.242 1.00 0.00 ? 7   ASP A CA   6  
ATOM 9238  C C    . ASP A 1 7   ? 14.087  1.043   -9.895  1.00 0.00 ? 7   ASP A C    6  
ATOM 9239  O O    . ASP A 1 7   ? 15.165  1.416   -10.313 1.00 0.00 ? 7   ASP A O    6  
ATOM 9240  C CB   . ASP A 1 7   ? 13.198  3.121   -10.925 1.00 0.00 ? 7   ASP A CB   6  
ATOM 9241  C CG   . ASP A 1 7   ? 13.249  2.915   -12.441 1.00 0.00 ? 7   ASP A CG   6  
ATOM 9242  O OD1  . ASP A 1 7   ? 14.285  2.489   -12.928 1.00 0.00 ? 7   ASP A OD1  6  
ATOM 9243  O OD2  . ASP A 1 7   ? 12.252  3.188   -13.091 1.00 0.00 ? 7   ASP A OD2  6  
ATOM 9244  H H    . ASP A 1 7   ? 12.132  2.960   -8.536  1.00 0.00 ? 7   ASP A H    6  
ATOM 9245  H HA   . ASP A 1 7   ? 12.217  1.224   -10.926 1.00 0.00 ? 7   ASP A HA   6  
ATOM 9246  H HB2  . ASP A 1 7   ? 12.469  3.879   -10.687 1.00 0.00 ? 7   ASP A HB2  6  
ATOM 9247  H HB3  . ASP A 1 7   ? 14.170  3.429   -10.574 1.00 0.00 ? 7   ASP A HB3  6  
ATOM 9248  N N    . THR A 1 8   ? 13.997  -0.035  -9.165  1.00 0.00 ? 8   THR A N    6  
ATOM 9249  C CA   . THR A 1 8   ? 15.244  -0.799  -8.856  1.00 0.00 ? 8   THR A CA   6  
ATOM 9250  C C    . THR A 1 8   ? 14.976  -1.931  -7.860  1.00 0.00 ? 8   THR A C    6  
ATOM 9251  O O    . THR A 1 8   ? 14.742  -3.061  -8.239  1.00 0.00 ? 8   THR A O    6  
ATOM 9252  C CB   . THR A 1 8   ? 16.304  0.144   -8.278  1.00 0.00 ? 8   THR A CB   6  
ATOM 9253  O OG1  . THR A 1 8   ? 17.149  -0.584  -7.398  1.00 0.00 ? 8   THR A OG1  6  
ATOM 9254  C CG2  . THR A 1 8   ? 15.630  1.281   -7.514  1.00 0.00 ? 8   THR A CG2  6  
ATOM 9255  H H    . THR A 1 8   ? 13.128  -0.344  -8.841  1.00 0.00 ? 8   THR A H    6  
ATOM 9256  H HA   . THR A 1 8   ? 15.622  -1.228  -9.772  1.00 0.00 ? 8   THR A HA   6  
ATOM 9257  H HB   . THR A 1 8   ? 16.893  0.556   -9.083  1.00 0.00 ? 8   THR A HB   6  
ATOM 9258  H HG1  . THR A 1 8   ? 17.478  -1.352  -7.870  1.00 0.00 ? 8   THR A HG1  6  
ATOM 9259  H HG21 . THR A 1 8   ? 14.641  0.973   -7.208  1.00 0.00 ? 8   THR A HG21 6  
ATOM 9260  H HG22 . THR A 1 8   ? 16.218  1.525   -6.642  1.00 0.00 ? 8   THR A HG22 6  
ATOM 9261  H HG23 . THR A 1 8   ? 15.558  2.147   -8.153  1.00 0.00 ? 8   THR A HG23 6  
ATOM 9262  N N    . ASN A 1 9   ? 15.052  -1.648  -6.590  1.00 0.00 ? 9   ASN A N    6  
ATOM 9263  C CA   . ASN A 1 9   ? 14.849  -2.721  -5.573  1.00 0.00 ? 9   ASN A CA   6  
ATOM 9264  C C    . ASN A 1 9   ? 13.379  -2.837  -5.173  1.00 0.00 ? 9   ASN A C    6  
ATOM 9265  O O    . ASN A 1 9   ? 12.670  -3.676  -5.669  1.00 0.00 ? 9   ASN A O    6  
ATOM 9266  C CB   . ASN A 1 9   ? 15.678  -2.392  -4.332  1.00 0.00 ? 9   ASN A CB   6  
ATOM 9267  C CG   . ASN A 1 9   ? 16.984  -3.187  -4.365  1.00 0.00 ? 9   ASN A CG   6  
ATOM 9268  O OD1  . ASN A 1 9   ? 17.337  -3.756  -5.379  1.00 0.00 ? 9   ASN A OD1  6  
ATOM 9269  N ND2  . ASN A 1 9   ? 17.720  -3.250  -3.291  1.00 0.00 ? 9   ASN A ND2  6  
ATOM 9270  H H    . ASN A 1 9   ? 15.271  -0.737  -6.305  1.00 0.00 ? 9   ASN A H    6  
ATOM 9271  H HA   . ASN A 1 9   ? 15.181  -3.666  -5.980  1.00 0.00 ? 9   ASN A HA   6  
ATOM 9272  H HB2  . ASN A 1 9   ? 15.898  -1.334  -4.316  1.00 0.00 ? 9   ASN A HB2  6  
ATOM 9273  H HB3  . ASN A 1 9   ? 15.120  -2.657  -3.446  1.00 0.00 ? 9   ASN A HB3  6  
ATOM 9274  H HD21 . ASN A 1 9   ? 17.435  -2.792  -2.472  1.00 0.00 ? 9   ASN A HD21 6  
ATOM 9275  H HD22 . ASN A 1 9   ? 18.561  -3.754  -3.302  1.00 0.00 ? 9   ASN A HD22 6  
ATOM 9276  N N    . LEU A 1 10  ? 12.949  -2.017  -4.250  1.00 0.00 ? 10  LEU A N    6  
ATOM 9277  C CA   . LEU A 1 10  ? 11.538  -2.057  -3.741  1.00 0.00 ? 10  LEU A CA   6  
ATOM 9278  C C    . LEU A 1 10  ? 10.578  -2.740  -4.721  1.00 0.00 ? 10  LEU A C    6  
ATOM 9279  O O    . LEU A 1 10  ? 9.756   -3.543  -4.325  1.00 0.00 ? 10  LEU A O    6  
ATOM 9280  C CB   . LEU A 1 10  ? 11.060  -0.631  -3.487  1.00 0.00 ? 10  LEU A CB   6  
ATOM 9281  C CG   . LEU A 1 10  ? 11.335  -0.261  -2.031  1.00 0.00 ? 10  LEU A CG   6  
ATOM 9282  C CD1  . LEU A 1 10  ? 10.623  -1.252  -1.108  1.00 0.00 ? 10  LEU A CD1  6  
ATOM 9283  C CD2  . LEU A 1 10  ? 12.842  -0.318  -1.767  1.00 0.00 ? 10  LEU A CD2  6  
ATOM 9284  H H    . LEU A 1 10  ? 13.573  -1.371  -3.862  1.00 0.00 ? 10  LEU A H    6  
ATOM 9285  H HA   . LEU A 1 10  ? 11.521  -2.596  -2.807  1.00 0.00 ? 10  LEU A HA   6  
ATOM 9286  H HB2  . LEU A 1 10  ? 11.592  0.045   -4.141  1.00 0.00 ? 10  LEU A HB2  6  
ATOM 9287  H HB3  . LEU A 1 10  ? 10.000  -0.564  -3.681  1.00 0.00 ? 10  LEU A HB3  6  
ATOM 9288  H HG   . LEU A 1 10  ? 10.969  0.736   -1.839  1.00 0.00 ? 10  LEU A HG   6  
ATOM 9289  H HD11 . LEU A 1 10  ? 10.000  -1.908  -1.697  1.00 0.00 ? 10  LEU A HD11 6  
ATOM 9290  H HD12 . LEU A 1 10  ? 11.356  -1.837  -0.573  1.00 0.00 ? 10  LEU A HD12 6  
ATOM 9291  H HD13 . LEU A 1 10  ? 10.010  -0.711  -0.402  1.00 0.00 ? 10  LEU A HD13 6  
ATOM 9292  H HD21 . LEU A 1 10  ? 13.364  0.207   -2.554  1.00 0.00 ? 10  LEU A HD21 6  
ATOM 9293  H HD22 . LEU A 1 10  ? 13.060  0.148   -0.818  1.00 0.00 ? 10  LEU A HD22 6  
ATOM 9294  H HD23 . LEU A 1 10  ? 13.165  -1.348  -1.746  1.00 0.00 ? 10  LEU A HD23 6  
ATOM 9295  N N    . VAL A 1 11  ? 10.654  -2.436  -5.985  1.00 0.00 ? 11  VAL A N    6  
ATOM 9296  C CA   . VAL A 1 11  ? 9.714   -3.088  -6.943  1.00 0.00 ? 11  VAL A CA   6  
ATOM 9297  C C    . VAL A 1 11  ? 10.300  -4.408  -7.445  1.00 0.00 ? 11  VAL A C    6  
ATOM 9298  O O    . VAL A 1 11  ? 9.698   -5.450  -7.277  1.00 0.00 ? 11  VAL A O    6  
ATOM 9299  C CB   . VAL A 1 11  ? 9.444   -2.159  -8.133  1.00 0.00 ? 11  VAL A CB   6  
ATOM 9300  C CG1  . VAL A 1 11  ? 8.776   -2.946  -9.265  1.00 0.00 ? 11  VAL A CG1  6  
ATOM 9301  C CG2  . VAL A 1 11  ? 8.513   -1.029  -7.691  1.00 0.00 ? 11  VAL A CG2  6  
ATOM 9302  H H    . VAL A 1 11  ? 11.314  -1.782  -6.299  1.00 0.00 ? 11  VAL A H    6  
ATOM 9303  H HA   . VAL A 1 11  ? 8.784   -3.294  -6.429  1.00 0.00 ? 11  VAL A HA   6  
ATOM 9304  H HB   . VAL A 1 11  ? 10.378  -1.743  -8.485  1.00 0.00 ? 11  VAL A HB   6  
ATOM 9305  H HG11 . VAL A 1 11  ? 8.582   -3.956  -8.938  1.00 0.00 ? 11  VAL A HG11 6  
ATOM 9306  H HG12 . VAL A 1 11  ? 7.844   -2.473  -9.531  1.00 0.00 ? 11  VAL A HG12 6  
ATOM 9307  H HG13 . VAL A 1 11  ? 9.429   -2.966  -10.125 1.00 0.00 ? 11  VAL A HG13 6  
ATOM 9308  H HG21 . VAL A 1 11  ? 8.698   -0.794  -6.654  1.00 0.00 ? 11  VAL A HG21 6  
ATOM 9309  H HG22 . VAL A 1 11  ? 8.697   -0.155  -8.297  1.00 0.00 ? 11  VAL A HG22 6  
ATOM 9310  H HG23 . VAL A 1 11  ? 7.486   -1.341  -7.811  1.00 0.00 ? 11  VAL A HG23 6  
ATOM 9311  N N    . GLY A 1 12  ? 11.454  -4.378  -8.069  1.00 0.00 ? 12  GLY A N    6  
ATOM 9312  C CA   . GLY A 1 12  ? 12.062  -5.647  -8.583  1.00 0.00 ? 12  GLY A CA   6  
ATOM 9313  C C    . GLY A 1 12  ? 11.789  -6.764  -7.578  1.00 0.00 ? 12  GLY A C    6  
ATOM 9314  O O    . GLY A 1 12  ? 11.443  -7.873  -7.935  1.00 0.00 ? 12  GLY A O    6  
ATOM 9315  H H    . GLY A 1 12  ? 11.917  -3.524  -8.202  1.00 0.00 ? 12  GLY A H    6  
ATOM 9316  H HA2  . GLY A 1 12  ? 11.619  -5.900  -9.536  1.00 0.00 ? 12  GLY A HA2  6  
ATOM 9317  H HA3  . GLY A 1 12  ? 13.127  -5.520  -8.699  1.00 0.00 ? 12  GLY A HA3  6  
ATOM 9318  N N    . THR A 1 13  ? 11.911  -6.447  -6.318  1.00 0.00 ? 13  THR A N    6  
ATOM 9319  C CA   . THR A 1 13  ? 11.634  -7.432  -5.240  1.00 0.00 ? 13  THR A CA   6  
ATOM 9320  C C    . THR A 1 13  ? 12.394  -7.031  -3.981  1.00 0.00 ? 13  THR A C    6  
ATOM 9321  O O    . THR A 1 13  ? 12.895  -7.860  -3.249  1.00 0.00 ? 13  THR A O    6  
ATOM 9322  C CB   . THR A 1 13  ? 12.052  -8.836  -5.658  1.00 0.00 ? 13  THR A CB   6  
ATOM 9323  O OG1  . THR A 1 13  ? 12.238  -9.645  -4.507  1.00 0.00 ? 13  THR A OG1  6  
ATOM 9324  C CG2  . THR A 1 13  ? 13.350  -8.776  -6.468  1.00 0.00 ? 13  THR A CG2  6  
ATOM 9325  H H    . THR A 1 13  ? 12.163  -5.540  -6.080  1.00 0.00 ? 13  THR A H    6  
ATOM 9326  H HA   . THR A 1 13  ? 10.566  -7.421  -5.031  1.00 0.00 ? 13  THR A HA   6  
ATOM 9327  H HB   . THR A 1 13  ? 11.272  -9.254  -6.256  1.00 0.00 ? 13  THR A HB   6  
ATOM 9328  H HG1  . THR A 1 13  ? 11.409  -10.094 -4.323  1.00 0.00 ? 13  THR A HG1  6  
ATOM 9329  H HG21 . THR A 1 13  ? 13.754  -7.775  -6.425  1.00 0.00 ? 13  THR A HG21 6  
ATOM 9330  H HG22 . THR A 1 13  ? 14.065  -9.471  -6.052  1.00 0.00 ? 13  THR A HG22 6  
ATOM 9331  H HG23 . THR A 1 13  ? 13.146  -9.038  -7.495  1.00 0.00 ? 13  THR A HG23 6  
ATOM 9332  N N    . GLY A 1 14  ? 12.445  -5.763  -3.687  1.00 0.00 ? 14  GLY A N    6  
ATOM 9333  C CA   . GLY A 1 14  ? 13.126  -5.328  -2.438  1.00 0.00 ? 14  GLY A CA   6  
ATOM 9334  C C    . GLY A 1 14  ? 12.117  -5.463  -1.296  1.00 0.00 ? 14  GLY A C    6  
ATOM 9335  O O    . GLY A 1 14  ? 12.256  -4.861  -0.249  1.00 0.00 ? 14  GLY A O    6  
ATOM 9336  H H    . GLY A 1 14  ? 12.005  -5.104  -4.264  1.00 0.00 ? 14  GLY A H    6  
ATOM 9337  H HA2  . GLY A 1 14  ? 13.985  -5.958  -2.251  1.00 0.00 ? 14  GLY A HA2  6  
ATOM 9338  H HA3  . GLY A 1 14  ? 13.436  -4.299  -2.527  1.00 0.00 ? 14  GLY A HA3  6  
ATOM 9339  N N    . ALA A 1 15  ? 11.091  -6.249  -1.514  1.00 0.00 ? 15  ALA A N    6  
ATOM 9340  C CA   . ALA A 1 15  ? 10.033  -6.448  -0.491  1.00 0.00 ? 15  ALA A CA   6  
ATOM 9341  C C    . ALA A 1 15  ? 8.783   -6.881  -1.243  1.00 0.00 ? 15  ALA A C    6  
ATOM 9342  O O    . ALA A 1 15  ? 7.940   -7.594  -0.735  1.00 0.00 ? 15  ALA A O    6  
ATOM 9343  C CB   . ALA A 1 15  ? 9.763   -5.137  0.254   1.00 0.00 ? 15  ALA A CB   6  
ATOM 9344  H H    . ALA A 1 15  ? 11.002  -6.713  -2.379  1.00 0.00 ? 15  ALA A H    6  
ATOM 9345  H HA   . ALA A 1 15  ? 10.332  -7.220  0.204   1.00 0.00 ? 15  ALA A HA   6  
ATOM 9346  H HB1  . ALA A 1 15  ? 10.027  -4.302  -0.378  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 9347  H HB2  . ALA A 1 15  ? 8.715   -5.078  0.511   1.00 0.00 ? 15  ALA A HB2  6  
ATOM 9348  H HB3  . ALA A 1 15  ? 10.357  -5.108  1.156   1.00 0.00 ? 15  ALA A HB3  6  
ATOM 9349  N N    . VAL A 1 16  ? 8.680   -6.457  -2.475  1.00 0.00 ? 16  VAL A N    6  
ATOM 9350  C CA   . VAL A 1 16  ? 7.519   -6.834  -3.312  1.00 0.00 ? 16  VAL A CA   6  
ATOM 9351  C C    . VAL A 1 16  ? 7.979   -6.839  -4.770  1.00 0.00 ? 16  VAL A C    6  
ATOM 9352  O O    . VAL A 1 16  ? 8.890   -6.123  -5.138  1.00 0.00 ? 16  VAL A O    6  
ATOM 9353  C CB   . VAL A 1 16  ? 6.400   -5.808  -3.119  1.00 0.00 ? 16  VAL A CB   6  
ATOM 9354  C CG1  . VAL A 1 16  ? 5.638   -6.122  -1.830  1.00 0.00 ? 16  VAL A CG1  6  
ATOM 9355  C CG2  . VAL A 1 16  ? 7.007   -4.407  -3.014  1.00 0.00 ? 16  VAL A CG2  6  
ATOM 9356  H H    . VAL A 1 16  ? 9.386   -5.891  -2.860  1.00 0.00 ? 16  VAL A H    6  
ATOM 9357  H HA   . VAL A 1 16  ? 7.169   -7.817  -3.034  1.00 0.00 ? 16  VAL A HA   6  
ATOM 9358  H HB   . VAL A 1 16  ? 5.722   -5.850  -3.959  1.00 0.00 ? 16  VAL A HB   6  
ATOM 9359  H HG11 . VAL A 1 16  ? 5.799   -7.156  -1.561  1.00 0.00 ? 16  VAL A HG11 6  
ATOM 9360  H HG12 . VAL A 1 16  ? 5.997   -5.483  -1.036  1.00 0.00 ? 16  VAL A HG12 6  
ATOM 9361  H HG13 . VAL A 1 16  ? 4.585   -5.950  -1.983  1.00 0.00 ? 16  VAL A HG13 6  
ATOM 9362  H HG21 . VAL A 1 16  ? 7.884   -4.346  -3.640  1.00 0.00 ? 16  VAL A HG21 6  
ATOM 9363  H HG22 . VAL A 1 16  ? 6.282   -3.675  -3.337  1.00 0.00 ? 16  VAL A HG22 6  
ATOM 9364  H HG23 . VAL A 1 16  ? 7.283   -4.210  -1.988  1.00 0.00 ? 16  VAL A HG23 6  
ATOM 9365  N N    . THR A 1 17  ? 7.370   -7.628  -5.609  1.00 0.00 ? 17  THR A N    6  
ATOM 9366  C CA   . THR A 1 17  ? 7.798   -7.651  -7.038  1.00 0.00 ? 17  THR A CA   6  
ATOM 9367  C C    . THR A 1 17  ? 7.193   -6.447  -7.767  1.00 0.00 ? 17  THR A C    6  
ATOM 9368  O O    . THR A 1 17  ? 7.285   -6.328  -8.973  1.00 0.00 ? 17  THR A O    6  
ATOM 9369  C CB   . THR A 1 17  ? 7.320   -8.946  -7.698  1.00 0.00 ? 17  THR A CB   6  
ATOM 9370  O OG1  . THR A 1 17  ? 6.634   -9.738  -6.738  1.00 0.00 ? 17  THR A OG1  6  
ATOM 9371  C CG2  . THR A 1 17  ? 8.525   -9.723  -8.233  1.00 0.00 ? 17  THR A CG2  6  
ATOM 9372  H H    . THR A 1 17  ? 6.636   -8.200  -5.303  1.00 0.00 ? 17  THR A H    6  
ATOM 9373  H HA   . THR A 1 17  ? 8.876   -7.598  -7.090  1.00 0.00 ? 17  THR A HA   6  
ATOM 9374  H HB   . THR A 1 17  ? 6.656   -8.713  -8.514  1.00 0.00 ? 17  THR A HB   6  
ATOM 9375  H HG1  . THR A 1 17  ? 6.639   -10.647 -7.046  1.00 0.00 ? 17  THR A HG1  6  
ATOM 9376  H HG21 . THR A 1 17  ? 9.413   -9.116  -8.139  1.00 0.00 ? 17  THR A HG21 6  
ATOM 9377  H HG22 . THR A 1 17  ? 8.649   -10.633 -7.666  1.00 0.00 ? 17  THR A HG22 6  
ATOM 9378  H HG23 . THR A 1 17  ? 8.364   -9.965  -9.273  1.00 0.00 ? 17  THR A HG23 6  
ATOM 9379  N N    . GLN A 1 18  ? 6.581   -5.554  -7.035  1.00 0.00 ? 18  GLN A N    6  
ATOM 9380  C CA   . GLN A 1 18  ? 5.963   -4.347  -7.658  1.00 0.00 ? 18  GLN A CA   6  
ATOM 9381  C C    . GLN A 1 18  ? 5.720   -3.303  -6.565  1.00 0.00 ? 18  GLN A C    6  
ATOM 9382  O O    . GLN A 1 18  ? 5.957   -3.552  -5.401  1.00 0.00 ? 18  GLN A O    6  
ATOM 9383  C CB   . GLN A 1 18  ? 4.621   -4.724  -8.297  1.00 0.00 ? 18  GLN A CB   6  
ATOM 9384  C CG   . GLN A 1 18  ? 4.840   -5.762  -9.398  1.00 0.00 ? 18  GLN A CG   6  
ATOM 9385  C CD   . GLN A 1 18  ? 3.517   -6.034  -10.117 1.00 0.00 ? 18  GLN A CD   6  
ATOM 9386  O OE1  . GLN A 1 18  ? 3.431   -5.905  -11.322 1.00 0.00 ? 18  GLN A OE1  6  
ATOM 9387  N NE2  . GLN A 1 18  ? 2.476   -6.408  -9.425  1.00 0.00 ? 18  GLN A NE2  6  
ATOM 9388  H H    . GLN A 1 18  ? 6.534   -5.673  -6.065  1.00 0.00 ? 18  GLN A H    6  
ATOM 9389  H HA   . GLN A 1 18  ? 6.625   -3.942  -8.411  1.00 0.00 ? 18  GLN A HA   6  
ATOM 9390  H HB2  . GLN A 1 18  ? 3.967   -5.135  -7.541  1.00 0.00 ? 18  GLN A HB2  6  
ATOM 9391  H HB3  . GLN A 1 18  ? 4.165   -3.842  -8.722  1.00 0.00 ? 18  GLN A HB3  6  
ATOM 9392  H HG2  . GLN A 1 18  ? 5.565   -5.387  -10.106 1.00 0.00 ? 18  GLN A HG2  6  
ATOM 9393  H HG3  . GLN A 1 18  ? 5.205   -6.680  -8.962  1.00 0.00 ? 18  GLN A HG3  6  
ATOM 9394  H HE21 . GLN A 1 18  ? 2.546   -6.513  -8.453  1.00 0.00 ? 18  GLN A HE21 6  
ATOM 9395  H HE22 . GLN A 1 18  ? 1.624   -6.583  -9.876  1.00 0.00 ? 18  GLN A HE22 6  
ATOM 9396  N N    . ALA A 1 19  ? 5.243   -2.138  -6.918  1.00 0.00 ? 19  ALA A N    6  
ATOM 9397  C CA   . ALA A 1 19  ? 4.990   -1.104  -5.872  1.00 0.00 ? 19  ALA A CA   6  
ATOM 9398  C C    . ALA A 1 19  ? 4.385   0.151   -6.504  1.00 0.00 ? 19  ALA A C    6  
ATOM 9399  O O    . ALA A 1 19  ? 4.566   0.419   -7.675  1.00 0.00 ? 19  ALA A O    6  
ATOM 9400  C CB   . ALA A 1 19  ? 6.309   -0.738  -5.190  1.00 0.00 ? 19  ALA A CB   6  
ATOM 9401  H H    . ALA A 1 19  ? 5.050   -1.947  -7.861  1.00 0.00 ? 19  ALA A H    6  
ATOM 9402  H HA   . ALA A 1 19  ? 4.306   -1.500  -5.136  1.00 0.00 ? 19  ALA A HA   6  
ATOM 9403  H HB1  . ALA A 1 19  ? 7.047   -1.497  -5.401  1.00 0.00 ? 19  ALA A HB1  6  
ATOM 9404  H HB2  . ALA A 1 19  ? 6.654   0.214   -5.566  1.00 0.00 ? 19  ALA A HB2  6  
ATOM 9405  H HB3  . ALA A 1 19  ? 6.156   -0.669  -4.124  1.00 0.00 ? 19  ALA A HB3  6  
ATOM 9406  N N    . ALA A 1 20  ? 3.668   0.927   -5.733  1.00 0.00 ? 20  ALA A N    6  
ATOM 9407  C CA   . ALA A 1 20  ? 3.057   2.166   -6.287  1.00 0.00 ? 20  ALA A CA   6  
ATOM 9408  C C    . ALA A 1 20  ? 2.969   3.230   -5.189  1.00 0.00 ? 20  ALA A C    6  
ATOM 9409  O O    . ALA A 1 20  ? 2.248   3.081   -4.223  1.00 0.00 ? 20  ALA A O    6  
ATOM 9410  C CB   . ALA A 1 20  ? 1.651   1.852   -6.803  1.00 0.00 ? 20  ALA A CB   6  
ATOM 9411  H H    . ALA A 1 20  ? 3.535   0.694   -4.790  1.00 0.00 ? 20  ALA A H    6  
ATOM 9412  H HA   . ALA A 1 20  ? 3.664   2.536   -7.098  1.00 0.00 ? 20  ALA A HA   6  
ATOM 9413  H HB1  . ALA A 1 20  ? 1.358   0.865   -6.474  1.00 0.00 ? 20  ALA A HB1  6  
ATOM 9414  H HB2  . ALA A 1 20  ? 0.953   2.582   -6.419  1.00 0.00 ? 20  ALA A HB2  6  
ATOM 9415  H HB3  . ALA A 1 20  ? 1.649   1.886   -7.882  1.00 0.00 ? 20  ALA A HB3  6  
ATOM 9416  N N    . ILE A 1 21  ? 3.686   4.311   -5.328  1.00 0.00 ? 21  ILE A N    6  
ATOM 9417  C CA   . ILE A 1 21  ? 3.619   5.378   -4.290  1.00 0.00 ? 21  ILE A CA   6  
ATOM 9418  C C    . ILE A 1 21  ? 2.377   6.231   -4.544  1.00 0.00 ? 21  ILE A C    6  
ATOM 9419  O O    . ILE A 1 21  ? 2.269   6.901   -5.551  1.00 0.00 ? 21  ILE A O    6  
ATOM 9420  C CB   . ILE A 1 21  ? 4.869   6.259   -4.362  1.00 0.00 ? 21  ILE A CB   6  
ATOM 9421  C CG1  . ILE A 1 21  ? 6.107   5.379   -4.549  1.00 0.00 ? 21  ILE A CG1  6  
ATOM 9422  C CG2  . ILE A 1 21  ? 5.006   7.058   -3.061  1.00 0.00 ? 21  ILE A CG2  6  
ATOM 9423  C CD1  . ILE A 1 21  ? 6.385   4.611   -3.256  1.00 0.00 ? 21  ILE A CD1  6  
ATOM 9424  H H    . ILE A 1 21  ? 4.257   4.426   -6.116  1.00 0.00 ? 21  ILE A H    6  
ATOM 9425  H HA   . ILE A 1 21  ? 3.551   4.924   -3.311  1.00 0.00 ? 21  ILE A HA   6  
ATOM 9426  H HB   . ILE A 1 21  ? 4.781   6.941   -5.195  1.00 0.00 ? 21  ILE A HB   6  
ATOM 9427  H HG12 . ILE A 1 21  ? 5.934   4.681   -5.354  1.00 0.00 ? 21  ILE A HG12 6  
ATOM 9428  H HG13 . ILE A 1 21  ? 6.958   6.000   -4.787  1.00 0.00 ? 21  ILE A HG13 6  
ATOM 9429  H HG21 . ILE A 1 21  ? 4.933   6.388   -2.217  1.00 0.00 ? 21  ILE A HG21 6  
ATOM 9430  H HG22 . ILE A 1 21  ? 5.963   7.556   -3.044  1.00 0.00 ? 21  ILE A HG22 6  
ATOM 9431  H HG23 . ILE A 1 21  ? 4.216   7.793   -3.005  1.00 0.00 ? 21  ILE A HG23 6  
ATOM 9432  H HD11 . ILE A 1 21  ? 6.518   5.311   -2.443  1.00 0.00 ? 21  ILE A HD11 6  
ATOM 9433  H HD12 . ILE A 1 21  ? 5.552   3.961   -3.038  1.00 0.00 ? 21  ILE A HD12 6  
ATOM 9434  H HD13 . ILE A 1 21  ? 7.282   4.021   -3.373  1.00 0.00 ? 21  ILE A HD13 6  
ATOM 9435  N N    . LEU A 1 22  ? 1.435   6.208   -3.643  1.00 0.00 ? 22  LEU A N    6  
ATOM 9436  C CA   . LEU A 1 22  ? 0.199   7.013   -3.843  1.00 0.00 ? 22  LEU A CA   6  
ATOM 9437  C C    . LEU A 1 22  ? 0.209   8.192   -2.867  1.00 0.00 ? 22  LEU A C    6  
ATOM 9438  O O    . LEU A 1 22  ? -0.296  8.105   -1.766  1.00 0.00 ? 22  LEU A O    6  
ATOM 9439  C CB   . LEU A 1 22  ? -1.035  6.133   -3.595  1.00 0.00 ? 22  LEU A CB   6  
ATOM 9440  C CG   . LEU A 1 22  ? -0.704  4.669   -3.922  1.00 0.00 ? 22  LEU A CG   6  
ATOM 9441  C CD1  . LEU A 1 22  ? -1.966  3.811   -3.813  1.00 0.00 ? 22  LEU A CD1  6  
ATOM 9442  C CD2  . LEU A 1 22  ? -0.158  4.571   -5.348  1.00 0.00 ? 22  LEU A CD2  6  
ATOM 9443  H H    . LEU A 1 22  ? 1.537   5.658   -2.836  1.00 0.00 ? 22  LEU A H    6  
ATOM 9444  H HA   . LEU A 1 22  ? 0.176   7.388   -4.857  1.00 0.00 ? 22  LEU A HA   6  
ATOM 9445  H HB2  . LEU A 1 22  ? -1.333  6.213   -2.560  1.00 0.00 ? 22  LEU A HB2  6  
ATOM 9446  H HB3  . LEU A 1 22  ? -1.844  6.464   -4.228  1.00 0.00 ? 22  LEU A HB3  6  
ATOM 9447  H HG   . LEU A 1 22  ? 0.039   4.306   -3.226  1.00 0.00 ? 22  LEU A HG   6  
ATOM 9448  H HD11 . LEU A 1 22  ? -2.415  3.948   -2.840  1.00 0.00 ? 22  LEU A HD11 6  
ATOM 9449  H HD12 . LEU A 1 22  ? -2.669  4.105   -4.579  1.00 0.00 ? 22  LEU A HD12 6  
ATOM 9450  H HD13 . LEU A 1 22  ? -1.706  2.770   -3.946  1.00 0.00 ? 22  LEU A HD13 6  
ATOM 9451  H HD21 . LEU A 1 22  ? -0.180  5.546   -5.812  1.00 0.00 ? 22  LEU A HD21 6  
ATOM 9452  H HD22 . LEU A 1 22  ? 0.857   4.208   -5.321  1.00 0.00 ? 22  LEU A HD22 6  
ATOM 9453  H HD23 . LEU A 1 22  ? -0.769  3.886   -5.919  1.00 0.00 ? 22  LEU A HD23 6  
ATOM 9454  N N    . GLY A 1 23  ? 0.792   9.292   -3.262  1.00 0.00 ? 23  GLY A N    6  
ATOM 9455  C CA   . GLY A 1 23  ? 0.850   10.477  -2.359  1.00 0.00 ? 23  GLY A CA   6  
ATOM 9456  C C    . GLY A 1 23  ? -0.540  10.785  -1.803  1.00 0.00 ? 23  GLY A C    6  
ATOM 9457  O O    . GLY A 1 23  ? -1.498  10.085  -2.067  1.00 0.00 ? 23  GLY A O    6  
ATOM 9458  H H    . GLY A 1 23  ? 1.198   9.336   -4.153  1.00 0.00 ? 23  GLY A H    6  
ATOM 9459  H HA2  . GLY A 1 23  ? 1.526   10.271  -1.543  1.00 0.00 ? 23  GLY A HA2  6  
ATOM 9460  H HA3  . GLY A 1 23  ? 1.207   11.332  -2.913  1.00 0.00 ? 23  GLY A HA3  6  
ATOM 9461  N N    . LEU A 1 24  ? -0.655  11.832  -1.032  1.00 0.00 ? 24  LEU A N    6  
ATOM 9462  C CA   . LEU A 1 24  ? -1.977  12.199  -0.451  1.00 0.00 ? 24  LEU A CA   6  
ATOM 9463  C C    . LEU A 1 24  ? -2.769  13.021  -1.469  1.00 0.00 ? 24  LEU A C    6  
ATOM 9464  O O    . LEU A 1 24  ? -3.910  12.725  -1.767  1.00 0.00 ? 24  LEU A O    6  
ATOM 9465  C CB   . LEU A 1 24  ? -1.761  13.027  0.817   1.00 0.00 ? 24  LEU A CB   6  
ATOM 9466  C CG   . LEU A 1 24  ? -0.609  12.430  1.628   1.00 0.00 ? 24  LEU A CG   6  
ATOM 9467  C CD1  . LEU A 1 24  ? -0.353  13.288  2.868   1.00 0.00 ? 24  LEU A CD1  6  
ATOM 9468  C CD2  . LEU A 1 24  ? -0.973  11.008  2.064   1.00 0.00 ? 24  LEU A CD2  6  
ATOM 9469  H H    . LEU A 1 24  ? 0.135   12.380  -0.835  1.00 0.00 ? 24  LEU A H    6  
ATOM 9470  H HA   . LEU A 1 24  ? -2.524  11.301  -0.206  1.00 0.00 ? 24  LEU A HA   6  
ATOM 9471  H HB2  . LEU A 1 24  ? -1.520  14.045  0.544   1.00 0.00 ? 24  LEU A HB2  6  
ATOM 9472  H HB3  . LEU A 1 24  ? -2.662  13.017  1.413   1.00 0.00 ? 24  LEU A HB3  6  
ATOM 9473  H HG   . LEU A 1 24  ? 0.283   12.404  1.019   1.00 0.00 ? 24  LEU A HG   6  
ATOM 9474  H HD11 . LEU A 1 24  ? -1.056  14.107  2.891   1.00 0.00 ? 24  LEU A HD11 6  
ATOM 9475  H HD12 . LEU A 1 24  ? -0.475  12.684  3.756   1.00 0.00 ? 24  LEU A HD12 6  
ATOM 9476  H HD13 . LEU A 1 24  ? 0.653   13.678  2.834   1.00 0.00 ? 24  LEU A HD13 6  
ATOM 9477  H HD21 . LEU A 1 24  ? -1.316  10.445  1.208   1.00 0.00 ? 24  LEU A HD21 6  
ATOM 9478  H HD22 . LEU A 1 24  ? -0.105  10.527  2.486   1.00 0.00 ? 24  LEU A HD22 6  
ATOM 9479  H HD23 . LEU A 1 24  ? -1.758  11.049  2.805   1.00 0.00 ? 24  LEU A HD23 6  
ATOM 9480  N N    . ASP A 1 25  ? -2.171  14.047  -2.009  1.00 0.00 ? 25  ASP A N    6  
ATOM 9481  C CA   . ASP A 1 25  ? -2.886  14.882  -3.013  1.00 0.00 ? 25  ASP A CA   6  
ATOM 9482  C C    . ASP A 1 25  ? -2.454  14.454  -4.415  1.00 0.00 ? 25  ASP A C    6  
ATOM 9483  O O    . ASP A 1 25  ? -2.711  15.129  -5.392  1.00 0.00 ? 25  ASP A O    6  
ATOM 9484  C CB   . ASP A 1 25  ? -2.536  16.356  -2.795  1.00 0.00 ? 25  ASP A CB   6  
ATOM 9485  C CG   . ASP A 1 25  ? -3.822  17.175  -2.651  1.00 0.00 ? 25  ASP A CG   6  
ATOM 9486  O OD1  . ASP A 1 25  ? -4.884  16.618  -2.870  1.00 0.00 ? 25  ASP A OD1  6  
ATOM 9487  O OD2  . ASP A 1 25  ? -3.720  18.345  -2.324  1.00 0.00 ? 25  ASP A OD2  6  
ATOM 9488  H H    . ASP A 1 25  ? -1.250  14.265  -1.758  1.00 0.00 ? 25  ASP A H    6  
ATOM 9489  H HA   . ASP A 1 25  ? -3.952  14.742  -2.905  1.00 0.00 ? 25  ASP A HA   6  
ATOM 9490  H HB2  . ASP A 1 25  ? -1.944  16.455  -1.897  1.00 0.00 ? 25  ASP A HB2  6  
ATOM 9491  H HB3  . ASP A 1 25  ? -1.973  16.721  -3.640  1.00 0.00 ? 25  ASP A HB3  6  
ATOM 9492  N N    . GLY A 1 26  ? -1.799  13.329  -4.519  1.00 0.00 ? 26  GLY A N    6  
ATOM 9493  C CA   . GLY A 1 26  ? -1.345  12.845  -5.852  1.00 0.00 ? 26  GLY A CA   6  
ATOM 9494  C C    . GLY A 1 26  ? -1.756  11.381  -6.024  1.00 0.00 ? 26  GLY A C    6  
ATOM 9495  O O    . GLY A 1 26  ? -0.965  10.481  -5.828  1.00 0.00 ? 26  GLY A O    6  
ATOM 9496  H H    . GLY A 1 26  ? -1.606  12.801  -3.719  1.00 0.00 ? 26  GLY A H    6  
ATOM 9497  H HA2  . GLY A 1 26  ? -1.801  13.444  -6.627  1.00 0.00 ? 26  GLY A HA2  6  
ATOM 9498  H HA3  . GLY A 1 26  ? -0.270  12.924  -5.917  1.00 0.00 ? 26  GLY A HA3  6  
ATOM 9499  N N    . ASN A 1 27  ? -2.993  11.149  -6.373  1.00 0.00 ? 27  ASN A N    6  
ATOM 9500  C CA   . ASN A 1 27  ? -3.490  9.745   -6.553  1.00 0.00 ? 27  ASN A CA   6  
ATOM 9501  C C    . ASN A 1 27  ? -2.387  8.858   -7.139  1.00 0.00 ? 27  ASN A C    6  
ATOM 9502  O O    . ASN A 1 27  ? -2.329  7.675   -6.870  1.00 0.00 ? 27  ASN A O    6  
ATOM 9503  C CB   . ASN A 1 27  ? -4.707  9.714   -7.496  1.00 0.00 ? 27  ASN A CB   6  
ATOM 9504  C CG   . ASN A 1 27  ? -4.901  11.070  -8.185  1.00 0.00 ? 27  ASN A CG   6  
ATOM 9505  O OD1  . ASN A 1 27  ? -5.403  12.002  -7.587  1.00 0.00 ? 27  ASN A OD1  6  
ATOM 9506  N ND2  . ASN A 1 27  ? -4.523  11.219  -9.424  1.00 0.00 ? 27  ASN A ND2  6  
ATOM 9507  H H    . ASN A 1 27  ? -3.603  11.903  -6.503  1.00 0.00 ? 27  ASN A H    6  
ATOM 9508  H HA   . ASN A 1 27  ? -3.781  9.351   -5.591  1.00 0.00 ? 27  ASN A HA   6  
ATOM 9509  H HB2  . ASN A 1 27  ? -4.554  8.955   -8.248  1.00 0.00 ? 27  ASN A HB2  6  
ATOM 9510  H HB3  . ASN A 1 27  ? -5.593  9.476   -6.926  1.00 0.00 ? 27  ASN A HB3  6  
ATOM 9511  H HD21 . ASN A 1 27  ? -4.117  10.469  -9.906  1.00 0.00 ? 27  ASN A HD21 6  
ATOM 9512  H HD22 . ASN A 1 27  ? -4.645  12.082  -9.874  1.00 0.00 ? 27  ASN A HD22 6  
ATOM 9513  N N    . THR A 1 28  ? -1.512  9.409   -7.938  1.00 0.00 ? 28  THR A N    6  
ATOM 9514  C CA   . THR A 1 28  ? -0.426  8.572   -8.529  1.00 0.00 ? 28  THR A CA   6  
ATOM 9515  C C    . THR A 1 28  ? 0.898   9.341   -8.519  1.00 0.00 ? 28  THR A C    6  
ATOM 9516  O O    . THR A 1 28  ? 1.160   10.156  -9.381  1.00 0.00 ? 28  THR A O    6  
ATOM 9517  C CB   . THR A 1 28  ? -0.788  8.202   -9.970  1.00 0.00 ? 28  THR A CB   6  
ATOM 9518  O OG1  . THR A 1 28  ? -2.201  8.178   -10.110 1.00 0.00 ? 28  THR A OG1  6  
ATOM 9519  C CG2  . THR A 1 28  ? -0.215  6.822   -10.302 1.00 0.00 ? 28  THR A CG2  6  
ATOM 9520  H H    . THR A 1 28  ? -1.569  10.365  -8.149  1.00 0.00 ? 28  THR A H    6  
ATOM 9521  H HA   . THR A 1 28  ? -0.317  7.669   -7.947  1.00 0.00 ? 28  THR A HA   6  
ATOM 9522  H HB   . THR A 1 28  ? -0.371  8.931   -10.646 1.00 0.00 ? 28  THR A HB   6  
ATOM 9523  H HG1  . THR A 1 28  ? -2.563  7.668   -9.382  1.00 0.00 ? 28  THR A HG1  6  
ATOM 9524  H HG21 . THR A 1 28  ? 0.602   6.601   -9.632  1.00 0.00 ? 28  THR A HG21 6  
ATOM 9525  H HG22 . THR A 1 28  ? -0.987  6.073   -10.187 1.00 0.00 ? 28  THR A HG22 6  
ATOM 9526  H HG23 . THR A 1 28  ? 0.143   6.815   -11.322 1.00 0.00 ? 28  THR A HG23 6  
ATOM 9527  N N    . TRP A 1 29  ? 1.742   9.076   -7.557  1.00 0.00 ? 29  TRP A N    6  
ATOM 9528  C CA   . TRP A 1 29  ? 3.056   9.779   -7.498  1.00 0.00 ? 29  TRP A CA   6  
ATOM 9529  C C    . TRP A 1 29  ? 4.120   8.902   -8.160  1.00 0.00 ? 29  TRP A C    6  
ATOM 9530  O O    . TRP A 1 29  ? 5.131   9.381   -8.632  1.00 0.00 ? 29  TRP A O    6  
ATOM 9531  C CB   . TRP A 1 29  ? 3.443   10.022  -6.035  1.00 0.00 ? 29  TRP A CB   6  
ATOM 9532  C CG   . TRP A 1 29  ? 2.924   11.350  -5.576  1.00 0.00 ? 29  TRP A CG   6  
ATOM 9533  C CD1  . TRP A 1 29  ? 2.270   12.249  -6.351  1.00 0.00 ? 29  TRP A CD1  6  
ATOM 9534  C CD2  . TRP A 1 29  ? 3.010   11.943  -4.248  1.00 0.00 ? 29  TRP A CD2  6  
ATOM 9535  N NE1  . TRP A 1 29  ? 1.952   13.354  -5.582  1.00 0.00 ? 29  TRP A NE1  6  
ATOM 9536  C CE2  . TRP A 1 29  ? 2.386   13.214  -4.279  1.00 0.00 ? 29  TRP A CE2  6  
ATOM 9537  C CE3  . TRP A 1 29  ? 3.563   11.507  -3.030  1.00 0.00 ? 29  TRP A CE3  6  
ATOM 9538  C CZ2  . TRP A 1 29  ? 2.314   14.021  -3.142  1.00 0.00 ? 29  TRP A CZ2  6  
ATOM 9539  C CZ3  . TRP A 1 29  ? 3.491   12.317  -1.884  1.00 0.00 ? 29  TRP A CZ3  6  
ATOM 9540  C CH2  . TRP A 1 29  ? 2.868   13.572  -1.941  1.00 0.00 ? 29  TRP A CH2  6  
ATOM 9541  H H    . TRP A 1 29  ? 1.514   8.407   -6.878  1.00 0.00 ? 29  TRP A H    6  
ATOM 9542  H HA   . TRP A 1 29  ? 2.990   10.720  -8.019  1.00 0.00 ? 29  TRP A HA   6  
ATOM 9543  H HB2  . TRP A 1 29  ? 3.023   9.242   -5.418  1.00 0.00 ? 29  TRP A HB2  6  
ATOM 9544  H HB3  . TRP A 1 29  ? 4.520   10.007  -5.944  1.00 0.00 ? 29  TRP A HB3  6  
ATOM 9545  H HD1  . TRP A 1 29  ? 2.034   12.127  -7.397  1.00 0.00 ? 29  TRP A HD1  6  
ATOM 9546  H HE1  . TRP A 1 29  ? 1.476   14.148  -5.902  1.00 0.00 ? 29  TRP A HE1  6  
ATOM 9547  H HE3  . TRP A 1 29  ? 4.046   10.541  -2.976  1.00 0.00 ? 29  TRP A HE3  6  
ATOM 9548  H HZ2  . TRP A 1 29  ? 1.833   14.986  -3.192  1.00 0.00 ? 29  TRP A HZ2  6  
ATOM 9549  H HZ3  . TRP A 1 29  ? 3.918   11.971  -0.955  1.00 0.00 ? 29  TRP A HZ3  6  
ATOM 9550  H HH2  . TRP A 1 29  ? 2.816   14.190  -1.057  1.00 0.00 ? 29  TRP A HH2  6  
ATOM 9551  N N    . ALA A 1 30  ? 3.896   7.618   -8.193  1.00 0.00 ? 30  ALA A N    6  
ATOM 9552  C CA   . ALA A 1 30  ? 4.886   6.698   -8.820  1.00 0.00 ? 30  ALA A CA   6  
ATOM 9553  C C    . ALA A 1 30  ? 4.278   5.297   -8.900  1.00 0.00 ? 30  ALA A C    6  
ATOM 9554  O O    . ALA A 1 30  ? 3.532   4.886   -8.034  1.00 0.00 ? 30  ALA A O    6  
ATOM 9555  C CB   . ALA A 1 30  ? 6.158   6.657   -7.970  1.00 0.00 ? 30  ALA A CB   6  
ATOM 9556  H H    . ALA A 1 30  ? 3.073   7.256   -7.805  1.00 0.00 ? 30  ALA A H    6  
ATOM 9557  H HA   . ALA A 1 30  ? 5.126   7.046   -9.815  1.00 0.00 ? 30  ALA A HA   6  
ATOM 9558  H HB1  . ALA A 1 30  ? 5.901   6.413   -6.950  1.00 0.00 ? 30  ALA A HB1  6  
ATOM 9559  H HB2  . ALA A 1 30  ? 6.829   5.906   -8.362  1.00 0.00 ? 30  ALA A HB2  6  
ATOM 9560  H HB3  . ALA A 1 30  ? 6.643   7.622   -7.999  1.00 0.00 ? 30  ALA A HB3  6  
ATOM 9561  N N    . THR A 1 31  ? 4.582   4.561   -9.933  1.00 0.00 ? 31  THR A N    6  
ATOM 9562  C CA   . THR A 1 31  ? 4.010   3.192   -10.056 1.00 0.00 ? 31  THR A CA   6  
ATOM 9563  C C    . THR A 1 31  ? 4.982   2.290   -10.814 1.00 0.00 ? 31  THR A C    6  
ATOM 9564  O O    . THR A 1 31  ? 5.875   2.754   -11.497 1.00 0.00 ? 31  THR A O    6  
ATOM 9565  C CB   . THR A 1 31  ? 2.683   3.263   -10.818 1.00 0.00 ? 31  THR A CB   6  
ATOM 9566  O OG1  . THR A 1 31  ? 2.855   4.055   -11.986 1.00 0.00 ? 31  THR A OG1  6  
ATOM 9567  C CG2  . THR A 1 31  ? 1.609   3.891   -9.926  1.00 0.00 ? 31  THR A CG2  6  
ATOM 9568  H H    . THR A 1 31  ? 5.182   4.907   -10.625 1.00 0.00 ? 31  THR A H    6  
ATOM 9569  H HA   . THR A 1 31  ? 3.839   2.785   -9.069  1.00 0.00 ? 31  THR A HA   6  
ATOM 9570  H HB   . THR A 1 31  ? 2.375   2.268   -11.099 1.00 0.00 ? 31  THR A HB   6  
ATOM 9571  H HG1  . THR A 1 31  ? 2.496   3.567   -12.731 1.00 0.00 ? 31  THR A HG1  6  
ATOM 9572  H HG21 . THR A 1 31  ? 1.607   3.401   -8.964  1.00 0.00 ? 31  THR A HG21 6  
ATOM 9573  H HG22 . THR A 1 31  ? 1.819   4.943   -9.795  1.00 0.00 ? 31  THR A HG22 6  
ATOM 9574  H HG23 . THR A 1 31  ? 0.641   3.773   -10.392 1.00 0.00 ? 31  THR A HG23 6  
ATOM 9575  N N    . SER A 1 32  ? 4.812   1.003   -10.700 1.00 0.00 ? 32  SER A N    6  
ATOM 9576  C CA   . SER A 1 32  ? 5.718   0.062   -11.411 1.00 0.00 ? 32  SER A CA   6  
ATOM 9577  C C    . SER A 1 32  ? 5.103   -1.338  -11.394 1.00 0.00 ? 32  SER A C    6  
ATOM 9578  O O    . SER A 1 32  ? 5.409   -2.153  -10.545 1.00 0.00 ? 32  SER A O    6  
ATOM 9579  C CB   . SER A 1 32  ? 7.076   0.034   -10.710 1.00 0.00 ? 32  SER A CB   6  
ATOM 9580  O OG   . SER A 1 32  ? 6.988   0.754   -9.488  1.00 0.00 ? 32  SER A OG   6  
ATOM 9581  H H    . SER A 1 32  ? 4.083   0.655   -10.144 1.00 0.00 ? 32  SER A H    6  
ATOM 9582  H HA   . SER A 1 32  ? 5.846   0.387   -12.433 1.00 0.00 ? 32  SER A HA   6  
ATOM 9583  H HB2  . SER A 1 32  ? 7.353   -0.985  -10.501 1.00 0.00 ? 32  SER A HB2  6  
ATOM 9584  H HB3  . SER A 1 32  ? 7.821   0.483   -11.352 1.00 0.00 ? 32  SER A HB3  6  
ATOM 9585  H HG   . SER A 1 32  ? 6.794   0.127   -8.787  1.00 0.00 ? 32  SER A HG   6  
ATOM 9586  N N    . ALA A 1 33  ? 4.233   -1.622  -12.324 1.00 0.00 ? 33  ALA A N    6  
ATOM 9587  C CA   . ALA A 1 33  ? 3.593   -2.966  -12.364 1.00 0.00 ? 33  ALA A CA   6  
ATOM 9588  C C    . ALA A 1 33  ? 2.771   -3.096  -13.646 1.00 0.00 ? 33  ALA A C    6  
ATOM 9589  O O    . ALA A 1 33  ? 3.093   -3.868  -14.527 1.00 0.00 ? 33  ALA A O    6  
ATOM 9590  C CB   . ALA A 1 33  ? 2.674   -3.131  -11.154 1.00 0.00 ? 33  ALA A CB   6  
ATOM 9591  H H    . ALA A 1 33  ? 3.999   -0.948  -12.995 1.00 0.00 ? 33  ALA A H    6  
ATOM 9592  H HA   . ALA A 1 33  ? 4.356   -3.731  -12.345 1.00 0.00 ? 33  ALA A HA   6  
ATOM 9593  H HB1  . ALA A 1 33  ? 3.237   -2.965  -10.249 1.00 0.00 ? 33  ALA A HB1  6  
ATOM 9594  H HB2  . ALA A 1 33  ? 1.868   -2.413  -11.214 1.00 0.00 ? 33  ALA A HB2  6  
ATOM 9595  H HB3  . ALA A 1 33  ? 2.266   -4.131  -11.147 1.00 0.00 ? 33  ALA A HB3  6  
ATOM 9596  N N    . GLY A 1 34  ? 1.712   -2.341  -13.758 1.00 0.00 ? 34  GLY A N    6  
ATOM 9597  C CA   . GLY A 1 34  ? 0.869   -2.417  -14.984 1.00 0.00 ? 34  GLY A CA   6  
ATOM 9598  C C    . GLY A 1 34  ? -0.610  -2.371  -14.599 1.00 0.00 ? 34  GLY A C    6  
ATOM 9599  O O    . GLY A 1 34  ? -1.454  -2.007  -15.393 1.00 0.00 ? 34  GLY A O    6  
ATOM 9600  H H    . GLY A 1 34  ? 1.472   -1.724  -13.036 1.00 0.00 ? 34  GLY A H    6  
ATOM 9601  H HA2  . GLY A 1 34  ? 1.099   -1.581  -15.629 1.00 0.00 ? 34  GLY A HA2  6  
ATOM 9602  H HA3  . GLY A 1 34  ? 1.073   -3.340  -15.505 1.00 0.00 ? 34  GLY A HA3  6  
ATOM 9603  N N    . PHE A 1 35  ? -0.937  -2.740  -13.390 1.00 0.00 ? 35  PHE A N    6  
ATOM 9604  C CA   . PHE A 1 35  ? -2.368  -2.714  -12.975 1.00 0.00 ? 35  PHE A CA   6  
ATOM 9605  C C    . PHE A 1 35  ? -2.899  -1.279  -13.035 1.00 0.00 ? 35  PHE A C    6  
ATOM 9606  O O    . PHE A 1 35  ? -2.185  -0.357  -13.375 1.00 0.00 ? 35  PHE A O    6  
ATOM 9607  C CB   . PHE A 1 35  ? -2.516  -3.279  -11.556 1.00 0.00 ? 35  PHE A CB   6  
ATOM 9608  C CG   . PHE A 1 35  ? -1.831  -2.396  -10.530 1.00 0.00 ? 35  PHE A CG   6  
ATOM 9609  C CD1  . PHE A 1 35  ? -1.005  -1.331  -10.924 1.00 0.00 ? 35  PHE A CD1  6  
ATOM 9610  C CD2  . PHE A 1 35  ? -2.029  -2.655  -9.168  1.00 0.00 ? 35  PHE A CD2  6  
ATOM 9611  C CE1  . PHE A 1 35  ? -0.383  -0.533  -9.954  1.00 0.00 ? 35  PHE A CE1  6  
ATOM 9612  C CE2  . PHE A 1 35  ? -1.407  -1.857  -8.202  1.00 0.00 ? 35  PHE A CE2  6  
ATOM 9613  C CZ   . PHE A 1 35  ? -0.585  -0.797  -8.594  1.00 0.00 ? 35  PHE A CZ   6  
ATOM 9614  H H    . PHE A 1 35  ? -0.246  -3.034  -12.759 1.00 0.00 ? 35  PHE A H    6  
ATOM 9615  H HA   . PHE A 1 35  ? -2.938  -3.325  -13.659 1.00 0.00 ? 35  PHE A HA   6  
ATOM 9616  H HB2  . PHE A 1 35  ? -3.565  -3.351  -11.314 1.00 0.00 ? 35  PHE A HB2  6  
ATOM 9617  H HB3  . PHE A 1 35  ? -2.077  -4.266  -11.523 1.00 0.00 ? 35  PHE A HB3  6  
ATOM 9618  H HD1  . PHE A 1 35  ? -0.846  -1.125  -11.970 1.00 0.00 ? 35  PHE A HD1  6  
ATOM 9619  H HD2  . PHE A 1 35  ? -2.664  -3.473  -8.863  1.00 0.00 ? 35  PHE A HD2  6  
ATOM 9620  H HE1  . PHE A 1 35  ? 0.254   0.286   -10.257 1.00 0.00 ? 35  PHE A HE1  6  
ATOM 9621  H HE2  . PHE A 1 35  ? -1.562  -2.059  -7.152  1.00 0.00 ? 35  PHE A HE2  6  
ATOM 9622  H HZ   . PHE A 1 35  ? -0.105  -0.182  -7.845  1.00 0.00 ? 35  PHE A HZ   6  
ATOM 9623  N N    . ALA A 1 36  ? -4.151  -1.085  -12.725 1.00 0.00 ? 36  ALA A N    6  
ATOM 9624  C CA   . ALA A 1 36  ? -4.727  0.290   -12.781 1.00 0.00 ? 36  ALA A CA   6  
ATOM 9625  C C    . ALA A 1 36  ? -4.966  0.817   -11.362 1.00 0.00 ? 36  ALA A C    6  
ATOM 9626  O O    . ALA A 1 36  ? -5.629  0.192   -10.559 1.00 0.00 ? 36  ALA A O    6  
ATOM 9627  C CB   . ALA A 1 36  ? -6.054  0.255   -13.545 1.00 0.00 ? 36  ALA A CB   6  
ATOM 9628  H H    . ALA A 1 36  ? -4.716  -1.842  -12.464 1.00 0.00 ? 36  ALA A H    6  
ATOM 9629  H HA   . ALA A 1 36  ? -4.037  0.945   -13.294 1.00 0.00 ? 36  ALA A HA   6  
ATOM 9630  H HB1  . ALA A 1 36  ? -6.630  -0.600  -13.224 1.00 0.00 ? 36  ALA A HB1  6  
ATOM 9631  H HB2  . ALA A 1 36  ? -6.609  1.159   -13.345 1.00 0.00 ? 36  ALA A HB2  6  
ATOM 9632  H HB3  . ALA A 1 36  ? -5.857  0.179   -14.604 1.00 0.00 ? 36  ALA A HB3  6  
ATOM 9633  N N    . VAL A 1 37  ? -4.431  1.969   -11.056 1.00 0.00 ? 37  VAL A N    6  
ATOM 9634  C CA   . VAL A 1 37  ? -4.621  2.557   -9.698  1.00 0.00 ? 37  VAL A CA   6  
ATOM 9635  C C    . VAL A 1 37  ? -4.718  4.080   -9.833  1.00 0.00 ? 37  VAL A C    6  
ATOM 9636  O O    . VAL A 1 37  ? -3.728  4.759   -10.019 1.00 0.00 ? 37  VAL A O    6  
ATOM 9637  C CB   . VAL A 1 37  ? -3.425  2.168   -8.808  1.00 0.00 ? 37  VAL A CB   6  
ATOM 9638  C CG1  . VAL A 1 37  ? -3.298  3.115   -7.605  1.00 0.00 ? 37  VAL A CG1  6  
ATOM 9639  C CG2  . VAL A 1 37  ? -3.625  0.743   -8.291  1.00 0.00 ? 37  VAL A CG2  6  
ATOM 9640  H H    . VAL A 1 37  ? -3.905  2.455   -11.726 1.00 0.00 ? 37  VAL A H    6  
ATOM 9641  H HA   . VAL A 1 37  ? -5.535  2.173   -9.264  1.00 0.00 ? 37  VAL A HA   6  
ATOM 9642  H HB   . VAL A 1 37  ? -2.518  2.212   -9.392  1.00 0.00 ? 37  VAL A HB   6  
ATOM 9643  H HG11 . VAL A 1 37  ? -3.953  3.961   -7.725  1.00 0.00 ? 37  VAL A HG11 6  
ATOM 9644  H HG12 . VAL A 1 37  ? -3.561  2.584   -6.703  1.00 0.00 ? 37  VAL A HG12 6  
ATOM 9645  H HG13 . VAL A 1 37  ? -2.278  3.461   -7.529  1.00 0.00 ? 37  VAL A HG13 6  
ATOM 9646  H HG21 . VAL A 1 37  ? -4.405  0.259   -8.859  1.00 0.00 ? 37  VAL A HG21 6  
ATOM 9647  H HG22 . VAL A 1 37  ? -2.704  0.188   -8.398  1.00 0.00 ? 37  VAL A HG22 6  
ATOM 9648  H HG23 . VAL A 1 37  ? -3.907  0.774   -7.248  1.00 0.00 ? 37  VAL A HG23 6  
ATOM 9649  N N    . THR A 1 38  ? -5.905  4.624   -9.739  1.00 0.00 ? 38  THR A N    6  
ATOM 9650  C CA   . THR A 1 38  ? -6.060  6.106   -9.858  1.00 0.00 ? 38  THR A CA   6  
ATOM 9651  C C    . THR A 1 38  ? -7.515  6.514   -9.557  1.00 0.00 ? 38  THR A C    6  
ATOM 9652  O O    . THR A 1 38  ? -7.751  7.285   -8.650  1.00 0.00 ? 38  THR A O    6  
ATOM 9653  C CB   . THR A 1 38  ? -5.650  6.598   -11.265 1.00 0.00 ? 38  THR A CB   6  
ATOM 9654  O OG1  . THR A 1 38  ? -6.703  7.367   -11.827 1.00 0.00 ? 38  THR A OG1  6  
ATOM 9655  C CG2  . THR A 1 38  ? -5.329  5.417   -12.190 1.00 0.00 ? 38  THR A CG2  6  
ATOM 9656  H H    . THR A 1 38  ? -6.688  4.059   -9.580  1.00 0.00 ? 38  THR A H    6  
ATOM 9657  H HA   . THR A 1 38  ? -5.418  6.575   -9.127  1.00 0.00 ? 38  THR A HA   6  
ATOM 9658  H HB   . THR A 1 38  ? -4.772  7.219   -11.176 1.00 0.00 ? 38  THR A HB   6  
ATOM 9659  H HG1  . THR A 1 38  ? -6.323  7.950   -12.490 1.00 0.00 ? 38  THR A HG1  6  
ATOM 9660  H HG21 . THR A 1 38  ? -5.946  4.572   -11.927 1.00 0.00 ? 38  THR A HG21 6  
ATOM 9661  H HG22 . THR A 1 38  ? -5.525  5.700   -13.215 1.00 0.00 ? 38  THR A HG22 6  
ATOM 9662  H HG23 . THR A 1 38  ? -4.289  5.149   -12.083 1.00 0.00 ? 38  THR A HG23 6  
ATOM 9663  N N    . PRO A 1 39  ? -8.451  5.993   -10.320 1.00 0.00 ? 39  PRO A N    6  
ATOM 9664  C CA   . PRO A 1 39  ? -9.880  6.313   -10.124 1.00 0.00 ? 39  PRO A CA   6  
ATOM 9665  C C    . PRO A 1 39  ? -10.338 5.917   -8.714  1.00 0.00 ? 39  PRO A C    6  
ATOM 9666  O O    . PRO A 1 39  ? -10.309 4.760   -8.344  1.00 0.00 ? 39  PRO A O    6  
ATOM 9667  C CB   . PRO A 1 39  ? -10.619 5.483   -11.181 1.00 0.00 ? 39  PRO A CB   6  
ATOM 9668  C CG   . PRO A 1 39  ? -9.562  4.653   -11.951 1.00 0.00 ? 39  PRO A CG   6  
ATOM 9669  C CD   . PRO A 1 39  ? -8.176  5.058   -11.427 1.00 0.00 ? 39  PRO A CD   6  
ATOM 9670  H HA   . PRO A 1 39  ? -10.057 7.363   -10.296 1.00 0.00 ? 39  PRO A HA   6  
ATOM 9671  H HB2  . PRO A 1 39  ? -11.327 4.823   -10.698 1.00 0.00 ? 39  PRO A HB2  6  
ATOM 9672  H HB3  . PRO A 1 39  ? -11.134 6.136   -11.868 1.00 0.00 ? 39  PRO A HB3  6  
ATOM 9673  H HG2  . PRO A 1 39  ? -9.727  3.598   -11.775 1.00 0.00 ? 39  PRO A HG2  6  
ATOM 9674  H HG3  . PRO A 1 39  ? -9.626  4.864   -13.008 1.00 0.00 ? 39  PRO A HG3  6  
ATOM 9675  H HD2  . PRO A 1 39  ? -7.643  4.188   -11.075 1.00 0.00 ? 39  PRO A HD2  6  
ATOM 9676  H HD3  . PRO A 1 39  ? -7.621  5.554   -12.204 1.00 0.00 ? 39  PRO A HD3  6  
ATOM 9677  N N    . ALA A 1 40  ? -10.770 6.869   -7.931  1.00 0.00 ? 40  ALA A N    6  
ATOM 9678  C CA   . ALA A 1 40  ? -11.242 6.551   -6.550  1.00 0.00 ? 40  ALA A CA   6  
ATOM 9679  C C    . ALA A 1 40  ? -10.151 5.799   -5.785  1.00 0.00 ? 40  ALA A C    6  
ATOM 9680  O O    . ALA A 1 40  ? -10.432 4.928   -4.988  1.00 0.00 ? 40  ALA A O    6  
ATOM 9681  C CB   . ALA A 1 40  ? -12.494 5.677   -6.627  1.00 0.00 ? 40  ALA A CB   6  
ATOM 9682  H H    . ALA A 1 40  ? -10.792 7.794   -8.253  1.00 0.00 ? 40  ALA A H    6  
ATOM 9683  H HA   . ALA A 1 40  ? -11.477 7.468   -6.032  1.00 0.00 ? 40  ALA A HA   6  
ATOM 9684  H HB1  . ALA A 1 40  ? -12.586 5.267   -7.623  1.00 0.00 ? 40  ALA A HB1  6  
ATOM 9685  H HB2  . ALA A 1 40  ? -12.414 4.870   -5.913  1.00 0.00 ? 40  ALA A HB2  6  
ATOM 9686  H HB3  . ALA A 1 40  ? -13.365 6.274   -6.401  1.00 0.00 ? 40  ALA A HB3  6  
ATOM 9687  N N    . GLN A 1 41  ? -8.911  6.123   -6.020  1.00 0.00 ? 41  GLN A N    6  
ATOM 9688  C CA   . GLN A 1 41  ? -7.814  5.416   -5.302  1.00 0.00 ? 41  GLN A CA   6  
ATOM 9689  C C    . GLN A 1 41  ? -7.482  6.157   -4.003  1.00 0.00 ? 41  GLN A C    6  
ATOM 9690  O O    . GLN A 1 41  ? -7.479  5.579   -2.933  1.00 0.00 ? 41  GLN A O    6  
ATOM 9691  C CB   . GLN A 1 41  ? -6.577  5.362   -6.199  1.00 0.00 ? 41  GLN A CB   6  
ATOM 9692  C CG   . GLN A 1 41  ? -6.394  3.935   -6.725  1.00 0.00 ? 41  GLN A CG   6  
ATOM 9693  C CD   . GLN A 1 41  ? -5.678  3.089   -5.670  1.00 0.00 ? 41  GLN A CD   6  
ATOM 9694  O OE1  . GLN A 1 41  ? -5.313  3.582   -4.622  1.00 0.00 ? 41  GLN A OE1  6  
ATOM 9695  N NE2  . GLN A 1 41  ? -5.461  1.823   -5.905  1.00 0.00 ? 41  GLN A NE2  6  
ATOM 9696  H H    . GLN A 1 41  ? -8.701  6.828   -6.668  1.00 0.00 ? 41  GLN A H    6  
ATOM 9697  H HA   . GLN A 1 41  ? -8.131  4.411   -5.070  1.00 0.00 ? 41  GLN A HA   6  
ATOM 9698  H HB2  . GLN A 1 41  ? -6.706  6.039   -7.031  1.00 0.00 ? 41  GLN A HB2  6  
ATOM 9699  H HB3  . GLN A 1 41  ? -5.705  5.650   -5.631  1.00 0.00 ? 41  GLN A HB3  6  
ATOM 9700  H HG2  . GLN A 1 41  ? -7.363  3.504   -6.936  1.00 0.00 ? 41  GLN A HG2  6  
ATOM 9701  H HG3  . GLN A 1 41  ? -5.805  3.957   -7.628  1.00 0.00 ? 41  GLN A HG3  6  
ATOM 9702  H HE21 . GLN A 1 41  ? -5.756  1.423   -6.749  1.00 0.00 ? 41  GLN A HE21 6  
ATOM 9703  H HE22 . GLN A 1 41  ? -5.003  1.271   -5.236  1.00 0.00 ? 41  GLN A HE22 6  
ATOM 9704  N N    . GLY A 1 42  ? -7.200  7.429   -4.086  1.00 0.00 ? 42  GLY A N    6  
ATOM 9705  C CA   . GLY A 1 42  ? -6.865  8.201   -2.854  1.00 0.00 ? 42  GLY A CA   6  
ATOM 9706  C C    . GLY A 1 42  ? -8.146  8.527   -2.081  1.00 0.00 ? 42  GLY A C    6  
ATOM 9707  O O    . GLY A 1 42  ? -8.194  8.422   -0.871  1.00 0.00 ? 42  GLY A O    6  
ATOM 9708  H H    . GLY A 1 42  ? -7.205  7.876   -4.957  1.00 0.00 ? 42  GLY A H    6  
ATOM 9709  H HA2  . GLY A 1 42  ? -6.207  7.614   -2.229  1.00 0.00 ? 42  GLY A HA2  6  
ATOM 9710  H HA3  . GLY A 1 42  ? -6.372  9.122   -3.129  1.00 0.00 ? 42  GLY A HA3  6  
ATOM 9711  N N    . GLN A 1 43  ? -9.183  8.927   -2.767  1.00 0.00 ? 43  GLN A N    6  
ATOM 9712  C CA   . GLN A 1 43  ? -10.455 9.262   -2.064  1.00 0.00 ? 43  GLN A CA   6  
ATOM 9713  C C    . GLN A 1 43  ? -10.962 8.034   -1.302  1.00 0.00 ? 43  GLN A C    6  
ATOM 9714  O O    . GLN A 1 43  ? -11.655 8.149   -0.311  1.00 0.00 ? 43  GLN A O    6  
ATOM 9715  C CB   . GLN A 1 43  ? -11.508 9.697   -3.085  1.00 0.00 ? 43  GLN A CB   6  
ATOM 9716  C CG   . GLN A 1 43  ? -11.949 8.490   -3.914  1.00 0.00 ? 43  GLN A CG   6  
ATOM 9717  C CD   . GLN A 1 43  ? -13.222 7.891   -3.312  1.00 0.00 ? 43  GLN A CD   6  
ATOM 9718  O OE1  . GLN A 1 43  ? -14.061 8.606   -2.802  1.00 0.00 ? 43  GLN A OE1  6  
ATOM 9719  N NE2  . GLN A 1 43  ? -13.403 6.599   -3.353  1.00 0.00 ? 43  GLN A NE2  6  
ATOM 9720  H H    . GLN A 1 43  ? -9.125  9.009   -3.740  1.00 0.00 ? 43  GLN A H    6  
ATOM 9721  H HA   . GLN A 1 43  ? -10.279 10.067  -1.366  1.00 0.00 ? 43  GLN A HA   6  
ATOM 9722  H HB2  . GLN A 1 43  ? -12.363 10.109  -2.567  1.00 0.00 ? 43  GLN A HB2  6  
ATOM 9723  H HB3  . GLN A 1 43  ? -11.087 10.445  -3.739  1.00 0.00 ? 43  GLN A HB3  6  
ATOM 9724  H HG2  . GLN A 1 43  ? -12.143 8.805   -4.930  1.00 0.00 ? 43  GLN A HG2  6  
ATOM 9725  H HG3  . GLN A 1 43  ? -11.168 7.745   -3.910  1.00 0.00 ? 43  GLN A HG3  6  
ATOM 9726  H HE21 . GLN A 1 43  ? -12.726 6.023   -3.765  1.00 0.00 ? 43  GLN A HE21 6  
ATOM 9727  H HE22 . GLN A 1 43  ? -14.217 6.207   -2.974  1.00 0.00 ? 43  GLN A HE22 6  
ATOM 9728  N N    . THR A 1 44  ? -10.622 6.859   -1.757  1.00 0.00 ? 44  THR A N    6  
ATOM 9729  C CA   . THR A 1 44  ? -11.084 5.627   -1.056  1.00 0.00 ? 44  THR A CA   6  
ATOM 9730  C C    . THR A 1 44  ? -10.412 5.542   0.314   1.00 0.00 ? 44  THR A C    6  
ATOM 9731  O O    . THR A 1 44  ? -11.066 5.410   1.330   1.00 0.00 ? 44  THR A O    6  
ATOM 9732  C CB   . THR A 1 44  ? -10.710 4.397   -1.890  1.00 0.00 ? 44  THR A CB   6  
ATOM 9733  O OG1  . THR A 1 44  ? -11.551 4.327   -3.032  1.00 0.00 ? 44  THR A OG1  6  
ATOM 9734  C CG2  . THR A 1 44  ? -10.885 3.132   -1.047  1.00 0.00 ? 44  THR A CG2  6  
ATOM 9735  H H    . THR A 1 44  ? -10.062 6.787   -2.558  1.00 0.00 ? 44  THR A H    6  
ATOM 9736  H HA   . THR A 1 44  ? -12.157 5.666   -0.931  1.00 0.00 ? 44  THR A HA   6  
ATOM 9737  H HB   . THR A 1 44  ? -9.681  4.475   -2.204  1.00 0.00 ? 44  THR A HB   6  
ATOM 9738  H HG1  . THR A 1 44  ? -11.549 3.420   -3.349  1.00 0.00 ? 44  THR A HG1  6  
ATOM 9739  H HG21 . THR A 1 44  ? -10.293 3.214   -0.148  1.00 0.00 ? 44  THR A HG21 6  
ATOM 9740  H HG22 . THR A 1 44  ? -11.926 3.015   -0.783  1.00 0.00 ? 44  THR A HG22 6  
ATOM 9741  H HG23 . THR A 1 44  ? -10.559 2.273   -1.615  1.00 0.00 ? 44  THR A HG23 6  
ATOM 9742  N N    . LEU A 1 45  ? -9.110  5.617   0.352   1.00 0.00 ? 45  LEU A N    6  
ATOM 9743  C CA   . LEU A 1 45  ? -8.394  5.540   1.658   1.00 0.00 ? 45  LEU A CA   6  
ATOM 9744  C C    . LEU A 1 45  ? -8.786  6.734   2.532   1.00 0.00 ? 45  LEU A C    6  
ATOM 9745  O O    . LEU A 1 45  ? -8.796  6.653   3.744   1.00 0.00 ? 45  LEU A O    6  
ATOM 9746  C CB   . LEU A 1 45  ? -6.883  5.558   1.411   1.00 0.00 ? 45  LEU A CB   6  
ATOM 9747  C CG   . LEU A 1 45  ? -6.364  4.122   1.325   1.00 0.00 ? 45  LEU A CG   6  
ATOM 9748  C CD1  . LEU A 1 45  ? -6.982  3.427   0.110   1.00 0.00 ? 45  LEU A CD1  6  
ATOM 9749  C CD2  . LEU A 1 45  ? -4.840  4.137   1.180   1.00 0.00 ? 45  LEU A CD2  6  
ATOM 9750  H H    . LEU A 1 45  ? -8.601  5.724   -0.479  1.00 0.00 ? 45  LEU A H    6  
ATOM 9751  H HA   . LEU A 1 45  ? -8.664  4.623   2.161   1.00 0.00 ? 45  LEU A HA   6  
ATOM 9752  H HB2  . LEU A 1 45  ? -6.677  6.073   0.484   1.00 0.00 ? 45  LEU A HB2  6  
ATOM 9753  H HB3  . LEU A 1 45  ? -6.391  6.069   2.224   1.00 0.00 ? 45  LEU A HB3  6  
ATOM 9754  H HG   . LEU A 1 45  ? -6.636  3.586   2.223   1.00 0.00 ? 45  LEU A HG   6  
ATOM 9755  H HD11 . LEU A 1 45  ? -7.260  4.168   -0.625  1.00 0.00 ? 45  LEU A HD11 6  
ATOM 9756  H HD12 . LEU A 1 45  ? -6.263  2.745   -0.320  1.00 0.00 ? 45  LEU A HD12 6  
ATOM 9757  H HD13 . LEU A 1 45  ? -7.860  2.878   0.418   1.00 0.00 ? 45  LEU A HD13 6  
ATOM 9758  H HD21 . LEU A 1 45  ? -4.504  5.150   1.017   1.00 0.00 ? 45  LEU A HD21 6  
ATOM 9759  H HD22 . LEU A 1 45  ? -4.388  3.749   2.081   1.00 0.00 ? 45  LEU A HD22 6  
ATOM 9760  H HD23 . LEU A 1 45  ? -4.552  3.524   0.339   1.00 0.00 ? 45  LEU A HD23 6  
ATOM 9761  N N    . ALA A 1 46  ? -9.111  7.844   1.926   1.00 0.00 ? 46  ALA A N    6  
ATOM 9762  C CA   . ALA A 1 46  ? -9.504  9.042   2.721   1.00 0.00 ? 46  ALA A CA   6  
ATOM 9763  C C    . ALA A 1 46  ? -10.770 8.732   3.521   1.00 0.00 ? 46  ALA A C    6  
ATOM 9764  O O    . ALA A 1 46  ? -10.914 9.138   4.656   1.00 0.00 ? 46  ALA A O    6  
ATOM 9765  C CB   . ALA A 1 46  ? -9.773  10.213  1.776   1.00 0.00 ? 46  ALA A CB   6  
ATOM 9766  H H    . ALA A 1 46  ? -9.098  7.889   0.947   1.00 0.00 ? 46  ALA A H    6  
ATOM 9767  H HA   . ALA A 1 46  ? -8.704  9.302   3.399   1.00 0.00 ? 46  ALA A HA   6  
ATOM 9768  H HB1  . ALA A 1 46  ? -9.391  9.978   0.793   1.00 0.00 ? 46  ALA A HB1  6  
ATOM 9769  H HB2  . ALA A 1 46  ? -10.838 10.387  1.716   1.00 0.00 ? 46  ALA A HB2  6  
ATOM 9770  H HB3  . ALA A 1 46  ? -9.284  11.099  2.151   1.00 0.00 ? 46  ALA A HB3  6  
ATOM 9771  N N    . SER A 1 47  ? -11.691 8.015   2.936   1.00 0.00 ? 47  SER A N    6  
ATOM 9772  C CA   . SER A 1 47  ? -12.949 7.681   3.662   1.00 0.00 ? 47  SER A CA   6  
ATOM 9773  C C    . SER A 1 47  ? -12.738 6.412   4.493   1.00 0.00 ? 47  SER A C    6  
ATOM 9774  O O    . SER A 1 47  ? -13.496 6.116   5.395   1.00 0.00 ? 47  SER A O    6  
ATOM 9775  C CB   . SER A 1 47  ? -14.075 7.452   2.653   1.00 0.00 ? 47  SER A CB   6  
ATOM 9776  O OG   . SER A 1 47  ? -15.109 6.696   3.266   1.00 0.00 ? 47  SER A OG   6  
ATOM 9777  H H    . SER A 1 47  ? -11.556 7.697   2.019   1.00 0.00 ? 47  SER A H    6  
ATOM 9778  H HA   . SER A 1 47  ? -13.213 8.498   4.317   1.00 0.00 ? 47  SER A HA   6  
ATOM 9779  H HB2  . SER A 1 47  ? -14.472 8.399   2.330   1.00 0.00 ? 47  SER A HB2  6  
ATOM 9780  H HB3  . SER A 1 47  ? -13.685 6.918   1.795   1.00 0.00 ? 47  SER A HB3  6  
ATOM 9781  H HG   . SER A 1 47  ? -14.963 5.770   3.060   1.00 0.00 ? 47  SER A HG   6  
ATOM 9782  N N    . ALA A 1 48  ? -11.714 5.660   4.196   1.00 0.00 ? 48  ALA A N    6  
ATOM 9783  C CA   . ALA A 1 48  ? -11.459 4.413   4.971   1.00 0.00 ? 48  ALA A CA   6  
ATOM 9784  C C    . ALA A 1 48  ? -10.810 4.770   6.311   1.00 0.00 ? 48  ALA A C    6  
ATOM 9785  O O    . ALA A 1 48  ? -10.841 4.002   7.252   1.00 0.00 ? 48  ALA A O    6  
ATOM 9786  C CB   . ALA A 1 48  ? -10.520 3.505   4.173   1.00 0.00 ? 48  ALA A CB   6  
ATOM 9787  H H    . ALA A 1 48  ? -11.113 5.915   3.466   1.00 0.00 ? 48  ALA A H    6  
ATOM 9788  H HA   . ALA A 1 48  ? -12.393 3.900   5.147   1.00 0.00 ? 48  ALA A HA   6  
ATOM 9789  H HB1  . ALA A 1 48  ? -10.948 3.307   3.202   1.00 0.00 ? 48  ALA A HB1  6  
ATOM 9790  H HB2  . ALA A 1 48  ? -9.564  3.992   4.054   1.00 0.00 ? 48  ALA A HB2  6  
ATOM 9791  H HB3  . ALA A 1 48  ? -10.383 2.572   4.703   1.00 0.00 ? 48  ALA A HB3  6  
ATOM 9792  N N    . PHE A 1 49  ? -10.219 5.931   6.405   1.00 0.00 ? 49  PHE A N    6  
ATOM 9793  C CA   . PHE A 1 49  ? -9.566  6.334   7.684   1.00 0.00 ? 49  PHE A CA   6  
ATOM 9794  C C    . PHE A 1 49  ? -10.628 6.816   8.674   1.00 0.00 ? 49  PHE A C    6  
ATOM 9795  O O    . PHE A 1 49  ? -10.356 7.021   9.841   1.00 0.00 ? 49  PHE A O    6  
ATOM 9796  C CB   . PHE A 1 49  ? -8.574  7.469   7.415   1.00 0.00 ? 49  PHE A CB   6  
ATOM 9797  C CG   . PHE A 1 49  ? -7.386  6.933   6.655   1.00 0.00 ? 49  PHE A CG   6  
ATOM 9798  C CD1  . PHE A 1 49  ? -6.649  5.862   7.172   1.00 0.00 ? 49  PHE A CD1  6  
ATOM 9799  C CD2  . PHE A 1 49  ? -7.022  7.508   5.431   1.00 0.00 ? 49  PHE A CD2  6  
ATOM 9800  C CE1  . PHE A 1 49  ? -5.547  5.366   6.466   1.00 0.00 ? 49  PHE A CE1  6  
ATOM 9801  C CE2  . PHE A 1 49  ? -5.921  7.012   4.725   1.00 0.00 ? 49  PHE A CE2  6  
ATOM 9802  C CZ   . PHE A 1 49  ? -5.183  5.940   5.243   1.00 0.00 ? 49  PHE A CZ   6  
ATOM 9803  H H    . PHE A 1 49  ? -10.203 6.536   5.634   1.00 0.00 ? 49  PHE A H    6  
ATOM 9804  H HA   . PHE A 1 49  ? -9.042  5.489   8.102   1.00 0.00 ? 49  PHE A HA   6  
ATOM 9805  H HB2  . PHE A 1 49  ? -9.059  8.240   6.832   1.00 0.00 ? 49  PHE A HB2  6  
ATOM 9806  H HB3  . PHE A 1 49  ? -8.241  7.885   8.355   1.00 0.00 ? 49  PHE A HB3  6  
ATOM 9807  H HD1  . PHE A 1 49  ? -6.930  5.420   8.117   1.00 0.00 ? 49  PHE A HD1  6  
ATOM 9808  H HD2  . PHE A 1 49  ? -7.592  8.334   5.031   1.00 0.00 ? 49  PHE A HD2  6  
ATOM 9809  H HE1  . PHE A 1 49  ? -4.978  4.540   6.866   1.00 0.00 ? 49  PHE A HE1  6  
ATOM 9810  H HE2  . PHE A 1 49  ? -5.639  7.456   3.782   1.00 0.00 ? 49  PHE A HE2  6  
ATOM 9811  H HZ   . PHE A 1 49  ? -4.333  5.557   4.698   1.00 0.00 ? 49  PHE A HZ   6  
ATOM 9812  N N    . ASN A 1 50  ? -11.836 7.002   8.220   1.00 0.00 ? 50  ASN A N    6  
ATOM 9813  C CA   . ASN A 1 50  ? -12.909 7.473   9.139   1.00 0.00 ? 50  ASN A CA   6  
ATOM 9814  C C    . ASN A 1 50  ? -13.597 6.269   9.783   1.00 0.00 ? 50  ASN A C    6  
ATOM 9815  O O    . ASN A 1 50  ? -14.505 6.415   10.579  1.00 0.00 ? 50  ASN A O    6  
ATOM 9816  C CB   . ASN A 1 50  ? -13.937 8.288   8.348   1.00 0.00 ? 50  ASN A CB   6  
ATOM 9817  C CG   . ASN A 1 50  ? -14.752 9.157   9.308   1.00 0.00 ? 50  ASN A CG   6  
ATOM 9818  O OD1  . ASN A 1 50  ? -15.486 8.650   10.133  1.00 0.00 ? 50  ASN A OD1  6  
ATOM 9819  N ND2  . ASN A 1 50  ? -14.654 10.456  9.234   1.00 0.00 ? 50  ASN A ND2  6  
ATOM 9820  H H    . ASN A 1 50  ? -12.037 6.834   7.276   1.00 0.00 ? 50  ASN A H    6  
ATOM 9821  H HA   . ASN A 1 50  ? -12.475 8.093   9.909   1.00 0.00 ? 50  ASN A HA   6  
ATOM 9822  H HB2  . ASN A 1 50  ? -13.425 8.919   7.636   1.00 0.00 ? 50  ASN A HB2  6  
ATOM 9823  H HB3  . ASN A 1 50  ? -14.599 7.617   7.823   1.00 0.00 ? 50  ASN A HB3  6  
ATOM 9824  H HD21 . ASN A 1 50  ? -14.062 10.867  8.568   1.00 0.00 ? 50  ASN A HD21 6  
ATOM 9825  H HD22 . ASN A 1 50  ? -15.173 11.023  9.843   1.00 0.00 ? 50  ASN A HD22 6  
ATOM 9826  N N    . ASN A 1 51  ? -13.178 5.077   9.449   1.00 0.00 ? 51  ASN A N    6  
ATOM 9827  C CA   . ASN A 1 51  ? -13.818 3.871   10.047  1.00 0.00 ? 51  ASN A CA   6  
ATOM 9828  C C    . ASN A 1 51  ? -13.235 2.605   9.413   1.00 0.00 ? 51  ASN A C    6  
ATOM 9829  O O    . ASN A 1 51  ? -13.350 2.386   8.223   1.00 0.00 ? 51  ASN A O    6  
ATOM 9830  C CB   . ASN A 1 51  ? -15.327 3.919   9.795   1.00 0.00 ? 51  ASN A CB   6  
ATOM 9831  C CG   . ASN A 1 51  ? -15.597 4.539   8.423   1.00 0.00 ? 51  ASN A CG   6  
ATOM 9832  O OD1  . ASN A 1 51  ? -15.180 4.010   7.412   1.00 0.00 ? 51  ASN A OD1  6  
ATOM 9833  N ND2  . ASN A 1 51  ? -16.283 5.647   8.343   1.00 0.00 ? 51  ASN A ND2  6  
ATOM 9834  H H    . ASN A 1 51  ? -12.446 4.976   8.805   1.00 0.00 ? 51  ASN A H    6  
ATOM 9835  H HA   . ASN A 1 51  ? -13.633 3.856   11.111  1.00 0.00 ? 51  ASN A HA   6  
ATOM 9836  H HB2  . ASN A 1 51  ? -15.727 2.915   9.822   1.00 0.00 ? 51  ASN A HB2  6  
ATOM 9837  H HB3  . ASN A 1 51  ? -15.800 4.517   10.558  1.00 0.00 ? 51  ASN A HB3  6  
ATOM 9838  H HD21 . ASN A 1 51  ? -16.618 6.075   9.158   1.00 0.00 ? 51  ASN A HD21 6  
ATOM 9839  H HD22 . ASN A 1 51  ? -16.462 6.050   7.468   1.00 0.00 ? 51  ASN A HD22 6  
ATOM 9840  N N    . ALA A 1 52  ? -12.618 1.768   10.202  1.00 0.00 ? 52  ALA A N    6  
ATOM 9841  C CA   . ALA A 1 52  ? -12.034 0.513   9.649   1.00 0.00 ? 52  ALA A CA   6  
ATOM 9842  C C    . ALA A 1 52  ? -13.038 -0.629  9.820   1.00 0.00 ? 52  ALA A C    6  
ATOM 9843  O O    . ALA A 1 52  ? -12.897 -1.687  9.241   1.00 0.00 ? 52  ALA A O    6  
ATOM 9844  C CB   . ALA A 1 52  ? -10.744 0.172   10.401  1.00 0.00 ? 52  ALA A CB   6  
ATOM 9845  H H    . ALA A 1 52  ? -12.541 1.963   11.159  1.00 0.00 ? 52  ALA A H    6  
ATOM 9846  H HA   . ALA A 1 52  ? -11.815 0.648   8.601   1.00 0.00 ? 52  ALA A HA   6  
ATOM 9847  H HB1  . ALA A 1 52  ? -10.244 1.085   10.691  1.00 0.00 ? 52  ALA A HB1  6  
ATOM 9848  H HB2  . ALA A 1 52  ? -10.984 -0.403  11.283  1.00 0.00 ? 52  ALA A HB2  6  
ATOM 9849  H HB3  . ALA A 1 52  ? -10.096 -0.405  9.759   1.00 0.00 ? 52  ALA A HB3  6  
ATOM 9850  N N    . ASP A 1 53  ? -14.052 -0.422  10.613  1.00 0.00 ? 53  ASP A N    6  
ATOM 9851  C CA   . ASP A 1 53  ? -15.068 -1.490  10.824  1.00 0.00 ? 53  ASP A CA   6  
ATOM 9852  C C    . ASP A 1 53  ? -15.783 -1.809  9.505   1.00 0.00 ? 53  ASP A C    6  
ATOM 9853  O O    . ASP A 1 53  ? -15.899 -2.960  9.134   1.00 0.00 ? 53  ASP A O    6  
ATOM 9854  C CB   . ASP A 1 53  ? -16.095 -1.019  11.855  1.00 0.00 ? 53  ASP A CB   6  
ATOM 9855  C CG   . ASP A 1 53  ? -15.799 -1.673  13.205  1.00 0.00 ? 53  ASP A CG   6  
ATOM 9856  O OD1  . ASP A 1 53  ? -16.026 -2.866  13.325  1.00 0.00 ? 53  ASP A OD1  6  
ATOM 9857  O OD2  . ASP A 1 53  ? -15.350 -0.972  14.097  1.00 0.00 ? 53  ASP A OD2  6  
ATOM 9858  H H    . ASP A 1 53  ? -14.146 0.439   11.071  1.00 0.00 ? 53  ASP A H    6  
ATOM 9859  H HA   . ASP A 1 53  ? -14.579 -2.380  11.190  1.00 0.00 ? 53  ASP A HA   6  
ATOM 9860  H HB2  . ASP A 1 53  ? -16.038 0.056   11.953  1.00 0.00 ? 53  ASP A HB2  6  
ATOM 9861  H HB3  . ASP A 1 53  ? -17.085 -1.299  11.530  1.00 0.00 ? 53  ASP A HB3  6  
ATOM 9862  N N    . PRO A 1 54  ? -16.257 -0.783  8.839   1.00 0.00 ? 54  PRO A N    6  
ATOM 9863  C CA   . PRO A 1 54  ? -16.981 -0.945  7.565   1.00 0.00 ? 54  PRO A CA   6  
ATOM 9864  C C    . PRO A 1 54  ? -16.066 -1.536  6.485   1.00 0.00 ? 54  PRO A C    6  
ATOM 9865  O O    . PRO A 1 54  ? -16.524 -1.968  5.446   1.00 0.00 ? 54  PRO A O    6  
ATOM 9866  C CB   . PRO A 1 54  ? -17.419 0.473   7.177   1.00 0.00 ? 54  PRO A CB   6  
ATOM 9867  C CG   . PRO A 1 54  ? -16.898 1.443   8.268   1.00 0.00 ? 54  PRO A CG   6  
ATOM 9868  C CD   . PRO A 1 54  ? -16.121 0.612   9.300   1.00 0.00 ? 54  PRO A CD   6  
ATOM 9869  H HA   . PRO A 1 54  ? -17.850 -1.569  7.704   1.00 0.00 ? 54  PRO A HA   6  
ATOM 9870  H HB2  . PRO A 1 54  ? -16.998 0.736   6.217   1.00 0.00 ? 54  PRO A HB2  6  
ATOM 9871  H HB3  . PRO A 1 54  ? -18.496 0.525   7.134   1.00 0.00 ? 54  PRO A HB3  6  
ATOM 9872  H HG2  . PRO A 1 54  ? -16.245 2.179   7.821   1.00 0.00 ? 54  PRO A HG2  6  
ATOM 9873  H HG3  . PRO A 1 54  ? -17.730 1.933   8.751   1.00 0.00 ? 54  PRO A HG3  6  
ATOM 9874  H HD2  . PRO A 1 54  ? -15.083 0.912   9.303   1.00 0.00 ? 54  PRO A HD2  6  
ATOM 9875  H HD3  . PRO A 1 54  ? -16.553 0.726   10.282  1.00 0.00 ? 54  PRO A HD3  6  
ATOM 9876  N N    . ILE A 1 55  ? -14.780 -1.557  6.710   1.00 0.00 ? 55  ILE A N    6  
ATOM 9877  C CA   . ILE A 1 55  ? -13.863 -2.120  5.676   1.00 0.00 ? 55  ILE A CA   6  
ATOM 9878  C C    . ILE A 1 55  ? -13.641 -3.614  5.946   1.00 0.00 ? 55  ILE A C    6  
ATOM 9879  O O    . ILE A 1 55  ? -13.152 -4.339  5.102   1.00 0.00 ? 55  ILE A O    6  
ATOM 9880  C CB   . ILE A 1 55  ? -12.519 -1.357  5.685   1.00 0.00 ? 55  ILE A CB   6  
ATOM 9881  C CG1  . ILE A 1 55  ? -11.472 -2.095  6.528   1.00 0.00 ? 55  ILE A CG1  6  
ATOM 9882  C CG2  . ILE A 1 55  ? -12.720 0.042   6.268   1.00 0.00 ? 55  ILE A CG2  6  
ATOM 9883  C CD1  . ILE A 1 55  ? -10.179 -1.280  6.554   1.00 0.00 ? 55  ILE A CD1  6  
ATOM 9884  H H    . ILE A 1 55  ? -14.420 -1.203  7.551   1.00 0.00 ? 55  ILE A H    6  
ATOM 9885  H HA   . ILE A 1 55  ? -14.325 -2.006  4.704   1.00 0.00 ? 55  ILE A HA   6  
ATOM 9886  H HB   . ILE A 1 55  ? -12.160 -1.267  4.669   1.00 0.00 ? 55  ILE A HB   6  
ATOM 9887  H HG12 . ILE A 1 55  ? -11.842 -2.218  7.534   1.00 0.00 ? 55  ILE A HG12 6  
ATOM 9888  H HG13 . ILE A 1 55  ? -11.277 -3.064  6.095   1.00 0.00 ? 55  ILE A HG13 6  
ATOM 9889  H HG21 . ILE A 1 55  ? -13.513 0.545   5.737   1.00 0.00 ? 55  ILE A HG21 6  
ATOM 9890  H HG22 . ILE A 1 55  ? -12.979 -0.039  7.313   1.00 0.00 ? 55  ILE A HG22 6  
ATOM 9891  H HG23 . ILE A 1 55  ? -11.804 0.606   6.168   1.00 0.00 ? 55  ILE A HG23 6  
ATOM 9892  H HD11 . ILE A 1 55  ? -10.307 -0.385  5.960   1.00 0.00 ? 55  ILE A HD11 6  
ATOM 9893  H HD12 . ILE A 1 55  ? -9.948  -1.005  7.572   1.00 0.00 ? 55  ILE A HD12 6  
ATOM 9894  H HD13 . ILE A 1 55  ? -9.373  -1.870  6.146   1.00 0.00 ? 55  ILE A HD13 6  
ATOM 9895  N N    . ARG A 1 56  ? -13.993 -4.075  7.114   1.00 0.00 ? 56  ARG A N    6  
ATOM 9896  C CA   . ARG A 1 56  ? -13.799 -5.517  7.434   1.00 0.00 ? 56  ARG A CA   6  
ATOM 9897  C C    . ARG A 1 56  ? -14.950 -6.331  6.839   1.00 0.00 ? 56  ARG A C    6  
ATOM 9898  O O    . ARG A 1 56  ? -14.742 -7.338  6.191   1.00 0.00 ? 56  ARG A O    6  
ATOM 9899  C CB   . ARG A 1 56  ? -13.776 -5.709  8.952   1.00 0.00 ? 56  ARG A CB   6  
ATOM 9900  C CG   . ARG A 1 56  ? -12.981 -4.573  9.602   1.00 0.00 ? 56  ARG A CG   6  
ATOM 9901  C CD   . ARG A 1 56  ? -12.098 -5.120  10.731  1.00 0.00 ? 56  ARG A CD   6  
ATOM 9902  N NE   . ARG A 1 56  ? -12.649 -6.416  11.251  1.00 0.00 ? 56  ARG A NE   6  
ATOM 9903  C CZ   . ARG A 1 56  ? -13.902 -6.532  11.613  1.00 0.00 ? 56  ARG A CZ   6  
ATOM 9904  N NH1  . ARG A 1 56  ? -14.669 -5.480  11.710  1.00 0.00 ? 56  ARG A NH1  6  
ATOM 9905  N NH2  . ARG A 1 56  ? -14.373 -7.706  11.932  1.00 0.00 ? 56  ARG A NH2  6  
ATOM 9906  H H    . ARG A 1 56  ? -14.384 -3.474  7.782   1.00 0.00 ? 56  ARG A H    6  
ATOM 9907  H HA   . ARG A 1 56  ? -12.864 -5.856  7.014   1.00 0.00 ? 56  ARG A HA   6  
ATOM 9908  H HB2  . ARG A 1 56  ? -14.789 -5.705  9.330   1.00 0.00 ? 56  ARG A HB2  6  
ATOM 9909  H HB3  . ARG A 1 56  ? -13.310 -6.654  9.186   1.00 0.00 ? 56  ARG A HB3  6  
ATOM 9910  H HG2  . ARG A 1 56  ? -12.355 -4.108  8.855   1.00 0.00 ? 56  ARG A HG2  6  
ATOM 9911  H HG3  . ARG A 1 56  ? -13.663 -3.838  10.001  1.00 0.00 ? 56  ARG A HG3  6  
ATOM 9912  H HD2  . ARG A 1 56  ? -11.114 -5.313  10.346  1.00 0.00 ? 56  ARG A HD2  6  
ATOM 9913  H HD3  . ARG A 1 56  ? -12.028 -4.378  11.522  1.00 0.00 ? 56  ARG A HD3  6  
ATOM 9914  H HE   . ARG A 1 56  ? -12.070 -7.207  11.273  1.00 0.00 ? 56  ARG A HE   6  
ATOM 9915  H HH11 . ARG A 1 56  ? -14.304 -4.574  11.514  1.00 0.00 ? 56  ARG A HH11 6  
ATOM 9916  H HH12 . ARG A 1 56  ? -15.626 -5.584  11.982  1.00 0.00 ? 56  ARG A HH12 6  
ATOM 9917  H HH21 . ARG A 1 56  ? -13.779 -8.510  11.901  1.00 0.00 ? 56  ARG A HH21 6  
ATOM 9918  H HH22 . ARG A 1 56  ? -15.330 -7.803  12.209  1.00 0.00 ? 56  ARG A HH22 6  
ATOM 9919  N N    . ALA A 1 57  ? -16.163 -5.905  7.056   1.00 0.00 ? 57  ALA A N    6  
ATOM 9920  C CA   . ALA A 1 57  ? -17.326 -6.653  6.505   1.00 0.00 ? 57  ALA A CA   6  
ATOM 9921  C C    . ALA A 1 57  ? -17.461 -6.355  5.011   1.00 0.00 ? 57  ALA A C    6  
ATOM 9922  O O    . ALA A 1 57  ? -16.944 -7.071  4.177   1.00 0.00 ? 57  ALA A O    6  
ATOM 9923  C CB   . ALA A 1 57  ? -18.601 -6.222  7.229   1.00 0.00 ? 57  ALA A CB   6  
ATOM 9924  H H    . ALA A 1 57  ? -16.309 -5.090  7.582   1.00 0.00 ? 57  ALA A H    6  
ATOM 9925  H HA   . ALA A 1 57  ? -17.171 -7.714  6.648   1.00 0.00 ? 57  ALA A HA   6  
ATOM 9926  H HB1  . ALA A 1 57  ? -18.431 -5.277  7.725   1.00 0.00 ? 57  ALA A HB1  6  
ATOM 9927  H HB2  . ALA A 1 57  ? -19.401 -6.113  6.512   1.00 0.00 ? 57  ALA A HB2  6  
ATOM 9928  H HB3  . ALA A 1 57  ? -18.870 -6.970  7.961   1.00 0.00 ? 57  ALA A HB3  6  
ATOM 9929  N N    . SER A 1 58  ? -18.150 -5.303  4.668   1.00 0.00 ? 58  SER A N    6  
ATOM 9930  C CA   . SER A 1 58  ? -18.314 -4.959  3.226   1.00 0.00 ? 58  SER A CA   6  
ATOM 9931  C C    . SER A 1 58  ? -16.967 -5.106  2.519   1.00 0.00 ? 58  SER A C    6  
ATOM 9932  O O    . SER A 1 58  ? -16.830 -5.854  1.571   1.00 0.00 ? 58  SER A O    6  
ATOM 9933  C CB   . SER A 1 58  ? -18.806 -3.517  3.098   1.00 0.00 ? 58  SER A CB   6  
ATOM 9934  O OG   . SER A 1 58  ? -20.185 -3.459  3.435   1.00 0.00 ? 58  SER A OG   6  
ATOM 9935  H H    . SER A 1 58  ? -18.559 -4.736  5.355   1.00 0.00 ? 58  SER A H    6  
ATOM 9936  H HA   . SER A 1 58  ? -19.033 -5.628  2.775   1.00 0.00 ? 58  SER A HA   6  
ATOM 9937  H HB2  . SER A 1 58  ? -18.250 -2.883  3.769   1.00 0.00 ? 58  SER A HB2  6  
ATOM 9938  H HB3  . SER A 1 58  ? -18.658 -3.176  2.082   1.00 0.00 ? 58  SER A HB3  6  
ATOM 9939  H HG   . SER A 1 58  ? -20.282 -2.877  4.191   1.00 0.00 ? 58  SER A HG   6  
ATOM 9940  N N    . GLY A 1 59  ? -15.967 -4.405  2.976   1.00 0.00 ? 59  GLY A N    6  
ATOM 9941  C CA   . GLY A 1 59  ? -14.628 -4.512  2.332   1.00 0.00 ? 59  GLY A CA   6  
ATOM 9942  C C    . GLY A 1 59  ? -14.264 -3.182  1.672   1.00 0.00 ? 59  GLY A C    6  
ATOM 9943  O O    . GLY A 1 59  ? -15.051 -2.258  1.633   1.00 0.00 ? 59  GLY A O    6  
ATOM 9944  H H    . GLY A 1 59  ? -16.096 -3.810  3.744   1.00 0.00 ? 59  GLY A H    6  
ATOM 9945  H HA2  . GLY A 1 59  ? -13.889 -4.758  3.080   1.00 0.00 ? 59  GLY A HA2  6  
ATOM 9946  H HA3  . GLY A 1 59  ? -14.651 -5.287  1.581   1.00 0.00 ? 59  GLY A HA3  6  
ATOM 9947  N N    . PHE A 1 60  ? -13.074 -3.084  1.149   1.00 0.00 ? 60  PHE A N    6  
ATOM 9948  C CA   . PHE A 1 60  ? -12.649 -1.821  0.484   1.00 0.00 ? 60  PHE A CA   6  
ATOM 9949  C C    . PHE A 1 60  ? -12.199 -2.137  -0.942  1.00 0.00 ? 60  PHE A C    6  
ATOM 9950  O O    . PHE A 1 60  ? -11.340 -2.969  -1.161  1.00 0.00 ? 60  PHE A O    6  
ATOM 9951  C CB   . PHE A 1 60  ? -11.491 -1.192  1.270   1.00 0.00 ? 60  PHE A CB   6  
ATOM 9952  C CG   . PHE A 1 60  ? -10.315 -2.141  1.299   1.00 0.00 ? 60  PHE A CG   6  
ATOM 9953  C CD1  . PHE A 1 60  ? -10.380 -3.315  2.059   1.00 0.00 ? 60  PHE A CD1  6  
ATOM 9954  C CD2  . PHE A 1 60  ? -9.159  -1.845  0.567   1.00 0.00 ? 60  PHE A CD2  6  
ATOM 9955  C CE1  . PHE A 1 60  ? -9.289  -4.192  2.085   1.00 0.00 ? 60  PHE A CE1  6  
ATOM 9956  C CE2  . PHE A 1 60  ? -8.069  -2.724  0.595   1.00 0.00 ? 60  PHE A CE2  6  
ATOM 9957  C CZ   . PHE A 1 60  ? -8.135  -3.897  1.354   1.00 0.00 ? 60  PHE A CZ   6  
ATOM 9958  H H    . PHE A 1 60  ? -12.460 -3.846  1.190   1.00 0.00 ? 60  PHE A H    6  
ATOM 9959  H HA   . PHE A 1 60  ? -13.481 -1.132  0.455   1.00 0.00 ? 60  PHE A HA   6  
ATOM 9960  H HB2  . PHE A 1 60  ? -11.195 -0.269  0.796   1.00 0.00 ? 60  PHE A HB2  6  
ATOM 9961  H HB3  . PHE A 1 60  ? -11.813 -0.990  2.281   1.00 0.00 ? 60  PHE A HB3  6  
ATOM 9962  H HD1  . PHE A 1 60  ? -11.270 -3.544  2.625   1.00 0.00 ? 60  PHE A HD1  6  
ATOM 9963  H HD2  . PHE A 1 60  ? -9.108  -0.939  -0.018  1.00 0.00 ? 60  PHE A HD2  6  
ATOM 9964  H HE1  . PHE A 1 60  ? -9.341  -5.095  2.671   1.00 0.00 ? 60  PHE A HE1  6  
ATOM 9965  H HE2  . PHE A 1 60  ? -7.178  -2.496  0.030   1.00 0.00 ? 60  PHE A HE2  6  
ATOM 9966  H HZ   . PHE A 1 60  ? -7.295  -4.575  1.374   1.00 0.00 ? 60  PHE A HZ   6  
ATOM 9967  N N    . ASP A 1 61  ? -12.780 -1.494  -1.917  1.00 0.00 ? 61  ASP A N    6  
ATOM 9968  C CA   . ASP A 1 61  ? -12.391 -1.776  -3.328  1.00 0.00 ? 61  ASP A CA   6  
ATOM 9969  C C    . ASP A 1 61  ? -11.630 -0.584  -3.913  1.00 0.00 ? 61  ASP A C    6  
ATOM 9970  O O    . ASP A 1 61  ? -11.698 0.521   -3.411  1.00 0.00 ? 61  ASP A O    6  
ATOM 9971  C CB   . ASP A 1 61  ? -13.647 -2.036  -4.169  1.00 0.00 ? 61  ASP A CB   6  
ATOM 9972  C CG   . ASP A 1 61  ? -14.835 -1.270  -3.580  1.00 0.00 ? 61  ASP A CG   6  
ATOM 9973  O OD1  . ASP A 1 61  ? -14.938 -0.083  -3.841  1.00 0.00 ? 61  ASP A OD1  6  
ATOM 9974  O OD2  . ASP A 1 61  ? -15.621 -1.886  -2.878  1.00 0.00 ? 61  ASP A OD2  6  
ATOM 9975  H H    . ASP A 1 61  ? -13.479 -0.835  -1.722  1.00 0.00 ? 61  ASP A H    6  
ATOM 9976  H HA   . ASP A 1 61  ? -11.758 -2.650  -3.354  1.00 0.00 ? 61  ASP A HA   6  
ATOM 9977  H HB2  . ASP A 1 61  ? -13.474 -1.706  -5.183  1.00 0.00 ? 61  ASP A HB2  6  
ATOM 9978  H HB3  . ASP A 1 61  ? -13.868 -3.094  -4.168  1.00 0.00 ? 61  ASP A HB3  6  
ATOM 9979  N N    . LEU A 1 62  ? -10.911 -0.808  -4.981  1.00 0.00 ? 62  LEU A N    6  
ATOM 9980  C CA   . LEU A 1 62  ? -10.144 0.296   -5.623  1.00 0.00 ? 62  LEU A CA   6  
ATOM 9981  C C    . LEU A 1 62  ? -10.441 0.297   -7.124  1.00 0.00 ? 62  LEU A C    6  
ATOM 9982  O O    . LEU A 1 62  ? -11.549 0.036   -7.547  1.00 0.00 ? 62  LEU A O    6  
ATOM 9983  C CB   . LEU A 1 62  ? -8.643  0.079   -5.400  1.00 0.00 ? 62  LEU A CB   6  
ATOM 9984  C CG   . LEU A 1 62  ? -8.387  -0.339  -3.954  1.00 0.00 ? 62  LEU A CG   6  
ATOM 9985  C CD1  . LEU A 1 62  ? -7.846  -1.770  -3.928  1.00 0.00 ? 62  LEU A CD1  6  
ATOM 9986  C CD2  . LEU A 1 62  ? -7.356  0.605   -3.331  1.00 0.00 ? 62  LEU A CD2  6  
ATOM 9987  H H    . LEU A 1 62  ? -10.883 -1.708  -5.367  1.00 0.00 ? 62  LEU A H    6  
ATOM 9988  H HA   . LEU A 1 62  ? -10.441 1.241   -5.197  1.00 0.00 ? 62  LEU A HA   6  
ATOM 9989  H HB2  . LEU A 1 62  ? -8.290  -0.695  -6.066  1.00 0.00 ? 62  LEU A HB2  6  
ATOM 9990  H HB3  . LEU A 1 62  ? -8.115  0.998   -5.605  1.00 0.00 ? 62  LEU A HB3  6  
ATOM 9991  H HG   . LEU A 1 62  ? -9.310  -0.292  -3.394  1.00 0.00 ? 62  LEU A HG   6  
ATOM 9992  H HD11 . LEU A 1 62  ? -7.474  -2.031  -4.907  1.00 0.00 ? 62  LEU A HD11 6  
ATOM 9993  H HD12 . LEU A 1 62  ? -7.043  -1.838  -3.208  1.00 0.00 ? 62  LEU A HD12 6  
ATOM 9994  H HD13 . LEU A 1 62  ? -8.638  -2.449  -3.650  1.00 0.00 ? 62  LEU A HD13 6  
ATOM 9995  H HD21 . LEU A 1 62  ? -7.630  1.628   -3.542  1.00 0.00 ? 62  LEU A HD21 6  
ATOM 9996  H HD22 . LEU A 1 62  ? -7.327  0.452   -2.262  1.00 0.00 ? 62  LEU A HD22 6  
ATOM 9997  H HD23 . LEU A 1 62  ? -6.381  0.400   -3.750  1.00 0.00 ? 62  LEU A HD23 6  
ATOM 9998  N N    . ALA A 1 63  ? -9.459  0.583   -7.932  1.00 0.00 ? 63  ALA A N    6  
ATOM 9999  C CA   . ALA A 1 63  ? -9.682  0.594   -9.403  1.00 0.00 ? 63  ALA A CA   6  
ATOM 10000 C C    . ALA A 1 63  ? -9.799  -0.846  -9.915  1.00 0.00 ? 63  ALA A C    6  
ATOM 10001 O O    . ALA A 1 63  ? -9.992  -1.080  -11.092 1.00 0.00 ? 63  ALA A O    6  
ATOM 10002 C CB   . ALA A 1 63  ? -8.500  1.282   -10.086 1.00 0.00 ? 63  ALA A CB   6  
ATOM 10003 H H    . ALA A 1 63  ? -8.573  0.788   -7.572  1.00 0.00 ? 63  ALA A H    6  
ATOM 10004 H HA   . ALA A 1 63  ? -10.591 1.132   -9.626  1.00 0.00 ? 63  ALA A HA   6  
ATOM 10005 H HB1  . ALA A 1 63  ? -7.671  1.344   -9.396  1.00 0.00 ? 63  ALA A HB1  6  
ATOM 10006 H HB2  . ALA A 1 63  ? -8.203  0.712   -10.955 1.00 0.00 ? 63  ALA A HB2  6  
ATOM 10007 H HB3  . ALA A 1 63  ? -8.789  2.277   -10.391 1.00 0.00 ? 63  ALA A HB3  6  
ATOM 10008 N N    . GLY A 1 64  ? -9.681  -1.813  -9.043  1.00 0.00 ? 64  GLY A N    6  
ATOM 10009 C CA   . GLY A 1 64  ? -9.784  -3.234  -9.486  1.00 0.00 ? 64  GLY A CA   6  
ATOM 10010 C C    . GLY A 1 64  ? -11.137 -3.810  -9.058  1.00 0.00 ? 64  GLY A C    6  
ATOM 10011 O O    . GLY A 1 64  ? -12.153 -3.552  -9.674  1.00 0.00 ? 64  GLY A O    6  
ATOM 10012 H H    . GLY A 1 64  ? -9.522  -1.606  -8.100  1.00 0.00 ? 64  GLY A H    6  
ATOM 10013 H HA2  . GLY A 1 64  ? -9.693  -3.283  -10.562 1.00 0.00 ? 64  GLY A HA2  6  
ATOM 10014 H HA3  . GLY A 1 64  ? -8.992  -3.810  -9.031  1.00 0.00 ? 64  GLY A HA3  6  
ATOM 10015 N N    . VAL A 1 65  ? -11.160 -4.590  -8.008  1.00 0.00 ? 65  VAL A N    6  
ATOM 10016 C CA   . VAL A 1 65  ? -12.450 -5.182  -7.544  1.00 0.00 ? 65  VAL A CA   6  
ATOM 10017 C C    . VAL A 1 65  ? -12.546 -5.070  -6.019  1.00 0.00 ? 65  VAL A C    6  
ATOM 10018 O O    . VAL A 1 65  ? -12.044 -4.137  -5.424  1.00 0.00 ? 65  VAL A O    6  
ATOM 10019 C CB   . VAL A 1 65  ? -12.522 -6.656  -7.952  1.00 0.00 ? 65  VAL A CB   6  
ATOM 10020 C CG1  . VAL A 1 65  ? -13.981 -7.050  -8.193  1.00 0.00 ? 65  VAL A CG1  6  
ATOM 10021 C CG2  . VAL A 1 65  ? -11.720 -6.873  -9.237  1.00 0.00 ? 65  VAL A CG2  6  
ATOM 10022 H H    . VAL A 1 65  ? -10.329 -4.785  -7.525  1.00 0.00 ? 65  VAL A H    6  
ATOM 10023 H HA   . VAL A 1 65  ? -13.273 -4.645  -7.994  1.00 0.00 ? 65  VAL A HA   6  
ATOM 10024 H HB   . VAL A 1 65  ? -12.111 -7.268  -7.161  1.00 0.00 ? 65  VAL A HB   6  
ATOM 10025 H HG11 . VAL A 1 65  ? -14.629 -6.379  -7.646  1.00 0.00 ? 65  VAL A HG11 6  
ATOM 10026 H HG12 . VAL A 1 65  ? -14.203 -6.985  -9.248  1.00 0.00 ? 65  VAL A HG12 6  
ATOM 10027 H HG13 . VAL A 1 65  ? -14.142 -8.061  -7.853  1.00 0.00 ? 65  VAL A HG13 6  
ATOM 10028 H HG21 . VAL A 1 65  ? -12.106 -6.232  -10.016 1.00 0.00 ? 65  VAL A HG21 6  
ATOM 10029 H HG22 . VAL A 1 65  ? -10.682 -6.638  -9.056  1.00 0.00 ? 65  VAL A HG22 6  
ATOM 10030 H HG23 . VAL A 1 65  ? -11.808 -7.905  -9.544  1.00 0.00 ? 65  VAL A HG23 6  
ATOM 10031 N N    . HIS A 1 66  ? -13.188 -6.013  -5.380  1.00 0.00 ? 66  HIS A N    6  
ATOM 10032 C CA   . HIS A 1 66  ? -13.314 -5.952  -3.893  1.00 0.00 ? 66  HIS A CA   6  
ATOM 10033 C C    . HIS A 1 66  ? -12.041 -6.507  -3.249  1.00 0.00 ? 66  HIS A C    6  
ATOM 10034 O O    . HIS A 1 66  ? -11.544 -7.548  -3.632  1.00 0.00 ? 66  HIS A O    6  
ATOM 10035 C CB   . HIS A 1 66  ? -14.515 -6.787  -3.431  1.00 0.00 ? 66  HIS A CB   6  
ATOM 10036 C CG   . HIS A 1 66  ? -15.528 -6.894  -4.538  1.00 0.00 ? 66  HIS A CG   6  
ATOM 10037 N ND1  . HIS A 1 66  ? -16.508 -5.935  -4.740  1.00 0.00 ? 66  HIS A ND1  6  
ATOM 10038 C CD2  . HIS A 1 66  ? -15.728 -7.844  -5.508  1.00 0.00 ? 66  HIS A CD2  6  
ATOM 10039 C CE1  . HIS A 1 66  ? -17.246 -6.325  -5.794  1.00 0.00 ? 66  HIS A CE1  6  
ATOM 10040 N NE2  . HIS A 1 66  ? -16.814 -7.483  -6.300  1.00 0.00 ? 66  HIS A NE2  6  
ATOM 10041 H H    . HIS A 1 66  ? -13.589 -6.756  -5.877  1.00 0.00 ? 66  HIS A H    6  
ATOM 10042 H HA   . HIS A 1 66  ? -13.452 -4.925  -3.587  1.00 0.00 ? 66  HIS A HA   6  
ATOM 10043 H HB2  . HIS A 1 66  ? -14.179 -7.775  -3.155  1.00 0.00 ? 66  HIS A HB2  6  
ATOM 10044 H HB3  . HIS A 1 66  ? -14.971 -6.312  -2.573  1.00 0.00 ? 66  HIS A HB3  6  
ATOM 10045 H HD1  . HIS A 1 66  ? -16.639 -5.121  -4.210  1.00 0.00 ? 66  HIS A HD1  6  
ATOM 10046 H HD2  . HIS A 1 66  ? -15.134 -8.738  -5.636  1.00 0.00 ? 66  HIS A HD2  6  
ATOM 10047 H HE1  . HIS A 1 66  ? -18.087 -5.771  -6.184  1.00 0.00 ? 66  HIS A HE1  6  
ATOM 10048 N N    . TYR A 1 67  ? -11.510 -5.824  -2.271  1.00 0.00 ? 67  TYR A N    6  
ATOM 10049 C CA   . TYR A 1 67  ? -10.270 -6.315  -1.602  1.00 0.00 ? 67  TYR A CA   6  
ATOM 10050 C C    . TYR A 1 67  ? -10.592 -6.716  -0.160  1.00 0.00 ? 67  TYR A C    6  
ATOM 10051 O O    . TYR A 1 67  ? -11.446 -6.136  0.480   1.00 0.00 ? 67  TYR A O    6  
ATOM 10052 C CB   . TYR A 1 67  ? -9.223  -5.199  -1.595  1.00 0.00 ? 67  TYR A CB   6  
ATOM 10053 C CG   . TYR A 1 67  ? -8.361  -5.284  -2.835  1.00 0.00 ? 67  TYR A CG   6  
ATOM 10054 C CD1  . TYR A 1 67  ? -8.773  -6.046  -3.937  1.00 0.00 ? 67  TYR A CD1  6  
ATOM 10055 C CD2  . TYR A 1 67  ? -7.146  -4.589  -2.882  1.00 0.00 ? 67  TYR A CD2  6  
ATOM 10056 C CE1  . TYR A 1 67  ? -7.968  -6.115  -5.081  1.00 0.00 ? 67  TYR A CE1  6  
ATOM 10057 C CE2  . TYR A 1 67  ? -6.343  -4.658  -4.025  1.00 0.00 ? 67  TYR A CE2  6  
ATOM 10058 C CZ   . TYR A 1 67  ? -6.754  -5.421  -5.125  1.00 0.00 ? 67  TYR A CZ   6  
ATOM 10059 O OH   . TYR A 1 67  ? -5.961  -5.488  -6.252  1.00 0.00 ? 67  TYR A OH   6  
ATOM 10060 H H    . TYR A 1 67  ? -11.927 -4.988  -1.975  1.00 0.00 ? 67  TYR A H    6  
ATOM 10061 H HA   . TYR A 1 67  ? -9.885  -7.170  -2.137  1.00 0.00 ? 67  TYR A HA   6  
ATOM 10062 H HB2  . TYR A 1 67  ? -9.721  -4.242  -1.570  1.00 0.00 ? 67  TYR A HB2  6  
ATOM 10063 H HB3  . TYR A 1 67  ? -8.598  -5.300  -0.720  1.00 0.00 ? 67  TYR A HB3  6  
ATOM 10064 H HD1  . TYR A 1 67  ? -9.708  -6.581  -3.903  1.00 0.00 ? 67  TYR A HD1  6  
ATOM 10065 H HD2  . TYR A 1 67  ? -6.829  -4.000  -2.034  1.00 0.00 ? 67  TYR A HD2  6  
ATOM 10066 H HE1  . TYR A 1 67  ? -8.286  -6.704  -5.930  1.00 0.00 ? 67  TYR A HE1  6  
ATOM 10067 H HE2  . TYR A 1 67  ? -5.407  -4.122  -4.060  1.00 0.00 ? 67  TYR A HE2  6  
ATOM 10068 H HH   . TYR A 1 67  ? -6.236  -4.792  -6.852  1.00 0.00 ? 67  TYR A HH   6  
ATOM 10069 N N    . VAL A 1 68  ? -9.910  -7.703  0.361   1.00 0.00 ? 68  VAL A N    6  
ATOM 10070 C CA   . VAL A 1 68  ? -10.176 -8.137  1.763   1.00 0.00 ? 68  VAL A CA   6  
ATOM 10071 C C    . VAL A 1 68  ? -9.220  -7.407  2.709   1.00 0.00 ? 68  VAL A C    6  
ATOM 10072 O O    . VAL A 1 68  ? -8.074  -7.169  2.384   1.00 0.00 ? 68  VAL A O    6  
ATOM 10073 C CB   . VAL A 1 68  ? -9.959  -9.648  1.885   1.00 0.00 ? 68  VAL A CB   6  
ATOM 10074 C CG1  . VAL A 1 68  ? -10.703 -10.175 3.112   1.00 0.00 ? 68  VAL A CG1  6  
ATOM 10075 C CG2  . VAL A 1 68  ? -10.496 -10.341 0.632   1.00 0.00 ? 68  VAL A CG2  6  
ATOM 10076 H H    . VAL A 1 68  ? -9.222  -8.156  -0.169  1.00 0.00 ? 68  VAL A H    6  
ATOM 10077 H HA   . VAL A 1 68  ? -11.195 -7.896  2.028   1.00 0.00 ? 68  VAL A HA   6  
ATOM 10078 H HB   . VAL A 1 68  ? -8.903  -9.852  1.988   1.00 0.00 ? 68  VAL A HB   6  
ATOM 10079 H HG11 . VAL A 1 68  ? -11.579 -9.570  3.290   1.00 0.00 ? 68  VAL A HG11 6  
ATOM 10080 H HG12 . VAL A 1 68  ? -11.000 -11.198 2.941   1.00 0.00 ? 68  VAL A HG12 6  
ATOM 10081 H HG13 . VAL A 1 68  ? -10.053 -10.129 3.974   1.00 0.00 ? 68  VAL A HG13 6  
ATOM 10082 H HG21 . VAL A 1 68  ? -10.179 -9.797  -0.246  1.00 0.00 ? 68  VAL A HG21 6  
ATOM 10083 H HG22 . VAL A 1 68  ? -10.116 -11.350 0.588   1.00 0.00 ? 68  VAL A HG22 6  
ATOM 10084 H HG23 . VAL A 1 68  ? -11.576 -10.365 0.670   1.00 0.00 ? 68  VAL A HG23 6  
ATOM 10085 N N    . THR A 1 69  ? -9.682  -7.046  3.874   1.00 0.00 ? 69  THR A N    6  
ATOM 10086 C CA   . THR A 1 69  ? -8.800  -6.327  4.834   1.00 0.00 ? 69  THR A CA   6  
ATOM 10087 C C    . THR A 1 69  ? -8.438  -7.256  5.994   1.00 0.00 ? 69  THR A C    6  
ATOM 10088 O O    . THR A 1 69  ? -9.293  -7.724  6.719   1.00 0.00 ? 69  THR A O    6  
ATOM 10089 C CB   . THR A 1 69  ? -9.529  -5.094  5.376   1.00 0.00 ? 69  THR A CB   6  
ATOM 10090 O OG1  . THR A 1 69  ? -10.439 -4.614  4.395   1.00 0.00 ? 69  THR A OG1  6  
ATOM 10091 C CG2  . THR A 1 69  ? -8.510  -4.002  5.706   1.00 0.00 ? 69  THR A CG2  6  
ATOM 10092 H H    . THR A 1 69  ? -10.611 -7.244  4.117   1.00 0.00 ? 69  THR A H    6  
ATOM 10093 H HA   . THR A 1 69  ? -7.898  -6.017  4.328   1.00 0.00 ? 69  THR A HA   6  
ATOM 10094 H HB   . THR A 1 69  ? -10.070 -5.358  6.271   1.00 0.00 ? 69  THR A HB   6  
ATOM 10095 H HG1  . THR A 1 69  ? -10.484 -3.658  4.472   1.00 0.00 ? 69  THR A HG1  6  
ATOM 10096 H HG21 . THR A 1 69  ? -7.518  -4.427  5.713   1.00 0.00 ? 69  THR A HG21 6  
ATOM 10097 H HG22 . THR A 1 69  ? -8.564  -3.224  4.959   1.00 0.00 ? 69  THR A HG22 6  
ATOM 10098 H HG23 . THR A 1 69  ? -8.732  -3.586  6.677   1.00 0.00 ? 69  THR A HG23 6  
ATOM 10099 N N    . LEU A 1 70  ? -7.174  -7.529  6.176   1.00 0.00 ? 70  LEU A N    6  
ATOM 10100 C CA   . LEU A 1 70  ? -6.757  -8.429  7.288   1.00 0.00 ? 70  LEU A CA   6  
ATOM 10101 C C    . LEU A 1 70  ? -5.994  -7.624  8.340   1.00 0.00 ? 70  LEU A C    6  
ATOM 10102 O O    . LEU A 1 70  ? -5.239  -8.167  9.122   1.00 0.00 ? 70  LEU A O    6  
ATOM 10103 C CB   . LEU A 1 70  ? -5.850  -9.533  6.741   1.00 0.00 ? 70  LEU A CB   6  
ATOM 10104 C CG   . LEU A 1 70  ? -4.626  -8.903  6.074   1.00 0.00 ? 70  LEU A CG   6  
ATOM 10105 C CD1  . LEU A 1 70  ? -3.395  -9.128  6.955   1.00 0.00 ? 70  LEU A CD1  6  
ATOM 10106 C CD2  . LEU A 1 70  ? -4.401  -9.553  4.708   1.00 0.00 ? 70  LEU A CD2  6  
ATOM 10107 H H    . LEU A 1 70  ? -6.500  -7.142  5.579   1.00 0.00 ? 70  LEU A H    6  
ATOM 10108 H HA   . LEU A 1 70  ? -7.631  -8.874  7.738   1.00 0.00 ? 70  LEU A HA   6  
ATOM 10109 H HB2  . LEU A 1 70  ? -5.531  -10.170 7.551   1.00 0.00 ? 70  LEU A HB2  6  
ATOM 10110 H HB3  . LEU A 1 70  ? -6.392  -10.117 6.013   1.00 0.00 ? 70  LEU A HB3  6  
ATOM 10111 H HG   . LEU A 1 70  ? -4.791  -7.843  5.950   1.00 0.00 ? 70  LEU A HG   6  
ATOM 10112 H HD11 . LEU A 1 70  ? -3.691  -9.128  7.993   1.00 0.00 ? 70  LEU A HD11 6  
ATOM 10113 H HD12 . LEU A 1 70  ? -2.948  -10.079 6.708   1.00 0.00 ? 70  LEU A HD12 6  
ATOM 10114 H HD13 . LEU A 1 70  ? -2.680  -8.338  6.782   1.00 0.00 ? 70  LEU A HD13 6  
ATOM 10115 H HD21 . LEU A 1 70  ? -4.992  -10.454 4.636   1.00 0.00 ? 70  LEU A HD21 6  
ATOM 10116 H HD22 . LEU A 1 70  ? -4.698  -8.865  3.929   1.00 0.00 ? 70  LEU A HD22 6  
ATOM 10117 H HD23 . LEU A 1 70  ? -3.355  -9.797  4.592   1.00 0.00 ? 70  LEU A HD23 6  
ATOM 10118 N N    . ARG A 1 71  ? -6.180  -6.334  8.368   1.00 0.00 ? 71  ARG A N    6  
ATOM 10119 C CA   . ARG A 1 71  ? -5.461  -5.505  9.373   1.00 0.00 ? 71  ARG A CA   6  
ATOM 10120 C C    . ARG A 1 71  ? -5.796  -4.029  9.152   1.00 0.00 ? 71  ARG A C    6  
ATOM 10121 O O    . ARG A 1 71  ? -5.276  -3.389  8.260   1.00 0.00 ? 71  ARG A O    6  
ATOM 10122 C CB   . ARG A 1 71  ? -3.955  -5.714  9.219   1.00 0.00 ? 71  ARG A CB   6  
ATOM 10123 C CG   . ARG A 1 71  ? -3.297  -5.751  10.599  1.00 0.00 ? 71  ARG A CG   6  
ATOM 10124 C CD   . ARG A 1 71  ? -1.890  -6.332  10.471  1.00 0.00 ? 71  ARG A CD   6  
ATOM 10125 N NE   . ARG A 1 71  ? -1.633  -7.291  11.593  1.00 0.00 ? 71  ARG A NE   6  
ATOM 10126 C CZ   . ARG A 1 71  ? -1.841  -6.952  12.839  1.00 0.00 ? 71  ARG A CZ   6  
ATOM 10127 N NH1  . ARG A 1 71  ? -2.113  -5.714  13.154  1.00 0.00 ? 71  ARG A NH1  6  
ATOM 10128 N NH2  . ARG A 1 71  ? -1.723  -7.848  13.781  1.00 0.00 ? 71  ARG A NH2  6  
ATOM 10129 H H    . ARG A 1 71  ? -6.793  -5.913  7.730   1.00 0.00 ? 71  ARG A H    6  
ATOM 10130 H HA   . ARG A 1 71  ? -5.766  -5.798  10.366  1.00 0.00 ? 71  ARG A HA   6  
ATOM 10131 H HB2  . ARG A 1 71  ? -3.772  -6.647  8.706   1.00 0.00 ? 71  ARG A HB2  6  
ATOM 10132 H HB3  . ARG A 1 71  ? -3.536  -4.901  8.645   1.00 0.00 ? 71  ARG A HB3  6  
ATOM 10133 H HG2  . ARG A 1 71  ? -3.243  -4.748  10.995  1.00 0.00 ? 71  ARG A HG2  6  
ATOM 10134 H HG3  . ARG A 1 71  ? -3.883  -6.371  11.262  1.00 0.00 ? 71  ARG A HG3  6  
ATOM 10135 H HD2  . ARG A 1 71  ? -1.811  -6.874  9.547   1.00 0.00 ? 71  ARG A HD2  6  
ATOM 10136 H HD3  . ARG A 1 71  ? -1.164  -5.523  10.470  1.00 0.00 ? 71  ARG A HD3  6  
ATOM 10137 H HE   . ARG A 1 71  ? -1.347  -8.206  11.386  1.00 0.00 ? 71  ARG A HE   6  
ATOM 10138 H HH11 . ARG A 1 71  ? -2.159  -5.013  12.447  1.00 0.00 ? 71  ARG A HH11 6  
ATOM 10139 H HH12 . ARG A 1 71  ? -2.272  -5.467  14.110  1.00 0.00 ? 71  ARG A HH12 6  
ATOM 10140 H HH21 . ARG A 1 71  ? -1.475  -8.789  13.548  1.00 0.00 ? 71  ARG A HH21 6  
ATOM 10141 H HH22 . ARG A 1 71  ? -1.880  -7.593  14.735  1.00 0.00 ? 71  ARG A HH22 6  
ATOM 10142 N N    . ALA A 1 72  ? -6.661  -3.483  9.961   1.00 0.00 ? 72  ALA A N    6  
ATOM 10143 C CA   . ALA A 1 72  ? -7.030  -2.048  9.804   1.00 0.00 ? 72  ALA A CA   6  
ATOM 10144 C C    . ALA A 1 72  ? -7.486  -1.498  11.155  1.00 0.00 ? 72  ALA A C    6  
ATOM 10145 O O    . ALA A 1 72  ? -8.571  -0.966  11.288  1.00 0.00 ? 72  ALA A O    6  
ATOM 10146 C CB   . ALA A 1 72  ? -8.171  -1.920  8.790   1.00 0.00 ? 72  ALA A CB   6  
ATOM 10147 H H    . ALA A 1 72  ? -7.067  -4.018  10.674  1.00 0.00 ? 72  ALA A H    6  
ATOM 10148 H HA   . ALA A 1 72  ? -6.173  -1.491  9.456   1.00 0.00 ? 72  ALA A HA   6  
ATOM 10149 H HB1  . ALA A 1 72  ? -8.982  -2.574  9.076   1.00 0.00 ? 72  ALA A HB1  6  
ATOM 10150 H HB2  . ALA A 1 72  ? -8.523  -0.899  8.772   1.00 0.00 ? 72  ALA A HB2  6  
ATOM 10151 H HB3  . ALA A 1 72  ? -7.815  -2.195  7.810   1.00 0.00 ? 72  ALA A HB3  6  
ATOM 10152 N N    . ASP A 1 73  ? -6.671  -1.631  12.166  1.00 0.00 ? 73  ASP A N    6  
ATOM 10153 C CA   . ASP A 1 73  ? -7.066  -1.126  13.510  1.00 0.00 ? 73  ASP A CA   6  
ATOM 10154 C C    . ASP A 1 73  ? -5.977  -0.203  14.068  1.00 0.00 ? 73  ASP A C    6  
ATOM 10155 O O    . ASP A 1 73  ? -6.208  0.548   14.996  1.00 0.00 ? 73  ASP A O    6  
ATOM 10156 C CB   . ASP A 1 73  ? -7.259  -2.314  14.456  1.00 0.00 ? 73  ASP A CB   6  
ATOM 10157 C CG   . ASP A 1 73  ? -8.644  -2.923  14.234  1.00 0.00 ? 73  ASP A CG   6  
ATOM 10158 O OD1  . ASP A 1 73  ? -8.825  -3.581  13.223  1.00 0.00 ? 73  ASP A OD1  6  
ATOM 10159 O OD2  . ASP A 1 73  ? -9.500  -2.722  15.079  1.00 0.00 ? 73  ASP A OD2  6  
ATOM 10160 H H    . ASP A 1 73  ? -5.805  -2.072  12.041  1.00 0.00 ? 73  ASP A H    6  
ATOM 10161 H HA   . ASP A 1 73  ? -7.994  -0.579  13.429  1.00 0.00 ? 73  ASP A HA   6  
ATOM 10162 H HB2  . ASP A 1 73  ? -6.501  -3.059  14.256  1.00 0.00 ? 73  ASP A HB2  6  
ATOM 10163 H HB3  . ASP A 1 73  ? -7.173  -1.978  15.479  1.00 0.00 ? 73  ASP A HB3  6  
ATOM 10164 N N    . ASP A 1 74  ? -4.793  -0.251  13.520  1.00 0.00 ? 74  ASP A N    6  
ATOM 10165 C CA   . ASP A 1 74  ? -3.703  0.625   14.037  1.00 0.00 ? 74  ASP A CA   6  
ATOM 10166 C C    . ASP A 1 74  ? -3.365  1.702   12.996  1.00 0.00 ? 74  ASP A C    6  
ATOM 10167 O O    . ASP A 1 74  ? -4.098  2.655   12.824  1.00 0.00 ? 74  ASP A O    6  
ATOM 10168 C CB   . ASP A 1 74  ? -2.465  -0.227  14.332  1.00 0.00 ? 74  ASP A CB   6  
ATOM 10169 C CG   . ASP A 1 74  ? -2.356  -1.342  13.292  1.00 0.00 ? 74  ASP A CG   6  
ATOM 10170 O OD1  . ASP A 1 74  ? -2.596  -1.067  12.128  1.00 0.00 ? 74  ASP A OD1  6  
ATOM 10171 O OD2  . ASP A 1 74  ? -2.036  -2.456  13.678  1.00 0.00 ? 74  ASP A OD2  6  
ATOM 10172 H H    . ASP A 1 74  ? -4.618  -0.862  12.774  1.00 0.00 ? 74  ASP A H    6  
ATOM 10173 H HA   . ASP A 1 74  ? -4.033  1.102   14.948  1.00 0.00 ? 74  ASP A HA   6  
ATOM 10174 H HB2  . ASP A 1 74  ? -1.583  0.395   14.289  1.00 0.00 ? 74  ASP A HB2  6  
ATOM 10175 H HB3  . ASP A 1 74  ? -2.553  -0.661  15.316  1.00 0.00 ? 74  ASP A HB3  6  
ATOM 10176 N N    . ARG A 1 75  ? -2.263  1.566   12.302  1.00 0.00 ? 75  ARG A N    6  
ATOM 10177 C CA   . ARG A 1 75  ? -1.895  2.593   11.283  1.00 0.00 ? 75  ARG A CA   6  
ATOM 10178 C C    . ARG A 1 75  ? -1.241  1.902   10.083  1.00 0.00 ? 75  ARG A C    6  
ATOM 10179 O O    . ARG A 1 75  ? -0.439  2.481   9.379   1.00 0.00 ? 75  ARG A O    6  
ATOM 10180 C CB   . ARG A 1 75  ? -0.915  3.615   11.880  1.00 0.00 ? 75  ARG A CB   6  
ATOM 10181 C CG   . ARG A 1 75  ? -0.300  3.078   13.181  1.00 0.00 ? 75  ARG A CG   6  
ATOM 10182 C CD   . ARG A 1 75  ? 0.336   4.231   13.965  1.00 0.00 ? 75  ARG A CD   6  
ATOM 10183 N NE   . ARG A 1 75  ? 0.847   5.269   13.014  1.00 0.00 ? 75  ARG A NE   6  
ATOM 10184 C CZ   . ARG A 1 75  ? 1.679   4.961   12.057  1.00 0.00 ? 75  ARG A CZ   6  
ATOM 10185 N NH1  . ARG A 1 75  ? 2.248   3.786   12.030  1.00 0.00 ? 75  ARG A NH1  6  
ATOM 10186 N NH2  . ARG A 1 75  ? 1.984   5.851   11.151  1.00 0.00 ? 75  ARG A NH2  6  
ATOM 10187 H H    . ARG A 1 75  ? -1.679  0.796   12.449  1.00 0.00 ? 75  ARG A H    6  
ATOM 10188 H HA   . ARG A 1 75  ? -2.788  3.104   10.954  1.00 0.00 ? 75  ARG A HA   6  
ATOM 10189 H HB2  . ARG A 1 75  ? -0.128  3.809   11.166  1.00 0.00 ? 75  ARG A HB2  6  
ATOM 10190 H HB3  . ARG A 1 75  ? -1.440  4.535   12.087  1.00 0.00 ? 75  ARG A HB3  6  
ATOM 10191 H HG2  . ARG A 1 75  ? -1.075  2.626   13.782  1.00 0.00 ? 75  ARG A HG2  6  
ATOM 10192 H HG3  . ARG A 1 75  ? 0.451   2.340   12.950  1.00 0.00 ? 75  ARG A HG3  6  
ATOM 10193 H HD2  . ARG A 1 75  ? -0.410  4.692   14.583  1.00 0.00 ? 75  ARG A HD2  6  
ATOM 10194 H HD3  . ARG A 1 75  ? 1.129   3.840   14.598  1.00 0.00 ? 75  ARG A HD3  6  
ATOM 10195 H HE   . ARG A 1 75  ? 0.505   6.185   13.076  1.00 0.00 ? 75  ARG A HE   6  
ATOM 10196 H HH11 . ARG A 1 75  ? 2.054   3.121   12.747  1.00 0.00 ? 75  ARG A HH11 6  
ATOM 10197 H HH12 . ARG A 1 75  ? 2.882   3.556   11.292  1.00 0.00 ? 75  ARG A HH12 6  
ATOM 10198 H HH21 . ARG A 1 75  ? 1.581   6.765   11.194  1.00 0.00 ? 75  ARG A HH21 6  
ATOM 10199 H HH22 . ARG A 1 75  ? 2.621   5.620   10.416  1.00 0.00 ? 75  ARG A HH22 6  
ATOM 10200 N N    . SER A 1 76  ? -1.584  0.667   9.848   1.00 0.00 ? 76  SER A N    6  
ATOM 10201 C CA   . SER A 1 76  ? -0.995  -0.074  8.698   1.00 0.00 ? 76  SER A CA   6  
ATOM 10202 C C    . SER A 1 76  ? -2.074  -0.976  8.094   1.00 0.00 ? 76  SER A C    6  
ATOM 10203 O O    . SER A 1 76  ? -2.740  -1.712  8.795   1.00 0.00 ? 76  SER A O    6  
ATOM 10204 C CB   . SER A 1 76  ? 0.173   -0.925  9.196   1.00 0.00 ? 76  SER A CB   6  
ATOM 10205 O OG   . SER A 1 76  ? 1.397   -0.272  8.883   1.00 0.00 ? 76  SER A OG   6  
ATOM 10206 H H    . SER A 1 76  ? -2.236  0.223   10.432  1.00 0.00 ? 76  SER A H    6  
ATOM 10207 H HA   . SER A 1 76  ? -0.645  0.626   7.953   1.00 0.00 ? 76  SER A HA   6  
ATOM 10208 H HB2  . SER A 1 76  ? 0.101   -1.049  10.264  1.00 0.00 ? 76  SER A HB2  6  
ATOM 10209 H HB3  . SER A 1 76  ? 0.138   -1.893  8.720   1.00 0.00 ? 76  SER A HB3  6  
ATOM 10210 H HG   . SER A 1 76  ? 1.262   0.243   8.083   1.00 0.00 ? 76  SER A HG   6  
ATOM 10211 N N    . ILE A 1 77  ? -2.273  -0.916  6.804   1.00 0.00 ? 77  ILE A N    6  
ATOM 10212 C CA   . ILE A 1 77  ? -3.332  -1.762  6.186   1.00 0.00 ? 77  ILE A CA   6  
ATOM 10213 C C    . ILE A 1 77  ? -2.808  -2.470  4.932   1.00 0.00 ? 77  ILE A C    6  
ATOM 10214 O O    . ILE A 1 77  ? -2.771  -1.903  3.857   1.00 0.00 ? 77  ILE A O    6  
ATOM 10215 C CB   . ILE A 1 77  ? -4.516  -0.880  5.795   1.00 0.00 ? 77  ILE A CB   6  
ATOM 10216 C CG1  . ILE A 1 77  ? -5.186  -0.339  7.059   1.00 0.00 ? 77  ILE A CG1  6  
ATOM 10217 C CG2  . ILE A 1 77  ? -5.526  -1.702  4.994   1.00 0.00 ? 77  ILE A CG2  6  
ATOM 10218 C CD1  . ILE A 1 77  ? -5.008  1.178   7.120   1.00 0.00 ? 77  ILE A CD1  6  
ATOM 10219 H H    . ILE A 1 77  ? -1.741  -0.308  6.249   1.00 0.00 ? 77  ILE A H    6  
ATOM 10220 H HA   . ILE A 1 77  ? -3.662  -2.500  6.902   1.00 0.00 ? 77  ILE A HA   6  
ATOM 10221 H HB   . ILE A 1 77  ? -4.164  -0.055  5.192   1.00 0.00 ? 77  ILE A HB   6  
ATOM 10222 H HG12 . ILE A 1 77  ? -6.241  -0.578  7.037   1.00 0.00 ? 77  ILE A HG12 6  
ATOM 10223 H HG13 . ILE A 1 77  ? -4.732  -0.789  7.929   1.00 0.00 ? 77  ILE A HG13 6  
ATOM 10224 H HG21 . ILE A 1 77  ? -5.474  -2.736  5.301   1.00 0.00 ? 77  ILE A HG21 6  
ATOM 10225 H HG22 . ILE A 1 77  ? -6.522  -1.324  5.172   1.00 0.00 ? 77  ILE A HG22 6  
ATOM 10226 H HG23 . ILE A 1 77  ? -5.297  -1.627  3.941   1.00 0.00 ? 77  ILE A HG23 6  
ATOM 10227 H HD11 . ILE A 1 77  ? -4.366  1.497   6.312   1.00 0.00 ? 77  ILE A HD11 6  
ATOM 10228 H HD12 . ILE A 1 77  ? -5.970  1.658   7.026   1.00 0.00 ? 77  ILE A HD12 6  
ATOM 10229 H HD13 . ILE A 1 77  ? -4.561  1.450   8.064   1.00 0.00 ? 77  ILE A HD13 6  
ATOM 10230 N N    . TYR A 1 78  ? -2.436  -3.715  5.051   1.00 0.00 ? 78  TYR A N    6  
ATOM 10231 C CA   . TYR A 1 78  ? -1.957  -4.469  3.858   1.00 0.00 ? 78  TYR A CA   6  
ATOM 10232 C C    . TYR A 1 78  ? -3.023  -5.508  3.504   1.00 0.00 ? 78  TYR A C    6  
ATOM 10233 O O    . TYR A 1 78  ? -3.080  -6.574  4.084   1.00 0.00 ? 78  TYR A O    6  
ATOM 10234 C CB   . TYR A 1 78  ? -0.632  -5.175  4.167   1.00 0.00 ? 78  TYR A CB   6  
ATOM 10235 C CG   . TYR A 1 78  ? 0.125   -4.415  5.230   1.00 0.00 ? 78  TYR A CG   6  
ATOM 10236 C CD1  . TYR A 1 78  ? -0.230  -4.562  6.575   1.00 0.00 ? 78  TYR A CD1  6  
ATOM 10237 C CD2  . TYR A 1 78  ? 1.189   -3.570  4.875   1.00 0.00 ? 78  TYR A CD2  6  
ATOM 10238 C CE1  . TYR A 1 78  ? 0.471   -3.867  7.564   1.00 0.00 ? 78  TYR A CE1  6  
ATOM 10239 C CE2  . TYR A 1 78  ? 1.891   -2.876  5.867   1.00 0.00 ? 78  TYR A CE2  6  
ATOM 10240 C CZ   . TYR A 1 78  ? 1.533   -3.025  7.212   1.00 0.00 ? 78  TYR A CZ   6  
ATOM 10241 O OH   . TYR A 1 78  ? 2.224   -2.339  8.191   1.00 0.00 ? 78  TYR A OH   6  
ATOM 10242 H H    . TYR A 1 78  ? -2.498  -4.163  5.920   1.00 0.00 ? 78  TYR A H    6  
ATOM 10243 H HA   . TYR A 1 78  ? -1.825  -3.788  3.028   1.00 0.00 ? 78  TYR A HA   6  
ATOM 10244 H HB2  . TYR A 1 78  ? -0.835  -6.176  4.518   1.00 0.00 ? 78  TYR A HB2  6  
ATOM 10245 H HB3  . TYR A 1 78  ? -0.035  -5.226  3.269   1.00 0.00 ? 78  TYR A HB3  6  
ATOM 10246 H HD1  . TYR A 1 78  ? -1.050  -5.210  6.847   1.00 0.00 ? 78  TYR A HD1  6  
ATOM 10247 H HD2  . TYR A 1 78  ? 1.465   -3.451  3.837   1.00 0.00 ? 78  TYR A HD2  6  
ATOM 10248 H HE1  . TYR A 1 78  ? 0.194   -3.980  8.602   1.00 0.00 ? 78  TYR A HE1  6  
ATOM 10249 H HE2  . TYR A 1 78  ? 2.709   -2.226  5.594   1.00 0.00 ? 78  TYR A HE2  6  
ATOM 10250 H HH   . TYR A 1 78  ? 3.112   -2.701  8.236   1.00 0.00 ? 78  TYR A HH   6  
ATOM 10251 N N    . GLY A 1 79  ? -3.886  -5.198  2.576   1.00 0.00 ? 79  GLY A N    6  
ATOM 10252 C CA   . GLY A 1 79  ? -4.966  -6.159  2.211   1.00 0.00 ? 79  GLY A CA   6  
ATOM 10253 C C    . GLY A 1 79  ? -4.463  -7.157  1.166   1.00 0.00 ? 79  GLY A C    6  
ATOM 10254 O O    . GLY A 1 79  ? -3.403  -6.995  0.594   1.00 0.00 ? 79  GLY A O    6  
ATOM 10255 H H    . GLY A 1 79  ? -3.835  -4.325  2.132   1.00 0.00 ? 79  GLY A H    6  
ATOM 10256 H HA2  . GLY A 1 79  ? -5.280  -6.694  3.094   1.00 0.00 ? 79  GLY A HA2  6  
ATOM 10257 H HA3  . GLY A 1 79  ? -5.806  -5.615  1.805   1.00 0.00 ? 79  GLY A HA3  6  
ATOM 10258 N N    . LYS A 1 80  ? -5.224  -8.189  0.915   1.00 0.00 ? 80  LYS A N    6  
ATOM 10259 C CA   . LYS A 1 80  ? -4.811  -9.207  -0.092  1.00 0.00 ? 80  LYS A CA   6  
ATOM 10260 C C    . LYS A 1 80  ? -6.061  -9.827  -0.719  1.00 0.00 ? 80  LYS A C    6  
ATOM 10261 O O    . LYS A 1 80  ? -7.119  -9.844  -0.124  1.00 0.00 ? 80  LYS A O    6  
ATOM 10262 C CB   . LYS A 1 80  ? -3.985  -10.298 0.592   1.00 0.00 ? 80  LYS A CB   6  
ATOM 10263 C CG   . LYS A 1 80  ? -2.922  -10.820 -0.377  1.00 0.00 ? 80  LYS A CG   6  
ATOM 10264 C CD   . LYS A 1 80  ? -2.376  -12.159 0.126   1.00 0.00 ? 80  LYS A CD   6  
ATOM 10265 C CE   . LYS A 1 80  ? -1.104  -12.514 -0.647  1.00 0.00 ? 80  LYS A CE   6  
ATOM 10266 N NZ   . LYS A 1 80  ? -0.919  -13.994 -0.645  1.00 0.00 ? 80  LYS A NZ   6  
ATOM 10267 H H    . LYS A 1 80  ? -6.075  -8.293  1.390   1.00 0.00 ? 80  LYS A H    6  
ATOM 10268 H HA   . LYS A 1 80  ? -4.218  -8.733  -0.861  1.00 0.00 ? 80  LYS A HA   6  
ATOM 10269 H HB2  . LYS A 1 80  ? -3.504  -9.889  1.469   1.00 0.00 ? 80  LYS A HB2  6  
ATOM 10270 H HB3  . LYS A 1 80  ? -4.634  -11.111 0.883   1.00 0.00 ? 80  LYS A HB3  6  
ATOM 10271 H HG2  . LYS A 1 80  ? -3.363  -10.955 -1.355  1.00 0.00 ? 80  LYS A HG2  6  
ATOM 10272 H HG3  . LYS A 1 80  ? -2.113  -10.106 -0.443  1.00 0.00 ? 80  LYS A HG3  6  
ATOM 10273 H HD2  . LYS A 1 80  ? -2.149  -12.081 1.181   1.00 0.00 ? 80  LYS A HD2  6  
ATOM 10274 H HD3  . LYS A 1 80  ? -3.116  -12.930 -0.028  1.00 0.00 ? 80  LYS A HD3  6  
ATOM 10275 H HE2  . LYS A 1 80  ? -1.192  -12.163 -1.664  1.00 0.00 ? 80  LYS A HE2  6  
ATOM 10276 H HE3  . LYS A 1 80  ? -0.253  -12.043 -0.175  1.00 0.00 ? 80  LYS A HE3  6  
ATOM 10277 H HZ1  . LYS A 1 80  ? -1.817  -14.455 -0.895  1.00 0.00 ? 80  LYS A HZ1  6  
ATOM 10278 H HZ2  . LYS A 1 80  ? -0.189  -14.252 -1.338  1.00 0.00 ? 80  LYS A HZ2  6  
ATOM 10279 H HZ3  . LYS A 1 80  ? -0.620  -14.305 0.301   1.00 0.00 ? 80  LYS A HZ3  6  
ATOM 10280 N N    . LYS A 1 81  ? -5.955  -10.334 -1.916  1.00 0.00 ? 81  LYS A N    6  
ATOM 10281 C CA   . LYS A 1 81  ? -7.148  -10.946 -2.568  1.00 0.00 ? 81  LYS A CA   6  
ATOM 10282 C C    . LYS A 1 81  ? -6.882  -12.428 -2.846  1.00 0.00 ? 81  LYS A C    6  
ATOM 10283 O O    . LYS A 1 81  ? -7.784  -13.181 -3.149  1.00 0.00 ? 81  LYS A O    6  
ATOM 10284 C CB   . LYS A 1 81  ? -7.442  -10.216 -3.883  1.00 0.00 ? 81  LYS A CB   6  
ATOM 10285 C CG   . LYS A 1 81  ? -6.442  -10.656 -4.955  1.00 0.00 ? 81  LYS A CG   6  
ATOM 10286 C CD   . LYS A 1 81  ? -7.179  -11.437 -6.045  1.00 0.00 ? 81  LYS A CD   6  
ATOM 10287 C CE   . LYS A 1 81  ? -6.182  -11.888 -7.114  1.00 0.00 ? 81  LYS A CE   6  
ATOM 10288 N NZ   . LYS A 1 81  ? -5.702  -10.703 -7.879  1.00 0.00 ? 81  LYS A NZ   6  
ATOM 10289 H H    . LYS A 1 81  ? -5.095  -10.312 -2.385  1.00 0.00 ? 81  LYS A H    6  
ATOM 10290 H HA   . LYS A 1 81  ? -8.000  -10.853 -1.911  1.00 0.00 ? 81  LYS A HA   6  
ATOM 10291 H HB2  . LYS A 1 81  ? -8.445  -10.454 -4.206  1.00 0.00 ? 81  LYS A HB2  6  
ATOM 10292 H HB3  . LYS A 1 81  ? -7.358  -9.151  -3.729  1.00 0.00 ? 81  LYS A HB3  6  
ATOM 10293 H HG2  . LYS A 1 81  ? -5.973  -9.784  -5.388  1.00 0.00 ? 81  LYS A HG2  6  
ATOM 10294 H HG3  . LYS A 1 81  ? -5.688  -11.287 -4.509  1.00 0.00 ? 81  LYS A HG3  6  
ATOM 10295 H HD2  . LYS A 1 81  ? -7.655  -12.302 -5.606  1.00 0.00 ? 81  LYS A HD2  6  
ATOM 10296 H HD3  . LYS A 1 81  ? -7.928  -10.804 -6.496  1.00 0.00 ? 81  LYS A HD3  6  
ATOM 10297 H HE2  . LYS A 1 81  ? -5.343  -12.376 -6.640  1.00 0.00 ? 81  LYS A HE2  6  
ATOM 10298 H HE3  . LYS A 1 81  ? -6.667  -12.580 -7.788  1.00 0.00 ? 81  LYS A HE3  6  
ATOM 10299 H HZ1  . LYS A 1 81  ? -5.334  -9.991  -7.216  1.00 0.00 ? 81  LYS A HZ1  6  
ATOM 10300 H HZ2  . LYS A 1 81  ? -4.947  -10.995 -8.531  1.00 0.00 ? 81  LYS A HZ2  6  
ATOM 10301 H HZ3  . LYS A 1 81  ? -6.489  -10.298 -8.423  1.00 0.00 ? 81  LYS A HZ3  6  
ATOM 10302 N N    . GLY A 1 82  ? -5.652  -12.851 -2.748  1.00 0.00 ? 82  GLY A N    6  
ATOM 10303 C CA   . GLY A 1 82  ? -5.336  -14.283 -3.009  1.00 0.00 ? 82  GLY A CA   6  
ATOM 10304 C C    . GLY A 1 82  ? -3.903  -14.405 -3.529  1.00 0.00 ? 82  GLY A C    6  
ATOM 10305 O O    . GLY A 1 82  ? -3.002  -14.787 -2.809  1.00 0.00 ? 82  GLY A O    6  
ATOM 10306 H H    . GLY A 1 82  ? -4.937  -12.228 -2.502  1.00 0.00 ? 82  GLY A H    6  
ATOM 10307 H HA2  . GLY A 1 82  ? -5.437  -14.845 -2.091  1.00 0.00 ? 82  GLY A HA2  6  
ATOM 10308 H HA3  . GLY A 1 82  ? -6.018  -14.673 -3.749  1.00 0.00 ? 82  GLY A HA3  6  
ATOM 10309 N N    . SER A 1 83  ? -3.681  -14.083 -4.776  1.00 0.00 ? 83  SER A N    6  
ATOM 10310 C CA   . SER A 1 83  ? -2.303  -14.182 -5.334  1.00 0.00 ? 83  SER A CA   6  
ATOM 10311 C C    . SER A 1 83  ? -1.614  -12.820 -5.230  1.00 0.00 ? 83  SER A C    6  
ATOM 10312 O O    . SER A 1 83  ? -0.448  -12.728 -4.902  1.00 0.00 ? 83  SER A O    6  
ATOM 10313 C CB   . SER A 1 83  ? -2.373  -14.609 -6.801  1.00 0.00 ? 83  SER A CB   6  
ATOM 10314 O OG   . SER A 1 83  ? -3.131  -13.654 -7.533  1.00 0.00 ? 83  SER A OG   6  
ATOM 10315 H H    . SER A 1 83  ? -4.420  -13.776 -5.342  1.00 0.00 ? 83  SER A H    6  
ATOM 10316 H HA   . SER A 1 83  ? -1.740  -14.912 -4.772  1.00 0.00 ? 83  SER A HA   6  
ATOM 10317 H HB2  . SER A 1 83  ? -1.378  -14.659 -7.210  1.00 0.00 ? 83  SER A HB2  6  
ATOM 10318 H HB3  . SER A 1 83  ? -2.839  -15.583 -6.870  1.00 0.00 ? 83  SER A HB3  6  
ATOM 10319 H HG   . SER A 1 83  ? -2.546  -13.236 -8.170  1.00 0.00 ? 83  SER A HG   6  
ATOM 10320 N N    . ALA A 1 84  ? -2.325  -11.763 -5.506  1.00 0.00 ? 84  ALA A N    6  
ATOM 10321 C CA   . ALA A 1 84  ? -1.709  -10.408 -5.422  1.00 0.00 ? 84  ALA A CA   6  
ATOM 10322 C C    . ALA A 1 84  ? -2.074  -9.767  -4.081  1.00 0.00 ? 84  ALA A C    6  
ATOM 10323 O O    . ALA A 1 84  ? -3.154  -9.965  -3.560  1.00 0.00 ? 84  ALA A O    6  
ATOM 10324 C CB   . ALA A 1 84  ? -2.234  -9.539  -6.567  1.00 0.00 ? 84  ALA A CB   6  
ATOM 10325 H H    . ALA A 1 84  ? -3.265  -11.858 -5.768  1.00 0.00 ? 84  ALA A H    6  
ATOM 10326 H HA   . ALA A 1 84  ? -0.636  -10.496 -5.499  1.00 0.00 ? 84  ALA A HA   6  
ATOM 10327 H HB1  . ALA A 1 84  ? -3.183  -9.926  -6.907  1.00 0.00 ? 84  ALA A HB1  6  
ATOM 10328 H HB2  . ALA A 1 84  ? -2.363  -8.525  -6.220  1.00 0.00 ? 84  ALA A HB2  6  
ATOM 10329 H HB3  . ALA A 1 84  ? -1.526  -9.554  -7.383  1.00 0.00 ? 84  ALA A HB3  6  
ATOM 10330 N N    . GLY A 1 85  ? -1.183  -9.000  -3.514  1.00 0.00 ? 85  GLY A N    6  
ATOM 10331 C CA   . GLY A 1 85  ? -1.483  -8.352  -2.206  1.00 0.00 ? 85  GLY A CA   6  
ATOM 10332 C C    . GLY A 1 85  ? -0.967  -6.910  -2.217  1.00 0.00 ? 85  GLY A C    6  
ATOM 10333 O O    . GLY A 1 85  ? 0.065   -6.615  -2.784  1.00 0.00 ? 85  GLY A O    6  
ATOM 10334 H H    . GLY A 1 85  ? -0.316  -8.853  -3.947  1.00 0.00 ? 85  GLY A H    6  
ATOM 10335 H HA2  . GLY A 1 85  ? -2.551  -8.353  -2.041  1.00 0.00 ? 85  GLY A HA2  6  
ATOM 10336 H HA3  . GLY A 1 85  ? -0.994  -8.897  -1.413  1.00 0.00 ? 85  GLY A HA3  6  
ATOM 10337 N N    . VAL A 1 86  ? -1.682  -6.011  -1.598  1.00 0.00 ? 86  VAL A N    6  
ATOM 10338 C CA   . VAL A 1 86  ? -1.236  -4.589  -1.574  1.00 0.00 ? 86  VAL A CA   6  
ATOM 10339 C C    . VAL A 1 86  ? -0.794  -4.214  -0.156  1.00 0.00 ? 86  VAL A C    6  
ATOM 10340 O O    . VAL A 1 86  ? -1.447  -4.541  0.816   1.00 0.00 ? 86  VAL A O    6  
ATOM 10341 C CB   . VAL A 1 86  ? -2.393  -3.686  -2.004  1.00 0.00 ? 86  VAL A CB   6  
ATOM 10342 C CG1  . VAL A 1 86  ? -3.658  -4.080  -1.238  1.00 0.00 ? 86  VAL A CG1  6  
ATOM 10343 C CG2  . VAL A 1 86  ? -2.041  -2.229  -1.695  1.00 0.00 ? 86  VAL A CG2  6  
ATOM 10344 H H    . VAL A 1 86  ? -2.514  -6.270  -1.149  1.00 0.00 ? 86  VAL A H    6  
ATOM 10345 H HA   . VAL A 1 86  ? -0.407  -4.461  -2.255  1.00 0.00 ? 86  VAL A HA   6  
ATOM 10346 H HB   . VAL A 1 86  ? -2.562  -3.802  -3.065  1.00 0.00 ? 86  VAL A HB   6  
ATOM 10347 H HG11 . VAL A 1 86  ? -3.413  -4.243  -0.200  1.00 0.00 ? 86  VAL A HG11 6  
ATOM 10348 H HG12 . VAL A 1 86  ? -4.387  -3.289  -1.318  1.00 0.00 ? 86  VAL A HG12 6  
ATOM 10349 H HG13 . VAL A 1 86  ? -4.064  -4.989  -1.659  1.00 0.00 ? 86  VAL A HG13 6  
ATOM 10350 H HG21 . VAL A 1 86  ? -1.036  -2.176  -1.303  1.00 0.00 ? 86  VAL A HG21 6  
ATOM 10351 H HG22 . VAL A 1 86  ? -2.105  -1.643  -2.602  1.00 0.00 ? 86  VAL A HG22 6  
ATOM 10352 H HG23 . VAL A 1 86  ? -2.734  -1.838  -0.965  1.00 0.00 ? 86  VAL A HG23 6  
ATOM 10353 N N    . ILE A 1 87  ? 0.310   -3.527  -0.036  1.00 0.00 ? 87  ILE A N    6  
ATOM 10354 C CA   . ILE A 1 87  ? 0.805   -3.121  1.312   1.00 0.00 ? 87  ILE A CA   6  
ATOM 10355 C C    . ILE A 1 87  ? 0.647   -1.603  1.466   1.00 0.00 ? 87  ILE A C    6  
ATOM 10356 O O    . ILE A 1 87  ? 1.519   -0.837  1.107   1.00 0.00 ? 87  ILE A O    6  
ATOM 10357 C CB   . ILE A 1 87  ? 2.282   -3.538  1.445   1.00 0.00 ? 87  ILE A CB   6  
ATOM 10358 C CG1  . ILE A 1 87  ? 2.350   -4.960  2.011   1.00 0.00 ? 87  ILE A CG1  6  
ATOM 10359 C CG2  . ILE A 1 87  ? 3.044   -2.586  2.377   1.00 0.00 ? 87  ILE A CG2  6  
ATOM 10360 C CD1  . ILE A 1 87  ? 3.682   -5.604  1.622   1.00 0.00 ? 87  ILE A CD1  6  
ATOM 10361 H H    . ILE A 1 87  ? 0.816   -3.274  -0.837  1.00 0.00 ? 87  ILE A H    6  
ATOM 10362 H HA   . ILE A 1 87  ? 0.221   -3.621  2.072   1.00 0.00 ? 87  ILE A HA   6  
ATOM 10363 H HB   . ILE A 1 87  ? 2.743   -3.523  0.469   1.00 0.00 ? 87  ILE A HB   6  
ATOM 10364 H HG12 . ILE A 1 87  ? 2.270   -4.925  3.087   1.00 0.00 ? 87  ILE A HG12 6  
ATOM 10365 H HG13 . ILE A 1 87  ? 1.538   -5.548  1.609   1.00 0.00 ? 87  ILE A HG13 6  
ATOM 10366 H HG21 . ILE A 1 87  ? 2.344   -2.047  2.997   1.00 0.00 ? 87  ILE A HG21 6  
ATOM 10367 H HG22 . ILE A 1 87  ? 3.714   -3.156  3.003   1.00 0.00 ? 87  ILE A HG22 6  
ATOM 10368 H HG23 . ILE A 1 87  ? 3.614   -1.884  1.786   1.00 0.00 ? 87  ILE A HG23 6  
ATOM 10369 H HD11 . ILE A 1 87  ? 4.326   -4.860  1.181   1.00 0.00 ? 87  ILE A HD11 6  
ATOM 10370 H HD12 . ILE A 1 87  ? 4.153   -6.014  2.503   1.00 0.00 ? 87  ILE A HD12 6  
ATOM 10371 H HD13 . ILE A 1 87  ? 3.504   -6.396  0.909   1.00 0.00 ? 87  ILE A HD13 6  
ATOM 10372 N N    . THR A 1 88  ? -0.463  -1.161  1.993   1.00 0.00 ? 88  THR A N    6  
ATOM 10373 C CA   . THR A 1 88  ? -0.671  0.305   2.159   1.00 0.00 ? 88  THR A CA   6  
ATOM 10374 C C    . THR A 1 88  ? -0.132  0.751   3.518   1.00 0.00 ? 88  THR A C    6  
ATOM 10375 O O    . THR A 1 88  ? -0.663  0.402   4.553   1.00 0.00 ? 88  THR A O    6  
ATOM 10376 C CB   . THR A 1 88  ? -2.164  0.636   2.077   1.00 0.00 ? 88  THR A CB   6  
ATOM 10377 O OG1  . THR A 1 88  ? -2.775  0.364   3.329   1.00 0.00 ? 88  THR A OG1  6  
ATOM 10378 C CG2  . THR A 1 88  ? -2.836  -0.203  0.988   1.00 0.00 ? 88  THR A CG2  6  
ATOM 10379 H H    . THR A 1 88  ? -1.160  -1.791  2.274   1.00 0.00 ? 88  THR A H    6  
ATOM 10380 H HA   . THR A 1 88  ? -0.146  0.828   1.375   1.00 0.00 ? 88  THR A HA   6  
ATOM 10381 H HB   . THR A 1 88  ? -2.283  1.683   1.842   1.00 0.00 ? 88  THR A HB   6  
ATOM 10382 H HG1  . THR A 1 88  ? -2.667  1.138   3.886   1.00 0.00 ? 88  THR A HG1  6  
ATOM 10383 H HG21 . THR A 1 88  ? -2.179  -1.005  0.687   1.00 0.00 ? 88  THR A HG21 6  
ATOM 10384 H HG22 . THR A 1 88  ? -3.756  -0.617  1.373   1.00 0.00 ? 88  THR A HG22 6  
ATOM 10385 H HG23 . THR A 1 88  ? -3.054  0.423   0.136   1.00 0.00 ? 88  THR A HG23 6  
ATOM 10386 N N    . VAL A 1 89  ? 0.914   1.532   3.523   1.00 0.00 ? 89  VAL A N    6  
ATOM 10387 C CA   . VAL A 1 89  ? 1.482   2.016   4.811   1.00 0.00 ? 89  VAL A CA   6  
ATOM 10388 C C    . VAL A 1 89  ? 1.239   3.522   4.923   1.00 0.00 ? 89  VAL A C    6  
ATOM 10389 O O    . VAL A 1 89  ? 1.402   4.257   3.970   1.00 0.00 ? 89  VAL A O    6  
ATOM 10390 C CB   . VAL A 1 89  ? 2.984   1.733   4.851   1.00 0.00 ? 89  VAL A CB   6  
ATOM 10391 C CG1  . VAL A 1 89  ? 3.545   2.129   6.217   1.00 0.00 ? 89  VAL A CG1  6  
ATOM 10392 C CG2  . VAL A 1 89  ? 3.230   0.241   4.613   1.00 0.00 ? 89  VAL A CG2  6  
ATOM 10393 H H    . VAL A 1 89  ? 1.320   1.810   2.675   1.00 0.00 ? 89  VAL A H    6  
ATOM 10394 H HA   . VAL A 1 89  ? 0.996   1.510   5.633   1.00 0.00 ? 89  VAL A HA   6  
ATOM 10395 H HB   . VAL A 1 89  ? 3.478   2.308   4.080   1.00 0.00 ? 89  VAL A HB   6  
ATOM 10396 H HG11 . VAL A 1 89  ? 2.742   2.477   6.849   1.00 0.00 ? 89  VAL A HG11 6  
ATOM 10397 H HG12 . VAL A 1 89  ? 4.017   1.272   6.675   1.00 0.00 ? 89  VAL A HG12 6  
ATOM 10398 H HG13 . VAL A 1 89  ? 4.273   2.916   6.092   1.00 0.00 ? 89  VAL A HG13 6  
ATOM 10399 H HG21 . VAL A 1 89  ? 2.315   -0.308  4.787   1.00 0.00 ? 89  VAL A HG21 6  
ATOM 10400 H HG22 . VAL A 1 89  ? 3.554   0.087   3.595   1.00 0.00 ? 89  VAL A HG22 6  
ATOM 10401 H HG23 . VAL A 1 89  ? 3.995   -0.111  5.290   1.00 0.00 ? 89  VAL A HG23 6  
ATOM 10402 N N    . LYS A 1 90  ? 0.837   3.990   6.074   1.00 0.00 ? 90  LYS A N    6  
ATOM 10403 C CA   . LYS A 1 90  ? 0.572   5.448   6.227   1.00 0.00 ? 90  LYS A CA   6  
ATOM 10404 C C    . LYS A 1 90  ? 1.736   6.118   6.957   1.00 0.00 ? 90  LYS A C    6  
ATOM 10405 O O    . LYS A 1 90  ? 2.409   5.512   7.768   1.00 0.00 ? 90  LYS A O    6  
ATOM 10406 C CB   . LYS A 1 90  ? -0.715  5.648   7.029   1.00 0.00 ? 90  LYS A CB   6  
ATOM 10407 C CG   . LYS A 1 90  ? -1.792  6.249   6.124   1.00 0.00 ? 90  LYS A CG   6  
ATOM 10408 C CD   . LYS A 1 90  ? -2.258  7.587   6.704   1.00 0.00 ? 90  LYS A CD   6  
ATOM 10409 C CE   . LYS A 1 90  ? -2.757  7.377   8.133   1.00 0.00 ? 90  LYS A CE   6  
ATOM 10410 N NZ   . LYS A 1 90  ? -1.802  8.005   9.089   1.00 0.00 ? 90  LYS A NZ   6  
ATOM 10411 H H    . LYS A 1 90  ? 0.700   3.382   6.831   1.00 0.00 ? 90  LYS A H    6  
ATOM 10412 H HA   . LYS A 1 90  ? 0.458   5.895   5.251   1.00 0.00 ? 90  LYS A HA   6  
ATOM 10413 H HB2  . LYS A 1 90  ? -1.054  4.696   7.411   1.00 0.00 ? 90  LYS A HB2  6  
ATOM 10414 H HB3  . LYS A 1 90  ? -0.524  6.319   7.853   1.00 0.00 ? 90  LYS A HB3  6  
ATOM 10415 H HG2  . LYS A 1 90  ? -1.386  6.408   5.135   1.00 0.00 ? 90  LYS A HG2  6  
ATOM 10416 H HG3  . LYS A 1 90  ? -2.632  5.574   6.064   1.00 0.00 ? 90  LYS A HG3  6  
ATOM 10417 H HD2  . LYS A 1 90  ? -1.431  8.282   6.709   1.00 0.00 ? 90  LYS A HD2  6  
ATOM 10418 H HD3  . LYS A 1 90  ? -3.058  7.985   6.099   1.00 0.00 ? 90  LYS A HD3  6  
ATOM 10419 H HE2  . LYS A 1 90  ? -3.730  7.832   8.246   1.00 0.00 ? 90  LYS A HE2  6  
ATOM 10420 H HE3  . LYS A 1 90  ? -2.829  6.319   8.339   1.00 0.00 ? 90  LYS A HE3  6  
ATOM 10421 H HZ1  . LYS A 1 90  ? -1.253  8.739   8.598   1.00 0.00 ? 90  LYS A HZ1  6  
ATOM 10422 H HZ2  . LYS A 1 90  ? -2.330  8.435   9.875   1.00 0.00 ? 90  LYS A HZ2  6  
ATOM 10423 H HZ3  . LYS A 1 90  ? -1.155  7.280   9.459   1.00 0.00 ? 90  LYS A HZ3  6  
ATOM 10424 N N    . THR A 1 91  ? 1.973   7.369   6.677   1.00 0.00 ? 91  THR A N    6  
ATOM 10425 C CA   . THR A 1 91  ? 3.087   8.092   7.354   1.00 0.00 ? 91  THR A CA   6  
ATOM 10426 C C    . THR A 1 91  ? 2.576   9.449   7.846   1.00 0.00 ? 91  THR A C    6  
ATOM 10427 O O    . THR A 1 91  ? 1.441   9.581   8.258   1.00 0.00 ? 91  THR A O    6  
ATOM 10428 C CB   . THR A 1 91  ? 4.237   8.299   6.365   1.00 0.00 ? 91  THR A CB   6  
ATOM 10429 O OG1  . THR A 1 91  ? 3.811   9.161   5.319   1.00 0.00 ? 91  THR A OG1  6  
ATOM 10430 C CG2  . THR A 1 91  ? 4.652   6.951   5.778   1.00 0.00 ? 91  THR A CG2  6  
ATOM 10431 H H    . THR A 1 91  ? 1.414   7.837   6.023   1.00 0.00 ? 91  THR A H    6  
ATOM 10432 H HA   . THR A 1 91  ? 3.435   7.511   8.196   1.00 0.00 ? 91  THR A HA   6  
ATOM 10433 H HB   . THR A 1 91  ? 5.079   8.740   6.875   1.00 0.00 ? 91  THR A HB   6  
ATOM 10434 H HG1  . THR A 1 91  ? 4.403   9.916   5.297   1.00 0.00 ? 91  THR A HG1  6  
ATOM 10435 H HG21 . THR A 1 91  ? 4.359   6.159   6.451   1.00 0.00 ? 91  THR A HG21 6  
ATOM 10436 H HG22 . THR A 1 91  ? 4.167   6.810   4.824   1.00 0.00 ? 91  THR A HG22 6  
ATOM 10437 H HG23 . THR A 1 91  ? 5.723   6.931   5.642   1.00 0.00 ? 91  THR A HG23 6  
ATOM 10438 N N    . SER A 1 92  ? 3.400   10.461  7.807   1.00 0.00 ? 92  SER A N    6  
ATOM 10439 C CA   . SER A 1 92  ? 2.949   11.803  8.273   1.00 0.00 ? 92  SER A CA   6  
ATOM 10440 C C    . SER A 1 92  ? 2.280   12.546  7.115   1.00 0.00 ? 92  SER A C    6  
ATOM 10441 O O    . SER A 1 92  ? 1.399   13.358  7.315   1.00 0.00 ? 92  SER A O    6  
ATOM 10442 C CB   . SER A 1 92  ? 4.155   12.605  8.764   1.00 0.00 ? 92  SER A CB   6  
ATOM 10443 O OG   . SER A 1 92  ? 3.718   13.881  9.213   1.00 0.00 ? 92  SER A OG   6  
ATOM 10444 H H    . SER A 1 92  ? 4.313   10.340  7.472   1.00 0.00 ? 92  SER A H    6  
ATOM 10445 H HA   . SER A 1 92  ? 2.242   11.685  9.080   1.00 0.00 ? 92  SER A HA   6  
ATOM 10446 H HB2  . SER A 1 92  ? 4.627   12.085  9.581   1.00 0.00 ? 92  SER A HB2  6  
ATOM 10447 H HB3  . SER A 1 92  ? 4.863   12.718  7.955   1.00 0.00 ? 92  SER A HB3  6  
ATOM 10448 H HG   . SER A 1 92  ? 2.881   13.765  9.669   1.00 0.00 ? 92  SER A HG   6  
ATOM 10449 N N    . LYS A 1 93  ? 2.691   12.278  5.904   1.00 0.00 ? 93  LYS A N    6  
ATOM 10450 C CA   . LYS A 1 93  ? 2.078   12.976  4.736   1.00 0.00 ? 93  LYS A CA   6  
ATOM 10451 C C    . LYS A 1 93  ? 2.331   12.170  3.459   1.00 0.00 ? 93  LYS A C    6  
ATOM 10452 O O    . LYS A 1 93  ? 2.883   12.675  2.502   1.00 0.00 ? 93  LYS A O    6  
ATOM 10453 C CB   . LYS A 1 93  ? 2.716   14.358  4.576   1.00 0.00 ? 93  LYS A CB   6  
ATOM 10454 C CG   . LYS A 1 93  ? 1.979   15.384  5.437   1.00 0.00 ? 93  LYS A CG   6  
ATOM 10455 C CD   . LYS A 1 93  ? 2.561   16.772  5.163   1.00 0.00 ? 93  LYS A CD   6  
ATOM 10456 C CE   . LYS A 1 93  ? 2.094   17.749  6.240   1.00 0.00 ? 93  LYS A CE   6  
ATOM 10457 N NZ   . LYS A 1 93  ? 1.415   18.907  5.593   1.00 0.00 ? 93  LYS A NZ   6  
ATOM 10458 H H    . LYS A 1 93  ? 3.403   11.621  5.763   1.00 0.00 ? 93  LYS A H    6  
ATOM 10459 H HA   . LYS A 1 93  ? 1.015   13.084  4.894   1.00 0.00 ? 93  LYS A HA   6  
ATOM 10460 H HB2  . LYS A 1 93  ? 3.751   14.311  4.882   1.00 0.00 ? 93  LYS A HB2  6  
ATOM 10461 H HB3  . LYS A 1 93  ? 2.662   14.659  3.541   1.00 0.00 ? 93  LYS A HB3  6  
ATOM 10462 H HG2  . LYS A 1 93  ? 0.926   15.376  5.191   1.00 0.00 ? 93  LYS A HG2  6  
ATOM 10463 H HG3  . LYS A 1 93  ? 2.108   15.142  6.482   1.00 0.00 ? 93  LYS A HG3  6  
ATOM 10464 H HD2  . LYS A 1 93  ? 3.639   16.715  5.171   1.00 0.00 ? 93  LYS A HD2  6  
ATOM 10465 H HD3  . LYS A 1 93  ? 2.226   17.116  4.196   1.00 0.00 ? 93  LYS A HD3  6  
ATOM 10466 H HE2  . LYS A 1 93  ? 1.404   17.252  6.906   1.00 0.00 ? 93  LYS A HE2  6  
ATOM 10467 H HE3  . LYS A 1 93  ? 2.949   18.100  6.800   1.00 0.00 ? 93  LYS A HE3  6  
ATOM 10468 H HZ1  . LYS A 1 93  ? 1.838   19.077  4.658   1.00 0.00 ? 93  LYS A HZ1  6  
ATOM 10469 H HZ2  . LYS A 1 93  ? 0.402   18.695  5.483   1.00 0.00 ? 93  LYS A HZ2  6  
ATOM 10470 H HZ3  . LYS A 1 93  ? 1.532   19.754  6.184   1.00 0.00 ? 93  LYS A HZ3  6  
ATOM 10471 N N    . SER A 1 94  ? 1.941   10.925  3.427   1.00 0.00 ? 94  SER A N    6  
ATOM 10472 C CA   . SER A 1 94  ? 2.177   10.118  2.195   1.00 0.00 ? 94  SER A CA   6  
ATOM 10473 C C    . SER A 1 94  ? 1.592   8.716   2.362   1.00 0.00 ? 94  SER A C    6  
ATOM 10474 O O    . SER A 1 94  ? 1.518   8.186   3.452   1.00 0.00 ? 94  SER A O    6  
ATOM 10475 C CB   . SER A 1 94  ? 3.683   10.016  1.944   1.00 0.00 ? 94  SER A CB   6  
ATOM 10476 O OG   . SER A 1 94  ? 4.015   8.685   1.566   1.00 0.00 ? 94  SER A OG   6  
ATOM 10477 H H    . SER A 1 94  ? 1.498   10.524  4.203   1.00 0.00 ? 94  SER A H    6  
ATOM 10478 H HA   . SER A 1 94  ? 1.707   10.604  1.352   1.00 0.00 ? 94  SER A HA   6  
ATOM 10479 H HB2  . SER A 1 94  ? 3.965   10.688  1.151   1.00 0.00 ? 94  SER A HB2  6  
ATOM 10480 H HB3  . SER A 1 94  ? 4.212   10.287  2.847   1.00 0.00 ? 94  SER A HB3  6  
ATOM 10481 H HG   . SER A 1 94  ? 4.070   8.155   2.365   1.00 0.00 ? 94  SER A HG   6  
ATOM 10482 N N    . ILE A 1 95  ? 1.194   8.107   1.279   1.00 0.00 ? 95  ILE A N    6  
ATOM 10483 C CA   . ILE A 1 95  ? 0.632   6.732   1.355   1.00 0.00 ? 95  ILE A CA   6  
ATOM 10484 C C    . ILE A 1 95  ? 1.431   5.838   0.406   1.00 0.00 ? 95  ILE A C    6  
ATOM 10485 O O    . ILE A 1 95  ? 1.589   6.143   -0.760  1.00 0.00 ? 95  ILE A O    6  
ATOM 10486 C CB   . ILE A 1 95  ? -0.843  6.755   0.946   1.00 0.00 ? 95  ILE A CB   6  
ATOM 10487 C CG1  . ILE A 1 95  ? -1.675  7.329   2.096   1.00 0.00 ? 95  ILE A CG1  6  
ATOM 10488 C CG2  . ILE A 1 95  ? -1.317  5.333   0.640   1.00 0.00 ? 95  ILE A CG2  6  
ATOM 10489 C CD1  . ILE A 1 95  ? -2.924  8.008   1.533   1.00 0.00 ? 95  ILE A CD1  6  
ATOM 10490 H H    . ILE A 1 95  ? 1.279   8.550   0.408   1.00 0.00 ? 95  ILE A H    6  
ATOM 10491 H HA   . ILE A 1 95  ? 0.724   6.361   2.365   1.00 0.00 ? 95  ILE A HA   6  
ATOM 10492 H HB   . ILE A 1 95  ? -0.965  7.371   0.069   1.00 0.00 ? 95  ILE A HB   6  
ATOM 10493 H HG12 . ILE A 1 95  ? -1.967  6.530   2.763   1.00 0.00 ? 95  ILE A HG12 6  
ATOM 10494 H HG13 . ILE A 1 95  ? -1.087  8.054   2.638   1.00 0.00 ? 95  ILE A HG13 6  
ATOM 10495 H HG21 . ILE A 1 95  ? -0.569  4.625   0.968   1.00 0.00 ? 95  ILE A HG21 6  
ATOM 10496 H HG22 . ILE A 1 95  ? -2.245  5.144   1.159   1.00 0.00 ? 95  ILE A HG22 6  
ATOM 10497 H HG23 . ILE A 1 95  ? -1.471  5.227   -0.423  1.00 0.00 ? 95  ILE A HG23 6  
ATOM 10498 H HD11 . ILE A 1 95  ? -2.897  7.977   0.453   1.00 0.00 ? 95  ILE A HD11 6  
ATOM 10499 H HD12 . ILE A 1 95  ? -3.806  7.493   1.885   1.00 0.00 ? 95  ILE A HD12 6  
ATOM 10500 H HD13 . ILE A 1 95  ? -2.955  9.036   1.861   1.00 0.00 ? 95  ILE A HD13 6  
ATOM 10501 N N    . LEU A 1 96  ? 1.951   4.749   0.897   1.00 0.00 ? 96  LEU A N    6  
ATOM 10502 C CA   . LEU A 1 96  ? 2.759   3.853   0.023   1.00 0.00 ? 96  LEU A CA   6  
ATOM 10503 C C    . LEU A 1 96  ? 1.982   2.572   -0.272  1.00 0.00 ? 96  LEU A C    6  
ATOM 10504 O O    . LEU A 1 96  ? 1.041   2.233   0.415   1.00 0.00 ? 96  LEU A O    6  
ATOM 10505 C CB   . LEU A 1 96  ? 4.069   3.504   0.735   1.00 0.00 ? 96  LEU A CB   6  
ATOM 10506 C CG   . LEU A 1 96  ? 4.654   4.757   1.400   1.00 0.00 ? 96  LEU A CG   6  
ATOM 10507 C CD1  . LEU A 1 96  ? 4.518   5.959   0.463   1.00 0.00 ? 96  LEU A CD1  6  
ATOM 10508 C CD2  . LEU A 1 96  ? 3.909   5.045   2.706   1.00 0.00 ? 96  LEU A CD2  6  
ATOM 10509 H H    . LEU A 1 96  ? 1.822   4.528   1.842   1.00 0.00 ? 96  LEU A H    6  
ATOM 10510 H HA   . LEU A 1 96  ? 2.980   4.361   -0.905  1.00 0.00 ? 96  LEU A HA   6  
ATOM 10511 H HB2  . LEU A 1 96  ? 3.877   2.754   1.489   1.00 0.00 ? 96  LEU A HB2  6  
ATOM 10512 H HB3  . LEU A 1 96  ? 4.777   3.118   0.016   1.00 0.00 ? 96  LEU A HB3  6  
ATOM 10513 H HG   . LEU A 1 96  ? 5.698   4.590   1.615   1.00 0.00 ? 96  LEU A HG   6  
ATOM 10514 H HD11 . LEU A 1 96  ? 4.380   5.612   -0.549  1.00 0.00 ? 96  LEU A HD11 6  
ATOM 10515 H HD12 . LEU A 1 96  ? 3.666   6.552   0.760   1.00 0.00 ? 96  LEU A HD12 6  
ATOM 10516 H HD13 . LEU A 1 96  ? 5.413   6.562   0.519   1.00 0.00 ? 96  LEU A HD13 6  
ATOM 10517 H HD21 . LEU A 1 96  ? 3.325   4.181   2.987   1.00 0.00 ? 96  LEU A HD21 6  
ATOM 10518 H HD22 . LEU A 1 96  ? 4.621   5.269   3.487   1.00 0.00 ? 96  LEU A HD22 6  
ATOM 10519 H HD23 . LEU A 1 96  ? 3.253   5.892   2.565   1.00 0.00 ? 96  LEU A HD23 6  
ATOM 10520 N N    . VAL A 1 97  ? 2.369   1.857   -1.294  1.00 0.00 ? 97  VAL A N    6  
ATOM 10521 C CA   . VAL A 1 97  ? 1.653   0.596   -1.637  1.00 0.00 ? 97  VAL A CA   6  
ATOM 10522 C C    . VAL A 1 97  ? 2.666   -0.475  -2.044  1.00 0.00 ? 97  VAL A C    6  
ATOM 10523 O O    . VAL A 1 97  ? 3.467   -0.284  -2.937  1.00 0.00 ? 97  VAL A O    6  
ATOM 10524 C CB   . VAL A 1 97  ? 0.690   0.851   -2.800  1.00 0.00 ? 97  VAL A CB   6  
ATOM 10525 C CG1  . VAL A 1 97  ? 0.243   -0.481  -3.412  1.00 0.00 ? 97  VAL A CG1  6  
ATOM 10526 C CG2  . VAL A 1 97  ? -0.539  1.608   -2.289  1.00 0.00 ? 97  VAL A CG2  6  
ATOM 10527 H H    . VAL A 1 97  ? 3.130   2.151   -1.837  1.00 0.00 ? 97  VAL A H    6  
ATOM 10528 H HA   . VAL A 1 97  ? 1.097   0.255   -0.776  1.00 0.00 ? 97  VAL A HA   6  
ATOM 10529 H HB   . VAL A 1 97  ? 1.188   1.439   -3.556  1.00 0.00 ? 97  VAL A HB   6  
ATOM 10530 H HG11 . VAL A 1 97  ? -0.189  -1.103  -2.644  1.00 0.00 ? 97  VAL A HG11 6  
ATOM 10531 H HG12 . VAL A 1 97  ? -0.492  -0.296  -4.182  1.00 0.00 ? 97  VAL A HG12 6  
ATOM 10532 H HG13 . VAL A 1 97  ? 1.097   -0.982  -3.843  1.00 0.00 ? 97  VAL A HG13 6  
ATOM 10533 H HG21 . VAL A 1 97  ? -0.672  1.408   -1.236  1.00 0.00 ? 97  VAL A HG21 6  
ATOM 10534 H HG22 . VAL A 1 97  ? -0.398  2.667   -2.439  1.00 0.00 ? 97  VAL A HG22 6  
ATOM 10535 H HG23 . VAL A 1 97  ? -1.414  1.280   -2.830  1.00 0.00 ? 97  VAL A HG23 6  
ATOM 10536 N N    . GLY A 1 98  ? 2.618   -1.612  -1.410  1.00 0.00 ? 98  GLY A N    6  
ATOM 10537 C CA   . GLY A 1 98  ? 3.554   -2.710  -1.774  1.00 0.00 ? 98  GLY A CA   6  
ATOM 10538 C C    . GLY A 1 98  ? 2.774   -3.741  -2.584  1.00 0.00 ? 98  GLY A C    6  
ATOM 10539 O O    . GLY A 1 98  ? 2.030   -4.535  -2.043  1.00 0.00 ? 98  GLY A O    6  
ATOM 10540 H H    . GLY A 1 98  ? 1.951   -1.752  -0.708  1.00 0.00 ? 98  GLY A H    6  
ATOM 10541 H HA2  . GLY A 1 98  ? 4.366   -2.314  -2.366  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 10542 H HA3  . GLY A 1 98  ? 3.943   -3.172  -0.881  1.00 0.00 ? 98  GLY A HA3  6  
ATOM 10543 N N    . VAL A 1 99  ? 2.922   -3.726  -3.878  1.00 0.00 ? 99  VAL A N    6  
ATOM 10544 C CA   . VAL A 1 99  ? 2.166   -4.696  -4.720  1.00 0.00 ? 99  VAL A CA   6  
ATOM 10545 C C    . VAL A 1 99  ? 3.085   -5.867  -5.081  1.00 0.00 ? 99  VAL A C    6  
ATOM 10546 O O    . VAL A 1 99  ? 4.192   -5.679  -5.542  1.00 0.00 ? 99  VAL A O    6  
ATOM 10547 C CB   . VAL A 1 99  ? 1.654   -4.006  -6.002  1.00 0.00 ? 99  VAL A CB   6  
ATOM 10548 C CG1  . VAL A 1 99  ? 0.125   -4.072  -6.037  1.00 0.00 ? 99  VAL A CG1  6  
ATOM 10549 C CG2  . VAL A 1 99  ? 2.083   -2.531  -6.030  1.00 0.00 ? 99  VAL A CG2  6  
ATOM 10550 H H    . VAL A 1 99  ? 3.520   -3.072  -4.297  1.00 0.00 ? 99  VAL A H    6  
ATOM 10551 H HA   . VAL A 1 99  ? 1.323   -5.069  -4.156  1.00 0.00 ? 99  VAL A HA   6  
ATOM 10552 H HB   . VAL A 1 99  ? 2.054   -4.515  -6.866  1.00 0.00 ? 99  VAL A HB   6  
ATOM 10553 H HG11 . VAL A 1 99  ? -0.210  -4.955  -5.516  1.00 0.00 ? 99  VAL A HG11 6  
ATOM 10554 H HG12 . VAL A 1 99  ? -0.283  -3.194  -5.555  1.00 0.00 ? 99  VAL A HG12 6  
ATOM 10555 H HG13 . VAL A 1 99  ? -0.212  -4.107  -7.064  1.00 0.00 ? 99  VAL A HG13 6  
ATOM 10556 H HG21 . VAL A 1 99  ? 1.980   -2.106  -5.042  1.00 0.00 ? 99  VAL A HG21 6  
ATOM 10557 H HG22 . VAL A 1 99  ? 3.112   -2.459  -6.347  1.00 0.00 ? 99  VAL A HG22 6  
ATOM 10558 H HG23 . VAL A 1 99  ? 1.455   -1.986  -6.721  1.00 0.00 ? 99  VAL A HG23 6  
ATOM 10559 N N    . TYR A 1 100 ? 2.640   -7.076  -4.857  1.00 0.00 ? 100 TYR A N    6  
ATOM 10560 C CA   . TYR A 1 100 ? 3.495   -8.256  -5.171  1.00 0.00 ? 100 TYR A CA   6  
ATOM 10561 C C    . TYR A 1 100 ? 2.620   -9.405  -5.678  1.00 0.00 ? 100 TYR A C    6  
ATOM 10562 O O    . TYR A 1 100 ? 1.442   -9.241  -5.927  1.00 0.00 ? 100 TYR A O    6  
ATOM 10563 C CB   . TYR A 1 100 ? 4.226   -8.707  -3.905  1.00 0.00 ? 100 TYR A CB   6  
ATOM 10564 C CG   . TYR A 1 100 ? 3.254   -8.745  -2.749  1.00 0.00 ? 100 TYR A CG   6  
ATOM 10565 C CD1  . TYR A 1 100 ? 2.713   -7.556  -2.242  1.00 0.00 ? 100 TYR A CD1  6  
ATOM 10566 C CD2  . TYR A 1 100 ? 2.889   -9.974  -2.185  1.00 0.00 ? 100 TYR A CD2  6  
ATOM 10567 C CE1  . TYR A 1 100 ? 1.810   -7.596  -1.172  1.00 0.00 ? 100 TYR A CE1  6  
ATOM 10568 C CE2  . TYR A 1 100 ? 1.987   -10.014 -1.115  1.00 0.00 ? 100 TYR A CE2  6  
ATOM 10569 C CZ   . TYR A 1 100 ? 1.447   -8.826  -0.609  1.00 0.00 ? 100 TYR A CZ   6  
ATOM 10570 O OH   . TYR A 1 100 ? 0.558   -8.867  0.445   1.00 0.00 ? 100 TYR A OH   6  
ATOM 10571 H H    . TYR A 1 100 ? 1.749   -7.206  -4.471  1.00 0.00 ? 100 TYR A H    6  
ATOM 10572 H HA   . TYR A 1 100 ? 4.216   -7.990  -5.929  1.00 0.00 ? 100 TYR A HA   6  
ATOM 10573 H HB2  . TYR A 1 100 ? 4.637   -9.694  -4.061  1.00 0.00 ? 100 TYR A HB2  6  
ATOM 10574 H HB3  . TYR A 1 100 ? 5.026   -8.015  -3.682  1.00 0.00 ? 100 TYR A HB3  6  
ATOM 10575 H HD1  . TYR A 1 100 ? 2.992   -6.607  -2.677  1.00 0.00 ? 100 TYR A HD1  6  
ATOM 10576 H HD2  . TYR A 1 100 ? 3.305   -10.890 -2.576  1.00 0.00 ? 100 TYR A HD2  6  
ATOM 10577 H HE1  . TYR A 1 100 ? 1.393   -6.679  -0.782  1.00 0.00 ? 100 TYR A HE1  6  
ATOM 10578 H HE2  . TYR A 1 100 ? 1.707   -10.962 -0.681  1.00 0.00 ? 100 TYR A HE2  6  
ATOM 10579 H HH   . TYR A 1 100 ? -0.059  -8.137  0.342   1.00 0.00 ? 100 TYR A HH   6  
ATOM 10580 N N    . ASN A 1 101 ? 3.188   -10.573 -5.824  1.00 0.00 ? 101 ASN A N    6  
ATOM 10581 C CA   . ASN A 1 101 ? 2.393   -11.737 -6.307  1.00 0.00 ? 101 ASN A CA   6  
ATOM 10582 C C    . ASN A 1 101 ? 2.425   -12.838 -5.246  1.00 0.00 ? 101 ASN A C    6  
ATOM 10583 O O    . ASN A 1 101 ? 2.693   -12.586 -4.087  1.00 0.00 ? 101 ASN A O    6  
ATOM 10584 C CB   . ASN A 1 101 ? 2.989   -12.278 -7.614  1.00 0.00 ? 101 ASN A CB   6  
ATOM 10585 C CG   . ASN A 1 101 ? 3.795   -11.180 -8.315  1.00 0.00 ? 101 ASN A CG   6  
ATOM 10586 O OD1  . ASN A 1 101 ? 3.437   -10.021 -8.264  1.00 0.00 ? 101 ASN A OD1  6  
ATOM 10587 N ND2  . ASN A 1 101 ? 4.877   -11.500 -8.972  1.00 0.00 ? 101 ASN A ND2  6  
ATOM 10588 H H    . ASN A 1 101 ? 4.140   -10.684 -5.612  1.00 0.00 ? 101 ASN A H    6  
ATOM 10589 H HA   . ASN A 1 101 ? 1.371   -11.430 -6.477  1.00 0.00 ? 101 ASN A HA   6  
ATOM 10590 H HB2  . ASN A 1 101 ? 3.637   -13.113 -7.393  1.00 0.00 ? 101 ASN A HB2  6  
ATOM 10591 H HB3  . ASN A 1 101 ? 2.192   -12.605 -8.264  1.00 0.00 ? 101 ASN A HB3  6  
ATOM 10592 H HD21 . ASN A 1 101 ? 5.166   -12.435 -9.014  1.00 0.00 ? 101 ASN A HD21 6  
ATOM 10593 H HD22 . ASN A 1 101 ? 5.401   -10.804 -9.422  1.00 0.00 ? 101 ASN A HD22 6  
ATOM 10594 N N    . GLU A 1 102 ? 2.158   -14.054 -5.630  1.00 0.00 ? 102 GLU A N    6  
ATOM 10595 C CA   . GLU A 1 102 ? 2.176   -15.166 -4.642  1.00 0.00 ? 102 GLU A CA   6  
ATOM 10596 C C    . GLU A 1 102 ? 3.624   -15.543 -4.321  1.00 0.00 ? 102 GLU A C    6  
ATOM 10597 O O    . GLU A 1 102 ? 3.899   -16.208 -3.342  1.00 0.00 ? 102 GLU A O    6  
ATOM 10598 C CB   . GLU A 1 102 ? 1.453   -16.379 -5.228  1.00 0.00 ? 102 GLU A CB   6  
ATOM 10599 C CG   . GLU A 1 102 ? 0.767   -17.148 -4.099  1.00 0.00 ? 102 GLU A CG   6  
ATOM 10600 C CD   . GLU A 1 102 ? -0.319  -18.053 -4.684  1.00 0.00 ? 102 GLU A CD   6  
ATOM 10601 O OE1  . GLU A 1 102 ? -0.095  -18.597 -5.754  1.00 0.00 ? 102 GLU A OE1  6  
ATOM 10602 O OE2  . GLU A 1 102 ? -1.354  -18.187 -4.052  1.00 0.00 ? 102 GLU A OE2  6  
ATOM 10603 H H    . GLU A 1 102 ? 1.945   -14.237 -6.569  1.00 0.00 ? 102 GLU A H    6  
ATOM 10604 H HA   . GLU A 1 102 ? 1.678   -14.852 -3.737  1.00 0.00 ? 102 GLU A HA   6  
ATOM 10605 H HB2  . GLU A 1 102 ? 0.714   -16.047 -5.943  1.00 0.00 ? 102 GLU A HB2  6  
ATOM 10606 H HB3  . GLU A 1 102 ? 2.168   -17.024 -5.717  1.00 0.00 ? 102 GLU A HB3  6  
ATOM 10607 H HG2  . GLU A 1 102 ? 1.496   -17.748 -3.578  1.00 0.00 ? 102 GLU A HG2  6  
ATOM 10608 H HG3  . GLU A 1 102 ? 0.317   -16.448 -3.412  1.00 0.00 ? 102 GLU A HG3  6  
ATOM 10609 N N    . LYS A 1 103 ? 4.553   -15.124 -5.138  1.00 0.00 ? 103 LYS A N    6  
ATOM 10610 C CA   . LYS A 1 103 ? 5.980   -15.464 -4.876  1.00 0.00 ? 103 LYS A CA   6  
ATOM 10611 C C    . LYS A 1 103 ? 6.450   -14.743 -3.610  1.00 0.00 ? 103 LYS A C    6  
ATOM 10612 O O    . LYS A 1 103 ? 7.199   -15.282 -2.820  1.00 0.00 ? 103 LYS A O    6  
ATOM 10613 C CB   . LYS A 1 103 ? 6.839   -15.028 -6.065  1.00 0.00 ? 103 LYS A CB   6  
ATOM 10614 C CG   . LYS A 1 103 ? 7.037   -16.213 -7.014  1.00 0.00 ? 103 LYS A CG   6  
ATOM 10615 C CD   . LYS A 1 103 ? 6.300   -15.946 -8.328  1.00 0.00 ? 103 LYS A CD   6  
ATOM 10616 C CE   . LYS A 1 103 ? 7.204   -16.318 -9.507  1.00 0.00 ? 103 LYS A CE   6  
ATOM 10617 N NZ   . LYS A 1 103 ? 6.488   -17.270 -10.402 1.00 0.00 ? 103 LYS A NZ   6  
ATOM 10618 H H    . LYS A 1 103 ? 4.311   -14.589 -5.922  1.00 0.00 ? 103 LYS A H    6  
ATOM 10619 H HA   . LYS A 1 103 ? 6.074   -16.531 -4.736  1.00 0.00 ? 103 LYS A HA   6  
ATOM 10620 H HB2  . LYS A 1 103 ? 6.344   -14.224 -6.591  1.00 0.00 ? 103 LYS A HB2  6  
ATOM 10621 H HB3  . LYS A 1 103 ? 7.800   -14.691 -5.711  1.00 0.00 ? 103 LYS A HB3  6  
ATOM 10622 H HG2  . LYS A 1 103 ? 8.091   -16.342 -7.211  1.00 0.00 ? 103 LYS A HG2  6  
ATOM 10623 H HG3  . LYS A 1 103 ? 6.643   -17.108 -6.558  1.00 0.00 ? 103 LYS A HG3  6  
ATOM 10624 H HD2  . LYS A 1 103 ? 5.399   -16.540 -8.361  1.00 0.00 ? 103 LYS A HD2  6  
ATOM 10625 H HD3  . LYS A 1 103 ? 6.045   -14.899 -8.391  1.00 0.00 ? 103 LYS A HD3  6  
ATOM 10626 H HE2  . LYS A 1 103 ? 7.459   -15.427 -10.059 1.00 0.00 ? 103 LYS A HE2  6  
ATOM 10627 H HE3  . LYS A 1 103 ? 8.106   -16.782 -9.135  1.00 0.00 ? 103 LYS A HE3  6  
ATOM 10628 H HZ1  . LYS A 1 103 ? 5.486   -17.315 -10.130 1.00 0.00 ? 103 LYS A HZ1  6  
ATOM 10629 H HZ2  . LYS A 1 103 ? 6.566   -16.942 -11.387 1.00 0.00 ? 103 LYS A HZ2  6  
ATOM 10630 H HZ3  . LYS A 1 103 ? 6.911   -18.216 -10.314 1.00 0.00 ? 103 LYS A HZ3  6  
ATOM 10631 N N    . ILE A 1 104 ? 6.012   -13.530 -3.407  1.00 0.00 ? 104 ILE A N    6  
ATOM 10632 C CA   . ILE A 1 104 ? 6.433   -12.782 -2.189  1.00 0.00 ? 104 ILE A CA   6  
ATOM 10633 C C    . ILE A 1 104 ? 5.603   -13.253 -0.995  1.00 0.00 ? 104 ILE A C    6  
ATOM 10634 O O    . ILE A 1 104 ? 4.470   -13.668 -1.142  1.00 0.00 ? 104 ILE A O    6  
ATOM 10635 C CB   . ILE A 1 104 ? 6.204   -11.285 -2.400  1.00 0.00 ? 104 ILE A CB   6  
ATOM 10636 C CG1  . ILE A 1 104 ? 6.728   -10.876 -3.777  1.00 0.00 ? 104 ILE A CG1  6  
ATOM 10637 C CG2  . ILE A 1 104 ? 6.948   -10.500 -1.320  1.00 0.00 ? 104 ILE A CG2  6  
ATOM 10638 C CD1  . ILE A 1 104 ? 8.248   -11.014 -3.803  1.00 0.00 ? 104 ILE A CD1  6  
ATOM 10639 H H    . ILE A 1 104 ? 5.405   -13.112 -4.053  1.00 0.00 ? 104 ILE A H    6  
ATOM 10640 H HA   . ILE A 1 104 ? 7.480   -12.964 -1.995  1.00 0.00 ? 104 ILE A HA   6  
ATOM 10641 H HB   . ILE A 1 104 ? 5.148   -11.072 -2.336  1.00 0.00 ? 104 ILE A HB   6  
ATOM 10642 H HG12 . ILE A 1 104 ? 6.294   -11.515 -4.532  1.00 0.00 ? 104 ILE A HG12 6  
ATOM 10643 H HG13 . ILE A 1 104 ? 6.461   -9.850  -3.974  1.00 0.00 ? 104 ILE A HG13 6  
ATOM 10644 H HG21 . ILE A 1 104 ? 6.716   -10.915 -0.351  1.00 0.00 ? 104 ILE A HG21 6  
ATOM 10645 H HG22 . ILE A 1 104 ? 8.012   -10.566 -1.495  1.00 0.00 ? 104 ILE A HG22 6  
ATOM 10646 H HG23 . ILE A 1 104 ? 6.640   -9.466  -1.352  1.00 0.00 ? 104 ILE A HG23 6  
ATOM 10647 H HD11 . ILE A 1 104 ? 8.600   -11.291 -2.821  1.00 0.00 ? 104 ILE A HD11 6  
ATOM 10648 H HD12 . ILE A 1 104 ? 8.527   -11.776 -4.515  1.00 0.00 ? 104 ILE A HD12 6  
ATOM 10649 H HD13 . ILE A 1 104 ? 8.688   -10.071 -4.092  1.00 0.00 ? 104 ILE A HD13 6  
ATOM 10650 N N    . GLN A 1 105 ? 6.151   -13.192 0.187   1.00 0.00 ? 105 GLN A N    6  
ATOM 10651 C CA   . GLN A 1 105 ? 5.383   -13.636 1.382   1.00 0.00 ? 105 GLN A CA   6  
ATOM 10652 C C    . GLN A 1 105 ? 4.684   -12.424 2.011   1.00 0.00 ? 105 GLN A C    6  
ATOM 10653 O O    . GLN A 1 105 ? 5.263   -11.361 2.106   1.00 0.00 ? 105 GLN A O    6  
ATOM 10654 C CB   . GLN A 1 105 ? 6.337   -14.264 2.398   1.00 0.00 ? 105 GLN A CB   6  
ATOM 10655 C CG   . GLN A 1 105 ? 6.257   -15.788 2.294   1.00 0.00 ? 105 GLN A CG   6  
ATOM 10656 C CD   . GLN A 1 105 ? 7.069   -16.419 3.426   1.00 0.00 ? 105 GLN A CD   6  
ATOM 10657 O OE1  . GLN A 1 105 ? 8.010   -17.148 3.181   1.00 0.00 ? 105 GLN A OE1  6  
ATOM 10658 N NE2  . GLN A 1 105 ? 6.746   -16.165 4.665   1.00 0.00 ? 105 GLN A NE2  6  
ATOM 10659 H H    . GLN A 1 105 ? 7.066   -12.853 0.289   1.00 0.00 ? 105 GLN A H    6  
ATOM 10660 H HA   . GLN A 1 105 ? 4.647   -14.365 1.079   1.00 0.00 ? 105 GLN A HA   6  
ATOM 10661 H HB2  . GLN A 1 105 ? 7.347   -13.942 2.188   1.00 0.00 ? 105 GLN A HB2  6  
ATOM 10662 H HB3  . GLN A 1 105 ? 6.060   -13.956 3.394   1.00 0.00 ? 105 GLN A HB3  6  
ATOM 10663 H HG2  . GLN A 1 105 ? 5.225   -16.100 2.373   1.00 0.00 ? 105 GLN A HG2  6  
ATOM 10664 H HG3  . GLN A 1 105 ? 6.659   -16.107 1.345   1.00 0.00 ? 105 GLN A HG3  6  
ATOM 10665 H HE21 . GLN A 1 105 ? 5.989   -15.575 4.862   1.00 0.00 ? 105 GLN A HE21 6  
ATOM 10666 H HE22 . GLN A 1 105 ? 7.260   -16.565 5.397   1.00 0.00 ? 105 GLN A HE22 6  
ATOM 10667 N N    . PRO A 1 106 ? 3.451   -12.614 2.417   1.00 0.00 ? 106 PRO A N    6  
ATOM 10668 C CA   . PRO A 1 106 ? 2.653   -11.536 3.031   1.00 0.00 ? 106 PRO A CA   6  
ATOM 10669 C C    . PRO A 1 106 ? 3.250   -11.116 4.379   1.00 0.00 ? 106 PRO A C    6  
ATOM 10670 O O    . PRO A 1 106 ? 3.029   -10.017 4.849   1.00 0.00 ? 106 PRO A O    6  
ATOM 10671 C CB   . PRO A 1 106 ? 1.261   -12.150 3.237   1.00 0.00 ? 106 PRO A CB   6  
ATOM 10672 C CG   . PRO A 1 106 ? 1.327   -13.633 2.785   1.00 0.00 ? 106 PRO A CG   6  
ATOM 10673 C CD   . PRO A 1 106 ? 2.754   -13.906 2.289   1.00 0.00 ? 106 PRO A CD   6  
ATOM 10674 H HA   . PRO A 1 106 ? 2.585   -10.691 2.368   1.00 0.00 ? 106 PRO A HA   6  
ATOM 10675 H HB2  . PRO A 1 106 ? 0.988   -12.094 4.281   1.00 0.00 ? 106 PRO A HB2  6  
ATOM 10676 H HB3  . PRO A 1 106 ? 0.535   -11.622 2.637   1.00 0.00 ? 106 PRO A HB3  6  
ATOM 10677 H HG2  . PRO A 1 106 ? 1.094   -14.280 3.618   1.00 0.00 ? 106 PRO A HG2  6  
ATOM 10678 H HG3  . PRO A 1 106 ? 0.626   -13.802 1.981   1.00 0.00 ? 106 PRO A HG3  6  
ATOM 10679 H HD2  . PRO A 1 106 ? 3.228   -14.655 2.909   1.00 0.00 ? 106 PRO A HD2  6  
ATOM 10680 H HD3  . PRO A 1 106 ? 2.741   -14.221 1.258   1.00 0.00 ? 106 PRO A HD3  6  
ATOM 10681 N N    . GLY A 1 107 ? 3.989   -11.983 5.015   1.00 0.00 ? 107 GLY A N    6  
ATOM 10682 C CA   . GLY A 1 107 ? 4.576   -11.629 6.341   1.00 0.00 ? 107 GLY A CA   6  
ATOM 10683 C C    . GLY A 1 107 ? 5.945   -10.965 6.162   1.00 0.00 ? 107 GLY A C    6  
ATOM 10684 O O    . GLY A 1 107 ? 6.236   -9.951  6.765   1.00 0.00 ? 107 GLY A O    6  
ATOM 10685 H H    . GLY A 1 107 ? 4.148   -12.869 4.629   1.00 0.00 ? 107 GLY A H    6  
ATOM 10686 H HA2  . GLY A 1 107 ? 3.912   -10.947 6.853   1.00 0.00 ? 107 GLY A HA2  6  
ATOM 10687 H HA3  . GLY A 1 107 ? 4.693   -12.526 6.929   1.00 0.00 ? 107 GLY A HA3  6  
ATOM 10688 N N    . THR A 1 108 ? 6.794   -11.530 5.348   1.00 0.00 ? 108 THR A N    6  
ATOM 10689 C CA   . THR A 1 108 ? 8.146   -10.933 5.145   1.00 0.00 ? 108 THR A CA   6  
ATOM 10690 C C    . THR A 1 108 ? 8.017   -9.577  4.447   1.00 0.00 ? 108 THR A C    6  
ATOM 10691 O O    . THR A 1 108 ? 8.617   -8.601  4.851   1.00 0.00 ? 108 THR A O    6  
ATOM 10692 C CB   . THR A 1 108 ? 8.991   -11.876 4.285   1.00 0.00 ? 108 THR A CB   6  
ATOM 10693 O OG1  . THR A 1 108 ? 9.357   -13.013 5.055   1.00 0.00 ? 108 THR A OG1  6  
ATOM 10694 C CG2  . THR A 1 108 ? 10.252  -11.152 3.810   1.00 0.00 ? 108 THR A CG2  6  
ATOM 10695 H H    . THR A 1 108 ? 6.546   -12.351 4.874   1.00 0.00 ? 108 THR A H    6  
ATOM 10696 H HA   . THR A 1 108 ? 8.624   -10.797 6.104   1.00 0.00 ? 108 THR A HA   6  
ATOM 10697 H HB   . THR A 1 108 ? 8.418   -12.191 3.427   1.00 0.00 ? 108 THR A HB   6  
ATOM 10698 H HG1  . THR A 1 108 ? 10.046  -12.745 5.668   1.00 0.00 ? 108 THR A HG1  6  
ATOM 10699 H HG21 . THR A 1 108 ? 10.612  -10.505 4.596   1.00 0.00 ? 108 THR A HG21 6  
ATOM 10700 H HG22 . THR A 1 108 ? 11.013  -11.878 3.565   1.00 0.00 ? 108 THR A HG22 6  
ATOM 10701 H HG23 . THR A 1 108 ? 10.021  -10.563 2.935   1.00 0.00 ? 108 THR A HG23 6  
ATOM 10702 N N    . ALA A 1 109 ? 7.245   -9.510  3.399   1.00 0.00 ? 109 ALA A N    6  
ATOM 10703 C CA   . ALA A 1 109 ? 7.083   -8.218  2.671   1.00 0.00 ? 109 ALA A CA   6  
ATOM 10704 C C    . ALA A 1 109 ? 6.427   -7.179  3.586   1.00 0.00 ? 109 ALA A C    6  
ATOM 10705 O O    . ALA A 1 109 ? 6.391   -6.004  3.278   1.00 0.00 ? 109 ALA A O    6  
ATOM 10706 C CB   . ALA A 1 109 ? 6.207   -8.437  1.436   1.00 0.00 ? 109 ALA A CB   6  
ATOM 10707 H H    . ALA A 1 109 ? 6.773   -10.310 3.088   1.00 0.00 ? 109 ALA A H    6  
ATOM 10708 H HA   . ALA A 1 109 ? 8.053   -7.859  2.361   1.00 0.00 ? 109 ALA A HA   6  
ATOM 10709 H HB1  . ALA A 1 109 ? 5.374   -9.076  1.691   1.00 0.00 ? 109 ALA A HB1  6  
ATOM 10710 H HB2  . ALA A 1 109 ? 5.834   -7.485  1.085   1.00 0.00 ? 109 ALA A HB2  6  
ATOM 10711 H HB3  . ALA A 1 109 ? 6.791   -8.902  0.656   1.00 0.00 ? 109 ALA A HB3  6  
ATOM 10712 N N    . ALA A 1 110 ? 5.901   -7.599  4.706   1.00 0.00 ? 110 ALA A N    6  
ATOM 10713 C CA   . ALA A 1 110 ? 5.243   -6.630  5.630   1.00 0.00 ? 110 ALA A CA   6  
ATOM 10714 C C    . ALA A 1 110 ? 6.266   -6.088  6.634   1.00 0.00 ? 110 ALA A C    6  
ATOM 10715 O O    . ALA A 1 110 ? 6.123   -4.997  7.151   1.00 0.00 ? 110 ALA A O    6  
ATOM 10716 C CB   . ALA A 1 110 ? 4.111   -7.330  6.382   1.00 0.00 ? 110 ALA A CB   6  
ATOM 10717 H H    . ALA A 1 110 ? 5.934   -8.551  4.938   1.00 0.00 ? 110 ALA A H    6  
ATOM 10718 H HA   . ALA A 1 110 ? 4.837   -5.809  5.056   1.00 0.00 ? 110 ALA A HA   6  
ATOM 10719 H HB1  . ALA A 1 110 ? 3.787   -8.195  5.821   1.00 0.00 ? 110 ALA A HB1  6  
ATOM 10720 H HB2  . ALA A 1 110 ? 4.462   -7.643  7.354   1.00 0.00 ? 110 ALA A HB2  6  
ATOM 10721 H HB3  . ALA A 1 110 ? 3.282   -6.648  6.502   1.00 0.00 ? 110 ALA A HB3  6  
ATOM 10722 N N    . ASN A 1 111 ? 7.294   -6.839  6.919   1.00 0.00 ? 111 ASN A N    6  
ATOM 10723 C CA   . ASN A 1 111 ? 8.317   -6.362  7.894   1.00 0.00 ? 111 ASN A CA   6  
ATOM 10724 C C    . ASN A 1 111 ? 9.326   -5.459  7.179   1.00 0.00 ? 111 ASN A C    6  
ATOM 10725 O O    . ASN A 1 111 ? 9.725   -4.431  7.691   1.00 0.00 ? 111 ASN A O    6  
ATOM 10726 C CB   . ASN A 1 111 ? 9.048   -7.563  8.496   1.00 0.00 ? 111 ASN A CB   6  
ATOM 10727 C CG   . ASN A 1 111 ? 8.305   -8.042  9.745   1.00 0.00 ? 111 ASN A CG   6  
ATOM 10728 O OD1  . ASN A 1 111 ? 8.835   -7.994  10.837  1.00 0.00 ? 111 ASN A OD1  6  
ATOM 10729 N ND2  . ASN A 1 111 ? 7.090   -8.505  9.629   1.00 0.00 ? 111 ASN A ND2  6  
ATOM 10730 H H    . ASN A 1 111 ? 7.394   -7.717  6.496   1.00 0.00 ? 111 ASN A H    6  
ATOM 10731 H HA   . ASN A 1 111 ? 7.831   -5.806  8.682   1.00 0.00 ? 111 ASN A HA   6  
ATOM 10732 H HB2  . ASN A 1 111 ? 9.083   -8.363  7.769   1.00 0.00 ? 111 ASN A HB2  6  
ATOM 10733 H HB3  . ASN A 1 111 ? 10.052  -7.276  8.765   1.00 0.00 ? 111 ASN A HB3  6  
ATOM 10734 H HD21 . ASN A 1 111 ? 6.663   -8.545  8.749   1.00 0.00 ? 111 ASN A HD21 6  
ATOM 10735 H HD22 . ASN A 1 111 ? 6.606   -8.812  10.424  1.00 0.00 ? 111 ASN A HD22 6  
ATOM 10736 N N    . VAL A 1 112 ? 9.744   -5.838  6.003   1.00 0.00 ? 112 VAL A N    6  
ATOM 10737 C CA   . VAL A 1 112 ? 10.730  -5.007  5.256   1.00 0.00 ? 112 VAL A CA   6  
ATOM 10738 C C    . VAL A 1 112 ? 10.091  -3.681  4.841   1.00 0.00 ? 112 VAL A C    6  
ATOM 10739 O O    . VAL A 1 112 ? 10.732  -2.650  4.837   1.00 0.00 ? 112 VAL A O    6  
ATOM 10740 C CB   . VAL A 1 112 ? 11.187  -5.755  4.015   1.00 0.00 ? 112 VAL A CB   6  
ATOM 10741 C CG1  . VAL A 1 112 ? 12.519  -5.180  3.533   1.00 0.00 ? 112 VAL A CG1  6  
ATOM 10742 C CG2  . VAL A 1 112 ? 11.358  -7.240  4.344   1.00 0.00 ? 112 VAL A CG2  6  
ATOM 10743 H H    . VAL A 1 112 ? 9.410   -6.673  5.612   1.00 0.00 ? 112 VAL A H    6  
ATOM 10744 H HA   . VAL A 1 112 ? 11.578  -4.815  5.875   1.00 0.00 ? 112 VAL A HA   6  
ATOM 10745 H HB   . VAL A 1 112 ? 10.450  -5.635  3.251   1.00 0.00 ? 112 VAL A HB   6  
ATOM 10746 H HG11 . VAL A 1 112 ? 13.175  -5.034  4.378   1.00 0.00 ? 112 VAL A HG11 6  
ATOM 10747 H HG12 . VAL A 1 112 ? 12.976  -5.867  2.836   1.00 0.00 ? 112 VAL A HG12 6  
ATOM 10748 H HG13 . VAL A 1 112 ? 12.346  -4.233  3.044   1.00 0.00 ? 112 VAL A HG13 6  
ATOM 10749 H HG21 . VAL A 1 112 ? 11.164  -7.400  5.395   1.00 0.00 ? 112 VAL A HG21 6  
ATOM 10750 H HG22 . VAL A 1 112 ? 10.661  -7.820  3.757   1.00 0.00 ? 112 VAL A HG22 6  
ATOM 10751 H HG23 . VAL A 1 112 ? 12.367  -7.546  4.113   1.00 0.00 ? 112 VAL A HG23 6  
ATOM 10752 N N    . VAL A 1 113 ? 8.836   -3.698  4.484   1.00 0.00 ? 113 VAL A N    6  
ATOM 10753 C CA   . VAL A 1 113 ? 8.164   -2.434  4.065   1.00 0.00 ? 113 VAL A CA   6  
ATOM 10754 C C    . VAL A 1 113 ? 7.840   -1.591  5.301   1.00 0.00 ? 113 VAL A C    6  
ATOM 10755 O O    . VAL A 1 113 ? 7.750   -0.382  5.231   1.00 0.00 ? 113 VAL A O    6  
ATOM 10756 C CB   . VAL A 1 113 ? 6.867   -2.767  3.322   1.00 0.00 ? 113 VAL A CB   6  
ATOM 10757 C CG1  . VAL A 1 113 ? 6.142   -1.470  2.953   1.00 0.00 ? 113 VAL A CG1  6  
ATOM 10758 C CG2  . VAL A 1 113 ? 7.196   -3.547  2.047   1.00 0.00 ? 113 VAL A CG2  6  
ATOM 10759 H H    . VAL A 1 113 ? 8.334   -4.542  4.490   1.00 0.00 ? 113 VAL A H    6  
ATOM 10760 H HA   . VAL A 1 113 ? 8.820   -1.879  3.413   1.00 0.00 ? 113 VAL A HA   6  
ATOM 10761 H HB   . VAL A 1 113 ? 6.232   -3.364  3.959   1.00 0.00 ? 113 VAL A HB   6  
ATOM 10762 H HG11 . VAL A 1 113 ? 6.863   -0.732  2.630   1.00 0.00 ? 113 VAL A HG11 6  
ATOM 10763 H HG12 . VAL A 1 113 ? 5.443   -1.665  2.153   1.00 0.00 ? 113 VAL A HG12 6  
ATOM 10764 H HG13 . VAL A 1 113 ? 5.609   -1.100  3.815   1.00 0.00 ? 113 VAL A HG13 6  
ATOM 10765 H HG21 . VAL A 1 113 ? 7.900   -4.333  2.276   1.00 0.00 ? 113 VAL A HG21 6  
ATOM 10766 H HG22 . VAL A 1 113 ? 6.290   -3.980  1.647   1.00 0.00 ? 113 VAL A HG22 6  
ATOM 10767 H HG23 . VAL A 1 113 ? 7.627   -2.879  1.316   1.00 0.00 ? 113 VAL A HG23 6  
ATOM 10768 N N    . GLU A 1 114 ? 7.663   -2.218  6.433   1.00 0.00 ? 114 GLU A N    6  
ATOM 10769 C CA   . GLU A 1 114 ? 7.342   -1.449  7.669   1.00 0.00 ? 114 GLU A CA   6  
ATOM 10770 C C    . GLU A 1 114 ? 8.478   -0.472  7.983   1.00 0.00 ? 114 GLU A C    6  
ATOM 10771 O O    . GLU A 1 114 ? 8.253   0.704   8.198   1.00 0.00 ? 114 GLU A O    6  
ATOM 10772 C CB   . GLU A 1 114 ? 7.165   -2.417  8.841   1.00 0.00 ? 114 GLU A CB   6  
ATOM 10773 C CG   . GLU A 1 114 ? 5.988   -1.959  9.705   1.00 0.00 ? 114 GLU A CG   6  
ATOM 10774 C CD   . GLU A 1 114 ? 6.110   -2.561  11.106  1.00 0.00 ? 114 GLU A CD   6  
ATOM 10775 O OE1  . GLU A 1 114 ? 6.397   -3.742  11.199  1.00 0.00 ? 114 GLU A OE1  6  
ATOM 10776 O OE2  . GLU A 1 114 ? 5.914   -1.828  12.062  1.00 0.00 ? 114 GLU A OE2  6  
ATOM 10777 H H    . GLU A 1 114 ? 7.737   -3.195  6.468   1.00 0.00 ? 114 GLU A H    6  
ATOM 10778 H HA   . GLU A 1 114 ? 6.426   -0.897  7.519   1.00 0.00 ? 114 GLU A HA   6  
ATOM 10779 H HB2  . GLU A 1 114 ? 6.969   -3.411  8.462   1.00 0.00 ? 114 GLU A HB2  6  
ATOM 10780 H HB3  . GLU A 1 114 ? 8.064   -2.429  9.437   1.00 0.00 ? 114 GLU A HB3  6  
ATOM 10781 H HG2  . GLU A 1 114 ? 5.992   -0.881  9.774   1.00 0.00 ? 114 GLU A HG2  6  
ATOM 10782 H HG3  . GLU A 1 114 ? 5.063   -2.286  9.255   1.00 0.00 ? 114 GLU A HG3  6  
ATOM 10783 N N    . LYS A 1 115 ? 9.696   -0.944  8.015   1.00 0.00 ? 115 LYS A N    6  
ATOM 10784 C CA   . LYS A 1 115 ? 10.839  -0.038  8.321   1.00 0.00 ? 115 LYS A CA   6  
ATOM 10785 C C    . LYS A 1 115 ? 11.008  0.978   7.188   1.00 0.00 ? 115 LYS A C    6  
ATOM 10786 O O    . LYS A 1 115 ? 11.360  2.118   7.416   1.00 0.00 ? 115 LYS A O    6  
ATOM 10787 C CB   . LYS A 1 115 ? 12.121  -0.860  8.471   1.00 0.00 ? 115 LYS A CB   6  
ATOM 10788 C CG   . LYS A 1 115 ? 12.562  -1.374  7.101   1.00 0.00 ? 115 LYS A CG   6  
ATOM 10789 C CD   . LYS A 1 115 ? 13.775  -2.288  7.269   1.00 0.00 ? 115 LYS A CD   6  
ATOM 10790 C CE   . LYS A 1 115 ? 14.839  -1.572  8.103   1.00 0.00 ? 115 LYS A CE   6  
ATOM 10791 N NZ   . LYS A 1 115 ? 15.253  -0.320  7.407   1.00 0.00 ? 115 LYS A NZ   6  
ATOM 10792 H H    . LYS A 1 115 ? 9.858   -1.895  7.841   1.00 0.00 ? 115 LYS A H    6  
ATOM 10793 H HA   . LYS A 1 115 ? 10.642  0.487   9.245   1.00 0.00 ? 115 LYS A HA   6  
ATOM 10794 H HB2  . LYS A 1 115 ? 12.900  -0.240  8.890   1.00 0.00 ? 115 LYS A HB2  6  
ATOM 10795 H HB3  . LYS A 1 115 ? 11.937  -1.699  9.125   1.00 0.00 ? 115 LYS A HB3  6  
ATOM 10796 H HG2  . LYS A 1 115 ? 11.753  -1.927  6.647   1.00 0.00 ? 115 LYS A HG2  6  
ATOM 10797 H HG3  . LYS A 1 115 ? 12.828  -0.539  6.471   1.00 0.00 ? 115 LYS A HG3  6  
ATOM 10798 H HD2  . LYS A 1 115 ? 13.474  -3.196  7.771   1.00 0.00 ? 115 LYS A HD2  6  
ATOM 10799 H HD3  . LYS A 1 115 ? 14.183  -2.529  6.300   1.00 0.00 ? 115 LYS A HD3  6  
ATOM 10800 H HE2  . LYS A 1 115 ? 14.432  -1.327  9.072   1.00 0.00 ? 115 LYS A HE2  6  
ATOM 10801 H HE3  . LYS A 1 115 ? 15.696  -2.217  8.225   1.00 0.00 ? 115 LYS A HE3  6  
ATOM 10802 H HZ1  . LYS A 1 115 ? 14.761  -0.254  6.492   1.00 0.00 ? 115 LYS A HZ1  6  
ATOM 10803 H HZ2  . LYS A 1 115 ? 15.005  0.501   7.994   1.00 0.00 ? 115 LYS A HZ2  6  
ATOM 10804 H HZ3  . LYS A 1 115 ? 16.280  -0.334  7.250   1.00 0.00 ? 115 LYS A HZ3  6  
ATOM 10805 N N    . LEU A 1 116 ? 10.755  0.577   5.971   1.00 0.00 ? 116 LEU A N    6  
ATOM 10806 C CA   . LEU A 1 116 ? 10.899  1.529   4.830   1.00 0.00 ? 116 LEU A CA   6  
ATOM 10807 C C    . LEU A 1 116 ? 10.272  2.868   5.216   1.00 0.00 ? 116 LEU A C    6  
ATOM 10808 O O    . LEU A 1 116 ? 10.819  3.922   4.951   1.00 0.00 ? 116 LEU A O    6  
ATOM 10809 C CB   . LEU A 1 116 ? 10.182  0.965   3.599   1.00 0.00 ? 116 LEU A CB   6  
ATOM 10810 C CG   . LEU A 1 116 ? 11.024  1.224   2.348   1.00 0.00 ? 116 LEU A CG   6  
ATOM 10811 C CD1  . LEU A 1 116 ? 11.099  2.728   2.082   1.00 0.00 ? 116 LEU A CD1  6  
ATOM 10812 C CD2  . LEU A 1 116 ? 12.436  0.675   2.560   1.00 0.00 ? 116 LEU A CD2  6  
ATOM 10813 H H    . LEU A 1 116 ? 10.470  -0.346  5.807   1.00 0.00 ? 116 LEU A H    6  
ATOM 10814 H HA   . LEU A 1 116 ? 11.946  1.671   4.607   1.00 0.00 ? 116 LEU A HA   6  
ATOM 10815 H HB2  . LEU A 1 116 ? 10.037  -0.098  3.724   1.00 0.00 ? 116 LEU A HB2  6  
ATOM 10816 H HB3  . LEU A 1 116 ? 9.222   1.448   3.491   1.00 0.00 ? 116 LEU A HB3  6  
ATOM 10817 H HG   . LEU A 1 116 ? 10.568  0.731   1.501   1.00 0.00 ? 116 LEU A HG   6  
ATOM 10818 H HD11 . LEU A 1 116 ? 10.221  3.210   2.485   1.00 0.00 ? 116 LEU A HD11 6  
ATOM 10819 H HD12 . LEU A 1 116 ? 11.981  3.134   2.555   1.00 0.00 ? 116 LEU A HD12 6  
ATOM 10820 H HD13 . LEU A 1 116 ? 11.149  2.903   1.017   1.00 0.00 ? 116 LEU A HD13 6  
ATOM 10821 H HD21 . LEU A 1 116 ? 12.469  0.116   3.483   1.00 0.00 ? 116 LEU A HD21 6  
ATOM 10822 H HD22 . LEU A 1 116 ? 12.699  0.028   1.736   1.00 0.00 ? 116 LEU A HD22 6  
ATOM 10823 H HD23 . LEU A 1 116 ? 13.137  1.496   2.611   1.00 0.00 ? 116 LEU A HD23 6  
ATOM 10824 N N    . ALA A 1 117 ? 9.131   2.837   5.851   1.00 0.00 ? 117 ALA A N    6  
ATOM 10825 C CA   . ALA A 1 117 ? 8.472   4.107   6.263   1.00 0.00 ? 117 ALA A CA   6  
ATOM 10826 C C    . ALA A 1 117 ? 9.204   4.677   7.479   1.00 0.00 ? 117 ALA A C    6  
ATOM 10827 O O    . ALA A 1 117 ? 9.366   5.871   7.614   1.00 0.00 ? 117 ALA A O    6  
ATOM 10828 C CB   . ALA A 1 117 ? 7.012   3.833   6.630   1.00 0.00 ? 117 ALA A CB   6  
ATOM 10829 H H    . ALA A 1 117 ? 8.711   1.978   6.061   1.00 0.00 ? 117 ALA A H    6  
ATOM 10830 H HA   . ALA A 1 117 ? 8.514   4.818   5.451   1.00 0.00 ? 117 ALA A HA   6  
ATOM 10831 H HB1  . ALA A 1 117 ? 6.918   2.822   7.000   1.00 0.00 ? 117 ALA A HB1  6  
ATOM 10832 H HB2  . ALA A 1 117 ? 6.695   4.528   7.393   1.00 0.00 ? 117 ALA A HB2  6  
ATOM 10833 H HB3  . ALA A 1 117 ? 6.393   3.954   5.754   1.00 0.00 ? 117 ALA A HB3  6  
ATOM 10834 N N    . ASP A 1 118 ? 9.647   3.827   8.366   1.00 0.00 ? 118 ASP A N    6  
ATOM 10835 C CA   . ASP A 1 118 ? 10.370  4.319   9.573   1.00 0.00 ? 118 ASP A CA   6  
ATOM 10836 C C    . ASP A 1 118 ? 11.429  5.335   9.145   1.00 0.00 ? 118 ASP A C    6  
ATOM 10837 O O    . ASP A 1 118 ? 11.821  6.197   9.905   1.00 0.00 ? 118 ASP A O    6  
ATOM 10838 C CB   . ASP A 1 118 ? 11.051  3.141   10.275  1.00 0.00 ? 118 ASP A CB   6  
ATOM 10839 C CG   . ASP A 1 118 ? 10.180  2.665   11.440  1.00 0.00 ? 118 ASP A CG   6  
ATOM 10840 O OD1  . ASP A 1 118 ? 9.492   3.490   12.016  1.00 0.00 ? 118 ASP A OD1  6  
ATOM 10841 O OD2  . ASP A 1 118 ? 10.219  1.482   11.735  1.00 0.00 ? 118 ASP A OD2  6  
ATOM 10842 H H    . ASP A 1 118 ? 9.505   2.866   8.238   1.00 0.00 ? 118 ASP A H    6  
ATOM 10843 H HA   . ASP A 1 118 ? 9.671   4.788   10.249  1.00 0.00 ? 118 ASP A HA   6  
ATOM 10844 H HB2  . ASP A 1 118 ? 11.188  2.333   9.571   1.00 0.00 ? 118 ASP A HB2  6  
ATOM 10845 H HB3  . ASP A 1 118 ? 12.012  3.456   10.653  1.00 0.00 ? 118 ASP A HB3  6  
ATOM 10846 N N    . TYR A 1 119 ? 11.893  5.238   7.930   1.00 0.00 ? 119 TYR A N    6  
ATOM 10847 C CA   . TYR A 1 119 ? 12.924  6.195   7.444   1.00 0.00 ? 119 TYR A CA   6  
ATOM 10848 C C    . TYR A 1 119 ? 12.239  7.472   6.956   1.00 0.00 ? 119 TYR A C    6  
ATOM 10849 O O    . TYR A 1 119 ? 12.656  8.572   7.265   1.00 0.00 ? 119 TYR A O    6  
ATOM 10850 C CB   . TYR A 1 119 ? 13.699  5.560   6.286   1.00 0.00 ? 119 TYR A CB   6  
ATOM 10851 C CG   . TYR A 1 119 ? 14.995  4.984   6.799   1.00 0.00 ? 119 TYR A CG   6  
ATOM 10852 C CD1  . TYR A 1 119 ? 15.018  4.285   8.011   1.00 0.00 ? 119 TYR A CD1  6  
ATOM 10853 C CD2  . TYR A 1 119 ? 16.174  5.146   6.061   1.00 0.00 ? 119 TYR A CD2  6  
ATOM 10854 C CE1  . TYR A 1 119 ? 16.221  3.750   8.487   1.00 0.00 ? 119 TYR A CE1  6  
ATOM 10855 C CE2  . TYR A 1 119 ? 17.376  4.610   6.536   1.00 0.00 ? 119 TYR A CE2  6  
ATOM 10856 C CZ   . TYR A 1 119 ? 17.400  3.911   7.749   1.00 0.00 ? 119 TYR A CZ   6  
ATOM 10857 O OH   . TYR A 1 119 ? 18.586  3.383   8.219   1.00 0.00 ? 119 TYR A OH   6  
ATOM 10858 H H    . TYR A 1 119 ? 11.560  4.533   7.335   1.00 0.00 ? 119 TYR A H    6  
ATOM 10859 H HA   . TYR A 1 119 ? 13.606  6.434   8.247   1.00 0.00 ? 119 TYR A HA   6  
ATOM 10860 H HB2  . TYR A 1 119 ? 13.105  4.773   5.845   1.00 0.00 ? 119 TYR A HB2  6  
ATOM 10861 H HB3  . TYR A 1 119 ? 13.910  6.311   5.539   1.00 0.00 ? 119 TYR A HB3  6  
ATOM 10862 H HD1  . TYR A 1 119 ? 14.109  4.160   8.580   1.00 0.00 ? 119 TYR A HD1  6  
ATOM 10863 H HD2  . TYR A 1 119 ? 16.155  5.684   5.125   1.00 0.00 ? 119 TYR A HD2  6  
ATOM 10864 H HE1  . TYR A 1 119 ? 16.239  3.210   9.423   1.00 0.00 ? 119 TYR A HE1  6  
ATOM 10865 H HE2  . TYR A 1 119 ? 18.285  4.735   5.966   1.00 0.00 ? 119 TYR A HE2  6  
ATOM 10866 H HH   . TYR A 1 119 ? 19.227  3.416   7.506   1.00 0.00 ? 119 TYR A HH   6  
ATOM 10867 N N    . LEU A 1 120 ? 11.193  7.336   6.188   1.00 0.00 ? 120 LEU A N    6  
ATOM 10868 C CA   . LEU A 1 120 ? 10.482  8.532   5.671   1.00 0.00 ? 120 LEU A CA   6  
ATOM 10869 C C    . LEU A 1 120 ? 9.416   8.977   6.675   1.00 0.00 ? 120 LEU A C    6  
ATOM 10870 O O    . LEU A 1 120 ? 8.581   9.809   6.379   1.00 0.00 ? 120 LEU A O    6  
ATOM 10871 C CB   . LEU A 1 120 ? 9.812   8.163   4.352   1.00 0.00 ? 120 LEU A CB   6  
ATOM 10872 C CG   . LEU A 1 120 ? 10.834  8.245   3.220   1.00 0.00 ? 120 LEU A CG   6  
ATOM 10873 C CD1  . LEU A 1 120 ? 10.873  6.913   2.472   1.00 0.00 ? 120 LEU A CD1  6  
ATOM 10874 C CD2  . LEU A 1 120 ? 10.435  9.360   2.252   1.00 0.00 ? 120 LEU A CD2  6  
ATOM 10875 H H    . LEU A 1 120 ? 10.876  6.441   5.945   1.00 0.00 ? 120 LEU A H    6  
ATOM 10876 H HA   . LEU A 1 120 ? 11.188  9.333   5.508   1.00 0.00 ? 120 LEU A HA   6  
ATOM 10877 H HB2  . LEU A 1 120 ? 9.428   7.155   4.419   1.00 0.00 ? 120 LEU A HB2  6  
ATOM 10878 H HB3  . LEU A 1 120 ? 9.002   8.847   4.158   1.00 0.00 ? 120 LEU A HB3  6  
ATOM 10879 H HG   . LEU A 1 120 ? 11.811  8.455   3.631   1.00 0.00 ? 120 LEU A HG   6  
ATOM 10880 H HD11 . LEU A 1 120 ? 10.576  6.118   3.140   1.00 0.00 ? 120 LEU A HD11 6  
ATOM 10881 H HD12 . LEU A 1 120 ? 10.194  6.950   1.634   1.00 0.00 ? 120 LEU A HD12 6  
ATOM 10882 H HD13 . LEU A 1 120 ? 11.876  6.728   2.117   1.00 0.00 ? 120 LEU A HD13 6  
ATOM 10883 H HD21 . LEU A 1 120 ? 9.623   9.933   2.676   1.00 0.00 ? 120 LEU A HD21 6  
ATOM 10884 H HD22 . LEU A 1 120 ? 11.282  10.008  2.081   1.00 0.00 ? 120 LEU A HD22 6  
ATOM 10885 H HD23 . LEU A 1 120 ? 10.119  8.927   1.314   1.00 0.00 ? 120 LEU A HD23 6  
ATOM 10886 N N    . ILE A 1 121 ? 9.435   8.431   7.860   1.00 0.00 ? 121 ILE A N    6  
ATOM 10887 C CA   . ILE A 1 121 ? 8.420   8.823   8.878   1.00 0.00 ? 121 ILE A CA   6  
ATOM 10888 C C    . ILE A 1 121 ? 8.959   10.001  9.700   1.00 0.00 ? 121 ILE A C    6  
ATOM 10889 O O    . ILE A 1 121 ? 8.210   10.748  10.297  1.00 0.00 ? 121 ILE A O    6  
ATOM 10890 C CB   . ILE A 1 121 ? 8.113   7.610   9.782   1.00 0.00 ? 121 ILE A CB   6  
ATOM 10891 C CG1  . ILE A 1 121 ? 6.858   6.904   9.257   1.00 0.00 ? 121 ILE A CG1  6  
ATOM 10892 C CG2  . ILE A 1 121 ? 7.871   8.051   11.232  1.00 0.00 ? 121 ILE A CG2  6  
ATOM 10893 C CD1  . ILE A 1 121 ? 6.895   5.426   9.653   1.00 0.00 ? 121 ILE A CD1  6  
ATOM 10894 H H    . ILE A 1 121 ? 10.116  7.762   8.079   1.00 0.00 ? 121 ILE A H    6  
ATOM 10895 H HA   . ILE A 1 121 ? 7.513   9.129   8.373   1.00 0.00 ? 121 ILE A HA   6  
ATOM 10896 H HB   . ILE A 1 121 ? 8.947   6.924   9.753   1.00 0.00 ? 121 ILE A HB   6  
ATOM 10897 H HG12 . ILE A 1 121 ? 5.980   7.367   9.682   1.00 0.00 ? 121 ILE A HG12 6  
ATOM 10898 H HG13 . ILE A 1 121 ? 6.823   6.984   8.182   1.00 0.00 ? 121 ILE A HG13 6  
ATOM 10899 H HG21 . ILE A 1 121 ? 7.326   8.984   11.239  1.00 0.00 ? 121 ILE A HG21 6  
ATOM 10900 H HG22 . ILE A 1 121 ? 7.298   7.296   11.749  1.00 0.00 ? 121 ILE A HG22 6  
ATOM 10901 H HG23 . ILE A 1 121 ? 8.820   8.187   11.730  1.00 0.00 ? 121 ILE A HG23 6  
ATOM 10902 H HD11 . ILE A 1 121 ? 7.831   4.992   9.337   1.00 0.00 ? 121 ILE A HD11 6  
ATOM 10903 H HD12 . ILE A 1 121 ? 6.802   5.337   10.725  1.00 0.00 ? 121 ILE A HD12 6  
ATOM 10904 H HD13 . ILE A 1 121 ? 6.077   4.905   9.176   1.00 0.00 ? 121 ILE A HD13 6  
ATOM 10905 N N    . GLY A 1 122 ? 10.252  10.171  9.738   1.00 0.00 ? 122 GLY A N    6  
ATOM 10906 C CA   . GLY A 1 122 ? 10.833  11.297  10.524  1.00 0.00 ? 122 GLY A CA   6  
ATOM 10907 C C    . GLY A 1 122 ? 10.547  12.623  9.815   1.00 0.00 ? 122 GLY A C    6  
ATOM 10908 O O    . GLY A 1 122 ? 10.143  13.591  10.430  1.00 0.00 ? 122 GLY A O    6  
ATOM 10909 H H    . GLY A 1 122 ? 10.842  9.557   9.252   1.00 0.00 ? 122 GLY A H    6  
ATOM 10910 H HA2  . GLY A 1 122 ? 10.391  11.312  11.510  1.00 0.00 ? 122 GLY A HA2  6  
ATOM 10911 H HA3  . GLY A 1 122 ? 11.900  11.162  10.612  1.00 0.00 ? 122 GLY A HA3  6  
ATOM 10912 N N    . GLN A 1 123 ? 10.757  12.679  8.528   1.00 0.00 ? 123 GLN A N    6  
ATOM 10913 C CA   . GLN A 1 123 ? 10.500  13.945  7.783   1.00 0.00 ? 123 GLN A CA   6  
ATOM 10914 C C    . GLN A 1 123 ? 9.016   14.027  7.415   1.00 0.00 ? 123 GLN A C    6  
ATOM 10915 O O    . GLN A 1 123 ? 8.452   15.097  7.298   1.00 0.00 ? 123 GLN A O    6  
ATOM 10916 C CB   . GLN A 1 123 ? 11.347  13.970  6.508   1.00 0.00 ? 123 GLN A CB   6  
ATOM 10917 C CG   . GLN A 1 123 ? 12.822  13.783  6.872   1.00 0.00 ? 123 GLN A CG   6  
ATOM 10918 C CD   . GLN A 1 123 ? 13.587  15.081  6.597   1.00 0.00 ? 123 GLN A CD   6  
ATOM 10919 O OE1  . GLN A 1 123 ? 13.644  15.539  5.473   1.00 0.00 ? 123 GLN A OE1  6  
ATOM 10920 N NE2  . GLN A 1 123 ? 14.186  15.693  7.582   1.00 0.00 ? 123 GLN A NE2  6  
ATOM 10921 H H    . GLN A 1 123 ? 11.085  11.889  8.050   1.00 0.00 ? 123 GLN A H    6  
ATOM 10922 H HA   . GLN A 1 123 ? 10.762  14.789  8.405   1.00 0.00 ? 123 GLN A HA   6  
ATOM 10923 H HB2  . GLN A 1 123 ? 11.034  13.170  5.853   1.00 0.00 ? 123 GLN A HB2  6  
ATOM 10924 H HB3  . GLN A 1 123 ? 11.218  14.918  6.007   1.00 0.00 ? 123 GLN A HB3  6  
ATOM 10925 H HG2  . GLN A 1 123 ? 12.905  13.531  7.918   1.00 0.00 ? 123 GLN A HG2  6  
ATOM 10926 H HG3  . GLN A 1 123 ? 13.242  12.988  6.274   1.00 0.00 ? 123 GLN A HG3  6  
ATOM 10927 H HE21 . GLN A 1 123 ? 14.144  15.324  8.488   1.00 0.00 ? 123 GLN A HE21 6  
ATOM 10928 H HE22 . GLN A 1 123 ? 14.678  16.525  7.413   1.00 0.00 ? 123 GLN A HE22 6  
ATOM 10929 N N    . GLY A 1 124 ? 8.376   12.902  7.239   1.00 0.00 ? 124 GLY A N    6  
ATOM 10930 C CA   . GLY A 1 124 ? 6.929   12.914  6.884   1.00 0.00 ? 124 GLY A CA   6  
ATOM 10931 C C    . GLY A 1 124 ? 6.766   13.162  5.382   1.00 0.00 ? 124 GLY A C    6  
ATOM 10932 O O    . GLY A 1 124 ? 5.990   13.997  4.963   1.00 0.00 ? 124 GLY A O    6  
ATOM 10933 H H    . GLY A 1 124 ? 8.849   12.050  7.343   1.00 0.00 ? 124 GLY A H    6  
ATOM 10934 H HA2  . GLY A 1 124 ? 6.489   11.960  7.143   1.00 0.00 ? 124 GLY A HA2  6  
ATOM 10935 H HA3  . GLY A 1 124 ? 6.431   13.700  7.432   1.00 0.00 ? 124 GLY A HA3  6  
ATOM 10936 N N    . PHE A 1 125 ? 7.489   12.437  4.571   1.00 0.00 ? 125 PHE A N    6  
ATOM 10937 C CA   . PHE A 1 125 ? 7.379   12.623  3.094   1.00 0.00 ? 125 PHE A CA   6  
ATOM 10938 C C    . PHE A 1 125 ? 7.294   14.116  2.762   1.00 0.00 ? 125 PHE A C    6  
ATOM 10939 O O    . PHE A 1 125 ? 6.308   14.514  2.163   1.00 0.00 ? 125 PHE A O    6  
ATOM 10940 C CB   . PHE A 1 125 ? 6.122   11.917  2.580   1.00 0.00 ? 125 PHE A CB   6  
ATOM 10941 C CG   . PHE A 1 125 ? 6.442   10.472  2.280   1.00 0.00 ? 125 PHE A CG   6  
ATOM 10942 C CD1  . PHE A 1 125 ? 6.709   9.583   3.329   1.00 0.00 ? 125 PHE A CD1  6  
ATOM 10943 C CD2  . PHE A 1 125 ? 6.464   10.017  0.955   1.00 0.00 ? 125 PHE A CD2  6  
ATOM 10944 C CE1  . PHE A 1 125 ? 7.000   8.241   3.053   1.00 0.00 ? 125 PHE A CE1  6  
ATOM 10945 C CE2  . PHE A 1 125 ? 6.753   8.676   0.681   1.00 0.00 ? 125 PHE A CE2  6  
ATOM 10946 C CZ   . PHE A 1 125 ? 7.021   7.788   1.729   1.00 0.00 ? 125 PHE A CZ   6  
ATOM 10947 O OXT  . PHE A 1 125 ? 8.215   14.835  3.112   1.00 0.00 ? 125 PHE A OXT  6  
ATOM 10948 H H    . PHE A 1 125 ? 8.105   11.768  4.933   1.00 0.00 ? 125 PHE A H    6  
ATOM 10949 H HA   . PHE A 1 125 ? 8.248   12.200  2.614   1.00 0.00 ? 125 PHE A HA   6  
ATOM 10950 H HB2  . PHE A 1 125 ? 5.343   11.967  3.330   1.00 0.00 ? 125 PHE A HB2  6  
ATOM 10951 H HB3  . PHE A 1 125 ? 5.782   12.403  1.677   1.00 0.00 ? 125 PHE A HB3  6  
ATOM 10952 H HD1  . PHE A 1 125 ? 6.693   9.934   4.351   1.00 0.00 ? 125 PHE A HD1  6  
ATOM 10953 H HD2  . PHE A 1 125 ? 6.259   10.703  0.146   1.00 0.00 ? 125 PHE A HD2  6  
ATOM 10954 H HE1  . PHE A 1 125 ? 7.205   7.557   3.862   1.00 0.00 ? 125 PHE A HE1  6  
ATOM 10955 H HE2  . PHE A 1 125 ? 6.771   8.326   -0.342  1.00 0.00 ? 125 PHE A HE2  6  
ATOM 10956 H HZ   . PHE A 1 125 ? 7.243   6.752   1.516   1.00 0.00 ? 125 PHE A HZ   6  
ATOM 10957 N N    . SER A 1 1   ? 5.940   2.466   -6.788  1.00 0.00 ? 1   SER A N    7  
ATOM 10958 C CA   . SER A 1 1   ? 6.462   2.155   -5.422  1.00 0.00 ? 1   SER A CA   7  
ATOM 10959 C C    . SER A 1 1   ? 7.133   3.399   -4.811  1.00 0.00 ? 1   SER A C    7  
ATOM 10960 O O    . SER A 1 1   ? 6.630   4.500   -4.922  1.00 0.00 ? 1   SER A O    7  
ATOM 10961 C CB   . SER A 1 1   ? 7.466   1.004   -5.517  1.00 0.00 ? 1   SER A CB   7  
ATOM 10962 O OG   . SER A 1 1   ? 7.139   0.195   -6.637  1.00 0.00 ? 1   SER A OG   7  
ATOM 10963 H H1   . SER A 1 1   ? 5.700   3.476   -6.848  1.00 0.00 ? 1   SER A H1   7  
ATOM 10964 H H2   . SER A 1 1   ? 6.651   2.238   -7.501  1.00 0.00 ? 1   SER A H2   7  
ATOM 10965 H H3   . SER A 1 1   ? 5.093   1.897   -6.971  1.00 0.00 ? 1   SER A H3   7  
ATOM 10966 H HA   . SER A 1 1   ? 5.639   1.855   -4.792  1.00 0.00 ? 1   SER A HA   7  
ATOM 10967 H HB2  . SER A 1 1   ? 8.461   1.395   -5.642  1.00 0.00 ? 1   SER A HB2  7  
ATOM 10968 H HB3  . SER A 1 1   ? 7.423   0.415   -4.610  1.00 0.00 ? 1   SER A HB3  7  
ATOM 10969 H HG   . SER A 1 1   ? 6.184   0.108   -6.671  1.00 0.00 ? 1   SER A HG   7  
ATOM 10970 N N    . TRP A 1 2   ? 8.265   3.235   -4.167  1.00 0.00 ? 2   TRP A N    7  
ATOM 10971 C CA   . TRP A 1 2   ? 8.956   4.407   -3.547  1.00 0.00 ? 2   TRP A CA   7  
ATOM 10972 C C    . TRP A 1 2   ? 9.904   5.065   -4.564  1.00 0.00 ? 2   TRP A C    7  
ATOM 10973 O O    . TRP A 1 2   ? 9.766   4.897   -5.758  1.00 0.00 ? 2   TRP A O    7  
ATOM 10974 C CB   . TRP A 1 2   ? 9.751   3.943   -2.318  1.00 0.00 ? 2   TRP A CB   7  
ATOM 10975 C CG   . TRP A 1 2   ? 8.998   2.865   -1.593  1.00 0.00 ? 2   TRP A CG   7  
ATOM 10976 C CD1  . TRP A 1 2   ? 8.943   1.565   -1.972  1.00 0.00 ? 2   TRP A CD1  7  
ATOM 10977 C CD2  . TRP A 1 2   ? 8.203   2.964   -0.371  1.00 0.00 ? 2   TRP A CD2  7  
ATOM 10978 N NE1  . TRP A 1 2   ? 8.158   0.866   -1.074  1.00 0.00 ? 2   TRP A NE1  7  
ATOM 10979 C CE2  . TRP A 1 2   ? 7.682   1.681   -0.067  1.00 0.00 ? 2   TRP A CE2  7  
ATOM 10980 C CE3  . TRP A 1 2   ? 7.885   4.028   0.491   1.00 0.00 ? 2   TRP A CE3  7  
ATOM 10981 C CZ2  . TRP A 1 2   ? 6.874   1.462   1.053   1.00 0.00 ? 2   TRP A CZ2  7  
ATOM 10982 C CZ3  . TRP A 1 2   ? 7.074   3.812   1.619   1.00 0.00 ? 2   TRP A CZ3  7  
ATOM 10983 C CH2  . TRP A 1 2   ? 6.571   2.532   1.897   1.00 0.00 ? 2   TRP A CH2  7  
ATOM 10984 H H    . TRP A 1 2   ? 8.659   2.346   -4.089  1.00 0.00 ? 2   TRP A H    7  
ATOM 10985 H HA   . TRP A 1 2   ? 8.215   5.129   -3.236  1.00 0.00 ? 2   TRP A HA   7  
ATOM 10986 H HB2  . TRP A 1 2   ? 10.709  3.560   -2.636  1.00 0.00 ? 2   TRP A HB2  7  
ATOM 10987 H HB3  . TRP A 1 2   ? 9.904   4.780   -1.655  1.00 0.00 ? 2   TRP A HB3  7  
ATOM 10988 H HD1  . TRP A 1 2   ? 9.426   1.145   -2.840  1.00 0.00 ? 2   TRP A HD1  7  
ATOM 10989 H HE1  . TRP A 1 2   ? 7.956   -0.091  -1.126  1.00 0.00 ? 2   TRP A HE1  7  
ATOM 10990 H HE3  . TRP A 1 2   ? 8.265   5.018   0.287   1.00 0.00 ? 2   TRP A HE3  7  
ATOM 10991 H HZ2  . TRP A 1 2   ? 6.484   0.472   1.265   1.00 0.00 ? 2   TRP A HZ2  7  
ATOM 10992 H HZ3  . TRP A 1 2   ? 6.838   4.635   2.275   1.00 0.00 ? 2   TRP A HZ3  7  
ATOM 10993 H HH2  . TRP A 1 2   ? 5.949   2.372   2.765   1.00 0.00 ? 2   TRP A HH2  7  
ATOM 10994 N N    . GLN A 1 3   ? 10.857  5.830   -4.100  1.00 0.00 ? 3   GLN A N    7  
ATOM 10995 C CA   . GLN A 1 3   ? 11.794  6.514   -5.043  1.00 0.00 ? 3   GLN A CA   7  
ATOM 10996 C C    . GLN A 1 3   ? 12.774  5.504   -5.657  1.00 0.00 ? 3   GLN A C    7  
ATOM 10997 O O    . GLN A 1 3   ? 12.400  4.688   -6.479  1.00 0.00 ? 3   GLN A O    7  
ATOM 10998 C CB   . GLN A 1 3   ? 12.566  7.598   -4.287  1.00 0.00 ? 3   GLN A CB   7  
ATOM 10999 C CG   . GLN A 1 3   ? 11.660  8.808   -4.055  1.00 0.00 ? 3   GLN A CG   7  
ATOM 11000 C CD   . GLN A 1 3   ? 12.238  10.027  -4.775  1.00 0.00 ? 3   GLN A CD   7  
ATOM 11001 O OE1  . GLN A 1 3   ? 13.435  10.131  -4.952  1.00 0.00 ? 3   GLN A OE1  7  
ATOM 11002 N NE2  . GLN A 1 3   ? 11.433  10.960  -5.202  1.00 0.00 ? 3   GLN A NE2  7  
ATOM 11003 H H    . GLN A 1 3   ? 10.946  5.968   -3.133  1.00 0.00 ? 3   GLN A H    7  
ATOM 11004 H HA   . GLN A 1 3   ? 11.223  6.973   -5.836  1.00 0.00 ? 3   GLN A HA   7  
ATOM 11005 H HB2  . GLN A 1 3   ? 12.896  7.207   -3.335  1.00 0.00 ? 3   GLN A HB2  7  
ATOM 11006 H HB3  . GLN A 1 3   ? 13.425  7.901   -4.868  1.00 0.00 ? 3   GLN A HB3  7  
ATOM 11007 H HG2  . GLN A 1 3   ? 10.672  8.595   -4.439  1.00 0.00 ? 3   GLN A HG2  7  
ATOM 11008 H HG3  . GLN A 1 3   ? 11.598  9.013   -2.997  1.00 0.00 ? 3   GLN A HG3  7  
ATOM 11009 H HE21 . GLN A 1 3   ? 10.466  10.877  -5.061  1.00 0.00 ? 3   GLN A HE21 7  
ATOM 11010 H HE22 . GLN A 1 3   ? 11.793  11.747  -5.663  1.00 0.00 ? 3   GLN A HE22 7  
ATOM 11011 N N    . THR A 1 4   ? 14.028  5.552   -5.285  1.00 0.00 ? 4   THR A N    7  
ATOM 11012 C CA   . THR A 1 4   ? 15.004  4.595   -5.870  1.00 0.00 ? 4   THR A CA   7  
ATOM 11013 C C    . THR A 1 4   ? 14.427  3.184   -5.789  1.00 0.00 ? 4   THR A C    7  
ATOM 11014 O O    . THR A 1 4   ? 14.469  2.433   -6.740  1.00 0.00 ? 4   THR A O    7  
ATOM 11015 C CB   . THR A 1 4   ? 16.319  4.658   -5.089  1.00 0.00 ? 4   THR A CB   7  
ATOM 11016 O OG1  . THR A 1 4   ? 17.212  3.671   -5.591  1.00 0.00 ? 4   THR A OG1  7  
ATOM 11017 C CG2  . THR A 1 4   ? 16.050  4.401   -3.606  1.00 0.00 ? 4   THR A CG2  7  
ATOM 11018 H H    . THR A 1 4   ? 14.328  6.216   -4.632  1.00 0.00 ? 4   THR A H    7  
ATOM 11019 H HA   . THR A 1 4   ? 15.183  4.852   -6.903  1.00 0.00 ? 4   THR A HA   7  
ATOM 11020 H HB   . THR A 1 4   ? 16.761  5.636   -5.207  1.00 0.00 ? 4   THR A HB   7  
ATOM 11021 H HG1  . THR A 1 4   ? 17.738  4.071   -6.286  1.00 0.00 ? 4   THR A HG1  7  
ATOM 11022 H HG21 . THR A 1 4   ? 15.331  5.120   -3.241  1.00 0.00 ? 4   THR A HG21 7  
ATOM 11023 H HG22 . THR A 1 4   ? 15.658  3.404   -3.479  1.00 0.00 ? 4   THR A HG22 7  
ATOM 11024 H HG23 . THR A 1 4   ? 16.971  4.499   -3.050  1.00 0.00 ? 4   THR A HG23 7  
ATOM 11025 N N    . TYR A 1 5   ? 13.878  2.828   -4.658  1.00 0.00 ? 5   TYR A N    7  
ATOM 11026 C CA   . TYR A 1 5   ? 13.288  1.470   -4.503  1.00 0.00 ? 5   TYR A CA   7  
ATOM 11027 C C    . TYR A 1 5   ? 12.516  1.105   -5.768  1.00 0.00 ? 5   TYR A C    7  
ATOM 11028 O O    . TYR A 1 5   ? 12.632  0.015   -6.291  1.00 0.00 ? 5   TYR A O    7  
ATOM 11029 C CB   . TYR A 1 5   ? 12.324  1.474   -3.316  1.00 0.00 ? 5   TYR A CB   7  
ATOM 11030 C CG   . TYR A 1 5   ? 13.046  1.917   -2.063  1.00 0.00 ? 5   TYR A CG   7  
ATOM 11031 C CD1  . TYR A 1 5   ? 14.445  1.852   -1.991  1.00 0.00 ? 5   TYR A CD1  7  
ATOM 11032 C CD2  . TYR A 1 5   ? 12.313  2.393   -0.970  1.00 0.00 ? 5   TYR A CD2  7  
ATOM 11033 C CE1  . TYR A 1 5   ? 15.106  2.263   -0.829  1.00 0.00 ? 5   TYR A CE1  7  
ATOM 11034 C CE2  . TYR A 1 5   ? 12.975  2.804   0.192   1.00 0.00 ? 5   TYR A CE2  7  
ATOM 11035 C CZ   . TYR A 1 5   ? 14.371  2.739   0.264   1.00 0.00 ? 5   TYR A CZ   7  
ATOM 11036 O OH   . TYR A 1 5   ? 15.022  3.145   1.413   1.00 0.00 ? 5   TYR A OH   7  
ATOM 11037 H H    . TYR A 1 5   ? 13.850  3.460   -3.910  1.00 0.00 ? 5   TYR A H    7  
ATOM 11038 H HA   . TYR A 1 5   ? 14.072  0.748   -4.332  1.00 0.00 ? 5   TYR A HA   7  
ATOM 11039 H HB2  . TYR A 1 5   ? 11.511  2.155   -3.521  1.00 0.00 ? 5   TYR A HB2  7  
ATOM 11040 H HB3  . TYR A 1 5   ? 11.930  0.483   -3.172  1.00 0.00 ? 5   TYR A HB3  7  
ATOM 11041 H HD1  . TYR A 1 5   ? 15.011  1.486   -2.835  1.00 0.00 ? 5   TYR A HD1  7  
ATOM 11042 H HD2  . TYR A 1 5   ? 11.234  2.444   -1.023  1.00 0.00 ? 5   TYR A HD2  7  
ATOM 11043 H HE1  . TYR A 1 5   ? 16.183  2.214   -0.773  1.00 0.00 ? 5   TYR A HE1  7  
ATOM 11044 H HE2  . TYR A 1 5   ? 12.408  3.172   1.036   1.00 0.00 ? 5   TYR A HE2  7  
ATOM 11045 H HH   . TYR A 1 5   ? 15.948  3.277   1.198   1.00 0.00 ? 5   TYR A HH   7  
ATOM 11046 N N    . VAL A 1 6   ? 11.717  2.010   -6.254  1.00 0.00 ? 6   VAL A N    7  
ATOM 11047 C CA   . VAL A 1 6   ? 10.925  1.726   -7.478  1.00 0.00 ? 6   VAL A CA   7  
ATOM 11048 C C    . VAL A 1 6   ? 11.850  1.237   -8.600  1.00 0.00 ? 6   VAL A C    7  
ATOM 11049 O O    . VAL A 1 6   ? 11.616  0.208   -9.202  1.00 0.00 ? 6   VAL A O    7  
ATOM 11050 C CB   . VAL A 1 6   ? 10.181  3.012   -7.896  1.00 0.00 ? 6   VAL A CB   7  
ATOM 11051 C CG1  . VAL A 1 6   ? 10.104  3.140   -9.423  1.00 0.00 ? 6   VAL A CG1  7  
ATOM 11052 C CG2  . VAL A 1 6   ? 8.765   2.956   -7.329  1.00 0.00 ? 6   VAL A CG2  7  
ATOM 11053 H H    . VAL A 1 6   ? 11.631  2.878   -5.808  1.00 0.00 ? 6   VAL A H    7  
ATOM 11054 H HA   . VAL A 1 6   ? 10.202  0.956   -7.258  1.00 0.00 ? 6   VAL A HA   7  
ATOM 11055 H HB   . VAL A 1 6   ? 10.695  3.874   -7.488  1.00 0.00 ? 6   VAL A HB   7  
ATOM 11056 H HG11 . VAL A 1 6   ? 11.101  3.110   -9.838  1.00 0.00 ? 6   VAL A HG11 7  
ATOM 11057 H HG12 . VAL A 1 6   ? 9.523   2.324   -9.825  1.00 0.00 ? 6   VAL A HG12 7  
ATOM 11058 H HG13 . VAL A 1 6   ? 9.636   4.078   -9.684  1.00 0.00 ? 6   VAL A HG13 7  
ATOM 11059 H HG21 . VAL A 1 6   ? 8.365   1.962   -7.463  1.00 0.00 ? 6   VAL A HG21 7  
ATOM 11060 H HG22 . VAL A 1 6   ? 8.792   3.184   -6.281  1.00 0.00 ? 6   VAL A HG22 7  
ATOM 11061 H HG23 . VAL A 1 6   ? 8.129   3.671   -7.838  1.00 0.00 ? 6   VAL A HG23 7  
ATOM 11062 N N    . ASP A 1 7   ? 12.876  1.979   -8.910  1.00 0.00 ? 7   ASP A N    7  
ATOM 11063 C CA   . ASP A 1 7   ? 13.779  1.558   -10.020 1.00 0.00 ? 7   ASP A CA   7  
ATOM 11064 C C    . ASP A 1 7   ? 14.955  0.709   -9.520  1.00 0.00 ? 7   ASP A C    7  
ATOM 11065 O O    . ASP A 1 7   ? 16.093  0.972   -9.854  1.00 0.00 ? 7   ASP A O    7  
ATOM 11066 C CB   . ASP A 1 7   ? 14.325  2.802   -10.717 1.00 0.00 ? 7   ASP A CB   7  
ATOM 11067 C CG   . ASP A 1 7   ? 13.722  2.906   -12.120 1.00 0.00 ? 7   ASP A CG   7  
ATOM 11068 O OD1  . ASP A 1 7   ? 14.191  2.203   -12.999 1.00 0.00 ? 7   ASP A OD1  7  
ATOM 11069 O OD2  . ASP A 1 7   ? 12.802  3.688   -12.291 1.00 0.00 ? 7   ASP A OD2  7  
ATOM 11070 H H    . ASP A 1 7   ? 13.038  2.822   -8.430  1.00 0.00 ? 7   ASP A H    7  
ATOM 11071 H HA   . ASP A 1 7   ? 13.209  0.980   -10.733 1.00 0.00 ? 7   ASP A HA   7  
ATOM 11072 H HB2  . ASP A 1 7   ? 14.060  3.679   -10.145 1.00 0.00 ? 7   ASP A HB2  7  
ATOM 11073 H HB3  . ASP A 1 7   ? 15.398  2.730   -10.793 1.00 0.00 ? 7   ASP A HB3  7  
ATOM 11074 N N    . THR A 1 8   ? 14.712  -0.318  -8.750  1.00 0.00 ? 8   THR A N    7  
ATOM 11075 C CA   . THR A 1 8   ? 15.850  -1.161  -8.291  1.00 0.00 ? 8   THR A CA   7  
ATOM 11076 C C    . THR A 1 8   ? 15.347  -2.541  -7.840  1.00 0.00 ? 8   THR A C    7  
ATOM 11077 O O    . THR A 1 8   ? 15.088  -3.408  -8.651  1.00 0.00 ? 8   THR A O    7  
ATOM 11078 C CB   . THR A 1 8   ? 16.607  -0.463  -7.150  1.00 0.00 ? 8   THR A CB   7  
ATOM 11079 O OG1  . THR A 1 8   ? 17.370  -1.424  -6.433  1.00 0.00 ? 8   THR A OG1  7  
ATOM 11080 C CG2  . THR A 1 8   ? 15.628  0.226   -6.197  1.00 0.00 ? 8   THR A CG2  7  
ATOM 11081 H H    . THR A 1 8   ? 13.795  -0.544  -8.493  1.00 0.00 ? 8   THR A H    7  
ATOM 11082 H HA   . THR A 1 8   ? 16.529  -1.300  -9.121  1.00 0.00 ? 8   THR A HA   7  
ATOM 11083 H HB   . THR A 1 8   ? 17.273  0.277   -7.566  1.00 0.00 ? 8   THR A HB   7  
ATOM 11084 H HG1  . THR A 1 8   ? 18.264  -1.414  -6.784  1.00 0.00 ? 8   THR A HG1  7  
ATOM 11085 H HG21 . THR A 1 8   ? 14.659  0.297   -6.664  1.00 0.00 ? 8   THR A HG21 7  
ATOM 11086 H HG22 . THR A 1 8   ? 15.548  -0.344  -5.285  1.00 0.00 ? 8   THR A HG22 7  
ATOM 11087 H HG23 . THR A 1 8   ? 15.989  1.219   -5.968  1.00 0.00 ? 8   THR A HG23 7  
ATOM 11088 N N    . ASN A 1 9   ? 15.225  -2.761  -6.561  1.00 0.00 ? 9   ASN A N    7  
ATOM 11089 C CA   . ASN A 1 9   ? 14.763  -4.093  -6.065  1.00 0.00 ? 9   ASN A CA   7  
ATOM 11090 C C    . ASN A 1 9   ? 13.294  -4.043  -5.651  1.00 0.00 ? 9   ASN A C    7  
ATOM 11091 O O    . ASN A 1 9   ? 12.454  -4.642  -6.278  1.00 0.00 ? 9   ASN A O    7  
ATOM 11092 C CB   . ASN A 1 9   ? 15.606  -4.493  -4.853  1.00 0.00 ? 9   ASN A CB   7  
ATOM 11093 C CG   . ASN A 1 9   ? 16.186  -5.889  -5.081  1.00 0.00 ? 9   ASN A CG   7  
ATOM 11094 O OD1  . ASN A 1 9   ? 15.455  -6.845  -5.246  1.00 0.00 ? 9   ASN A OD1  7  
ATOM 11095 N ND2  . ASN A 1 9   ? 17.482  -6.047  -5.099  1.00 0.00 ? 9   ASN A ND2  7  
ATOM 11096 H H    . ASN A 1 9   ? 15.446  -2.059  -5.924  1.00 0.00 ? 9   ASN A H    7  
ATOM 11097 H HA   . ASN A 1 9   ? 14.885  -4.835  -6.843  1.00 0.00 ? 9   ASN A HA   7  
ATOM 11098 H HB2  . ASN A 1 9   ? 16.410  -3.784  -4.724  1.00 0.00 ? 9   ASN A HB2  7  
ATOM 11099 H HB3  . ASN A 1 9   ? 14.985  -4.500  -3.967  1.00 0.00 ? 9   ASN A HB3  7  
ATOM 11100 H HD21 . ASN A 1 9   ? 18.071  -5.277  -4.966  1.00 0.00 ? 9   ASN A HD21 7  
ATOM 11101 H HD22 . ASN A 1 9   ? 17.863  -6.938  -5.247  1.00 0.00 ? 9   ASN A HD22 7  
ATOM 11102 N N    . LEU A 1 10  ? 13.009  -3.355  -4.574  1.00 0.00 ? 10  LEU A N    7  
ATOM 11103 C CA   . LEU A 1 10  ? 11.613  -3.254  -4.034  1.00 0.00 ? 10  LEU A CA   7  
ATOM 11104 C C    . LEU A 1 10  ? 10.542  -3.520  -5.100  1.00 0.00 ? 10  LEU A C    7  
ATOM 11105 O O    . LEU A 1 10  ? 9.547   -4.163  -4.829  1.00 0.00 ? 10  LEU A O    7  
ATOM 11106 C CB   . LEU A 1 10  ? 11.405  -1.857  -3.456  1.00 0.00 ? 10  LEU A CB   7  
ATOM 11107 C CG   . LEU A 1 10  ? 11.282  -1.950  -1.934  1.00 0.00 ? 10  LEU A CG   7  
ATOM 11108 C CD1  . LEU A 1 10  ? 12.143  -0.868  -1.282  1.00 0.00 ? 10  LEU A CD1  7  
ATOM 11109 C CD2  . LEU A 1 10  ? 9.820   -1.748  -1.528  1.00 0.00 ? 10  LEU A CD2  7  
ATOM 11110 H H    . LEU A 1 10  ? 13.735  -2.910  -4.091  1.00 0.00 ? 10  LEU A H    7  
ATOM 11111 H HA   . LEU A 1 10  ? 11.497  -3.975  -3.238  1.00 0.00 ? 10  LEU A HA   7  
ATOM 11112 H HB2  . LEU A 1 10  ? 12.250  -1.236  -3.714  1.00 0.00 ? 10  LEU A HB2  7  
ATOM 11113 H HB3  . LEU A 1 10  ? 10.502  -1.428  -3.864  1.00 0.00 ? 10  LEU A HB3  7  
ATOM 11114 H HG   . LEU A 1 10  ? 11.618  -2.923  -1.604  1.00 0.00 ? 10  LEU A HG   7  
ATOM 11115 H HD11 . LEU A 1 10  ? 13.107  -0.833  -1.769  1.00 0.00 ? 10  LEU A HD11 7  
ATOM 11116 H HD12 . LEU A 1 10  ? 11.654  0.090   -1.385  1.00 0.00 ? 10  LEU A HD12 7  
ATOM 11117 H HD13 . LEU A 1 10  ? 12.276  -1.093  -0.235  1.00 0.00 ? 10  LEU A HD13 7  
ATOM 11118 H HD21 . LEU A 1 10  ? 9.209   -1.661  -2.414  1.00 0.00 ? 10  LEU A HD21 7  
ATOM 11119 H HD22 . LEU A 1 10  ? 9.488   -2.594  -0.944  1.00 0.00 ? 10  LEU A HD22 7  
ATOM 11120 H HD23 . LEU A 1 10  ? 9.730   -0.848  -0.939  1.00 0.00 ? 10  LEU A HD23 7  
ATOM 11121 N N    . VAL A 1 11  ? 10.707  -3.028  -6.297  1.00 0.00 ? 11  VAL A N    7  
ATOM 11122 C CA   . VAL A 1 11  ? 9.655   -3.267  -7.328  1.00 0.00 ? 11  VAL A CA   7  
ATOM 11123 C C    . VAL A 1 11  ? 9.819   -4.658  -7.944  1.00 0.00 ? 11  VAL A C    7  
ATOM 11124 O O    . VAL A 1 11  ? 9.004   -5.530  -7.717  1.00 0.00 ? 11  VAL A O    7  
ATOM 11125 C CB   . VAL A 1 11  ? 9.744   -2.188  -8.422  1.00 0.00 ? 11  VAL A CB   7  
ATOM 11126 C CG1  . VAL A 1 11  ? 9.085   -2.684  -9.717  1.00 0.00 ? 11  VAL A CG1  7  
ATOM 11127 C CG2  . VAL A 1 11  ? 9.020   -0.930  -7.952  1.00 0.00 ? 11  VAL A CG2  7  
ATOM 11128 H H    . VAL A 1 11  ? 11.503  -2.499  -6.510  1.00 0.00 ? 11  VAL A H    7  
ATOM 11129 H HA   . VAL A 1 11  ? 8.688   -3.217  -6.845  1.00 0.00 ? 11  VAL A HA   7  
ATOM 11130 H HB   . VAL A 1 11  ? 10.783  -1.954  -8.616  1.00 0.00 ? 11  VAL A HB   7  
ATOM 11131 H HG11 . VAL A 1 11  ? 8.131   -3.133  -9.485  1.00 0.00 ? 11  VAL A HG11 7  
ATOM 11132 H HG12 . VAL A 1 11  ? 8.937   -1.850  -10.388 1.00 0.00 ? 11  VAL A HG12 7  
ATOM 11133 H HG13 . VAL A 1 11  ? 9.723   -3.417  -10.188 1.00 0.00 ? 11  VAL A HG13 7  
ATOM 11134 H HG21 . VAL A 1 11  ? 9.260   -0.742  -6.916  1.00 0.00 ? 11  VAL A HG21 7  
ATOM 11135 H HG22 . VAL A 1 11  ? 9.330   -0.089  -8.554  1.00 0.00 ? 11  VAL A HG22 7  
ATOM 11136 H HG23 . VAL A 1 11  ? 7.956   -1.073  -8.056  1.00 0.00 ? 11  VAL A HG23 7  
ATOM 11137 N N    . GLY A 1 12  ? 10.851  -4.872  -8.726  1.00 0.00 ? 12  GLY A N    7  
ATOM 11138 C CA   . GLY A 1 12  ? 11.048  -6.216  -9.356  1.00 0.00 ? 12  GLY A CA   7  
ATOM 11139 C C    . GLY A 1 12  ? 10.648  -7.290  -8.350  1.00 0.00 ? 12  GLY A C    7  
ATOM 11140 O O    . GLY A 1 12  ? 10.143  -8.338  -8.701  1.00 0.00 ? 12  GLY A O    7  
ATOM 11141 H H    . GLY A 1 12  ? 11.491  -4.152  -8.902  1.00 0.00 ? 12  GLY A H    7  
ATOM 11142 H HA2  . GLY A 1 12  ? 10.432  -6.297  -10.240 1.00 0.00 ? 12  GLY A HA2  7  
ATOM 11143 H HA3  . GLY A 1 12  ? 12.086  -6.345  -9.623  1.00 0.00 ? 12  GLY A HA3  7  
ATOM 11144 N N    . THR A 1 13  ? 10.854  -7.001  -7.092  1.00 0.00 ? 13  THR A N    7  
ATOM 11145 C CA   . THR A 1 13  ? 10.487  -7.944  -6.004  1.00 0.00 ? 13  THR A CA   7  
ATOM 11146 C C    . THR A 1 13  ? 11.406  -7.707  -4.814  1.00 0.00 ? 13  THR A C    7  
ATOM 11147 O O    . THR A 1 13  ? 11.852  -8.632  -4.165  1.00 0.00 ? 13  THR A O    7  
ATOM 11148 C CB   . THR A 1 13  ? 10.656  -9.382  -6.462  1.00 0.00 ? 13  THR A CB   7  
ATOM 11149 O OG1  . THR A 1 13  ? 10.699  -10.243 -5.332  1.00 0.00 ? 13  THR A OG1  7  
ATOM 11150 C CG2  . THR A 1 13  ? 11.954  -9.511  -7.265  1.00 0.00 ? 13  THR A CG2  7  
ATOM 11151 H H    . THR A 1 13  ? 11.244  -6.139  -6.860  1.00 0.00 ? 13  THR A H    7  
ATOM 11152 H HA   . THR A 1 13  ? 9.450   -7.767  -5.715  1.00 0.00 ? 13  THR A HA   7  
ATOM 11153 H HB   . THR A 1 13  ? 9.824   -9.646  -7.073  1.00 0.00 ? 13  THR A HB   7  
ATOM 11154 H HG1  . THR A 1 13  ? 9.810   -10.313 -4.979  1.00 0.00 ? 13  THR A HG1  7  
ATOM 11155 H HG21 . THR A 1 13  ? 12.408  -8.535  -7.374  1.00 0.00 ? 13  THR A HG21 7  
ATOM 11156 H HG22 . THR A 1 13  ? 12.638  -10.165 -6.743  1.00 0.00 ? 13  THR A HG22 7  
ATOM 11157 H HG23 . THR A 1 13  ? 11.738  -9.917  -8.241  1.00 0.00 ? 13  THR A HG23 7  
ATOM 11158 N N    . GLY A 1 14  ? 11.665  -6.477  -4.487  1.00 0.00 ? 14  GLY A N    7  
ATOM 11159 C CA   . GLY A 1 14  ? 12.519  -6.199  -3.303  1.00 0.00 ? 14  GLY A CA   7  
ATOM 11160 C C    . GLY A 1 14  ? 11.612  -6.221  -2.076  1.00 0.00 ? 14  GLY A C    7  
ATOM 11161 O O    . GLY A 1 14  ? 11.908  -5.637  -1.051  1.00 0.00 ? 14  GLY A O    7  
ATOM 11162 H H    . GLY A 1 14  ? 11.273  -5.740  -4.996  1.00 0.00 ? 14  GLY A H    7  
ATOM 11163 H HA2  . GLY A 1 14  ? 13.283  -6.960  -3.215  1.00 0.00 ? 14  GLY A HA2  7  
ATOM 11164 H HA3  . GLY A 1 14  ? 12.975  -5.226  -3.397  1.00 0.00 ? 14  GLY A HA3  7  
ATOM 11165 N N    . ALA A 1 15  ? 10.493  -6.889  -2.198  1.00 0.00 ? 15  ALA A N    7  
ATOM 11166 C CA   . ALA A 1 15  ? 9.511   -6.972  -1.092  1.00 0.00 ? 15  ALA A CA   7  
ATOM 11167 C C    . ALA A 1 15  ? 8.163   -7.226  -1.743  1.00 0.00 ? 15  ALA A C    7  
ATOM 11168 O O    . ALA A 1 15  ? 7.300   -7.883  -1.195  1.00 0.00 ? 15  ALA A O    7  
ATOM 11169 C CB   . ALA A 1 15  ? 9.471   -5.656  -0.312  1.00 0.00 ? 15  ALA A CB   7  
ATOM 11170 H H    . ALA A 1 15  ? 10.281  -7.340  -3.050  1.00 0.00 ? 15  ALA A H    7  
ATOM 11171 H HA   . ALA A 1 15  ? 9.764   -7.791  -0.434  1.00 0.00 ? 15  ALA A HA   7  
ATOM 11172 H HB1  . ALA A 1 15  ? 9.506   -4.827  -1.002  1.00 0.00 ? 15  ALA A HB1  7  
ATOM 11173 H HB2  . ALA A 1 15  ? 8.557   -5.608  0.263   1.00 0.00 ? 15  ALA A HB2  7  
ATOM 11174 H HB3  . ALA A 1 15  ? 10.319  -5.607  0.355   1.00 0.00 ? 15  ALA A HB3  7  
ATOM 11175 N N    . VAL A 1 16  ? 7.989   -6.716  -2.935  1.00 0.00 ? 16  VAL A N    7  
ATOM 11176 C CA   . VAL A 1 16  ? 6.719   -6.929  -3.657  1.00 0.00 ? 16  VAL A CA   7  
ATOM 11177 C C    . VAL A 1 16  ? 7.010   -6.863  -5.154  1.00 0.00 ? 16  VAL A C    7  
ATOM 11178 O O    . VAL A 1 16  ? 7.869   -6.125  -5.593  1.00 0.00 ? 16  VAL A O    7  
ATOM 11179 C CB   . VAL A 1 16  ? 5.729   -5.829  -3.267  1.00 0.00 ? 16  VAL A CB   7  
ATOM 11180 C CG1  . VAL A 1 16  ? 5.356   -5.979  -1.791  1.00 0.00 ? 16  VAL A CG1  7  
ATOM 11181 C CG2  . VAL A 1 16  ? 6.380   -4.463  -3.487  1.00 0.00 ? 16  VAL A CG2  7  
ATOM 11182 H H    . VAL A 1 16  ? 8.711   -6.193  -3.366  1.00 0.00 ? 16  VAL A H    7  
ATOM 11183 H HA   . VAL A 1 16  ? 6.313   -7.896  -3.404  1.00 0.00 ? 16  VAL A HA   7  
ATOM 11184 H HB   . VAL A 1 16  ? 4.840   -5.910  -3.875  1.00 0.00 ? 16  VAL A HB   7  
ATOM 11185 H HG11 . VAL A 1 16  ? 5.301   -7.028  -1.538  1.00 0.00 ? 16  VAL A HG11 7  
ATOM 11186 H HG12 . VAL A 1 16  ? 6.108   -5.501  -1.180  1.00 0.00 ? 16  VAL A HG12 7  
ATOM 11187 H HG13 . VAL A 1 16  ? 4.398   -5.515  -1.613  1.00 0.00 ? 16  VAL A HG13 7  
ATOM 11188 H HG21 . VAL A 1 16  ? 6.856   -4.442  -4.456  1.00 0.00 ? 16  VAL A HG21 7  
ATOM 11189 H HG22 . VAL A 1 16  ? 5.625   -3.693  -3.438  1.00 0.00 ? 16  VAL A HG22 7  
ATOM 11190 H HG23 . VAL A 1 16  ? 7.119   -4.290  -2.719  1.00 0.00 ? 16  VAL A HG23 7  
ATOM 11191 N N    . THR A 1 17  ? 6.300   -7.612  -5.947  1.00 0.00 ? 17  THR A N    7  
ATOM 11192 C CA   . THR A 1 17  ? 6.544   -7.563  -7.414  1.00 0.00 ? 17  THR A CA   7  
ATOM 11193 C C    . THR A 1 17  ? 5.866   -6.312  -7.981  1.00 0.00 ? 17  THR A C    7  
ATOM 11194 O O    . THR A 1 17  ? 5.837   -6.093  -9.174  1.00 0.00 ? 17  THR A O    7  
ATOM 11195 C CB   . THR A 1 17  ? 5.949   -8.812  -8.070  1.00 0.00 ? 17  THR A CB   7  
ATOM 11196 O OG1  . THR A 1 17  ? 4.817   -9.237  -7.325  1.00 0.00 ? 17  THR A OG1  7  
ATOM 11197 C CG2  . THR A 1 17  ? 6.992   -9.930  -8.094  1.00 0.00 ? 17  THR A CG2  7  
ATOM 11198 H H    . THR A 1 17  ? 5.603   -8.195  -5.582  1.00 0.00 ? 17  THR A H    7  
ATOM 11199 H HA   . THR A 1 17  ? 7.606   -7.519  -7.605  1.00 0.00 ? 17  THR A HA   7  
ATOM 11200 H HB   . THR A 1 17  ? 5.650   -8.582  -9.081  1.00 0.00 ? 17  THR A HB   7  
ATOM 11201 H HG1  . THR A 1 17  ? 4.040   -9.130  -7.878  1.00 0.00 ? 17  THR A HG1  7  
ATOM 11202 H HG21 . THR A 1 17  ? 7.508   -9.963  -7.146  1.00 0.00 ? 17  THR A HG21 7  
ATOM 11203 H HG22 . THR A 1 17  ? 6.501   -10.875 -8.269  1.00 0.00 ? 17  THR A HG22 7  
ATOM 11204 H HG23 . THR A 1 17  ? 7.703   -9.741  -8.884  1.00 0.00 ? 17  THR A HG23 7  
ATOM 11205 N N    . GLN A 1 18  ? 5.328   -5.488  -7.118  1.00 0.00 ? 18  GLN A N    7  
ATOM 11206 C CA   . GLN A 1 18  ? 4.648   -4.238  -7.570  1.00 0.00 ? 18  GLN A CA   7  
ATOM 11207 C C    . GLN A 1 18  ? 4.499   -3.301  -6.370  1.00 0.00 ? 18  GLN A C    7  
ATOM 11208 O O    . GLN A 1 18  ? 4.561   -3.723  -5.232  1.00 0.00 ? 18  GLN A O    7  
ATOM 11209 C CB   . GLN A 1 18  ? 3.247   -4.552  -8.110  1.00 0.00 ? 18  GLN A CB   7  
ATOM 11210 C CG   . GLN A 1 18  ? 3.259   -5.841  -8.934  1.00 0.00 ? 18  GLN A CG   7  
ATOM 11211 C CD   . GLN A 1 18  ? 1.840   -6.140  -9.417  1.00 0.00 ? 18  GLN A CD   7  
ATOM 11212 O OE1  . GLN A 1 18  ? 0.981   -6.486  -8.632  1.00 0.00 ? 18  GLN A OE1  7  
ATOM 11213 N NE2  . GLN A 1 18  ? 1.554   -6.016  -10.685 1.00 0.00 ? 18  GLN A NE2  7  
ATOM 11214 H H    . GLN A 1 18  ? 5.381   -5.688  -6.162  1.00 0.00 ? 18  GLN A H    7  
ATOM 11215 H HA   . GLN A 1 18  ? 5.237   -3.758  -8.336  1.00 0.00 ? 18  GLN A HA   7  
ATOM 11216 H HB2  . GLN A 1 18  ? 2.566   -4.670  -7.282  1.00 0.00 ? 18  GLN A HB2  7  
ATOM 11217 H HB3  . GLN A 1 18  ? 2.912   -3.735  -8.730  1.00 0.00 ? 18  GLN A HB3  7  
ATOM 11218 H HG2  . GLN A 1 18  ? 3.911   -5.717  -9.787  1.00 0.00 ? 18  GLN A HG2  7  
ATOM 11219 H HG3  . GLN A 1 18  ? 3.608   -6.659  -8.324  1.00 0.00 ? 18  GLN A HG3  7  
ATOM 11220 H HE21 . GLN A 1 18  ? 2.246   -5.734  -11.319 1.00 0.00 ? 18  GLN A HE21 7  
ATOM 11221 H HE22 . GLN A 1 18  ? 0.647   -6.207  -11.003 1.00 0.00 ? 18  GLN A HE22 7  
ATOM 11222 N N    . ALA A 1 19  ? 4.291   -2.037  -6.608  1.00 0.00 ? 19  ALA A N    7  
ATOM 11223 C CA   . ALA A 1 19  ? 4.126   -1.083  -5.474  1.00 0.00 ? 19  ALA A CA   7  
ATOM 11224 C C    . ALA A 1 19  ? 3.733   0.284   -6.027  1.00 0.00 ? 19  ALA A C    7  
ATOM 11225 O O    . ALA A 1 19  ? 3.598   0.457   -7.222  1.00 0.00 ? 19  ALA A O    7  
ATOM 11226 C CB   . ALA A 1 19  ? 5.444   -0.968  -4.703  1.00 0.00 ? 19  ALA A CB   7  
ATOM 11227 H H    . ALA A 1 19  ? 4.235   -1.715  -7.533  1.00 0.00 ? 19  ALA A H    7  
ATOM 11228 H HA   . ALA A 1 19  ? 3.351   -1.439  -4.812  1.00 0.00 ? 19  ALA A HA   7  
ATOM 11229 H HB1  . ALA A 1 19  ? 6.267   -1.217  -5.357  1.00 0.00 ? 19  ALA A HB1  7  
ATOM 11230 H HB2  . ALA A 1 19  ? 5.563   0.042   -4.342  1.00 0.00 ? 19  ALA A HB2  7  
ATOM 11231 H HB3  . ALA A 1 19  ? 5.431   -1.650  -3.865  1.00 0.00 ? 19  ALA A HB3  7  
ATOM 11232 N N    . ALA A 1 20  ? 3.546   1.258   -5.176  1.00 0.00 ? 20  ALA A N    7  
ATOM 11233 C CA   . ALA A 1 20  ? 3.158   2.606   -5.677  1.00 0.00 ? 20  ALA A CA   7  
ATOM 11234 C C    . ALA A 1 20  ? 2.913   3.556   -4.509  1.00 0.00 ? 20  ALA A C    7  
ATOM 11235 O O    . ALA A 1 20  ? 1.994   3.384   -3.733  1.00 0.00 ? 20  ALA A O    7  
ATOM 11236 C CB   . ALA A 1 20  ? 1.872   2.491   -6.499  1.00 0.00 ? 20  ALA A CB   7  
ATOM 11237 H H    . ALA A 1 20  ? 3.657   1.101   -4.215  1.00 0.00 ? 20  ALA A H    7  
ATOM 11238 H HA   . ALA A 1 20  ? 3.948   3.008   -6.298  1.00 0.00 ? 20  ALA A HA   7  
ATOM 11239 H HB1  . ALA A 1 20  ? 2.025   1.808   -7.320  1.00 0.00 ? 20  ALA A HB1  7  
ATOM 11240 H HB2  . ALA A 1 20  ? 1.076   2.122   -5.868  1.00 0.00 ? 20  ALA A HB2  7  
ATOM 11241 H HB3  . ALA A 1 20  ? 1.602   3.463   -6.884  1.00 0.00 ? 20  ALA A HB3  7  
ATOM 11242 N N    . ILE A 1 21  ? 3.712   4.575   -4.398  1.00 0.00 ? 21  ILE A N    7  
ATOM 11243 C CA   . ILE A 1 21  ? 3.507   5.558   -3.307  1.00 0.00 ? 21  ILE A CA   7  
ATOM 11244 C C    . ILE A 1 21  ? 2.393   6.499   -3.767  1.00 0.00 ? 21  ILE A C    7  
ATOM 11245 O O    . ILE A 1 21  ? 2.604   7.389   -4.568  1.00 0.00 ? 21  ILE A O    7  
ATOM 11246 C CB   . ILE A 1 21  ? 4.821   6.312   -3.048  1.00 0.00 ? 21  ILE A CB   7  
ATOM 11247 C CG1  . ILE A 1 21  ? 5.601   5.594   -1.941  1.00 0.00 ? 21  ILE A CG1  7  
ATOM 11248 C CG2  . ILE A 1 21  ? 4.539   7.753   -2.608  1.00 0.00 ? 21  ILE A CG2  7  
ATOM 11249 C CD1  . ILE A 1 21  ? 5.892   4.147   -2.360  1.00 0.00 ? 21  ILE A CD1  7  
ATOM 11250 H H    . ILE A 1 21  ? 4.434   4.705   -5.047  1.00 0.00 ? 21  ILE A H    7  
ATOM 11251 H HA   . ILE A 1 21  ? 3.195   5.042   -2.409  1.00 0.00 ? 21  ILE A HA   7  
ATOM 11252 H HB   . ILE A 1 21  ? 5.412   6.323   -3.953  1.00 0.00 ? 21  ILE A HB   7  
ATOM 11253 H HG12 . ILE A 1 21  ? 6.533   6.111   -1.763  1.00 0.00 ? 21  ILE A HG12 7  
ATOM 11254 H HG13 . ILE A 1 21  ? 5.014   5.591   -1.033  1.00 0.00 ? 21  ILE A HG13 7  
ATOM 11255 H HG21 . ILE A 1 21  ? 3.607   7.788   -2.065  1.00 0.00 ? 21  ILE A HG21 7  
ATOM 11256 H HG22 . ILE A 1 21  ? 5.341   8.098   -1.971  1.00 0.00 ? 21  ILE A HG22 7  
ATOM 11257 H HG23 . ILE A 1 21  ? 4.472   8.388   -3.479  1.00 0.00 ? 21  ILE A HG23 7  
ATOM 11258 H HD11 . ILE A 1 21  ? 5.437   3.948   -3.314  1.00 0.00 ? 21  ILE A HD11 7  
ATOM 11259 H HD12 . ILE A 1 21  ? 6.959   4.002   -2.434  1.00 0.00 ? 21  ILE A HD12 7  
ATOM 11260 H HD13 . ILE A 1 21  ? 5.488   3.471   -1.623  1.00 0.00 ? 21  ILE A HD13 7  
ATOM 11261 N N    . LEU A 1 22  ? 1.198   6.278   -3.291  1.00 0.00 ? 22  LEU A N    7  
ATOM 11262 C CA   . LEU A 1 22  ? 0.048   7.120   -3.718  1.00 0.00 ? 22  LEU A CA   7  
ATOM 11263 C C    . LEU A 1 22  ? -0.044  8.364   -2.830  1.00 0.00 ? 22  LEU A C    7  
ATOM 11264 O O    . LEU A 1 22  ? -0.345  8.283   -1.656  1.00 0.00 ? 22  LEU A O    7  
ATOM 11265 C CB   . LEU A 1 22  ? -1.246  6.300   -3.615  1.00 0.00 ? 22  LEU A CB   7  
ATOM 11266 C CG   . LEU A 1 22  ? -0.958  4.822   -3.922  1.00 0.00 ? 22  LEU A CG   7  
ATOM 11267 C CD1  . LEU A 1 22  ? -2.251  4.009   -3.822  1.00 0.00 ? 22  LEU A CD1  7  
ATOM 11268 C CD2  . LEU A 1 22  ? -0.389  4.682   -5.338  1.00 0.00 ? 22  LEU A CD2  7  
ATOM 11269 H H    . LEU A 1 22  ? 1.056   5.540   -2.664  1.00 0.00 ? 22  LEU A H    7  
ATOM 11270 H HA   . LEU A 1 22  ? 0.195   7.427   -4.744  1.00 0.00 ? 22  LEU A HA   7  
ATOM 11271 H HB2  . LEU A 1 22  ? -1.647  6.388   -2.615  1.00 0.00 ? 22  LEU A HB2  7  
ATOM 11272 H HB3  . LEU A 1 22  ? -1.967  6.678   -4.325  1.00 0.00 ? 22  LEU A HB3  7  
ATOM 11273 H HG   . LEU A 1 22  ? -0.246  4.439   -3.210  1.00 0.00 ? 22  LEU A HG   7  
ATOM 11274 H HD11 . LEU A 1 22  ? -3.090  4.626   -4.108  1.00 0.00 ? 22  LEU A HD11 7  
ATOM 11275 H HD12 . LEU A 1 22  ? -2.192  3.155   -4.482  1.00 0.00 ? 22  LEU A HD12 7  
ATOM 11276 H HD13 . LEU A 1 22  ? -2.384  3.667   -2.806  1.00 0.00 ? 22  LEU A HD13 7  
ATOM 11277 H HD21 . LEU A 1 22  ? 0.166   5.571   -5.594  1.00 0.00 ? 22  LEU A HD21 7  
ATOM 11278 H HD22 . LEU A 1 22  ? 0.266   3.824   -5.378  1.00 0.00 ? 22  LEU A HD22 7  
ATOM 11279 H HD23 . LEU A 1 22  ? -1.199  4.548   -6.040  1.00 0.00 ? 22  LEU A HD23 7  
ATOM 11280 N N    . GLY A 1 23  ? 0.220   9.516   -3.387  1.00 0.00 ? 23  GLY A N    7  
ATOM 11281 C CA   . GLY A 1 23  ? 0.156   10.771  -2.584  1.00 0.00 ? 23  GLY A CA   7  
ATOM 11282 C C    . GLY A 1 23  ? -1.262  10.969  -2.048  1.00 0.00 ? 23  GLY A C    7  
ATOM 11283 O O    . GLY A 1 23  ? -2.078  10.069  -2.075  1.00 0.00 ? 23  GLY A O    7  
ATOM 11284 H H    . GLY A 1 23  ? 0.465   9.555   -4.335  1.00 0.00 ? 23  GLY A H    7  
ATOM 11285 H HA2  . GLY A 1 23  ? 0.847   10.702  -1.757  1.00 0.00 ? 23  GLY A HA2  7  
ATOM 11286 H HA3  . GLY A 1 23  ? 0.421   11.611  -3.207  1.00 0.00 ? 23  GLY A HA3  7  
ATOM 11287 N N    . LEU A 1 24  ? -1.560  12.142  -1.560  1.00 0.00 ? 24  LEU A N    7  
ATOM 11288 C CA   . LEU A 1 24  ? -2.924  12.401  -1.019  1.00 0.00 ? 24  LEU A CA   7  
ATOM 11289 C C    . LEU A 1 24  ? -3.612  13.475  -1.863  1.00 0.00 ? 24  LEU A C    7  
ATOM 11290 O O    . LEU A 1 24  ? -4.599  14.058  -1.458  1.00 0.00 ? 24  LEU A O    7  
ATOM 11291 C CB   . LEU A 1 24  ? -2.816  12.883  0.432   1.00 0.00 ? 24  LEU A CB   7  
ATOM 11292 C CG   . LEU A 1 24  ? -1.592  12.246  1.094   1.00 0.00 ? 24  LEU A CG   7  
ATOM 11293 C CD1  . LEU A 1 24  ? -0.404  13.207  1.008   1.00 0.00 ? 24  LEU A CD1  7  
ATOM 11294 C CD2  . LEU A 1 24  ? -1.902  11.951  2.564   1.00 0.00 ? 24  LEU A CD2  7  
ATOM 11295 H H    . LEU A 1 24  ? -0.885  12.852  -1.547  1.00 0.00 ? 24  LEU A H    7  
ATOM 11296 H HA   . LEU A 1 24  ? -3.503  11.490  -1.054  1.00 0.00 ? 24  LEU A HA   7  
ATOM 11297 H HB2  . LEU A 1 24  ? -2.718  13.959  0.446   1.00 0.00 ? 24  LEU A HB2  7  
ATOM 11298 H HB3  . LEU A 1 24  ? -3.706  12.596  0.972   1.00 0.00 ? 24  LEU A HB3  7  
ATOM 11299 H HG   . LEU A 1 24  ? -1.346  11.326  0.584   1.00 0.00 ? 24  LEU A HG   7  
ATOM 11300 H HD11 . LEU A 1 24  ? -0.666  14.049  0.384   1.00 0.00 ? 24  LEU A HD11 7  
ATOM 11301 H HD12 . LEU A 1 24  ? -0.152  13.558  1.998   1.00 0.00 ? 24  LEU A HD12 7  
ATOM 11302 H HD13 . LEU A 1 24  ? 0.444   12.693  0.581   1.00 0.00 ? 24  LEU A HD13 7  
ATOM 11303 H HD21 . LEU A 1 24  ? -2.530  12.732  2.964   1.00 0.00 ? 24  LEU A HD21 7  
ATOM 11304 H HD22 . LEU A 1 24  ? -2.412  11.003  2.641   1.00 0.00 ? 24  LEU A HD22 7  
ATOM 11305 H HD23 . LEU A 1 24  ? -0.980  11.908  3.124   1.00 0.00 ? 24  LEU A HD23 7  
ATOM 11306 N N    . ASP A 1 25  ? -3.102  13.741  -3.033  1.00 0.00 ? 25  ASP A N    7  
ATOM 11307 C CA   . ASP A 1 25  ? -3.729  14.777  -3.901  1.00 0.00 ? 25  ASP A CA   7  
ATOM 11308 C C    . ASP A 1 25  ? -4.669  14.102  -4.902  1.00 0.00 ? 25  ASP A C    7  
ATOM 11309 O O    . ASP A 1 25  ? -5.646  14.676  -5.337  1.00 0.00 ? 25  ASP A O    7  
ATOM 11310 C CB   . ASP A 1 25  ? -2.637  15.537  -4.657  1.00 0.00 ? 25  ASP A CB   7  
ATOM 11311 C CG   . ASP A 1 25  ? -1.712  16.231  -3.655  1.00 0.00 ? 25  ASP A CG   7  
ATOM 11312 O OD1  . ASP A 1 25  ? -1.779  15.894  -2.484  1.00 0.00 ? 25  ASP A OD1  7  
ATOM 11313 O OD2  . ASP A 1 25  ? -0.954  17.090  -4.075  1.00 0.00 ? 25  ASP A OD2  7  
ATOM 11314 H H    . ASP A 1 25  ? -2.306  13.260  -3.342  1.00 0.00 ? 25  ASP A H    7  
ATOM 11315 H HA   . ASP A 1 25  ? -4.291  15.468  -3.290  1.00 0.00 ? 25  ASP A HA   7  
ATOM 11316 H HB2  . ASP A 1 25  ? -2.065  14.844  -5.256  1.00 0.00 ? 25  ASP A HB2  7  
ATOM 11317 H HB3  . ASP A 1 25  ? -3.092  16.278  -5.297  1.00 0.00 ? 25  ASP A HB3  7  
ATOM 11318 N N    . GLY A 1 26  ? -4.379  12.884  -5.271  1.00 0.00 ? 26  GLY A N    7  
ATOM 11319 C CA   . GLY A 1 26  ? -5.254  12.168  -6.243  1.00 0.00 ? 26  GLY A CA   7  
ATOM 11320 C C    . GLY A 1 26  ? -4.386  11.437  -7.268  1.00 0.00 ? 26  GLY A C    7  
ATOM 11321 O O    . GLY A 1 26  ? -4.791  10.451  -7.850  1.00 0.00 ? 26  GLY A O    7  
ATOM 11322 H H    . GLY A 1 26  ? -3.585  12.438  -4.908  1.00 0.00 ? 26  GLY A H    7  
ATOM 11323 H HA2  . GLY A 1 26  ? -5.870  11.454  -5.716  1.00 0.00 ? 26  GLY A HA2  7  
ATOM 11324 H HA3  . GLY A 1 26  ? -5.884  12.881  -6.755  1.00 0.00 ? 26  GLY A HA3  7  
ATOM 11325 N N    . ASN A 1 27  ? -3.191  11.912  -7.489  1.00 0.00 ? 27  ASN A N    7  
ATOM 11326 C CA   . ASN A 1 27  ? -2.291  11.249  -8.473  1.00 0.00 ? 27  ASN A CA   7  
ATOM 11327 C C    . ASN A 1 27  ? -1.284  10.369  -7.730  1.00 0.00 ? 27  ASN A C    7  
ATOM 11328 O O    . ASN A 1 27  ? -1.469  10.040  -6.575  1.00 0.00 ? 27  ASN A O    7  
ATOM 11329 C CB   . ASN A 1 27  ? -1.544  12.319  -9.274  1.00 0.00 ? 27  ASN A CB   7  
ATOM 11330 C CG   . ASN A 1 27  ? -0.816  13.258  -8.310  1.00 0.00 ? 27  ASN A CG   7  
ATOM 11331 O OD1  . ASN A 1 27  ? -0.581  12.912  -7.169  1.00 0.00 ? 27  ASN A OD1  7  
ATOM 11332 N ND2  . ASN A 1 27  ? -0.447  14.439  -8.723  1.00 0.00 ? 27  ASN A ND2  7  
ATOM 11333 H H    . ASN A 1 27  ? -2.885  12.708  -7.007  1.00 0.00 ? 27  ASN A H    7  
ATOM 11334 H HA   . ASN A 1 27  ? -2.877  10.639  -9.145  1.00 0.00 ? 27  ASN A HA   7  
ATOM 11335 H HB2  . ASN A 1 27  ? -0.827  11.845  -9.930  1.00 0.00 ? 27  ASN A HB2  7  
ATOM 11336 H HB3  . ASN A 1 27  ? -2.249  12.886  -9.861  1.00 0.00 ? 27  ASN A HB3  7  
ATOM 11337 H HD21 . ASN A 1 27  ? -0.636  14.718  -9.643  1.00 0.00 ? 27  ASN A HD21 7  
ATOM 11338 H HD22 . ASN A 1 27  ? 0.017   15.048  -8.112  1.00 0.00 ? 27  ASN A HD22 7  
ATOM 11339 N N    . THR A 1 28  ? -0.219  9.983   -8.379  1.00 0.00 ? 28  THR A N    7  
ATOM 11340 C CA   . THR A 1 28  ? 0.793   9.122   -7.704  1.00 0.00 ? 28  THR A CA   7  
ATOM 11341 C C    . THR A 1 28  ? 2.186   9.730   -7.883  1.00 0.00 ? 28  THR A C    7  
ATOM 11342 O O    . THR A 1 28  ? 2.548   10.170  -8.956  1.00 0.00 ? 28  THR A O    7  
ATOM 11343 C CB   . THR A 1 28  ? 0.767   7.724   -8.324  1.00 0.00 ? 28  THR A CB   7  
ATOM 11344 O OG1  . THR A 1 28  ? -0.573  7.252   -8.374  1.00 0.00 ? 28  THR A OG1  7  
ATOM 11345 C CG2  . THR A 1 28  ? 1.617   6.773   -7.480  1.00 0.00 ? 28  THR A CG2  7  
ATOM 11346 H H    . THR A 1 28  ? -0.086  10.257  -9.310  1.00 0.00 ? 28  THR A H    7  
ATOM 11347 H HA   . THR A 1 28  ? 0.563   9.054   -6.651  1.00 0.00 ? 28  THR A HA   7  
ATOM 11348 H HB   . THR A 1 28  ? 1.171   7.766   -9.325  1.00 0.00 ? 28  THR A HB   7  
ATOM 11349 H HG1  . THR A 1 28  ? -0.927  7.271   -7.482  1.00 0.00 ? 28  THR A HG1  7  
ATOM 11350 H HG21 . THR A 1 28  ? 1.619   7.107   -6.454  1.00 0.00 ? 28  THR A HG21 7  
ATOM 11351 H HG22 . THR A 1 28  ? 1.204   5.777   -7.534  1.00 0.00 ? 28  THR A HG22 7  
ATOM 11352 H HG23 . THR A 1 28  ? 2.629   6.763   -7.858  1.00 0.00 ? 28  THR A HG23 7  
ATOM 11353 N N    . TRP A 1 29  ? 2.975   9.751   -6.842  1.00 0.00 ? 29  TRP A N    7  
ATOM 11354 C CA   . TRP A 1 29  ? 4.346   10.321  -6.961  1.00 0.00 ? 29  TRP A CA   7  
ATOM 11355 C C    . TRP A 1 29  ? 5.263   9.278   -7.600  1.00 0.00 ? 29  TRP A C    7  
ATOM 11356 O O    . TRP A 1 29  ? 6.022   9.570   -8.502  1.00 0.00 ? 29  TRP A O    7  
ATOM 11357 C CB   . TRP A 1 29  ? 4.877   10.679  -5.571  1.00 0.00 ? 29  TRP A CB   7  
ATOM 11358 C CG   . TRP A 1 29  ? 4.143   11.870  -5.047  1.00 0.00 ? 29  TRP A CG   7  
ATOM 11359 C CD1  . TRP A 1 29  ? 3.344   12.678  -5.782  1.00 0.00 ? 29  TRP A CD1  7  
ATOM 11360 C CD2  . TRP A 1 29  ? 4.129   12.401  -3.691  1.00 0.00 ? 29  TRP A CD2  7  
ATOM 11361 N NE1  . TRP A 1 29  ? 2.838   13.671  -4.962  1.00 0.00 ? 29  TRP A NE1  7  
ATOM 11362 C CE2  . TRP A 1 29  ? 3.293   13.543  -3.665  1.00 0.00 ? 29  TRP A CE2  7  
ATOM 11363 C CE3  . TRP A 1 29  ? 4.751   12.007  -2.493  1.00 0.00 ? 29  TRP A CE3  7  
ATOM 11364 C CZ2  . TRP A 1 29  ? 3.083   14.269  -2.492  1.00 0.00 ? 29  TRP A CZ2  7  
ATOM 11365 C CZ3  . TRP A 1 29  ? 4.542   12.736  -1.310  1.00 0.00 ? 29  TRP A CZ3  7  
ATOM 11366 C CH2  . TRP A 1 29  ? 3.710   13.864  -1.310  1.00 0.00 ? 29  TRP A CH2  7  
ATOM 11367 H H    . TRP A 1 29  ? 2.668   9.385   -5.986  1.00 0.00 ? 29  TRP A H    7  
ATOM 11368 H HA   . TRP A 1 29  ? 4.318   11.205  -7.579  1.00 0.00 ? 29  TRP A HA   7  
ATOM 11369 H HB2  . TRP A 1 29  ? 4.729   9.843   -4.903  1.00 0.00 ? 29  TRP A HB2  7  
ATOM 11370 H HB3  . TRP A 1 29  ? 5.931   10.906  -5.635  1.00 0.00 ? 29  TRP A HB3  7  
ATOM 11371 H HD1  . TRP A 1 29  ? 3.134   12.565  -6.835  1.00 0.00 ? 29  TRP A HD1  7  
ATOM 11372 H HE1  . TRP A 1 29  ? 2.232   14.385  -5.248  1.00 0.00 ? 29  TRP A HE1  7  
ATOM 11373 H HE3  . TRP A 1 29  ? 5.396   11.141  -2.483  1.00 0.00 ? 29  TRP A HE3  7  
ATOM 11374 H HZ2  . TRP A 1 29  ? 2.440   15.136  -2.497  1.00 0.00 ? 29  TRP A HZ2  7  
ATOM 11375 H HZ3  . TRP A 1 29  ? 5.025   12.425  -0.395  1.00 0.00 ? 29  TRP A HZ3  7  
ATOM 11376 H HH2  . TRP A 1 29  ? 3.552   14.419  -0.398  1.00 0.00 ? 29  TRP A HH2  7  
ATOM 11377 N N    . ALA A 1 30  ? 5.190   8.060   -7.140  1.00 0.00 ? 30  ALA A N    7  
ATOM 11378 C CA   . ALA A 1 30  ? 6.047   6.990   -7.722  1.00 0.00 ? 30  ALA A CA   7  
ATOM 11379 C C    . ALA A 1 30  ? 5.207   5.725   -7.896  1.00 0.00 ? 30  ALA A C    7  
ATOM 11380 O O    . ALA A 1 30  ? 4.434   5.361   -7.032  1.00 0.00 ? 30  ALA A O    7  
ATOM 11381 C CB   . ALA A 1 30  ? 7.220   6.702   -6.782  1.00 0.00 ? 30  ALA A CB   7  
ATOM 11382 H H    . ALA A 1 30  ? 4.565   7.846   -6.415  1.00 0.00 ? 30  ALA A H    7  
ATOM 11383 H HA   . ALA A 1 30  ? 6.422   7.309   -8.683  1.00 0.00 ? 30  ALA A HA   7  
ATOM 11384 H HB1  . ALA A 1 30  ? 6.903   6.832   -5.757  1.00 0.00 ? 30  ALA A HB1  7  
ATOM 11385 H HB2  . ALA A 1 30  ? 7.559   5.687   -6.928  1.00 0.00 ? 30  ALA A HB2  7  
ATOM 11386 H HB3  . ALA A 1 30  ? 8.029   7.385   -6.997  1.00 0.00 ? 30  ALA A HB3  7  
ATOM 11387 N N    . THR A 1 31  ? 5.338   5.053   -9.006  1.00 0.00 ? 31  THR A N    7  
ATOM 11388 C CA   . THR A 1 31  ? 4.528   3.818   -9.216  1.00 0.00 ? 31  THR A CA   7  
ATOM 11389 C C    . THR A 1 31  ? 5.358   2.772   -9.961  1.00 0.00 ? 31  THR A C    7  
ATOM 11390 O O    . THR A 1 31  ? 6.415   3.057   -10.487 1.00 0.00 ? 31  THR A O    7  
ATOM 11391 C CB   . THR A 1 31  ? 3.253   4.144   -10.020 1.00 0.00 ? 31  THR A CB   7  
ATOM 11392 O OG1  . THR A 1 31  ? 3.170   3.285   -11.150 1.00 0.00 ? 31  THR A OG1  7  
ATOM 11393 C CG2  . THR A 1 31  ? 3.274   5.601   -10.493 1.00 0.00 ? 31  THR A CG2  7  
ATOM 11394 H H    . THR A 1 31  ? 5.960   5.360   -9.699  1.00 0.00 ? 31  THR A H    7  
ATOM 11395 H HA   . THR A 1 31  ? 4.247   3.419   -8.252  1.00 0.00 ? 31  THR A HA   7  
ATOM 11396 H HB   . THR A 1 31  ? 2.389   3.989   -9.392  1.00 0.00 ? 31  THR A HB   7  
ATOM 11397 H HG1  . THR A 1 31  ? 2.342   2.801   -11.094 1.00 0.00 ? 31  THR A HG1  7  
ATOM 11398 H HG21 . THR A 1 31  ? 4.266   5.854   -10.836 1.00 0.00 ? 31  THR A HG21 7  
ATOM 11399 H HG22 . THR A 1 31  ? 2.570   5.727   -11.301 1.00 0.00 ? 31  THR A HG22 7  
ATOM 11400 H HG23 . THR A 1 31  ? 3.002   6.248   -9.673  1.00 0.00 ? 31  THR A HG23 7  
ATOM 11401 N N    . SER A 1 32  ? 4.879   1.560   -10.002 1.00 0.00 ? 32  SER A N    7  
ATOM 11402 C CA   . SER A 1 32  ? 5.620   0.475   -10.703 1.00 0.00 ? 32  SER A CA   7  
ATOM 11403 C C    . SER A 1 32  ? 4.868   -0.840  -10.503 1.00 0.00 ? 32  SER A C    7  
ATOM 11404 O O    . SER A 1 32  ? 5.401   -1.805  -9.992  1.00 0.00 ? 32  SER A O    7  
ATOM 11405 C CB   . SER A 1 32  ? 7.027   0.355   -10.116 1.00 0.00 ? 32  SER A CB   7  
ATOM 11406 O OG   . SER A 1 32  ? 7.986   0.656   -11.121 1.00 0.00 ? 32  SER A OG   7  
ATOM 11407 H H    . SER A 1 32  ? 4.024   1.361   -9.567  1.00 0.00 ? 32  SER A H    7  
ATOM 11408 H HA   . SER A 1 32  ? 5.684   0.702   -11.757 1.00 0.00 ? 32  SER A HA   7  
ATOM 11409 H HB2  . SER A 1 32  ? 7.139   1.051   -9.301  1.00 0.00 ? 32  SER A HB2  7  
ATOM 11410 H HB3  . SER A 1 32  ? 7.177   -0.652  -9.749  1.00 0.00 ? 32  SER A HB3  7  
ATOM 11411 H HG   . SER A 1 32  ? 7.879   0.022   -11.834 1.00 0.00 ? 32  SER A HG   7  
ATOM 11412 N N    . ALA A 1 33  ? 3.624   -0.881  -10.895 1.00 0.00 ? 33  ALA A N    7  
ATOM 11413 C CA   . ALA A 1 33  ? 2.828   -2.127  -10.722 1.00 0.00 ? 33  ALA A CA   7  
ATOM 11414 C C    . ALA A 1 33  ? 2.336   -2.615  -12.085 1.00 0.00 ? 33  ALA A C    7  
ATOM 11415 O O    . ALA A 1 33  ? 3.014   -2.477  -13.083 1.00 0.00 ? 33  ALA A O    7  
ATOM 11416 C CB   . ALA A 1 33  ? 1.631   -1.841  -9.813  1.00 0.00 ? 33  ALA A CB   7  
ATOM 11417 H H    . ALA A 1 33  ? 3.212   -0.088  -11.296 1.00 0.00 ? 33  ALA A H    7  
ATOM 11418 H HA   . ALA A 1 33  ? 3.448   -2.887  -10.272 1.00 0.00 ? 33  ALA A HA   7  
ATOM 11419 H HB1  . ALA A 1 33  ? 1.965   -1.315  -8.930  1.00 0.00 ? 33  ALA A HB1  7  
ATOM 11420 H HB2  . ALA A 1 33  ? 0.913   -1.233  -10.343 1.00 0.00 ? 33  ALA A HB2  7  
ATOM 11421 H HB3  . ALA A 1 33  ? 1.168   -2.773  -9.522  1.00 0.00 ? 33  ALA A HB3  7  
ATOM 11422 N N    . GLY A 1 34  ? 1.164   -3.190  -12.137 1.00 0.00 ? 34  GLY A N    7  
ATOM 11423 C CA   . GLY A 1 34  ? 0.641   -3.690  -13.440 1.00 0.00 ? 34  GLY A CA   7  
ATOM 11424 C C    . GLY A 1 34  ? -0.793  -3.196  -13.649 1.00 0.00 ? 34  GLY A C    7  
ATOM 11425 O O    . GLY A 1 34  ? -1.468  -3.600  -14.574 1.00 0.00 ? 34  GLY A O    7  
ATOM 11426 H H    . GLY A 1 34  ? 0.631   -3.298  -11.322 1.00 0.00 ? 34  GLY A H    7  
ATOM 11427 H HA2  . GLY A 1 34  ? 1.267   -3.325  -14.241 1.00 0.00 ? 34  GLY A HA2  7  
ATOM 11428 H HA3  . GLY A 1 34  ? 0.650   -4.769  -13.439 1.00 0.00 ? 34  GLY A HA3  7  
ATOM 11429 N N    . PHE A 1 35  ? -1.264  -2.325  -12.797 1.00 0.00 ? 35  PHE A N    7  
ATOM 11430 C CA   . PHE A 1 35  ? -2.653  -1.807  -12.952 1.00 0.00 ? 35  PHE A CA   7  
ATOM 11431 C C    . PHE A 1 35  ? -2.653  -0.285  -12.778 1.00 0.00 ? 35  PHE A C    7  
ATOM 11432 O O    . PHE A 1 35  ? -1.634  0.318   -12.506 1.00 0.00 ? 35  PHE A O    7  
ATOM 11433 C CB   . PHE A 1 35  ? -3.563  -2.440  -11.895 1.00 0.00 ? 35  PHE A CB   7  
ATOM 11434 C CG   . PHE A 1 35  ? -2.905  -2.357  -10.537 1.00 0.00 ? 35  PHE A CG   7  
ATOM 11435 C CD1  . PHE A 1 35  ? -3.000  -1.178  -9.786  1.00 0.00 ? 35  PHE A CD1  7  
ATOM 11436 C CD2  . PHE A 1 35  ? -2.208  -3.458  -10.026 1.00 0.00 ? 35  PHE A CD2  7  
ATOM 11437 C CE1  . PHE A 1 35  ? -2.395  -1.102  -8.525  1.00 0.00 ? 35  PHE A CE1  7  
ATOM 11438 C CE2  . PHE A 1 35  ? -1.602  -3.380  -8.766  1.00 0.00 ? 35  PHE A CE2  7  
ATOM 11439 C CZ   . PHE A 1 35  ? -1.696  -2.203  -8.015  1.00 0.00 ? 35  PHE A CZ   7  
ATOM 11440 H H    . PHE A 1 35  ? -0.703  -2.012  -12.058 1.00 0.00 ? 35  PHE A H    7  
ATOM 11441 H HA   . PHE A 1 35  ? -3.021  -2.054  -13.937 1.00 0.00 ? 35  PHE A HA   7  
ATOM 11442 H HB2  . PHE A 1 35  ? -4.505  -1.910  -11.871 1.00 0.00 ? 35  PHE A HB2  7  
ATOM 11443 H HB3  . PHE A 1 35  ? -3.740  -3.475  -12.146 1.00 0.00 ? 35  PHE A HB3  7  
ATOM 11444 H HD1  . PHE A 1 35  ? -3.538  -0.329  -10.179 1.00 0.00 ? 35  PHE A HD1  7  
ATOM 11445 H HD2  . PHE A 1 35  ? -2.134  -4.367  -10.605 1.00 0.00 ? 35  PHE A HD2  7  
ATOM 11446 H HE1  . PHE A 1 35  ? -2.467  -0.194  -7.946  1.00 0.00 ? 35  PHE A HE1  7  
ATOM 11447 H HE2  . PHE A 1 35  ? -1.064  -4.230  -8.372  1.00 0.00 ? 35  PHE A HE2  7  
ATOM 11448 H HZ   . PHE A 1 35  ? -1.231  -2.142  -7.041  1.00 0.00 ? 35  PHE A HZ   7  
ATOM 11449 N N    . ALA A 1 36  ? -3.788  0.339   -12.936 1.00 0.00 ? 36  ALA A N    7  
ATOM 11450 C CA   . ALA A 1 36  ? -3.854  1.820   -12.783 1.00 0.00 ? 36  ALA A CA   7  
ATOM 11451 C C    . ALA A 1 36  ? -4.911  2.177   -11.734 1.00 0.00 ? 36  ALA A C    7  
ATOM 11452 O O    . ALA A 1 36  ? -6.070  1.843   -11.871 1.00 0.00 ? 36  ALA A O    7  
ATOM 11453 C CB   . ALA A 1 36  ? -4.229  2.454   -14.124 1.00 0.00 ? 36  ALA A CB   7  
ATOM 11454 H H    . ALA A 1 36  ? -4.598  -0.167  -13.157 1.00 0.00 ? 36  ALA A H    7  
ATOM 11455 H HA   . ALA A 1 36  ? -2.891  2.192   -12.465 1.00 0.00 ? 36  ALA A HA   7  
ATOM 11456 H HB1  . ALA A 1 36  ? -4.585  1.688   -14.798 1.00 0.00 ? 36  ALA A HB1  7  
ATOM 11457 H HB2  . ALA A 1 36  ? -5.005  3.189   -13.972 1.00 0.00 ? 36  ALA A HB2  7  
ATOM 11458 H HB3  . ALA A 1 36  ? -3.359  2.931   -14.551 1.00 0.00 ? 36  ALA A HB3  7  
ATOM 11459 N N    . VAL A 1 37  ? -4.519  2.851   -10.686 1.00 0.00 ? 37  VAL A N    7  
ATOM 11460 C CA   . VAL A 1 37  ? -5.503  3.223   -9.629  1.00 0.00 ? 37  VAL A CA   7  
ATOM 11461 C C    . VAL A 1 37  ? -6.159  4.559   -9.988  1.00 0.00 ? 37  VAL A C    7  
ATOM 11462 O O    . VAL A 1 37  ? -5.576  5.386   -10.660 1.00 0.00 ? 37  VAL A O    7  
ATOM 11463 C CB   . VAL A 1 37  ? -4.783  3.348   -8.285  1.00 0.00 ? 37  VAL A CB   7  
ATOM 11464 C CG1  . VAL A 1 37  ? -5.807  3.287   -7.152  1.00 0.00 ? 37  VAL A CG1  7  
ATOM 11465 C CG2  . VAL A 1 37  ? -3.786  2.195   -8.130  1.00 0.00 ? 37  VAL A CG2  7  
ATOM 11466 H H    . VAL A 1 37  ? -3.578  3.109   -10.592 1.00 0.00 ? 37  VAL A H    7  
ATOM 11467 H HA   . VAL A 1 37  ? -6.262  2.458   -9.560  1.00 0.00 ? 37  VAL A HA   7  
ATOM 11468 H HB   . VAL A 1 37  ? -4.257  4.290   -8.244  1.00 0.00 ? 37  VAL A HB   7  
ATOM 11469 H HG11 . VAL A 1 37  ? -6.427  2.411   -7.274  1.00 0.00 ? 37  VAL A HG11 7  
ATOM 11470 H HG12 . VAL A 1 37  ? -5.292  3.234   -6.204  1.00 0.00 ? 37  VAL A HG12 7  
ATOM 11471 H HG13 . VAL A 1 37  ? -6.425  4.172   -7.177  1.00 0.00 ? 37  VAL A HG13 7  
ATOM 11472 H HG21 . VAL A 1 37  ? -3.272  2.035   -9.067  1.00 0.00 ? 37  VAL A HG21 7  
ATOM 11473 H HG22 . VAL A 1 37  ? -3.068  2.440   -7.362  1.00 0.00 ? 37  VAL A HG22 7  
ATOM 11474 H HG23 . VAL A 1 37  ? -4.317  1.295   -7.853  1.00 0.00 ? 37  VAL A HG23 7  
ATOM 11475 N N    . THR A 1 38  ? -7.370  4.774   -9.547  1.00 0.00 ? 38  THR A N    7  
ATOM 11476 C CA   . THR A 1 38  ? -8.061  6.055   -9.868  1.00 0.00 ? 38  THR A CA   7  
ATOM 11477 C C    . THR A 1 38  ? -8.080  6.955   -8.629  1.00 0.00 ? 38  THR A C    7  
ATOM 11478 O O    . THR A 1 38  ? -7.949  6.481   -7.519  1.00 0.00 ? 38  THR A O    7  
ATOM 11479 C CB   . THR A 1 38  ? -9.499  5.767   -10.306 1.00 0.00 ? 38  THR A CB   7  
ATOM 11480 O OG1  . THR A 1 38  ? -10.012 4.676   -9.554  1.00 0.00 ? 38  THR A OG1  7  
ATOM 11481 C CG2  . THR A 1 38  ? -9.524  5.421   -11.795 1.00 0.00 ? 38  THR A CG2  7  
ATOM 11482 H H    . THR A 1 38  ? -7.825  4.095   -9.007  1.00 0.00 ? 38  THR A H    7  
ATOM 11483 H HA   . THR A 1 38  ? -7.536  6.556   -10.668 1.00 0.00 ? 38  THR A HA   7  
ATOM 11484 H HB   . THR A 1 38  ? -10.109 6.641   -10.134 1.00 0.00 ? 38  THR A HB   7  
ATOM 11485 H HG1  . THR A 1 38  ? -9.873  3.873   -10.064 1.00 0.00 ? 38  THR A HG1  7  
ATOM 11486 H HG21 . THR A 1 38  ? -8.620  5.780   -12.263 1.00 0.00 ? 38  THR A HG21 7  
ATOM 11487 H HG22 . THR A 1 38  ? -9.591  4.350   -11.914 1.00 0.00 ? 38  THR A HG22 7  
ATOM 11488 H HG23 . THR A 1 38  ? -10.381 5.888   -12.258 1.00 0.00 ? 38  THR A HG23 7  
ATOM 11489 N N    . PRO A 1 39  ? -8.245  8.233   -8.861  1.00 0.00 ? 39  PRO A N    7  
ATOM 11490 C CA   . PRO A 1 39  ? -8.287  9.229   -7.774  1.00 0.00 ? 39  PRO A CA   7  
ATOM 11491 C C    . PRO A 1 39  ? -9.487  8.969   -6.857  1.00 0.00 ? 39  PRO A C    7  
ATOM 11492 O O    . PRO A 1 39  ? -9.450  9.249   -5.675  1.00 0.00 ? 39  PRO A O    7  
ATOM 11493 C CB   . PRO A 1 39  ? -8.439  10.580  -8.489  1.00 0.00 ? 39  PRO A CB   7  
ATOM 11494 C CG   . PRO A 1 39  ? -8.513  10.304  -10.012 1.00 0.00 ? 39  PRO A CG   7  
ATOM 11495 C CD   . PRO A 1 39  ? -8.399  8.786   -10.218 1.00 0.00 ? 39  PRO A CD   7  
ATOM 11496 H HA   . PRO A 1 39  ? -7.370  9.214   -7.210  1.00 0.00 ? 39  PRO A HA   7  
ATOM 11497 H HB2  . PRO A 1 39  ? -9.345  11.068  -8.158  1.00 0.00 ? 39  PRO A HB2  7  
ATOM 11498 H HB3  . PRO A 1 39  ? -7.586  11.206  -8.277  1.00 0.00 ? 39  PRO A HB3  7  
ATOM 11499 H HG2  . PRO A 1 39  ? -9.458  10.657  -10.402 1.00 0.00 ? 39  PRO A HG2  7  
ATOM 11500 H HG3  . PRO A 1 39  ? -7.699  10.800  -10.517 1.00 0.00 ? 39  PRO A HG3  7  
ATOM 11501 H HD2  . PRO A 1 39  ? -9.296  8.403   -10.686 1.00 0.00 ? 39  PRO A HD2  7  
ATOM 11502 H HD3  . PRO A 1 39  ? -7.531  8.551   -10.817 1.00 0.00 ? 39  PRO A HD3  7  
ATOM 11503 N N    . ALA A 1 40  ? -10.555 8.443   -7.394  1.00 0.00 ? 40  ALA A N    7  
ATOM 11504 C CA   . ALA A 1 40  ? -11.758 8.171   -6.554  1.00 0.00 ? 40  ALA A CA   7  
ATOM 11505 C C    . ALA A 1 40  ? -11.403 7.194   -5.425  1.00 0.00 ? 40  ALA A C    7  
ATOM 11506 O O    . ALA A 1 40  ? -11.902 7.301   -4.323  1.00 0.00 ? 40  ALA A O    7  
ATOM 11507 C CB   . ALA A 1 40  ? -12.857 7.561   -7.425  1.00 0.00 ? 40  ALA A CB   7  
ATOM 11508 H H    . ALA A 1 40  ? -10.569 8.232   -8.352  1.00 0.00 ? 40  ALA A H    7  
ATOM 11509 H HA   . ALA A 1 40  ? -12.112 9.098   -6.128  1.00 0.00 ? 40  ALA A HA   7  
ATOM 11510 H HB1  . ALA A 1 40  ? -12.418 6.858   -8.117  1.00 0.00 ? 40  ALA A HB1  7  
ATOM 11511 H HB2  . ALA A 1 40  ? -13.571 7.050   -6.797  1.00 0.00 ? 40  ALA A HB2  7  
ATOM 11512 H HB3  . ALA A 1 40  ? -13.357 8.345   -7.975  1.00 0.00 ? 40  ALA A HB3  7  
ATOM 11513 N N    . GLN A 1 41  ? -10.557 6.235   -5.694  1.00 0.00 ? 41  GLN A N    7  
ATOM 11514 C CA   . GLN A 1 41  ? -10.186 5.249   -4.639  1.00 0.00 ? 41  GLN A CA   7  
ATOM 11515 C C    . GLN A 1 41  ? -9.113  5.843   -3.721  1.00 0.00 ? 41  GLN A C    7  
ATOM 11516 O O    . GLN A 1 41  ? -8.786  5.285   -2.692  1.00 0.00 ? 41  GLN A O    7  
ATOM 11517 C CB   . GLN A 1 41  ? -9.643  3.983   -5.305  1.00 0.00 ? 41  GLN A CB   7  
ATOM 11518 C CG   . GLN A 1 41  ? -10.720 3.384   -6.209  1.00 0.00 ? 41  GLN A CG   7  
ATOM 11519 C CD   . GLN A 1 41  ? -11.975 3.098   -5.383  1.00 0.00 ? 41  GLN A CD   7  
ATOM 11520 O OE1  . GLN A 1 41  ? -11.889 2.578   -4.288  1.00 0.00 ? 41  GLN A OE1  7  
ATOM 11521 N NE2  . GLN A 1 41  ? -13.145 3.417   -5.863  1.00 0.00 ? 41  GLN A NE2  7  
ATOM 11522 H H    . GLN A 1 41  ? -10.172 6.157   -6.590  1.00 0.00 ? 41  GLN A H    7  
ATOM 11523 H HA   . GLN A 1 41  ? -11.060 5.000   -4.056  1.00 0.00 ? 41  GLN A HA   7  
ATOM 11524 H HB2  . GLN A 1 41  ? -8.774  4.232   -5.896  1.00 0.00 ? 41  GLN A HB2  7  
ATOM 11525 H HB3  . GLN A 1 41  ? -9.372  3.264   -4.547  1.00 0.00 ? 41  GLN A HB3  7  
ATOM 11526 H HG2  . GLN A 1 41  ? -10.958 4.084   -6.998  1.00 0.00 ? 41  GLN A HG2  7  
ATOM 11527 H HG3  . GLN A 1 41  ? -10.358 2.464   -6.642  1.00 0.00 ? 41  GLN A HG3  7  
ATOM 11528 H HE21 . GLN A 1 41  ? -13.215 3.837   -6.746  1.00 0.00 ? 41  GLN A HE21 7  
ATOM 11529 H HE22 . GLN A 1 41  ? -13.954 3.238   -5.340  1.00 0.00 ? 41  GLN A HE22 7  
ATOM 11530 N N    . GLY A 1 42  ? -8.558  6.965   -4.085  1.00 0.00 ? 42  GLY A N    7  
ATOM 11531 C CA   . GLY A 1 42  ? -7.503  7.585   -3.232  1.00 0.00 ? 42  GLY A CA   7  
ATOM 11532 C C    . GLY A 1 42  ? -8.145  8.233   -2.003  1.00 0.00 ? 42  GLY A C    7  
ATOM 11533 O O    . GLY A 1 42  ? -7.577  8.243   -0.929  1.00 0.00 ? 42  GLY A O    7  
ATOM 11534 H H    . GLY A 1 42  ? -8.831  7.398   -4.920  1.00 0.00 ? 42  GLY A H    7  
ATOM 11535 H HA2  . GLY A 1 42  ? -6.805  6.824   -2.915  1.00 0.00 ? 42  GLY A HA2  7  
ATOM 11536 H HA3  . GLY A 1 42  ? -6.980  8.339   -3.799  1.00 0.00 ? 42  GLY A HA3  7  
ATOM 11537 N N    . GLN A 1 43  ? -9.320  8.780   -2.150  1.00 0.00 ? 43  GLN A N    7  
ATOM 11538 C CA   . GLN A 1 43  ? -9.987  9.428   -0.987  1.00 0.00 ? 43  GLN A CA   7  
ATOM 11539 C C    . GLN A 1 43  ? -10.627 8.359   -0.098  1.00 0.00 ? 43  GLN A C    7  
ATOM 11540 O O    . GLN A 1 43  ? -10.557 8.423   1.113   1.00 0.00 ? 43  GLN A O    7  
ATOM 11541 C CB   . GLN A 1 43  ? -11.067 10.390  -1.488  1.00 0.00 ? 43  GLN A CB   7  
ATOM 11542 C CG   . GLN A 1 43  ? -10.989 11.698  -0.695  1.00 0.00 ? 43  GLN A CG   7  
ATOM 11543 C CD   . GLN A 1 43  ? -11.927 12.732  -1.319  1.00 0.00 ? 43  GLN A CD   7  
ATOM 11544 O OE1  . GLN A 1 43  ? -13.121 12.520  -1.391  1.00 0.00 ? 43  GLN A OE1  7  
ATOM 11545 N NE2  . GLN A 1 43  ? -11.433 13.850  -1.774  1.00 0.00 ? 43  GLN A NE2  7  
ATOM 11546 H H    . GLN A 1 43  ? -9.762  8.766   -3.025  1.00 0.00 ? 43  GLN A H    7  
ATOM 11547 H HA   . GLN A 1 43  ? -9.255  9.978   -0.414  1.00 0.00 ? 43  GLN A HA   7  
ATOM 11548 H HB2  . GLN A 1 43  ? -10.908 10.594  -2.538  1.00 0.00 ? 43  GLN A HB2  7  
ATOM 11549 H HB3  . GLN A 1 43  ? -12.040 9.944   -1.348  1.00 0.00 ? 43  GLN A HB3  7  
ATOM 11550 H HG2  . GLN A 1 43  ? -11.284 11.515  0.328   1.00 0.00 ? 43  GLN A HG2  7  
ATOM 11551 H HG3  . GLN A 1 43  ? -9.978  12.073  -0.717  1.00 0.00 ? 43  GLN A HG3  7  
ATOM 11552 H HE21 . GLN A 1 43  ? -10.470 14.020  -1.716  1.00 0.00 ? 43  GLN A HE21 7  
ATOM 11553 H HE22 . GLN A 1 43  ? -12.025 14.520  -2.175  1.00 0.00 ? 43  GLN A HE22 7  
ATOM 11554 N N    . THR A 1 44  ? -11.248 7.376   -0.690  1.00 0.00 ? 44  THR A N    7  
ATOM 11555 C CA   . THR A 1 44  ? -11.890 6.306   0.124   1.00 0.00 ? 44  THR A CA   7  
ATOM 11556 C C    . THR A 1 44  ? -10.860 5.715   1.090   1.00 0.00 ? 44  THR A C    7  
ATOM 11557 O O    . THR A 1 44  ? -11.147 5.468   2.244   1.00 0.00 ? 44  THR A O    7  
ATOM 11558 C CB   . THR A 1 44  ? -12.409 5.205   -0.804  1.00 0.00 ? 44  THR A CB   7  
ATOM 11559 O OG1  . THR A 1 44  ? -13.254 5.780   -1.792  1.00 0.00 ? 44  THR A OG1  7  
ATOM 11560 C CG2  . THR A 1 44  ? -13.199 4.178   0.010   1.00 0.00 ? 44  THR A CG2  7  
ATOM 11561 H H    . THR A 1 44  ? -11.293 7.341   -1.668  1.00 0.00 ? 44  THR A H    7  
ATOM 11562 H HA   . THR A 1 44  ? -12.713 6.723   0.685   1.00 0.00 ? 44  THR A HA   7  
ATOM 11563 H HB   . THR A 1 44  ? -11.576 4.714   -1.282  1.00 0.00 ? 44  THR A HB   7  
ATOM 11564 H HG1  . THR A 1 44  ? -12.838 5.653   -2.647  1.00 0.00 ? 44  THR A HG1  7  
ATOM 11565 H HG21 . THR A 1 44  ? -12.853 4.187   1.033   1.00 0.00 ? 44  THR A HG21 7  
ATOM 11566 H HG22 . THR A 1 44  ? -14.249 4.426   -0.017  1.00 0.00 ? 44  THR A HG22 7  
ATOM 11567 H HG23 . THR A 1 44  ? -13.050 3.194   -0.411  1.00 0.00 ? 44  THR A HG23 7  
ATOM 11568 N N    . LEU A 1 45  ? -9.663  5.487   0.625   1.00 0.00 ? 45  LEU A N    7  
ATOM 11569 C CA   . LEU A 1 45  ? -8.615  4.912   1.514   1.00 0.00 ? 45  LEU A CA   7  
ATOM 11570 C C    . LEU A 1 45  ? -8.322  5.887   2.654   1.00 0.00 ? 45  LEU A C    7  
ATOM 11571 O O    . LEU A 1 45  ? -8.139  5.494   3.789   1.00 0.00 ? 45  LEU A O    7  
ATOM 11572 C CB   . LEU A 1 45  ? -7.338  4.679   0.705   1.00 0.00 ? 45  LEU A CB   7  
ATOM 11573 C CG   . LEU A 1 45  ? -6.780  3.294   1.024   1.00 0.00 ? 45  LEU A CG   7  
ATOM 11574 C CD1  . LEU A 1 45  ? -6.744  2.455   -0.254  1.00 0.00 ? 45  LEU A CD1  7  
ATOM 11575 C CD2  . LEU A 1 45  ? -5.362  3.434   1.583   1.00 0.00 ? 45  LEU A CD2  7  
ATOM 11576 H H    . LEU A 1 45  ? -9.454  5.693   -0.310  1.00 0.00 ? 45  LEU A H    7  
ATOM 11577 H HA   . LEU A 1 45  ? -8.961  3.974   1.921   1.00 0.00 ? 45  LEU A HA   7  
ATOM 11578 H HB2  . LEU A 1 45  ? -7.563  4.744   -0.350  1.00 0.00 ? 45  LEU A HB2  7  
ATOM 11579 H HB3  . LEU A 1 45  ? -6.605  5.429   0.965   1.00 0.00 ? 45  LEU A HB3  7  
ATOM 11580 H HG   . LEU A 1 45  ? -7.412  2.810   1.754   1.00 0.00 ? 45  LEU A HG   7  
ATOM 11581 H HD11 . LEU A 1 45  ? -6.377  3.058   -1.071  1.00 0.00 ? 45  LEU A HD11 7  
ATOM 11582 H HD12 . LEU A 1 45  ? -6.090  1.608   -0.110  1.00 0.00 ? 45  LEU A HD12 7  
ATOM 11583 H HD13 . LEU A 1 45  ? -7.740  2.105   -0.483  1.00 0.00 ? 45  LEU A HD13 7  
ATOM 11584 H HD21 . LEU A 1 45  ? -5.073  4.474   1.571   1.00 0.00 ? 45  LEU A HD21 7  
ATOM 11585 H HD22 . LEU A