data_2PTM
# 
_entry.id   2PTM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.347 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2PTM         
RCSB  RCSB042761   
WWPDB D_1000042761 
# 
_pdbx_database_status.entry_id                        2PTM 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-05-08 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Flynn, G.E.'   1 
'Black, K.D.'   2 
'Islas, L.D.'   3 
'Sankaran, B.'  4 
'Zagotta, W.N.' 5 
# 
_citation.id                        primary 
_citation.title                     'Structure and rearrangements in the carboxy-terminal region of SpIH channels.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            15 
_citation.page_first                671 
_citation.page_last                 682 
_citation.year                      2007 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17562314 
_citation.pdbx_database_id_DOI      10.1016/j.str.2007.04.008 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Flynn, G.E.'   1 ? 
primary 'Black, K.D.'   2 ? 
primary 'Islas, L.D.'   3 ? 
primary 'Sankaran, B.'  4 ? 
primary 'Zagotta, W.N.' 5 ? 
# 
_cell.entry_id           2PTM 
_cell.length_a           92.354 
_cell.length_b           92.354 
_cell.length_c           63.646 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PTM 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hyperpolarization-activated (Ih) channel' 23292.576 1   ? ? 'C-terminal region (residues 470-665)' ? 
2 non-polymer syn 'COBALT HEXAMMINE(III)'                    161.116   1   ? ? ?                                      ? 
3 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"     329.206   1   ? ? ?                                      ? 
4 water       nat water                                      18.015    204 ? ? ?                                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMDSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFV
GADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCE
TYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRLTRI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMDSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFV
GADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCE
TYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRLTRI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   SER n 
1 6   SER n 
1 7   SER n 
1 8   ARG n 
1 9   GLN n 
1 10  TYR n 
1 11  ARG n 
1 12  GLU n 
1 13  LYS n 
1 14  LEU n 
1 15  LYS n 
1 16  GLN n 
1 17  VAL n 
1 18  GLU n 
1 19  GLU n 
1 20  TYR n 
1 21  MET n 
1 22  GLN n 
1 23  TYR n 
1 24  ARG n 
1 25  LYS n 
1 26  LEU n 
1 27  PRO n 
1 28  SER n 
1 29  HIS n 
1 30  LEU n 
1 31  ARG n 
1 32  ASN n 
1 33  LYS n 
1 34  ILE n 
1 35  LEU n 
1 36  ASP n 
1 37  TYR n 
1 38  TYR n 
1 39  GLU n 
1 40  TYR n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  GLY n 
1 45  LYS n 
1 46  MET n 
1 47  PHE n 
1 48  ASP n 
1 49  GLU n 
1 50  ARG n 
1 51  HIS n 
1 52  ILE n 
1 53  PHE n 
1 54  ARG n 
1 55  GLU n 
1 56  VAL n 
1 57  SER n 
1 58  GLU n 
1 59  SER n 
1 60  ILE n 
1 61  ARG n 
1 62  GLN n 
1 63  ASP n 
1 64  VAL n 
1 65  ALA n 
1 66  ASN n 
1 67  TYR n 
1 68  ASN n 
1 69  CYS n 
1 70  ARG n 
1 71  ASP n 
1 72  LEU n 
1 73  VAL n 
1 74  ALA n 
1 75  SER n 
1 76  VAL n 
1 77  PRO n 
1 78  PHE n 
1 79  PHE n 
1 80  VAL n 
1 81  GLY n 
1 82  ALA n 
1 83  ASP n 
1 84  SER n 
1 85  ASN n 
1 86  PHE n 
1 87  VAL n 
1 88  THR n 
1 89  ARG n 
1 90  VAL n 
1 91  VAL n 
1 92  THR n 
1 93  LEU n 
1 94  LEU n 
1 95  GLU n 
1 96  PHE n 
1 97  GLU n 
1 98  VAL n 
1 99  PHE n 
1 100 GLN n 
1 101 PRO n 
1 102 ALA n 
1 103 ASP n 
1 104 TYR n 
1 105 VAL n 
1 106 ILE n 
1 107 GLN n 
1 108 GLU n 
1 109 GLY n 
1 110 THR n 
1 111 PHE n 
1 112 GLY n 
1 113 ASP n 
1 114 ARG n 
1 115 MET n 
1 116 PHE n 
1 117 PHE n 
1 118 ILE n 
1 119 GLN n 
1 120 GLN n 
1 121 GLY n 
1 122 ILE n 
1 123 VAL n 
1 124 ASP n 
1 125 ILE n 
1 126 ILE n 
1 127 MET n 
1 128 SER n 
1 129 ASP n 
1 130 GLY n 
1 131 VAL n 
1 132 ILE n 
1 133 ALA n 
1 134 THR n 
1 135 SER n 
1 136 LEU n 
1 137 SER n 
1 138 ASP n 
1 139 GLY n 
1 140 SER n 
1 141 TYR n 
1 142 PHE n 
1 143 GLY n 
1 144 GLU n 
1 145 ILE n 
1 146 CYS n 
1 147 LEU n 
1 148 LEU n 
1 149 THR n 
1 150 ARG n 
1 151 GLU n 
1 152 ARG n 
1 153 ARG n 
1 154 VAL n 
1 155 ALA n 
1 156 SER n 
1 157 VAL n 
1 158 LYS n 
1 159 CYS n 
1 160 GLU n 
1 161 THR n 
1 162 TYR n 
1 163 CYS n 
1 164 THR n 
1 165 LEU n 
1 166 PHE n 
1 167 SER n 
1 168 LEU n 
1 169 SER n 
1 170 VAL n 
1 171 GLN n 
1 172 HIS n 
1 173 PHE n 
1 174 ASN n 
1 175 GLN n 
1 176 VAL n 
1 177 LEU n 
1 178 ASP n 
1 179 GLU n 
1 180 PHE n 
1 181 PRO n 
1 182 ALA n 
1 183 MET n 
1 184 ARG n 
1 185 LYS n 
1 186 THR n 
1 187 MET n 
1 188 GLU n 
1 189 GLU n 
1 190 ILE n 
1 191 ALA n 
1 192 VAL n 
1 193 ARG n 
1 194 ARG n 
1 195 LEU n 
1 196 THR n 
1 197 ARG n 
1 198 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Strongylocentrotus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Strongylocentrotus purpuratus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7668 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl-21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHMalc2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    O76977_STRPU 
_struct_ref.pdbx_db_accession          O76977 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFVGA
DSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCETY
CTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRLTRI
;
_struct_ref.pdbx_align_begin           470 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2PTM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 198 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O76977 
_struct_ref_seq.db_align_beg                  470 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  665 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       470 
_struct_ref_seq.pdbx_auth_seq_align_end       665 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2PTM GLY A 1 ? UNP O76977 ? ? 'cloning artifact' 468 1 
1 2PTM ALA A 2 ? UNP O76977 ? ? 'cloning artifact' 469 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
NCO non-polymer         . 'COBALT HEXAMMINE(III)'                ?                  'Co H18 N6 3'     161.116 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2PTM 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.82 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;10 % w/v PEG 6000, 0.5 M NaCl, 20 % glycerol, 0.1 M HEPES, 10 mM hexamine cobalt trichloride, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-04-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97935 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_wavelength             0.97935 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
# 
_reflns.entry_id                     2PTM 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.93 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   21275 
_reflns.number_obs                   21201 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.074 
_reflns.pdbx_netI_over_sigmaI        30.5 
_reflns.B_iso_Wilson_estimate        30.440 
_reflns.pdbx_redundancy              13.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_CC_star                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.d_res_high             1.93 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    7.9 
_reflns_shell.pdbx_Rsym_value        0.30 
_reflns_shell.pdbx_redundancy        10.4 
_reflns_shell.number_unique_all      2077 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_CC_star           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.entry_id                                 2PTM 
_refine.ls_d_res_high                            1.930 
_refine.ls_d_res_low                             29.205 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_number_reflns_obs                     21201 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_percent_reflns_R_free                 5.140 
_refine.ls_number_reflns_R_free                  1089 
_refine.B_iso_mean                               41.330 
_refine.solvent_model_param_bsol                 79.142 
_refine.solvent_model_param_ksol                 0.368 
_refine.aniso_B[1][1]                            1.473 
_refine.aniso_B[2][2]                            1.473 
_refine.aniso_B[3][3]                            -2.945 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_stereochemistry_target_values       ml 
_refine.overall_FOM_work_R_set                   0.852 
_refine.B_iso_max                                99.940 
_refine.B_iso_min                                11.620 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     21201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1q5o' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_details                    ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1544 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             204 
_refine_hist.number_atoms_total               1777 
_refine_hist.d_res_high                       1.930 
_refine_hist.d_res_low                        29.205 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_angle_deg        ? 0.633 ? 1.000 'X-RAY DIFFRACTION' ? 
f_bond_d           ? 0.004 ? 1.000 'X-RAY DIFFRACTION' ? 
fHIRAL             ? 0.051 ? 1.000 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d ? 9.474 ? 1.000 'X-RAY DIFFRACTION' ? 
fLANE              ? 0.002 ? 1.000 'X-RAY DIFFRACTION' ? 
fonbonded          ? 4.266 ? 1.000 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2PTM 
_struct.title                     'Structure and rearrangements in the carboxy-terminal region of SpIH channels' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PTM 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
'ion channel, cyclic nucleotide binding domain, C-linker, cAMP, cGMP, spHCN1, HCN, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The biological assembly is a tetramer generated from the monomer 
in the asymmetric unit by the operations:  
Symmetry operation      Symm. ID.  (Pisa) 
 x,y,z                    1_555  
-y+1/2,x+1/2,z            3_555  
 y-1/2,-x+1/2,z           4_455  
-x,-y+1,z                 2_565
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? ARG A 24  ? ASP A 471 ARG A 491 1 ? 21 
HELX_P HELX_P2  2  PRO A 27  ? ARG A 43  ? PRO A 494 ARG A 510 1 ? 17 
HELX_P HELX_P3  3  GLU A 49  ? VAL A 56  ? GLU A 516 VAL A 523 1 ? 8  
HELX_P HELX_P4  4  SER A 57  ? CYS A 69  ? SER A 524 CYS A 536 1 ? 13 
HELX_P HELX_P5  5  CYS A 69  ? VAL A 76  ? CYS A 536 VAL A 543 1 ? 8  
HELX_P HELX_P6  6  PRO A 77  ? VAL A 80  ? PRO A 544 VAL A 547 5 ? 4  
HELX_P HELX_P7  7  ASP A 83  ? LEU A 94  ? ASP A 550 LEU A 561 1 ? 12 
HELX_P HELX_P8  8  GLU A 144 ? ARG A 150 ? GLU A 611 ARG A 617 1 ? 7  
HELX_P HELX_P9  9  VAL A 170 ? PHE A 180 ? VAL A 637 PHE A 647 1 ? 11 
HELX_P HELX_P10 10 PHE A 180 ? ARG A 193 ? PHE A 647 ARG A 660 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 95  ? PHE A 99  ? GLU A 562 PHE A 566 
A 2 CYS A 163 ? SER A 169 ? CYS A 630 SER A 636 
A 3 ARG A 114 ? GLN A 120 ? ARG A 581 GLN A 587 
A 4 TYR A 141 ? PHE A 142 ? TYR A 608 PHE A 609 
B 1 TYR A 104 ? ILE A 106 ? TYR A 571 ILE A 573 
B 2 SER A 156 ? CYS A 159 ? SER A 623 CYS A 626 
B 3 VAL A 123 ? ILE A 126 ? VAL A 590 ILE A 593 
B 4 ILE A 132 ? LEU A 136 ? ILE A 599 LEU A 603 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 97  ? N GLU A 564 O LEU A 165 ? O LEU A 632 
A 2 3 O THR A 164 ? O THR A 631 N GLN A 120 ? N GLN A 587 
A 3 4 N PHE A 116 ? N PHE A 583 O PHE A 142 ? O PHE A 609 
B 1 2 N ILE A 106 ? N ILE A 573 O VAL A 157 ? O VAL A 624 
B 2 3 O SER A 156 ? O SER A 623 N ILE A 126 ? N ILE A 593 
B 3 4 N ILE A 125 ? N ILE A 592 O THR A 134 ? O THR A 601 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NCO 301 ? 7  'BINDING SITE FOR RESIDUE NCO A 301' 
AC2 Software A CMP 401 ? 13 'BINDING SITE FOR RESIDUE CMP A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  HOH D .   ? HOH A 49  . ? 1_555 ? 
2  AC1 7  HOH D .   ? HOH A 56  . ? 1_555 ? 
3  AC1 7  ASP A 36  ? ASP A 503 . ? 1_555 ? 
4  AC1 7  GLU A 39  ? GLU A 506 . ? 1_555 ? 
5  AC1 7  ASP A 124 ? ASP A 591 . ? 7_555 ? 
6  AC1 7  SER A 135 ? SER A 602 . ? 7_555 ? 
7  AC1 7  GLU A 160 ? GLU A 627 . ? 7_555 ? 
8  AC2 13 HOH D .   ? HOH A 42  . ? 1_555 ? 
9  AC2 13 HOH D .   ? HOH A 99  . ? 1_555 ? 
10 AC2 13 ILE A 125 ? ILE A 592 . ? 1_555 ? 
11 AC2 13 THR A 134 ? THR A 601 . ? 1_555 ? 
12 AC2 13 PHE A 142 ? PHE A 609 . ? 1_555 ? 
13 AC2 13 GLY A 143 ? GLY A 610 . ? 1_555 ? 
14 AC2 13 GLU A 144 ? GLU A 611 . ? 1_555 ? 
15 AC2 13 ILE A 145 ? ILE A 612 . ? 1_555 ? 
16 AC2 13 CYS A 146 ? CYS A 613 . ? 1_555 ? 
17 AC2 13 ARG A 153 ? ARG A 620 . ? 1_555 ? 
18 AC2 13 VAL A 154 ? VAL A 621 . ? 1_555 ? 
19 AC2 13 ALA A 155 ? ALA A 622 . ? 1_555 ? 
20 AC2 13 ARG A 194 ? ARG A 661 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2PTM 
_atom_sites.fract_transf_matrix[1][1]   0.010828 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010828 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015712 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CO 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 4   ? 9.122  31.156 -16.241 1.00 66.85 ? 471 ASP A N     1 
ATOM   2    C  CA    . ASP A 1 4   ? 9.127  32.332 -17.106 1.00 68.21 ? 471 ASP A CA    1 
ATOM   3    C  C     . ASP A 1 4   ? 8.587  33.566 -16.388 1.00 66.19 ? 471 ASP A C     1 
ATOM   4    O  O     . ASP A 1 4   ? 9.143  34.656 -16.511 1.00 68.33 ? 471 ASP A O     1 
ATOM   5    C  CB    . ASP A 1 4   ? 8.335  32.065 -18.376 1.00 70.47 ? 471 ASP A CB    1 
ATOM   6    N  N     . SER A 1 5   ? 7.495  33.395 -15.649 1.00 62.72 ? 472 SER A N     1 
ATOM   7    C  CA    . SER A 1 5   ? 6.935  34.484 -14.849 1.00 61.12 ? 472 SER A CA    1 
ATOM   8    C  C     . SER A 1 5   ? 7.861  34.837 -13.678 1.00 56.69 ? 472 SER A C     1 
ATOM   9    O  O     . SER A 1 5   ? 7.969  36.001 -13.275 1.00 52.92 ? 472 SER A O     1 
ATOM   10   C  CB    . SER A 1 5   ? 5.548  34.111 -14.342 1.00 62.83 ? 472 SER A CB    1 
ATOM   11   N  N     . SER A 1 6   ? 8.525  33.822 -13.134 1.00 56.01 ? 473 SER A N     1 
ATOM   12   C  CA    . SER A 1 6   ? 9.475  34.025 -12.047 1.00 53.94 ? 473 SER A CA    1 
ATOM   13   C  C     . SER A 1 6   ? 10.737 34.721 -12.566 1.00 55.44 ? 473 SER A C     1 
ATOM   14   O  O     . SER A 1 6   ? 11.362 35.518 -11.859 1.00 54.90 ? 473 SER A O     1 
ATOM   15   C  CB    . SER A 1 6   ? 9.825  32.688 -11.393 1.00 53.05 ? 473 SER A CB    1 
ATOM   16   O  OG    . SER A 1 6   ? 10.496 31.832 -12.303 1.00 56.72 ? 473 SER A OG    1 
ATOM   17   N  N     . SER A 1 7   ? 11.098 34.423 -13.811 1.00 56.58 ? 474 SER A N     1 
ATOM   18   C  CA    . SER A 1 7   ? 12.264 35.029 -14.446 1.00 55.87 ? 474 SER A CA    1 
ATOM   19   C  C     . SER A 1 7   ? 12.038 36.507 -14.751 1.00 54.59 ? 474 SER A C     1 
ATOM   20   O  O     . SER A 1 7   ? 12.936 37.327 -14.561 1.00 50.53 ? 474 SER A O     1 
ATOM   21   C  CB    . SER A 1 7   ? 12.617 34.284 -15.733 1.00 55.18 ? 474 SER A CB    1 
ATOM   22   O  OG    . SER A 1 7   ? 12.912 32.927 -15.460 1.00 56.90 ? 474 SER A OG    1 
ATOM   23   N  N     . ARG A 1 8   ? 10.840 36.835 -15.234 1.00 55.58 ? 475 ARG A N     1 
ATOM   24   C  CA    . ARG A 1 8   ? 10.485 38.216 -15.543 1.00 56.29 ? 475 ARG A CA    1 
ATOM   25   C  C     . ARG A 1 8   ? 10.482 39.057 -14.272 1.00 59.25 ? 475 ARG A C     1 
ATOM   26   O  O     . ARG A 1 8   ? 10.925 40.203 -14.269 1.00 58.42 ? 475 ARG A O     1 
ATOM   27   C  CB    . ARG A 1 8   ? 9.119  38.278 -16.233 1.00 57.43 ? 475 ARG A CB    1 
ATOM   28   N  N     . GLN A 1 9   ? 9.982  38.469 -13.191 1.00 61.70 ? 476 GLN A N     1 
ATOM   29   C  CA    . GLN A 1 9   ? 9.930  39.139 -11.903 1.00 62.53 ? 476 GLN A CA    1 
ATOM   30   C  C     . GLN A 1 9   ? 11.334 39.573 -11.487 1.00 60.09 ? 476 GLN A C     1 
ATOM   31   O  O     . GLN A 1 9   ? 11.524 40.677 -10.973 1.00 62.69 ? 476 GLN A O     1 
ATOM   32   C  CB    . GLN A 1 9   ? 9.341  38.197 -10.850 1.00 68.70 ? 476 GLN A CB    1 
ATOM   33   C  CG    . GLN A 1 9   ? 8.993  38.860 -9.524  1.00 74.51 ? 476 GLN A CG    1 
ATOM   34   C  CD    . GLN A 1 9   ? 7.588  39.430 -9.506  1.00 80.53 ? 476 GLN A CD    1 
ATOM   35   O  OE1   . GLN A 1 9   ? 6.815  39.240 -10.446 1.00 83.08 ? 476 GLN A OE1   1 
ATOM   36   N  NE2   . GLN A 1 9   ? 7.246  40.128 -8.428  1.00 82.92 ? 476 GLN A NE2   1 
ATOM   37   N  N     . TYR A 1 10  ? 12.310 38.699 -11.729 1.00 52.95 ? 477 TYR A N     1 
ATOM   38   C  CA    . TYR A 1 10  ? 13.702 38.927 -11.315 1.00 48.55 ? 477 TYR A CA    1 
ATOM   39   C  C     . TYR A 1 10  ? 14.411 39.982 -12.161 1.00 48.17 ? 477 TYR A C     1 
ATOM   40   O  O     . TYR A 1 10  ? 15.130 40.829 -11.630 1.00 47.53 ? 477 TYR A O     1 
ATOM   41   C  CB    . TYR A 1 10  ? 14.489 37.617 -11.365 1.00 41.79 ? 477 TYR A CB    1 
ATOM   42   C  CG    . TYR A 1 10  ? 15.962 37.756 -11.042 1.00 39.71 ? 477 TYR A CG    1 
ATOM   43   C  CD1   . TYR A 1 10  ? 16.424 37.594 -9.747  1.00 37.75 ? 477 TYR A CD1   1 
ATOM   44   C  CD2   . TYR A 1 10  ? 16.890 38.037 -12.038 1.00 38.79 ? 477 TYR A CD2   1 
ATOM   45   C  CE1   . TYR A 1 10  ? 17.772 37.712 -9.445  1.00 38.14 ? 477 TYR A CE1   1 
ATOM   46   C  CE2   . TYR A 1 10  ? 18.236 38.158 -11.748 1.00 36.65 ? 477 TYR A CE2   1 
ATOM   47   C  CZ    . TYR A 1 10  ? 18.668 37.997 -10.450 1.00 35.92 ? 477 TYR A CZ    1 
ATOM   48   O  OH    . TYR A 1 10  ? 20.006 38.115 -10.164 1.00 36.58 ? 477 TYR A OH    1 
ATOM   49   N  N     . ARG A 1 11  ? 14.228 39.908 -13.478 1.00 47.94 ? 478 ARG A N     1 
ATOM   50   C  CA    . ARG A 1 11  ? 14.820 40.883 -14.383 1.00 51.23 ? 478 ARG A CA    1 
ATOM   51   C  C     . ARG A 1 11  ? 14.220 42.249 -14.085 1.00 56.28 ? 478 ARG A C     1 
ATOM   52   O  O     . ARG A 1 11  ? 14.921 43.262 -14.068 1.00 53.99 ? 478 ARG A O     1 
ATOM   53   C  CB    . ARG A 1 11  ? 14.570 40.487 -15.841 1.00 50.80 ? 478 ARG A CB    1 
ATOM   54   N  N     . GLU A 1 12  ? 12.911 42.255 -13.855 1.00 62.48 ? 479 GLU A N     1 
ATOM   55   C  CA    . GLU A 1 12  ? 12.186 43.443 -13.429 1.00 67.79 ? 479 GLU A CA    1 
ATOM   56   C  C     . GLU A 1 12  ? 12.903 44.063 -12.237 1.00 65.27 ? 479 GLU A C     1 
ATOM   57   O  O     . GLU A 1 12  ? 13.384 45.195 -12.295 1.00 66.01 ? 479 GLU A O     1 
ATOM   58   C  CB    . GLU A 1 12  ? 10.769 43.044 -13.007 1.00 74.82 ? 479 GLU A CB    1 
ATOM   59   C  CG    . GLU A 1 12  ? 9.705  44.102 -13.232 1.00 81.19 ? 479 GLU A CG    1 
ATOM   60   C  CD    . GLU A 1 12  ? 9.204  44.122 -14.666 1.00 86.02 ? 479 GLU A CD    1 
ATOM   61   O  OE1   . GLU A 1 12  ? 8.057  44.566 -14.893 1.00 86.58 ? 479 GLU A OE1   1 
ATOM   62   O  OE2   . GLU A 1 12  ? 9.957  43.685 -15.564 1.00 88.18 ? 479 GLU A OE2   1 
ATOM   63   N  N     . LYS A 1 13  ? 12.966 43.293 -11.158 1.00 61.09 ? 480 LYS A N     1 
ATOM   64   C  CA    . LYS A 1 13  ? 13.595 43.713 -9.912  1.00 58.39 ? 480 LYS A CA    1 
ATOM   65   C  C     . LYS A 1 13  ? 15.013 44.245 -10.109 1.00 55.19 ? 480 LYS A C     1 
ATOM   66   O  O     . LYS A 1 13  ? 15.347 45.332 -9.638  1.00 55.81 ? 480 LYS A O     1 
ATOM   67   C  CB    . LYS A 1 13  ? 13.626 42.530 -8.942  1.00 60.52 ? 480 LYS A CB    1 
ATOM   68   C  CG    . LYS A 1 13  ? 13.978 42.883 -7.511  1.00 64.58 ? 480 LYS A CG    1 
ATOM   69   C  CD    . LYS A 1 13  ? 12.780 43.463 -6.779  1.00 67.47 ? 480 LYS A CD    1 
ATOM   70   C  CE    . LYS A 1 13  ? 12.728 44.973 -6.901  1.00 71.04 ? 480 LYS A CE    1 
ATOM   71   N  NZ    . LYS A 1 13  ? 13.992 45.612 -6.446  1.00 73.01 ? 480 LYS A NZ    1 
ATOM   72   N  N     . LEU A 1 14  ? 15.849 43.475 -10.795 1.00 50.67 ? 481 LEU A N     1 
ATOM   73   C  CA    . LEU A 1 14  ? 17.259 43.826 -10.924 1.00 51.84 ? 481 LEU A CA    1 
ATOM   74   C  C     . LEU A 1 14  ? 17.463 45.146 -11.659 1.00 51.97 ? 481 LEU A C     1 
ATOM   75   O  O     . LEU A 1 14  ? 18.380 45.900 -11.347 1.00 50.36 ? 481 LEU A O     1 
ATOM   76   C  CB    . LEU A 1 14  ? 18.037 42.711 -11.620 1.00 52.72 ? 481 LEU A CB    1 
ATOM   77   C  CG    . LEU A 1 14  ? 19.456 42.510 -11.087 1.00 54.15 ? 481 LEU A CG    1 
ATOM   78   C  CD1   . LEU A 1 14  ? 19.402 42.254 -9.592  1.00 50.57 ? 481 LEU A CD1   1 
ATOM   79   C  CD2   . LEU A 1 14  ? 20.161 41.372 -11.802 1.00 55.80 ? 481 LEU A CD2   1 
ATOM   80   N  N     . LYS A 1 15  ? 16.609 45.421 -12.639 1.00 52.65 ? 482 LYS A N     1 
ATOM   81   C  CA    . LYS A 1 15  ? 16.690 46.675 -13.381 1.00 51.78 ? 482 LYS A CA    1 
ATOM   82   C  C     . LYS A 1 15  ? 16.514 47.880 -12.454 1.00 50.59 ? 482 LYS A C     1 
ATOM   83   O  O     . LYS A 1 15  ? 17.310 48.816 -12.472 1.00 47.75 ? 482 LYS A O     1 
ATOM   84   C  CB    . LYS A 1 15  ? 15.660 46.700 -14.504 1.00 54.38 ? 482 LYS A CB    1 
ATOM   85   N  N     . GLN A 1 16  ? 15.479 47.843 -11.627 1.00 51.38 ? 483 GLN A N     1 
ATOM   86   C  CA    . GLN A 1 16  ? 15.204 48.958 -10.738 1.00 55.81 ? 483 GLN A CA    1 
ATOM   87   C  C     . GLN A 1 16  ? 16.226 49.071 -9.608  1.00 50.71 ? 483 GLN A C     1 
ATOM   88   O  O     . GLN A 1 16  ? 16.481 50.164 -9.109  1.00 49.16 ? 483 GLN A O     1 
ATOM   89   C  CB    . GLN A 1 16  ? 13.787 48.864 -10.185 1.00 62.55 ? 483 GLN A CB    1 
ATOM   90   C  CG    . GLN A 1 16  ? 13.632 47.896 -9.042  1.00 67.52 ? 483 GLN A CG    1 
ATOM   91   C  CD    . GLN A 1 16  ? 12.213 47.852 -8.528  1.00 70.32 ? 483 GLN A CD    1 
ATOM   92   O  OE1   . GLN A 1 16  ? 11.271 47.700 -9.305  1.00 71.32 ? 483 GLN A OE1   1 
ATOM   93   N  NE2   . GLN A 1 16  ? 12.050 47.981 -7.210  1.00 69.65 ? 483 GLN A NE2   1 
ATOM   94   N  N     . VAL A 1 17  ? 16.814 47.944 -9.211  1.00 48.84 ? 484 VAL A N     1 
ATOM   95   C  CA    . VAL A 1 17  ? 17.867 47.953 -8.197  1.00 46.03 ? 484 VAL A CA    1 
ATOM   96   C  C     . VAL A 1 17  ? 19.091 48.717 -8.694  1.00 46.34 ? 484 VAL A C     1 
ATOM   97   O  O     . VAL A 1 17  ? 19.645 49.549 -7.983  1.00 47.50 ? 484 VAL A O     1 
ATOM   98   C  CB    . VAL A 1 17  ? 18.287 46.525 -7.779  1.00 43.26 ? 484 VAL A CB    1 
ATOM   99   C  CG1   . VAL A 1 17  ? 19.651 46.545 -7.094  1.00 44.31 ? 484 VAL A CG1   1 
ATOM   100  C  CG2   . VAL A 1 17  ? 17.243 45.908 -6.869  1.00 39.11 ? 484 VAL A CG2   1 
ATOM   101  N  N     . GLU A 1 18  ? 19.502 48.448 -9.926  1.00 43.09 ? 485 GLU A N     1 
ATOM   102  C  CA    . GLU A 1 18  ? 20.665 49.120 -10.486 1.00 47.86 ? 485 GLU A CA    1 
ATOM   103  C  C     . GLU A 1 18  ? 20.406 50.613 -10.665 1.00 49.29 ? 485 GLU A C     1 
ATOM   104  O  O     . GLU A 1 18  ? 21.324 51.421 -10.562 1.00 48.10 ? 485 GLU A O     1 
ATOM   105  C  CB    . GLU A 1 18  ? 21.064 48.475 -11.809 1.00 53.05 ? 485 GLU A CB    1 
ATOM   106  C  CG    . GLU A 1 18  ? 21.014 46.963 -11.740 1.00 59.11 ? 485 GLU A CG    1 
ATOM   107  C  CD    . GLU A 1 18  ? 22.113 46.299 -12.530 1.00 65.02 ? 485 GLU A CD    1 
ATOM   108  O  OE1   . GLU A 1 18  ? 21.912 45.147 -12.979 1.00 68.24 ? 485 GLU A OE1   1 
ATOM   109  O  OE2   . GLU A 1 18  ? 23.180 46.925 -12.691 1.00 65.69 ? 485 GLU A OE2   1 
ATOM   110  N  N     . GLU A 1 19  ? 19.149 50.966 -10.921 1.00 50.94 ? 486 GLU A N     1 
ATOM   111  C  CA    . GLU A 1 19  ? 18.749 52.365 -11.050 1.00 52.77 ? 486 GLU A CA    1 
ATOM   112  C  C     . GLU A 1 19  ? 18.839 53.092 -9.718  1.00 54.84 ? 486 GLU A C     1 
ATOM   113  O  O     . GLU A 1 19  ? 19.303 54.232 -9.649  1.00 55.29 ? 486 GLU A O     1 
ATOM   114  C  CB    . GLU A 1 19  ? 17.324 52.469 -11.579 1.00 53.71 ? 486 GLU A CB    1 
ATOM   115  C  CG    . GLU A 1 19  ? 17.179 52.097 -13.030 1.00 55.75 ? 486 GLU A CG    1 
ATOM   116  C  CD    . GLU A 1 19  ? 15.944 52.704 -13.657 1.00 58.09 ? 486 GLU A CD    1 
ATOM   117  O  OE1   . GLU A 1 19  ? 15.263 53.508 -12.981 1.00 56.89 ? 486 GLU A OE1   1 
ATOM   118  O  OE2   . GLU A 1 19  ? 15.659 52.379 -14.829 1.00 58.25 ? 486 GLU A OE2   1 
ATOM   119  N  N     . TYR A 1 20  ? 18.378 52.431 -8.662  1.00 51.15 ? 487 TYR A N     1 
ATOM   120  C  CA    . TYR A 1 20  ? 18.438 53.016 -7.330  1.00 50.79 ? 487 TYR A CA    1 
ATOM   121  C  C     . TYR A 1 20  ? 19.887 53.237 -6.910  1.00 49.98 ? 487 TYR A C     1 
ATOM   122  O  O     . TYR A 1 20  ? 20.244 54.311 -6.428  1.00 50.47 ? 487 TYR A O     1 
ATOM   123  C  CB    . TYR A 1 20  ? 17.716 52.135 -6.309  1.00 48.79 ? 487 TYR A CB    1 
ATOM   124  C  CG    . TYR A 1 20  ? 18.029 52.496 -4.871  1.00 53.15 ? 487 TYR A CG    1 
ATOM   125  C  CD1   . TYR A 1 20  ? 17.399 53.568 -4.245  1.00 55.25 ? 487 TYR A CD1   1 
ATOM   126  C  CD2   . TYR A 1 20  ? 18.962 51.772 -4.143  1.00 56.03 ? 487 TYR A CD2   1 
ATOM   127  C  CE1   . TYR A 1 20  ? 17.688 53.904 -2.926  1.00 55.39 ? 487 TYR A CE1   1 
ATOM   128  C  CE2   . TYR A 1 20  ? 19.258 52.099 -2.826  1.00 57.59 ? 487 TYR A CE2   1 
ATOM   129  C  CZ    . TYR A 1 20  ? 18.621 53.166 -2.222  1.00 56.68 ? 487 TYR A CZ    1 
ATOM   130  O  OH    . TYR A 1 20  ? 18.920 53.483 -0.911  1.00 54.36 ? 487 TYR A OH    1 
ATOM   131  N  N     . MET A 1 21  ? 20.716 52.215 -7.100  1.00 46.86 ? 488 MET A N     1 
ATOM   132  C  CA    . MET A 1 21  ? 22.125 52.294 -6.731  1.00 47.21 ? 488 MET A CA    1 
ATOM   133  C  C     . MET A 1 21  ? 22.850 53.405 -7.486  1.00 52.35 ? 488 MET A C     1 
ATOM   134  O  O     . MET A 1 21  ? 23.832 53.964 -6.992  1.00 52.71 ? 488 MET A O     1 
ATOM   135  C  CB    . MET A 1 21  ? 22.805 50.944 -6.954  1.00 44.91 ? 488 MET A CB    1 
ATOM   136  C  CG    . MET A 1 21  ? 22.229 49.837 -6.072  1.00 41.11 ? 488 MET A CG    1 
ATOM   137  S  SD    . MET A 1 21  ? 23.236 48.353 -6.089  1.00 41.19 ? 488 MET A SD    1 
ATOM   138  C  CE    . MET A 1 21  ? 23.264 48.003 -7.843  1.00 38.60 ? 488 MET A CE    1 
ATOM   139  N  N     . GLN A 1 22  ? 22.354 53.719 -8.681  1.00 54.45 ? 489 GLN A N     1 
ATOM   140  C  CA    . GLN A 1 22  ? 22.882 54.824 -9.474  1.00 59.40 ? 489 GLN A CA    1 
ATOM   141  C  C     . GLN A 1 22  ? 22.505 56.176 -8.874  1.00 61.63 ? 489 GLN A C     1 
ATOM   142  O  O     . GLN A 1 22  ? 23.348 57.061 -8.768  1.00 63.91 ? 489 GLN A O     1 
ATOM   143  C  CB    . GLN A 1 22  ? 22.395 54.733 -10.923 1.00 59.14 ? 489 GLN A CB    1 
ATOM   144  C  CG    . GLN A 1 22  ? 22.741 55.945 -11.777 1.00 65.24 ? 489 GLN A CG    1 
ATOM   145  C  CD    . GLN A 1 22  ? 24.223 56.041 -12.096 1.00 68.39 ? 489 GLN A CD    1 
ATOM   146  O  OE1   . GLN A 1 22  ? 25.061 55.461 -11.403 1.00 69.33 ? 489 GLN A OE1   1 
ATOM   147  N  NE2   . GLN A 1 22  ? 24.554 56.776 -13.152 1.00 69.10 ? 489 GLN A NE2   1 
ATOM   148  N  N     . TYR A 1 23  ? 21.243 56.335 -8.484  1.00 61.38 ? 490 TYR A N     1 
ATOM   149  C  CA    . TYR A 1 23  ? 20.780 57.588 -7.886  1.00 62.34 ? 490 TYR A CA    1 
ATOM   150  C  C     . TYR A 1 23  ? 21.469 57.855 -6.553  1.00 60.24 ? 490 TYR A C     1 
ATOM   151  O  O     . TYR A 1 23  ? 21.686 59.004 -6.171  1.00 60.54 ? 490 TYR A O     1 
ATOM   152  C  CB    . TYR A 1 23  ? 19.275 57.565 -7.697  1.00 66.15 ? 490 TYR A CB    1 
ATOM   153  N  N     . ARG A 1 24  ? 21.808 56.781 -5.849  1.00 54.48 ? 491 ARG A N     1 
ATOM   154  C  CA    . ARG A 1 24  ? 22.464 56.884 -4.555  1.00 56.13 ? 491 ARG A CA    1 
ATOM   155  C  C     . ARG A 1 24  ? 23.978 56.929 -4.694  1.00 56.12 ? 491 ARG A C     1 
ATOM   156  O  O     . ARG A 1 24  ? 24.697 57.062 -3.702  1.00 56.38 ? 491 ARG A O     1 
ATOM   157  C  CB    . ARG A 1 24  ? 22.063 55.701 -3.679  1.00 57.85 ? 491 ARG A CB    1 
ATOM   158  C  CG    . ARG A 1 24  ? 20.616 55.740 -3.257  1.00 60.19 ? 491 ARG A CG    1 
ATOM   159  C  CD    . ARG A 1 24  ? 20.324 57.029 -2.517  1.00 62.23 ? 491 ARG A CD    1 
ATOM   160  N  NE    . ARG A 1 24  ? 19.200 56.873 -1.601  1.00 64.65 ? 491 ARG A NE    1 
ATOM   161  C  CZ    . ARG A 1 24  ? 18.976 57.658 -0.553  1.00 64.73 ? 491 ARG A CZ    1 
ATOM   162  N  NH1   . ARG A 1 24  ? 19.803 58.661 -0.286  1.00 64.12 ? 491 ARG A NH1   1 
ATOM   163  N  NH2   . ARG A 1 24  ? 17.927 57.437 0.231   1.00 61.85 ? 491 ARG A NH2   1 
ATOM   164  N  N     . LYS A 1 25  ? 24.452 56.809 -5.929  1.00 55.62 ? 492 LYS A N     1 
ATOM   165  C  CA    . LYS A 1 25  ? 25.882 56.821 -6.218  1.00 55.33 ? 492 LYS A CA    1 
ATOM   166  C  C     . LYS A 1 25  ? 26.651 55.885 -5.291  1.00 52.03 ? 492 LYS A C     1 
ATOM   167  O  O     . LYS A 1 25  ? 27.722 56.230 -4.792  1.00 51.92 ? 492 LYS A O     1 
ATOM   168  C  CB    . LYS A 1 25  ? 26.439 58.243 -6.121  1.00 58.86 ? 492 LYS A CB    1 
ATOM   169  C  CG    . LYS A 1 25  ? 25.685 59.262 -6.962  1.00 61.58 ? 492 LYS A CG    1 
ATOM   170  C  CD    . LYS A 1 25  ? 25.641 58.858 -8.423  1.00 63.87 ? 492 LYS A CD    1 
ATOM   171  C  CE    . LYS A 1 25  ? 24.799 59.831 -9.234  1.00 66.38 ? 492 LYS A CE    1 
ATOM   172  N  NZ    . LYS A 1 25  ? 24.693 59.417 -10.662 1.00 69.31 ? 492 LYS A NZ    1 
ATOM   173  N  N     . LEU A 1 26  ? 26.101 54.698 -5.063  1.00 50.60 ? 493 LEU A N     1 
ATOM   174  C  CA    . LEU A 1 26  ? 26.751 53.727 -4.200  1.00 50.97 ? 493 LEU A CA    1 
ATOM   175  C  C     . LEU A 1 26  ? 28.122 53.386 -4.765  1.00 52.55 ? 493 LEU A C     1 
ATOM   176  O  O     . LEU A 1 26  ? 28.305 53.356 -5.980  1.00 54.09 ? 493 LEU A O     1 
ATOM   177  C  CB    . LEU A 1 26  ? 25.900 52.460 -4.077  1.00 48.90 ? 493 LEU A CB    1 
ATOM   178  C  CG    . LEU A 1 26  ? 24.486 52.636 -3.522  1.00 46.95 ? 493 LEU A CG    1 
ATOM   179  C  CD1   . LEU A 1 26  ? 23.869 51.277 -3.202  1.00 43.04 ? 493 LEU A CD1   1 
ATOM   180  C  CD2   . LEU A 1 26  ? 24.503 53.519 -2.282  1.00 47.96 ? 493 LEU A CD2   1 
ATOM   181  N  N     . PRO A 1 27  ? 29.099 53.142 -3.884  1.00 51.53 ? 494 PRO A N     1 
ATOM   182  C  CA    . PRO A 1 27  ? 30.431 52.738 -4.343  1.00 51.19 ? 494 PRO A CA    1 
ATOM   183  C  C     . PRO A 1 27  ? 30.346 51.408 -5.086  1.00 52.89 ? 494 PRO A C     1 
ATOM   184  O  O     . PRO A 1 27  ? 29.451 50.618 -4.792  1.00 52.83 ? 494 PRO A O     1 
ATOM   185  C  CB    . PRO A 1 27  ? 31.214 52.564 -3.039  1.00 52.25 ? 494 PRO A CB    1 
ATOM   186  C  CG    . PRO A 1 27  ? 30.445 53.347 -2.008  1.00 53.15 ? 494 PRO A CG    1 
ATOM   187  C  CD    . PRO A 1 27  ? 29.012 53.230 -2.416  1.00 52.57 ? 494 PRO A CD    1 
ATOM   188  N  N     . SER A 1 28  ? 31.252 51.163 -6.029  1.00 53.26 ? 495 SER A N     1 
ATOM   189  C  CA    . SER A 1 28  ? 31.189 49.938 -6.826  1.00 55.37 ? 495 SER A CA    1 
ATOM   190  C  C     . SER A 1 28  ? 31.236 48.669 -5.974  1.00 51.15 ? 495 SER A C     1 
ATOM   191  O  O     . SER A 1 28  ? 30.553 47.697 -6.276  1.00 50.96 ? 495 SER A O     1 
ATOM   192  C  CB    . SER A 1 28  ? 32.290 49.915 -7.893  1.00 63.89 ? 495 SER A CB    1 
ATOM   193  O  OG    . SER A 1 28  ? 33.576 50.005 -7.305  1.00 70.39 ? 495 SER A OG    1 
ATOM   194  N  N     . HIS A 1 29  ? 32.033 48.681 -4.910  1.00 48.56 ? 496 HIS A N     1 
ATOM   195  C  CA    . HIS A 1 29  ? 32.154 47.514 -4.039  1.00 49.46 ? 496 HIS A CA    1 
ATOM   196  C  C     . HIS A 1 29  ? 30.810 47.122 -3.432  1.00 46.27 ? 496 HIS A C     1 
ATOM   197  O  O     . HIS A 1 29  ? 30.516 45.941 -3.242  1.00 46.53 ? 496 HIS A O     1 
ATOM   198  C  CB    . HIS A 1 29  ? 33.167 47.784 -2.922  1.00 54.00 ? 496 HIS A CB    1 
ATOM   199  C  CG    . HIS A 1 29  ? 32.728 48.834 -1.947  1.00 57.86 ? 496 HIS A CG    1 
ATOM   200  N  ND1   . HIS A 1 29  ? 32.016 48.539 -0.802  1.00 59.92 ? 496 HIS A ND1   1 
ATOM   201  C  CD2   . HIS A 1 29  ? 32.906 50.178 -1.940  1.00 59.55 ? 496 HIS A CD2   1 
ATOM   202  C  CE1   . HIS A 1 29  ? 31.769 49.655 -0.138  1.00 59.49 ? 496 HIS A CE1   1 
ATOM   203  N  NE2   . HIS A 1 29  ? 32.299 50.664 -0.807  1.00 60.43 ? 496 HIS A NE2   1 
ATOM   204  N  N     . LEU A 1 30  ? 29.997 48.126 -3.128  1.00 43.38 ? 497 LEU A N     1 
ATOM   205  C  CA    . LEU A 1 30  ? 28.702 47.910 -2.494  1.00 41.01 ? 497 LEU A CA    1 
ATOM   206  C  C     . LEU A 1 30  ? 27.638 47.542 -3.522  1.00 39.28 ? 497 LEU A C     1 
ATOM   207  O  O     . LEU A 1 30  ? 26.764 46.723 -3.247  1.00 36.96 ? 497 LEU A O     1 
ATOM   208  C  CB    . LEU A 1 30  ? 28.288 49.165 -1.730  1.00 41.04 ? 497 LEU A CB    1 
ATOM   209  C  CG    . LEU A 1 30  ? 26.946 49.170 -1.000  1.00 42.49 ? 497 LEU A CG    1 
ATOM   210  C  CD1   . LEU A 1 30  ? 26.770 47.910 -0.174  1.00 39.55 ? 497 LEU A CD1   1 
ATOM   211  C  CD2   . LEU A 1 30  ? 26.844 50.408 -0.118  1.00 42.78 ? 497 LEU A CD2   1 
ATOM   212  N  N     . ARG A 1 31  ? 27.711 48.155 -4.703  1.00 36.68 ? 498 ARG A N     1 
ATOM   213  C  CA    . ARG A 1 31  ? 26.821 47.795 -5.796  1.00 34.90 ? 498 ARG A CA    1 
ATOM   214  C  C     . ARG A 1 31  ? 27.030 46.332 -6.120  1.00 33.64 ? 498 ARG A C     1 
ATOM   215  O  O     . ARG A 1 31  ? 26.077 45.586 -6.305  1.00 33.29 ? 498 ARG A O     1 
ATOM   216  C  CB    . ARG A 1 31  ? 27.110 48.633 -7.044  1.00 37.96 ? 498 ARG A CB    1 
ATOM   217  C  CG    . ARG A 1 31  ? 26.822 50.116 -6.883  1.00 39.83 ? 498 ARG A CG    1 
ATOM   218  C  CD    . ARG A 1 31  ? 26.681 50.809 -8.227  1.00 42.31 ? 498 ARG A CD    1 
ATOM   219  N  NE    . ARG A 1 31  ? 26.686 52.263 -8.067  1.00 47.30 ? 498 ARG A NE    1 
ATOM   220  C  CZ    . ARG A 1 31  ? 26.377 53.125 -9.030  1.00 50.31 ? 498 ARG A CZ    1 
ATOM   221  N  NH1   . ARG A 1 31  ? 26.025 52.680 -10.228 1.00 50.18 ? 498 ARG A NH1   1 
ATOM   222  N  NH2   . ARG A 1 31  ? 26.413 54.431 -8.794  1.00 53.73 ? 498 ARG A NH2   1 
ATOM   223  N  N     . ASN A 1 32  ? 28.292 45.927 -6.189  1.00 32.53 ? 499 ASN A N     1 
ATOM   224  C  CA    . ASN A 1 32  ? 28.621 44.539 -6.488  1.00 35.36 ? 499 ASN A CA    1 
ATOM   225  C  C     . ASN A 1 32  ? 28.186 43.574 -5.395  1.00 31.77 ? 499 ASN A C     1 
ATOM   226  O  O     . ASN A 1 32  ? 27.782 42.453 -5.686  1.00 29.59 ? 499 ASN A O     1 
ATOM   227  C  CB    . ASN A 1 32  ? 30.109 44.393 -6.803  1.00 38.30 ? 499 ASN A CB    1 
ATOM   228  C  CG    . ASN A 1 32  ? 30.457 44.944 -8.169  1.00 42.37 ? 499 ASN A CG    1 
ATOM   229  O  OD1   . ASN A 1 32  ? 29.679 44.805 -9.113  1.00 42.56 ? 499 ASN A OD1   1 
ATOM   230  N  ND2   . ASN A 1 32  ? 31.623 45.576 -8.284  1.00 42.79 ? 499 ASN A ND2   1 
ATOM   231  N  N     . LYS A 1 33  ? 28.253 44.016 -4.141  1.00 32.57 ? 500 LYS A N     1 
ATOM   232  C  CA    . LYS A 1 33  ? 27.789 43.192 -3.028  1.00 30.04 ? 500 LYS A CA    1 
ATOM   233  C  C     . LYS A 1 33  ? 26.296 42.917 -3.166  1.00 29.75 ? 500 LYS A C     1 
ATOM   234  O  O     . LYS A 1 33  ? 25.830 41.786 -2.981  1.00 27.50 ? 500 LYS A O     1 
ATOM   235  C  CB    . LYS A 1 33  ? 28.068 43.875 -1.690  1.00 31.39 ? 500 LYS A CB    1 
ATOM   236  C  CG    . LYS A 1 33  ? 27.530 43.100 -0.486  1.00 30.00 ? 500 LYS A CG    1 
ATOM   237  C  CD    . LYS A 1 33  ? 27.984 43.685 0.846   1.00 31.48 ? 500 LYS A CD    1 
ATOM   238  C  CE    . LYS A 1 33  ? 27.690 42.696 2.006   1.00 29.77 ? 500 LYS A CE    1 
ATOM   239  N  NZ    . LYS A 1 33  ? 27.506 43.393 3.293   1.00 37.24 ? 500 LYS A NZ    1 
ATOM   240  N  N     . ILE A 1 34  ? 25.553 43.962 -3.503  1.00 26.79 ? 501 ILE A N     1 
ATOM   241  C  CA    . ILE A 1 34  ? 24.108 43.857 -3.665  1.00 25.68 ? 501 ILE A CA    1 
ATOM   242  C  C     . ILE A 1 34  ? 23.731 42.976 -4.855  1.00 25.03 ? 501 ILE A C     1 
ATOM   243  O  O     . ILE A 1 34  ? 22.887 42.095 -4.732  1.00 27.63 ? 501 ILE A O     1 
ATOM   244  C  CB    . ILE A 1 34  ? 23.486 45.249 -3.774  1.00 26.91 ? 501 ILE A CB    1 
ATOM   245  C  CG1   . ILE A 1 34  ? 23.686 45.972 -2.443  1.00 26.95 ? 501 ILE A CG1   1 
ATOM   246  C  CG2   . ILE A 1 34  ? 22.004 45.165 -4.142  1.00 27.91 ? 501 ILE A CG2   1 
ATOM   247  C  CD1   . ILE A 1 34  ? 23.392 47.457 -2.485  1.00 29.89 ? 501 ILE A CD1   1 
ATOM   248  N  N     . LEU A 1 35  ? 24.367 43.194 -6.001  1.00 24.26 ? 502 LEU A N     1 
ATOM   249  C  CA    . LEU A 1 35  ? 24.094 42.351 -7.173  1.00 23.06 ? 502 LEU A CA    1 
ATOM   250  C  C     . LEU A 1 35  ? 24.450 40.889 -6.906  1.00 24.49 ? 502 LEU A C     1 
ATOM   251  O  O     . LEU A 1 35  ? 23.699 39.989 -7.280  1.00 23.62 ? 502 LEU A O     1 
ATOM   252  C  CB    . LEU A 1 35  ? 24.836 42.873 -8.404  1.00 26.25 ? 502 LEU A CB    1 
ATOM   253  C  CG    . LEU A 1 35  ? 24.413 44.273 -8.857  1.00 30.40 ? 502 LEU A CG    1 
ATOM   254  C  CD1   . LEU A 1 35  ? 25.287 44.754 -10.019 1.00 34.50 ? 502 LEU A CD1   1 
ATOM   255  C  CD2   . LEU A 1 35  ? 22.934 44.284 -9.260  1.00 33.05 ? 502 LEU A CD2   1 
ATOM   256  N  N     . ASP A 1 36  ? 25.589 40.650 -6.255  1.00 24.37 ? 503 ASP A N     1 
ATOM   257  C  CA    . ASP A 1 36  ? 25.977 39.285 -5.868  1.00 25.54 ? 503 ASP A CA    1 
ATOM   258  C  C     . ASP A 1 36  ? 24.948 38.637 -4.942  1.00 23.83 ? 503 ASP A C     1 
ATOM   259  O  O     . ASP A 1 36  ? 24.681 37.423 -5.016  1.00 23.09 ? 503 ASP A O     1 
ATOM   260  C  CB    . ASP A 1 36  ? 27.322 39.290 -5.142  1.00 28.41 ? 503 ASP A CB    1 
ATOM   261  C  CG    . ASP A 1 36  ? 28.484 39.600 -6.056  1.00 31.28 ? 503 ASP A CG    1 
ATOM   262  O  OD1   . ASP A 1 36  ? 28.268 39.787 -7.267  1.00 33.55 ? 503 ASP A OD1   1 
ATOM   263  O  OD2   . ASP A 1 36  ? 29.622 39.664 -5.551  1.00 30.81 ? 503 ASP A OD2   1 
ATOM   264  N  N     . TYR A 1 37  ? 24.402 39.435 -4.034  1.00 20.64 ? 504 TYR A N     1 
ATOM   265  C  CA    . TYR A 1 37  ? 23.368 38.936 -3.124  1.00 19.41 ? 504 TYR A CA    1 
ATOM   266  C  C     . TYR A 1 37  ? 22.113 38.502 -3.892  1.00 22.00 ? 504 TYR A C     1 
ATOM   267  O  O     . TYR A 1 37  ? 21.594 37.407 -3.672  1.00 22.36 ? 504 TYR A O     1 
ATOM   268  C  CB    . TYR A 1 37  ? 23.025 39.984 -2.045  1.00 19.42 ? 504 TYR A CB    1 
ATOM   269  C  CG    . TYR A 1 37  ? 21.864 39.587 -1.146  1.00 21.56 ? 504 TYR A CG    1 
ATOM   270  C  CD1   . TYR A 1 37  ? 22.083 38.994 0.095   1.00 23.58 ? 504 TYR A CD1   1 
ATOM   271  C  CD2   . TYR A 1 37  ? 20.546 39.784 -1.550  1.00 23.25 ? 504 TYR A CD2   1 
ATOM   272  C  CE1   . TYR A 1 37  ? 21.019 38.631 0.920   1.00 26.38 ? 504 TYR A CE1   1 
ATOM   273  C  CE2   . TYR A 1 37  ? 19.479 39.418 -0.731  1.00 25.45 ? 504 TYR A CE2   1 
ATOM   274  C  CZ    . TYR A 1 37  ? 19.722 38.847 0.498   1.00 28.78 ? 504 TYR A CZ    1 
ATOM   275  O  OH    . TYR A 1 37  ? 18.657 38.484 1.294   1.00 32.96 ? 504 TYR A OH    1 
ATOM   276  N  N     . TYR A 1 38  ? 21.625 39.344 -4.799  1.00 23.64 ? 505 TYR A N     1 
ATOM   277  C  CA    . TYR A 1 38  ? 20.418 38.983 -5.549  1.00 24.52 ? 505 TYR A CA    1 
ATOM   278  C  C     . TYR A 1 38  ? 20.655 37.737 -6.378  1.00 23.72 ? 505 TYR A C     1 
ATOM   279  O  O     . TYR A 1 38  ? 19.792 36.868 -6.463  1.00 25.41 ? 505 TYR A O     1 
ATOM   280  C  CB    . TYR A 1 38  ? 19.950 40.121 -6.458  1.00 25.00 ? 505 TYR A CB    1 
ATOM   281  C  CG    . TYR A 1 38  ? 19.042 41.118 -5.766  1.00 27.88 ? 505 TYR A CG    1 
ATOM   282  C  CD1   . TYR A 1 38  ? 19.560 42.252 -5.163  1.00 28.29 ? 505 TYR A CD1   1 
ATOM   283  C  CD2   . TYR A 1 38  ? 17.667 40.915 -5.709  1.00 31.53 ? 505 TYR A CD2   1 
ATOM   284  C  CE1   . TYR A 1 38  ? 18.737 43.161 -4.521  1.00 27.50 ? 505 TYR A CE1   1 
ATOM   285  C  CE2   . TYR A 1 38  ? 16.835 41.820 -5.069  1.00 31.97 ? 505 TYR A CE2   1 
ATOM   286  C  CZ    . TYR A 1 38  ? 17.379 42.943 -4.482  1.00 29.43 ? 505 TYR A CZ    1 
ATOM   287  O  OH    . TYR A 1 38  ? 16.572 43.856 -3.847  1.00 31.22 ? 505 TYR A OH    1 
ATOM   288  N  N     . GLU A 1 39  ? 21.825 37.655 -7.001  1.00 23.77 ? 506 GLU A N     1 
ATOM   289  C  CA    . GLU A 1 39  ? 22.139 36.500 -7.826  1.00 20.92 ? 506 GLU A CA    1 
ATOM   290  C  C     . GLU A 1 39  ? 22.205 35.249 -6.963  1.00 23.97 ? 506 GLU A C     1 
ATOM   291  O  O     . GLU A 1 39  ? 21.653 34.208 -7.318  1.00 28.38 ? 506 GLU A O     1 
ATOM   292  C  CB    . GLU A 1 39  ? 23.470 36.678 -8.561  1.00 23.39 ? 506 GLU A CB    1 
ATOM   293  C  CG    . GLU A 1 39  ? 23.810 35.457 -9.427  1.00 31.41 ? 506 GLU A CG    1 
ATOM   294  C  CD    . GLU A 1 39  ? 25.211 35.500 -9.999  1.00 38.97 ? 506 GLU A CD    1 
ATOM   295  O  OE1   . GLU A 1 39  ? 26.156 35.804 -9.246  1.00 43.02 ? 506 GLU A OE1   1 
ATOM   296  O  OE2   . GLU A 1 39  ? 25.370 35.225 -11.205 1.00 41.54 ? 506 GLU A OE2   1 
ATOM   297  N  N     . TYR A 1 40  ? 22.885 35.349 -5.826  1.00 24.79 ? 507 TYR A N     1 
ATOM   298  C  CA    . TYR A 1 40  ? 23.064 34.187 -4.953  1.00 24.70 ? 507 TYR A CA    1 
ATOM   299  C  C     . TYR A 1 40  ? 21.742 33.711 -4.374  1.00 25.57 ? 507 TYR A C     1 
ATOM   300  O  O     . TYR A 1 40  ? 21.448 32.509 -4.351  1.00 25.63 ? 507 TYR A O     1 
ATOM   301  C  CB    . TYR A 1 40  ? 24.034 34.483 -3.805  1.00 22.88 ? 507 TYR A CB    1 
ATOM   302  C  CG    . TYR A 1 40  ? 24.290 33.259 -2.954  1.00 24.14 ? 507 TYR A CG    1 
ATOM   303  C  CD1   . TYR A 1 40  ? 25.357 32.404 -3.226  1.00 24.66 ? 507 TYR A CD1   1 
ATOM   304  C  CD2   . TYR A 1 40  ? 23.446 32.933 -1.901  1.00 26.00 ? 507 TYR A CD2   1 
ATOM   305  C  CE1   . TYR A 1 40  ? 25.582 31.267 -2.447  1.00 25.65 ? 507 TYR A CE1   1 
ATOM   306  C  CE2   . TYR A 1 40  ? 23.664 31.805 -1.127  1.00 26.50 ? 507 TYR A CE2   1 
ATOM   307  C  CZ    . TYR A 1 40  ? 24.732 30.980 -1.402  1.00 27.44 ? 507 TYR A CZ    1 
ATOM   308  O  OH    . TYR A 1 40  ? 24.937 29.855 -0.626  1.00 29.55 ? 507 TYR A OH    1 
ATOM   309  N  N     . ARG A 1 41  ? 20.950 34.654 -3.884  1.00 23.20 ? 508 ARG A N     1 
ATOM   310  C  CA    . ARG A 1 41  ? 19.715 34.286 -3.207  1.00 24.62 ? 508 ARG A CA    1 
ATOM   311  C  C     . ARG A 1 41  ? 18.645 33.811 -4.172  1.00 27.86 ? 508 ARG A C     1 
ATOM   312  O  O     . ARG A 1 41  ? 18.005 32.788 -3.931  1.00 30.51 ? 508 ARG A O     1 
ATOM   313  C  CB    . ARG A 1 41  ? 19.162 35.436 -2.378  1.00 21.12 ? 508 ARG A CB    1 
ATOM   314  C  CG    . ARG A 1 41  ? 17.870 35.037 -1.699  1.00 24.16 ? 508 ARG A CG    1 
ATOM   315  C  CD    . ARG A 1 41  ? 17.376 36.062 -0.711  1.00 26.06 ? 508 ARG A CD    1 
ATOM   316  N  NE    . ARG A 1 41  ? 16.050 35.702 -0.209  1.00 26.77 ? 508 ARG A NE    1 
ATOM   317  C  CZ    . ARG A 1 41  ? 15.377 36.411 0.689   1.00 33.29 ? 508 ARG A CZ    1 
ATOM   318  N  NH1   . ARG A 1 41  ? 15.909 37.515 1.200   1.00 36.32 ? 508 ARG A NH1   1 
ATOM   319  N  NH2   . ARG A 1 41  ? 14.178 36.012 1.085   1.00 34.35 ? 508 ARG A NH2   1 
ATOM   320  N  N     . TYR A 1 42  ? 18.451 34.549 -5.262  1.00 24.73 ? 509 TYR A N     1 
ATOM   321  C  CA    . TYR A 1 42  ? 17.294 34.312 -6.129  1.00 33.57 ? 509 TYR A CA    1 
ATOM   322  C  C     . TYR A 1 42  ? 17.625 33.520 -7.391  1.00 39.05 ? 509 TYR A C     1 
ATOM   323  O  O     . TYR A 1 42  ? 16.751 32.864 -7.964  1.00 43.03 ? 509 TYR A O     1 
ATOM   324  C  CB    . TYR A 1 42  ? 16.567 35.629 -6.460  1.00 33.92 ? 509 TYR A CB    1 
ATOM   325  C  CG    . TYR A 1 42  ? 16.074 36.377 -5.230  1.00 34.11 ? 509 TYR A CG    1 
ATOM   326  C  CD1   . TYR A 1 42  ? 14.934 35.963 -4.544  1.00 35.88 ? 509 TYR A CD1   1 
ATOM   327  C  CD2   . TYR A 1 42  ? 16.749 37.492 -4.754  1.00 33.73 ? 509 TYR A CD2   1 
ATOM   328  C  CE1   . TYR A 1 42  ? 14.486 36.639 -3.415  1.00 36.28 ? 509 TYR A CE1   1 
ATOM   329  C  CE2   . TYR A 1 42  ? 16.308 38.173 -3.620  1.00 35.52 ? 509 TYR A CE2   1 
ATOM   330  C  CZ    . TYR A 1 42  ? 15.175 37.742 -2.960  1.00 37.71 ? 509 TYR A CZ    1 
ATOM   331  O  OH    . TYR A 1 42  ? 14.741 38.419 -1.838  1.00 42.06 ? 509 TYR A OH    1 
ATOM   332  N  N     . ARG A 1 43  ? 18.884 33.573 -7.815  1.00 38.20 ? 510 ARG A N     1 
ATOM   333  C  CA    . ARG A 1 43  ? 19.346 32.783 -8.957  1.00 42.03 ? 510 ARG A CA    1 
ATOM   334  C  C     . ARG A 1 43  ? 18.505 33.012 -10.210 1.00 39.79 ? 510 ARG A C     1 
ATOM   335  O  O     . ARG A 1 43  ? 18.243 32.076 -10.975 1.00 38.06 ? 510 ARG A O     1 
ATOM   336  C  CB    . ARG A 1 43  ? 19.372 31.292 -8.607  1.00 48.73 ? 510 ARG A CB    1 
ATOM   337  C  CG    . ARG A 1 43  ? 20.245 30.948 -7.401  1.00 53.37 ? 510 ARG A CG    1 
ATOM   338  C  CD    . ARG A 1 43  ? 21.720 31.181 -7.692  1.00 58.76 ? 510 ARG A CD    1 
ATOM   339  N  NE    . ARG A 1 43  ? 22.572 30.852 -6.547  1.00 64.75 ? 510 ARG A NE    1 
ATOM   340  C  CZ    . ARG A 1 43  ? 22.895 29.611 -6.195  1.00 69.80 ? 510 ARG A CZ    1 
ATOM   341  N  NH1   . ARG A 1 43  ? 22.428 28.588 -6.898  1.00 71.82 ? 510 ARG A NH1   1 
ATOM   342  N  NH2   . ARG A 1 43  ? 23.677 29.391 -5.143  1.00 70.60 ? 510 ARG A NH2   1 
ATOM   343  N  N     . GLY A 1 44  ? 18.075 34.253 -10.413 1.00 37.15 ? 511 GLY A N     1 
ATOM   344  C  CA    . GLY A 1 44  ? 17.411 34.636 -11.647 1.00 38.37 ? 511 GLY A CA    1 
ATOM   345  C  C     . GLY A 1 44  ? 15.908 34.446 -11.648 1.00 41.57 ? 511 GLY A C     1 
ATOM   346  O  O     . GLY A 1 44  ? 15.250 34.636 -12.669 1.00 43.82 ? 511 GLY A O     1 
ATOM   347  N  N     . LYS A 1 45  ? 15.354 34.077 -10.502 1.00 42.62 ? 512 LYS A N     1 
ATOM   348  C  CA    . LYS A 1 45  ? 13.924 33.828 -10.412 1.00 46.92 ? 512 LYS A CA    1 
ATOM   349  C  C     . LYS A 1 45  ? 13.377 34.291 -9.075  1.00 50.67 ? 512 LYS A C     1 
ATOM   350  O  O     . LYS A 1 45  ? 13.915 33.952 -8.023  1.00 49.74 ? 512 LYS A O     1 
ATOM   351  C  CB    . LYS A 1 45  ? 13.627 32.341 -10.617 1.00 48.15 ? 512 LYS A CB    1 
ATOM   352  C  CG    . LYS A 1 45  ? 13.866 31.854 -12.038 1.00 54.18 ? 512 LYS A CG    1 
ATOM   353  C  CD    . LYS A 1 45  ? 13.698 30.345 -12.148 1.00 58.91 ? 512 LYS A CD    1 
ATOM   354  C  CE    . LYS A 1 45  ? 13.721 29.889 -13.599 1.00 62.45 ? 512 LYS A CE    1 
ATOM   355  N  NZ    . LYS A 1 45  ? 13.479 28.423 -13.726 1.00 64.04 ? 512 LYS A NZ    1 
ATOM   356  N  N     . MET A 1 46  ? 12.311 35.079 -9.122  1.00 53.77 ? 513 MET A N     1 
ATOM   357  C  CA    . MET A 1 46  ? 11.644 35.508 -7.906  1.00 57.54 ? 513 MET A CA    1 
ATOM   358  C  C     . MET A 1 46  ? 10.186 35.085 -7.897  1.00 63.82 ? 513 MET A C     1 
ATOM   359  O  O     . MET A 1 46  ? 9.341  35.693 -8.554  1.00 64.41 ? 513 MET A O     1 
ATOM   360  C  CB    . MET A 1 46  ? 11.752 37.021 -7.719  1.00 58.07 ? 513 MET A CB    1 
ATOM   361  C  CG    . MET A 1 46  ? 13.159 37.506 -7.442  1.00 56.18 ? 513 MET A CG    1 
ATOM   362  S  SD    . MET A 1 46  ? 13.226 39.292 -7.280  1.00 57.22 ? 513 MET A SD    1 
ATOM   363  C  CE    . MET A 1 46  ? 13.036 39.498 -5.512  1.00 59.59 ? 513 MET A CE    1 
ATOM   364  N  N     . PHE A 1 47  ? 9.908  34.022 -7.155  1.00 67.92 ? 514 PHE A N     1 
ATOM   365  C  CA    . PHE A 1 47  ? 8.545  33.638 -6.852  1.00 72.39 ? 514 PHE A CA    1 
ATOM   366  C  C     . PHE A 1 47  ? 8.145  34.501 -5.661  1.00 81.10 ? 514 PHE A C     1 
ATOM   367  O  O     . PHE A 1 47  ? 8.748  35.551 -5.432  1.00 83.39 ? 514 PHE A O     1 
ATOM   368  C  CB    . PHE A 1 47  ? 8.493  32.152 -6.517  1.00 69.46 ? 514 PHE A CB    1 
ATOM   369  C  CG    . PHE A 1 47  ? 9.302  31.296 -7.455  1.00 69.14 ? 514 PHE A CG    1 
ATOM   370  C  CD1   . PHE A 1 47  ? 10.660 31.101 -7.244  1.00 70.63 ? 514 PHE A CD1   1 
ATOM   371  C  CD2   . PHE A 1 47  ? 8.709  30.691 -8.550  1.00 66.34 ? 514 PHE A CD2   1 
ATOM   372  C  CE1   . PHE A 1 47  ? 11.409 30.317 -8.106  1.00 69.51 ? 514 PHE A CE1   1 
ATOM   373  C  CE2   . PHE A 1 47  ? 9.452  29.903 -9.411  1.00 67.12 ? 514 PHE A CE2   1 
ATOM   374  C  CZ    . PHE A 1 47  ? 10.803 29.718 -9.191  1.00 67.89 ? 514 PHE A CZ    1 
ATOM   375  N  N     . ASP A 1 48  ? 7.143  34.080 -4.899  1.00 87.44 ? 515 ASP A N     1 
ATOM   376  C  CA    . ASP A 1 48  ? 6.750  34.847 -3.717  1.00 92.14 ? 515 ASP A CA    1 
ATOM   377  C  C     . ASP A 1 48  ? 6.672  33.970 -2.471  1.00 90.39 ? 515 ASP A C     1 
ATOM   378  O  O     . ASP A 1 48  ? 7.315  34.255 -1.457  1.00 90.78 ? 515 ASP A O     1 
ATOM   379  C  CB    . ASP A 1 48  ? 5.416  35.565 -3.951  1.00 96.13 ? 515 ASP A CB    1 
ATOM   380  C  CG    . ASP A 1 48  ? 5.137  36.636 -2.909  1.00 98.85 ? 515 ASP A CG    1 
ATOM   381  O  OD1   . ASP A 1 48  ? 5.819  36.650 -1.861  1.00 99.79 ? 515 ASP A OD1   1 
ATOM   382  O  OD2   . ASP A 1 48  ? 4.234  37.469 -3.138  1.00 99.94 ? 515 ASP A OD2   1 
ATOM   383  N  N     . GLU A 1 49  ? 5.879  32.905 -2.567  1.00 87.02 ? 516 GLU A N     1 
ATOM   384  C  CA    . GLU A 1 49  ? 5.628  31.986 -1.457  1.00 82.35 ? 516 GLU A CA    1 
ATOM   385  C  C     . GLU A 1 49  ? 4.706  32.589 -0.398  1.00 75.70 ? 516 GLU A C     1 
ATOM   386  O  O     . GLU A 1 49  ? 3.785  31.925 0.075   1.00 73.03 ? 516 GLU A O     1 
ATOM   387  C  CB    . GLU A 1 49  ? 6.930  31.494 -0.819  1.00 83.03 ? 516 GLU A CB    1 
ATOM   388  C  CG    . GLU A 1 49  ? 6.725  30.373 0.188   1.00 83.24 ? 516 GLU A CG    1 
ATOM   389  C  CD    . GLU A 1 49  ? 8.017  29.925 0.841   1.00 84.22 ? 516 GLU A CD    1 
ATOM   390  O  OE1   . GLU A 1 49  ? 8.920  30.769 1.015   1.00 86.72 ? 516 GLU A OE1   1 
ATOM   391  O  OE2   . GLU A 1 49  ? 8.127  28.731 1.187   1.00 82.58 ? 516 GLU A OE2   1 
ATOM   392  N  N     . ARG A 1 50  ? 4.956  33.843 -0.028  1.00 71.56 ? 517 ARG A N     1 
ATOM   393  C  CA    . ARG A 1 50  ? 4.109  34.537 0.939   1.00 66.53 ? 517 ARG A CA    1 
ATOM   394  C  C     . ARG A 1 50  ? 2.673  34.657 0.431   1.00 61.71 ? 517 ARG A C     1 
ATOM   395  O  O     . ARG A 1 50  ? 1.726  34.507 1.195   1.00 62.34 ? 517 ARG A O     1 
ATOM   396  C  CB    . ARG A 1 50  ? 4.679  35.909 1.266   1.00 66.18 ? 517 ARG A CB    1 
ATOM   397  N  N     . HIS A 1 51  ? 2.517  34.922 -0.862  1.00 59.08 ? 518 HIS A N     1 
ATOM   398  C  CA    . HIS A 1 51  ? 1.193  35.043 -1.459  1.00 58.64 ? 518 HIS A CA    1 
ATOM   399  C  C     . HIS A 1 51  ? 0.508  33.684 -1.496  1.00 57.37 ? 518 HIS A C     1 
ATOM   400  O  O     . HIS A 1 51  ? -0.650 33.543 -1.096  1.00 59.49 ? 518 HIS A O     1 
ATOM   401  C  CB    . HIS A 1 51  ? 1.294  35.621 -2.862  1.00 59.37 ? 518 HIS A CB    1 
ATOM   402  N  N     . ILE A 1 52  ? 1.240  32.686 -1.979  1.00 52.90 ? 519 ILE A N     1 
ATOM   403  C  CA    . ILE A 1 52  ? 0.734  31.325 -2.069  1.00 50.15 ? 519 ILE A CA    1 
ATOM   404  C  C     . ILE A 1 52  ? 0.352  30.790 -0.691  1.00 46.33 ? 519 ILE A C     1 
ATOM   405  O  O     . ILE A 1 52  ? -0.765 30.322 -0.488  1.00 42.41 ? 519 ILE A O     1 
ATOM   406  C  CB    . ILE A 1 52  ? 1.769  30.394 -2.722  1.00 50.88 ? 519 ILE A CB    1 
ATOM   407  C  CG1   . ILE A 1 52  ? 2.093  30.897 -4.138  1.00 52.09 ? 519 ILE A CG1   1 
ATOM   408  C  CG2   . ILE A 1 52  ? 1.267  28.945 -2.719  1.00 49.12 ? 519 ILE A CG2   1 
ATOM   409  C  CD1   . ILE A 1 52  ? 3.373  30.334 -4.731  1.00 52.47 ? 519 ILE A CD1   1 
ATOM   410  N  N     . PHE A 1 53  ? 1.274  30.864 0.261   1.00 45.77 ? 520 PHE A N     1 
ATOM   411  C  CA    . PHE A 1 53  ? 0.962  30.433 1.622   1.00 47.34 ? 520 PHE A CA    1 
ATOM   412  C  C     . PHE A 1 53  ? -0.357 31.039 2.128   1.00 43.29 ? 520 PHE A C     1 
ATOM   413  O  O     . PHE A 1 53  ? -1.142 30.361 2.780   1.00 44.08 ? 520 PHE A O     1 
ATOM   414  C  CB    . PHE A 1 53  ? 2.116  30.744 2.580   1.00 49.72 ? 520 PHE A CB    1 
ATOM   415  C  CG    . PHE A 1 53  ? 3.110  29.619 2.719   1.00 52.86 ? 520 PHE A CG    1 
ATOM   416  C  CD1   . PHE A 1 53  ? 3.754  29.101 1.605   1.00 54.90 ? 520 PHE A CD1   1 
ATOM   417  C  CD2   . PHE A 1 53  ? 3.405  29.084 3.965   1.00 53.39 ? 520 PHE A CD2   1 
ATOM   418  C  CE1   . PHE A 1 53  ? 4.668  28.069 1.731   1.00 54.68 ? 520 PHE A CE1   1 
ATOM   419  C  CE2   . PHE A 1 53  ? 4.320  28.051 4.100   1.00 51.83 ? 520 PHE A CE2   1 
ATOM   420  C  CZ    . PHE A 1 53  ? 4.953  27.546 2.982   1.00 54.22 ? 520 PHE A CZ    1 
ATOM   421  N  N     . ARG A 1 54  ? -0.611 32.302 1.808   1.00 44.00 ? 521 ARG A N     1 
ATOM   422  C  CA    . ARG A 1 54  ? -1.806 32.980 2.320   1.00 47.66 ? 521 ARG A CA    1 
ATOM   423  C  C     . ARG A 1 54  ? -3.095 32.569 1.603   1.00 44.06 ? 521 ARG A C     1 
ATOM   424  O  O     . ARG A 1 54  ? -4.187 32.763 2.130   1.00 42.47 ? 521 ARG A O     1 
ATOM   425  C  CB    . ARG A 1 54  ? -1.621 34.499 2.274   1.00 55.14 ? 521 ARG A CB    1 
ATOM   426  C  CG    . ARG A 1 54  ? -0.631 35.015 3.306   1.00 61.59 ? 521 ARG A CG    1 
ATOM   427  C  CD    . ARG A 1 54  ? -0.139 36.424 2.995   1.00 68.67 ? 521 ARG A CD    1 
ATOM   428  N  NE    . ARG A 1 54  ? 0.714  36.944 4.065   1.00 73.85 ? 521 ARG A NE    1 
ATOM   429  C  CZ    . ARG A 1 54  ? 1.994  36.619 4.233   1.00 76.38 ? 521 ARG A CZ    1 
ATOM   430  N  NH1   . ARG A 1 54  ? 2.583  35.772 3.399   1.00 78.04 ? 521 ARG A NH1   1 
ATOM   431  N  NH2   . ARG A 1 54  ? 2.687  37.139 5.236   1.00 76.54 ? 521 ARG A NH2   1 
ATOM   432  N  N     . GLU A 1 55  ? -2.961 31.998 0.407   1.00 44.18 ? 522 GLU A N     1 
ATOM   433  C  CA    . GLU A 1 55  ? -4.109 31.549 -0.392  1.00 47.05 ? 522 GLU A CA    1 
ATOM   434  C  C     . GLU A 1 55  ? -4.568 30.134 -0.029  1.00 44.85 ? 522 GLU A C     1 
ATOM   435  O  O     . GLU A 1 55  ? -5.600 29.648 -0.529  1.00 45.03 ? 522 GLU A O     1 
ATOM   436  C  CB    . GLU A 1 55  ? -3.764 31.597 -1.893  1.00 50.70 ? 522 GLU A CB    1 
ATOM   437  C  CG    . GLU A 1 55  ? -3.681 32.995 -2.473  1.00 57.56 ? 522 GLU A CG    1 
ATOM   438  C  CD    . GLU A 1 55  ? -2.718 33.094 -3.646  1.00 64.06 ? 522 GLU A CD    1 
ATOM   439  O  OE1   . GLU A 1 55  ? -2.363 32.048 -4.227  1.00 62.51 ? 522 GLU A OE1   1 
ATOM   440  O  OE2   . GLU A 1 55  ? -2.309 34.224 -3.988  1.00 68.94 ? 522 GLU A OE2   1 
ATOM   441  N  N     . VAL A 1 56  ? -3.800 29.471 0.832   1.00 39.03 ? 523 VAL A N     1 
ATOM   442  C  CA    . VAL A 1 56  ? -4.029 28.061 1.112   1.00 33.44 ? 523 VAL A CA    1 
ATOM   443  C  C     . VAL A 1 56  ? -4.401 27.817 2.574   1.00 28.45 ? 523 VAL A C     1 
ATOM   444  O  O     . VAL A 1 56  ? -4.441 28.739 3.388   1.00 28.48 ? 523 VAL A O     1 
ATOM   445  C  CB    . VAL A 1 56  ? -2.801 27.188 0.715   1.00 33.12 ? 523 VAL A CB    1 
ATOM   446  C  CG1   . VAL A 1 56  ? -2.441 27.381 -0.759  1.00 36.46 ? 523 VAL A CG1   1 
ATOM   447  C  CG2   . VAL A 1 56  ? -1.613 27.513 1.579   1.00 30.77 ? 523 VAL A CG2   1 
ATOM   448  N  N     . SER A 1 57  ? -4.686 26.565 2.893   1.00 24.79 ? 524 SER A N     1 
ATOM   449  C  CA    . SER A 1 57  ? -5.089 26.190 4.237   1.00 25.74 ? 524 SER A CA    1 
ATOM   450  C  C     . SER A 1 57  ? -3.883 26.176 5.156   1.00 25.88 ? 524 SER A C     1 
ATOM   451  O  O     . SER A 1 57  ? -2.735 26.135 4.691   1.00 24.79 ? 524 SER A O     1 
ATOM   452  C  CB    . SER A 1 57  ? -5.682 24.786 4.211   1.00 24.00 ? 524 SER A CB    1 
ATOM   453  O  OG    . SER A 1 57  ? -4.678 23.879 3.804   1.00 23.27 ? 524 SER A OG    1 
ATOM   454  N  N     . GLU A 1 58  ? -4.142 26.171 6.460   1.00 23.12 ? 525 GLU A N     1 
ATOM   455  C  CA    . GLU A 1 58  ? -3.075 26.028 7.442   1.00 22.89 ? 525 GLU A CA    1 
ATOM   456  C  C     . GLU A 1 58  ? -2.359 24.694 7.247   1.00 23.11 ? 525 GLU A C     1 
ATOM   457  O  O     . GLU A 1 58  ? -1.145 24.613 7.413   1.00 25.02 ? 525 GLU A O     1 
ATOM   458  C  CB    . GLU A 1 58  ? -3.628 26.140 8.862   1.00 23.85 ? 525 GLU A CB    1 
ATOM   459  C  CG    . GLU A 1 58  ? -2.576 25.992 9.950   1.00 25.36 ? 525 GLU A CG    1 
ATOM   460  C  CD    . GLU A 1 58  ? -3.103 26.400 11.302  0.50 23.79 ? 525 GLU A CD    1 
ATOM   461  O  OE1   . GLU A 1 58  ? -4.325 26.289 11.519  0.50 23.48 ? 525 GLU A OE1   1 
ATOM   462  O  OE2   . GLU A 1 58  ? -2.299 26.831 12.146  0.50 22.70 ? 525 GLU A OE2   1 
ATOM   463  N  N     . SER A 1 59  ? -3.104 23.655 6.876   1.00 21.92 ? 526 SER A N     1 
ATOM   464  C  CA    . SER A 1 59  ? -2.506 22.341 6.606   1.00 24.69 ? 526 SER A CA    1 
ATOM   465  C  C     . SER A 1 59  ? -1.518 22.358 5.438   1.00 26.19 ? 526 SER A C     1 
ATOM   466  O  O     . SER A 1 59  ? -0.414 21.796 5.523   1.00 25.67 ? 526 SER A O     1 
ATOM   467  C  CB    . SER A 1 59  ? -3.594 21.302 6.334   1.00 29.19 ? 526 SER A CB    1 
ATOM   468  O  OG    . SER A 1 59  ? -4.390 21.107 7.486   1.00 30.25 ? 526 SER A OG    1 
ATOM   469  N  N     . ILE A 1 60  ? -1.912 22.986 4.336   1.00 24.24 ? 527 ILE A N     1 
ATOM   470  C  CA    . ILE A 1 60  ? -0.990 23.118 3.213   1.00 25.07 ? 527 ILE A CA    1 
ATOM   471  C  C     . ILE A 1 60  ? 0.250  23.907 3.645   1.00 27.34 ? 527 ILE A C     1 
ATOM   472  O  O     . ILE A 1 60  ? 1.379  23.537 3.308   1.00 28.84 ? 527 ILE A O     1 
ATOM   473  C  CB    . ILE A 1 60  ? -1.665 23.751 1.992   1.00 24.38 ? 527 ILE A CB    1 
ATOM   474  C  CG1   . ILE A 1 60  ? -2.678 22.756 1.406   1.00 24.74 ? 527 ILE A CG1   1 
ATOM   475  C  CG2   . ILE A 1 60  ? -0.607 24.189 0.944   1.00 25.50 ? 527 ILE A CG2   1 
ATOM   476  C  CD1   . ILE A 1 60  ? -3.511 23.288 0.277   1.00 24.82 ? 527 ILE A CD1   1 
ATOM   477  N  N     . ARG A 1 61  ? 0.052  24.974 4.417   1.00 25.99 ? 528 ARG A N     1 
ATOM   478  C  CA    . ARG A 1 61  ? 1.191  25.769 4.890   1.00 27.43 ? 528 ARG A CA    1 
ATOM   479  C  C     . ARG A 1 61  ? 2.143  24.942 5.740   1.00 30.22 ? 528 ARG A C     1 
ATOM   480  O  O     . ARG A 1 61  ? 3.360  25.102 5.654   1.00 29.85 ? 528 ARG A O     1 
ATOM   481  C  CB    . ARG A 1 61  ? 0.735  26.992 5.686   1.00 30.58 ? 528 ARG A CB    1 
ATOM   482  C  CG    . ARG A 1 61  ? 0.235  28.142 4.838   1.00 32.51 ? 528 ARG A CG    1 
ATOM   483  C  CD    . ARG A 1 61  ? 0.148  29.418 5.659   1.00 35.57 ? 528 ARG A CD    1 
ATOM   484  N  NE    . ARG A 1 61  ? -0.843 29.305 6.718   1.00 37.19 ? 528 ARG A NE    1 
ATOM   485  C  CZ    . ARG A 1 61  ? -2.149 29.496 6.534   1.00 38.14 ? 528 ARG A CZ    1 
ATOM   486  N  NH1   . ARG A 1 61  ? -2.605 29.817 5.330   1.00 39.84 ? 528 ARG A NH1   1 
ATOM   487  N  NH2   . ARG A 1 61  ? -2.995 29.370 7.548   1.00 36.73 ? 528 ARG A NH2   1 
ATOM   488  N  N     . GLN A 1 62  ? 1.592  24.067 6.575   1.00 29.38 ? 529 GLN A N     1 
ATOM   489  C  CA    . GLN A 1 62  ? 2.433  23.216 7.416   1.00 29.79 ? 529 GLN A CA    1 
ATOM   490  C  C     . GLN A 1 62  ? 3.153  22.186 6.564   1.00 30.96 ? 529 GLN A C     1 
ATOM   491  O  O     . GLN A 1 62  ? 4.345  21.932 6.757   1.00 33.88 ? 529 GLN A O     1 
ATOM   492  C  CB    . GLN A 1 62  ? 1.607  22.521 8.503   1.00 29.91 ? 529 GLN A CB    1 
ATOM   493  C  CG    . GLN A 1 62  ? 1.075  23.468 9.562   1.00 31.21 ? 529 GLN A CG    1 
ATOM   494  C  CD    . GLN A 1 62  ? -0.015 22.848 10.417  1.00 33.99 ? 529 GLN A CD    1 
ATOM   495  O  OE1   . GLN A 1 62  ? -0.586 21.811 10.071  1.00 36.21 ? 529 GLN A OE1   1 
ATOM   496  N  NE2   . GLN A 1 62  ? -0.317 23.490 11.537  1.00 33.62 ? 529 GLN A NE2   1 
ATOM   497  N  N     . ASP A 1 63  ? 2.427  21.592 5.621   1.00 29.68 ? 530 ASP A N     1 
ATOM   498  C  CA    . ASP A 1 63  ? 3.017  20.592 4.734   1.00 33.07 ? 530 ASP A CA    1 
ATOM   499  C  C     . ASP A 1 63  ? 4.152  21.194 3.920   1.00 35.26 ? 530 ASP A C     1 
ATOM   500  O  O     . ASP A 1 63  ? 5.223  20.597 3.787   1.00 37.85 ? 530 ASP A O     1 
ATOM   501  C  CB    . ASP A 1 63  ? 1.956  20.006 3.798   1.00 35.69 ? 530 ASP A CB    1 
ATOM   502  C  CG    . ASP A 1 63  ? 0.944  19.154 4.529   1.00 40.39 ? 530 ASP A CG    1 
ATOM   503  O  OD1   . ASP A 1 63  ? 1.151  18.866 5.723   1.00 41.89 ? 530 ASP A OD1   1 
ATOM   504  O  OD2   . ASP A 1 63  ? -0.066 18.769 3.909   1.00 44.46 ? 530 ASP A OD2   1 
ATOM   505  N  N     . VAL A 1 64  ? 3.926  22.383 3.378   1.00 32.58 ? 531 VAL A N     1 
ATOM   506  C  CA    . VAL A 1 64  ? 4.954  23.017 2.561   1.00 35.79 ? 531 VAL A CA    1 
ATOM   507  C  C     . VAL A 1 64  ? 6.152  23.445 3.407   1.00 36.27 ? 531 VAL A C     1 
ATOM   508  O  O     . VAL A 1 64  ? 7.298  23.224 3.022   1.00 38.41 ? 531 VAL A O     1 
ATOM   509  C  CB    . VAL A 1 64  ? 4.404  24.209 1.752   1.00 38.01 ? 531 VAL A CB    1 
ATOM   510  C  CG1   . VAL A 1 64  ? 5.525  24.849 0.944   1.00 39.82 ? 531 VAL A CG1   1 
ATOM   511  C  CG2   . VAL A 1 64  ? 3.276  23.745 0.833   1.00 38.82 ? 531 VAL A CG2   1 
ATOM   512  N  N     . ALA A 1 65  ? 5.901  24.035 4.572   1.00 34.02 ? 532 ALA A N     1 
ATOM   513  C  CA    . ALA A 1 65  ? 7.015  24.454 5.422   1.00 33.16 ? 532 ALA A CA    1 
ATOM   514  C  C     . ALA A 1 65  ? 7.822  23.243 5.901   1.00 35.53 ? 532 ALA A C     1 
ATOM   515  O  O     . ALA A 1 65  ? 9.057  23.278 5.947   1.00 37.36 ? 532 ALA A O     1 
ATOM   516  C  CB    . ALA A 1 65  ? 6.518  25.275 6.603   1.00 33.50 ? 532 ALA A CB    1 
ATOM   517  N  N     . ASN A 1 66  ? 7.125  22.168 6.253   1.00 34.26 ? 533 ASN A N     1 
ATOM   518  C  CA    . ASN A 1 66  ? 7.802  20.950 6.680   1.00 34.94 ? 533 ASN A CA    1 
ATOM   519  C  C     . ASN A 1 66  ? 8.678  20.383 5.577   1.00 34.87 ? 533 ASN A C     1 
ATOM   520  O  O     . ASN A 1 66  ? 9.788  19.920 5.838   1.00 35.94 ? 533 ASN A O     1 
ATOM   521  C  CB    . ASN A 1 66  ? 6.805  19.890 7.153   1.00 33.93 ? 533 ASN A CB    1 
ATOM   522  C  CG    . ASN A 1 66  ? 6.548  19.957 8.651   1.00 34.20 ? 533 ASN A CG    1 
ATOM   523  O  OD1   . ASN A 1 66  ? 7.470  19.869 9.461   1.00 35.89 ? 533 ASN A OD1   1 
ATOM   524  N  ND2   . ASN A 1 66  ? 5.296  20.089 9.022   1.00 33.94 ? 533 ASN A ND2   1 
ATOM   525  N  N     . TYR A 1 67  ? 8.184  20.411 4.343   1.00 34.29 ? 534 TYR A N     1 
ATOM   526  C  CA    . TYR A 1 67  ? 8.982  19.872 3.240   1.00 37.79 ? 534 TYR A CA    1 
ATOM   527  C  C     . TYR A 1 67  ? 10.197 20.741 2.924   1.00 42.38 ? 534 TYR A C     1 
ATOM   528  O  O     . TYR A 1 67  ? 11.313 20.236 2.751   1.00 42.91 ? 534 TYR A O     1 
ATOM   529  C  CB    . TYR A 1 67  ? 8.152  19.659 1.974   1.00 43.24 ? 534 TYR A CB    1 
ATOM   530  C  CG    . TYR A 1 67  ? 8.925  18.877 0.931   1.00 47.91 ? 534 TYR A CG    1 
ATOM   531  C  CD1   . TYR A 1 67  ? 8.893  17.489 0.913   1.00 51.16 ? 534 TYR A CD1   1 
ATOM   532  C  CD2   . TYR A 1 67  ? 9.725  19.525 -0.007  1.00 52.26 ? 534 TYR A CD2   1 
ATOM   533  C  CE1   . TYR A 1 67  ? 9.617  16.768 -0.031  1.00 54.59 ? 534 TYR A CE1   1 
ATOM   534  C  CE2   . TYR A 1 67  ? 10.450 18.814 -0.949  1.00 53.03 ? 534 TYR A CE2   1 
ATOM   535  C  CZ    . TYR A 1 67  ? 10.392 17.435 -0.957  1.00 55.89 ? 534 TYR A CZ    1 
ATOM   536  O  OH    . TYR A 1 67  ? 11.114 16.715 -1.890  1.00 59.89 ? 534 TYR A OH    1 
ATOM   537  N  N     . ASN A 1 68  ? 9.984  22.047 2.834   1.00 44.85 ? 535 ASN A N     1 
ATOM   538  C  CA    . ASN A 1 68  ? 11.077 22.956 2.520   1.00 47.31 ? 535 ASN A CA    1 
ATOM   539  C  C     . ASN A 1 68  ? 12.153 22.969 3.604   1.00 46.89 ? 535 ASN A C     1 
ATOM   540  O  O     . ASN A 1 68  ? 13.328 23.210 3.319   1.00 46.17 ? 535 ASN A O     1 
ATOM   541  C  CB    . ASN A 1 68  ? 10.552 24.366 2.253   1.00 47.90 ? 535 ASN A CB    1 
ATOM   542  C  CG    . ASN A 1 68  ? 9.666  24.428 1.027   1.00 48.01 ? 535 ASN A CG    1 
ATOM   543  O  OD1   . ASN A 1 68  ? 9.633  23.493 0.225   1.00 47.22 ? 535 ASN A OD1   1 
ATOM   544  N  ND2   . ASN A 1 68  ? 8.940  25.527 0.875   1.00 47.85 ? 535 ASN A ND2   1 
ATOM   545  N  N     . CYS A 1 69  ? 11.748 22.692 4.842   1.00 46.34 ? 536 CYS A N     1 
ATOM   546  C  CA    . CYS A 1 69  ? 12.679 22.688 5.973   1.00 46.90 ? 536 CYS A CA    1 
ATOM   547  C  C     . CYS A 1 69  ? 13.135 21.283 6.388   1.00 43.38 ? 536 CYS A C     1 
ATOM   548  O  O     . CYS A 1 69  ? 13.761 21.119 7.429   1.00 41.78 ? 536 CYS A O     1 
ATOM   549  C  CB    . CYS A 1 69  ? 12.060 23.404 7.182   1.00 49.57 ? 536 CYS A CB    1 
ATOM   550  S  SG    . CYS A 1 69  ? 11.898 25.206 7.032   1.00 57.69 ? 536 CYS A SG    1 
ATOM   551  N  N     . ARG A 1 70  ? 12.825 20.277 5.575   1.00 45.46 ? 537 ARG A N     1 
ATOM   552  C  CA    . ARG A 1 70  ? 13.137 18.886 5.907   1.00 47.50 ? 537 ARG A CA    1 
ATOM   553  C  C     . ARG A 1 70  ? 14.627 18.647 6.200   1.00 45.92 ? 537 ARG A C     1 
ATOM   554  O  O     . ARG A 1 70  ? 14.973 18.044 7.221   1.00 44.73 ? 537 ARG A O     1 
ATOM   555  C  CB    . ARG A 1 70  ? 12.652 17.945 4.795   1.00 56.71 ? 537 ARG A CB    1 
ATOM   556  C  CG    . ARG A 1 70  ? 13.404 18.095 3.478   1.00 65.63 ? 537 ARG A CG    1 
ATOM   557  C  CD    . ARG A 1 70  ? 12.679 17.435 2.309   1.00 72.11 ? 537 ARG A CD    1 
ATOM   558  N  NE    . ARG A 1 70  ? 13.497 17.463 1.097   1.00 76.29 ? 537 ARG A NE    1 
ATOM   559  C  CZ    . ARG A 1 70  ? 13.587 18.504 0.274   1.00 79.10 ? 537 ARG A CZ    1 
ATOM   560  N  NH1   . ARG A 1 70  ? 12.903 19.613 0.522   1.00 78.88 ? 537 ARG A NH1   1 
ATOM   561  N  NH2   . ARG A 1 70  ? 14.363 18.438 -0.801  1.00 81.14 ? 537 ARG A NH2   1 
ATOM   562  N  N     . ASP A 1 71  ? 15.500 19.123 5.312   1.00 43.64 ? 538 ASP A N     1 
ATOM   563  C  CA    . ASP A 1 71  ? 16.944 18.965 5.486   1.00 43.04 ? 538 ASP A CA    1 
ATOM   564  C  C     . ASP A 1 71  ? 17.452 19.692 6.729   1.00 39.97 ? 538 ASP A C     1 
ATOM   565  O  O     . ASP A 1 71  ? 18.303 19.174 7.453   1.00 41.27 ? 538 ASP A O     1 
ATOM   566  C  CB    . ASP A 1 71  ? 17.697 19.453 4.245   1.00 43.02 ? 538 ASP A CB    1 
ATOM   567  N  N     . LEU A 1 72  ? 16.948 20.899 6.970   1.00 38.05 ? 539 LEU A N     1 
ATOM   568  C  CA    . LEU A 1 72  ? 17.361 21.640 8.160   1.00 33.99 ? 539 LEU A CA    1 
ATOM   569  C  C     . LEU A 1 72  ? 16.968 20.862 9.401   1.00 33.22 ? 539 LEU A C     1 
ATOM   570  O  O     . LEU A 1 72  ? 17.786 20.675 10.300  1.00 35.25 ? 539 LEU A O     1 
ATOM   571  C  CB    . LEU A 1 72  ? 16.744 23.038 8.210   1.00 35.63 ? 539 LEU A CB    1 
ATOM   572  C  CG    . LEU A 1 72  ? 16.985 23.794 9.526   1.00 32.30 ? 539 LEU A CG    1 
ATOM   573  C  CD1   . LEU A 1 72  ? 18.412 24.326 9.591   1.00 30.24 ? 539 LEU A CD1   1 
ATOM   574  C  CD2   . LEU A 1 72  ? 16.002 24.933 9.673   1.00 34.74 ? 539 LEU A CD2   1 
ATOM   575  N  N     . VAL A 1 73  ? 15.719 20.399 9.445   1.00 29.85 ? 540 VAL A N     1 
ATOM   576  C  CA    . VAL A 1 73  ? 15.230 19.688 10.619  1.00 30.42 ? 540 VAL A CA    1 
ATOM   577  C  C     . VAL A 1 73  ? 16.059 18.435 10.884  1.00 33.88 ? 540 VAL A C     1 
ATOM   578  O  O     . VAL A 1 73  ? 16.409 18.156 12.024  1.00 35.87 ? 540 VAL A O     1 
ATOM   579  C  CB    . VAL A 1 73  ? 13.731 19.327 10.514  1.00 33.18 ? 540 VAL A CB    1 
ATOM   580  C  CG1   . VAL A 1 73  ? 13.324 18.445 11.679  1.00 35.05 ? 540 VAL A CG1   1 
ATOM   581  C  CG2   . VAL A 1 73  ? 12.887 20.583 10.497  1.00 31.86 ? 540 VAL A CG2   1 
ATOM   582  N  N     . ALA A 1 74  ? 16.390 17.703 9.822   1.00 38.02 ? 541 ALA A N     1 
ATOM   583  C  CA    . ALA A 1 74  ? 17.213 16.503 9.940   1.00 39.01 ? 541 ALA A CA    1 
ATOM   584  C  C     . ALA A 1 74  ? 18.621 16.815 10.445  1.00 38.06 ? 541 ALA A C     1 
ATOM   585  O  O     . ALA A 1 74  ? 19.237 15.987 11.113  1.00 40.93 ? 541 ALA A O     1 
ATOM   586  C  CB    . ALA A 1 74  ? 17.283 15.767 8.602   1.00 41.59 ? 541 ALA A CB    1 
ATOM   587  N  N     . SER A 1 75  ? 19.124 18.007 10.128  1.00 33.29 ? 542 SER A N     1 
ATOM   588  C  CA    . SER A 1 75  ? 20.498 18.386 10.476  1.00 33.78 ? 542 SER A CA    1 
ATOM   589  C  C     . SER A 1 75  ? 20.642 18.980 11.874  1.00 34.45 ? 542 SER A C     1 
ATOM   590  O  O     . SER A 1 75  ? 21.749 19.026 12.422  1.00 31.93 ? 542 SER A O     1 
ATOM   591  C  CB    . SER A 1 75  ? 21.058 19.371 9.449   1.00 34.78 ? 542 SER A CB    1 
ATOM   592  O  OG    . SER A 1 75  ? 20.447 20.642 9.595   1.00 32.67 ? 542 SER A OG    1 
ATOM   593  N  N     . VAL A 1 76  ? 19.534 19.449 12.444  1.00 36.49 ? 543 VAL A N     1 
ATOM   594  C  CA    . VAL A 1 76  ? 19.556 20.035 13.779  1.00 37.70 ? 543 VAL A CA    1 
ATOM   595  C  C     . VAL A 1 76  ? 19.288 18.996 14.873  1.00 38.87 ? 543 VAL A C     1 
ATOM   596  O  O     . VAL A 1 76  ? 18.148 18.573 15.073  1.00 37.47 ? 543 VAL A O     1 
ATOM   597  C  CB    . VAL A 1 76  ? 18.551 21.203 13.904  1.00 37.79 ? 543 VAL A CB    1 
ATOM   598  C  CG1   . VAL A 1 76  ? 18.631 21.828 15.290  1.00 39.49 ? 543 VAL A CG1   1 
ATOM   599  C  CG2   . VAL A 1 76  ? 18.832 22.248 12.839  1.00 34.98 ? 543 VAL A CG2   1 
ATOM   600  N  N     . PRO A 1 77  ? 20.344 18.591 15.596  1.00 39.24 ? 544 PRO A N     1 
ATOM   601  C  CA    . PRO A 1 77  ? 20.192 17.591 16.659  1.00 44.69 ? 544 PRO A CA    1 
ATOM   602  C  C     . PRO A 1 77  ? 19.128 18.013 17.667  1.00 47.75 ? 544 PRO A C     1 
ATOM   603  O  O     . PRO A 1 77  ? 18.476 17.155 18.250  1.00 47.63 ? 544 PRO A O     1 
ATOM   604  C  CB    . PRO A 1 77  ? 21.576 17.565 17.314  1.00 46.04 ? 544 PRO A CB    1 
ATOM   605  C  CG    . PRO A 1 77  ? 22.515 18.035 16.231  1.00 44.60 ? 544 PRO A CG    1 
ATOM   606  C  CD    . PRO A 1 77  ? 21.729 19.087 15.498  1.00 41.43 ? 544 PRO A CD    1 
ATOM   607  N  N     . PHE A 1 78  ? 18.953 19.323 17.839  1.00 51.36 ? 545 PHE A N     1 
ATOM   608  C  CA    . PHE A 1 78  ? 17.942 19.882 18.732  1.00 55.69 ? 545 PHE A CA    1 
ATOM   609  C  C     . PHE A 1 78  ? 16.556 19.278 18.479  1.00 59.29 ? 545 PHE A C     1 
ATOM   610  O  O     . PHE A 1 78  ? 15.789 19.051 19.418  1.00 63.04 ? 545 PHE A O     1 
ATOM   611  C  CB    . PHE A 1 78  ? 17.915 21.411 18.578  1.00 56.27 ? 545 PHE A CB    1 
ATOM   612  C  CG    . PHE A 1 78  ? 16.838 22.098 19.375  1.00 57.18 ? 545 PHE A CG    1 
ATOM   613  C  CD1   . PHE A 1 78  ? 16.851 22.068 20.760  1.00 57.63 ? 545 PHE A CD1   1 
ATOM   614  C  CD2   . PHE A 1 78  ? 15.829 22.801 18.735  1.00 58.84 ? 545 PHE A CD2   1 
ATOM   615  C  CE1   . PHE A 1 78  ? 15.866 22.708 21.490  1.00 58.96 ? 545 PHE A CE1   1 
ATOM   616  C  CE2   . PHE A 1 78  ? 14.839 23.445 19.458  1.00 59.24 ? 545 PHE A CE2   1 
ATOM   617  C  CZ    . PHE A 1 78  ? 14.855 23.399 20.835  1.00 59.97 ? 545 PHE A CZ    1 
ATOM   618  N  N     . PHE A 1 79  ? 16.248 19.001 17.213  1.00 55.02 ? 546 PHE A N     1 
ATOM   619  C  CA    . PHE A 1 79  ? 14.926 18.496 16.836  1.00 52.65 ? 546 PHE A CA    1 
ATOM   620  C  C     . PHE A 1 79  ? 14.766 16.988 17.000  1.00 57.16 ? 546 PHE A C     1 
ATOM   621  O  O     . PHE A 1 79  ? 13.677 16.456 16.781  1.00 60.26 ? 546 PHE A O     1 
ATOM   622  C  CB    . PHE A 1 79  ? 14.591 18.869 15.390  1.00 49.74 ? 546 PHE A CB    1 
ATOM   623  C  CG    . PHE A 1 79  ? 14.391 20.337 15.168  1.00 48.56 ? 546 PHE A CG    1 
ATOM   624  C  CD1   . PHE A 1 79  ? 13.641 21.091 16.053  1.00 49.00 ? 546 PHE A CD1   1 
ATOM   625  C  CD2   . PHE A 1 79  ? 14.933 20.959 14.056  1.00 48.99 ? 546 PHE A CD2   1 
ATOM   626  C  CE1   . PHE A 1 79  ? 13.450 22.443 15.841  1.00 50.13 ? 546 PHE A CE1   1 
ATOM   627  C  CE2   . PHE A 1 79  ? 14.748 22.309 13.840  1.00 49.25 ? 546 PHE A CE2   1 
ATOM   628  C  CZ    . PHE A 1 79  ? 14.006 23.053 14.734  1.00 51.06 ? 546 PHE A CZ    1 
ATOM   629  N  N     . VAL A 1 80  ? 15.843 16.302 17.373  1.00 59.16 ? 547 VAL A N     1 
ATOM   630  C  CA    . VAL A 1 80  ? 15.806 14.850 17.522  1.00 60.67 ? 547 VAL A CA    1 
ATOM   631  C  C     . VAL A 1 80  ? 14.893 14.430 18.670  1.00 60.94 ? 547 VAL A C     1 
ATOM   632  O  O     . VAL A 1 80  ? 15.103 14.823 19.818  1.00 58.81 ? 547 VAL A O     1 
ATOM   633  C  CB    . VAL A 1 80  ? 17.220 14.289 17.722  1.00 61.93 ? 547 VAL A CB    1 
ATOM   634  N  N     . GLY A 1 81  ? 13.876 13.635 18.349  1.00 62.72 ? 548 GLY A N     1 
ATOM   635  C  CA    . GLY A 1 81  ? 12.945 13.137 19.345  1.00 62.78 ? 548 GLY A CA    1 
ATOM   636  C  C     . GLY A 1 81  ? 11.913 14.159 19.785  1.00 61.09 ? 548 GLY A C     1 
ATOM   637  O  O     . GLY A 1 81  ? 11.073 13.871 20.639  1.00 61.67 ? 548 GLY A O     1 
ATOM   638  N  N     . ALA A 1 82  ? 11.979 15.355 19.203  1.00 56.10 ? 549 ALA A N     1 
ATOM   639  C  CA    . ALA A 1 82  ? 11.047 16.426 19.532  1.00 51.03 ? 549 ALA A CA    1 
ATOM   640  C  C     . ALA A 1 82  ? 9.625  16.051 19.139  1.00 51.64 ? 549 ALA A C     1 
ATOM   641  O  O     . ALA A 1 82  ? 9.414  15.217 18.260  1.00 51.70 ? 549 ALA A O     1 
ATOM   642  C  CB    . ALA A 1 82  ? 11.458 17.721 18.831  1.00 47.40 ? 549 ALA A CB    1 
ATOM   643  N  N     . ASP A 1 83  ? 8.653  16.678 19.792  1.00 50.75 ? 550 ASP A N     1 
ATOM   644  C  CA    . ASP A 1 83  ? 7.244  16.489 19.455  1.00 48.77 ? 550 ASP A CA    1 
ATOM   645  C  C     . ASP A 1 83  ? 6.999  17.019 18.044  1.00 47.84 ? 550 ASP A C     1 
ATOM   646  O  O     . ASP A 1 83  ? 7.439  18.122 17.716  1.00 46.66 ? 550 ASP A O     1 
ATOM   647  C  CB    . ASP A 1 83  ? 6.377  17.240 20.465  1.00 51.56 ? 550 ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 83  ? 4.894  16.921 20.331  1.00 54.69 ? 550 ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 83  ? 4.373  16.883 19.196  1.00 54.76 ? 550 ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 83  ? 4.241  16.725 21.377  1.00 56.56 ? 550 ASP A OD2   1 
ATOM   651  N  N     . SER A 1 84  ? 6.319  16.228 17.211  1.00 47.54 ? 551 SER A N     1 
ATOM   652  C  CA    . SER A 1 84  ? 5.993  16.624 15.835  1.00 47.26 ? 551 SER A CA    1 
ATOM   653  C  C     . SER A 1 84  ? 5.297  17.980 15.764  1.00 42.96 ? 551 SER A C     1 
ATOM   654  O  O     . SER A 1 84  ? 5.511  18.751 14.821  1.00 41.44 ? 551 SER A O     1 
ATOM   655  C  CB    . SER A 1 84  ? 5.116  15.567 15.154  1.00 54.18 ? 551 SER A CB    1 
ATOM   656  O  OG    . SER A 1 84  ? 5.893  14.472 14.691  1.00 61.16 ? 551 SER A OG    1 
ATOM   657  N  N     . ASN A 1 85  ? 4.460  18.262 16.758  1.00 39.02 ? 552 ASN A N     1 
ATOM   658  C  CA    . ASN A 1 85  ? 3.753  19.537 16.825  1.00 37.33 ? 552 ASN A CA    1 
ATOM   659  C  C     . ASN A 1 85  ? 4.706  20.693 17.103  1.00 36.51 ? 552 ASN A C     1 
ATOM   660  O  O     . ASN A 1 85  ? 4.487  21.807 16.624  1.00 34.66 ? 552 ASN A O     1 
ATOM   661  C  CB    . ASN A 1 85  ? 2.651  19.501 17.883  1.00 35.97 ? 552 ASN A CB    1 
ATOM   662  C  CG    . ASN A 1 85  ? 1.533  18.537 17.532  1.00 37.10 ? 552 ASN A CG    1 
ATOM   663  O  OD1   . ASN A 1 85  ? 1.190  18.360 16.359  1.00 38.06 ? 552 ASN A OD1   1 
ATOM   664  N  ND2   . ASN A 1 85  ? 0.949  17.912 18.552  1.00 36.91 ? 552 ASN A ND2   1 
ATOM   665  N  N     . PHE A 1 86  ? 5.747  20.431 17.895  1.00 37.33 ? 553 PHE A N     1 
ATOM   666  C  CA    . PHE A 1 86  ? 6.809  21.419 18.124  1.00 37.40 ? 553 PHE A CA    1 
ATOM   667  C  C     . PHE A 1 86  ? 7.538  21.744 16.824  1.00 37.68 ? 553 PHE A C     1 
ATOM   668  O  O     . PHE A 1 86  ? 7.666  22.913 16.452  1.00 37.98 ? 553 PHE A O     1 
ATOM   669  C  CB    . PHE A 1 86  ? 7.813  20.952 19.197  1.00 37.18 ? 553 PHE A CB    1 
ATOM   670  C  CG    . PHE A 1 86  ? 9.003  21.889 19.379  1.00 38.81 ? 553 PHE A CG    1 
ATOM   671  C  CD1   . PHE A 1 86  ? 8.883  23.056 20.121  1.00 38.74 ? 553 PHE A CD1   1 
ATOM   672  C  CD2   . PHE A 1 86  ? 10.228 21.600 18.808  1.00 39.60 ? 553 PHE A CD2   1 
ATOM   673  C  CE1   . PHE A 1 86  ? 9.954  23.921 20.283  1.00 38.32 ? 553 PHE A CE1   1 
ATOM   674  C  CE2   . PHE A 1 86  ? 11.315 22.455 18.974  1.00 42.55 ? 553 PHE A CE2   1 
ATOM   675  C  CZ    . PHE A 1 86  ? 11.177 23.618 19.716  1.00 39.66 ? 553 PHE A CZ    1 
ATOM   676  N  N     . VAL A 1 87  ? 8.014  20.713 16.132  1.00 37.13 ? 554 VAL A N     1 
ATOM   677  C  CA    . VAL A 1 87  ? 8.725  20.927 14.876  1.00 36.42 ? 554 VAL A CA    1 
ATOM   678  C  C     . VAL A 1 87  ? 7.837  21.684 13.874  1.00 33.97 ? 554 VAL A C     1 
ATOM   679  O  O     . VAL A 1 87  ? 8.273  22.641 13.239  1.00 32.32 ? 554 VAL A O     1 
ATOM   680  C  CB    . VAL A 1 87  ? 9.202  19.606 14.256  1.00 38.67 ? 554 VAL A CB    1 
ATOM   681  C  CG1   . VAL A 1 87  ? 9.910  19.875 12.933  1.00 39.77 ? 554 VAL A CG1   1 
ATOM   682  C  CG2   . VAL A 1 87  ? 10.115 18.863 15.224  1.00 43.17 ? 554 VAL A CG2   1 
ATOM   683  N  N     . THR A 1 88  ? 6.583  21.268 13.745  1.00 31.48 ? 555 THR A N     1 
ATOM   684  C  CA    . THR A 1 88  ? 5.686  21.946 12.816  1.00 31.55 ? 555 THR A CA    1 
ATOM   685  C  C     . THR A 1 88  ? 5.500  23.430 13.161  1.00 32.10 ? 555 THR A C     1 
ATOM   686  O  O     . THR A 1 88  ? 5.526  24.298 12.281  1.00 32.95 ? 555 THR A O     1 
ATOM   687  C  CB    . THR A 1 88  ? 4.328  21.232 12.723  1.00 34.04 ? 555 THR A CB    1 
ATOM   688  O  OG1   . THR A 1 88  ? 4.513  19.964 12.078  1.00 36.39 ? 555 THR A OG1   1 
ATOM   689  C  CG2   . THR A 1 88  ? 3.340  22.072 11.923  1.00 33.17 ? 555 THR A CG2   1 
ATOM   690  N  N     . ARG A 1 89  ? 5.329  23.723 14.443  1.00 30.42 ? 556 ARG A N     1 
ATOM   691  C  CA    . ARG A 1 89  ? 5.146  25.102 14.880  1.00 34.09 ? 556 ARG A CA    1 
ATOM   692  C  C     . ARG A 1 89  ? 6.356  25.965 14.520  1.00 32.16 ? 556 ARG A C     1 
ATOM   693  O  O     . ARG A 1 89  ? 6.213  27.063 13.982  1.00 32.01 ? 556 ARG A O     1 
ATOM   694  C  CB    . ARG A 1 89  ? 4.898  25.161 16.388  1.00 34.16 ? 556 ARG A CB    1 
ATOM   695  C  CG    . ARG A 1 89  ? 4.576  26.563 16.904  1.00 35.97 ? 556 ARG A CG    1 
ATOM   696  C  CD    . ARG A 1 89  ? 3.185  26.994 16.482  1.00 37.99 ? 556 ARG A CD    1 
ATOM   697  N  NE    . ARG A 1 89  ? 2.155  26.149 17.084  1.00 40.51 ? 556 ARG A NE    1 
ATOM   698  C  CZ    . ARG A 1 89  ? 0.859  26.220 16.796  0.50 42.02 ? 556 ARG A CZ    1 
ATOM   699  N  NH1   . ARG A 1 89  ? 0.424  27.092 15.896  0.50 40.89 ? 556 ARG A NH1   1 
ATOM   700  N  NH2   . ARG A 1 89  ? -0.003 25.416 17.407  0.50 41.98 ? 556 ARG A NH2   1 
ATOM   701  N  N     . VAL A 1 90  ? 7.548  25.462 14.815  1.00 29.92 ? 557 VAL A N     1 
ATOM   702  C  CA    . VAL A 1 90  ? 8.772  26.201 14.534  1.00 30.24 ? 557 VAL A CA    1 
ATOM   703  C  C     . VAL A 1 90  ? 8.940  26.474 13.047  1.00 31.56 ? 557 VAL A C     1 
ATOM   704  O  O     . VAL A 1 90  ? 9.115  27.625 12.647  1.00 30.78 ? 557 VAL A O     1 
ATOM   705  C  CB    . VAL A 1 90  ? 10.012 25.466 15.068  1.00 33.82 ? 557 VAL A CB    1 
ATOM   706  C  CG1   . VAL A 1 90  ? 11.294 26.162 14.603  1.00 34.63 ? 557 VAL A CG1   1 
ATOM   707  C  CG2   . VAL A 1 90  ? 9.953  25.407 16.579  1.00 34.32 ? 557 VAL A CG2   1 
ATOM   708  N  N     . VAL A 1 91  ? 8.867  25.427 12.227  1.00 33.13 ? 558 VAL A N     1 
ATOM   709  C  CA    . VAL A 1 91  ? 9.139  25.594 10.802  1.00 33.14 ? 558 VAL A CA    1 
ATOM   710  C  C     . VAL A 1 91  ? 8.161  26.559 10.139  1.00 31.55 ? 558 VAL A C     1 
ATOM   711  O  O     . VAL A 1 91  ? 8.511  27.206 9.163   1.00 31.78 ? 558 VAL A O     1 
ATOM   712  C  CB    . VAL A 1 91  ? 9.196  24.254 10.006  1.00 34.91 ? 558 VAL A CB    1 
ATOM   713  C  CG1   . VAL A 1 91  ? 10.386 23.393 10.457  1.00 33.95 ? 558 VAL A CG1   1 
ATOM   714  C  CG2   . VAL A 1 91  ? 7.887  23.482 10.100  1.00 36.13 ? 558 VAL A CG2   1 
ATOM   715  N  N     . THR A 1 92  ? 6.946  26.665 10.667  1.00 32.57 ? 559 THR A N     1 
ATOM   716  C  CA    . THR A 1 92  ? 5.965  27.578 10.085  1.00 31.62 ? 559 THR A CA    1 
ATOM   717  C  C     . THR A 1 92  ? 6.245  29.027 10.486  1.00 32.32 ? 559 THR A C     1 
ATOM   718  O  O     . THR A 1 92  ? 5.696  29.958 9.899   1.00 35.33 ? 559 THR A O     1 
ATOM   719  C  CB    . THR A 1 92  ? 4.517  27.216 10.485  1.00 35.74 ? 559 THR A CB    1 
ATOM   720  O  OG1   . THR A 1 92  ? 4.360  27.351 11.901  1.00 35.40 ? 559 THR A OG1   1 
ATOM   721  C  CG2   . THR A 1 92  ? 4.169  25.795 10.064  1.00 35.97 ? 559 THR A CG2   1 
ATOM   722  N  N     . LEU A 1 93  ? 7.094  29.220 11.489  1.00 29.45 ? 560 LEU A N     1 
ATOM   723  C  CA    . LEU A 1 93  ? 7.424  30.567 11.951  1.00 30.73 ? 560 LEU A CA    1 
ATOM   724  C  C     . LEU A 1 93  ? 8.814  31.043 11.537  1.00 29.62 ? 560 LEU A C     1 
ATOM   725  O  O     . LEU A 1 93  ? 9.143  32.212 11.721  1.00 32.35 ? 560 LEU A O     1 
ATOM   726  C  CB    . LEU A 1 93  ? 7.287  30.674 13.470  1.00 31.08 ? 560 LEU A CB    1 
ATOM   727  C  CG    . LEU A 1 93  ? 5.908  30.356 14.060  1.00 34.40 ? 560 LEU A CG    1 
ATOM   728  C  CD1   . LEU A 1 93  ? 5.963  30.458 15.566  1.00 34.53 ? 560 LEU A CD1   1 
ATOM   729  C  CD2   . LEU A 1 93  ? 4.832  31.281 13.500  1.00 38.07 ? 560 LEU A CD2   1 
ATOM   730  N  N     . LEU A 1 94  ? 9.630  30.145 10.995  1.00 26.25 ? 561 LEU A N     1 
ATOM   731  C  CA    . LEU A 1 94  ? 10.987 30.513 10.581  1.00 24.76 ? 561 LEU A CA    1 
ATOM   732  C  C     . LEU A 1 94  ? 10.982 31.505 9.412   1.00 25.67 ? 561 LEU A C     1 
ATOM   733  O  O     . LEU A 1 94  ? 10.112 31.444 8.551   1.00 27.41 ? 561 LEU A O     1 
ATOM   734  C  CB    . LEU A 1 94  ? 11.785 29.263 10.203  1.00 23.11 ? 561 LEU A CB    1 
ATOM   735  C  CG    . LEU A 1 94  ? 12.117 28.274 11.321  1.00 23.94 ? 561 LEU A CG    1 
ATOM   736  C  CD1   . LEU A 1 94  ? 12.846 27.067 10.741  1.00 26.42 ? 561 LEU A CD1   1 
ATOM   737  C  CD2   . LEU A 1 94  ? 12.960 28.944 12.397  1.00 24.21 ? 561 LEU A CD2   1 
ATOM   738  N  N     . GLU A 1 95  ? 11.949 32.420 9.387   1.00 24.47 ? 562 GLU A N     1 
ATOM   739  C  CA    . GLU A 1 95  ? 12.112 33.342 8.262   1.00 26.58 ? 562 GLU A CA    1 
ATOM   740  C  C     . GLU A 1 95  ? 13.439 33.085 7.560   1.00 24.45 ? 562 GLU A C     1 
ATOM   741  O  O     . GLU A 1 95  ? 14.483 33.058 8.197   1.00 23.70 ? 562 GLU A O     1 
ATOM   742  C  CB    . GLU A 1 95  ? 12.067 34.793 8.742   1.00 28.38 ? 562 GLU A CB    1 
ATOM   743  C  CG    . GLU A 1 95  ? 10.678 35.254 9.154   1.00 34.00 ? 562 GLU A CG    1 
ATOM   744  C  CD    . GLU A 1 95  ? 9.744  35.413 7.967   0.50 34.97 ? 562 GLU A CD    1 
ATOM   745  O  OE1   . GLU A 1 95  ? 10.239 35.686 6.855   0.50 33.69 ? 562 GLU A OE1   1 
ATOM   746  O  OE2   . GLU A 1 95  ? 8.518  35.266 8.146   0.50 37.03 ? 562 GLU A OE2   1 
ATOM   747  N  N     . PHE A 1 96  ? 13.401 32.900 6.247   1.00 22.42 ? 563 PHE A N     1 
ATOM   748  C  CA    . PHE A 1 96  ? 14.627 32.647 5.484   1.00 22.92 ? 563 PHE A CA    1 
ATOM   749  C  C     . PHE A 1 96  ? 15.475 33.912 5.388   1.00 21.48 ? 563 PHE A C     1 
ATOM   750  O  O     . PHE A 1 96  ? 14.962 34.992 5.093   1.00 22.34 ? 563 PHE A O     1 
ATOM   751  C  CB    . PHE A 1 96  ? 14.259 32.164 4.086   1.00 25.26 ? 563 PHE A CB    1 
ATOM   752  C  CG    . PHE A 1 96  ? 15.437 31.793 3.239   1.00 28.33 ? 563 PHE A CG    1 
ATOM   753  C  CD1   . PHE A 1 96  ? 16.274 30.757 3.610   1.00 33.98 ? 563 PHE A CD1   1 
ATOM   754  C  CD2   . PHE A 1 96  ? 15.700 32.471 2.062   1.00 31.35 ? 563 PHE A CD2   1 
ATOM   755  C  CE1   . PHE A 1 96  ? 17.353 30.400 2.821   1.00 35.90 ? 563 PHE A CE1   1 
ATOM   756  C  CE2   . PHE A 1 96  ? 16.779 32.113 1.262   1.00 33.47 ? 563 PHE A CE2   1 
ATOM   757  C  CZ    . PHE A 1 96  ? 17.610 31.082 1.648   1.00 34.21 ? 563 PHE A CZ    1 
ATOM   758  N  N     . GLU A 1 97  ? 16.769 33.788 5.648   1.00 20.23 ? 564 GLU A N     1 
ATOM   759  C  CA    . GLU A 1 97  ? 17.677 34.930 5.546   1.00 21.35 ? 564 GLU A CA    1 
ATOM   760  C  C     . GLU A 1 97  ? 18.946 34.447 4.884   1.00 20.45 ? 564 GLU A C     1 
ATOM   761  O  O     . GLU A 1 97  ? 19.340 33.299 5.071   1.00 22.80 ? 564 GLU A O     1 
ATOM   762  C  CB    . GLU A 1 97  ? 18.007 35.517 6.933   1.00 21.97 ? 564 GLU A CB    1 
ATOM   763  C  CG    . GLU A 1 97  ? 16.806 36.181 7.640   1.00 22.11 ? 564 GLU A CG    1 
ATOM   764  C  CD    . GLU A 1 97  ? 17.196 36.941 8.894   1.00 24.75 ? 564 GLU A CD    1 
ATOM   765  O  OE1   . GLU A 1 97  ? 18.272 37.575 8.907   1.00 26.44 ? 564 GLU A OE1   1 
ATOM   766  O  OE2   . GLU A 1 97  ? 16.421 36.911 9.869   1.00 26.32 ? 564 GLU A OE2   1 
ATOM   767  N  N     . VAL A 1 98  ? 19.581 35.315 4.108   1.00 17.45 ? 565 VAL A N     1 
ATOM   768  C  CA    . VAL A 1 98  ? 20.868 34.985 3.509   1.00 17.39 ? 565 VAL A CA    1 
ATOM   769  C  C     . VAL A 1 98  ? 21.845 36.069 3.909   1.00 19.93 ? 565 VAL A C     1 
ATOM   770  O  O     . VAL A 1 98  ? 21.490 37.255 3.890   1.00 19.95 ? 565 VAL A O     1 
ATOM   771  C  CB    . VAL A 1 98  ? 20.781 34.921 1.957   1.00 18.27 ? 565 VAL A CB    1 
ATOM   772  C  CG1   . VAL A 1 98  ? 22.175 34.970 1.343   1.00 19.95 ? 565 VAL A CG1   1 
ATOM   773  C  CG2   . VAL A 1 98  ? 20.042 33.666 1.506   1.00 19.25 ? 565 VAL A CG2   1 
ATOM   774  N  N     . PHE A 1 99  ? 23.060 35.660 4.287   1.00 18.67 ? 566 PHE A N     1 
ATOM   775  C  CA    . PHE A 1 99  ? 24.154 36.581 4.572   1.00 18.48 ? 566 PHE A CA    1 
ATOM   776  C  C     . PHE A 1 99  ? 25.394 36.209 3.741   1.00 19.01 ? 566 PHE A C     1 
ATOM   777  O  O     . PHE A 1 99  ? 25.508 35.088 3.227   1.00 20.83 ? 566 PHE A O     1 
ATOM   778  C  CB    . PHE A 1 99  ? 24.505 36.592 6.076   1.00 18.11 ? 566 PHE A CB    1 
ATOM   779  C  CG    . PHE A 1 99  ? 23.476 37.279 6.949   1.00 21.79 ? 566 PHE A CG    1 
ATOM   780  C  CD1   . PHE A 1 99  ? 23.627 38.620 7.312   1.00 22.52 ? 566 PHE A CD1   1 
ATOM   781  C  CD2   . PHE A 1 99  ? 22.375 36.582 7.425   1.00 23.20 ? 566 PHE A CD2   1 
ATOM   782  C  CE1   . PHE A 1 99  ? 22.695 39.260 8.108   1.00 22.54 ? 566 PHE A CE1   1 
ATOM   783  C  CE2   . PHE A 1 99  ? 21.426 37.210 8.233   1.00 23.44 ? 566 PHE A CE2   1 
ATOM   784  C  CZ    . PHE A 1 99  ? 21.589 38.559 8.578   1.00 23.69 ? 566 PHE A CZ    1 
ATOM   785  N  N     . GLN A 1 100 ? 26.313 37.163 3.624   1.00 18.69 ? 567 GLN A N     1 
ATOM   786  C  CA    . GLN A 1 100 ? 27.488 37.047 2.766   1.00 18.54 ? 567 GLN A CA    1 
ATOM   787  C  C     . GLN A 1 100 ? 28.770 36.968 3.582   1.00 22.06 ? 567 GLN A C     1 
ATOM   788  O  O     . GLN A 1 100 ? 28.786 37.349 4.747   1.00 22.39 ? 567 GLN A O     1 
ATOM   789  C  CB    . GLN A 1 100 ? 27.544 38.248 1.814   1.00 19.66 ? 567 GLN A CB    1 
ATOM   790  C  CG    . GLN A 1 100 ? 26.493 38.159 0.699   1.00 21.40 ? 567 GLN A CG    1 
ATOM   791  C  CD    . GLN A 1 100 ? 26.301 39.453 -0.046  1.00 23.56 ? 567 GLN A CD    1 
ATOM   792  O  OE1   . GLN A 1 100 ? 25.826 40.434 0.520   1.00 23.03 ? 567 GLN A OE1   1 
ATOM   793  N  NE2   . GLN A 1 100 ? 26.650 39.461 -1.339  1.00 23.25 ? 567 GLN A NE2   1 
ATOM   794  N  N     . PRO A 1 101 ? 29.855 36.468 2.969   1.00 23.75 ? 568 PRO A N     1 
ATOM   795  C  CA    . PRO A 1 101 ? 31.144 36.359 3.657   1.00 22.89 ? 568 PRO A CA    1 
ATOM   796  C  C     . PRO A 1 101 ? 31.537 37.665 4.349   1.00 25.54 ? 568 PRO A C     1 
ATOM   797  O  O     . PRO A 1 101 ? 31.391 38.740 3.754   1.00 23.28 ? 568 PRO A O     1 
ATOM   798  C  CB    . PRO A 1 101 ? 32.114 36.049 2.515   1.00 23.03 ? 568 PRO A CB    1 
ATOM   799  C  CG    . PRO A 1 101 ? 31.299 35.325 1.534   1.00 22.96 ? 568 PRO A CG    1 
ATOM   800  C  CD    . PRO A 1 101 ? 29.912 35.909 1.606   1.00 22.57 ? 568 PRO A CD    1 
ATOM   801  N  N     . ALA A 1 102 ? 31.998 37.548 5.596   1.00 21.71 ? 569 ALA A N     1 
ATOM   802  C  CA    . ALA A 1 102 ? 32.421 38.674 6.430   1.00 22.47 ? 569 ALA A CA    1 
ATOM   803  C  C     . ALA A 1 102 ? 31.277 39.514 7.041   1.00 23.43 ? 569 ALA A C     1 
ATOM   804  O  O     . ALA A 1 102 ? 31.533 40.432 7.819   1.00 25.70 ? 569 ALA A O     1 
ATOM   805  C  CB    . ALA A 1 102 ? 33.455 39.562 5.693   1.00 25.68 ? 569 ALA A CB    1 
ATOM   806  N  N     . ASP A 1 103 ? 30.024 39.206 6.706   1.00 21.98 ? 570 ASP A N     1 
ATOM   807  C  CA    . ASP A 1 103 ? 28.891 39.876 7.353   1.00 20.78 ? 570 ASP A CA    1 
ATOM   808  C  C     . ASP A 1 103 ? 28.843 39.545 8.842   1.00 22.86 ? 570 ASP A C     1 
ATOM   809  O  O     . ASP A 1 103 ? 28.979 38.385 9.230   1.00 23.65 ? 570 ASP A O     1 
ATOM   810  C  CB    . ASP A 1 103 ? 27.556 39.435 6.748   1.00 19.88 ? 570 ASP A CB    1 
ATOM   811  C  CG    . ASP A 1 103 ? 27.227 40.136 5.451   1.00 24.76 ? 570 ASP A CG    1 
ATOM   812  O  OD1   . ASP A 1 103 ? 27.980 41.053 5.044   1.00 30.01 ? 570 ASP A OD1   1 
ATOM   813  O  OD2   . ASP A 1 103 ? 26.199 39.762 4.841   1.00 22.99 ? 570 ASP A OD2   1 
ATOM   814  N  N     . TYR A 1 104 ? 28.622 40.558 9.671   1.00 22.95 ? 571 TYR A N     1 
ATOM   815  C  CA    . TYR A 1 104 ? 28.305 40.319 11.076  1.00 23.05 ? 571 TYR A CA    1 
ATOM   816  C  C     . TYR A 1 104 ? 26.801 40.136 11.250  1.00 23.91 ? 571 TYR A C     1 
ATOM   817  O  O     . TYR A 1 104 ? 26.038 41.090 11.157  1.00 24.28 ? 571 TYR A O     1 
ATOM   818  C  CB    . TYR A 1 104 ? 28.807 41.464 11.959  1.00 25.34 ? 571 TYR A CB    1 
ATOM   819  C  CG    . TYR A 1 104 ? 30.294 41.424 12.202  1.00 27.53 ? 571 TYR A CG    1 
ATOM   820  C  CD1   . TYR A 1 104 ? 30.826 40.737 13.286  1.00 31.23 ? 571 TYR A CD1   1 
ATOM   821  C  CD2   . TYR A 1 104 ? 31.167 42.070 11.345  1.00 32.95 ? 571 TYR A CD2   1 
ATOM   822  C  CE1   . TYR A 1 104 ? 32.189 40.698 13.503  1.00 35.78 ? 571 TYR A CE1   1 
ATOM   823  C  CE2   . TYR A 1 104 ? 32.522 42.040 11.553  1.00 36.96 ? 571 TYR A CE2   1 
ATOM   824  C  CZ    . TYR A 1 104 ? 33.031 41.356 12.626  1.00 39.89 ? 571 TYR A CZ    1 
ATOM   825  O  OH    . TYR A 1 104 ? 34.390 41.337 12.803  1.00 42.73 ? 571 TYR A OH    1 
ATOM   826  N  N     . VAL A 1 105 ? 26.375 38.901 11.482  1.00 20.30 ? 572 VAL A N     1 
ATOM   827  C  CA    . VAL A 1 105 ? 24.967 38.622 11.737  1.00 19.46 ? 572 VAL A CA    1 
ATOM   828  C  C     . VAL A 1 105 ? 24.584 39.171 13.105  1.00 20.81 ? 572 VAL A C     1 
ATOM   829  O  O     . VAL A 1 105 ? 23.481 39.681 13.296  1.00 23.91 ? 572 VAL A O     1 
ATOM   830  C  CB    . VAL A 1 105 ? 24.688 37.120 11.718  1.00 19.84 ? 572 VAL A CB    1 
ATOM   831  C  CG1   . VAL A 1 105 ? 23.179 36.845 11.855  1.00 20.37 ? 572 VAL A CG1   1 
ATOM   832  C  CG2   . VAL A 1 105 ? 25.253 36.501 10.441  1.00 22.30 ? 572 VAL A CG2   1 
ATOM   833  N  N     . ILE A 1 106 ? 25.516 39.070 14.044  1.00 18.20 ? 573 ILE A N     1 
ATOM   834  C  CA    . ILE A 1 106 ? 25.295 39.494 15.428  1.00 19.66 ? 573 ILE A CA    1 
ATOM   835  C  C     . ILE A 1 106 ? 26.513 40.231 15.936  1.00 23.79 ? 573 ILE A C     1 
ATOM   836  O  O     . ILE A 1 106 ? 27.639 39.806 15.688  1.00 24.63 ? 573 ILE A O     1 
ATOM   837  C  CB    . ILE A 1 106 ? 25.048 38.280 16.348  1.00 18.94 ? 573 ILE A CB    1 
ATOM   838  C  CG1   . ILE A 1 106 ? 23.666 37.667 16.076  1.00 19.55 ? 573 ILE A CG1   1 
ATOM   839  C  CG2   . ILE A 1 106 ? 25.137 38.681 17.828  1.00 21.04 ? 573 ILE A CG2   1 
ATOM   840  C  CD1   . ILE A 1 106 ? 23.384 36.407 16.926  1.00 19.89 ? 573 ILE A CD1   1 
ATOM   841  N  N     . GLN A 1 107 ? 26.276 41.340 16.642  1.00 24.05 ? 574 GLN A N     1 
ATOM   842  C  CA    . GLN A 1 107 ? 27.328 42.103 17.301  1.00 28.46 ? 574 GLN A CA    1 
ATOM   843  C  C     . GLN A 1 107 ? 27.234 41.947 18.818  1.00 28.51 ? 574 GLN A C     1 
ATOM   844  O  O     . GLN A 1 107 ? 26.171 42.142 19.403  1.00 29.78 ? 574 GLN A O     1 
ATOM   845  C  CB    . GLN A 1 107 ? 27.197 43.591 16.946  1.00 28.84 ? 574 GLN A CB    1 
ATOM   846  C  CG    . GLN A 1 107 ? 27.547 43.925 15.505  1.00 33.90 ? 574 GLN A CG    1 
ATOM   847  C  CD    . GLN A 1 107 ? 29.036 44.022 15.289  1.00 35.35 ? 574 GLN A CD    1 
ATOM   848  O  OE1   . GLN A 1 107 ? 29.813 43.971 16.239  1.00 36.22 ? 574 GLN A OE1   1 
ATOM   849  N  NE2   . GLN A 1 107 ? 29.445 44.165 14.038  1.00 37.06 ? 574 GLN A NE2   1 
ATOM   850  N  N     . GLU A 1 108 ? 28.352 41.604 19.448  1.00 27.88 ? 575 GLU A N     1 
ATOM   851  C  CA    . GLU A 1 108 ? 28.413 41.493 20.900  1.00 29.25 ? 575 GLU A CA    1 
ATOM   852  C  C     . GLU A 1 108 ? 27.958 42.789 21.553  1.00 34.00 ? 575 GLU A C     1 
ATOM   853  O  O     . GLU A 1 108 ? 28.315 43.873 21.097  1.00 34.58 ? 575 GLU A O     1 
ATOM   854  C  CB    . GLU A 1 108 ? 29.844 41.168 21.334  1.00 30.85 ? 575 GLU A CB    1 
ATOM   855  C  CG    . GLU A 1 108 ? 30.034 40.938 22.825  1.00 35.67 ? 575 GLU A CG    1 
ATOM   856  C  CD    . GLU A 1 108 ? 30.326 42.211 23.594  1.00 46.28 ? 575 GLU A CD    1 
ATOM   857  O  OE1   . GLU A 1 108 ? 30.877 43.168 23.002  1.00 48.15 ? 575 GLU A OE1   1 
ATOM   858  O  OE2   . GLU A 1 108 ? 30.007 42.249 24.801  1.00 52.01 ? 575 GLU A OE2   1 
ATOM   859  N  N     . GLY A 1 109 ? 27.161 42.675 22.613  1.00 34.92 ? 576 GLY A N     1 
ATOM   860  C  CA    . GLY A 1 109 ? 26.797 43.830 23.417  1.00 37.63 ? 576 GLY A CA    1 
ATOM   861  C  C     . GLY A 1 109 ? 25.533 44.563 23.004  1.00 37.46 ? 576 GLY A C     1 
ATOM   862  O  O     . GLY A 1 109 ? 25.123 45.514 23.664  1.00 38.21 ? 576 GLY A O     1 
ATOM   863  N  N     . THR A 1 110 ? 24.909 44.131 21.916  1.00 35.53 ? 577 THR A N     1 
ATOM   864  C  CA    . THR A 1 110 ? 23.674 44.757 21.456  1.00 34.65 ? 577 THR A CA    1 
ATOM   865  C  C     . THR A 1 110 ? 22.478 43.966 21.977  1.00 34.05 ? 577 THR A C     1 
ATOM   866  O  O     . THR A 1 110 ? 22.644 42.874 22.529  1.00 35.78 ? 577 THR A O     1 
ATOM   867  C  CB    . THR A 1 110 ? 23.606 44.790 19.914  1.00 33.38 ? 577 THR A CB    1 
ATOM   868  O  OG1   . THR A 1 110 ? 23.614 43.450 19.413  1.00 31.08 ? 577 THR A OG1   1 
ATOM   869  C  CG2   . THR A 1 110 ? 24.797 45.550 19.325  1.00 32.68 ? 577 THR A CG2   1 
ATOM   870  N  N     . PHE A 1 111 ? 21.277 44.506 21.799  1.00 33.70 ? 578 PHE A N     1 
ATOM   871  C  CA    . PHE A 1 111 ? 20.053 43.755 22.074  1.00 35.85 ? 578 PHE A CA    1 
ATOM   872  C  C     . PHE A 1 111 ? 19.758 42.829 20.901  1.00 38.11 ? 578 PHE A C     1 
ATOM   873  O  O     . PHE A 1 111 ? 20.102 43.139 19.760  1.00 40.56 ? 578 PHE A O     1 
ATOM   874  C  CB    . PHE A 1 111 ? 18.856 44.691 22.266  1.00 36.30 ? 578 PHE A CB    1 
ATOM   875  C  CG    . PHE A 1 111 ? 18.920 45.518 23.515  1.00 40.40 ? 578 PHE A CG    1 
ATOM   876  C  CD1   . PHE A 1 111 ? 19.672 45.100 24.604  1.00 41.22 ? 578 PHE A CD1   1 
ATOM   877  C  CD2   . PHE A 1 111 ? 18.203 46.706 23.613  1.00 41.53 ? 578 PHE A CD2   1 
ATOM   878  C  CE1   . PHE A 1 111 ? 19.725 45.859 25.755  1.00 43.06 ? 578 PHE A CE1   1 
ATOM   879  C  CE2   . PHE A 1 111 ? 18.250 47.470 24.770  1.00 43.59 ? 578 PHE A CE2   1 
ATOM   880  C  CZ    . PHE A 1 111 ? 19.012 47.043 25.839  1.00 44.67 ? 578 PHE A CZ    1 
ATOM   881  N  N     . GLY A 1 112 ? 19.104 41.705 21.173  1.00 35.28 ? 579 GLY A N     1 
ATOM   882  C  CA    . GLY A 1 112 ? 18.776 40.753 20.124  1.00 33.54 ? 579 GLY A CA    1 
ATOM   883  C  C     . GLY A 1 112 ? 17.283 40.670 19.879  1.00 32.19 ? 579 GLY A C     1 
ATOM   884  O  O     . GLY A 1 112 ? 16.487 40.729 20.815  1.00 33.91 ? 579 GLY A O     1 
ATOM   885  N  N     . ASP A 1 113 ? 16.897 40.543 18.617  1.00 30.45 ? 580 ASP A N     1 
ATOM   886  C  CA    . ASP A 1 113 ? 15.480 40.466 18.268  1.00 33.23 ? 580 ASP A CA    1 
ATOM   887  C  C     . ASP A 1 113 ? 15.076 39.101 17.707  1.00 28.89 ? 580 ASP A C     1 
ATOM   888  O  O     . ASP A 1 113 ? 13.902 38.854 17.455  1.00 29.23 ? 580 ASP A O     1 
ATOM   889  C  CB    . ASP A 1 113 ? 15.078 41.596 17.299  1.00 36.08 ? 580 ASP A CB    1 
ATOM   890  C  CG    . ASP A 1 113 ? 15.801 41.523 15.958  1.00 40.94 ? 580 ASP A CG    1 
ATOM   891  O  OD1   . ASP A 1 113 ? 16.722 40.696 15.794  1.00 37.49 ? 580 ASP A OD1   1 
ATOM   892  O  OD2   . ASP A 1 113 ? 15.441 42.306 15.054  1.00 45.15 ? 580 ASP A OD2   1 
ATOM   893  N  N     . ARG A 1 114 ? 16.049 38.216 17.515  1.00 24.90 ? 581 ARG A N     1 
ATOM   894  C  CA    . ARG A 1 114 ? 15.769 36.907 16.935  1.00 21.04 ? 581 ARG A CA    1 
ATOM   895  C  C     . ARG A 1 114 ? 16.972 35.972 17.095  1.00 24.12 ? 581 ARG A C     1 
ATOM   896  O  O     . ARG A 1 114 ? 18.077 36.424 17.395  1.00 24.58 ? 581 ARG A O     1 
ATOM   897  C  CB    . ARG A 1 114 ? 15.403 37.051 15.444  1.00 21.64 ? 581 ARG A CB    1 
ATOM   898  C  CG    . ARG A 1 114 ? 16.531 37.570 14.528  1.00 22.39 ? 581 ARG A CG    1 
ATOM   899  C  CD    . ARG A 1 114 ? 15.952 38.163 13.243  1.00 23.79 ? 581 ARG A CD    1 
ATOM   900  N  NE    . ARG A 1 114 ? 16.944 38.360 12.184  1.00 24.81 ? 581 ARG A NE    1 
ATOM   901  C  CZ    . ARG A 1 114 ? 17.770 39.400 12.113  1.00 26.54 ? 581 ARG A CZ    1 
ATOM   902  N  NH1   . ARG A 1 114 ? 17.738 40.337 13.055  1.00 26.24 ? 581 ARG A NH1   1 
ATOM   903  N  NH2   . ARG A 1 114 ? 18.632 39.501 11.106  1.00 25.23 ? 581 ARG A NH2   1 
ATOM   904  N  N     . MET A 1 115 ? 16.747 34.673 16.902  1.00 22.64 ? 582 MET A N     1 
ATOM   905  C  CA    . MET A 1 115 ? 17.836 33.697 16.867  1.00 19.98 ? 582 MET A CA    1 
ATOM   906  C  C     . MET A 1 115 ? 17.869 33.068 15.482  1.00 20.19 ? 582 MET A C     1 
ATOM   907  O  O     . MET A 1 115 ? 16.967 33.308 14.673  1.00 20.54 ? 582 MET A O     1 
ATOM   908  C  CB    . MET A 1 115 ? 17.652 32.608 17.923  1.00 19.65 ? 582 MET A CB    1 
ATOM   909  C  CG    . MET A 1 115 ? 16.469 31.689 17.646  1.00 26.49 ? 582 MET A CG    1 
ATOM   910  S  SD    . MET A 1 115 ? 16.568 30.220 18.664  1.00 31.79 ? 582 MET A SD    1 
ATOM   911  C  CE    . MET A 1 115 ? 18.064 29.473 18.040  1.00 26.40 ? 582 MET A CE    1 
ATOM   912  N  N     . PHE A 1 116 ? 18.902 32.267 15.219  1.00 17.74 ? 583 PHE A N     1 
ATOM   913  C  CA    . PHE A 1 116 ? 19.170 31.763 13.869  1.00 17.34 ? 583 PHE A CA    1 
ATOM   914  C  C     . PHE A 1 116 ? 19.500 30.280 13.848  1.00 17.95 ? 583 PHE A C     1 
ATOM   915  O  O     . PHE A 1 116 ? 20.269 29.799 14.686  1.00 22.00 ? 583 PHE A O     1 
ATOM   916  C  CB    . PHE A 1 116 ? 20.361 32.501 13.256  1.00 17.76 ? 583 PHE A CB    1 
ATOM   917  C  CG    . PHE A 1 116 ? 20.194 33.992 13.210  1.00 18.56 ? 583 PHE A CG    1 
ATOM   918  C  CD1   . PHE A 1 116 ? 19.716 34.612 12.060  1.00 16.53 ? 583 PHE A CD1   1 
ATOM   919  C  CD2   . PHE A 1 116 ? 20.520 34.775 14.311  1.00 17.27 ? 583 PHE A CD2   1 
ATOM   920  C  CE1   . PHE A 1 116 ? 19.566 35.992 12.012  1.00 18.36 ? 583 PHE A CE1   1 
ATOM   921  C  CE2   . PHE A 1 116 ? 20.362 36.150 14.270  1.00 17.77 ? 583 PHE A CE2   1 
ATOM   922  C  CZ    . PHE A 1 116 ? 19.883 36.761 13.122  1.00 20.00 ? 583 PHE A CZ    1 
ATOM   923  N  N     . PHE A 1 117 ? 18.942 29.569 12.874  1.00 16.94 ? 584 PHE A N     1 
ATOM   924  C  CA    . PHE A 1 117 ? 19.319 28.184 12.595  1.00 18.59 ? 584 PHE A CA    1 
ATOM   925  C  C     . PHE A 1 117 ? 20.107 28.183 11.301  1.00 19.09 ? 584 PHE A C     1 
ATOM   926  O  O     . PHE A 1 117 ? 19.696 28.827 10.334  1.00 18.72 ? 584 PHE A O     1 
ATOM   927  C  CB    . PHE A 1 117 ? 18.073 27.311 12.427  1.00 20.99 ? 584 PHE A CB    1 
ATOM   928  C  CG    . PHE A 1 117 ? 17.288 27.143 13.691  1.00 24.88 ? 584 PHE A CG    1 
ATOM   929  C  CD1   . PHE A 1 117 ? 17.538 26.073 14.537  1.00 25.39 ? 584 PHE A CD1   1 
ATOM   930  C  CD2   . PHE A 1 117 ? 16.318 28.066 14.048  1.00 28.84 ? 584 PHE A CD2   1 
ATOM   931  C  CE1   . PHE A 1 117 ? 16.823 25.917 15.708  1.00 30.26 ? 584 PHE A CE1   1 
ATOM   932  C  CE2   . PHE A 1 117 ? 15.596 27.919 15.227  1.00 28.85 ? 584 PHE A CE2   1 
ATOM   933  C  CZ    . PHE A 1 117 ? 15.849 26.845 16.055  1.00 30.02 ? 584 PHE A CZ    1 
ATOM   934  N  N     . ILE A 1 118 ? 21.228 27.462 11.270  1.00 17.61 ? 585 ILE A N     1 
ATOM   935  C  CA    . ILE A 1 118 ? 22.063 27.429 10.074  1.00 15.57 ? 585 ILE A CA    1 
ATOM   936  C  C     . ILE A 1 118 ? 21.631 26.299 9.145   1.00 19.42 ? 585 ILE A C     1 
ATOM   937  O  O     . ILE A 1 118 ? 21.738 25.120 9.493   1.00 19.15 ? 585 ILE A O     1 
ATOM   938  C  CB    . ILE A 1 118 ? 23.556 27.234 10.422  1.00 15.16 ? 585 ILE A CB    1 
ATOM   939  C  CG1   . ILE A 1 118 ? 24.045 28.349 11.358  1.00 16.21 ? 585 ILE A CG1   1 
ATOM   940  C  CG2   . ILE A 1 118 ? 24.413 27.193 9.158   1.00 15.92 ? 585 ILE A CG2   1 
ATOM   941  C  CD1   . ILE A 1 118 ? 25.501 28.162 11.836  1.00 18.31 ? 585 ILE A CD1   1 
ATOM   942  N  N     . GLN A 1 119 ? 21.127 26.652 7.968   1.00 18.81 ? 586 GLN A N     1 
ATOM   943  C  CA    . GLN A 1 119 ? 20.841 25.631 6.974   1.00 22.05 ? 586 GLN A CA    1 
ATOM   944  C  C     . GLN A 1 119 ? 22.157 25.264 6.334   1.00 24.08 ? 586 GLN A C     1 
ATOM   945  O  O     . GLN A 1 119 ? 22.586 24.106 6.370   1.00 26.10 ? 586 GLN A O     1 
ATOM   946  C  CB    . GLN A 1 119 ? 19.892 26.134 5.900   1.00 23.80 ? 586 GLN A CB    1 
ATOM   947  C  CG    . GLN A 1 119 ? 19.645 25.080 4.807   1.00 28.37 ? 586 GLN A CG    1 
ATOM   948  C  CD    . GLN A 1 119 ? 18.650 25.555 3.793   1.00 40.97 ? 586 GLN A CD    1 
ATOM   949  O  OE1   . GLN A 1 119 ? 18.918 26.487 3.031   1.00 46.68 ? 586 GLN A OE1   1 
ATOM   950  N  NE2   . GLN A 1 119 ? 17.481 24.935 3.783   1.00 43.76 ? 586 GLN A NE2   1 
ATOM   951  N  N     . GLN A 1 120 ? 22.816 26.264 5.761   1.00 21.52 ? 587 GLN A N     1 
ATOM   952  C  CA    . GLN A 1 120 ? 24.134 26.035 5.188   1.00 24.71 ? 587 GLN A CA    1 
ATOM   953  C  C     . GLN A 1 120 ? 25.066 27.202 5.431   1.00 22.76 ? 587 GLN A C     1 
ATOM   954  O  O     . GLN A 1 120 ? 24.654 28.352 5.358   1.00 23.87 ? 587 GLN A O     1 
ATOM   955  C  CB    . GLN A 1 120 ? 24.024 25.731 3.697   1.00 28.81 ? 587 GLN A CB    1 
ATOM   956  C  CG    . GLN A 1 120 ? 23.835 24.240 3.437   1.00 37.32 ? 587 GLN A CG    1 
ATOM   957  C  CD    . GLN A 1 120 ? 23.931 23.885 1.978   1.00 43.48 ? 587 GLN A CD    1 
ATOM   958  O  OE1   . GLN A 1 120 ? 24.838 23.160 1.561   1.00 47.36 ? 587 GLN A OE1   1 
ATOM   959  N  NE2   . GLN A 1 120 ? 22.991 24.388 1.186   1.00 41.13 ? 587 GLN A NE2   1 
ATOM   960  N  N     . GLY A 1 121 ? 26.322 26.897 5.739   1.00 20.14 ? 588 GLY A N     1 
ATOM   961  C  CA    . GLY A 1 121 ? 27.315 27.934 5.888   1.00 20.82 ? 588 GLY A CA    1 
ATOM   962  C  C     . GLY A 1 121 ? 28.156 27.728 7.132   1.00 20.99 ? 588 GLY A C     1 
ATOM   963  O  O     . GLY A 1 121 ? 27.898 26.841 7.946   1.00 22.99 ? 588 GLY A O     1 
ATOM   964  N  N     . ILE A 1 122 ? 29.165 28.568 7.273   1.00 19.83 ? 589 ILE A N     1 
ATOM   965  C  CA    . ILE A 1 122 ? 30.057 28.514 8.427   1.00 21.24 ? 589 ILE A CA    1 
ATOM   966  C  C     . ILE A 1 122 ? 30.144 29.906 9.030   1.00 20.34 ? 589 ILE A C     1 
ATOM   967  O  O     . ILE A 1 122 ? 30.357 30.879 8.310   1.00 23.29 ? 589 ILE A O     1 
ATOM   968  C  CB    . ILE A 1 122 ? 31.464 28.079 8.006   1.00 22.43 ? 589 ILE A CB    1 
ATOM   969  C  CG1   . ILE A 1 122 ? 31.419 26.668 7.410   1.00 26.68 ? 589 ILE A CG1   1 
ATOM   970  C  CG2   . ILE A 1 122 ? 32.405 28.155 9.190   1.00 23.83 ? 589 ILE A CG2   1 
ATOM   971  C  CD1   . ILE A 1 122 ? 32.723 26.222 6.801   1.00 30.91 ? 589 ILE A CD1   1 
ATOM   972  N  N     . VAL A 1 123 ? 29.958 30.004 10.344  1.00 18.68 ? 590 VAL A N     1 
ATOM   973  C  CA    . VAL A 1 123 ? 30.125 31.270 11.048  1.00 17.45 ? 590 VAL A CA    1 
ATOM   974  C  C     . VAL A 1 123 ? 31.160 31.123 12.159  1.00 20.41 ? 590 VAL A C     1 
ATOM   975  O  O     . VAL A 1 123 ? 31.379 30.020 12.669  1.00 21.47 ? 590 VAL A O     1 
ATOM   976  C  CB    . VAL A 1 123 ? 28.783 31.790 11.638  1.00 17.34 ? 590 VAL A CB    1 
ATOM   977  C  CG1   . VAL A 1 123 ? 27.755 31.944 10.540  1.00 18.29 ? 590 VAL A CG1   1 
ATOM   978  C  CG2   . VAL A 1 123 ? 28.265 30.847 12.710  1.00 19.11 ? 590 VAL A CG2   1 
ATOM   979  N  N     . ASP A 1 124 ? 31.814 32.232 12.501  1.00 20.30 ? 591 ASP A N     1 
ATOM   980  C  CA    . ASP A 1 124 ? 32.745 32.277 13.624  1.00 20.66 ? 591 ASP A CA    1 
ATOM   981  C  C     . ASP A 1 124 ? 32.074 32.956 14.803  1.00 19.91 ? 591 ASP A C     1 
ATOM   982  O  O     . ASP A 1 124 ? 31.389 33.964 14.626  1.00 20.53 ? 591 ASP A O     1 
ATOM   983  C  CB    . ASP A 1 124 ? 33.991 33.085 13.257  1.00 26.85 ? 591 ASP A CB    1 
ATOM   984  C  CG    . ASP A 1 124 ? 34.899 32.359 12.287  1.00 31.84 ? 591 ASP A CG    1 
ATOM   985  O  OD1   . ASP A 1 124 ? 34.879 31.109 12.240  1.00 31.83 ? 591 ASP A OD1   1 
ATOM   986  O  OD2   . ASP A 1 124 ? 35.651 33.050 11.577  1.00 32.89 ? 591 ASP A OD2   1 
ATOM   987  N  N     . ILE A 1 125 ? 32.267 32.399 15.999  1.00 20.23 ? 592 ILE A N     1 
ATOM   988  C  CA    . ILE A 1 125 ? 31.815 33.025 17.236  1.00 21.22 ? 592 ILE A CA    1 
ATOM   989  C  C     . ILE A 1 125 ? 32.996 33.804 17.818  1.00 23.48 ? 592 ILE A C     1 
ATOM   990  O  O     . ILE A 1 125 ? 34.005 33.213 18.186  1.00 23.77 ? 592 ILE A O     1 
ATOM   991  C  CB    . ILE A 1 125 ? 31.342 31.961 18.261  1.00 20.75 ? 592 ILE A CB    1 
ATOM   992  C  CG1   . ILE A 1 125 ? 30.293 31.025 17.633  1.00 20.81 ? 592 ILE A CG1   1 
ATOM   993  C  CG2   . ILE A 1 125 ? 30.824 32.621 19.538  1.00 21.75 ? 592 ILE A CG2   1 
ATOM   994  C  CD1   . ILE A 1 125 ? 29.099 31.732 17.051  1.00 19.47 ? 592 ILE A CD1   1 
ATOM   995  N  N     . ILE A 1 126 ? 32.874 35.126 17.891  1.00 24.47 ? 593 ILE A N     1 
ATOM   996  C  CA    . ILE A 1 126 ? 33.996 35.984 18.260  1.00 25.68 ? 593 ILE A CA    1 
ATOM   997  C  C     . ILE A 1 126 ? 33.744 36.684 19.592  1.00 28.16 ? 593 ILE A C     1 
ATOM   998  O  O     . ILE A 1 126 ? 32.798 37.459 19.719  1.00 28.95 ? 593 ILE A O     1 
ATOM   999  C  CB    . ILE A 1 126 ? 34.249 37.052 17.165  1.00 27.95 ? 593 ILE A CB    1 
ATOM   1000 C  CG1   . ILE A 1 126 ? 34.344 36.382 15.786  1.00 27.15 ? 593 ILE A CG1   1 
ATOM   1001 C  CG2   . ILE A 1 126 ? 35.489 37.890 17.500  1.00 30.82 ? 593 ILE A CG2   1 
ATOM   1002 C  CD1   . ILE A 1 126 ? 34.565 37.344 14.637  1.00 27.90 ? 593 ILE A CD1   1 
ATOM   1003 N  N     . MET A 1 127 ? 34.587 36.412 20.582  1.00 30.27 ? 594 MET A N     1 
ATOM   1004 C  CA    . MET A 1 127 ? 34.422 37.005 21.905  1.00 35.33 ? 594 MET A CA    1 
ATOM   1005 C  C     . MET A 1 127 ? 34.765 38.489 21.885  1.00 42.82 ? 594 MET A C     1 
ATOM   1006 O  O     . MET A 1 127 ? 35.341 38.986 20.918  1.00 46.46 ? 594 MET A O     1 
ATOM   1007 C  CB    . MET A 1 127 ? 35.281 36.270 22.939  1.00 39.84 ? 594 MET A CB    1 
ATOM   1008 C  CG    . MET A 1 127 ? 34.972 34.787 23.042  1.00 46.64 ? 594 MET A CG    1 
ATOM   1009 S  SD    . MET A 1 127 ? 33.194 34.460 23.032  1.00 53.80 ? 594 MET A SD    1 
ATOM   1010 C  CE    . MET A 1 127 ? 32.661 35.360 24.497  1.00 50.89 ? 594 MET A CE    1 
ATOM   1011 N  N     . SER A 1 128 ? 34.417 39.190 22.961  1.00 48.03 ? 595 SER A N     1 
ATOM   1012 C  CA    . SER A 1 128 ? 34.600 40.634 23.027  1.00 53.18 ? 595 SER A CA    1 
ATOM   1013 C  C     . SER A 1 128 ? 36.072 41.030 22.960  1.00 55.02 ? 595 SER A C     1 
ATOM   1014 O  O     . SER A 1 128 ? 36.402 42.181 22.675  1.00 55.61 ? 595 SER A O     1 
ATOM   1015 C  CB    . SER A 1 128 ? 33.967 41.192 24.301  1.00 56.57 ? 595 SER A CB    1 
ATOM   1016 O  OG    . SER A 1 128 ? 34.675 40.755 25.448  1.00 60.30 ? 595 SER A OG    1 
ATOM   1017 N  N     . ASP A 1 129 ? 36.952 40.074 23.230  1.00 54.41 ? 596 ASP A N     1 
ATOM   1018 C  CA    . ASP A 1 129 ? 38.384 40.329 23.181  1.00 56.85 ? 596 ASP A CA    1 
ATOM   1019 C  C     . ASP A 1 129 ? 38.938 40.052 21.784  1.00 54.37 ? 596 ASP A C     1 
ATOM   1020 O  O     . ASP A 1 129 ? 40.093 40.337 21.497  1.00 53.91 ? 596 ASP A O     1 
ATOM   1021 C  CB    . ASP A 1 129 ? 39.107 39.484 24.236  1.00 62.78 ? 596 ASP A CB    1 
ATOM   1022 C  CG    . ASP A 1 129 ? 38.847 38.000 24.069  1.00 67.87 ? 596 ASP A CG    1 
ATOM   1023 O  OD1   . ASP A 1 129 ? 39.184 37.467 22.998  1.00 67.98 ? 596 ASP A OD1   1 
ATOM   1024 O  OD2   . ASP A 1 129 ? 38.313 37.366 25.002  1.00 71.98 ? 596 ASP A OD2   1 
ATOM   1025 N  N     . GLY A 1 130 ? 38.104 39.489 20.919  1.00 52.27 ? 597 GLY A N     1 
ATOM   1026 C  CA    . GLY A 1 130 ? 38.501 39.206 19.551  1.00 46.83 ? 597 GLY A CA    1 
ATOM   1027 C  C     . GLY A 1 130 ? 38.892 37.762 19.286  1.00 42.86 ? 597 GLY A C     1 
ATOM   1028 O  O     . GLY A 1 130 ? 39.133 37.389 18.141  1.00 43.41 ? 597 GLY A O     1 
ATOM   1029 N  N     . VAL A 1 131 ? 38.972 36.945 20.334  1.00 40.75 ? 598 VAL A N     1 
ATOM   1030 C  CA    . VAL A 1 131 ? 39.287 35.531 20.156  1.00 42.47 ? 598 VAL A CA    1 
ATOM   1031 C  C     . VAL A 1 131 ? 38.087 34.786 19.588  1.00 37.63 ? 598 VAL A C     1 
ATOM   1032 O  O     . VAL A 1 131 ? 36.951 35.006 20.006  1.00 37.93 ? 598 VAL A O     1 
ATOM   1033 C  CB    . VAL A 1 131 ? 39.708 34.835 21.470  1.00 48.58 ? 598 VAL A CB    1 
ATOM   1034 C  CG1   . VAL A 1 131 ? 38.543 34.790 22.456  1.00 54.77 ? 598 VAL A CG1   1 
ATOM   1035 C  CG2   . VAL A 1 131 ? 40.173 33.421 21.181  1.00 47.81 ? 598 VAL A CG2   1 
ATOM   1036 N  N     . ILE A 1 132 ? 38.350 33.903 18.634  1.00 33.27 ? 599 ILE A N     1 
ATOM   1037 C  CA    . ILE A 1 132 ? 37.303 33.069 18.070  1.00 32.68 ? 599 ILE A CA    1 
ATOM   1038 C  C     . ILE A 1 132 ? 37.100 31.875 18.989  1.00 34.10 ? 599 ILE A C     1 
ATOM   1039 O  O     . ILE A 1 132 ? 37.999 31.047 19.151  1.00 35.18 ? 599 ILE A O     1 
ATOM   1040 C  CB    . ILE A 1 132 ? 37.675 32.605 16.660  1.00 34.67 ? 599 ILE A CB    1 
ATOM   1041 C  CG1   . ILE A 1 132 ? 37.821 33.826 15.743  1.00 35.13 ? 599 ILE A CG1   1 
ATOM   1042 C  CG2   . ILE A 1 132 ? 36.626 31.621 16.121  1.00 32.35 ? 599 ILE A CG2   1 
ATOM   1043 C  CD1   . ILE A 1 132 ? 38.353 33.502 14.364  1.00 36.57 ? 599 ILE A CD1   1 
ATOM   1044 N  N     . ALA A 1 133 ? 35.937 31.812 19.628  1.00 31.50 ? 600 ALA A N     1 
ATOM   1045 C  CA    . ALA A 1 133 ? 35.651 30.728 20.563  1.00 32.85 ? 600 ALA A CA    1 
ATOM   1046 C  C     . ALA A 1 133 ? 35.481 29.428 19.794  1.00 31.64 ? 600 ALA A C     1 
ATOM   1047 O  O     . ALA A 1 133 ? 35.972 28.381 20.194  1.00 32.91 ? 600 ALA A O     1 
ATOM   1048 C  CB    . ALA A 1 133 ? 34.397 31.035 21.367  1.00 34.75 ? 600 ALA A CB    1 
ATOM   1049 N  N     . THR A 1 134 ? 34.781 29.509 18.674  1.00 27.01 ? 601 THR A N     1 
ATOM   1050 C  CA    . THR A 1 134 ? 34.479 28.329 17.891  1.00 27.25 ? 601 THR A CA    1 
ATOM   1051 C  C     . THR A 1 134 ? 33.828 28.764 16.591  1.00 25.11 ? 601 THR A C     1 
ATOM   1052 O  O     . THR A 1 134 ? 33.534 29.948 16.402  1.00 23.80 ? 601 THR A O     1 
ATOM   1053 C  CB    . THR A 1 134 ? 33.512 27.401 18.644  1.00 30.54 ? 601 THR A CB    1 
ATOM   1054 O  OG1   . THR A 1 134 ? 33.465 26.122 18.000  1.00 31.42 ? 601 THR A OG1   1 
ATOM   1055 C  CG2   . THR A 1 134 ? 32.111 28.007 18.682  1.00 30.00 ? 601 THR A CG2   1 
ATOM   1056 N  N     . SER A 1 135 ? 33.626 27.805 15.693  1.00 22.57 ? 602 SER A N     1 
ATOM   1057 C  CA    . SER A 1 135 ? 32.879 28.050 14.467  1.00 22.73 ? 602 SER A CA    1 
ATOM   1058 C  C     . SER A 1 135 ? 31.699 27.101 14.441  1.00 23.59 ? 602 SER A C     1 
ATOM   1059 O  O     . SER A 1 135 ? 31.784 25.994 14.975  1.00 26.16 ? 602 SER A O     1 
ATOM   1060 C  CB    . SER A 1 135 ? 33.766 27.836 13.238  1.00 26.22 ? 602 SER A CB    1 
ATOM   1061 O  OG    . SER A 1 135 ? 34.951 28.608 13.349  1.00 28.49 ? 602 SER A OG    1 
ATOM   1062 N  N     . LEU A 1 136 ? 30.598 27.540 13.835  1.00 20.71 ? 603 LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 136 ? 29.381 26.743 13.765  1.00 20.50 ? 603 LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 136 ? 28.991 26.564 12.310  1.00 21.86 ? 603 LEU A C     1 
ATOM   1065 O  O     . LEU A 1 136 ? 29.318 27.404 11.469  1.00 19.89 ? 603 LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 136 ? 28.237 27.432 14.515  1.00 20.15 ? 603 LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 136 ? 28.407 27.694 16.011  1.00 22.52 ? 603 LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 136 ? 27.176 28.416 16.536  1.00 22.67 ? 603 LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 136 ? 28.635 26.387 16.769  1.00 23.18 ? 603 LEU A CD2   1 
ATOM   1070 N  N     . SER A 1 137 ? 28.310 25.465 11.998  1.00 20.78 ? 604 SER A N     1 
ATOM   1071 C  CA    . SER A 1 137 ? 27.904 25.236 10.609  1.00 18.97 ? 604 SER A CA    1 
ATOM   1072 C  C     . SER A 1 137 ? 26.572 24.524 10.499  1.00 20.33 ? 604 SER A C     1 
ATOM   1073 O  O     . SER A 1 137 ? 25.797 24.506 11.452  1.00 22.41 ? 604 SER A O     1 
ATOM   1074 C  CB    . SER A 1 137 ? 28.973 24.460 9.835   1.00 25.51 ? 604 SER A CB    1 
ATOM   1075 O  OG    . SER A 1 137 ? 29.283 23.248 10.490  1.00 30.02 ? 604 SER A OG    1 
ATOM   1076 N  N     . ASP A 1 138 ? 26.323 23.938 9.325   1.00 22.04 ? 605 ASP A N     1 
ATOM   1077 C  CA    . ASP A 1 138 ? 25.037 23.320 8.999   1.00 21.17 ? 605 ASP A CA    1 
ATOM   1078 C  C     . ASP A 1 138 ? 24.448 22.554 10.173  1.00 24.75 ? 605 ASP A C     1 
ATOM   1079 O  O     . ASP A 1 138 ? 25.092 21.641 10.713  1.00 23.39 ? 605 ASP A O     1 
ATOM   1080 C  CB    . ASP A 1 138 ? 25.192 22.319 7.850   1.00 26.13 ? 605 ASP A CB    1 
ATOM   1081 C  CG    . ASP A 1 138 ? 25.860 22.908 6.617   1.00 29.63 ? 605 ASP A CG    1 
ATOM   1082 O  OD1   . ASP A 1 138 ? 26.481 23.987 6.697   1.00 28.04 ? 605 ASP A OD1   1 
ATOM   1083 O  OD2   . ASP A 1 138 ? 25.777 22.255 5.551   1.00 32.52 ? 605 ASP A OD2   1 
ATOM   1084 N  N     . GLY A 1 139 ? 23.215 22.891 10.542  1.00 23.55 ? 606 GLY A N     1 
ATOM   1085 C  CA    . GLY A 1 139 ? 22.509 22.150 11.573  1.00 24.54 ? 606 GLY A CA    1 
ATOM   1086 C  C     . GLY A 1 139 ? 22.658 22.735 12.959  1.00 25.54 ? 606 GLY A C     1 
ATOM   1087 O  O     . GLY A 1 139 ? 22.010 22.287 13.903  1.00 28.58 ? 606 GLY A O     1 
ATOM   1088 N  N     . SER A 1 140 ? 23.516 23.736 13.098  1.00 23.30 ? 607 SER A N     1 
ATOM   1089 C  CA    . SER A 1 140 ? 23.682 24.369 14.397  1.00 22.56 ? 607 SER A CA    1 
ATOM   1090 C  C     . SER A 1 140 ? 22.769 25.591 14.491  1.00 22.01 ? 607 SER A C     1 
ATOM   1091 O  O     . SER A 1 140 ? 22.018 25.897 13.562  1.00 22.78 ? 607 SER A O     1 
ATOM   1092 C  CB    . SER A 1 140 ? 25.153 24.734 14.637  1.00 25.70 ? 607 SER A CB    1 
ATOM   1093 O  OG    . SER A 1 140 ? 25.370 25.085 15.985  1.00 31.93 ? 607 SER A OG    1 
ATOM   1094 N  N     . TYR A 1 141 ? 22.815 26.279 15.619  1.00 18.20 ? 608 TYR A N     1 
ATOM   1095 C  CA    . TYR A 1 141 ? 22.018 27.483 15.775  1.00 20.04 ? 608 TYR A CA    1 
ATOM   1096 C  C     . TYR A 1 141 ? 22.753 28.439 16.696  1.00 19.83 ? 608 TYR A C     1 
ATOM   1097 O  O     . TYR A 1 141 ? 23.670 28.030 17.407  1.00 22.59 ? 608 TYR A O     1 
ATOM   1098 C  CB    . TYR A 1 141 ? 20.615 27.160 16.292  1.00 20.13 ? 608 TYR A CB    1 
ATOM   1099 C  CG    . TYR A 1 141 ? 20.550 26.512 17.661  1.00 28.12 ? 608 TYR A CG    1 
ATOM   1100 C  CD1   . TYR A 1 141 ? 20.929 27.205 18.803  1.00 31.37 ? 608 TYR A CD1   1 
ATOM   1101 C  CD2   . TYR A 1 141 ? 20.066 25.220 17.812  1.00 35.63 ? 608 TYR A CD2   1 
ATOM   1102 C  CE1   . TYR A 1 141 ? 20.860 26.615 20.057  1.00 35.29 ? 608 TYR A CE1   1 
ATOM   1103 C  CE2   . TYR A 1 141 ? 19.987 24.620 19.066  1.00 39.06 ? 608 TYR A CE2   1 
ATOM   1104 C  CZ    . TYR A 1 141 ? 20.383 25.326 20.181  1.00 40.07 ? 608 TYR A CZ    1 
ATOM   1105 O  OH    . TYR A 1 141 ? 20.300 24.740 21.422  1.00 43.90 ? 608 TYR A OH    1 
ATOM   1106 N  N     . PHE A 1 142 ? 22.371 29.708 16.663  1.00 17.02 ? 609 PHE A N     1 
ATOM   1107 C  CA    . PHE A 1 142 ? 23.030 30.693 17.505  1.00 18.05 ? 609 PHE A CA    1 
ATOM   1108 C  C     . PHE A 1 142 ? 22.116 31.889 17.703  1.00 18.06 ? 609 PHE A C     1 
ATOM   1109 O  O     . PHE A 1 142 ? 21.147 32.055 16.966  1.00 20.17 ? 609 PHE A O     1 
ATOM   1110 C  CB    . PHE A 1 142 ? 24.361 31.142 16.885  1.00 17.97 ? 609 PHE A CB    1 
ATOM   1111 C  CG    . PHE A 1 142 ? 24.212 31.800 15.526  1.00 19.77 ? 609 PHE A CG    1 
ATOM   1112 C  CD1   . PHE A 1 142 ? 23.897 33.150 15.422  1.00 18.51 ? 609 PHE A CD1   1 
ATOM   1113 C  CD2   . PHE A 1 142 ? 24.386 31.066 14.359  1.00 18.23 ? 609 PHE A CD2   1 
ATOM   1114 C  CE1   . PHE A 1 142 ? 23.761 33.764 14.165  1.00 17.78 ? 609 PHE A CE1   1 
ATOM   1115 C  CE2   . PHE A 1 142 ? 24.247 31.657 13.101  1.00 17.73 ? 609 PHE A CE2   1 
ATOM   1116 C  CZ    . PHE A 1 142 ? 23.937 33.001 12.999  1.00 17.02 ? 609 PHE A CZ    1 
ATOM   1117 N  N     . GLY A 1 143 ? 22.437 32.717 18.695  1.00 16.41 ? 610 GLY A N     1 
ATOM   1118 C  CA    . GLY A 1 143 ? 21.677 33.923 18.978  1.00 18.38 ? 610 GLY A CA    1 
ATOM   1119 C  C     . GLY A 1 143 ? 20.541 33.642 19.945  1.00 21.82 ? 610 GLY A C     1 
ATOM   1120 O  O     . GLY A 1 143 ? 19.628 34.457 20.108  1.00 24.38 ? 610 GLY A O     1 
ATOM   1121 N  N     . GLU A 1 144 ? 20.588 32.480 20.587  1.00 19.35 ? 611 GLU A N     1 
ATOM   1122 C  CA    . GLU A 1 144 ? 19.533 32.107 21.521  1.00 23.77 ? 611 GLU A CA    1 
ATOM   1123 C  C     . GLU A 1 144 ? 19.763 32.654 22.935  1.00 24.07 ? 611 GLU A C     1 
ATOM   1124 O  O     . GLU A 1 144 ? 18.807 32.851 23.687  1.00 27.00 ? 611 GLU A O     1 
ATOM   1125 C  CB    . GLU A 1 144 ? 19.367 30.581 21.577  1.00 26.16 ? 611 GLU A CB    1 
ATOM   1126 C  CG    . GLU A 1 144 ? 20.378 29.858 22.459  1.00 26.23 ? 611 GLU A CG    1 
ATOM   1127 C  CD    . GLU A 1 144 ? 21.752 29.732 21.830  1.00 26.84 ? 611 GLU A CD    1 
ATOM   1128 O  OE1   . GLU A 1 144 ? 21.934 30.128 20.666  1.00 27.22 ? 611 GLU A OE1   1 
ATOM   1129 O  OE2   . GLU A 1 144 ? 22.664 29.222 22.505  1.00 33.42 ? 611 GLU A OE2   1 
ATOM   1130 N  N     . ILE A 1 145 ? 21.020 32.878 23.306  1.00 21.73 ? 612 ILE A N     1 
ATOM   1131 C  CA    . ILE A 1 145 ? 21.338 33.210 24.700  1.00 21.03 ? 612 ILE A CA    1 
ATOM   1132 C  C     . ILE A 1 145 ? 20.614 34.480 25.107  1.00 23.96 ? 612 ILE A C     1 
ATOM   1133 O  O     . ILE A 1 145 ? 19.936 34.531 26.139  1.00 26.83 ? 612 ILE A O     1 
ATOM   1134 C  CB    . ILE A 1 145 ? 22.859 33.433 24.936  1.00 23.71 ? 612 ILE A CB    1 
ATOM   1135 C  CG1   . ILE A 1 145 ? 23.677 32.200 24.567  1.00 27.59 ? 612 ILE A CG1   1 
ATOM   1136 C  CG2   . ILE A 1 145 ? 23.110 33.819 26.379  1.00 24.83 ? 612 ILE A CG2   1 
ATOM   1137 C  CD1   . ILE A 1 145 ? 23.137 30.956 25.124  1.00 32.14 ? 612 ILE A CD1   1 
ATOM   1138 N  N     . CYS A 1 146 ? 20.759 35.507 24.277  1.00 24.02 ? 613 CYS A N     1 
ATOM   1139 C  CA    . CYS A 1 146 ? 20.135 36.809 24.509  1.00 26.24 ? 613 CYS A CA    1 
ATOM   1140 C  C     . CYS A 1 146 ? 18.612 36.706 24.649  1.00 27.07 ? 613 CYS A C     1 
ATOM   1141 O  O     . CYS A 1 146 ? 17.998 37.436 25.423  1.00 30.00 ? 613 CYS A O     1 
ATOM   1142 C  CB    . CYS A 1 146 ? 20.498 37.730 23.344  1.00 37.57 ? 613 CYS A CB    1 
ATOM   1143 S  SG    . CYS A 1 146 ? 19.891 39.387 23.459  1.00 49.54 ? 613 CYS A SG    1 
ATOM   1144 N  N     . LEU A 1 147 ? 18.000 35.801 23.892  1.00 27.74 ? 614 LEU A N     1 
ATOM   1145 C  CA    . LEU A 1 147 ? 16.549 35.599 23.971  1.00 27.69 ? 614 LEU A CA    1 
ATOM   1146 C  C     . LEU A 1 147 ? 16.141 34.919 25.274  1.00 28.85 ? 614 LEU A C     1 
ATOM   1147 O  O     . LEU A 1 147 ? 15.023 35.099 25.755  1.00 28.58 ? 614 LEU A O     1 
ATOM   1148 C  CB    . LEU A 1 147 ? 16.048 34.764 22.789  1.00 26.86 ? 614 LEU A CB    1 
ATOM   1149 C  CG    . LEU A 1 147 ? 16.336 35.300 21.386  1.00 27.16 ? 614 LEU A CG    1 
ATOM   1150 C  CD1   . LEU A 1 147 ? 15.506 34.547 20.374  1.00 27.08 ? 614 LEU A CD1   1 
ATOM   1151 C  CD2   . LEU A 1 147 ? 16.020 36.772 21.327  1.00 29.13 ? 614 LEU A CD2   1 
ATOM   1152 N  N     . LEU A 1 148 ? 17.040 34.115 25.824  1.00 29.57 ? 615 LEU A N     1 
ATOM   1153 C  CA    . LEU A 1 148 ? 16.770 33.416 27.076  1.00 32.48 ? 615 LEU A CA    1 
ATOM   1154 C  C     . LEU A 1 148 ? 16.963 34.327 28.286  1.00 36.17 ? 615 LEU A C     1 
ATOM   1155 O  O     . LEU A 1 148 ? 16.196 34.263 29.248  1.00 38.75 ? 615 LEU A O     1 
ATOM   1156 C  CB    . LEU A 1 148 ? 17.652 32.166 27.199  1.00 31.59 ? 615 LEU A CB    1 
ATOM   1157 C  CG    . LEU A 1 148 ? 17.380 31.035 26.205  1.00 33.37 ? 615 LEU A CG    1 
ATOM   1158 C  CD1   . LEU A 1 148 ? 18.507 29.996 26.219  1.00 32.06 ? 615 LEU A CD1   1 
ATOM   1159 C  CD2   . LEU A 1 148 ? 16.035 30.387 26.498  1.00 35.70 ? 615 LEU A CD2   1 
ATOM   1160 N  N     . THR A 1 149 ? 17.980 35.181 28.233  1.00 36.06 ? 616 THR A N     1 
ATOM   1161 C  CA    . THR A 1 149 ? 18.304 36.054 29.358  1.00 39.32 ? 616 THR A CA    1 
ATOM   1162 C  C     . THR A 1 149 ? 17.595 37.399 29.265  1.00 43.57 ? 616 THR A C     1 
ATOM   1163 O  O     . THR A 1 149 ? 17.466 38.111 30.259  1.00 45.44 ? 616 THR A O     1 
ATOM   1164 C  CB    . THR A 1 149 ? 19.805 36.352 29.414  1.00 39.65 ? 616 THR A CB    1 
ATOM   1165 O  OG1   . THR A 1 149 ? 20.169 37.142 28.276  1.00 37.22 ? 616 THR A OG1   1 
ATOM   1166 C  CG2   . THR A 1 149 ? 20.609 35.067 29.420  1.00 41.03 ? 616 THR A CG2   1 
ATOM   1167 N  N     . ARG A 1 150 ? 17.151 37.746 28.064  1.00 47.05 ? 617 ARG A N     1 
ATOM   1168 C  CA    . ARG A 1 150 ? 16.601 39.071 27.792  1.00 51.98 ? 617 ARG A CA    1 
ATOM   1169 C  C     . ARG A 1 150 ? 17.616 40.162 28.138  1.00 50.26 ? 617 ARG A C     1 
ATOM   1170 O  O     . ARG A 1 150 ? 17.246 41.292 28.470  1.00 50.41 ? 617 ARG A O     1 
ATOM   1171 C  CB    . ARG A 1 150 ? 15.290 39.276 28.553  1.00 57.85 ? 617 ARG A CB    1 
ATOM   1172 C  CG    . ARG A 1 150 ? 14.260 38.191 28.284  1.00 64.38 ? 617 ARG A CG    1 
ATOM   1173 C  CD    . ARG A 1 150 ? 13.178 38.161 29.353  1.00 71.69 ? 617 ARG A CD    1 
ATOM   1174 N  NE    . ARG A 1 150 ? 12.319 36.989 29.209  1.00 78.98 ? 617 ARG A NE    1 
ATOM   1175 C  CZ    . ARG A 1 150 ? 12.571 35.805 29.761  1.00 83.46 ? 617 ARG A CZ    1 
ATOM   1176 N  NH1   . ARG A 1 150 ? 13.659 35.635 30.502  1.00 83.80 ? 617 ARG A NH1   1 
ATOM   1177 N  NH2   . ARG A 1 150 ? 11.735 34.791 29.574  1.00 84.80 ? 617 ARG A NH2   1 
ATOM   1178 N  N     . GLU A 1 151 ? 18.895 39.804 28.071  1.00 46.13 ? 618 GLU A N     1 
ATOM   1179 C  CA    . GLU A 1 151 ? 19.992 40.739 28.278  1.00 47.07 ? 618 GLU A CA    1 
ATOM   1180 C  C     . GLU A 1 151 ? 20.586 41.154 26.934  1.00 43.60 ? 618 GLU A C     1 
ATOM   1181 O  O     . GLU A 1 151 ? 19.863 41.597 26.043  1.00 44.85 ? 618 GLU A O     1 
ATOM   1182 C  CB    . GLU A 1 151 ? 21.077 40.109 29.155  1.00 53.72 ? 618 GLU A CB    1 
ATOM   1183 C  CG    . GLU A 1 151 ? 20.624 39.778 30.570  1.00 62.31 ? 618 GLU A CG    1 
ATOM   1184 C  CD    . GLU A 1 151 ? 20.445 41.010 31.425  1.00 71.87 ? 618 GLU A CD    1 
ATOM   1185 O  OE1   . GLU A 1 151 ? 20.778 42.118 30.950  1.00 77.12 ? 618 GLU A OE1   1 
ATOM   1186 O  OE2   . GLU A 1 151 ? 19.975 40.872 32.575  1.00 75.36 ? 618 GLU A OE2   1 
ATOM   1187 N  N     . ARG A 1 152 ? 21.898 41.013 26.788  1.00 36.11 ? 619 ARG A N     1 
ATOM   1188 C  CA    . ARG A 1 152 ? 22.561 41.413 25.548  1.00 35.71 ? 619 ARG A CA    1 
ATOM   1189 C  C     . ARG A 1 152 ? 23.293 40.252 24.895  1.00 34.39 ? 619 ARG A C     1 
ATOM   1190 O  O     . ARG A 1 152 ? 23.555 39.248 25.540  1.00 33.86 ? 619 ARG A O     1 
ATOM   1191 C  CB    . ARG A 1 152 ? 23.537 42.558 25.812  1.00 36.92 ? 619 ARG A CB    1 
ATOM   1192 C  CG    . ARG A 1 152 ? 22.880 43.782 26.435  1.00 38.37 ? 619 ARG A CG    1 
ATOM   1193 C  CD    . ARG A 1 152 ? 23.908 44.821 26.830  1.00 38.73 ? 619 ARG A CD    1 
ATOM   1194 N  NE    . ARG A 1 152 ? 23.278 46.025 27.371  1.00 41.10 ? 619 ARG A NE    1 
ATOM   1195 C  CZ    . ARG A 1 152 ? 23.014 47.110 26.649  1.00 43.03 ? 619 ARG A CZ    1 
ATOM   1196 N  NH1   . ARG A 1 152 ? 23.338 47.142 25.364  1.00 43.40 ? 619 ARG A NH1   1 
ATOM   1197 N  NH2   . ARG A 1 152 ? 22.442 48.170 27.207  1.00 44.18 ? 619 ARG A NH2   1 
ATOM   1198 N  N     . ARG A 1 153 ? 23.618 40.406 23.611  1.00 31.41 ? 620 ARG A N     1 
ATOM   1199 C  CA    . ARG A 1 153 ? 24.432 39.430 22.884  1.00 27.99 ? 620 ARG A CA    1 
ATOM   1200 C  C     . ARG A 1 153 ? 25.774 39.223 23.587  1.00 29.80 ? 620 ARG A C     1 
ATOM   1201 O  O     . ARG A 1 153 ? 26.428 40.194 23.953  1.00 28.81 ? 620 ARG A O     1 
ATOM   1202 C  CB    . ARG A 1 153 ? 24.682 39.916 21.458  1.00 23.05 ? 620 ARG A CB    1 
ATOM   1203 C  CG    . ARG A 1 153 ? 23.416 40.184 20.624  1.00 23.66 ? 620 ARG A CG    1 
ATOM   1204 C  CD    . ARG A 1 153 ? 22.605 38.926 20.381  1.00 24.31 ? 620 ARG A CD    1 
ATOM   1205 N  NE    . ARG A 1 153 ? 21.683 39.083 19.258  1.00 23.12 ? 620 ARG A NE    1 
ATOM   1206 C  CZ    . ARG A 1 153 ? 20.793 38.170 18.882  1.00 24.24 ? 620 ARG A CZ    1 
ATOM   1207 N  NH1   . ARG A 1 153 ? 20.692 37.027 19.547  1.00 24.61 ? 620 ARG A NH1   1 
ATOM   1208 N  NH2   . ARG A 1 153 ? 20.006 38.400 17.831  1.00 21.90 ? 620 ARG A NH2   1 
ATOM   1209 N  N     . VAL A 1 154 ? 26.195 37.967 23.764  1.00 27.73 ? 621 VAL A N     1 
ATOM   1210 C  CA    . VAL A 1 154 ? 27.416 37.695 24.533  1.00 29.13 ? 621 VAL A CA    1 
ATOM   1211 C  C     . VAL A 1 154 ? 28.658 37.500 23.670  1.00 29.78 ? 621 VAL A C     1 
ATOM   1212 O  O     . VAL A 1 154 ? 29.768 37.368 24.186  1.00 31.21 ? 621 VAL A O     1 
ATOM   1213 C  CB    . VAL A 1 154 ? 27.253 36.504 25.508  1.00 30.95 ? 621 VAL A CB    1 
ATOM   1214 C  CG1   . VAL A 1 154 ? 26.016 36.703 26.367  1.00 33.78 ? 621 VAL A CG1   1 
ATOM   1215 C  CG2   . VAL A 1 154 ? 27.193 35.175 24.752  1.00 30.52 ? 621 VAL A CG2   1 
ATOM   1216 N  N     . ALA A 1 155 ? 28.467 37.510 22.356  1.00 23.07 ? 622 ALA A N     1 
ATOM   1217 C  CA    . ALA A 1 155 ? 29.557 37.283 21.421  1.00 23.38 ? 622 ALA A CA    1 
ATOM   1218 C  C     . ALA A 1 155 ? 29.115 37.866 20.097  1.00 24.63 ? 622 ALA A C     1 
ATOM   1219 O  O     . ALA A 1 155 ? 27.930 38.125 19.912  1.00 26.14 ? 622 ALA A O     1 
ATOM   1220 C  CB    . ALA A 1 155 ? 29.822 35.784 21.271  1.00 19.96 ? 622 ALA A CB    1 
ATOM   1221 N  N     . SER A 1 156 ? 30.049 38.089 19.178  1.00 22.87 ? 623 SER A N     1 
ATOM   1222 C  CA    . SER A 1 156 ? 29.659 38.438 17.814  1.00 23.40 ? 623 SER A CA    1 
ATOM   1223 C  C     . SER A 1 156 ? 29.632 37.177 16.958  1.00 21.30 ? 623 SER A C     1 
ATOM   1224 O  O     . SER A 1 156 ? 30.272 36.176 17.293  1.00 24.43 ? 623 SER A O     1 
ATOM   1225 C  CB    . SER A 1 156 ? 30.622 39.467 17.215  1.00 26.52 ? 623 SER A CB    1 
ATOM   1226 O  OG    . SER A 1 156 ? 30.687 40.634 18.020  1.00 25.87 ? 623 SER A OG    1 
ATOM   1227 N  N     . VAL A 1 157 ? 28.876 37.210 15.862  1.00 20.17 ? 624 VAL A N     1 
ATOM   1228 C  CA    . VAL A 1 157 ? 28.835 36.077 14.950  1.00 20.58 ? 624 VAL A CA    1 
ATOM   1229 C  C     . VAL A 1 157 ? 29.086 36.603 13.549  1.00 22.54 ? 624 VAL A C     1 
ATOM   1230 O  O     . VAL A 1 157 ? 28.343 37.459 13.064  1.00 24.19 ? 624 VAL A O     1 
ATOM   1231 C  CB    . VAL A 1 157 ? 27.473 35.367 15.002  1.00 17.55 ? 624 VAL A CB    1 
ATOM   1232 C  CG1   . VAL A 1 157 ? 27.447 34.160 14.045  1.00 17.55 ? 624 VAL A CG1   1 
ATOM   1233 C  CG2   . VAL A 1 157 ? 27.155 34.938 16.452  1.00 18.30 ? 624 VAL A CG2   1 
ATOM   1234 N  N     . LYS A 1 158 ? 30.138 36.093 12.911  1.00 21.11 ? 625 LYS A N     1 
ATOM   1235 C  CA    . LYS A 1 158 ? 30.580 36.603 11.616  1.00 20.15 ? 625 LYS A CA    1 
ATOM   1236 C  C     . LYS A 1 158 ? 30.600 35.480 10.600  1.00 20.36 ? 625 LYS A C     1 
ATOM   1237 O  O     . LYS A 1 158 ? 31.162 34.424 10.858  1.00 20.73 ? 625 LYS A O     1 
ATOM   1238 C  CB    . LYS A 1 158 ? 31.985 37.201 11.739  1.00 21.68 ? 625 LYS A CB    1 
ATOM   1239 C  CG    . LYS A 1 158 ? 32.524 37.900 10.487  1.00 23.16 ? 625 LYS A CG    1 
ATOM   1240 C  CD    . LYS A 1 158 ? 33.909 38.483 10.781  1.00 25.34 ? 625 LYS A CD    1 
ATOM   1241 C  CE    . LYS A 1 158 ? 34.415 39.369 9.630   1.00 29.43 ? 625 LYS A CE    1 
ATOM   1242 N  NZ    . LYS A 1 158 ? 35.833 39.774 9.837   1.00 36.05 ? 625 LYS A NZ    1 
ATOM   1243 N  N     . CYS A 1 159 ? 30.000 35.713 9.436   1.00 20.23 ? 626 CYS A N     1 
ATOM   1244 C  CA    . CYS A 1 159 ? 29.974 34.704 8.382   1.00 20.37 ? 626 CYS A CA    1 
ATOM   1245 C  C     . CYS A 1 159 ? 31.341 34.493 7.729   1.00 23.16 ? 626 CYS A C     1 
ATOM   1246 O  O     . CYS A 1 159 ? 32.007 35.454 7.337   1.00 26.73 ? 626 CYS A O     1 
ATOM   1247 C  CB    . CYS A 1 159 ? 28.987 35.108 7.297   1.00 19.55 ? 626 CYS A CB    1 
ATOM   1248 S  SG    . CYS A 1 159 ? 27.302 35.190 7.869   1.00 23.34 ? 626 CYS A SG    1 
ATOM   1249 N  N     . GLU A 1 160 ? 31.740 33.233 7.583   1.00 22.58 ? 627 GLU A N     1 
ATOM   1250 C  CA    . GLU A 1 160 ? 32.950 32.904 6.841   1.00 23.66 ? 627 GLU A CA    1 
ATOM   1251 C  C     . GLU A 1 160 ? 32.594 32.703 5.369   1.00 26.23 ? 627 GLU A C     1 
ATOM   1252 O  O     . GLU A 1 160 ? 33.354 33.083 4.496   1.00 28.78 ? 627 GLU A O     1 
ATOM   1253 C  CB    . GLU A 1 160 ? 33.630 31.642 7.401   1.00 28.65 ? 627 GLU A CB    1 
ATOM   1254 C  CG    . GLU A 1 160 ? 34.331 31.825 8.735   1.00 38.58 ? 627 GLU A CG    1 
ATOM   1255 C  CD    . GLU A 1 160 ? 35.727 32.402 8.583   1.00 49.35 ? 627 GLU A CD    1 
ATOM   1256 O  OE1   . GLU A 1 160 ? 36.661 31.856 9.201   1.00 52.48 ? 627 GLU A OE1   1 
ATOM   1257 O  OE2   . GLU A 1 160 ? 35.892 33.391 7.831   1.00 56.48 ? 627 GLU A OE2   1 
ATOM   1258 N  N     . THR A 1 161 ? 31.425 32.117 5.109   1.00 22.86 ? 628 THR A N     1 
ATOM   1259 C  CA    . THR A 1 161 ? 31.004 31.766 3.759   1.00 21.48 ? 628 THR A CA    1 
ATOM   1260 C  C     . THR A 1 161 ? 29.687 32.480 3.506   1.00 23.66 ? 628 THR A C     1 
ATOM   1261 O  O     . THR A 1 161 ? 29.219 33.217 4.365   1.00 25.31 ? 628 THR A O     1 
ATOM   1262 C  CB    . THR A 1 161 ? 30.742 30.258 3.650   1.00 22.32 ? 628 THR A CB    1 
ATOM   1263 O  OG1   . THR A 1 161 ? 29.665 29.902 4.527   1.00 20.72 ? 628 THR A OG1   1 
ATOM   1264 C  CG2   . THR A 1 161 ? 31.982 29.446 4.041   1.00 22.81 ? 628 THR A CG2   1 
ATOM   1265 N  N     . TYR A 1 162 ? 29.090 32.281 2.336   1.00 22.57 ? 629 TYR A N     1 
ATOM   1266 C  CA    . TYR A 1 162 ? 27.679 32.614 2.187   1.00 22.97 ? 629 TYR A CA    1 
ATOM   1267 C  C     . TYR A 1 162 ? 26.926 31.739 3.182   1.00 22.91 ? 629 TYR A C     1 
ATOM   1268 O  O     . TYR A 1 162 ? 27.252 30.559 3.335   1.00 22.71 ? 629 TYR A O     1 
ATOM   1269 C  CB    . TYR A 1 162 ? 27.194 32.328 0.758   1.00 23.16 ? 629 TYR A CB    1 
ATOM   1270 C  CG    . TYR A 1 162 ? 27.331 33.519 -0.154  1.00 22.38 ? 629 TYR A CG    1 
ATOM   1271 C  CD1   . TYR A 1 162 ? 28.542 33.812 -0.763  1.00 22.64 ? 629 TYR A CD1   1 
ATOM   1272 C  CD2   . TYR A 1 162 ? 26.249 34.367 -0.388  1.00 21.67 ? 629 TYR A CD2   1 
ATOM   1273 C  CE1   . TYR A 1 162 ? 28.675 34.913 -1.592  1.00 23.59 ? 629 TYR A CE1   1 
ATOM   1274 C  CE2   . TYR A 1 162 ? 26.368 35.466 -1.201  1.00 22.90 ? 629 TYR A CE2   1 
ATOM   1275 C  CZ    . TYR A 1 162 ? 27.586 35.738 -1.803  1.00 24.19 ? 629 TYR A CZ    1 
ATOM   1276 O  OH    . TYR A 1 162 ? 27.712 36.832 -2.617  1.00 24.08 ? 629 TYR A OH    1 
ATOM   1277 N  N     . CYS A 1 163 ? 25.926 32.302 3.855   1.00 20.67 ? 630 CYS A N     1 
ATOM   1278 C  CA    . CYS A 1 163 ? 25.153 31.544 4.835   1.00 19.68 ? 630 CYS A CA    1 
ATOM   1279 C  C     . CYS A 1 163 ? 23.679 31.664 4.546   1.00 19.62 ? 630 CYS A C     1 
ATOM   1280 O  O     . CYS A 1 163 ? 23.178 32.756 4.295   1.00 21.90 ? 630 CYS A O     1 
ATOM   1281 C  CB    . CYS A 1 163 ? 25.426 32.032 6.264   1.00 20.80 ? 630 CYS A CB    1 
ATOM   1282 S  SG    . CYS A 1 163 ? 27.106 31.653 6.827   1.00 25.06 ? 630 CYS A SG    1 
ATOM   1283 N  N     . THR A 1 164 ? 22.994 30.533 4.574   1.00 16.92 ? 631 THR A N     1 
ATOM   1284 C  CA    . THR A 1 164 ? 21.549 30.539 4.498   1.00 18.84 ? 631 THR A CA    1 
ATOM   1285 C  C     . THR A 1 164 ? 21.049 30.141 5.877   1.00 18.61 ? 631 THR A C     1 
ATOM   1286 O  O     . THR A 1 164 ? 21.387 29.074 6.392   1.00 19.98 ? 631 THR A O     1 
ATOM   1287 C  CB    . THR A 1 164 ? 21.049 29.584 3.414   1.00 21.68 ? 631 THR A CB    1 
ATOM   1288 O  OG1   . THR A 1 164 ? 21.581 28.280 3.657   1.00 30.13 ? 631 THR A OG1   1 
ATOM   1289 C  CG2   . THR A 1 164 ? 21.535 30.046 2.053   1.00 16.90 ? 631 THR A CG2   1 
ATOM   1290 N  N     . LEU A 1 165 ? 20.270 31.029 6.476   1.00 18.42 ? 632 LEU A N     1 
ATOM   1291 C  CA    . LEU A 1 165 ? 19.815 30.882 7.853   1.00 15.45 ? 632 LEU A CA    1 
ATOM   1292 C  C     . LEU A 1 165 ? 18.296 30.923 7.893   1.00 16.27 ? 632 LEU A C     1 
ATOM   1293 O  O     . LEU A 1 165 ? 17.651 31.430 6.960   1.00 19.05 ? 632 LEU A O     1 
ATOM   1294 C  CB    . LEU A 1 165 ? 20.349 32.042 8.709   1.00 17.96 ? 632 LEU A CB    1 
ATOM   1295 C  CG    . LEU A 1 165 ? 21.846 32.333 8.614   1.00 15.82 ? 632 LEU A CG    1 
ATOM   1296 C  CD1   . LEU A 1 165 ? 22.213 33.559 9.442   1.00 17.28 ? 632 LEU A CD1   1 
ATOM   1297 C  CD2   . LEU A 1 165 ? 22.621 31.108 9.081   1.00 16.97 ? 632 LEU A CD2   1 
ATOM   1298 N  N     . PHE A 1 166 ? 17.722 30.394 8.968   1.00 16.19 ? 633 PHE A N     1 
ATOM   1299 C  CA    . PHE A 1 166 ? 16.305 30.586 9.243   1.00 17.95 ? 633 PHE A CA    1 
ATOM   1300 C  C     . PHE A 1 166 ? 16.195 31.196 10.618  1.00 21.43 ? 633 PHE A C     1 
ATOM   1301 O  O     . PHE A 1 166 ? 16.690 30.617 11.594  1.00 21.39 ? 633 PHE A O     1 
ATOM   1302 C  CB    . PHE A 1 166 ? 15.563 29.255 9.189   1.00 21.00 ? 633 PHE A CB    1 
ATOM   1303 C  CG    . PHE A 1 166 ? 15.393 28.728 7.794   1.00 25.43 ? 633 PHE A CG    1 
ATOM   1304 C  CD1   . PHE A 1 166 ? 14.273 29.062 7.048   1.00 28.81 ? 633 PHE A CD1   1 
ATOM   1305 C  CD2   . PHE A 1 166 ? 16.365 27.931 7.218   1.00 26.83 ? 633 PHE A CD2   1 
ATOM   1306 C  CE1   . PHE A 1 166 ? 14.111 28.578 5.758   1.00 31.80 ? 633 PHE A CE1   1 
ATOM   1307 C  CE2   . PHE A 1 166 ? 16.217 27.449 5.924   1.00 30.12 ? 633 PHE A CE2   1 
ATOM   1308 C  CZ    . PHE A 1 166 ? 15.094 27.778 5.191   1.00 33.21 ? 633 PHE A CZ    1 
ATOM   1309 N  N     . SER A 1 167 ? 15.582 32.373 10.709  1.00 19.01 ? 634 SER A N     1 
ATOM   1310 C  CA    . SER A 1 167 ? 15.509 33.053 11.999  1.00 19.71 ? 634 SER A CA    1 
ATOM   1311 C  C     . SER A 1 167 ? 14.162 32.831 12.675  1.00 21.43 ? 634 SER A C     1 
ATOM   1312 O  O     . SER A 1 167 ? 13.162 32.567 12.005  1.00 23.18 ? 634 SER A O     1 
ATOM   1313 C  CB    . SER A 1 167 ? 15.782 34.551 11.836  1.00 22.60 ? 634 SER A CB    1 
ATOM   1314 O  OG    . SER A 1 167 ? 14.825 35.150 10.975  1.00 21.93 ? 634 SER A OG    1 
ATOM   1315 N  N     . LEU A 1 168 ? 14.155 32.921 14.006  1.00 22.17 ? 635 LEU A N     1 
ATOM   1316 C  CA    . LEU A 1 168 ? 12.934 32.877 14.797  1.00 23.01 ? 635 LEU A CA    1 
ATOM   1317 C  C     . LEU A 1 168 ? 12.937 34.118 15.686  1.00 27.30 ? 635 LEU A C     1 
ATOM   1318 O  O     . LEU A 1 168 ? 13.858 34.304 16.478  1.00 27.59 ? 635 LEU A O     1 
ATOM   1319 C  CB    . LEU A 1 168 ? 12.936 31.625 15.680  1.00 27.29 ? 635 LEU A CB    1 
ATOM   1320 C  CG    . LEU A 1 168 ? 11.643 31.223 16.381  1.00 29.12 ? 635 LEU A CG    1 
ATOM   1321 C  CD1   . LEU A 1 168 ? 10.595 30.796 15.357  1.00 32.13 ? 635 LEU A CD1   1 
ATOM   1322 C  CD2   . LEU A 1 168 ? 11.957 30.079 17.352  1.00 31.62 ? 635 LEU A CD2   1 
ATOM   1323 N  N     . SER A 1 169 ? 11.913 34.959 15.566  1.00 27.27 ? 636 SER A N     1 
ATOM   1324 C  CA    . SER A 1 169 ? 11.862 36.223 16.296  1.00 29.04 ? 636 SER A CA    1 
ATOM   1325 C  C     . SER A 1 169 ? 11.698 35.979 17.790  1.00 30.16 ? 636 SER A C     1 
ATOM   1326 O  O     . SER A 1 169 ? 11.283 34.902 18.200  1.00 31.49 ? 636 SER A O     1 
ATOM   1327 C  CB    . SER A 1 169 ? 10.687 37.058 15.798  1.00 30.48 ? 636 SER A CB    1 
ATOM   1328 O  OG    . SER A 1 169 ? 9.469  36.465 16.214  1.00 29.68 ? 636 SER A OG    1 
ATOM   1329 N  N     . VAL A 1 170 ? 12.016 36.978 18.605  1.00 32.87 ? 637 VAL A N     1 
ATOM   1330 C  CA    . VAL A 1 170 ? 11.891 36.814 20.054  1.00 33.08 ? 637 VAL A CA    1 
ATOM   1331 C  C     . VAL A 1 170 ? 10.437 36.508 20.436  1.00 34.81 ? 637 VAL A C     1 
ATOM   1332 O  O     . VAL A 1 170 ? 10.177 35.699 21.326  1.00 36.29 ? 637 VAL A O     1 
ATOM   1333 C  CB    . VAL A 1 170 ? 12.455 38.031 20.835  1.00 36.70 ? 637 VAL A CB    1 
ATOM   1334 C  CG1   . VAL A 1 170 ? 11.865 39.326 20.315  1.00 40.66 ? 637 VAL A CG1   1 
ATOM   1335 C  CG2   . VAL A 1 170 ? 12.210 37.878 22.342  1.00 38.83 ? 637 VAL A CG2   1 
ATOM   1336 N  N     . GLN A 1 171 ? 9.484  37.126 19.745  1.00 35.50 ? 638 GLN A N     1 
ATOM   1337 C  CA    . GLN A 1 171 ? 8.077  36.868 20.046  1.00 38.82 ? 638 GLN A CA    1 
ATOM   1338 C  C     . GLN A 1 171 ? 7.691  35.422 19.751  1.00 38.19 ? 638 GLN A C     1 
ATOM   1339 O  O     . GLN A 1 171 ? 7.054  34.774 20.576  1.00 40.52 ? 638 GLN A O     1 
ATOM   1340 C  CB    . GLN A 1 171 ? 7.154  37.843 19.304  1.00 41.38 ? 638 GLN A CB    1 
ATOM   1341 C  CG    . GLN A 1 171 ? 7.800  38.493 18.094  1.00 50.41 ? 638 GLN A CG    1 
ATOM   1342 C  CD    . GLN A 1 171 ? 8.629  39.713 18.462  1.00 53.36 ? 638 GLN A CD    1 
ATOM   1343 O  OE1   . GLN A 1 171 ? 8.210  40.542 19.279  1.00 61.36 ? 638 GLN A OE1   1 
ATOM   1344 N  NE2   . GLN A 1 171 ? 9.806  39.834 17.858  1.00 45.85 ? 638 GLN A NE2   1 
ATOM   1345 N  N     . HIS A 1 172 ? 8.085  34.915 18.585  1.00 33.88 ? 639 HIS A N     1 
ATOM   1346 C  CA    . HIS A 1 172 ? 7.782  33.530 18.223  1.00 35.13 ? 639 HIS A CA    1 
ATOM   1347 C  C     . HIS A 1 172 ? 8.557  32.529 19.080  1.00 36.30 ? 639 HIS A C     1 
ATOM   1348 O  O     . HIS A 1 172 ? 8.033  31.478 19.445  1.00 37.74 ? 639 HIS A O     1 
ATOM   1349 C  CB    . HIS A 1 172 ? 8.069  33.275 16.738  1.00 33.12 ? 639 HIS A CB    1 
ATOM   1350 C  CG    . HIS A 1 172 ? 7.262  34.127 15.808  1.00 34.11 ? 639 HIS A CG    1 
ATOM   1351 N  ND1   . HIS A 1 172 ? 5.933  34.426 16.032  1.00 37.98 ? 639 HIS A ND1   1 
ATOM   1352 C  CD2   . HIS A 1 172 ? 7.587  34.728 14.638  1.00 33.86 ? 639 HIS A CD2   1 
ATOM   1353 C  CE1   . HIS A 1 172 ? 5.479  35.183 15.048  1.00 34.21 ? 639 HIS A CE1   1 
ATOM   1354 N  NE2   . HIS A 1 172 ? 6.464  35.383 14.190  1.00 37.22 ? 639 HIS A NE2   1 
ATOM   1355 N  N     . PHE A 1 173 ? 9.817  32.855 19.361  1.00 34.26 ? 640 PHE A N     1 
ATOM   1356 C  CA    . PHE A 1 173 ? 10.672 32.065 20.243  1.00 35.26 ? 640 PHE A CA    1 
ATOM   1357 C  C     . PHE A 1 173 ? 9.969  31.838 21.578  1.00 38.77 ? 640 PHE A C     1 
ATOM   1358 O  O     . PHE A 1 173 ? 9.828  30.699 22.042  1.00 39.24 ? 640 PHE A O     1 
ATOM   1359 C  CB    . PHE A 1 173 ? 11.999 32.810 20.437  1.00 34.72 ? 640 PHE A CB    1 
ATOM   1360 C  CG    . PHE A 1 173 ? 12.960 32.155 21.397  1.00 32.58 ? 640 PHE A CG    1 
ATOM   1361 C  CD1   . PHE A 1 173 ? 13.891 31.230 20.947  1.00 29.68 ? 640 PHE A CD1   1 
ATOM   1362 C  CD2   . PHE A 1 173 ? 12.962 32.500 22.739  1.00 33.32 ? 640 PHE A CD2   1 
ATOM   1363 C  CE1   . PHE A 1 173 ? 14.798 30.645 21.822  1.00 29.50 ? 640 PHE A CE1   1 
ATOM   1364 C  CE2   . PHE A 1 173 ? 13.862 31.916 23.625  1.00 33.21 ? 640 PHE A CE2   1 
ATOM   1365 C  CZ    . PHE A 1 173 ? 14.784 30.985 23.164  1.00 30.08 ? 640 PHE A CZ    1 
ATOM   1366 N  N     . ASN A 1 174 ? 9.513  32.922 22.189  1.00 36.16 ? 641 ASN A N     1 
ATOM   1367 C  CA    . ASN A 1 174 ? 8.854  32.825 23.481  1.00 40.07 ? 641 ASN A CA    1 
ATOM   1368 C  C     . ASN A 1 174 ? 7.520  32.091 23.390  1.00 41.20 ? 641 ASN A C     1 
ATOM   1369 O  O     . ASN A 1 174 ? 7.111  31.429 24.329  1.00 42.90 ? 641 ASN A O     1 
ATOM   1370 C  CB    . ASN A 1 174 ? 8.689  34.210 24.112  1.00 40.08 ? 641 ASN A CB    1 
ATOM   1371 C  CG    . ASN A 1 174 ? 9.963  34.700 24.774  1.00 42.33 ? 641 ASN A CG    1 
ATOM   1372 O  OD1   . ASN A 1 174 ? 10.595 33.976 25.547  1.00 43.71 ? 641 ASN A OD1   1 
ATOM   1373 N  ND2   . ASN A 1 174 ? 10.346 35.934 24.476  1.00 43.12 ? 641 ASN A ND2   1 
ATOM   1374 N  N     . GLN A 1 175 ? 6.861  32.195 22.242  1.00 42.81 ? 642 GLN A N     1 
ATOM   1375 C  CA    . GLN A 1 175 ? 5.611  31.483 22.006  1.00 43.83 ? 642 GLN A CA    1 
ATOM   1376 C  C     . GLN A 1 175 ? 5.816  29.967 21.981  1.00 43.43 ? 642 GLN A C     1 
ATOM   1377 O  O     . GLN A 1 175 ? 5.138  29.232 22.694  1.00 45.80 ? 642 GLN A O     1 
ATOM   1378 C  CB    . GLN A 1 175 ? 4.973  31.943 20.692  1.00 49.14 ? 642 GLN A CB    1 
ATOM   1379 C  CG    . GLN A 1 175 ? 4.376  33.341 20.732  1.00 51.55 ? 642 GLN A CG    1 
ATOM   1380 C  CD    . GLN A 1 175 ? 3.856  33.789 19.373  1.00 55.94 ? 642 GLN A CD    1 
ATOM   1381 O  OE1   . GLN A 1 175 ? 3.755  32.991 18.436  1.00 54.36 ? 642 GLN A OE1   1 
ATOM   1382 N  NE2   . GLN A 1 175 ? 3.527  35.072 19.260  1.00 57.36 ? 642 GLN A NE2   1 
ATOM   1383 N  N     . VAL A 1 176 ? 6.756  29.499 21.166  1.00 41.98 ? 643 VAL A N     1 
ATOM   1384 C  CA    . VAL A 1 176 ? 6.956  28.062 21.006  1.00 44.81 ? 643 VAL A CA    1 
ATOM   1385 C  C     . VAL A 1 176 ? 7.504  27.385 22.268  1.00 47.37 ? 643 VAL A C     1 
ATOM   1386 O  O     . VAL A 1 176 ? 7.192  26.223 22.540  1.00 47.01 ? 643 VAL A O     1 
ATOM   1387 C  CB    . VAL A 1 176 ? 7.837  27.736 19.782  1.00 45.40 ? 643 VAL A CB    1 
ATOM   1388 C  CG1   . VAL A 1 176 ? 7.318  28.471 18.563  1.00 47.73 ? 643 VAL A CG1   1 
ATOM   1389 C  CG2   . VAL A 1 176 ? 9.274  28.115 20.042  1.00 43.67 ? 643 VAL A CG2   1 
ATOM   1390 N  N     . LEU A 1 177 ? 8.304  28.119 23.040  1.00 49.63 ? 644 LEU A N     1 
ATOM   1391 C  CA    . LEU A 1 177 ? 8.851  27.607 24.296  1.00 49.22 ? 644 LEU A CA    1 
ATOM   1392 C  C     . LEU A 1 177 ? 7.801  27.507 25.398  1.00 50.22 ? 644 LEU A C     1 
ATOM   1393 O  O     . LEU A 1 177 ? 7.923  26.686 26.311  1.00 47.71 ? 644 LEU A O     1 
ATOM   1394 C  CB    . LEU A 1 177 ? 10.011 28.481 24.773  1.00 48.28 ? 644 LEU A CB    1 
ATOM   1395 C  CG    . LEU A 1 177 ? 11.398 28.000 24.353  1.00 51.88 ? 644 LEU A CG    1 
ATOM   1396 C  CD1   . LEU A 1 177 ? 11.422 27.591 22.896  1.00 47.48 ? 644 LEU A CD1   1 
ATOM   1397 C  CD2   . LEU A 1 177 ? 12.465 29.053 24.647  1.00 54.49 ? 644 LEU A CD2   1 
ATOM   1398 N  N     . ASP A 1 178 ? 6.786  28.361 25.329  1.00 51.39 ? 645 ASP A N     1 
ATOM   1399 C  CA    . ASP A 1 178 ? 5.686  28.295 26.283  1.00 54.10 ? 645 ASP A CA    1 
ATOM   1400 C  C     . ASP A 1 178 ? 4.787  27.126 25.921  1.00 52.28 ? 645 ASP A C     1 
ATOM   1401 O  O     . ASP A 1 178 ? 4.327  26.383 26.786  1.00 53.33 ? 645 ASP A O     1 
ATOM   1402 C  CB    . ASP A 1 178 ? 4.880  29.593 26.274  1.00 59.47 ? 645 ASP A CB    1 
ATOM   1403 C  CG    . ASP A 1 178 ? 5.587  30.721 26.997  1.00 66.18 ? 645 ASP A CG    1 
ATOM   1404 O  OD1   . ASP A 1 178 ? 6.670  30.475 27.569  1.00 64.13 ? 645 ASP A OD1   1 
ATOM   1405 O  OD2   . ASP A 1 178 ? 5.057  31.853 26.993  1.00 71.13 ? 645 ASP A OD2   1 
ATOM   1406 N  N     . GLU A 1 179 ? 4.545  26.968 24.627  1.00 51.29 ? 646 GLU A N     1 
ATOM   1407 C  CA    . GLU A 1 179 ? 3.690  25.901 24.144  1.00 51.12 ? 646 GLU A CA    1 
ATOM   1408 C  C     . GLU A 1 179 ? 4.351  24.553 24.395  1.00 50.52 ? 646 GLU A C     1 
ATOM   1409 O  O     . GLU A 1 179 ? 3.675  23.567 24.679  1.00 51.38 ? 646 GLU A O     1 
ATOM   1410 C  CB    . GLU A 1 179 ? 3.387  26.089 22.656  1.00 48.85 ? 646 GLU A CB    1 
ATOM   1411 C  CG    . GLU A 1 179 ? 2.274  25.202 22.137  1.00 48.14 ? 646 GLU A CG    1 
ATOM   1412 C  CD    . GLU A 1 179 ? 1.823  25.578 20.742  1.00 48.82 ? 646 GLU A CD    1 
ATOM   1413 O  OE1   . GLU A 1 179 ? 2.535  26.365 20.079  1.00 48.81 ? 646 GLU A OE1   1 
ATOM   1414 O  OE2   . GLU A 1 179 ? 0.758  25.081 20.309  1.00 46.00 ? 646 GLU A OE2   1 
ATOM   1415 N  N     . PHE A 1 180 ? 5.678  24.522 24.311  1.00 47.56 ? 647 PHE A N     1 
ATOM   1416 C  CA    . PHE A 1 180 ? 6.426  23.286 24.523  1.00 49.25 ? 647 PHE A CA    1 
ATOM   1417 C  C     . PHE A 1 180 ? 7.571  23.476 25.526  1.00 50.16 ? 647 PHE A C     1 
ATOM   1418 O  O     . PHE A 1 180 ? 8.732  23.584 25.135  1.00 50.94 ? 647 PHE A O     1 
ATOM   1419 C  CB    . PHE A 1 180 ? 6.959  22.759 23.184  1.00 49.14 ? 647 PHE A CB    1 
ATOM   1420 C  CG    . PHE A 1 180 ? 5.882  22.520 22.157  1.00 48.47 ? 647 PHE A CG    1 
ATOM   1421 C  CD1   . PHE A 1 180 ? 5.201  21.312 22.115  1.00 47.90 ? 647 PHE A CD1   1 
ATOM   1422 C  CD2   . PHE A 1 180 ? 5.541  23.507 21.246  1.00 47.69 ? 647 PHE A CD2   1 
ATOM   1423 C  CE1   . PHE A 1 180 ? 4.201  21.092 21.176  1.00 47.42 ? 647 PHE A CE1   1 
ATOM   1424 C  CE2   . PHE A 1 180 ? 4.547  23.296 20.306  1.00 47.72 ? 647 PHE A CE2   1 
ATOM   1425 C  CZ    . PHE A 1 180 ? 3.875  22.087 20.272  1.00 48.07 ? 647 PHE A CZ    1 
ATOM   1426 N  N     . PRO A 1 181 ? 7.243  23.489 26.830  1.00 52.09 ? 648 PRO A N     1 
ATOM   1427 C  CA    . PRO A 1 181 ? 8.202  23.835 27.888  1.00 52.86 ? 648 PRO A CA    1 
ATOM   1428 C  C     . PRO A 1 181 ? 9.412  22.903 27.923  1.00 53.99 ? 648 PRO A C     1 
ATOM   1429 O  O     . PRO A 1 181 ? 10.503 23.339 28.284  1.00 53.22 ? 648 PRO A O     1 
ATOM   1430 C  CB    . PRO A 1 181 ? 7.383  23.685 29.177  1.00 53.07 ? 648 PRO A CB    1 
ATOM   1431 C  CG    . PRO A 1 181 ? 5.940  23.674 28.733  1.00 53.68 ? 648 PRO A CG    1 
ATOM   1432 C  CD    . PRO A 1 181 ? 5.955  23.039 27.383  1.00 52.08 ? 648 PRO A CD    1 
ATOM   1433 N  N     . ALA A 1 182 ? 9.218  21.640 27.557  1.00 56.03 ? 649 ALA A N     1 
ATOM   1434 C  CA    . ALA A 1 182 ? 10.320 20.681 27.529  1.00 57.49 ? 649 ALA A CA    1 
ATOM   1435 C  C     . ALA A 1 182 ? 11.473 21.194 26.670  1.00 58.19 ? 649 ALA A C     1 
ATOM   1436 O  O     . ALA A 1 182 ? 12.643 20.948 26.976  1.00 59.96 ? 649 ALA A O     1 
ATOM   1437 C  CB    . ALA A 1 182 ? 9.842  19.328 27.026  1.00 57.70 ? 649 ALA A CB    1 
ATOM   1438 N  N     . MET A 1 183 ? 11.136 21.914 25.601  1.00 53.93 ? 650 MET A N     1 
ATOM   1439 C  CA    . MET A 1 183 ? 12.146 22.469 24.707  1.00 53.08 ? 650 MET A CA    1 
ATOM   1440 C  C     . MET A 1 183 ? 12.854 23.724 25.241  1.00 50.13 ? 650 MET A C     1 
ATOM   1441 O  O     . MET A 1 183 ? 13.964 24.042 24.806  1.00 47.66 ? 650 MET A O     1 
ATOM   1442 C  CB    . MET A 1 183 ? 11.566 22.723 23.317  1.00 57.18 ? 650 MET A CB    1 
ATOM   1443 C  CG    . MET A 1 183 ? 12.045 21.730 22.266  1.00 60.97 ? 650 MET A CG    1 
ATOM   1444 S  SD    . MET A 1 183 ? 11.722 20.000 22.650  1.00 61.83 ? 650 MET A SD    1 
ATOM   1445 C  CE    . MET A 1 183 ? 9.953  19.911 22.371  1.00 64.27 ? 650 MET A CE    1 
ATOM   1446 N  N     . ARG A 1 184 ? 12.220 24.437 26.169  1.00 47.77 ? 651 ARG A N     1 
ATOM   1447 C  CA    . ARG A 1 184 ? 12.906 25.524 26.854  1.00 45.82 ? 651 ARG A CA    1 
ATOM   1448 C  C     . ARG A 1 184 ? 14.007 24.927 27.708  1.00 44.61 ? 651 ARG A C     1 
ATOM   1449 O  O     . ARG A 1 184 ? 15.108 25.476 27.804  1.00 42.63 ? 651 ARG A O     1 
ATOM   1450 C  CB    . ARG A 1 184 ? 11.957 26.330 27.742  1.00 47.89 ? 651 ARG A CB    1 
ATOM   1451 C  CG    . ARG A 1 184 ? 12.660 27.453 28.499  1.00 52.61 ? 651 ARG A CG    1 
ATOM   1452 C  CD    . ARG A 1 184 ? 11.684 28.375 29.221  1.00 57.71 ? 651 ARG A CD    1 
ATOM   1453 N  NE    . ARG A 1 184 ? 10.880 29.180 28.300  1.00 61.31 ? 651 ARG A NE    1 
ATOM   1454 C  CZ    . ARG A 1 184 ? 11.269 30.343 27.780  1.00 63.67 ? 651 ARG A CZ    1 
ATOM   1455 N  NH1   . ARG A 1 184 ? 12.461 30.846 28.079  1.00 65.33 ? 651 ARG A NH1   1 
ATOM   1456 N  NH2   . ARG A 1 184 ? 10.466 31.005 26.958  1.00 63.15 ? 651 ARG A NH2   1 
ATOM   1457 N  N     . LYS A 1 185 ? 13.698 23.798 28.336  1.00 45.10 ? 652 LYS A N     1 
ATOM   1458 C  CA    . LYS A 1 185 ? 14.655 23.127 29.205  1.00 47.42 ? 652 LYS A CA    1 
ATOM   1459 C  C     . LYS A 1 185 ? 15.855 22.684 28.393  1.00 49.21 ? 652 LYS A C     1 
ATOM   1460 O  O     . LYS A 1 185 ? 16.994 22.968 28.755  1.00 49.57 ? 652 LYS A O     1 
ATOM   1461 C  CB    . LYS A 1 185 ? 14.006 21.935 29.901  1.00 49.75 ? 652 LYS A CB    1 
ATOM   1462 N  N     . THR A 1 186 ? 15.605 22.000 27.280  1.00 50.61 ? 653 THR A N     1 
ATOM   1463 C  CA    . THR A 1 186 ? 16.710 21.535 26.451  1.00 50.83 ? 653 THR A CA    1 
ATOM   1464 C  C     . THR A 1 186 ? 17.493 22.720 25.895  1.00 47.68 ? 653 THR A C     1 
ATOM   1465 O  O     . THR A 1 186 ? 18.712 22.664 25.775  1.00 50.38 ? 653 THR A O     1 
ATOM   1466 C  CB    . THR A 1 186 ? 16.258 20.578 25.321  1.00 51.89 ? 653 THR A CB    1 
ATOM   1467 O  OG1   . THR A 1 186 ? 15.752 21.329 24.214  1.00 52.79 ? 653 THR A OG1   1 
ATOM   1468 C  CG2   . THR A 1 186 ? 15.189 19.620 25.821  1.00 52.41 ? 653 THR A CG2   1 
ATOM   1469 N  N     . MET A 1 187 ? 16.801 23.811 25.585  1.00 43.07 ? 654 MET A N     1 
ATOM   1470 C  CA    . MET A 1 187 ? 17.488 24.987 25.073  1.00 37.24 ? 654 MET A CA    1 
ATOM   1471 C  C     . MET A 1 187 ? 18.366 25.643 26.137  1.00 34.57 ? 654 MET A C     1 
ATOM   1472 O  O     . MET A 1 187 ? 19.505 26.006 25.870  1.00 38.71 ? 654 MET A O     1 
ATOM   1473 C  CB    . MET A 1 187 ? 16.491 26.007 24.518  1.00 43.76 ? 654 MET A CB    1 
ATOM   1474 C  CG    . MET A 1 187 ? 17.147 27.229 23.907  1.00 50.28 ? 654 MET A CG    1 
ATOM   1475 S  SD    . MET A 1 187 ? 17.242 27.163 22.105  1.00 54.30 ? 654 MET A SD    1 
ATOM   1476 C  CE    . MET A 1 187 ? 15.516 26.879 21.716  1.00 53.49 ? 654 MET A CE    1 
ATOM   1477 N  N     . GLU A 1 188 ? 17.832 25.816 27.339  1.00 32.43 ? 655 GLU A N     1 
ATOM   1478 C  CA    . GLU A 1 188 ? 18.616 26.408 28.420  1.00 32.78 ? 655 GLU A CA    1 
ATOM   1479 C  C     . GLU A 1 188 ? 19.894 25.610 28.670  1.00 33.47 ? 655 GLU A C     1 
ATOM   1480 O  O     . GLU A 1 188 ? 20.948 26.179 28.935  1.00 33.87 ? 655 GLU A O     1 
ATOM   1481 C  CB    . GLU A 1 188 ? 17.780 26.522 29.696  1.00 37.46 ? 655 GLU A CB    1 
ATOM   1482 C  CG    . GLU A 1 188 ? 16.747 27.640 29.640  1.00 41.14 ? 655 GLU A CG    1 
ATOM   1483 C  CD    . GLU A 1 188 ? 15.726 27.562 30.762  1.00 47.87 ? 655 GLU A CD    1 
ATOM   1484 O  OE1   . GLU A 1 188 ? 15.723 26.550 31.497  1.00 50.50 ? 655 GLU A OE1   1 
ATOM   1485 O  OE2   . GLU A 1 188 ? 14.921 28.510 30.903  1.00 48.87 ? 655 GLU A OE2   1 
ATOM   1486 N  N     . GLU A 1 189 ? 19.811 24.291 28.550  1.00 33.97 ? 656 GLU A N     1 
ATOM   1487 C  CA    . GLU A 1 189 ? 20.975 23.448 28.828  1.00 38.86 ? 656 GLU A CA    1 
ATOM   1488 C  C     . GLU A 1 189 ? 22.167 23.699 27.885  1.00 37.33 ? 656 GLU A C     1 
ATOM   1489 O  O     . GLU A 1 189 ? 23.307 23.688 28.328  1.00 36.09 ? 656 GLU A O     1 
ATOM   1490 C  CB    . GLU A 1 189 ? 20.579 21.967 28.879  1.00 39.29 ? 656 GLU A CB    1 
ATOM   1491 C  CG    . GLU A 1 189 ? 19.566 21.661 29.977  1.00 43.94 ? 656 GLU A CG    1 
ATOM   1492 C  CD    . GLU A 1 189 ? 18.928 20.284 29.852  1.00 50.80 ? 656 GLU A CD    1 
ATOM   1493 O  OE1   . GLU A 1 189 ? 19.261 19.539 28.901  1.00 55.74 ? 656 GLU A OE1   1 
ATOM   1494 O  OE2   . GLU A 1 189 ? 18.086 19.949 30.712  1.00 49.57 ? 656 GLU A OE2   1 
ATOM   1495 N  N     . ILE A 1 190 ? 21.908 23.939 26.600  1.00 43.06 ? 657 ILE A N     1 
ATOM   1496 C  CA    . ILE A 1 190 ? 22.970 24.274 25.637  1.00 40.67 ? 657 ILE A CA    1 
ATOM   1497 C  C     . ILE A 1 190 ? 23.500 25.712 25.843  1.00 44.34 ? 657 ILE A C     1 
ATOM   1498 O  O     . ILE A 1 190 ? 24.693 26.010 25.650  1.00 39.67 ? 657 ILE A O     1 
ATOM   1499 C  CB    . ILE A 1 190 ? 22.471 24.112 24.180  1.00 45.25 ? 657 ILE A CB    1 
ATOM   1500 C  CG1   . ILE A 1 190 ? 22.317 22.631 23.805  1.00 44.13 ? 657 ILE A CG1   1 
ATOM   1501 C  CG2   . ILE A 1 190 ? 23.421 24.803 23.193  1.00 45.24 ? 657 ILE A CG2   1 
ATOM   1502 C  CD1   . ILE A 1 190 ? 21.149 21.923 24.428  1.00 41.47 ? 657 ILE A CD1   1 
ATOM   1503 N  N     . ALA A 1 191 ? 22.599 26.604 26.231  1.00 45.49 ? 658 ALA A N     1 
ATOM   1504 C  CA    . ALA A 1 191 ? 22.952 27.983 26.525  1.00 41.30 ? 658 ALA A CA    1 
ATOM   1505 C  C     . ALA A 1 191 ? 23.994 28.014 27.622  1.00 40.85 ? 658 ALA A C     1 
ATOM   1506 O  O     . ALA A 1 191 ? 25.005 28.703 27.518  1.00 40.66 ? 658 ALA A O     1 
ATOM   1507 C  CB    . ALA A 1 191 ? 21.719 28.765 26.954  1.00 39.45 ? 658 ALA A CB    1 
ATOM   1508 N  N     . VAL A 1 192 ? 23.739 27.274 28.688  1.00 40.98 ? 659 VAL A N     1 
ATOM   1509 C  CA    . VAL A 1 192 ? 24.721 27.185 29.751  1.00 47.61 ? 659 VAL A CA    1 
ATOM   1510 C  C     . VAL A 1 192 ? 25.996 26.534 29.196  1.00 48.43 ? 659 VAL A C     1 
ATOM   1511 O  O     . VAL A 1 192 ? 27.094 27.035 29.435  1.00 49.07 ? 659 VAL A O     1 
ATOM   1512 C  CB    . VAL A 1 192 ? 24.191 26.415 30.978  1.00 54.32 ? 659 VAL A CB    1 
ATOM   1513 C  CG1   . VAL A 1 192 ? 24.777 26.998 32.230  1.00 61.43 ? 659 VAL A CG1   1 
ATOM   1514 C  CG2   . VAL A 1 192 ? 22.690 26.515 31.070  1.00 53.59 ? 659 VAL A CG2   1 
ATOM   1515 N  N     . ARG A 1 193 ? 25.847 25.442 28.442  1.00 47.27 ? 660 ARG A N     1 
ATOM   1516 C  CA    . ARG A 1 193 ? 27.001 24.712 27.895  1.00 55.52 ? 660 ARG A CA    1 
ATOM   1517 C  C     . ARG A 1 193 ? 27.614 25.425 26.708  1.00 65.72 ? 660 ARG A C     1 
ATOM   1518 O  O     . ARG A 1 193 ? 28.175 24.791 25.817  1.00 73.17 ? 660 ARG A O     1 
ATOM   1519 C  CB    . ARG A 1 193 ? 26.621 23.310 27.435  1.00 57.24 ? 660 ARG A CB    1 
ATOM   1520 C  CG    . ARG A 1 193 ? 26.204 22.363 28.508  1.00 56.38 ? 660 ARG A CG    1 
ATOM   1521 C  CD    . ARG A 1 193 ? 26.585 20.951 28.119  1.00 61.02 ? 660 ARG A CD    1 
ATOM   1522 N  NE    . ARG A 1 193 ? 26.096 19.981 29.094  1.00 66.86 ? 660 ARG A NE    1 
ATOM   1523 C  CZ    . ARG A 1 193 ? 26.539 18.732 29.199  1.00 69.27 ? 660 ARG A CZ    1 
ATOM   1524 N  NH1   . ARG A 1 193 ? 27.493 18.290 28.390  1.00 71.93 ? 660 ARG A NH1   1 
ATOM   1525 N  NH2   . ARG A 1 193 ? 26.027 17.923 30.118  1.00 66.84 ? 660 ARG A NH2   1 
ATOM   1526 N  N     . ARG A 1 194 ? 27.451 26.737 26.670  1.00 61.40 ? 661 ARG A N     1 
ATOM   1527 C  CA    . ARG A 1 194 ? 28.263 27.579 25.821  1.00 54.05 ? 661 ARG A CA    1 
ATOM   1528 C  C     . ARG A 1 194 ? 28.967 28.438 26.856  1.00 58.57 ? 661 ARG A C     1 
ATOM   1529 O  O     . ARG A 1 194 ? 28.583 29.566 27.149  1.00 59.49 ? 661 ARG A O     1 
ATOM   1530 C  CB    . ARG A 1 194 ? 27.392 28.310 24.786  1.00 48.10 ? 661 ARG A CB    1 
ATOM   1531 C  CG    . ARG A 1 194 ? 27.030 27.341 23.621  1.00 37.03 ? 661 ARG A CG    1 
ATOM   1532 C  CD    . ARG A 1 194 ? 25.907 27.792 22.656  1.00 33.65 ? 661 ARG A CD    1 
ATOM   1533 N  NE    . ARG A 1 194 ? 25.928 26.922 21.458  1.00 31.23 ? 661 ARG A NE    1 
ATOM   1534 C  CZ    . ARG A 1 194 ? 25.261 27.145 20.327  1.00 28.83 ? 661 ARG A CZ    1 
ATOM   1535 N  NH1   . ARG A 1 194 ? 24.480 28.204 20.210  1.00 32.43 ? 661 ARG A NH1   1 
ATOM   1536 N  NH2   . ARG A 1 194 ? 25.372 26.299 19.301  1.00 27.22 ? 661 ARG A NH2   1 
ATOM   1537 N  N     . LEU A 1 195 ? 30.005 27.820 27.417  1.00 66.34 ? 662 LEU A N     1 
ATOM   1538 C  CA    . LEU A 1 195 ? 30.486 28.047 28.786  1.00 72.19 ? 662 LEU A CA    1 
ATOM   1539 C  C     . LEU A 1 195 ? 30.748 29.485 29.256  1.00 77.94 ? 662 LEU A C     1 
ATOM   1540 O  O     . LEU A 1 195 ? 30.544 30.473 28.553  1.00 80.93 ? 662 LEU A O     1 
ATOM   1541 C  CB    . LEU A 1 195 ? 31.705 27.154 29.052  1.00 69.20 ? 662 LEU A CB    1 
ATOM   1542 C  CG    . LEU A 1 195 ? 31.400 25.659 28.886  1.00 64.35 ? 662 LEU A CG    1 
ATOM   1543 C  CD1   . LEU A 1 195 ? 32.674 24.825 28.828  1.00 64.57 ? 662 LEU A CD1   1 
ATOM   1544 C  CD2   . LEU A 1 195 ? 30.455 25.166 29.993  1.00 55.86 ? 662 LEU A CD2   1 
HETATM 1545 CO CO    . NCO B 2 .   ? 28.586 38.252 -11.079 0.50 17.76 ? 301 NCO A CO    1 
HETATM 1546 N  N1    . NCO B 2 .   ? 27.122 37.517 -12.481 1.00 37.97 ? 301 NCO A N1    1 
HETATM 1547 N  N2    . NCO B 2 .   ? 30.162 37.937 -12.534 1.00 30.30 ? 301 NCO A N2    1 
HETATM 1548 N  N3    . NCO B 2 .   ? 28.401 40.389 -11.667 1.00 33.66 ? 301 NCO A N3    1 
HETATM 1549 N  N4    . NCO B 2 .   ? 28.887 36.059 -10.259 1.00 23.55 ? 301 NCO A N4    1 
HETATM 1550 N  N5    . NCO B 2 .   ? 30.076 38.925 -9.659  1.00 40.36 ? 301 NCO A N5    1 
HETATM 1551 N  N6    . NCO B 2 .   ? 26.927 38.543 -9.623  1.00 30.63 ? 301 NCO A N6    1 
HETATM 1552 P  P     . CMP C 3 .   ? 23.664 35.454 21.768  1.00 21.46 ? 401 CMP A P     1 
HETATM 1553 O  O1P   . CMP C 3 .   ? 24.416 35.998 23.023  1.00 23.37 ? 401 CMP A O1P   1 
HETATM 1554 O  O2P   . CMP C 3 .   ? 22.236 35.713 21.672  1.00 20.50 ? 401 CMP A O2P   1 
HETATM 1555 O  "O5'" . CMP C 3 .   ? 24.599 36.012 20.584  1.00 22.44 ? 401 CMP A "O5'" 1 
HETATM 1556 C  "C5'" . CMP C 3 .   ? 25.802 35.432 20.138  1.00 20.34 ? 401 CMP A "C5'" 1 
HETATM 1557 C  "C4'" . CMP C 3 .   ? 25.717 33.917 20.012  1.00 20.81 ? 401 CMP A "C4'" 1 
HETATM 1558 O  "O4'" . CMP C 3 .   ? 26.957 33.222 19.941  1.00 20.78 ? 401 CMP A "O4'" 1 
HETATM 1559 C  "C3'" . CMP C 3 .   ? 25.162 33.392 21.314  1.00 20.30 ? 401 CMP A "C3'" 1 
HETATM 1560 O  "O3'" . CMP C 3 .   ? 23.953 33.860 21.806  1.00 23.86 ? 401 CMP A "O3'" 1 
HETATM 1561 C  "C2'" . CMP C 3 .   ? 25.319 31.872 21.252  1.00 21.94 ? 401 CMP A "C2'" 1 
HETATM 1562 O  "O2'" . CMP C 3 .   ? 24.372 31.350 20.331  1.00 22.16 ? 401 CMP A "O2'" 1 
HETATM 1563 C  "C1'" . CMP C 3 .   ? 26.676 31.877 20.468  1.00 17.03 ? 401 CMP A "C1'" 1 
HETATM 1564 N  N9    . CMP C 3 .   ? 27.777 31.499 21.306  1.00 24.48 ? 401 CMP A N9    1 
HETATM 1565 C  C8    . CMP C 3 .   ? 28.422 32.240 22.328  1.00 29.79 ? 401 CMP A C8    1 
HETATM 1566 N  N7    . CMP C 3 .   ? 29.457 31.578 22.872  1.00 26.90 ? 401 CMP A N7    1 
HETATM 1567 C  C5    . CMP C 3 .   ? 29.493 30.346 22.209  1.00 30.34 ? 401 CMP A C5    1 
HETATM 1568 C  C6    . CMP C 3 .   ? 30.312 29.184 22.305  1.00 30.95 ? 401 CMP A C6    1 
HETATM 1569 N  N6    . CMP C 3 .   ? 31.353 29.134 23.197  1.00 35.47 ? 401 CMP A N6    1 
HETATM 1570 N  N1    . CMP C 3 .   ? 30.047 28.119 21.489  1.00 27.40 ? 401 CMP A N1    1 
HETATM 1571 C  C2    . CMP C 3 .   ? 29.028 28.209 20.605  1.00 34.91 ? 401 CMP A C2    1 
HETATM 1572 N  N3    . CMP C 3 .   ? 28.175 29.234 20.391  1.00 24.67 ? 401 CMP A N3    1 
HETATM 1573 C  C4    . CMP C 3 .   ? 28.449 30.285 21.201  1.00 28.98 ? 401 CMP A C4    1 
HETATM 1574 O  O     . HOH D 4 .   ? 30.250 30.250 0.000   0.50 11.62 ? 0   HOH A O     1 
HETATM 1575 O  O     . HOH D 4 .   ? 32.320 32.320 0.000   0.50 29.54 ? 1   HOH A O     1 
HETATM 1576 O  O     . HOH D 4 .   ? 18.443 37.957 4.072   1.00 24.71 ? 2   HOH A O     1 
HETATM 1577 O  O     . HOH D 4 .   ? 12.661 36.078 12.392  1.00 30.58 ? 3   HOH A O     1 
HETATM 1578 O  O     . HOH D 4 .   ? 10.364 34.372 13.247  1.00 27.58 ? 4   HOH A O     1 
HETATM 1579 O  O     . HOH D 4 .   ? 18.625 39.413 6.911   1.00 26.28 ? 5   HOH A O     1 
HETATM 1580 O  O     . HOH D 4 .   ? 28.333 23.230 13.972  1.00 27.81 ? 6   HOH A O     1 
HETATM 1581 O  O     . HOH D 4 .   ? 21.633 41.471 17.863  1.00 35.81 ? 7   HOH A O     1 
HETATM 1582 O  O     . HOH D 4 .   ? 2.769  18.856 7.859   1.00 39.98 ? 8   HOH A O     1 
HETATM 1583 O  O     . HOH D 4 .   ? 30.611 41.375 4.298   1.00 30.59 ? 10  HOH A O     1 
HETATM 1584 O  O     . HOH D 4 .   ? 26.632 27.953 2.450   1.00 42.37 ? 12  HOH A O     1 
HETATM 1585 O  O     . HOH D 4 .   ? 21.073 21.940 7.322   1.00 33.34 ? 13  HOH A O     1 
HETATM 1586 O  O     . HOH D 4 .   ? 34.281 32.617 1.925   1.00 27.23 ? 14  HOH A O     1 
HETATM 1587 O  O     . HOH D 4 .   ? 10.281 19.376 8.497   1.00 35.94 ? 15  HOH A O     1 
HETATM 1588 O  O     . HOH D 4 .   ? 28.368 43.324 8.797   1.00 36.04 ? 16  HOH A O     1 
HETATM 1589 O  O     . HOH D 4 .   ? 23.562 22.164 30.776  1.00 33.01 ? 17  HOH A O     1 
HETATM 1590 O  O     . HOH D 4 .   ? 7.046  18.189 11.745  1.00 37.21 ? 18  HOH A O     1 
HETATM 1591 O  O     . HOH D 4 .   ? 6.996  20.101 25.953  1.00 43.75 ? 19  HOH A O     1 
HETATM 1592 O  O     . HOH D 4 .   ? 22.710 37.386 27.571  1.00 38.62 ? 20  HOH A O     1 
HETATM 1593 O  O     . HOH D 4 .   ? 14.500 33.251 -1.409  1.00 42.62 ? 21  HOH A O     1 
HETATM 1594 O  O     . HOH D 4 .   ? 30.098 37.103 -4.115  1.00 44.90 ? 22  HOH A O     1 
HETATM 1595 O  O     . HOH D 4 .   ? 12.939 33.877 26.993  1.00 50.88 ? 23  HOH A O     1 
HETATM 1596 O  O     . HOH D 4 .   ? 26.354 23.353 18.035  1.00 42.51 ? 24  HOH A O     1 
HETATM 1597 O  O     . HOH D 4 .   ? 5.537  17.941 4.268   1.00 45.35 ? 25  HOH A O     1 
HETATM 1598 O  O     . HOH D 4 .   ? 26.544 35.952 -6.504  1.00 41.11 ? 26  HOH A O     1 
HETATM 1599 O  O     . HOH D 4 .   ? 15.554 37.843 4.460   1.00 40.58 ? 27  HOH A O     1 
HETATM 1600 O  O     . HOH D 4 .   ? 21.117 26.870 23.611  1.00 54.49 ? 28  HOH A O     1 
HETATM 1601 O  O     . HOH D 4 .   ? -2.032 17.304 6.065   1.00 53.33 ? 29  HOH A O     1 
HETATM 1602 O  O     . HOH D 4 .   ? 31.678 23.186 12.298  1.00 58.89 ? 30  HOH A O     1 
HETATM 1603 O  O     . HOH D 4 .   ? 24.132 39.851 -10.547 1.00 57.32 ? 31  HOH A O     1 
HETATM 1604 O  O     . HOH D 4 .   ? -4.901 23.658 11.125  1.00 47.86 ? 32  HOH A O     1 
HETATM 1605 O  O     . HOH D 4 .   ? 8.224  29.468 7.619   1.00 48.41 ? 33  HOH A O     1 
HETATM 1606 O  O     . HOH D 4 .   ? 17.419 43.085 -15.319 1.00 53.15 ? 34  HOH A O     1 
HETATM 1607 O  O     . HOH D 4 .   ? 7.540  37.896 14.830  1.00 42.99 ? 35  HOH A O     1 
HETATM 1608 O  O     . HOH D 4 .   ? 19.459 40.640 16.233  1.00 38.46 ? 36  HOH A O     1 
HETATM 1609 O  O     . HOH D 4 .   ? 35.194 35.365 5.017   1.00 37.70 ? 37  HOH A O     1 
HETATM 1610 O  O     . HOH D 4 .   ? 12.914 37.887 2.706   1.00 42.70 ? 39  HOH A O     1 
HETATM 1611 O  O     . HOH D 4 .   ? 32.636 40.283 19.966  1.00 48.21 ? 40  HOH A O     1 
HETATM 1612 O  O     . HOH D 4 .   ? -5.928 30.141 6.593   1.00 42.65 ? 41  HOH A O     1 
HETATM 1613 O  O     . HOH D 4 .   ? 31.021 25.720 21.665  1.00 43.77 ? 42  HOH A O     1 
HETATM 1614 O  O     . HOH D 4 .   ? 30.015 44.600 18.960  1.00 37.09 ? 44  HOH A O     1 
HETATM 1615 O  O     . HOH D 4 .   ? 41.268 33.814 17.677  1.00 45.18 ? 45  HOH A O     1 
HETATM 1616 O  O     . HOH D 4 .   ? 1.976  33.852 16.001  1.00 60.31 ? 46  HOH A O     1 
HETATM 1617 O  O     . HOH D 4 .   ? 8.169  38.340 23.620  1.00 49.85 ? 47  HOH A O     1 
HETATM 1618 O  O     . HOH D 4 .   ? 25.230 21.611 24.647  1.00 45.11 ? 48  HOH A O     1 
HETATM 1619 O  O     . HOH D 4 .   ? 28.354 41.809 -9.140  1.00 45.90 ? 49  HOH A O     1 
HETATM 1620 O  O     . HOH D 4 .   ? 28.059 21.271 24.450  1.00 59.53 ? 50  HOH A O     1 
HETATM 1621 O  O     . HOH D 4 .   ? 10.251 28.398 -12.576 1.00 47.63 ? 51  HOH A O     1 
HETATM 1622 O  O     . HOH D 4 .   ? -2.911 21.750 13.012  1.00 43.47 ? 52  HOH A O     1 
HETATM 1623 O  O     . HOH D 4 .   ? 16.683 30.235 -4.982  1.00 58.37 ? 53  HOH A O     1 
HETATM 1624 O  O     . HOH D 4 .   ? 18.058 41.738 24.073  1.00 40.25 ? 54  HOH A O     1 
HETATM 1625 O  O     . HOH D 4 .   ? 25.039 35.802 -15.390 1.00 53.05 ? 55  HOH A O     1 
HETATM 1626 O  O     . HOH D 4 .   ? 27.799 37.062 -15.366 1.00 48.81 ? 56  HOH A O     1 
HETATM 1627 O  O     . HOH D 4 .   ? 32.241 37.217 -1.964  1.00 54.72 ? 57  HOH A O     1 
HETATM 1628 O  O     . HOH D 4 .   ? 8.494  27.674 28.836  1.00 48.05 ? 58  HOH A O     1 
HETATM 1629 O  O     . HOH D 4 .   ? 0.267  26.530 11.512  1.00 46.75 ? 59  HOH A O     1 
HETATM 1630 O  O     . HOH D 4 .   ? 32.703 42.759 7.864   1.00 43.82 ? 60  HOH A O     1 
HETATM 1631 O  O     . HOH D 4 .   ? 29.306 35.477 -6.358  1.00 48.20 ? 61  HOH A O     1 
HETATM 1632 O  O     . HOH D 4 .   ? 30.773 23.017 15.238  1.00 47.86 ? 62  HOH A O     1 
HETATM 1633 O  O     . HOH D 4 .   ? 34.918 36.387 7.748   1.00 40.33 ? 63  HOH A O     1 
HETATM 1634 O  O     . HOH D 4 .   ? 19.953 17.085 6.715   1.00 46.94 ? 64  HOH A O     1 
HETATM 1635 O  O     . HOH D 4 .   ? 36.278 35.768 11.721  1.00 53.57 ? 65  HOH A O     1 
HETATM 1636 O  O     . HOH D 4 .   ? 24.766 20.778 15.625  1.00 46.99 ? 66  HOH A O     1 
HETATM 1637 O  O     . HOH D 4 .   ? 32.570 43.358 16.355  1.00 53.15 ? 67  HOH A O     1 
HETATM 1638 O  O     . HOH D 4 .   ? 10.808 33.467 4.758   1.00 44.35 ? 68  HOH A O     1 
HETATM 1639 O  O     . HOH D 4 .   ? 15.877 22.545 4.625   1.00 50.92 ? 69  HOH A O     1 
HETATM 1640 O  O     . HOH D 4 .   ? 10.909 16.744 9.302   1.00 47.55 ? 70  HOH A O     1 
HETATM 1641 O  O     . HOH D 4 .   ? -1.075 22.868 15.326  1.00 50.00 ? 71  HOH A O     1 
HETATM 1642 O  O     . HOH D 4 .   ? 24.205 50.723 -10.406 1.00 45.18 ? 72  HOH A O     1 
HETATM 1643 O  O     . HOH D 4 .   ? 29.252 39.569 -15.251 1.00 58.56 ? 73  HOH A O     1 
HETATM 1644 O  O     . HOH D 4 .   ? 8.362  15.968 12.736  1.00 56.31 ? 74  HOH A O     1 
HETATM 1645 O  O     . HOH D 4 .   ? 9.032  27.094 3.291   1.00 49.03 ? 75  HOH A O     1 
HETATM 1646 O  O     . HOH D 4 .   ? 20.940 40.435 14.024  1.00 50.81 ? 76  HOH A O     1 
HETATM 1647 O  O     . HOH D 4 .   ? 24.189 20.111 4.620   1.00 79.55 ? 77  HOH A O     1 
HETATM 1648 O  O     . HOH D 4 .   ? 23.353 24.414 18.251  1.00 59.05 ? 78  HOH A O     1 
HETATM 1649 O  O     . HOH D 4 .   ? 18.461 30.824 -2.026  1.00 62.65 ? 79  HOH A O     1 
HETATM 1650 O  O     . HOH D 4 .   ? 35.695 40.641 15.111  1.00 50.92 ? 80  HOH A O     1 
HETATM 1651 O  O     . HOH D 4 .   ? 24.314 37.705 29.761  1.00 42.85 ? 81  HOH A O     1 
HETATM 1652 O  O     . HOH D 4 .   ? 17.010 16.193 13.830  1.00 45.74 ? 82  HOH A O     1 
HETATM 1653 O  O     . HOH D 4 .   ? 0.883  28.155 9.081   1.00 44.26 ? 83  HOH A O     1 
HETATM 1654 O  O     . HOH D 4 .   ? 13.359 15.866 8.247   1.00 46.13 ? 84  HOH A O     1 
HETATM 1655 O  O     . HOH D 4 .   ? 26.368 21.260 13.065  1.00 44.75 ? 85  HOH A O     1 
HETATM 1656 O  O     . HOH D 4 .   ? 16.765 17.303 -2.930  1.00 52.81 ? 86  HOH A O     1 
HETATM 1657 O  O     . HOH D 4 .   ? 23.697 42.559 16.505  1.00 42.65 ? 87  HOH A O     1 
HETATM 1658 O  O     . HOH D 4 .   ? 18.735 27.131 0.146   1.00 52.76 ? 88  HOH A O     1 
HETATM 1659 O  O     . HOH D 4 .   ? 27.307 22.655 3.248   1.00 58.21 ? 89  HOH A O     1 
HETATM 1660 O  O     . HOH D 4 .   ? 25.677 43.231 9.655   1.00 60.68 ? 90  HOH A O     1 
HETATM 1661 O  O     . HOH D 4 .   ? 34.001 34.836 9.850   1.00 49.82 ? 91  HOH A O     1 
HETATM 1662 O  O     . HOH D 4 .   ? 21.281 21.133 18.140  1.00 59.54 ? 92  HOH A O     1 
HETATM 1663 O  O     . HOH D 4 .   ? 24.186 27.476 1.087   1.00 71.89 ? 93  HOH A O     1 
HETATM 1664 O  O     . HOH D 4 .   ? 35.561 42.499 8.797   1.00 60.16 ? 95  HOH A O     1 
HETATM 1665 O  O     . HOH D 4 .   ? 12.396 32.686 32.138  1.00 71.07 ? 96  HOH A O     1 
HETATM 1666 O  O     . HOH D 4 .   ? 2.186  27.094 13.403  1.00 51.08 ? 97  HOH A O     1 
HETATM 1667 O  O     . HOH D 4 .   ? 14.252 14.470 10.556  1.00 57.15 ? 98  HOH A O     1 
HETATM 1668 O  O     . HOH D 4 .   ? 30.872 32.670 25.211  1.00 62.17 ? 99  HOH A O     1 
HETATM 1669 O  O     . HOH D 4 .   ? 15.528 56.758 -1.606  1.00 62.81 ? 100 HOH A O     1 
HETATM 1670 O  O     . HOH D 4 .   ? 26.408 48.205 -10.944 1.00 56.01 ? 101 HOH A O     1 
HETATM 1671 O  O     . HOH D 4 .   ? 27.439 24.759 20.874  1.00 50.27 ? 103 HOH A O     1 
HETATM 1672 O  O     . HOH D 4 .   ? 30.299 25.740 24.442  1.00 57.64 ? 104 HOH A O     1 
HETATM 1673 O  O     . HOH D 4 .   ? -4.768 30.674 10.192  1.00 51.02 ? 105 HOH A O     1 
HETATM 1674 O  O     . HOH D 4 .   ? 32.194 45.521 -0.500  1.00 69.01 ? 106 HOH A O     1 
HETATM 1675 O  O     . HOH D 4 .   ? 29.326 48.371 -10.207 1.00 60.90 ? 108 HOH A O     1 
HETATM 1676 O  O     . HOH D 4 .   ? 32.057 43.650 -3.454  1.00 51.49 ? 110 HOH A O     1 
HETATM 1677 O  O     . HOH D 4 .   ? 39.373 32.625 7.407   1.00 73.91 ? 113 HOH A O     1 
HETATM 1678 O  O     . HOH D 4 .   ? 42.621 39.351 19.478  1.00 63.51 ? 114 HOH A O     1 
HETATM 1679 O  O     . HOH D 4 .   ? 19.276 27.807 -7.235  1.00 72.24 ? 115 HOH A O     1 
HETATM 1680 O  O     . HOH D 4 .   ? 15.799 32.482 -15.029 1.00 56.42 ? 116 HOH A O     1 
HETATM 1681 O  O     . HOH D 4 .   ? 12.203 38.929 12.959  1.00 56.60 ? 117 HOH A O     1 
HETATM 1682 O  O     . HOH D 4 .   ? 15.884 39.767 23.673  1.00 65.28 ? 118 HOH A O     1 
HETATM 1683 O  O     . HOH D 4 .   ? 31.675 44.963 9.646   1.00 56.49 ? 119 HOH A O     1 
HETATM 1684 O  O     . HOH D 4 .   ? 32.492 30.818 26.612  1.00 62.89 ? 120 HOH A O     1 
HETATM 1685 O  O     . HOH D 4 .   ? 10.810 29.495 5.875   1.00 60.01 ? 121 HOH A O     1 
HETATM 1686 O  O     . HOH D 4 .   ? 17.622 44.234 17.561  1.00 75.02 ? 122 HOH A O     1 
HETATM 1687 O  O     . HOH D 4 .   ? 33.793 53.277 -6.553  1.00 58.60 ? 125 HOH A O     1 
HETATM 1688 O  O     . HOH D 4 .   ? 0.777  16.152 2.692   1.00 58.21 ? 126 HOH A O     1 
HETATM 1689 O  O     . HOH D 4 .   ? 21.132 26.260 1.672   1.00 48.88 ? 127 HOH A O     1 
HETATM 1690 O  O     . HOH D 4 .   ? 27.238 36.679 30.101  1.00 52.05 ? 128 HOH A O     1 
HETATM 1691 O  O     . HOH D 4 .   ? 12.086 40.273 15.679  1.00 62.55 ? 130 HOH A O     1 
HETATM 1692 O  O     . HOH D 4 .   ? 37.406 43.847 14.432  1.00 65.46 ? 131 HOH A O     1 
HETATM 1693 O  O     . HOH D 4 .   ? 4.163  29.357 7.194   1.00 57.46 ? 132 HOH A O     1 
HETATM 1694 O  O     . HOH D 4 .   ? 24.041 22.205 20.155  1.00 65.18 ? 133 HOH A O     1 
HETATM 1695 O  O     . HOH D 4 .   ? 33.054 26.713 24.238  1.00 64.68 ? 134 HOH A O     1 
HETATM 1696 O  O     . HOH D 4 .   ? 6.208  16.161 9.827   1.00 52.97 ? 135 HOH A O     1 
HETATM 1697 O  O     . HOH D 4 .   ? 13.203 16.836 24.420  1.00 66.37 ? 136 HOH A O     1 
HETATM 1698 O  O     . HOH D 4 .   ? 10.614 38.876 -3.344  1.00 70.42 ? 137 HOH A O     1 
HETATM 1699 O  O     . HOH D 4 .   ? 15.501 44.132 20.064  1.00 62.46 ? 138 HOH A O     1 
HETATM 1700 O  O     . HOH D 4 .   ? 30.011 40.668 -2.925  1.00 52.76 ? 139 HOH A O     1 
HETATM 1701 O  O     . HOH D 4 .   ? 32.726 45.088 13.741  1.00 48.47 ? 140 HOH A O     1 
HETATM 1702 O  O     . HOH D 4 .   ? 14.221 31.859 -6.026  1.00 58.05 ? 141 HOH A O     1 
HETATM 1703 O  O     . HOH D 4 .   ? 23.684 34.761 32.729  1.00 71.79 ? 142 HOH A O     1 
HETATM 1704 O  O     . HOH D 4 .   ? 4.705  37.172 -14.917 1.00 73.71 ? 143 HOH A O     1 
HETATM 1705 O  O     . HOH D 4 .   ? 31.289 40.026 1.274   1.00 43.00 ? 145 HOH A O     1 
HETATM 1706 O  O     . HOH D 4 .   ? 2.840  30.524 17.662  1.00 51.72 ? 146 HOH A O     1 
HETATM 1707 O  O     . HOH D 4 .   ? 1.267  23.143 17.399  1.00 52.19 ? 147 HOH A O     1 
HETATM 1708 O  O     . HOH D 4 .   ? 22.152 38.315 -11.963 1.00 51.36 ? 148 HOH A O     1 
HETATM 1709 O  O     . HOH D 4 .   ? 5.606  13.216 17.682  1.00 54.98 ? 149 HOH A O     1 
HETATM 1710 O  O     . HOH D 4 .   ? 24.258 48.094 29.707  1.00 75.05 ? 150 HOH A O     1 
HETATM 1711 O  O     . HOH D 4 .   ? -2.520 27.334 14.984  1.00 66.49 ? 151 HOH A O     1 
HETATM 1712 O  O     . HOH D 4 .   ? -2.561 14.301 5.123   1.00 54.96 ? 152 HOH A O     1 
HETATM 1713 O  O     . HOH D 4 .   ? 38.710 38.747 15.767  1.00 64.31 ? 153 HOH A O     1 
HETATM 1714 O  O     . HOH D 4 .   ? 30.507 39.775 26.037  1.00 64.73 ? 156 HOH A O     1 
HETATM 1715 O  O     . HOH D 4 .   ? 3.724  16.600 2.410   1.00 61.23 ? 157 HOH A O     1 
HETATM 1716 O  O     . HOH D 4 .   ? 24.163 51.187 -13.857 1.00 64.94 ? 159 HOH A O     1 
HETATM 1717 O  O     . HOH D 4 .   ? 10.527 25.458 31.453  1.00 65.10 ? 161 HOH A O     1 
HETATM 1718 O  O     . HOH D 4 .   ? 21.028 34.862 -12.402 1.00 59.63 ? 162 HOH A O     1 
HETATM 1719 O  O     . HOH D 4 .   ? 12.356 35.980 4.882   1.00 72.81 ? 163 HOH A O     1 
HETATM 1720 O  O     . HOH D 4 .   ? 15.834 29.791 -7.694  1.00 67.90 ? 164 HOH A O     1 
HETATM 1721 O  O     . HOH D 4 .   ? 12.999 38.501 7.670   1.00 60.97 ? 165 HOH A O     1 
HETATM 1722 O  O     . HOH D 4 .   ? 0.968  20.351 14.506  1.00 49.36 ? 166 HOH A O     1 
HETATM 1723 O  O     . HOH D 4 .   ? 4.218  40.553 -10.238 1.00 77.52 ? 168 HOH A O     1 
HETATM 1724 O  O     . HOH D 4 .   ? 9.039  37.451 4.905   1.00 77.41 ? 169 HOH A O     1 
HETATM 1725 O  O     . HOH D 4 .   ? 21.124 18.607 20.712  1.00 64.64 ? 170 HOH A O     1 
HETATM 1726 O  O     . HOH D 4 .   ? 35.951 44.257 20.728  1.00 68.07 ? 171 HOH A O     1 
HETATM 1727 O  O     . HOH D 4 .   ? 12.051 33.201 -4.459  1.00 67.15 ? 172 HOH A O     1 
HETATM 1728 O  O     . HOH D 4 .   ? 3.524  15.795 9.294   1.00 72.92 ? 174 HOH A O     1 
HETATM 1729 O  O     . HOH D 4 .   ? -5.330 35.079 0.799   1.00 66.18 ? 177 HOH A O     1 
HETATM 1730 O  O     . HOH D 4 .   ? 18.603 37.272 32.867  1.00 55.32 ? 178 HOH A O     1 
HETATM 1731 O  O     . HOH D 4 .   ? 19.519 44.956 -14.716 1.00 67.98 ? 179 HOH A O     1 
HETATM 1732 O  O     . HOH D 4 .   ? 24.449 40.337 28.494  1.00 48.65 ? 180 HOH A O     1 
HETATM 1733 O  O     . HOH D 4 .   ? 37.995 37.636 13.173  1.00 72.51 ? 182 HOH A O     1 
HETATM 1734 O  O     . HOH D 4 .   ? 21.632 59.258 -11.063 1.00 64.06 ? 184 HOH A O     1 
HETATM 1735 O  O     . HOH D 4 .   ? 5.297  18.067 23.826  1.00 70.12 ? 186 HOH A O     1 
HETATM 1736 O  O     . HOH D 4 .   ? 11.535 43.207 17.461  1.00 58.68 ? 188 HOH A O     1 
HETATM 1737 O  O     . HOH D 4 .   ? 30.251 21.750 26.429  1.00 55.96 ? 189 HOH A O     1 
HETATM 1738 O  O     . HOH D 4 .   ? 0.894  16.500 23.737  1.00 75.95 ? 190 HOH A O     1 
HETATM 1739 O  O     . HOH D 4 .   ? 28.471 20.322 21.423  1.00 68.16 ? 191 HOH A O     1 
HETATM 1740 O  O     . HOH D 4 .   ? 1.722  18.523 21.770  1.00 53.63 ? 192 HOH A O     1 
HETATM 1741 O  O     . HOH D 4 .   ? -1.693 33.145 6.758   1.00 56.17 ? 193 HOH A O     1 
HETATM 1742 O  O     . HOH D 4 .   ? 7.419  34.260 10.825  1.00 40.01 ? 195 HOH A O     1 
HETATM 1743 O  O     . HOH D 4 .   ? 9.214  35.177 30.722  1.00 72.65 ? 196 HOH A O     1 
HETATM 1744 O  O     . HOH D 4 .   ? 1.907  16.213 14.561  1.00 58.74 ? 197 HOH A O     1 
HETATM 1745 O  O     . HOH D 4 .   ? 33.045 43.188 20.700  1.00 69.29 ? 198 HOH A O     1 
HETATM 1746 O  O     . HOH D 4 .   ? 17.601 33.340 32.703  1.00 69.11 ? 201 HOH A O     1 
HETATM 1747 O  O     . HOH D 4 .   ? 7.239  12.881 20.837  1.00 64.94 ? 202 HOH A O     1 
HETATM 1748 O  O     . HOH D 4 .   ? 2.493  18.234 12.418  1.00 55.49 ? 204 HOH A O     1 
HETATM 1749 O  O     . HOH D 4 .   ? 28.926 27.562 0.864   1.00 51.46 ? 208 HOH A O     1 
HETATM 1750 O  O     . HOH D 4 .   ? 41.856 32.416 9.284   1.00 54.96 ? 209 HOH A O     1 
HETATM 1751 O  O     . HOH D 4 .   ? 30.191 19.898 31.753  1.00 65.51 ? 211 HOH A O     1 
HETATM 1752 O  O     . HOH D 4 .   ? 32.651 20.694 28.984  1.00 70.78 ? 212 HOH A O     1 
HETATM 1753 O  O     . HOH D 4 .   ? 34.558 29.220 25.335  1.00 61.79 ? 213 HOH A O     1 
HETATM 1754 O  O     . HOH D 4 .   ? 23.667 19.290 7.478   1.00 58.16 ? 219 HOH A O     1 
HETATM 1755 O  O     . HOH D 4 .   ? 39.630 33.034 11.419  1.00 72.16 ? 221 HOH A O     1 
HETATM 1756 O  O     . HOH D 4 .   ? 35.585 49.802 -5.089  1.00 64.61 ? 222 HOH A O     1 
HETATM 1757 O  O     . HOH D 4 .   ? 2.757  29.030 20.093  1.00 60.46 ? 223 HOH A O     1 
HETATM 1758 O  O     . HOH D 4 .   ? 25.385 42.829 30.154  1.00 62.54 ? 224 HOH A O     1 
HETATM 1759 O  O     . HOH D 4 .   ? 8.995  36.873 11.791  1.00 74.75 ? 226 HOH A O     1 
HETATM 1760 O  O     . HOH D 4 .   ? 39.354 43.110 26.018  1.00 67.45 ? 228 HOH A O     1 
HETATM 1761 O  O     . HOH D 4 .   ? 30.014 38.753 -0.912  1.00 66.03 ? 229 HOH A O     1 
HETATM 1762 O  O     . HOH D 4 .   ? -3.406 11.834 3.121   1.00 73.75 ? 230 HOH A O     1 
HETATM 1763 O  O     . HOH D 4 .   ? 2.740  20.055 24.613  1.00 63.56 ? 233 HOH A O     1 
HETATM 1764 O  O     . HOH D 4 .   ? 26.798 38.822 32.299  1.00 68.74 ? 235 HOH A O     1 
HETATM 1765 O  O     . HOH D 4 .   ? 36.857 40.454 7.034   1.00 62.13 ? 236 HOH A O     1 
HETATM 1766 O  O     . HOH D 4 .   ? 1.326  30.430 15.264  1.00 65.18 ? 241 HOH A O     1 
HETATM 1767 O  O     . HOH D 4 .   ? 27.603 21.275 0.941   1.00 73.40 ? 243 HOH A O     1 
HETATM 1768 O  O     . HOH D 4 .   ? 35.739 37.862 26.558  1.00 67.56 ? 246 HOH A O     1 
HETATM 1769 O  O     . HOH D 4 .   ? 14.842 31.586 29.870  1.00 55.45 ? 247 HOH A O     1 
HETATM 1770 O  O     . HOH D 4 .   ? 6.957  35.801 27.392  1.00 66.90 ? 248 HOH A O     1 
HETATM 1771 O  O     . HOH D 4 .   ? 37.831 33.776 4.993   1.00 69.77 ? 249 HOH A O     1 
HETATM 1772 O  O     . HOH D 4 .   ? 40.942 42.193 18.807  1.00 68.52 ? 250 HOH A O     1 
HETATM 1773 O  O     . HOH D 4 .   ? 27.630 53.767 -12.913 1.00 66.73 ? 252 HOH A O     1 
HETATM 1774 O  O     . HOH D 4 .   ? 38.838 41.679 10.648  1.00 75.11 ? 253 HOH A O     1 
HETATM 1775 O  O     . HOH D 4 .   ? 21.308 20.839 4.509   1.00 64.07 ? 257 HOH A O     1 
HETATM 1776 O  O     . HOH D 4 .   ? 21.327 60.522 -3.021  1.00 70.61 ? 260 HOH A O     1 
HETATM 1777 O  O     . HOH D 4 .   ? 28.954 45.193 11.050  1.00 74.98 ? 262 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 4   ? 0.6361 1.1215 0.7822 -0.0780 0.0152  -0.0771 471 ASP A N   
2    C CA  . ASP A 4   ? 0.6692 1.1382 0.7841 -0.0692 -0.0672 -0.1184 471 ASP A CA  
3    C C   . ASP A 4   ? 0.6414 1.1348 0.7386 -0.0583 -0.0969 -0.1321 471 ASP A C   
4    O O   . ASP A 4   ? 0.6386 1.1610 0.7966 -0.0589 -0.1184 -0.1341 471 ASP A O   
5    C CB  . ASP A 4   ? 0.7152 1.1549 0.8075 -0.0649 -0.0656 -0.1301 471 ASP A CB  
6    N N   . SER A 5   ? 0.6124 1.1124 0.6582 -0.0584 -0.1406 -0.1473 472 SER A N   
7    C CA  . SER A 5   ? 0.5823 1.0962 0.6438 -0.0287 -0.1330 -0.1312 472 SER A CA  
8    C C   . SER A 5   ? 0.5500 1.0609 0.5432 -0.0206 -0.1198 -0.1444 472 SER A C   
9    O O   . SER A 5   ? 0.4683 1.0523 0.4901 -0.0062 -0.0947 -0.1641 472 SER A O   
10   C CB  . SER A 5   ? 0.6057 1.1106 0.6709 0.0060  -0.0961 -0.1055 472 SER A CB  
11   N N   . SER A 6   ? 0.5711 1.0264 0.5309 -0.0475 -0.1339 -0.1613 473 SER A N   
12   C CA  . SER A 6   ? 0.6136 0.9895 0.4462 -0.0617 -0.1387 -0.1317 473 SER A CA  
13   C C   . SER A 6   ? 0.6587 0.9907 0.4572 -0.0484 -0.1178 -0.1176 473 SER A C   
14   O O   . SER A 6   ? 0.6686 0.9843 0.4331 -0.0490 -0.0919 -0.0883 473 SER A O   
15   C CB  . SER A 6   ? 0.6411 0.9474 0.4270 -0.1070 -0.1001 -0.1453 473 SER A CB  
16   O OG  . SER A 6   ? 0.6727 0.9432 0.5391 -0.1347 -0.0699 -0.0772 473 SER A OG  
17   N N   . SER A 7   ? 0.6798 0.9786 0.4914 -0.0567 -0.0856 -0.1546 474 SER A N   
18   C CA  . SER A 7   ? 0.6757 0.9422 0.5049 -0.0222 -0.0505 -0.1659 474 SER A CA  
19   C C   . SER A 7   ? 0.6726 0.9082 0.4932 -0.0015 -0.1352 -0.1899 474 SER A C   
20   O O   . SER A 7   ? 0.6518 0.8650 0.4030 -0.0230 -0.1626 -0.2398 474 SER A O   
21   C CB  . SER A 7   ? 0.6841 0.9249 0.4874 -0.0235 0.0036  -0.2140 474 SER A CB  
22   O OG  . SER A 7   ? 0.6905 0.9361 0.5353 -0.0217 0.0146  -0.2171 474 SER A OG  
23   N N   . ARG A 8   ? 0.6725 0.9256 0.5137 0.0293  -0.2081 -0.1569 475 ARG A N   
24   C CA  . ARG A 8   ? 0.6774 0.9447 0.5166 0.0517  -0.2506 -0.0926 475 ARG A CA  
25   C C   . ARG A 8   ? 0.6881 0.9445 0.6185 0.0540  -0.2537 -0.0518 475 ARG A C   
26   O O   . ARG A 8   ? 0.6816 0.8872 0.6510 0.0723  -0.2887 -0.0196 475 ARG A O   
27   C CB  . ARG A 8   ? 0.6892 0.9572 0.5356 0.0531  -0.2043 -0.0900 475 ARG A CB  
28   N N   . GLN A 9   ? 0.7082 1.0017 0.6343 0.0358  -0.2743 -0.0730 476 GLN A N   
29   C CA  . GLN A 9   ? 0.7203 1.0324 0.6230 0.0307  -0.2731 -0.1034 476 GLN A CA  
30   C C   . GLN A 9   ? 0.6948 0.9992 0.5890 0.0262  -0.2665 -0.0940 476 GLN A C   
31   O O   . GLN A 9   ? 0.7226 1.0106 0.6488 0.0181  -0.2759 -0.0985 476 GLN A O   
32   C CB  . GLN A 9   ? 0.7818 1.0890 0.7394 0.0482  -0.2223 -0.0976 476 GLN A CB  
33   C CG  . GLN A 9   ? 0.8632 1.1503 0.8175 0.0765  -0.1509 -0.0571 476 GLN A CG  
34   C CD  . GLN A 9   ? 0.9535 1.1945 0.9117 0.0854  -0.0852 -0.0347 476 GLN A CD  
35   O OE1 . GLN A 9   ? 0.9857 1.2194 0.9516 0.0846  -0.0519 -0.0255 476 GLN A OE1 
36   N NE2 . GLN A 9   ? 0.9847 1.2025 0.9634 0.0865  -0.0698 -0.0260 476 GLN A NE2 
37   N N   . TYR A 10  ? 0.6363 0.9218 0.4536 0.0539  -0.2742 -0.0789 477 TYR A N   
38   C CA  . TYR A 10  ? 0.6112 0.8040 0.4295 0.0594  -0.1932 -0.0288 477 TYR A CA  
39   C C   . TYR A 10  ? 0.6762 0.7802 0.3738 0.0717  -0.1397 -0.0074 477 TYR A C   
40   O O   . TYR A 10  ? 0.6686 0.7781 0.3592 0.1040  -0.1447 0.0281  477 TYR A O   
41   C CB  . TYR A 10  ? 0.5110 0.6967 0.3802 0.0299  -0.1892 -0.0249 477 TYR A CB  
42   C CG  . TYR A 10  ? 0.4819 0.5952 0.4317 -0.0145 -0.1064 -0.0166 477 TYR A CG  
43   C CD1 . TYR A 10  ? 0.4465 0.5497 0.4383 -0.0395 -0.1496 -0.0075 477 TYR A CD1 
44   C CD2 . TYR A 10  ? 0.4622 0.5590 0.4525 -0.0500 -0.0834 0.0471  477 TYR A CD2 
45   C CE1 . TYR A 10  ? 0.4426 0.5262 0.4803 -0.0604 -0.1406 -0.0057 477 TYR A CE1 
46   C CE2 . TYR A 10  ? 0.4429 0.5308 0.4187 -0.0372 -0.1579 0.0492  477 TYR A CE2 
47   C CZ  . TYR A 10  ? 0.4482 0.5182 0.3985 -0.0504 -0.1433 0.0208  477 TYR A CZ  
48   O OH  . TYR A 10  ? 0.4904 0.5141 0.3854 -0.0585 -0.1696 0.0259  477 TYR A OH  
49   N N   . ARG A 11  ? 0.7363 0.7702 0.3149 0.0893  -0.2169 0.0357  478 ARG A N   
50   C CA  . ARG A 11  ? 0.8001 0.7929 0.3535 0.0627  -0.1634 0.0111  478 ARG A CA  
51   C C   . ARG A 11  ? 0.8604 0.8164 0.4615 0.0866  -0.1725 0.0015  478 ARG A C   
52   O O   . ARG A 11  ? 0.8549 0.7369 0.4597 0.0808  -0.2267 -0.0024 478 ARG A O   
53   C CB  . ARG A 11  ? 0.7997 0.8126 0.3181 0.0321  -0.1446 0.0276  478 ARG A CB  
54   N N   . GLU A 12  ? 0.9269 0.8984 0.5486 0.1049  -0.1900 -0.0119 479 GLU A N   
55   C CA  . GLU A 12  ? 0.9775 0.9581 0.6401 0.1194  -0.2211 -0.0018 479 GLU A CA  
56   C C   . GLU A 12  ? 0.9639 0.9069 0.6093 0.1321  -0.2681 0.0165  479 GLU A C   
57   O O   . GLU A 12  ? 0.9570 0.9262 0.6247 0.1180  -0.3104 -0.0091 479 GLU A O   
58   C CB  . GLU A 12  ? 1.0431 1.0501 0.7496 0.1216  -0.2041 0.0164  479 GLU A CB  
59   C CG  . GLU A 12  ? 1.1012 1.1332 0.8503 0.1287  -0.1664 0.0263  479 GLU A CG  
60   C CD  . GLU A 12  ? 1.1394 1.2017 0.9274 0.1354  -0.1347 0.0097  479 GLU A CD  
61   O OE1 . GLU A 12  ? 1.1330 1.2171 0.9395 0.1508  -0.1221 0.0204  479 GLU A OE1 
62   O OE2 . GLU A 12  ? 1.1622 1.2316 0.9566 0.1355  -0.1206 -0.0091 479 GLU A OE2 
63   N N   . LYS A 13  ? 0.9553 0.8354 0.5303 0.1655  -0.2538 0.0667  480 LYS A N   
64   C CA  . LYS A 13  ? 0.9395 0.7805 0.4985 0.1451  -0.2402 0.0585  480 LYS A CA  
65   C C   . LYS A 13  ? 0.9500 0.7095 0.4376 0.1581  -0.1886 0.1066  480 LYS A C   
66   O O   . LYS A 13  ? 0.9744 0.6754 0.4705 0.1897  -0.1335 0.1587  480 LYS A O   
67   C CB  . LYS A 13  ? 0.9399 0.8230 0.5364 0.1129  -0.2268 0.0460  480 LYS A CB  
68   C CG  . LYS A 13  ? 0.9489 0.8601 0.6447 0.0975  -0.2241 0.0409  480 LYS A CG  
69   C CD  . LYS A 13  ? 0.9643 0.8802 0.7192 0.0928  -0.2206 0.0392  480 LYS A CD  
70   C CE  . LYS A 13  ? 0.9755 0.9137 0.8100 0.0860  -0.2197 -0.0036 480 LYS A CE  
71   N NZ  . LYS A 13  ? 0.9826 0.9309 0.8604 0.0770  -0.2268 -0.0193 480 LYS A NZ  
72   N N   . LEU A 14  ? 0.9129 0.6763 0.3362 0.1501  -0.2461 0.0725  481 LEU A N   
73   C CA  . LEU A 14  ? 0.8879 0.6399 0.4418 0.1518  -0.2519 0.0690  481 LEU A CA  
74   C C   . LEU A 14  ? 0.9082 0.6157 0.4507 0.1530  -0.2513 0.0778  481 LEU A C   
75   O O   . LEU A 14  ? 0.9251 0.5637 0.4245 0.1497  -0.2701 0.0895  481 LEU A O   
76   C CB  . LEU A 14  ? 0.8524 0.6427 0.5081 0.1539  -0.2488 -0.0040 481 LEU A CB  
77   C CG  . LEU A 14  ? 0.8438 0.6544 0.5590 0.1374  -0.1928 -0.0208 481 LEU A CG  
78   C CD1 . LEU A 14  ? 0.8323 0.6210 0.4683 0.1642  -0.1826 0.0579  481 LEU A CD1 
79   C CD2 . LEU A 14  ? 0.8385 0.6846 0.5973 0.1273  -0.1440 -0.0233 481 LEU A CD2 
80   N N   . LYS A 15  ? 0.9093 0.6168 0.4743 0.1684  -0.2353 0.0377  482 LYS A N   
81   C CA  . LYS A 15  ? 0.9135 0.5891 0.4647 0.1956  -0.2250 0.0260  482 LYS A CA  
82   C C   . LYS A 15  ? 0.9111 0.5342 0.4768 0.2194  -0.1560 0.0611  482 LYS A C   
83   O O   . LYS A 15  ? 0.9072 0.5045 0.4024 0.2499  -0.1242 0.0655  482 LYS A O   
84   C CB  . LYS A 15  ? 0.9135 0.6197 0.5331 0.2046  -0.2493 0.0018  482 LYS A CB  
85   N N   . GLN A 16  ? 0.9154 0.5174 0.5193 0.2471  -0.1460 0.0424  483 GLN A N   
86   C CA  . GLN A 16  ? 0.9511 0.5700 0.5993 0.2276  -0.0907 0.0792  483 GLN A CA  
87   C C   . GLN A 16  ? 0.9531 0.4944 0.4792 0.2445  -0.0899 0.0747  483 GLN A C   
88   O O   . GLN A 16  ? 0.9770 0.4425 0.4484 0.2955  -0.0539 0.1163  483 GLN A O   
89   C CB  . GLN A 16  ? 0.9779 0.6686 0.7302 0.1934  -0.0674 0.1014  483 GLN A CB  
90   C CG  . GLN A 16  ? 0.9968 0.7450 0.8237 0.1702  -0.0854 0.1034  483 GLN A CG  
91   C CD  . GLN A 16  ? 0.9940 0.8162 0.8616 0.1566  -0.1062 0.0854  483 GLN A CD  
92   O OE1 . GLN A 16  ? 1.0103 0.8575 0.8421 0.1643  -0.1511 0.1029  483 GLN A OE1 
93   N NE2 . GLN A 16  ? 0.9823 0.8248 0.8393 0.1387  -0.0962 0.0321  483 GLN A NE2 
94   N N   . VAL A 17  ? 0.9403 0.4610 0.4545 0.2018  -0.1277 -0.0024 484 VAL A N   
95   C CA  . VAL A 17  ? 0.9098 0.4521 0.3871 0.2085  -0.1255 0.0162  484 VAL A CA  
96   C C   . VAL A 17  ? 0.9522 0.4483 0.3601 0.2500  -0.0849 -0.0074 484 VAL A C   
97   O O   . VAL A 17  ? 0.9807 0.4897 0.3345 0.2181  -0.0815 -0.0541 484 VAL A O   
98   C CB  . VAL A 17  ? 0.8272 0.4442 0.3723 0.2078  -0.2113 0.0043  484 VAL A CB  
99   C CG1 . VAL A 17  ? 0.8241 0.4405 0.4190 0.2104  -0.2169 -0.0370 484 VAL A CG1 
100  C CG2 . VAL A 17  ? 0.7506 0.4295 0.3060 0.2044  -0.3363 0.0281  484 VAL A CG2 
101  N N   . GLU A 18  ? 0.9811 0.3816 0.2744 0.2864  -0.0516 0.0561  485 GLU A N   
102  C CA  . GLU A 18  ? 1.0136 0.4066 0.3982 0.2288  0.0253  0.0463  485 GLU A CA  
103  C C   . GLU A 18  ? 1.0407 0.4208 0.4111 0.1733  0.0893  0.0765  485 GLU A C   
104  O O   . GLU A 18  ? 1.0528 0.4116 0.3632 0.1388  0.1829  0.0854  485 GLU A O   
105  C CB  . GLU A 18  ? 1.0325 0.4837 0.4993 0.1725  0.0265  0.0492  485 GLU A CB  
106  C CG  . GLU A 18  ? 1.0665 0.5825 0.5970 0.1380  0.0341  0.0520  485 GLU A CG  
107  C CD  . GLU A 18  ? 1.0933 0.6774 0.6999 0.0680  0.0767  0.1022  485 GLU A CD  
108  O OE1 . GLU A 18  ? 1.1148 0.7450 0.7331 0.0532  0.0892  0.0645  485 GLU A OE1 
109  O OE2 . GLU A 18  ? 1.1091 0.6609 0.7260 0.0111  0.1000  0.1839  485 GLU A OE2 
110  N N   . GLU A 19  ? 1.0507 0.4421 0.4426 0.1827  0.0723  0.0927  486 GLU A N   
111  C CA  . GLU A 19  ? 1.0546 0.4866 0.4640 0.1822  0.0705  0.0606  486 GLU A CA  
112  C C   . GLU A 19  ? 1.0938 0.4604 0.5295 0.1440  0.1221  0.1162  486 GLU A C   
113  O O   . GLU A 19  ? 1.1274 0.4207 0.5526 0.1139  0.1274  0.1671  486 GLU A O   
114  C CB  . GLU A 19  ? 1.0174 0.5478 0.4753 0.2090  0.0904  0.0514  486 GLU A CB  
115  C CG  . GLU A 19  ? 1.0105 0.6247 0.4830 0.2176  0.0704  0.0566  486 GLU A CG  
116  C CD  . GLU A 19  ? 1.0261 0.7021 0.4790 0.2182  0.0662  -0.0067 486 GLU A CD  
117  O OE1 . GLU A 19  ? 1.0271 0.6986 0.4361 0.2434  0.1083  -0.1125 486 GLU A OE1 
118  O OE2 . GLU A 19  ? 1.0231 0.7507 0.4395 0.2133  0.0295  0.0320  486 GLU A OE2 
119  N N   . TYR A 20  ? 1.0911 0.4096 0.4429 0.1117  0.1346  0.1594  487 TYR A N   
120  C CA  . TYR A 20  ? 1.0780 0.3918 0.4601 0.0659  0.1071  0.0810  487 TYR A CA  
121  C C   . TYR A 20  ? 1.0682 0.3681 0.4628 0.0420  0.1324  0.0961  487 TYR A C   
122  O O   . TYR A 20  ? 1.0831 0.3161 0.5183 -0.0146 0.1638  0.1438  487 TYR A O   
123  C CB  . TYR A 20  ? 1.0557 0.3704 0.4277 0.0243  0.1145  0.0734  487 TYR A CB  
124  C CG  . TYR A 20  ? 1.0471 0.4629 0.5095 0.0077  0.0752  0.1126  487 TYR A CG  
125  C CD1 . TYR A 20  ? 1.0339 0.5282 0.5371 -0.0049 0.0874  0.1116  487 TYR A CD1 
126  C CD2 . TYR A 20  ? 1.0527 0.5266 0.5496 0.0027  0.0604  0.0944  487 TYR A CD2 
127  C CE1 . TYR A 20  ? 1.0262 0.5404 0.5381 -0.0001 0.0472  0.1654  487 TYR A CE1 
128  C CE2 . TYR A 20  ? 1.0456 0.5594 0.5830 -0.0001 0.0549  0.1068  487 TYR A CE2 
129  C CZ  . TYR A 20  ? 1.0230 0.5621 0.5685 -0.0146 0.0442  0.1314  487 TYR A CZ  
130  O OH  . TYR A 20  ? 0.9919 0.5476 0.5258 -0.0306 -0.0301 0.1515  487 TYR A OH  
131  N N   . MET A 21  ? 1.0518 0.3479 0.3807 0.0578  0.1318  0.0637  488 MET A N   
132  C CA  . MET A 21  ? 1.0395 0.3474 0.4067 0.0570  0.1311  0.1213  488 MET A CA  
133  C C   . MET A 21  ? 1.0774 0.3861 0.5257 0.0517  0.1462  0.1456  488 MET A C   
134  O O   . MET A 21  ? 1.0816 0.3816 0.5397 0.0873  0.1564  0.1350  488 MET A O   
135  C CB  . MET A 21  ? 0.9878 0.3334 0.3852 0.0404  0.0659  0.1202  488 MET A CB  
136  C CG  . MET A 21  ? 0.9310 0.3133 0.3178 0.0045  0.0125  0.1369  488 MET A CG  
137  S SD  . MET A 21  ? 0.8874 0.3280 0.3496 -0.0173 -0.0991 0.1331  488 MET A SD  
138  C CE  . MET A 21  ? 0.8677 0.3107 0.2881 0.0785  -0.0994 0.2107  488 MET A CE  
139  N N   . GLN A 22  ? 1.1157 0.4118 0.5414 0.0154  0.1710  0.2384  489 GLN A N   
140  C CA  . GLN A 22  ? 1.1729 0.4791 0.6049 -0.0086 0.1686  0.2128  489 GLN A CA  
141  C C   . GLN A 22  ? 1.2009 0.5007 0.6403 -0.0487 0.1957  0.1649  489 GLN A C   
142  O O   . GLN A 22  ? 1.2183 0.5229 0.6870 -0.0742 0.2279  0.1676  489 GLN A O   
143  C CB  . GLN A 22  ? 1.1954 0.5207 0.5308 0.0016  0.1508  0.2817  489 GLN A CB  
144  C CG  . GLN A 22  ? 1.2509 0.6332 0.5948 0.0102  0.1353  0.2202  489 GLN A CG  
145  C CD  . GLN A 22  ? 1.2988 0.7088 0.5907 0.0153  0.1199  0.2313  489 GLN A CD  
146  O OE1 . GLN A 22  ? 1.3200 0.7475 0.5667 0.0192  0.1021  0.2241  489 GLN A OE1 
147  N NE2 . GLN A 22  ? 1.3234 0.7339 0.5681 0.0234  0.1138  0.2234  489 GLN A NE2 
148  N N   . TYR A 23  ? 1.2038 0.4985 0.6298 -0.0561 0.1943  0.1554  490 TYR A N   
149  C CA  . TYR A 23  ? 1.2152 0.4913 0.6620 -0.0558 0.1878  0.1247  490 TYR A CA  
150  C C   . TYR A 23  ? 1.2373 0.4244 0.6273 -0.0708 0.2085  0.0799  490 TYR A C   
151  O O   . TYR A 23  ? 1.2625 0.4201 0.6175 -0.1151 0.2417  0.0209  490 TYR A O   
152  C CB  . TYR A 23  ? 1.2184 0.5280 0.7670 -0.0532 0.1635  0.1344  490 TYR A CB  
153  N N   . ARG A 24  ? 1.2195 0.3320 0.5185 -0.0531 0.1967  0.1470  491 ARG A N   
154  C CA  . ARG A 24  ? 1.2120 0.3503 0.5703 -0.0862 0.2077  0.0874  491 ARG A CA  
155  C C   . ARG A 24  ? 1.2056 0.3474 0.5795 -0.1254 0.1833  0.0497  491 ARG A C   
156  O O   . ARG A 24  ? 1.2069 0.3658 0.5694 -0.1313 0.1605  0.0544  491 ARG A O   
157  C CB  . ARG A 24  ? 1.2172 0.3832 0.5977 -0.0864 0.2306  0.0553  491 ARG A CB  
158  C CG  . ARG A 24  ? 1.2180 0.4291 0.6397 -0.0590 0.2311  0.0090  491 ARG A CG  
159  C CD  . ARG A 24  ? 1.2283 0.4538 0.6824 -0.0178 0.2127  -0.0081 491 ARG A CD  
160  N NE  . ARG A 24  ? 1.2425 0.5049 0.7089 0.0105  0.1742  -0.0249 491 ARG A NE  
161  C CZ  . ARG A 24  ? 1.2292 0.5242 0.7061 0.0116  0.1393  -0.0193 491 ARG A CZ  
162  N NH1 . ARG A 24  ? 1.2144 0.5193 0.7024 -0.0176 0.0956  -0.0365 491 ARG A NH1 
163  N NH2 . ARG A 24  ? 1.2096 0.5176 0.6227 0.0257  0.1825  0.0439  491 ARG A NH2 
164  N N   . LYS A 25  ? 1.1936 0.3275 0.5923 -0.1372 0.1614  0.0119  492 LYS A N   
165  C CA  . LYS A 25  ? 1.1712 0.3279 0.6034 -0.1541 0.1722  -0.0040 492 LYS A CA  
166  C C   . LYS A 25  ? 1.1430 0.3191 0.5147 -0.1639 0.1739  -0.0138 492 LYS A C   
167  O O   . LYS A 25  ? 1.1644 0.3262 0.4820 -0.1366 0.1324  -0.0521 492 LYS A O   
168  C CB  . LYS A 25  ? 1.1928 0.3525 0.6911 -0.1430 0.1736  0.0347  492 LYS A CB  
169  C CG  . LYS A 25  ? 1.2122 0.4448 0.6826 -0.1472 0.1926  0.0701  492 LYS A CG  
170  C CD  . LYS A 25  ? 1.2303 0.4889 0.7075 -0.1504 0.1828  0.0637  492 LYS A CD  
171  C CE  . LYS A 25  ? 1.2494 0.5426 0.7303 -0.1152 0.1642  0.0692  492 LYS A CE  
172  N NZ  . LYS A 25  ? 1.2692 0.5713 0.7929 -0.0822 0.1726  0.0583  492 LYS A NZ  
173  N N   . LEU A 26  ? 1.1134 0.3143 0.4949 -0.1746 0.2012  0.0225  493 LEU A N   
174  C CA  . LEU A 26  ? 1.0950 0.3459 0.4958 -0.1916 0.1711  0.0098  493 LEU A CA  
175  C C   . LEU A 26  ? 1.0909 0.4329 0.4729 -0.2321 0.1394  0.0131  493 LEU A C   
176  O O   . LEU A 26  ? 1.1156 0.4624 0.4772 -0.2271 0.1693  0.0498  493 LEU A O   
177  C CB  . LEU A 26  ? 1.0844 0.3070 0.4665 -0.1863 0.1538  -0.0086 493 LEU A CB  
178  C CG  . LEU A 26  ? 1.0763 0.2464 0.4612 -0.1544 0.1144  -0.0080 493 LEU A CG  
179  C CD1 . LEU A 26  ? 1.0681 0.1807 0.3865 -0.1259 0.1531  0.0924  493 LEU A CD1 
180  C CD2 . LEU A 26  ? 1.0898 0.2109 0.5216 -0.1650 0.0657  -0.0178 493 LEU A CD2 
181  N N   . PRO A 27  ? 1.0542 0.4575 0.4462 -0.2819 0.0943  -0.0255 494 PRO A N   
182  C CA  . PRO A 27  ? 1.0451 0.4694 0.4305 -0.2952 0.1027  -0.0595 494 PRO A CA  
183  C C   . PRO A 27  ? 1.0488 0.5464 0.4144 -0.3214 0.0954  -0.0367 494 PRO A C   
184  O O   . PRO A 27  ? 1.0857 0.5510 0.3705 -0.3555 0.0747  0.0003  494 PRO A O   
185  C CB  . PRO A 27  ? 1.0383 0.4637 0.4833 -0.2868 0.0817  -0.1006 494 PRO A CB  
186  C CG  . PRO A 27  ? 1.0324 0.4795 0.5074 -0.2837 0.0899  -0.0697 494 PRO A CG  
187  C CD  . PRO A 27  ? 1.0339 0.4702 0.4932 -0.2969 0.0891  -0.0390 494 PRO A CD  
188  N N   . SER A 28  ? 1.0247 0.5803 0.4187 -0.2982 0.0787  -0.0238 495 SER A N   
189  C CA  . SER A 28  ? 0.9827 0.6221 0.4989 -0.2859 0.0707  0.0196  495 SER A CA  
190  C C   . SER A 28  ? 0.9235 0.5949 0.4250 -0.3180 0.0138  0.0419  495 SER A C   
191  O O   . SER A 28  ? 0.9407 0.6054 0.3900 -0.3217 -0.0549 0.0905  495 SER A O   
192  C CB  . SER A 28  ? 1.0140 0.7039 0.7098 -0.2473 0.0709  0.0208  495 SER A CB  
193  O OG  . SER A 28  ? 1.0629 0.7489 0.8628 -0.2247 0.0987  0.0251  495 SER A OG  
194  N N   . HIS A 29  ? 0.8521 0.5727 0.4202 -0.3502 0.0163  0.0688  496 HIS A N   
195  C CA  . HIS A 29  ? 0.8299 0.5959 0.4534 -0.3032 0.0148  0.0287  496 HIS A CA  
196  C C   . HIS A 29  ? 0.7664 0.5496 0.4422 -0.3060 -0.0266 0.0510  496 HIS A C   
197  O O   . HIS A 29  ? 0.7283 0.5787 0.4610 -0.3429 -0.0249 0.0651  496 HIS A O   
198  C CB  . HIS A 29  ? 0.8753 0.6452 0.5313 -0.2942 0.0330  -0.0062 496 HIS A CB  
199  C CG  . HIS A 29  ? 0.9334 0.6798 0.5853 -0.2745 0.0708  0.0096  496 HIS A CG  
200  N ND1 . HIS A 29  ? 0.9552 0.7010 0.6203 -0.2790 0.0621  -0.0005 496 HIS A ND1 
201  C CD2 . HIS A 29  ? 0.9706 0.6928 0.5993 -0.2626 0.0773  0.0265  496 HIS A CD2 
202  C CE1 . HIS A 29  ? 0.9725 0.7039 0.5839 -0.2723 0.0834  0.0137  496 HIS A CE1 
203  N NE2 . HIS A 29  ? 0.9864 0.6826 0.6270 -0.2615 0.0743  -0.0078 496 HIS A NE2 
204  N N   . LEU A 30  ? 0.7671 0.5038 0.3773 -0.2772 -0.0038 0.0512  497 LEU A N   
205  C CA  . LEU A 30  ? 0.7702 0.4654 0.3226 -0.2038 0.0104  0.0119  497 LEU A CA  
206  C C   . LEU A 30  ? 0.7428 0.4467 0.3028 -0.1517 -0.0071 0.0389  497 LEU A C   
207  O O   . LEU A 30  ? 0.7219 0.4839 0.1988 -0.1400 -0.0359 0.0253  497 LEU A O   
208  C CB  . LEU A 30  ? 0.8053 0.3973 0.3568 -0.1888 0.0719  -0.0127 497 LEU A CB  
209  C CG  . LEU A 30  ? 0.8171 0.3748 0.4223 -0.2014 0.0763  -0.0499 497 LEU A CG  
210  C CD1 . LEU A 30  ? 0.8131 0.3692 0.3206 -0.2095 0.0478  -0.0592 497 LEU A CD1 
211  C CD2 . LEU A 30  ? 0.8419 0.3685 0.4150 -0.2237 0.0844  -0.1292 497 LEU A CD2 
212  N N   . ARG A 31  ? 0.7358 0.3961 0.2619 -0.1051 -0.0225 0.0932  498 ARG A N   
213  C CA  . ARG A 31  ? 0.7243 0.3332 0.2684 -0.0881 -0.0079 0.0886  498 ARG A CA  
214  C C   . ARG A 31  ? 0.6428 0.3402 0.2950 -0.0662 -0.0450 0.0755  498 ARG A C   
215  O O   . ARG A 31  ? 0.5882 0.3353 0.3412 -0.0663 -0.1002 0.0376  498 ARG A O   
216  C CB  . ARG A 31  ? 0.8129 0.3138 0.3157 -0.0636 0.0146  0.1093  498 ARG A CB  
217  C CG  . ARG A 31  ? 0.8918 0.2636 0.3580 -0.0802 0.0463  0.1429  498 ARG A CG  
218  C CD  . ARG A 31  ? 0.9525 0.2462 0.4090 -0.0794 0.0738  0.0925  498 ARG A CD  
219  N NE  . ARG A 31  ? 1.0338 0.2811 0.4823 -0.0614 0.0875  0.0797  498 ARG A NE  
220  C CZ  . ARG A 31  ? 1.1000 0.2900 0.5216 -0.0328 0.1418  0.0762  498 ARG A CZ  
221  N NH1 . ARG A 31  ? 1.1319 0.2801 0.4946 0.0031  0.1149  0.1037  498 ARG A NH1 
222  N NH2 . ARG A 31  ? 1.1289 0.3416 0.5710 -0.0576 0.2266  0.0764  498 ARG A NH2 
223  N N   . ASN A 32  ? 0.6070 0.3530 0.2760 -0.0389 -0.0310 0.0492  499 ASN A N   
224  C CA  . ASN A 32  ? 0.5634 0.4391 0.3410 -0.0455 -0.0309 0.0681  499 ASN A CA  
225  C C   . ASN A 32  ? 0.5093 0.3984 0.2993 -0.0409 -0.0714 0.0472  499 ASN A C   
226  O O   . ASN A 32  ? 0.4504 0.3665 0.3072 -0.0038 -0.0318 -0.0033 499 ASN A O   
227  C CB  . ASN A 32  ? 0.5815 0.5163 0.3575 -0.0512 -0.0053 0.1042  499 ASN A CB  
228  C CG  . ASN A 32  ? 0.5972 0.5860 0.4267 -0.0631 0.0338  0.0683  499 ASN A CG  
229  O OD1 . ASN A 32  ? 0.5658 0.6159 0.4354 -0.0012 0.0444  0.1576  499 ASN A OD1 
230  N ND2 . ASN A 32  ? 0.6328 0.5504 0.4426 -0.1379 0.0204  0.0133  499 ASN A ND2 
231  N N   . LYS A 33  ? 0.5130 0.4081 0.3163 -0.0590 -0.0619 0.0480  500 LYS A N   
232  C CA  . LYS A 33  ? 0.4799 0.3822 0.2794 -0.0756 -0.0712 0.0684  500 LYS A CA  
233  C C   . LYS A 33  ? 0.4778 0.3366 0.3160 -0.0173 -0.0674 0.0467  500 LYS A C   
234  O O   . LYS A 33  ? 0.4474 0.2746 0.3228 -0.0302 -0.0295 0.0496  500 LYS A O   
235  C CB  . LYS A 33  ? 0.5286 0.4136 0.2507 -0.1126 -0.0559 0.0693  500 LYS A CB  
236  C CG  . LYS A 33  ? 0.5438 0.4107 0.1854 -0.1328 -0.0368 0.0641  500 LYS A CG  
237  C CD  . LYS A 33  ? 0.5577 0.4649 0.1733 -0.1029 -0.0553 0.0864  500 LYS A CD  
238  C CE  . LYS A 33  ? 0.5252 0.5201 0.0860 -0.1190 0.0656  0.0383  500 LYS A CE  
239  N NZ  . LYS A 33  ? 0.5351 0.5933 0.2865 -0.1004 0.0528  0.1239  500 LYS A NZ  
240  N N   . ILE A 34  ? 0.4589 0.2962 0.2629 0.0367  -0.0519 0.0014  501 ILE A N   
241  C CA  . ILE A 34  ? 0.4542 0.2720 0.2495 0.0712  -0.0592 -0.0411 501 ILE A CA  
242  C C   . ILE A 34  ? 0.4148 0.2874 0.2488 0.0612  -0.0423 0.0032  501 ILE A C   
243  O O   . ILE A 34  ? 0.4083 0.2839 0.3577 0.0684  0.0449  0.0730  501 ILE A O   
244  C CB  . ILE A 34  ? 0.4884 0.2315 0.3026 0.0568  -0.0429 -0.0715 501 ILE A CB  
245  C CG1 . ILE A 34  ? 0.5065 0.2243 0.2932 0.0453  0.0028  -0.1315 501 ILE A CG1 
246  C CG2 . ILE A 34  ? 0.5051 0.2371 0.3182 0.0564  -0.0267 0.0018  501 ILE A CG2 
247  C CD1 . ILE A 34  ? 0.5514 0.2035 0.3806 0.0668  -0.0132 -0.0965 501 ILE A CD1 
248  N N   . LEU A 35  ? 0.4334 0.2904 0.1978 0.0712  0.0116  0.0231  502 LEU A N   
249  C CA  . LEU A 35  ? 0.4223 0.2866 0.1672 0.0044  0.0302  0.0161  502 LEU A CA  
250  C C   . LEU A 35  ? 0.3608 0.3049 0.2648 0.0226  -0.0137 0.0166  502 LEU A C   
251  O O   . LEU A 35  ? 0.2833 0.2997 0.3145 0.0034  -0.0390 0.0098  502 LEU A O   
252  C CB  . LEU A 35  ? 0.4573 0.3383 0.2018 -0.0010 -0.0188 0.0266  502 LEU A CB  
253  C CG  . LEU A 35  ? 0.4402 0.4037 0.3113 -0.0268 -0.0151 0.0388  502 LEU A CG  
254  C CD1 . LEU A 35  ? 0.4886 0.4292 0.3932 -0.0615 0.0168  0.0644  502 LEU A CD1 
255  C CD2 . LEU A 35  ? 0.4596 0.4505 0.3457 -0.0350 -0.0794 -0.0005 502 LEU A CD2 
256  N N   . ASP A 36  ? 0.3251 0.3114 0.2894 0.0250  0.0003  0.0852  503 ASP A N   
257  C CA  . ASP A 36  ? 0.3212 0.3160 0.3333 0.0335  -0.0068 0.1063  503 ASP A CA  
258  C C   . ASP A 36  ? 0.2891 0.2784 0.3378 0.0246  -0.0258 0.0311  503 ASP A C   
259  O O   . ASP A 36  ? 0.3077 0.2101 0.3596 0.0397  -0.0329 0.0002  503 ASP A O   
260  C CB  . ASP A 36  ? 0.3531 0.3923 0.3340 0.0061  0.0070  0.1054  503 ASP A CB  
261  C CG  . ASP A 36  ? 0.4071 0.4219 0.3593 -0.0083 0.0165  0.0159  503 ASP A CG  
262  O OD1 . ASP A 36  ? 0.4737 0.4127 0.3883 -0.0365 0.0098  0.0213  503 ASP A OD1 
263  O OD2 . ASP A 36  ? 0.3640 0.4588 0.3476 -0.0548 0.0302  -0.0108 503 ASP A OD2 
264  N N   . TYR A 37  ? 0.2494 0.2578 0.2770 0.0262  -0.0268 -0.0179 504 TYR A N   
265  C CA  . TYR A 37  ? 0.2777 0.2916 0.1681 0.0029  0.0531  -0.0362 504 TYR A CA  
266  C C   . TYR A 37  ? 0.2624 0.3243 0.2494 0.0631  0.0235  0.0277  504 TYR A C   
267  O O   . TYR A 37  ? 0.2619 0.3217 0.2661 0.0443  -0.0092 0.0658  504 TYR A O   
268  C CB  . TYR A 37  ? 0.3171 0.2341 0.1866 0.0349  -0.0281 -0.0327 504 TYR A CB  
269  C CG  . TYR A 37  ? 0.3685 0.2529 0.1979 0.0188  -0.0312 -0.0004 504 TYR A CG  
270  C CD1 . TYR A 37  ? 0.4301 0.2639 0.2021 -0.0193 -0.0400 -0.0140 504 TYR A CD1 
271  C CD2 . TYR A 37  ? 0.3505 0.2750 0.2578 -0.0178 -0.0238 -0.0215 504 TYR A CD2 
272  C CE1 . TYR A 37  ? 0.4574 0.2497 0.2950 -0.0081 -0.0750 0.0148  504 TYR A CE1 
273  C CE2 . TYR A 37  ? 0.4202 0.2858 0.2610 0.0190  -0.0061 0.0324  504 TYR A CE2 
274  C CZ  . TYR A 37  ? 0.4774 0.3003 0.3160 0.0249  0.0148  -0.0329 504 TYR A CZ  
275  O OH  . TYR A 37  ? 0.5722 0.3747 0.3055 0.0422  -0.0127 -0.0544 504 TYR A OH  
276  N N   . TYR A 38  ? 0.3087 0.3413 0.2482 0.0674  0.0172  0.0273  505 TYR A N   
277  C CA  . TYR A 38  ? 0.3107 0.3222 0.2990 0.0706  -0.0553 0.0141  505 TYR A CA  
278  C C   . TYR A 38  ? 0.3175 0.3115 0.2720 0.0477  -0.0182 -0.0286 505 TYR A C   
279  O O   . TYR A 38  ? 0.3304 0.3193 0.3158 0.0533  -0.0113 -0.0758 505 TYR A O   
280  C CB  . TYR A 38  ? 0.3355 0.3034 0.3112 0.0910  -0.0333 0.0459  505 TYR A CB  
281  C CG  . TYR A 38  ? 0.3471 0.3555 0.3567 0.1078  0.0228  0.0182  505 TYR A CG  
282  C CD1 . TYR A 38  ? 0.3548 0.3504 0.3695 0.1350  0.0160  0.0220  505 TYR A CD1 
283  C CD2 . TYR A 38  ? 0.3790 0.3832 0.4358 0.1376  -0.0184 -0.0192 505 TYR A CD2 
284  C CE1 . TYR A 38  ? 0.3499 0.3557 0.3390 0.1418  -0.0284 0.1055  505 TYR A CE1 
285  C CE2 . TYR A 38  ? 0.3999 0.3995 0.4151 0.1167  -0.0482 0.0018  505 TYR A CE2 
286  C CZ  . TYR A 38  ? 0.3846 0.3820 0.3516 0.1308  -0.0792 0.0417  505 TYR A CZ  
287  O OH  . TYR A 38  ? 0.3538 0.4028 0.4296 0.1165  -0.1466 -0.0103 505 TYR A OH  
288  N N   . GLU A 39  ? 0.3226 0.3109 0.2698 0.0630  -0.0071 -0.0577 506 GLU A N   
289  C CA  . GLU A 39  ? 0.2965 0.2791 0.2194 0.0600  0.0289  -0.1017 506 GLU A CA  
290  C C   . GLU A 39  ? 0.3109 0.3011 0.2987 0.0197  -0.0194 -0.0648 506 GLU A C   
291  O O   . GLU A 39  ? 0.3738 0.3216 0.3829 0.0544  -0.0570 -0.0822 506 GLU A O   
292  C CB  . GLU A 39  ? 0.3024 0.3162 0.2700 0.0722  0.0912  -0.1531 506 GLU A CB  
293  C CG  . GLU A 39  ? 0.3831 0.3875 0.4229 0.0437  0.0882  -0.0885 506 GLU A CG  
294  C CD  . GLU A 39  ? 0.4950 0.4422 0.5437 0.0350  0.0527  -0.0734 506 GLU A CD  
295  O OE1 . GLU A 39  ? 0.5510 0.4540 0.6297 0.0439  0.0331  -0.0359 506 GLU A OE1 
296  O OE2 . GLU A 39  ? 0.5340 0.4762 0.5682 -0.0042 0.0780  -0.0607 506 GLU A OE2 
297  N N   . TYR A 40  ? 0.3462 0.2995 0.2963 0.0240  -0.0246 -0.0391 507 TYR A N   
298  C CA  . TYR A 40  ? 0.3147 0.3030 0.3208 0.0287  -0.0015 0.0223  507 TYR A CA  
299  C C   . TYR A 40  ? 0.3226 0.3132 0.3358 0.0072  -0.0464 -0.0218 507 TYR A C   
300  O O   . TYR A 40  ? 0.3164 0.2592 0.3984 0.0316  -0.0666 -0.0267 507 TYR A O   
301  C CB  . TYR A 40  ? 0.2840 0.2727 0.3128 0.0584  -0.0183 0.0191  507 TYR A CB  
302  C CG  . TYR A 40  ? 0.2971 0.2743 0.3459 0.0430  -0.0387 0.0250  507 TYR A CG  
303  C CD1 . TYR A 40  ? 0.2728 0.2651 0.3992 0.0451  -0.0394 0.0357  507 TYR A CD1 
304  C CD2 . TYR A 40  ? 0.3534 0.2806 0.3537 0.0549  -0.0250 -0.0259 507 TYR A CD2 
305  C CE1 . TYR A 40  ? 0.2853 0.2990 0.3902 -0.0225 -0.0445 0.0565  507 TYR A CE1 
306  C CE2 . TYR A 40  ? 0.3692 0.2545 0.3830 -0.0074 -0.0180 -0.0128 507 TYR A CE2 
307  C CZ  . TYR A 40  ? 0.3566 0.3018 0.3844 -0.0301 -0.0524 0.0462  507 TYR A CZ  
308  O OH  . TYR A 40  ? 0.4001 0.3444 0.3782 -0.0400 0.0064  0.0617  507 TYR A OH  
309  N N   . ARG A 41  ? 0.2730 0.3175 0.2911 0.0022  -0.0021 0.0151  508 ARG A N   
310  C CA  . ARG A 41  ? 0.2651 0.3864 0.2840 -0.0025 -0.0020 0.0117  508 ARG A CA  
311  C C   . ARG A 41  ? 0.3001 0.4220 0.3367 -0.0373 -0.0092 -0.0065 508 ARG A C   
312  O O   . ARG A 41  ? 0.3660 0.4176 0.3755 -0.0614 -0.0274 0.0071  508 ARG A O   
313  C CB  . ARG A 41  ? 0.2074 0.3400 0.2551 0.0563  0.0377  0.0052  508 ARG A CB  
314  C CG  . ARG A 41  ? 0.2022 0.3804 0.3353 0.1030  0.0265  0.0121  508 ARG A CG  
315  C CD  . ARG A 41  ? 0.2730 0.4065 0.3108 0.0828  0.0332  0.0228  508 ARG A CD  
316  N NE  . ARG A 41  ? 0.2839 0.4216 0.3118 0.0558  0.0464  0.0587  508 ARG A NE  
317  C CZ  . ARG A 41  ? 0.3670 0.4825 0.4154 -0.0135 0.0478  0.1079  508 ARG A CZ  
318  N NH1 . ARG A 41  ? 0.4547 0.4469 0.4785 0.0257  0.0281  0.1572  508 ARG A NH1 
319  N NH2 . ARG A 41  ? 0.3692 0.5373 0.3987 -0.0597 0.0698  0.1296  508 ARG A NH2 
320  N N   . TYR A 42  ? 0.3069 0.4470 0.1856 -0.0187 0.0145  -0.0092 509 TYR A N   
321  C CA  . TYR A 42  ? 0.4117 0.5608 0.3029 -0.0405 -0.0506 -0.0270 509 TYR A CA  
322  C C   . TYR A 42  ? 0.4937 0.5903 0.3999 -0.1039 -0.0836 -0.0339 509 TYR A C   
323  O O   . TYR A 42  ? 0.5178 0.6258 0.4914 -0.1859 -0.1001 0.0331  509 TYR A O   
324  C CB  . TYR A 42  ? 0.4114 0.6241 0.2532 -0.0030 -0.0713 -0.0149 509 TYR A CB  
325  C CG  . TYR A 42  ? 0.3778 0.6763 0.2418 0.0543  0.0051  0.0477  509 TYR A CG  
326  C CD1 . TYR A 42  ? 0.3734 0.6982 0.2917 0.1194  0.0139  0.1073  509 TYR A CD1 
327  C CD2 . TYR A 42  ? 0.3799 0.6663 0.2355 0.1059  -0.0056 0.0479  509 TYR A CD2 
328  C CE1 . TYR A 42  ? 0.3823 0.6989 0.2974 0.1519  0.0093  0.1374  509 TYR A CE1 
329  C CE2 . TYR A 42  ? 0.3969 0.6853 0.2673 0.1350  0.0413  0.1204  509 TYR A CE2 
330  C CZ  . TYR A 42  ? 0.4171 0.7188 0.2970 0.1802  0.0464  0.1394  509 TYR A CZ  
331  O OH  . TYR A 42  ? 0.4462 0.7637 0.3883 0.2284  0.0938  0.2072  509 TYR A OH  
332  N N   . ARG A 43  ? 0.5185 0.5663 0.3668 -0.0688 -0.0574 -0.0583 510 ARG A N   
333  C CA  . ARG A 43  ? 0.5871 0.5718 0.4382 -0.0873 -0.0987 -0.0584 510 ARG A CA  
334  C C   . ARG A 43  ? 0.5857 0.5439 0.3823 -0.1229 -0.0317 -0.1095 510 ARG A C   
335  O O   . ARG A 43  ? 0.6006 0.4850 0.3604 -0.1427 -0.0079 -0.1526 510 ARG A O   
336  C CB  . ARG A 43  ? 0.6630 0.6285 0.5600 -0.0820 -0.1300 -0.0816 510 ARG A CB  
337  C CG  . ARG A 43  ? 0.7104 0.6680 0.6494 -0.0798 -0.1643 -0.1269 510 ARG A CG  
338  C CD  . ARG A 43  ? 0.7733 0.7193 0.7402 -0.0588 -0.1309 -0.1621 510 ARG A CD  
339  N NE  . ARG A 43  ? 0.8419 0.7635 0.8547 -0.0689 -0.0598 -0.1489 510 ARG A NE  
340  C CZ  . ARG A 43  ? 0.8946 0.8167 0.9408 -0.1131 -0.0234 -0.1393 510 ARG A CZ  
341  N NH1 . ARG A 43  ? 0.9228 0.8124 0.9936 -0.1205 0.0112  -0.1417 510 ARG A NH1 
342  N NH2 . ARG A 43  ? 0.9130 0.8412 0.9284 -0.1678 -0.0290 -0.1556 510 ARG A NH2 
343  N N   . GLY A 44  ? 0.5373 0.5555 0.3185 -0.1070 -0.0368 -0.1340 511 GLY A N   
344  C CA  . GLY A 44  ? 0.5344 0.6432 0.2804 -0.1188 -0.0610 -0.1341 511 GLY A CA  
345  C C   . GLY A 44  ? 0.5614 0.7451 0.2729 -0.1081 -0.0418 -0.1085 511 GLY A C   
346  O O   . GLY A 44  ? 0.5840 0.8271 0.2540 -0.1014 -0.0094 -0.0932 511 GLY A O   
347  N N   . LYS A 45  ? 0.5481 0.7527 0.3185 -0.1184 -0.0049 -0.1029 512 LYS A N   
348  C CA  . LYS A 45  ? 0.5514 0.8130 0.4182 -0.0832 -0.0465 -0.1076 512 LYS A CA  
349  C C   . LYS A 45  ? 0.5487 0.8538 0.5227 -0.0537 -0.1122 -0.0577 512 LYS A C   
350  O O   . LYS A 45  ? 0.5169 0.8644 0.5087 -0.0537 -0.1139 -0.0333 512 LYS A O   
351  C CB  . LYS A 45  ? 0.5627 0.8156 0.4511 -0.1062 0.0265  -0.1630 512 LYS A CB  
352  C CG  . LYS A 45  ? 0.6538 0.8534 0.5513 -0.1044 0.0916  -0.1608 512 LYS A CG  
353  C CD  . LYS A 45  ? 0.7291 0.8942 0.6149 -0.0969 0.1403  -0.1675 512 LYS A CD  
354  C CE  . LYS A 45  ? 0.7801 0.9185 0.6742 -0.0971 0.1823  -0.1706 512 LYS A CE  
355  N NZ  . LYS A 45  ? 0.7947 0.9365 0.7021 -0.1121 0.2074  -0.1409 512 LYS A NZ  
356  N N   . MET A 46  ? 0.5637 0.8909 0.5883 -0.0142 -0.2016 -0.0155 513 MET A N   
357  C CA  . MET A 46  ? 0.6262 0.9296 0.6304 0.0173  -0.1722 0.0485  513 MET A CA  
358  C C   . MET A 46  ? 0.6754 0.9952 0.7542 0.0191  -0.1301 0.0757  513 MET A C   
359  O O   . MET A 46  ? 0.6375 1.0222 0.7875 -0.0247 -0.1522 0.0867  513 MET A O   
360  C CB  . MET A 46  ? 0.6734 0.9067 0.6264 0.0685  -0.1361 0.0826  513 MET A CB  
361  C CG  . MET A 46  ? 0.6998 0.8797 0.5552 0.0997  -0.1382 0.0835  513 MET A CG  
362  S SD  . MET A 46  ? 0.7651 0.8534 0.5557 0.1457  -0.0649 0.1149  513 MET A SD  
363  C CE  . MET A 46  ? 0.7978 0.8587 0.6076 0.1624  -0.0741 0.1314  513 MET A CE  
364  N N   . PHE A 47  ? 0.7462 1.0224 0.8121 0.0419  -0.0900 0.0514  514 PHE A N   
365  C CA  . PHE A 47  ? 0.8523 1.0609 0.8375 0.0223  -0.0352 0.0216  514 PHE A CA  
366  C C   . PHE A 47  ? 0.9616 1.1404 0.9796 0.0474  -0.0189 0.0485  514 PHE A C   
367  O O   . PHE A 47  ? 0.9887 1.1576 1.0219 0.0530  -0.0161 0.0688  514 PHE A O   
368  C CB  . PHE A 47  ? 0.8302 1.0345 0.7743 -0.0345 0.0001  -0.0438 514 PHE A CB  
369  C CG  . PHE A 47  ? 0.8144 1.0293 0.7832 -0.0833 -0.0016 -0.0777 514 PHE A CG  
370  C CD1 . PHE A 47  ? 0.8363 1.0368 0.8107 -0.1148 0.0237  -0.0981 514 PHE A CD1 
371  C CD2 . PHE A 47  ? 0.7974 1.0247 0.6984 -0.1066 0.0012  -0.1071 514 PHE A CD2 
372  C CE1 . PHE A 47  ? 0.8305 1.0406 0.7701 -0.1296 0.0341  -0.1029 514 PHE A CE1 
373  C CE2 . PHE A 47  ? 0.8041 1.0283 0.7179 -0.1289 -0.0068 -0.0980 514 PHE A CE2 
374  C CZ  . PHE A 47  ? 0.8229 1.0324 0.7241 -0.1220 0.0185  -0.1014 514 PHE A CZ  
375  N N   . ASP A 48  ? 1.0411 1.1958 1.0856 0.0585  -0.0034 0.0473  515 ASP A N   
376  C CA  . ASP A 48  ? 1.0991 1.2416 1.1603 0.0717  -0.0076 0.0408  515 ASP A CA  
377  C C   . ASP A 48  ? 1.0805 1.2229 1.1310 0.0542  -0.0083 0.0268  515 ASP A C   
378  O O   . ASP A 48  ? 1.0830 1.2260 1.1401 0.0444  -0.0174 0.0143  515 ASP A O   
379  C CB  . ASP A 48  ? 1.1500 1.2861 1.2165 0.1029  -0.0206 0.0491  515 ASP A CB  
380  C CG  . ASP A 48  ? 1.1918 1.3227 1.2414 0.1160  -0.0185 0.0586  515 ASP A CG  
381  O OD1 . ASP A 48  ? 1.2054 1.3235 1.2624 0.1222  -0.0131 0.0554  515 ASP A OD1 
382  O OD2 . ASP A 48  ? 1.2058 1.3493 1.2421 0.1153  -0.0236 0.0706  515 ASP A OD2 
383  N N   . GLU A 49  ? 1.0371 1.1861 1.0831 0.0392  -0.0155 0.0122  516 GLU A N   
384  C CA  . GLU A 49  ? 0.9778 1.1329 1.0181 0.0343  -0.0543 0.0041  516 GLU A CA  
385  C C   . GLU A 49  ? 0.9041 1.0772 0.8948 0.0197  -0.0423 -0.0044 516 GLU A C   
386  O O   . GLU A 49  ? 0.8800 1.0610 0.8336 -0.0166 -0.0847 -0.0296 516 GLU A O   
387  C CB  . GLU A 49  ? 0.9778 1.1319 1.0452 0.0421  -0.0931 0.0105  516 GLU A CB  
388  C CG  . GLU A 49  ? 0.9687 1.1314 1.0626 0.0315  -0.0999 0.0125  516 GLU A CG  
389  C CD  . GLU A 49  ? 0.9609 1.1267 1.1125 0.0377  -0.0983 0.0277  516 GLU A CD  
390  O OE1 . GLU A 49  ? 0.9744 1.1557 1.1649 0.0432  -0.1130 0.0335  516 GLU A OE1 
391  O OE2 . GLU A 49  ? 0.9381 1.0862 1.1133 0.0384  -0.0837 0.0452  516 GLU A OE2 
392  N N   . ARG A 50  ? 0.8404 1.0281 0.8504 0.0164  -0.0146 0.0139  517 ARG A N   
393  C CA  . ARG A 50  ? 0.7748 0.9730 0.7800 0.0134  0.0046  0.0108  517 ARG A CA  
394  C C   . ARG A 50  ? 0.6855 0.9191 0.7401 -0.0019 -0.0133 0.0282  517 ARG A C   
395  O O   . ARG A 50  ? 0.6881 0.9071 0.7734 -0.0363 -0.1005 0.0253  517 ARG A O   
396  C CB  . ARG A 50  ? 0.7780 0.9727 0.7639 0.0138  0.0027  -0.0040 517 ARG A CB  
397  N N   . HIS A 51  ? 0.6365 0.8887 0.7194 -0.0014 0.0206  0.0518  518 HIS A N   
398  C CA  . HIS A 51  ? 0.6445 0.8842 0.6995 0.0147  0.0131  0.0547  518 HIS A CA  
399  C C   . HIS A 51  ? 0.6288 0.8953 0.6558 0.0617  0.0199  0.0434  518 HIS A C   
400  O O   . HIS A 51  ? 0.6626 0.9055 0.6923 0.0648  -0.0292 0.0580  518 HIS A O   
401  C CB  . HIS A 51  ? 0.6679 0.8912 0.6968 0.0192  0.0228  0.0718  518 HIS A CB  
402  N N   . ILE A 52  ? 0.5782 0.8628 0.5691 0.0888  0.0817  -0.0002 519 ILE A N   
403  C CA  . ILE A 52  ? 0.5299 0.8508 0.5246 0.0743  0.0986  -0.0142 519 ILE A CA  
404  C C   . ILE A 52  ? 0.4781 0.8063 0.4760 0.0474  0.0369  -0.0281 519 ILE A C   
405  O O   . ILE A 52  ? 0.4345 0.7413 0.4358 0.0456  -0.0058 -0.0079 519 ILE A O   
406  C CB  . ILE A 52  ? 0.5371 0.8743 0.5220 0.1033  0.0426  -0.0226 519 ILE A CB  
407  C CG1 . ILE A 52  ? 0.5581 0.9073 0.5136 0.1124  0.0105  -0.0206 519 ILE A CG1 
408  C CG2 . ILE A 52  ? 0.4942 0.8669 0.5054 0.1334  -0.0171 0.0403  519 ILE A CG2 
409  C CD1 . ILE A 52  ? 0.5507 0.9391 0.5037 0.0735  -0.0190 -0.0064 519 ILE A CD1 
410  N N   . PHE A 53  ? 0.4356 0.8262 0.4772 -0.0078 0.0440  -0.0796 520 PHE A N   
411  C CA  . PHE A 53  ? 0.4350 0.8158 0.5478 -0.0060 0.0122  -0.0709 520 PHE A CA  
412  C C   . PHE A 53  ? 0.3591 0.7773 0.5083 0.0008  0.0389  -0.0999 520 PHE A C   
413  O O   . PHE A 53  ? 0.3480 0.7732 0.5537 -0.0196 -0.0459 -0.0383 520 PHE A O   
414  C CB  . PHE A 53  ? 0.4712 0.8242 0.5937 0.0138  0.0235  -0.0480 520 PHE A CB  
415  C CG  . PHE A 53  ? 0.5397 0.8174 0.6514 -0.0075 0.0154  -0.0615 520 PHE A CG  
416  C CD1 . PHE A 53  ? 0.5713 0.8135 0.7010 -0.0124 -0.0185 -0.0711 520 PHE A CD1 
417  C CD2 . PHE A 53  ? 0.5550 0.7983 0.6752 -0.0289 0.0297  -0.0762 520 PHE A CD2 
418  C CE1 . PHE A 53  ? 0.5797 0.7828 0.7150 -0.0253 -0.0189 -0.0761 520 PHE A CE1 
419  C CE2 . PHE A 53  ? 0.5365 0.7591 0.6735 -0.0355 0.0054  -0.1055 520 PHE A CE2 
420  C CZ  . PHE A 53  ? 0.5616 0.7648 0.7339 -0.0425 -0.0406 -0.0681 520 PHE A CZ  
421  N N   . ARG A 54  ? 0.3593 0.7692 0.5432 0.0065  0.0218  -0.0744 521 ARG A N   
422  C CA  . ARG A 54  ? 0.4785 0.7559 0.5765 -0.0046 -0.0131 -0.1038 521 ARG A CA  
423  C C   . ARG A 54  ? 0.4899 0.7019 0.4822 -0.0172 -0.0092 -0.0929 521 ARG A C   
424  O O   . ARG A 54  ? 0.5472 0.6905 0.3760 -0.0236 0.0137  -0.1674 521 ARG A O   
425  C CB  . ARG A 54  ? 0.5898 0.8482 0.6571 -0.0010 -0.0229 -0.1059 521 ARG A CB  
426  C CG  . ARG A 54  ? 0.6928 0.9214 0.7261 -0.0146 -0.0627 -0.1022 521 ARG A CG  
427  C CD  . ARG A 54  ? 0.7817 0.9974 0.8301 -0.0056 -0.0576 -0.0793 521 ARG A CD  
428  N NE  . ARG A 54  ? 0.8409 1.0447 0.9202 0.0142  -0.0387 -0.0714 521 ARG A NE  
429  C CZ  . ARG A 54  ? 0.8674 1.0720 0.9627 0.0463  -0.0400 -0.0783 521 ARG A CZ  
430  N NH1 . ARG A 54  ? 0.8855 1.0910 0.9888 0.0678  -0.0453 -0.0835 521 ARG A NH1 
431  N NH2 . ARG A 54  ? 0.8732 1.0746 0.9604 0.0571  -0.0293 -0.0789 521 ARG A NH2 
432  N N   . GLU A 55  ? 0.4955 0.6765 0.5068 -0.0667 -0.0449 -0.0908 522 GLU A N   
433  C CA  . GLU A 55  ? 0.5052 0.6980 0.5845 -0.1285 -0.0405 -0.0136 522 GLU A CA  
434  C C   . GLU A 55  ? 0.4435 0.6289 0.6317 -0.2096 -0.0448 -0.0164 522 GLU A C   
435  O O   . GLU A 55  ? 0.4364 0.6046 0.6698 -0.2863 -0.0141 -0.1151 522 GLU A O   
436  C CB  . GLU A 55  ? 0.5632 0.8011 0.5622 -0.1057 0.0030  -0.0333 522 GLU A CB  
437  C CG  . GLU A 55  ? 0.6128 0.9099 0.6645 -0.0700 0.0103  -0.0259 522 GLU A CG  
438  C CD  . GLU A 55  ? 0.6562 0.9867 0.7911 -0.0166 -0.0629 -0.0373 522 GLU A CD  
439  O OE1 . GLU A 55  ? 0.5930 0.9934 0.7885 -0.0050 -0.1243 -0.0424 522 GLU A OE1 
440  O OE2 . GLU A 55  ? 0.7250 1.0327 0.8618 0.0197  -0.0612 -0.0009 522 GLU A OE2 
441  N N   . VAL A 56  ? 0.4023 0.5288 0.5517 -0.2190 -0.0702 0.0932  523 VAL A N   
442  C CA  . VAL A 56  ? 0.3621 0.4963 0.4121 -0.1303 -0.0226 0.1302  523 VAL A CA  
443  C C   . VAL A 56  ? 0.2916 0.4128 0.3765 -0.1001 0.0066  0.0739  523 VAL A C   
444  O O   . VAL A 56  ? 0.3222 0.3805 0.3793 -0.0747 0.0517  0.0840  523 VAL A O   
445  C CB  . VAL A 56  ? 0.3818 0.5121 0.3647 -0.1010 0.0272  0.1303  523 VAL A CB  
446  C CG1 . VAL A 56  ? 0.4161 0.5440 0.4254 -0.1141 0.0050  0.0866  523 VAL A CG1 
447  C CG2 . VAL A 56  ? 0.3071 0.4924 0.3696 -0.1104 0.0427  0.0665  523 VAL A CG2 
448  N N   . SER A 57  ? 0.2759 0.3378 0.3283 -0.0515 0.0019  0.0892  524 SER A N   
449  C CA  . SER A 57  ? 0.2704 0.3665 0.3412 -0.0332 0.0097  0.0592  524 SER A CA  
450  C C   . SER A 57  ? 0.2854 0.3782 0.3195 -0.0574 0.0160  0.0704  524 SER A C   
451  O O   . SER A 57  ? 0.3079 0.3709 0.2633 -0.0355 0.0301  0.0459  524 SER A O   
452  C CB  . SER A 57  ? 0.2679 0.3234 0.3207 -0.0128 -0.0375 0.0064  524 SER A CB  
453  O OG  . SER A 57  ? 0.2312 0.3460 0.3070 -0.0539 -0.0436 -0.0196 524 SER A OG  
454  N N   . GLU A 58  ? 0.2455 0.3525 0.2805 -0.0293 0.0351  0.0969  525 GLU A N   
455  C CA  . GLU A 58  ? 0.2226 0.3873 0.2598 0.0014  0.0235  0.0963  525 GLU A CA  
456  C C   . GLU A 58  ? 0.1990 0.4274 0.2518 0.0171  -0.0184 0.0466  525 GLU A C   
457  O O   . GLU A 58  ? 0.1974 0.4856 0.2678 -0.0089 -0.0445 0.0386  525 GLU A O   
458  C CB  . GLU A 58  ? 0.2355 0.4062 0.2646 0.0232  -0.0397 0.0495  525 GLU A CB  
459  C CG  . GLU A 58  ? 0.2766 0.4217 0.2654 0.0211  -0.0216 0.0236  525 GLU A CG  
460  C CD  . GLU A 58  ? 0.2304 0.4092 0.2643 0.0778  -0.0237 0.0375  525 GLU A CD  
461  O OE1 . GLU A 58  ? 0.2216 0.4060 0.2647 0.1216  -0.0817 0.0703  525 GLU A OE1 
462  O OE2 . GLU A 58  ? 0.1681 0.4203 0.2739 0.0838  -0.0161 0.0022  525 GLU A OE2 
463  N N   . SER A 59  ? 0.1668 0.4192 0.2468 0.0050  0.0073  -0.0175 526 SER A N   
464  C CA  . SER A 59  ? 0.1738 0.4192 0.3450 -0.0314 -0.0191 0.0130  526 SER A CA  
465  C C   . SER A 59  ? 0.1915 0.4624 0.3412 -0.0244 -0.0210 0.0289  526 SER A C   
466  O O   . SER A 59  ? 0.1553 0.4989 0.3209 -0.0141 -0.0011 0.0271  526 SER A O   
467  C CB  . SER A 59  ? 0.2222 0.4242 0.4626 -0.0564 0.0633  0.0143  526 SER A CB  
468  O OG  . SER A 59  ? 0.2627 0.4036 0.4830 -0.0423 0.0383  0.0285  526 SER A OG  
469  N N   . ILE A 60  ? 0.1769 0.4628 0.2812 -0.0606 -0.0051 0.0020  527 ILE A N   
470  C CA  . ILE A 60  ? 0.2054 0.4805 0.2668 -0.0436 0.0635  -0.0076 527 ILE A CA  
471  C C   . ILE A 60  ? 0.2122 0.5253 0.3013 -0.0089 0.0279  -0.0355 527 ILE A C   
472  O O   . ILE A 60  ? 0.2387 0.5834 0.2735 0.0531  0.0075  0.0231  527 ILE A O   
473  C CB  . ILE A 60  ? 0.2325 0.4391 0.2548 -0.0648 0.0567  0.0232  527 ILE A CB  
474  C CG1 . ILE A 60  ? 0.3096 0.3798 0.2507 -0.0364 -0.0376 -0.0246 527 ILE A CG1 
475  C CG2 . ILE A 60  ? 0.2626 0.4437 0.2625 -0.0396 0.0367  0.0329  527 ILE A CG2 
476  C CD1 . ILE A 60  ? 0.3236 0.3953 0.2240 -0.0052 -0.0655 -0.0375 527 ILE A CD1 
477  N N   . ARG A 61  ? 0.2121 0.5313 0.2439 -0.0249 -0.0001 -0.0717 528 ARG A N   
478  C CA  . ARG A 61  ? 0.2201 0.5244 0.2976 -0.0401 -0.0213 -0.0336 528 ARG A CA  
479  C C   . ARG A 61  ? 0.2330 0.5687 0.3467 -0.0255 0.0368  0.0358  528 ARG A C   
480  O O   . ARG A 61  ? 0.1773 0.6017 0.3551 -0.0288 0.0564  0.0392  528 ARG A O   
481  C CB  . ARG A 61  ? 0.3093 0.5125 0.3402 -0.0423 -0.0123 -0.0611 528 ARG A CB  
482  C CG  . ARG A 61  ? 0.3494 0.4701 0.4158 -0.0523 0.0227  -0.0745 528 ARG A CG  
483  C CD  . ARG A 61  ? 0.3414 0.4955 0.5148 -0.0518 0.0397  -0.0792 528 ARG A CD  
484  N NE  . ARG A 61  ? 0.3331 0.5016 0.5782 -0.0840 0.0351  -0.0262 528 ARG A NE  
485  C CZ  . ARG A 61  ? 0.3328 0.4876 0.6288 -0.0427 0.0212  -0.0331 528 ARG A CZ  
486  N NH1 . ARG A 61  ? 0.3284 0.4979 0.6873 -0.0419 -0.0337 -0.0835 528 ARG A NH1 
487  N NH2 . ARG A 61  ? 0.3129 0.4627 0.6198 -0.0698 0.1105  -0.0190 528 ARG A NH2 
488  N N   . GLN A 62  ? 0.2525 0.5535 0.3102 -0.0030 0.0522  0.0285  529 GLN A N   
489  C CA  . GLN A 62  ? 0.2514 0.5529 0.3278 0.0281  0.0468  0.0183  529 GLN A CA  
490  C C   . GLN A 62  ? 0.2216 0.5592 0.3956 0.0341  -0.0083 -0.0254 529 GLN A C   
491  O O   . GLN A 62  ? 0.2030 0.6016 0.4827 0.0401  -0.0216 -0.0587 529 GLN A O   
492  C CB  . GLN A 62  ? 0.3044 0.5452 0.2869 0.0388  0.0578  0.0191  529 GLN A CB  
493  C CG  . GLN A 62  ? 0.3465 0.5376 0.3017 0.0242  0.0464  -0.0101 529 GLN A CG  
494  C CD  . GLN A 62  ? 0.3960 0.5811 0.3144 0.0404  0.0228  0.0390  529 GLN A CD  
495  O OE1 . GLN A 62  ? 0.4308 0.5838 0.3612 -0.0059 0.0337  0.1012  529 GLN A OE1 
496  N NE2 . GLN A 62  ? 0.3616 0.6207 0.2950 0.0775  -0.0148 0.0529  529 GLN A NE2 
497  N N   . ASP A 63  ? 0.2093 0.5631 0.3554 0.0187  -0.0050 -0.0699 530 ASP A N   
498  C CA  . ASP A 63  ? 0.2233 0.6531 0.3802 0.0066  0.0014  -0.1609 530 ASP A CA  
499  C C   . ASP A 63  ? 0.1959 0.7197 0.4240 0.0543  0.0365  -0.1357 530 ASP A C   
500  O O   . ASP A 63  ? 0.1843 0.7805 0.4735 0.0975  0.0144  -0.1481 530 ASP A O   
501  C CB  . ASP A 63  ? 0.2460 0.6810 0.4291 0.0132  -0.0385 -0.2209 530 ASP A CB  
502  C CG  . ASP A 63  ? 0.2812 0.7036 0.5497 0.0097  -0.0709 -0.1824 530 ASP A CG  
503  O OD1 . ASP A 63  ? 0.2603 0.7282 0.6030 0.0153  -0.0388 -0.1144 530 ASP A OD1 
504  O OD2 . ASP A 63  ? 0.3342 0.7290 0.6263 0.0158  -0.0646 -0.1887 530 ASP A OD2 
505  N N   . VAL A 64  ? 0.1656 0.7220 0.3503 0.0350  0.0799  -0.0578 531 VAL A N   
506  C CA  . VAL A 64  ? 0.2000 0.7620 0.3979 0.0154  0.0391  -0.0187 531 VAL A CA  
507  C C   . VAL A 64  ? 0.2073 0.7745 0.3965 0.0244  0.0529  -0.0112 531 VAL A C   
508  O O   . VAL A 64  ? 0.2737 0.8230 0.3629 -0.0245 0.1043  0.0344  531 VAL A O   
509  C CB  . VAL A 64  ? 0.2224 0.7802 0.4415 0.0379  0.0093  -0.0021 531 VAL A CB  
510  C CG1 . VAL A 64  ? 0.3025 0.7908 0.4195 0.0632  0.0105  0.0363  531 VAL A CG1 
511  C CG2 . VAL A 64  ? 0.2345 0.7915 0.4490 0.0979  0.0376  -0.0606 531 VAL A CG2 
512  N N   . ALA A 65  ? 0.1615 0.7216 0.4095 0.0462  0.0241  -0.0169 532 ALA A N   
513  C CA  . ALA A 65  ? 0.1680 0.6871 0.4049 0.0547  -0.0345 0.0054  532 ALA A CA  
514  C C   . ALA A 65  ? 0.1772 0.7166 0.4563 0.0348  -0.0060 0.0139  532 ALA A C   
515  O O   . ALA A 65  ? 0.1700 0.7400 0.5094 0.0719  0.0126  0.0503  532 ALA A O   
516  C CB  . ALA A 65  ? 0.1730 0.6497 0.4501 0.0375  0.0267  0.0420  532 ALA A CB  
517  N N   . ASN A 66  ? 0.2085 0.6911 0.4019 0.0307  -0.0175 -0.0036 533 ASN A N   
518  C CA  . ASN A 66  ? 0.2327 0.6716 0.4233 0.0552  0.0593  -0.0317 533 ASN A CA  
519  C C   . ASN A 66  ? 0.2147 0.7027 0.4074 0.0902  0.0772  -0.0445 533 ASN A C   
520  O O   . ASN A 66  ? 0.2000 0.7047 0.4608 0.0688  0.0253  -0.0388 533 ASN A O   
521  C CB  . ASN A 66  ? 0.2248 0.6386 0.4257 0.0185  0.0846  0.0393  533 ASN A CB  
522  C CG  . ASN A 66  ? 0.2461 0.6183 0.4349 0.0206  0.0478  0.0503  533 ASN A CG  
523  O OD1 . ASN A 66  ? 0.3140 0.6106 0.4389 -0.0145 0.0292  0.0038  533 ASN A OD1 
524  N ND2 . ASN A 66  ? 0.2138 0.6297 0.4460 0.0952  0.0795  0.0842  533 ASN A ND2 
525  N N   . TYR A 67  ? 0.2206 0.7269 0.3553 0.1642  0.0274  -0.0633 534 TYR A N   
526  C CA  . TYR A 67  ? 0.2708 0.7962 0.3690 0.1780  0.0293  -0.1250 534 TYR A CA  
527  C C   . TYR A 67  ? 0.2663 0.8399 0.5042 0.2062  0.0265  -0.0881 534 TYR A C   
528  O O   . TYR A 67  ? 0.1864 0.8708 0.5730 0.2055  0.0530  -0.0267 534 TYR A O   
529  C CB  . TYR A 67  ? 0.3672 0.8198 0.4559 0.2024  0.0018  -0.1567 534 TYR A CB  
530  C CG  . TYR A 67  ? 0.4475 0.8404 0.5324 0.2126  -0.0454 -0.2273 534 TYR A CG  
531  C CD1 . TYR A 67  ? 0.4825 0.8516 0.6097 0.2252  -0.0369 -0.2523 534 TYR A CD1 
532  C CD2 . TYR A 67  ? 0.4990 0.8593 0.6275 0.2189  -0.0829 -0.2229 534 TYR A CD2 
533  C CE1 . TYR A 67  ? 0.5216 0.8761 0.6765 0.2451  -0.0283 -0.2349 534 TYR A CE1 
534  C CE2 . TYR A 67  ? 0.4997 0.8796 0.6355 0.2636  -0.0391 -0.2127 534 TYR A CE2 
535  C CZ  . TYR A 67  ? 0.5405 0.9005 0.6827 0.2579  -0.0624 -0.1855 534 TYR A CZ  
536  O OH  . TYR A 67  ? 0.5723 0.9510 0.7521 0.2525  -0.1729 -0.0726 534 TYR A OH  
537  N N   . ASN A 68  ? 0.2894 0.8596 0.5549 0.1862  0.0003  -0.0410 535 ASN A N   
538  C CA  . ASN A 68  ? 0.3101 0.8730 0.6146 0.1336  -0.0160 -0.0019 535 ASN A CA  
539  C C   . ASN A 68  ? 0.3508 0.8695 0.5613 0.0939  -0.0232 0.0160  535 ASN A C   
540  O O   . ASN A 68  ? 0.3157 0.8954 0.5429 0.1167  0.0768  0.0371  535 ASN A O   
541  C CB  . ASN A 68  ? 0.2914 0.8882 0.6405 0.1250  -0.0401 -0.0127 535 ASN A CB  
542  C CG  . ASN A 68  ? 0.3175 0.8940 0.6127 0.1401  -0.0080 -0.0013 535 ASN A CG  
543  O OD1 . ASN A 68  ? 0.3161 0.9282 0.5499 0.1451  -0.0071 0.0360  535 ASN A OD1 
544  N ND2 . ASN A 68  ? 0.2992 0.8782 0.6406 0.1421  0.0346  -0.0433 535 ASN A ND2 
545  N N   . CYS A 69  ? 0.3853 0.8208 0.5546 0.0602  0.0008  -0.0030 536 CYS A N   
546  C CA  . CYS A 69  ? 0.4251 0.7882 0.5688 0.0424  -0.0240 -0.0494 536 CYS A CA  
547  C C   . CYS A 69  ? 0.3635 0.7294 0.5552 0.0623  -0.0204 -0.1245 536 CYS A C   
548  O O   . CYS A 69  ? 0.3791 0.6666 0.5419 0.0730  0.0370  -0.1214 536 CYS A O   
549  C CB  . CYS A 69  ? 0.4912 0.8193 0.5729 0.0533  0.0667  0.0051  536 CYS A CB  
550  S SG  . CYS A 69  ? 0.6084 0.8930 0.6907 0.0587  -0.0359 0.0748  536 CYS A SG  
551  N N   . ARG A 70  ? 0.3485 0.7698 0.6090 0.0549  -0.0202 -0.1421 537 ARG A N   
552  C CA  . ARG A 70  ? 0.3514 0.7608 0.6928 0.0324  -0.0192 -0.1346 537 ARG A CA  
553  C C   . ARG A 70  ? 0.3013 0.7150 0.7283 0.0089  -0.0123 -0.1398 537 ARG A C   
554  O O   . ARG A 70  ? 0.2389 0.6563 0.8042 -0.0341 0.0726  -0.1493 537 ARG A O   
555  C CB  . ARG A 70  ? 0.4803 0.8504 0.8241 0.0369  0.0009  -0.1261 537 ARG A CB  
556  C CG  . ARG A 70  ? 0.6205 0.9312 0.9421 0.0676  -0.0047 -0.1430 537 ARG A CG  
557  C CD  . ARG A 70  ? 0.7194 0.9916 1.0288 0.1097  0.0305  -0.1375 537 ARG A CD  
558  N NE  . ARG A 70  ? 0.7890 1.0307 1.0790 0.1449  0.0693  -0.1345 537 ARG A NE  
559  C CZ  . ARG A 70  ? 0.8365 1.0530 1.1161 0.1626  0.0902  -0.1469 537 ARG A CZ  
560  N NH1 . ARG A 70  ? 0.8413 1.0483 1.1075 0.1716  0.1030  -0.1478 537 ARG A NH1 
561  N NH2 . ARG A 70  ? 0.8607 1.0678 1.1543 0.1627  0.0881  -0.1523 537 ARG A NH2 
562  N N   . ASP A 71  ? 0.2738 0.7288 0.6555 0.0442  -0.0338 -0.1732 538 ASP A N   
563  C CA  . ASP A 71  ? 0.3044 0.6893 0.6414 0.0515  -0.0455 -0.1304 538 ASP A CA  
564  C C   . ASP A 71  ? 0.3128 0.5949 0.6111 0.0562  -0.1118 -0.1361 538 ASP A C   
565  O O   . ASP A 71  ? 0.3157 0.5436 0.7089 0.0682  -0.1410 -0.1120 538 ASP A O   
566  C CB  . ASP A 71  ? 0.3087 0.7273 0.5988 0.0626  0.0182  -0.0775 538 ASP A CB  
567  N N   . LEU A 72  ? 0.3237 0.5789 0.5431 0.0423  -0.0808 -0.1189 539 LEU A N   
568  C CA  . LEU A 72  ? 0.3157 0.5029 0.4730 0.0611  -0.0420 -0.1195 539 LEU A CA  
569  C C   . LEU A 72  ? 0.3090 0.4652 0.4881 0.0352  -0.0801 -0.0451 539 LEU A C   
570  O O   . LEU A 72  ? 0.3193 0.4718 0.5484 -0.0198 -0.1135 -0.0441 539 LEU A O   
571  C CB  . LEU A 72  ? 0.3345 0.4911 0.5281 0.0702  -0.0618 -0.0408 539 LEU A CB  
572  C CG  . LEU A 72  ? 0.2725 0.4768 0.4782 0.0720  -0.0475 -0.0318 539 LEU A CG  
573  C CD1 . LEU A 72  ? 0.2252 0.4777 0.4461 0.0269  -0.0178 0.0315  539 LEU A CD1 
574  C CD2 . LEU A 72  ? 0.3070 0.4843 0.5287 0.0514  0.0375  -0.0115 539 LEU A CD2 
575  N N   . VAL A 73  ? 0.2780 0.4366 0.4198 0.0423  -0.0375 -0.0849 540 VAL A N   
576  C CA  . VAL A 73  ? 0.2794 0.4217 0.4546 -0.0109 0.0576  -0.0414 540 VAL A CA  
577  C C   . VAL A 73  ? 0.3118 0.4405 0.5350 -0.0173 0.0089  -0.0497 540 VAL A C   
578  O O   . VAL A 73  ? 0.3577 0.4685 0.5365 0.0291  0.0312  0.0143  540 VAL A O   
579  C CB  . VAL A 73  ? 0.3725 0.4137 0.4743 -0.0263 0.0932  -0.0644 540 VAL A CB  
580  C CG1 . VAL A 73  ? 0.4181 0.4041 0.5096 -0.0806 0.1463  -0.0291 540 VAL A CG1 
581  C CG2 . VAL A 73  ? 0.3563 0.4133 0.4410 0.0566  0.1286  -0.1053 540 VAL A CG2 
582  N N   . ALA A 74  ? 0.3258 0.4483 0.6704 -0.0090 -0.0746 -0.0903 541 ALA A N   
583  C CA  . ALA A 74  ? 0.3515 0.4161 0.7147 0.0014  -0.1231 -0.1092 541 ALA A CA  
584  C C   . ALA A 74  ? 0.3604 0.3898 0.6960 0.0051  -0.1129 -0.0671 541 ALA A C   
585  O O   . ALA A 74  ? 0.4188 0.3848 0.7515 0.0032  -0.0942 -0.0190 541 ALA A O   
586  C CB  . ALA A 74  ? 0.3560 0.4357 0.7884 0.0325  -0.1643 -0.0746 541 ALA A CB  
587  N N   . SER A 75  ? 0.3175 0.3391 0.6082 -0.0492 -0.0950 -0.0424 542 SER A N   
588  C CA  . SER A 75  ? 0.3473 0.3480 0.5880 -0.0268 -0.0742 -0.0341 542 SER A CA  
589  C C   . SER A 75  ? 0.3350 0.3691 0.6048 -0.0166 -0.0804 0.0085  542 SER A C   
590  O O   . SER A 75  ? 0.3202 0.3417 0.5512 0.0426  -0.0721 0.0081  542 SER A O   
591  C CB  . SER A 75  ? 0.3790 0.3474 0.5951 -0.0040 -0.0864 -0.0358 542 SER A CB  
592  O OG  . SER A 75  ? 0.3539 0.3614 0.5258 0.0536  -0.1114 -0.0288 542 SER A OG  
593  N N   . VAL A 76  ? 0.3539 0.4286 0.6038 -0.0048 -0.1240 -0.0039 543 VAL A N   
594  C CA  . VAL A 76  ? 0.3892 0.4721 0.5713 0.0256  -0.0715 -0.0140 543 VAL A CA  
595  C C   . VAL A 76  ? 0.4014 0.5178 0.5576 0.0460  -0.0788 -0.0157 543 VAL A C   
596  O O   . VAL A 76  ? 0.3972 0.5620 0.4646 0.0018  -0.0676 0.0360  543 VAL A O   
597  C CB  . VAL A 76  ? 0.3697 0.4855 0.5808 0.0438  -0.0751 -0.0081 543 VAL A CB  
598  C CG1 . VAL A 76  ? 0.3907 0.5242 0.5854 0.0443  -0.0446 -0.0136 543 VAL A CG1 
599  C CG2 . VAL A 76  ? 0.3440 0.4178 0.5673 0.0210  -0.0441 0.0206  543 VAL A CG2 
600  N N   . PRO A 77  ? 0.3852 0.5181 0.5877 0.1365  -0.0552 -0.0365 544 PRO A N   
601  C CA  . PRO A 77  ? 0.4021 0.6125 0.6833 0.0899  -0.0739 -0.0211 544 PRO A CA  
602  C C   . PRO A 77  ? 0.4358 0.7045 0.6740 0.0318  -0.0502 0.0121  544 PRO A C   
603  O O   . PRO A 77  ? 0.4913 0.7157 0.6026 0.0012  -0.0140 0.0885  544 PRO A O   
604  C CB  . PRO A 77  ? 0.4127 0.6099 0.7266 0.0895  -0.1401 0.0226  544 PRO A CB  
605  C CG  . PRO A 77  ? 0.3983 0.5808 0.7153 0.0989  -0.1353 0.0378  544 PRO A CG  
606  C CD  . PRO A 77  ? 0.3931 0.5433 0.6376 0.1442  -0.1276 0.0386  544 PRO A CD  
607  N N   . PHE A 78  ? 0.4167 0.7911 0.7435 0.0260  -0.1143 -0.0294 545 PHE A N   
608  C CA  . PHE A 78  ? 0.4516 0.8294 0.8348 -0.0069 -0.1908 -0.0132 545 PHE A CA  
609  C C   . PHE A 78  ? 0.4965 0.8762 0.8801 -0.0211 -0.1792 0.0283  545 PHE A C   
610  O O   . PHE A 78  ? 0.5643 0.9281 0.9029 -0.0583 -0.1719 0.0650  545 PHE A O   
611  C CB  . PHE A 78  ? 0.4725 0.8222 0.8434 -0.0320 -0.1967 0.0236  545 PHE A CB  
612  C CG  . PHE A 78  ? 0.4898 0.8167 0.8661 -0.0264 -0.2109 0.0719  545 PHE A CG  
613  C CD1 . PHE A 78  ? 0.4973 0.8117 0.8805 -0.0145 -0.1941 0.1279  545 PHE A CD1 
614  C CD2 . PHE A 78  ? 0.5327 0.8239 0.8791 -0.0348 -0.1903 0.0853  545 PHE A CD2 
615  C CE1 . PHE A 78  ? 0.5225 0.8200 0.8978 -0.0182 -0.2167 0.1606  545 PHE A CE1 
616  C CE2 . PHE A 78  ? 0.5324 0.8273 0.8911 -0.0508 -0.2050 0.1202  545 PHE A CE2 
617  C CZ  . PHE A 78  ? 0.5381 0.8313 0.9092 -0.0569 -0.2131 0.1323  545 PHE A CZ  
618  N N   . PHE A 79  ? 0.4685 0.8365 0.7855 0.0077  -0.1974 0.0533  546 PHE A N   
619  C CA  . PHE A 79  ? 0.4151 0.8165 0.7689 0.0181  -0.2015 0.0912  546 PHE A CA  
620  C C   . PHE A 79  ? 0.4787 0.8436 0.8495 0.0342  -0.2000 0.1157  546 PHE A C   
621  O O   . PHE A 79  ? 0.5584 0.8676 0.8637 0.0252  -0.2460 0.0992  546 PHE A O   
622  C CB  . PHE A 79  ? 0.3957 0.8005 0.6936 0.0141  -0.1614 0.0720  546 PHE A CB  
623  C CG  . PHE A 79  ? 0.3878 0.7758 0.6814 0.0467  -0.1064 0.0631  546 PHE A CG  
624  C CD1 . PHE A 79  ? 0.4113 0.7829 0.6674 0.0343  -0.0956 0.0942  546 PHE A CD1 
625  C CD2 . PHE A 79  ? 0.3963 0.7760 0.6892 0.0629  -0.0773 0.0528  546 PHE A CD2 
626  C CE1 . PHE A 79  ? 0.4408 0.7883 0.6757 0.0237  -0.0623 0.0791  546 PHE A CE1 
627  C CE2 . PHE A 79  ? 0.4110 0.7817 0.6787 0.0851  -0.0816 0.0832  546 PHE A CE2 
628  C CZ  . PHE A 79  ? 0.4478 0.8012 0.6911 0.0592  -0.0737 0.0844  546 PHE A CZ  
629  N N   . VAL A 80  ? 0.5132 0.8378 0.8968 0.0743  -0.1552 0.1528  547 VAL A N   
630  C CA  . VAL A 80  ? 0.5199 0.8427 0.9426 0.1082  -0.1333 0.1775  547 VAL A CA  
631  C C   . VAL A 80  ? 0.5034 0.8363 0.9757 0.1179  -0.1123 0.2038  547 VAL A C   
632  O O   . VAL A 80  ? 0.4571 0.8312 0.9460 0.1383  -0.1227 0.2629  547 VAL A O   
633  C CB  . VAL A 80  ? 0.5373 0.8423 0.9734 0.1302  -0.1084 0.1562  547 VAL A CB  
634  N N   . GLY A 81  ? 0.5473 0.8261 1.0096 0.1227  -0.0853 0.2119  548 GLY A N   
635  C CA  . GLY A 81  ? 0.5649 0.7939 1.0265 0.1328  -0.0872 0.2339  548 GLY A CA  
636  C C   . GLY A 81  ? 0.5637 0.7589 0.9985 0.1322  -0.0910 0.2659  548 GLY A C   
637  O O   . GLY A 81  ? 0.5686 0.7466 1.0278 0.1667  -0.0463 0.2876  548 GLY A O   
638  N N   . ALA A 82  ? 0.5191 0.7260 0.8866 0.0886  -0.1526 0.2746  549 ALA A N   
639  C CA  . ALA A 82  ? 0.4256 0.6782 0.8352 0.0503  -0.1776 0.2513  549 ALA A CA  
640  C C   . ALA A 82  ? 0.4236 0.6689 0.8696 0.0259  -0.0932 0.2517  549 ALA A C   
641  O O   . ALA A 82  ? 0.4447 0.6623 0.8573 0.0402  -0.0997 0.1948  549 ALA A O   
642  C CB  . ALA A 82  ? 0.3596 0.6731 0.7681 0.0114  -0.2072 0.2491  549 ALA A CB  
643  N N   . ASP A 83  ? 0.3923 0.6709 0.8649 0.0192  -0.0412 0.3100  550 ASP A N   
644  C CA  . ASP A 83  ? 0.3238 0.6918 0.8375 -0.0205 -0.0575 0.3109  550 ASP A CA  
645  C C   . ASP A 83  ? 0.3017 0.6705 0.8456 -0.0067 -0.0535 0.3030  550 ASP A C   
646  O O   . ASP A 83  ? 0.2998 0.6387 0.8341 -0.0022 -0.0394 0.3869  550 ASP A O   
647  C CB  . ASP A 83  ? 0.3319 0.7447 0.8825 -0.0530 -0.0642 0.2758  550 ASP A CB  
648  C CG  . ASP A 83  ? 0.3891 0.7934 0.8956 -0.0815 -0.0509 0.2963  550 ASP A CG  
649  O OD1 . ASP A 83  ? 0.4004 0.7954 0.8851 -0.0973 -0.0756 0.2986  550 ASP A OD1 
650  O OD2 . ASP A 83  ? 0.4176 0.8104 0.9212 -0.0750 -0.0404 0.3582  550 ASP A OD2 
651  N N   . SER A 84  ? 0.3090 0.6576 0.8395 -0.0130 -0.0180 0.2128  551 SER A N   
652  C CA  . SER A 84  ? 0.3381 0.6607 0.7968 0.0014  -0.0473 0.1340  551 SER A CA  
653  C C   . SER A 84  ? 0.3083 0.6525 0.6714 -0.0340 -0.0684 0.1809  551 SER A C   
654  O O   . SER A 84  ? 0.2896 0.6571 0.6278 -0.0832 -0.1198 0.1736  551 SER A O   
655  C CB  . SER A 84  ? 0.4268 0.7083 0.9235 0.0502  -0.0507 0.0537  551 SER A CB  
656  O OG  . SER A 84  ? 0.5017 0.7926 1.0295 0.0161  -0.0535 0.0219  551 SER A OG  
657  N N   . ASN A 85  ? 0.2861 0.6317 0.5646 -0.0133 -0.0087 0.1977  552 ASN A N   
658  C CA  . ASN A 85  ? 0.2954 0.6065 0.5163 -0.0499 -0.0434 0.1683  552 ASN A CA  
659  C C   . ASN A 85  ? 0.2686 0.6174 0.5014 -0.0928 -0.0517 0.2191  552 ASN A C   
660  O O   . ASN A 85  ? 0.2978 0.5977 0.4215 -0.1086 -0.0732 0.2368  552 ASN A O   
661  C CB  . ASN A 85  ? 0.2643 0.5987 0.5037 -0.0180 -0.0567 0.1079  552 ASN A CB  
662  C CG  . ASN A 85  ? 0.3026 0.6280 0.4789 -0.0124 -0.0829 0.1206  552 ASN A CG  
663  O OD1 . ASN A 85  ? 0.3008 0.6171 0.5282 -0.0247 -0.1287 0.1213  552 ASN A OD1 
664  N ND2 . ASN A 85  ? 0.3126 0.6669 0.4227 0.0300  -0.0731 0.1451  552 ASN A ND2 
665  N N   . PHE A 86  ? 0.2610 0.6381 0.5195 -0.0500 -0.0809 0.2191  553 PHE A N   
666  C CA  . PHE A 86  ? 0.2466 0.6345 0.5398 -0.0799 -0.0878 0.1937  553 PHE A CA  
667  C C   . PHE A 86  ? 0.2574 0.6294 0.5449 -0.0081 -0.0846 0.1560  553 PHE A C   
668  O O   . PHE A 86  ? 0.2449 0.6285 0.5698 -0.0140 -0.0579 0.1405  553 PHE A O   
669  C CB  . PHE A 86  ? 0.2271 0.6560 0.5298 -0.1216 -0.1462 0.1930  553 PHE A CB  
670  C CG  . PHE A 86  ? 0.2657 0.6664 0.5426 -0.0613 -0.1426 0.1925  553 PHE A CG  
671  C CD1 . PHE A 86  ? 0.2628 0.6784 0.5306 -0.0652 -0.1418 0.1457  553 PHE A CD1 
672  C CD2 . PHE A 86  ? 0.3058 0.6654 0.5333 -0.0621 -0.1424 0.2194  553 PHE A CD2 
673  C CE1 . PHE A 86  ? 0.2704 0.6877 0.4978 -0.0374 -0.0894 0.1506  553 PHE A CE1 
674  C CE2 . PHE A 86  ? 0.3280 0.6866 0.6022 -0.0324 -0.1253 0.1724  553 PHE A CE2 
675  C CZ  . PHE A 86  ? 0.3007 0.6818 0.5244 -0.0223 -0.1110 0.1487  553 PHE A CZ  
676  N N   . VAL A 87  ? 0.2466 0.6325 0.5318 0.0170  -0.1462 0.2002  554 VAL A N   
677  C CA  . VAL A 87  ? 0.2255 0.5844 0.5740 0.0342  -0.1036 0.1452  554 VAL A CA  
678  C C   . VAL A 87  ? 0.1729 0.5434 0.5743 0.0068  -0.0598 0.0762  554 VAL A C   
679  O O   . VAL A 87  ? 0.1384 0.5430 0.5466 -0.0007 -0.0185 0.0122  554 VAL A O   
680  C CB  . VAL A 87  ? 0.2463 0.5514 0.6714 0.0487  -0.0830 0.1668  554 VAL A CB  
681  C CG1 . VAL A 87  ? 0.2690 0.4772 0.7650 0.0424  -0.0274 0.1599  554 VAL A CG1 
682  C CG2 . VAL A 87  ? 0.2627 0.6116 0.7660 -0.0086 -0.0885 0.1597  554 VAL A CG2 
683  N N   . THR A 88  ? 0.1453 0.4723 0.5786 -0.0213 -0.0229 0.0911  555 THR A N   
684  C CA  . THR A 88  ? 0.2086 0.4778 0.5124 -0.0281 -0.0627 0.1146  555 THR A CA  
685  C C   . THR A 88  ? 0.2150 0.4999 0.5046 0.0349  -0.0473 0.0994  555 THR A C   
686  O O   . THR A 88  ? 0.2863 0.4354 0.5301 0.0387  -0.0038 0.0895  555 THR A O   
687  C CB  . THR A 88  ? 0.2858 0.4908 0.5167 -0.0349 -0.0605 0.1146  555 THR A CB  
688  O OG1 . THR A 88  ? 0.3234 0.4558 0.6033 -0.0765 -0.0177 0.0983  555 THR A OG1 
689  C CG2 . THR A 88  ? 0.2913 0.4927 0.4764 -0.0397 -0.0558 0.1906  555 THR A CG2 
690  N N   . ARG A 89  ? 0.1927 0.5250 0.4382 0.0345  -0.0618 0.0553  556 ARG A N   
691  C CA  . ARG A 89  ? 0.2634 0.5357 0.4961 -0.0166 -0.0228 0.0842  556 ARG A CA  
692  C C   . ARG A 89  ? 0.2366 0.4938 0.4915 -0.0117 -0.0355 0.0853  556 ARG A C   
693  O O   . ARG A 89  ? 0.2199 0.4660 0.5305 -0.0407 -0.0685 0.0753  556 ARG A O   
694  C CB  . ARG A 89  ? 0.2789 0.5657 0.4534 -0.0259 -0.0206 0.0970  556 ARG A CB  
695  C CG  . ARG A 89  ? 0.2770 0.5849 0.5046 -0.0335 0.0011  0.1024  556 ARG A CG  
696  C CD  . ARG A 89  ? 0.2989 0.6010 0.5435 -0.0082 0.0328  0.1269  556 ARG A CD  
697  N NE  . ARG A 89  ? 0.3180 0.6449 0.5763 -0.0107 0.0255  0.1024  556 ARG A NE  
698  C CZ  . ARG A 89  ? 0.3722 0.6537 0.5707 -0.1108 0.0003  0.0884  556 ARG A CZ  
699  N NH1 . ARG A 89  ? 0.3985 0.6436 0.5116 -0.1399 -0.0167 0.1077  556 ARG A NH1 
700  N NH2 . ARG A 89  ? 0.3764 0.6616 0.5571 -0.1583 0.0405  0.1014  556 ARG A NH2 
701  N N   . VAL A 90  ? 0.2451 0.4696 0.4220 0.0246  -0.0275 0.0801  557 VAL A N   
702  C CA  . VAL A 90  ? 0.2142 0.4905 0.4444 0.0331  -0.0289 0.1379  557 VAL A CA  
703  C C   . VAL A 90  ? 0.2088 0.5124 0.4779 0.0237  -0.0433 0.1204  557 VAL A C   
704  O O   . VAL A 90  ? 0.2104 0.5228 0.4364 -0.0033 -0.0673 0.1226  557 VAL A O   
705  C CB  . VAL A 90  ? 0.2505 0.5538 0.4805 0.0052  -0.0093 0.2038  557 VAL A CB  
706  C CG1 . VAL A 90  ? 0.2647 0.5294 0.5217 0.0360  0.0228  0.2179  557 VAL A CG1 
707  C CG2 . VAL A 90  ? 0.2706 0.6060 0.4275 -0.0151 -0.0406 0.1768  557 VAL A CG2 
708  N N   . VAL A 91  ? 0.1885 0.5488 0.5215 0.0547  -0.0769 0.1558  558 VAL A N   
709  C CA  . VAL A 91  ? 0.2070 0.5239 0.5284 0.0209  -0.0927 0.1420  558 VAL A CA  
710  C C   . VAL A 91  ? 0.2034 0.5085 0.4867 -0.0255 -0.0760 0.1496  558 VAL A C   
711  O O   . VAL A 91  ? 0.2288 0.5158 0.4628 -0.0437 -0.0541 0.1868  558 VAL A O   
712  C CB  . VAL A 91  ? 0.2109 0.5265 0.5890 0.0576  -0.0743 0.0626  558 VAL A CB  
713  C CG1 . VAL A 91  ? 0.2332 0.4937 0.5628 0.0898  -0.1358 0.1238  558 VAL A CG1 
714  C CG2 . VAL A 91  ? 0.2320 0.5373 0.6034 0.0144  -0.0607 0.0340  558 VAL A CG2 
715  N N   . THR A 92  ? 0.2346 0.5086 0.4943 -0.0131 -0.0422 0.0817  559 THR A N   
716  C CA  . THR A 92  ? 0.1902 0.5516 0.4595 0.0182  -0.0743 0.1057  559 THR A CA  
717  C C   . THR A 92  ? 0.1919 0.5714 0.4647 0.0580  -0.0654 0.1615  559 THR A C   
718  O O   . THR A 92  ? 0.2145 0.5948 0.5332 0.0334  -0.0473 0.1928  559 THR A O   
719  C CB  . THR A 92  ? 0.2412 0.6353 0.4817 -0.0281 -0.0365 0.0776  559 THR A CB  
720  O OG1 . THR A 92  ? 0.2243 0.6912 0.4293 -0.0178 0.0168  0.0828  559 THR A OG1 
721  C CG2 . THR A 92  ? 0.1920 0.6387 0.5361 -0.1146 -0.0390 0.0605  559 THR A CG2 
722  N N   . LEU A 93  ? 0.1951 0.5358 0.3879 0.0866  -0.0044 0.1387  560 LEU A N   
723  C CA  . LEU A 93  ? 0.2009 0.5403 0.4263 0.0801  0.0524  0.1210  560 LEU A CA  
724  C C   . LEU A 93  ? 0.1679 0.5245 0.4329 0.0829  0.0553  0.1024  560 LEU A C   
725  O O   . LEU A 93  ? 0.1956 0.5506 0.4830 0.1272  0.0432  0.1149  560 LEU A O   
726  C CB  . LEU A 93  ? 0.2183 0.5730 0.3896 0.0708  0.0748  0.0530  560 LEU A CB  
727  C CG  . LEU A 93  ? 0.2449 0.5967 0.4654 0.0283  0.0754  0.0595  560 LEU A CG  
728  C CD1 . LEU A 93  ? 0.2660 0.6053 0.4407 0.0035  0.0821  0.0072  560 LEU A CD1 
729  C CD2 . LEU A 93  ? 0.2853 0.6241 0.5371 0.0034  0.0482  0.0296  560 LEU A CD2 
730  N N   . LEU A 94  ? 0.1273 0.4785 0.3916 0.0812  -0.0160 0.0927  561 LEU A N   
731  C CA  . LEU A 94  ? 0.1289 0.4625 0.3493 0.0385  -0.0153 0.0419  561 LEU A CA  
732  C C   . LEU A 94  ? 0.1614 0.4658 0.3482 0.0492  -0.0322 0.0191  561 LEU A C   
733  O O   . LEU A 94  ? 0.1638 0.5007 0.3770 0.0439  -0.1142 0.0041  561 LEU A O   
734  C CB  . LEU A 94  ? 0.1134 0.4280 0.3368 0.0228  -0.0332 0.0318  561 LEU A CB  
735  C CG  . LEU A 94  ? 0.1535 0.4063 0.3499 0.0013  -0.0597 0.0527  561 LEU A CG  
736  C CD1 . LEU A 94  ? 0.1622 0.4542 0.3874 0.0454  -0.0038 0.0678  561 LEU A CD1 
737  C CD2 . LEU A 94  ? 0.2076 0.4048 0.3074 -0.0231 -0.1077 0.1519  561 LEU A CD2 
738  N N   . GLU A 95  ? 0.2306 0.4077 0.2916 0.0562  0.0225  0.0380  562 GLU A N   
739  C CA  . GLU A 95  ? 0.2589 0.4091 0.3418 0.1032  0.0602  0.0273  562 GLU A CA  
740  C C   . GLU A 95  ? 0.2259 0.3982 0.3048 0.0605  0.0507  0.0489  562 GLU A C   
741  O O   . GLU A 95  ? 0.2335 0.3593 0.3079 0.0915  -0.0202 0.0614  562 GLU A O   
742  C CB  . GLU A 95  ? 0.2620 0.4199 0.3966 0.0717  0.0395  0.0168  562 GLU A CB  
743  C CG  . GLU A 95  ? 0.3545 0.4830 0.4544 0.0737  -0.0147 0.0400  562 GLU A CG  
744  C CD  . GLU A 95  ? 0.3661 0.4872 0.4755 0.0746  -0.0453 0.0830  562 GLU A CD  
745  O OE1 . GLU A 95  ? 0.3788 0.4756 0.4255 0.0647  -0.0352 0.0718  562 GLU A OE1 
746  O OE2 . GLU A 95  ? 0.3793 0.5002 0.5275 0.0875  -0.0721 0.1185  562 GLU A OE2 
747  N N   . PHE A 96  ? 0.1704 0.4287 0.2526 0.0502  0.0004  -0.0002 563 PHE A N   
748  C CA  . PHE A 96  ? 0.2239 0.3714 0.2758 0.0687  0.0283  -0.0111 563 PHE A CA  
749  C C   . PHE A 96  ? 0.1790 0.3711 0.2659 0.0555  0.0093  0.0057  563 PHE A C   
750  O O   . PHE A 96  ? 0.1342 0.3761 0.3387 0.0863  -0.0162 0.0446  563 PHE A O   
751  C CB  . PHE A 96  ? 0.2977 0.3820 0.2800 0.0526  0.0024  -0.0315 563 PHE A CB  
752  C CG  . PHE A 96  ? 0.3097 0.4461 0.3205 0.0427  0.0228  -0.0593 563 PHE A CG  
753  C CD1 . PHE A 96  ? 0.3617 0.4960 0.4334 0.0376  0.0861  -0.0502 563 PHE A CD1 
754  C CD2 . PHE A 96  ? 0.3090 0.4887 0.3933 0.0106  0.0066  -0.0314 563 PHE A CD2 
755  C CE1 . PHE A 96  ? 0.3746 0.5269 0.4625 0.0245  0.0572  -0.0243 563 PHE A CE1 
756  C CE2 . PHE A 96  ? 0.3418 0.4995 0.4305 0.0112  0.0282  -0.0505 563 PHE A CE2 
757  C CZ  . PHE A 96  ? 0.3800 0.5124 0.4073 -0.0012 0.0256  -0.0305 563 PHE A CZ  
758  N N   . GLU A 97  ? 0.2309 0.3100 0.2277 0.0050  -0.0154 -0.0254 564 GLU A N   
759  C CA  . GLU A 97  ? 0.2788 0.2929 0.2395 -0.0011 0.0161  -0.0480 564 GLU A CA  
760  C C   . GLU A 97  ? 0.2406 0.3040 0.2324 -0.0095 -0.0078 -0.0090 564 GLU A C   
761  O O   . GLU A 97  ? 0.2530 0.2967 0.3166 0.0245  0.0450  -0.0415 564 GLU A O   
762  C CB  . GLU A 97  ? 0.3012 0.2406 0.2928 0.0456  0.0624  -0.0740 564 GLU A CB  
763  C CG  . GLU A 97  ? 0.3019 0.2880 0.2500 0.0696  0.0489  -0.0749 564 GLU A CG  
764  C CD  . GLU A 97  ? 0.3073 0.3155 0.3175 0.0844  0.0152  -0.0312 564 GLU A CD  
765  O OE1 . GLU A 97  ? 0.3323 0.3503 0.3220 0.0641  -0.0230 -0.0872 564 GLU A OE1 
766  O OE2 . GLU A 97  ? 0.2876 0.3392 0.3732 0.0760  -0.0108 -0.0687 564 GLU A OE2 
767  N N   . VAL A 98  ? 0.2152 0.2653 0.1826 0.0010  0.0125  0.0363  565 VAL A N   
768  C CA  . VAL A 98  ? 0.2244 0.2580 0.1781 -0.0175 0.0253  0.0161  565 VAL A CA  
769  C C   . VAL A 98  ? 0.2390 0.2513 0.2667 0.0055  -0.0218 0.0166  565 VAL A C   
770  O O   . VAL A 98  ? 0.2382 0.2429 0.2768 0.0193  -0.0142 -0.0122 565 VAL A O   
771  C CB  . VAL A 98  ? 0.2338 0.2647 0.1954 -0.0272 0.0243  -0.0216 565 VAL A CB  
772  C CG1 . VAL A 98  ? 0.2653 0.3081 0.1847 0.0175  0.0516  -0.0543 565 VAL A CG1 
773  C CG2 . VAL A 98  ? 0.2317 0.2560 0.2439 -0.0131 -0.0422 -0.0457 565 VAL A CG2 
774  N N   . PHE A 99  ? 0.2650 0.2305 0.2140 0.0323  -0.0470 0.0234  566 PHE A N   
775  C CA  . PHE A 99  ? 0.2293 0.2641 0.2086 0.0033  -0.0069 0.0182  566 PHE A CA  
776  C C   . PHE A 99  ? 0.2596 0.2304 0.2324 0.0236  0.0198  0.0196  566 PHE A C   
777  O O   . PHE A 99  ? 0.2396 0.2539 0.2981 0.0192  0.0039  0.0156  566 PHE A O   
778  C CB  . PHE A 99  ? 0.2200 0.2708 0.1971 -0.0012 -0.0736 0.0333  566 PHE A CB  
779  C CG  . PHE A 99  ? 0.3305 0.2529 0.2445 -0.0067 -0.0262 0.0348  566 PHE A CG  
780  C CD1 . PHE A 99  ? 0.3664 0.2605 0.2289 0.0260  0.0078  0.0434  566 PHE A CD1 
781  C CD2 . PHE A 99  ? 0.3737 0.2459 0.2621 0.0061  -0.0562 0.0183  566 PHE A CD2 
782  C CE1 . PHE A 99  ? 0.3869 0.2051 0.2643 0.0773  -0.0649 0.0019  566 PHE A CE1 
783  C CE2 . PHE A 99  ? 0.4311 0.1974 0.2619 0.0551  -0.0538 0.0063  566 PHE A CE2 
784  C CZ  . PHE A 99  ? 0.4308 0.1640 0.3051 0.0646  -0.0636 0.0045  566 PHE A CZ  
785  N N   . GLN A 100 ? 0.2449 0.2231 0.2420 -0.0037 -0.0080 0.0188  567 GLN A N   
786  C CA  . GLN A 100 ? 0.2413 0.2522 0.2111 -0.0014 -0.0141 0.0813  567 GLN A CA  
787  C C   . GLN A 100 ? 0.2871 0.2806 0.2705 0.0011  0.0462  0.0356  567 GLN A C   
788  O O   . GLN A 100 ? 0.2958 0.2554 0.2995 -0.0217 -0.0094 0.0258  567 GLN A O   
789  C CB  . GLN A 100 ? 0.2965 0.2461 0.2046 -0.0275 -0.0707 0.0803  567 GLN A CB  
790  C CG  . GLN A 100 ? 0.3129 0.2515 0.2487 0.0058  -0.1071 0.0379  567 GLN A CG  
791  C CD  . GLN A 100 ? 0.3551 0.3195 0.2208 -0.0121 -0.0486 -0.0194 567 GLN A CD  
792  O OE1 . GLN A 100 ? 0.3984 0.2723 0.2043 -0.0636 0.0138  -0.0227 567 GLN A OE1 
793  N NE2 . GLN A 100 ? 0.3503 0.3602 0.1731 -0.0183 -0.0682 -0.0178 567 GLN A NE2 
794  N N   . PRO A 101 ? 0.2642 0.3202 0.3181 0.0307  0.0484  0.0052  568 PRO A N   
795  C CA  . PRO A 101 ? 0.2678 0.3105 0.2914 0.0270  0.0201  -0.0040 568 PRO A CA  
796  C C   . PRO A 101 ? 0.2945 0.3277 0.3484 -0.0249 0.0006  0.0094  568 PRO A C   
797  O O   . PRO A 101 ? 0.2745 0.3073 0.3025 -0.0266 -0.0218 0.0581  568 PRO A O   
798  C CB  . PRO A 101 ? 0.2790 0.3472 0.2488 0.0490  0.0389  -0.0285 568 PRO A CB  
799  C CG  . PRO A 101 ? 0.2576 0.3381 0.2766 0.0444  0.0265  -0.0784 568 PRO A CG  
800  C CD  . PRO A 101 ? 0.2356 0.3302 0.2919 0.0751  0.0577  -0.0346 568 PRO A CD  
801  N N   . ALA A 102 ? 0.2590 0.2811 0.2847 -0.0378 -0.0228 -0.0194 569 ALA A N   
802  C CA  . ALA A 102 ? 0.2660 0.2397 0.3479 -0.1159 0.0019  0.0265  569 ALA A CA  
803  C C   . ALA A 102 ? 0.3021 0.2311 0.3570 -0.1077 -0.0521 -0.0067 569 ALA A C   
804  O O   . ALA A 102 ? 0.3729 0.2206 0.3829 -0.1096 -0.0787 -0.0123 569 ALA A O   
805  C CB  . ALA A 102 ? 0.3060 0.2665 0.4033 -0.0565 -0.0125 0.0884  569 ALA A CB  
806  N N   . ASP A 103 ? 0.2657 0.2289 0.3404 -0.0831 0.0284  0.0260  570 ASP A N   
807  C CA  . ASP A 103 ? 0.2782 0.2597 0.2519 -0.0302 -0.0046 -0.0032 570 ASP A CA  
808  C C   . ASP A 103 ? 0.3340 0.2673 0.2673 0.0003  -0.0267 -0.0140 570 ASP A C   
809  O O   . ASP A 103 ? 0.3699 0.2657 0.2629 0.0332  -0.0666 -0.0108 570 ASP A O   
810  C CB  . ASP A 103 ? 0.2454 0.2644 0.2454 -0.0568 0.0542  0.0130  570 ASP A CB  
811  C CG  . ASP A 103 ? 0.2816 0.3215 0.3377 -0.0161 -0.0753 0.0016  570 ASP A CG  
812  O OD1 . ASP A 103 ? 0.3977 0.3753 0.3673 -0.0099 -0.1039 -0.0335 570 ASP A OD1 
813  O OD2 . ASP A 103 ? 0.2516 0.2974 0.3244 0.0331  -0.1827 0.0298  570 ASP A OD2 
814  N N   . TYR A 104 ? 0.3494 0.2163 0.3062 -0.0242 -0.0446 -0.0123 571 TYR A N   
815  C CA  . TYR A 104 ? 0.3429 0.2363 0.2968 -0.0426 -0.0603 -0.0147 571 TYR A CA  
816  C C   . TYR A 104 ? 0.3495 0.2156 0.3433 -0.0071 -0.0261 0.0269  571 TYR A C   
817  O O   . TYR A 104 ? 0.3896 0.1673 0.3656 0.0176  -0.0926 0.0527  571 TYR A O   
818  C CB  . TYR A 104 ? 0.3769 0.2460 0.3397 -0.0337 -0.0118 -0.0252 571 TYR A CB  
819  C CG  . TYR A 104 ? 0.3960 0.2856 0.3644 -0.0929 -0.0412 -0.0030 571 TYR A CG  
820  C CD1 . TYR A 104 ? 0.4073 0.3261 0.4532 -0.0982 -0.0582 -0.0278 571 TYR A CD1 
821  C CD2 . TYR A 104 ? 0.4351 0.3762 0.4407 -0.0653 -0.0758 -0.0253 571 TYR A CD2 
822  C CE1 . TYR A 104 ? 0.4513 0.4054 0.5028 -0.1247 -0.0958 -0.0224 571 TYR A CE1 
823  C CE2 . TYR A 104 ? 0.4849 0.4394 0.4799 -0.1011 -0.1584 0.0012  571 TYR A CE2 
824  C CZ  . TYR A 104 ? 0.4967 0.4622 0.5567 -0.1302 -0.1579 -0.0122 571 TYR A CZ  
825  O OH  . TYR A 104 ? 0.5327 0.5050 0.5860 -0.1418 -0.2065 -0.0352 571 TYR A OH  
826  N N   . VAL A 105 ? 0.2747 0.1951 0.3016 -0.0086 -0.0005 0.0100  572 VAL A N   
827  C CA  . VAL A 105 ? 0.2852 0.2324 0.2219 0.0197  0.0214  -0.0393 572 VAL A CA  
828  C C   . VAL A 105 ? 0.2972 0.2423 0.2512 0.0140  0.0045  -0.0415 572 VAL A C   
829  O O   . VAL A 105 ? 0.3073 0.3071 0.2940 0.0151  -0.0763 -0.0476 572 VAL A O   
830  C CB  . VAL A 105 ? 0.2464 0.2285 0.2789 0.0202  0.0324  -0.0319 572 VAL A CB  
831  C CG1 . VAL A 105 ? 0.2442 0.2313 0.2986 0.0564  -0.0370 0.0003  572 VAL A CG1 
832  C CG2 . VAL A 105 ? 0.2816 0.2904 0.2751 0.0293  0.0396  -0.0232 572 VAL A CG2 
833  N N   . ILE A 106 ? 0.3309 0.1929 0.1677 -0.0250 -0.0066 -0.0683 573 ILE A N   
834  C CA  . ILE A 106 ? 0.3519 0.2050 0.1901 -0.0491 -0.0256 -0.0606 573 ILE A CA  
835  C C   . ILE A 106 ? 0.4287 0.2074 0.2678 -0.0294 -0.0314 -0.0325 573 ILE A C   
836  O O   . ILE A 106 ? 0.4324 0.1821 0.3213 0.0307  -0.0051 -0.0311 573 ILE A O   
837  C CB  . ILE A 106 ? 0.3781 0.1868 0.1548 -0.0462 -0.0588 -0.0385 573 ILE A CB  
838  C CG1 . ILE A 106 ? 0.3768 0.1540 0.2118 -0.1047 -0.0338 0.0001  573 ILE A CG1 
839  C CG2 . ILE A 106 ? 0.3843 0.2705 0.1448 -0.0049 -0.0444 -0.0033 573 ILE A CG2 
840  C CD1 . ILE A 106 ? 0.4124 0.0955 0.2480 -0.0538 0.0167  0.0643  573 ILE A CD1 
841  N N   . GLN A 107 ? 0.4640 0.1686 0.2811 -0.0315 -0.0819 -0.0274 574 GLN A N   
842  C CA  . GLN A 107 ? 0.5027 0.2194 0.3594 -0.0640 -0.0827 0.0158  574 GLN A CA  
843  C C   . GLN A 107 ? 0.4953 0.2565 0.3315 -0.0431 -0.0992 0.0103  574 GLN A C   
844  O O   . GLN A 107 ? 0.4878 0.2813 0.3625 -0.0243 -0.1026 0.0054  574 GLN A O   
845  C CB  . GLN A 107 ? 0.5067 0.1867 0.4024 -0.1027 -0.0486 0.0148  574 GLN A CB  
846  C CG  . GLN A 107 ? 0.5259 0.2548 0.5072 -0.0954 -0.0514 0.0211  574 GLN A CG  
847  C CD  . GLN A 107 ? 0.5542 0.2869 0.5019 -0.0708 -0.0186 -0.0390 574 GLN A CD  
848  O OE1 . GLN A 107 ? 0.5518 0.2703 0.5543 -0.0039 -0.0160 -0.0966 574 GLN A OE1 
849  N NE2 . GLN A 107 ? 0.5886 0.3217 0.4979 -0.1195 -0.0026 -0.0557 574 GLN A NE2 
850  N N   . GLU A 108 ? 0.5018 0.2498 0.3076 -0.0215 -0.1342 -0.0100 575 GLU A N   
851  C CA  . GLU A 108 ? 0.5430 0.2847 0.2837 -0.0268 -0.0880 -0.0659 575 GLU A CA  
852  C C   . GLU A 108 ? 0.5865 0.3407 0.3648 0.0001  -0.0706 -0.0805 575 GLU A C   
853  O O   . GLU A 108 ? 0.6101 0.3218 0.3821 0.0034  -0.1007 -0.1456 575 GLU A O   
854  C CB  . GLU A 108 ? 0.5743 0.3244 0.2734 -0.0264 -0.1278 -0.0918 575 GLU A CB  
855  C CG  . GLU A 108 ? 0.6786 0.3792 0.2976 -0.1124 -0.1105 -0.1753 575 GLU A CG  
856  C CD  . GLU A 108 ? 0.7487 0.5600 0.4495 -0.0978 -0.1311 -0.0920 575 GLU A CD  
857  O OE1 . GLU A 108 ? 0.7709 0.5636 0.4949 -0.1265 -0.1517 -0.0496 575 GLU A OE1 
858  O OE2 . GLU A 108 ? 0.7864 0.6463 0.5433 -0.0819 -0.1297 -0.0637 575 GLU A OE2 
859  N N   . GLY A 109 ? 0.6060 0.3710 0.3496 -0.0071 0.0073  -0.0621 576 GLY A N   
860  C CA  . GLY A 109 ? 0.6563 0.3778 0.3956 -0.0215 0.0139  -0.1044 576 GLY A CA  
861  C C   . GLY A 109 ? 0.6852 0.3540 0.3841 0.0005  -0.0027 -0.1058 576 GLY A C   
862  O O   . GLY A 109 ? 0.7309 0.3419 0.3790 -0.0111 -0.0706 -0.1700 576 GLY A O   
863  N N   . THR A 110 ? 0.6391 0.3178 0.3932 0.0031  0.0183  -0.0533 577 THR A N   
864  C CA  . THR A 110 ? 0.6280 0.3205 0.3682 0.0676  0.0248  -0.0848 577 THR A CA  
865  C C   . THR A 110 ? 0.6243 0.3407 0.3285 0.1124  0.0012  -0.1087 577 THR A C   
866  O O   . THR A 110 ? 0.6510 0.4051 0.3034 0.1184  -0.0232 -0.0846 577 THR A O   
867  C CB  . THR A 110 ? 0.6213 0.2814 0.3656 0.0438  0.0238  -0.0831 577 THR A CB  
868  O OG1 . THR A 110 ? 0.6306 0.2446 0.3056 0.0534  0.0335  -0.0492 577 THR A OG1 
869  C CG2 . THR A 110 ? 0.6215 0.2650 0.3553 0.0156  0.0515  -0.0814 577 THR A CG2 
870  N N   . PHE A 111 ? 0.6171 0.3286 0.3350 0.1612  -0.0376 -0.0789 578 PHE A N   
871  C CA  . PHE A 111 ? 0.6247 0.3689 0.3684 0.1648  0.0112  -0.0729 578 PHE A CA  
872  C C   . PHE A 111 ? 0.6738 0.3797 0.3944 0.1498  0.0035  -0.0716 578 PHE A C   
873  O O   . PHE A 111 ? 0.7487 0.4156 0.3768 0.1382  -0.0339 -0.0896 578 PHE A O   
874  C CB  . PHE A 111 ? 0.6166 0.4041 0.3588 0.1688  0.0571  -0.0966 578 PHE A CB  
875  C CG  . PHE A 111 ? 0.6250 0.5087 0.4013 0.1745  0.0192  -0.0954 578 PHE A CG  
876  C CD1 . PHE A 111 ? 0.6006 0.5603 0.4054 0.1862  -0.0381 -0.0973 578 PHE A CD1 
877  C CD2 . PHE A 111 ? 0.6294 0.5496 0.3989 0.1590  0.0308  -0.1211 578 PHE A CD2 
878  C CE1 . PHE A 111 ? 0.6184 0.5873 0.4306 0.1852  -0.0638 -0.1320 578 PHE A CE1 
879  C CE2 . PHE A 111 ? 0.6368 0.5935 0.4258 0.1650  -0.0230 -0.1119 578 PHE A CE2 
880  C CZ  . PHE A 111 ? 0.6508 0.6111 0.4352 0.1643  -0.0534 -0.1247 578 PHE A CZ  
881  N N   . GLY A 112 ? 0.6246 0.3534 0.3627 0.1498  -0.0020 -0.0474 579 GLY A N   
882  C CA  . GLY A 112 ? 0.5727 0.3185 0.3831 0.1812  0.0618  -0.0844 579 GLY A CA  
883  C C   . GLY A 112 ? 0.5503 0.3173 0.3553 0.1663  0.0412  -0.0269 579 GLY A C   
884  O O   . GLY A 112 ? 0.5445 0.3956 0.3483 0.1640  0.1077  0.0108  579 GLY A O   
885  N N   . ASP A 113 ? 0.5326 0.2885 0.3357 0.1518  0.0300  -0.0587 580 ASP A N   
886  C CA  . ASP A 113 ? 0.5124 0.3129 0.4372 0.1520  0.0384  -0.0389 580 ASP A CA  
887  C C   . ASP A 113 ? 0.4084 0.2797 0.4096 0.1372  0.0340  -0.0677 580 ASP A C   
888  O O   . ASP A 113 ? 0.3815 0.3041 0.4248 0.1511  0.0952  -0.0283 580 ASP A O   
889  C CB  . ASP A 113 ? 0.6106 0.3264 0.4340 0.1385  0.0913  0.0117  580 ASP A CB  
890  C CG  . ASP A 113 ? 0.6928 0.3480 0.5147 0.1221  0.0664  0.0684  580 ASP A CG  
891  O OD1 . ASP A 113 ? 0.6740 0.2955 0.4548 0.1425  0.1468  0.0987  580 ASP A OD1 
892  O OD2 . ASP A 113 ? 0.7598 0.3987 0.5569 0.1196  0.0594  0.0606  580 ASP A OD2 
893  N N   . ARG A 114 ? 0.3831 0.2904 0.2728 0.1276  0.0291  -0.0180 581 ARG A N   
894  C CA  . ARG A 114 ? 0.3495 0.2723 0.1775 0.1191  -0.0347 -0.0080 581 ARG A CA  
895  C C   . ARG A 114 ? 0.3749 0.2882 0.2534 0.0765  -0.0046 0.0052  581 ARG A C   
896  O O   . ARG A 114 ? 0.3834 0.2644 0.2861 0.0100  -0.0160 -0.0337 581 ARG A O   
897  C CB  . ARG A 114 ? 0.3405 0.2990 0.1826 0.0734  0.0055  -0.0047 581 ARG A CB  
898  C CG  . ARG A 114 ? 0.3378 0.3113 0.2016 0.1291  0.0136  -0.0167 581 ARG A CG  
899  C CD  . ARG A 114 ? 0.3877 0.3162 0.1999 0.1042  0.0480  0.0262  581 ARG A CD  
900  N NE  . ARG A 114 ? 0.4013 0.2652 0.2760 0.0848  0.0348  0.0231  581 ARG A NE  
901  C CZ  . ARG A 114 ? 0.4354 0.2661 0.3068 0.0931  0.0335  0.0015  581 ARG A CZ  
902  N NH1 . ARG A 114 ? 0.4547 0.2235 0.3189 0.0514  0.0606  -0.0436 581 ARG A NH1 
903  N NH2 . ARG A 114 ? 0.4134 0.2679 0.2775 0.1302  0.0182  0.0472  581 ARG A NH2 
904  N N   . MET A 115 ? 0.3563 0.2668 0.2372 0.1027  0.0588  0.0270  582 MET A N   
905  C CA  . MET A 115 ? 0.3274 0.2604 0.1713 0.0807  0.0249  -0.0086 582 MET A CA  
906  C C   . MET A 115 ? 0.3184 0.2527 0.1960 0.0638  0.0128  -0.0358 582 MET A C   
907  O O   . MET A 115 ? 0.2775 0.2630 0.2399 0.0991  0.0218  -0.0310 582 MET A O   
908  C CB  . MET A 115 ? 0.2869 0.2387 0.2211 0.0216  0.0622  0.0240  582 MET A CB  
909  C CG  . MET A 115 ? 0.3102 0.3282 0.3680 0.0280  0.1095  0.1457  582 MET A CG  
910  S SD  . MET A 115 ? 0.3469 0.3900 0.4710 0.0549  0.1020  0.0784  582 MET A SD  
911  C CE  . MET A 115 ? 0.2168 0.3275 0.4586 0.1219  0.1376  0.1107  582 MET A CE  
912  N N   . PHE A 116 ? 0.2687 0.2103 0.1951 0.0511  0.0077  -0.0141 583 PHE A N   
913  C CA  . PHE A 116 ? 0.2466 0.2002 0.2120 0.0342  -0.0119 -0.0154 583 PHE A CA  
914  C C   . PHE A 116 ? 0.2488 0.2091 0.2241 0.0446  -0.0292 0.0159  583 PHE A C   
915  O O   . PHE A 116 ? 0.2726 0.2322 0.3312 0.0746  -0.0292 0.0090  583 PHE A O   
916  C CB  . PHE A 116 ? 0.2575 0.1845 0.2327 0.0663  0.0000  -0.0128 583 PHE A CB  
917  C CG  . PHE A 116 ? 0.2617 0.1689 0.2745 0.0724  -0.0056 -0.0230 583 PHE A CG  
918  C CD1 . PHE A 116 ? 0.2347 0.1742 0.2192 0.0920  -0.0238 0.0499  583 PHE A CD1 
919  C CD2 . PHE A 116 ? 0.1865 0.1999 0.2697 0.0495  -0.0096 -0.0851 583 PHE A CD2 
920  C CE1 . PHE A 116 ? 0.2108 0.2138 0.2730 0.0324  0.0159  -0.0024 583 PHE A CE1 
921  C CE2 . PHE A 116 ? 0.1919 0.2275 0.2558 0.0508  -0.0051 -0.0468 583 PHE A CE2 
922  C CZ  . PHE A 116 ? 0.2012 0.2527 0.3062 0.0365  -0.0289 -0.0284 583 PHE A CZ  
923  N N   . PHE A 117 ? 0.2306 0.2231 0.1901 0.0497  -0.0385 0.0253  584 PHE A N   
924  C CA  . PHE A 117 ? 0.2035 0.2744 0.2283 0.0257  0.0009  -0.0061 584 PHE A CA  
925  C C   . PHE A 117 ? 0.1902 0.2481 0.2870 0.0411  0.0107  0.0047  584 PHE A C   
926  O O   . PHE A 117 ? 0.1953 0.2326 0.2835 0.0528  -0.0105 0.0127  584 PHE A O   
927  C CB  . PHE A 117 ? 0.2117 0.3323 0.2537 0.0199  0.0403  0.0140  584 PHE A CB  
928  C CG  . PHE A 117 ? 0.2312 0.3925 0.3217 0.0109  0.0325  0.0270  584 PHE A CG  
929  C CD1 . PHE A 117 ? 0.2724 0.3686 0.3238 0.0430  0.0725  0.0489  584 PHE A CD1 
930  C CD2 . PHE A 117 ? 0.2734 0.4381 0.3843 0.0242  0.0078  0.0781  584 PHE A CD2 
931  C CE1 . PHE A 117 ? 0.3239 0.4386 0.3874 0.0505  0.0082  0.0706  584 PHE A CE1 
932  C CE2 . PHE A 117 ? 0.2846 0.4474 0.3643 0.0166  0.0329  0.0964  584 PHE A CE2 
933  C CZ  . PHE A 117 ? 0.2922 0.4670 0.3814 0.0346  -0.0021 0.0710  584 PHE A CZ  
934  N N   . ILE A 118 ? 0.2051 0.2080 0.2558 0.0486  -0.0363 -0.0058 585 ILE A N   
935  C CA  . ILE A 118 ? 0.2212 0.1776 0.1927 0.0161  -0.0014 -0.0787 585 ILE A CA  
936  C C   . ILE A 118 ? 0.2881 0.2205 0.2293 0.0093  -0.0265 -0.0094 585 ILE A C   
937  O O   . ILE A 118 ? 0.3092 0.1818 0.2367 0.0446  -0.0366 0.0124  585 ILE A O   
938  C CB  . ILE A 118 ? 0.1813 0.2112 0.1836 0.0047  -0.0238 -0.0453 585 ILE A CB  
939  C CG1 . ILE A 118 ? 0.1429 0.1806 0.2925 0.0344  -0.0838 -0.0565 585 ILE A CG1 
940  C CG2 . ILE A 118 ? 0.2062 0.2183 0.1805 0.0059  0.0012  -0.0869 585 ILE A CG2 
941  C CD1 . ILE A 118 ? 0.1787 0.2404 0.2766 0.0505  -0.0681 -0.0471 585 ILE A CD1 
942  N N   . GLN A 119 ? 0.2825 0.2269 0.2055 -0.0201 -0.0236 -0.0028 586 GLN A N   
943  C CA  . GLN A 119 ? 0.3062 0.2939 0.2378 0.0114  -0.0141 -0.0338 586 GLN A CA  
944  C C   . GLN A 119 ? 0.3584 0.2901 0.2663 0.0302  -0.0030 -0.0180 586 GLN A C   
945  O O   . GLN A 119 ? 0.4292 0.2356 0.3270 0.0166  -0.0178 -0.0457 586 GLN A O   
946  C CB  . GLN A 119 ? 0.3078 0.3352 0.2615 -0.0095 -0.0509 -0.1365 586 GLN A CB  
947  C CG  . GLN A 119 ? 0.3561 0.3768 0.3451 0.0557  -0.1406 -0.1793 586 GLN A CG  
948  C CD  . GLN A 119 ? 0.4917 0.4810 0.5841 0.0482  -0.1447 -0.1537 586 GLN A CD  
949  O OE1 . GLN A 119 ? 0.5494 0.5655 0.6589 0.1255  -0.1449 -0.1158 586 GLN A OE1 
950  N NE2 . GLN A 119 ? 0.5178 0.4764 0.6687 0.0003  -0.1878 -0.1621 586 GLN A NE2 
951  N N   . GLN A 120 ? 0.3332 0.2666 0.2178 0.0398  -0.0289 0.0329  587 GLN A N   
952  C CA  . GLN A 120 ? 0.3640 0.2808 0.2942 0.0178  -0.0307 -0.0697 587 GLN A CA  
953  C C   . GLN A 120 ? 0.2742 0.2644 0.3263 0.0005  -0.0202 -0.0606 587 GLN A C   
954  O O   . GLN A 120 ? 0.2678 0.2800 0.3590 -0.0008 -0.0131 -0.0592 587 GLN A O   
955  C CB  . GLN A 120 ? 0.4759 0.2945 0.3242 0.0288  -0.0312 -0.1812 587 GLN A CB  
956  C CG  . GLN A 120 ? 0.5619 0.4362 0.4200 0.0816  -0.0984 -0.1770 587 GLN A CG  
957  C CD  . GLN A 120 ? 0.6121 0.5354 0.5045 0.1471  -0.0903 -0.1112 587 GLN A CD  
958  O OE1 . GLN A 120 ? 0.6133 0.6307 0.5553 0.1734  -0.0610 -0.0758 587 GLN A OE1 
959  N NE2 . GLN A 120 ? 0.5934 0.5139 0.4553 0.1929  -0.1382 -0.0460 587 GLN A NE2 
960  N N   . GLY A 121 ? 0.2303 0.2402 0.2948 0.0021  -0.0749 -0.0669 588 GLY A N   
961  C CA  . GLY A 121 ? 0.2308 0.2659 0.2943 0.0056  -0.1129 -0.0342 588 GLY A CA  
962  C C   . GLY A 121 ? 0.2290 0.2457 0.3228 0.0229  -0.0663 -0.0320 588 GLY A C   
963  O O   . GLY A 121 ? 0.2581 0.1894 0.4261 0.0114  -0.0052 -0.0320 588 GLY A O   
964  N N   . ILE A 122 ? 0.1859 0.2725 0.2949 0.0195  -0.0856 -0.0283 589 ILE A N   
965  C CA  . ILE A 122 ? 0.1990 0.3006 0.3076 0.0196  -0.0310 -0.0478 589 ILE A CA  
966  C C   . ILE A 122 ? 0.2183 0.2797 0.2749 0.0131  -0.0179 -0.0590 589 ILE A C   
967  O O   . ILE A 122 ? 0.2963 0.2998 0.2889 0.0586  0.0219  -0.0482 589 ILE A O   
968  C CB  . ILE A 122 ? 0.2045 0.3110 0.3366 0.0209  -0.0603 0.0057  589 ILE A CB  
969  C CG1 . ILE A 122 ? 0.2427 0.4146 0.3563 0.0781  -0.0191 -0.0551 589 ILE A CG1 
970  C CG2 . ILE A 122 ? 0.1612 0.3417 0.4024 -0.0385 -0.0664 0.0139  589 ILE A CG2 
971  C CD1 . ILE A 122 ? 0.2777 0.4487 0.4481 0.1496  -0.0126 -0.0506 589 ILE A CD1 
972  N N   . VAL A 123 ? 0.1577 0.2701 0.2818 0.0450  -0.0155 -0.0137 590 VAL A N   
973  C CA  . VAL A 123 ? 0.1629 0.2356 0.2646 0.0561  -0.0406 -0.0096 590 VAL A CA  
974  C C   . VAL A 123 ? 0.2436 0.2598 0.2719 0.0494  -0.0699 -0.0287 590 VAL A C   
975  O O   . VAL A 123 ? 0.2680 0.2758 0.2721 0.0805  -0.0843 -0.0210 590 VAL A O   
976  C CB  . VAL A 123 ? 0.2133 0.2502 0.1953 -0.0019 0.0026  0.0516  590 VAL A CB  
977  C CG1 . VAL A 123 ? 0.1924 0.2632 0.2393 -0.0429 -0.0390 0.0900  590 VAL A CG1 
978  C CG2 . VAL A 123 ? 0.2358 0.2429 0.2476 -0.0350 0.0141  -0.0010 590 VAL A CG2 
979  N N   . ASP A 124 ? 0.1938 0.2624 0.3149 0.0045  -0.0646 -0.0317 591 ASP A N   
980  C CA  . ASP A 124 ? 0.2192 0.2830 0.2830 -0.0499 -0.0435 -0.0196 591 ASP A CA  
981  C C   . ASP A 124 ? 0.2297 0.2779 0.2489 0.0045  -0.0123 0.0036  591 ASP A C   
982  O O   . ASP A 124 ? 0.2329 0.2697 0.2775 -0.0025 -0.0207 0.0114  591 ASP A O   
983  C CB  . ASP A 124 ? 0.2313 0.4035 0.3852 -0.0601 -0.0097 -0.0386 591 ASP A CB  
984  C CG  . ASP A 124 ? 0.2985 0.4392 0.4722 -0.0613 0.0281  -0.0348 591 ASP A CG  
985  O OD1 . ASP A 124 ? 0.3547 0.3913 0.4632 -0.0550 0.0526  -0.0582 591 ASP A OD1 
986  O OD2 . ASP A 124 ? 0.2718 0.4802 0.4977 -0.0427 0.0185  -0.0355 591 ASP A OD2 
987  N N   . ILE A 125 ? 0.2779 0.2710 0.2196 0.0267  -0.0522 -0.0026 592 ILE A N   
988  C CA  . ILE A 125 ? 0.2828 0.2843 0.2391 -0.0221 -0.0568 -0.0089 592 ILE A CA  
989  C C   . ILE A 125 ? 0.2765 0.3277 0.2880 -0.0090 -0.0531 0.0002  592 ILE A C   
990  O O   . ILE A 125 ? 0.2584 0.3318 0.3127 0.0602  -0.0837 -0.0029 592 ILE A O   
991  C CB  . ILE A 125 ? 0.2811 0.2460 0.2614 -0.0356 -0.0706 0.0172  592 ILE A CB  
992  C CG1 . ILE A 125 ? 0.2461 0.2344 0.3100 0.0123  -0.0441 0.0462  592 ILE A CG1 
993  C CG2 . ILE A 125 ? 0.2718 0.2595 0.2951 -0.0203 -0.0152 0.0684  592 ILE A CG2 
994  C CD1 . ILE A 125 ? 0.2209 0.2334 0.2856 0.0385  0.0062  0.0157  592 ILE A CD1 
995  N N   . ILE A 126 ? 0.2876 0.3617 0.2803 -0.1139 -0.0640 -0.0055 593 ILE A N   
996  C CA  . ILE A 126 ? 0.3088 0.3774 0.2895 -0.0959 -0.0886 0.0270  593 ILE A CA  
997  C C   . ILE A 126 ? 0.3467 0.3854 0.3378 -0.0582 -0.1495 -0.0339 593 ILE A C   
998  O O   . ILE A 126 ? 0.3347 0.3820 0.3832 -0.0693 -0.0843 -0.0140 593 ILE A O   
999  C CB  . ILE A 126 ? 0.3048 0.3806 0.3768 -0.1317 -0.0143 0.0139  593 ILE A CB  
1000 C CG1 . ILE A 126 ? 0.3295 0.3749 0.3271 -0.1501 -0.0038 0.0899  593 ILE A CG1 
1001 C CG2 . ILE A 126 ? 0.3016 0.3935 0.4759 -0.1071 -0.0517 0.0063  593 ILE A CG2 
1002 C CD1 . ILE A 126 ? 0.3407 0.3831 0.3364 -0.1911 0.0230  0.0881  593 ILE A CD1 
1003 N N   . MET A 127 ? 0.3954 0.4000 0.3546 -0.0859 -0.2054 -0.0536 594 MET A N   
1004 C CA  . MET A 127 ? 0.4871 0.4692 0.3862 -0.0763 -0.2280 -0.1069 594 MET A CA  
1005 C C   . MET A 127 ? 0.5742 0.5483 0.5045 -0.0761 -0.2274 -0.0974 594 MET A C   
1006 O O   . MET A 127 ? 0.6175 0.5802 0.5676 -0.0907 -0.2377 -0.1314 594 MET A O   
1007 C CB  . MET A 127 ? 0.5515 0.5211 0.4410 -0.0550 -0.1604 -0.0744 594 MET A CB  
1008 C CG  . MET A 127 ? 0.6278 0.6139 0.5303 -0.0367 -0.1093 -0.0485 594 MET A CG  
1009 S SD  . MET A 127 ? 0.7480 0.7067 0.5895 -0.0113 -0.0913 -0.0030 594 MET A SD  
1010 C CE  . MET A 127 ? 0.7499 0.7178 0.4658 -0.0324 -0.0837 0.0000  594 MET A CE  
1011 N N   . SER A 128 ? 0.5970 0.5856 0.6422 -0.0518 -0.2349 -0.0731 595 SER A N   
1012 C CA  . SER A 128 ? 0.6457 0.6459 0.7290 -0.0893 -0.2315 -0.1288 595 SER A CA  
1013 C C   . SER A 128 ? 0.6449 0.6547 0.7910 -0.1540 -0.2058 -0.1216 595 SER A C   
1014 O O   . SER A 128 ? 0.6422 0.6411 0.8296 -0.1687 -0.1733 -0.1325 595 SER A O   
1015 C CB  . SER A 128 ? 0.7166 0.6993 0.7336 -0.0389 -0.2077 -0.1198 595 SER A CB  
1016 O OG  . SER A 128 ? 0.7665 0.7288 0.7959 -0.0381 -0.1827 -0.1452 595 SER A OG  
1017 N N   . ASP A 129 ? 0.6459 0.6573 0.7640 -0.1985 -0.2287 -0.1319 596 ASP A N   
1018 C CA  . ASP A 129 ? 0.6849 0.7015 0.7737 -0.1970 -0.2149 -0.1238 596 ASP A CA  
1019 C C   . ASP A 129 ? 0.6225 0.7082 0.7353 -0.2252 -0.2405 -0.0718 596 ASP A C   
1020 O O   . ASP A 129 ? 0.5681 0.7273 0.7529 -0.2882 -0.2937 -0.0889 596 ASP A O   
1021 C CB  . ASP A 129 ? 0.7700 0.7489 0.8663 -0.1941 -0.1486 -0.1328 596 ASP A CB  
1022 C CG  . ASP A 129 ? 0.8531 0.7937 0.9322 -0.1908 -0.0849 -0.1122 596 ASP A CG  
1023 O OD1 . ASP A 129 ? 0.8650 0.7756 0.9423 -0.2427 -0.1111 -0.1436 596 ASP A OD1 
1024 O OD2 . ASP A 129 ? 0.9127 0.8408 0.9815 -0.1439 -0.0818 -0.0828 596 ASP A OD2 
1025 N N   . GLY A 130 ? 0.6056 0.6988 0.6815 -0.2013 -0.2016 -0.0504 597 GLY A N   
1026 C CA  . GLY A 130 ? 0.5486 0.6676 0.5630 -0.1940 -0.1659 -0.0221 597 GLY A CA  
1027 C C   . GLY A 130 ? 0.4950 0.6584 0.4751 -0.1933 -0.1744 -0.0531 597 GLY A C   
1028 O O   . GLY A 130 ? 0.4853 0.6825 0.4815 -0.1872 -0.1229 0.0040  597 GLY A O   
1029 N N   . VAL A 131 ? 0.4655 0.6268 0.4559 -0.1452 -0.1831 -0.0382 598 VAL A N   
1030 C CA  . VAL A 131 ? 0.4355 0.6615 0.5167 -0.0930 -0.1923 -0.0098 598 VAL A CA  
1031 C C   . VAL A 131 ? 0.3475 0.6058 0.4765 -0.0887 -0.2069 -0.0055 598 VAL A C   
1032 O O   . VAL A 131 ? 0.3394 0.5994 0.5023 -0.0345 -0.1779 0.0064  598 VAL A O   
1033 C CB  . VAL A 131 ? 0.4614 0.7357 0.6485 -0.0283 -0.1288 0.0215  598 VAL A CB  
1034 C CG1 . VAL A 131 ? 0.5372 0.7822 0.7616 -0.0312 -0.1281 0.0287  598 VAL A CG1 
1035 C CG2 . VAL A 131 ? 0.4115 0.7520 0.6530 -0.0188 -0.1378 0.0363  598 VAL A CG2 
1036 N N   . ILE A 132 ? 0.3048 0.5515 0.4078 -0.0927 -0.1806 -0.0042 599 ILE A N   
1037 C CA  . ILE A 132 ? 0.3777 0.4979 0.3662 -0.0500 -0.1842 -0.0225 599 ILE A CA  
1038 C C   . ILE A 132 ? 0.4258 0.4589 0.4110 0.0354  -0.1209 -0.0310 599 ILE A C   
1039 O O   . ILE A 132 ? 0.4256 0.4446 0.4664 0.0952  -0.1335 -0.0217 599 ILE A O   
1040 C CB  . ILE A 132 ? 0.3682 0.5311 0.4180 -0.0518 -0.0756 -0.0315 599 ILE A CB  
1041 C CG1 . ILE A 132 ? 0.3737 0.5567 0.4045 -0.0179 -0.0121 -0.0384 599 ILE A CG1 
1042 C CG2 . ILE A 132 ? 0.2932 0.5031 0.4327 -0.0591 -0.0906 -0.0495 599 ILE A CG2 
1043 C CD1 . ILE A 132 ? 0.3438 0.5914 0.4543 0.0198  -0.0150 -0.0505 599 ILE A CD1 
1044 N N   . ALA A 133 ? 0.4209 0.4317 0.3444 0.0752  -0.1099 -0.0475 600 ALA A N   
1045 C CA  . ALA A 133 ? 0.4635 0.4445 0.3400 0.0562  -0.0670 -0.0618 600 ALA A CA  
1046 C C   . ALA A 133 ? 0.4402 0.4119 0.3501 0.0888  -0.0985 0.0034  600 ALA A C   
1047 O O   . ALA A 133 ? 0.4603 0.4673 0.3230 0.1153  -0.1583 0.0404  600 ALA A O   
1048 C CB  . ALA A 133 ? 0.5063 0.4930 0.3211 0.0427  -0.0528 -0.0158 600 ALA A CB  
1049 N N   . THR A 134 ? 0.3896 0.3714 0.2652 0.0620  -0.1071 -0.0489 601 THR A N   
1050 C CA  . THR A 134 ? 0.3593 0.3886 0.2874 0.0630  -0.0405 0.0170  601 THR A CA  
1051 C C   . THR A 134 ? 0.3026 0.3565 0.2949 0.0760  -0.0980 0.0109  601 THR A C   
1052 O O   . THR A 134 ? 0.2936 0.3285 0.2823 0.0480  -0.0612 -0.0054 601 THR A O   
1053 C CB  . THR A 134 ? 0.3213 0.4193 0.4199 0.0869  -0.0108 0.0319  601 THR A CB  
1054 O OG1 . THR A 134 ? 0.3417 0.3791 0.4730 0.1214  -0.0228 0.0954  601 THR A OG1 
1055 C CG2 . THR A 134 ? 0.2621 0.4392 0.4388 0.0989  -0.0205 0.0708  601 THR A CG2 
1056 N N   . SER A 135 ? 0.2675 0.3243 0.2658 0.0380  -0.1351 0.0407  602 SER A N   
1057 C CA  . SER A 135 ? 0.1986 0.3637 0.3013 0.0190  -0.0701 0.0493  602 SER A CA  
1058 C C   . SER A 135 ? 0.2537 0.3262 0.3165 0.0362  -0.0411 0.0434  602 SER A C   
1059 O O   . SER A 135 ? 0.2984 0.3680 0.3276 0.0276  -0.0524 0.1103  602 SER A O   
1060 C CB  . SER A 135 ? 0.1692 0.4327 0.3943 -0.0112 -0.0266 0.0024  602 SER A CB  
1061 O OG  . SER A 135 ? 0.1990 0.4745 0.4087 0.0367  -0.0166 0.0192  602 SER A OG  
1062 N N   . LEU A 136 ? 0.2354 0.2916 0.2600 0.0346  -0.0250 0.0227  603 LEU A N   
1063 C CA  . LEU A 136 ? 0.2514 0.2828 0.2448 0.0197  0.0420  -0.0355 603 LEU A CA  
1064 C C   . LEU A 136 ? 0.2847 0.2679 0.2780 0.0144  -0.0305 -0.0420 603 LEU A C   
1065 O O   . LEU A 136 ? 0.2839 0.2303 0.2416 0.0105  -0.0547 0.0434  603 LEU A O   
1066 C CB  . LEU A 136 ? 0.2515 0.2889 0.2253 0.0452  0.0204  -0.0199 603 LEU A CB  
1067 C CG  . LEU A 136 ? 0.2902 0.3182 0.2471 0.0193  0.0066  -0.0368 603 LEU A CG  
1068 C CD1 . LEU A 136 ? 0.3130 0.2853 0.2629 0.0390  0.0435  -0.0944 603 LEU A CD1 
1069 C CD2 . LEU A 136 ? 0.3088 0.3426 0.2292 0.0135  -0.0303 -0.0263 603 LEU A CD2 
1070 N N   . SER A 137 ? 0.2074 0.2885 0.2936 -0.0110 -0.0426 -0.0239 604 SER A N   
1071 C CA  . SER A 137 ? 0.2131 0.2693 0.2382 0.0698  -0.0306 -0.0057 604 SER A CA  
1072 C C   . SER A 137 ? 0.2625 0.2822 0.2277 0.0485  -0.0237 -0.0175 604 SER A C   
1073 O O   . SER A 137 ? 0.2723 0.2955 0.2835 0.0499  0.0476  0.0579  604 SER A O   
1074 C CB  . SER A 137 ? 0.2561 0.2517 0.4614 0.1079  0.0291  0.0656  604 SER A CB  
1075 O OG  . SER A 137 ? 0.3121 0.3351 0.4933 0.0159  0.0187  0.0153  604 SER A OG  
1076 N N   . ASP A 138 ? 0.3306 0.2681 0.2389 0.0054  -0.0552 -0.0654 605 ASP A N   
1077 C CA  . ASP A 138 ? 0.3315 0.2289 0.2441 0.0121  -0.0746 -0.0415 605 ASP A CA  
1078 C C   . ASP A 138 ? 0.3203 0.2531 0.3669 0.0168  -0.0103 -0.0514 605 ASP A C   
1079 O O   . ASP A 138 ? 0.2492 0.2395 0.3998 0.0748  -0.0237 -0.0536 605 ASP A O   
1080 C CB  . ASP A 138 ? 0.4029 0.2805 0.3093 -0.0087 -0.0701 -0.1148 605 ASP A CB  
1081 C CG  . ASP A 138 ? 0.4239 0.2902 0.4118 -0.0151 -0.0465 -0.0943 605 ASP A CG  
1082 O OD1 . ASP A 138 ? 0.4185 0.2378 0.4093 0.0123  -0.0266 -0.0616 605 ASP A OD1 
1083 O OD2 . ASP A 138 ? 0.4534 0.3523 0.4298 -0.0340 -0.0250 -0.1121 605 ASP A OD2 
1084 N N   . GLY A 139 ? 0.3115 0.2148 0.3683 -0.0759 -0.0114 -0.0291 606 GLY A N   
1085 C CA  . GLY A 139 ? 0.3634 0.2555 0.3133 -0.0492 -0.0379 0.0138  606 GLY A CA  
1086 C C   . GLY A 139 ? 0.3640 0.2664 0.3398 -0.0214 0.0229  -0.0144 606 GLY A C   
1087 O O   . GLY A 139 ? 0.3872 0.3303 0.3684 -0.0145 0.0184  -0.0215 606 GLY A O   
1088 N N   . SER A 140 ? 0.3211 0.2441 0.3201 0.0092  0.0133  -0.0479 607 SER A N   
1089 C CA  . SER A 140 ? 0.3183 0.2432 0.2956 0.0178  0.0022  -0.0704 607 SER A CA  
1090 C C   . SER A 140 ? 0.3050 0.2343 0.2971 0.0566  -0.0086 -0.0271 607 SER A C   
1091 O O   . SER A 140 ? 0.3358 0.1975 0.3321 0.1163  -0.0256 0.0235  607 SER A O   
1092 C CB  . SER A 140 ? 0.3888 0.3196 0.2682 -0.0134 -0.0911 -0.1582 607 SER A CB  
1093 O OG  . SER A 140 ? 0.4156 0.3703 0.4276 0.0887  -0.1023 -0.0223 607 SER A OG  
1094 N N   . TYR A 141 ? 0.2463 0.2000 0.2451 0.0407  0.0168  0.0027  608 TYR A N   
1095 C CA  . TYR A 141 ? 0.3181 0.2117 0.2315 0.0011  -0.0402 -0.0288 608 TYR A CA  
1096 C C   . TYR A 141 ? 0.2929 0.2462 0.2142 0.0007  -0.0203 -0.0777 608 TYR A C   
1097 O O   . TYR A 141 ? 0.2559 0.2910 0.3115 0.0169  -0.0898 -0.0663 608 TYR A O   
1098 C CB  . TYR A 141 ? 0.3715 0.2082 0.1851 -0.0094 -0.0817 0.0079  608 TYR A CB  
1099 C CG  . TYR A 141 ? 0.4984 0.2699 0.3001 0.0156  -0.0963 0.0415  608 TYR A CG  
1100 C CD1 . TYR A 141 ? 0.5695 0.3190 0.3034 0.0130  -0.0387 0.0531  608 TYR A CD1 
1101 C CD2 . TYR A 141 ? 0.6304 0.3428 0.3804 -0.0237 -0.0858 0.0618  608 TYR A CD2 
1102 C CE1 . TYR A 141 ? 0.6522 0.3655 0.3233 0.0076  -0.0180 0.0085  608 TYR A CE1 
1103 C CE2 . TYR A 141 ? 0.7104 0.3854 0.3883 -0.0296 -0.0964 -0.0143 608 TYR A CE2 
1104 C CZ  . TYR A 141 ? 0.7174 0.4105 0.3944 0.0207  -0.0453 0.0271  608 TYR A CZ  
1105 O OH  . TYR A 141 ? 0.7413 0.4396 0.4870 0.0425  0.0055  0.0605  608 TYR A OH  
1106 N N   . PHE A 142 ? 0.2682 0.1795 0.1989 0.0328  -0.0364 -0.0834 609 PHE A N   
1107 C CA  . PHE A 142 ? 0.2671 0.2209 0.1977 0.0400  -0.0319 -0.0660 609 PHE A CA  
1108 C C   . PHE A 142 ? 0.2540 0.2450 0.1872 0.0779  -0.0469 -0.0176 609 PHE A C   
1109 O O   . PHE A 142 ? 0.2872 0.2762 0.2031 0.0800  -0.0098 0.0002  609 PHE A O   
1110 C CB  . PHE A 142 ? 0.2150 0.2478 0.2200 0.0541  -0.0804 0.0187  609 PHE A CB  
1111 C CG  . PHE A 142 ? 0.2336 0.2561 0.2614 0.0382  -0.0581 0.0017  609 PHE A CG  
1112 C CD1 . PHE A 142 ? 0.2461 0.2152 0.2419 0.0342  -0.0580 0.0481  609 PHE A CD1 
1113 C CD2 . PHE A 142 ? 0.1733 0.2406 0.2790 0.0590  -0.0764 -0.0273 609 PHE A CD2 
1114 C CE1 . PHE A 142 ? 0.2333 0.2367 0.2054 0.0155  -0.0774 0.0462  609 PHE A CE1 
1115 C CE2 . PHE A 142 ? 0.1851 0.2281 0.2605 0.0254  -0.0469 -0.0364 609 PHE A CE2 
1116 C CZ  . PHE A 142 ? 0.2027 0.2054 0.2385 0.0331  -0.0279 0.0334  609 PHE A CZ  
1117 N N   . GLY A 143 ? 0.2562 0.2110 0.1562 0.0442  -0.0384 -0.0508 610 GLY A N   
1118 C CA  . GLY A 143 ? 0.2771 0.2189 0.2024 0.0394  0.0299  0.0380  610 GLY A CA  
1119 C C   . GLY A 143 ? 0.3190 0.2468 0.2631 0.0247  0.0260  -0.0059 610 GLY A C   
1120 O O   . GLY A 143 ? 0.3641 0.2637 0.2988 0.0275  0.1165  -0.0594 610 GLY A O   
1121 N N   . GLU A 144 ? 0.2945 0.1893 0.2514 -0.0578 -0.0232 -0.0304 611 GLU A N   
1122 C CA  . GLU A 144 ? 0.3358 0.2720 0.2953 0.0164  0.0212  -0.0110 611 GLU A CA  
1123 C C   . GLU A 144 ? 0.3262 0.3157 0.2728 0.0534  -0.0172 -0.0250 611 GLU A C   
1124 O O   . GLU A 144 ? 0.3658 0.3531 0.3070 0.0403  0.0114  0.0159  611 GLU A O   
1125 C CB  . GLU A 144 ? 0.3273 0.3135 0.3532 -0.0050 -0.0132 0.0126  611 GLU A CB  
1126 C CG  . GLU A 144 ? 0.3772 0.3257 0.2937 -0.0223 -0.0171 0.0014  611 GLU A CG  
1127 C CD  . GLU A 144 ? 0.4045 0.3527 0.2624 0.0583  -0.0341 -0.0292 611 GLU A CD  
1128 O OE1 . GLU A 144 ? 0.3995 0.3200 0.3147 0.0449  0.0539  0.0936  611 GLU A OE1 
1129 O OE2 . GLU A 144 ? 0.4431 0.4312 0.3954 0.0992  -0.0666 -0.0833 611 GLU A OE2 
1130 N N   . ILE A 145 ? 0.3082 0.2864 0.2310 0.0360  -0.0179 -0.0117 612 ILE A N   
1131 C CA  . ILE A 145 ? 0.3143 0.2992 0.1854 0.0421  -0.0366 -0.0294 612 ILE A CA  
1132 C C   . ILE A 145 ? 0.3528 0.3174 0.2401 0.0510  -0.0341 0.0096  612 ILE A C   
1133 O O   . ILE A 145 ? 0.4038 0.3413 0.2741 0.0670  0.0039  0.0621  612 ILE A O   
1134 C CB  . ILE A 145 ? 0.3424 0.3393 0.2190 0.0703  -0.0786 -0.0366 612 ILE A CB  
1135 C CG1 . ILE A 145 ? 0.4456 0.3499 0.2529 0.0011  -0.0155 0.0311  612 ILE A CG1 
1136 C CG2 . ILE A 145 ? 0.3219 0.3805 0.2409 0.0915  -0.1101 -0.0174 612 ILE A CG2 
1137 C CD1 . ILE A 145 ? 0.5002 0.3821 0.3389 0.0434  0.0047  0.0232  612 ILE A CD1 
1138 N N   . CYS A 146 ? 0.3384 0.2894 0.2850 0.0161  -0.0404 0.0439  613 CYS A N   
1139 C CA  . CYS A 146 ? 0.3370 0.3402 0.3198 0.0817  -0.0562 0.0805  613 CYS A CA  
1140 C C   . CYS A 146 ? 0.3818 0.3505 0.2963 0.0275  -0.0161 0.0116  613 CYS A C   
1141 O O   . CYS A 146 ? 0.4029 0.3854 0.3517 -0.0070 -0.0910 -0.0489 613 CYS A O   
1142 C CB  . CYS A 146 ? 0.4485 0.4351 0.5441 0.0996  0.1325  0.0835  613 CYS A CB  
1143 S SG  . CYS A 146 ? 0.5314 0.5990 0.7519 0.1306  0.1150  0.1581  613 CYS A SG  
1144 N N   . LEU A 147 ? 0.3591 0.3623 0.3327 -0.0077 -0.0575 0.0344  614 LEU A N   
1145 C CA  . LEU A 147 ? 0.3531 0.3768 0.3221 0.0307  -0.0290 0.0115  614 LEU A CA  
1146 C C   . LEU A 147 ? 0.3473 0.3940 0.3547 0.0431  0.0114  -0.0245 614 LEU A C   
1147 O O   . LEU A 147 ? 0.3199 0.3916 0.3743 0.0753  0.0729  0.0037  614 LEU A O   
1148 C CB  . LEU A 147 ? 0.3706 0.3769 0.2729 0.0156  -0.0309 -0.0113 614 LEU A CB  
1149 C CG  . LEU A 147 ? 0.4015 0.3815 0.2489 -0.0024 -0.0359 -0.0358 614 LEU A CG  
1150 C CD1 . LEU A 147 ? 0.4083 0.3941 0.2266 0.0095  0.0298  -0.0696 614 LEU A CD1 
1151 C CD2 . LEU A 147 ? 0.4637 0.3906 0.2526 0.0141  -0.0469 -0.0360 614 LEU A CD2 
1152 N N   . LEU A 148 ? 0.3650 0.3989 0.3596 0.0513  0.0027  0.0372  615 LEU A N   
1153 C CA  . LEU A 148 ? 0.4304 0.4379 0.3656 0.0337  0.0418  0.0275  615 LEU A CA  
1154 C C   . LEU A 148 ? 0.4830 0.5194 0.3719 0.0192  0.0776  0.0137  615 LEU A C   
1155 O O   . LEU A 148 ? 0.5064 0.5584 0.4077 -0.0261 0.1055  -0.0034 615 LEU A O   
1156 C CB  . LEU A 148 ? 0.4288 0.4169 0.3545 0.0270  0.0340  0.0555  615 LEU A CB  
1157 C CG  . LEU A 148 ? 0.4641 0.3704 0.4333 0.0080  0.0500  0.0391  615 LEU A CG  
1158 C CD1 . LEU A 148 ? 0.4649 0.3391 0.4139 -0.0039 0.0501  -0.0911 615 LEU A CD1 
1159 C CD2 . LEU A 148 ? 0.5094 0.4111 0.4361 0.0159  0.0397  0.0717  615 LEU A CD2 
1160 N N   . THR A 149 ? 0.4882 0.5230 0.3588 0.0849  0.0845  0.0123  616 THR A N   
1161 C CA  . THR A 149 ? 0.5476 0.5470 0.3995 0.1094  0.0798  -0.0853 616 THR A CA  
1162 C C   . THR A 149 ? 0.6284 0.6083 0.4188 0.1158  0.1559  -0.1352 616 THR A C   
1163 O O   . THR A 149 ? 0.6721 0.6271 0.4274 0.0968  0.1169  -0.1758 616 THR A O   
1164 C CB  . THR A 149 ? 0.5470 0.5465 0.4131 0.1091  0.0564  -0.1148 616 THR A CB  
1165 O OG1 . THR A 149 ? 0.5246 0.5328 0.3566 0.0758  0.0164  -0.1220 616 THR A OG1 
1166 C CG2 . THR A 149 ? 0.5536 0.5342 0.4712 0.1407  0.0707  -0.1364 616 THR A CG2 
1167 N N   . ARG A 150 ? 0.6845 0.6378 0.4656 0.1530  0.1761  -0.1340 617 ARG A N   
1168 C CA  . ARG A 150 ? 0.7653 0.6467 0.5630 0.1737  0.1874  -0.1440 617 ARG A CA  
1169 C C   . ARG A 150 ? 0.7810 0.6085 0.5199 0.1849  0.1806  -0.1299 617 ARG A C   
1170 O O   . ARG A 150 ? 0.7757 0.5794 0.5603 0.2111  0.1997  -0.0852 617 ARG A O   
1171 C CB  . ARG A 150 ? 0.8103 0.7126 0.6754 0.1914  0.1908  -0.0802 617 ARG A CB  
1172 C CG  . ARG A 150 ? 0.8882 0.7965 0.7615 0.1829  0.1608  -0.0219 617 ARG A CG  
1173 C CD  . ARG A 150 ? 0.9860 0.8852 0.8525 0.1461  0.1557  0.0477  617 ARG A CD  
1174 N NE  . ARG A 150 ? 1.0683 0.9746 0.9579 0.1209  0.1538  0.0723  617 ARG A NE  
1175 C CZ  . ARG A 150 ? 1.1138 1.0360 1.0215 0.1111  0.1465  0.0745  617 ARG A CZ  
1176 N NH1 . ARG A 150 ? 1.1144 1.0502 1.0194 0.1193  0.1085  0.0898  617 ARG A NH1 
1177 N NH2 . ARG A 150 ? 1.1277 1.0549 1.0393 0.0982  0.1711  0.0622  617 ARG A NH2 
1178 N N   . GLU A 151 ? 0.7783 0.5867 0.3876 0.1740  0.1509  -0.1379 618 GLU A N   
1179 C CA  . GLU A 151 ? 0.8028 0.6129 0.3728 0.1189  0.1105  -0.0519 618 GLU A CA  
1180 C C   . GLU A 151 ? 0.7776 0.5610 0.3181 0.1246  0.0348  -0.0045 618 GLU A C   
1181 O O   . GLU A 151 ? 0.8185 0.5629 0.3229 0.0665  0.0232  0.0362  618 GLU A O   
1182 C CB  . GLU A 151 ? 0.8686 0.6928 0.4796 0.0698  0.0748  -0.0147 618 GLU A CB  
1183 C CG  . GLU A 151 ? 0.9504 0.7769 0.6403 0.0259  0.0810  -0.0377 618 GLU A CG  
1184 C CD  . GLU A 151 ? 1.0492 0.8956 0.7859 -0.0040 0.0634  -0.0140 618 GLU A CD  
1185 O OE1 . GLU A 151 ? 1.0959 0.9673 0.8670 0.0173  0.0481  -0.0251 618 GLU A OE1 
1186 O OE2 . GLU A 151 ? 1.0903 0.9254 0.8474 -0.0309 0.0231  0.0086  618 GLU A OE2 
1187 N N   . ARG A 152 ? 0.6714 0.4715 0.2289 0.2276  0.0363  0.0015  619 ARG A N   
1188 C CA  . ARG A 152 ? 0.6731 0.4213 0.2626 0.1668  0.0001  -0.0592 619 ARG A CA  
1189 C C   . ARG A 152 ? 0.6452 0.3881 0.2734 0.1076  -0.0152 -0.0352 619 ARG A C   
1190 O O   . ARG A 152 ? 0.6709 0.3517 0.2638 0.1459  -0.0123 0.0337  619 ARG A O   
1191 C CB  . ARG A 152 ? 0.7061 0.4095 0.2871 0.1218  -0.0371 -0.1191 619 ARG A CB  
1192 C CG  . ARG A 152 ? 0.7369 0.3941 0.3271 0.1151  -0.0629 -0.1458 619 ARG A CG  
1193 C CD  . ARG A 152 ? 0.7592 0.3674 0.3449 0.1118  -0.0502 -0.1659 619 ARG A CD  
1194 N NE  . ARG A 152 ? 0.7768 0.3906 0.3942 0.1243  -0.0037 -0.1432 619 ARG A NE  
1195 C CZ  . ARG A 152 ? 0.8001 0.3923 0.4426 0.1164  -0.0134 -0.1673 619 ARG A CZ  
1196 N NH1 . ARG A 152 ? 0.8099 0.3724 0.4667 0.0962  -0.0706 -0.2080 619 ARG A NH1 
1197 N NH2 . ARG A 152 ? 0.8227 0.4063 0.4498 0.1175  0.0139  -0.1467 619 ARG A NH2 
1198 N N   . ARG A 153 ? 0.5819 0.3733 0.2381 0.0498  -0.0720 -0.0948 620 ARG A N   
1199 C CA  . ARG A 153 ? 0.5115 0.3168 0.2351 0.0625  -0.0897 -0.0715 620 ARG A CA  
1200 C C   . ARG A 153 ? 0.5161 0.3118 0.3044 0.0130  -0.0638 -0.0610 620 ARG A C   
1201 O O   . ARG A 153 ? 0.5115 0.3322 0.2509 -0.0360 -0.0115 -0.0577 620 ARG A O   
1202 C CB  . ARG A 153 ? 0.4585 0.2510 0.1665 0.0999  -0.1017 -0.0326 620 ARG A CB  
1203 C CG  . ARG A 153 ? 0.4306 0.2528 0.2154 0.0743  -0.1455 -0.0675 620 ARG A CG  
1204 C CD  . ARG A 153 ? 0.4074 0.3266 0.1895 0.0482  -0.1290 -0.0725 620 ARG A CD  
1205 N NE  . ARG A 153 ? 0.3445 0.3284 0.2057 0.0503  -0.1014 -0.0438 620 ARG A NE  
1206 C CZ  . ARG A 153 ? 0.3410 0.3456 0.2343 0.0735  -0.0722 -0.0353 620 ARG A CZ  
1207 N NH1 . ARG A 153 ? 0.3300 0.3508 0.2542 0.1000  -0.0252 -0.0573 620 ARG A NH1 
1208 N NH2 . ARG A 153 ? 0.3276 0.3264 0.1781 0.0624  -0.0312 -0.0258 620 ARG A NH2 
1209 N N   . VAL A 154 ? 0.5219 0.2821 0.2497 -0.0069 -0.0348 -0.0556 621 VAL A N   
1210 C CA  . VAL A 154 ? 0.5351 0.2963 0.2753 -0.0186 -0.0372 -0.0103 621 VAL A CA  
1211 C C   . VAL A 154 ? 0.5136 0.3428 0.2751 -0.0227 -0.0718 -0.0163 621 VAL A C   
1212 O O   . VAL A 154 ? 0.5558 0.4181 0.2122 -0.0379 -0.1444 -0.0131 621 VAL A O   
1213 C CB  . VAL A 154 ? 0.5947 0.2624 0.3189 0.0058  -0.0403 -0.0200 621 VAL A CB  
1214 C CG1 . VAL A 154 ? 0.6284 0.3014 0.3534 -0.0120 0.0326  0.0490  621 VAL A CG1 
1215 C CG2 . VAL A 154 ? 0.6097 0.1819 0.3680 0.0373  -0.0811 0.0321  621 VAL A CG2 
1216 N N   . ALA A 155 ? 0.4285 0.2729 0.1752 -0.0387 -0.0439 0.0178  622 ALA A N   
1217 C CA  . ALA A 155 ? 0.3821 0.2189 0.2875 -0.0143 -0.0344 -0.0189 622 ALA A CA  
1218 C C   . ALA A 155 ? 0.3718 0.2326 0.3314 -0.0399 -0.0682 -0.0394 622 ALA A C   
1219 O O   . ALA A 155 ? 0.3087 0.2614 0.4229 -0.0489 -0.0823 0.0218  622 ALA A O   
1220 C CB  . ALA A 155 ? 0.3226 0.1629 0.2728 -0.0128 -0.0673 -0.0450 622 ALA A CB  
1221 N N   . SER A 156 ? 0.3514 0.2385 0.2791 -0.0626 -0.0492 -0.0395 623 SER A N   
1222 C CA  . SER A 156 ? 0.3502 0.2544 0.2844 -0.0458 -0.0509 0.0235  623 SER A CA  
1223 C C   . SER A 156 ? 0.3012 0.2783 0.2296 -0.0308 -0.1099 0.0629  623 SER A C   
1224 O O   . SER A 156 ? 0.2983 0.3105 0.3194 0.0065  -0.0982 0.0202  623 SER A O   
1225 C CB  . SER A 156 ? 0.3715 0.2597 0.3764 -0.0905 -0.0225 -0.0464 623 SER A CB  
1226 O OG  . SER A 156 ? 0.3835 0.2222 0.3773 -0.0588 -0.0550 -0.0272 623 SER A OG  
1227 N N   . VAL A 157 ? 0.2868 0.2884 0.1913 -0.0221 -0.0757 -0.0029 624 VAL A N   
1228 C CA  . VAL A 157 ? 0.3080 0.2753 0.1985 -0.0322 -0.0216 -0.0711 624 VAL A CA  
1229 C C   . VAL A 157 ? 0.3155 0.2913 0.2498 -0.0370 0.0140  -0.0262 624 VAL A C   
1230 O O   . VAL A 157 ? 0.3329 0.2948 0.2912 -0.0350 -0.0556 -0.0508 624 VAL A O   
1231 C CB  . VAL A 157 ? 0.2837 0.2590 0.1243 -0.0199 0.0063  -0.0633 624 VAL A CB  
1232 C CG1 . VAL A 157 ? 0.2275 0.2438 0.1956 0.0344  -0.0195 -0.0868 624 VAL A CG1 
1233 C CG2 . VAL A 157 ? 0.3163 0.2651 0.1139 0.0115  -0.0056 0.0358  624 VAL A CG2 
1234 N N   . LYS A 158 ? 0.2654 0.2693 0.2673 -0.0137 0.0193  -0.0081 625 LYS A N   
1235 C CA  . LYS A 158 ? 0.2563 0.2667 0.2426 0.0088  -0.0078 0.0155  625 LYS A CA  
1236 C C   . LYS A 158 ? 0.2738 0.2523 0.2474 -0.0193 -0.0211 0.0141  625 LYS A C   
1237 O O   . LYS A 158 ? 0.3028 0.2277 0.2571 -0.0197 -0.0624 0.0255  625 LYS A O   
1238 C CB  . LYS A 158 ? 0.2345 0.3034 0.2860 -0.0268 0.0316  0.0830  625 LYS A CB  
1239 C CG  . LYS A 158 ? 0.2091 0.3737 0.2974 -0.0658 -0.0186 0.0483  625 LYS A CG  
1240 C CD  . LYS A 158 ? 0.1909 0.4432 0.3287 -0.0736 -0.0137 0.1373  625 LYS A CD  
1241 C CE  . LYS A 158 ? 0.2079 0.5134 0.3969 -0.1096 -0.0252 0.1084  625 LYS A CE  
1242 N NZ  . LYS A 158 ? 0.3317 0.5732 0.4647 -0.1172 -0.0212 0.0808  625 LYS A NZ  
1243 N N   . CYS A 159 ? 0.2135 0.3049 0.2502 -0.0311 -0.0102 -0.0075 626 CYS A N   
1244 C CA  . CYS A 159 ? 0.2085 0.2744 0.2911 -0.0123 -0.0003 -0.0723 626 CYS A CA  
1245 C C   . CYS A 159 ? 0.2139 0.3141 0.3520 -0.0186 0.0089  0.0034  626 CYS A C   
1246 O O   . CYS A 159 ? 0.3071 0.3319 0.3767 -0.0575 -0.0231 -0.0024 626 CYS A O   
1247 C CB  . CYS A 159 ? 0.1484 0.2757 0.3186 0.0134  -0.0878 -0.0250 626 CYS A CB  
1248 S SG  . CYS A 159 ? 0.2156 0.3351 0.3362 0.0380  -0.0637 -0.0152 626 CYS A SG  
1249 N N   . GLU A 160 ? 0.1975 0.3784 0.2821 0.0240  -0.0245 0.0652  627 GLU A N   
1250 C CA  . GLU A 160 ? 0.1888 0.4248 0.2853 0.0760  -0.0616 0.0653  627 GLU A CA  
1251 C C   . GLU A 160 ? 0.2257 0.4458 0.3250 0.0176  -0.0109 0.0240  627 GLU A C   
1252 O O   . GLU A 160 ? 0.2164 0.5119 0.3652 -0.0263 0.0059  0.0020  627 GLU A O   
1253 C CB  . GLU A 160 ? 0.2043 0.4723 0.4119 0.1323  -0.1687 0.1395  627 GLU A CB  
1254 C CG  . GLU A 160 ? 0.3001 0.5405 0.6253 0.1468  -0.0089 0.1631  627 GLU A CG  
1255 C CD  . GLU A 160 ? 0.4423 0.6361 0.7968 0.1675  -0.0379 0.2024  627 GLU A CD  
1256 O OE1 . GLU A 160 ? 0.4528 0.6702 0.8710 0.2050  -0.0198 0.2686  627 GLU A OE1 
1257 O OE2 . GLU A 160 ? 0.5328 0.7055 0.9078 0.1531  -0.0325 0.1314  627 GLU A OE2 
1258 N N   . THR A 161 ? 0.1971 0.3964 0.2752 0.0239  -0.0686 -0.0180 628 THR A N   
1259 C CA  . THR A 161 ? 0.1883 0.3154 0.3123 0.0288  -0.0409 0.0057  628 THR A CA  
1260 C C   . THR A 161 ? 0.2496 0.3316 0.3180 0.0126  -0.0477 0.0109  628 THR A C   
1261 O O   . THR A 161 ? 0.2802 0.3901 0.2914 0.0526  -0.0596 0.0038  628 THR A O   
1262 C CB  . THR A 161 ? 0.2049 0.3062 0.3370 0.0426  -0.0042 -0.0709 628 THR A CB  
1263 O OG1 . THR A 161 ? 0.2500 0.2316 0.3058 -0.0098 -0.0367 -0.0694 628 THR A OG1 
1264 C CG2 . THR A 161 ? 0.2416 0.3075 0.3176 0.1037  0.0277  -0.0053 628 THR A CG2 
1265 N N   . TYR A 162 ? 0.2649 0.2892 0.3034 0.0268  -0.0163 0.0250  629 TYR A N   
1266 C CA  . TYR A 162 ? 0.3073 0.2882 0.2773 -0.0182 -0.0417 0.0169  629 TYR A CA  
1267 C C   . TYR A 162 ? 0.3038 0.2682 0.2984 -0.0008 0.0356  0.0026  629 TYR A C   
1268 O O   . TYR A 162 ? 0.2624 0.2424 0.3580 0.0521  0.0249  0.0134  629 TYR A O   
1269 C CB  . TYR A 162 ? 0.3277 0.2884 0.2639 -0.0061 -0.0602 0.0155  629 TYR A CB  
1270 C CG  . TYR A 162 ? 0.3272 0.2570 0.2659 0.0127  -0.0109 -0.0009 629 TYR A CG  
1271 C CD1 . TYR A 162 ? 0.3389 0.2499 0.2713 0.0371  0.0245  0.0035  629 TYR A CD1 
1272 C CD2 . TYR A 162 ? 0.3089 0.2527 0.2620 0.0254  -0.0498 0.0249  629 TYR A CD2 
1273 C CE1 . TYR A 162 ? 0.3490 0.2422 0.3049 0.0818  -0.0133 0.0289  629 TYR A CE1 
1274 C CE2 . TYR A 162 ? 0.3264 0.2469 0.2966 0.0813  -0.0164 0.0502  629 TYR A CE2 
1275 C CZ  . TYR A 162 ? 0.3606 0.2491 0.3095 0.0913  -0.0144 0.0838  629 TYR A CZ  
1276 O OH  . TYR A 162 ? 0.4182 0.2313 0.2652 0.1070  -0.0469 0.0424  629 TYR A OH  
1277 N N   . CYS A 163 ? 0.2913 0.2256 0.2683 -0.0149 0.0259  -0.0322 630 CYS A N   
1278 C CA  . CYS A 163 ? 0.2158 0.2533 0.2785 -0.0151 -0.0327 -0.0410 630 CYS A CA  
1279 C C   . CYS A 163 ? 0.1982 0.2523 0.2949 0.0250  -0.0296 -0.0294 630 CYS A C   
1280 O O   . CYS A 163 ? 0.1936 0.2621 0.3763 0.0690  -0.0409 -0.0335 630 CYS A O   
1281 C CB  . CYS A 163 ? 0.2053 0.2494 0.3354 0.0039  -0.0452 -0.0783 630 CYS A CB  
1282 S SG  . CYS A 163 ? 0.2906 0.2927 0.3686 0.0212  -0.0456 -0.0100 630 CYS A SG  
1283 N N   . THR A 164 ? 0.1782 0.2088 0.2561 0.0222  0.0003  -0.0152 631 THR A N   
1284 C CA  . THR A 164 ? 0.2126 0.2207 0.2826 -0.0291 0.0121  0.0167  631 THR A CA  
1285 C C   . THR A 164 ? 0.2333 0.2146 0.2593 -0.0132 -0.0004 -0.0532 631 THR A C   
1286 O O   . THR A 164 ? 0.2708 0.2409 0.2475 -0.0067 0.0056  -0.0674 631 THR A O   
1287 C CB  . THR A 164 ? 0.2771 0.2475 0.2993 0.0277  -0.0021 0.0212  631 THR A CB  
1288 O OG1 . THR A 164 ? 0.3516 0.3348 0.4584 0.0171  -0.0348 0.0117  631 THR A OG1 
1289 C CG2 . THR A 164 ? 0.2211 0.2447 0.1764 0.0168  0.0395  -0.0468 631 THR A CG2 
1290 N N   . LEU A 165 ? 0.2081 0.1985 0.2931 0.0155  0.0037  -0.0683 632 LEU A N   
1291 C CA  . LEU A 165 ? 0.1807 0.2168 0.1894 -0.0339 -0.0807 -0.0412 632 LEU A CA  
1292 C C   . LEU A 165 ? 0.1668 0.2369 0.2146 0.0174  -0.0394 0.0305  632 LEU A C   
1293 O O   . LEU A 165 ? 0.1748 0.2585 0.2907 0.0162  -0.0854 0.0018  632 LEU A O   
1294 C CB  . LEU A 165 ? 0.1756 0.2445 0.2621 0.0097  -0.1323 -0.0242 632 LEU A CB  
1295 C CG  . LEU A 165 ? 0.2036 0.1377 0.2600 -0.0150 -0.0730 -0.0432 632 LEU A CG  
1296 C CD1 . LEU A 165 ? 0.2249 0.1877 0.2438 -0.0335 -0.0287 -0.0662 632 LEU A CD1 
1297 C CD2 . LEU A 165 ? 0.2427 0.1098 0.2921 0.0155  -0.0098 0.0263  632 LEU A CD2 
1298 N N   . PHE A 166 ? 0.1429 0.2327 0.2397 0.0011  -0.0103 0.0668  633 PHE A N   
1299 C CA  . PHE A 166 ? 0.1828 0.2595 0.2399 -0.0163 -0.0273 0.0152  633 PHE A CA  
1300 C C   . PHE A 166 ? 0.2689 0.2680 0.2773 0.0384  -0.0028 -0.0100 633 PHE A C   
1301 O O   . PHE A 166 ? 0.2968 0.2846 0.2314 0.0163  0.0339  -0.0319 633 PHE A O   
1302 C CB  . PHE A 166 ? 0.2210 0.3023 0.2745 0.0031  -0.0168 0.0299  633 PHE A CB  
1303 C CG  . PHE A 166 ? 0.3112 0.3462 0.3089 -0.0055 -0.0388 -0.0278 633 PHE A CG  
1304 C CD1 . PHE A 166 ? 0.3674 0.3977 0.3294 -0.0040 -0.0372 -0.0176 633 PHE A CD1 
1305 C CD2 . PHE A 166 ? 0.3573 0.3158 0.3461 0.0523  -0.0740 -0.0817 633 PHE A CD2 
1306 C CE1 . PHE A 166 ? 0.4294 0.3780 0.4008 0.0443  0.0026  -0.1150 633 PHE A CE1 
1307 C CE2 . PHE A 166 ? 0.3873 0.3485 0.4086 0.0793  -0.1012 -0.0985 633 PHE A CE2 
1308 C CZ  . PHE A 166 ? 0.4256 0.3616 0.4745 0.0449  -0.0615 -0.1017 633 PHE A CZ  
1309 N N   . SER A 167 ? 0.2623 0.2370 0.2231 0.0666  -0.0105 0.0001  634 SER A N   
1310 C CA  . SER A 167 ? 0.2460 0.2318 0.2710 0.0670  -0.0238 -0.0284 634 SER A CA  
1311 C C   . SER A 167 ? 0.2723 0.2920 0.2498 0.0160  0.0030  -0.0390 634 SER A C   
1312 O O   . SER A 167 ? 0.2312 0.3047 0.3449 -0.0228 0.0027  0.0020  634 SER A O   
1313 C CB  . SER A 167 ? 0.2587 0.2621 0.3380 0.0738  -0.0582 -0.0070 634 SER A CB  
1314 O OG  . SER A 167 ? 0.2194 0.2655 0.3484 0.0865  -0.0154 0.0087  634 SER A OG  
1315 N N   . LEU A 168 ? 0.3123 0.3271 0.2030 0.0444  0.0804  -0.0816 635 LEU A N   
1316 C CA  . LEU A 168 ? 0.2958 0.3477 0.2308 0.0498  0.0769  0.0278  635 LEU A CA  
1317 C C   . LEU A 168 ? 0.3078 0.3708 0.3589 0.0787  0.0435  0.0045  635 LEU A C   
1318 O O   . LEU A 168 ? 0.2966 0.3625 0.3892 0.0542  0.0543  -0.0474 635 LEU A O   
1319 C CB  . LEU A 168 ? 0.3144 0.4154 0.3070 0.0119  0.0484  0.0930  635 LEU A CB  
1320 C CG  . LEU A 168 ? 0.3529 0.4618 0.2918 -0.0065 -0.0952 0.1538  635 LEU A CG  
1321 C CD1 . LEU A 168 ? 0.3278 0.4719 0.4210 -0.0014 -0.0461 0.1954  635 LEU A CD1 
1322 C CD2 . LEU A 168 ? 0.3591 0.5008 0.3416 -0.0061 -0.1590 0.1220  635 LEU A CD2 
1323 N N   . SER A 169 ? 0.3024 0.3592 0.3746 0.1410  0.0407  -0.0198 636 SER A N   
1324 C CA  . SER A 169 ? 0.3290 0.4102 0.3641 0.1377  0.0728  -0.0175 636 SER A CA  
1325 C C   . SER A 169 ? 0.3883 0.4634 0.2944 0.1370  0.0503  -0.0285 636 SER A C   
1326 O O   . SER A 169 ? 0.4067 0.4871 0.3028 0.1143  0.0991  0.0090  636 SER A O   
1327 C CB  . SER A 169 ? 0.3083 0.4154 0.4344 0.1652  0.0817  -0.0052 636 SER A CB  
1328 O OG  . SER A 169 ? 0.3256 0.4429 0.3592 0.1855  0.0880  0.0276  636 SER A OG  
1329 N N   . VAL A 170 ? 0.4196 0.5231 0.3063 0.2100  0.0929  -0.0009 637 VAL A N   
1330 C CA  . VAL A 170 ? 0.4446 0.5674 0.2449 0.2025  0.0809  -0.0345 637 VAL A CA  
1331 C C   . VAL A 170 ? 0.4372 0.6262 0.2592 0.2028  0.0401  0.0020  637 VAL A C   
1332 O O   . VAL A 170 ? 0.4442 0.6514 0.2831 0.1761  0.0235  0.0941  637 VAL A O   
1333 C CB  . VAL A 170 ? 0.5019 0.6064 0.2863 0.1637  0.0381  0.0084  637 VAL A CB  
1334 C CG1 . VAL A 170 ? 0.5294 0.6021 0.4135 0.1679  0.0270  -0.0343 637 VAL A CG1 
1335 C CG2 . VAL A 170 ? 0.5090 0.6166 0.3498 0.0883  0.0181  0.0140  637 VAL A CG2 
1336 N N   . GLN A 171 ? 0.4052 0.6611 0.2826 0.2105  0.0296  -0.0314 638 GLN A N   
1337 C CA  . GLN A 171 ? 0.4392 0.6879 0.3478 0.2227  -0.0128 -0.0053 638 GLN A CA  
1338 C C   . GLN A 171 ? 0.3876 0.7417 0.3217 0.1920  -0.0190 0.0234  638 GLN A C   
1339 O O   . GLN A 171 ? 0.3918 0.8148 0.3330 0.1843  0.0542  0.0229  638 GLN A O   
1340 C CB  . GLN A 171 ? 0.5422 0.6762 0.3540 0.2312  -0.0291 0.0160  638 GLN A CB  
1341 C CG  . GLN A 171 ? 0.6564 0.7018 0.5570 0.2434  -0.0626 -0.0696 638 GLN A CG  
1342 C CD  . GLN A 171 ? 0.6959 0.6875 0.6439 0.2871  -0.0285 -0.1721 638 GLN A CD  
1343 O OE1 . GLN A 171 ? 0.7847 0.7629 0.7836 0.2836  0.0334  -0.1592 638 GLN A OE1 
1344 N NE2 . GLN A 171 ? 0.5748 0.5895 0.5778 0.3973  -0.0276 -0.2028 638 GLN A NE2 
1345 N N   . HIS A 172 ? 0.3305 0.7125 0.2442 0.2012  -0.0408 0.0020  639 HIS A N   
1346 C CA  . HIS A 172 ? 0.3065 0.7130 0.3154 0.1570  -0.0481 0.0519  639 HIS A CA  
1347 C C   . HIS A 172 ? 0.3032 0.7348 0.3411 0.0583  -0.0427 0.0808  639 HIS A C   
1348 O O   . HIS A 172 ? 0.2550 0.8027 0.3763 0.0303  -0.0309 0.0865  639 HIS A O   
1349 C CB  . HIS A 172 ? 0.3091 0.6759 0.2733 0.1651  -0.0519 0.0970  639 HIS A CB  
1350 C CG  . HIS A 172 ? 0.3016 0.6815 0.3131 0.1597  -0.0879 0.1226  639 HIS A CG  
1351 N ND1 . HIS A 172 ? 0.3713 0.6925 0.3792 0.1729  0.0052  0.0773  639 HIS A ND1 
1352 C CD2 . HIS A 172 ? 0.3106 0.6747 0.3010 0.1600  -0.0480 0.1777  639 HIS A CD2 
1353 C CE1 . HIS A 172 ? 0.3370 0.6888 0.2742 0.1851  0.0090  0.1181  639 HIS A CE1 
1354 N NE2 . HIS A 172 ? 0.3747 0.7080 0.3316 0.1482  -0.0251 0.1388  639 HIS A NE2 
1355 N N   . PHE A 173 ? 0.2522 0.6784 0.3711 0.0449  -0.0118 0.0485  640 PHE A N   
1356 C CA  . PHE A 173 ? 0.3139 0.6605 0.3652 -0.0233 0.0183  0.0596  640 PHE A CA  
1357 C C   . PHE A 173 ? 0.3523 0.7115 0.4093 -0.0641 -0.0348 0.0967  640 PHE A C   
1358 O O   . PHE A 173 ? 0.3517 0.7594 0.3799 -0.1045 -0.0273 0.1672  640 PHE A O   
1359 C CB  . PHE A 173 ? 0.3193 0.6075 0.3923 0.0090  -0.0356 0.0350  640 PHE A CB  
1360 C CG  . PHE A 173 ? 0.3100 0.5573 0.3707 -0.0367 -0.0241 0.0405  640 PHE A CG  
1361 C CD1 . PHE A 173 ? 0.2914 0.4680 0.3683 -0.0412 -0.0508 0.0680  640 PHE A CD1 
1362 C CD2 . PHE A 173 ? 0.3258 0.5435 0.3966 -0.0461 -0.0790 -0.0170 640 PHE A CD2 
1363 C CE1 . PHE A 173 ? 0.3456 0.4574 0.3179 -0.0566 -0.0180 0.0690  640 PHE A CE1 
1364 C CE2 . PHE A 173 ? 0.3430 0.5090 0.4098 -0.0169 -0.0465 0.0339  640 PHE A CE2 
1365 C CZ  . PHE A 173 ? 0.3411 0.4523 0.3494 -0.0552 -0.0336 -0.0078 640 PHE A CZ  
1366 N N   . ASN A 174 ? 0.2946 0.7137 0.3657 -0.0348 -0.0359 0.0777  641 ASN A N   
1367 C CA  . ASN A 174 ? 0.3393 0.7600 0.4232 -0.0448 -0.0725 0.0642  641 ASN A CA  
1368 C C   . ASN A 174 ? 0.3432 0.8146 0.4078 -0.1008 -0.0587 0.1194  641 ASN A C   
1369 O O   . ASN A 174 ? 0.3379 0.8926 0.3997 -0.1036 -0.0674 0.1347  641 ASN A O   
1370 C CB  . ASN A 174 ? 0.4007 0.7132 0.4090 -0.0174 0.0010  0.0297  641 ASN A CB  
1371 C CG  . ASN A 174 ? 0.4545 0.6962 0.4577 -0.0100 0.0550  0.0382  641 ASN A CG  
1372 O OD1 . ASN A 174 ? 0.4526 0.7053 0.5030 -0.0234 0.0663  0.0103  641 ASN A OD1 
1373 N ND2 . ASN A 174 ? 0.4876 0.6923 0.4586 -0.0019 0.0485  0.0467  641 ASN A ND2 
1374 N N   . GLN A 175 ? 0.3585 0.8121 0.4559 -0.1169 -0.1200 0.0930  642 GLN A N   
1375 C CA  . GLN A 175 ? 0.3859 0.8259 0.4535 -0.0751 -0.0942 0.0989  642 GLN A CA  
1376 C C   . GLN A 175 ? 0.3953 0.8386 0.4163 -0.1067 -0.0763 0.1077  642 GLN A C   
1377 O O   . GLN A 175 ? 0.3963 0.8726 0.4713 -0.1269 -0.0269 0.0683  642 GLN A O   
1378 C CB  . GLN A 175 ? 0.4372 0.8589 0.5709 0.0013  -0.0832 0.0859  642 GLN A CB  
1379 C CG  . GLN A 175 ? 0.4699 0.8962 0.5926 0.0725  -0.0800 0.0465  642 GLN A CG  
1380 C CD  . GLN A 175 ? 0.4975 0.9327 0.6951 0.1133  -0.0545 0.0242  642 GLN A CD  
1381 O OE1 . GLN A 175 ? 0.4533 0.9471 0.6649 0.1266  -0.0794 0.0150  642 GLN A OE1 
1382 N NE2 . GLN A 175 ? 0.5278 0.9303 0.7213 0.1366  -0.0238 0.0196  642 GLN A NE2 
1383 N N   . VAL A 176 ? 0.4125 0.8007 0.3818 -0.0938 -0.1052 0.1135  643 VAL A N   
1384 C CA  . VAL A 176 ? 0.4605 0.8172 0.4247 -0.1044 -0.0764 0.1344  643 VAL A CA  
1385 C C   . VAL A 176 ? 0.4760 0.8522 0.4717 -0.1178 -0.1224 0.0982  643 VAL A C   
1386 O O   . VAL A 176 ? 0.4521 0.8388 0.4953 -0.1242 -0.0923 0.0767  643 VAL A O   
1387 C CB  . VAL A 176 ? 0.4848 0.8055 0.4345 -0.0879 -0.0843 0.1553  643 VAL A CB  
1388 C CG1 . VAL A 176 ? 0.5293 0.8286 0.4559 -0.1030 -0.0929 0.1740  643 VAL A CG1 
1389 C CG2 . VAL A 176 ? 0.4261 0.7798 0.4532 -0.0703 -0.0795 0.1365  643 VAL A CG2 
1390 N N   . LEU A 177 ? 0.4928 0.8959 0.4969 -0.1365 -0.1380 0.1336  644 LEU A N   
1391 C CA  . LEU A 177 ? 0.4797 0.9298 0.4608 -0.1169 -0.1391 0.1784  644 LEU A CA  
1392 C C   . LEU A 177 ? 0.4990 0.9548 0.4544 -0.1389 -0.1149 0.1399  644 LEU A C   
1393 O O   . LEU A 177 ? 0.5118 0.9669 0.3341 -0.1374 -0.0824 0.1815  644 LEU A O   
1394 C CB  . LEU A 177 ? 0.4355 0.9129 0.4861 -0.0990 -0.1907 0.2303  644 LEU A CB  
1395 C CG  . LEU A 177 ? 0.4465 0.9197 0.6051 -0.0821 -0.1795 0.2564  644 LEU A CG  
1396 C CD1 . LEU A 177 ? 0.3854 0.9134 0.5054 -0.0192 -0.1855 0.3181  644 LEU A CD1 
1397 C CD2 . LEU A 177 ? 0.4680 0.8968 0.7057 -0.1502 -0.1416 0.2669  644 LEU A CD2 
1398 N N   . ASP A 178 ? 0.5006 0.9757 0.4761 -0.1443 -0.1718 0.0737  645 ASP A N   
1399 C CA  . ASP A 178 ? 0.5551 1.0074 0.4931 -0.1256 -0.0763 0.0523  645 ASP A CA  
1400 C C   . ASP A 178 ? 0.5134 0.9891 0.4839 -0.1620 -0.0714 0.0692  645 ASP A C   
1401 O O   . ASP A 178 ? 0.5177 0.9869 0.5218 -0.1589 -0.0477 0.0654  645 ASP A O   
1402 C CB  . ASP A 178 ? 0.6528 1.0641 0.5428 -0.0758 -0.1069 0.0424  645 ASP A CB  
1403 C CG  . ASP A 178 ? 0.7308 1.1355 0.6484 -0.0206 -0.1259 0.0540  645 ASP A CG  
1404 O OD1 . ASP A 178 ? 0.7304 1.1677 0.5387 0.0085  -0.2661 0.0588  645 ASP A OD1 
1405 O OD2 . ASP A 178 ? 0.7908 1.1613 0.7507 -0.0075 -0.0600 0.0692  645 ASP A OD2 
1406 N N   . GLU A 179 ? 0.4961 0.9774 0.4753 -0.2202 -0.0979 0.0464  646 GLU A N   
1407 C CA  . GLU A 179 ? 0.5112 0.9538 0.4773 -0.2186 -0.1194 0.1009  646 GLU A CA  
1408 C C   . GLU A 179 ? 0.5258 0.9416 0.4521 -0.2075 -0.1706 0.1263  646 GLU A C   
1409 O O   . GLU A 179 ? 0.5420 0.9384 0.4718 -0.2347 -0.1836 0.0701  646 GLU A O   
1410 C CB  . GLU A 179 ? 0.4658 0.9374 0.4530 -0.2045 -0.1353 0.1415  646 GLU A CB  
1411 C CG  . GLU A 179 ? 0.4529 0.9242 0.4521 -0.1940 -0.1338 0.1157  646 GLU A CG  
1412 C CD  . GLU A 179 ? 0.4219 0.9319 0.5014 -0.1811 -0.1460 0.0756  646 GLU A CD  
1413 O OE1 . GLU A 179 ? 0.4425 0.9347 0.4774 -0.1808 -0.1930 0.1036  646 GLU A OE1 
1414 O OE2 . GLU A 179 ? 0.3400 0.9145 0.4934 -0.1847 -0.1636 0.0088  646 GLU A OE2 
1415 N N   . PHE A 180 ? 0.4812 0.9221 0.4037 -0.2020 -0.1418 0.1545  647 PHE A N   
1416 C CA  . PHE A 180 ? 0.4852 0.9247 0.4615 -0.1825 -0.1471 0.1335  647 PHE A CA  
1417 C C   . PHE A 180 ? 0.4960 0.9025 0.5075 -0.1911 -0.1308 0.2011  647 PHE A C   
1418 O O   . PHE A 180 ? 0.5190 0.8611 0.5554 -0.1748 -0.1426 0.2515  647 PHE A O   
1419 C CB  . PHE A 180 ? 0.4525 0.9207 0.4939 -0.2034 -0.1582 0.0959  647 PHE A CB  
1420 C CG  . PHE A 180 ? 0.4374 0.9098 0.4945 -0.2240 -0.1394 0.0876  647 PHE A CG  
1421 C CD1 . PHE A 180 ? 0.4498 0.9053 0.4650 -0.2250 -0.1531 0.0507  647 PHE A CD1 
1422 C CD2 . PHE A 180 ? 0.4050 0.9021 0.5050 -0.2431 -0.1082 0.0661  647 PHE A CD2 
1423 C CE1 . PHE A 180 ? 0.4511 0.9038 0.4469 -0.2092 -0.1557 0.0889  647 PHE A CE1 
1424 C CE2 . PHE A 180 ? 0.4310 0.8961 0.4860 -0.2003 -0.1134 0.0408  647 PHE A CE2 
1425 C CZ  . PHE A 180 ? 0.4288 0.9040 0.4938 -0.2045 -0.1362 0.0562  647 PHE A CZ  
1426 N N   . PRO A 181 ? 0.5008 0.9455 0.5329 -0.1803 -0.1544 0.1921  648 PRO A N   
1427 C CA  . PRO A 181 ? 0.5048 0.9301 0.5738 -0.1908 -0.1494 0.1805  648 PRO A CA  
1428 C C   . PRO A 181 ? 0.5233 0.9027 0.6252 -0.1613 -0.1535 0.1511  648 PRO A C   
1429 O O   . PRO A 181 ? 0.4878 0.8855 0.6489 -0.1438 -0.1417 0.1242  648 PRO A O   
1430 C CB  . PRO A 181 ? 0.5066 0.9474 0.5626 -0.1914 -0.1424 0.1999  648 PRO A CB  
1431 C CG  . PRO A 181 ? 0.5165 0.9721 0.5511 -0.1868 -0.1429 0.2129  648 PRO A CG  
1432 C CD  . PRO A 181 ? 0.5010 0.9730 0.5047 -0.1933 -0.1535 0.1905  648 PRO A CD  
1433 N N   . ALA A 182 ? 0.5670 0.9108 0.6511 -0.1465 -0.1507 0.1870  649 ALA A N   
1434 C CA  . ALA A 182 ? 0.6182 0.9124 0.6537 -0.1481 -0.1490 0.2179  649 ALA A CA  
1435 C C   . ALA A 182 ? 0.6430 0.9157 0.6523 -0.1208 -0.1805 0.2110  649 ALA A C   
1436 O O   . ALA A 182 ? 0.7030 0.9262 0.6491 -0.1235 -0.2032 0.1687  649 ALA A O   
1437 C CB  . ALA A 182 ? 0.6421 0.9009 0.6492 -0.1489 -0.1154 0.2272  649 ALA A CB  
1438 N N   . MET A 183 ? 0.6054 0.8688 0.5747 -0.0858 -0.2174 0.2827  650 MET A N   
1439 C CA  . MET A 183 ? 0.6205 0.8362 0.5601 -0.0762 -0.1933 0.2299  650 MET A CA  
1440 C C   . MET A 183 ? 0.5894 0.7726 0.5428 -0.0724 -0.1719 0.2082  650 MET A C   
1441 O O   . MET A 183 ? 0.5674 0.7332 0.5104 -0.1371 -0.1951 0.1589  650 MET A O   
1442 C CB  . MET A 183 ? 0.6939 0.8805 0.5981 -0.0765 -0.1583 0.1957  650 MET A CB  
1443 C CG  . MET A 183 ? 0.7725 0.9164 0.6277 -0.0936 -0.1693 0.1883  650 MET A CG  
1444 S SD  . MET A 183 ? 0.7964 0.9244 0.6283 -0.1002 -0.2081 0.1770  650 MET A SD  
1445 C CE  . MET A 183 ? 0.8217 0.9644 0.6559 -0.0592 -0.1962 0.2026  650 MET A CE  
1446 N N   . ARG A 184 ? 0.5522 0.7357 0.5273 -0.0107 -0.1389 0.2037  651 ARG A N   
1447 C CA  . ARG A 184 ? 0.5242 0.7231 0.4936 0.0055  -0.1102 0.1730  651 ARG A CA  
1448 C C   . ARG A 184 ? 0.5294 0.6397 0.5258 -0.0096 -0.0506 0.1958  651 ARG A C   
1449 O O   . ARG A 184 ? 0.5104 0.5610 0.5484 0.0287  0.0049  0.1982  651 ARG A O   
1450 C CB  . ARG A 184 ? 0.5339 0.8120 0.4737 0.0119  -0.0856 0.1243  651 ARG A CB  
1451 C CG  . ARG A 184 ? 0.5528 0.8989 0.5471 0.0276  -0.0413 0.1124  651 ARG A CG  
1452 C CD  . ARG A 184 ? 0.6172 0.9631 0.6126 0.0099  -0.0408 0.1136  651 ARG A CD  
1453 N NE  . ARG A 184 ? 0.6356 1.0229 0.6709 -0.0300 -0.0252 0.0809  651 ARG A NE  
1454 C CZ  . ARG A 184 ? 0.6466 1.0706 0.7020 -0.0540 -0.0376 0.0487  651 ARG A CZ  
1455 N NH1 . ARG A 184 ? 0.6408 1.0968 0.7448 -0.0530 0.0027  0.0230  651 ARG A NH1 
1456 N NH2 . ARG A 184 ? 0.6349 1.0870 0.6776 -0.0834 -0.0647 0.0562  651 ARG A NH2 
1457 N N   . LYS A 185 ? 0.5283 0.6186 0.5667 -0.0698 -0.0961 0.2315  652 LYS A N   
1458 C CA  . LYS A 185 ? 0.5653 0.6402 0.5963 -0.0622 -0.1473 0.2217  652 LYS A CA  
1459 C C   . LYS A 185 ? 0.5785 0.6708 0.6206 -0.0296 -0.2439 0.1461  652 LYS A C   
1460 O O   . LYS A 185 ? 0.6144 0.6603 0.6086 -0.0684 -0.3080 0.1232  652 LYS A O   
1461 C CB  . LYS A 185 ? 0.5934 0.6635 0.6332 -0.0803 -0.1396 0.2333  652 LYS A CB  
1462 N N   . THR A 186 ? 0.5718 0.7161 0.6352 0.0426  -0.2693 0.1055  653 THR A N   
1463 C CA  . THR A 186 ? 0.5913 0.7227 0.6174 0.0866  -0.2992 0.0826  653 THR A CA  
1464 C C   . THR A 186 ? 0.5604 0.6621 0.5892 0.1805  -0.2909 0.0477  653 THR A C   
1465 O O   . THR A 186 ? 0.5812 0.6564 0.6767 0.1977  -0.2995 -0.0619 653 THR A O   
1466 C CB  . THR A 186 ? 0.6150 0.7430 0.6137 0.0357  -0.3131 0.1080  653 THR A CB  
1467 O OG1 . THR A 186 ? 0.6203 0.7387 0.6468 0.0161  -0.3141 0.1149  653 THR A OG1 
1468 C CG2 . THR A 186 ? 0.6308 0.7556 0.6048 0.0021  -0.3216 0.1195  653 THR A CG2 
1469 N N   . MET A 187 ? 0.5122 0.6350 0.4894 0.2169  -0.2683 0.0499  654 MET A N   
1470 C CA  . MET A 187 ? 0.4863 0.5679 0.3606 0.2112  -0.1445 0.1268  654 MET A CA  
1471 C C   . MET A 187 ? 0.4451 0.5596 0.3088 0.2184  -0.0197 0.1262  654 MET A C   
1472 O O   . MET A 187 ? 0.4999 0.6239 0.3469 0.2090  -0.0138 0.0625  654 MET A O   
1473 C CB  . MET A 187 ? 0.5677 0.5970 0.4980 0.1146  -0.1672 0.1295  654 MET A CB  
1474 C CG  . MET A 187 ? 0.6261 0.6315 0.6528 -0.0167 -0.1399 0.0857  654 MET A CG  
1475 S SD  . MET A 187 ? 0.6617 0.6381 0.7633 -0.1446 -0.1331 0.0131  654 MET A SD  
1476 C CE  . MET A 187 ? 0.6282 0.6249 0.7795 -0.1231 -0.2075 -0.0043 654 MET A CE  
1477 N N   . GLU A 188 ? 0.4423 0.5466 0.2434 0.1618  0.0284  0.1334  655 GLU A N   
1478 C CA  . GLU A 188 ? 0.4139 0.5372 0.2943 0.1347  0.0675  0.1017  655 GLU A CA  
1479 C C   . GLU A 188 ? 0.3867 0.5252 0.3598 0.0761  0.0308  0.1029  655 GLU A C   
1480 O O   . GLU A 188 ? 0.3833 0.5365 0.3673 0.0874  0.0442  0.0468  655 GLU A O   
1481 C CB  . GLU A 188 ? 0.4534 0.5953 0.3748 0.1089  0.0410  0.0401  655 GLU A CB  
1482 C CG  . GLU A 188 ? 0.4788 0.6733 0.4111 0.1124  0.0396  0.0486  655 GLU A CG  
1483 C CD  . GLU A 188 ? 0.5644 0.7533 0.5010 0.1175  -0.0002 0.0591  655 GLU A CD  
1484 O OE1 . GLU A 188 ? 0.6292 0.7884 0.5010 0.0951  -0.0131 0.0787  655 GLU A OE1 
1485 O OE2 . GLU A 188 ? 0.5272 0.7730 0.5566 0.1606  -0.0201 0.0482  655 GLU A OE2 
1486 N N   . GLU A 189 ? 0.3517 0.4757 0.4634 0.0683  -0.0424 0.1373  656 GLU A N   
1487 C CA  . GLU A 189 ? 0.4439 0.5263 0.5063 0.0268  -0.0915 0.1362  656 GLU A CA  
1488 C C   . GLU A 189 ? 0.4462 0.5651 0.4072 0.0862  -0.1013 0.0740  656 GLU A C   
1489 O O   . GLU A 189 ? 0.5140 0.5552 0.3020 0.1686  -0.1610 -0.0010 656 GLU A O   
1490 C CB  . GLU A 189 ? 0.4865 0.5264 0.4801 -0.0511 -0.1386 0.2051  656 GLU A CB  
1491 C CG  . GLU A 189 ? 0.5272 0.5400 0.6022 -0.1221 -0.1421 0.2646  656 GLU A CG  
1492 C CD  . GLU A 189 ? 0.5808 0.6000 0.7493 -0.1791 -0.0782 0.2955  656 GLU A CD  
1493 O OE1 . GLU A 189 ? 0.6449 0.6431 0.8298 -0.2145 -0.0685 0.2417  656 GLU A OE1 
1494 O OE2 . GLU A 189 ? 0.5203 0.5602 0.8030 -0.2225 -0.0105 0.3725  656 GLU A OE2 
1495 N N   . ILE A 190 ? 0.4632 0.6284 0.5444 0.0272  -0.0804 0.0523  657 ILE A N   
1496 C CA  . ILE A 190 ? 0.4783 0.6247 0.4424 -0.0652 -0.0095 0.0758  657 ILE A CA  
1497 C C   . ILE A 190 ? 0.4962 0.7273 0.4612 -0.0109 0.0897  0.0881  657 ILE A C   
1498 O O   . ILE A 190 ? 0.5149 0.7779 0.2145 -0.0020 0.0323  0.0275  657 ILE A O   
1499 C CB  . ILE A 190 ? 0.4663 0.6100 0.6429 -0.0883 -0.0264 0.1018  657 ILE A CB  
1500 C CG1 . ILE A 190 ? 0.4581 0.5809 0.6376 -0.0783 -0.0565 0.0593  657 ILE A CG1 
1501 C CG2 . ILE A 190 ? 0.4323 0.6032 0.6835 -0.1555 -0.0438 0.1539  657 ILE A CG2 
1502 C CD1 . ILE A 190 ? 0.4056 0.5324 0.6377 -0.0867 -0.1229 0.0168  657 ILE A CD1 
1503 N N   . ALA A 191 ? 0.4859 0.6915 0.5510 -0.0249 0.1257  0.0740  658 ALA A N   
1504 C CA  . ALA A 191 ? 0.4482 0.6787 0.4422 -0.0933 -0.0072 0.0559  658 ALA A CA  
1505 C C   . ALA A 191 ? 0.4311 0.6459 0.4752 -0.1024 -0.0807 0.0841  658 ALA A C   
1506 O O   . ALA A 191 ? 0.4426 0.6328 0.4696 -0.0498 -0.1572 -0.0350 658 ALA A O   
1507 C CB  . ALA A 191 ? 0.4436 0.6483 0.4072 -0.0372 -0.0348 0.0906  658 ALA A CB  
1508 N N   . VAL A 192 ? 0.4503 0.6158 0.4910 -0.1681 -0.1715 0.1834  659 VAL A N   
1509 C CA  . VAL A 192 ? 0.5369 0.6904 0.5814 -0.1466 -0.0687 0.2521  659 VAL A CA  
1510 C C   . VAL A 192 ? 0.4883 0.7121 0.6399 -0.0780 0.0409  0.2556  659 VAL A C   
1511 O O   . VAL A 192 ? 0.4088 0.7349 0.7208 -0.0520 0.1651  0.2819  659 VAL A O   
1512 C CB  . VAL A 192 ? 0.6543 0.7992 0.6105 -0.1751 -0.1420 0.1554  659 VAL A CB  
1513 C CG1 . VAL A 192 ? 0.7108 0.8729 0.7502 -0.1960 -0.1376 0.1023  659 VAL A CG1 
1514 C CG2 . VAL A 192 ? 0.6783 0.7836 0.5743 -0.1617 -0.1914 0.2139  659 VAL A CG2 
1515 N N   . ARG A 193 ? 0.5799 0.7440 0.4720 -0.0323 0.0499  0.1571  660 ARG A N   
1516 C CA  . ARG A 193 ? 0.7193 0.7985 0.5917 -0.0022 -0.1158 0.1890  660 ARG A CA  
1517 C C   . ARG A 193 ? 0.7781 0.8679 0.8511 0.0726  -0.0906 0.1087  660 ARG A C   
1518 O O   . ARG A 193 ? 0.8482 0.9065 1.0256 0.1226  -0.0873 0.0011  660 ARG A O   
1519 C CB  . ARG A 193 ? 0.7834 0.8051 0.5864 0.0337  -0.2054 0.2334  660 ARG A CB  
1520 C CG  . ARG A 193 ? 0.7900 0.7862 0.5660 -0.0343 -0.2303 0.2960  660 ARG A CG  
1521 C CD  . ARG A 193 ? 0.8196 0.8240 0.6748 -0.0538 -0.2535 0.2472  660 ARG A CD  
1522 N NE  . ARG A 193 ? 0.8553 0.8511 0.8339 -0.0871 -0.2729 0.2141  660 ARG A NE  
1523 C CZ  . ARG A 193 ? 0.8795 0.8761 0.8763 -0.1202 -0.3258 0.1732  660 ARG A CZ  
1524 N NH1 . ARG A 193 ? 0.8803 0.9009 0.9519 -0.1520 -0.3181 0.1473  660 ARG A NH1 
1525 N NH2 . ARG A 193 ? 0.8939 0.8559 0.7898 -0.1225 -0.3822 0.1771  660 ARG A NH2 
1526 N N   . ARG A 194 ? 0.7195 0.8280 0.7855 0.0632  -0.1784 0.1858  661 ARG A N   
1527 C CA  . ARG A 194 ? 0.6384 0.8160 0.5993 0.0186  -0.2230 0.2671  661 ARG A CA  
1528 C C   . ARG A 194 ? 0.6760 0.8564 0.6930 -0.0065 -0.2911 0.3123  661 ARG A C   
1529 O O   . ARG A 194 ? 0.6671 0.8376 0.7555 0.0144  -0.3409 0.3447  661 ARG A O   
1530 C CB  . ARG A 194 ? 0.5592 0.7713 0.4972 0.0193  -0.1992 0.1934  661 ARG A CB  
1531 C CG  . ARG A 194 ? 0.4918 0.7197 0.1956 0.0203  -0.2129 0.2254  661 ARG A CG  
1532 C CD  . ARG A 194 ? 0.4944 0.5769 0.2074 -0.0094 -0.1833 0.2679  661 ARG A CD  
1533 N NE  . ARG A 194 ? 0.4471 0.4893 0.2504 0.0387  -0.1537 0.1587  661 ARG A NE  
1534 C CZ  . ARG A 194 ? 0.4014 0.3810 0.3129 0.0178  -0.0989 -0.0172 661 ARG A CZ  
1535 N NH1 . ARG A 194 ? 0.4541 0.3791 0.3988 0.0511  -0.1131 -0.0276 661 ARG A NH1 
1536 N NH2 . ARG A 194 ? 0.3282 0.3171 0.3891 0.0148  -0.0588 0.0674  661 ARG A NH2 
1537 N N   . LEU A 195 ? 0.7536 0.9520 0.8150 -0.0843 -0.2622 0.2313  662 LEU A N   
1538 C CA  . LEU A 195 ? 0.8029 0.9933 0.9465 -0.1025 -0.2682 0.2820  662 LEU A CA  
1539 C C   . LEU A 195 ? 0.8608 1.0368 1.0638 -0.1103 -0.2435 0.2470  662 LEU A C   
1540 O O   . LEU A 195 ? 0.8858 1.0334 1.1558 -0.0994 -0.2177 0.2672  662 LEU A O   
1541 C CB  . LEU A 195 ? 0.7487 0.9803 0.9003 -0.1074 -0.2442 0.3366  662 LEU A CB  
1542 C CG  . LEU A 195 ? 0.7141 0.9806 0.7504 -0.0935 -0.2303 0.4281  662 LEU A CG  
1543 C CD1 . LEU A 195 ? 0.6975 0.9879 0.7682 -0.1150 -0.2199 0.3784  662 LEU A CD1 
1544 C CD2 . LEU A 195 ? 0.6840 0.9835 0.4548 -0.0789 -0.2666 0.5618  662 LEU A CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   468 ?   ?   ?   A . n 
A 1 2   ALA 2   469 ?   ?   ?   A . n 
A 1 3   MET 3   470 ?   ?   ?   A . n 
A 1 4   ASP 4   471 471 ASP ALA A . n 
A 1 5   SER 5   472 472 SER ALA A . n 
A 1 6   SER 6   473 473 SER SER A . n 
A 1 7   SER 7   474 474 SER SER A . n 
A 1 8   ARG 8   475 475 ARG ALA A . n 
A 1 9   GLN 9   476 476 GLN GLN A . n 
A 1 10  TYR 10  477 477 TYR TYR A . n 
A 1 11  ARG 11  478 478 ARG ALA A . n 
A 1 12  GLU 12  479 479 GLU GLU A . n 
A 1 13  LYS 13  480 480 LYS LYS A . n 
A 1 14  LEU 14  481 481 LEU LEU A . n 
A 1 15  LYS 15  482 482 LYS ALA A . n 
A 1 16  GLN 16  483 483 GLN GLN A . n 
A 1 17  VAL 17  484 484 VAL VAL A . n 
A 1 18  GLU 18  485 485 GLU GLU A . n 
A 1 19  GLU 19  486 486 GLU GLU A . n 
A 1 20  TYR 20  487 487 TYR TYR A . n 
A 1 21  MET 21  488 488 MET MET A . n 
A 1 22  GLN 22  489 489 GLN GLN A . n 
A 1 23  TYR 23  490 490 TYR ALA A . n 
A 1 24  ARG 24  491 491 ARG ARG A . n 
A 1 25  LYS 25  492 492 LYS LYS A . n 
A 1 26  LEU 26  493 493 LEU LEU A . n 
A 1 27  PRO 27  494 494 PRO PRO A . n 
A 1 28  SER 28  495 495 SER SER A . n 
A 1 29  HIS 29  496 496 HIS HIS A . n 
A 1 30  LEU 30  497 497 LEU LEU A . n 
A 1 31  ARG 31  498 498 ARG ARG A . n 
A 1 32  ASN 32  499 499 ASN ASN A . n 
A 1 33  LYS 33  500 500 LYS LYS A . n 
A 1 34  ILE 34  501 501 ILE ILE A . n 
A 1 35  LEU 35  502 502 LEU LEU A . n 
A 1 36  ASP 36  503 503 ASP ASP A . n 
A 1 37  TYR 37  504 504 TYR TYR A . n 
A 1 38  TYR 38  505 505 TYR TYR A . n 
A 1 39  GLU 39  506 506 GLU GLU A . n 
A 1 40  TYR 40  507 507 TYR TYR A . n 
A 1 41  ARG 41  508 508 ARG ARG A . n 
A 1 42  TYR 42  509 509 TYR TYR A . n 
A 1 43  ARG 43  510 510 ARG ARG A . n 
A 1 44  GLY 44  511 511 GLY GLY A . n 
A 1 45  LYS 45  512 512 LYS LYS A . n 
A 1 46  MET 46  513 513 MET MET A . n 
A 1 47  PHE 47  514 514 PHE PHE A . n 
A 1 48  ASP 48  515 515 ASP ASP A . n 
A 1 49  GLU 49  516 516 GLU GLU A . n 
A 1 50  ARG 50  517 517 ARG ALA A . n 
A 1 51  HIS 51  518 518 HIS ALA A . n 
A 1 52  ILE 52  519 519 ILE ILE A . n 
A 1 53  PHE 53  520 520 PHE PHE A . n 
A 1 54  ARG 54  521 521 ARG ARG A . n 
A 1 55  GLU 55  522 522 GLU GLU A . n 
A 1 56  VAL 56  523 523 VAL VAL A . n 
A 1 57  SER 57  524 524 SER SER A . n 
A 1 58  GLU 58  525 525 GLU GLU A . n 
A 1 59  SER 59  526 526 SER SER A . n 
A 1 60  ILE 60  527 527 ILE ILE A . n 
A 1 61  ARG 61  528 528 ARG ARG A . n 
A 1 62  GLN 62  529 529 GLN GLN A . n 
A 1 63  ASP 63  530 530 ASP ASP A . n 
A 1 64  VAL 64  531 531 VAL VAL A . n 
A 1 65  ALA 65  532 532 ALA ALA A . n 
A 1 66  ASN 66  533 533 ASN ASN A . n 
A 1 67  TYR 67  534 534 TYR TYR A . n 
A 1 68  ASN 68  535 535 ASN ASN A . n 
A 1 69  CYS 69  536 536 CYS CYS A . n 
A 1 70  ARG 70  537 537 ARG ARG A . n 
A 1 71  ASP 71  538 538 ASP ALA A . n 
A 1 72  LEU 72  539 539 LEU LEU A . n 
A 1 73  VAL 73  540 540 VAL VAL A . n 
A 1 74  ALA 74  541 541 ALA ALA A . n 
A 1 75  SER 75  542 542 SER SER A . n 
A 1 76  VAL 76  543 543 VAL VAL A . n 
A 1 77  PRO 77  544 544 PRO PRO A . n 
A 1 78  PHE 78  545 545 PHE PHE A . n 
A 1 79  PHE 79  546 546 PHE PHE A . n 
A 1 80  VAL 80  547 547 VAL ALA A . n 
A 1 81  GLY 81  548 548 GLY GLY A . n 
A 1 82  ALA 82  549 549 ALA ALA A . n 
A 1 83  ASP 83  550 550 ASP ASP A . n 
A 1 84  SER 84  551 551 SER SER A . n 
A 1 85  ASN 85  552 552 ASN ASN A . n 
A 1 86  PHE 86  553 553 PHE PHE A . n 
A 1 87  VAL 87  554 554 VAL VAL A . n 
A 1 88  THR 88  555 555 THR THR A . n 
A 1 89  ARG 89  556 556 ARG ARG A . n 
A 1 90  VAL 90  557 557 VAL VAL A . n 
A 1 91  VAL 91  558 558 VAL VAL A . n 
A 1 92  THR 92  559 559 THR THR A . n 
A 1 93  LEU 93  560 560 LEU LEU A . n 
A 1 94  LEU 94  561 561 LEU LEU A . n 
A 1 95  GLU 95  562 562 GLU GLU A . n 
A 1 96  PHE 96  563 563 PHE PHE A . n 
A 1 97  GLU 97  564 564 GLU GLU A . n 
A 1 98  VAL 98  565 565 VAL VAL A . n 
A 1 99  PHE 99  566 566 PHE PHE A . n 
A 1 100 GLN 100 567 567 GLN GLN A . n 
A 1 101 PRO 101 568 568 PRO PRO A . n 
A 1 102 ALA 102 569 569 ALA ALA A . n 
A 1 103 ASP 103 570 570 ASP ASP A . n 
A 1 104 TYR 104 571 571 TYR TYR A . n 
A 1 105 VAL 105 572 572 VAL VAL A . n 
A 1 106 ILE 106 573 573 ILE ILE A . n 
A 1 107 GLN 107 574 574 GLN GLN A . n 
A 1 108 GLU 108 575 575 GLU GLU A . n 
A 1 109 GLY 109 576 576 GLY GLY A . n 
A 1 110 THR 110 577 577 THR THR A . n 
A 1 111 PHE 111 578 578 PHE PHE A . n 
A 1 112 GLY 112 579 579 GLY GLY A . n 
A 1 113 ASP 113 580 580 ASP ASP A . n 
A 1 114 ARG 114 581 581 ARG ARG A . n 
A 1 115 MET 115 582 582 MET MET A . n 
A 1 116 PHE 116 583 583 PHE PHE A . n 
A 1 117 PHE 117 584 584 PHE PHE A . n 
A 1 118 ILE 118 585 585 ILE ILE A . n 
A 1 119 GLN 119 586 586 GLN GLN A . n 
A 1 120 GLN 120 587 587 GLN GLN A . n 
A 1 121 GLY 121 588 588 GLY GLY A . n 
A 1 122 ILE 122 589 589 ILE ILE A . n 
A 1 123 VAL 123 590 590 VAL VAL A . n 
A 1 124 ASP 124 591 591 ASP ASP A . n 
A 1 125 ILE 125 592 592 ILE ILE A . n 
A 1 126 ILE 126 593 593 ILE ILE A . n 
A 1 127 MET 127 594 594 MET MET A . n 
A 1 128 SER 128 595 595 SER SER A . n 
A 1 129 ASP 129 596 596 ASP ASP A . n 
A 1 130 GLY 130 597 597 GLY GLY A . n 
A 1 131 VAL 131 598 598 VAL VAL A . n 
A 1 132 ILE 132 599 599 ILE ILE A . n 
A 1 133 ALA 133 600 600 ALA ALA A . n 
A 1 134 THR 134 601 601 THR THR A . n 
A 1 135 SER 135 602 602 SER SER A . n 
A 1 136 LEU 136 603 603 LEU LEU A . n 
A 1 137 SER 137 604 604 SER SER A . n 
A 1 138 ASP 138 605 605 ASP ASP A . n 
A 1 139 GLY 139 606 606 GLY GLY A . n 
A 1 140 SER 140 607 607 SER SER A . n 
A 1 141 TYR 141 608 608 TYR TYR A . n 
A 1 142 PHE 142 609 609 PHE PHE A . n 
A 1 143 GLY 143 610 610 GLY GLY A . n 
A 1 144 GLU 144 611 611 GLU GLU A . n 
A 1 145 ILE 145 612 612 ILE ILE A . n 
A 1 146 CYS 146 613 613 CYS CYS A . n 
A 1 147 LEU 147 614 614 LEU LEU A . n 
A 1 148 LEU 148 615 615 LEU LEU A . n 
A 1 149 THR 149 616 616 THR THR A . n 
A 1 150 ARG 150 617 617 ARG ARG A . n 
A 1 151 GLU 151 618 618 GLU GLU A . n 
A 1 152 ARG 152 619 619 ARG ARG A . n 
A 1 153 ARG 153 620 620 ARG ARG A . n 
A 1 154 VAL 154 621 621 VAL VAL A . n 
A 1 155 ALA 155 622 622 ALA ALA A . n 
A 1 156 SER 156 623 623 SER SER A . n 
A 1 157 VAL 157 624 624 VAL VAL A . n 
A 1 158 LYS 158 625 625 LYS LYS A . n 
A 1 159 CYS 159 626 626 CYS CYS A . n 
A 1 160 GLU 160 627 627 GLU GLU A . n 
A 1 161 THR 161 628 628 THR THR A . n 
A 1 162 TYR 162 629 629 TYR TYR A . n 
A 1 163 CYS 163 630 630 CYS CYS A . n 
A 1 164 THR 164 631 631 THR THR A . n 
A 1 165 LEU 165 632 632 LEU LEU A . n 
A 1 166 PHE 166 633 633 PHE PHE A . n 
A 1 167 SER 167 634 634 SER SER A . n 
A 1 168 LEU 168 635 635 LEU LEU A . n 
A 1 169 SER 169 636 636 SER SER A . n 
A 1 170 VAL 170 637 637 VAL VAL A . n 
A 1 171 GLN 171 638 638 GLN GLN A . n 
A 1 172 HIS 172 639 639 HIS HIS A . n 
A 1 173 PHE 173 640 640 PHE PHE A . n 
A 1 174 ASN 174 641 641 ASN ASN A . n 
A 1 175 GLN 175 642 642 GLN GLN A . n 
A 1 176 VAL 176 643 643 VAL VAL A . n 
A 1 177 LEU 177 644 644 LEU LEU A . n 
A 1 178 ASP 178 645 645 ASP ASP A . n 
A 1 179 GLU 179 646 646 GLU GLU A . n 
A 1 180 PHE 180 647 647 PHE PHE A . n 
A 1 181 PRO 181 648 648 PRO PRO A . n 
A 1 182 ALA 182 649 649 ALA ALA A . n 
A 1 183 MET 183 650 650 MET MET A . n 
A 1 184 ARG 184 651 651 ARG ARG A . n 
A 1 185 LYS 185 652 652 LYS ALA A . n 
A 1 186 THR 186 653 653 THR THR A . n 
A 1 187 MET 187 654 654 MET MET A . n 
A 1 188 GLU 188 655 655 GLU GLU A . n 
A 1 189 GLU 189 656 656 GLU GLU A . n 
A 1 190 ILE 190 657 657 ILE ILE A . n 
A 1 191 ALA 191 658 658 ALA ALA A . n 
A 1 192 VAL 192 659 659 VAL VAL A . n 
A 1 193 ARG 193 660 660 ARG ARG A . n 
A 1 194 ARG 194 661 661 ARG ARG A . n 
A 1 195 LEU 195 662 662 LEU LEU A . n 
A 1 196 THR 196 663 ?   ?   ?   A . n 
A 1 197 ARG 197 664 ?   ?   ?   A . n 
A 1 198 ILE 198 665 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NCO 1   301 301 NCO NCO A . 
C 3 CMP 1   401 401 CMP CMP A . 
D 4 HOH 1   0   0   HOH HOH A . 
D 4 HOH 2   1   1   HOH HOH A . 
D 4 HOH 3   2   2   HOH HOH A . 
D 4 HOH 4   3   3   HOH HOH A . 
D 4 HOH 5   4   4   HOH HOH A . 
D 4 HOH 6   5   5   HOH HOH A . 
D 4 HOH 7   6   6   HOH HOH A . 
D 4 HOH 8   7   7   HOH HOH A . 
D 4 HOH 9   8   8   HOH HOH A . 
D 4 HOH 10  10  10  HOH HOH A . 
D 4 HOH 11  12  12  HOH HOH A . 
D 4 HOH 12  13  13  HOH HOH A . 
D 4 HOH 13  14  14  HOH HOH A . 
D 4 HOH 14  15  15  HOH HOH A . 
D 4 HOH 15  16  16  HOH HOH A . 
D 4 HOH 16  17  17  HOH HOH A . 
D 4 HOH 17  18  18  HOH HOH A . 
D 4 HOH 18  19  19  HOH HOH A . 
D 4 HOH 19  20  20  HOH HOH A . 
D 4 HOH 20  21  21  HOH HOH A . 
D 4 HOH 21  22  22  HOH HOH A . 
D 4 HOH 22  23  23  HOH HOH A . 
D 4 HOH 23  24  24  HOH HOH A . 
D 4 HOH 24  25  25  HOH HOH A . 
D 4 HOH 25  26  26  HOH HOH A . 
D 4 HOH 26  27  27  HOH HOH A . 
D 4 HOH 27  28  28  HOH HOH A . 
D 4 HOH 28  29  29  HOH HOH A . 
D 4 HOH 29  30  30  HOH HOH A . 
D 4 HOH 30  31  31  HOH HOH A . 
D 4 HOH 31  32  32  HOH HOH A . 
D 4 HOH 32  33  33  HOH HOH A . 
D 4 HOH 33  34  34  HOH HOH A . 
D 4 HOH 34  35  35  HOH HOH A . 
D 4 HOH 35  36  36  HOH HOH A . 
D 4 HOH 36  37  37  HOH HOH A . 
D 4 HOH 37  39  39  HOH HOH A . 
D 4 HOH 38  40  40  HOH HOH A . 
D 4 HOH 39  41  41  HOH HOH A . 
D 4 HOH 40  42  42  HOH HOH A . 
D 4 HOH 41  44  44  HOH HOH A . 
D 4 HOH 42  45  45  HOH HOH A . 
D 4 HOH 43  46  46  HOH HOH A . 
D 4 HOH 44  47  47  HOH HOH A . 
D 4 HOH 45  48  48  HOH HOH A . 
D 4 HOH 46  49  49  HOH HOH A . 
D 4 HOH 47  50  50  HOH HOH A . 
D 4 HOH 48  51  51  HOH HOH A . 
D 4 HOH 49  52  52  HOH HOH A . 
D 4 HOH 50  53  53  HOH HOH A . 
D 4 HOH 51  54  54  HOH HOH A . 
D 4 HOH 52  55  55  HOH HOH A . 
D 4 HOH 53  56  56  HOH HOH A . 
D 4 HOH 54  57  57  HOH HOH A . 
D 4 HOH 55  58  58  HOH HOH A . 
D 4 HOH 56  59  59  HOH HOH A . 
D 4 HOH 57  60  60  HOH HOH A . 
D 4 HOH 58  61  61  HOH HOH A . 
D 4 HOH 59  62  62  HOH HOH A . 
D 4 HOH 60  63  63  HOH HOH A . 
D 4 HOH 61  64  64  HOH HOH A . 
D 4 HOH 62  65  65  HOH HOH A . 
D 4 HOH 63  66  66  HOH HOH A . 
D 4 HOH 64  67  67  HOH HOH A . 
D 4 HOH 65  68  68  HOH HOH A . 
D 4 HOH 66  69  69  HOH HOH A . 
D 4 HOH 67  70  70  HOH HOH A . 
D 4 HOH 68  71  71  HOH HOH A . 
D 4 HOH 69  72  72  HOH HOH A . 
D 4 HOH 70  73  73  HOH HOH A . 
D 4 HOH 71  74  74  HOH HOH A . 
D 4 HOH 72  75  75  HOH HOH A . 
D 4 HOH 73  76  76  HOH HOH A . 
D 4 HOH 74  77  77  HOH HOH A . 
D 4 HOH 75  78  78  HOH HOH A . 
D 4 HOH 76  79  79  HOH HOH A . 
D 4 HOH 77  80  80  HOH HOH A . 
D 4 HOH 78  81  81  HOH HOH A . 
D 4 HOH 79  82  82  HOH HOH A . 
D 4 HOH 80  83  83  HOH HOH A . 
D 4 HOH 81  84  84  HOH HOH A . 
D 4 HOH 82  85  85  HOH HOH A . 
D 4 HOH 83  86  86  HOH HOH A . 
D 4 HOH 84  87  87  HOH HOH A . 
D 4 HOH 85  88  88  HOH HOH A . 
D 4 HOH 86  89  89  HOH HOH A . 
D 4 HOH 87  90  90  HOH HOH A . 
D 4 HOH 88  91  91  HOH HOH A . 
D 4 HOH 89  92  92  HOH HOH A . 
D 4 HOH 90  93  93  HOH HOH A . 
D 4 HOH 91  95  95  HOH HOH A . 
D 4 HOH 92  96  96  HOH HOH A . 
D 4 HOH 93  97  97  HOH HOH A . 
D 4 HOH 94  98  98  HOH HOH A . 
D 4 HOH 95  99  99  HOH HOH A . 
D 4 HOH 96  100 100 HOH HOH A . 
D 4 HOH 97  101 101 HOH HOH A . 
D 4 HOH 98  103 103 HOH HOH A . 
D 4 HOH 99  104 104 HOH HOH A . 
D 4 HOH 100 105 105 HOH HOH A . 
D 4 HOH 101 106 106 HOH HOH A . 
D 4 HOH 102 108 108 HOH HOH A . 
D 4 HOH 103 110 110 HOH HOH A . 
D 4 HOH 104 113 113 HOH HOH A . 
D 4 HOH 105 114 114 HOH HOH A . 
D 4 HOH 106 115 115 HOH HOH A . 
D 4 HOH 107 116 116 HOH HOH A . 
D 4 HOH 108 117 117 HOH HOH A . 
D 4 HOH 109 118 118 HOH HOH A . 
D 4 HOH 110 119 119 HOH HOH A . 
D 4 HOH 111 120 120 HOH HOH A . 
D 4 HOH 112 121 121 HOH HOH A . 
D 4 HOH 113 122 122 HOH HOH A . 
D 4 HOH 114 125 125 HOH HOH A . 
D 4 HOH 115 126 126 HOH HOH A . 
D 4 HOH 116 127 127 HOH HOH A . 
D 4 HOH 117 128 128 HOH HOH A . 
D 4 HOH 118 130 130 HOH HOH A . 
D 4 HOH 119 131 131 HOH HOH A . 
D 4 HOH 120 132 132 HOH HOH A . 
D 4 HOH 121 133 133 HOH HOH A . 
D 4 HOH 122 134 134 HOH HOH A . 
D 4 HOH 123 135 135 HOH HOH A . 
D 4 HOH 124 136 136 HOH HOH A . 
D 4 HOH 125 137 137 HOH HOH A . 
D 4 HOH 126 138 138 HOH HOH A . 
D 4 HOH 127 139 139 HOH HOH A . 
D 4 HOH 128 140 140 HOH HOH A . 
D 4 HOH 129 141 141 HOH HOH A . 
D 4 HOH 130 142 142 HOH HOH A . 
D 4 HOH 131 143 143 HOH HOH A . 
D 4 HOH 132 145 145 HOH HOH A . 
D 4 HOH 133 146 146 HOH HOH A . 
D 4 HOH 134 147 147 HOH HOH A . 
D 4 HOH 135 148 148 HOH HOH A . 
D 4 HOH 136 149 149 HOH HOH A . 
D 4 HOH 137 150 150 HOH HOH A . 
D 4 HOH 138 151 151 HOH HOH A . 
D 4 HOH 139 152 152 HOH HOH A . 
D 4 HOH 140 153 153 HOH HOH A . 
D 4 HOH 141 156 156 HOH HOH A . 
D 4 HOH 142 157 157 HOH HOH A . 
D 4 HOH 143 159 159 HOH HOH A . 
D 4 HOH 144 161 161 HOH HOH A . 
D 4 HOH 145 162 162 HOH HOH A . 
D 4 HOH 146 163 163 HOH HOH A . 
D 4 HOH 147 164 164 HOH HOH A . 
D 4 HOH 148 165 165 HOH HOH A . 
D 4 HOH 149 166 166 HOH HOH A . 
D 4 HOH 150 168 168 HOH HOH A . 
D 4 HOH 151 169 169 HOH HOH A . 
D 4 HOH 152 170 170 HOH HOH A . 
D 4 HOH 153 171 171 HOH HOH A . 
D 4 HOH 154 172 172 HOH HOH A . 
D 4 HOH 155 174 174 HOH HOH A . 
D 4 HOH 156 177 177 HOH HOH A . 
D 4 HOH 157 178 178 HOH HOH A . 
D 4 HOH 158 179 179 HOH HOH A . 
D 4 HOH 159 180 180 HOH HOH A . 
D 4 HOH 160 182 182 HOH HOH A . 
D 4 HOH 161 184 184 HOH HOH A . 
D 4 HOH 162 186 186 HOH HOH A . 
D 4 HOH 163 188 188 HOH HOH A . 
D 4 HOH 164 189 189 HOH HOH A . 
D 4 HOH 165 190 190 HOH HOH A . 
D 4 HOH 166 191 191 HOH HOH A . 
D 4 HOH 167 192 192 HOH HOH A . 
D 4 HOH 168 193 193 HOH HOH A . 
D 4 HOH 169 195 195 HOH HOH A . 
D 4 HOH 170 196 196 HOH HOH A . 
D 4 HOH 171 197 197 HOH HOH A . 
D 4 HOH 172 198 198 HOH HOH A . 
D 4 HOH 173 201 201 HOH HOH A . 
D 4 HOH 174 202 202 HOH HOH A . 
D 4 HOH 175 204 204 HOH HOH A . 
D 4 HOH 176 208 208 HOH HOH A . 
D 4 HOH 177 209 209 HOH HOH A . 
D 4 HOH 178 211 211 HOH HOH A . 
D 4 HOH 179 212 212 HOH HOH A . 
D 4 HOH 180 213 213 HOH HOH A . 
D 4 HOH 181 219 219 HOH HOH A . 
D 4 HOH 182 221 221 HOH HOH A . 
D 4 HOH 183 222 222 HOH HOH A . 
D 4 HOH 184 223 223 HOH HOH A . 
D 4 HOH 185 224 224 HOH HOH A . 
D 4 HOH 186 226 226 HOH HOH A . 
D 4 HOH 187 228 228 HOH HOH A . 
D 4 HOH 188 229 229 HOH HOH A . 
D 4 HOH 189 230 230 HOH HOH A . 
D 4 HOH 190 233 233 HOH HOH A . 
D 4 HOH 191 235 235 HOH HOH A . 
D 4 HOH 192 236 236 HOH HOH A . 
D 4 HOH 193 241 241 HOH HOH A . 
D 4 HOH 194 243 243 HOH HOH A . 
D 4 HOH 195 246 246 HOH HOH A . 
D 4 HOH 196 247 247 HOH HOH A . 
D 4 HOH 197 248 248 HOH HOH A . 
D 4 HOH 198 249 249 HOH HOH A . 
D 4 HOH 199 250 250 HOH HOH A . 
D 4 HOH 200 252 252 HOH HOH A . 
D 4 HOH 201 253 253 HOH HOH A . 
D 4 HOH 202 257 257 HOH HOH A . 
D 4 HOH 203 260 260 HOH HOH A . 
D 4 HOH 204 262 262 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12000 ? 
1 MORE         -47   ? 
1 'SSA (A^2)'  35900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_565 -x,-y+1,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 92.3540000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y+1/2,x+1/2,z 0.0000000000  -1.0000000000 0.0000000000 46.1770000000  1.0000000000  
0.0000000000  0.0000000000 46.1770000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_455 y-1/2,-x+1/2,z 0.0000000000  1.0000000000  0.0000000000 -46.1770000000 -1.0000000000 
0.0000000000  0.0000000000 46.1770000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 0 ? D HOH . 
2 1 A HOH 1 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-07-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' refine             
2 4 'Structure model' struct_ref_seq_dif 
3 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_refine.ls_percent_reflns_obs'  
2 4 'Structure model' '_struct_ref_seq_dif.details'    
3 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 
4 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 
5 4 'Structure model' '_struct_site.pdbx_auth_seq_id'  
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX      .     ?                package 'P.D. Adams' PDAdams@lbl.gov          refinement        http://www.phenix-online.org/ 
C++ ? 1 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB          sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++ ? 2 
HKL-2000    .     ?                ?       ?            ?                        'data collection' ? ?   ? 3 
HKL-2000    .     ?                ?       ?            ?                        'data reduction'  ? ?   ? 4 
SCALEPACK   .     ?                ?       ?            ?                        'data scaling'    ? ?   ? 5 
AMoRE       .     ?                ?       ?            ?                        phasing           ? ?   ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 514 ? ? -83.08  -158.28 
2 1 ASP A 515 ? ? -128.80 -55.17  
3 1 GLU A 516 ? ? 73.74   -44.82  
4 1 ALA A 569 ? ? 76.30   -3.85   
5 1 GLU A 618 ? ? -101.63 -127.13 
6 1 ARG A 660 ? ? -76.34  26.76   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ARG 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    661 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    662 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.91 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 471 ? CG  ? A ASP 4   CG  
2  1 Y 1 A ASP 471 ? OD1 ? A ASP 4   OD1 
3  1 Y 1 A ASP 471 ? OD2 ? A ASP 4   OD2 
4  1 Y 1 A SER 472 ? OG  ? A SER 5   OG  
5  1 Y 1 A ARG 475 ? CG  ? A ARG 8   CG  
6  1 Y 1 A ARG 475 ? CD  ? A ARG 8   CD  
7  1 Y 1 A ARG 475 ? NE  ? A ARG 8   NE  
8  1 Y 1 A ARG 475 ? CZ  ? A ARG 8   CZ  
9  1 Y 1 A ARG 475 ? NH1 ? A ARG 8   NH1 
10 1 Y 1 A ARG 475 ? NH2 ? A ARG 8   NH2 
11 1 Y 1 A ARG 478 ? CG  ? A ARG 11  CG  
12 1 Y 1 A ARG 478 ? CD  ? A ARG 11  CD  
13 1 Y 1 A ARG 478 ? NE  ? A ARG 11  NE  
14 1 Y 1 A ARG 478 ? CZ  ? A ARG 11  CZ  
15 1 Y 1 A ARG 478 ? NH1 ? A ARG 11  NH1 
16 1 Y 1 A ARG 478 ? NH2 ? A ARG 11  NH2 
17 1 Y 1 A LYS 482 ? CG  ? A LYS 15  CG  
18 1 Y 1 A LYS 482 ? CD  ? A LYS 15  CD  
19 1 Y 1 A LYS 482 ? CE  ? A LYS 15  CE  
20 1 Y 1 A LYS 482 ? NZ  ? A LYS 15  NZ  
21 1 Y 1 A TYR 490 ? CG  ? A TYR 23  CG  
22 1 Y 1 A TYR 490 ? CD1 ? A TYR 23  CD1 
23 1 Y 1 A TYR 490 ? CD2 ? A TYR 23  CD2 
24 1 Y 1 A TYR 490 ? CE1 ? A TYR 23  CE1 
25 1 Y 1 A TYR 490 ? CE2 ? A TYR 23  CE2 
26 1 Y 1 A TYR 490 ? CZ  ? A TYR 23  CZ  
27 1 Y 1 A TYR 490 ? OH  ? A TYR 23  OH  
28 1 Y 1 A ARG 517 ? CG  ? A ARG 50  CG  
29 1 Y 1 A ARG 517 ? CD  ? A ARG 50  CD  
30 1 Y 1 A ARG 517 ? NE  ? A ARG 50  NE  
31 1 Y 1 A ARG 517 ? CZ  ? A ARG 50  CZ  
32 1 Y 1 A ARG 517 ? NH1 ? A ARG 50  NH1 
33 1 Y 1 A ARG 517 ? NH2 ? A ARG 50  NH2 
34 1 Y 1 A HIS 518 ? CG  ? A HIS 51  CG  
35 1 Y 1 A HIS 518 ? ND1 ? A HIS 51  ND1 
36 1 Y 1 A HIS 518 ? CD2 ? A HIS 51  CD2 
37 1 Y 1 A HIS 518 ? CE1 ? A HIS 51  CE1 
38 1 Y 1 A HIS 518 ? NE2 ? A HIS 51  NE2 
39 1 Y 1 A ASP 538 ? CG  ? A ASP 71  CG  
40 1 Y 1 A ASP 538 ? OD1 ? A ASP 71  OD1 
41 1 Y 1 A ASP 538 ? OD2 ? A ASP 71  OD2 
42 1 Y 1 A VAL 547 ? CG1 ? A VAL 80  CG1 
43 1 Y 1 A VAL 547 ? CG2 ? A VAL 80  CG2 
44 1 Y 1 A LYS 652 ? CG  ? A LYS 185 CG  
45 1 Y 1 A LYS 652 ? CD  ? A LYS 185 CD  
46 1 Y 1 A LYS 652 ? CE  ? A LYS 185 CE  
47 1 Y 1 A LYS 652 ? NZ  ? A LYS 185 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 468 ? A GLY 1   
2 1 Y 1 A ALA 469 ? A ALA 2   
3 1 Y 1 A MET 470 ? A MET 3   
4 1 Y 1 A THR 663 ? A THR 196 
5 1 Y 1 A ARG 664 ? A ARG 197 
6 1 Y 1 A ILE 665 ? A ILE 198 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COBALT HEXAMMINE(III)'                NCO 
3 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
4 water                                  HOH 
#