data_2PUA
# 
_entry.id   2PUA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2PUA         pdb_00002pua 10.2210/pdb2pua/pdb 
RCSB  PDR040       ?            ?                   
WWPDB D_1000178518 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2PUA 
_pdbx_database_status.recvd_initial_deposition_date   1997-10-04 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schumacher, R.G.' 1 
'Choi, K.Y.'       2 
'Zalkin, H.'       3 
'Brennan, M.A.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.' Science      266 763 770 
1994 SCIEAS US 0036-8075 0038 ? 7973627 ? 
1       
'Structure-Based Redesign of Corepressor Specificity of the Escherichia Coli Purine Repressor by Substitution of Residue 190' 
Biochemistry 37  971 982 1998 BICHAW US 0006-2960 0033 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schumacher, M.A.' 1  ? 
primary 'Choi, K.Y.'       2  ? 
primary 'Zalkin, H.'       3  ? 
primary 'Brennan, R.G.'    4  ? 
1       'Lu, F.'           5  ? 
1       'Schumacher, M.A.' 6  ? 
1       'Arvidson, D.N.'   7  ? 
1       'Haldimann, A.'    8  ? 
1       'Wanner, B.L.'     9  ? 
1       'Zalkin, H.'       10 ? 
1       'Brennan, R.G.'    11 ? 
# 
_cell.entry_id           2PUA 
_cell.length_a           175.650 
_cell.length_b           94.680 
_cell.length_c           81.830 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2PUA 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T )-3')
;
5202.384  1  ? ?     ? ? 
2 polymer     man 'PURINE REPRESSOR'                                                   38005.480 1  ? R190A ? ? 
3 non-polymer syn 6-METHYLPURINE                                                       134.139   1  ? ?     ? ? 
4 water       nat water                                                                18.015    59 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DG)(DC)(DA)(DA)(DA)(DC)(DG)(DT)(DT)(DT)(DG)(DC)(DG)(DT)' TACGCAAACGTTTGCGT B ? 
2 'polypeptide(L)'        no no 
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DC  n 
1 4   DG  n 
1 5   DC  n 
1 6   DA  n 
1 7   DA  n 
1 8   DA  n 
1 9   DC  n 
1 10  DG  n 
1 11  DT  n 
1 12  DT  n 
1 13  DT  n 
1 14  DG  n 
1 15  DC  n 
1 16  DG  n 
1 17  DT  n 
2 1   ALA n 
2 2   THR n 
2 3   ILE n 
2 4   LYS n 
2 5   ASP n 
2 6   VAL n 
2 7   ALA n 
2 8   LYS n 
2 9   ARG n 
2 10  ALA n 
2 11  ASN n 
2 12  VAL n 
2 13  SER n 
2 14  THR n 
2 15  THR n 
2 16  THR n 
2 17  VAL n 
2 18  SER n 
2 19  HIS n 
2 20  VAL n 
2 21  ILE n 
2 22  ASN n 
2 23  LYS n 
2 24  THR n 
2 25  ARG n 
2 26  PHE n 
2 27  VAL n 
2 28  ALA n 
2 29  GLU n 
2 30  GLU n 
2 31  THR n 
2 32  ARG n 
2 33  ASN n 
2 34  ALA n 
2 35  VAL n 
2 36  TRP n 
2 37  ALA n 
2 38  ALA n 
2 39  ILE n 
2 40  LYS n 
2 41  GLU n 
2 42  LEU n 
2 43  HIS n 
2 44  TYR n 
2 45  SER n 
2 46  PRO n 
2 47  SER n 
2 48  ALA n 
2 49  VAL n 
2 50  ALA n 
2 51  ARG n 
2 52  SER n 
2 53  LEU n 
2 54  LYS n 
2 55  VAL n 
2 56  ASN n 
2 57  HIS n 
2 58  THR n 
2 59  LYS n 
2 60  SER n 
2 61  ILE n 
2 62  GLY n 
2 63  LEU n 
2 64  LEU n 
2 65  ALA n 
2 66  THR n 
2 67  SER n 
2 68  SER n 
2 69  GLU n 
2 70  ALA n 
2 71  ALA n 
2 72  TYR n 
2 73  PHE n 
2 74  ALA n 
2 75  GLU n 
2 76  ILE n 
2 77  ILE n 
2 78  GLU n 
2 79  ALA n 
2 80  VAL n 
2 81  GLU n 
2 82  LYS n 
2 83  ASN n 
2 84  CYS n 
2 85  PHE n 
2 86  GLN n 
2 87  LYS n 
2 88  GLY n 
2 89  TYR n 
2 90  THR n 
2 91  LEU n 
2 92  ILE n 
2 93  LEU n 
2 94  GLY n 
2 95  ASN n 
2 96  ALA n 
2 97  TRP n 
2 98  ASN n 
2 99  ASN n 
2 100 LEU n 
2 101 GLU n 
2 102 LYS n 
2 103 GLN n 
2 104 ARG n 
2 105 ALA n 
2 106 TYR n 
2 107 LEU n 
2 108 SER n 
2 109 MET n 
2 110 MET n 
2 111 ALA n 
2 112 GLN n 
2 113 LYS n 
2 114 ARG n 
2 115 VAL n 
2 116 ASP n 
2 117 GLY n 
2 118 LEU n 
2 119 LEU n 
2 120 VAL n 
2 121 MET n 
2 122 CYS n 
2 123 SER n 
2 124 GLU n 
2 125 TYR n 
2 126 PRO n 
2 127 GLU n 
2 128 PRO n 
2 129 LEU n 
2 130 LEU n 
2 131 ALA n 
2 132 MET n 
2 133 LEU n 
2 134 GLU n 
2 135 GLU n 
2 136 TYR n 
2 137 ARG n 
2 138 HIS n 
2 139 ILE n 
2 140 PRO n 
2 141 MET n 
2 142 VAL n 
2 143 VAL n 
2 144 MET n 
2 145 ASP n 
2 146 TRP n 
2 147 GLY n 
2 148 GLU n 
2 149 ALA n 
2 150 LYS n 
2 151 ALA n 
2 152 ASP n 
2 153 PHE n 
2 154 THR n 
2 155 ASP n 
2 156 ALA n 
2 157 VAL n 
2 158 ILE n 
2 159 ASP n 
2 160 ASN n 
2 161 ALA n 
2 162 PHE n 
2 163 GLU n 
2 164 GLY n 
2 165 GLY n 
2 166 TYR n 
2 167 MET n 
2 168 ALA n 
2 169 GLY n 
2 170 ARG n 
2 171 TYR n 
2 172 LEU n 
2 173 ILE n 
2 174 GLU n 
2 175 ARG n 
2 176 GLY n 
2 177 HIS n 
2 178 ARG n 
2 179 GLU n 
2 180 ILE n 
2 181 GLY n 
2 182 VAL n 
2 183 ILE n 
2 184 PRO n 
2 185 GLY n 
2 186 PRO n 
2 187 LEU n 
2 188 GLU n 
2 189 ALA n 
2 190 ASN n 
2 191 THR n 
2 192 GLY n 
2 193 ALA n 
2 194 GLY n 
2 195 ARG n 
2 196 LEU n 
2 197 ALA n 
2 198 GLY n 
2 199 PHE n 
2 200 MET n 
2 201 LYS n 
2 202 ALA n 
2 203 MET n 
2 204 GLU n 
2 205 GLU n 
2 206 ALA n 
2 207 MET n 
2 208 ILE n 
2 209 LYS n 
2 210 VAL n 
2 211 PRO n 
2 212 GLU n 
2 213 SER n 
2 214 TRP n 
2 215 ILE n 
2 216 VAL n 
2 217 GLN n 
2 218 GLY n 
2 219 ASP n 
2 220 PHE n 
2 221 GLU n 
2 222 PRO n 
2 223 GLU n 
2 224 SER n 
2 225 GLY n 
2 226 TYR n 
2 227 ARG n 
2 228 ALA n 
2 229 MET n 
2 230 GLN n 
2 231 GLN n 
2 232 ILE n 
2 233 LEU n 
2 234 SER n 
2 235 GLN n 
2 236 PRO n 
2 237 HIS n 
2 238 ARG n 
2 239 PRO n 
2 240 THR n 
2 241 ALA n 
2 242 VAL n 
2 243 PHE n 
2 244 CYS n 
2 245 GLY n 
2 246 GLY n 
2 247 ASP n 
2 248 ILE n 
2 249 MET n 
2 250 ALA n 
2 251 MET n 
2 252 GLY n 
2 253 ALA n 
2 254 LEU n 
2 255 CYS n 
2 256 ALA n 
2 257 ALA n 
2 258 ASP n 
2 259 GLU n 
2 260 MET n 
2 261 GLY n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 PRO n 
2 266 GLN n 
2 267 ASP n 
2 268 VAL n 
2 269 SER n 
2 270 LEU n 
2 271 ILE n 
2 272 GLY n 
2 273 TYR n 
2 274 ASP n 
2 275 ASN n 
2 276 VAL n 
2 277 ARG n 
2 278 ASN n 
2 279 ALA n 
2 280 ARG n 
2 281 TYR n 
2 282 PHE n 
2 283 THR n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 THR n 
2 288 THR n 
2 289 ILE n 
2 290 HIS n 
2 291 GLN n 
2 292 PRO n 
2 293 LYS n 
2 294 ASP n 
2 295 SER n 
2 296 LEU n 
2 297 GLY n 
2 298 GLU n 
2 299 THR n 
2 300 ALA n 
2 301 PHE n 
2 302 ASN n 
2 303 MET n 
2 304 LEU n 
2 305 LEU n 
2 306 ASP n 
2 307 ARG n 
2 308 ILE n 
2 309 VAL n 
2 310 ASN n 
2 311 LYS n 
2 312 ARG n 
2 313 GLU n 
2 314 GLU n 
2 315 PRO n 
2 316 GLN n 
2 317 SER n 
2 318 ILE n 
2 319 GLU n 
2 320 VAL n 
2 321 HIS n 
2 322 PRO n 
2 323 ARG n 
2 324 LEU n 
2 325 ILE n 
2 326 GLU n 
2 327 ARG n 
2 328 ARG n 
2 329 SER n 
2 330 VAL n 
2 331 ALA n 
2 332 ASP n 
2 333 GLY n 
2 334 PRO n 
2 335 PHE n 
2 336 ARG n 
2 337 ASP n 
2 338 TYR n 
2 339 ARG n 
2 340 ARG n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PURR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET24A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PURR_ECOLI 2 ? ? P0ACP7 ? 
2 PDB 2PUA       1 ? ? 2PUA   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2PUA A 1 ? 340 ? P0ACP7 1   ? 340 ? 2   341 
2 2 2PUA B 1 ? 17  ? 2PUA   699 ? 715 ? 699 715 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2PUA 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      189 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P0ACP7 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          189 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            190 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6MP non-polymer         n 6-METHYLPURINE                       ? 'C6 H6 N4'        134.139 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2PUA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.76 
_exptl_crystal.density_Matthews      3.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.00 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.40 
_exptl_crystal_grow.pdbx_details    'pH 7.40, VAPOR DIFFUSION, HANGING DROP, temperature 293.00K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 WATER                    ? ? ? 
1 2  1 'NA-K PHOSPHATE'         ? ? ? 
1 3  1 DTT                      ? ? ? 
1 4  1 'NA CACODYLATE'          ? ? ? 
1 5  1 'PRECIPITATING SOLUTION' ? ? ? 
1 6  2 WATER                    ? ? ? 
1 7  2 'PEG 4000'               ? ? ? 
1 8  2 'AMMONIUM SULFATE'       ? ? ? 
1 9  2 'COBALT HEXAMINE'        ? ? ? 
1 10 2 'AMMONIUM PHOSPHATE'     ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SDMS 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2PUA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            2.900 
_reflns.number_obs                   14911 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.000 
_reflns.pdbx_Rmerge_I_obs            0.0900000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.7000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.430 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2PUA 
_refine.ls_number_reflns_obs                     14911 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.000 
_refine.ls_d_res_high                            2.900 
_refine.ls_percent_reflns_obs                    99.000 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1660000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2651 
_refine_hist.pdbx_number_atoms_nucleic_acid   345 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             59 
_refine_hist.number_atoms_total               3065 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        10.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.016 ? 1.900 3097 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.756 ? 2.200 4243 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 20.51 ? 0.000 1754 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle      63.31 ? 1.000 15   'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.012 ? 3.400 67   'X-RAY DIFFRACTION' ? 
t_gen_planes       0.010 ? 4.000 409  'X-RAY DIFFRACTION' ? 
t_it               5.098 ? 4.900 2705 'X-RAY DIFFRACTION' ? 
t_nbd              0.060 ? 19.00 0    'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2PUA 
_struct.title                     
'CRYSTAL STRUCTURE OF THE LACI FAMILY MEMBER, PURR, BOUND TO DNA: MINOR GROOVE BINDING BY ALPHA HELICES' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2PUA 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'COMPLEX (DNA-BINDING PROTEIN-DNA), DNA-BINDING REGULATORY PROTEIN, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE COMPLEX LIES ON A CRYSTALLOGRAPHIC TWO-FOLD AXIS, AND
ONLY ONE MONOMER-DNA HALF-SITE CONSTITUTES THE ASYMMETRIC
UNIT.  THE COORDINATES COMPRISE ONE REPRESSOR MONOMER AND
ONE DNA STRAND FOR THE ENTIRE SITE.  THE FULL COMPLEX CAN
BE CONSTRUCTED BY GENERATING THE SECOND HALF USING THE
CRYSTALLOGRAPHIC SYMMETRY OPERATION (X, -Y, -Z).
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE B 3   ? ALA B 10  ? ILE A 4   ALA A 11  1 ? 8  
HELX_P HELX_P2  2  THR B 14  ? ASN B 22  ? THR A 15  ASN A 23  1 ? 9  
HELX_P HELX_P3  3  GLU B 29  ? LEU B 42  ? GLU A 30  LEU A 43  1 ? 14 
HELX_P HELX_P4  4  ALA B 48  ? VAL B 55  ? ALA A 49  VAL A 56  1 ? 8  
HELX_P HELX_P5  5  ALA B 71  ? GLN B 86  ? ALA A 72  GLN A 87  1 ? 16 
HELX_P HELX_P6  6  LEU B 100 ? GLN B 112 ? LEU A 101 GLN A 113 1 ? 13 
HELX_P HELX_P7  7  GLU B 127 ? TYR B 136 ? GLU A 128 TYR A 137 1 ? 10 
HELX_P HELX_P8  8  ALA B 161 ? ARG B 175 ? ALA A 162 ARG A 176 1 ? 15 
HELX_P HELX_P9  9  ASN B 190 ? GLU B 205 ? ASN A 191 GLU A 206 1 ? 16 
HELX_P HELX_P10 10 GLU B 212 ? TRP B 214 ? GLU A 213 TRP A 215 5 ? 3  
HELX_P HELX_P11 11 PRO B 222 ? LEU B 233 ? PRO A 223 LEU A 234 1 ? 12 
HELX_P HELX_P12 12 ASP B 247 ? MET B 260 ? ASP A 248 MET A 261 1 ? 14 
HELX_P HELX_P13 13 ALA B 279 ? TYR B 281 ? ALA A 280 TYR A 282 5 ? 3  
HELX_P HELX_P14 14 LYS B 293 ? VAL B 309 ? LYS A 294 VAL A 310 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 A DT 17 N3 ? ? B DA 700 B DT 715 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 A DT 17 O4 ? ? B DA 700 B DT 715 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DC 3  N3 ? ? ? 1_555 A DG 16 N1 ? ? B DC 701 B DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DC 3  N4 ? ? ? 1_555 A DG 16 O6 ? ? B DC 701 B DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DC 3  O2 ? ? ? 1_555 A DG 16 N2 ? ? B DC 701 B DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DG 4  N1 ? ? ? 1_555 A DC 15 N3 ? ? B DG 702 B DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DG 4  N2 ? ? ? 1_555 A DC 15 O2 ? ? B DG 702 B DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DG 4  O6 ? ? ? 1_555 A DC 15 N4 ? ? B DG 702 B DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DC 5  N3 ? ? ? 1_555 A DG 14 N1 ? ? B DC 703 B DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DC 5  N4 ? ? ? 1_555 A DG 14 O6 ? ? B DC 703 B DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DC 5  O2 ? ? ? 1_555 A DG 14 N2 ? ? B DC 703 B DG 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DA 6  N1 ? ? ? 1_555 A DT 13 N3 ? ? B DA 704 B DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DA 6  N6 ? ? ? 1_555 A DT 13 O4 ? ? B DA 704 B DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 7  N1 ? ? ? 1_555 A DT 12 N3 ? ? B DA 705 B DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DA 7  N6 ? ? ? 1_555 A DT 12 O4 ? ? B DA 705 B DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DA 8  N1 ? ? ? 1_555 A DT 11 N3 ? ? B DA 706 B DT 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DA 8  N6 ? ? ? 1_555 A DT 11 O4 ? ? B DA 706 B DT 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 9  N3 ? ? ? 1_555 A DG 10 N1 ? ? B DC 707 B DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DC 9  N4 ? ? ? 1_555 A DG 10 O6 ? ? B DC 707 B DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DC 9  O2 ? ? ? 1_555 A DG 10 N2 ? ? B DC 707 B DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DG 10 N1 ? ? ? 1_555 A DC 9  N3 ? ? B DG 708 B DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DG 10 N2 ? ? ? 1_555 A DC 9  O2 ? ? B DG 708 B DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DG 10 O6 ? ? ? 1_555 A DC 9  N4 ? ? B DG 708 B DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DT 11 N3 ? ? ? 1_555 A DA 8  N1 ? ? B DT 709 B DA 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DT 11 O4 ? ? ? 1_555 A DA 8  N6 ? ? B DT 709 B DA 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DT 12 N3 ? ? ? 1_555 A DA 7  N1 ? ? B DT 710 B DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DT 12 O4 ? ? ? 1_555 A DA 7  N6 ? ? B DT 710 B DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DT 13 N3 ? ? ? 1_555 A DA 6  N1 ? ? B DT 711 B DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DT 13 O4 ? ? ? 1_555 A DA 6  N6 ? ? B DT 711 B DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DG 14 N1 ? ? ? 1_555 A DC 5  N3 ? ? B DG 712 B DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DG 14 N2 ? ? ? 1_555 A DC 5  O2 ? ? B DG 712 B DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DG 14 O6 ? ? ? 1_555 A DC 5  N4 ? ? B DG 712 B DC 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DC 15 N3 ? ? ? 1_555 A DG 4  N1 ? ? B DC 713 B DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DC 15 N4 ? ? ? 1_555 A DG 4  O6 ? ? B DC 713 B DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DC 15 O2 ? ? ? 1_555 A DG 4  N2 ? ? B DC 713 B DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DG 16 N1 ? ? ? 1_555 A DC 3  N3 ? ? B DG 714 B DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DG 16 N2 ? ? ? 1_555 A DC 3  O2 ? ? B DG 714 B DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DG 16 O6 ? ? ? 1_555 A DC 3  N4 ? ? B DG 714 B DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DT 17 N3 ? ? ? 1_555 A DA 2  N1 ? ? B DT 715 B DA 700 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DT 17 O4 ? ? ? 1_555 A DA 2  N6 ? ? B DT 715 B DA 700 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 264 B . ? VAL 265 A PRO 265 B ? PRO 266 A 1 3.47 
2 THR 283 B . ? THR 284 A PRO 284 B ? PRO 285 A 1 2.54 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU B 91  ? ASN B 95  ? LEU A 92  ASN A 96  
A 2 ILE B 61  ? ALA B 65  ? ILE A 62  ALA A 66  
A 3 GLY B 117 ? MET B 121 ? GLY A 118 MET A 122 
A 4 PRO B 140 ? VAL B 143 ? PRO A 141 VAL A 144 
B 1 ALA B 156 ? ILE B 158 ? ALA A 157 ILE A 159 
B 2 SER B 317 ? GLU B 319 ? SER A 318 GLU A 320 
C 1 ILE B 180 ? ILE B 183 ? ILE A 181 ILE A 184 
C 2 ALA B 241 ? CYS B 244 ? ALA A 242 CYS A 245 
C 3 SER B 269 ? ASP B 274 ? SER A 270 ASP A 275 
C 4 THR B 287 ? HIS B 290 ? THR A 288 HIS A 291 
C 5 ARG B 323 ? ILE B 325 ? ARG A 324 ILE A 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE B 92  ? O ILE A 93  N ILE B 61  ? N ILE A 62  
A 2 3 O GLY B 62  ? O GLY A 63  N GLY B 117 ? N GLY A 118 
A 3 4 O LEU B 118 ? O LEU A 119 N PRO B 140 ? N PRO A 141 
B 1 2 O ALA B 156 ? O ALA A 157 N ILE B 318 ? N ILE A 319 
C 1 2 O GLY B 181 ? O GLY A 182 N ALA B 241 ? N ALA A 242 
C 2 3 O VAL B 242 ? O VAL A 243 N SER B 269 ? N SER A 270 
C 3 4 O GLY B 272 ? O GLY A 273 N THR B 287 ? N THR A 288 
C 4 5 O THR B 288 ? O THR A 289 N ILE B 325 ? N ILE A 326 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    6MP 
_struct_site.pdbx_auth_seq_id     599 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE 6MP A 599' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 TYR B 72  ? TYR A 73  . ? 1_555 ? 
2 AC1 7 PHE B 73  ? PHE A 74  . ? 1_555 ? 
3 AC1 7 SER B 123 ? SER A 124 . ? 1_555 ? 
4 AC1 7 THR B 191 ? THR A 192 . ? 1_555 ? 
5 AC1 7 ARG B 195 ? ARG A 196 . ? 1_555 ? 
6 AC1 7 PHE B 220 ? PHE A 221 . ? 1_555 ? 
7 AC1 7 ASP B 274 ? ASP A 275 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2PUA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2PUA 
_atom_sites.fract_transf_matrix[1][1]   0.005693 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010562 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012220 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? 7.495  26.763  18.857  1.00 100.00 ? 699 DT  B "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? 7.142  26.894  20.226  1.00 13.33  ? 699 DT  B "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 7.409  25.600  20.970  1.00 86.98  ? 699 DT  B "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 6.297  24.688  20.796  1.00 57.06  ? 699 DT  B "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 8.650  24.830  20.532  1.00 3.56   ? 699 DT  B "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 9.246  24.278  21.694  1.00 79.12  ? 699 DT  B "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? 8.082  23.744  19.627  1.00 31.07  ? 699 DT  B "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 6.781  23.442  20.353  1.00 41.43  ? 699 DT  B "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? 5.743  22.860  19.477  1.00 31.48  ? 699 DT  B N1    1 
ATOM   10   C C2    . DT  A 1 1   ? 5.042  21.782  19.967  1.00 100.00 ? 699 DT  B C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 5.246  21.308  21.071  1.00 76.25  ? 699 DT  B O2    1 
ATOM   12   N N3    . DT  A 1 1   ? 4.092  21.275  19.112  1.00 2.20   ? 699 DT  B N3    1 
ATOM   13   C C4    . DT  A 1 1   ? 3.779  21.753  17.847  1.00 14.39  ? 699 DT  B C4    1 
ATOM   14   O O4    . DT  A 1 1   ? 2.896  21.207  17.189  1.00 71.65  ? 699 DT  B O4    1 
ATOM   15   C C5    . DT  A 1 1   ? 4.556  22.887  17.404  1.00 100.00 ? 699 DT  B C5    1 
ATOM   16   C C7    . DT  A 1 1   ? 4.292  23.461  16.049  1.00 11.91  ? 699 DT  B C7    1 
ATOM   17   C C6    . DT  A 1 1   ? 5.490  23.393  18.230  1.00 2.28   ? 699 DT  B C6    1 
ATOM   18   P P     . DA  A 1 2   ? 10.435 23.226  21.559  1.00 35.96  ? 700 DA  B P     1 
ATOM   19   O OP1   . DA  A 1 2   ? 11.051 23.086  22.888  1.00 39.52  ? 700 DA  B OP1   1 
ATOM   20   O OP2   . DA  A 1 2   ? 11.263 23.617  20.393  1.00 41.99  ? 700 DA  B OP2   1 
ATOM   21   O "O5'" . DA  A 1 2   ? 9.668  21.878  21.199  1.00 27.18  ? 700 DA  B "O5'" 1 
ATOM   22   C "C5'" . DA  A 1 2   ? 9.770  20.745  22.048  1.00 78.36  ? 700 DA  B "C5'" 1 
ATOM   23   C "C4'" . DA  A 1 2   ? 9.151  19.547  21.358  1.00 36.06  ? 700 DA  B "C4'" 1 
ATOM   24   O "O4'" . DA  A 1 2   ? 8.349  20.026  20.265  1.00 60.42  ? 700 DA  B "O4'" 1 
ATOM   25   C "C3'" . DA  A 1 2   ? 10.156 18.574  20.748  1.00 91.90  ? 700 DA  B "C3'" 1 
ATOM   26   O "O3'" . DA  A 1 2   ? 10.187 17.387  21.519  1.00 43.06  ? 700 DA  B "O3'" 1 
ATOM   27   C "C2'" . DA  A 1 2   ? 9.653  18.306  19.321  1.00 10.92  ? 700 DA  B "C2'" 1 
ATOM   28   C "C1'" . DA  A 1 2   ? 8.338  19.074  19.238  1.00 37.82  ? 700 DA  B "C1'" 1 
ATOM   29   N N9    . DA  A 1 2   ? 8.155  19.797  17.990  1.00 25.21  ? 700 DA  B N9    1 
ATOM   30   C C8    . DA  A 1 2   ? 8.943  20.771  17.455  1.00 50.08  ? 700 DA  B C8    1 
ATOM   31   N N7    . DA  A 1 2   ? 8.500  21.245  16.317  1.00 93.60  ? 700 DA  B N7    1 
ATOM   32   C C5    . DA  A 1 2   ? 7.334  20.536  16.101  1.00 1.00   ? 700 DA  B C5    1 
ATOM   33   C C6    . DA  A 1 2   ? 6.383  20.574  15.071  1.00 30.48  ? 700 DA  B C6    1 
ATOM   34   N N6    . DA  A 1 2   ? 6.481  21.384  14.006  1.00 42.25  ? 700 DA  B N6    1 
ATOM   35   N N1    . DA  A 1 2   ? 5.334  19.729  15.162  1.00 9.93   ? 700 DA  B N1    1 
ATOM   36   C C2    . DA  A 1 2   ? 5.237  18.924  16.222  1.00 63.66  ? 700 DA  B C2    1 
ATOM   37   N N3    . DA  A 1 2   ? 6.063  18.807  17.254  1.00 16.74  ? 700 DA  B N3    1 
ATOM   38   C C4    . DA  A 1 2   ? 7.099  19.650  17.130  1.00 69.00  ? 700 DA  B C4    1 
ATOM   39   P P     . DC  A 1 3   ? 10.898 16.078  20.953  1.00 36.51  ? 701 DC  B P     1 
ATOM   40   O OP1   . DC  A 1 3   ? 10.956 15.094  22.056  1.00 17.82  ? 701 DC  B OP1   1 
ATOM   41   O OP2   . DC  A 1 3   ? 12.141 16.477  20.240  1.00 30.86  ? 701 DC  B OP2   1 
ATOM   42   O "O5'" . DC  A 1 3   ? 9.854  15.597  19.863  1.00 51.28  ? 701 DC  B "O5'" 1 
ATOM   43   C "C5'" . DC  A 1 3   ? 9.040  14.472  20.117  1.00 27.22  ? 701 DC  B "C5'" 1 
ATOM   44   C "C4'" . DC  A 1 3   ? 8.103  14.316  18.960  1.00 10.66  ? 701 DC  B "C4'" 1 
ATOM   45   O "O4'" . DC  A 1 3   ? 8.152  15.504  18.149  1.00 15.44  ? 701 DC  B "O4'" 1 
ATOM   46   C "C3'" . DC  A 1 3   ? 8.418  13.175  18.003  1.00 62.37  ? 701 DC  B "C3'" 1 
ATOM   47   O "O3'" . DC  A 1 3   ? 7.546  12.106  18.292  1.00 24.83  ? 701 DC  B "O3'" 1 
ATOM   48   C "C2'" . DC  A 1 3   ? 8.137  13.763  16.605  1.00 12.32  ? 701 DC  B "C2'" 1 
ATOM   49   C "C1'" . DC  A 1 3   ? 7.587  15.158  16.917  1.00 5.09   ? 701 DC  B "C1'" 1 
ATOM   50   N N1    . DC  A 1 3   ? 7.953  16.204  15.935  1.00 13.08  ? 701 DC  B N1    1 
ATOM   51   C C2    . DC  A 1 3   ? 7.143  16.366  14.794  1.00 16.96  ? 701 DC  B C2    1 
ATOM   52   O O2    . DC  A 1 3   ? 6.157  15.637  14.637  1.00 52.21  ? 701 DC  B O2    1 
ATOM   53   N N3    . DC  A 1 3   ? 7.473  17.324  13.891  1.00 74.12  ? 701 DC  B N3    1 
ATOM   54   C C4    . DC  A 1 3   ? 8.546  18.094  14.097  1.00 27.24  ? 701 DC  B C4    1 
ATOM   55   N N4    . DC  A 1 3   ? 8.830  19.017  13.185  1.00 25.89  ? 701 DC  B N4    1 
ATOM   56   C C5    . DC  A 1 3   ? 9.369  17.955  15.254  1.00 14.63  ? 701 DC  B C5    1 
ATOM   57   C C6    . DC  A 1 3   ? 9.042  17.007  16.139  1.00 4.21   ? 701 DC  B C6    1 
ATOM   58   P P     . DG  A 1 4   ? 7.903  10.634  17.840  1.00 62.63  ? 702 DG  B P     1 
ATOM   59   O OP1   . DG  A 1 4   ? 7.532  9.750   18.970  1.00 64.15  ? 702 DG  B OP1   1 
ATOM   60   O OP2   . DG  A 1 4   ? 9.281  10.629  17.308  1.00 53.02  ? 702 DG  B OP2   1 
ATOM   61   O "O5'" . DG  A 1 4   ? 6.906  10.408  16.623  1.00 47.19  ? 702 DG  B "O5'" 1 
ATOM   62   C "C5'" . DG  A 1 4   ? 5.510  10.478  16.865  1.00 74.22  ? 702 DG  B "C5'" 1 
ATOM   63   C "C4'" . DG  A 1 4   ? 4.755  10.605  15.564  1.00 22.02  ? 702 DG  B "C4'" 1 
ATOM   64   O "O4'" . DG  A 1 4   ? 5.209  11.768  14.845  1.00 55.07  ? 702 DG  B "O4'" 1 
ATOM   65   C "C3'" . DG  A 1 4   ? 4.917  9.431   14.610  1.00 100.00 ? 702 DG  B "C3'" 1 
ATOM   66   O "O3'" . DG  A 1 4   ? 3.640  9.026   14.136  1.00 37.83  ? 702 DG  B "O3'" 1 
ATOM   67   C "C2'" . DG  A 1 4   ? 5.789  9.998   13.485  1.00 100.00 ? 702 DG  B "C2'" 1 
ATOM   68   C "C1'" . DG  A 1 4   ? 5.337  11.443  13.482  1.00 4.49   ? 702 DG  B "C1'" 1 
ATOM   69   N N9    . DG  A 1 4   ? 6.291  12.398  12.949  1.00 63.85  ? 702 DG  B N9    1 
ATOM   70   C C8    . DG  A 1 4   ? 7.450  12.820  13.540  1.00 36.49  ? 702 DG  B C8    1 
ATOM   71   N N7    . DG  A 1 4   ? 8.090  13.774  12.822  1.00 4.56   ? 702 DG  B N7    1 
ATOM   72   C C5    . DG  A 1 4   ? 7.262  13.980  11.741  1.00 51.34  ? 702 DG  B C5    1 
ATOM   73   C C6    . DG  A 1 4   ? 7.430  14.870  10.668  1.00 11.34  ? 702 DG  B C6    1 
ATOM   74   O O6    . DG  A 1 4   ? 8.357  15.661  10.494  1.00 23.96  ? 702 DG  B O6    1 
ATOM   75   N N1    . DG  A 1 4   ? 6.374  14.798  9.763   1.00 29.64  ? 702 DG  B N1    1 
ATOM   76   C C2    . DG  A 1 4   ? 5.297  13.965  9.883   1.00 28.02  ? 702 DG  B C2    1 
ATOM   77   N N2    . DG  A 1 4   ? 4.396  14.040  8.901   1.00 48.90  ? 702 DG  B N2    1 
ATOM   78   N N3    . DG  A 1 4   ? 5.119  13.108  10.895  1.00 60.53  ? 702 DG  B N3    1 
ATOM   79   C C4    . DG  A 1 4   ? 6.143  13.168  11.793  1.00 5.94   ? 702 DG  B C4    1 
ATOM   80   P P     . DC  A 1 5   ? 3.458  7.553   13.545  1.00 68.18  ? 703 DC  B P     1 
ATOM   81   O OP1   . DC  A 1 5   ? 2.447  6.858   14.367  1.00 100.00 ? 703 DC  B OP1   1 
ATOM   82   O OP2   . DC  A 1 5   ? 4.805  6.958   13.361  1.00 99.86  ? 703 DC  B OP2   1 
ATOM   83   O "O5'" . DC  A 1 5   ? 2.856  7.833   12.102  1.00 21.83  ? 703 DC  B "O5'" 1 
ATOM   84   C "C5'" . DC  A 1 5   ? 2.812  9.155   11.594  1.00 28.54  ? 703 DC  B "C5'" 1 
ATOM   85   C "C4'" . DC  A 1 5   ? 1.891  9.188   10.402  1.00 46.57  ? 703 DC  B "C4'" 1 
ATOM   86   O "O4'" . DC  A 1 5   ? 2.416  10.084  9.403   1.00 78.01  ? 703 DC  B "O4'" 1 
ATOM   87   C "C3'" . DC  A 1 5   ? 1.814  7.865   9.672   1.00 22.21  ? 703 DC  B "C3'" 1 
ATOM   88   O "O3'" . DC  A 1 5   ? 0.710  7.895   8.782   1.00 100.00 ? 703 DC  B "O3'" 1 
ATOM   89   C "C2'" . DC  A 1 5   ? 3.142  7.873   8.917   1.00 49.33  ? 703 DC  B "C2'" 1 
ATOM   90   C "C1'" . DC  A 1 5   ? 3.289  9.357   8.550   1.00 27.84  ? 703 DC  B "C1'" 1 
ATOM   91   N N1    . DC  A 1 5   ? 4.643  9.911   8.788   1.00 59.42  ? 703 DC  B N1    1 
ATOM   92   C C2    . DC  A 1 5   ? 5.114  10.890  7.904   1.00 100.00 ? 703 DC  B C2    1 
ATOM   93   O O2    . DC  A 1 5   ? 4.408  11.223  6.947   1.00 28.94  ? 703 DC  B O2    1 
ATOM   94   N N3    . DC  A 1 5   ? 6.335  11.433  8.124   1.00 9.02   ? 703 DC  B N3    1 
ATOM   95   C C4    . DC  A 1 5   ? 7.070  11.031  9.166   1.00 100.00 ? 703 DC  B C4    1 
ATOM   96   N N4    . DC  A 1 5   ? 8.274  11.583  9.356   1.00 16.73  ? 703 DC  B N4    1 
ATOM   97   C C5    . DC  A 1 5   ? 6.595  10.044  10.080  1.00 59.91  ? 703 DC  B C5    1 
ATOM   98   C C6    . DC  A 1 5   ? 5.386  9.525   9.859   1.00 17.73  ? 703 DC  B C6    1 
ATOM   99   P P     . DA  A 1 6   ? 0.298  6.583   7.981   1.00 79.52  ? 704 DA  B P     1 
ATOM   100  O OP1   . DA  A 1 6   ? -1.132 6.708   7.630   1.00 100.00 ? 704 DA  B OP1   1 
ATOM   101  O OP2   . DA  A 1 6   ? 0.770  5.417   8.769   1.00 70.72  ? 704 DA  B OP2   1 
ATOM   102  O "O5'" . DA  A 1 6   ? 1.173  6.692   6.641   1.00 29.60  ? 704 DA  B "O5'" 1 
ATOM   103  C "C5'" . DA  A 1 6   ? 1.075  7.857   5.823   1.00 52.78  ? 704 DA  B "C5'" 1 
ATOM   104  C "C4'" . DA  A 1 6   ? 2.130  7.883   4.717   1.00 93.26  ? 704 DA  B "C4'" 1 
ATOM   105  O "O4'" . DA  A 1 6   ? 3.418  8.299   5.242   1.00 79.28  ? 704 DA  B "O4'" 1 
ATOM   106  C "C3'" . DA  A 1 6   ? 2.405  6.568   3.985   1.00 100.00 ? 704 DA  B "C3'" 1 
ATOM   107  O "O3'" . DA  A 1 6   ? 2.798  6.886   2.655   1.00 79.83  ? 704 DA  B "O3'" 1 
ATOM   108  C "C2'" . DA  A 1 6   ? 3.605  6.040   4.760   1.00 100.00 ? 704 DA  B "C2'" 1 
ATOM   109  C "C1'" . DA  A 1 6   ? 4.384  7.338   4.862   1.00 71.93  ? 704 DA  B "C1'" 1 
ATOM   110  N N9    . DA  A 1 6   ? 5.453  7.347   5.852   1.00 100.00 ? 704 DA  B N9    1 
ATOM   111  C C8    . DA  A 1 6   ? 5.588  6.586   6.980   1.00 33.84  ? 704 DA  B C8    1 
ATOM   112  N N7    . DA  A 1 6   ? 6.667  6.860   7.676   1.00 94.29  ? 704 DA  B N7    1 
ATOM   113  C C5    . DA  A 1 6   ? 7.277  7.872   6.955   1.00 67.75  ? 704 DA  B C5    1 
ATOM   114  C C6    . DA  A 1 6   ? 8.462  8.601   7.161   1.00 24.82  ? 704 DA  B C6    1 
ATOM   115  N N6    . DA  A 1 6   ? 9.271  8.399   8.203   1.00 61.42  ? 704 DA  B N6    1 
ATOM   116  N N1    . DA  A 1 6   ? 8.779  9.542   6.251   1.00 53.06  ? 704 DA  B N1    1 
ATOM   117  C C2    . DA  A 1 6   ? 7.962  9.738   5.210   1.00 41.24  ? 704 DA  B C2    1 
ATOM   118  N N3    . DA  A 1 6   ? 6.827  9.113   4.906   1.00 71.58  ? 704 DA  B N3    1 
ATOM   119  C C4    . DA  A 1 6   ? 6.542  8.181   5.827   1.00 41.34  ? 704 DA  B C4    1 
ATOM   120  P P     . DA  A 1 7   ? 2.347  5.987   1.415   1.00 100.00 ? 705 DA  B P     1 
ATOM   121  O OP1   . DA  A 1 7   ? 0.884  6.138   1.246   1.00 100.00 ? 705 DA  B OP1   1 
ATOM   122  O OP2   . DA  A 1 7   ? 2.943  4.641   1.587   1.00 100.00 ? 705 DA  B OP2   1 
ATOM   123  O "O5'" . DA  A 1 7   ? 3.052  6.722   0.180   1.00 68.77  ? 705 DA  B "O5'" 1 
ATOM   124  C "C5'" . DA  A 1 7   ? 3.419  8.090   0.293   1.00 99.25  ? 705 DA  B "C5'" 1 
ATOM   125  C "C4'" . DA  A 1 7   ? 4.803  8.321   -0.282  1.00 53.00  ? 705 DA  B "C4'" 1 
ATOM   126  O "O4'" . DA  A 1 7   ? 5.797  8.219   0.766   1.00 100.00 ? 705 DA  B "O4'" 1 
ATOM   127  C "C3'" . DA  A 1 7   ? 5.220  7.330   -1.359  1.00 77.19  ? 705 DA  B "C3'" 1 
ATOM   128  O "O3'" . DA  A 1 7   ? 5.923  8.008   -2.383  1.00 54.95  ? 705 DA  B "O3'" 1 
ATOM   129  C "C2'" . DA  A 1 7   ? 6.121  6.348   -0.616  1.00 39.85  ? 705 DA  B "C2'" 1 
ATOM   130  C "C1'" . DA  A 1 7   ? 6.767  7.254   0.416   1.00 57.48  ? 705 DA  B "C1'" 1 
ATOM   131  N N9    . DA  A 1 7   ? 7.184  6.568   1.633   1.00 10.41  ? 705 DA  B N9    1 
ATOM   132  C C8    . DA  A 1 7   ? 6.623  5.475   2.239   1.00 100.00 ? 705 DA  B C8    1 
ATOM   133  N N7    . DA  A 1 7   ? 7.242  5.108   3.337   1.00 24.80  ? 705 DA  B N7    1 
ATOM   134  C C5    . DA  A 1 7   ? 8.275  6.031   3.456   1.00 100.00 ? 705 DA  B C5    1 
ATOM   135  C C6    . DA  A 1 7   ? 9.300  6.198   4.410   1.00 18.18  ? 705 DA  B C6    1 
ATOM   136  N N6    . DA  A 1 7   ? 9.447  5.400   5.473   1.00 34.70  ? 705 DA  B N6    1 
ATOM   137  N N1    . DA  A 1 7   ? 10.155 7.222   4.230   1.00 56.78  ? 705 DA  B N1    1 
ATOM   138  C C2    . DA  A 1 7   ? 10.000 8.012   3.163   1.00 42.99  ? 705 DA  B C2    1 
ATOM   139  N N3    . DA  A 1 7   ? 9.088  7.949   2.202   1.00 23.47  ? 705 DA  B N3    1 
ATOM   140  C C4    . DA  A 1 7   ? 8.246  6.932   2.414   1.00 95.57  ? 705 DA  B C4    1 
ATOM   141  P P     . DA  A 1 8   ? 6.207  7.252   -3.760  1.00 61.46  ? 706 DA  B P     1 
ATOM   142  O OP1   . DA  A 1 8   ? 5.755  8.121   -4.871  1.00 96.66  ? 706 DA  B OP1   1 
ATOM   143  O OP2   . DA  A 1 8   ? 5.690  5.871   -3.636  1.00 95.05  ? 706 DA  B OP2   1 
ATOM   144  O "O5'" . DA  A 1 8   ? 7.797  7.170   -3.785  1.00 100.00 ? 706 DA  B "O5'" 1 
ATOM   145  C "C5'" . DA  A 1 8   ? 8.578  8.337   -3.567  1.00 39.37  ? 706 DA  B "C5'" 1 
ATOM   146  C "C4'" . DA  A 1 8   ? 9.984  7.948   -3.155  1.00 100.00 ? 706 DA  B "C4'" 1 
ATOM   147  O "O4'" . DA  A 1 8   ? 9.945  7.381   -1.827  1.00 43.83  ? 706 DA  B "O4'" 1 
ATOM   148  C "C3'" . DA  A 1 8   ? 10.640 6.889   -4.042  1.00 100.00 ? 706 DA  B "C3'" 1 
ATOM   149  O "O3'" . DA  A 1 8   ? 11.755 7.437   -4.729  1.00 90.06  ? 706 DA  B "O3'" 1 
ATOM   150  C "C2'" . DA  A 1 8   ? 11.054 5.758   -3.091  1.00 53.90  ? 706 DA  B "C2'" 1 
ATOM   151  C "C1'" . DA  A 1 8   ? 10.953 6.408   -1.717  1.00 85.71  ? 706 DA  B "C1'" 1 
ATOM   152  N N9    . DA  A 1 8   ? 10.567 5.482   -0.655  1.00 16.19  ? 706 DA  B N9    1 
ATOM   153  C C8    . DA  A 1 8   ? 9.497  4.636   -0.629  1.00 100.00 ? 706 DA  B C8    1 
ATOM   154  N N7    . DA  A 1 8   ? 9.402  3.936   0.475   1.00 34.73  ? 706 DA  B N7    1 
ATOM   155  C C5    . DA  A 1 8   ? 10.476 4.358   1.233   1.00 39.28  ? 706 DA  B C5    1 
ATOM   156  C C6    . DA  A 1 8   ? 10.924 3.994   2.514   1.00 23.85  ? 706 DA  B C6    1 
ATOM   157  N N6    . DA  A 1 8   ? 10.312 3.081   3.267   1.00 93.61  ? 706 DA  B N6    1 
ATOM   158  N N1    . DA  A 1 8   ? 12.028 4.595   2.986   1.00 34.64  ? 706 DA  B N1    1 
ATOM   159  C C2    . DA  A 1 8   ? 12.639 5.507   2.220   1.00 46.62  ? 706 DA  B C2    1 
ATOM   160  N N3    . DA  A 1 8   ? 12.313 5.935   1.003   1.00 26.93  ? 706 DA  B N3    1 
ATOM   161  C C4    . DA  A 1 8   ? 11.203 5.315   0.561   1.00 48.27  ? 706 DA  B C4    1 
ATOM   162  P P     . DC  A 1 9   ? 12.142 6.859   -6.166  1.00 100.00 ? 707 DC  B P     1 
ATOM   163  O OP1   . DC  A 1 9   ? 12.015 7.960   -7.153  1.00 99.17  ? 707 DC  B OP1   1 
ATOM   164  O OP2   . DC  A 1 9   ? 11.397 5.594   -6.352  1.00 51.13  ? 707 DC  B OP2   1 
ATOM   165  O "O5'" . DC  A 1 9   ? 13.690 6.509   -6.011  1.00 100.00 ? 707 DC  B "O5'" 1 
ATOM   166  C "C5'" . DC  A 1 9   ? 14.538 7.346   -5.242  1.00 100.00 ? 707 DC  B "C5'" 1 
ATOM   167  C "C4'" . DC  A 1 9   ? 15.608 6.503   -4.588  1.00 41.34  ? 707 DC  B "C4'" 1 
ATOM   168  O "O4'" . DC  A 1 9   ? 15.111 6.037   -3.327  1.00 32.83  ? 707 DC  B "O4'" 1 
ATOM   169  C "C3'" . DC  A 1 9   ? 15.919 5.236   -5.348  1.00 39.21  ? 707 DC  B "C3'" 1 
ATOM   170  O "O3'" . DC  A 1 9   ? 16.959 5.474   -6.280  1.00 21.23  ? 707 DC  B "O3'" 1 
ATOM   171  C "C2'" . DC  A 1 9   ? 16.325 4.237   -4.262  1.00 35.99  ? 707 DC  B "C2'" 1 
ATOM   172  C "C1'" . DC  A 1 9   ? 15.778 4.855   -2.969  1.00 48.92  ? 707 DC  B "C1'" 1 
ATOM   173  N N1    . DC  A 1 9   ? 14.791 4.006   -2.235  1.00 18.22  ? 707 DC  B N1    1 
ATOM   174  C C2    . DC  A 1 9   ? 15.003 3.793   -0.869  1.00 46.02  ? 707 DC  B C2    1 
ATOM   175  O O2    . DC  A 1 9   ? 15.996 4.285   -0.332  1.00 33.08  ? 707 DC  B O2    1 
ATOM   176  N N3    . DC  A 1 9   ? 14.114 3.043   -0.174  1.00 40.63  ? 707 DC  B N3    1 
ATOM   177  C C4    . DC  A 1 9   ? 13.052 2.530   -0.792  1.00 16.12  ? 707 DC  B C4    1 
ATOM   178  N N4    . DC  A 1 9   ? 12.207 1.797   -0.065  1.00 98.48  ? 707 DC  B N4    1 
ATOM   179  C C5    . DC  A 1 9   ? 12.815 2.743   -2.185  1.00 100.00 ? 707 DC  B C5    1 
ATOM   180  C C6    . DC  A 1 9   ? 13.697 3.485   -2.860  1.00 55.22  ? 707 DC  B C6    1 
ATOM   181  P P     . DG  A 1 10  ? 16.748 5.021   -7.793  1.00 52.17  ? 708 DG  B P     1 
ATOM   182  O OP1   . DG  A 1 10  ? 17.513 5.927   -8.667  1.00 35.80  ? 708 DG  B OP1   1 
ATOM   183  O OP2   . DG  A 1 10  ? 15.296 4.836   -8.011  1.00 66.69  ? 708 DG  B OP2   1 
ATOM   184  O "O5'" . DG  A 1 10  ? 17.448 3.592   -7.815  1.00 53.39  ? 708 DG  B "O5'" 1 
ATOM   185  C "C5'" . DG  A 1 10  ? 18.413 3.274   -6.824  1.00 24.79  ? 708 DG  B "C5'" 1 
ATOM   186  C "C4'" . DG  A 1 10  ? 18.728 1.791   -6.847  1.00 30.26  ? 708 DG  B "C4'" 1 
ATOM   187  O "O4'" . DG  A 1 10  ? 18.023 1.102   -5.778  1.00 39.84  ? 708 DG  B "O4'" 1 
ATOM   188  C "C3'" . DG  A 1 10  ? 18.348 1.083   -8.138  1.00 100.00 ? 708 DG  B "C3'" 1 
ATOM   189  O "O3'" . DG  A 1 10  ? 19.343 0.121   -8.441  1.00 19.87  ? 708 DG  B "O3'" 1 
ATOM   190  C "C2'" . DG  A 1 10  ? 17.021 0.432   -7.785  1.00 1.00   ? 708 DG  B "C2'" 1 
ATOM   191  C "C1'" . DG  A 1 10  ? 17.219 0.075   -6.321  1.00 39.76  ? 708 DG  B "C1'" 1 
ATOM   192  N N9    . DG  A 1 10  ? 15.949 0.075   -5.617  1.00 35.50  ? 708 DG  B N9    1 
ATOM   193  C C8    . DG  A 1 10  ? 14.805 0.752   -5.957  1.00 63.46  ? 708 DG  B C8    1 
ATOM   194  N N7    . DG  A 1 10  ? 13.786 0.543   -5.092  1.00 68.28  ? 708 DG  B N7    1 
ATOM   195  C C5    . DG  A 1 10  ? 14.333 -0.321  -4.154  1.00 1.00   ? 708 DG  B C5    1 
ATOM   196  C C6    . DG  A 1 10  ? 13.738 -0.886  -3.000  1.00 48.15  ? 708 DG  B C6    1 
ATOM   197  O O6    . DG  A 1 10  ? 12.582 -0.726  -2.584  1.00 80.18  ? 708 DG  B O6    1 
ATOM   198  N N1    . DG  A 1 10  ? 14.624 -1.706  -2.305  1.00 15.00  ? 708 DG  B N1    1 
ATOM   199  C C2    . DG  A 1 10  ? 15.929 -1.950  -2.675  1.00 100.00 ? 708 DG  B C2    1 
ATOM   200  N N2    . DG  A 1 10  ? 16.616 -2.773  -1.870  1.00 19.52  ? 708 DG  B N2    1 
ATOM   201  N N3    . DG  A 1 10  ? 16.512 -1.430  -3.765  1.00 15.46  ? 708 DG  B N3    1 
ATOM   202  C C4    . DG  A 1 10  ? 15.657 -0.622  -4.456  1.00 44.27  ? 708 DG  B C4    1 
ATOM   203  P P     . DT  A 1 11  ? 19.195 -0.888  -9.671  1.00 61.13  ? 709 DT  B P     1 
ATOM   204  O OP1   . DT  A 1 11  ? 20.244 -0.566  -10.663 1.00 25.75  ? 709 DT  B OP1   1 
ATOM   205  O OP2   . DT  A 1 11  ? 17.780 -0.952  -10.104 1.00 37.39  ? 709 DT  B OP2   1 
ATOM   206  O "O5'" . DT  A 1 11  ? 19.560 -2.260  -8.946  1.00 9.52   ? 709 DT  B "O5'" 1 
ATOM   207  C "C5'" . DT  A 1 11  ? 18.644 -3.338  -8.938  1.00 25.07  ? 709 DT  B "C5'" 1 
ATOM   208  C "C4'" . DT  A 1 11  ? 18.699 -4.019  -7.592  1.00 35.82  ? 709 DT  B "C4'" 1 
ATOM   209  O "O4'" . DT  A 1 11  ? 17.784 -3.352  -6.707  1.00 55.40  ? 709 DT  B "O4'" 1 
ATOM   210  C "C3'" . DT  A 1 11  ? 18.321 -5.490  -7.594  1.00 47.25  ? 709 DT  B "C3'" 1 
ATOM   211  O "O3'" . DT  A 1 11  ? 19.506 -6.268  -7.518  1.00 38.50  ? 709 DT  B "O3'" 1 
ATOM   212  C "C2'" . DT  A 1 11  ? 17.459 -5.684  -6.345  1.00 15.88  ? 709 DT  B "C2'" 1 
ATOM   213  C "C1'" . DT  A 1 11  ? 17.180 -4.273  -5.829  1.00 96.31  ? 709 DT  B "C1'" 1 
ATOM   214  N N1    . DT  A 1 11  ? 15.737 -3.945  -5.819  1.00 18.61  ? 709 DT  B N1    1 
ATOM   215  C C2    . DT  A 1 11  ? 14.983 -4.401  -4.762  1.00 14.78  ? 709 DT  B C2    1 
ATOM   216  O O2    . DT  A 1 11  ? 15.439 -5.060  -3.844  1.00 95.81  ? 709 DT  B O2    1 
ATOM   217  N N3    . DT  A 1 11  ? 13.659 -4.048  -4.822  1.00 60.63  ? 709 DT  B N3    1 
ATOM   218  C C4    . DT  A 1 11  ? 13.038 -3.299  -5.806  1.00 35.54  ? 709 DT  B C4    1 
ATOM   219  O O4    . DT  A 1 11  ? 11.837 -3.066  -5.715  1.00 73.37  ? 709 DT  B O4    1 
ATOM   220  C C5    . DT  A 1 11  ? 13.894 -2.853  -6.884  1.00 22.45  ? 709 DT  B C5    1 
ATOM   221  C C7    . DT  A 1 11  ? 13.343 -2.036  -8.009  1.00 11.05  ? 709 DT  B C7    1 
ATOM   222  C C6    . DT  A 1 11  ? 15.187 -3.194  -6.839  1.00 31.97  ? 709 DT  B C6    1 
ATOM   223  P P     . DT  A 1 12  ? 19.457 -7.835  -7.816  1.00 46.88  ? 710 DT  B P     1 
ATOM   224  O OP1   . DT  A 1 12  ? 20.821 -8.373  -7.596  1.00 80.71  ? 710 DT  B OP1   1 
ATOM   225  O OP2   . DT  A 1 12  ? 18.786 -8.022  -9.122  1.00 15.42  ? 710 DT  B OP2   1 
ATOM   226  O "O5'" . DT  A 1 12  ? 18.487 -8.405  -6.681  1.00 7.20   ? 710 DT  B "O5'" 1 
ATOM   227  C "C5'" . DT  A 1 12  ? 18.999 -8.571  -5.366  1.00 27.85  ? 710 DT  B "C5'" 1 
ATOM   228  C "C4'" . DT  A 1 12  ? 18.074 -9.421  -4.524  1.00 16.82  ? 710 DT  B "C4'" 1 
ATOM   229  O "O4'" . DT  A 1 12  ? 16.770 -8.798  -4.418  1.00 59.06  ? 710 DT  B "O4'" 1 
ATOM   230  C "C3'" . DT  A 1 12  ? 17.820 -10.839 -5.021  1.00 12.75  ? 710 DT  B "C3'" 1 
ATOM   231  O "O3'" . DT  A 1 12  ? 17.672 -11.654 -3.864  1.00 43.58  ? 710 DT  B "O3'" 1 
ATOM   232  C "C2'" . DT  A 1 12  ? 16.504 -10.679 -5.795  1.00 48.37  ? 710 DT  B "C2'" 1 
ATOM   233  C "C1'" . DT  A 1 12  ? 15.771 -9.666  -4.920  1.00 25.71  ? 710 DT  B "C1'" 1 
ATOM   234  N N1    . DT  A 1 12  ? 14.765 -8.809  -5.613  1.00 31.94  ? 710 DT  B N1    1 
ATOM   235  C C2    . DT  A 1 12  ? 13.608 -8.503  -4.914  1.00 100.00 ? 710 DT  B C2    1 
ATOM   236  O O2    . DT  A 1 12  ? 13.366 -8.937  -3.802  1.00 50.38  ? 710 DT  B O2    1 
ATOM   237  N N3    . DT  A 1 12  ? 12.733 -7.672  -5.575  1.00 3.99   ? 710 DT  B N3    1 
ATOM   238  C C4    . DT  A 1 12  ? 12.894 -7.132  -6.842  1.00 67.35  ? 710 DT  B C4    1 
ATOM   239  O O4    . DT  A 1 12  ? 12.017 -6.420  -7.331  1.00 39.90  ? 710 DT  B O4    1 
ATOM   240  C C5    . DT  A 1 12  ? 14.126 -7.478  -7.504  1.00 39.82  ? 710 DT  B C5    1 
ATOM   241  C C7    . DT  A 1 12  ? 14.391 -6.940  -8.876  1.00 15.24  ? 710 DT  B C7    1 
ATOM   242  C C6    . DT  A 1 12  ? 15.005 -8.282  -6.867  1.00 11.40  ? 710 DT  B C6    1 
ATOM   243  P P     . DT  A 1 13  ? 17.817 -13.246 -3.919  1.00 41.75  ? 711 DT  B P     1 
ATOM   244  O OP1   . DT  A 1 13  ? 18.530 -13.678 -2.696  1.00 46.39  ? 711 DT  B OP1   1 
ATOM   245  O OP2   . DT  A 1 13  ? 18.324 -13.625 -5.258  1.00 58.81  ? 711 DT  B OP2   1 
ATOM   246  O "O5'" . DT  A 1 13  ? 16.297 -13.705 -3.789  1.00 79.08  ? 711 DT  B "O5'" 1 
ATOM   247  C "C5'" . DT  A 1 13  ? 15.573 -13.282 -2.642  1.00 40.96  ? 711 DT  B "C5'" 1 
ATOM   248  C "C4'" . DT  A 1 13  ? 14.141 -13.759 -2.696  1.00 100.00 ? 711 DT  B "C4'" 1 
ATOM   249  O "O4'" . DT  A 1 13  ? 13.337 -12.806 -3.435  1.00 65.45  ? 711 DT  B "O4'" 1 
ATOM   250  C "C3'" . DT  A 1 13  ? 13.949 -15.093 -3.403  1.00 42.52  ? 711 DT  B "C3'" 1 
ATOM   251  O "O3'" . DT  A 1 13  ? 12.889 -15.792 -2.778  1.00 38.87  ? 711 DT  B "O3'" 1 
ATOM   252  C "C2'" . DT  A 1 13  ? 13.559 -14.664 -4.811  1.00 20.77  ? 711 DT  B "C2'" 1 
ATOM   253  C "C1'" . DT  A 1 13  ? 12.656 -13.496 -4.460  1.00 35.89  ? 711 DT  B "C1'" 1 
ATOM   254  N N1    . DT  A 1 13  ? 12.402 -12.550 -5.570  1.00 31.74  ? 711 DT  B N1    1 
ATOM   255  C C2    . DT  A 1 13  ? 11.230 -11.842 -5.502  1.00 53.91  ? 711 DT  B C2    1 
ATOM   256  O O2    . DT  A 1 13  ? 10.424 -11.978 -4.599  1.00 98.30  ? 711 DT  B O2    1 
ATOM   257  N N3    . DT  A 1 13  ? 11.030 -10.963 -6.535  1.00 17.00  ? 711 DT  B N3    1 
ATOM   258  C C4    . DT  A 1 13  ? 11.874 -10.740 -7.608  1.00 33.86  ? 711 DT  B C4    1 
ATOM   259  O O4    . DT  A 1 13  ? 11.566 -9.917  -8.464  1.00 38.28  ? 711 DT  B O4    1 
ATOM   260  C C5    . DT  A 1 13  ? 13.085 -11.517 -7.617  1.00 28.73  ? 711 DT  B C5    1 
ATOM   261  C C7    . DT  A 1 13  ? 14.055 -11.334 -8.744  1.00 1.00   ? 711 DT  B C7    1 
ATOM   262  C C6    . DT  A 1 13  ? 13.298 -12.383 -6.609  1.00 1.00   ? 711 DT  B C6    1 
ATOM   263  P P     . DG  A 1 14  ? 13.127 -17.297 -2.331  1.00 72.09  ? 712 DG  B P     1 
ATOM   264  O OP1   . DG  A 1 14  ? 14.102 -17.287 -1.213  1.00 61.49  ? 712 DG  B OP1   1 
ATOM   265  O OP2   . DG  A 1 14  ? 13.408 -18.088 -3.547  1.00 73.91  ? 712 DG  B OP2   1 
ATOM   266  O "O5'" . DG  A 1 14  ? 11.690 -17.704 -1.764  1.00 83.05  ? 712 DG  B "O5'" 1 
ATOM   267  C "C5'" . DG  A 1 14  ? 11.194 -17.052 -0.601  1.00 41.84  ? 712 DG  B "C5'" 1 
ATOM   268  C "C4'" . DG  A 1 14  ? 9.711  -16.769 -0.723  1.00 48.75  ? 712 DG  B "C4'" 1 
ATOM   269  O "O4'" . DG  A 1 14  ? 9.465  -15.819 -1.793  1.00 37.99  ? 712 DG  B "O4'" 1 
ATOM   270  C "C3'" . DG  A 1 14  ? 8.839  -17.986 -1.011  1.00 100.00 ? 712 DG  B "C3'" 1 
ATOM   271  O "O3'" . DG  A 1 14  ? 7.676  -17.931 -0.188  1.00 100.00 ? 712 DG  B "O3'" 1 
ATOM   272  C "C2'" . DG  A 1 14  ? 8.513  -17.854 -2.505  1.00 48.07  ? 712 DG  B "C2'" 1 
ATOM   273  C "C1'" . DG  A 1 14  ? 8.515  -16.342 -2.711  1.00 31.13  ? 712 DG  B "C1'" 1 
ATOM   274  N N9    . DG  A 1 14  ? 8.929  -15.934 -4.054  1.00 25.36  ? 712 DG  B N9    1 
ATOM   275  C C8    . DG  A 1 14  ? 10.012 -16.364 -4.776  1.00 32.67  ? 712 DG  B C8    1 
ATOM   276  N N7    . DG  A 1 14  ? 10.133 -15.748 -5.975  1.00 91.04  ? 712 DG  B N7    1 
ATOM   277  C C5    . DG  A 1 14  ? 9.056  -14.876 -6.000  1.00 1.37   ? 712 DG  B C5    1 
ATOM   278  C C6    . DG  A 1 14  ? 8.660  -13.957 -7.003  1.00 59.86  ? 712 DG  B C6    1 
ATOM   279  O O6    . DG  A 1 14  ? 9.190  -13.742 -8.101  1.00 17.25  ? 712 DG  B O6    1 
ATOM   280  N N1    . DG  A 1 14  ? 7.518  -13.258 -6.641  1.00 20.28  ? 712 DG  B N1    1 
ATOM   281  C C2    . DG  A 1 14  ? 6.844  -13.413 -5.454  1.00 88.19  ? 712 DG  B C2    1 
ATOM   282  N N2    . DG  A 1 14  ? 5.757  -12.648 -5.283  1.00 53.13  ? 712 DG  B N2    1 
ATOM   283  N N3    . DG  A 1 14  ? 7.199  -14.267 -4.502  1.00 11.01  ? 712 DG  B N3    1 
ATOM   284  C C4    . DG  A 1 14  ? 8.316  -14.963 -4.832  1.00 78.74  ? 712 DG  B C4    1 
ATOM   285  P P     . DC  A 1 15  ? 6.917  -19.270 0.253   1.00 100.00 ? 713 DC  B P     1 
ATOM   286  O OP1   . DC  A 1 15  ? 6.584  -19.171 1.692   1.00 100.00 ? 713 DC  B OP1   1 
ATOM   287  O OP2   . DC  A 1 15  ? 7.681  -20.431 -0.260  1.00 79.41  ? 713 DC  B OP2   1 
ATOM   288  O "O5'" . DC  A 1 15  ? 5.583  -19.162 -0.596  1.00 85.59  ? 713 DC  B "O5'" 1 
ATOM   289  C "C5'" . DC  A 1 15  ? 5.696  -18.985 -1.994  1.00 32.56  ? 713 DC  B "C5'" 1 
ATOM   290  C "C4'" . DC  A 1 15  ? 4.532  -18.188 -2.526  1.00 77.28  ? 713 DC  B "C4'" 1 
ATOM   291  O "O4'" . DC  A 1 15  ? 5.051  -17.222 -3.487  1.00 75.43  ? 713 DC  B "O4'" 1 
ATOM   292  C "C3'" . DC  A 1 15  ? 3.529  -19.042 -3.294  1.00 100.00 ? 713 DC  B "C3'" 1 
ATOM   293  O "O3'" . DC  A 1 15  ? 2.233  -18.462 -3.281  1.00 100.00 ? 713 DC  B "O3'" 1 
ATOM   294  C "C2'" . DC  A 1 15  ? 4.120  -18.993 -4.682  1.00 57.48  ? 713 DC  B "C2'" 1 
ATOM   295  C "C1'" . DC  A 1 15  ? 4.549  -17.534 -4.764  1.00 33.25  ? 713 DC  B "C1'" 1 
ATOM   296  N N1    . DC  A 1 15  ? 5.607  -17.383 -5.789  1.00 94.17  ? 713 DC  B N1    1 
ATOM   297  C C2    . DC  A 1 15  ? 5.379  -16.512 -6.865  1.00 43.95  ? 713 DC  B C2    1 
ATOM   298  O O2    . DC  A 1 15  ? 4.343  -15.837 -6.896  1.00 42.39  ? 713 DC  B O2    1 
ATOM   299  N N3    . DC  A 1 15  ? 6.320  -16.425 -7.834  1.00 60.15  ? 713 DC  B N3    1 
ATOM   300  C C4    . DC  A 1 15  ? 7.423  -17.172 -7.766  1.00 20.19  ? 713 DC  B C4    1 
ATOM   301  N N4    . DC  A 1 15  ? 8.332  -17.050 -8.731  1.00 23.22  ? 713 DC  B N4    1 
ATOM   302  C C5    . DC  A 1 15  ? 7.657  -18.073 -6.690  1.00 100.00 ? 713 DC  B C5    1 
ATOM   303  C C6    . DC  A 1 15  ? 6.731  -18.148 -5.739  1.00 4.65   ? 713 DC  B C6    1 
ATOM   304  P P     . DG  A 1 16  ? 0.925  -19.388 -3.374  1.00 100.00 ? 714 DG  B P     1 
ATOM   305  O OP1   . DG  A 1 16  ? -0.201 -18.529 -3.802  1.00 88.28  ? 714 DG  B OP1   1 
ATOM   306  O OP2   . DG  A 1 16  ? 0.832  -20.154 -2.103  1.00 62.46  ? 714 DG  B OP2   1 
ATOM   307  O "O5'" . DG  A 1 16  ? 1.226  -20.410 -4.574  1.00 54.05  ? 714 DG  B "O5'" 1 
ATOM   308  C "C5'" . DG  A 1 16  ? 1.655  -19.964 -5.867  1.00 100.00 ? 714 DG  B "C5'" 1 
ATOM   309  C "C4'" . DG  A 1 16  ? 0.884  -18.752 -6.383  1.00 47.40  ? 714 DG  B "C4'" 1 
ATOM   310  O "O4'" . DG  A 1 16  ? 1.817  -17.681 -6.690  1.00 100.00 ? 714 DG  B "O4'" 1 
ATOM   311  C "C3'" . DG  A 1 16  ? 0.121  -19.016 -7.679  1.00 100.00 ? 714 DG  B "C3'" 1 
ATOM   312  O "O3'" . DG  A 1 16  ? -1.271 -18.893 -7.462  1.00 100.00 ? 714 DG  B "O3'" 1 
ATOM   313  C "C2'" . DG  A 1 16  ? 0.623  -17.977 -8.688  1.00 44.65  ? 714 DG  B "C2'" 1 
ATOM   314  C "C1'" . DG  A 1 16  ? 1.937  -17.523 -8.092  1.00 92.36  ? 714 DG  B "C1'" 1 
ATOM   315  N N9    . DG  A 1 16  ? 3.097  -18.274 -8.570  1.00 60.78  ? 714 DG  B N9    1 
ATOM   316  C C8    . DG  A 1 16  ? 3.724  -19.347 -7.977  1.00 39.30  ? 714 DG  B C8    1 
ATOM   317  N N7    . DG  A 1 16  ? 4.799  -19.787 -8.682  1.00 74.10  ? 714 DG  B N7    1 
ATOM   318  C C5    . DG  A 1 16  ? 4.847  -18.926 -9.779  1.00 29.84  ? 714 DG  B C5    1 
ATOM   319  C C6    . DG  A 1 16  ? 5.762  -18.891 -10.868 1.00 22.71  ? 714 DG  B C6    1 
ATOM   320  O O6    . DG  A 1 16  ? 6.727  -19.638 -11.084 1.00 100.00 ? 714 DG  B O6    1 
ATOM   321  N N1    . DG  A 1 16  ? 5.469  -17.869 -11.762 1.00 21.89  ? 714 DG  B N1    1 
ATOM   322  C C2    . DG  A 1 16  ? 4.438  -16.979 -11.622 1.00 23.00  ? 714 DG  B C2    1 
ATOM   323  N N2    . DG  A 1 16  ? 4.336  -16.057 -12.589 1.00 36.04  ? 714 DG  B N2    1 
ATOM   324  N N3    . DG  A 1 16  ? 3.560  -16.995 -10.614 1.00 74.71  ? 714 DG  B N3    1 
ATOM   325  C C4    . DG  A 1 16  ? 3.815  -18.001 -9.732  1.00 34.18  ? 714 DG  B C4    1 
ATOM   326  P P     . DT  A 1 17  ? -2.264 -19.756 -8.361  1.00 100.00 ? 715 DT  B P     1 
ATOM   327  O OP1   . DT  A 1 17  ? -3.653 -19.342 -8.065  1.00 100.00 ? 715 DT  B OP1   1 
ATOM   328  O OP2   . DT  A 1 17  ? -1.854 -21.169 -8.223  1.00 100.00 ? 715 DT  B OP2   1 
ATOM   329  O "O5'" . DT  A 1 17  ? -1.923 -19.268 -9.838  1.00 100.00 ? 715 DT  B "O5'" 1 
ATOM   330  C "C5'" . DT  A 1 17  ? -2.157 -17.916 -10.224 1.00 20.90  ? 715 DT  B "C5'" 1 
ATOM   331  C "C4'" . DT  A 1 17  ? -2.138 -17.827 -11.739 1.00 100.00 ? 715 DT  B "C4'" 1 
ATOM   332  O "O4'" . DT  A 1 17  ? -0.766 -17.943 -12.205 1.00 100.00 ? 715 DT  B "O4'" 1 
ATOM   333  C "C3'" . DT  A 1 17  ? -2.889 -18.972 -12.407 1.00 100.00 ? 715 DT  B "C3'" 1 
ATOM   334  O "O3'" . DT  A 1 17  ? -3.395 -18.557 -13.669 1.00 100.00 ? 715 DT  B "O3'" 1 
ATOM   335  C "C2'" . DT  A 1 17  ? -1.793 -20.014 -12.570 1.00 56.87  ? 715 DT  B "C2'" 1 
ATOM   336  C "C1'" . DT  A 1 17  ? -0.635 -19.118 -12.981 1.00 100.00 ? 715 DT  B "C1'" 1 
ATOM   337  N N1    . DT  A 1 17  ? 0.695  -19.743 -12.751 1.00 98.30  ? 715 DT  B N1    1 
ATOM   338  C C2    . DT  A 1 17  ? 1.713  -19.383 -13.597 1.00 80.67  ? 715 DT  B C2    1 
ATOM   339  O O2    . DT  A 1 17  ? 1.584  -18.573 -14.496 1.00 100.00 ? 715 DT  B O2    1 
ATOM   340  N N3    . DT  A 1 17  ? 2.902  -20.012 -13.348 1.00 20.55  ? 715 DT  B N3    1 
ATOM   341  C C4    . DT  A 1 17  ? 3.171  -20.938 -12.358 1.00 100.00 ? 715 DT  B C4    1 
ATOM   342  O O4    . DT  A 1 17  ? 4.301  -21.411 -12.260 1.00 43.39  ? 715 DT  B O4    1 
ATOM   343  C C5    . DT  A 1 17  ? 2.055  -21.272 -11.515 1.00 26.87  ? 715 DT  B C5    1 
ATOM   344  C C7    . DT  A 1 17  ? 2.233  -22.272 -10.407 1.00 39.67  ? 715 DT  B C7    1 
ATOM   345  C C6    . DT  A 1 17  ? 0.882  -20.667 -11.747 1.00 42.60  ? 715 DT  B C6    1 
ATOM   346  N N     . ALA B 2 1   ? 20.457 -3.442  16.620  1.00 69.60  ? 2   ALA A N     1 
ATOM   347  C CA    . ALA B 2 1   ? 19.943 -4.110  15.420  1.00 67.15  ? 2   ALA A CA    1 
ATOM   348  C C     . ALA B 2 1   ? 19.461 -3.133  14.327  1.00 63.32  ? 2   ALA A C     1 
ATOM   349  O O     . ALA B 2 1   ? 20.263 -2.658  13.514  1.00 63.04  ? 2   ALA A O     1 
ATOM   350  C CB    . ALA B 2 1   ? 18.864 -5.105  15.792  1.00 67.61  ? 2   ALA A CB    1 
ATOM   351  N N     . THR B 2 2   ? 18.174 -2.803  14.287  1.00 51.78  ? 3   THR A N     1 
ATOM   352  C CA    . THR B 2 2   ? 17.755 -1.868  13.256  1.00 51.02  ? 3   THR A CA    1 
ATOM   353  C C     . THR B 2 2   ? 17.194 -0.573  13.802  1.00 50.43  ? 3   THR A C     1 
ATOM   354  O O     . THR B 2 2   ? 16.847 -0.506  15.001  1.00 49.05  ? 3   THR A O     1 
ATOM   355  C CB    . THR B 2 2   ? 16.814 -2.484  12.227  1.00 67.74  ? 3   THR A CB    1 
ATOM   356  O OG1   . THR B 2 2   ? 16.990 -1.787  10.987  1.00 68.08  ? 3   THR A OG1   1 
ATOM   357  C CG2   . THR B 2 2   ? 15.349 -2.393  12.689  1.00 58.39  ? 3   THR A CG2   1 
ATOM   358  N N     . ILE B 2 3   ? 17.121 0.454   12.948  1.00 38.84  ? 4   ILE A N     1 
ATOM   359  C CA    . ILE B 2 3   ? 16.562 1.736   13.387  1.00 39.45  ? 4   ILE A CA    1 
ATOM   360  C C     . ILE B 2 3   ? 15.220 1.512   14.113  1.00 41.18  ? 4   ILE A C     1 
ATOM   361  O O     . ILE B 2 3   ? 15.013 2.063   15.208  1.00 37.83  ? 4   ILE A O     1 
ATOM   362  C CB    . ILE B 2 3   ? 16.357 2.713   12.216  1.00 42.27  ? 4   ILE A CB    1 
ATOM   363  C CG1   . ILE B 2 3   ? 16.358 4.149   12.712  1.00 37.30  ? 4   ILE A CG1   1 
ATOM   364  C CG2   . ILE B 2 3   ? 15.028 2.483   11.553  1.00 46.93  ? 4   ILE A CG2   1 
ATOM   365  C CD1   . ILE B 2 3   ? 17.183 5.051   11.845  1.00 72.14  ? 4   ILE A CD1   1 
ATOM   366  N N     . LYS B 2 4   ? 14.366 0.659   13.519  1.00 37.91  ? 5   LYS A N     1 
ATOM   367  C CA    . LYS B 2 4   ? 13.082 0.295   14.083  1.00 36.38  ? 5   LYS A CA    1 
ATOM   368  C C     . LYS B 2 4   ? 13.274 -0.100  15.519  1.00 37.82  ? 5   LYS A C     1 
ATOM   369  O O     . LYS B 2 4   ? 12.666 0.478   16.433  1.00 42.49  ? 5   LYS A O     1 
ATOM   370  C CB    . LYS B 2 4   ? 12.481 -0.873  13.333  1.00 36.07  ? 5   LYS A CB    1 
ATOM   371  C CG    . LYS B 2 4   ? 11.498 -0.408  12.284  1.00 49.77  ? 5   LYS A CG    1 
ATOM   372  C CD    . LYS B 2 4   ? 11.976 -0.807  10.908  1.00 58.85  ? 5   LYS A CD    1 
ATOM   373  C CE    . LYS B 2 4   ? 10.795 -1.111  9.966   1.00 92.07  ? 5   LYS A CE    1 
ATOM   374  N NZ    . LYS B 2 4   ? 11.095 -2.300  9.010   1.00 92.16  ? 5   LYS A NZ    1 
ATOM   375  N N     . ASP B 2 5   ? 14.148 -1.062  15.726  1.00 30.83  ? 6   ASP A N     1 
ATOM   376  C CA    . ASP B 2 5   ? 14.419 -1.519  17.074  1.00 34.39  ? 6   ASP A CA    1 
ATOM   377  C C     . ASP B 2 5   ? 14.782 -0.373  17.999  1.00 39.87  ? 6   ASP A C     1 
ATOM   378  O O     . ASP B 2 5   ? 14.248 -0.235  19.123  1.00 39.88  ? 6   ASP A O     1 
ATOM   379  C CB    . ASP B 2 5   ? 15.420 -2.673  17.089  1.00 38.90  ? 6   ASP A CB    1 
ATOM   380  C CG    . ASP B 2 5   ? 15.234 -3.635  15.898  1.00 71.07  ? 6   ASP A CG    1 
ATOM   381  O OD1   . ASP B 2 5   ? 14.121 -3.710  15.285  1.00 70.03  ? 6   ASP A OD1   1 
ATOM   382  O OD2   . ASP B 2 5   ? 16.238 -4.279  15.557  1.00 71.55  ? 6   ASP A OD2   1 
ATOM   383  N N     . VAL B 2 6   ? 15.630 0.508   17.511  1.00 36.87  ? 7   VAL A N     1 
ATOM   384  C CA    . VAL B 2 6   ? 15.974 1.629   18.358  1.00 37.13  ? 7   VAL A CA    1 
ATOM   385  C C     . VAL B 2 6   ? 14.743 2.501   18.721  1.00 35.03  ? 7   VAL A C     1 
ATOM   386  O O     . VAL B 2 6   ? 14.498 2.793   19.926  1.00 27.62  ? 7   VAL A O     1 
ATOM   387  C CB    . VAL B 2 6   ? 17.213 2.429   17.841  1.00 41.21  ? 7   VAL A CB    1 
ATOM   388  C CG1   . VAL B 2 6   ? 17.785 3.342   18.909  1.00 35.74  ? 7   VAL A CG1   1 
ATOM   389  C CG2   . VAL B 2 6   ? 18.289 1.461   17.409  1.00 43.71  ? 7   VAL A CG2   1 
ATOM   390  N N     . ALA B 2 7   ? 13.961 2.925   17.728  1.00 34.16  ? 8   ALA A N     1 
ATOM   391  C CA    . ALA B 2 7   ? 12.815 3.786   18.056  1.00 36.66  ? 8   ALA A CA    1 
ATOM   392  C C     . ALA B 2 7   ? 11.858 3.229   19.136  1.00 48.90  ? 8   ALA A C     1 
ATOM   393  O O     . ALA B 2 7   ? 11.360 3.954   20.037  1.00 43.45  ? 8   ALA A O     1 
ATOM   394  C CB    . ALA B 2 7   ? 12.099 4.254   16.793  1.00 35.46  ? 8   ALA A CB    1 
ATOM   395  N N     . LYS B 2 8   ? 11.674 1.917   19.037  1.00 50.03  ? 9   LYS A N     1 
ATOM   396  C CA    . LYS B 2 8   ? 10.816 1.175   19.914  1.00 51.72  ? 9   LYS A CA    1 
ATOM   397  C C     . LYS B 2 8   ? 11.340 1.175   21.306  1.00 58.86  ? 9   LYS A C     1 
ATOM   398  O O     . LYS B 2 8   ? 10.604 1.377   22.269  1.00 66.43  ? 9   LYS A O     1 
ATOM   399  C CB    . LYS B 2 8   ? 10.683 -0.252  19.416  1.00 57.70  ? 9   LYS A CB    1 
ATOM   400  C CG    . LYS B 2 8   ? 9.257  -0.795  19.472  1.00 88.58  ? 9   LYS A CG    1 
ATOM   401  C CD    . LYS B 2 8   ? 9.015  -1.855  18.366  1.00 100.00 ? 9   LYS A CD    1 
ATOM   402  C CE    . LYS B 2 8   ? 7.672  -1.643  17.576  1.00 100.00 ? 9   LYS A CE    1 
ATOM   403  N NZ    . LYS B 2 8   ? 7.599  -2.281  16.171  1.00 100.00 ? 9   LYS A NZ    1 
ATOM   404  N N     . ARG B 2 9   ? 12.621 0.945   21.447  1.00 53.68  ? 10  ARG A N     1 
ATOM   405  C CA    . ARG B 2 9   ? 13.142 0.948   22.792  1.00 59.42  ? 10  ARG A CA    1 
ATOM   406  C C     . ARG B 2 9   ? 12.976 2.382   23.336  1.00 67.64  ? 10  ARG A C     1 
ATOM   407  O O     . ARG B 2 9   ? 12.666 2.612   24.516  1.00 63.25  ? 10  ARG A O     1 
ATOM   408  C CB    . ARG B 2 9   ? 14.618 0.533   22.777  1.00 66.94  ? 10  ARG A CB    1 
ATOM   409  C CG    . ARG B 2 9   ? 15.203 0.245   24.164  1.00 86.39  ? 10  ARG A CG    1 
ATOM   410  C CD    . ARG B 2 9   ? 15.423 -1.265  24.385  1.00 100.00 ? 10  ARG A CD    1 
ATOM   411  N NE    . ARG B 2 9   ? 16.363 -1.539  25.473  1.00 100.00 ? 10  ARG A NE    1 
ATOM   412  C CZ    . ARG B 2 9   ? 16.174 -1.173  26.743  1.00 100.00 ? 10  ARG A CZ    1 
ATOM   413  N NH1   . ARG B 2 9   ? 15.077 -0.492  27.100  1.00 100.00 ? 10  ARG A NH1   1 
ATOM   414  N NH2   . ARG B 2 9   ? 17.105 -1.468  27.658  1.00 100.00 ? 10  ARG A NH2   1 
ATOM   415  N N     . ALA B 2 10  ? 13.170 3.331   22.430  1.00 65.92  ? 11  ALA A N     1 
ATOM   416  C CA    . ALA B 2 10  ? 13.096 4.740   22.724  1.00 64.27  ? 11  ALA A CA    1 
ATOM   417  C C     . ALA B 2 10  ? 11.685 5.229   22.828  1.00 61.69  ? 11  ALA A C     1 
ATOM   418  O O     . ALA B 2 10  ? 11.421 6.276   23.416  1.00 63.51  ? 11  ALA A O     1 
ATOM   419  C CB    . ALA B 2 10  ? 13.812 5.507   21.637  1.00 65.76  ? 11  ALA A CB    1 
ATOM   420  N N     . ASN B 2 11  ? 10.773 4.488   22.237  1.00 52.56  ? 12  ASN A N     1 
ATOM   421  C CA    . ASN B 2 11  ? 9.385  4.891   22.276  1.00 53.79  ? 12  ASN A CA    1 
ATOM   422  C C     . ASN B 2 11  ? 9.290  6.193   21.557  1.00 57.43  ? 12  ASN A C     1 
ATOM   423  O O     . ASN B 2 11  ? 8.789  7.177   22.087  1.00 64.41  ? 12  ASN A O     1 
ATOM   424  C CB    . ASN B 2 11  ? 8.906  5.103   23.707  1.00 47.35  ? 12  ASN A CB    1 
ATOM   425  C CG    . ASN B 2 11  ? 9.090  3.878   24.561  1.00 100.00 ? 12  ASN A CG    1 
ATOM   426  O OD1   . ASN B 2 11  ? 10.038 3.793   25.352  1.00 100.00 ? 12  ASN A OD1   1 
ATOM   427  N ND2   . ASN B 2 11  ? 8.222  2.888   24.366  1.00 100.00 ? 12  ASN A ND2   1 
ATOM   428  N N     . VAL B 2 12  ? 9.802  6.220   20.351  1.00 41.71  ? 13  VAL A N     1 
ATOM   429  C CA    . VAL B 2 12  ? 9.779  7.423   19.558  1.00 34.54  ? 13  VAL A CA    1 
ATOM   430  C C     . VAL B 2 12  ? 9.806  6.866   18.171  1.00 34.57  ? 13  VAL A C     1 
ATOM   431  O O     . VAL B 2 12  ? 9.981  5.682   17.971  1.00 39.49  ? 13  VAL A O     1 
ATOM   432  C CB    . VAL B 2 12  ? 11.070 8.108   19.664  1.00 35.66  ? 13  VAL A CB    1 
ATOM   433  C CG1   . VAL B 2 12  ? 11.564 7.992   21.090  1.00 35.20  ? 13  VAL A CG1   1 
ATOM   434  C CG2   . VAL B 2 12  ? 12.058 7.424   18.705  1.00 34.07  ? 13  VAL A CG2   1 
ATOM   435  N N     . SER B 2 13  ? 9.617  7.725   17.197  1.00 22.62  ? 14  SER A N     1 
ATOM   436  C CA    . SER B 2 13  ? 9.639  7.276   15.837  1.00 21.16  ? 14  SER A CA    1 
ATOM   437  C C     . SER B 2 13  ? 11.009 7.190   15.228  1.00 39.05  ? 14  SER A C     1 
ATOM   438  O O     . SER B 2 13  ? 11.968 7.875   15.632  1.00 42.81  ? 14  SER A O     1 
ATOM   439  C CB    . SER B 2 13  ? 8.799  8.232   14.999  1.00 30.01  ? 14  SER A CB    1 
ATOM   440  O OG    . SER B 2 13  ? 9.450  9.479   14.784  1.00 47.77  ? 14  SER A OG    1 
ATOM   441  N N     . THR B 2 14  ? 11.112 6.381   14.203  1.00 40.22  ? 15  THR A N     1 
ATOM   442  C CA    . THR B 2 14  ? 12.383 6.254   13.566  1.00 41.52  ? 15  THR A CA    1 
ATOM   443  C C     . THR B 2 14  ? 12.822 7.569   13.007  1.00 45.62  ? 15  THR A C     1 
ATOM   444  O O     . THR B 2 14  ? 14.030 7.880   12.967  1.00 43.00  ? 15  THR A O     1 
ATOM   445  C CB    . THR B 2 14  ? 12.418 5.142   12.558  1.00 52.20  ? 15  THR A CB    1 
ATOM   446  O OG1   . THR B 2 14  ? 11.509 5.395   11.463  1.00 28.99  ? 15  THR A OG1   1 
ATOM   447  C CG2   . THR B 2 14  ? 12.102 3.842   13.274  1.00 55.31  ? 15  THR A CG2   1 
ATOM   448  N N     . THR B 2 15  ? 11.839 8.366   12.599  1.00 44.04  ? 16  THR A N     1 
ATOM   449  C CA    . THR B 2 15  ? 12.141 9.677   12.060  1.00 41.98  ? 16  THR A CA    1 
ATOM   450  C C     . THR B 2 15  ? 12.934 10.384  13.137  1.00 40.29  ? 16  THR A C     1 
ATOM   451  O O     . THR B 2 15  ? 14.010 10.910  12.901  1.00 33.64  ? 16  THR A O     1 
ATOM   452  C CB    . THR B 2 15  ? 10.864 10.472  11.794  1.00 53.59  ? 16  THR A CB    1 
ATOM   453  O OG1   . THR B 2 15  ? 9.798  9.575   11.419  1.00 58.66  ? 16  THR A OG1   1 
ATOM   454  C CG2   . THR B 2 15  ? 11.116 11.526  10.721  1.00 53.56  ? 16  THR A CG2   1 
ATOM   455  N N     . THR B 2 16  ? 12.407 10.330  14.349  1.00 31.77  ? 17  THR A N     1 
ATOM   456  C CA    . THR B 2 16  ? 13.079 10.958  15.453  1.00 27.83  ? 17  THR A CA    1 
ATOM   457  C C     . THR B 2 16  ? 14.491 10.388  15.571  1.00 36.70  ? 17  THR A C     1 
ATOM   458  O O     . THR B 2 16  ? 15.468 11.130  15.441  1.00 38.43  ? 17  THR A O     1 
ATOM   459  C CB    . THR B 2 16  ? 12.314 10.697  16.745  1.00 44.82  ? 17  THR A CB    1 
ATOM   460  O OG1   . THR B 2 16  ? 11.280 11.677  16.900  1.00 60.05  ? 17  THR A OG1   1 
ATOM   461  C CG2   . THR B 2 16  ? 13.258 10.780  17.909  1.00 33.87  ? 17  THR A CG2   1 
ATOM   462  N N     . VAL B 2 17  ? 14.593 9.070   15.801  1.00 30.73  ? 18  VAL A N     1 
ATOM   463  C CA    . VAL B 2 17  ? 15.900 8.375   15.941  1.00 30.50  ? 18  VAL A CA    1 
ATOM   464  C C     . VAL B 2 17  ? 16.931 8.847   14.922  1.00 30.64  ? 18  VAL A C     1 
ATOM   465  O O     . VAL B 2 17  ? 18.053 9.184   15.220  1.00 36.28  ? 18  VAL A O     1 
ATOM   466  C CB    . VAL B 2 17  ? 15.731 6.885   15.681  1.00 36.32  ? 18  VAL A CB    1 
ATOM   467  C CG1   . VAL B 2 17  ? 17.073 6.230   15.588  1.00 37.24  ? 18  VAL A CG1   1 
ATOM   468  C CG2   . VAL B 2 17  ? 14.930 6.228   16.776  1.00 37.57  ? 18  VAL A CG2   1 
ATOM   469  N N     . SER B 2 18  ? 16.488 8.868   13.696  1.00 15.20  ? 19  SER A N     1 
ATOM   470  C CA    . SER B 2 18  ? 17.313 9.318   12.665  1.00 13.28  ? 19  SER A CA    1 
ATOM   471  C C     . SER B 2 18  ? 17.730 10.807  12.868  1.00 31.20  ? 19  SER A C     1 
ATOM   472  O O     . SER B 2 18  ? 18.834 11.190  12.599  1.00 32.62  ? 19  SER A O     1 
ATOM   473  C CB    . SER B 2 18  ? 16.516 9.215   11.370  1.00 1.00   ? 19  SER A CB    1 
ATOM   474  O OG    . SER B 2 18  ? 17.153 10.043  10.344  1.00 5.62   ? 19  SER A OG    1 
ATOM   475  N N     . HIS B 2 19  ? 16.826 11.669  13.292  1.00 37.08  ? 20  HIS A N     1 
ATOM   476  C CA    . HIS B 2 19  ? 17.209 13.076  13.425  1.00 34.90  ? 20  HIS A CA    1 
ATOM   477  C C     . HIS B 2 19  ? 18.206 13.246  14.543  1.00 37.76  ? 20  HIS A C     1 
ATOM   478  O O     . HIS B 2 19  ? 19.090 14.122  14.474  1.00 38.27  ? 20  HIS A O     1 
ATOM   479  C CB    . HIS B 2 19  ? 15.995 14.000  13.710  1.00 29.33  ? 20  HIS A CB    1 
ATOM   480  C CG    . HIS B 2 19  ? 15.235 14.398  12.490  1.00 29.83  ? 20  HIS A CG    1 
ATOM   481  N ND1   . HIS B 2 19  ? 15.657 15.397  11.638  1.00 37.45  ? 20  HIS A ND1   1 
ATOM   482  C CD2   . HIS B 2 19  ? 14.085 13.924  11.966  1.00 28.42  ? 20  HIS A CD2   1 
ATOM   483  C CE1   . HIS B 2 19  ? 14.817 15.505  10.623  1.00 33.88  ? 20  HIS A CE1   1 
ATOM   484  N NE2   . HIS B 2 19  ? 13.851 14.622  10.799  1.00 32.27  ? 20  HIS A NE2   1 
ATOM   485  N N     . VAL B 2 20  ? 18.070 12.438  15.587  1.00 23.25  ? 21  VAL A N     1 
ATOM   486  C CA    . VAL B 2 20  ? 19.010 12.633  16.696  1.00 29.17  ? 21  VAL A CA    1 
ATOM   487  C C     . VAL B 2 20  ? 20.357 12.051  16.351  1.00 32.81  ? 21  VAL A C     1 
ATOM   488  O O     . VAL B 2 20  ? 21.384 12.437  16.907  1.00 33.28  ? 21  VAL A O     1 
ATOM   489  C CB    . VAL B 2 20  ? 18.553 12.037  18.065  1.00 29.32  ? 21  VAL A CB    1 
ATOM   490  C CG1   . VAL B 2 20  ? 17.138 11.515  17.962  1.00 29.99  ? 21  VAL A CG1   1 
ATOM   491  C CG2   . VAL B 2 20  ? 19.556 10.927  18.468  1.00 26.08  ? 21  VAL A CG2   1 
ATOM   492  N N     . ILE B 2 21  ? 20.330 11.108  15.438  1.00 28.46  ? 22  ILE A N     1 
ATOM   493  C CA    . ILE B 2 21  ? 21.549 10.505  15.024  1.00 27.98  ? 22  ILE A CA    1 
ATOM   494  C C     . ILE B 2 21  ? 22.274 11.386  14.007  1.00 29.85  ? 22  ILE A C     1 
ATOM   495  O O     . ILE B 2 21  ? 23.471 11.390  13.944  1.00 37.84  ? 22  ILE A O     1 
ATOM   496  C CB    . ILE B 2 21  ? 21.401 9.042   14.624  1.00 28.37  ? 22  ILE A CB    1 
ATOM   497  C CG1   . ILE B 2 21  ? 22.512 8.243   15.257  1.00 32.92  ? 22  ILE A CG1   1 
ATOM   498  C CG2   . ILE B 2 21  ? 21.489 8.846   13.144  1.00 19.79  ? 22  ILE A CG2   1 
ATOM   499  C CD1   . ILE B 2 21  ? 21.977 7.081   16.052  1.00 56.82  ? 22  ILE A CD1   1 
ATOM   500  N N     . ASN B 2 22  ? 21.571 12.177  13.235  1.00 21.33  ? 23  ASN A N     1 
ATOM   501  C CA    . ASN B 2 22  ? 22.297 13.025  12.301  1.00 25.24  ? 23  ASN A CA    1 
ATOM   502  C C     . ASN B 2 22  ? 22.172 14.487  12.642  1.00 38.13  ? 23  ASN A C     1 
ATOM   503  O O     . ASN B 2 22  ? 22.662 15.303  11.873  1.00 30.08  ? 23  ASN A O     1 
ATOM   504  C CB    . ASN B 2 22  ? 21.873 12.814  10.833  1.00 9.89   ? 23  ASN A CB    1 
ATOM   505  C CG    . ASN B 2 22  ? 21.556 11.341  10.507  1.00 65.28  ? 23  ASN A CG    1 
ATOM   506  O OD1   . ASN B 2 22  ? 22.109 10.758  9.575   1.00 66.14  ? 23  ASN A OD1   1 
ATOM   507  N ND2   . ASN B 2 22  ? 20.662 10.748  11.281  1.00 73.64  ? 23  ASN A ND2   1 
ATOM   508  N N     . LYS B 2 23  ? 21.519 14.793  13.783  1.00 45.30  ? 24  LYS A N     1 
ATOM   509  C CA    . LYS B 2 23  ? 21.249 16.165  14.281  1.00 42.27  ? 24  LYS A CA    1 
ATOM   510  C C     . LYS B 2 23  ? 20.767 16.903  13.105  1.00 41.25  ? 24  LYS A C     1 
ATOM   511  O O     . LYS B 2 23  ? 21.324 17.914  12.713  1.00 41.93  ? 24  LYS A O     1 
ATOM   512  C CB    . LYS B 2 23  ? 22.496 16.876  14.791  1.00 47.35  ? 24  LYS A CB    1 
ATOM   513  C CG    . LYS B 2 23  ? 23.823 16.341  14.290  1.00 88.39  ? 24  LYS A CG    1 
ATOM   514  C CD    . LYS B 2 23  ? 24.837 16.204  15.436  1.00 100.00 ? 24  LYS A CD    1 
ATOM   515  C CE    . LYS B 2 23  ? 24.290 15.333  16.575  1.00 100.00 ? 24  LYS A CE    1 
ATOM   516  N NZ    . LYS B 2 23  ? 23.160 14.424  16.164  1.00 100.00 ? 24  LYS A NZ    1 
ATOM   517  N N     . THR B 2 24  ? 19.779 16.349  12.461  1.00 38.10  ? 25  THR A N     1 
ATOM   518  C CA    . THR B 2 24  ? 19.331 16.991  11.278  1.00 36.57  ? 25  THR A CA    1 
ATOM   519  C C     . THR B 2 24  ? 18.139 17.892  11.640  1.00 35.86  ? 25  THR A C     1 
ATOM   520  O O     . THR B 2 24  ? 17.559 18.633  10.785  1.00 31.19  ? 25  THR A O     1 
ATOM   521  C CB    . THR B 2 24  ? 19.022 15.939  10.275  1.00 35.64  ? 25  THR A CB    1 
ATOM   522  O OG1   . THR B 2 24  ? 18.219 16.500  9.240   1.00 79.13  ? 25  THR A OG1   1 
ATOM   523  C CG2   . THR B 2 24  ? 18.283 14.778  10.968  1.00 33.29  ? 25  THR A CG2   1 
ATOM   524  N N     . ARG B 2 25  ? 17.804 17.868  12.928  1.00 23.86  ? 26  ARG A N     1 
ATOM   525  C CA    . ARG B 2 25  ? 16.708 18.709  13.369  1.00 27.68  ? 26  ARG A CA    1 
ATOM   526  C C     . ARG B 2 25  ? 16.640 18.706  14.906  1.00 35.07  ? 26  ARG A C     1 
ATOM   527  O O     . ARG B 2 25  ? 17.206 17.806  15.534  1.00 42.73  ? 26  ARG A O     1 
ATOM   528  C CB    . ARG B 2 25  ? 15.386 18.405  12.601  1.00 22.52  ? 26  ARG A CB    1 
ATOM   529  C CG    . ARG B 2 25  ? 14.280 17.909  13.515  1.00 27.17  ? 26  ARG A CG    1 
ATOM   530  C CD    . ARG B 2 25  ? 12.962 17.607  12.798  1.00 24.92  ? 26  ARG A CD    1 
ATOM   531  N NE    . ARG B 2 25  ? 12.263 16.693  13.679  1.00 36.40  ? 26  ARG A NE    1 
ATOM   532  C CZ    . ARG B 2 25  ? 11.160 16.014  13.398  1.00 30.23  ? 26  ARG A CZ    1 
ATOM   533  N NH1   . ARG B 2 25  ? 10.573 16.123  12.228  1.00 30.82  ? 26  ARG A NH1   1 
ATOM   534  N NH2   . ARG B 2 25  ? 10.662 15.218  14.301  1.00 37.92  ? 26  ARG A NH2   1 
ATOM   535  N N     . PHE B 2 26  ? 16.031 19.705  15.530  1.00 26.80  ? 27  PHE A N     1 
ATOM   536  C CA    . PHE B 2 26  ? 16.033 19.704  16.995  1.00 24.97  ? 27  PHE A CA    1 
ATOM   537  C C     . PHE B 2 26  ? 15.329 18.569  17.681  1.00 26.83  ? 27  PHE A C     1 
ATOM   538  O O     . PHE B 2 26  ? 14.222 18.185  17.302  1.00 36.48  ? 27  PHE A O     1 
ATOM   539  C CB    . PHE B 2 26  ? 15.611 21.055  17.575  1.00 23.39  ? 27  PHE A CB    1 
ATOM   540  C CG    . PHE B 2 26  ? 15.491 21.051  19.061  1.00 24.99  ? 27  PHE A CG    1 
ATOM   541  C CD1   . PHE B 2 26  ? 14.384 20.503  19.682  1.00 29.74  ? 27  PHE A CD1   1 
ATOM   542  C CD2   . PHE B 2 26  ? 16.471 21.609  19.831  1.00 32.63  ? 27  PHE A CD2   1 
ATOM   543  C CE1   . PHE B 2 26  ? 14.287 20.475  21.052  1.00 30.65  ? 27  PHE A CE1   1 
ATOM   544  C CE2   . PHE B 2 26  ? 16.378 21.609  21.207  1.00 36.65  ? 27  PHE A CE2   1 
ATOM   545  C CZ    . PHE B 2 26  ? 15.283 21.035  21.814  1.00 31.34  ? 27  PHE A CZ    1 
ATOM   546  N N     . VAL B 2 27  ? 15.924 18.057  18.726  1.00 16.59  ? 28  VAL A N     1 
ATOM   547  C CA    . VAL B 2 27  ? 15.218 16.974  19.446  1.00 18.53  ? 28  VAL A CA    1 
ATOM   548  C C     . VAL B 2 27  ? 15.314 17.254  20.911  1.00 29.21  ? 28  VAL A C     1 
ATOM   549  O O     . VAL B 2 27  ? 16.357 17.673  21.412  1.00 29.05  ? 28  VAL A O     1 
ATOM   550  C CB    . VAL B 2 27  ? 15.815 15.561  19.209  1.00 21.32  ? 28  VAL A CB    1 
ATOM   551  C CG1   . VAL B 2 27  ? 15.057 14.502  20.015  1.00 22.92  ? 28  VAL A CG1   1 
ATOM   552  C CG2   . VAL B 2 27  ? 15.849 15.235  17.711  1.00 18.10  ? 28  VAL A CG2   1 
ATOM   553  N N     . ALA B 2 28  ? 14.224 17.042  21.606  1.00 34.02  ? 29  ALA A N     1 
ATOM   554  C CA    . ALA B 2 28  ? 14.205 17.269  23.031  1.00 39.44  ? 29  ALA A CA    1 
ATOM   555  C C     . ALA B 2 28  ? 15.386 16.501  23.738  1.00 39.75  ? 29  ALA A C     1 
ATOM   556  O O     . ALA B 2 28  ? 15.735 15.391  23.321  1.00 32.18  ? 29  ALA A O     1 
ATOM   557  C CB    . ALA B 2 28  ? 12.823 16.838  23.575  1.00 40.16  ? 29  ALA A CB    1 
ATOM   558  N N     . GLU B 2 29  ? 15.999 17.100  24.771  1.00 44.51  ? 30  GLU A N     1 
ATOM   559  C CA    . GLU B 2 29  ? 17.133 16.427  25.454  1.00 50.73  ? 30  GLU A CA    1 
ATOM   560  C C     . GLU B 2 29  ? 16.730 15.075  25.890  1.00 44.81  ? 30  GLU A C     1 
ATOM   561  O O     . GLU B 2 29  ? 17.317 14.030  25.490  1.00 34.42  ? 30  GLU A O     1 
ATOM   562  C CB    . GLU B 2 29  ? 17.716 17.205  26.671  1.00 55.07  ? 30  GLU A CB    1 
ATOM   563  C CG    . GLU B 2 29  ? 19.268 17.114  26.757  1.00 80.42  ? 30  GLU A CG    1 
ATOM   564  C CD    . GLU B 2 29  ? 19.942 17.847  27.968  1.00 100.00 ? 30  GLU A CD    1 
ATOM   565  O OE1   . GLU B 2 29  ? 19.611 19.044  28.246  1.00 100.00 ? 30  GLU A OE1   1 
ATOM   566  O OE2   . GLU B 2 29  ? 20.871 17.228  28.580  1.00 100.00 ? 30  GLU A OE2   1 
ATOM   567  N N     . GLU B 2 30  ? 15.711 15.123  26.721  1.00 46.77  ? 31  GLU A N     1 
ATOM   568  C CA    . GLU B 2 30  ? 15.116 13.936  27.261  1.00 54.11  ? 31  GLU A CA    1 
ATOM   569  C C     . GLU B 2 30  ? 14.922 12.966  26.059  1.00 58.61  ? 31  GLU A C     1 
ATOM   570  O O     . GLU B 2 30  ? 15.321 11.793  26.078  1.00 62.44  ? 31  GLU A O     1 
ATOM   571  C CB    . GLU B 2 30  ? 13.787 14.349  27.880  1.00 56.60  ? 31  GLU A CB    1 
ATOM   572  C CG    . GLU B 2 30  ? 13.423 13.601  29.164  1.00 100.00 ? 31  GLU A CG    1 
ATOM   573  C CD    . GLU B 2 30  ? 11.886 13.401  29.345  1.00 100.00 ? 31  GLU A CD    1 
ATOM   574  O OE1   . GLU B 2 30  ? 11.117 13.690  28.374  1.00 100.00 ? 31  GLU A OE1   1 
ATOM   575  O OE2   . GLU B 2 30  ? 11.475 12.918  30.448  1.00 100.00 ? 31  GLU A OE2   1 
ATOM   576  N N     . THR B 2 31  ? 14.416 13.516  24.977  1.00 41.06  ? 32  THR A N     1 
ATOM   577  C CA    . THR B 2 31  ? 14.238 12.722  23.806  1.00 37.05  ? 32  THR A CA    1 
ATOM   578  C C     . THR B 2 31  ? 15.570 12.169  23.288  1.00 38.72  ? 32  THR A C     1 
ATOM   579  O O     . THR B 2 31  ? 15.793 10.951  23.246  1.00 35.98  ? 32  THR A O     1 
ATOM   580  C CB    . THR B 2 31  ? 13.445 13.490  22.812  1.00 44.26  ? 32  THR A CB    1 
ATOM   581  O OG1   . THR B 2 31  ? 12.166 13.773  23.406  1.00 51.70  ? 32  THR A OG1   1 
ATOM   582  C CG2   . THR B 2 31  ? 13.260 12.669  21.549  1.00 48.20  ? 32  THR A CG2   1 
ATOM   583  N N     . ARG B 2 32  ? 16.451 13.069  22.918  1.00 35.21  ? 33  ARG A N     1 
ATOM   584  C CA    . ARG B 2 32  ? 17.766 12.717  22.459  1.00 39.65  ? 33  ARG A CA    1 
ATOM   585  C C     . ARG B 2 32  ? 18.425 11.627  23.314  1.00 45.03  ? 33  ARG A C     1 
ATOM   586  O O     . ARG B 2 32  ? 18.889 10.604  22.813  1.00 47.44  ? 33  ARG A O     1 
ATOM   587  C CB    . ARG B 2 32  ? 18.622 13.945  22.646  1.00 45.84  ? 33  ARG A CB    1 
ATOM   588  C CG    . ARG B 2 32  ? 19.154 14.498  21.394  1.00 80.60  ? 33  ARG A CG    1 
ATOM   589  C CD    . ARG B 2 32  ? 20.139 15.602  21.715  1.00 100.00 ? 33  ARG A CD    1 
ATOM   590  N NE    . ARG B 2 32  ? 19.434 16.852  21.999  1.00 100.00 ? 33  ARG A NE    1 
ATOM   591  C CZ    . ARG B 2 32  ? 19.477 17.486  23.167  1.00 100.00 ? 33  ARG A CZ    1 
ATOM   592  N NH1   . ARG B 2 32  ? 20.215 16.977  24.157  1.00 100.00 ? 33  ARG A NH1   1 
ATOM   593  N NH2   . ARG B 2 32  ? 18.784 18.625  23.333  1.00 57.60  ? 33  ARG A NH2   1 
ATOM   594  N N     . ASN B 2 33  ? 18.473 11.863  24.609  1.00 43.08  ? 34  ASN A N     1 
ATOM   595  C CA    . ASN B 2 33  ? 19.102 10.915  25.519  1.00 50.00  ? 34  ASN A CA    1 
ATOM   596  C C     . ASN B 2 33  ? 18.636 9.513   25.323  1.00 61.48  ? 34  ASN A C     1 
ATOM   597  O O     . ASN B 2 33  ? 19.409 8.631   24.970  1.00 67.79  ? 34  ASN A O     1 
ATOM   598  C CB    . ASN B 2 33  ? 18.799 11.303  26.944  1.00 69.32  ? 34  ASN A CB    1 
ATOM   599  C CG    . ASN B 2 33  ? 19.451 12.594  27.335  1.00 99.94  ? 34  ASN A CG    1 
ATOM   600  O OD1   . ASN B 2 33  ? 19.054 13.200  28.333  1.00 100.00 ? 34  ASN A OD1   1 
ATOM   601  N ND2   . ASN B 2 33  ? 20.452 13.035  26.542  1.00 41.85  ? 34  ASN A ND2   1 
ATOM   602  N N     . ALA B 2 34  ? 17.348 9.334   25.543  1.00 59.60  ? 35  ALA A N     1 
ATOM   603  C CA    . ALA B 2 34  ? 16.695 8.052   25.401  1.00 60.90  ? 35  ALA A CA    1 
ATOM   604  C C     . ALA B 2 34  ? 17.152 7.297   24.148  1.00 61.91  ? 35  ALA A C     1 
ATOM   605  O O     . ALA B 2 34  ? 17.552 6.128   24.184  1.00 64.14  ? 35  ALA A O     1 
ATOM   606  C CB    . ALA B 2 34  ? 15.213 8.288   25.338  1.00 62.26  ? 35  ALA A CB    1 
ATOM   607  N N     . VAL B 2 35  ? 17.086 8.000   23.045  1.00 47.01  ? 36  VAL A N     1 
ATOM   608  C CA    . VAL B 2 35  ? 17.493 7.438   21.801  1.00 44.22  ? 36  VAL A CA    1 
ATOM   609  C C     . VAL B 2 35  ? 18.934 7.002   21.919  1.00 50.61  ? 36  VAL A C     1 
ATOM   610  O O     . VAL B 2 35  ? 19.334 5.933   21.453  1.00 50.22  ? 36  VAL A O     1 
ATOM   611  C CB    . VAL B 2 35  ? 17.462 8.515   20.790  1.00 43.80  ? 36  VAL A CB    1 
ATOM   612  C CG1   . VAL B 2 35  ? 18.285 8.153   19.597  1.00 44.00  ? 36  VAL A CG1   1 
ATOM   613  C CG2   . VAL B 2 35  ? 16.053 8.819   20.425  1.00 42.50  ? 36  VAL A CG2   1 
ATOM   614  N N     . TRP B 2 36  ? 19.730 7.858   22.515  1.00 48.32  ? 37  TRP A N     1 
ATOM   615  C CA    . TRP B 2 36  ? 21.109 7.532   22.673  1.00 54.85  ? 37  TRP A CA    1 
ATOM   616  C C     . TRP B 2 36  ? 21.179 6.273   23.470  1.00 59.26  ? 37  TRP A C     1 
ATOM   617  O O     . TRP B 2 36  ? 21.796 5.293   23.054  1.00 61.97  ? 37  TRP A O     1 
ATOM   618  C CB    . TRP B 2 36  ? 21.849 8.665   23.358  1.00 58.18  ? 37  TRP A CB    1 
ATOM   619  C CG    . TRP B 2 36  ? 22.366 9.570   22.310  1.00 63.94  ? 37  TRP A CG    1 
ATOM   620  C CD1   . TRP B 2 36  ? 22.363 10.920  22.292  1.00 69.54  ? 37  TRP A CD1   1 
ATOM   621  C CD2   . TRP B 2 36  ? 22.930 9.156   21.066  1.00 66.23  ? 37  TRP A CD2   1 
ATOM   622  N NE1   . TRP B 2 36  ? 22.862 11.397  21.114  1.00 73.76  ? 37  TRP A NE1   1 
ATOM   623  C CE2   . TRP B 2 36  ? 23.262 10.320  20.325  1.00 74.40  ? 37  TRP A CE2   1 
ATOM   624  C CE3   . TRP B 2 36  ? 23.217 7.901   20.488  1.00 69.92  ? 37  TRP A CE3   1 
ATOM   625  C CZ2   . TRP B 2 36  ? 23.820 10.281  19.049  1.00 74.68  ? 37  TRP A CZ2   1 
ATOM   626  C CZ3   . TRP B 2 36  ? 23.773 7.852   19.227  1.00 73.65  ? 37  TRP A CZ3   1 
ATOM   627  C CH2   . TRP B 2 36  ? 24.091 9.037   18.511  1.00 75.12  ? 37  TRP A CH2   1 
ATOM   628  N N     . ALA B 2 37  ? 20.494 6.294   24.594  1.00 57.05  ? 38  ALA A N     1 
ATOM   629  C CA    . ALA B 2 37  ? 20.442 5.148   25.473  1.00 64.12  ? 38  ALA A CA    1 
ATOM   630  C C     . ALA B 2 37  ? 20.051 3.895   24.707  1.00 66.22  ? 38  ALA A C     1 
ATOM   631  O O     . ALA B 2 37  ? 20.690 2.849   24.834  1.00 62.11  ? 38  ALA A O     1 
ATOM   632  C CB    . ALA B 2 37  ? 19.421 5.398   26.574  1.00 67.59  ? 38  ALA A CB    1 
ATOM   633  N N     . ALA B 2 38  ? 18.979 4.006   23.931  1.00 62.29  ? 39  ALA A N     1 
ATOM   634  C CA    . ALA B 2 38  ? 18.504 2.868   23.166  1.00 59.12  ? 39  ALA A CA    1 
ATOM   635  C C     . ALA B 2 38  ? 19.652 2.394   22.310  1.00 60.67  ? 39  ALA A C     1 
ATOM   636  O O     . ALA B 2 38  ? 20.044 1.215   22.355  1.00 54.88  ? 39  ALA A O     1 
ATOM   637  C CB    . ALA B 2 38  ? 17.292 3.258   22.288  1.00 57.40  ? 39  ALA A CB    1 
ATOM   638  N N     . ILE B 2 39  ? 20.184 3.343   21.545  1.00 53.40  ? 40  ILE A N     1 
ATOM   639  C CA    . ILE B 2 39  ? 21.258 3.069   20.642  1.00 47.41  ? 40  ILE A CA    1 
ATOM   640  C C     . ILE B 2 39  ? 22.337 2.322   21.335  1.00 58.06  ? 40  ILE A C     1 
ATOM   641  O O     . ILE B 2 39  ? 22.971 1.410   20.800  1.00 55.08  ? 40  ILE A O     1 
ATOM   642  C CB    . ILE B 2 39  ? 21.915 4.322   20.211  1.00 45.27  ? 40  ILE A CB    1 
ATOM   643  C CG1   . ILE B 2 39  ? 21.028 5.106   19.264  1.00 44.55  ? 40  ILE A CG1   1 
ATOM   644  C CG2   . ILE B 2 39  ? 23.164 3.934   19.459  1.00 39.81  ? 40  ILE A CG2   1 
ATOM   645  C CD1   . ILE B 2 39  ? 21.358 4.779   17.813  1.00 42.48  ? 40  ILE A CD1   1 
ATOM   646  N N     . LYS B 2 40  ? 22.547 2.682   22.566  1.00 63.58  ? 41  LYS A N     1 
ATOM   647  C CA    . LYS B 2 40  ? 23.609 2.029   23.191  1.00 68.14  ? 41  LYS A CA    1 
ATOM   648  C C     . LYS B 2 40  ? 23.530 0.698   23.832  1.00 70.76  ? 41  LYS A C     1 
ATOM   649  O O     . LYS B 2 40  ? 24.541 0.081   24.053  1.00 80.45  ? 41  LYS A O     1 
ATOM   650  C CB    . LYS B 2 40  ? 24.688 3.013   23.621  1.00 77.78  ? 41  LYS A CB    1 
ATOM   651  C CG    . LYS B 2 40  ? 24.918 4.135   22.544  1.00 100.00 ? 41  LYS A CG    1 
ATOM   652  C CD    . LYS B 2 40  ? 25.518 3.554   21.219  1.00 100.00 ? 41  LYS A CD    1 
ATOM   653  C CE    . LYS B 2 40  ? 25.943 4.644   20.185  1.00 100.00 ? 41  LYS A CE    1 
ATOM   654  N NZ    . LYS B 2 40  ? 26.872 4.154   19.093  1.00 100.00 ? 41  LYS A NZ    1 
ATOM   655  N N     . GLU B 2 41  ? 22.330 0.204   24.077  1.00 59.56  ? 42  GLU A N     1 
ATOM   656  C CA    . GLU B 2 41  ? 22.235 -1.113  24.657  1.00 60.38  ? 42  GLU A CA    1 
ATOM   657  C C     . GLU B 2 41  ? 22.108 -1.998  23.435  1.00 71.72  ? 42  GLU A C     1 
ATOM   658  O O     . GLU B 2 41  ? 22.875 -2.950  23.236  1.00 78.55  ? 42  GLU A O     1 
ATOM   659  C CB    . GLU B 2 41  ? 21.024 -1.265  25.577  1.00 58.95  ? 42  GLU A CB    1 
ATOM   660  C CG    . GLU B 2 41  ? 20.804 -0.139  26.570  1.00 73.56  ? 42  GLU A CG    1 
ATOM   661  C CD    . GLU B 2 41  ? 19.326 0.256   26.603  1.00 100.00 ? 42  GLU A CD    1 
ATOM   662  O OE1   . GLU B 2 41  ? 18.585 -0.266  25.733  1.00 100.00 ? 42  GLU A OE1   1 
ATOM   663  O OE2   . GLU B 2 41  ? 18.901 1.059   27.476  1.00 100.00 ? 42  GLU A OE2   1 
ATOM   664  N N     . LEU B 2 42  ? 21.180 -1.629  22.570  1.00 62.56  ? 43  LEU A N     1 
ATOM   665  C CA    . LEU B 2 42  ? 20.941 -2.374  21.361  1.00 60.99  ? 43  LEU A CA    1 
ATOM   666  C C     . LEU B 2 42  ? 22.209 -2.491  20.598  1.00 61.76  ? 43  LEU A C     1 
ATOM   667  O O     . LEU B 2 42  ? 22.337 -3.341  19.716  1.00 55.93  ? 43  LEU A O     1 
ATOM   668  C CB    . LEU B 2 42  ? 19.962 -1.623  20.491  1.00 62.20  ? 43  LEU A CB    1 
ATOM   669  C CG    . LEU B 2 42  ? 18.488 -1.933  20.648  1.00 67.19  ? 43  LEU A CG    1 
ATOM   670  C CD1   . LEU B 2 42  ? 18.003 -3.027  19.688  1.00 65.36  ? 43  LEU A CD1   1 
ATOM   671  C CD2   . LEU B 2 42  ? 18.204 -2.240  22.116  1.00 66.35  ? 43  LEU A CD2   1 
ATOM   672  N N     . HIS B 2 43  ? 23.148 -1.617  20.936  1.00 67.41  ? 44  HIS A N     1 
ATOM   673  C CA    . HIS B 2 43  ? 24.405 -1.633  20.268  1.00 75.38  ? 44  HIS A CA    1 
ATOM   674  C C     . HIS B 2 43  ? 24.126 -1.425  18.810  1.00 75.93  ? 44  HIS A C     1 
ATOM   675  O O     . HIS B 2 43  ? 24.490 -2.269  17.988  1.00 79.48  ? 44  HIS A O     1 
ATOM   676  C CB    . HIS B 2 43  ? 25.014 -3.016  20.434  1.00 83.54  ? 44  HIS A CB    1 
ATOM   677  C CG    . HIS B 2 43  ? 26.249 -3.007  21.259  1.00 95.38  ? 44  HIS A CG    1 
ATOM   678  N ND1   . HIS B 2 43  ? 26.265 -3.413  22.579  1.00 100.00 ? 44  HIS A ND1   1 
ATOM   679  C CD2   . HIS B 2 43  ? 27.512 -2.592  20.971  1.00 100.00 ? 44  HIS A CD2   1 
ATOM   680  C CE1   . HIS B 2 43  ? 27.493 -3.273  23.060  1.00 100.00 ? 44  HIS A CE1   1 
ATOM   681  N NE2   . HIS B 2 43  ? 28.267 -2.774  22.106  1.00 100.00 ? 44  HIS A NE2   1 
ATOM   682  N N     . TYR B 2 44  ? 23.441 -0.323  18.494  1.00 59.17  ? 45  TYR A N     1 
ATOM   683  C CA    . TYR B 2 44  ? 23.079 -0.006  17.118  1.00 51.99  ? 45  TYR A CA    1 
ATOM   684  C C     . TYR B 2 44  ? 24.201 0.562   16.252  1.00 47.16  ? 45  TYR A C     1 
ATOM   685  O O     . TYR B 2 44  ? 25.027 1.333   16.682  1.00 43.00  ? 45  TYR A O     1 
ATOM   686  C CB    . TYR B 2 44  ? 21.897 0.973   17.088  1.00 50.27  ? 45  TYR A CB    1 
ATOM   687  C CG    . TYR B 2 44  ? 21.449 1.395   15.682  1.00 44.92  ? 45  TYR A CG    1 
ATOM   688  C CD1   . TYR B 2 44  ? 21.067 0.448   14.741  1.00 40.10  ? 45  TYR A CD1   1 
ATOM   689  C CD2   . TYR B 2 44  ? 21.394 2.741   15.316  1.00 46.14  ? 45  TYR A CD2   1 
ATOM   690  C CE1   . TYR B 2 44  ? 20.656 0.813   13.481  1.00 36.19  ? 45  TYR A CE1   1 
ATOM   691  C CE2   . TYR B 2 44  ? 20.996 3.117   14.056  1.00 47.84  ? 45  TYR A CE2   1 
ATOM   692  C CZ    . TYR B 2 44  ? 20.610 2.144   13.149  1.00 56.89  ? 45  TYR A CZ    1 
ATOM   693  O OH    . TYR B 2 44  ? 20.208 2.535   11.919  1.00 42.86  ? 45  TYR A OH    1 
ATOM   694  N N     . SER B 2 45  ? 24.201 0.185   14.998  1.00 47.49  ? 46  SER A N     1 
ATOM   695  C CA    . SER B 2 45  ? 25.163 0.720   14.075  1.00 49.68  ? 46  SER A CA    1 
ATOM   696  C C     . SER B 2 45  ? 24.385 1.011   12.820  1.00 47.32  ? 46  SER A C     1 
ATOM   697  O O     . SER B 2 45  ? 23.836 0.152   12.140  1.00 48.59  ? 46  SER A O     1 
ATOM   698  C CB    . SER B 2 45  ? 26.311 -0.209  13.753  1.00 63.96  ? 46  SER A CB    1 
ATOM   699  O OG    . SER B 2 45  ? 27.020 0.323   12.627  1.00 83.31  ? 46  SER A OG    1 
ATOM   700  N N     . PRO B 2 46  ? 24.333 2.263   12.534  1.00 37.52  ? 47  PRO A N     1 
ATOM   701  C CA    . PRO B 2 46  ? 23.627 2.727   11.391  1.00 38.20  ? 47  PRO A CA    1 
ATOM   702  C C     . PRO B 2 46  ? 24.160 2.073   10.120  1.00 41.87  ? 47  PRO A C     1 
ATOM   703  O O     . PRO B 2 46  ? 25.374 1.967   9.934   1.00 46.49  ? 47  PRO A O     1 
ATOM   704  C CB    . PRO B 2 46  ? 23.979 4.210   11.381  1.00 41.48  ? 47  PRO A CB    1 
ATOM   705  C CG    . PRO B 2 46  ? 24.403 4.548   12.780  1.00 43.19  ? 47  PRO A CG    1 
ATOM   706  C CD    . PRO B 2 46  ? 24.605 3.304   13.529  1.00 36.84  ? 47  PRO A CD    1 
ATOM   707  N N     . SER B 2 47  ? 23.252 1.658   9.230   1.00 29.17  ? 48  SER A N     1 
ATOM   708  C CA    . SER B 2 47  ? 23.678 1.064   7.978   1.00 32.57  ? 48  SER A CA    1 
ATOM   709  C C     . SER B 2 47  ? 23.935 2.037   6.835   1.00 43.32  ? 48  SER A C     1 
ATOM   710  O O     . SER B 2 47  ? 23.018 2.529   6.172   1.00 53.70  ? 48  SER A O     1 
ATOM   711  C CB    . SER B 2 47  ? 22.739 -0.013  7.452   1.00 39.34  ? 48  SER A CB    1 
ATOM   712  O OG    . SER B 2 47  ? 22.949 -0.159  6.029   1.00 33.89  ? 48  SER A OG    1 
ATOM   713  N N     . ALA B 2 48  ? 25.196 2.281   6.574   1.00 31.88  ? 49  ALA A N     1 
ATOM   714  C CA    . ALA B 2 48  ? 25.577 3.167   5.479   1.00 28.84  ? 49  ALA A CA    1 
ATOM   715  C C     . ALA B 2 48  ? 25.026 2.670   4.130   1.00 30.26  ? 49  ALA A C     1 
ATOM   716  O O     . ALA B 2 48  ? 25.010 3.405   3.119   1.00 17.74  ? 49  ALA A O     1 
ATOM   717  C CB    . ALA B 2 48  ? 27.103 3.205   5.387   1.00 26.57  ? 49  ALA A CB    1 
ATOM   718  N N     . VAL B 2 49  ? 24.679 1.401   4.069   1.00 25.60  ? 50  VAL A N     1 
ATOM   719  C CA    . VAL B 2 49  ? 24.250 0.949   2.763   1.00 28.76  ? 50  VAL A CA    1 
ATOM   720  C C     . VAL B 2 49  ? 22.924 1.515   2.514   1.00 32.85  ? 50  VAL A C     1 
ATOM   721  O O     . VAL B 2 49  ? 22.637 2.128   1.443   1.00 26.30  ? 50  VAL A O     1 
ATOM   722  C CB    . VAL B 2 49  ? 24.248 -0.550  2.690   1.00 25.66  ? 50  VAL A CB    1 
ATOM   723  C CG1   . VAL B 2 49  ? 24.267 -1.014  1.250   1.00 18.86  ? 50  VAL A CG1   1 
ATOM   724  C CG2   . VAL B 2 49  ? 25.430 -1.051  3.467   1.00 26.02  ? 50  VAL A CG2   1 
ATOM   725  N N     . ALA B 2 50  ? 22.125 1.321   3.554   1.00 26.60  ? 51  ALA A N     1 
ATOM   726  C CA    . ALA B 2 50  ? 20.773 1.796   3.573   1.00 31.74  ? 51  ALA A CA    1 
ATOM   727  C C     . ALA B 2 50  ? 20.912 3.275   3.242   1.00 38.68  ? 51  ALA A C     1 
ATOM   728  O O     . ALA B 2 50  ? 20.368 3.788   2.212   1.00 37.51  ? 51  ALA A O     1 
ATOM   729  C CB    . ALA B 2 50  ? 20.186 1.643   4.996   1.00 32.76  ? 51  ALA A CB    1 
ATOM   730  N N     . ARG B 2 51  ? 21.679 3.948   4.101   1.00 18.46  ? 52  ARG A N     1 
ATOM   731  C CA    . ARG B 2 51  ? 21.847 5.320   3.904   1.00 14.91  ? 52  ARG A CA    1 
ATOM   732  C C     . ARG B 2 51  ? 22.284 5.750   2.490   1.00 25.92  ? 52  ARG A C     1 
ATOM   733  O O     . ARG B 2 51  ? 21.684 6.630   1.918   1.00 29.30  ? 52  ARG A O     1 
ATOM   734  C CB    . ARG B 2 51  ? 22.725 5.912   4.954   1.00 16.98  ? 52  ARG A CB    1 
ATOM   735  C CG    . ARG B 2 51  ? 22.980 7.427   4.658   1.00 45.99  ? 52  ARG A CG    1 
ATOM   736  C CD    . ARG B 2 51  ? 23.518 8.182   5.875   1.00 62.38  ? 52  ARG A CD    1 
ATOM   737  N NE    . ARG B 2 51  ? 22.833 9.450   6.064   1.00 50.59  ? 52  ARG A NE    1 
ATOM   738  C CZ    . ARG B 2 51  ? 23.326 10.626  5.712   1.00 67.51  ? 52  ARG A CZ    1 
ATOM   739  N NH1   . ARG B 2 51  ? 24.527 10.713  5.143   1.00 96.57  ? 52  ARG A NH1   1 
ATOM   740  N NH2   . ARG B 2 51  ? 22.613 11.719  5.936   1.00 81.52  ? 52  ARG A NH2   1 
ATOM   741  N N     . SER B 2 52  ? 23.311 5.141   1.925   1.00 22.34  ? 53  SER A N     1 
ATOM   742  C CA    . SER B 2 52  ? 23.771 5.565   0.623   1.00 20.35  ? 53  SER A CA    1 
ATOM   743  C C     . SER B 2 52  ? 22.707 5.439   -0.348  1.00 37.20  ? 53  SER A C     1 
ATOM   744  O O     . SER B 2 52  ? 22.528 6.296   -1.222  1.00 33.92  ? 53  SER A O     1 
ATOM   745  C CB    . SER B 2 52  ? 24.922 4.734   0.209   1.00 28.89  ? 53  SER A CB    1 
ATOM   746  O OG    . SER B 2 52  ? 25.987 4.969   1.122   1.00 79.61  ? 53  SER A OG    1 
ATOM   747  N N     . LEU B 2 53  ? 21.953 4.367   -0.142  1.00 44.19  ? 54  LEU A N     1 
ATOM   748  C CA    . LEU B 2 53  ? 20.807 4.047   -0.977  1.00 48.37  ? 54  LEU A CA    1 
ATOM   749  C C     . LEU B 2 53  ? 19.841 5.223   -1.081  1.00 42.67  ? 54  LEU A C     1 
ATOM   750  O O     . LEU B 2 53  ? 19.444 5.608   -2.179  1.00 45.22  ? 54  LEU A O     1 
ATOM   751  C CB    . LEU B 2 53  ? 20.086 2.838   -0.426  1.00 53.45  ? 54  LEU A CB    1 
ATOM   752  C CG    . LEU B 2 53  ? 19.716 1.777   -1.462  1.00 61.66  ? 54  LEU A CG    1 
ATOM   753  C CD1   . LEU B 2 53  ? 18.519 1.017   -0.898  1.00 62.85  ? 54  LEU A CD1   1 
ATOM   754  C CD2   . LEU B 2 53  ? 19.405 2.393   -2.835  1.00 60.48  ? 54  LEU A CD2   1 
ATOM   755  N N     . LYS B 2 54  ? 19.478 5.813   0.055   1.00 37.16  ? 55  LYS A N     1 
ATOM   756  C CA    . LYS B 2 54  ? 18.576 6.989   0.021   1.00 37.36  ? 55  LYS A CA    1 
ATOM   757  C C     . LYS B 2 54  ? 19.257 8.267   -0.476  1.00 36.60  ? 55  LYS A C     1 
ATOM   758  O O     . LYS B 2 54  ? 18.869 8.841   -1.498  1.00 43.72  ? 55  LYS A O     1 
ATOM   759  C CB    . LYS B 2 54  ? 17.887 7.251   1.362   1.00 38.61  ? 55  LYS A CB    1 
ATOM   760  C CG    . LYS B 2 54  ? 16.377 7.048   1.314   1.00 63.61  ? 55  LYS A CG    1 
ATOM   761  C CD    . LYS B 2 54  ? 15.670 8.315   0.815   1.00 80.25  ? 55  LYS A CD    1 
ATOM   762  C CE    . LYS B 2 54  ? 14.200 8.051   0.485   1.00 83.68  ? 55  LYS A CE    1 
ATOM   763  N NZ    . LYS B 2 54  ? 13.753 8.708   -0.808  1.00 66.46  ? 55  LYS A NZ    1 
ATOM   764  N N     . VAL B 2 55  ? 20.312 8.666   0.213   1.00 29.95  ? 56  VAL A N     1 
ATOM   765  C CA    . VAL B 2 55  ? 21.088 9.886   -0.079  1.00 29.79  ? 56  VAL A CA    1 
ATOM   766  C C     . VAL B 2 55  ? 21.893 9.936   -1.351  1.00 40.34  ? 56  VAL A C     1 
ATOM   767  O O     . VAL B 2 55  ? 22.375 11.001  -1.733  1.00 43.43  ? 56  VAL A O     1 
ATOM   768  C CB    . VAL B 2 55  ? 22.151 10.077  0.959   1.00 29.36  ? 56  VAL A CB    1 
ATOM   769  C CG1   . VAL B 2 55  ? 21.536 10.258  2.375   1.00 23.57  ? 56  VAL A CG1   1 
ATOM   770  C CG2   . VAL B 2 55  ? 23.042 8.865   0.881   1.00 31.96  ? 56  VAL A CG2   1 
ATOM   771  N N     . ASN B 2 56  ? 22.094 8.799   -1.994  1.00 39.14  ? 57  ASN A N     1 
ATOM   772  C CA    . ASN B 2 56  ? 22.862 8.776   -3.234  1.00 38.15  ? 57  ASN A CA    1 
ATOM   773  C C     . ASN B 2 56  ? 24.331 9.130   -3.253  1.00 46.76  ? 57  ASN A C     1 
ATOM   774  O O     . ASN B 2 56  ? 24.786 9.899   -4.119  1.00 46.46  ? 57  ASN A O     1 
ATOM   775  C CB    . ASN B 2 56  ? 22.209 9.488   -4.376  1.00 12.85  ? 57  ASN A CB    1 
ATOM   776  C CG    . ASN B 2 56  ? 22.593 8.872   -5.702  1.00 93.82  ? 57  ASN A CG    1 
ATOM   777  O OD1   . ASN B 2 56  ? 22.770 7.658   -5.775  1.00 100.00 ? 57  ASN A OD1   1 
ATOM   778  N ND2   . ASN B 2 56  ? 22.812 9.703   -6.719  1.00 100.00 ? 57  ASN A ND2   1 
ATOM   779  N N     . HIS B 2 57  ? 25.082 8.527   -2.350  1.00 44.88  ? 58  HIS A N     1 
ATOM   780  C CA    . HIS B 2 57  ? 26.501 8.723   -2.295  1.00 47.33  ? 58  HIS A CA    1 
ATOM   781  C C     . HIS B 2 57  ? 27.022 7.851   -1.204  1.00 40.16  ? 58  HIS A C     1 
ATOM   782  O O     . HIS B 2 57  ? 26.365 7.645   -0.172  1.00 39.22  ? 58  HIS A O     1 
ATOM   783  C CB    . HIS B 2 57  ? 26.885 10.186  -2.156  1.00 53.86  ? 58  HIS A CB    1 
ATOM   784  C CG    . HIS B 2 57  ? 26.582 10.755  -0.819  1.00 63.00  ? 58  HIS A CG    1 
ATOM   785  N ND1   . HIS B 2 57  ? 25.806 11.879  -0.653  1.00 69.30  ? 58  HIS A ND1   1 
ATOM   786  C CD2   . HIS B 2 57  ? 26.953 10.365  0.421   1.00 73.03  ? 58  HIS A CD2   1 
ATOM   787  C CE1   . HIS B 2 57  ? 25.707 12.157  0.636   1.00 73.13  ? 58  HIS A CE1   1 
ATOM   788  N NE2   . HIS B 2 57  ? 26.394 11.251  1.310   1.00 74.64  ? 58  HIS A NE2   1 
ATOM   789  N N     . THR B 2 58  ? 28.200 7.312   -1.457  1.00 30.97  ? 59  THR A N     1 
ATOM   790  C CA    . THR B 2 58  ? 28.816 6.377   -0.530  1.00 32.68  ? 59  THR A CA    1 
ATOM   791  C C     . THR B 2 58  ? 29.891 6.868   0.392   1.00 33.76  ? 59  THR A C     1 
ATOM   792  O O     . THR B 2 58  ? 30.257 6.149   1.292   1.00 34.56  ? 59  THR A O     1 
ATOM   793  C CB    . THR B 2 58  ? 29.411 5.351   -1.329  1.00 35.27  ? 59  THR A CB    1 
ATOM   794  O OG1   . THR B 2 58  ? 30.630 5.882   -1.885  1.00 59.89  ? 59  THR A OG1   1 
ATOM   795  C CG2   . THR B 2 58  ? 28.441 5.097   -2.464  1.00 16.22  ? 59  THR A CG2   1 
ATOM   796  N N     . LYS B 2 59  ? 30.379 8.080   0.170   1.00 30.56  ? 60  LYS A N     1 
ATOM   797  C CA    . LYS B 2 59  ? 31.444 8.643   0.998   1.00 34.54  ? 60  LYS A CA    1 
ATOM   798  C C     . LYS B 2 59  ? 32.591 7.606   0.982   1.00 39.21  ? 60  LYS A C     1 
ATOM   799  O O     . LYS B 2 59  ? 33.160 7.169   2.037   1.00 33.64  ? 60  LYS A O     1 
ATOM   800  C CB    . LYS B 2 59  ? 30.943 8.943   2.409   1.00 36.72  ? 60  LYS A CB    1 
ATOM   801  C CG    . LYS B 2 59  ? 31.341 10.327  2.925   1.00 80.01  ? 60  LYS A CG    1 
ATOM   802  C CD    . LYS B 2 59  ? 30.512 11.470  2.297   1.00 86.24  ? 60  LYS A CD    1 
ATOM   803  C CE    . LYS B 2 59  ? 30.588 12.784  3.096   1.00 74.21  ? 60  LYS A CE    1 
ATOM   804  N NZ    . LYS B 2 59  ? 31.638 12.714  4.190   1.00 83.18  ? 60  LYS A NZ    1 
ATOM   805  N N     . SER B 2 60  ? 32.895 7.213   -0.246  1.00 27.82  ? 61  SER A N     1 
ATOM   806  C CA    . SER B 2 60  ? 33.904 6.256   -0.460  1.00 25.81  ? 61  SER A CA    1 
ATOM   807  C C     . SER B 2 60  ? 34.495 6.499   -1.877  1.00 33.79  ? 61  SER A C     1 
ATOM   808  O O     . SER B 2 60  ? 33.754 6.669   -2.857  1.00 22.00  ? 61  SER A O     1 
ATOM   809  C CB    . SER B 2 60  ? 33.242 4.902   -0.277  1.00 33.04  ? 61  SER A CB    1 
ATOM   810  O OG    . SER B 2 60  ? 33.458 4.018   -1.339  1.00 63.26  ? 61  SER A OG    1 
ATOM   811  N N     . ILE B 2 61  ? 35.837 6.557   -1.946  1.00 38.57  ? 62  ILE A N     1 
ATOM   812  C CA    . ILE B 2 61  ? 36.585 6.779   -3.198  1.00 35.83  ? 62  ILE A CA    1 
ATOM   813  C C     . ILE B 2 61  ? 37.364 5.534   -3.608  1.00 22.03  ? 62  ILE A C     1 
ATOM   814  O O     . ILE B 2 61  ? 37.843 4.757   -2.772  1.00 22.90  ? 62  ILE A O     1 
ATOM   815  C CB    . ILE B 2 61  ? 37.643 7.919   -3.044  1.00 41.34  ? 62  ILE A CB    1 
ATOM   816  C CG1   . ILE B 2 61  ? 36.988 9.291   -3.202  1.00 42.41  ? 62  ILE A CG1   1 
ATOM   817  C CG2   . ILE B 2 61  ? 38.781 7.759   -4.047  1.00 42.24  ? 62  ILE A CG2   1 
ATOM   818  C CD1   . ILE B 2 61  ? 36.901 10.053  -1.887  1.00 56.06  ? 62  ILE A CD1   1 
ATOM   819  N N     . GLY B 2 62  ? 37.506 5.368   -4.906  1.00 15.79  ? 63  GLY A N     1 
ATOM   820  C CA    . GLY B 2 62  ? 38.219 4.246   -5.446  1.00 23.31  ? 63  GLY A CA    1 
ATOM   821  C C     . GLY B 2 62  ? 39.521 4.628   -6.148  1.00 35.14  ? 63  GLY A C     1 
ATOM   822  O O     . GLY B 2 62  ? 39.508 5.434   -7.068  1.00 38.45  ? 63  GLY A O     1 
ATOM   823  N N     . LEU B 2 63  ? 40.618 4.001   -5.713  1.00 29.18  ? 64  LEU A N     1 
ATOM   824  C CA    . LEU B 2 63  ? 41.952 4.192   -6.257  1.00 27.30  ? 64  LEU A CA    1 
ATOM   825  C C     . LEU B 2 63  ? 42.270 2.997   -7.099  1.00 37.25  ? 64  LEU A C     1 
ATOM   826  O O     . LEU B 2 63  ? 42.493 1.868   -6.577  1.00 33.21  ? 64  LEU A O     1 
ATOM   827  C CB    . LEU B 2 63  ? 43.001 4.180   -5.128  1.00 28.70  ? 64  LEU A CB    1 
ATOM   828  C CG    . LEU B 2 63  ? 44.376 4.436   -5.745  1.00 31.96  ? 64  LEU A CG    1 
ATOM   829  C CD1   . LEU B 2 63  ? 44.139 5.307   -6.951  1.00 37.23  ? 64  LEU A CD1   1 
ATOM   830  C CD2   . LEU B 2 63  ? 45.232 5.208   -4.787  1.00 39.33  ? 64  LEU A CD2   1 
ATOM   831  N N     . LEU B 2 64  ? 42.325 3.233   -8.397  1.00 34.02  ? 65  LEU A N     1 
ATOM   832  C CA    . LEU B 2 64  ? 42.643 2.166   -9.309  1.00 30.17  ? 65  LEU A CA    1 
ATOM   833  C C     . LEU B 2 64  ? 44.125 2.345   -9.584  1.00 38.64  ? 65  LEU A C     1 
ATOM   834  O O     . LEU B 2 64  ? 44.538 3.087   -10.487 1.00 27.90  ? 65  LEU A O     1 
ATOM   835  C CB    . LEU B 2 64  ? 41.829 2.332   -10.576 1.00 29.03  ? 65  LEU A CB    1 
ATOM   836  C CG    . LEU B 2 64  ? 42.339 1.465   -11.722 1.00 34.41  ? 65  LEU A CG    1 
ATOM   837  C CD1   . LEU B 2 64  ? 42.299 0.041   -11.230 1.00 37.82  ? 65  LEU A CD1   1 
ATOM   838  C CD2   . LEU B 2 64  ? 41.479 1.633   -12.972 1.00 20.93  ? 65  LEU A CD2   1 
ATOM   839  N N     . ALA B 2 65  ? 44.919 1.672   -8.763  1.00 42.62  ? 66  ALA A N     1 
ATOM   840  C CA    . ALA B 2 65  ? 46.370 1.718   -8.869  1.00 42.58  ? 66  ALA A CA    1 
ATOM   841  C C     . ALA B 2 65  ? 46.969 0.686   -9.803  1.00 39.18  ? 66  ALA A C     1 
ATOM   842  O O     . ALA B 2 65  ? 46.341 -0.274  -10.206 1.00 31.68  ? 66  ALA A O     1 
ATOM   843  C CB    . ALA B 2 65  ? 46.973 1.531   -7.506  1.00 44.70  ? 66  ALA A CB    1 
ATOM   844  N N     . THR B 2 66  ? 48.245 0.865   -10.081 1.00 45.25  ? 67  THR A N     1 
ATOM   845  C CA    . THR B 2 66  ? 48.973 -0.056  -10.938 1.00 46.00  ? 67  THR A CA    1 
ATOM   846  C C     . THR B 2 66  ? 49.491 -1.274  -10.126 1.00 41.64  ? 67  THR A C     1 
ATOM   847  O O     . THR B 2 66  ? 49.296 -2.414  -10.500 1.00 38.18  ? 67  THR A O     1 
ATOM   848  C CB    . THR B 2 66  ? 50.114 0.645   -11.650 1.00 43.75  ? 67  THR A CB    1 
ATOM   849  O OG1   . THR B 2 66  ? 49.594 1.461   -12.727 1.00 60.85  ? 67  THR A OG1   1 
ATOM   850  C CG2   . THR B 2 66  ? 51.026 -0.393  -12.193 1.00 1.00   ? 67  THR A CG2   1 
ATOM   851  N N     . SER B 2 67  ? 50.135 -1.002  -9.010  1.00 33.24  ? 68  SER A N     1 
ATOM   852  C CA    . SER B 2 67  ? 50.636 -2.006  -8.101  1.00 30.02  ? 68  SER A CA    1 
ATOM   853  C C     . SER B 2 67  ? 50.743 -1.149  -6.853  1.00 37.66  ? 68  SER A C     1 
ATOM   854  O O     . SER B 2 67  ? 50.782 0.052   -6.946  1.00 41.80  ? 68  SER A O     1 
ATOM   855  C CB    . SER B 2 67  ? 52.044 -2.456  -8.521  1.00 40.60  ? 68  SER A CB    1 
ATOM   856  O OG    . SER B 2 67  ? 52.977 -2.436  -7.422  1.00 59.15  ? 68  SER A OG    1 
ATOM   857  N N     . SER B 2 68  ? 50.812 -1.736  -5.683  1.00 35.53  ? 69  SER A N     1 
ATOM   858  C CA    . SER B 2 68  ? 50.912 -0.913  -4.506  1.00 30.87  ? 69  SER A CA    1 
ATOM   859  C C     . SER B 2 68  ? 52.163 -1.221  -3.617  1.00 32.20  ? 69  SER A C     1 
ATOM   860  O O     . SER B 2 68  ? 52.397 -0.507  -2.649  1.00 25.42  ? 69  SER A O     1 
ATOM   861  C CB    . SER B 2 68  ? 49.631 -1.062  -3.727  1.00 38.08  ? 69  SER A CB    1 
ATOM   862  O OG    . SER B 2 68  ? 49.181 -2.421  -3.799  1.00 48.19  ? 69  SER A OG    1 
ATOM   863  N N     . GLU B 2 69  ? 52.953 -2.272  -3.917  1.00 34.28  ? 70  GLU A N     1 
ATOM   864  C CA    . GLU B 2 69  ? 54.152 -2.571  -3.097  1.00 33.89  ? 70  GLU A CA    1 
ATOM   865  C C     . GLU B 2 69  ? 55.270 -1.590  -3.423  1.00 31.46  ? 70  GLU A C     1 
ATOM   866  O O     . GLU B 2 69  ? 55.966 -1.109  -2.541  1.00 31.37  ? 70  GLU A O     1 
ATOM   867  C CB    . GLU B 2 69  ? 54.683 -3.971  -3.318  1.00 37.47  ? 70  GLU A CB    1 
ATOM   868  C CG    . GLU B 2 69  ? 55.867 -4.298  -2.413  1.00 57.58  ? 70  GLU A CG    1 
ATOM   869  C CD    . GLU B 2 69  ? 57.213 -4.241  -3.145  1.00 83.03  ? 70  GLU A CD    1 
ATOM   870  O OE1   . GLU B 2 69  ? 57.206 -4.040  -4.380  1.00 100.00 ? 70  GLU A OE1   1 
ATOM   871  O OE2   . GLU B 2 69  ? 58.266 -4.412  -2.484  1.00 73.19  ? 70  GLU A OE2   1 
ATOM   872  N N     . ALA B 2 70  ? 55.447 -1.290  -4.707  1.00 18.62  ? 71  ALA A N     1 
ATOM   873  C CA    . ALA B 2 70  ? 56.448 -0.343  -5.136  1.00 12.01  ? 71  ALA A CA    1 
ATOM   874  C C     . ALA B 2 70  ? 56.557 0.969   -4.267  1.00 28.60  ? 71  ALA A C     1 
ATOM   875  O O     . ALA B 2 70  ? 55.578 1.696   -3.992  1.00 30.65  ? 71  ALA A O     1 
ATOM   876  C CB    . ALA B 2 70  ? 56.210 -0.029  -6.565  1.00 11.14  ? 71  ALA A CB    1 
ATOM   877  N N     . ALA B 2 71  ? 57.781 1.207   -3.830  1.00 25.86  ? 72  ALA A N     1 
ATOM   878  C CA    . ALA B 2 71  ? 58.120 2.323   -2.972  1.00 26.11  ? 72  ALA A CA    1 
ATOM   879  C C     . ALA B 2 71  ? 57.368 3.590   -3.309  1.00 24.57  ? 72  ALA A C     1 
ATOM   880  O O     . ALA B 2 71  ? 56.701 4.141   -2.459  1.00 8.74   ? 72  ALA A O     1 
ATOM   881  C CB    . ALA B 2 71  ? 59.646 2.577   -3.004  1.00 25.35  ? 72  ALA A CB    1 
ATOM   882  N N     . TYR B 2 72  ? 57.502 3.990   -4.581  1.00 26.22  ? 73  TYR A N     1 
ATOM   883  C CA    . TYR B 2 72  ? 56.921 5.181   -5.165  1.00 23.73  ? 73  TYR A CA    1 
ATOM   884  C C     . TYR B 2 72  ? 55.437 5.154   -4.812  1.00 29.60  ? 73  TYR A C     1 
ATOM   885  O O     . TYR B 2 72  ? 54.891 5.847   -3.917  1.00 20.73  ? 73  TYR A O     1 
ATOM   886  C CB    . TYR B 2 72  ? 57.114 5.023   -6.673  1.00 27.58  ? 73  TYR A CB    1 
ATOM   887  C CG    . TYR B 2 72  ? 56.637 6.173   -7.429  1.00 41.29  ? 73  TYR A CG    1 
ATOM   888  C CD1   . TYR B 2 72  ? 57.268 7.378   -7.303  1.00 50.18  ? 73  TYR A CD1   1 
ATOM   889  C CD2   . TYR B 2 72  ? 55.547 6.086   -8.272  1.00 45.38  ? 73  TYR A CD2   1 
ATOM   890  C CE1   . TYR B 2 72  ? 56.848 8.504   -7.990  1.00 56.54  ? 73  TYR A CE1   1 
ATOM   891  C CE2   . TYR B 2 72  ? 55.114 7.207   -8.977  1.00 49.27  ? 73  TYR A CE2   1 
ATOM   892  C CZ    . TYR B 2 72  ? 55.781 8.423   -8.820  1.00 50.51  ? 73  TYR A CZ    1 
ATOM   893  O OH    . TYR B 2 72  ? 55.402 9.559   -9.444  1.00 32.46  ? 73  TYR A OH    1 
ATOM   894  N N     . PHE B 2 73  ? 54.818 4.248   -5.496  1.00 28.26  ? 74  PHE A N     1 
ATOM   895  C CA    . PHE B 2 73  ? 53.432 4.001   -5.349  1.00 23.99  ? 74  PHE A CA    1 
ATOM   896  C C     . PHE B 2 73  ? 52.879 3.948   -3.945  1.00 31.32  ? 74  PHE A C     1 
ATOM   897  O O     . PHE B 2 73  ? 51.886 4.591   -3.597  1.00 38.74  ? 74  PHE A O     1 
ATOM   898  C CB    . PHE B 2 73  ? 53.237 2.671   -6.002  1.00 18.76  ? 74  PHE A CB    1 
ATOM   899  C CG    . PHE B 2 73  ? 53.199 2.781   -7.480  1.00 17.96  ? 74  PHE A CG    1 
ATOM   900  C CD1   . PHE B 2 73  ? 52.665 3.929   -8.051  1.00 4.59   ? 74  PHE A CD1   1 
ATOM   901  C CD2   . PHE B 2 73  ? 53.684 1.747   -8.322  1.00 24.54  ? 74  PHE A CD2   1 
ATOM   902  C CE1   . PHE B 2 73  ? 52.577 4.046   -9.403  1.00 8.51   ? 74  PHE A CE1   1 
ATOM   903  C CE2   . PHE B 2 73  ? 53.601 1.870   -9.693  1.00 22.54  ? 74  PHE A CE2   1 
ATOM   904  C CZ    . PHE B 2 73  ? 53.052 3.053   -10.225 1.00 19.07  ? 74  PHE A CZ    1 
ATOM   905  N N     . ALA B 2 74  ? 53.525 3.148   -3.151  1.00 20.77  ? 75  ALA A N     1 
ATOM   906  C CA    . ALA B 2 74  ? 53.077 2.927   -1.812  1.00 20.80  ? 75  ALA A CA    1 
ATOM   907  C C     . ALA B 2 74  ? 52.914 4.216   -1.096  1.00 28.44  ? 75  ALA A C     1 
ATOM   908  O O     . ALA B 2 74  ? 51.917 4.514   -0.446  1.00 27.13  ? 75  ALA A O     1 
ATOM   909  C CB    . ALA B 2 74  ? 54.097 2.052   -1.089  1.00 20.57  ? 75  ALA A CB    1 
ATOM   910  N N     . GLU B 2 75  ? 53.935 5.002   -1.313  1.00 30.58  ? 76  GLU A N     1 
ATOM   911  C CA    . GLU B 2 75  ? 54.088 6.267   -0.709  1.00 28.75  ? 76  GLU A CA    1 
ATOM   912  C C     . GLU B 2 75  ? 52.954 7.226   -1.057  1.00 32.54  ? 76  GLU A C     1 
ATOM   913  O O     . GLU B 2 75  ? 52.443 7.936   -0.179  1.00 27.47  ? 76  GLU A O     1 
ATOM   914  C CB    . GLU B 2 75  ? 55.470 6.814   -1.081  1.00 27.80  ? 76  GLU A CB    1 
ATOM   915  C CG    . GLU B 2 75  ? 56.227 7.403   0.089   1.00 39.16  ? 76  GLU A CG    1 
ATOM   916  C CD    . GLU B 2 75  ? 57.686 7.716   -0.230  1.00 85.50  ? 76  GLU A CD    1 
ATOM   917  O OE1   . GLU B 2 75  ? 58.467 6.756   -0.469  1.00 36.05  ? 76  GLU A OE1   1 
ATOM   918  O OE2   . GLU B 2 75  ? 58.061 8.916   -0.171  1.00 87.21  ? 76  GLU A OE2   1 
ATOM   919  N N     . ILE B 2 76  ? 52.560 7.276   -2.326  1.00 27.20  ? 77  ILE A N     1 
ATOM   920  C CA    . ILE B 2 76  ? 51.493 8.175   -2.704  1.00 26.66  ? 77  ILE A CA    1 
ATOM   921  C C     . ILE B 2 76  ? 50.227 7.666   -2.051  1.00 28.15  ? 77  ILE A C     1 
ATOM   922  O O     . ILE B 2 76  ? 49.479 8.389   -1.372  1.00 27.61  ? 77  ILE A O     1 
ATOM   923  C CB    . ILE B 2 76  ? 51.200 8.047   -4.162  1.00 32.17  ? 77  ILE A CB    1 
ATOM   924  C CG1   . ILE B 2 76  ? 52.248 8.763   -4.994  1.00 27.71  ? 77  ILE A CG1   1 
ATOM   925  C CG2   . ILE B 2 76  ? 49.786 8.541   -4.433  1.00 42.07  ? 77  ILE A CG2   1 
ATOM   926  C CD1   . ILE B 2 76  ? 52.968 7.812   -5.890  1.00 75.58  ? 77  ILE A CD1   1 
ATOM   927  N N     . ILE B 2 77  ? 49.989 6.401   -2.292  1.00 17.71  ? 78  ILE A N     1 
ATOM   928  C CA    . ILE B 2 77  ? 48.835 5.770   -1.771  1.00 20.15  ? 78  ILE A CA    1 
ATOM   929  C C     . ILE B 2 77  ? 48.543 6.095   -0.298  1.00 20.86  ? 78  ILE A C     1 
ATOM   930  O O     . ILE B 2 77  ? 47.447 6.519   0.056   1.00 17.10  ? 78  ILE A O     1 
ATOM   931  C CB    . ILE B 2 77  ? 49.017 4.371   -1.918  1.00 21.12  ? 78  ILE A CB    1 
ATOM   932  C CG1   . ILE B 2 77  ? 48.296 3.942   -3.164  1.00 21.91  ? 78  ILE A CG1   1 
ATOM   933  C CG2   . ILE B 2 77  ? 48.552 3.697   -0.668  1.00 15.21  ? 78  ILE A CG2   1 
ATOM   934  C CD1   . ILE B 2 77  ? 48.814 2.639   -3.655  1.00 40.67  ? 78  ILE A CD1   1 
ATOM   935  N N     . GLU B 2 78  ? 49.562 5.958   0.523   1.00 16.62  ? 79  GLU A N     1 
ATOM   936  C CA    . GLU B 2 78  ? 49.412 6.241   1.936   1.00 22.28  ? 79  GLU A CA    1 
ATOM   937  C C     . GLU B 2 78  ? 48.899 7.674   2.098   1.00 26.35  ? 79  GLU A C     1 
ATOM   938  O O     . GLU B 2 78  ? 48.145 8.030   3.038   1.00 21.59  ? 79  GLU A O     1 
ATOM   939  C CB    . GLU B 2 78  ? 50.795 6.072   2.656   1.00 20.91  ? 79  GLU A CB    1 
ATOM   940  C CG    . GLU B 2 78  ? 50.773 6.245   4.185   1.00 25.84  ? 79  GLU A CG    1 
ATOM   941  C CD    . GLU B 2 78  ? 51.956 5.606   4.976   1.00 83.77  ? 79  GLU A CD    1 
ATOM   942  O OE1   . GLU B 2 78  ? 52.985 6.305   5.185   1.00 75.55  ? 79  GLU A OE1   1 
ATOM   943  O OE2   . GLU B 2 78  ? 51.788 4.471   5.497   1.00 61.52  ? 79  GLU A OE2   1 
ATOM   944  N N     . ALA B 2 79  ? 49.293 8.499   1.156   1.00 19.48  ? 80  ALA A N     1 
ATOM   945  C CA    . ALA B 2 79  ? 48.892 9.877   1.268   1.00 27.06  ? 80  ALA A CA    1 
ATOM   946  C C     . ALA B 2 79  ? 47.437 10.018  1.071   1.00 33.84  ? 80  ALA A C     1 
ATOM   947  O O     . ALA B 2 79  ? 46.725 10.469  1.972   1.00 34.24  ? 80  ALA A O     1 
ATOM   948  C CB    . ALA B 2 79  ? 49.647 10.732  0.277   1.00 31.72  ? 80  ALA A CB    1 
ATOM   949  N N     . VAL B 2 80  ? 47.023 9.621   -0.135  1.00 25.27  ? 81  VAL A N     1 
ATOM   950  C CA    . VAL B 2 80  ? 45.637 9.632   -0.555  1.00 20.22  ? 81  VAL A CA    1 
ATOM   951  C C     . VAL B 2 80  ? 44.811 9.101   0.577   1.00 21.75  ? 81  VAL A C     1 
ATOM   952  O O     . VAL B 2 80  ? 43.829 9.720   0.995   1.00 18.78  ? 81  VAL A O     1 
ATOM   953  C CB    . VAL B 2 80  ? 45.448 8.688   -1.660  1.00 16.65  ? 81  VAL A CB    1 
ATOM   954  C CG1   . VAL B 2 80  ? 43.968 8.584   -1.963  1.00 13.46  ? 81  VAL A CG1   1 
ATOM   955  C CG2   . VAL B 2 80  ? 46.250 9.175   -2.839  1.00 17.37  ? 81  VAL A CG2   1 
ATOM   956  N N     . GLU B 2 81  ? 45.256 7.973   1.108   1.00 13.52  ? 82  GLU A N     1 
ATOM   957  C CA    . GLU B 2 81  ? 44.554 7.435   2.214   1.00 16.43  ? 82  GLU A CA    1 
ATOM   958  C C     . GLU B 2 81  ? 44.427 8.449   3.341   1.00 20.67  ? 82  GLU A C     1 
ATOM   959  O O     . GLU B 2 81  ? 43.332 8.628   3.883   1.00 19.02  ? 82  GLU A O     1 
ATOM   960  C CB    . GLU B 2 81  ? 45.151 6.146   2.757   1.00 19.07  ? 82  GLU A CB    1 
ATOM   961  C CG    . GLU B 2 81  ? 44.182 5.576   3.835   1.00 2.99   ? 82  GLU A CG    1 
ATOM   962  C CD    . GLU B 2 81  ? 44.542 5.915   5.263   1.00 25.77  ? 82  GLU A CD    1 
ATOM   963  O OE1   . GLU B 2 81  ? 45.602 6.555   5.523   1.00 77.43  ? 82  GLU A OE1   1 
ATOM   964  O OE2   . GLU B 2 81  ? 43.852 5.382   6.136   1.00 58.70  ? 82  GLU A OE2   1 
ATOM   965  N N     . LYS B 2 82  ? 45.514 9.130   3.676   1.00 23.24  ? 83  LYS A N     1 
ATOM   966  C CA    . LYS B 2 82  ? 45.414 10.123  4.759   1.00 33.35  ? 83  LYS A CA    1 
ATOM   967  C C     . LYS B 2 82  ? 44.317 11.150  4.399   1.00 37.07  ? 83  LYS A C     1 
ATOM   968  O O     . LYS B 2 82  ? 43.576 11.617  5.263   1.00 29.33  ? 83  LYS A O     1 
ATOM   969  C CB    . LYS B 2 82  ? 46.756 10.858  5.015   1.00 37.32  ? 83  LYS A CB    1 
ATOM   970  C CG    . LYS B 2 82  ? 47.862 9.996   5.619   1.00 77.09  ? 83  LYS A CG    1 
ATOM   971  C CD    . LYS B 2 82  ? 48.961 10.883  6.252   1.00 100.00 ? 83  LYS A CD    1 
ATOM   972  C CE    . LYS B 2 82  ? 50.237 10.075  6.603   1.00 100.00 ? 83  LYS A CE    1 
ATOM   973  N NZ    . LYS B 2 82  ? 51.027 10.616  7.783   1.00 100.00 ? 83  LYS A NZ    1 
ATOM   974  N N     . ASN B 2 83  ? 44.187 11.463  3.118   1.00 33.25  ? 84  ASN A N     1 
ATOM   975  C CA    . ASN B 2 83  ? 43.184 12.428  2.771   1.00 35.87  ? 84  ASN A CA    1 
ATOM   976  C C     . ASN B 2 83  ? 41.737 11.973  2.872   1.00 43.54  ? 84  ASN A C     1 
ATOM   977  O O     . ASN B 2 83  ? 40.902 12.688  3.392   1.00 44.36  ? 84  ASN A O     1 
ATOM   978  C CB    . ASN B 2 83  ? 43.553 13.238  1.530   1.00 35.28  ? 84  ASN A CB    1 
ATOM   979  C CG    . ASN B 2 83  ? 44.917 13.994  1.708   1.00 84.68  ? 84  ASN A CG    1 
ATOM   980  O OD1   . ASN B 2 83  ? 44.958 15.226  1.743   1.00 76.76  ? 84  ASN A OD1   1 
ATOM   981  N ND2   . ASN B 2 83  ? 46.013 13.233  1.772   1.00 76.95  ? 84  ASN A ND2   1 
ATOM   982  N N     . CYS B 2 84  ? 41.454 10.766  2.401   1.00 40.94  ? 85  CYS A N     1 
ATOM   983  C CA    . CYS B 2 84  ? 40.113 10.252  2.476   1.00 38.35  ? 85  CYS A CA    1 
ATOM   984  C C     . CYS B 2 84  ? 39.686 10.223  3.914   1.00 44.53  ? 85  CYS A C     1 
ATOM   985  O O     . CYS B 2 84  ? 38.555 10.550  4.244   1.00 45.74  ? 85  CYS A O     1 
ATOM   986  C CB    . CYS B 2 84  ? 40.066 8.837   1.928   1.00 37.79  ? 85  CYS A CB    1 
ATOM   987  S SG    . CYS B 2 84  ? 40.674 8.822   0.220   1.00 44.36  ? 85  CYS A SG    1 
ATOM   988  N N     . PHE B 2 85  ? 40.584 9.831   4.790   1.00 42.24  ? 86  PHE A N     1 
ATOM   989  C CA    . PHE B 2 85  ? 40.204 9.755   6.176   1.00 45.36  ? 86  PHE A CA    1 
ATOM   990  C C     . PHE B 2 85  ? 39.848 11.066  6.820   1.00 57.89  ? 86  PHE A C     1 
ATOM   991  O O     . PHE B 2 85  ? 38.841 11.191  7.544   1.00 62.06  ? 86  PHE A O     1 
ATOM   992  C CB    . PHE B 2 85  ? 41.318 9.149   7.002   1.00 46.37  ? 86  PHE A CB    1 
ATOM   993  C CG    . PHE B 2 85  ? 40.977 8.996   8.448   1.00 45.98  ? 86  PHE A CG    1 
ATOM   994  C CD1   . PHE B 2 85  ? 40.067 8.010   8.855   1.00 50.36  ? 86  PHE A CD1   1 
ATOM   995  C CD2   . PHE B 2 85  ? 41.578 9.813   9.414   1.00 46.26  ? 86  PHE A CD2   1 
ATOM   996  C CE1   . PHE B 2 85  ? 39.764 7.830   10.206  1.00 51.86  ? 86  PHE A CE1   1 
ATOM   997  C CE2   . PHE B 2 85  ? 41.273 9.656   10.765  1.00 49.95  ? 86  PHE A CE2   1 
ATOM   998  C CZ    . PHE B 2 85  ? 40.370 8.655   11.165  1.00 49.73  ? 86  PHE A CZ    1 
ATOM   999  N N     . GLN B 2 86  ? 40.687 12.059  6.626   1.00 52.82  ? 87  GLN A N     1 
ATOM   1000 C CA    . GLN B 2 86  ? 40.365 13.265  7.317   1.00 55.49  ? 87  GLN A CA    1 
ATOM   1001 C C     . GLN B 2 86  ? 39.173 13.996  6.907   1.00 48.88  ? 87  GLN A C     1 
ATOM   1002 O O     . GLN B 2 86  ? 38.636 14.783  7.674   1.00 47.44  ? 87  GLN A O     1 
ATOM   1003 C CB    . GLN B 2 86  ? 41.538 14.060  7.949   1.00 60.93  ? 87  GLN A CB    1 
ATOM   1004 C CG    . GLN B 2 86  ? 42.560 14.632  6.972   1.00 90.30  ? 87  GLN A CG    1 
ATOM   1005 C CD    . GLN B 2 86  ? 41.983 15.791  6.177   1.00 100.00 ? 87  GLN A CD    1 
ATOM   1006 O OE1   . GLN B 2 86  ? 41.667 15.647  4.977   1.00 100.00 ? 87  GLN A OE1   1 
ATOM   1007 N NE2   . GLN B 2 86  ? 41.732 16.929  6.862   1.00 100.00 ? 87  GLN A NE2   1 
ATOM   1008 N N     . LYS B 2 87  ? 38.738 13.660  5.701   1.00 44.16  ? 88  LYS A N     1 
ATOM   1009 C CA    . LYS B 2 87  ? 37.582 14.252  5.053   1.00 42.10  ? 88  LYS A CA    1 
ATOM   1010 C C     . LYS B 2 87  ? 36.429 13.304  4.993   1.00 38.73  ? 88  LYS A C     1 
ATOM   1011 O O     . LYS B 2 87  ? 35.545 13.446  4.137   1.00 42.54  ? 88  LYS A O     1 
ATOM   1012 C CB    . LYS B 2 87  ? 37.945 14.699  3.632   1.00 44.19  ? 88  LYS A CB    1 
ATOM   1013 C CG    . LYS B 2 87  ? 37.890 16.234  3.411   1.00 48.81  ? 88  LYS A CG    1 
ATOM   1014 C CD    . LYS B 2 87  ? 39.031 16.945  4.131   1.00 79.41  ? 88  LYS A CD    1 
ATOM   1015 C CE    . LYS B 2 87  ? 39.579 18.137  3.330   1.00 100.00 ? 88  LYS A CE    1 
ATOM   1016 N NZ    . LYS B 2 87  ? 39.275 19.463  3.996   1.00 100.00 ? 88  LYS A NZ    1 
ATOM   1017 N N     . GLY B 2 88  ? 36.437 12.321  5.878   1.00 31.17  ? 89  GLY A N     1 
ATOM   1018 C CA    . GLY B 2 88  ? 35.328 11.366  5.904   1.00 34.89  ? 89  GLY A CA    1 
ATOM   1019 C C     . GLY B 2 88  ? 35.171 10.250  4.866   1.00 36.78  ? 89  GLY A C     1 
ATOM   1020 O O     . GLY B 2 88  ? 34.282 9.388   5.014   1.00 46.78  ? 89  GLY A O     1 
ATOM   1021 N N     . TYR B 2 89  ? 36.012 10.239  3.839   1.00 22.93  ? 90  TYR A N     1 
ATOM   1022 C CA    . TYR B 2 89  ? 35.952 9.169   2.846   1.00 22.33  ? 90  TYR A CA    1 
ATOM   1023 C C     . TYR B 2 89  ? 36.498 7.744   3.224   1.00 30.95  ? 90  TYR A C     1 
ATOM   1024 O O     . TYR B 2 89  ? 36.969 7.487   4.315   1.00 31.32  ? 90  TYR A O     1 
ATOM   1025 C CB    . TYR B 2 89  ? 36.390 9.629   1.508   1.00 22.48  ? 90  TYR A CB    1 
ATOM   1026 C CG    . TYR B 2 89  ? 35.456 10.648  1.017   1.00 37.03  ? 90  TYR A CG    1 
ATOM   1027 C CD1   . TYR B 2 89  ? 35.380 11.909  1.592   1.00 41.23  ? 90  TYR A CD1   1 
ATOM   1028 C CD2   . TYR B 2 89  ? 34.601 10.343  -0.014  1.00 45.82  ? 90  TYR A CD2   1 
ATOM   1029 C CE1   . TYR B 2 89  ? 34.486 12.848  1.098   1.00 46.82  ? 90  TYR A CE1   1 
ATOM   1030 C CE2   . TYR B 2 89  ? 33.700 11.250  -0.498  1.00 46.39  ? 90  TYR A CE2   1 
ATOM   1031 C CZ    . TYR B 2 89  ? 33.641 12.482  0.046   1.00 46.46  ? 90  TYR A CZ    1 
ATOM   1032 O OH    . TYR B 2 89  ? 32.718 13.325  -0.490  1.00 50.98  ? 90  TYR A OH    1 
ATOM   1033 N N     . THR B 2 90  ? 36.357 6.814   2.309   1.00 30.43  ? 91  THR A N     1 
ATOM   1034 C CA    . THR B 2 90  ? 36.742 5.434   2.541   1.00 24.94  ? 91  THR A CA    1 
ATOM   1035 C C     . THR B 2 90  ? 37.463 4.970   1.294   1.00 34.25  ? 91  THR A C     1 
ATOM   1036 O O     . THR B 2 90  ? 37.026 5.172   0.111   1.00 28.42  ? 91  THR A O     1 
ATOM   1037 C CB    . THR B 2 90  ? 35.478 4.594   2.773   1.00 23.43  ? 91  THR A CB    1 
ATOM   1038 O OG1   . THR B 2 90  ? 35.653 3.812   3.952   1.00 13.83  ? 91  THR A OG1   1 
ATOM   1039 C CG2   . THR B 2 90  ? 35.178 3.695   1.597   1.00 27.51  ? 91  THR A CG2   1 
ATOM   1040 N N     . LEU B 2 91  ? 38.608 4.367   1.520   1.00 27.10  ? 92  LEU A N     1 
ATOM   1041 C CA    . LEU B 2 91  ? 39.350 3.979   0.360   1.00 22.43  ? 92  LEU A CA    1 
ATOM   1042 C C     . LEU B 2 91  ? 39.227 2.552   -0.144  1.00 28.95  ? 92  LEU A C     1 
ATOM   1043 O O     . LEU B 2 91  ? 39.344 1.555   0.627   1.00 26.19  ? 92  LEU A O     1 
ATOM   1044 C CB    . LEU B 2 91  ? 40.789 4.502   0.454   1.00 19.94  ? 92  LEU A CB    1 
ATOM   1045 C CG    . LEU B 2 91  ? 41.697 4.799   -0.727  1.00 29.76  ? 92  LEU A CG    1 
ATOM   1046 C CD1   . LEU B 2 91  ? 42.541 3.541   -0.777  1.00 39.27  ? 92  LEU A CD1   1 
ATOM   1047 C CD2   . LEU B 2 91  ? 41.002 5.028   -2.072  1.00 24.32  ? 92  LEU A CD2   1 
ATOM   1048 N N     . ILE B 2 92  ? 38.987 2.468   -1.442  1.00 17.34  ? 93  ILE A N     1 
ATOM   1049 C CA    . ILE B 2 92  ? 38.947 1.208   -2.020  1.00 23.01  ? 93  ILE A CA    1 
ATOM   1050 C C     . ILE B 2 92  ? 40.178 1.142   -2.873  1.00 36.38  ? 93  ILE A C     1 
ATOM   1051 O O     . ILE B 2 92  ? 40.301 1.820   -3.909  1.00 34.79  ? 93  ILE A O     1 
ATOM   1052 C CB    . ILE B 2 92  ? 37.757 0.911   -2.799  1.00 28.68  ? 93  ILE A CB    1 
ATOM   1053 C CG1   . ILE B 2 92  ? 36.540 1.177   -1.912  1.00 31.88  ? 93  ILE A CG1   1 
ATOM   1054 C CG2   . ILE B 2 92  ? 37.835 -0.577  -3.288  1.00 15.58  ? 93  ILE A CG2   1 
ATOM   1055 C CD1   . ILE B 2 92  ? 35.231 0.789   -2.615  1.00 45.60  ? 93  ILE A CD1   1 
ATOM   1056 N N     . LEU B 2 93  ? 41.095 0.312   -2.404  1.00 36.49  ? 94  LEU A N     1 
ATOM   1057 C CA    . LEU B 2 93  ? 42.331 0.099   -3.090  1.00 39.99  ? 94  LEU A CA    1 
ATOM   1058 C C     . LEU B 2 93  ? 42.170 -0.978  -4.151  1.00 34.23  ? 94  LEU A C     1 
ATOM   1059 O O     . LEU B 2 93  ? 41.588 -1.995  -3.899  1.00 38.98  ? 94  LEU A O     1 
ATOM   1060 C CB    . LEU B 2 93  ? 43.378 -0.405  -2.096  1.00 42.34  ? 94  LEU A CB    1 
ATOM   1061 C CG    . LEU B 2 93  ? 44.720 -0.498  -2.858  1.00 45.00  ? 94  LEU A CG    1 
ATOM   1062 C CD1   . LEU B 2 93  ? 45.050 0.817   -3.598  1.00 36.27  ? 94  LEU A CD1   1 
ATOM   1063 C CD2   . LEU B 2 93  ? 45.831 -0.877  -1.892  1.00 52.19  ? 94  LEU A CD2   1 
ATOM   1064 N N     . GLY B 2 94  ? 42.714 -0.788  -5.334  1.00 30.15  ? 95  GLY A N     1 
ATOM   1065 C CA    . GLY B 2 94  ? 42.613 -1.845  -6.368  1.00 30.77  ? 95  GLY A CA    1 
ATOM   1066 C C     . GLY B 2 94  ? 43.727 -1.758  -7.427  1.00 34.23  ? 95  GLY A C     1 
ATOM   1067 O O     . GLY B 2 94  ? 43.793 -0.764  -8.187  1.00 29.46  ? 95  GLY A O     1 
ATOM   1068 N N     . ASN B 2 95  ? 44.591 -2.771  -7.471  1.00 39.51  ? 96  ASN A N     1 
ATOM   1069 C CA    . ASN B 2 95  ? 45.708 -2.777  -8.433  1.00 42.09  ? 96  ASN A CA    1 
ATOM   1070 C C     . ASN B 2 95  ? 45.376 -3.607  -9.663  1.00 51.85  ? 96  ASN A C     1 
ATOM   1071 O O     . ASN B 2 95  ? 44.949 -4.746  -9.525  1.00 57.95  ? 96  ASN A O     1 
ATOM   1072 C CB    . ASN B 2 95  ? 46.954 -3.370  -7.797  1.00 34.15  ? 96  ASN A CB    1 
ATOM   1073 C CG    . ASN B 2 95  ? 47.162 -2.912  -6.399  1.00 51.48  ? 96  ASN A CG    1 
ATOM   1074 O OD1   . ASN B 2 95  ? 47.324 -3.729  -5.492  1.00 37.90  ? 96  ASN A OD1   1 
ATOM   1075 N ND2   . ASN B 2 95  ? 47.169 -1.599  -6.202  1.00 42.51  ? 96  ASN A ND2   1 
ATOM   1076 N N     . ALA B 2 96  ? 45.590 -3.036  -10.853 1.00 50.33  ? 97  ALA A N     1 
ATOM   1077 C CA    . ALA B 2 96  ? 45.332 -3.686  -12.170 1.00 57.15  ? 97  ALA A CA    1 
ATOM   1078 C C     . ALA B 2 96  ? 46.560 -4.294  -12.819 1.00 66.35  ? 97  ALA A C     1 
ATOM   1079 O O     . ALA B 2 96  ? 46.458 -5.040  -13.833 1.00 59.19  ? 97  ALA A O     1 
ATOM   1080 C CB    . ALA B 2 96  ? 44.711 -2.712  -13.155 1.00 61.75  ? 97  ALA A CB    1 
ATOM   1081 N N     . TRP B 2 97  ? 47.716 -3.939  -12.264 1.00 66.51  ? 98  TRP A N     1 
ATOM   1082 C CA    . TRP B 2 97  ? 48.956 -4.474  -12.746 1.00 68.32  ? 98  TRP A CA    1 
ATOM   1083 C C     . TRP B 2 97  ? 49.177 -4.241  -14.193 1.00 64.69  ? 98  TRP A C     1 
ATOM   1084 O O     . TRP B 2 97  ? 50.002 -4.895  -14.782 1.00 65.30  ? 98  TRP A O     1 
ATOM   1085 C CB    . TRP B 2 97  ? 48.881 -5.975  -12.537 1.00 72.29  ? 98  TRP A CB    1 
ATOM   1086 C CG    . TRP B 2 97  ? 49.024 -6.267  -11.085 1.00 76.46  ? 98  TRP A CG    1 
ATOM   1087 C CD1   . TRP B 2 97  ? 48.051 -6.659  -10.198 1.00 80.27  ? 98  TRP A CD1   1 
ATOM   1088 C CD2   . TRP B 2 97  ? 50.208 -6.099  -10.348 1.00 77.40  ? 98  TRP A CD2   1 
ATOM   1089 N NE1   . TRP B 2 97  ? 48.592 -6.775  -8.938  1.00 81.83  ? 98  TRP A NE1   1 
ATOM   1090 C CE2   . TRP B 2 97  ? 49.920 -6.433  -9.003  1.00 84.16  ? 98  TRP A CE2   1 
ATOM   1091 C CE3   . TRP B 2 97  ? 51.506 -5.715  -10.694 1.00 79.18  ? 98  TRP A CE3   1 
ATOM   1092 C CZ2   . TRP B 2 97  ? 50.891 -6.388  -8.000  1.00 84.15  ? 98  TRP A CZ2   1 
ATOM   1093 C CZ3   . TRP B 2 97  ? 52.467 -5.679  -9.703  1.00 83.38  ? 98  TRP A CZ3   1 
ATOM   1094 C CH2   . TRP B 2 97  ? 52.155 -6.012  -8.368  1.00 84.18  ? 98  TRP A CH2   1 
ATOM   1095 N N     . ASN B 2 98  ? 48.420 -3.334  -14.781 1.00 63.36  ? 99  ASN A N     1 
ATOM   1096 C CA    . ASN B 2 98  ? 48.542 -3.045  -16.208 1.00 62.49  ? 99  ASN A CA    1 
ATOM   1097 C C     . ASN B 2 98  ? 47.831 -4.128  -17.060 1.00 62.15  ? 99  ASN A C     1 
ATOM   1098 O O     . ASN B 2 98  ? 48.146 -4.339  -18.219 1.00 55.03  ? 99  ASN A O     1 
ATOM   1099 C CB    . ASN B 2 98  ? 50.014 -2.814  -16.631 1.00 56.87  ? 99  ASN A CB    1 
ATOM   1100 C CG    . ASN B 2 98  ? 50.421 -1.339  -16.577 1.00 96.48  ? 99  ASN A CG    1 
ATOM   1101 O OD1   . ASN B 2 98  ? 51.302 -0.964  -15.814 1.00 74.48  ? 99  ASN A OD1   1 
ATOM   1102 N ND2   . ASN B 2 98  ? 49.765 -0.505  -17.397 1.00 100.00 ? 99  ASN A ND2   1 
ATOM   1103 N N     . ASN B 2 99  ? 46.860 -4.814  -16.461 1.00 64.54  ? 100 ASN A N     1 
ATOM   1104 C CA    . ASN B 2 99  ? 46.098 -5.870  -17.164 1.00 60.43  ? 100 ASN A CA    1 
ATOM   1105 C C     . ASN B 2 99  ? 44.736 -5.339  -17.525 1.00 54.58  ? 100 ASN A C     1 
ATOM   1106 O O     . ASN B 2 99  ? 43.869 -5.178  -16.656 1.00 49.10  ? 100 ASN A O     1 
ATOM   1107 C CB    . ASN B 2 99  ? 45.907 -7.078  -16.258 1.00 41.29  ? 100 ASN A CB    1 
ATOM   1108 C CG    . ASN B 2 99  ? 45.494 -8.289  -17.029 1.00 95.26  ? 100 ASN A CG    1 
ATOM   1109 O OD1   . ASN B 2 99  ? 46.255 -8.752  -17.848 1.00 100.00 ? 100 ASN A OD1   1 
ATOM   1110 N ND2   . ASN B 2 99  ? 44.240 -8.654  -16.840 1.00 93.41  ? 100 ASN A ND2   1 
ATOM   1111 N N     . LEU B 2 100 ? 44.562 -5.032  -18.806 1.00 45.39  ? 101 LEU A N     1 
ATOM   1112 C CA    . LEU B 2 100 ? 43.335 -4.464  -19.317 1.00 39.82  ? 101 LEU A CA    1 
ATOM   1113 C C     . LEU B 2 100 ? 42.103 -5.093  -18.750 1.00 41.64  ? 101 LEU A C     1 
ATOM   1114 O O     . LEU B 2 100 ? 41.136 -4.422  -18.351 1.00 35.80  ? 101 LEU A O     1 
ATOM   1115 C CB    . LEU B 2 100 ? 43.302 -4.618  -20.808 1.00 39.74  ? 101 LEU A CB    1 
ATOM   1116 C CG    . LEU B 2 100 ? 42.468 -3.567  -21.508 1.00 55.57  ? 101 LEU A CG    1 
ATOM   1117 C CD1   . LEU B 2 100 ? 42.049 -2.523  -20.477 1.00 61.62  ? 101 LEU A CD1   1 
ATOM   1118 C CD2   . LEU B 2 100 ? 43.294 -2.913  -22.604 1.00 66.20  ? 101 LEU A CD2   1 
ATOM   1119 N N     . GLU B 2 101 ? 42.164 -6.409  -18.700 1.00 42.89  ? 102 GLU A N     1 
ATOM   1120 C CA    . GLU B 2 101 ? 41.072 -7.197  -18.199 1.00 44.64  ? 102 GLU A CA    1 
ATOM   1121 C C     . GLU B 2 101 ? 40.879 -6.804  -16.760 1.00 40.39  ? 102 GLU A C     1 
ATOM   1122 O O     . GLU B 2 101 ? 39.798 -6.332  -16.364 1.00 42.46  ? 102 GLU A O     1 
ATOM   1123 C CB    . GLU B 2 101 ? 41.422 -8.670  -18.340 1.00 49.04  ? 102 GLU A CB    1 
ATOM   1124 C CG    . GLU B 2 101 ? 41.478 -9.148  -19.797 1.00 94.09  ? 102 GLU A CG    1 
ATOM   1125 C CD    . GLU B 2 101 ? 40.151 -8.925  -20.597 1.00 100.00 ? 102 GLU A CD    1 
ATOM   1126 O OE1   . GLU B 2 101 ? 39.037 -9.027  -19.984 1.00 100.00 ? 102 GLU A OE1   1 
ATOM   1127 O OE2   . GLU B 2 101 ? 40.231 -8.728  -21.854 1.00 100.00 ? 102 GLU A OE2   1 
ATOM   1128 N N     . LYS B 2 102 ? 41.952 -6.979  -16.005 1.00 23.20  ? 103 LYS A N     1 
ATOM   1129 C CA    . LYS B 2 102 ? 41.950 -6.621  -14.611 1.00 22.58  ? 103 LYS A CA    1 
ATOM   1130 C C     . LYS B 2 102 ? 41.470 -5.137  -14.506 1.00 24.60  ? 103 LYS A C     1 
ATOM   1131 O O     . LYS B 2 102 ? 40.840 -4.703  -13.557 1.00 18.57  ? 103 LYS A O     1 
ATOM   1132 C CB    . LYS B 2 102 ? 43.363 -6.749  -14.080 1.00 26.16  ? 103 LYS A CB    1 
ATOM   1133 C CG    . LYS B 2 102 ? 43.410 -6.840  -12.613 1.00 34.73  ? 103 LYS A CG    1 
ATOM   1134 C CD    . LYS B 2 102 ? 43.422 -8.264  -12.238 1.00 63.28  ? 103 LYS A CD    1 
ATOM   1135 C CE    . LYS B 2 102 ? 44.738 -8.633  -11.650 1.00 94.00  ? 103 LYS A CE    1 
ATOM   1136 N NZ    . LYS B 2 102 ? 45.792 -8.434  -12.696 1.00 100.00 ? 103 LYS A NZ    1 
ATOM   1137 N N     . GLN B 2 103 ? 41.751 -4.378  -15.536 1.00 25.63  ? 104 GLN A N     1 
ATOM   1138 C CA    . GLN B 2 103 ? 41.332 -3.017  -15.510 1.00 30.73  ? 104 GLN A CA    1 
ATOM   1139 C C     . GLN B 2 103 ? 39.866 -2.885  -15.770 1.00 32.89  ? 104 GLN A C     1 
ATOM   1140 O O     . GLN B 2 103 ? 39.182 -2.142  -15.032 1.00 31.12  ? 104 GLN A O     1 
ATOM   1141 C CB    . GLN B 2 103 ? 42.210 -2.176  -16.395 1.00 37.70  ? 104 GLN A CB    1 
ATOM   1142 C CG    . GLN B 2 103 ? 43.670 -2.137  -15.903 1.00 39.91  ? 104 GLN A CG    1 
ATOM   1143 C CD    . GLN B 2 103 ? 44.528 -1.583  -16.941 1.00 54.17  ? 104 GLN A CD    1 
ATOM   1144 O OE1   . GLN B 2 103 ? 45.516 -0.894  -16.685 1.00 92.65  ? 104 GLN A OE1   1 
ATOM   1145 N NE2   . GLN B 2 103 ? 44.091 -1.759  -18.155 1.00 32.34  ? 104 GLN A NE2   1 
ATOM   1146 N N     . ARG B 2 104 ? 39.320 -3.597  -16.764 1.00 34.88  ? 105 ARG A N     1 
ATOM   1147 C CA    . ARG B 2 104 ? 37.845 -3.449  -16.918 1.00 38.26  ? 105 ARG A CA    1 
ATOM   1148 C C     . ARG B 2 104 ? 37.213 -4.018  -15.638 1.00 39.90  ? 105 ARG A C     1 
ATOM   1149 O O     . ARG B 2 104 ? 36.224 -3.497  -15.089 1.00 33.59  ? 105 ARG A O     1 
ATOM   1150 C CB    . ARG B 2 104 ? 37.244 -4.091  -18.166 1.00 30.96  ? 105 ARG A CB    1 
ATOM   1151 C CG    . ARG B 2 104 ? 37.267 -5.633  -18.233 1.00 67.26  ? 105 ARG A CG    1 
ATOM   1152 C CD    . ARG B 2 104 ? 36.243 -6.147  -19.322 1.00 98.76  ? 105 ARG A CD    1 
ATOM   1153 N NE    . ARG B 2 104 ? 36.738 -6.267  -20.713 1.00 97.50  ? 105 ARG A NE    1 
ATOM   1154 C CZ    . ARG B 2 104 ? 36.681 -5.313  -21.656 1.00 100.00 ? 105 ARG A CZ    1 
ATOM   1155 N NH1   . ARG B 2 104 ? 36.169 -4.109  -21.396 1.00 100.00 ? 105 ARG A NH1   1 
ATOM   1156 N NH2   . ARG B 2 104 ? 37.154 -5.571  -22.877 1.00 100.00 ? 105 ARG A NH2   1 
ATOM   1157 N N     . ALA B 2 105 ? 37.849 -5.050  -15.137 1.00 32.13  ? 106 ALA A N     1 
ATOM   1158 C CA    . ALA B 2 105 ? 37.376 -5.658  -13.951 1.00 33.66  ? 106 ALA A CA    1 
ATOM   1159 C C     . ALA B 2 105 ? 37.119 -4.689  -12.785 1.00 42.26  ? 106 ALA A C     1 
ATOM   1160 O O     . ALA B 2 105 ? 36.005 -4.511  -12.274 1.00 42.27  ? 106 ALA A O     1 
ATOM   1161 C CB    . ALA B 2 105 ? 38.359 -6.724  -13.539 1.00 33.49  ? 106 ALA A CB    1 
ATOM   1162 N N     . TYR B 2 106 ? 38.171 -4.071  -12.351 1.00 39.72  ? 107 TYR A N     1 
ATOM   1163 C CA    . TYR B 2 106 ? 38.040 -3.232  -11.222 1.00 39.92  ? 107 TYR A CA    1 
ATOM   1164 C C     . TYR B 2 106 ? 37.106 -2.102  -11.451 1.00 32.24  ? 107 TYR A C     1 
ATOM   1165 O O     . TYR B 2 106 ? 36.267 -1.798  -10.619 1.00 23.85  ? 107 TYR A O     1 
ATOM   1166 C CB    . TYR B 2 106 ? 39.429 -2.729  -10.841 1.00 40.65  ? 107 TYR A CB    1 
ATOM   1167 C CG    . TYR B 2 106 ? 40.046 -3.546  -9.752  1.00 42.54  ? 107 TYR A CG    1 
ATOM   1168 C CD1   . TYR B 2 106 ? 39.418 -3.667  -8.534  1.00 44.15  ? 107 TYR A CD1   1 
ATOM   1169 C CD2   . TYR B 2 106 ? 41.263 -4.201  -9.932  1.00 46.40  ? 107 TYR A CD2   1 
ATOM   1170 C CE1   . TYR B 2 106 ? 39.972 -4.402  -7.510  1.00 48.93  ? 107 TYR A CE1   1 
ATOM   1171 C CE2   . TYR B 2 106 ? 41.837 -4.939  -8.908  1.00 49.22  ? 107 TYR A CE2   1 
ATOM   1172 C CZ    . TYR B 2 106 ? 41.178 -5.034  -7.695  1.00 64.96  ? 107 TYR A CZ    1 
ATOM   1173 O OH    . TYR B 2 106 ? 41.674 -5.764  -6.653  1.00 76.71  ? 107 TYR A OH    1 
ATOM   1174 N N     . LEU B 2 107 ? 37.304 -1.483  -12.595 1.00 28.32  ? 108 LEU A N     1 
ATOM   1175 C CA    . LEU B 2 107 ? 36.573 -0.325  -12.977 1.00 31.21  ? 108 LEU A CA    1 
ATOM   1176 C C     . LEU B 2 107 ? 35.103 -0.595  -12.784 1.00 42.05  ? 108 LEU A C     1 
ATOM   1177 O O     . LEU B 2 107 ? 34.422 0.091   -12.016 1.00 48.15  ? 108 LEU A O     1 
ATOM   1178 C CB    . LEU B 2 107 ? 36.968 0.062   -14.392 1.00 31.87  ? 108 LEU A CB    1 
ATOM   1179 C CG    . LEU B 2 107 ? 37.438 1.497   -14.716 1.00 36.09  ? 108 LEU A CG    1 
ATOM   1180 C CD1   . LEU B 2 107 ? 38.314 2.116   -13.672 1.00 34.54  ? 108 LEU A CD1   1 
ATOM   1181 C CD2   . LEU B 2 107 ? 38.007 1.683   -16.138 1.00 28.50  ? 108 LEU A CD2   1 
ATOM   1182 N N     . SER B 2 108 ? 34.635 -1.672  -13.371 1.00 36.71  ? 109 SER A N     1 
ATOM   1183 C CA    . SER B 2 108 ? 33.236 -2.035  -13.191 1.00 34.68  ? 109 SER A CA    1 
ATOM   1184 C C     . SER B 2 108 ? 32.767 -2.245  -11.728 1.00 32.67  ? 109 SER A C     1 
ATOM   1185 O O     . SER B 2 108 ? 31.763 -1.680  -11.330 1.00 34.88  ? 109 SER A O     1 
ATOM   1186 C CB    . SER B 2 108 ? 32.856 -3.216  -14.076 1.00 38.70  ? 109 SER A CB    1 
ATOM   1187 O OG    . SER B 2 108 ? 32.368 -4.286  -13.279 1.00 85.03  ? 109 SER A OG    1 
ATOM   1188 N N     . MET B 2 109 ? 33.470 -3.071  -10.956 1.00 27.29  ? 110 MET A N     1 
ATOM   1189 C CA    . MET B 2 109 ? 33.105 -3.326  -9.594  1.00 29.66  ? 110 MET A CA    1 
ATOM   1190 C C     . MET B 2 109 ? 32.975 -2.011  -8.865  1.00 37.18  ? 110 MET A C     1 
ATOM   1191 O O     . MET B 2 109 ? 32.212 -1.866  -7.918  1.00 32.24  ? 110 MET A O     1 
ATOM   1192 C CB    . MET B 2 109 ? 34.235 -4.062  -8.925  1.00 38.76  ? 110 MET A CB    1 
ATOM   1193 C CG    . MET B 2 109 ? 34.681 -5.320  -9.626  1.00 56.66  ? 110 MET A CG    1 
ATOM   1194 S SD    . MET B 2 109 ? 35.521 -6.428  -8.434  1.00 71.59  ? 110 MET A SD    1 
ATOM   1195 C CE    . MET B 2 109 ? 34.164 -6.736  -7.267  1.00 67.91  ? 110 MET A CE    1 
ATOM   1196 N N     . MET B 2 110 ? 33.760 -1.044  -9.291  1.00 40.77  ? 111 MET A N     1 
ATOM   1197 C CA    . MET B 2 110 ? 33.747 0.214   -8.609  1.00 39.89  ? 111 MET A CA    1 
ATOM   1198 C C     . MET B 2 110 ? 32.462 1.003   -8.770  1.00 42.05  ? 111 MET A C     1 
ATOM   1199 O O     . MET B 2 110 ? 31.830 1.470   -7.776  1.00 34.00  ? 111 MET A O     1 
ATOM   1200 C CB    . MET B 2 110 ? 34.982 0.954   -8.993  1.00 41.65  ? 111 MET A CB    1 
ATOM   1201 C CG    . MET B 2 110 ? 36.153 0.127   -8.532  1.00 48.20  ? 111 MET A CG    1 
ATOM   1202 S SD    . MET B 2 110 ? 37.688 1.065   -8.552  1.00 63.01  ? 111 MET A SD    1 
ATOM   1203 C CE    . MET B 2 110 ? 38.203 0.952   -6.819  1.00 58.82  ? 111 MET A CE    1 
ATOM   1204 N N     . ALA B 2 111 ? 32.081 1.106   -10.039 1.00 34.37  ? 112 ALA A N     1 
ATOM   1205 C CA    . ALA B 2 111 ? 30.877 1.795   -10.473 1.00 34.00  ? 112 ALA A CA    1 
ATOM   1206 C C     . ALA B 2 111 ? 29.696 1.216   -9.700  1.00 38.51  ? 112 ALA A C     1 
ATOM   1207 O O     . ALA B 2 111 ? 28.902 1.936   -9.033  1.00 37.95  ? 112 ALA A O     1 
ATOM   1208 C CB    . ALA B 2 111 ? 30.697 1.534   -11.959 1.00 34.18  ? 112 ALA A CB    1 
ATOM   1209 N N     . GLN B 2 112 ? 29.633 -0.105  -9.806  1.00 29.64  ? 113 GLN A N     1 
ATOM   1210 C CA    . GLN B 2 112 ? 28.646 -0.923  -9.161  1.00 29.31  ? 113 GLN A CA    1 
ATOM   1211 C C     . GLN B 2 112 ? 28.607 -0.599  -7.710  1.00 27.65  ? 113 GLN A C     1 
ATOM   1212 O O     . GLN B 2 112 ? 27.532 -0.382  -7.159  1.00 34.24  ? 113 GLN A O     1 
ATOM   1213 C CB    . GLN B 2 112 ? 28.976 -2.382  -9.404  1.00 31.85  ? 113 GLN A CB    1 
ATOM   1214 C CG    . GLN B 2 112 ? 28.948 -2.714  -10.939 1.00 43.13  ? 113 GLN A CG    1 
ATOM   1215 C CD    . GLN B 2 112 ? 28.755 -4.203  -11.249 1.00 75.42  ? 113 GLN A CD    1 
ATOM   1216 O OE1   . GLN B 2 112 ? 28.908 -4.628  -12.391 1.00 93.66  ? 113 GLN A OE1   1 
ATOM   1217 N NE2   . GLN B 2 112 ? 28.417 -5.002  -10.224 1.00 51.61  ? 113 GLN A NE2   1 
ATOM   1218 N N     . LYS B 2 113 ? 29.778 -0.549  -7.100  1.00 19.61  ? 114 LYS A N     1 
ATOM   1219 C CA    . LYS B 2 113 ? 29.868 -0.200  -5.686  1.00 23.96  ? 114 LYS A CA    1 
ATOM   1220 C C     . LYS B 2 113 ? 29.582 1.305   -5.540  1.00 30.69  ? 114 LYS A C     1 
ATOM   1221 O O     . LYS B 2 113 ? 29.493 1.833   -4.424  1.00 33.42  ? 114 LYS A O     1 
ATOM   1222 C CB    . LYS B 2 113 ? 31.203 -0.618  -5.049  1.00 30.54  ? 114 LYS A CB    1 
ATOM   1223 C CG    . LYS B 2 113 ? 31.344 -2.121  -4.839  1.00 43.42  ? 114 LYS A CG    1 
ATOM   1224 C CD    . LYS B 2 113 ? 31.398 -2.570  -3.364  1.00 50.09  ? 114 LYS A CD    1 
ATOM   1225 C CE    . LYS B 2 113 ? 31.519 -4.124  -3.271  1.00 90.04  ? 114 LYS A CE    1 
ATOM   1226 N NZ    . LYS B 2 113 ? 32.657 -4.652  -2.439  1.00 83.92  ? 114 LYS A NZ    1 
ATOM   1227 N N     . ARG B 2 114 ? 29.414 1.991   -6.671  1.00 20.58  ? 115 ARG A N     1 
ATOM   1228 C CA    . ARG B 2 114 ? 29.032 3.384   -6.631  1.00 27.27  ? 115 ARG A CA    1 
ATOM   1229 C C     . ARG B 2 114 ? 29.897 4.349   -5.826  1.00 44.64  ? 115 ARG A C     1 
ATOM   1230 O O     . ARG B 2 114 ? 29.413 5.172   -5.034  1.00 40.87  ? 115 ARG A O     1 
ATOM   1231 C CB    . ARG B 2 114 ? 27.570 3.471   -6.149  1.00 19.19  ? 115 ARG A CB    1 
ATOM   1232 C CG    . ARG B 2 114 ? 26.579 2.807   -7.155  1.00 13.35  ? 115 ARG A CG    1 
ATOM   1233 C CD    . ARG B 2 114 ? 26.066 3.716   -8.282  1.00 21.07  ? 115 ARG A CD    1 
ATOM   1234 N NE    . ARG B 2 114 ? 24.956 3.123   -9.061  1.00 61.62  ? 115 ARG A NE    1 
ATOM   1235 C CZ    . ARG B 2 114 ? 25.080 2.076   -9.884  1.00 82.05  ? 115 ARG A CZ    1 
ATOM   1236 N NH1   . ARG B 2 114 ? 26.265 1.495   -10.053 1.00 70.27  ? 115 ARG A NH1   1 
ATOM   1237 N NH2   . ARG B 2 114 ? 24.025 1.603   -10.541 1.00 62.62  ? 115 ARG A NH2   1 
ATOM   1238 N N     . VAL B 2 115 ? 31.193 4.245   -6.049  1.00 44.82  ? 116 VAL A N     1 
ATOM   1239 C CA    . VAL B 2 115 ? 32.168 5.097   -5.401  1.00 42.69  ? 116 VAL A CA    1 
ATOM   1240 C C     . VAL B 2 115 ? 31.912 6.533   -5.836  1.00 43.52  ? 116 VAL A C     1 
ATOM   1241 O O     . VAL B 2 115 ? 31.587 6.782   -7.009  1.00 34.60  ? 116 VAL A O     1 
ATOM   1242 C CB    . VAL B 2 115 ? 33.589 4.680   -5.824  1.00 43.31  ? 116 VAL A CB    1 
ATOM   1243 C CG1   . VAL B 2 115 ? 34.159 3.725   -4.787  1.00 43.60  ? 116 VAL A CG1   1 
ATOM   1244 C CG2   . VAL B 2 115 ? 33.569 3.996   -7.186  1.00 40.62  ? 116 VAL A CG2   1 
ATOM   1245 N N     . ASP B 2 116 ? 32.010 7.473   -4.893  1.00 41.32  ? 117 ASP A N     1 
ATOM   1246 C CA    . ASP B 2 116 ? 31.767 8.876   -5.197  1.00 35.09  ? 117 ASP A CA    1 
ATOM   1247 C C     . ASP B 2 116 ? 32.706 9.477   -6.273  1.00 44.30  ? 117 ASP A C     1 
ATOM   1248 O O     . ASP B 2 116 ? 32.313 10.277  -7.098  1.00 46.80  ? 117 ASP A O     1 
ATOM   1249 C CB    . ASP B 2 116 ? 31.619 9.691   -3.925  1.00 33.15  ? 117 ASP A CB    1 
ATOM   1250 C CG    . ASP B 2 116 ? 30.543 9.116   -2.972  1.00 51.12  ? 117 ASP A CG    1 
ATOM   1251 O OD1   . ASP B 2 116 ? 29.477 8.627   -3.426  1.00 49.96  ? 117 ASP A OD1   1 
ATOM   1252 O OD2   . ASP B 2 116 ? 30.774 9.190   -1.753  1.00 56.53  ? 117 ASP A OD2   1 
ATOM   1253 N N     . GLY B 2 117 ? 33.941 9.031   -6.301  1.00 46.17  ? 118 GLY A N     1 
ATOM   1254 C CA    . GLY B 2 117 ? 34.888 9.516   -7.298  1.00 42.61  ? 118 GLY A CA    1 
ATOM   1255 C C     . GLY B 2 117 ? 35.911 8.390   -7.559  1.00 38.95  ? 118 GLY A C     1 
ATOM   1256 O O     . GLY B 2 117 ? 35.894 7.316   -6.878  1.00 30.55  ? 118 GLY A O     1 
ATOM   1257 N N     . LEU B 2 118 ? 36.789 8.658   -8.536  1.00 27.34  ? 119 LEU A N     1 
ATOM   1258 C CA    . LEU B 2 118 ? 37.816 7.725   -8.955  1.00 25.89  ? 119 LEU A CA    1 
ATOM   1259 C C     . LEU B 2 118 ? 39.210 8.263   -9.186  1.00 34.00  ? 119 LEU A C     1 
ATOM   1260 O O     . LEU B 2 118 ? 39.424 9.053   -10.123 1.00 36.09  ? 119 LEU A O     1 
ATOM   1261 C CB    . LEU B 2 118 ? 37.384 7.162   -10.286 1.00 25.89  ? 119 LEU A CB    1 
ATOM   1262 C CG    . LEU B 2 118 ? 37.019 5.689   -10.258 1.00 37.42  ? 119 LEU A CG    1 
ATOM   1263 C CD1   . LEU B 2 118 ? 37.561 4.998   -11.490 1.00 40.30  ? 119 LEU A CD1   1 
ATOM   1264 C CD2   . LEU B 2 118 ? 37.521 4.999   -8.982  1.00 49.15  ? 119 LEU A CD2   1 
ATOM   1265 N N     . LEU B 2 119 ? 40.162 7.793   -8.374  1.00 33.03  ? 120 LEU A N     1 
ATOM   1266 C CA    . LEU B 2 119 ? 41.617 8.146   -8.484  1.00 24.81  ? 120 LEU A CA    1 
ATOM   1267 C C     . LEU B 2 119 ? 42.229 7.091   -9.392  1.00 29.75  ? 120 LEU A C     1 
ATOM   1268 O O     . LEU B 2 119 ? 42.023 5.867   -9.189  1.00 29.85  ? 120 LEU A O     1 
ATOM   1269 C CB    . LEU B 2 119 ? 42.304 8.171   -7.110  1.00 18.53  ? 120 LEU A CB    1 
ATOM   1270 C CG    . LEU B 2 119 ? 41.929 9.565   -6.589  1.00 26.61  ? 120 LEU A CG    1 
ATOM   1271 C CD1   . LEU B 2 119 ? 42.319 9.902   -5.161  1.00 27.24  ? 120 LEU A CD1   1 
ATOM   1272 C CD2   . LEU B 2 119 ? 42.305 10.666  -7.597  1.00 18.72  ? 120 LEU A CD2   1 
ATOM   1273 N N     . VAL B 2 120 ? 42.951 7.579   -10.408 1.00 28.88  ? 121 VAL A N     1 
ATOM   1274 C CA    . VAL B 2 120 ? 43.597 6.735   -11.421 1.00 33.69  ? 121 VAL A CA    1 
ATOM   1275 C C     . VAL B 2 120 ? 45.080 6.925   -11.690 1.00 47.90  ? 121 VAL A C     1 
ATOM   1276 O O     . VAL B 2 120 ? 45.527 8.020   -12.091 1.00 48.55  ? 121 VAL A O     1 
ATOM   1277 C CB    . VAL B 2 120 ? 42.943 6.902   -12.731 1.00 39.29  ? 121 VAL A CB    1 
ATOM   1278 C CG1   . VAL B 2 120 ? 43.266 5.729   -13.635 1.00 37.05  ? 121 VAL A CG1   1 
ATOM   1279 C CG2   . VAL B 2 120 ? 41.464 7.058   -12.504 1.00 41.98  ? 121 VAL A CG2   1 
ATOM   1280 N N     . MET B 2 121 ? 45.819 5.823   -11.494 1.00 44.02  ? 122 MET A N     1 
ATOM   1281 C CA    . MET B 2 121 ? 47.268 5.735   -11.661 1.00 37.73  ? 122 MET A CA    1 
ATOM   1282 C C     . MET B 2 121 ? 47.649 4.458   -12.402 1.00 35.87  ? 122 MET A C     1 
ATOM   1283 O O     . MET B 2 121 ? 48.211 3.540   -11.822 1.00 32.16  ? 122 MET A O     1 
ATOM   1284 C CB    . MET B 2 121 ? 47.849 5.621   -10.274 1.00 40.20  ? 122 MET A CB    1 
ATOM   1285 C CG    . MET B 2 121 ? 49.292 6.006   -10.218 1.00 50.89  ? 122 MET A CG    1 
ATOM   1286 S SD    . MET B 2 121 ? 49.752 6.605   -8.614  1.00 62.13  ? 122 MET A SD    1 
ATOM   1287 C CE    . MET B 2 121 ? 48.934 5.490   -7.513  1.00 59.41  ? 122 MET A CE    1 
ATOM   1288 N N     . CYS B 2 122 ? 47.338 4.381   -13.677 1.00 37.17  ? 123 CYS A N     1 
ATOM   1289 C CA    . CYS B 2 122 ? 47.628 3.171   -14.430 1.00 42.90  ? 123 CYS A CA    1 
ATOM   1290 C C     . CYS B 2 122 ? 48.932 3.076   -15.153 1.00 46.16  ? 123 CYS A C     1 
ATOM   1291 O O     . CYS B 2 122 ? 49.182 2.146   -15.927 1.00 45.45  ? 123 CYS A O     1 
ATOM   1292 C CB    . CYS B 2 122 ? 46.453 2.820   -15.329 1.00 48.16  ? 123 CYS A CB    1 
ATOM   1293 S SG    . CYS B 2 122 ? 45.014 2.400   -14.298 1.00 52.10  ? 123 CYS A SG    1 
ATOM   1294 N N     . SER B 2 123 ? 49.789 4.040   -14.893 1.00 45.69  ? 124 SER A N     1 
ATOM   1295 C CA    . SER B 2 123 ? 51.097 4.022   -15.513 1.00 43.57  ? 124 SER A CA    1 
ATOM   1296 C C     . SER B 2 123 ? 51.002 4.142   -17.022 1.00 32.18  ? 124 SER A C     1 
ATOM   1297 O O     . SER B 2 123 ? 51.166 5.222   -17.545 1.00 28.37  ? 124 SER A O     1 
ATOM   1298 C CB    . SER B 2 123 ? 51.863 2.776   -15.092 1.00 50.00  ? 124 SER A CB    1 
ATOM   1299 O OG    . SER B 2 123 ? 52.061 2.782   -13.697 1.00 50.05  ? 124 SER A OG    1 
ATOM   1300 N N     . GLU B 2 124 ? 50.723 3.068   -17.739 1.00 22.63  ? 125 GLU A N     1 
ATOM   1301 C CA    . GLU B 2 124 ? 50.618 3.214   -19.182 1.00 26.46  ? 125 GLU A CA    1 
ATOM   1302 C C     . GLU B 2 124 ? 49.164 3.421   -19.535 1.00 39.02  ? 125 GLU A C     1 
ATOM   1303 O O     . GLU B 2 124 ? 48.278 2.961   -18.804 1.00 43.93  ? 125 GLU A O     1 
ATOM   1304 C CB    . GLU B 2 124 ? 51.214 2.000   -19.877 1.00 29.65  ? 125 GLU A CB    1 
ATOM   1305 C CG    . GLU B 2 124 ? 52.393 1.448   -19.099 1.00 34.84  ? 125 GLU A CG    1 
ATOM   1306 C CD    . GLU B 2 124 ? 53.022 0.330   -19.819 1.00 66.99  ? 125 GLU A CD    1 
ATOM   1307 O OE1   . GLU B 2 124 ? 52.372 -0.203  -20.739 1.00 92.31  ? 125 GLU A OE1   1 
ATOM   1308 O OE2   . GLU B 2 124 ? 54.175 -0.005  -19.513 1.00 55.04  ? 125 GLU A OE2   1 
ATOM   1309 N N     . TYR B 2 125 ? 48.927 4.124   -20.637 1.00 37.61  ? 126 TYR A N     1 
ATOM   1310 C CA    . TYR B 2 125 ? 47.570 4.427   -21.099 1.00 39.28  ? 126 TYR A CA    1 
ATOM   1311 C C     . TYR B 2 125 ? 47.379 4.148   -22.590 1.00 48.38  ? 126 TYR A C     1 
ATOM   1312 O O     . TYR B 2 125 ? 47.579 5.001   -23.438 1.00 55.70  ? 126 TYR A O     1 
ATOM   1313 C CB    . TYR B 2 125 ? 47.239 5.881   -20.808 1.00 36.86  ? 126 TYR A CB    1 
ATOM   1314 C CG    . TYR B 2 125 ? 47.049 6.110   -19.365 1.00 43.20  ? 126 TYR A CG    1 
ATOM   1315 C CD1   . TYR B 2 125 ? 48.094 6.369   -18.569 1.00 41.12  ? 126 TYR A CD1   1 
ATOM   1316 C CD2   . TYR B 2 125 ? 45.818 5.967   -18.781 1.00 54.68  ? 126 TYR A CD2   1 
ATOM   1317 C CE1   . TYR B 2 125 ? 47.936 6.589   -17.209 1.00 38.29  ? 126 TYR A CE1   1 
ATOM   1318 C CE2   . TYR B 2 125 ? 45.655 6.182   -17.417 1.00 56.75  ? 126 TYR A CE2   1 
ATOM   1319 C CZ    . TYR B 2 125 ? 46.720 6.460   -16.659 1.00 45.93  ? 126 TYR A CZ    1 
ATOM   1320 O OH    . TYR B 2 125 ? 46.566 6.610   -15.336 1.00 58.05  ? 126 TYR A OH    1 
ATOM   1321 N N     . PRO B 2 126 ? 46.985 2.951   -22.918 1.00 38.28  ? 127 PRO A N     1 
ATOM   1322 C CA    . PRO B 2 126 ? 46.777 2.606   -24.317 1.00 39.82  ? 127 PRO A CA    1 
ATOM   1323 C C     . PRO B 2 126 ? 45.390 3.087   -24.675 1.00 58.16  ? 127 PRO A C     1 
ATOM   1324 O O     . PRO B 2 126 ? 44.593 3.378   -23.782 1.00 63.06  ? 127 PRO A O     1 
ATOM   1325 C CB    . PRO B 2 126 ? 46.772 1.077   -24.308 1.00 41.74  ? 127 PRO A CB    1 
ATOM   1326 C CG    . PRO B 2 126 ? 47.491 0.690   -23.061 1.00 41.88  ? 127 PRO A CG    1 
ATOM   1327 C CD    . PRO B 2 126 ? 47.379 1.817   -22.076 1.00 34.19  ? 127 PRO A CD    1 
ATOM   1328 N N     . GLU B 2 127 ? 45.080 3.177   -25.966 1.00 59.78  ? 128 GLU A N     1 
ATOM   1329 C CA    . GLU B 2 127 ? 43.749 3.631   -26.364 1.00 58.79  ? 128 GLU A CA    1 
ATOM   1330 C C     . GLU B 2 127 ? 42.695 2.794   -25.678 1.00 52.36  ? 128 GLU A C     1 
ATOM   1331 O O     . GLU B 2 127 ? 41.874 3.359   -24.950 1.00 53.18  ? 128 GLU A O     1 
ATOM   1332 C CB    . GLU B 2 127 ? 43.542 3.663   -27.878 1.00 62.23  ? 128 GLU A CB    1 
ATOM   1333 C CG    . GLU B 2 127 ? 43.342 5.069   -28.483 1.00 96.21  ? 128 GLU A CG    1 
ATOM   1334 C CD    . GLU B 2 127 ? 41.892 5.630   -28.345 1.00 100.00 ? 128 GLU A CD    1 
ATOM   1335 O OE1   . GLU B 2 127 ? 41.036 5.376   -29.248 1.00 100.00 ? 128 GLU A OE1   1 
ATOM   1336 O OE2   . GLU B 2 127 ? 41.644 6.391   -27.369 1.00 100.00 ? 128 GLU A OE2   1 
ATOM   1337 N N     . PRO B 2 128 ? 42.768 1.472   -25.856 1.00 40.00  ? 129 PRO A N     1 
ATOM   1338 C CA    . PRO B 2 128 ? 41.830 0.555   -25.230 1.00 42.29  ? 129 PRO A CA    1 
ATOM   1339 C C     . PRO B 2 128 ? 41.539 0.954   -23.779 1.00 51.96  ? 129 PRO A C     1 
ATOM   1340 O O     . PRO B 2 128 ? 40.397 0.909   -23.336 1.00 52.24  ? 129 PRO A O     1 
ATOM   1341 C CB    . PRO B 2 128 ? 42.566 -0.820  -25.264 1.00 40.81  ? 129 PRO A CB    1 
ATOM   1342 C CG    . PRO B 2 128 ? 43.604 -0.706  -26.298 1.00 40.06  ? 129 PRO A CG    1 
ATOM   1343 C CD    . PRO B 2 128 ? 43.821 0.765   -26.607 1.00 36.97  ? 129 PRO A CD    1 
ATOM   1344 N N     . LEU B 2 129 ? 42.556 1.389   -23.059 1.00 44.63  ? 130 LEU A N     1 
ATOM   1345 C CA    . LEU B 2 129 ? 42.314 1.765   -21.679 1.00 45.38  ? 130 LEU A CA    1 
ATOM   1346 C C     . LEU B 2 129 ? 41.645 3.075   -21.593 1.00 36.93  ? 130 LEU A C     1 
ATOM   1347 O O     . LEU B 2 129 ? 40.730 3.278   -20.808 1.00 36.30  ? 130 LEU A O     1 
ATOM   1348 C CB    . LEU B 2 129 ? 43.641 1.880   -20.945 1.00 47.59  ? 130 LEU A CB    1 
ATOM   1349 C CG    . LEU B 2 129 ? 43.620 2.076   -19.427 1.00 46.55  ? 130 LEU A CG    1 
ATOM   1350 C CD1   . LEU B 2 129 ? 44.395 3.348   -19.107 1.00 48.11  ? 130 LEU A CD1   1 
ATOM   1351 C CD2   . LEU B 2 129 ? 42.216 2.072   -18.807 1.00 38.76  ? 130 LEU A CD2   1 
ATOM   1352 N N     . LEU B 2 130 ? 42.153 3.987   -22.383 1.00 37.15  ? 131 LEU A N     1 
ATOM   1353 C CA    . LEU B 2 130 ? 41.614 5.324   -22.369 1.00 49.22  ? 131 LEU A CA    1 
ATOM   1354 C C     . LEU B 2 130 ? 40.152 5.190   -22.724 1.00 62.09  ? 131 LEU A C     1 
ATOM   1355 O O     . LEU B 2 130 ? 39.299 5.885   -22.165 1.00 66.81  ? 131 LEU A O     1 
ATOM   1356 C CB    . LEU B 2 130 ? 42.347 6.220   -23.393 1.00 52.46  ? 131 LEU A CB    1 
ATOM   1357 C CG    . LEU B 2 130 ? 43.572 7.051   -22.983 1.00 55.16  ? 131 LEU A CG    1 
ATOM   1358 C CD1   . LEU B 2 130 ? 43.504 7.442   -21.512 1.00 56.32  ? 131 LEU A CD1   1 
ATOM   1359 C CD2   . LEU B 2 130 ? 44.809 6.208   -23.236 1.00 55.49  ? 131 LEU A CD2   1 
ATOM   1360 N N     . ALA B 2 131 ? 39.867 4.253   -23.625 1.00 55.65  ? 132 ALA A N     1 
ATOM   1361 C CA    . ALA B 2 131 ? 38.499 4.011   -24.039 1.00 56.29  ? 132 ALA A CA    1 
ATOM   1362 C C     . ALA B 2 131 ? 37.593 3.616   -22.869 1.00 66.14  ? 132 ALA A C     1 
ATOM   1363 O O     . ALA B 2 131 ? 36.562 4.262   -22.648 1.00 73.82  ? 132 ALA A O     1 
ATOM   1364 C CB    . ALA B 2 131 ? 38.437 2.972   -25.135 1.00 56.30  ? 132 ALA A CB    1 
ATOM   1365 N N     . MET B 2 132 ? 37.976 2.563   -22.138 1.00 55.01  ? 133 MET A N     1 
ATOM   1366 C CA    . MET B 2 132 ? 37.192 2.090   -21.011 1.00 52.16  ? 133 MET A CA    1 
ATOM   1367 C C     . MET B 2 132 ? 36.965 3.266   -20.119 1.00 55.76  ? 133 MET A C     1 
ATOM   1368 O O     . MET B 2 132 ? 35.824 3.534   -19.720 1.00 57.39  ? 133 MET A O     1 
ATOM   1369 C CB    . MET B 2 132 ? 37.938 1.026   -20.234 1.00 55.02  ? 133 MET A CB    1 
ATOM   1370 C CG    . MET B 2 132 ? 38.522 -0.035  -21.104 1.00 63.35  ? 133 MET A CG    1 
ATOM   1371 S SD    . MET B 2 132 ? 38.154 -1.677  -20.483 1.00 72.03  ? 133 MET A SD    1 
ATOM   1372 C CE    . MET B 2 132 ? 39.318 -1.787  -19.115 1.00 68.60  ? 133 MET A CE    1 
ATOM   1373 N N     . LEU B 2 133 ? 38.048 3.984   -19.837 1.00 48.15  ? 134 LEU A N     1 
ATOM   1374 C CA    . LEU B 2 133 ? 37.975 5.164   -18.985 1.00 50.01  ? 134 LEU A CA    1 
ATOM   1375 C C     . LEU B 2 133 ? 36.823 6.114   -19.332 1.00 47.82  ? 134 LEU A C     1 
ATOM   1376 O O     . LEU B 2 133 ? 36.036 6.510   -18.447 1.00 38.38  ? 134 LEU A O     1 
ATOM   1377 C CB    . LEU B 2 133 ? 39.308 5.919   -18.991 1.00 49.72  ? 134 LEU A CB    1 
ATOM   1378 C CG    . LEU B 2 133 ? 40.417 5.237   -18.195 1.00 49.90  ? 134 LEU A CG    1 
ATOM   1379 C CD1   . LEU B 2 133 ? 41.757 5.923   -18.475 1.00 45.40  ? 134 LEU A CD1   1 
ATOM   1380 C CD2   . LEU B 2 133 ? 40.053 5.234   -16.712 1.00 40.52  ? 134 LEU A CD2   1 
ATOM   1381 N N     . GLU B 2 134 ? 36.724 6.489   -20.610 1.00 47.24  ? 135 GLU A N     1 
ATOM   1382 C CA    . GLU B 2 134 ? 35.668 7.412   -21.043 1.00 54.42  ? 135 GLU A CA    1 
ATOM   1383 C C     . GLU B 2 134 ? 34.272 6.931   -20.633 1.00 59.10  ? 135 GLU A C     1 
ATOM   1384 O O     . GLU B 2 134 ? 33.486 7.664   -20.046 1.00 57.09  ? 135 GLU A O     1 
ATOM   1385 C CB    . GLU B 2 134 ? 35.730 7.684   -22.545 1.00 57.83  ? 135 GLU A CB    1 
ATOM   1386 C CG    . GLU B 2 134 ? 34.577 8.563   -23.047 1.00 87.27  ? 135 GLU A CG    1 
ATOM   1387 C CD    . GLU B 2 134 ? 34.990 9.558   -24.156 1.00 100.00 ? 135 GLU A CD    1 
ATOM   1388 O OE1   . GLU B 2 134 ? 35.910 9.228   -24.949 1.00 100.00 ? 135 GLU A OE1   1 
ATOM   1389 O OE2   . GLU B 2 134 ? 34.349 10.642  -24.265 1.00 100.00 ? 135 GLU A OE2   1 
ATOM   1390 N N     . GLU B 2 135 ? 34.001 5.673   -20.928 1.00 53.40  ? 136 GLU A N     1 
ATOM   1391 C CA    . GLU B 2 135 ? 32.750 5.026   -20.591 1.00 52.56  ? 136 GLU A CA    1 
ATOM   1392 C C     . GLU B 2 135 ? 32.245 5.346   -19.202 1.00 51.02  ? 136 GLU A C     1 
ATOM   1393 O O     . GLU B 2 135 ? 31.072 5.160   -18.895 1.00 62.30  ? 136 GLU A O     1 
ATOM   1394 C CB    . GLU B 2 135 ? 32.979 3.529   -20.654 1.00 54.50  ? 136 GLU A CB    1 
ATOM   1395 C CG    . GLU B 2 135 ? 33.091 3.022   -22.078 1.00 73.86  ? 136 GLU A CG    1 
ATOM   1396 C CD    . GLU B 2 135 ? 32.550 1.618   -22.221 1.00 100.00 ? 136 GLU A CD    1 
ATOM   1397 O OE1   . GLU B 2 135 ? 31.456 1.321   -21.654 1.00 100.00 ? 136 GLU A OE1   1 
ATOM   1398 O OE2   . GLU B 2 135 ? 33.274 0.802   -22.850 1.00 60.08  ? 136 GLU A OE2   1 
ATOM   1399 N N     . TYR B 2 136 ? 33.149 5.819   -18.371 1.00 32.84  ? 137 TYR A N     1 
ATOM   1400 C CA    . TYR B 2 136 ? 32.847 6.139   -17.007 1.00 35.18  ? 137 TYR A CA    1 
ATOM   1401 C C     . TYR B 2 136 ? 32.967 7.630   -16.682 1.00 46.32  ? 137 TYR A C     1 
ATOM   1402 O O     . TYR B 2 136 ? 33.142 8.018   -15.497 1.00 38.51  ? 137 TYR A O     1 
ATOM   1403 C CB    . TYR B 2 136 ? 33.777 5.340   -16.138 1.00 34.52  ? 137 TYR A CB    1 
ATOM   1404 C CG    . TYR B 2 136 ? 33.511 3.880   -16.225 1.00 34.74  ? 137 TYR A CG    1 
ATOM   1405 C CD1   . TYR B 2 136 ? 32.587 3.301   -15.389 1.00 41.76  ? 137 TYR A CD1   1 
ATOM   1406 C CD2   . TYR B 2 136 ? 34.163 3.085   -17.149 1.00 34.00  ? 137 TYR A CD2   1 
ATOM   1407 C CE1   . TYR B 2 136 ? 32.324 1.954   -15.435 1.00 52.02  ? 137 TYR A CE1   1 
ATOM   1408 C CE2   . TYR B 2 136 ? 33.908 1.744   -17.220 1.00 36.48  ? 137 TYR A CE2   1 
ATOM   1409 C CZ    . TYR B 2 136 ? 32.978 1.179   -16.343 1.00 65.50  ? 137 TYR A CZ    1 
ATOM   1410 O OH    . TYR B 2 136 ? 32.682 -0.166  -16.372 1.00 80.08  ? 137 TYR A OH    1 
ATOM   1411 N N     . ARG B 2 137 ? 32.891 8.460   -17.730 1.00 45.71  ? 138 ARG A N     1 
ATOM   1412 C CA    . ARG B 2 137 ? 32.984 9.890   -17.531 1.00 45.35  ? 138 ARG A CA    1 
ATOM   1413 C C     . ARG B 2 137 ? 31.956 10.318  -16.502 1.00 58.17  ? 138 ARG A C     1 
ATOM   1414 O O     . ARG B 2 137 ? 32.118 11.334  -15.825 1.00 65.96  ? 138 ARG A O     1 
ATOM   1415 C CB    . ARG B 2 137 ? 32.832 10.714  -18.826 1.00 44.98  ? 138 ARG A CB    1 
ATOM   1416 C CG    . ARG B 2 137 ? 32.137 10.067  -20.018 1.00 70.12  ? 138 ARG A CG    1 
ATOM   1417 C CD    . ARG B 2 137 ? 32.264 10.911  -21.330 1.00 90.54  ? 138 ARG A CD    1 
ATOM   1418 N NE    . ARG B 2 137 ? 32.446 12.357  -21.102 1.00 100.00 ? 138 ARG A NE    1 
ATOM   1419 C CZ    . ARG B 2 137 ? 33.196 13.161  -21.867 1.00 100.00 ? 138 ARG A CZ    1 
ATOM   1420 N NH1   . ARG B 2 137 ? 33.852 12.675  -22.922 1.00 100.00 ? 138 ARG A NH1   1 
ATOM   1421 N NH2   . ARG B 2 137 ? 33.300 14.457  -21.573 1.00 89.86  ? 138 ARG A NH2   1 
ATOM   1422 N N     . HIS B 2 138 ? 30.906 9.533   -16.366 1.00 53.06  ? 139 HIS A N     1 
ATOM   1423 C CA    . HIS B 2 138 ? 29.908 9.902   -15.423 1.00 53.88  ? 139 HIS A CA    1 
ATOM   1424 C C     . HIS B 2 138 ? 30.503 10.018  -14.028 1.00 47.74  ? 139 HIS A C     1 
ATOM   1425 O O     . HIS B 2 138 ? 30.319 11.021  -13.357 1.00 47.71  ? 139 HIS A O     1 
ATOM   1426 C CB    . HIS B 2 138 ? 28.683 9.008   -15.569 1.00 61.61  ? 139 HIS A CB    1 
ATOM   1427 C CG    . HIS B 2 138 ? 28.900 7.602   -15.136 1.00 72.05  ? 139 HIS A CG    1 
ATOM   1428 N ND1   . HIS B 2 138 ? 29.531 6.658   -15.923 1.00 76.39  ? 139 HIS A ND1   1 
ATOM   1429 C CD2   . HIS B 2 138 ? 28.543 6.971   -13.992 1.00 81.13  ? 139 HIS A CD2   1 
ATOM   1430 C CE1   . HIS B 2 138 ? 29.558 5.505   -15.275 1.00 80.25  ? 139 HIS A CE1   1 
ATOM   1431 N NE2   . HIS B 2 138 ? 28.966 5.668   -14.101 1.00 82.41  ? 139 HIS A NE2   1 
ATOM   1432 N N     . ILE B 2 139 ? 31.320 9.056   -13.642 1.00 40.95  ? 140 ILE A N     1 
ATOM   1433 C CA    . ILE B 2 139 ? 31.960 9.139   -12.337 1.00 38.04  ? 140 ILE A CA    1 
ATOM   1434 C C     . ILE B 2 139 ? 33.064 10.169  -12.335 1.00 40.99  ? 140 ILE A C     1 
ATOM   1435 O O     . ILE B 2 139 ? 33.909 10.202  -13.237 1.00 39.64  ? 140 ILE A O     1 
ATOM   1436 C CB    . ILE B 2 139 ? 32.694 7.887   -11.996 1.00 39.43  ? 140 ILE A CB    1 
ATOM   1437 C CG1   . ILE B 2 139 ? 31.861 6.645   -12.311 1.00 45.34  ? 140 ILE A CG1   1 
ATOM   1438 C CG2   . ILE B 2 139 ? 33.223 7.973   -10.594 1.00 28.03  ? 140 ILE A CG2   1 
ATOM   1439 C CD1   . ILE B 2 139 ? 32.252 5.965   -13.647 1.00 29.95  ? 140 ILE A CD1   1 
ATOM   1440 N N     . PRO B 2 140 ? 33.073 10.986  -11.298 1.00 34.59  ? 141 PRO A N     1 
ATOM   1441 C CA    . PRO B 2 140 ? 34.101 12.016  -11.152 1.00 32.32  ? 141 PRO A CA    1 
ATOM   1442 C C     . PRO B 2 140 ? 35.413 11.303  -10.957 1.00 44.30  ? 141 PRO A C     1 
ATOM   1443 O O     . PRO B 2 140 ? 35.512 10.370  -10.129 1.00 43.77  ? 141 PRO A O     1 
ATOM   1444 C CB    . PRO B 2 140 ? 33.743 12.725  -9.846  1.00 31.62  ? 141 PRO A CB    1 
ATOM   1445 C CG    . PRO B 2 140 ? 32.596 11.982  -9.260  1.00 35.79  ? 141 PRO A CG    1 
ATOM   1446 C CD    . PRO B 2 140 ? 32.090 10.966  -10.209 1.00 30.61  ? 141 PRO A CD    1 
ATOM   1447 N N     . MET B 2 141 ? 36.428 11.742  -11.700 1.00 44.77  ? 142 MET A N     1 
ATOM   1448 C CA    . MET B 2 141 ? 37.735 11.123  -11.568 1.00 43.58  ? 142 MET A CA    1 
ATOM   1449 C C     . MET B 2 141 ? 38.944 11.921  -11.930 1.00 43.58  ? 142 MET A C     1 
ATOM   1450 O O     . MET B 2 141 ? 38.898 12.812  -12.759 1.00 42.64  ? 142 MET A O     1 
ATOM   1451 C CB    . MET B 2 141 ? 37.777 9.893   -12.431 1.00 44.57  ? 142 MET A CB    1 
ATOM   1452 C CG    . MET B 2 141 ? 37.686 10.156  -13.918 1.00 46.25  ? 142 MET A CG    1 
ATOM   1453 S SD    . MET B 2 141 ? 38.266 8.574   -14.556 1.00 53.51  ? 142 MET A SD    1 
ATOM   1454 C CE    . MET B 2 141 ? 37.364 8.282   -16.082 1.00 51.33  ? 142 MET A CE    1 
ATOM   1455 N N     . VAL B 2 142 ? 40.068 11.567  -11.353 1.00 35.40  ? 143 VAL A N     1 
ATOM   1456 C CA    . VAL B 2 142 ? 41.233 12.272  -11.792 1.00 29.81  ? 143 VAL A CA    1 
ATOM   1457 C C     . VAL B 2 142 ? 42.352 11.304  -12.052 1.00 31.89  ? 143 VAL A C     1 
ATOM   1458 O O     . VAL B 2 142 ? 42.500 10.320  -11.316 1.00 27.55  ? 143 VAL A O     1 
ATOM   1459 C CB    . VAL B 2 142 ? 41.737 13.397  -10.886 1.00 24.57  ? 143 VAL A CB    1 
ATOM   1460 C CG1   . VAL B 2 142 ? 41.247 13.297  -9.426  1.00 18.83  ? 143 VAL A CG1   1 
ATOM   1461 C CG2   . VAL B 2 142 ? 43.245 13.433  -10.996 1.00 23.25  ? 143 VAL A CG2   1 
ATOM   1462 N N     . VAL B 2 143 ? 43.129 11.587  -13.105 1.00 30.67  ? 144 VAL A N     1 
ATOM   1463 C CA    . VAL B 2 143 ? 44.273 10.747  -13.402 1.00 33.81  ? 144 VAL A CA    1 
ATOM   1464 C C     . VAL B 2 143 ? 45.506 11.418  -12.845 1.00 37.61  ? 144 VAL A C     1 
ATOM   1465 O O     . VAL B 2 143 ? 45.933 12.476  -13.323 1.00 37.02  ? 144 VAL A O     1 
ATOM   1466 C CB    . VAL B 2 143 ? 44.419 10.133  -14.834 1.00 36.46  ? 144 VAL A CB    1 
ATOM   1467 C CG1   . VAL B 2 143 ? 43.636 10.833  -15.896 1.00 31.54  ? 144 VAL A CG1   1 
ATOM   1468 C CG2   . VAL B 2 143 ? 45.877 10.063  -15.200 1.00 37.24  ? 144 VAL A CG2   1 
ATOM   1469 N N     . MET B 2 144 ? 46.040 10.827  -11.777 1.00 32.71  ? 145 MET A N     1 
ATOM   1470 C CA    . MET B 2 144 ? 47.183 11.422  -11.121 1.00 29.55  ? 145 MET A CA    1 
ATOM   1471 C C     . MET B 2 144 ? 48.533 11.374  -11.835 1.00 38.03  ? 145 MET A C     1 
ATOM   1472 O O     . MET B 2 144 ? 49.463 12.020  -11.399 1.00 40.99  ? 145 MET A O     1 
ATOM   1473 C CB    . MET B 2 144 ? 47.274 10.968  -9.677  1.00 28.97  ? 145 MET A CB    1 
ATOM   1474 C CG    . MET B 2 144 ? 46.201 9.968   -9.286  1.00 35.24  ? 145 MET A CG    1 
ATOM   1475 S SD    . MET B 2 144 ? 46.111 9.782   -7.459  1.00 48.42  ? 145 MET A SD    1 
ATOM   1476 C CE    . MET B 2 144 ? 47.506 10.865  -6.971  1.00 47.35  ? 145 MET A CE    1 
ATOM   1477 N N     . ASP B 2 145 ? 48.622 10.630  -12.935 1.00 37.03  ? 146 ASP A N     1 
ATOM   1478 C CA    . ASP B 2 145 ? 49.882 10.454  -13.656 1.00 38.01  ? 146 ASP A CA    1 
ATOM   1479 C C     . ASP B 2 145 ? 50.025 10.691  -15.169 1.00 49.02  ? 146 ASP A C     1 
ATOM   1480 O O     . ASP B 2 145 ? 50.672 9.887   -15.853 1.00 44.92  ? 146 ASP A O     1 
ATOM   1481 C CB    . ASP B 2 145 ? 50.443 9.057   -13.338 1.00 38.82  ? 146 ASP A CB    1 
ATOM   1482 C CG    . ASP B 2 145 ? 49.483 7.909   -13.767 1.00 46.80  ? 146 ASP A CG    1 
ATOM   1483 O OD1   . ASP B 2 145 ? 48.495 8.219   -14.502 1.00 41.14  ? 146 ASP A OD1   1 
ATOM   1484 O OD2   . ASP B 2 145 ? 49.728 6.712   -13.381 1.00 27.57  ? 146 ASP A OD2   1 
ATOM   1485 N N     . TRP B 2 146 ? 49.492 11.784  -15.703 1.00 53.26  ? 147 TRP A N     1 
ATOM   1486 C CA    . TRP B 2 146 ? 49.694 12.007  -17.129 1.00 57.07  ? 147 TRP A CA    1 
ATOM   1487 C C     . TRP B 2 146 ? 50.807 13.033  -17.236 1.00 57.79  ? 147 TRP A C     1 
ATOM   1488 O O     . TRP B 2 146 ? 51.162 13.678  -16.234 1.00 54.86  ? 147 TRP A O     1 
ATOM   1489 C CB    . TRP B 2 146 ? 48.418 12.516  -17.792 1.00 60.23  ? 147 TRP A CB    1 
ATOM   1490 C CG    . TRP B 2 146 ? 47.544 11.362  -18.180 1.00 64.83  ? 147 TRP A CG    1 
ATOM   1491 C CD1   . TRP B 2 146 ? 47.883 10.008  -18.155 1.00 67.08  ? 147 TRP A CD1   1 
ATOM   1492 C CD2   . TRP B 2 146 ? 46.186 11.421  -18.615 1.00 66.36  ? 147 TRP A CD2   1 
ATOM   1493 N NE1   . TRP B 2 146 ? 46.796 9.235   -18.559 1.00 64.36  ? 147 TRP A NE1   1 
ATOM   1494 C CE2   . TRP B 2 146 ? 45.755 10.074  -18.830 1.00 68.74  ? 147 TRP A CE2   1 
ATOM   1495 C CE3   . TRP B 2 146 ? 45.292 12.468  -18.827 1.00 67.96  ? 147 TRP A CE3   1 
ATOM   1496 C CZ2   . TRP B 2 146 ? 44.481 9.778   -19.270 1.00 70.10  ? 147 TRP A CZ2   1 
ATOM   1497 C CZ3   . TRP B 2 146 ? 44.025 12.156  -19.256 1.00 70.75  ? 147 TRP A CZ3   1 
ATOM   1498 C CH2   . TRP B 2 146 ? 43.631 10.821  -19.463 1.00 71.86  ? 147 TRP A CH2   1 
ATOM   1499 N N     . GLY B 2 147 ? 51.361 13.205  -18.430 1.00 56.17  ? 148 GLY A N     1 
ATOM   1500 C CA    . GLY B 2 147 ? 52.424 14.206  -18.614 1.00 59.70  ? 148 GLY A CA    1 
ATOM   1501 C C     . GLY B 2 147 ? 51.741 15.468  -19.172 1.00 73.52  ? 148 GLY A C     1 
ATOM   1502 O O     . GLY B 2 147 ? 52.158 16.603  -18.943 1.00 75.34  ? 148 GLY A O     1 
ATOM   1503 N N     . GLU B 2 148 ? 50.659 15.217  -19.894 1.00 70.78  ? 149 GLU A N     1 
ATOM   1504 C CA    . GLU B 2 148 ? 49.840 16.227  -20.509 1.00 68.21  ? 149 GLU A CA    1 
ATOM   1505 C C     . GLU B 2 148 ? 48.416 15.765  -20.200 1.00 73.31  ? 149 GLU A C     1 
ATOM   1506 O O     . GLU B 2 148 ? 48.196 14.678  -19.614 1.00 65.11  ? 149 GLU A O     1 
ATOM   1507 C CB    . GLU B 2 148 ? 50.065 16.188  -22.037 1.00 69.39  ? 149 GLU A CB    1 
ATOM   1508 C CG    . GLU B 2 148 ? 49.731 14.847  -22.715 1.00 74.44  ? 149 GLU A CG    1 
ATOM   1509 C CD    . GLU B 2 148 ? 50.905 13.820  -22.676 1.00 100.00 ? 149 GLU A CD    1 
ATOM   1510 O OE1   . GLU B 2 148 ? 51.581 13.675  -21.617 1.00 100.00 ? 149 GLU A OE1   1 
ATOM   1511 O OE2   . GLU B 2 148 ? 51.118 13.120  -23.706 1.00 100.00 ? 149 GLU A OE2   1 
ATOM   1512 N N     . ALA B 2 149 ? 47.442 16.581  -20.598 1.00 77.01  ? 150 ALA A N     1 
ATOM   1513 C CA    . ALA B 2 149 ? 46.032 16.228  -20.400 1.00 76.05  ? 150 ALA A CA    1 
ATOM   1514 C C     . ALA B 2 149 ? 45.637 15.277  -21.525 1.00 81.85  ? 150 ALA A C     1 
ATOM   1515 O O     . ALA B 2 149 ? 45.194 15.701  -22.598 1.00 79.82  ? 150 ALA A O     1 
ATOM   1516 C CB    . ALA B 2 149 ? 45.137 17.459  -20.427 1.00 76.25  ? 150 ALA A CB    1 
ATOM   1517 N N     . LYS B 2 150 ? 45.820 13.989  -21.271 1.00 81.74  ? 151 LYS A N     1 
ATOM   1518 C CA    . LYS B 2 150 ? 45.484 12.975  -22.244 1.00 83.47  ? 151 LYS A CA    1 
ATOM   1519 C C     . LYS B 2 150 ? 44.026 13.114  -22.777 1.00 94.75  ? 151 LYS A C     1 
ATOM   1520 O O     . LYS B 2 150 ? 43.774 12.889  -23.971 1.00 100.00 ? 151 LYS A O     1 
ATOM   1521 C CB    . LYS B 2 150 ? 45.754 11.579  -21.659 1.00 84.14  ? 151 LYS A CB    1 
ATOM   1522 C CG    . LYS B 2 150 ? 46.971 10.869  -22.269 1.00 98.66  ? 151 LYS A CG    1 
ATOM   1523 C CD    . LYS B 2 150 ? 48.263 11.192  -21.527 1.00 100.00 ? 151 LYS A CD    1 
ATOM   1524 C CE    . LYS B 2 150 ? 49.492 10.557  -22.184 1.00 100.00 ? 151 LYS A CE    1 
ATOM   1525 N NZ    . LYS B 2 150 ? 49.635 10.933  -23.624 1.00 100.00 ? 151 LYS A NZ    1 
ATOM   1526 N N     . ALA B 2 151 ? 43.076 13.490  -21.916 1.00 81.65  ? 152 ALA A N     1 
ATOM   1527 C CA    . ALA B 2 151 ? 41.705 13.620  -22.366 1.00 75.24  ? 152 ALA A CA    1 
ATOM   1528 C C     . ALA B 2 151 ? 41.031 14.792  -21.802 1.00 79.87  ? 152 ALA A C     1 
ATOM   1529 O O     . ALA B 2 151 ? 41.569 15.524  -20.963 1.00 82.96  ? 152 ALA A O     1 
ATOM   1530 C CB    . ALA B 2 151 ? 40.904 12.391  -22.054 1.00 74.27  ? 152 ALA A CB    1 
ATOM   1531 N N     . ASP B 2 152 ? 39.803 14.928  -22.260 1.00 75.61  ? 153 ASP A N     1 
ATOM   1532 C CA    . ASP B 2 152 ? 38.930 16.016  -21.897 1.00 77.90  ? 153 ASP A CA    1 
ATOM   1533 C C     . ASP B 2 152 ? 37.974 15.592  -20.810 1.00 79.19  ? 153 ASP A C     1 
ATOM   1534 O O     . ASP B 2 152 ? 37.341 16.414  -20.143 1.00 77.31  ? 153 ASP A O     1 
ATOM   1535 C CB    . ASP B 2 152 ? 38.118 16.381  -23.148 1.00 81.30  ? 153 ASP A CB    1 
ATOM   1536 C CG    . ASP B 2 152 ? 37.795 15.146  -24.007 1.00 100.00 ? 153 ASP A CG    1 
ATOM   1537 O OD1   . ASP B 2 152 ? 38.747 14.463  -24.473 1.00 100.00 ? 153 ASP A OD1   1 
ATOM   1538 O OD2   . ASP B 2 152 ? 36.589 14.819  -24.140 1.00 100.00 ? 153 ASP A OD2   1 
ATOM   1539 N N     . PHE B 2 153 ? 37.839 14.302  -20.624 1.00 73.70  ? 154 PHE A N     1 
ATOM   1540 C CA    . PHE B 2 153 ? 36.895 13.878  -19.642 1.00 75.89  ? 154 PHE A CA    1 
ATOM   1541 C C     . PHE B 2 153 ? 37.460 13.620  -18.250 1.00 76.21  ? 154 PHE A C     1 
ATOM   1542 O O     . PHE B 2 153 ? 36.968 12.735  -17.539 1.00 81.22  ? 154 PHE A O     1 
ATOM   1543 C CB    . PHE B 2 153 ? 36.135 12.669  -20.177 1.00 81.58  ? 154 PHE A CB    1 
ATOM   1544 C CG    . PHE B 2 153 ? 37.013 11.480  -20.419 1.00 86.01  ? 154 PHE A CG    1 
ATOM   1545 C CD1   . PHE B 2 153 ? 37.922 11.488  -21.443 1.00 89.85  ? 154 PHE A CD1   1 
ATOM   1546 C CD2   . PHE B 2 153 ? 36.951 10.382  -19.589 1.00 89.90  ? 154 PHE A CD2   1 
ATOM   1547 C CE1   . PHE B 2 153 ? 38.736 10.406  -21.658 1.00 91.36  ? 154 PHE A CE1   1 
ATOM   1548 C CE2   . PHE B 2 153 ? 37.769 9.306   -19.795 1.00 94.31  ? 154 PHE A CE2   1 
ATOM   1549 C CZ    . PHE B 2 153 ? 38.665 9.320   -20.833 1.00 91.86  ? 154 PHE A CZ    1 
ATOM   1550 N N     . THR B 2 154 ? 38.483 14.367  -17.833 1.00 61.10  ? 155 THR A N     1 
ATOM   1551 C CA    . THR B 2 154 ? 39.031 14.123  -16.490 1.00 53.97  ? 155 THR A CA    1 
ATOM   1552 C C     . THR B 2 154 ? 39.856 15.178  -15.906 1.00 54.55  ? 155 THR A C     1 
ATOM   1553 O O     . THR B 2 154 ? 40.344 16.046  -16.596 1.00 61.00  ? 155 THR A O     1 
ATOM   1554 C CB    . THR B 2 154 ? 40.124 13.046  -16.473 1.00 39.83  ? 155 THR A CB    1 
ATOM   1555 O OG1   . THR B 2 154 ? 40.147 12.281  -17.691 1.00 47.24  ? 155 THR A OG1   1 
ATOM   1556 C CG2   . THR B 2 154 ? 39.973 12.167  -15.254 1.00 36.54  ? 155 THR A CG2   1 
ATOM   1557 N N     . ASP B 2 155 ? 40.125 15.018  -14.629 1.00 45.05  ? 156 ASP A N     1 
ATOM   1558 C CA    . ASP B 2 155 ? 41.015 15.931  -13.999 1.00 41.45  ? 156 ASP A CA    1 
ATOM   1559 C C     . ASP B 2 155 ? 42.381 15.344  -14.077 1.00 46.32  ? 156 ASP A C     1 
ATOM   1560 O O     . ASP B 2 155 ? 42.560 14.110  -14.277 1.00 34.25  ? 156 ASP A O     1 
ATOM   1561 C CB    . ASP B 2 155 ? 40.565 16.342  -12.651 1.00 40.71  ? 156 ASP A CB    1 
ATOM   1562 C CG    . ASP B 2 155 ? 39.532 17.337  -12.772 1.00 51.30  ? 156 ASP A CG    1 
ATOM   1563 O OD1   . ASP B 2 155 ? 39.217 17.630  -13.965 1.00 44.13  ? 156 ASP A OD1   1 
ATOM   1564 O OD2   . ASP B 2 155 ? 39.057 17.858  -11.745 1.00 67.29  ? 156 ASP A OD2   1 
ATOM   1565 N N     . ALA B 2 156 ? 43.355 16.240  -13.996 1.00 48.38  ? 157 ALA A N     1 
ATOM   1566 C CA    . ALA B 2 156 ? 44.735 15.827  -14.141 1.00 44.49  ? 157 ALA A CA    1 
ATOM   1567 C C     . ALA B 2 156 ? 45.741 16.517  -13.318 1.00 45.39  ? 157 ALA A C     1 
ATOM   1568 O O     . ALA B 2 156 ? 45.782 17.750  -13.175 1.00 46.73  ? 157 ALA A O     1 
ATOM   1569 C CB    . ALA B 2 156 ? 45.151 15.922  -15.588 1.00 43.81  ? 157 ALA A CB    1 
ATOM   1570 N N     . VAL B 2 157 ? 46.622 15.723  -12.785 1.00 42.95  ? 158 VAL A N     1 
ATOM   1571 C CA    . VAL B 2 157 ? 47.649 16.367  -12.053 1.00 44.29  ? 158 VAL A CA    1 
ATOM   1572 C C     . VAL B 2 157 ? 48.889 16.096  -12.905 1.00 42.81  ? 158 VAL A C     1 
ATOM   1573 O O     . VAL B 2 157 ? 49.075 14.973  -13.411 1.00 39.76  ? 158 VAL A O     1 
ATOM   1574 C CB    . VAL B 2 157 ? 47.799 15.819  -10.720 1.00 46.65  ? 158 VAL A CB    1 
ATOM   1575 C CG1   . VAL B 2 157 ? 47.495 14.359  -10.770 1.00 46.88  ? 158 VAL A CG1   1 
ATOM   1576 C CG2   . VAL B 2 157 ? 49.226 16.028  -10.319 1.00 49.84  ? 158 VAL A CG2   1 
ATOM   1577 N N     . ILE B 2 158 ? 49.705 17.126  -13.098 1.00 37.79  ? 159 ILE A N     1 
ATOM   1578 C CA    . ILE B 2 158 ? 50.922 16.970  -13.895 1.00 38.25  ? 159 ILE A CA    1 
ATOM   1579 C C     . ILE B 2 158 ? 52.222 17.268  -13.119 1.00 37.96  ? 159 ILE A C     1 
ATOM   1580 O O     . ILE B 2 158 ? 52.406 18.339  -12.483 1.00 26.90  ? 159 ILE A O     1 
ATOM   1581 C CB    . ILE B 2 158 ? 50.837 17.642  -15.216 1.00 41.22  ? 159 ILE A CB    1 
ATOM   1582 C CG1   . ILE B 2 158 ? 50.961 19.117  -14.996 1.00 45.12  ? 159 ILE A CG1   1 
ATOM   1583 C CG2   . ILE B 2 158 ? 49.543 17.243  -15.944 1.00 37.70  ? 159 ILE A CG2   1 
ATOM   1584 C CD1   . ILE B 2 158 ? 52.393 19.475  -15.111 1.00 93.70  ? 159 ILE A CD1   1 
ATOM   1585 N N     . ASP B 2 159 ? 53.106 16.272  -13.177 1.00 32.63  ? 160 ASP A N     1 
ATOM   1586 C CA    . ASP B 2 159 ? 54.379 16.301  -12.481 1.00 23.58  ? 160 ASP A CA    1 
ATOM   1587 C C     . ASP B 2 159 ? 55.576 17.037  -13.132 1.00 30.21  ? 160 ASP A C     1 
ATOM   1588 O O     . ASP B 2 159 ? 56.593 17.252  -12.460 1.00 35.01  ? 160 ASP A O     1 
ATOM   1589 C CB    . ASP B 2 159 ? 54.762 14.894  -12.064 1.00 21.40  ? 160 ASP A CB    1 
ATOM   1590 C CG    . ASP B 2 159 ? 54.994 14.004  -13.253 1.00 34.58  ? 160 ASP A CG    1 
ATOM   1591 O OD1   . ASP B 2 159 ? 55.081 14.630  -14.371 1.00 14.40  ? 160 ASP A OD1   1 
ATOM   1592 O OD2   . ASP B 2 159 ? 55.074 12.711  -13.087 1.00 34.62  ? 160 ASP A OD2   1 
ATOM   1593 N N     . ASN B 2 160 ? 55.487 17.420  -14.407 1.00 23.54  ? 161 ASN A N     1 
ATOM   1594 C CA    . ASN B 2 160 ? 56.620 18.129  -14.999 1.00 28.66  ? 161 ASN A CA    1 
ATOM   1595 C C     . ASN B 2 160 ? 57.847 17.183  -14.921 1.00 38.48  ? 161 ASN A C     1 
ATOM   1596 O O     . ASN B 2 160 ? 58.932 17.545  -14.467 1.00 33.59  ? 161 ASN A O     1 
ATOM   1597 C CB    . ASN B 2 160 ? 56.867 19.424  -14.203 1.00 25.98  ? 161 ASN A CB    1 
ATOM   1598 C CG    . ASN B 2 160 ? 55.880 20.548  -14.576 1.00 66.86  ? 161 ASN A CG    1 
ATOM   1599 O OD1   . ASN B 2 160 ? 55.972 21.156  -15.670 1.00 42.41  ? 161 ASN A OD1   1 
ATOM   1600 N ND2   . ASN B 2 160 ? 54.941 20.850  -13.652 1.00 29.96  ? 161 ASN A ND2   1 
ATOM   1601 N N     . ALA B 2 161 ? 57.637 15.949  -15.341 1.00 33.64  ? 162 ALA A N     1 
ATOM   1602 C CA    . ALA B 2 161 ? 58.675 14.977  -15.291 1.00 37.37  ? 162 ALA A CA    1 
ATOM   1603 C C     . ALA B 2 161 ? 59.791 15.230  -16.290 1.00 37.78  ? 162 ALA A C     1 
ATOM   1604 O O     . ALA B 2 161 ? 60.881 14.646  -16.198 1.00 37.82  ? 162 ALA A O     1 
ATOM   1605 C CB    . ALA B 2 161 ? 58.074 13.617  -15.497 1.00 42.94  ? 162 ALA A CB    1 
ATOM   1606 N N     . PHE B 2 162 ? 59.506 16.100  -17.238 1.00 27.32  ? 163 PHE A N     1 
ATOM   1607 C CA    . PHE B 2 162 ? 60.478 16.459  -18.257 1.00 22.45  ? 163 PHE A CA    1 
ATOM   1608 C C     . PHE B 2 162 ? 61.409 17.461  -17.597 1.00 27.29  ? 163 PHE A C     1 
ATOM   1609 O O     . PHE B 2 162 ? 62.600 17.325  -17.659 1.00 23.70  ? 163 PHE A O     1 
ATOM   1610 C CB    . PHE B 2 162 ? 59.726 17.066  -19.397 1.00 22.17  ? 163 PHE A CB    1 
ATOM   1611 C CG    . PHE B 2 162 ? 60.572 17.695  -20.418 1.00 24.64  ? 163 PHE A CG    1 
ATOM   1612 C CD1   . PHE B 2 162 ? 61.024 19.011  -20.249 1.00 26.29  ? 163 PHE A CD1   1 
ATOM   1613 C CD2   . PHE B 2 162 ? 60.842 17.033  -21.636 1.00 32.82  ? 163 PHE A CD2   1 
ATOM   1614 C CE1   . PHE B 2 162 ? 61.794 19.633  -21.249 1.00 25.56  ? 163 PHE A CE1   1 
ATOM   1615 C CE2   . PHE B 2 162 ? 61.605 17.652  -22.640 1.00 34.39  ? 163 PHE A CE2   1 
ATOM   1616 C CZ    . PHE B 2 162 ? 62.086 18.955  -22.449 1.00 26.01  ? 163 PHE A CZ    1 
ATOM   1617 N N     . GLU B 2 163 ? 60.843 18.453  -16.931 1.00 32.84  ? 164 GLU A N     1 
ATOM   1618 C CA    . GLU B 2 163 ? 61.615 19.445  -16.205 1.00 35.66  ? 164 GLU A CA    1 
ATOM   1619 C C     . GLU B 2 163 ? 62.595 18.715  -15.262 1.00 40.89  ? 164 GLU A C     1 
ATOM   1620 O O     . GLU B 2 163 ? 63.772 19.113  -15.130 1.00 39.45  ? 164 GLU A O     1 
ATOM   1621 C CB    . GLU B 2 163 ? 60.626 20.231  -15.348 1.00 40.68  ? 164 GLU A CB    1 
ATOM   1622 C CG    . GLU B 2 163 ? 61.028 21.645  -14.886 1.00 68.15  ? 164 GLU A CG    1 
ATOM   1623 C CD    . GLU B 2 163 ? 60.316 22.063  -13.569 1.00 100.00 ? 164 GLU A CD    1 
ATOM   1624 O OE1   . GLU B 2 163 ? 59.061 21.996  -13.481 1.00 97.94  ? 164 GLU A OE1   1 
ATOM   1625 O OE2   . GLU B 2 163 ? 61.029 22.432  -12.607 1.00 97.10  ? 164 GLU A OE2   1 
ATOM   1626 N N     . GLY B 2 164 ? 62.107 17.626  -14.636 1.00 35.13  ? 165 GLY A N     1 
ATOM   1627 C CA    . GLY B 2 164 ? 62.918 16.789  -13.719 1.00 31.47  ? 165 GLY A CA    1 
ATOM   1628 C C     . GLY B 2 164 ? 64.082 16.173  -14.517 1.00 27.72  ? 165 GLY A C     1 
ATOM   1629 O O     . GLY B 2 164 ? 65.257 16.358  -14.176 1.00 26.40  ? 165 GLY A O     1 
ATOM   1630 N N     . GLY B 2 165 ? 63.731 15.491  -15.605 1.00 21.76  ? 166 GLY A N     1 
ATOM   1631 C CA    . GLY B 2 165 ? 64.701 14.866  -16.506 1.00 21.31  ? 166 GLY A CA    1 
ATOM   1632 C C     . GLY B 2 165 ? 65.824 15.851  -16.807 1.00 33.10  ? 166 GLY A C     1 
ATOM   1633 O O     . GLY B 2 165 ? 66.997 15.511  -16.672 1.00 41.68  ? 166 GLY A O     1 
ATOM   1634 N N     . TYR B 2 166 ? 65.445 17.079  -17.187 1.00 28.31  ? 167 TYR A N     1 
ATOM   1635 C CA    . TYR B 2 166 ? 66.381 18.160  -17.519 1.00 26.19  ? 167 TYR A CA    1 
ATOM   1636 C C     . TYR B 2 166 ? 67.194 18.561  -16.327 1.00 32.92  ? 167 TYR A C     1 
ATOM   1637 O O     . TYR B 2 166 ? 68.404 18.776  -16.432 1.00 31.14  ? 167 TYR A O     1 
ATOM   1638 C CB    . TYR B 2 166 ? 65.627 19.370  -18.080 1.00 22.83  ? 167 TYR A CB    1 
ATOM   1639 C CG    . TYR B 2 166 ? 66.474 20.499  -18.701 1.00 19.52  ? 167 TYR A CG    1 
ATOM   1640 C CD1   . TYR B 2 166 ? 66.855 20.481  -20.066 1.00 18.60  ? 167 TYR A CD1   1 
ATOM   1641 C CD2   . TYR B 2 166 ? 66.802 21.650  -17.949 1.00 19.44  ? 167 TYR A CD2   1 
ATOM   1642 C CE1   . TYR B 2 166 ? 67.585 21.534  -20.621 1.00 18.66  ? 167 TYR A CE1   1 
ATOM   1643 C CE2   . TYR B 2 166 ? 67.525 22.693  -18.485 1.00 16.66  ? 167 TYR A CE2   1 
ATOM   1644 C CZ    . TYR B 2 166 ? 67.919 22.646  -19.802 1.00 33.16  ? 167 TYR A CZ    1 
ATOM   1645 O OH    . TYR B 2 166 ? 68.648 23.723  -20.280 1.00 40.14  ? 167 TYR A OH    1 
ATOM   1646 N N     . MET B 2 167 ? 66.559 18.642  -15.183 1.00 29.39  ? 168 MET A N     1 
ATOM   1647 C CA    . MET B 2 167 ? 67.335 19.029  -14.050 1.00 29.81  ? 168 MET A CA    1 
ATOM   1648 C C     . MET B 2 167 ? 68.427 18.010  -13.789 1.00 27.27  ? 168 MET A C     1 
ATOM   1649 O O     . MET B 2 167 ? 69.609 18.358  -13.565 1.00 22.83  ? 168 MET A O     1 
ATOM   1650 C CB    . MET B 2 167 ? 66.445 19.262  -12.850 1.00 32.90  ? 168 MET A CB    1 
ATOM   1651 C CG    . MET B 2 167 ? 65.438 20.355  -13.082 1.00 38.93  ? 168 MET A CG    1 
ATOM   1652 S SD    . MET B 2 167 ? 64.529 20.609  -11.569 1.00 49.48  ? 168 MET A SD    1 
ATOM   1653 C CE    . MET B 2 167 ? 65.853 20.900  -10.391 1.00 45.95  ? 168 MET A CE    1 
ATOM   1654 N N     . ALA B 2 168 ? 68.067 16.737  -13.863 1.00 27.16  ? 169 ALA A N     1 
ATOM   1655 C CA    . ALA B 2 168 ? 69.082 15.673  -13.607 1.00 28.06  ? 169 ALA A CA    1 
ATOM   1656 C C     . ALA B 2 168 ? 70.295 15.788  -14.524 1.00 28.32  ? 169 ALA A C     1 
ATOM   1657 O O     . ALA B 2 168 ? 71.444 15.862  -14.060 1.00 20.40  ? 169 ALA A O     1 
ATOM   1658 C CB    . ALA B 2 168 ? 68.489 14.260  -13.644 1.00 24.46  ? 169 ALA A CB    1 
ATOM   1659 N N     . GLY B 2 169 ? 70.026 15.843  -15.817 1.00 22.00  ? 170 GLY A N     1 
ATOM   1660 C CA    . GLY B 2 169 ? 71.096 15.977  -16.750 1.00 26.92  ? 170 GLY A CA    1 
ATOM   1661 C C     . GLY B 2 169 ? 72.016 17.201  -16.439 1.00 36.00  ? 170 GLY A C     1 
ATOM   1662 O O     . GLY B 2 169 ? 73.279 17.070  -16.402 1.00 37.31  ? 170 GLY A O     1 
ATOM   1663 N N     . ARG B 2 170 ? 71.397 18.378  -16.219 1.00 24.47  ? 171 ARG A N     1 
ATOM   1664 C CA    . ARG B 2 170 ? 72.167 19.593  -15.963 1.00 22.80  ? 171 ARG A CA    1 
ATOM   1665 C C     . ARG B 2 170 ? 73.162 19.390  -14.885 1.00 22.54  ? 171 ARG A C     1 
ATOM   1666 O O     . ARG B 2 170 ? 74.353 19.632  -15.093 1.00 21.70  ? 171 ARG A O     1 
ATOM   1667 C CB    . ARG B 2 170 ? 71.316 20.854  -15.750 1.00 24.81  ? 171 ARG A CB    1 
ATOM   1668 C CG    . ARG B 2 170 ? 70.570 21.315  -17.046 1.00 63.48  ? 171 ARG A CG    1 
ATOM   1669 C CD    . ARG B 2 170 ? 71.374 22.272  -17.992 1.00 38.16  ? 171 ARG A CD    1 
ATOM   1670 N NE    . ARG B 2 170 ? 72.445 22.894  -17.246 1.00 31.88  ? 171 ARG A NE    1 
ATOM   1671 C CZ    . ARG B 2 170 ? 73.622 23.205  -17.745 1.00 38.32  ? 171 ARG A CZ    1 
ATOM   1672 N NH1   . ARG B 2 170 ? 73.891 22.934  -19.021 1.00 23.94  ? 171 ARG A NH1   1 
ATOM   1673 N NH2   . ARG B 2 170 ? 74.521 23.749  -16.959 1.00 46.00  ? 171 ARG A NH2   1 
ATOM   1674 N N     . TYR B 2 171 ? 72.691 18.900  -13.748 1.00 16.14  ? 172 TYR A N     1 
ATOM   1675 C CA    . TYR B 2 171 ? 73.587 18.647  -12.605 1.00 14.57  ? 172 TYR A CA    1 
ATOM   1676 C C     . TYR B 2 171 ? 74.757 17.833  -13.047 1.00 22.02  ? 172 TYR A C     1 
ATOM   1677 O O     . TYR B 2 171 ? 75.903 18.144  -12.710 1.00 21.98  ? 172 TYR A O     1 
ATOM   1678 C CB    . TYR B 2 171 ? 72.865 17.885  -11.528 1.00 8.87   ? 172 TYR A CB    1 
ATOM   1679 C CG    . TYR B 2 171 ? 73.561 17.750  -10.236 1.00 14.17  ? 172 TYR A CG    1 
ATOM   1680 C CD1   . TYR B 2 171 ? 73.570 18.811  -9.276  1.00 19.11  ? 172 TYR A CD1   1 
ATOM   1681 C CD2   . TYR B 2 171 ? 74.148 16.532  -9.879  1.00 17.92  ? 172 TYR A CD2   1 
ATOM   1682 C CE1   . TYR B 2 171 ? 74.216 18.661  -8.013  1.00 12.91  ? 172 TYR A CE1   1 
ATOM   1683 C CE2   . TYR B 2 171 ? 74.786 16.380  -8.625  1.00 20.44  ? 172 TYR A CE2   1 
ATOM   1684 C CZ    . TYR B 2 171 ? 74.828 17.438  -7.705  1.00 20.23  ? 172 TYR A CZ    1 
ATOM   1685 O OH    . TYR B 2 171 ? 75.423 17.214  -6.509  1.00 32.10  ? 172 TYR A OH    1 
ATOM   1686 N N     . LEU B 2 172 ? 74.471 16.818  -13.841 1.00 14.71  ? 173 LEU A N     1 
ATOM   1687 C CA    . LEU B 2 172 ? 75.528 15.979  -14.311 1.00 21.75  ? 173 LEU A CA    1 
ATOM   1688 C C     . LEU B 2 172 ? 76.530 16.795  -15.021 1.00 25.56  ? 173 LEU A C     1 
ATOM   1689 O O     . LEU B 2 172 ? 77.695 16.853  -14.577 1.00 20.06  ? 173 LEU A O     1 
ATOM   1690 C CB    . LEU B 2 172 ? 74.989 14.841  -15.149 1.00 25.71  ? 173 LEU A CB    1 
ATOM   1691 C CG    . LEU B 2 172 ? 74.313 13.992  -14.069 1.00 30.13  ? 173 LEU A CG    1 
ATOM   1692 C CD1   . LEU B 2 172 ? 74.315 12.532  -14.404 1.00 27.35  ? 173 LEU A CD1   1 
ATOM   1693 C CD2   . LEU B 2 172 ? 75.098 14.243  -12.814 1.00 29.55  ? 173 LEU A CD2   1 
ATOM   1694 N N     . ILE B 2 173 ? 76.073 17.470  -16.079 1.00 20.50  ? 174 ILE A N     1 
ATOM   1695 C CA    . ILE B 2 173 ? 76.934 18.349  -16.862 1.00 21.92  ? 174 ILE A CA    1 
ATOM   1696 C C     . ILE B 2 173 ? 77.657 19.327  -15.948 1.00 26.27  ? 174 ILE A C     1 
ATOM   1697 O O     . ILE B 2 173 ? 78.841 19.429  -15.960 1.00 30.13  ? 174 ILE A O     1 
ATOM   1698 C CB    . ILE B 2 173 ? 76.106 19.299  -17.757 1.00 26.51  ? 174 ILE A CB    1 
ATOM   1699 C CG1   . ILE B 2 173 ? 75.131 18.506  -18.644 1.00 32.65  ? 174 ILE A CG1   1 
ATOM   1700 C CG2   . ILE B 2 173 ? 77.030 20.195  -18.553 1.00 16.63  ? 174 ILE A CG2   1 
ATOM   1701 C CD1   . ILE B 2 173 ? 75.702 17.929  -19.941 1.00 34.03  ? 174 ILE A CD1   1 
ATOM   1702 N N     . GLU B 2 174 ? 76.915 20.061  -15.181 1.00 29.23  ? 175 GLU A N     1 
ATOM   1703 C CA    . GLU B 2 174 ? 77.514 21.044  -14.310 1.00 35.47  ? 175 GLU A CA    1 
ATOM   1704 C C     . GLU B 2 174 ? 78.544 20.487  -13.353 1.00 46.66  ? 175 GLU A C     1 
ATOM   1705 O O     . GLU B 2 174 ? 79.299 21.245  -12.755 1.00 57.13  ? 175 GLU A O     1 
ATOM   1706 C CB    . GLU B 2 174 ? 76.401 21.722  -13.489 1.00 38.92  ? 175 GLU A CB    1 
ATOM   1707 C CG    . GLU B 2 174 ? 75.232 22.199  -14.339 1.00 43.52  ? 175 GLU A CG    1 
ATOM   1708 C CD    . GLU B 2 174 ? 74.570 23.444  -13.804 1.00 83.23  ? 175 GLU A CD    1 
ATOM   1709 O OE1   . GLU B 2 174 ? 74.656 23.668  -12.553 1.00 78.14  ? 175 GLU A OE1   1 
ATOM   1710 O OE2   . GLU B 2 174 ? 73.991 24.171  -14.643 1.00 74.23  ? 175 GLU A OE2   1 
ATOM   1711 N N     . ARG B 2 175 ? 78.576 19.177  -13.166 1.00 30.85  ? 176 ARG A N     1 
ATOM   1712 C CA    . ARG B 2 175 ? 79.523 18.622  -12.225 1.00 25.71  ? 176 ARG A CA    1 
ATOM   1713 C C     . ARG B 2 175 ? 80.806 18.124  -12.894 1.00 36.41  ? 176 ARG A C     1 
ATOM   1714 O O     . ARG B 2 175 ? 81.692 17.591  -12.228 1.00 44.60  ? 176 ARG A O     1 
ATOM   1715 C CB    . ARG B 2 175 ? 78.857 17.481  -11.474 1.00 36.21  ? 176 ARG A CB    1 
ATOM   1716 C CG    . ARG B 2 175 ? 78.070 17.932  -10.270 1.00 32.59  ? 176 ARG A CG    1 
ATOM   1717 C CD    . ARG B 2 175 ? 78.975 18.102  -9.098  1.00 22.55  ? 176 ARG A CD    1 
ATOM   1718 N NE    . ARG B 2 175 ? 78.424 17.507  -7.903  1.00 52.95  ? 176 ARG A NE    1 
ATOM   1719 C CZ    . ARG B 2 175 ? 79.161 16.809  -7.054  1.00 44.01  ? 176 ARG A CZ    1 
ATOM   1720 N NH1   . ARG B 2 175 ? 80.444 16.661  -7.333  1.00 39.06  ? 176 ARG A NH1   1 
ATOM   1721 N NH2   . ARG B 2 175 ? 78.641 16.271  -5.962  1.00 76.67  ? 176 ARG A NH2   1 
ATOM   1722 N N     . GLY B 2 176 ? 80.892 18.275  -14.211 1.00 24.92  ? 177 GLY A N     1 
ATOM   1723 C CA    . GLY B 2 176 ? 82.077 17.857  -14.933 1.00 20.55  ? 177 GLY A CA    1 
ATOM   1724 C C     . GLY B 2 176 ? 81.911 16.623  -15.794 1.00 27.94  ? 177 GLY A C     1 
ATOM   1725 O O     . GLY B 2 176 ? 82.901 16.112  -16.375 1.00 26.11  ? 177 GLY A O     1 
ATOM   1726 N N     . HIS B 2 177 ? 80.680 16.133  -15.920 1.00 21.38  ? 178 HIS A N     1 
ATOM   1727 C CA    . HIS B 2 177 ? 80.502 14.943  -16.772 1.00 20.62  ? 178 HIS A CA    1 
ATOM   1728 C C     . HIS B 2 177 ? 80.117 15.215  -18.219 1.00 25.62  ? 178 HIS A C     1 
ATOM   1729 O O     . HIS B 2 177 ? 79.467 16.211  -18.521 1.00 37.29  ? 178 HIS A O     1 
ATOM   1730 C CB    . HIS B 2 177 ? 79.557 13.908  -16.153 1.00 21.47  ? 178 HIS A CB    1 
ATOM   1731 C CG    . HIS B 2 177 ? 79.929 13.493  -14.760 1.00 20.06  ? 178 HIS A CG    1 
ATOM   1732 N ND1   . HIS B 2 177 ? 80.735 12.399  -14.508 1.00 15.96  ? 178 HIS A ND1   1 
ATOM   1733 C CD2   . HIS B 2 177 ? 79.615 14.018  -13.552 1.00 18.99  ? 178 HIS A CD2   1 
ATOM   1734 C CE1   . HIS B 2 177 ? 80.893 12.257  -13.211 1.00 11.51  ? 178 HIS A CE1   1 
ATOM   1735 N NE2   . HIS B 2 177 ? 80.217 13.218  -12.604 1.00 16.63  ? 178 HIS A NE2   1 
ATOM   1736 N N     . ARG B 2 178 ? 80.519 14.300  -19.099 1.00 19.83  ? 179 ARG A N     1 
ATOM   1737 C CA    . ARG B 2 178 ? 80.260 14.344  -20.551 1.00 17.90  ? 179 ARG A CA    1 
ATOM   1738 C C     . ARG B 2 178 ? 80.065 12.919  -21.097 1.00 29.86  ? 179 ARG A C     1 
ATOM   1739 O O     . ARG B 2 178 ? 79.503 12.731  -22.163 1.00 43.33  ? 179 ARG A O     1 
ATOM   1740 C CB    . ARG B 2 178 ? 81.285 15.190  -21.304 1.00 20.01  ? 179 ARG A CB    1 
ATOM   1741 C CG    . ARG B 2 178 ? 81.423 16.553  -20.668 1.00 43.07  ? 179 ARG A CG    1 
ATOM   1742 C CD    . ARG B 2 178 ? 81.801 17.613  -21.671 1.00 59.97  ? 179 ARG A CD    1 
ATOM   1743 N NE    . ARG B 2 178 ? 80.773 17.860  -22.681 1.00 35.92  ? 179 ARG A NE    1 
ATOM   1744 C CZ    . ARG B 2 178 ? 80.938 17.584  -23.961 1.00 67.41  ? 179 ARG A CZ    1 
ATOM   1745 N NH1   . ARG B 2 178 ? 82.095 17.045  -24.374 1.00 87.44  ? 179 ARG A NH1   1 
ATOM   1746 N NH2   . ARG B 2 178 ? 79.951 17.840  -24.820 1.00 47.13  ? 179 ARG A NH2   1 
ATOM   1747 N N     . GLU B 2 179 ? 80.495 11.911  -20.338 1.00 29.91  ? 180 GLU A N     1 
ATOM   1748 C CA    . GLU B 2 179 ? 80.254 10.511  -20.738 1.00 34.93  ? 180 GLU A CA    1 
ATOM   1749 C C     . GLU B 2 179 ? 79.267 10.036  -19.696 1.00 38.95  ? 180 GLU A C     1 
ATOM   1750 O O     . GLU B 2 179 ? 79.644 9.702   -18.525 1.00 30.87  ? 180 GLU A O     1 
ATOM   1751 C CB    . GLU B 2 179 ? 81.484 9.655   -20.743 1.00 35.41  ? 180 GLU A CB    1 
ATOM   1752 C CG    . GLU B 2 179 ? 82.366 9.970   -21.912 1.00 34.01  ? 180 GLU A CG    1 
ATOM   1753 C CD    . GLU B 2 179 ? 83.780 9.833   -21.496 1.00 96.67  ? 180 GLU A CD    1 
ATOM   1754 O OE1   . GLU B 2 179 ? 84.204 10.614  -20.579 1.00 62.43  ? 180 GLU A OE1   1 
ATOM   1755 O OE2   . GLU B 2 179 ? 84.402 8.848   -21.977 1.00 78.21  ? 180 GLU A OE2   1 
ATOM   1756 N N     . ILE B 2 180 ? 78.004 10.039  -20.127 1.00 30.37  ? 181 ILE A N     1 
ATOM   1757 C CA    . ILE B 2 180 ? 76.913 9.703   -19.256 1.00 27.50  ? 181 ILE A CA    1 
ATOM   1758 C C     . ILE B 2 180 ? 76.044 8.682   -19.871 1.00 32.44  ? 181 ILE A C     1 
ATOM   1759 O O     . ILE B 2 180 ? 75.969 8.562   -21.082 1.00 30.70  ? 181 ILE A O     1 
ATOM   1760 C CB    . ILE B 2 180 ? 76.061 10.952  -19.088 1.00 29.29  ? 181 ILE A CB    1 
ATOM   1761 C CG1   . ILE B 2 180 ? 76.889 12.044  -18.419 1.00 31.81  ? 181 ILE A CG1   1 
ATOM   1762 C CG2   . ILE B 2 180 ? 74.751 10.666  -18.389 1.00 18.29  ? 181 ILE A CG2   1 
ATOM   1763 C CD1   . ILE B 2 180 ? 76.491 13.463  -18.797 1.00 27.58  ? 181 ILE A CD1   1 
ATOM   1764 N N     . GLY B 2 181 ? 75.362 7.937   -19.028 1.00 29.73  ? 182 GLY A N     1 
ATOM   1765 C CA    . GLY B 2 181 ? 74.480 6.938   -19.540 1.00 31.65  ? 182 GLY A CA    1 
ATOM   1766 C C     . GLY B 2 181 ? 73.123 7.044   -18.855 1.00 40.79  ? 182 GLY A C     1 
ATOM   1767 O O     . GLY B 2 181 ? 72.936 7.831   -17.883 1.00 35.58  ? 182 GLY A O     1 
ATOM   1768 N N     . VAL B 2 182 ? 72.191 6.207   -19.325 1.00 34.32  ? 183 VAL A N     1 
ATOM   1769 C CA    . VAL B 2 182 ? 70.870 6.226   -18.756 1.00 33.31  ? 183 VAL A CA    1 
ATOM   1770 C C     . VAL B 2 182 ? 70.040 4.905   -18.768 1.00 34.15  ? 183 VAL A C     1 
ATOM   1771 O O     . VAL B 2 182 ? 69.927 4.149   -19.779 1.00 33.64  ? 183 VAL A O     1 
ATOM   1772 C CB    . VAL B 2 182 ? 70.090 7.428   -19.308 1.00 32.38  ? 183 VAL A CB    1 
ATOM   1773 C CG1   . VAL B 2 182 ? 70.296 7.560   -20.810 1.00 27.18  ? 183 VAL A CG1   1 
ATOM   1774 C CG2   . VAL B 2 182 ? 68.637 7.247   -19.045 1.00 33.38  ? 183 VAL A CG2   1 
ATOM   1775 N N     . ILE B 2 183 ? 69.434 4.643   -17.629 1.00 15.60  ? 184 ILE A N     1 
ATOM   1776 C CA    . ILE B 2 183 ? 68.635 3.477   -17.559 1.00 19.99  ? 184 ILE A CA    1 
ATOM   1777 C C     . ILE B 2 183 ? 67.276 4.003   -17.342 1.00 27.51  ? 184 ILE A C     1 
ATOM   1778 O O     . ILE B 2 183 ? 66.827 4.243   -16.230 1.00 23.57  ? 184 ILE A O     1 
ATOM   1779 C CB    . ILE B 2 183 ? 69.011 2.595   -16.428 1.00 26.32  ? 184 ILE A CB    1 
ATOM   1780 C CG1   . ILE B 2 183 ? 70.407 2.026   -16.680 1.00 26.44  ? 184 ILE A CG1   1 
ATOM   1781 C CG2   . ILE B 2 183 ? 67.941 1.520   -16.258 1.00 25.64  ? 184 ILE A CG2   1 
ATOM   1782 C CD1   . ILE B 2 183 ? 71.228 1.882   -15.427 1.00 21.74  ? 184 ILE A CD1   1 
ATOM   1783 N N     . PRO B 2 184 ? 66.607 4.201   -18.442 1.00 28.17  ? 185 PRO A N     1 
ATOM   1784 C CA    . PRO B 2 184 ? 65.261 4.738   -18.423 1.00 28.95  ? 185 PRO A CA    1 
ATOM   1785 C C     . PRO B 2 184 ? 64.270 3.696   -17.958 1.00 37.42  ? 185 PRO A C     1 
ATOM   1786 O O     . PRO B 2 184 ? 64.528 2.498   -18.043 1.00 38.13  ? 185 PRO A O     1 
ATOM   1787 C CB    . PRO B 2 184 ? 65.002 5.021   -19.906 1.00 26.51  ? 185 PRO A CB    1 
ATOM   1788 C CG    . PRO B 2 184 ? 65.902 4.046   -20.637 1.00 27.63  ? 185 PRO A CG    1 
ATOM   1789 C CD    . PRO B 2 184 ? 67.003 3.599   -19.738 1.00 20.77  ? 185 PRO A CD    1 
ATOM   1790 N N     . GLY B 2 185 ? 63.124 4.162   -17.479 1.00 31.85  ? 186 GLY A N     1 
ATOM   1791 C CA    . GLY B 2 185 ? 62.021 3.302   -17.065 1.00 30.73  ? 186 GLY A CA    1 
ATOM   1792 C C     . GLY B 2 185 ? 61.199 3.214   -18.374 1.00 39.76  ? 186 GLY A C     1 
ATOM   1793 O O     . GLY B 2 185 ? 61.431 4.006   -19.290 1.00 44.89  ? 186 GLY A O     1 
ATOM   1794 N N     . PRO B 2 186 ? 60.284 2.247   -18.499 1.00 31.65  ? 187 PRO A N     1 
ATOM   1795 C CA    . PRO B 2 186 ? 59.477 2.070   -19.734 1.00 30.86  ? 187 PRO A CA    1 
ATOM   1796 C C     . PRO B 2 186 ? 58.937 3.310   -20.423 1.00 34.97  ? 187 PRO A C     1 
ATOM   1797 O O     . PRO B 2 186 ? 58.293 4.157   -19.776 1.00 30.05  ? 187 PRO A O     1 
ATOM   1798 C CB    . PRO B 2 186 ? 58.290 1.206   -19.275 1.00 31.94  ? 187 PRO A CB    1 
ATOM   1799 C CG    . PRO B 2 186 ? 58.260 1.358   -17.788 1.00 39.00  ? 187 PRO A CG    1 
ATOM   1800 C CD    . PRO B 2 186 ? 59.701 1.520   -17.361 1.00 33.55  ? 187 PRO A CD    1 
ATOM   1801 N N     . LEU B 2 187 ? 59.160 3.360   -21.750 1.00 29.93  ? 188 LEU A N     1 
ATOM   1802 C CA    . LEU B 2 187 ? 58.742 4.472   -22.593 1.00 29.21  ? 188 LEU A CA    1 
ATOM   1803 C C     . LEU B 2 187 ? 57.257 4.549   -22.685 1.00 44.57  ? 188 LEU A C     1 
ATOM   1804 O O     . LEU B 2 187 ? 56.698 5.560   -23.100 1.00 48.76  ? 188 LEU A O     1 
ATOM   1805 C CB    . LEU B 2 187 ? 59.391 4.410   -23.972 1.00 29.04  ? 188 LEU A CB    1 
ATOM   1806 C CG    . LEU B 2 187 ? 60.930 4.626   -24.059 1.00 34.10  ? 188 LEU A CG    1 
ATOM   1807 C CD1   . LEU B 2 187 ? 61.252 5.849   -24.873 1.00 33.04  ? 188 LEU A CD1   1 
ATOM   1808 C CD2   . LEU B 2 187 ? 61.690 4.702   -22.726 1.00 31.03  ? 188 LEU A CD2   1 
ATOM   1809 N N     . GLU B 2 188 ? 56.589 3.491   -22.264 1.00 49.15  ? 189 GLU A N     1 
ATOM   1810 C CA    . GLU B 2 188 ? 55.131 3.511   -22.308 1.00 52.85  ? 189 GLU A CA    1 
ATOM   1811 C C     . GLU B 2 188 ? 54.466 4.299   -21.190 1.00 58.60  ? 189 GLU A C     1 
ATOM   1812 O O     . GLU B 2 188 ? 53.246 4.448   -21.193 1.00 65.24  ? 189 GLU A O     1 
ATOM   1813 C CB    . GLU B 2 188 ? 54.532 2.114   -22.403 1.00 56.15  ? 189 GLU A CB    1 
ATOM   1814 C CG    . GLU B 2 188 ? 54.889 1.400   -23.682 1.00 64.01  ? 189 GLU A CG    1 
ATOM   1815 C CD    . GLU B 2 188 ? 56.062 0.485   -23.490 1.00 97.09  ? 189 GLU A CD    1 
ATOM   1816 O OE1   . GLU B 2 188 ? 56.407 0.208   -22.316 1.00 88.38  ? 189 GLU A OE1   1 
ATOM   1817 O OE2   . GLU B 2 188 ? 56.614 0.060   -24.522 1.00 100.00 ? 189 GLU A OE2   1 
ATOM   1818 N N     . ALA B 2 189 ? 55.248 4.794   -20.227 1.00 47.43  ? 190 ALA A N     1 
ATOM   1819 C CA    . ALA B 2 189 ? 54.711 5.596   -19.133 1.00 41.95  ? 190 ALA A CA    1 
ATOM   1820 C C     . ALA B 2 189 ? 55.392 6.961   -19.110 1.00 49.46  ? 190 ALA A C     1 
ATOM   1821 O O     . ALA B 2 189 ? 56.480 7.174   -19.686 1.00 51.37  ? 190 ALA A O     1 
ATOM   1822 C CB    . ALA B 2 189 ? 54.846 4.900   -17.799 1.00 42.46  ? 190 ALA A CB    1 
ATOM   1823 N N     . ASN B 2 190 ? 54.724 7.886   -18.446 1.00 43.04  ? 191 ASN A N     1 
ATOM   1824 C CA    . ASN B 2 190 ? 55.178 9.253   -18.349 1.00 41.12  ? 191 ASN A CA    1 
ATOM   1825 C C     . ASN B 2 190 ? 56.508 9.385   -17.641 1.00 37.63  ? 191 ASN A C     1 
ATOM   1826 O O     . ASN B 2 190 ? 57.507 9.887   -18.198 1.00 32.42  ? 191 ASN A O     1 
ATOM   1827 C CB    . ASN B 2 190 ? 54.089 10.053  -17.623 1.00 50.78  ? 191 ASN A CB    1 
ATOM   1828 C CG    . ASN B 2 190 ? 54.498 11.472  -17.346 1.00 59.21  ? 191 ASN A CG    1 
ATOM   1829 O OD1   . ASN B 2 190 ? 55.016 12.166  -18.253 1.00 34.52  ? 191 ASN A OD1   1 
ATOM   1830 N ND2   . ASN B 2 190 ? 54.323 11.937  -16.071 1.00 7.13   ? 191 ASN A ND2   1 
ATOM   1831 N N     . THR B 2 191 ? 56.500 8.890   -16.404 1.00 31.74  ? 192 THR A N     1 
ATOM   1832 C CA    . THR B 2 191 ? 57.647 8.892   -15.525 1.00 30.11  ? 192 THR A CA    1 
ATOM   1833 C C     . THR B 2 191 ? 58.782 8.166   -16.198 1.00 36.43  ? 192 THR A C     1 
ATOM   1834 O O     . THR B 2 191 ? 59.918 8.212   -15.703 1.00 44.09  ? 192 THR A O     1 
ATOM   1835 C CB    . THR B 2 191 ? 57.343 8.153   -14.267 1.00 37.12  ? 192 THR A CB    1 
ATOM   1836 O OG1   . THR B 2 191 ? 56.823 6.869   -14.615 1.00 49.48  ? 192 THR A OG1   1 
ATOM   1837 C CG2   . THR B 2 191 ? 56.314 8.909   -13.441 1.00 47.73  ? 192 THR A CG2   1 
ATOM   1838 N N     . GLY B 2 192 ? 58.476 7.485   -17.318 1.00 15.90  ? 193 GLY A N     1 
ATOM   1839 C CA    . GLY B 2 192 ? 59.460 6.778   -18.094 1.00 11.36  ? 193 GLY A CA    1 
ATOM   1840 C C     . GLY B 2 192 ? 59.893 7.791   -19.157 1.00 28.54  ? 193 GLY A C     1 
ATOM   1841 O O     . GLY B 2 192 ? 60.734 8.674   -18.937 1.00 30.13  ? 193 GLY A O     1 
ATOM   1842 N N     . ALA B 2 193 ? 59.277 7.672   -20.308 1.00 35.67  ? 194 ALA A N     1 
ATOM   1843 C CA    . ALA B 2 193 ? 59.519 8.564   -21.431 1.00 34.98  ? 194 ALA A CA    1 
ATOM   1844 C C     . ALA B 2 193 ? 59.698 10.022  -21.065 1.00 28.10  ? 194 ALA A C     1 
ATOM   1845 O O     . ALA B 2 193 ? 60.581 10.689  -21.534 1.00 33.88  ? 194 ALA A O     1 
ATOM   1846 C CB    . ALA B 2 193 ? 58.339 8.460   -22.341 1.00 34.78  ? 194 ALA A CB    1 
ATOM   1847 N N     . GLY B 2 194 ? 58.863 10.518  -20.209 1.00 21.00  ? 195 GLY A N     1 
ATOM   1848 C CA    . GLY B 2 194 ? 59.012 11.909  -19.894 1.00 28.01  ? 195 GLY A CA    1 
ATOM   1849 C C     . GLY B 2 194 ? 60.318 12.342  -19.274 1.00 33.24  ? 195 GLY A C     1 
ATOM   1850 O O     . GLY B 2 194 ? 60.887 13.392  -19.630 1.00 22.96  ? 195 GLY A O     1 
ATOM   1851 N N     . ARG B 2 195 ? 60.761 11.562  -18.296 1.00 33.55  ? 196 ARG A N     1 
ATOM   1852 C CA    . ARG B 2 195 ? 61.963 11.915  -17.584 1.00 27.39  ? 196 ARG A CA    1 
ATOM   1853 C C     . ARG B 2 195 ? 63.119 11.814  -18.570 1.00 26.42  ? 196 ARG A C     1 
ATOM   1854 O O     . ARG B 2 195 ? 63.987 12.676  -18.584 1.00 24.19  ? 196 ARG A O     1 
ATOM   1855 C CB    . ARG B 2 195 ? 62.144 11.010  -16.347 1.00 18.34  ? 196 ARG A CB    1 
ATOM   1856 C CG    . ARG B 2 195 ? 61.023 11.108  -15.310 1.00 3.72   ? 196 ARG A CG    1 
ATOM   1857 C CD    . ARG B 2 195 ? 61.180 10.205  -14.102 1.00 1.00   ? 196 ARG A CD    1 
ATOM   1858 N NE    . ARG B 2 195 ? 60.133 10.414  -13.102 1.00 15.45  ? 196 ARG A NE    1 
ATOM   1859 C CZ    . ARG B 2 195 ? 60.028 9.735   -11.950 1.00 56.02  ? 196 ARG A CZ    1 
ATOM   1860 N NH1   . ARG B 2 195 ? 60.914 8.793   -11.638 1.00 31.00  ? 196 ARG A NH1   1 
ATOM   1861 N NH2   . ARG B 2 195 ? 59.024 9.989   -11.116 1.00 41.32  ? 196 ARG A NH2   1 
ATOM   1862 N N     . LEU B 2 196 ? 63.069 10.801  -19.429 1.00 12.86  ? 197 LEU A N     1 
ATOM   1863 C CA    . LEU B 2 196 ? 64.131 10.557  -20.373 1.00 13.38  ? 197 LEU A CA    1 
ATOM   1864 C C     . LEU B 2 196 ? 64.331 11.590  -21.367 1.00 30.31  ? 197 LEU A C     1 
ATOM   1865 O O     . LEU B 2 196 ? 65.454 11.839  -21.828 1.00 36.13  ? 197 LEU A O     1 
ATOM   1866 C CB    . LEU B 2 196 ? 63.863 9.288   -21.172 1.00 13.76  ? 197 LEU A CB    1 
ATOM   1867 C CG    . LEU B 2 196 ? 64.983 9.076   -22.202 1.00 22.23  ? 197 LEU A CG    1 
ATOM   1868 C CD1   . LEU B 2 196 ? 66.231 8.600   -21.525 1.00 16.80  ? 197 LEU A CD1   1 
ATOM   1869 C CD2   . LEU B 2 196 ? 64.608 8.071   -23.271 1.00 47.58  ? 197 LEU A CD2   1 
ATOM   1870 N N     . ALA B 2 197 ? 63.213 12.139  -21.787 1.00 30.76  ? 198 ALA A N     1 
ATOM   1871 C CA    . ALA B 2 197 ? 63.275 13.154  -22.786 1.00 31.20  ? 198 ALA A CA    1 
ATOM   1872 C C     . ALA B 2 197 ? 63.737 14.415  -22.112 1.00 39.69  ? 198 ALA A C     1 
ATOM   1873 O O     . ALA B 2 197 ? 64.465 15.185  -22.717 1.00 39.61  ? 198 ALA A O     1 
ATOM   1874 C CB    . ALA B 2 197 ? 61.961 13.345  -23.429 1.00 29.28  ? 198 ALA A CB    1 
ATOM   1875 N N     . GLY B 2 198 ? 63.353 14.625  -20.857 1.00 38.22  ? 199 GLY A N     1 
ATOM   1876 C CA    . GLY B 2 198 ? 63.821 15.820  -20.169 1.00 41.45  ? 199 GLY A CA    1 
ATOM   1877 C C     . GLY B 2 198 ? 65.378 15.784  -20.176 1.00 44.09  ? 199 GLY A C     1 
ATOM   1878 O O     . GLY B 2 198 ? 66.061 16.768  -20.497 1.00 39.09  ? 199 GLY A O     1 
ATOM   1879 N N     . PHE B 2 199 ? 65.897 14.606  -19.856 1.00 36.72  ? 200 PHE A N     1 
ATOM   1880 C CA    . PHE B 2 199 ? 67.323 14.341  -19.797 1.00 34.08  ? 200 PHE A CA    1 
ATOM   1881 C C     . PHE B 2 199 ? 67.929 14.487  -21.153 1.00 35.68  ? 200 PHE A C     1 
ATOM   1882 O O     . PHE B 2 199 ? 68.985 15.058  -21.347 1.00 39.84  ? 200 PHE A O     1 
ATOM   1883 C CB    . PHE B 2 199 ? 67.533 12.908  -19.338 1.00 36.19  ? 200 PHE A CB    1 
ATOM   1884 C CG    . PHE B 2 199 ? 68.943 12.456  -19.402 1.00 39.78  ? 200 PHE A CG    1 
ATOM   1885 C CD1   . PHE B 2 199 ? 69.810 12.662  -18.318 1.00 43.22  ? 200 PHE A CD1   1 
ATOM   1886 C CD2   . PHE B 2 199 ? 69.404 11.793  -20.525 1.00 39.48  ? 200 PHE A CD2   1 
ATOM   1887 C CE1   . PHE B 2 199 ? 71.115 12.212  -18.377 1.00 42.08  ? 200 PHE A CE1   1 
ATOM   1888 C CE2   . PHE B 2 199 ? 70.708 11.357  -20.600 1.00 40.53  ? 200 PHE A CE2   1 
ATOM   1889 C CZ    . PHE B 2 199 ? 71.568 11.572  -19.532 1.00 38.95  ? 200 PHE A CZ    1 
ATOM   1890 N N     . MET B 2 200 ? 67.268 13.967  -22.135 1.00 33.79  ? 201 MET A N     1 
ATOM   1891 C CA    . MET B 2 200 ? 67.877 14.088  -23.424 1.00 35.92  ? 201 MET A CA    1 
ATOM   1892 C C     . MET B 2 200 ? 68.042 15.524  -23.967 1.00 37.54  ? 201 MET A C     1 
ATOM   1893 O O     . MET B 2 200 ? 68.943 15.768  -24.771 1.00 32.42  ? 201 MET A O     1 
ATOM   1894 C CB    . MET B 2 200 ? 67.182 13.146  -24.396 1.00 40.49  ? 201 MET A CB    1 
ATOM   1895 C CG    . MET B 2 200 ? 68.134 12.479  -25.414 1.00 47.67  ? 201 MET A CG    1 
ATOM   1896 S SD    . MET B 2 200 ? 69.334 11.342  -24.739 1.00 48.53  ? 201 MET A SD    1 
ATOM   1897 C CE    . MET B 2 200 ? 68.494 10.962  -23.233 1.00 49.53  ? 201 MET A CE    1 
ATOM   1898 N N     . LYS B 2 201 ? 67.183 16.448  -23.515 1.00 33.28  ? 202 LYS A N     1 
ATOM   1899 C CA    . LYS B 2 201 ? 67.207 17.836  -23.963 1.00 31.91  ? 202 LYS A CA    1 
ATOM   1900 C C     . LYS B 2 201 ? 68.516 18.475  -23.570 1.00 35.74  ? 202 LYS A C     1 
ATOM   1901 O O     . LYS B 2 201 ? 69.311 19.022  -24.408 1.00 27.14  ? 202 LYS A O     1 
ATOM   1902 C CB    . LYS B 2 201 ? 66.116 18.618  -23.250 1.00 37.56  ? 202 LYS A CB    1 
ATOM   1903 C CG    . LYS B 2 201 ? 66.418 20.114  -23.153 1.00 31.97  ? 202 LYS A CG    1 
ATOM   1904 C CD    . LYS B 2 201 ? 66.279 20.726  -24.561 1.00 49.06  ? 202 LYS A CD    1 
ATOM   1905 C CE    . LYS B 2 201 ? 65.643 22.107  -24.510 1.00 100.00 ? 202 LYS A CE    1 
ATOM   1906 N NZ    . LYS B 2 201 ? 64.270 22.116  -23.930 1.00 100.00 ? 202 LYS A NZ    1 
ATOM   1907 N N     . ALA B 2 202 ? 68.733 18.434  -22.266 1.00 31.40  ? 203 ALA A N     1 
ATOM   1908 C CA    . ALA B 2 202 ? 69.951 18.999  -21.702 1.00 37.59  ? 203 ALA A CA    1 
ATOM   1909 C C     . ALA B 2 202 ? 71.246 18.568  -22.441 1.00 46.27  ? 203 ALA A C     1 
ATOM   1910 O O     . ALA B 2 202 ? 72.164 19.369  -22.633 1.00 48.03  ? 203 ALA A O     1 
ATOM   1911 C CB    . ALA B 2 202 ? 70.049 18.631  -20.230 1.00 38.86  ? 203 ALA A CB    1 
ATOM   1912 N N     . MET B 2 203 ? 71.301 17.288  -22.823 1.00 35.61  ? 204 MET A N     1 
ATOM   1913 C CA    . MET B 2 203 ? 72.435 16.694  -23.523 1.00 28.59  ? 204 MET A CA    1 
ATOM   1914 C C     . MET B 2 203 ? 72.622 17.391  -24.846 1.00 34.66  ? 204 MET A C     1 
ATOM   1915 O O     . MET B 2 203 ? 73.717 17.808  -25.199 1.00 34.30  ? 204 MET A O     1 
ATOM   1916 C CB    . MET B 2 203 ? 72.165 15.201  -23.768 1.00 27.07  ? 204 MET A CB    1 
ATOM   1917 C CG    . MET B 2 203 ? 71.981 14.344  -22.516 1.00 27.25  ? 204 MET A CG    1 
ATOM   1918 S SD    . MET B 2 203 ? 73.499 14.495  -21.592 1.00 32.03  ? 204 MET A SD    1 
ATOM   1919 C CE    . MET B 2 203 ? 73.074 14.391  -19.858 1.00 21.03  ? 204 MET A CE    1 
ATOM   1920 N N     . GLU B 2 204 ? 71.535 17.510  -25.586 1.00 37.43  ? 205 GLU A N     1 
ATOM   1921 C CA    . GLU B 2 204 ? 71.590 18.179  -26.878 1.00 39.08  ? 205 GLU A CA    1 
ATOM   1922 C C     . GLU B 2 204 ? 72.073 19.577  -26.630 1.00 33.55  ? 205 GLU A C     1 
ATOM   1923 O O     . GLU B 2 204 ? 72.849 20.158  -27.381 1.00 30.74  ? 205 GLU A O     1 
ATOM   1924 C CB    . GLU B 2 204 ? 70.187 18.345  -27.441 1.00 40.84  ? 205 GLU A CB    1 
ATOM   1925 C CG    . GLU B 2 204 ? 69.468 17.035  -27.738 1.00 79.17  ? 205 GLU A CG    1 
ATOM   1926 C CD    . GLU B 2 204 ? 68.684 17.058  -29.074 1.00 100.00 ? 205 GLU A CD    1 
ATOM   1927 O OE1   . GLU B 2 204 ? 68.220 18.158  -29.485 1.00 100.00 ? 205 GLU A OE1   1 
ATOM   1928 O OE2   . GLU B 2 204 ? 68.547 15.969  -29.698 1.00 100.00 ? 205 GLU A OE2   1 
ATOM   1929 N N     . GLU B 2 205 ? 71.555 20.147  -25.578 1.00 25.68  ? 206 GLU A N     1 
ATOM   1930 C CA    . GLU B 2 205 ? 71.924 21.497  -25.303 1.00 25.64  ? 206 GLU A CA    1 
ATOM   1931 C C     . GLU B 2 205 ? 73.382 21.506  -25.069 1.00 39.76  ? 206 GLU A C     1 
ATOM   1932 O O     . GLU B 2 205 ? 74.045 22.481  -25.353 1.00 40.11  ? 206 GLU A O     1 
ATOM   1933 C CB    . GLU B 2 205 ? 71.210 21.986  -24.055 1.00 22.43  ? 206 GLU A CB    1 
ATOM   1934 C CG    . GLU B 2 205 ? 69.913 22.651  -24.341 1.00 24.35  ? 206 GLU A CG    1 
ATOM   1935 C CD    . GLU B 2 205 ? 69.269 23.067  -23.078 1.00 67.86  ? 206 GLU A CD    1 
ATOM   1936 O OE1   . GLU B 2 205 ? 69.868 22.695  -22.025 1.00 48.50  ? 206 GLU A OE1   1 
ATOM   1937 O OE2   . GLU B 2 205 ? 68.239 23.788  -23.125 1.00 43.69  ? 206 GLU A OE2   1 
ATOM   1938 N N     . ALA B 2 206 ? 73.891 20.402  -24.561 1.00 40.46  ? 207 ALA A N     1 
ATOM   1939 C CA    . ALA B 2 206 ? 75.289 20.367  -24.263 1.00 38.35  ? 207 ALA A CA    1 
ATOM   1940 C C     . ALA B 2 206 ? 76.096 19.798  -25.363 1.00 40.27  ? 207 ALA A C     1 
ATOM   1941 O O     . ALA B 2 206 ? 77.296 19.651  -25.225 1.00 47.30  ? 207 ALA A O     1 
ATOM   1942 C CB    . ALA B 2 206 ? 75.543 19.624  -22.972 1.00 40.42  ? 207 ALA A CB    1 
ATOM   1943 N N     . MET B 2 207 ? 75.457 19.464  -26.464 1.00 41.10  ? 208 MET A N     1 
ATOM   1944 C CA    . MET B 2 207 ? 76.206 18.881  -27.565 1.00 46.18  ? 208 MET A CA    1 
ATOM   1945 C C     . MET B 2 207 ? 76.759 17.563  -27.049 1.00 47.35  ? 208 MET A C     1 
ATOM   1946 O O     . MET B 2 207 ? 77.841 17.134  -27.428 1.00 50.59  ? 208 MET A O     1 
ATOM   1947 C CB    . MET B 2 207 ? 77.359 19.800  -28.005 1.00 52.57  ? 208 MET A CB    1 
ATOM   1948 C CG    . MET B 2 207 ? 76.921 21.164  -28.549 1.00 63.86  ? 208 MET A CG    1 
ATOM   1949 S SD    . MET B 2 207 ? 77.668 21.528  -30.159 1.00 78.44  ? 208 MET A SD    1 
ATOM   1950 C CE    . MET B 2 207 ? 79.250 20.625  -30.035 1.00 79.67  ? 208 MET A CE    1 
ATOM   1951 N N     . ILE B 2 208 ? 76.019 16.927  -26.154 1.00 35.72  ? 209 ILE A N     1 
ATOM   1952 C CA    . ILE B 2 208 ? 76.460 15.651  -25.647 1.00 30.54  ? 209 ILE A CA    1 
ATOM   1953 C C     . ILE B 2 208 ? 75.756 14.522  -26.419 1.00 43.36  ? 209 ILE A C     1 
ATOM   1954 O O     . ILE B 2 208 ? 74.574 14.618  -26.735 1.00 49.18  ? 209 ILE A O     1 
ATOM   1955 C CB    . ILE B 2 208 ? 76.116 15.487  -24.236 1.00 28.57  ? 209 ILE A CB    1 
ATOM   1956 C CG1   . ILE B 2 208 ? 76.949 16.444  -23.368 1.00 24.84  ? 209 ILE A CG1   1 
ATOM   1957 C CG2   . ILE B 2 208 ? 76.333 14.012  -23.884 1.00 23.32  ? 209 ILE A CG2   1 
ATOM   1958 C CD1   . ILE B 2 208 ? 77.725 15.705  -22.251 1.00 17.18  ? 209 ILE A CD1   1 
ATOM   1959 N N     . LYS B 2 209 ? 76.471 13.457  -26.721 1.00 43.02  ? 210 LYS A N     1 
ATOM   1960 C CA    . LYS B 2 209 ? 75.882 12.369  -27.477 1.00 45.50  ? 210 LYS A CA    1 
ATOM   1961 C C     . LYS B 2 209 ? 75.799 11.139  -26.663 1.00 48.97  ? 210 LYS A C     1 
ATOM   1962 O O     . LYS B 2 209 ? 76.818 10.635  -26.210 1.00 53.96  ? 210 LYS A O     1 
ATOM   1963 C CB    . LYS B 2 209 ? 76.799 12.019  -28.641 1.00 52.98  ? 210 LYS A CB    1 
ATOM   1964 C CG    . LYS B 2 209 ? 76.166 12.122  -30.017 1.00 100.00 ? 210 LYS A CG    1 
ATOM   1965 C CD    . LYS B 2 209 ? 76.881 13.175  -30.917 1.00 100.00 ? 210 LYS A CD    1 
ATOM   1966 C CE    . LYS B 2 209 ? 78.399 12.902  -31.093 1.00 100.00 ? 210 LYS A CE    1 
ATOM   1967 N NZ    . LYS B 2 209 ? 78.946 13.513  -32.359 1.00 100.00 ? 210 LYS A NZ    1 
ATOM   1968 N N     . VAL B 2 210 ? 74.613 10.599  -26.505 1.00 41.04  ? 211 VAL A N     1 
ATOM   1969 C CA    . VAL B 2 210 ? 74.553 9.358   -25.768 1.00 38.11  ? 211 VAL A CA    1 
ATOM   1970 C C     . VAL B 2 210 ? 74.539 8.149   -26.710 1.00 41.22  ? 211 VAL A C     1 
ATOM   1971 O O     . VAL B 2 210 ? 73.616 7.941   -27.479 1.00 43.07  ? 211 VAL A O     1 
ATOM   1972 C CB    . VAL B 2 210 ? 73.446 9.298   -24.723 1.00 37.23  ? 211 VAL A CB    1 
ATOM   1973 C CG1   . VAL B 2 210 ? 73.513 7.957   -24.036 1.00 34.92  ? 211 VAL A CG1   1 
ATOM   1974 C CG2   . VAL B 2 210 ? 73.552 10.477  -23.713 1.00 35.17  ? 211 VAL A CG2   1 
ATOM   1975 N N     . PRO B 2 211 ? 75.612 7.388   -26.660 1.00 38.71  ? 212 PRO A N     1 
ATOM   1976 C CA    . PRO B 2 211 ? 75.794 6.167   -27.463 1.00 39.18  ? 212 PRO A CA    1 
ATOM   1977 C C     . PRO B 2 211 ? 74.722 5.211   -26.997 1.00 45.16  ? 212 PRO A C     1 
ATOM   1978 O O     . PRO B 2 211 ? 74.458 5.098   -25.791 1.00 40.27  ? 212 PRO A O     1 
ATOM   1979 C CB    . PRO B 2 211 ? 77.147 5.642   -26.991 1.00 38.50  ? 212 PRO A CB    1 
ATOM   1980 C CG    . PRO B 2 211 ? 77.314 6.214   -25.625 1.00 40.93  ? 212 PRO A CG    1 
ATOM   1981 C CD    . PRO B 2 211 ? 76.698 7.593   -25.701 1.00 35.62  ? 212 PRO A CD    1 
ATOM   1982 N N     . GLU B 2 212 ? 74.073 4.547   -27.937 1.00 47.98  ? 213 GLU A N     1 
ATOM   1983 C CA    . GLU B 2 212 ? 72.994 3.673   -27.545 1.00 47.68  ? 213 GLU A CA    1 
ATOM   1984 C C     . GLU B 2 212 ? 73.406 2.516   -26.691 1.00 52.23  ? 213 GLU A C     1 
ATOM   1985 O O     . GLU B 2 212 ? 72.587 1.943   -25.966 1.00 57.42  ? 213 GLU A O     1 
ATOM   1986 C CB    . GLU B 2 212 ? 72.049 3.333   -28.684 1.00 50.99  ? 213 GLU A CB    1 
ATOM   1987 C CG    . GLU B 2 212 ? 72.729 3.085   -30.027 1.00 91.17  ? 213 GLU A CG    1 
ATOM   1988 C CD    . GLU B 2 212 ? 72.474 1.646   -30.554 1.00 100.00 ? 213 GLU A CD    1 
ATOM   1989 O OE1   . GLU B 2 212 ? 71.379 1.086   -30.254 1.00 100.00 ? 213 GLU A OE1   1 
ATOM   1990 O OE2   . GLU B 2 212 ? 73.379 1.059   -31.226 1.00 100.00 ? 213 GLU A OE2   1 
ATOM   1991 N N     . SER B 2 213 ? 74.697 2.202   -26.711 1.00 40.14  ? 214 SER A N     1 
ATOM   1992 C CA    . SER B 2 213 ? 75.188 1.112   -25.869 1.00 36.01  ? 214 SER A CA    1 
ATOM   1993 C C     . SER B 2 213 ? 75.100 1.595   -24.456 1.00 40.07  ? 214 SER A C     1 
ATOM   1994 O O     . SER B 2 213 ? 75.218 0.841   -23.500 1.00 40.72  ? 214 SER A O     1 
ATOM   1995 C CB    . SER B 2 213 ? 76.627 0.831   -26.180 1.00 40.63  ? 214 SER A CB    1 
ATOM   1996 O OG    . SER B 2 213 ? 77.182 1.925   -26.879 1.00 90.30  ? 214 SER A OG    1 
ATOM   1997 N N     . TRP B 2 214 ? 74.886 2.876   -24.317 1.00 39.90  ? 215 TRP A N     1 
ATOM   1998 C CA    . TRP B 2 214 ? 74.817 3.400   -23.002 1.00 43.78  ? 215 TRP A CA    1 
ATOM   1999 C C     . TRP B 2 214 ? 73.408 3.654   -22.504 1.00 46.68  ? 215 TRP A C     1 
ATOM   2000 O O     . TRP B 2 214 ? 73.211 4.199   -21.413 1.00 45.62  ? 215 TRP A O     1 
ATOM   2001 C CB    . TRP B 2 214 ? 75.690 4.618   -22.951 1.00 45.05  ? 215 TRP A CB    1 
ATOM   2002 C CG    . TRP B 2 214 ? 77.123 4.265   -22.682 1.00 49.12  ? 215 TRP A CG    1 
ATOM   2003 C CD1   . TRP B 2 214 ? 77.638 3.034   -22.524 1.00 53.93  ? 215 TRP A CD1   1 
ATOM   2004 C CD2   . TRP B 2 214 ? 78.196 5.184   -22.579 1.00 49.33  ? 215 TRP A CD2   1 
ATOM   2005 N NE1   . TRP B 2 214 ? 78.997 3.128   -22.232 1.00 54.33  ? 215 TRP A NE1   1 
ATOM   2006 C CE2   . TRP B 2 214 ? 79.353 4.447   -22.305 1.00 52.61  ? 215 TRP A CE2   1 
ATOM   2007 C CE3   . TRP B 2 214 ? 78.297 6.562   -22.658 1.00 50.89  ? 215 TRP A CE3   1 
ATOM   2008 C CZ2   . TRP B 2 214 ? 80.580 5.032   -22.140 1.00 49.81  ? 215 TRP A CZ2   1 
ATOM   2009 C CZ3   . TRP B 2 214 ? 79.528 7.144   -22.499 1.00 50.77  ? 215 TRP A CZ3   1 
ATOM   2010 C CH2   . TRP B 2 214 ? 80.642 6.383   -22.244 1.00 51.51  ? 215 TRP A CH2   1 
ATOM   2011 N N     . ILE B 2 215 ? 72.419 3.230   -23.288 1.00 43.82  ? 216 ILE A N     1 
ATOM   2012 C CA    . ILE B 2 215 ? 71.013 3.408   -22.886 1.00 42.30  ? 216 ILE A CA    1 
ATOM   2013 C C     . ILE B 2 215 ? 70.337 2.133   -22.534 1.00 37.13  ? 216 ILE A C     1 
ATOM   2014 O O     . ILE B 2 215 ? 70.239 1.243   -23.364 1.00 40.26  ? 216 ILE A O     1 
ATOM   2015 C CB    . ILE B 2 215 ? 70.202 4.033   -23.940 1.00 43.61  ? 216 ILE A CB    1 
ATOM   2016 C CG1   . ILE B 2 215 ? 71.026 5.190   -24.536 1.00 46.08  ? 216 ILE A CG1   1 
ATOM   2017 C CG2   . ILE B 2 215 ? 68.840 4.408   -23.343 1.00 30.78  ? 216 ILE A CG2   1 
ATOM   2018 C CD1   . ILE B 2 215 ? 70.372 5.934   -25.690 1.00 64.68  ? 216 ILE A CD1   1 
ATOM   2019 N N     . VAL B 2 216 ? 69.863 2.005   -21.307 1.00 26.74  ? 217 VAL A N     1 
ATOM   2020 C CA    . VAL B 2 216 ? 69.244 0.726   -20.991 1.00 26.32  ? 217 VAL A CA    1 
ATOM   2021 C C     . VAL B 2 216 ? 68.021 0.783   -20.167 1.00 34.00  ? 217 VAL A C     1 
ATOM   2022 O O     . VAL B 2 216 ? 68.039 1.144   -18.982 1.00 26.79  ? 217 VAL A O     1 
ATOM   2023 C CB    . VAL B 2 216 ? 70.224 -0.281  -20.397 1.00 27.99  ? 217 VAL A CB    1 
ATOM   2024 C CG1   . VAL B 2 216 ? 69.670 -1.660  -20.503 1.00 23.73  ? 217 VAL A CG1   1 
ATOM   2025 C CG2   . VAL B 2 216 ? 71.597 -0.164  -21.060 1.00 26.15  ? 217 VAL A CG2   1 
ATOM   2026 N N     . GLN B 2 217 ? 66.962 0.404   -20.851 1.00 38.84  ? 218 GLN A N     1 
ATOM   2027 C CA    . GLN B 2 217 ? 65.605 0.338   -20.381 1.00 37.80  ? 218 GLN A CA    1 
ATOM   2028 C C     . GLN B 2 217 ? 65.453 -0.504  -19.146 1.00 33.86  ? 218 GLN A C     1 
ATOM   2029 O O     . GLN B 2 217 ? 65.913 -1.644  -19.108 1.00 36.16  ? 218 GLN A O     1 
ATOM   2030 C CB    . GLN B 2 217 ? 64.792 -0.349  -21.469 1.00 40.66  ? 218 GLN A CB    1 
ATOM   2031 C CG    . GLN B 2 217 ? 63.325 -0.262  -21.295 1.00 76.93  ? 218 GLN A CG    1 
ATOM   2032 C CD    . GLN B 2 217 ? 62.916 1.146   -21.313 1.00 84.03  ? 218 GLN A CD    1 
ATOM   2033 O OE1   . GLN B 2 217 ? 63.023 1.806   -22.345 1.00 81.46  ? 218 GLN A OE1   1 
ATOM   2034 N NE2   . GLN B 2 217 ? 62.674 1.692   -20.138 1.00 62.01  ? 218 GLN A NE2   1 
ATOM   2035 N N     . GLY B 2 218 ? 64.779 0.052   -18.148 1.00 27.06  ? 219 GLY A N     1 
ATOM   2036 C CA    . GLY B 2 218 ? 64.502 -0.651  -16.894 1.00 28.96  ? 219 GLY A CA    1 
ATOM   2037 C C     . GLY B 2 218 ? 62.972 -0.842  -16.745 1.00 40.10  ? 219 GLY A C     1 
ATOM   2038 O O     . GLY B 2 218 ? 62.176 -0.539  -17.663 1.00 40.56  ? 219 GLY A O     1 
ATOM   2039 N N     . ASP B 2 219 ? 62.532 -1.350  -15.606 1.00 33.65  ? 220 ASP A N     1 
ATOM   2040 C CA    . ASP B 2 219 ? 61.094 -1.535  -15.482 1.00 27.18  ? 220 ASP A CA    1 
ATOM   2041 C C     . ASP B 2 219 ? 60.657 -0.983  -14.156 1.00 36.13  ? 220 ASP A C     1 
ATOM   2042 O O     . ASP B 2 219 ? 59.578 -1.310  -13.676 1.00 44.79  ? 220 ASP A O     1 
ATOM   2043 C CB    . ASP B 2 219 ? 60.755 -3.027  -15.561 1.00 21.83  ? 220 ASP A CB    1 
ATOM   2044 C CG    . ASP B 2 219 ? 61.463 -3.835  -14.491 1.00 46.43  ? 220 ASP A CG    1 
ATOM   2045 O OD1   . ASP B 2 219 ? 62.109 -3.273  -13.574 1.00 36.64  ? 220 ASP A OD1   1 
ATOM   2046 O OD2   . ASP B 2 219 ? 61.411 -5.061  -14.587 1.00 64.69  ? 220 ASP A OD2   1 
ATOM   2047 N N     . PHE B 2 220 ? 61.518 -0.154  -13.567 1.00 28.42  ? 221 PHE A N     1 
ATOM   2048 C CA    . PHE B 2 220 ? 61.309 0.466   -12.250 1.00 26.80  ? 221 PHE A CA    1 
ATOM   2049 C C     . PHE B 2 220 ? 61.643 -0.533  -11.161 1.00 39.62  ? 221 PHE A C     1 
ATOM   2050 O O     . PHE B 2 220 ? 61.583 -0.239  -9.990  1.00 42.30  ? 221 PHE A O     1 
ATOM   2051 C CB    . PHE B 2 220 ? 59.913 1.006   -12.078 1.00 29.34  ? 221 PHE A CB    1 
ATOM   2052 C CG    . PHE B 2 220 ? 59.660 2.209   -12.881 1.00 34.09  ? 221 PHE A CG    1 
ATOM   2053 C CD1   . PHE B 2 220 ? 60.419 3.345   -12.700 1.00 40.46  ? 221 PHE A CD1   1 
ATOM   2054 C CD2   . PHE B 2 220 ? 58.701 2.191   -13.862 1.00 37.94  ? 221 PHE A CD2   1 
ATOM   2055 C CE1   . PHE B 2 220 ? 60.203 4.463   -13.472 1.00 41.32  ? 221 PHE A CE1   1 
ATOM   2056 C CE2   . PHE B 2 220 ? 58.472 3.295   -14.635 1.00 39.23  ? 221 PHE A CE2   1 
ATOM   2057 C CZ    . PHE B 2 220 ? 59.225 4.437   -14.437 1.00 39.57  ? 221 PHE A CZ    1 
ATOM   2058 N N     . GLU B 2 221 ? 62.016 -1.725  -11.573 1.00 41.83  ? 222 GLU A N     1 
ATOM   2059 C CA    . GLU B 2 221 ? 62.378 -2.745  -10.632 1.00 39.62  ? 222 GLU A CA    1 
ATOM   2060 C C     . GLU B 2 221 ? 63.925 -2.958  -10.517 1.00 35.31  ? 222 GLU A C     1 
ATOM   2061 O O     . GLU B 2 221 ? 64.721 -3.050  -11.490 1.00 25.96  ? 222 GLU A O     1 
ATOM   2062 C CB    . GLU B 2 221 ? 61.622 -4.024  -10.938 1.00 41.88  ? 222 GLU A CB    1 
ATOM   2063 C CG    . GLU B 2 221 ? 60.118 -3.896  -10.782 1.00 59.64  ? 222 GLU A CG    1 
ATOM   2064 C CD    . GLU B 2 221 ? 59.565 -4.757  -9.634  1.00 100.00 ? 222 GLU A CD    1 
ATOM   2065 O OE1   . GLU B 2 221 ? 59.985 -4.553  -8.472  1.00 100.00 ? 222 GLU A OE1   1 
ATOM   2066 O OE2   . GLU B 2 221 ? 58.731 -5.661  -9.887  1.00 100.00 ? 222 GLU A OE2   1 
ATOM   2067 N N     . PRO B 2 222 ? 64.319 -3.018  -9.277  1.00 30.01  ? 223 PRO A N     1 
ATOM   2068 C CA    . PRO B 2 222 ? 65.700 -3.232  -8.897  1.00 31.51  ? 223 PRO A CA    1 
ATOM   2069 C C     . PRO B 2 222 ? 66.446 -4.278  -9.691  1.00 32.31  ? 223 PRO A C     1 
ATOM   2070 O O     . PRO B 2 222 ? 67.652 -4.185  -9.849  1.00 31.91  ? 223 PRO A O     1 
ATOM   2071 C CB    . PRO B 2 222 ? 65.608 -3.696  -7.445  1.00 32.08  ? 223 PRO A CB    1 
ATOM   2072 C CG    . PRO B 2 222 ? 64.155 -3.760  -7.108  1.00 36.62  ? 223 PRO A CG    1 
ATOM   2073 C CD    . PRO B 2 222 ? 63.365 -3.631  -8.367  1.00 29.77  ? 223 PRO A CD    1 
ATOM   2074 N N     . GLU B 2 223 ? 65.777 -5.297  -10.166 1.00 28.40  ? 224 GLU A N     1 
ATOM   2075 C CA    . GLU B 2 223 ? 66.590 -6.211  -10.887 1.00 29.87  ? 224 GLU A CA    1 
ATOM   2076 C C     . GLU B 2 223 ? 66.978 -5.517  -12.160 1.00 30.93  ? 224 GLU A C     1 
ATOM   2077 O O     . GLU B 2 223 ? 68.137 -5.604  -12.589 1.00 24.82  ? 224 GLU A O     1 
ATOM   2078 C CB    . GLU B 2 223 ? 65.846 -7.457  -11.255 1.00 32.01  ? 224 GLU A CB    1 
ATOM   2079 C CG    . GLU B 2 223 ? 66.617 -8.306  -12.269 1.00 53.06  ? 224 GLU A CG    1 
ATOM   2080 C CD    . GLU B 2 223 ? 67.530 -9.393  -11.609 1.00 100.00 ? 224 GLU A CD    1 
ATOM   2081 O OE1   . GLU B 2 223 ? 67.026 -10.508 -11.329 1.00 100.00 ? 224 GLU A OE1   1 
ATOM   2082 O OE2   . GLU B 2 223 ? 68.749 -9.132  -11.423 1.00 100.00 ? 224 GLU A OE2   1 
ATOM   2083 N N     . SER B 2 224 ? 66.009 -4.803  -12.738 1.00 25.97  ? 225 SER A N     1 
ATOM   2084 C CA    . SER B 2 224 ? 66.229 -4.113  -14.001 1.00 26.47  ? 225 SER A CA    1 
ATOM   2085 C C     . SER B 2 224 ? 67.395 -3.196  -13.889 1.00 34.25  ? 225 SER A C     1 
ATOM   2086 O O     . SER B 2 224 ? 68.249 -3.131  -14.787 1.00 33.45  ? 225 SER A O     1 
ATOM   2087 C CB    . SER B 2 224 ? 64.963 -3.411  -14.538 1.00 32.63  ? 225 SER A CB    1 
ATOM   2088 O OG    . SER B 2 224 ? 64.655 -2.212  -13.861 1.00 39.57  ? 225 SER A OG    1 
ATOM   2089 N N     . GLY B 2 225 ? 67.474 -2.530  -12.736 1.00 37.13  ? 226 GLY A N     1 
ATOM   2090 C CA    . GLY B 2 225 ? 68.577 -1.611  -12.438 1.00 35.25  ? 226 GLY A CA    1 
ATOM   2091 C C     . GLY B 2 225 ? 69.853 -2.417  -12.599 1.00 33.79  ? 226 GLY A C     1 
ATOM   2092 O O     . GLY B 2 225 ? 70.630 -2.207  -13.558 1.00 34.34  ? 226 GLY A O     1 
ATOM   2093 N N     . TYR B 2 226 ? 70.006 -3.355  -11.664 1.00 28.65  ? 227 TYR A N     1 
ATOM   2094 C CA    . TYR B 2 226 ? 71.094 -4.313  -11.607 1.00 28.57  ? 227 TYR A CA    1 
ATOM   2095 C C     . TYR B 2 226 ? 71.565 -4.682  -13.032 1.00 35.67  ? 227 TYR A C     1 
ATOM   2096 O O     . TYR B 2 226 ? 72.637 -4.243  -13.507 1.00 38.84  ? 227 TYR A O     1 
ATOM   2097 C CB    . TYR B 2 226 ? 70.580 -5.566  -10.925 1.00 31.69  ? 227 TYR A CB    1 
ATOM   2098 C CG    . TYR B 2 226 ? 71.720 -6.356  -10.338 1.00 42.68  ? 227 TYR A CG    1 
ATOM   2099 C CD1   . TYR B 2 226 ? 72.168 -6.099  -9.044  1.00 45.91  ? 227 TYR A CD1   1 
ATOM   2100 C CD2   . TYR B 2 226 ? 72.389 -7.324  -11.089 1.00 43.25  ? 227 TYR A CD2   1 
ATOM   2101 C CE1   . TYR B 2 226 ? 73.234 -6.788  -8.503  1.00 40.25  ? 227 TYR A CE1   1 
ATOM   2102 C CE2   . TYR B 2 226 ? 73.452 -8.020  -10.557 1.00 43.21  ? 227 TYR A CE2   1 
ATOM   2103 C CZ    . TYR B 2 226 ? 73.868 -7.742  -9.260  1.00 54.00  ? 227 TYR A CZ    1 
ATOM   2104 O OH    . TYR B 2 226 ? 74.918 -8.434  -8.694  1.00 57.52  ? 227 TYR A OH    1 
ATOM   2105 N N     . ARG B 2 227 ? 70.740 -5.405  -13.751 1.00 26.13  ? 228 ARG A N     1 
ATOM   2106 C CA    . ARG B 2 227 ? 71.120 -5.753  -15.084 1.00 28.25  ? 228 ARG A CA    1 
ATOM   2107 C C     . ARG B 2 227 ? 71.505 -4.570  -16.007 1.00 34.74  ? 228 ARG A C     1 
ATOM   2108 O O     . ARG B 2 227 ? 72.455 -4.690  -16.813 1.00 27.78  ? 228 ARG A O     1 
ATOM   2109 C CB    . ARG B 2 227 ? 70.029 -6.603  -15.709 1.00 39.86  ? 228 ARG A CB    1 
ATOM   2110 C CG    . ARG B 2 227 ? 69.533 -7.729  -14.825 1.00 58.14  ? 228 ARG A CG    1 
ATOM   2111 C CD    . ARG B 2 227 ? 67.998 -7.810  -14.934 1.00 100.00 ? 228 ARG A CD    1 
ATOM   2112 N NE    . ARG B 2 227 ? 67.438 -9.126  -15.287 1.00 100.00 ? 228 ARG A NE    1 
ATOM   2113 C CZ    . ARG B 2 227 ? 67.934 -10.304 -14.895 1.00 100.00 ? 228 ARG A CZ    1 
ATOM   2114 N NH1   . ARG B 2 227 ? 69.045 -10.383 -14.145 1.00 100.00 ? 228 ARG A NH1   1 
ATOM   2115 N NH2   . ARG B 2 227 ? 67.304 -11.418 -15.278 1.00 100.00 ? 228 ARG A NH2   1 
ATOM   2116 N N     . ALA B 2 228 ? 70.807 -3.433  -15.904 1.00 30.72  ? 229 ALA A N     1 
ATOM   2117 C CA    . ALA B 2 228 ? 71.187 -2.341  -16.795 1.00 24.64  ? 229 ALA A CA    1 
ATOM   2118 C C     . ALA B 2 228 ? 72.616 -1.850  -16.499 1.00 30.30  ? 229 ALA A C     1 
ATOM   2119 O O     . ALA B 2 228 ? 73.478 -1.760  -17.392 1.00 27.59  ? 229 ALA A O     1 
ATOM   2120 C CB    . ALA B 2 228 ? 70.216 -1.249  -16.722 1.00 20.96  ? 229 ALA A CB    1 
ATOM   2121 N N     . MET B 2 229 ? 72.848 -1.558  -15.233 1.00 20.59  ? 230 MET A N     1 
ATOM   2122 C CA    . MET B 2 229 ? 74.105 -1.079  -14.812 1.00 22.31  ? 230 MET A CA    1 
ATOM   2123 C C     . MET B 2 229 ? 75.095 -2.058  -15.267 1.00 41.84  ? 230 MET A C     1 
ATOM   2124 O O     . MET B 2 229 ? 76.067 -1.691  -15.908 1.00 50.81  ? 230 MET A O     1 
ATOM   2125 C CB    . MET B 2 229 ? 74.122 -1.008  -13.296 1.00 26.34  ? 230 MET A CB    1 
ATOM   2126 C CG    . MET B 2 229 ? 75.291 -0.243  -12.731 1.00 30.16  ? 230 MET A CG    1 
ATOM   2127 S SD    . MET B 2 229 ? 75.495 1.369   -13.516 1.00 38.36  ? 230 MET A SD    1 
ATOM   2128 C CE    . MET B 2 229 ? 75.903 2.200   -11.959 1.00 30.24  ? 230 MET A CE    1 
ATOM   2129 N N     . GLN B 2 230 ? 74.809 -3.325  -15.002 1.00 40.44  ? 231 GLN A N     1 
ATOM   2130 C CA    . GLN B 2 230 ? 75.727 -4.397  -15.379 1.00 42.93  ? 231 GLN A CA    1 
ATOM   2131 C C     . GLN B 2 230 ? 76.070 -4.320  -16.816 1.00 45.99  ? 231 GLN A C     1 
ATOM   2132 O O     . GLN B 2 230 ? 77.215 -4.277  -17.214 1.00 47.18  ? 231 GLN A O     1 
ATOM   2133 C CB    . GLN B 2 230 ? 75.072 -5.710  -15.113 1.00 46.58  ? 231 GLN A CB    1 
ATOM   2134 C CG    . GLN B 2 230 ? 75.808 -6.927  -15.579 1.00 93.51  ? 231 GLN A CG    1 
ATOM   2135 C CD    . GLN B 2 230 ? 75.203 -8.185  -14.968 1.00 100.00 ? 231 GLN A CD    1 
ATOM   2136 O OE1   . GLN B 2 230 ? 75.149 -8.335  -13.724 1.00 63.59  ? 231 GLN A OE1   1 
ATOM   2137 N NE2   . GLN B 2 230 ? 74.625 -9.045  -15.824 1.00 85.63  ? 231 GLN A NE2   1 
ATOM   2138 N N     . GLN B 2 231 ? 75.049 -4.276  -17.620 1.00 43.55  ? 232 GLN A N     1 
ATOM   2139 C CA    . GLN B 2 231 ? 75.280 -4.193  -19.023 1.00 44.54  ? 232 GLN A CA    1 
ATOM   2140 C C     . GLN B 2 231 ? 76.068 -2.932  -19.402 1.00 54.73  ? 232 GLN A C     1 
ATOM   2141 O O     . GLN B 2 231 ? 76.785 -2.932  -20.402 1.00 59.02  ? 232 GLN A O     1 
ATOM   2142 C CB    . GLN B 2 231 ? 73.951 -4.226  -19.737 1.00 45.30  ? 232 GLN A CB    1 
ATOM   2143 C CG    . GLN B 2 231 ? 73.629 -5.564  -20.362 1.00 94.87  ? 232 GLN A CG    1 
ATOM   2144 C CD    . GLN B 2 231 ? 72.576 -5.445  -21.459 1.00 100.00 ? 232 GLN A CD    1 
ATOM   2145 O OE1   . GLN B 2 231 ? 72.622 -4.534  -22.293 1.00 82.19  ? 232 GLN A OE1   1 
ATOM   2146 N NE2   . GLN B 2 231 ? 71.602 -6.348  -21.441 1.00 100.00 ? 232 GLN A NE2   1 
ATOM   2147 N N     . ILE B 2 232 ? 75.959 -1.855  -18.631 1.00 45.15  ? 233 ILE A N     1 
ATOM   2148 C CA    . ILE B 2 232 ? 76.727 -0.676  -19.028 1.00 46.94  ? 233 ILE A CA    1 
ATOM   2149 C C     . ILE B 2 232 ? 78.204 -0.755  -18.652 1.00 53.92  ? 233 ILE A C     1 
ATOM   2150 O O     . ILE B 2 232 ? 79.068 -0.373  -19.437 1.00 53.33  ? 233 ILE A O     1 
ATOM   2151 C CB    . ILE B 2 232 ? 76.229 0.675   -18.419 1.00 49.02  ? 233 ILE A CB    1 
ATOM   2152 C CG1   . ILE B 2 232 ? 74.954 1.152   -19.076 1.00 42.23  ? 233 ILE A CG1   1 
ATOM   2153 C CG2   . ILE B 2 232 ? 77.281 1.763   -18.636 1.00 52.59  ? 233 ILE A CG2   1 
ATOM   2154 C CD1   . ILE B 2 232 ? 73.949 1.547   -18.064 1.00 27.24  ? 233 ILE A CD1   1 
ATOM   2155 N N     . LEU B 2 233 ? 78.481 -1.202  -17.429 1.00 52.70  ? 234 LEU A N     1 
ATOM   2156 C CA    . LEU B 2 233 ? 79.850 -1.276  -16.953 1.00 56.98  ? 234 LEU A CA    1 
ATOM   2157 C C     . LEU B 2 233 ? 80.553 -2.460  -17.538 1.00 70.98  ? 234 LEU A C     1 
ATOM   2158 O O     . LEU B 2 233 ? 81.759 -2.607  -17.389 1.00 73.01  ? 234 LEU A O     1 
ATOM   2159 C CB    . LEU B 2 233 ? 79.912 -1.293  -15.421 1.00 55.81  ? 234 LEU A CB    1 
ATOM   2160 C CG    . LEU B 2 233 ? 79.046 -0.144  -14.929 1.00 63.12  ? 234 LEU A CG    1 
ATOM   2161 C CD1   . LEU B 2 233 ? 79.433 0.294   -13.544 1.00 64.13  ? 234 LEU A CD1   1 
ATOM   2162 C CD2   . LEU B 2 233 ? 79.244 1.003   -15.907 1.00 71.78  ? 234 LEU A CD2   1 
ATOM   2163 N N     . SER B 2 234 ? 79.796 -3.314  -18.215 1.00 69.30  ? 235 SER A N     1 
ATOM   2164 C CA    . SER B 2 234 ? 80.376 -4.507  -18.806 1.00 68.78  ? 235 SER A CA    1 
ATOM   2165 C C     . SER B 2 234 ? 80.846 -4.277  -20.208 1.00 81.58  ? 235 SER A C     1 
ATOM   2166 O O     . SER B 2 234 ? 80.764 -5.188  -21.028 1.00 86.58  ? 235 SER A O     1 
ATOM   2167 C CB    . SER B 2 234 ? 79.369 -5.647  -18.807 1.00 68.18  ? 235 SER A CB    1 
ATOM   2168 O OG    . SER B 2 234 ? 79.786 -6.664  -17.898 1.00 91.58  ? 235 SER A OG    1 
ATOM   2169 N N     . GLN B 2 235 ? 81.326 -3.073  -20.500 1.00 73.65  ? 236 GLN A N     1 
ATOM   2170 C CA    . GLN B 2 235 ? 81.779 -2.776  -21.853 1.00 66.72  ? 236 GLN A CA    1 
ATOM   2171 C C     . GLN B 2 235 ? 83.013 -1.910  -21.888 1.00 69.56  ? 236 GLN A C     1 
ATOM   2172 O O     . GLN B 2 235 ? 83.203 -1.115  -20.993 1.00 71.04  ? 236 GLN A O     1 
ATOM   2173 C CB    . GLN B 2 235 ? 80.623 -2.275  -22.714 1.00 67.04  ? 236 GLN A CB    1 
ATOM   2174 C CG    . GLN B 2 235 ? 79.874 -1.076  -22.252 1.00 50.58  ? 236 GLN A CG    1 
ATOM   2175 C CD    . GLN B 2 235 ? 78.809 -0.751  -23.239 1.00 69.44  ? 236 GLN A CD    1 
ATOM   2176 O OE1   . GLN B 2 235 ? 78.783 0.338   -23.806 1.00 92.15  ? 236 GLN A OE1   1 
ATOM   2177 N NE2   . GLN B 2 235 ? 77.985 -1.743  -23.548 1.00 83.77  ? 236 GLN A NE2   1 
ATOM   2178 N N     . PRO B 2 236 ? 83.869 -2.108  -22.902 1.00 74.73  ? 237 PRO A N     1 
ATOM   2179 C CA    . PRO B 2 236 ? 85.166 -1.425  -23.069 1.00 74.84  ? 237 PRO A CA    1 
ATOM   2180 C C     . PRO B 2 236 ? 85.301 -0.047  -22.484 1.00 76.51  ? 237 PRO A C     1 
ATOM   2181 O O     . PRO B 2 236 ? 86.099 0.202   -21.571 1.00 75.46  ? 237 PRO A O     1 
ATOM   2182 C CB    . PRO B 2 236 ? 85.260 -1.282  -24.584 1.00 77.21  ? 237 PRO A CB    1 
ATOM   2183 C CG    . PRO B 2 236 ? 83.846 -1.070  -24.997 1.00 81.43  ? 237 PRO A CG    1 
ATOM   2184 C CD    . PRO B 2 236 ? 83.136 -2.112  -24.184 1.00 77.01  ? 237 PRO A CD    1 
ATOM   2185 N N     . HIS B 2 237 ? 84.505 0.836   -23.067 1.00 74.62  ? 238 HIS A N     1 
ATOM   2186 C CA    . HIS B 2 237 ? 84.416 2.226   -22.720 1.00 75.80  ? 238 HIS A CA    1 
ATOM   2187 C C     . HIS B 2 237 ? 83.121 2.379   -21.906 1.00 65.65  ? 238 HIS A C     1 
ATOM   2188 O O     . HIS B 2 237 ? 82.039 1.942   -22.338 1.00 63.61  ? 238 HIS A O     1 
ATOM   2189 C CB    . HIS B 2 237 ? 84.294 3.009   -24.040 1.00 82.75  ? 238 HIS A CB    1 
ATOM   2190 C CG    . HIS B 2 237 ? 84.396 4.495   -23.883 1.00 93.82  ? 238 HIS A CG    1 
ATOM   2191 N ND1   . HIS B 2 237 ? 84.003 5.378   -24.871 1.00 99.62  ? 238 HIS A ND1   1 
ATOM   2192 C CD2   . HIS B 2 237 ? 84.846 5.259   -22.854 1.00 100.00 ? 238 HIS A CD2   1 
ATOM   2193 C CE1   . HIS B 2 237 ? 84.207 6.621   -24.457 1.00 100.00 ? 238 HIS A CE1   1 
ATOM   2194 N NE2   . HIS B 2 237 ? 84.712 6.577   -23.235 1.00 100.00 ? 238 HIS A NE2   1 
ATOM   2195 N N     . ARG B 2 238 ? 83.211 2.988   -20.728 1.00 48.05  ? 239 ARG A N     1 
ATOM   2196 C CA    . ARG B 2 238 ? 81.999 3.184   -19.944 1.00 42.45  ? 239 ARG A CA    1 
ATOM   2197 C C     . ARG B 2 238 ? 81.836 4.650   -19.511 1.00 41.63  ? 239 ARG A C     1 
ATOM   2198 O O     . ARG B 2 238 ? 82.809 5.367   -19.345 1.00 50.89  ? 239 ARG A O     1 
ATOM   2199 C CB    . ARG B 2 238 ? 81.931 2.221   -18.765 1.00 32.42  ? 239 ARG A CB    1 
ATOM   2200 C CG    . ARG B 2 238 ? 83.121 2.285   -17.900 1.00 44.75  ? 239 ARG A CG    1 
ATOM   2201 C CD    . ARG B 2 238 ? 82.745 1.971   -16.481 1.00 69.41  ? 239 ARG A CD    1 
ATOM   2202 N NE    . ARG B 2 238 ? 83.438 0.800   -15.923 1.00 100.00 ? 239 ARG A NE    1 
ATOM   2203 C CZ    . ARG B 2 238 ? 83.652 -0.350  -16.565 1.00 100.00 ? 239 ARG A CZ    1 
ATOM   2204 N NH1   . ARG B 2 238 ? 83.246 -0.507  -17.826 1.00 100.00 ? 239 ARG A NH1   1 
ATOM   2205 N NH2   . ARG B 2 238 ? 84.287 -1.345  -15.938 1.00 100.00 ? 239 ARG A NH2   1 
ATOM   2206 N N     . PRO B 2 239 ? 80.596 5.099   -19.338 1.00 32.28  ? 240 PRO A N     1 
ATOM   2207 C CA    . PRO B 2 239 ? 80.335 6.468   -18.940 1.00 31.56  ? 240 PRO A CA    1 
ATOM   2208 C C     . PRO B 2 239 ? 80.952 6.751   -17.562 1.00 35.88  ? 240 PRO A C     1 
ATOM   2209 O O     . PRO B 2 239 ? 81.322 5.795   -16.816 1.00 29.41  ? 240 PRO A O     1 
ATOM   2210 C CB    . PRO B 2 239 ? 78.805 6.489   -18.809 1.00 29.04  ? 240 PRO A CB    1 
ATOM   2211 C CG    . PRO B 2 239 ? 78.372 5.052   -18.863 1.00 31.28  ? 240 PRO A CG    1 
ATOM   2212 C CD    . PRO B 2 239 ? 79.595 4.224   -18.724 1.00 30.86  ? 240 PRO A CD    1 
ATOM   2213 N N     . THR B 2 240 ? 81.067 8.041   -17.219 1.00 25.69  ? 241 THR A N     1 
ATOM   2214 C CA    . THR B 2 240 ? 81.630 8.379   -15.917 1.00 23.24  ? 241 THR A CA    1 
ATOM   2215 C C     . THR B 2 240 ? 80.488 8.642   -14.986 1.00 39.10  ? 241 THR A C     1 
ATOM   2216 O O     . THR B 2 240 ? 80.645 8.851   -13.776 1.00 43.23  ? 241 THR A O     1 
ATOM   2217 C CB    . THR B 2 240 ? 82.570 9.548   -15.988 1.00 33.95  ? 241 THR A CB    1 
ATOM   2218 O OG1   . THR B 2 240 ? 81.847 10.770  -15.792 1.00 47.71  ? 241 THR A OG1   1 
ATOM   2219 C CG2   . THR B 2 240 ? 83.159 9.598   -17.376 1.00 56.35  ? 241 THR A CG2   1 
ATOM   2220 N N     . ALA B 2 241 ? 79.296 8.625   -15.548 1.00 40.28  ? 242 ALA A N     1 
ATOM   2221 C CA    . ALA B 2 241 ? 78.136 8.907   -14.737 1.00 35.23  ? 242 ALA A CA    1 
ATOM   2222 C C     . ALA B 2 241 ? 76.858 8.377   -15.359 1.00 28.69  ? 242 ALA A C     1 
ATOM   2223 O O     . ALA B 2 241 ? 76.733 8.262   -16.630 1.00 16.34  ? 242 ALA A O     1 
ATOM   2224 C CB    . ALA B 2 241 ? 78.042 10.405  -14.514 1.00 32.37  ? 242 ALA A CB    1 
ATOM   2225 N N     . VAL B 2 242 ? 75.911 8.058   -14.465 1.00 21.81  ? 243 VAL A N     1 
ATOM   2226 C CA    . VAL B 2 242 ? 74.628 7.556   -14.904 1.00 21.52  ? 243 VAL A CA    1 
ATOM   2227 C C     . VAL B 2 242 ? 73.374 8.101   -14.250 1.00 24.76  ? 243 VAL A C     1 
ATOM   2228 O O     . VAL B 2 242 ? 73.256 8.252   -12.993 1.00 19.87  ? 243 VAL A O     1 
ATOM   2229 C CB    . VAL B 2 242 ? 74.585 6.096   -14.941 1.00 25.34  ? 243 VAL A CB    1 
ATOM   2230 C CG1   . VAL B 2 242 ? 73.464 5.658   -14.077 1.00 23.85  ? 243 VAL A CG1   1 
ATOM   2231 C CG2   . VAL B 2 242 ? 74.309 5.696   -16.345 1.00 27.87  ? 243 VAL A CG2   1 
ATOM   2232 N N     . PHE B 2 243 ? 72.442 8.436   -15.126 1.00 19.79  ? 244 PHE A N     1 
ATOM   2233 C CA    . PHE B 2 243 ? 71.177 8.957   -14.650 1.00 22.11  ? 244 PHE A CA    1 
ATOM   2234 C C     . PHE B 2 243 ? 70.180 7.833   -14.724 1.00 28.12  ? 244 PHE A C     1 
ATOM   2235 O O     . PHE B 2 243 ? 69.884 7.292   -15.819 1.00 29.54  ? 244 PHE A O     1 
ATOM   2236 C CB    . PHE B 2 243 ? 70.648 10.034  -15.546 1.00 26.46  ? 244 PHE A CB    1 
ATOM   2237 C CG    . PHE B 2 243 ? 69.232 10.332  -15.255 1.00 28.46  ? 244 PHE A CG    1 
ATOM   2238 C CD1   . PHE B 2 243 ? 68.810 10.482  -13.885 1.00 37.12  ? 244 PHE A CD1   1 
ATOM   2239 C CD2   . PHE B 2 243 ? 68.301 10.451  -16.273 1.00 18.19  ? 244 PHE A CD2   1 
ATOM   2240 C CE1   . PHE B 2 243 ? 67.481 10.781  -13.568 1.00 33.14  ? 244 PHE A CE1   1 
ATOM   2241 C CE2   . PHE B 2 243 ? 66.979 10.748  -15.963 1.00 25.65  ? 244 PHE A CE2   1 
ATOM   2242 C CZ    . PHE B 2 243 ? 66.564 10.907  -14.624 1.00 28.46  ? 244 PHE A CZ    1 
ATOM   2243 N N     . CYS B 2 244 ? 69.698 7.479   -13.554 1.00 25.69  ? 245 CYS A N     1 
ATOM   2244 C CA    . CYS B 2 244 ? 68.752 6.395   -13.377 1.00 32.13  ? 245 CYS A CA    1 
ATOM   2245 C C     . CYS B 2 244 ? 67.221 6.817   -13.141 1.00 29.34  ? 245 CYS A C     1 
ATOM   2246 O O     . CYS B 2 244 ? 66.846 7.455   -12.114 1.00 25.10  ? 245 CYS A O     1 
ATOM   2247 C CB    . CYS B 2 244 ? 69.317 5.548   -12.238 1.00 37.74  ? 245 CYS A CB    1 
ATOM   2248 S SG    . CYS B 2 244 ? 68.483 3.961   -11.942 1.00 47.82  ? 245 CYS A SG    1 
ATOM   2249 N N     . GLY B 2 245 ? 66.383 6.460   -14.132 1.00 19.90  ? 246 GLY A N     1 
ATOM   2250 C CA    . GLY B 2 245 ? 64.912 6.683   -14.204 1.00 17.18  ? 246 GLY A CA    1 
ATOM   2251 C C     . GLY B 2 245 ? 64.059 6.700   -12.939 1.00 29.25  ? 246 GLY A C     1 
ATOM   2252 O O     . GLY B 2 245 ? 63.053 7.403   -12.898 1.00 35.77  ? 246 GLY A O     1 
ATOM   2253 N N     . GLY B 2 246 ? 64.450 5.912   -11.921 1.00 25.46  ? 247 GLY A N     1 
ATOM   2254 C CA    . GLY B 2 246 ? 63.777 5.841   -10.602 1.00 18.83  ? 247 GLY A CA    1 
ATOM   2255 C C     . GLY B 2 246 ? 64.773 5.333   -9.485  1.00 27.95  ? 247 GLY A C     1 
ATOM   2256 O O     . GLY B 2 246 ? 65.701 4.548   -9.756  1.00 25.70  ? 247 GLY A O     1 
ATOM   2257 N N     . ASP B 2 247 ? 64.598 5.774   -8.234  1.00 21.51  ? 248 ASP A N     1 
ATOM   2258 C CA    . ASP B 2 247 ? 65.475 5.311   -7.130  1.00 24.38  ? 248 ASP A CA    1 
ATOM   2259 C C     . ASP B 2 247 ? 65.554 3.732   -6.876  1.00 37.49  ? 248 ASP A C     1 
ATOM   2260 O O     . ASP B 2 247 ? 66.614 3.152   -6.515  1.00 27.39  ? 248 ASP A O     1 
ATOM   2261 C CB    . ASP B 2 247 ? 64.980 5.894   -5.787  1.00 25.88  ? 248 ASP A CB    1 
ATOM   2262 C CG    . ASP B 2 247 ? 65.026 7.464   -5.724  1.00 32.48  ? 248 ASP A CG    1 
ATOM   2263 O OD1   . ASP B 2 247 ? 65.228 8.020   -6.800  1.00 21.36  ? 248 ASP A OD1   1 
ATOM   2264 O OD2   . ASP B 2 247 ? 64.729 8.148   -4.697  1.00 35.44  ? 248 ASP A OD2   1 
ATOM   2265 N N     . ILE B 2 248 ? 64.422 3.045   -6.972  1.00 37.30  ? 249 ILE A N     1 
ATOM   2266 C CA    . ILE B 2 248 ? 64.499 1.615   -6.689  1.00 34.64  ? 249 ILE A CA    1 
ATOM   2267 C C     . ILE B 2 248 ? 65.367 0.879   -7.702  1.00 34.75  ? 249 ILE A C     1 
ATOM   2268 O O     . ILE B 2 248 ? 66.051 -0.094  -7.405  1.00 34.07  ? 249 ILE A O     1 
ATOM   2269 C CB    . ILE B 2 248 ? 63.130 0.955   -6.540  1.00 29.86  ? 249 ILE A CB    1 
ATOM   2270 C CG1   . ILE B 2 248 ? 62.303 1.626   -5.444  1.00 17.52  ? 249 ILE A CG1   1 
ATOM   2271 C CG2   . ILE B 2 248 ? 63.335 -0.516  -6.268  1.00 29.89  ? 249 ILE A CG2   1 
ATOM   2272 C CD1   . ILE B 2 248 ? 62.802 1.401   -4.071  1.00 1.00   ? 249 ILE A CD1   1 
ATOM   2273 N N     . MET B 2 249 ? 65.331 1.373   -8.914  1.00 23.59  ? 250 MET A N     1 
ATOM   2274 C CA    . MET B 2 249 ? 66.132 0.767   -9.967  1.00 20.55  ? 250 MET A CA    1 
ATOM   2275 C C     . MET B 2 249 ? 67.578 1.262   -9.678  1.00 25.08  ? 250 MET A C     1 
ATOM   2276 O O     . MET B 2 249 ? 68.577 0.638   -10.019 1.00 19.03  ? 250 MET A O     1 
ATOM   2277 C CB    . MET B 2 249 ? 65.684 1.327   -11.364 1.00 19.80  ? 250 MET A CB    1 
ATOM   2278 C CG    . MET B 2 249 ? 64.746 0.481   -12.229 1.00 24.54  ? 250 MET A CG    1 
ATOM   2279 S SD    . MET B 2 249 ? 64.484 1.129   -13.972 1.00 39.97  ? 250 MET A SD    1 
ATOM   2280 C CE    . MET B 2 249 ? 64.780 2.847   -13.848 1.00 40.18  ? 250 MET A CE    1 
ATOM   2281 N N     . ALA B 2 250 ? 67.654 2.425   -9.061  1.00 22.55  ? 251 ALA A N     1 
ATOM   2282 C CA    . ALA B 2 250 ? 68.930 3.021   -8.795  1.00 24.31  ? 251 ALA A CA    1 
ATOM   2283 C C     . ALA B 2 250 ? 69.631 2.179   -7.812  1.00 19.78  ? 251 ALA A C     1 
ATOM   2284 O O     . ALA B 2 250 ? 70.841 1.897   -7.909  1.00 15.62  ? 251 ALA A O     1 
ATOM   2285 C CB    . ALA B 2 250 ? 68.697 4.401   -8.211  1.00 24.24  ? 251 ALA A CB    1 
ATOM   2286 N N     . MET B 2 251 ? 68.843 1.826   -6.825  1.00 17.18  ? 252 MET A N     1 
ATOM   2287 C CA    . MET B 2 251 ? 69.325 1.025   -5.762  1.00 23.46  ? 252 MET A CA    1 
ATOM   2288 C C     . MET B 2 251 ? 69.779 -0.194  -6.498  1.00 29.49  ? 252 MET A C     1 
ATOM   2289 O O     . MET B 2 251 ? 70.812 -0.802  -6.211  1.00 14.56  ? 252 MET A O     1 
ATOM   2290 C CB    . MET B 2 251 ? 68.160 0.636   -4.850  1.00 27.04  ? 252 MET A CB    1 
ATOM   2291 C CG    . MET B 2 251 ? 68.351 -0.678  -4.079  1.00 32.66  ? 252 MET A CG    1 
ATOM   2292 S SD    . MET B 2 251 ? 67.054 -1.007  -2.840  1.00 46.60  ? 252 MET A SD    1 
ATOM   2293 C CE    . MET B 2 251 ? 67.953 -1.545  -1.398  1.00 50.70  ? 252 MET A CE    1 
ATOM   2294 N N     . GLY B 2 252 ? 69.008 -0.542  -7.507  1.00 36.57  ? 253 GLY A N     1 
ATOM   2295 C CA    . GLY B 2 252 ? 69.359 -1.731  -8.247  1.00 41.55  ? 253 GLY A CA    1 
ATOM   2296 C C     . GLY B 2 252 ? 70.778 -1.667  -8.787  1.00 45.20  ? 253 GLY A C     1 
ATOM   2297 O O     . GLY B 2 252 ? 71.584 -2.619  -8.649  1.00 33.71  ? 253 GLY A O     1 
ATOM   2298 N N     . ALA B 2 253 ? 71.079 -0.510  -9.370  1.00 39.24  ? 254 ALA A N     1 
ATOM   2299 C CA    . ALA B 2 253 ? 72.357 -0.335  -9.962  1.00 34.80  ? 254 ALA A CA    1 
ATOM   2300 C C     . ALA B 2 253 ? 73.455 -0.169  -8.933  1.00 34.06  ? 254 ALA A C     1 
ATOM   2301 O O     . ALA B 2 253 ? 74.632 -0.476  -9.194  1.00 33.01  ? 254 ALA A O     1 
ATOM   2302 C CB    . ALA B 2 253 ? 72.318 0.765   -10.973 1.00 35.38  ? 254 ALA A CB    1 
ATOM   2303 N N     . LEU B 2 254 ? 73.095 0.297   -7.745  1.00 17.70  ? 255 LEU A N     1 
ATOM   2304 C CA    . LEU B 2 254 ? 74.143 0.423   -6.778  1.00 18.56  ? 255 LEU A CA    1 
ATOM   2305 C C     . LEU B 2 254 ? 74.722 -0.957  -6.454  1.00 32.43  ? 255 LEU A C     1 
ATOM   2306 O O     . LEU B 2 254 ? 75.936 -1.153  -6.417  1.00 39.83  ? 255 LEU A O     1 
ATOM   2307 C CB    . LEU B 2 254 ? 73.646 1.106   -5.512  1.00 19.30  ? 255 LEU A CB    1 
ATOM   2308 C CG    . LEU B 2 254 ? 73.954 2.594   -5.450  1.00 29.15  ? 255 LEU A CG    1 
ATOM   2309 C CD1   . LEU B 2 254 ? 73.900 3.100   -6.880  1.00 36.88  ? 255 LEU A CD1   1 
ATOM   2310 C CD2   . LEU B 2 254 ? 72.827 3.209   -4.672  1.00 34.36  ? 255 LEU A CD2   1 
ATOM   2311 N N     . CYS B 2 255 ? 73.845 -1.917  -6.216  1.00 33.26  ? 256 CYS A N     1 
ATOM   2312 C CA    . CYS B 2 255 ? 74.297 -3.252  -5.888  1.00 33.98  ? 256 CYS A CA    1 
ATOM   2313 C C     . CYS B 2 255 ? 75.150 -3.899  -7.005  1.00 34.58  ? 256 CYS A C     1 
ATOM   2314 O O     . CYS B 2 255 ? 76.196 -4.508  -6.762  1.00 28.65  ? 256 CYS A O     1 
ATOM   2315 C CB    . CYS B 2 255 ? 73.197 -4.112  -5.173  1.00 33.39  ? 256 CYS A CB    1 
ATOM   2316 S SG    . CYS B 2 255 ? 73.053 -5.928  -5.455  1.00 38.11  ? 256 CYS A SG    1 
ATOM   2317 N N     . ALA B 2 256 ? 74.794 -3.713  -8.241  1.00 33.33  ? 257 ALA A N     1 
ATOM   2318 C CA    . ALA B 2 256 ? 75.673 -4.325  -9.203  1.00 43.59  ? 257 ALA A CA    1 
ATOM   2319 C C     . ALA B 2 256 ? 77.086 -3.705  -9.289  1.00 52.32  ? 257 ALA A C     1 
ATOM   2320 O O     . ALA B 2 256 ? 78.044 -4.408  -9.569  1.00 58.58  ? 257 ALA A O     1 
ATOM   2321 C CB    . ALA B 2 256 ? 75.016 -4.424  -10.575 1.00 48.73  ? 257 ALA A CB    1 
ATOM   2322 N N     . ALA B 2 257 ? 77.232 -2.404  -9.057  1.00 46.25  ? 258 ALA A N     1 
ATOM   2323 C CA    . ALA B 2 257 ? 78.567 -1.800  -9.154  1.00 43.44  ? 258 ALA A CA    1 
ATOM   2324 C C     . ALA B 2 257 ? 79.378 -2.329  -8.016  1.00 38.81  ? 258 ALA A C     1 
ATOM   2325 O O     . ALA B 2 257 ? 80.507 -2.724  -8.221  1.00 29.80  ? 258 ALA A O     1 
ATOM   2326 C CB    . ALA B 2 257 ? 78.511 -0.285  -9.137  1.00 44.72  ? 258 ALA A CB    1 
ATOM   2327 N N     . ASP B 2 258 ? 78.784 -2.358  -6.822  1.00 40.11  ? 259 ASP A N     1 
ATOM   2328 C CA    . ASP B 2 258 ? 79.488 -2.883  -5.657  1.00 42.89  ? 259 ASP A CA    1 
ATOM   2329 C C     . ASP B 2 258 ? 79.962 -4.251  -6.003  1.00 42.51  ? 259 ASP A C     1 
ATOM   2330 O O     . ASP B 2 258 ? 81.093 -4.586  -5.743  1.00 46.79  ? 259 ASP A O     1 
ATOM   2331 C CB    . ASP B 2 258 ? 78.587 -3.016  -4.432  1.00 46.60  ? 259 ASP A CB    1 
ATOM   2332 C CG    . ASP B 2 258 ? 79.369 -3.396  -3.165  1.00 61.41  ? 259 ASP A CG    1 
ATOM   2333 O OD1   . ASP B 2 258 ? 80.129 -2.538  -2.642  1.00 61.03  ? 259 ASP A OD1   1 
ATOM   2334 O OD2   . ASP B 2 258 ? 79.208 -4.537  -2.680  1.00 87.86  ? 259 ASP A OD2   1 
ATOM   2335 N N     . GLU B 2 259 ? 79.106 -5.026  -6.629  1.00 36.79  ? 260 GLU A N     1 
ATOM   2336 C CA    . GLU B 2 259 ? 79.485 -6.365  -7.001  1.00 42.33  ? 260 GLU A CA    1 
ATOM   2337 C C     . GLU B 2 259 ? 80.638 -6.443  -8.001  1.00 56.80  ? 260 GLU A C     1 
ATOM   2338 O O     . GLU B 2 259 ? 81.427 -7.404  -7.955  1.00 60.88  ? 260 GLU A O     1 
ATOM   2339 C CB    . GLU B 2 259 ? 78.266 -7.246  -7.315  1.00 44.29  ? 260 GLU A CB    1 
ATOM   2340 C CG    . GLU B 2 259 ? 77.243 -7.152  -6.178  1.00 68.29  ? 260 GLU A CG    1 
ATOM   2341 C CD    . GLU B 2 259 ? 76.152 -8.223  -6.181  1.00 58.04  ? 260 GLU A CD    1 
ATOM   2342 O OE1   . GLU B 2 259 ? 76.252 -9.227  -6.906  1.00 79.65  ? 260 GLU A OE1   1 
ATOM   2343 O OE2   . GLU B 2 259 ? 75.201 -8.075  -5.395  1.00 64.61  ? 260 GLU A OE2   1 
ATOM   2344 N N     . MET B 2 260 ? 80.786 -5.435  -8.863  1.00 45.11  ? 261 MET A N     1 
ATOM   2345 C CA    . MET B 2 260 ? 81.916 -5.463  -9.785  1.00 42.20  ? 261 MET A CA    1 
ATOM   2346 C C     . MET B 2 260 ? 83.027 -4.700  -9.056  1.00 32.43  ? 261 MET A C     1 
ATOM   2347 O O     . MET B 2 260 ? 84.047 -4.364  -9.610  1.00 29.83  ? 261 MET A O     1 
ATOM   2348 C CB    . MET B 2 260 ? 81.585 -4.795  -11.115 1.00 47.79  ? 261 MET A CB    1 
ATOM   2349 C CG    . MET B 2 260 ? 80.135 -4.960  -11.493 1.00 61.10  ? 261 MET A CG    1 
ATOM   2350 S SD    . MET B 2 260 ? 79.969 -5.329  -13.244 1.00 74.30  ? 261 MET A SD    1 
ATOM   2351 C CE    . MET B 2 260 ? 81.413 -4.464  -13.801 1.00 71.48  ? 261 MET A CE    1 
ATOM   2352 N N     . GLY B 2 261 ? 82.837 -4.419  -7.782  1.00 28.20  ? 262 GLY A N     1 
ATOM   2353 C CA    . GLY B 2 261 ? 83.883 -3.701  -7.071  1.00 26.43  ? 262 GLY A CA    1 
ATOM   2354 C C     . GLY B 2 261 ? 84.086 -2.316  -7.670  1.00 39.51  ? 262 GLY A C     1 
ATOM   2355 O O     . GLY B 2 261 ? 85.162 -1.759  -7.558  1.00 36.32  ? 262 GLY A O     1 
ATOM   2356 N N     . LEU B 2 262 ? 83.031 -1.756  -8.281  1.00 42.59  ? 263 LEU A N     1 
ATOM   2357 C CA    . LEU B 2 262 ? 83.086 -0.404  -8.832  1.00 37.66  ? 263 LEU A CA    1 
ATOM   2358 C C     . LEU B 2 262 ? 82.792 0.491   -7.668  1.00 40.96  ? 263 LEU A C     1 
ATOM   2359 O O     . LEU B 2 262 ? 81.999 0.142   -6.811  1.00 47.82  ? 263 LEU A O     1 
ATOM   2360 C CB    . LEU B 2 262 ? 82.035 -0.184  -9.865  1.00 37.57  ? 263 LEU A CB    1 
ATOM   2361 C CG    . LEU B 2 262 ? 83.004 0.154   -10.966 1.00 37.97  ? 263 LEU A CG    1 
ATOM   2362 C CD1   . LEU B 2 262 ? 84.210 -0.680  -10.537 1.00 31.16  ? 263 LEU A CD1   1 
ATOM   2363 C CD2   . LEU B 2 262 ? 82.498 -0.281  -12.344 1.00 41.65  ? 263 LEU A CD2   1 
ATOM   2364 N N     . ARG B 2 263 ? 83.422 1.641   -7.603  1.00 35.23  ? 264 ARG A N     1 
ATOM   2365 C CA    . ARG B 2 263 ? 83.214 2.514   -6.449  1.00 33.88  ? 264 ARG A CA    1 
ATOM   2366 C C     . ARG B 2 263 ? 82.333 3.717   -6.742  1.00 40.41  ? 264 ARG A C     1 
ATOM   2367 O O     . ARG B 2 263 ? 82.511 4.425   -7.736  1.00 36.57  ? 264 ARG A O     1 
ATOM   2368 C CB    . ARG B 2 263 ? 84.555 2.911   -5.893  1.00 26.92  ? 264 ARG A CB    1 
ATOM   2369 C CG    . ARG B 2 263 ? 84.453 3.592   -4.594  1.00 70.67  ? 264 ARG A CG    1 
ATOM   2370 C CD    . ARG B 2 263 ? 83.185 3.195   -3.803  1.00 100.00 ? 264 ARG A CD    1 
ATOM   2371 N NE    . ARG B 2 263 ? 83.334 3.583   -2.380  1.00 100.00 ? 264 ARG A NE    1 
ATOM   2372 C CZ    . ARG B 2 263 ? 82.336 3.791   -1.496  1.00 100.00 ? 264 ARG A CZ    1 
ATOM   2373 N NH1   . ARG B 2 263 ? 81.042 3.647   -1.843  1.00 100.00 ? 264 ARG A NH1   1 
ATOM   2374 N NH2   . ARG B 2 263 ? 82.632 4.133   -0.235  1.00 100.00 ? 264 ARG A NH2   1 
ATOM   2375 N N     . VAL B 2 264 ? 81.335 3.917   -5.895  1.00 35.83  ? 265 VAL A N     1 
ATOM   2376 C CA    . VAL B 2 264 ? 80.386 5.012   -6.115  1.00 33.21  ? 265 VAL A CA    1 
ATOM   2377 C C     . VAL B 2 264 ? 80.344 5.945   -4.948  1.00 34.56  ? 265 VAL A C     1 
ATOM   2378 O O     . VAL B 2 264 ? 80.185 5.522   -3.816  1.00 35.91  ? 265 VAL A O     1 
ATOM   2379 C CB    . VAL B 2 264 ? 79.000 4.434   -6.413  1.00 36.30  ? 265 VAL A CB    1 
ATOM   2380 C CG1   . VAL B 2 264 ? 77.996 5.493   -6.799  1.00 36.33  ? 265 VAL A CG1   1 
ATOM   2381 C CG2   . VAL B 2 264 ? 79.121 3.441   -7.548  1.00 36.84  ? 265 VAL A CG2   1 
ATOM   2382 N N     . PRO B 2 265 ? 80.547 7.218   -5.215  1.00 29.29  ? 266 PRO A N     1 
ATOM   2383 C CA    . PRO B 2 265 ? 80.723 7.695   -6.570  1.00 26.18  ? 266 PRO A CA    1 
ATOM   2384 C C     . PRO B 2 265 ? 82.078 7.596   -7.187  1.00 37.87  ? 266 PRO A C     1 
ATOM   2385 O O     . PRO B 2 265 ? 82.206 7.739   -8.403  1.00 39.39  ? 266 PRO A O     1 
ATOM   2386 C CB    . PRO B 2 265 ? 80.384 9.192   -6.449  1.00 26.46  ? 266 PRO A CB    1 
ATOM   2387 C CG    . PRO B 2 265 ? 80.629 9.560   -5.012  1.00 29.56  ? 266 PRO A CG    1 
ATOM   2388 C CD    . PRO B 2 265 ? 80.766 8.275   -4.204  1.00 28.03  ? 266 PRO A CD    1 
ATOM   2389 N N     . GLN B 2 266 ? 83.098 7.367   -6.358  1.00 41.91  ? 267 GLN A N     1 
ATOM   2390 C CA    . GLN B 2 266 ? 84.496 7.318   -6.826  1.00 40.85  ? 267 GLN A CA    1 
ATOM   2391 C C     . GLN B 2 266 ? 84.770 6.786   -8.197  1.00 33.37  ? 267 GLN A C     1 
ATOM   2392 O O     . GLN B 2 266 ? 85.493 7.409   -8.927  1.00 37.71  ? 267 GLN A O     1 
ATOM   2393 C CB    . GLN B 2 266 ? 85.461 6.744   -5.813  1.00 43.84  ? 267 GLN A CB    1 
ATOM   2394 C CG    . GLN B 2 266 ? 85.357 7.359   -4.451  1.00 92.63  ? 267 GLN A CG    1 
ATOM   2395 C CD    . GLN B 2 266 ? 84.228 6.746   -3.694  1.00 100.00 ? 267 GLN A CD    1 
ATOM   2396 O OE1   . GLN B 2 266 ? 83.337 6.130   -4.297  1.00 69.08  ? 267 GLN A OE1   1 
ATOM   2397 N NE2   . GLN B 2 266 ? 84.244 6.881   -2.368  1.00 100.00 ? 267 GLN A NE2   1 
ATOM   2398 N N     . ASP B 2 267 ? 84.195 5.651   -8.569  1.00 27.10  ? 268 ASP A N     1 
ATOM   2399 C CA    . ASP B 2 267 ? 84.415 5.147   -9.925  1.00 30.01  ? 268 ASP A CA    1 
ATOM   2400 C C     . ASP B 2 267 ? 83.299 5.577   -10.850 1.00 39.78  ? 268 ASP A C     1 
ATOM   2401 O O     . ASP B 2 267 ? 83.580 5.999   -11.964 1.00 45.46  ? 268 ASP A O     1 
ATOM   2402 C CB    . ASP B 2 267 ? 84.637 3.623   -10.014 1.00 30.52  ? 268 ASP A CB    1 
ATOM   2403 C CG    . ASP B 2 267 ? 85.542 3.102   -8.913  1.00 53.70  ? 268 ASP A CG    1 
ATOM   2404 O OD1   . ASP B 2 267 ? 86.387 3.847   -8.380  1.00 55.59  ? 268 ASP A OD1   1 
ATOM   2405 O OD2   . ASP B 2 267 ? 85.424 1.919   -8.585  1.00 67.54  ? 268 ASP A OD2   1 
ATOM   2406 N N     . VAL B 2 268 ? 82.039 5.467   -10.392 1.00 37.98  ? 269 VAL A N     1 
ATOM   2407 C CA    . VAL B 2 268 ? 80.851 5.845   -11.208 1.00 33.55  ? 269 VAL A CA    1 
ATOM   2408 C C     . VAL B 2 268 ? 79.896 6.721   -10.484 1.00 34.73  ? 269 VAL A C     1 
ATOM   2409 O O     . VAL B 2 268 ? 79.465 6.377   -9.378  1.00 29.05  ? 269 VAL A O     1 
ATOM   2410 C CB    . VAL B 2 268 ? 79.911 4.730   -11.511 1.00 35.56  ? 269 VAL A CB    1 
ATOM   2411 C CG1   . VAL B 2 268 ? 79.309 4.992   -12.833 1.00 36.20  ? 269 VAL A CG1   1 
ATOM   2412 C CG2   . VAL B 2 268 ? 80.577 3.373   -11.447 1.00 39.12  ? 269 VAL A CG2   1 
ATOM   2413 N N     . SER B 2 269 ? 79.522 7.834   -11.110 1.00 31.83  ? 270 SER A N     1 
ATOM   2414 C CA    . SER B 2 269 ? 78.561 8.709   -10.465 1.00 30.13  ? 270 SER A CA    1 
ATOM   2415 C C     . SER B 2 269 ? 77.061 8.292   -10.605 1.00 28.93  ? 270 SER A C     1 
ATOM   2416 O O     . SER B 2 269 ? 76.624 7.738   -11.645 1.00 16.35  ? 270 SER A O     1 
ATOM   2417 C CB    . SER B 2 269 ? 78.853 10.148  -10.774 1.00 22.21  ? 270 SER A CB    1 
ATOM   2418 O OG    . SER B 2 269 ? 78.970 10.819  -9.474  1.00 37.31  ? 270 SER A OG    1 
ATOM   2419 N N     . LEU B 2 270 ? 76.261 8.535   -9.577  1.00 22.18  ? 271 LEU A N     1 
ATOM   2420 C CA    . LEU B 2 270 ? 74.909 8.081   -9.755  1.00 29.57  ? 271 LEU A CA    1 
ATOM   2421 C C     . LEU B 2 270 ? 73.715 8.977   -9.476  1.00 27.96  ? 271 LEU A C     1 
ATOM   2422 O O     . LEU B 2 270 ? 73.395 9.267   -8.309  1.00 26.36  ? 271 LEU A O     1 
ATOM   2423 C CB    . LEU B 2 270 ? 74.711 6.673   -9.135  1.00 31.71  ? 271 LEU A CB    1 
ATOM   2424 C CG    . LEU B 2 270 ? 73.509 5.837   -9.641  1.00 37.02  ? 271 LEU A CG    1 
ATOM   2425 C CD1   . LEU B 2 270 ? 72.996 6.468   -10.903 1.00 32.94  ? 271 LEU A CD1   1 
ATOM   2426 C CD2   . LEU B 2 270 ? 73.853 4.356   -9.965  1.00 45.77  ? 271 LEU A CD2   1 
ATOM   2427 N N     . ILE B 2 271 ? 72.990 9.363   -10.512 1.00 9.38   ? 272 ILE A N     1 
ATOM   2428 C CA    . ILE B 2 271 ? 71.824 10.159  -10.132 1.00 12.73  ? 272 ILE A CA    1 
ATOM   2429 C C     . ILE B 2 271 ? 70.509 9.424   -10.339 1.00 18.56  ? 272 ILE A C     1 
ATOM   2430 O O     . ILE B 2 271 ? 70.243 8.823   -11.440 1.00 8.40   ? 272 ILE A O     1 
ATOM   2431 C CB    . ILE B 2 271 ? 71.772 11.549  -10.739 1.00 16.62  ? 272 ILE A CB    1 
ATOM   2432 C CG1   . ILE B 2 271 ? 70.673 12.337  -10.057 1.00 17.26  ? 272 ILE A CG1   1 
ATOM   2433 C CG2   . ILE B 2 271 ? 71.554 11.503  -12.281 1.00 1.33   ? 272 ILE A CG2   1 
ATOM   2434 C CD1   . ILE B 2 271 ? 70.641 13.764  -10.578 1.00 37.35  ? 272 ILE A CD1   1 
ATOM   2435 N N     . GLY B 2 272 ? 69.680 9.438   -9.292  1.00 15.32  ? 273 GLY A N     1 
ATOM   2436 C CA    . GLY B 2 272 ? 68.378 8.751   -9.375  1.00 17.72  ? 273 GLY A CA    1 
ATOM   2437 C C     . GLY B 2 272 ? 67.185 9.711   -9.631  1.00 31.94  ? 273 GLY A C     1 
ATOM   2438 O O     . GLY B 2 272 ? 67.347 10.853  -10.085 1.00 28.72  ? 273 GLY A O     1 
ATOM   2439 N N     . TYR B 2 273 ? 65.985 9.241   -9.321  1.00 28.99  ? 274 TYR A N     1 
ATOM   2440 C CA    . TYR B 2 273 ? 64.782 10.049  -9.520  1.00 25.32  ? 274 TYR A CA    1 
ATOM   2441 C C     . TYR B 2 273 ? 63.616 9.489   -8.748  1.00 27.79  ? 274 TYR A C     1 
ATOM   2442 O O     . TYR B 2 273 ? 63.337 8.306   -8.929  1.00 29.35  ? 274 TYR A O     1 
ATOM   2443 C CB    . TYR B 2 273 ? 64.347 9.927   -10.941 1.00 19.48  ? 274 TYR A CB    1 
ATOM   2444 C CG    . TYR B 2 273 ? 63.492 11.064  -11.363 1.00 26.80  ? 274 TYR A CG    1 
ATOM   2445 C CD1   . TYR B 2 273 ? 62.445 11.536  -10.566 1.00 29.95  ? 274 TYR A CD1   1 
ATOM   2446 C CD2   . TYR B 2 273 ? 63.723 11.693  -12.596 1.00 30.91  ? 274 TYR A CD2   1 
ATOM   2447 C CE1   . TYR B 2 273 ? 61.640 12.597  -11.007 1.00 30.60  ? 274 TYR A CE1   1 
ATOM   2448 C CE2   . TYR B 2 273 ? 62.948 12.745  -13.046 1.00 30.27  ? 274 TYR A CE2   1 
ATOM   2449 C CZ    . TYR B 2 273 ? 61.917 13.196  -12.258 1.00 36.92  ? 274 TYR A CZ    1 
ATOM   2450 O OH    . TYR B 2 273 ? 61.203 14.245  -12.751 1.00 27.32  ? 274 TYR A OH    1 
ATOM   2451 N N     . ASP B 2 274 ? 62.955 10.346  -7.955  1.00 14.16  ? 275 ASP A N     1 
ATOM   2452 C CA    . ASP B 2 274 ? 61.736 10.066  -7.140  1.00 20.56  ? 275 ASP A CA    1 
ATOM   2453 C C     . ASP B 2 274 ? 61.883 10.528  -5.709  1.00 27.37  ? 275 ASP A C     1 
ATOM   2454 O O     . ASP B 2 274 ? 60.967 11.071  -5.042  1.00 20.83  ? 275 ASP A O     1 
ATOM   2455 C CB    . ASP B 2 274 ? 61.394 8.588   -7.060  1.00 21.68  ? 275 ASP A CB    1 
ATOM   2456 C CG    . ASP B 2 274 ? 60.654 8.062   -8.305  1.00 40.94  ? 275 ASP A CG    1 
ATOM   2457 O OD1   . ASP B 2 274 ? 60.139 8.864   -9.145  1.00 34.14  ? 275 ASP A OD1   1 
ATOM   2458 O OD2   . ASP B 2 274 ? 60.581 6.806   -8.404  1.00 39.32  ? 275 ASP A OD2   1 
ATOM   2459 N N     . ASN B 2 275 ? 63.058 10.243  -5.228  1.00 25.97  ? 276 ASN A N     1 
ATOM   2460 C CA    . ASN B 2 275 ? 63.349 10.551  -3.893  1.00 27.97  ? 276 ASN A CA    1 
ATOM   2461 C C     . ASN B 2 275 ? 62.442 9.770   -2.963  1.00 27.38  ? 276 ASN A C     1 
ATOM   2462 O O     . ASN B 2 275 ? 61.629 10.334  -2.220  1.00 22.78  ? 276 ASN A O     1 
ATOM   2463 C CB    . ASN B 2 275 ? 63.208 12.037  -3.612  1.00 28.99  ? 276 ASN A CB    1 
ATOM   2464 C CG    . ASN B 2 275 ? 63.701 12.387  -2.193  1.00 53.66  ? 276 ASN A CG    1 
ATOM   2465 O OD1   . ASN B 2 275 ? 64.346 11.569  -1.527  1.00 16.09  ? 276 ASN A OD1   1 
ATOM   2466 N ND2   . ASN B 2 275 ? 63.380 13.570  -1.735  1.00 43.08  ? 276 ASN A ND2   1 
ATOM   2467 N N     . VAL B 2 276 ? 62.585 8.459   -2.978  1.00 23.49  ? 277 VAL A N     1 
ATOM   2468 C CA    . VAL B 2 276 ? 61.774 7.648   -2.088  1.00 23.47  ? 277 VAL A CA    1 
ATOM   2469 C C     . VAL B 2 276 ? 62.266 7.807   -0.650  1.00 18.22  ? 277 VAL A C     1 
ATOM   2470 O O     . VAL B 2 276 ? 63.407 8.144   -0.412  1.00 21.51  ? 277 VAL A O     1 
ATOM   2471 C CB    . VAL B 2 276 ? 61.826 6.164   -2.460  1.00 24.97  ? 277 VAL A CB    1 
ATOM   2472 C CG1   . VAL B 2 276 ? 61.140 5.916   -3.768  1.00 21.08  ? 277 VAL A CG1   1 
ATOM   2473 C CG2   . VAL B 2 276 ? 63.250 5.712   -2.546  1.00 25.55  ? 277 VAL A CG2   1 
ATOM   2474 N N     . ARG B 2 277 ? 61.390 7.553   0.309   1.00 21.66  ? 278 ARG A N     1 
ATOM   2475 C CA    . ARG B 2 277 ? 61.730 7.659   1.728   1.00 21.16  ? 278 ARG A CA    1 
ATOM   2476 C C     . ARG B 2 277 ? 63.046 6.990   2.227   1.00 33.69  ? 278 ARG A C     1 
ATOM   2477 O O     . ARG B 2 277 ? 63.629 7.433   3.217   1.00 39.30  ? 278 ARG A O     1 
ATOM   2478 C CB    . ARG B 2 277 ? 60.580 7.122   2.551   1.00 11.02  ? 278 ARG A CB    1 
ATOM   2479 C CG    . ARG B 2 277 ? 59.508 8.142   2.901   1.00 62.67  ? 278 ARG A CG    1 
ATOM   2480 C CD    . ARG B 2 277 ? 58.962 7.921   4.314   1.00 84.20  ? 278 ARG A CD    1 
ATOM   2481 N NE    . ARG B 2 277 ? 57.602 7.367   4.349   1.00 100.00 ? 278 ARG A NE    1 
ATOM   2482 C CZ    . ARG B 2 277 ? 56.481 8.045   4.097   1.00 100.00 ? 278 ARG A CZ    1 
ATOM   2483 N NH1   . ARG B 2 277 ? 56.523 9.340   3.756   1.00 100.00 ? 278 ARG A NH1   1 
ATOM   2484 N NH2   . ARG B 2 277 ? 55.312 7.407   4.145   1.00 68.89  ? 278 ARG A NH2   1 
ATOM   2485 N N     . ASN B 2 278 ? 63.485 5.932   1.559   1.00 20.15  ? 279 ASN A N     1 
ATOM   2486 C CA    . ASN B 2 278 ? 64.685 5.220   1.948   1.00 25.29  ? 279 ASN A CA    1 
ATOM   2487 C C     . ASN B 2 278 ? 65.935 5.603   1.186   1.00 36.70  ? 279 ASN A C     1 
ATOM   2488 O O     . ASN B 2 278 ? 67.061 5.197   1.571   1.00 32.34  ? 279 ASN A O     1 
ATOM   2489 C CB    . ASN B 2 278 ? 64.458 3.748   1.686   1.00 38.76  ? 279 ASN A CB    1 
ATOM   2490 C CG    . ASN B 2 278 ? 63.445 3.157   2.616   1.00 62.06  ? 279 ASN A CG    1 
ATOM   2491 O OD1   . ASN B 2 278 ? 63.207 3.667   3.719   1.00 29.92  ? 279 ASN A OD1   1 
ATOM   2492 N ND2   . ASN B 2 278 ? 62.835 2.063   2.185   1.00 76.00  ? 279 ASN A ND2   1 
ATOM   2493 N N     . ALA B 2 279 ? 65.730 6.354   0.098   1.00 35.44  ? 280 ALA A N     1 
ATOM   2494 C CA    . ALA B 2 279 ? 66.824 6.832   -0.749  1.00 36.42  ? 280 ALA A CA    1 
ATOM   2495 C C     . ALA B 2 279 ? 68.016 7.445   0.071   1.00 37.52  ? 280 ALA A C     1 
ATOM   2496 O O     . ALA B 2 279 ? 69.206 7.251   -0.236  1.00 30.99  ? 280 ALA A O     1 
ATOM   2497 C CB    . ALA B 2 279 ? 66.300 7.844   -1.727  1.00 34.78  ? 280 ALA A CB    1 
ATOM   2498 N N     . ARG B 2 280 ? 67.695 8.181   1.118   1.00 27.51  ? 281 ARG A N     1 
ATOM   2499 C CA    . ARG B 2 280 ? 68.757 8.772   1.888   1.00 28.88  ? 281 ARG A CA    1 
ATOM   2500 C C     . ARG B 2 280 ? 69.619 7.686   2.503   1.00 39.38  ? 281 ARG A C     1 
ATOM   2501 O O     . ARG B 2 280 ? 70.822 7.867   2.786   1.00 39.25  ? 281 ARG A O     1 
ATOM   2502 C CB    . ARG B 2 280 ? 68.168 9.596   3.036   1.00 29.82  ? 281 ARG A CB    1 
ATOM   2503 C CG    . ARG B 2 280 ? 69.247 10.225  3.928   1.00 39.94  ? 281 ARG A CG    1 
ATOM   2504 C CD    . ARG B 2 280 ? 69.302 9.649   5.325   1.00 71.74  ? 281 ARG A CD    1 
ATOM   2505 N NE    . ARG B 2 280 ? 70.540 10.031  5.991   1.00 94.40  ? 281 ARG A NE    1 
ATOM   2506 C CZ    . ARG B 2 280 ? 71.712 9.496   5.701   1.00 80.90  ? 281 ARG A CZ    1 
ATOM   2507 N NH1   . ARG B 2 280 ? 71.775 8.559   4.770   1.00 77.50  ? 281 ARG A NH1   1 
ATOM   2508 N NH2   . ARG B 2 280 ? 72.801 9.884   6.343   1.00 61.08  ? 281 ARG A NH2   1 
ATOM   2509 N N     . TYR B 2 281 ? 68.993 6.562   2.755   1.00 28.24  ? 282 TYR A N     1 
ATOM   2510 C CA    . TYR B 2 281 ? 69.753 5.565   3.382   1.00 19.52  ? 282 TYR A CA    1 
ATOM   2511 C C     . TYR B 2 281 ? 70.262 4.550   2.432   1.00 33.17  ? 282 TYR A C     1 
ATOM   2512 O O     . TYR B 2 281 ? 70.686 3.452   2.810   1.00 39.07  ? 282 TYR A O     1 
ATOM   2513 C CB    . TYR B 2 281 ? 69.057 5.026   4.574   1.00 16.61  ? 282 TYR A CB    1 
ATOM   2514 C CG    . TYR B 2 281 ? 68.747 6.011   5.681   1.00 21.23  ? 282 TYR A CG    1 
ATOM   2515 C CD1   . TYR B 2 281 ? 69.696 6.405   6.591   1.00 30.11  ? 282 TYR A CD1   1 
ATOM   2516 C CD2   . TYR B 2 281 ? 67.487 6.435   5.883   1.00 23.57  ? 282 TYR A CD2   1 
ATOM   2517 C CE1   . TYR B 2 281 ? 69.374 7.232   7.658   1.00 42.93  ? 282 TYR A CE1   1 
ATOM   2518 C CE2   . TYR B 2 281 ? 67.159 7.252   6.950   1.00 27.03  ? 282 TYR A CE2   1 
ATOM   2519 C CZ    . TYR B 2 281 ? 68.083 7.646   7.823   1.00 46.72  ? 282 TYR A CZ    1 
ATOM   2520 O OH    . TYR B 2 281 ? 67.692 8.475   8.837   1.00 57.11  ? 282 TYR A OH    1 
ATOM   2521 N N     . PHE B 2 282 ? 70.318 4.921   1.173   1.00 25.80  ? 283 PHE A N     1 
ATOM   2522 C CA    . PHE B 2 282 ? 70.945 4.023   0.273   1.00 26.96  ? 283 PHE A CA    1 
ATOM   2523 C C     . PHE B 2 282 ? 72.448 4.192   0.671   1.00 40.43  ? 283 PHE A C     1 
ATOM   2524 O O     . PHE B 2 282 ? 72.807 5.033   1.541   1.00 36.95  ? 283 PHE A O     1 
ATOM   2525 C CB    . PHE B 2 282 ? 70.672 4.428   -1.130  1.00 30.14  ? 283 PHE A CB    1 
ATOM   2526 C CG    . PHE B 2 282 ? 69.343 4.003   -1.564  1.00 33.62  ? 283 PHE A CG    1 
ATOM   2527 C CD1   . PHE B 2 282 ? 68.386 3.777   -0.620  1.00 39.51  ? 283 PHE A CD1   1 
ATOM   2528 C CD2   . PHE B 2 282 ? 69.049 3.804   -2.894  1.00 33.35  ? 283 PHE A CD2   1 
ATOM   2529 C CE1   . PHE B 2 282 ? 67.128 3.377   -0.999  1.00 41.90  ? 283 PHE A CE1   1 
ATOM   2530 C CE2   . PHE B 2 282 ? 67.803 3.386   -3.273  1.00 37.71  ? 283 PHE A CE2   1 
ATOM   2531 C CZ    . PHE B 2 282 ? 66.846 3.163   -2.322  1.00 36.07  ? 283 PHE A CZ    1 
ATOM   2532 N N     . THR B 2 283 ? 73.314 3.369   0.084   1.00 41.90  ? 284 THR A N     1 
ATOM   2533 C CA    . THR B 2 283 ? 74.754 3.409   0.417   1.00 36.81  ? 284 THR A CA    1 
ATOM   2534 C C     . THR B 2 283 ? 75.540 3.436   -0.856  1.00 33.14  ? 284 THR A C     1 
ATOM   2535 O O     . THR B 2 283 ? 75.702 2.419   -1.533  1.00 36.77  ? 284 THR A O     1 
ATOM   2536 C CB    . THR B 2 283 ? 75.174 2.137   1.198   1.00 31.17  ? 284 THR A CB    1 
ATOM   2537 O OG1   . THR B 2 283 ? 74.906 2.293   2.598   1.00 53.65  ? 284 THR A OG1   1 
ATOM   2538 C CG2   . THR B 2 283 ? 76.619 1.883   1.027   1.00 28.60  ? 284 THR A CG2   1 
ATOM   2539 N N     . PRO B 2 284 ? 76.016 4.607   -1.198  1.00 23.78  ? 285 PRO A N     1 
ATOM   2540 C CA    . PRO B 2 284 ? 75.860 5.809   -0.392  1.00 30.01  ? 285 PRO A CA    1 
ATOM   2541 C C     . PRO B 2 284 ? 74.537 6.522   -0.524  1.00 30.63  ? 285 PRO A C     1 
ATOM   2542 O O     . PRO B 2 284 ? 73.701 6.132   -1.326  1.00 31.14  ? 285 PRO A O     1 
ATOM   2543 C CB    . PRO B 2 284 ? 76.905 6.720   -1.004  1.00 34.92  ? 285 PRO A CB    1 
ATOM   2544 C CG    . PRO B 2 284 ? 76.821 6.370   -2.458  1.00 30.17  ? 285 PRO A CG    1 
ATOM   2545 C CD    . PRO B 2 284 ? 76.711 4.872   -2.458  1.00 18.48  ? 285 PRO A CD    1 
ATOM   2546 N N     . ALA B 2 285 ? 74.371 7.597   0.246   1.00 29.53  ? 286 ALA A N     1 
ATOM   2547 C CA    . ALA B 2 285 ? 73.124 8.344   0.196   1.00 29.75  ? 286 ALA A CA    1 
ATOM   2548 C C     . ALA B 2 285 ? 72.812 8.890   -1.178  1.00 34.38  ? 286 ALA A C     1 
ATOM   2549 O O     . ALA B 2 285 ? 73.552 9.710   -1.764  1.00 33.59  ? 286 ALA A O     1 
ATOM   2550 C CB    . ALA B 2 285 ? 73.053 9.390   1.260   1.00 30.52  ? 286 ALA A CB    1 
ATOM   2551 N N     . LEU B 2 286 ? 71.709 8.382   -1.695  1.00 28.97  ? 287 LEU A N     1 
ATOM   2552 C CA    . LEU B 2 286 ? 71.256 8.722   -3.006  1.00 31.00  ? 287 LEU A CA    1 
ATOM   2553 C C     . LEU B 2 286 ? 70.980 10.157  -3.406  1.00 33.83  ? 287 LEU A C     1 
ATOM   2554 O O     . LEU B 2 286 ? 70.297 10.912  -2.747  1.00 30.08  ? 287 LEU A O     1 
ATOM   2555 C CB    . LEU B 2 286 ? 70.117 7.853   -3.428  1.00 31.98  ? 287 LEU A CB    1 
ATOM   2556 C CG    . LEU B 2 286 ? 70.213 7.996   -4.925  1.00 31.29  ? 287 LEU A CG    1 
ATOM   2557 C CD1   . LEU B 2 286 ? 71.190 6.918   -5.331  1.00 18.28  ? 287 LEU A CD1   1 
ATOM   2558 C CD2   . LEU B 2 286 ? 68.820 7.829   -5.526  1.00 39.30  ? 287 LEU A CD2   1 
ATOM   2559 N N     . THR B 2 287 ? 71.509 10.521  -4.540  1.00 31.60  ? 288 THR A N     1 
ATOM   2560 C CA    . THR B 2 287 ? 71.286 11.852  -5.012  1.00 32.81  ? 288 THR A CA    1 
ATOM   2561 C C     . THR B 2 287 ? 70.197 11.672  -6.062  1.00 32.84  ? 288 THR A C     1 
ATOM   2562 O O     . THR B 2 287 ? 70.341 10.868  -7.049  1.00 34.85  ? 288 THR A O     1 
ATOM   2563 C CB    . THR B 2 287 ? 72.567 12.416  -5.578  1.00 32.19  ? 288 THR A CB    1 
ATOM   2564 O OG1   . THR B 2 287 ? 73.173 13.180  -4.564  1.00 27.55  ? 288 THR A OG1   1 
ATOM   2565 C CG2   . THR B 2 287 ? 72.294 13.340  -6.714  1.00 30.90  ? 288 THR A CG2   1 
ATOM   2566 N N     . THR B 2 288 ? 69.100 12.391  -5.865  1.00 17.23  ? 289 THR A N     1 
ATOM   2567 C CA    . THR B 2 288 ? 68.033 12.180  -6.799  1.00 22.55  ? 289 THR A CA    1 
ATOM   2568 C C     . THR B 2 288 ? 67.081 13.309  -7.026  1.00 24.22  ? 289 THR A C     1 
ATOM   2569 O O     . THR B 2 288 ? 67.032 14.272  -6.282  1.00 25.02  ? 289 THR A O     1 
ATOM   2570 C CB    . THR B 2 288 ? 67.175 10.968  -6.207  1.00 37.74  ? 289 THR A CB    1 
ATOM   2571 O OG1   . THR B 2 288 ? 66.195 10.483  -7.158  1.00 11.38  ? 289 THR A OG1   1 
ATOM   2572 C CG2   . THR B 2 288 ? 66.540 11.365  -4.855  1.00 6.75   ? 289 THR A CG2   1 
ATOM   2573 N N     . ILE B 2 289 ? 66.264 13.154  -8.049  1.00 27.32  ? 290 ILE A N     1 
ATOM   2574 C CA    . ILE B 2 289 ? 65.239 14.129  -8.238  1.00 33.56  ? 290 ILE A CA    1 
ATOM   2575 C C     . ILE B 2 289 ? 64.062 13.709  -7.333  1.00 43.76  ? 290 ILE A C     1 
ATOM   2576 O O     . ILE B 2 289 ? 63.599 12.531  -7.305  1.00 42.98  ? 290 ILE A O     1 
ATOM   2577 C CB    . ILE B 2 289 ? 64.761 14.175  -9.610  1.00 38.11  ? 290 ILE A CB    1 
ATOM   2578 C CG1   . ILE B 2 289 ? 65.887 14.757  -10.446 1.00 38.16  ? 290 ILE A CG1   1 
ATOM   2579 C CG2   . ILE B 2 289 ? 63.587 15.136  -9.634  1.00 43.32  ? 290 ILE A CG2   1 
ATOM   2580 C CD1   . ILE B 2 289 ? 66.684 15.801  -9.650  1.00 43.56  ? 290 ILE A CD1   1 
ATOM   2581 N N     . HIS B 2 290 ? 63.594 14.673  -6.577  1.00 33.09  ? 291 HIS A N     1 
ATOM   2582 C CA    . HIS B 2 290 ? 62.514 14.405  -5.701  1.00 25.43  ? 291 HIS A CA    1 
ATOM   2583 C C     . HIS B 2 290 ? 61.176 14.740  -6.304  1.00 26.91  ? 291 HIS A C     1 
ATOM   2584 O O     . HIS B 2 290 ? 60.919 15.887  -6.701  1.00 26.74  ? 291 HIS A O     1 
ATOM   2585 C CB    . HIS B 2 290 ? 62.590 15.351  -4.564  1.00 24.98  ? 291 HIS A CB    1 
ATOM   2586 C CG    . HIS B 2 290 ? 61.350 15.369  -3.771  1.00 28.27  ? 291 HIS A CG    1 
ATOM   2587 N ND1   . HIS B 2 290 ? 60.260 16.130  -4.104  1.00 31.83  ? 291 HIS A ND1   1 
ATOM   2588 C CD2   . HIS B 2 290 ? 61.018 14.694  -2.650  1.00 32.74  ? 291 HIS A CD2   1 
ATOM   2589 C CE1   . HIS B 2 290 ? 59.317 15.952  -3.194  1.00 34.72  ? 291 HIS A CE1   1 
ATOM   2590 N NE2   . HIS B 2 290 ? 59.760 15.090  -2.295  1.00 34.06  ? 291 HIS A NE2   1 
ATOM   2591 N N     . GLN B 2 291 ? 60.323 13.735  -6.296  1.00 22.70  ? 292 GLN A N     1 
ATOM   2592 C CA    . GLN B 2 291 ? 58.982 13.872  -6.759  1.00 24.78  ? 292 GLN A CA    1 
ATOM   2593 C C     . GLN B 2 291 ? 58.181 14.121  -5.503  1.00 24.20  ? 292 GLN A C     1 
ATOM   2594 O O     . GLN B 2 291 ? 58.255 13.340  -4.547  1.00 17.58  ? 292 GLN A O     1 
ATOM   2595 C CB    . GLN B 2 291 ? 58.465 12.549  -7.279  1.00 29.11  ? 292 GLN A CB    1 
ATOM   2596 C CG    . GLN B 2 291 ? 56.968 12.604  -7.639  1.00 19.65  ? 292 GLN A CG    1 
ATOM   2597 C CD    . GLN B 2 291 ? 56.771 13.168  -9.047  1.00 37.76  ? 292 GLN A CD    1 
ATOM   2598 O OE1   . GLN B 2 291 ? 56.510 12.427  -9.998  1.00 18.37  ? 292 GLN A OE1   1 
ATOM   2599 N NE2   . GLN B 2 291 ? 57.010 14.475  -9.199  1.00 63.00  ? 292 GLN A NE2   1 
ATOM   2600 N N     . PRO B 2 292 ? 57.414 15.201  -5.517  1.00 23.25  ? 293 PRO A N     1 
ATOM   2601 C CA    . PRO B 2 292 ? 56.540 15.565  -4.406  1.00 27.05  ? 293 PRO A CA    1 
ATOM   2602 C C     . PRO B 2 292 ? 55.513 14.476  -4.427  1.00 35.40  ? 293 PRO A C     1 
ATOM   2603 O O     . PRO B 2 292 ? 54.629 14.498  -5.274  1.00 38.96  ? 293 PRO A O     1 
ATOM   2604 C CB    . PRO B 2 292 ? 55.837 16.816  -4.928  1.00 28.57  ? 293 PRO A CB    1 
ATOM   2605 C CG    . PRO B 2 292 ? 56.484 17.186  -6.235  1.00 23.64  ? 293 PRO A CG    1 
ATOM   2606 C CD    . PRO B 2 292 ? 57.122 15.947  -6.751  1.00 20.58  ? 293 PRO A CD    1 
ATOM   2607 N N     . LYS B 2 293 ? 55.615 13.493  -3.565  1.00 28.33  ? 294 LYS A N     1 
ATOM   2608 C CA    . LYS B 2 293 ? 54.590 12.479  -3.677  1.00 28.23  ? 294 LYS A CA    1 
ATOM   2609 C C     . LYS B 2 293 ? 53.322 12.869  -2.856  1.00 33.37  ? 294 LYS A C     1 
ATOM   2610 O O     . LYS B 2 293 ? 52.166 12.745  -3.312  1.00 25.78  ? 294 LYS A O     1 
ATOM   2611 C CB    . LYS B 2 293 ? 55.160 11.091  -3.367  1.00 34.02  ? 294 LYS A CB    1 
ATOM   2612 C CG    . LYS B 2 293 ? 56.275 10.611  -4.363  1.00 33.57  ? 294 LYS A CG    1 
ATOM   2613 C CD    . LYS B 2 293 ? 57.408 9.762   -3.637  1.00 31.24  ? 294 LYS A CD    1 
ATOM   2614 C CE    . LYS B 2 293 ? 58.713 10.576  -3.161  1.00 5.36   ? 294 LYS A CE    1 
ATOM   2615 N NZ    . LYS B 2 293 ? 58.420 11.772  -2.219  1.00 59.33  ? 294 LYS A NZ    1 
ATOM   2616 N N     . ASP B 2 294 ? 53.565 13.374  -1.659  1.00 39.54  ? 295 ASP A N     1 
ATOM   2617 C CA    . ASP B 2 294 ? 52.493 13.817  -0.758  1.00 42.21  ? 295 ASP A CA    1 
ATOM   2618 C C     . ASP B 2 294 ? 51.578 14.912  -1.305  1.00 47.25  ? 295 ASP A C     1 
ATOM   2619 O O     . ASP B 2 294 ? 50.545 15.169  -0.744  1.00 49.59  ? 295 ASP A O     1 
ATOM   2620 C CB    . ASP B 2 294 ? 53.070 14.353  0.566   1.00 47.30  ? 295 ASP A CB    1 
ATOM   2621 C CG    . ASP B 2 294 ? 53.893 13.309  1.341   1.00 94.77  ? 295 ASP A CG    1 
ATOM   2622 O OD1   . ASP B 2 294 ? 54.971 12.869  0.850   1.00 100.00 ? 295 ASP A OD1   1 
ATOM   2623 O OD2   . ASP B 2 294 ? 53.506 13.000  2.496   1.00 100.00 ? 295 ASP A OD2   1 
ATOM   2624 N N     . SER B 2 295 ? 51.952 15.613  -2.348  1.00 44.99  ? 296 SER A N     1 
ATOM   2625 C CA    . SER B 2 295 ? 51.061 16.662  -2.799  1.00 38.40  ? 296 SER A CA    1 
ATOM   2626 C C     . SER B 2 295 ? 50.331 16.118  -3.929  1.00 36.65  ? 296 SER A C     1 
ATOM   2627 O O     . SER B 2 295 ? 49.133 16.385  -4.115  1.00 43.12  ? 296 SER A O     1 
ATOM   2628 C CB    . SER B 2 295 ? 51.863 17.852  -3.172  1.00 35.99  ? 296 SER A CB    1 
ATOM   2629 O OG    . SER B 2 295 ? 52.589 18.147  -2.003  1.00 61.12  ? 296 SER A OG    1 
ATOM   2630 N N     . LEU B 2 296 ? 51.051 15.290  -4.668  1.00 22.06  ? 297 LEU A N     1 
ATOM   2631 C CA    . LEU B 2 296 ? 50.452 14.621  -5.782  1.00 24.15  ? 297 LEU A CA    1 
ATOM   2632 C C     . LEU B 2 296 ? 49.254 13.868  -5.144  1.00 33.45  ? 297 LEU A C     1 
ATOM   2633 O O     . LEU B 2 296 ? 48.182 13.686  -5.749  1.00 29.75  ? 297 LEU A O     1 
ATOM   2634 C CB    . LEU B 2 296 ? 51.429 13.632  -6.376  1.00 23.35  ? 297 LEU A CB    1 
ATOM   2635 C CG    . LEU B 2 296 ? 50.996 13.442  -7.816  1.00 36.48  ? 297 LEU A CG    1 
ATOM   2636 C CD1   . LEU B 2 296 ? 52.174 13.102  -8.693  1.00 40.94  ? 297 LEU A CD1   1 
ATOM   2637 C CD2   . LEU B 2 296 ? 49.896 12.385  -7.935  1.00 49.49  ? 297 LEU A CD2   1 
ATOM   2638 N N     . GLY B 2 297 ? 49.416 13.500  -3.870  1.00 27.11  ? 298 GLY A N     1 
ATOM   2639 C CA    . GLY B 2 297 ? 48.355 12.803  -3.184  1.00 22.93  ? 298 GLY A CA    1 
ATOM   2640 C C     . GLY B 2 297 ? 47.220 13.772  -3.002  1.00 39.38  ? 298 GLY A C     1 
ATOM   2641 O O     . GLY B 2 297 ? 46.135 13.666  -3.592  1.00 45.97  ? 298 GLY A O     1 
ATOM   2642 N N     . GLU B 2 298 ? 47.512 14.744  -2.170  1.00 33.25  ? 299 GLU A N     1 
ATOM   2643 C CA    . GLU B 2 298 ? 46.609 15.770  -1.780  1.00 26.64  ? 299 GLU A CA    1 
ATOM   2644 C C     . GLU B 2 298 ? 46.002 16.519  -2.903  1.00 34.37  ? 299 GLU A C     1 
ATOM   2645 O O     . GLU B 2 298 ? 44.812 16.760  -2.945  1.00 33.10  ? 299 GLU A O     1 
ATOM   2646 C CB    . GLU B 2 298 ? 47.398 16.735  -0.968  1.00 29.61  ? 299 GLU A CB    1 
ATOM   2647 C CG    . GLU B 2 298 ? 46.650 17.921  -0.471  1.00 57.16  ? 299 GLU A CG    1 
ATOM   2648 C CD    . GLU B 2 298 ? 47.530 18.758  0.393   1.00 94.47  ? 299 GLU A CD    1 
ATOM   2649 O OE1   . GLU B 2 298 ? 47.772 18.328  1.547   1.00 67.02  ? 299 GLU A OE1   1 
ATOM   2650 O OE2   . GLU B 2 298 ? 48.086 19.752  -0.135  1.00 100.00 ? 299 GLU A OE2   1 
ATOM   2651 N N     . THR B 2 299 ? 46.799 16.949  -3.843  1.00 42.93  ? 300 THR A N     1 
ATOM   2652 C CA    . THR B 2 299 ? 46.171 17.697  -4.909  1.00 42.57  ? 300 THR A CA    1 
ATOM   2653 C C     . THR B 2 299 ? 45.145 16.896  -5.691  1.00 42.73  ? 300 THR A C     1 
ATOM   2654 O O     . THR B 2 299 ? 44.183 17.449  -6.187  1.00 33.71  ? 300 THR A O     1 
ATOM   2655 C CB    . THR B 2 299 ? 47.187 18.268  -5.850  1.00 38.94  ? 300 THR A CB    1 
ATOM   2656 O OG1   . THR B 2 299 ? 47.827 19.359  -5.191  1.00 38.56  ? 300 THR A OG1   1 
ATOM   2657 C CG2   . THR B 2 299 ? 46.516 18.758  -7.134  1.00 36.03  ? 300 THR A CG2   1 
ATOM   2658 N N     . ALA B 2 300 ? 45.346 15.588  -5.810  1.00 45.67  ? 301 ALA A N     1 
ATOM   2659 C CA    . ALA B 2 300 ? 44.393 14.787  -6.570  1.00 43.92  ? 301 ALA A CA    1 
ATOM   2660 C C     . ALA B 2 300 ? 43.065 14.665  -5.792  1.00 43.72  ? 301 ALA A C     1 
ATOM   2661 O O     . ALA B 2 300 ? 41.944 14.858  -6.342  1.00 36.16  ? 301 ALA A O     1 
ATOM   2662 C CB    . ALA B 2 300 ? 44.986 13.417  -6.929  1.00 42.10  ? 301 ALA A CB    1 
ATOM   2663 N N     . PHE B 2 301 ? 43.201 14.344  -4.506  1.00 32.59  ? 302 PHE A N     1 
ATOM   2664 C CA    . PHE B 2 301 ? 42.024 14.194  -3.700  1.00 36.28  ? 302 PHE A CA    1 
ATOM   2665 C C     . PHE B 2 301 ? 41.187 15.392  -3.756  1.00 45.00  ? 302 PHE A C     1 
ATOM   2666 O O     . PHE B 2 301 ? 39.959 15.340  -3.859  1.00 49.12  ? 302 PHE A O     1 
ATOM   2667 C CB    . PHE B 2 301 ? 42.395 14.051  -2.272  1.00 38.18  ? 302 PHE A CB    1 
ATOM   2668 C CG    . PHE B 2 301 ? 41.276 13.624  -1.425  1.00 40.27  ? 302 PHE A CG    1 
ATOM   2669 C CD1   . PHE B 2 301 ? 40.909 12.302  -1.383  1.00 43.30  ? 302 PHE A CD1   1 
ATOM   2670 C CD2   . PHE B 2 301 ? 40.611 14.533  -0.644  1.00 47.60  ? 302 PHE A CD2   1 
ATOM   2671 C CE1   . PHE B 2 301 ? 39.897 11.877  -0.551  1.00 48.74  ? 302 PHE A CE1   1 
ATOM   2672 C CE2   . PHE B 2 301 ? 39.590 14.124  0.196   1.00 54.91  ? 302 PHE A CE2   1 
ATOM   2673 C CZ    . PHE B 2 301 ? 39.228 12.790  0.241   1.00 53.83  ? 302 PHE A CZ    1 
ATOM   2674 N N     . ASN B 2 302 ? 41.882 16.500  -3.694  1.00 43.48  ? 303 ASN A N     1 
ATOM   2675 C CA    . ASN B 2 302 ? 41.218 17.763  -3.674  1.00 44.34  ? 303 ASN A CA    1 
ATOM   2676 C C     . ASN B 2 302 ? 40.465 18.074  -4.893  1.00 45.65  ? 303 ASN A C     1 
ATOM   2677 O O     . ASN B 2 302 ? 39.289 18.454  -4.806  1.00 48.13  ? 303 ASN A O     1 
ATOM   2678 C CB    . ASN B 2 302 ? 42.153 18.869  -3.242  1.00 49.43  ? 303 ASN A CB    1 
ATOM   2679 C CG    . ASN B 2 302 ? 42.403 18.838  -1.762  1.00 76.39  ? 303 ASN A CG    1 
ATOM   2680 O OD1   . ASN B 2 302 ? 41.595 18.307  -1.011  1.00 67.48  ? 303 ASN A OD1   1 
ATOM   2681 N ND2   . ASN B 2 302 ? 43.558 19.314  -1.342  1.00 75.06  ? 303 ASN A ND2   1 
ATOM   2682 N N     . MET B 2 303 ? 41.118 17.916  -6.024  1.00 37.93  ? 304 MET A N     1 
ATOM   2683 C CA    . MET B 2 303 ? 40.467 18.198  -7.275  1.00 43.88  ? 304 MET A CA    1 
ATOM   2684 C C     . MET B 2 303 ? 39.171 17.393  -7.300  1.00 43.63  ? 304 MET A C     1 
ATOM   2685 O O     . MET B 2 303 ? 38.083 17.950  -7.514  1.00 48.29  ? 304 MET A O     1 
ATOM   2686 C CB    . MET B 2 303 ? 41.366 17.846  -8.480  1.00 48.48  ? 304 MET A CB    1 
ATOM   2687 C CG    . MET B 2 303 ? 42.442 18.856  -8.855  1.00 54.64  ? 304 MET A CG    1 
ATOM   2688 S SD    . MET B 2 303 ? 43.235 18.293  -10.395 1.00 69.47  ? 304 MET A SD    1 
ATOM   2689 C CE    . MET B 2 303 ? 42.929 19.697  -11.506 1.00 66.66  ? 304 MET A CE    1 
ATOM   2690 N N     . LEU B 2 304 ? 39.297 16.098  -7.024  1.00 31.93  ? 305 LEU A N     1 
ATOM   2691 C CA    . LEU B 2 304 ? 38.149 15.213  -7.014  1.00 27.35  ? 305 LEU A CA    1 
ATOM   2692 C C     . LEU B 2 304 ? 37.049 15.750  -6.151  1.00 32.18  ? 305 LEU A C     1 
ATOM   2693 O O     . LEU B 2 304 ? 35.948 15.982  -6.638  1.00 31.19  ? 305 LEU A O     1 
ATOM   2694 C CB    . LEU B 2 304 ? 38.538 13.856  -6.502  1.00 25.78  ? 305 LEU A CB    1 
ATOM   2695 C CG    . LEU B 2 304 ? 37.695 12.638  -6.865  1.00 23.42  ? 305 LEU A CG    1 
ATOM   2696 C CD1   . LEU B 2 304 ? 37.614 12.392  -8.391  1.00 15.75  ? 305 LEU A CD1   1 
ATOM   2697 C CD2   . LEU B 2 304 ? 38.487 11.535  -6.183  1.00 27.77  ? 305 LEU A CD2   1 
ATOM   2698 N N     . LEU B 2 305 ? 37.361 15.965  -4.879  1.00 26.00  ? 306 LEU A N     1 
ATOM   2699 C CA    . LEU B 2 305 ? 36.379 16.491  -3.949  1.00 31.27  ? 306 LEU A CA    1 
ATOM   2700 C C     . LEU B 2 305 ? 35.587 17.636  -4.533  1.00 36.99  ? 306 LEU A C     1 
ATOM   2701 O O     . LEU B 2 305 ? 34.349 17.675  -4.457  1.00 31.26  ? 306 LEU A O     1 
ATOM   2702 C CB    . LEU B 2 305 ? 37.048 16.975  -2.685  1.00 30.19  ? 306 LEU A CB    1 
ATOM   2703 C CG    . LEU B 2 305 ? 36.291 16.322  -1.540  1.00 39.65  ? 306 LEU A CG    1 
ATOM   2704 C CD1   . LEU B 2 305 ? 35.982 14.867  -1.895  1.00 42.19  ? 306 LEU A CD1   1 
ATOM   2705 C CD2   . LEU B 2 305 ? 37.013 16.369  -0.202  1.00 50.25  ? 306 LEU A CD2   1 
ATOM   2706 N N     . ASP B 2 306 ? 36.331 18.531  -5.159  1.00 35.81  ? 307 ASP A N     1 
ATOM   2707 C CA    . ASP B 2 306 ? 35.760 19.694  -5.788  1.00 40.79  ? 307 ASP A CA    1 
ATOM   2708 C C     . ASP B 2 306 ? 34.672 19.219  -6.689  1.00 50.16  ? 307 ASP A C     1 
ATOM   2709 O O     . ASP B 2 306 ? 33.480 19.408  -6.389  1.00 53.24  ? 307 ASP A O     1 
ATOM   2710 C CB    . ASP B 2 306 ? 36.803 20.378  -6.667  1.00 48.99  ? 307 ASP A CB    1 
ATOM   2711 C CG    . ASP B 2 306 ? 36.306 21.712  -7.243  1.00 74.66  ? 307 ASP A CG    1 
ATOM   2712 O OD1   . ASP B 2 306 ? 35.561 22.428  -6.515  1.00 62.95  ? 307 ASP A OD1   1 
ATOM   2713 O OD2   . ASP B 2 306 ? 36.681 22.056  -8.402  1.00 79.41  ? 307 ASP A OD2   1 
ATOM   2714 N N     . ARG B 2 307 ? 35.111 18.568  -7.760  1.00 41.68  ? 308 ARG A N     1 
ATOM   2715 C CA    . ARG B 2 307 ? 34.225 18.015  -8.745  1.00 43.15  ? 308 ARG A CA    1 
ATOM   2716 C C     . ARG B 2 307 ? 33.057 17.339  -8.023  1.00 46.40  ? 308 ARG A C     1 
ATOM   2717 O O     . ARG B 2 307 ? 31.896 17.671  -8.251  1.00 40.83  ? 308 ARG A O     1 
ATOM   2718 C CB    . ARG B 2 307 ? 35.003 17.023  -9.615  1.00 48.00  ? 308 ARG A CB    1 
ATOM   2719 C CG    . ARG B 2 307 ? 34.582 17.044  -11.101 1.00 79.88  ? 308 ARG A CG    1 
ATOM   2720 C CD    . ARG B 2 307 ? 35.542 16.255  -11.996 1.00 47.39  ? 308 ARG A CD    1 
ATOM   2721 N NE    . ARG B 2 307 ? 35.886 16.981  -13.215 1.00 62.97  ? 308 ARG A NE    1 
ATOM   2722 C CZ    . ARG B 2 307 ? 35.984 16.412  -14.420 1.00 100.00 ? 308 ARG A CZ    1 
ATOM   2723 N NH1   . ARG B 2 307 ? 35.723 15.115  -14.554 1.00 100.00 ? 308 ARG A NH1   1 
ATOM   2724 N NH2   . ARG B 2 307 ? 36.306 17.122  -15.498 1.00 93.38  ? 308 ARG A NH2   1 
ATOM   2725 N N     . ILE B 2 308 ? 33.410 16.483  -7.068  1.00 44.69  ? 309 ILE A N     1 
ATOM   2726 C CA    . ILE B 2 308 ? 32.437 15.774  -6.270  1.00 44.53  ? 309 ILE A CA    1 
ATOM   2727 C C     . ILE B 2 308 ? 31.488 16.756  -5.662  1.00 49.47  ? 309 ILE A C     1 
ATOM   2728 O O     . ILE B 2 308 ? 30.356 16.876  -6.114  1.00 53.45  ? 309 ILE A O     1 
ATOM   2729 C CB    . ILE B 2 308 ? 33.061 15.035  -5.095  1.00 48.74  ? 309 ILE A CB    1 
ATOM   2730 C CG1   . ILE B 2 308 ? 33.701 13.725  -5.529  1.00 49.44  ? 309 ILE A CG1   1 
ATOM   2731 C CG2   . ILE B 2 308 ? 32.004 14.703  -4.084  1.00 50.07  ? 309 ILE A CG2   1 
ATOM   2732 C CD1   . ILE B 2 308 ? 35.161 13.677  -5.164  1.00 63.04  ? 309 ILE A CD1   1 
ATOM   2733 N N     . VAL B 2 309 ? 31.905 17.477  -4.637  1.00 38.90  ? 310 VAL A N     1 
ATOM   2734 C CA    . VAL B 2 309 ? 30.913 18.363  -4.091  1.00 39.28  ? 310 VAL A CA    1 
ATOM   2735 C C     . VAL B 2 309 ? 30.592 19.577  -4.901  1.00 53.79  ? 310 VAL A C     1 
ATOM   2736 O O     . VAL B 2 309 ? 29.452 19.980  -4.990  1.00 57.35  ? 310 VAL A O     1 
ATOM   2737 C CB    . VAL B 2 309 ? 31.159 18.800  -2.692  1.00 37.68  ? 310 VAL A CB    1 
ATOM   2738 C CG1   . VAL B 2 309 ? 32.324 18.063  -2.085  1.00 39.60  ? 310 VAL A CG1   1 
ATOM   2739 C CG2   . VAL B 2 309 ? 31.345 20.287  -2.683  1.00 33.79  ? 310 VAL A CG2   1 
ATOM   2740 N N     . ASN B 2 310 ? 31.569 20.215  -5.477  1.00 53.12  ? 311 ASN A N     1 
ATOM   2741 C CA    . ASN B 2 310 ? 31.174 21.395  -6.200  1.00 56.25  ? 311 ASN A CA    1 
ATOM   2742 C C     . ASN B 2 310 ? 30.638 21.123  -7.556  1.00 59.93  ? 311 ASN A C     1 
ATOM   2743 O O     . ASN B 2 310 ? 30.635 21.994  -8.405  1.00 63.77  ? 311 ASN A O     1 
ATOM   2744 C CB    . ASN B 2 310 ? 32.253 22.452  -6.212  1.00 64.92  ? 311 ASN A CB    1 
ATOM   2745 C CG    . ASN B 2 310 ? 32.278 23.229  -4.937  1.00 100.00 ? 311 ASN A CG    1 
ATOM   2746 O OD1   . ASN B 2 310 ? 31.732 22.770  -3.927  1.00 95.67  ? 311 ASN A OD1   1 
ATOM   2747 N ND2   . ASN B 2 310 ? 32.884 24.423  -4.964  1.00 100.00 ? 311 ASN A ND2   1 
ATOM   2748 N N     . LYS B 2 311 ? 30.170 19.907  -7.733  1.00 57.28  ? 312 LYS A N     1 
ATOM   2749 C CA    . LYS B 2 311 ? 29.605 19.451  -8.993  1.00 63.44  ? 312 LYS A CA    1 
ATOM   2750 C C     . LYS B 2 311 ? 30.232 20.072  -10.248 1.00 67.38  ? 312 LYS A C     1 
ATOM   2751 O O     . LYS B 2 311 ? 29.552 20.449  -11.203 1.00 66.99  ? 312 LYS A O     1 
ATOM   2752 C CB    . LYS B 2 311 ? 28.068 19.496  -8.973  1.00 71.14  ? 312 LYS A CB    1 
ATOM   2753 C CG    . LYS B 2 311 ? 27.395 18.258  -8.301  1.00 80.21  ? 312 LYS A CG    1 
ATOM   2754 C CD    . LYS B 2 311 ? 25.854 18.150  -8.556  1.00 99.43  ? 312 LYS A CD    1 
ATOM   2755 C CE    . LYS B 2 311 ? 25.501 17.851  -10.048 1.00 100.00 ? 312 LYS A CE    1 
ATOM   2756 N NZ    . LYS B 2 311 ? 24.058 18.070  -10.451 1.00 89.17  ? 312 LYS A NZ    1 
ATOM   2757 N N     . ARG B 2 312 ? 31.550 20.197  -10.195 1.00 65.37  ? 313 ARG A N     1 
ATOM   2758 C CA    . ARG B 2 312 ? 32.278 20.768  -11.298 1.00 64.51  ? 313 ARG A CA    1 
ATOM   2759 C C     . ARG B 2 312 ? 32.134 19.946  -12.569 1.00 69.60  ? 313 ARG A C     1 
ATOM   2760 O O     . ARG B 2 312 ? 32.016 18.716  -12.552 1.00 67.02  ? 313 ARG A O     1 
ATOM   2761 C CB    . ARG B 2 312 ? 33.732 20.990  -10.944 1.00 62.34  ? 313 ARG A CB    1 
ATOM   2762 C CG    . ARG B 2 312 ? 34.609 21.348  -12.150 1.00 66.69  ? 313 ARG A CG    1 
ATOM   2763 C CD    . ARG B 2 312 ? 35.738 22.273  -11.710 1.00 77.37  ? 313 ARG A CD    1 
ATOM   2764 N NE    . ARG B 2 312 ? 36.621 21.574  -10.792 1.00 70.84  ? 313 ARG A NE    1 
ATOM   2765 C CZ    . ARG B 2 312 ? 37.317 20.493  -11.139 1.00 84.72  ? 313 ARG A CZ    1 
ATOM   2766 N NH1   . ARG B 2 312 ? 37.246 20.006  -12.397 1.00 36.48  ? 313 ARG A NH1   1 
ATOM   2767 N NH2   . ARG B 2 312 ? 38.089 19.898  -10.229 1.00 53.21  ? 313 ARG A NH2   1 
ATOM   2768 N N     . GLU B 2 313 ? 32.082 20.656  -13.675 1.00 68.80  ? 314 GLU A N     1 
ATOM   2769 C CA    . GLU B 2 313 ? 31.895 20.041  -14.958 1.00 70.94  ? 314 GLU A CA    1 
ATOM   2770 C C     . GLU B 2 313 ? 33.140 19.954  -15.809 1.00 73.56  ? 314 GLU A C     1 
ATOM   2771 O O     . GLU B 2 313 ? 33.409 18.941  -16.453 1.00 68.68  ? 314 GLU A O     1 
ATOM   2772 C CB    . GLU B 2 313 ? 30.844 20.878  -15.683 1.00 73.52  ? 314 GLU A CB    1 
ATOM   2773 C CG    . GLU B 2 313 ? 29.425 20.546  -15.233 1.00 100.00 ? 314 GLU A CG    1 
ATOM   2774 C CD    . GLU B 2 313 ? 29.096 19.040  -15.368 1.00 100.00 ? 314 GLU A CD    1 
ATOM   2775 O OE1   . GLU B 2 313 ? 29.230 18.492  -16.496 1.00 100.00 ? 314 GLU A OE1   1 
ATOM   2776 O OE2   . GLU B 2 313 ? 28.721 18.404  -14.339 1.00 100.00 ? 314 GLU A OE2   1 
ATOM   2777 N N     . GLU B 2 314 ? 33.879 21.051  -15.819 1.00 71.77  ? 315 GLU A N     1 
ATOM   2778 C CA    . GLU B 2 314 ? 35.080 21.140  -16.599 1.00 71.23  ? 315 GLU A CA    1 
ATOM   2779 C C     . GLU B 2 314 ? 36.296 20.497  -15.979 1.00 65.89  ? 315 GLU A C     1 
ATOM   2780 O O     . GLU B 2 314 ? 36.570 20.609  -14.755 1.00 62.79  ? 315 GLU A O     1 
ATOM   2781 C CB    . GLU B 2 314 ? 35.391 22.599  -16.951 1.00 74.89  ? 315 GLU A CB    1 
ATOM   2782 C CG    . GLU B 2 314 ? 34.161 23.423  -17.331 1.00 100.00 ? 315 GLU A CG    1 
ATOM   2783 C CD    . GLU B 2 314 ? 33.954 24.656  -16.429 1.00 100.00 ? 315 GLU A CD    1 
ATOM   2784 O OE1   . GLU B 2 314 ? 33.482 24.460  -15.263 1.00 100.00 ? 315 GLU A OE1   1 
ATOM   2785 O OE2   . GLU B 2 314 ? 34.219 25.807  -16.898 1.00 100.00 ? 315 GLU A OE2   1 
ATOM   2786 N N     . PRO B 2 315 ? 37.012 19.827  -16.880 1.00 51.85  ? 316 PRO A N     1 
ATOM   2787 C CA    . PRO B 2 315 ? 38.251 19.149  -16.612 1.00 48.08  ? 316 PRO A CA    1 
ATOM   2788 C C     . PRO B 2 315 ? 39.236 20.244  -16.263 1.00 52.08  ? 316 PRO A C     1 
ATOM   2789 O O     . PRO B 2 315 ? 39.229 21.323  -16.837 1.00 54.79  ? 316 PRO A O     1 
ATOM   2790 C CB    . PRO B 2 315 ? 38.582 18.529  -17.945 1.00 49.16  ? 316 PRO A CB    1 
ATOM   2791 C CG    . PRO B 2 315 ? 38.006 19.479  -18.936 1.00 56.04  ? 316 PRO A CG    1 
ATOM   2792 C CD    . PRO B 2 315 ? 36.869 20.186  -18.293 1.00 50.51  ? 316 PRO A CD    1 
ATOM   2793 N N     . GLN B 2 316 ? 40.069 19.961  -15.297 1.00 50.72  ? 317 GLN A N     1 
ATOM   2794 C CA    . GLN B 2 316 ? 41.026 20.913  -14.831 1.00 49.01  ? 317 GLN A CA    1 
ATOM   2795 C C     . GLN B 2 316 ? 42.332 20.139  -14.706 1.00 50.74  ? 317 GLN A C     1 
ATOM   2796 O O     . GLN B 2 316 ? 42.318 18.894  -14.583 1.00 50.33  ? 317 GLN A O     1 
ATOM   2797 C CB    . GLN B 2 316 ? 40.549 21.272  -13.442 1.00 48.49  ? 317 GLN A CB    1 
ATOM   2798 C CG    . GLN B 2 316 ? 41.299 22.303  -12.726 1.00 62.81  ? 317 GLN A CG    1 
ATOM   2799 C CD    . GLN B 2 316 ? 40.377 22.990  -11.760 1.00 93.91  ? 317 GLN A CD    1 
ATOM   2800 O OE1   . GLN B 2 316 ? 39.432 23.671  -12.181 1.00 99.86  ? 317 GLN A OE1   1 
ATOM   2801 N NE2   . GLN B 2 316 ? 40.522 22.672  -10.469 1.00 62.14  ? 317 GLN A NE2   1 
ATOM   2802 N N     . SER B 2 317 ? 43.453 20.861  -14.687 1.00 44.59  ? 318 SER A N     1 
ATOM   2803 C CA    . SER B 2 317 ? 44.795 20.232  -14.536 1.00 40.83  ? 318 SER A CA    1 
ATOM   2804 C C     . SER B 2 317 ? 45.630 20.986  -13.555 1.00 43.99  ? 318 SER A C     1 
ATOM   2805 O O     . SER B 2 317 ? 45.548 22.193  -13.477 1.00 44.36  ? 318 SER A O     1 
ATOM   2806 C CB    . SER B 2 317 ? 45.532 20.214  -15.853 1.00 39.90  ? 318 SER A CB    1 
ATOM   2807 O OG    . SER B 2 317 ? 44.929 21.123  -16.757 1.00 88.44  ? 318 SER A OG    1 
ATOM   2808 N N     . ILE B 2 318 ? 46.439 20.298  -12.767 1.00 38.86  ? 319 ILE A N     1 
ATOM   2809 C CA    . ILE B 2 318 ? 47.241 21.050  -11.835 1.00 34.71  ? 319 ILE A CA    1 
ATOM   2810 C C     . ILE B 2 318 ? 48.664 20.582  -11.973 1.00 41.72  ? 319 ILE A C     1 
ATOM   2811 O O     . ILE B 2 318 ? 48.905 19.374  -12.031 1.00 48.68  ? 319 ILE A O     1 
ATOM   2812 C CB    . ILE B 2 318 ? 46.682 20.956  -10.477 1.00 34.51  ? 319 ILE A CB    1 
ATOM   2813 C CG1   . ILE B 2 318 ? 45.334 21.677  -10.443 1.00 38.20  ? 319 ILE A CG1   1 
ATOM   2814 C CG2   . ILE B 2 318 ? 47.563 21.691  -9.511  1.00 25.38  ? 319 ILE A CG2   1 
ATOM   2815 C CD1   . ILE B 2 318 ? 44.786 21.819  -9.012  1.00 49.40  ? 319 ILE A CD1   1 
ATOM   2816 N N     . GLU B 2 319 ? 49.602 21.516  -12.100 1.00 28.68  ? 320 GLU A N     1 
ATOM   2817 C CA    . GLU B 2 319 ? 50.985 21.099  -12.255 1.00 25.80  ? 320 GLU A CA    1 
ATOM   2818 C C     . GLU B 2 319 ? 51.615 20.929  -10.907 1.00 34.48  ? 320 GLU A C     1 
ATOM   2819 O O     . GLU B 2 319 ? 51.197 21.528  -9.916  1.00 25.88  ? 320 GLU A O     1 
ATOM   2820 C CB    . GLU B 2 319 ? 51.824 22.141  -12.943 1.00 26.38  ? 320 GLU A CB    1 
ATOM   2821 C CG    . GLU B 2 319 ? 51.621 22.226  -14.429 1.00 35.54  ? 320 GLU A CG    1 
ATOM   2822 C CD    . GLU B 2 319 ? 52.618 23.162  -15.075 1.00 32.16  ? 320 GLU A CD    1 
ATOM   2823 O OE1   . GLU B 2 319 ? 53.239 23.954  -14.337 1.00 99.60  ? 320 GLU A OE1   1 
ATOM   2824 O OE2   . GLU B 2 319 ? 52.692 23.189  -16.325 1.00 77.86  ? 320 GLU A OE2   1 
ATOM   2825 N N     . VAL B 2 320 ? 52.684 20.153  -10.877 1.00 38.35  ? 321 VAL A N     1 
ATOM   2826 C CA    . VAL B 2 320 ? 53.400 19.943  -9.632  1.00 34.15  ? 321 VAL A CA    1 
ATOM   2827 C C     . VAL B 2 320 ? 54.894 19.955  -10.045 1.00 32.14  ? 321 VAL A C     1 
ATOM   2828 O O     . VAL B 2 320 ? 55.200 19.789  -11.221 1.00 22.15  ? 321 VAL A O     1 
ATOM   2829 C CB    . VAL B 2 320 ? 52.941 18.670  -8.984  1.00 30.06  ? 321 VAL A CB    1 
ATOM   2830 C CG1   . VAL B 2 320 ? 53.417 17.476  -9.813  1.00 32.40  ? 321 VAL A CG1   1 
ATOM   2831 C CG2   . VAL B 2 320 ? 53.374 18.612  -7.566  1.00 24.32  ? 321 VAL A CG2   1 
ATOM   2832 N N     . HIS B 2 321 ? 55.806 20.244  -9.108  1.00 34.85  ? 322 HIS A N     1 
ATOM   2833 C CA    . HIS B 2 321 ? 57.230 20.321  -9.454  1.00 37.07  ? 322 HIS A CA    1 
ATOM   2834 C C     . HIS B 2 321 ? 58.266 19.564  -8.708  1.00 38.22  ? 322 HIS A C     1 
ATOM   2835 O O     . HIS B 2 321 ? 58.352 19.616  -7.487  1.00 47.74  ? 322 HIS A O     1 
ATOM   2836 C CB    . HIS B 2 321 ? 57.691 21.779  -9.561  1.00 43.14  ? 322 HIS A CB    1 
ATOM   2837 C CG    . HIS B 2 321 ? 56.974 22.522  -10.620 1.00 53.54  ? 322 HIS A CG    1 
ATOM   2838 N ND1   . HIS B 2 321 ? 57.435 22.590  -11.918 1.00 59.65  ? 322 HIS A ND1   1 
ATOM   2839 C CD2   . HIS B 2 321 ? 55.770 23.143  -10.606 1.00 59.39  ? 322 HIS A CD2   1 
ATOM   2840 C CE1   . HIS B 2 321 ? 56.570 23.277  -12.648 1.00 61.16  ? 322 HIS A CE1   1 
ATOM   2841 N NE2   . HIS B 2 321 ? 55.549 23.616  -11.877 1.00 61.25  ? 322 HIS A NE2   1 
ATOM   2842 N N     . PRO B 2 322 ? 59.105 18.890  -9.481  1.00 26.67  ? 323 PRO A N     1 
ATOM   2843 C CA    . PRO B 2 322 ? 60.210 18.082  -8.964  1.00 26.14  ? 323 PRO A CA    1 
ATOM   2844 C C     . PRO B 2 322 ? 61.365 18.998  -8.602  1.00 37.57  ? 323 PRO A C     1 
ATOM   2845 O O     . PRO B 2 322 ? 61.471 20.105  -9.124  1.00 37.48  ? 323 PRO A O     1 
ATOM   2846 C CB    . PRO B 2 322 ? 60.619 17.301  -10.212 1.00 26.58  ? 323 PRO A CB    1 
ATOM   2847 C CG    . PRO B 2 322 ? 60.451 18.319  -11.310 1.00 23.81  ? 323 PRO A CG    1 
ATOM   2848 C CD    . PRO B 2 322 ? 59.189 19.046  -10.952 1.00 21.19  ? 323 PRO A CD    1 
ATOM   2849 N N     . ARG B 2 323 ? 62.259 18.540  -7.744  1.00 37.47  ? 324 ARG A N     1 
ATOM   2850 C CA    . ARG B 2 323 ? 63.371 19.397  -7.381  1.00 34.01  ? 324 ARG A CA    1 
ATOM   2851 C C     . ARG B 2 323 ? 64.576 18.574  -6.942  1.00 41.54  ? 324 ARG A C     1 
ATOM   2852 O O     . ARG B 2 323 ? 64.448 17.591  -6.178  1.00 35.91  ? 324 ARG A O     1 
ATOM   2853 C CB    . ARG B 2 323 ? 62.920 20.295  -6.259  1.00 22.50  ? 324 ARG A CB    1 
ATOM   2854 C CG    . ARG B 2 323 ? 63.075 19.636  -4.927  1.00 38.16  ? 324 ARG A CG    1 
ATOM   2855 C CD    . ARG B 2 323 ? 62.331 20.339  -3.791  1.00 81.26  ? 324 ARG A CD    1 
ATOM   2856 N NE    . ARG B 2 323 ? 62.884 19.896  -2.502  1.00 100.00 ? 324 ARG A NE    1 
ATOM   2857 C CZ    . ARG B 2 323 ? 62.194 19.283  -1.539  1.00 100.00 ? 324 ARG A CZ    1 
ATOM   2858 N NH1   . ARG B 2 323 ? 60.899 19.041  -1.708  1.00 100.00 ? 324 ARG A NH1   1 
ATOM   2859 N NH2   . ARG B 2 323 ? 62.796 18.919  -0.404  1.00 100.00 ? 324 ARG A NH2   1 
ATOM   2860 N N     . LEU B 2 324 ? 65.745 18.987  -7.443  1.00 35.68  ? 325 LEU A N     1 
ATOM   2861 C CA    . LEU B 2 324 ? 66.998 18.292  -7.165  1.00 28.95  ? 325 LEU A CA    1 
ATOM   2862 C C     . LEU B 2 324 ? 67.305 18.138  -5.709  1.00 26.23  ? 325 LEU A C     1 
ATOM   2863 O O     . LEU B 2 324 ? 67.192 19.101  -4.958  1.00 30.99  ? 325 LEU A O     1 
ATOM   2864 C CB    . LEU B 2 324 ? 68.190 18.959  -7.894  1.00 26.32  ? 325 LEU A CB    1 
ATOM   2865 C CG    . LEU B 2 324 ? 69.631 18.411  -7.738  1.00 27.64  ? 325 LEU A CG    1 
ATOM   2866 C CD1   . LEU B 2 324 ? 70.229 18.537  -6.331  1.00 27.02  ? 325 LEU A CD1   1 
ATOM   2867 C CD2   . LEU B 2 324 ? 69.628 16.965  -8.124  1.00 26.93  ? 325 LEU A CD2   1 
ATOM   2868 N N     . ILE B 2 325 ? 67.708 16.939  -5.313  1.00 12.85  ? 326 ILE A N     1 
ATOM   2869 C CA    . ILE B 2 325 ? 68.095 16.707  -3.934  1.00 18.09  ? 326 ILE A CA    1 
ATOM   2870 C C     . ILE B 2 325 ? 69.531 16.213  -3.971  1.00 29.79  ? 326 ILE A C     1 
ATOM   2871 O O     . ILE B 2 325 ? 69.801 15.085  -4.432  1.00 31.12  ? 326 ILE A O     1 
ATOM   2872 C CB    . ILE B 2 325 ? 67.270 15.622  -3.288  1.00 22.81  ? 326 ILE A CB    1 
ATOM   2873 C CG1   . ILE B 2 325 ? 65.838 16.058  -3.234  1.00 23.78  ? 326 ILE A CG1   1 
ATOM   2874 C CG2   . ILE B 2 325 ? 67.763 15.328  -1.858  1.00 16.92  ? 326 ILE A CG2   1 
ATOM   2875 C CD1   . ILE B 2 325 ? 65.525 16.568  -1.885  1.00 28.78  ? 326 ILE A CD1   1 
ATOM   2876 N N     . GLU B 2 326 ? 70.449 17.033  -3.477  1.00 22.55  ? 327 GLU A N     1 
ATOM   2877 C CA    . GLU B 2 326 ? 71.849 16.616  -3.476  1.00 23.10  ? 327 GLU A CA    1 
ATOM   2878 C C     . GLU B 2 326 ? 72.349 15.702  -2.364  1.00 32.79  ? 327 GLU A C     1 
ATOM   2879 O O     . GLU B 2 326 ? 72.345 16.106  -1.228  1.00 35.04  ? 327 GLU A O     1 
ATOM   2880 C CB    . GLU B 2 326 ? 72.774 17.817  -3.466  1.00 23.26  ? 327 GLU A CB    1 
ATOM   2881 C CG    . GLU B 2 326 ? 73.102 18.381  -4.826  1.00 41.70  ? 327 GLU A CG    1 
ATOM   2882 C CD    . GLU B 2 326 ? 73.971 19.610  -4.713  1.00 40.02  ? 327 GLU A CD    1 
ATOM   2883 O OE1   . GLU B 2 326 ? 73.415 20.709  -4.469  1.00 56.30  ? 327 GLU A OE1   1 
ATOM   2884 O OE2   . GLU B 2 326 ? 75.210 19.498  -4.840  1.00 71.14  ? 327 GLU A OE2   1 
ATOM   2885 N N     . ARG B 2 327 ? 72.818 14.493  -2.695  1.00 32.66  ? 328 ARG A N     1 
ATOM   2886 C CA    . ARG B 2 327 ? 73.441 13.563  -1.715  1.00 27.81  ? 328 ARG A CA    1 
ATOM   2887 C C     . ARG B 2 327 ? 74.908 13.156  -1.842  1.00 31.60  ? 328 ARG A C     1 
ATOM   2888 O O     . ARG B 2 327 ? 75.782 13.993  -2.080  1.00 37.56  ? 328 ARG A O     1 
ATOM   2889 C CB    . ARG B 2 327 ? 72.574 12.771  -0.723  1.00 27.12  ? 328 ARG A CB    1 
ATOM   2890 C CG    . ARG B 2 327 ? 71.075 12.993  -0.804  1.00 26.22  ? 328 ARG A CG    1 
ATOM   2891 C CD    . ARG B 2 327 ? 70.404 11.917  -0.030  1.00 4.02   ? 328 ARG A CD    1 
ATOM   2892 N NE    . ARG B 2 327 ? 69.107 12.310  0.512   1.00 49.11  ? 328 ARG A NE    1 
ATOM   2893 C CZ    . ARG B 2 327 ? 67.917 12.110  -0.073  1.00 15.00  ? 328 ARG A CZ    1 
ATOM   2894 N NH1   . ARG B 2 327 ? 67.817 11.522  -1.262  1.00 28.52  ? 328 ARG A NH1   1 
ATOM   2895 N NH2   . ARG B 2 327 ? 66.809 12.528  0.539   1.00 36.90  ? 328 ARG A NH2   1 
ATOM   2896 N N     . ARG B 2 328 ? 75.203 11.884  -1.732  1.00 30.39  ? 329 ARG A N     1 
ATOM   2897 C CA    . ARG B 2 328 ? 76.584 11.519  -1.824  1.00 26.37  ? 329 ARG A CA    1 
ATOM   2898 C C     . ARG B 2 328 ? 76.996 10.684  -2.950  1.00 28.52  ? 329 ARG A C     1 
ATOM   2899 O O     . ARG B 2 328 ? 78.149 10.315  -3.018  1.00 40.54  ? 329 ARG A O     1 
ATOM   2900 C CB    . ARG B 2 328 ? 76.885 10.778  -0.565  1.00 23.94  ? 329 ARG A CB    1 
ATOM   2901 C CG    . ARG B 2 328 ? 76.080 11.346  0.593   1.00 67.79  ? 329 ARG A CG    1 
ATOM   2902 C CD    . ARG B 2 328 ? 76.939 11.511  1.834   1.00 87.72  ? 329 ARG A CD    1 
ATOM   2903 N NE    . ARG B 2 328 ? 78.334 11.297  1.475   1.00 100.00 ? 329 ARG A NE    1 
ATOM   2904 C CZ    . ARG B 2 328 ? 78.961 10.117  1.484   1.00 100.00 ? 329 ARG A CZ    1 
ATOM   2905 N NH1   . ARG B 2 328 ? 78.339 8.980   1.876   1.00 87.12  ? 329 ARG A NH1   1 
ATOM   2906 N NH2   . ARG B 2 328 ? 80.224 10.070  1.114   1.00 100.00 ? 329 ARG A NH2   1 
ATOM   2907 N N     . SER B 2 329 ? 76.081 10.379  -3.848  1.00 18.61  ? 330 SER A N     1 
ATOM   2908 C CA    . SER B 2 329 ? 76.372 9.495   -4.974  1.00 20.01  ? 330 SER A CA    1 
ATOM   2909 C C     . SER B 2 329 ? 76.968 10.137  -6.233  1.00 25.76  ? 330 SER A C     1 
ATOM   2910 O O     . SER B 2 329 ? 77.230 9.470   -7.278  1.00 22.53  ? 330 SER A O     1 
ATOM   2911 C CB    . SER B 2 329 ? 75.088 8.742   -5.338  1.00 28.18  ? 330 SER A CB    1 
ATOM   2912 O OG    . SER B 2 329 ? 74.139 9.587   -6.035  1.00 18.03  ? 330 SER A OG    1 
ATOM   2913 N N     . VAL B 2 330 ? 77.155 11.447  -6.167  1.00 17.78  ? 331 VAL A N     1 
ATOM   2914 C CA    . VAL B 2 330 ? 77.703 12.086  -7.335  1.00 18.02  ? 331 VAL A CA    1 
ATOM   2915 C C     . VAL B 2 330 ? 78.930 12.795  -6.940  1.00 32.86  ? 331 VAL A C     1 
ATOM   2916 O O     . VAL B 2 330 ? 79.067 13.260  -5.784  1.00 37.29  ? 331 VAL A O     1 
ATOM   2917 C CB    . VAL B 2 330 ? 76.726 12.997  -8.069  1.00 25.52  ? 331 VAL A CB    1 
ATOM   2918 C CG1   . VAL B 2 330 ? 77.505 13.977  -8.942  1.00 23.26  ? 331 VAL A CG1   1 
ATOM   2919 C CG2   . VAL B 2 330 ? 75.693 12.142  -8.884  1.00 23.71  ? 331 VAL A CG2   1 
ATOM   2920 N N     . ALA B 2 331 ? 79.868 12.818  -7.888  1.00 27.76  ? 332 ALA A N     1 
ATOM   2921 C CA    . ALA B 2 331 ? 81.128 13.466  -7.681  1.00 29.39  ? 332 ALA A CA    1 
ATOM   2922 C C     . ALA B 2 331 ? 81.502 14.185  -8.935  1.00 41.04  ? 332 ALA A C     1 
ATOM   2923 O O     . ALA B 2 331 ? 80.992 13.848  -10.020 1.00 42.16  ? 332 ALA A O     1 
ATOM   2924 C CB    . ALA B 2 331 ? 82.159 12.458  -7.347  1.00 34.12  ? 332 ALA A CB    1 
ATOM   2925 N N     . ASP B 2 332 ? 82.379 15.175  -8.773  1.00 33.77  ? 333 ASP A N     1 
ATOM   2926 C CA    . ASP B 2 332 ? 82.877 15.965  -9.884  1.00 27.48  ? 333 ASP A CA    1 
ATOM   2927 C C     . ASP B 2 332 ? 83.410 15.151  -11.062 1.00 27.53  ? 333 ASP A C     1 
ATOM   2928 O O     . ASP B 2 332 ? 84.135 14.214  -10.874 1.00 32.35  ? 333 ASP A O     1 
ATOM   2929 C CB    . ASP B 2 332 ? 83.990 16.824  -9.341  1.00 30.23  ? 333 ASP A CB    1 
ATOM   2930 C CG    . ASP B 2 332 ? 83.459 17.996  -8.580  1.00 53.64  ? 333 ASP A CG    1 
ATOM   2931 O OD1   . ASP B 2 332 ? 82.265 18.347  -8.793  1.00 61.28  ? 333 ASP A OD1   1 
ATOM   2932 O OD2   . ASP B 2 332 ? 84.196 18.523  -7.713  1.00 35.50  ? 333 ASP A OD2   1 
ATOM   2933 N N     . GLY B 2 333 ? 83.047 15.514  -12.285 1.00 30.50  ? 334 GLY A N     1 
ATOM   2934 C CA    . GLY B 2 333 ? 83.532 14.807  -13.480 1.00 26.84  ? 334 GLY A CA    1 
ATOM   2935 C C     . GLY B 2 333 ? 84.804 15.495  -14.058 1.00 35.14  ? 334 GLY A C     1 
ATOM   2936 O O     . GLY B 2 333 ? 85.222 16.609  -13.641 1.00 28.68  ? 334 GLY A O     1 
ATOM   2937 N N     . PRO B 2 334 ? 85.413 14.828  -15.020 1.00 32.71  ? 335 PRO A N     1 
ATOM   2938 C CA    . PRO B 2 334 ? 86.625 15.322  -15.614 1.00 29.82  ? 335 PRO A CA    1 
ATOM   2939 C C     . PRO B 2 334 ? 86.625 16.761  -16.138 1.00 27.43  ? 335 PRO A C     1 
ATOM   2940 O O     . PRO B 2 334 ? 87.679 17.402  -16.220 1.00 33.97  ? 335 PRO A O     1 
ATOM   2941 C CB    . PRO B 2 334 ? 86.912 14.286  -16.706 1.00 32.86  ? 335 PRO A CB    1 
ATOM   2942 C CG    . PRO B 2 334 ? 85.942 13.149  -16.468 1.00 35.68  ? 335 PRO A CG    1 
ATOM   2943 C CD    . PRO B 2 334 ? 84.762 13.856  -15.903 1.00 32.90  ? 335 PRO A CD    1 
ATOM   2944 N N     . PHE B 2 335 ? 85.478 17.300  -16.481 1.00 16.24  ? 336 PHE A N     1 
ATOM   2945 C CA    . PHE B 2 335 ? 85.496 18.677  -16.981 1.00 16.55  ? 336 PHE A CA    1 
ATOM   2946 C C     . PHE B 2 335 ? 85.050 19.795  -16.044 1.00 26.85  ? 336 PHE A C     1 
ATOM   2947 O O     . PHE B 2 335 ? 84.867 20.942  -16.496 1.00 32.12  ? 336 PHE A O     1 
ATOM   2948 C CB    . PHE B 2 335 ? 84.692 18.791  -18.213 1.00 18.68  ? 336 PHE A CB    1 
ATOM   2949 C CG    . PHE B 2 335 ? 84.994 17.758  -19.207 1.00 24.04  ? 336 PHE A CG    1 
ATOM   2950 C CD1   . PHE B 2 335 ? 84.591 16.481  -18.997 1.00 35.96  ? 336 PHE A CD1   1 
ATOM   2951 C CD2   . PHE B 2 335 ? 85.651 18.085  -20.385 1.00 28.19  ? 336 PHE A CD2   1 
ATOM   2952 C CE1   . PHE B 2 335 ? 84.851 15.528  -19.936 1.00 41.41  ? 336 PHE A CE1   1 
ATOM   2953 C CE2   . PHE B 2 335 ? 85.937 17.157  -21.334 1.00 29.59  ? 336 PHE A CE2   1 
ATOM   2954 C CZ    . PHE B 2 335 ? 85.525 15.876  -21.110 1.00 38.70  ? 336 PHE A CZ    1 
ATOM   2955 N N     . ARG B 2 336 ? 84.895 19.485  -14.759 1.00 16.52  ? 337 ARG A N     1 
ATOM   2956 C CA    . ARG B 2 336 ? 84.476 20.498  -13.803 1.00 18.13  ? 337 ARG A CA    1 
ATOM   2957 C C     . ARG B 2 336 ? 85.359 21.713  -13.883 1.00 32.38  ? 337 ARG A C     1 
ATOM   2958 O O     . ARG B 2 336 ? 84.871 22.787  -14.237 1.00 41.16  ? 337 ARG A O     1 
ATOM   2959 C CB    . ARG B 2 336 ? 84.351 19.962  -12.368 1.00 30.54  ? 337 ARG A CB    1 
ATOM   2960 C CG    . ARG B 2 336 ? 83.533 20.861  -11.444 1.00 54.93  ? 337 ARG A CG    1 
ATOM   2961 C CD    . ARG B 2 336 ? 84.326 21.187  -10.159 1.00 100.00 ? 337 ARG A CD    1 
ATOM   2962 N NE    . ARG B 2 336 ? 84.496 22.625  -9.841  1.00 100.00 ? 337 ARG A NE    1 
ATOM   2963 C CZ    . ARG B 2 336 ? 85.474 23.419  -10.323 1.00 100.00 ? 337 ARG A CZ    1 
ATOM   2964 N NH1   . ARG B 2 336 ? 86.380 22.928  -11.174 1.00 100.00 ? 337 ARG A NH1   1 
ATOM   2965 N NH2   . ARG B 2 336 ? 85.546 24.715  -9.960  1.00 100.00 ? 337 ARG A NH2   1 
ATOM   2966 N N     . ASP B 2 337 ? 86.647 21.555  -13.598 1.00 30.52  ? 338 ASP A N     1 
ATOM   2967 C CA    . ASP B 2 337 ? 87.586 22.687  -13.663 1.00 33.76  ? 338 ASP A CA    1 
ATOM   2968 C C     . ASP B 2 337 ? 87.573 23.513  -14.947 1.00 35.95  ? 338 ASP A C     1 
ATOM   2969 O O     . ASP B 2 337 ? 87.881 24.718  -14.919 1.00 33.30  ? 338 ASP A O     1 
ATOM   2970 C CB    . ASP B 2 337 ? 89.009 22.230  -13.398 1.00 35.84  ? 338 ASP A CB    1 
ATOM   2971 C CG    . ASP B 2 337 ? 89.197 21.727  -12.014 1.00 46.97  ? 338 ASP A CG    1 
ATOM   2972 O OD1   . ASP B 2 337 ? 88.562 22.277  -11.077 1.00 43.83  ? 338 ASP A OD1   1 
ATOM   2973 O OD2   . ASP B 2 337 ? 89.941 20.737  -11.867 1.00 70.46  ? 338 ASP A OD2   1 
ATOM   2974 N N     . TYR B 2 338 ? 87.230 22.871  -16.065 1.00 31.97  ? 339 TYR A N     1 
ATOM   2975 C CA    . TYR B 2 338 ? 87.188 23.543  -17.355 1.00 31.08  ? 339 TYR A CA    1 
ATOM   2976 C C     . TYR B 2 338 ? 85.904 24.251  -17.655 1.00 39.59  ? 339 TYR A C     1 
ATOM   2977 O O     . TYR B 2 338 ? 85.657 24.579  -18.811 1.00 40.37  ? 339 TYR A O     1 
ATOM   2978 C CB    . TYR B 2 338 ? 87.482 22.579  -18.486 1.00 35.29  ? 339 TYR A CB    1 
ATOM   2979 C CG    . TYR B 2 338 ? 88.788 21.923  -18.321 1.00 41.09  ? 339 TYR A CG    1 
ATOM   2980 C CD1   . TYR B 2 338 ? 88.992 21.068  -17.266 1.00 48.64  ? 339 TYR A CD1   1 
ATOM   2981 C CD2   . TYR B 2 338 ? 89.843 22.182  -19.168 1.00 39.69  ? 339 TYR A CD2   1 
ATOM   2982 C CE1   . TYR B 2 338 ? 90.205 20.457  -17.065 1.00 53.73  ? 339 TYR A CE1   1 
ATOM   2983 C CE2   . TYR B 2 338 ? 91.060 21.553  -18.993 1.00 41.09  ? 339 TYR A CE2   1 
ATOM   2984 C CZ    . TYR B 2 338 ? 91.222 20.690  -17.918 1.00 49.34  ? 339 TYR A CZ    1 
ATOM   2985 O OH    . TYR B 2 338 ? 92.379 20.031  -17.646 1.00 68.97  ? 339 TYR A OH    1 
ATOM   2986 N N     . ARG B 2 339 ? 85.077 24.495  -16.638 1.00 40.00  ? 340 ARG A N     1 
ATOM   2987 C CA    . ARG B 2 339 ? 83.804 25.189  -16.829 1.00 61.50  ? 340 ARG A CA    1 
ATOM   2988 C C     . ARG B 2 339 ? 83.796 26.654  -16.323 1.00 82.06  ? 340 ARG A C     1 
ATOM   2989 O O     . ARG B 2 339 ? 83.398 27.597  -17.036 1.00 65.65  ? 340 ARG A O     1 
ATOM   2990 C CB    . ARG B 2 339 ? 82.684 24.379  -16.179 1.00 66.69  ? 340 ARG A CB    1 
ATOM   2991 C CG    . ARG B 2 339 ? 82.109 23.289  -17.087 1.00 70.97  ? 340 ARG A CG    1 
ATOM   2992 C CD    . ARG B 2 339 ? 80.859 22.648  -16.500 1.00 64.46  ? 340 ARG A CD    1 
ATOM   2993 N NE    . ARG B 2 339 ? 79.672 23.446  -16.785 1.00 92.60  ? 340 ARG A NE    1 
ATOM   2994 C CZ    . ARG B 2 339 ? 79.072 24.215  -15.888 1.00 90.05  ? 340 ARG A CZ    1 
ATOM   2995 N NH1   . ARG B 2 339 ? 79.533 24.263  -14.641 1.00 44.97  ? 340 ARG A NH1   1 
ATOM   2996 N NH2   . ARG B 2 339 ? 78.003 24.927  -16.232 1.00 55.54  ? 340 ARG A NH2   1 
HETATM 2997 N N9    . 6MP C 3 .   ? 58.478 5.825   -10.183 1.00 24.59  ? 599 6MP A N9    1 
HETATM 2998 C C4    . 6MP C 3 .   ? 57.917 4.579   -10.331 1.00 37.02  ? 599 6MP A C4    1 
HETATM 2999 N N3    . 6MP C 3 .   ? 58.157 3.499   -9.555  1.00 41.04  ? 599 6MP A N3    1 
HETATM 3000 C C2    . 6MP C 3 .   ? 57.476 2.445   -9.971  1.00 60.78  ? 599 6MP A C2    1 
HETATM 3001 N N1    . 6MP C 3 .   ? 56.613 2.451   -11.040 1.00 59.71  ? 599 6MP A N1    1 
HETATM 3002 C C6    . 6MP C 3 .   ? 56.329 3.562   -11.824 1.00 23.64  ? 599 6MP A C6    1 
HETATM 3003 C C7    . 6MP C 3 .   ? 55.307 3.456   -12.966 1.00 44.73  ? 599 6MP A C7    1 
HETATM 3004 C C5    . 6MP C 3 .   ? 57.073 4.687   -11.411 1.00 77.53  ? 599 6MP A C5    1 
HETATM 3005 N N7    . 6MP C 3 .   ? 57.101 5.971   -11.935 1.00 57.96  ? 599 6MP A N7    1 
HETATM 3006 C C8    . 6MP C 3 .   ? 57.954 6.603   -11.182 1.00 27.10  ? 599 6MP A C8    1 
HETATM 3007 O O     . HOH D 4 .   ? 20.895 2.333   -10.807 1.00 60.44  ? 816 HOH B O     1 
HETATM 3008 O O     . HOH D 4 .   ? -5.670 10.969  5.906   1.00 86.00  ? 842 HOH B O     1 
HETATM 3009 O O     . HOH D 4 .   ? 11.695 16.368  17.982  1.00 61.62  ? 844 HOH B O     1 
HETATM 3010 O O     . HOH D 4 .   ? 13.179 3.210   -7.300  1.00 71.04  ? 845 HOH B O     1 
HETATM 3011 O O     . HOH D 4 .   ? 11.277 10.494  -9.440  1.00 96.05  ? 879 HOH B O     1 
HETATM 3012 O O     . HOH D 4 .   ? 6.953  10.012  -5.345  1.00 67.72  ? 884 HOH B O     1 
HETATM 3013 O O     . HOH E 4 .   ? 71.028 -7.907  -24.830 1.00 91.24  ? 800 HOH A O     1 
HETATM 3014 O O     . HOH E 4 .   ? 27.022 12.917  4.441   1.00 52.53  ? 801 HOH A O     1 
HETATM 3015 O O     . HOH E 4 .   ? 62.733 6.833   -17.073 1.00 52.02  ? 802 HOH A O     1 
HETATM 3016 O O     . HOH E 4 .   ? 82.842 12.178  -18.370 1.00 35.81  ? 803 HOH A O     1 
HETATM 3017 O O     . HOH E 4 .   ? 68.002 14.467  3.360   1.00 51.54  ? 804 HOH A O     1 
HETATM 3018 O O     . HOH E 4 .   ? 87.685 4.740   -11.379 1.00 57.40  ? 805 HOH A O     1 
HETATM 3019 O O     . HOH E 4 .   ? 85.719 2.818   -26.788 1.00 60.53  ? 806 HOH A O     1 
HETATM 3020 O O     . HOH E 4 .   ? 68.204 25.758  -18.567 1.00 52.82  ? 808 HOH A O     1 
HETATM 3021 O O     . HOH E 4 .   ? 76.129 13.801  -5.090  1.00 56.02  ? 809 HOH A O     1 
HETATM 3022 O O     . HOH E 4 .   ? 82.116 9.640   -10.964 1.00 45.47  ? 810 HOH A O     1 
HETATM 3023 O O     . HOH E 4 .   ? 63.555 -6.678  -9.647  1.00 67.67  ? 811 HOH A O     1 
HETATM 3024 O O     . HOH E 4 .   ? 56.081 -0.613  -11.925 1.00 100.00 ? 812 HOH A O     1 
HETATM 3025 O O     . HOH E 4 .   ? 11.578 17.547  10.444  1.00 61.81  ? 813 HOH A O     1 
HETATM 3026 O O     . HOH E 4 .   ? 53.256 10.038  -11.637 1.00 51.48  ? 814 HOH A O     1 
HETATM 3027 O O     . HOH E 4 .   ? 59.779 -0.612  -3.743  1.00 44.65  ? 815 HOH A O     1 
HETATM 3028 O O     . HOH E 4 .   ? 11.399 14.722  9.006   1.00 23.69  ? 817 HOH A O     1 
HETATM 3029 O O     . HOH E 4 .   ? 72.356 0.983   3.033   1.00 57.60  ? 818 HOH A O     1 
HETATM 3030 O O     . HOH E 4 .   ? 53.651 -4.587  -12.555 1.00 88.39  ? 819 HOH A O     1 
HETATM 3031 O O     . HOH E 4 .   ? 37.754 24.941  -1.651  1.00 86.65  ? 823 HOH A O     1 
HETATM 3032 O O     . HOH E 4 .   ? 58.848 2.556   -6.298  1.00 44.51  ? 824 HOH A O     1 
HETATM 3033 O O     . HOH E 4 .   ? 12.319 19.552  15.632  1.00 72.98  ? 826 HOH A O     1 
HETATM 3034 O O     . HOH E 4 .   ? 26.726 7.020   -5.497  1.00 45.84  ? 827 HOH A O     1 
HETATM 3035 O O     . HOH E 4 .   ? 72.144 22.238  -20.662 1.00 52.61  ? 828 HOH A O     1 
HETATM 3036 O O     . HOH E 4 .   ? 61.084 4.714   -0.129  1.00 78.42  ? 829 HOH A O     1 
HETATM 3037 O O     . HOH E 4 .   ? 55.877 16.447  -0.789  1.00 20.72  ? 830 HOH A O     1 
HETATM 3038 O O     . HOH E 4 .   ? 80.677 18.647  -17.890 1.00 51.32  ? 831 HOH A O     1 
HETATM 3039 O O     . HOH E 4 .   ? 88.129 19.083  -14.295 1.00 72.65  ? 832 HOH A O     1 
HETATM 3040 O O     . HOH E 4 .   ? 7.506  -1.416  9.063   1.00 60.43  ? 833 HOH A O     1 
HETATM 3041 O O     . HOH E 4 .   ? 29.208 5.252   -8.682  1.00 73.20  ? 834 HOH A O     1 
HETATM 3042 O O     . HOH E 4 .   ? 58.053 13.921  -12.327 1.00 61.02  ? 835 HOH A O     1 
HETATM 3043 O O     . HOH E 4 .   ? 51.931 13.179  -13.550 1.00 43.63  ? 836 HOH A O     1 
HETATM 3044 O O     . HOH E 4 .   ? 55.035 21.484  -7.418  1.00 46.58  ? 837 HOH A O     1 
HETATM 3045 O O     . HOH E 4 .   ? 88.009 4.407   -5.405  1.00 58.52  ? 838 HOH A O     1 
HETATM 3046 O O     . HOH E 4 .   ? 76.536 9.928   -32.157 1.00 85.52  ? 839 HOH A O     1 
HETATM 3047 O O     . HOH E 4 .   ? 48.467 -15.200 -17.932 1.00 67.30  ? 840 HOH A O     1 
HETATM 3048 O O     . HOH E 4 .   ? 80.145 14.907  -3.675  1.00 82.09  ? 841 HOH A O     1 
HETATM 3049 O O     . HOH E 4 .   ? 39.271 4.196   3.728   1.00 56.93  ? 847 HOH A O     1 
HETATM 3050 O O     . HOH E 4 .   ? 70.965 25.829  -15.176 1.00 100.00 ? 850 HOH A O     1 
HETATM 3051 O O     . HOH E 4 .   ? 72.654 11.925  -27.362 1.00 82.12  ? 851 HOH A O     1 
HETATM 3052 O O     . HOH E 4 .   ? 38.767 23.910  -14.552 1.00 89.26  ? 852 HOH A O     1 
HETATM 3053 O O     . HOH E 4 .   ? 70.303 21.480  -11.911 1.00 94.40  ? 859 HOH A O     1 
HETATM 3054 O O     . HOH E 4 .   ? 50.148 -2.748  -1.373  1.00 39.18  ? 862 HOH A O     1 
HETATM 3055 O O     . HOH E 4 .   ? 75.882 6.715   3.011   1.00 79.62  ? 866 HOH A O     1 
HETATM 3056 O O     . HOH E 4 .   ? 44.664 -7.053  -8.344  1.00 85.98  ? 874 HOH A O     1 
HETATM 3057 O O     . HOH E 4 .   ? 8.147  1.619   21.908  1.00 86.33  ? 876 HOH A O     1 
HETATM 3058 O O     . HOH E 4 .   ? 59.756 -0.610  -7.564  1.00 67.40  ? 880 HOH A O     1 
HETATM 3059 O O     . HOH E 4 .   ? 80.215 6.394   -0.876  1.00 80.17  ? 883 HOH A O     1 
HETATM 3060 O O     . HOH E 4 .   ? 93.143 3.681   0.793   1.00 83.06  ? 886 HOH A O     1 
HETATM 3061 O O     . HOH E 4 .   ? 81.130 11.559  -9.826  1.00 77.81  ? 888 HOH A O     1 
HETATM 3062 O O     . HOH E 4 .   ? 42.415 18.498  -17.676 1.00 70.05  ? 889 HOH A O     1 
HETATM 3063 O O     . HOH E 4 .   ? 28.907 26.477  -31.098 1.00 70.56  ? 892 HOH A O     1 
HETATM 3064 O O     . HOH E 4 .   ? 20.536 -6.060  11.689  1.00 99.66  ? 895 HOH A O     1 
HETATM 3065 O O     . HOH E 4 .   ? 63.974 16.402  -25.858 1.00 82.03  ? 896 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   699 699 DT  T   B . n 
A 1 2   DA  2   700 700 DA  A   B . n 
A 1 3   DC  3   701 701 DC  C   B . n 
A 1 4   DG  4   702 702 DG  G   B . n 
A 1 5   DC  5   703 703 DC  C   B . n 
A 1 6   DA  6   704 704 DA  A   B . n 
A 1 7   DA  7   705 705 DA  A   B . n 
A 1 8   DA  8   706 706 DA  A   B . n 
A 1 9   DC  9   707 707 DC  C   B . n 
A 1 10  DG  10  708 708 DG  G   B . n 
A 1 11  DT  11  709 709 DT  T   B . n 
A 1 12  DT  12  710 710 DT  T   B . n 
A 1 13  DT  13  711 711 DT  T   B . n 
A 1 14  DG  14  712 712 DG  G   B . n 
A 1 15  DC  15  713 713 DC  C   B . n 
A 1 16  DG  16  714 714 DG  G   B . n 
A 1 17  DT  17  715 715 DT  T   B . n 
B 2 1   ALA 1   2   2   ALA ALA A . n 
B 2 2   THR 2   3   3   THR THR A . n 
B 2 3   ILE 3   4   4   ILE ILE A . n 
B 2 4   LYS 4   5   5   LYS LYS A . n 
B 2 5   ASP 5   6   6   ASP ASP A . n 
B 2 6   VAL 6   7   7   VAL VAL A . n 
B 2 7   ALA 7   8   8   ALA ALA A . n 
B 2 8   LYS 8   9   9   LYS LYS A . n 
B 2 9   ARG 9   10  10  ARG ARG A . n 
B 2 10  ALA 10  11  11  ALA ALA A . n 
B 2 11  ASN 11  12  12  ASN ASN A . n 
B 2 12  VAL 12  13  13  VAL VAL A . n 
B 2 13  SER 13  14  14  SER SER A . n 
B 2 14  THR 14  15  15  THR THR A . n 
B 2 15  THR 15  16  16  THR THR A . n 
B 2 16  THR 16  17  17  THR THR A . n 
B 2 17  VAL 17  18  18  VAL VAL A . n 
B 2 18  SER 18  19  19  SER SER A . n 
B 2 19  HIS 19  20  20  HIS HIS A . n 
B 2 20  VAL 20  21  21  VAL VAL A . n 
B 2 21  ILE 21  22  22  ILE ILE A . n 
B 2 22  ASN 22  23  23  ASN ASN A . n 
B 2 23  LYS 23  24  24  LYS LYS A . n 
B 2 24  THR 24  25  25  THR THR A . n 
B 2 25  ARG 25  26  26  ARG ARG A . n 
B 2 26  PHE 26  27  27  PHE PHE A . n 
B 2 27  VAL 27  28  28  VAL VAL A . n 
B 2 28  ALA 28  29  29  ALA ALA A . n 
B 2 29  GLU 29  30  30  GLU GLU A . n 
B 2 30  GLU 30  31  31  GLU GLU A . n 
B 2 31  THR 31  32  32  THR THR A . n 
B 2 32  ARG 32  33  33  ARG ARG A . n 
B 2 33  ASN 33  34  34  ASN ASN A . n 
B 2 34  ALA 34  35  35  ALA ALA A . n 
B 2 35  VAL 35  36  36  VAL VAL A . n 
B 2 36  TRP 36  37  37  TRP TRP A . n 
B 2 37  ALA 37  38  38  ALA ALA A . n 
B 2 38  ALA 38  39  39  ALA ALA A . n 
B 2 39  ILE 39  40  40  ILE ILE A . n 
B 2 40  LYS 40  41  41  LYS LYS A . n 
B 2 41  GLU 41  42  42  GLU GLU A . n 
B 2 42  LEU 42  43  43  LEU LEU A . n 
B 2 43  HIS 43  44  44  HIS HIS A . n 
B 2 44  TYR 44  45  45  TYR TYR A . n 
B 2 45  SER 45  46  46  SER SER A . n 
B 2 46  PRO 46  47  47  PRO PRO A . n 
B 2 47  SER 47  48  48  SER SER A . n 
B 2 48  ALA 48  49  49  ALA ALA A . n 
B 2 49  VAL 49  50  50  VAL VAL A . n 
B 2 50  ALA 50  51  51  ALA ALA A . n 
B 2 51  ARG 51  52  52  ARG ARG A . n 
B 2 52  SER 52  53  53  SER SER A . n 
B 2 53  LEU 53  54  54  LEU LEU A . n 
B 2 54  LYS 54  55  55  LYS LYS A . n 
B 2 55  VAL 55  56  56  VAL VAL A . n 
B 2 56  ASN 56  57  57  ASN ASN A . n 
B 2 57  HIS 57  58  58  HIS HIS A . n 
B 2 58  THR 58  59  59  THR THR A . n 
B 2 59  LYS 59  60  60  LYS LYS A . n 
B 2 60  SER 60  61  61  SER SER A . n 
B 2 61  ILE 61  62  62  ILE ILE A . n 
B 2 62  GLY 62  63  63  GLY GLY A . n 
B 2 63  LEU 63  64  64  LEU LEU A . n 
B 2 64  LEU 64  65  65  LEU LEU A . n 
B 2 65  ALA 65  66  66  ALA ALA A . n 
B 2 66  THR 66  67  67  THR THR A . n 
B 2 67  SER 67  68  68  SER SER A . n 
B 2 68  SER 68  69  69  SER SER A . n 
B 2 69  GLU 69  70  70  GLU GLU A . n 
B 2 70  ALA 70  71  71  ALA ALA A . n 
B 2 71  ALA 71  72  72  ALA ALA A . n 
B 2 72  TYR 72  73  73  TYR TYR A . n 
B 2 73  PHE 73  74  74  PHE PHE A . n 
B 2 74  ALA 74  75  75  ALA ALA A . n 
B 2 75  GLU 75  76  76  GLU GLU A . n 
B 2 76  ILE 76  77  77  ILE ILE A . n 
B 2 77  ILE 77  78  78  ILE ILE A . n 
B 2 78  GLU 78  79  79  GLU GLU A . n 
B 2 79  ALA 79  80  80  ALA ALA A . n 
B 2 80  VAL 80  81  81  VAL VAL A . n 
B 2 81  GLU 81  82  82  GLU GLU A . n 
B 2 82  LYS 82  83  83  LYS LYS A . n 
B 2 83  ASN 83  84  84  ASN ASN A . n 
B 2 84  CYS 84  85  85  CYS CYS A . n 
B 2 85  PHE 85  86  86  PHE PHE A . n 
B 2 86  GLN 86  87  87  GLN GLN A . n 
B 2 87  LYS 87  88  88  LYS LYS A . n 
B 2 88  GLY 88  89  89  GLY GLY A . n 
B 2 89  TYR 89  90  90  TYR TYR A . n 
B 2 90  THR 90  91  91  THR THR A . n 
B 2 91  LEU 91  92  92  LEU LEU A . n 
B 2 92  ILE 92  93  93  ILE ILE A . n 
B 2 93  LEU 93  94  94  LEU LEU A . n 
B 2 94  GLY 94  95  95  GLY GLY A . n 
B 2 95  ASN 95  96  96  ASN ASN A . n 
B 2 96  ALA 96  97  97  ALA ALA A . n 
B 2 97  TRP 97  98  98  TRP TRP A . n 
B 2 98  ASN 98  99  99  ASN ASN A . n 
B 2 99  ASN 99  100 100 ASN ASN A . n 
B 2 100 LEU 100 101 101 LEU LEU A . n 
B 2 101 GLU 101 102 102 GLU GLU A . n 
B 2 102 LYS 102 103 103 LYS LYS A . n 
B 2 103 GLN 103 104 104 GLN GLN A . n 
B 2 104 ARG 104 105 105 ARG ARG A . n 
B 2 105 ALA 105 106 106 ALA ALA A . n 
B 2 106 TYR 106 107 107 TYR TYR A . n 
B 2 107 LEU 107 108 108 LEU LEU A . n 
B 2 108 SER 108 109 109 SER SER A . n 
B 2 109 MET 109 110 110 MET MET A . n 
B 2 110 MET 110 111 111 MET MET A . n 
B 2 111 ALA 111 112 112 ALA ALA A . n 
B 2 112 GLN 112 113 113 GLN GLN A . n 
B 2 113 LYS 113 114 114 LYS LYS A . n 
B 2 114 ARG 114 115 115 ARG ARG A . n 
B 2 115 VAL 115 116 116 VAL VAL A . n 
B 2 116 ASP 116 117 117 ASP ASP A . n 
B 2 117 GLY 117 118 118 GLY GLY A . n 
B 2 118 LEU 118 119 119 LEU LEU A . n 
B 2 119 LEU 119 120 120 LEU LEU A . n 
B 2 120 VAL 120 121 121 VAL VAL A . n 
B 2 121 MET 121 122 122 MET MET A . n 
B 2 122 CYS 122 123 123 CYS CYS A . n 
B 2 123 SER 123 124 124 SER SER A . n 
B 2 124 GLU 124 125 125 GLU GLU A . n 
B 2 125 TYR 125 126 126 TYR TYR A . n 
B 2 126 PRO 126 127 127 PRO PRO A . n 
B 2 127 GLU 127 128 128 GLU GLU A . n 
B 2 128 PRO 128 129 129 PRO PRO A . n 
B 2 129 LEU 129 130 130 LEU LEU A . n 
B 2 130 LEU 130 131 131 LEU LEU A . n 
B 2 131 ALA 131 132 132 ALA ALA A . n 
B 2 132 MET 132 133 133 MET MET A . n 
B 2 133 LEU 133 134 134 LEU LEU A . n 
B 2 134 GLU 134 135 135 GLU GLU A . n 
B 2 135 GLU 135 136 136 GLU GLU A . n 
B 2 136 TYR 136 137 137 TYR TYR A . n 
B 2 137 ARG 137 138 138 ARG ARG A . n 
B 2 138 HIS 138 139 139 HIS HIS A . n 
B 2 139 ILE 139 140 140 ILE ILE A . n 
B 2 140 PRO 140 141 141 PRO PRO A . n 
B 2 141 MET 141 142 142 MET MET A . n 
B 2 142 VAL 142 143 143 VAL VAL A . n 
B 2 143 VAL 143 144 144 VAL VAL A . n 
B 2 144 MET 144 145 145 MET MET A . n 
B 2 145 ASP 145 146 146 ASP ASP A . n 
B 2 146 TRP 146 147 147 TRP TRP A . n 
B 2 147 GLY 147 148 148 GLY GLY A . n 
B 2 148 GLU 148 149 149 GLU GLU A . n 
B 2 149 ALA 149 150 150 ALA ALA A . n 
B 2 150 LYS 150 151 151 LYS LYS A . n 
B 2 151 ALA 151 152 152 ALA ALA A . n 
B 2 152 ASP 152 153 153 ASP ASP A . n 
B 2 153 PHE 153 154 154 PHE PHE A . n 
B 2 154 THR 154 155 155 THR THR A . n 
B 2 155 ASP 155 156 156 ASP ASP A . n 
B 2 156 ALA 156 157 157 ALA ALA A . n 
B 2 157 VAL 157 158 158 VAL VAL A . n 
B 2 158 ILE 158 159 159 ILE ILE A . n 
B 2 159 ASP 159 160 160 ASP ASP A . n 
B 2 160 ASN 160 161 161 ASN ASN A . n 
B 2 161 ALA 161 162 162 ALA ALA A . n 
B 2 162 PHE 162 163 163 PHE PHE A . n 
B 2 163 GLU 163 164 164 GLU GLU A . n 
B 2 164 GLY 164 165 165 GLY GLY A . n 
B 2 165 GLY 165 166 166 GLY GLY A . n 
B 2 166 TYR 166 167 167 TYR TYR A . n 
B 2 167 MET 167 168 168 MET MET A . n 
B 2 168 ALA 168 169 169 ALA ALA A . n 
B 2 169 GLY 169 170 170 GLY GLY A . n 
B 2 170 ARG 170 171 171 ARG ARG A . n 
B 2 171 TYR 171 172 172 TYR TYR A . n 
B 2 172 LEU 172 173 173 LEU LEU A . n 
B 2 173 ILE 173 174 174 ILE ILE A . n 
B 2 174 GLU 174 175 175 GLU GLU A . n 
B 2 175 ARG 175 176 176 ARG ARG A . n 
B 2 176 GLY 176 177 177 GLY GLY A . n 
B 2 177 HIS 177 178 178 HIS HIS A . n 
B 2 178 ARG 178 179 179 ARG ARG A . n 
B 2 179 GLU 179 180 180 GLU GLU A . n 
B 2 180 ILE 180 181 181 ILE ILE A . n 
B 2 181 GLY 181 182 182 GLY GLY A . n 
B 2 182 VAL 182 183 183 VAL VAL A . n 
B 2 183 ILE 183 184 184 ILE ILE A . n 
B 2 184 PRO 184 185 185 PRO PRO A . n 
B 2 185 GLY 185 186 186 GLY GLY A . n 
B 2 186 PRO 186 187 187 PRO PRO A . n 
B 2 187 LEU 187 188 188 LEU LEU A . n 
B 2 188 GLU 188 189 189 GLU GLU A . n 
B 2 189 ALA 189 190 190 ALA ALA A . n 
B 2 190 ASN 190 191 191 ASN ASN A . n 
B 2 191 THR 191 192 192 THR THR A . n 
B 2 192 GLY 192 193 193 GLY GLY A . n 
B 2 193 ALA 193 194 194 ALA ALA A . n 
B 2 194 GLY 194 195 195 GLY GLY A . n 
B 2 195 ARG 195 196 196 ARG ARG A . n 
B 2 196 LEU 196 197 197 LEU LEU A . n 
B 2 197 ALA 197 198 198 ALA ALA A . n 
B 2 198 GLY 198 199 199 GLY GLY A . n 
B 2 199 PHE 199 200 200 PHE PHE A . n 
B 2 200 MET 200 201 201 MET MET A . n 
B 2 201 LYS 201 202 202 LYS LYS A . n 
B 2 202 ALA 202 203 203 ALA ALA A . n 
B 2 203 MET 203 204 204 MET MET A . n 
B 2 204 GLU 204 205 205 GLU GLU A . n 
B 2 205 GLU 205 206 206 GLU GLU A . n 
B 2 206 ALA 206 207 207 ALA ALA A . n 
B 2 207 MET 207 208 208 MET MET A . n 
B 2 208 ILE 208 209 209 ILE ILE A . n 
B 2 209 LYS 209 210 210 LYS LYS A . n 
B 2 210 VAL 210 211 211 VAL VAL A . n 
B 2 211 PRO 211 212 212 PRO PRO A . n 
B 2 212 GLU 212 213 213 GLU GLU A . n 
B 2 213 SER 213 214 214 SER SER A . n 
B 2 214 TRP 214 215 215 TRP TRP A . n 
B 2 215 ILE 215 216 216 ILE ILE A . n 
B 2 216 VAL 216 217 217 VAL VAL A . n 
B 2 217 GLN 217 218 218 GLN GLN A . n 
B 2 218 GLY 218 219 219 GLY GLY A . n 
B 2 219 ASP 219 220 220 ASP ASP A . n 
B 2 220 PHE 220 221 221 PHE PHE A . n 
B 2 221 GLU 221 222 222 GLU GLU A . n 
B 2 222 PRO 222 223 223 PRO PRO A . n 
B 2 223 GLU 223 224 224 GLU GLU A . n 
B 2 224 SER 224 225 225 SER SER A . n 
B 2 225 GLY 225 226 226 GLY GLY A . n 
B 2 226 TYR 226 227 227 TYR TYR A . n 
B 2 227 ARG 227 228 228 ARG ARG A . n 
B 2 228 ALA 228 229 229 ALA ALA A . n 
B 2 229 MET 229 230 230 MET MET A . n 
B 2 230 GLN 230 231 231 GLN GLN A . n 
B 2 231 GLN 231 232 232 GLN GLN A . n 
B 2 232 ILE 232 233 233 ILE ILE A . n 
B 2 233 LEU 233 234 234 LEU LEU A . n 
B 2 234 SER 234 235 235 SER SER A . n 
B 2 235 GLN 235 236 236 GLN GLN A . n 
B 2 236 PRO 236 237 237 PRO PRO A . n 
B 2 237 HIS 237 238 238 HIS HIS A . n 
B 2 238 ARG 238 239 239 ARG ARG A . n 
B 2 239 PRO 239 240 240 PRO PRO A . n 
B 2 240 THR 240 241 241 THR THR A . n 
B 2 241 ALA 241 242 242 ALA ALA A . n 
B 2 242 VAL 242 243 243 VAL VAL A . n 
B 2 243 PHE 243 244 244 PHE PHE A . n 
B 2 244 CYS 244 245 245 CYS CYS A . n 
B 2 245 GLY 245 246 246 GLY GLY A . n 
B 2 246 GLY 246 247 247 GLY GLY A . n 
B 2 247 ASP 247 248 248 ASP ASP A . n 
B 2 248 ILE 248 249 249 ILE ILE A . n 
B 2 249 MET 249 250 250 MET MET A . n 
B 2 250 ALA 250 251 251 ALA ALA A . n 
B 2 251 MET 251 252 252 MET MET A . n 
B 2 252 GLY 252 253 253 GLY GLY A . n 
B 2 253 ALA 253 254 254 ALA ALA A . n 
B 2 254 LEU 254 255 255 LEU LEU A . n 
B 2 255 CYS 255 256 256 CYS CYS A . n 
B 2 256 ALA 256 257 257 ALA ALA A . n 
B 2 257 ALA 257 258 258 ALA ALA A . n 
B 2 258 ASP 258 259 259 ASP ASP A . n 
B 2 259 GLU 259 260 260 GLU GLU A . n 
B 2 260 MET 260 261 261 MET MET A . n 
B 2 261 GLY 261 262 262 GLY GLY A . n 
B 2 262 LEU 262 263 263 LEU LEU A . n 
B 2 263 ARG 263 264 264 ARG ARG A . n 
B 2 264 VAL 264 265 265 VAL VAL A . n 
B 2 265 PRO 265 266 266 PRO PRO A . n 
B 2 266 GLN 266 267 267 GLN GLN A . n 
B 2 267 ASP 267 268 268 ASP ASP A . n 
B 2 268 VAL 268 269 269 VAL VAL A . n 
B 2 269 SER 269 270 270 SER SER A . n 
B 2 270 LEU 270 271 271 LEU LEU A . n 
B 2 271 ILE 271 272 272 ILE ILE A . n 
B 2 272 GLY 272 273 273 GLY GLY A . n 
B 2 273 TYR 273 274 274 TYR TYR A . n 
B 2 274 ASP 274 275 275 ASP ASP A . n 
B 2 275 ASN 275 276 276 ASN ASN A . n 
B 2 276 VAL 276 277 277 VAL VAL A . n 
B 2 277 ARG 277 278 278 ARG ARG A . n 
B 2 278 ASN 278 279 279 ASN ASN A . n 
B 2 279 ALA 279 280 280 ALA ALA A . n 
B 2 280 ARG 280 281 281 ARG ARG A . n 
B 2 281 TYR 281 282 282 TYR TYR A . n 
B 2 282 PHE 282 283 283 PHE PHE A . n 
B 2 283 THR 283 284 284 THR THR A . n 
B 2 284 PRO 284 285 285 PRO PRO A . n 
B 2 285 ALA 285 286 286 ALA ALA A . n 
B 2 286 LEU 286 287 287 LEU LEU A . n 
B 2 287 THR 287 288 288 THR THR A . n 
B 2 288 THR 288 289 289 THR THR A . n 
B 2 289 ILE 289 290 290 ILE ILE A . n 
B 2 290 HIS 290 291 291 HIS HIS A . n 
B 2 291 GLN 291 292 292 GLN GLN A . n 
B 2 292 PRO 292 293 293 PRO PRO A . n 
B 2 293 LYS 293 294 294 LYS LYS A . n 
B 2 294 ASP 294 295 295 ASP ASP A . n 
B 2 295 SER 295 296 296 SER SER A . n 
B 2 296 LEU 296 297 297 LEU LEU A . n 
B 2 297 GLY 297 298 298 GLY GLY A . n 
B 2 298 GLU 298 299 299 GLU GLU A . n 
B 2 299 THR 299 300 300 THR THR A . n 
B 2 300 ALA 300 301 301 ALA ALA A . n 
B 2 301 PHE 301 302 302 PHE PHE A . n 
B 2 302 ASN 302 303 303 ASN ASN A . n 
B 2 303 MET 303 304 304 MET MET A . n 
B 2 304 LEU 304 305 305 LEU LEU A . n 
B 2 305 LEU 305 306 306 LEU LEU A . n 
B 2 306 ASP 306 307 307 ASP ASP A . n 
B 2 307 ARG 307 308 308 ARG ARG A . n 
B 2 308 ILE 308 309 309 ILE ILE A . n 
B 2 309 VAL 309 310 310 VAL VAL A . n 
B 2 310 ASN 310 311 311 ASN ASN A . n 
B 2 311 LYS 311 312 312 LYS LYS A . n 
B 2 312 ARG 312 313 313 ARG ARG A . n 
B 2 313 GLU 313 314 314 GLU GLU A . n 
B 2 314 GLU 314 315 315 GLU GLU A . n 
B 2 315 PRO 315 316 316 PRO PRO A . n 
B 2 316 GLN 316 317 317 GLN GLN A . n 
B 2 317 SER 317 318 318 SER SER A . n 
B 2 318 ILE 318 319 319 ILE ILE A . n 
B 2 319 GLU 319 320 320 GLU GLU A . n 
B 2 320 VAL 320 321 321 VAL VAL A . n 
B 2 321 HIS 321 322 322 HIS HIS A . n 
B 2 322 PRO 322 323 323 PRO PRO A . n 
B 2 323 ARG 323 324 324 ARG ARG A . n 
B 2 324 LEU 324 325 325 LEU LEU A . n 
B 2 325 ILE 325 326 326 ILE ILE A . n 
B 2 326 GLU 326 327 327 GLU GLU A . n 
B 2 327 ARG 327 328 328 ARG ARG A . n 
B 2 328 ARG 328 329 329 ARG ARG A . n 
B 2 329 SER 329 330 330 SER SER A . n 
B 2 330 VAL 330 331 331 VAL VAL A . n 
B 2 331 ALA 331 332 332 ALA ALA A . n 
B 2 332 ASP 332 333 333 ASP ASP A . n 
B 2 333 GLY 333 334 334 GLY GLY A . n 
B 2 334 PRO 334 335 335 PRO PRO A . n 
B 2 335 PHE 335 336 336 PHE PHE A . n 
B 2 336 ARG 336 337 337 ARG ARG A . n 
B 2 337 ASP 337 338 338 ASP ASP A . n 
B 2 338 TYR 338 339 339 TYR TYR A . n 
B 2 339 ARG 339 340 340 ARG ARG A . n 
B 2 340 ARG 340 341 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 6MP 1  599 599 6MP 6MP A . 
D 4 HOH 1  816 816 HOH HOH B . 
D 4 HOH 2  842 842 HOH HOH B . 
D 4 HOH 3  844 844 HOH HOH B . 
D 4 HOH 4  845 845 HOH HOH B . 
D 4 HOH 5  879 879 HOH HOH B . 
D 4 HOH 6  884 884 HOH HOH B . 
E 4 HOH 1  800 800 HOH HOH A . 
E 4 HOH 2  801 801 HOH HOH A . 
E 4 HOH 3  802 802 HOH HOH A . 
E 4 HOH 4  803 803 HOH HOH A . 
E 4 HOH 5  804 804 HOH HOH A . 
E 4 HOH 6  805 805 HOH HOH A . 
E 4 HOH 7  806 806 HOH HOH A . 
E 4 HOH 8  808 808 HOH HOH A . 
E 4 HOH 9  809 809 HOH HOH A . 
E 4 HOH 10 810 810 HOH HOH A . 
E 4 HOH 11 811 811 HOH HOH A . 
E 4 HOH 12 812 812 HOH HOH A . 
E 4 HOH 13 813 813 HOH HOH A . 
E 4 HOH 14 814 814 HOH HOH A . 
E 4 HOH 15 815 815 HOH HOH A . 
E 4 HOH 16 817 817 HOH HOH A . 
E 4 HOH 17 818 818 HOH HOH A . 
E 4 HOH 18 819 819 HOH HOH A . 
E 4 HOH 19 823 823 HOH HOH A . 
E 4 HOH 20 824 824 HOH HOH A . 
E 4 HOH 21 826 826 HOH HOH A . 
E 4 HOH 22 827 827 HOH HOH A . 
E 4 HOH 23 828 828 HOH HOH A . 
E 4 HOH 24 829 829 HOH HOH A . 
E 4 HOH 25 830 830 HOH HOH A . 
E 4 HOH 26 831 831 HOH HOH A . 
E 4 HOH 27 832 832 HOH HOH A . 
E 4 HOH 28 833 833 HOH HOH A . 
E 4 HOH 29 834 834 HOH HOH A . 
E 4 HOH 30 835 835 HOH HOH A . 
E 4 HOH 31 836 836 HOH HOH A . 
E 4 HOH 32 837 837 HOH HOH A . 
E 4 HOH 33 838 838 HOH HOH A . 
E 4 HOH 34 839 839 HOH HOH A . 
E 4 HOH 35 840 840 HOH HOH A . 
E 4 HOH 36 841 841 HOH HOH A . 
E 4 HOH 37 847 847 HOH HOH A . 
E 4 HOH 38 850 850 HOH HOH A . 
E 4 HOH 39 851 851 HOH HOH A . 
E 4 HOH 40 852 852 HOH HOH A . 
E 4 HOH 41 859 859 HOH HOH A . 
E 4 HOH 42 862 862 HOH HOH A . 
E 4 HOH 43 866 866 HOH HOH A . 
E 4 HOH 44 874 874 HOH HOH A . 
E 4 HOH 45 876 876 HOH HOH A . 
E 4 HOH 46 880 880 HOH HOH A . 
E 4 HOH 47 883 883 HOH HOH A . 
E 4 HOH 48 886 886 HOH HOH A . 
E 4 HOH 49 888 888 HOH HOH A . 
E 4 HOH 50 889 889 HOH HOH A . 
E 4 HOH 51 892 892 HOH HOH A . 
E 4 HOH 52 895 895 HOH HOH A . 
E 4 HOH 53 896 896 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-05-06 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-03-08 
5 'Structure model' 1 4 2018-04-04 
6 'Structure model' 1 5 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Structure summary'         
4 5 'Structure model' 'Data collection'           
5 6 'Structure model' 'Database references'       
6 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' diffrn_source      
2 6 'Structure model' database_2         
3 6 'Structure model' struct_ref_seq_dif 
4 6 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_diffrn_source.type'                 
2 6 'Structure model' '_database_2.pdbx_DOI'                
3 6 'Structure model' '_database_2.pdbx_database_accession' 
4 6 'Structure model' '_struct_ref_seq_dif.details'         
5 6 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 6 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 6 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT  refinement       . ? 1 
SDMS 'data reduction' . ? 2 
SDMS 'data scaling'   . ? 3 
# 
_pdbx_entry_details.entry_id                 2PUA 
_pdbx_entry_details.compound_details         
;THE HYDROGEN BONDS FROM ARG 190 TO THE O6 EXOCYCLIC ATOM
IS WHAT DETERMINES PURR'S SPECIFICITY FOR COREPRESSORS
HYPOXANTHINE AND GUANINE AND ALLOWS IT TO DISCRIMINATE
AGAINST ADENINE.  MUTATING ARG 190 TO ALA RESULTS IN A
PURR PROTEIN WHICH CAN BIND ADENINE IN ADDITION TO
HYPOXANTHINE AND GUANINE.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N7 B DG 702 ? ? C8 B DG 702 ? ? 1.355 1.305 0.050 0.006 N 
2 1 N7 B DG 708 ? ? C8 B DG 708 ? ? 1.353 1.305 0.048 0.006 N 
3 1 N7 B DG 712 ? ? C8 B DG 712 ? ? 1.353 1.305 0.048 0.006 N 
4 1 N7 B DG 714 ? ? C8 B DG 714 ? ? 1.359 1.305 0.054 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DC  713 ? ? "C1'" B DC  713 ? ? N1  B DC  713 ? ? 110.53 108.30 2.23   0.30 N 
2  1 "O4'" B DT  715 ? ? "C1'" B DT  715 ? ? N1  B DT  715 ? ? 110.31 108.30 2.01   0.30 N 
3  1 CA    A LEU 173 ? ? CB    A LEU 173 ? ? CG  A LEU 173 ? ? 100.59 115.30 -14.71 2.30 N 
4  1 C     A GLU 222 ? ? N     A PRO 223 ? ? CD  A PRO 223 ? ? 114.63 128.40 -13.77 2.10 Y 
5  1 C     A GLN 236 ? ? N     A PRO 237 ? ? CD  A PRO 237 ? ? 109.87 128.40 -18.53 2.10 Y 
6  1 CB    A ASP 248 ? ? CG    A ASP 248 ? ? OD2 A ASP 248 ? ? 124.32 118.30 6.02   0.90 N 
7  1 CB    A CYS 256 ? ? CA    A CYS 256 ? ? C   A CYS 256 ? ? 119.10 111.50 7.60   1.20 N 
8  1 CA    A CYS 256 ? ? CB    A CYS 256 ? ? SG  A CYS 256 ? ? 121.68 114.20 7.48   1.10 N 
9  1 CA    A LEU 263 ? ? CB    A LEU 263 ? ? CG  A LEU 263 ? ? 94.94  115.30 -20.36 2.30 N 
10 1 CB    A LEU 263 ? ? CG    A LEU 263 ? ? CD1 A LEU 263 ? ? 100.38 111.00 -10.62 1.70 N 
11 1 CB    A VAL 269 ? ? CA    A VAL 269 ? ? C   A VAL 269 ? ? 97.76  111.40 -13.64 1.90 N 
12 1 CA    A LEU 287 ? ? CB    A LEU 287 ? ? CG  A LEU 287 ? ? 100.19 115.30 -15.11 2.30 N 
13 1 CB    A LEU 305 ? ? CG    A LEU 305 ? ? CD2 A LEU 305 ? ? 100.65 111.00 -10.35 1.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 58  ? ? -177.58 143.38  
2  1 TYR A 73  ? ? -51.00  -72.39  
3  1 TRP A 98  ? ? 56.10   15.74   
4  1 SER A 124 ? ? 63.40   -80.89  
5  1 GLU A 136 ? ? -42.37  -18.95  
6  1 PHE A 154 ? ? -94.24  33.02   
7  1 ARG A 179 ? ? -145.80 -17.41  
8  1 PHE A 221 ? ? 79.66   -1.24   
9  1 TYR A 227 ? ? -32.30  -70.13  
10 1 SER A 235 ? ? -90.46  33.51   
11 1 PRO A 237 ? ? -28.38  -64.93  
12 1 ASP A 275 ? ? 130.38  -42.27  
13 1 ASN A 276 ? ? 62.94   64.70   
14 1 ASP A 307 ? ? -52.08  -70.36  
15 1 ILE A 309 ? ? -53.46  -75.50  
16 1 LYS A 312 ? ? 32.58   40.80   
17 1 ARG A 328 ? ? -116.13 -132.88 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    ARG 
_pdbx_validate_chiral.auth_seq_id     328 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ARG 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      341 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ARG 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     340 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2PUA 'double helix'        
2PUA 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 A DT 17 4_555 0.354  0.051  -0.168 -16.338 3.564   -8.444 1  B_DA700:DT715_B B 700 ? B 715 ? 20 1 
1 A DC 3  1_555 A DG 16 4_555 0.191  -0.057 0.477  -1.159  -2.611  0.786  2  B_DC701:DG714_B B 701 ? B 714 ? 19 1 
1 A DG 4  1_555 A DC 15 4_555 0.264  -0.546 0.211  1.029   1.914   -8.523 3  B_DG702:DC713_B B 702 ? B 713 ? 19 1 
1 A DC 5  1_555 A DG 14 4_555 -0.271 -0.354 0.100  0.095   -11.905 -0.623 4  B_DC703:DG712_B B 703 ? B 712 ? 19 1 
1 A DA 6  1_555 A DT 13 4_555 -0.083 -0.304 0.100  3.418   -0.256  -0.186 5  B_DA704:DT711_B B 704 ? B 711 ? 20 1 
1 A DA 7  1_555 A DT 12 4_555 0.077  0.050  -0.132 6.942   -14.468 7.716  6  B_DA705:DT710_B B 705 ? B 710 ? 20 1 
1 A DA 8  1_555 A DT 11 4_555 0.442  -0.361 0.193  15.565  -16.743 5.931  7  B_DA706:DT709_B B 706 ? B 709 ? 20 1 
1 A DC 9  1_555 A DG 10 4_555 -0.258 -0.079 -0.538 19.819  -11.454 0.719  8  B_DC707:DG708_B B 707 ? B 708 ? 19 1 
1 A DG 10 1_555 A DC 9  4_555 0.258  -0.079 -0.538 -19.819 -11.454 0.719  9  B_DG708:DC707_B B 708 ? B 707 ? 19 1 
1 A DT 11 1_555 A DA 8  4_555 -0.442 -0.361 0.193  -15.565 -16.743 5.931  10 B_DT709:DA706_B B 709 ? B 706 ? 20 1 
1 A DT 12 1_555 A DA 7  4_555 -0.077 0.050  -0.132 -6.942  -14.467 7.716  11 B_DT710:DA705_B B 710 ? B 705 ? 20 1 
1 A DT 13 1_555 A DA 6  4_555 0.083  -0.304 0.100  -3.418  -0.256  -0.186 12 B_DT711:DA704_B B 711 ? B 704 ? 20 1 
1 A DG 14 1_555 A DC 5  4_555 0.271  -0.354 0.100  -0.095  -11.905 -0.623 13 B_DG712:DC703_B B 712 ? B 703 ? 19 1 
1 A DC 15 1_555 A DG 4  4_555 -0.264 -0.546 0.211  -1.029  1.914   -8.523 14 B_DC713:DG702_B B 713 ? B 702 ? 19 1 
1 A DG 16 1_555 A DC 3  4_555 -0.191 -0.057 0.477  1.159   -2.611  0.786  15 B_DG714:DC701_B B 714 ? B 701 ? 19 1 
1 A DT 17 1_555 A DA 2  4_555 -0.354 0.051  -0.168 16.338  3.564   -8.444 16 B_DT715:DA700_B B 715 ? B 700 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 A DT 17 4_555 A DC 3  1_555 A DG 16 4_555 0.466  -0.761 3.189 -9.334 8.508  24.011 -3.593 -3.156 2.439 18.871  
20.705  27.087 1  BB_DA700DC701:DG714DT715_BB B 700 ? B 715 ? B 701 ? B 714 ? 
1 A DC 3  1_555 A DG 16 4_555 A DG 4  1_555 A DC 15 4_555 -1.517 -0.765 3.324 0.072  -7.450 33.313 -0.072 2.597  3.407 -12.797 
-0.123  34.113 2  BB_DC701DG702:DC713DG714_BB B 701 ? B 714 ? B 702 ? B 713 ? 
1 A DG 4  1_555 A DC 15 4_555 A DC 5  1_555 A DG 14 4_555 -0.867 -0.347 3.318 -0.390 1.341  34.031 -0.809 1.418  3.312 2.291   
0.666   34.059 3  BB_DG702DC703:DG712DC713_BB B 702 ? B 713 ? B 703 ? B 712 ? 
1 A DC 5  1_555 A DG 14 4_555 A DA 6  1_555 A DT 13 4_555 1.201  1.166  3.424 0.880  -1.681 35.955 2.135  -1.812 3.395 -2.721  
-1.424  36.004 4  BB_DC703DA704:DT711DG712_BB B 703 ? B 712 ? B 704 ? B 711 ? 
1 A DA 6  1_555 A DT 13 4_555 A DA 7  1_555 A DT 12 4_555 -0.103 0.636  3.483 2.308  2.598  35.477 0.635  0.528  3.506 4.251   
-3.776  35.642 5  BB_DA704DA705:DT710DT711_BB B 704 ? B 711 ? B 705 ? B 710 ? 
1 A DA 7  1_555 A DT 12 4_555 A DA 8  1_555 A DT 11 4_555 0.182  0.075  3.208 -5.616 7.358  36.076 -0.841 -1.017 3.102 11.647  
8.889   37.207 6  BB_DA705DA706:DT709DT710_BB B 705 ? B 710 ? B 706 ? B 709 ? 
1 A DA 8  1_555 A DT 11 4_555 A DC 9  1_555 A DG 10 4_555 -0.783 -0.020 3.310 5.007  0.174  28.566 -0.077 2.659  3.130 0.349   
-10.049 28.993 7  BB_DA706DC707:DG708DT709_BB B 706 ? B 709 ? B 707 ? B 708 ? 
1 A DC 9  1_555 A DG 10 4_555 A DG 10 1_555 A DC 9  4_555 0.000  1.738  5.330 0.000  49.802 15.832 -5.141 0.000  3.321 73.475  
0.000   52.105 8  BB_DC707DG708:DC707DG708_BB B 707 ? B 708 ? B 708 ? B 707 ? 
1 A DG 10 1_555 A DC 9  4_555 A DT 11 1_555 A DA 8  4_555 0.783  -0.020 3.310 -5.007 0.174  28.566 -0.077 -2.659 3.130 0.349   
10.049  28.993 9  BB_DG708DT709:DA706DC707_BB B 708 ? B 707 ? B 709 ? B 706 ? 
1 A DT 11 1_555 A DA 8  4_555 A DT 12 1_555 A DA 7  4_555 -0.182 0.075  3.208 5.616  7.358  36.076 -0.841 1.017  3.102 11.647  
-8.889  37.207 10 BB_DT709DT710:DA705DA706_BB B 709 ? B 706 ? B 710 ? B 705 ? 
1 A DT 12 1_555 A DA 7  4_555 A DT 13 1_555 A DA 6  4_555 0.103  0.636  3.483 -2.308 2.598  35.477 0.635  -0.528 3.506 4.251   
3.776   35.642 11 BB_DT710DT711:DA704DA705_BB B 710 ? B 705 ? B 711 ? B 704 ? 
1 A DT 13 1_555 A DA 6  4_555 A DG 14 1_555 A DC 5  4_555 -1.201 1.166  3.424 -0.880 -1.681 35.955 2.135  1.812  3.395 -2.721  
1.424   36.004 12 BB_DT711DG712:DC703DA704_BB B 711 ? B 704 ? B 712 ? B 703 ? 
1 A DG 14 1_555 A DC 5  4_555 A DC 15 1_555 A DG 4  4_555 0.867  -0.347 3.318 0.390  1.341  34.031 -0.809 -1.418 3.312 2.291   
-0.666  34.059 13 BB_DG712DC713:DG702DC703_BB B 712 ? B 703 ? B 713 ? B 702 ? 
1 A DC 15 1_555 A DG 4  4_555 A DG 16 1_555 A DC 3  4_555 1.517  -0.765 3.324 -0.072 -7.450 33.313 -0.072 -2.597 3.407 -12.797 
0.123   34.113 14 BB_DC713DG714:DC701DG702_BB B 713 ? B 702 ? B 714 ? B 701 ? 
1 A DG 16 1_555 A DC 3  4_555 A DT 17 1_555 A DA 2  4_555 -0.466 -0.761 3.189 9.334  8.508  24.011 -3.593 3.156  2.439 18.871  
-20.705 27.087 15 BB_DG714DT715:DA700DC701_BB B 714 ? B 701 ? B 715 ? B 700 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 6-METHYLPURINE 6MP 
4 water          HOH 
#