data_2Q0N
# 
_entry.id   2Q0N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Q0N         
RCSB  RCSB043000   
WWPDB D_1000043000 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2J0I 
_pdbx_database_related.details        'Crystal structure of human p21 activating kinase 4 (PAK4)' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2Q0N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-05-22 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Eswaran, J.'                          2  
'Turnbull, A.'                         3  
'Papagrigoriou, E.'                    4  
'Pike, A.W.'                           5  
'von Delft, F.'                        6  
'Sundstrom, M.'                        7  
'Edwards, A.'                          8  
'Arrowsmith, C.H.'                     9  
'Weigelt, J.'                          10 
'Knapp, S.'                            11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     'Structure of human p21 activating kinase 4 (PAK4) in complex with a consensus peptide.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1  
primary 'Eswaran, J.'         2  
primary 'Turnbull, A.'        3  
primary 'Papagrigoriou, E.'   4  
primary 'Pike, A.W.'          5  
primary 'von Delft, F.'       6  
primary 'Sundstrom, M.'       7  
primary 'Edwards, A.'         8  
primary 'Arrowsmith, C.H.'    9  
primary 'Weigelt, J.'         10 
primary 'Knapp, S.'           11 
# 
_cell.length_a           145.678 
_cell.length_b           145.678 
_cell.length_c           39.577 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2Q0N 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         2Q0N 
_symmetry.Int_Tables_number                96 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase PAK 4' 34091.566 1   2.7.11.1 ? 'Kinase domain, residues 291-591' ? 
2 polymer     syn 'Synthetic peptide'                     1559.759  1   ?        ? ?                                 ? 
3 non-polymer syn 'SULFATE ION'                           96.063    1   ?        ? ?                                 ? 
4 non-polymer syn 1,2-ETHANEDIOL                          62.068    8   ?        ? ?                                 ? 
5 water       nat water                                   18.015    251 ?        ? ?                                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'p21-activated kinase 4, PAK-4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM
RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTH
DGRVKLSDFGFCAQVSKEVPRRK(SEP)LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKM
IRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
;SPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM
RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTH
DGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN
LPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
A ? 
2 'polypeptide(L)' no no  RRRRRSWYFDG RRRRRSWYFDG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   PRO n 
1 3   GLN n 
1 4   ARG n 
1 5   GLU n 
1 6   PRO n 
1 7   GLN n 
1 8   ARG n 
1 9   VAL n 
1 10  SER n 
1 11  HIS n 
1 12  GLU n 
1 13  GLN n 
1 14  PHE n 
1 15  ARG n 
1 16  ALA n 
1 17  ALA n 
1 18  LEU n 
1 19  GLN n 
1 20  LEU n 
1 21  VAL n 
1 22  VAL n 
1 23  ASP n 
1 24  PRO n 
1 25  GLY n 
1 26  ASP n 
1 27  PRO n 
1 28  ARG n 
1 29  SER n 
1 30  TYR n 
1 31  LEU n 
1 32  ASP n 
1 33  ASN n 
1 34  PHE n 
1 35  ILE n 
1 36  LYS n 
1 37  ILE n 
1 38  GLY n 
1 39  GLU n 
1 40  GLY n 
1 41  SER n 
1 42  THR n 
1 43  GLY n 
1 44  ILE n 
1 45  VAL n 
1 46  CYS n 
1 47  ILE n 
1 48  ALA n 
1 49  THR n 
1 50  VAL n 
1 51  ARG n 
1 52  SER n 
1 53  SER n 
1 54  GLY n 
1 55  LYS n 
1 56  LEU n 
1 57  VAL n 
1 58  ALA n 
1 59  VAL n 
1 60  LYS n 
1 61  LYS n 
1 62  MET n 
1 63  ASP n 
1 64  LEU n 
1 65  ARG n 
1 66  LYS n 
1 67  GLN n 
1 68  GLN n 
1 69  ARG n 
1 70  ARG n 
1 71  GLU n 
1 72  LEU n 
1 73  LEU n 
1 74  PHE n 
1 75  ASN n 
1 76  GLU n 
1 77  VAL n 
1 78  VAL n 
1 79  ILE n 
1 80  MET n 
1 81  ARG n 
1 82  ASP n 
1 83  TYR n 
1 84  GLN n 
1 85  HIS n 
1 86  GLU n 
1 87  ASN n 
1 88  VAL n 
1 89  VAL n 
1 90  GLU n 
1 91  MET n 
1 92  TYR n 
1 93  ASN n 
1 94  SER n 
1 95  TYR n 
1 96  LEU n 
1 97  VAL n 
1 98  GLY n 
1 99  ASP n 
1 100 GLU n 
1 101 LEU n 
1 102 TRP n 
1 103 VAL n 
1 104 VAL n 
1 105 MET n 
1 106 GLU n 
1 107 PHE n 
1 108 LEU n 
1 109 GLU n 
1 110 GLY n 
1 111 GLY n 
1 112 ALA n 
1 113 LEU n 
1 114 THR n 
1 115 ASP n 
1 116 ILE n 
1 117 VAL n 
1 118 THR n 
1 119 HIS n 
1 120 THR n 
1 121 ARG n 
1 122 MET n 
1 123 ASN n 
1 124 GLU n 
1 125 GLU n 
1 126 GLN n 
1 127 ILE n 
1 128 ALA n 
1 129 ALA n 
1 130 VAL n 
1 131 CYS n 
1 132 LEU n 
1 133 ALA n 
1 134 VAL n 
1 135 LEU n 
1 136 GLN n 
1 137 ALA n 
1 138 LEU n 
1 139 SER n 
1 140 VAL n 
1 141 LEU n 
1 142 HIS n 
1 143 ALA n 
1 144 GLN n 
1 145 GLY n 
1 146 VAL n 
1 147 ILE n 
1 148 HIS n 
1 149 ARG n 
1 150 ASP n 
1 151 ILE n 
1 152 LYS n 
1 153 SER n 
1 154 ASP n 
1 155 SER n 
1 156 ILE n 
1 157 LEU n 
1 158 LEU n 
1 159 THR n 
1 160 HIS n 
1 161 ASP n 
1 162 GLY n 
1 163 ARG n 
1 164 VAL n 
1 165 LYS n 
1 166 LEU n 
1 167 SER n 
1 168 ASP n 
1 169 PHE n 
1 170 GLY n 
1 171 PHE n 
1 172 CYS n 
1 173 ALA n 
1 174 GLN n 
1 175 VAL n 
1 176 SER n 
1 177 LYS n 
1 178 GLU n 
1 179 VAL n 
1 180 PRO n 
1 181 ARG n 
1 182 ARG n 
1 183 LYS n 
1 184 SEP n 
1 185 LEU n 
1 186 VAL n 
1 187 GLY n 
1 188 THR n 
1 189 PRO n 
1 190 TYR n 
1 191 TRP n 
1 192 MET n 
1 193 ALA n 
1 194 PRO n 
1 195 GLU n 
1 196 LEU n 
1 197 ILE n 
1 198 SER n 
1 199 ARG n 
1 200 LEU n 
1 201 PRO n 
1 202 TYR n 
1 203 GLY n 
1 204 PRO n 
1 205 GLU n 
1 206 VAL n 
1 207 ASP n 
1 208 ILE n 
1 209 TRP n 
1 210 SER n 
1 211 LEU n 
1 212 GLY n 
1 213 ILE n 
1 214 MET n 
1 215 VAL n 
1 216 ILE n 
1 217 GLU n 
1 218 MET n 
1 219 VAL n 
1 220 ASP n 
1 221 GLY n 
1 222 GLU n 
1 223 PRO n 
1 224 PRO n 
1 225 TYR n 
1 226 PHE n 
1 227 ASN n 
1 228 GLU n 
1 229 PRO n 
1 230 PRO n 
1 231 LEU n 
1 232 LYS n 
1 233 ALA n 
1 234 MET n 
1 235 LYS n 
1 236 MET n 
1 237 ILE n 
1 238 ARG n 
1 239 ASP n 
1 240 ASN n 
1 241 LEU n 
1 242 PRO n 
1 243 PRO n 
1 244 ARG n 
1 245 LEU n 
1 246 LYS n 
1 247 ASN n 
1 248 LEU n 
1 249 HIS n 
1 250 LYS n 
1 251 VAL n 
1 252 SER n 
1 253 PRO n 
1 254 SER n 
1 255 LEU n 
1 256 LYS n 
1 257 GLY n 
1 258 PHE n 
1 259 LEU n 
1 260 ASP n 
1 261 ARG n 
1 262 LEU n 
1 263 LEU n 
1 264 VAL n 
1 265 ARG n 
1 266 ASP n 
1 267 PRO n 
1 268 ALA n 
1 269 GLN n 
1 270 ARG n 
1 271 ALA n 
1 272 THR n 
1 273 ALA n 
1 274 ALA n 
1 275 GLU n 
1 276 LEU n 
1 277 LEU n 
1 278 LYS n 
1 279 HIS n 
1 280 PRO n 
1 281 PHE n 
1 282 LEU n 
1 283 ALA n 
1 284 LYS n 
1 285 ALA n 
1 286 GLY n 
1 287 PRO n 
1 288 PRO n 
1 289 ALA n 
1 290 SER n 
1 291 ILE n 
1 292 VAL n 
1 293 PRO n 
1 294 LEU n 
1 295 MET n 
1 296 ARG n 
1 297 GLN n 
1 298 ASN n 
1 299 ARG n 
1 300 THR n 
1 301 ARG n 
2 1   ARG n 
2 2   ARG n 
2 3   ARG n 
2 4   ARG n 
2 5   ARG n 
2 6   SER n 
2 7   TRP n 
2 8   TYR n 
2 9   PHE n 
2 10  ASP n 
2 11  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PAK4, KIAA1142' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosetta-R3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic peptide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PAK4_HUMAN O96013 1 
;SPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM
RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTH
DGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDN
LPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
291 ? 
2 PDB 2Q0N       2Q0N   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Q0N A 1 ? 301 ? O96013 291 ? 591 ? 291 591 
2 2 2Q0N B 1 ? 11  ? 2Q0N   -5  ? 5   ? -5  5   
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2Q0N 
_struct_ref_seq_dif.mon_id                       SEP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      184 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O96013 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          474 
_struct_ref_seq_dif.details                      'MODIFIED RESIDUE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            474 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE   'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2Q0N 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.94 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'1.7M Ammonium sulfate, 15% PEG400, 1M Tris-HCl pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97910 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97910 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
# 
_reflns.entry_id                     2Q0N 
_reflns.d_resolution_high            1.750 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   40410 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_netI_over_sigmaI        16.300 
_reflns.pdbx_chi_squared             1.050 
_reflns.pdbx_redundancy              12.000 
_reflns.percent_possible_obs         92.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   43686 
_reflns.pdbx_Rsym_value              0.057 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.81 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.355 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.046 
_reflns_shell.pdbx_redundancy        5.60 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4036 
_reflns_shell.percent_possible_all   94.20 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2Q0N 
_refine.ls_d_res_high                            1.750 
_refine.ls_d_res_low                             32.58 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    92.470 
_refine.ls_number_reflns_obs                     40359 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.228 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2020 
_refine.B_iso_mean                               19.143 
_refine.aniso_B[1][1]                            0.300 
_refine.aniso_B[2][2]                            0.300 
_refine.aniso_B[3][3]                            -0.600 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.pdbx_overall_ESU_R                       0.105 
_refine.pdbx_overall_ESU_R_Free                  0.111 
_refine.overall_SU_ML                            0.064 
_refine.overall_SU_B                             3.673 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 2J0I' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2379 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             251 
_refine_hist.number_atoms_total               2667 
_refine_hist.d_res_high                       1.750 
_refine_hist.d_res_low                        32.58 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2523 0.016  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           1755 0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3425 1.588  1.982  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        4272 1.011  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   325  5.729  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   107  32.147 23.084 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   433  12.871 15.035 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22   19.773 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           387  0.094  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2782 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       504  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            498  0.229  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              1906 0.207  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1205 0.174  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            1266 0.088  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    163  0.135  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   13   0.134  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     70   0.298  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 17   0.156  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1712 1.102  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           619  0.294  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2535 1.450  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1036 2.308  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             880  3.182  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.750 
_refine_ls_shell.d_res_low                        1.795 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               92.890 
_refine_ls_shell.number_reflns_R_work             2792 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.R_factor_R_free                  0.332 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             159 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2951 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2Q0N 
_struct.title                     'Structure of human p21 activating kinase 4 (PAK4) in complex with a consensus peptide' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase PAK 4 (E.C.2.7.11.1), Synthetic peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Q0N 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;PROTEIN KINASE, PHOSPHORYLATION, NUCLEOTIDE-BINDING, PAK4, STE20, KINASE, TRANSFERASE, ATP-BINDING, SERINE/THREONINE-PROTEIN KINASE, Structural Genomics, Structural Genomics Consortium, SGC
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 10  ? VAL A 22  ? SER A 300 VAL A 312 1 ? 13 
HELX_P HELX_P2  2  ASP A 26  ? SER A 29  ? ASP A 316 SER A 319 5 ? 4  
HELX_P HELX_P3  3  ARG A 65  ? GLN A 67  ? ARG A 355 GLN A 357 5 ? 3  
HELX_P HELX_P4  4  ARG A 70  ? TYR A 83  ? ARG A 360 TYR A 373 1 ? 14 
HELX_P HELX_P5  5  LEU A 113 ? THR A 118 ? LEU A 403 THR A 408 1 ? 6  
HELX_P HELX_P6  6  ASN A 123 ? GLN A 144 ? ASN A 413 GLN A 434 1 ? 22 
HELX_P HELX_P7  7  LYS A 152 ? ASP A 154 ? LYS A 442 ASP A 444 5 ? 3  
HELX_P HELX_P8  8  THR A 188 ? MET A 192 ? THR A 478 MET A 482 5 ? 5  
HELX_P HELX_P9  9  ALA A 193 ? SER A 198 ? ALA A 483 SER A 488 1 ? 6  
HELX_P HELX_P10 10 PRO A 204 ? GLY A 221 ? PRO A 494 GLY A 511 1 ? 18 
HELX_P HELX_P11 11 PRO A 229 ? ASN A 240 ? PRO A 519 ASN A 530 1 ? 12 
HELX_P HELX_P12 12 ASN A 247 ? VAL A 251 ? ASN A 537 VAL A 541 5 ? 5  
HELX_P HELX_P13 13 SER A 252 ? LEU A 263 ? SER A 542 LEU A 553 1 ? 12 
HELX_P HELX_P14 14 THR A 272 ? LEU A 277 ? THR A 562 LEU A 567 1 ? 6  
HELX_P HELX_P15 15 LYS A 278 ? ALA A 285 ? LYS A 568 ALA A 575 5 ? 8  
HELX_P HELX_P16 16 PRO A 287 ? MET A 295 ? PRO A 577 MET A 585 5 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 183 C ? ? ? 1_555 A SEP 184 N ? ? A LYS 473 A SEP 474 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A SEP 184 C ? ? ? 1_555 A LEU 185 N ? ? A SEP 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 31  ? GLU A 39  ? LEU A 321 GLU A 329 
A 2 ILE A 44  ? VAL A 50  ? ILE A 334 VAL A 340 
A 3 LEU A 56  ? ASP A 63  ? LEU A 346 ASP A 353 
A 4 GLU A 100 ? GLU A 106 ? GLU A 390 GLU A 396 
A 5 MET A 91  ? VAL A 97  ? MET A 381 VAL A 387 
B 1 GLY A 111 ? ALA A 112 ? GLY A 401 ALA A 402 
B 2 ILE A 156 ? LEU A 158 ? ILE A 446 LEU A 448 
B 3 VAL A 164 ? LEU A 166 ? VAL A 454 LEU A 456 
C 1 VAL A 146 ? ILE A 147 ? VAL A 436 ILE A 437 
C 2 ALA A 173 ? GLN A 174 ? ALA A 463 GLN A 464 
D 1 LEU A 185 ? GLY A 187 ? LEU A 475 GLY A 477 
D 2 TRP B 7   ? ASP B 10  ? TRP B 1   ASP B 4   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 37  ? N ILE A 327 O VAL A 45  ? O VAL A 335 
A 2 3 N CYS A 46  ? N CYS A 336 O VAL A 59  ? O VAL A 349 
A 3 4 N MET A 62  ? N MET A 352 O LEU A 101 ? O LEU A 391 
A 4 5 O VAL A 104 ? O VAL A 394 N ASN A 93  ? N ASN A 383 
B 1 2 N GLY A 111 ? N GLY A 401 O LEU A 158 ? O LEU A 448 
B 2 3 N LEU A 157 ? N LEU A 447 O LYS A 165 ? O LYS A 455 
C 1 2 N ILE A 147 ? N ILE A 437 O ALA A 173 ? O ALA A 463 
D 1 2 N GLY A 187 ? N GLY A 477 O TRP B 7   ? O TRP B 1   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 592' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 593' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 594' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO B 403' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 595' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE EDO A 596' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 597' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 598' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 599' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG A 8   ? ARG A 298 . ? 1_555 ? 
2  AC1 4 ARG A 69  ? ARG A 359 . ? 1_555 ? 
3  AC1 4 ARG A 70  ? ARG A 360 . ? 1_555 ? 
4  AC1 4 GLU A 71  ? GLU A 361 . ? 1_555 ? 
5  AC2 6 HOH L .   ? HOH A 70  . ? 1_555 ? 
6  AC2 6 ARG A 69  ? ARG A 359 . ? 1_555 ? 
7  AC2 6 LEU A 72  ? LEU A 362 . ? 1_555 ? 
8  AC2 6 ASN A 75  ? ASN A 365 . ? 1_555 ? 
9  AC2 6 ARG A 149 ? ARG A 439 . ? 1_555 ? 
10 AC2 6 SEP A 184 ? SEP A 474 . ? 1_555 ? 
11 AC3 2 ASN A 123 ? ASN A 413 . ? 1_555 ? 
12 AC3 2 GLU A 124 ? GLU A 414 . ? 1_555 ? 
13 AC4 4 LYS A 284 ? LYS A 574 . ? 1_554 ? 
14 AC4 4 ARG A 301 ? ARG A 591 . ? 8_554 ? 
15 AC4 4 ARG B 1   ? ARG B -5  . ? 1_555 ? 
16 AC4 4 ARG B 3   ? ARG B -3  . ? 1_555 ? 
17 AC5 4 LEU A 185 ? LEU A 475 . ? 1_555 ? 
18 AC5 4 LEU A 231 ? LEU A 521 . ? 1_555 ? 
19 AC5 4 ARG A 238 ? ARG A 528 . ? 1_555 ? 
20 AC5 4 EDO G .   ? EDO A 596 . ? 1_555 ? 
21 AC6 2 ARG A 238 ? ARG A 528 . ? 1_555 ? 
22 AC6 2 EDO F .   ? EDO A 595 . ? 1_555 ? 
23 AC7 5 HOH L .   ? HOH A 265 . ? 1_555 ? 
24 AC7 5 GLU A 106 ? GLU A 396 . ? 1_555 ? 
25 AC7 5 PHE A 107 ? PHE A 397 . ? 1_555 ? 
26 AC7 5 LEU A 108 ? LEU A 398 . ? 1_555 ? 
27 AC7 5 GLY A 111 ? GLY A 401 . ? 1_555 ? 
28 AC8 4 HOH L .   ? HOH A 273 . ? 1_555 ? 
29 AC8 4 HOH L .   ? HOH A 275 . ? 1_555 ? 
30 AC8 4 GLU A 109 ? GLU A 399 . ? 8_554 ? 
31 AC8 4 GLN A 297 ? GLN A 587 . ? 8_554 ? 
32 AC9 3 VAL A 117 ? VAL A 407 . ? 1_555 ? 
33 AC9 3 HIS A 119 ? HIS A 409 . ? 1_555 ? 
34 AC9 3 THR A 120 ? THR A 410 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2Q0N 
_atom_sites.fract_transf_matrix[1][1]   0.006864 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006864 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025267 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 8   ? -64.726 12.266 -26.599 1.00 35.89 ? 298 ARG A N   1 
ATOM   2    C CA  . ARG A 1 8   ? -64.089 13.569 -26.236 1.00 36.35 ? 298 ARG A CA  1 
ATOM   3    C C   . ARG A 1 8   ? -64.955 14.721 -26.747 1.00 35.29 ? 298 ARG A C   1 
ATOM   4    O O   . ARG A 1 8   ? -65.255 14.795 -27.946 1.00 35.69 ? 298 ARG A O   1 
ATOM   5    C CB  . ARG A 1 8   ? -62.684 13.653 -26.833 1.00 36.63 ? 298 ARG A CB  1 
ATOM   6    C CG  . ARG A 1 8   ? -61.930 14.947 -26.542 1.00 36.61 ? 298 ARG A CG  1 
ATOM   7    C CD  . ARG A 1 8   ? -60.407 14.767 -26.712 1.00 38.25 ? 298 ARG A CD  1 
ATOM   8    N NE  . ARG A 1 8   ? -59.651 15.975 -26.344 1.00 40.45 ? 298 ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 8   ? -58.332 16.020 -26.118 1.00 41.56 ? 298 ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 8   ? -57.581 14.927 -26.204 1.00 43.64 ? 298 ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 8   ? -57.752 17.172 -25.778 1.00 41.98 ? 298 ARG A NH2 1 
ATOM   12   N N   . VAL A 1 9   ? -65.345 15.619 -25.846 1.00 34.19 ? 299 VAL A N   1 
ATOM   13   C CA  . VAL A 1 9   ? -66.273 16.678 -26.201 1.00 32.60 ? 299 VAL A CA  1 
ATOM   14   C C   . VAL A 1 9   ? -65.550 17.696 -27.065 1.00 32.20 ? 299 VAL A C   1 
ATOM   15   O O   . VAL A 1 9   ? -64.330 17.791 -27.036 1.00 31.67 ? 299 VAL A O   1 
ATOM   16   C CB  . VAL A 1 9   ? -66.902 17.354 -24.960 1.00 33.55 ? 299 VAL A CB  1 
ATOM   17   C CG1 . VAL A 1 9   ? -67.485 16.295 -24.026 1.00 31.67 ? 299 VAL A CG1 1 
ATOM   18   C CG2 . VAL A 1 9   ? -65.875 18.240 -24.232 1.00 31.41 ? 299 VAL A CG2 1 
ATOM   19   N N   . SER A 1 10  ? -66.301 18.431 -27.875 1.00 31.76 ? 300 SER A N   1 
ATOM   20   C CA  . SER A 1 10  ? -65.715 19.409 -28.766 1.00 31.08 ? 300 SER A CA  1 
ATOM   21   C C   . SER A 1 10  ? -65.150 20.589 -27.962 1.00 30.96 ? 300 SER A C   1 
ATOM   22   O O   . SER A 1 10  ? -65.533 20.826 -26.800 1.00 30.20 ? 300 SER A O   1 
ATOM   23   C CB  . SER A 1 10  ? -66.775 19.929 -29.729 1.00 31.73 ? 300 SER A CB  1 
ATOM   24   O OG  . SER A 1 10  ? -67.705 20.712 -29.004 1.00 29.92 ? 300 SER A OG  1 
ATOM   25   N N   . HIS A 1 11  ? -64.242 21.324 -28.599 1.00 30.86 ? 301 HIS A N   1 
ATOM   26   C CA  A HIS A 1 11  ? -63.720 22.574 -28.055 0.70 30.96 ? 301 HIS A CA  1 
ATOM   27   C CA  B HIS A 1 11  ? -63.705 22.527 -27.986 0.30 30.35 ? 301 HIS A CA  1 
ATOM   28   C C   . HIS A 1 11  ? -64.844 23.475 -27.596 1.00 30.32 ? 301 HIS A C   1 
ATOM   29   O O   . HIS A 1 11  ? -64.771 24.097 -26.541 1.00 30.02 ? 301 HIS A O   1 
ATOM   30   C CB  A HIS A 1 11  ? -62.912 23.352 -29.100 0.70 31.10 ? 301 HIS A CB  1 
ATOM   31   C CB  B HIS A 1 11  ? -62.687 23.227 -28.899 0.30 30.11 ? 301 HIS A CB  1 
ATOM   32   C CG  A HIS A 1 11  ? -62.578 24.745 -28.662 0.70 32.99 ? 301 HIS A CG  1 
ATOM   33   C CG  B HIS A 1 11  ? -61.350 22.545 -28.963 0.30 29.28 ? 301 HIS A CG  1 
ATOM   34   N ND1 A HIS A 1 11  ? -61.440 25.041 -27.942 0.70 33.87 ? 301 HIS A ND1 1 
ATOM   35   N ND1 B HIS A 1 11  ? -60.581 22.286 -27.847 0.30 28.28 ? 301 HIS A ND1 1 
ATOM   36   C CD2 A HIS A 1 11  ? -63.270 25.906 -28.763 0.70 34.27 ? 301 HIS A CD2 1 
ATOM   37   C CD2 B HIS A 1 11  ? -60.636 22.094 -30.022 0.30 28.88 ? 301 HIS A CD2 1 
ATOM   38   C CE1 A HIS A 1 11  ? -61.427 26.331 -27.652 0.70 33.59 ? 301 HIS A CE1 1 
ATOM   39   C CE1 B HIS A 1 11  ? -59.460 21.691 -28.216 0.30 28.38 ? 301 HIS A CE1 1 
ATOM   40   N NE2 A HIS A 1 11  ? -62.525 26.880 -28.139 0.70 34.86 ? 301 HIS A NE2 1 
ATOM   41   N NE2 B HIS A 1 11  ? -59.467 21.564 -29.531 0.30 28.12 ? 301 HIS A NE2 1 
ATOM   42   N N   . GLU A 1 12  ? -65.898 23.569 -28.426 1.00 30.33 ? 302 GLU A N   1 
ATOM   43   C CA  . GLU A 1 12  ? -67.003 24.468 -28.134 1.00 30.75 ? 302 GLU A CA  1 
ATOM   44   C C   . GLU A 1 12  ? -67.675 24.043 -26.838 1.00 30.35 ? 302 GLU A C   1 
ATOM   45   O O   . GLU A 1 12  ? -67.937 24.874 -25.976 1.00 31.38 ? 302 GLU A O   1 
ATOM   46   C CB  . GLU A 1 12  ? -68.010 24.486 -29.290 1.00 31.64 ? 302 GLU A CB  1 
ATOM   47   C CG  . GLU A 1 12  ? -67.435 25.082 -30.585 1.00 34.07 ? 302 GLU A CG  1 
ATOM   48   C CD  . GLU A 1 12  ? -66.314 24.244 -31.252 1.00 37.11 ? 302 GLU A CD  1 
ATOM   49   O OE1 . GLU A 1 12  ? -66.301 22.991 -31.126 1.00 35.87 ? 302 GLU A OE1 1 
ATOM   50   O OE2 . GLU A 1 12  ? -65.445 24.860 -31.918 1.00 39.95 ? 302 GLU A OE2 1 
ATOM   51   N N   . GLN A 1 13  ? -67.894 22.745 -26.677 1.00 29.44 ? 303 GLN A N   1 
ATOM   52   C CA  . GLN A 1 13  ? -68.561 22.239 -25.495 1.00 29.28 ? 303 GLN A CA  1 
ATOM   53   C C   . GLN A 1 13  ? -67.655 22.363 -24.272 1.00 27.91 ? 303 GLN A C   1 
ATOM   54   O O   . GLN A 1 13  ? -68.102 22.760 -23.195 1.00 27.29 ? 303 GLN A O   1 
ATOM   55   C CB  . GLN A 1 13  ? -69.041 20.801 -25.666 1.00 29.56 ? 303 GLN A CB  1 
ATOM   56   C CG  . GLN A 1 13  ? -69.860 20.366 -24.468 1.00 32.37 ? 303 GLN A CG  1 
ATOM   57   C CD  . GLN A 1 13  ? -70.632 19.087 -24.671 1.00 32.11 ? 303 GLN A CD  1 
ATOM   58   O OE1 . GLN A 1 13  ? -71.062 18.756 -25.790 1.00 35.93 ? 303 GLN A OE1 1 
ATOM   59   N NE2 . GLN A 1 13  ? -70.819 18.347 -23.576 1.00 34.12 ? 303 GLN A NE2 1 
ATOM   60   N N   . PHE A 1 14  ? -66.377 22.053 -24.424 1.00 26.84 ? 304 PHE A N   1 
ATOM   61   C CA  . PHE A 1 14  ? -65.463 22.280 -23.310 1.00 26.11 ? 304 PHE A CA  1 
ATOM   62   C C   . PHE A 1 14  ? -65.441 23.751 -22.866 1.00 26.68 ? 304 PHE A C   1 
ATOM   63   O O   . PHE A 1 14  ? -65.567 24.038 -21.664 1.00 27.57 ? 304 PHE A O   1 
ATOM   64   C CB  . PHE A 1 14  ? -64.033 21.802 -23.597 1.00 26.39 ? 304 PHE A CB  1 
ATOM   65   C CG  . PHE A 1 14  ? -63.133 22.058 -22.446 1.00 26.21 ? 304 PHE A CG  1 
ATOM   66   C CD1 . PHE A 1 14  ? -63.173 21.247 -21.320 1.00 27.50 ? 304 PHE A CD1 1 
ATOM   67   C CD2 . PHE A 1 14  ? -62.330 23.183 -22.425 1.00 29.32 ? 304 PHE A CD2 1 
ATOM   68   C CE1 . PHE A 1 14  ? -62.377 21.527 -20.230 1.00 25.83 ? 304 PHE A CE1 1 
ATOM   69   C CE2 . PHE A 1 14  ? -61.560 23.475 -21.361 1.00 25.68 ? 304 PHE A CE2 1 
ATOM   70   C CZ  . PHE A 1 14  ? -61.585 22.648 -20.240 1.00 25.83 ? 304 PHE A CZ  1 
ATOM   71   N N   . ARG A 1 15  ? -65.298 24.687 -23.809 1.00 26.20 ? 305 ARG A N   1 
ATOM   72   C CA  . ARG A 1 15  ? -65.265 26.103 -23.452 1.00 26.45 ? 305 ARG A CA  1 
ATOM   73   C C   . ARG A 1 15  ? -66.543 26.535 -22.704 1.00 26.63 ? 305 ARG A C   1 
ATOM   74   O O   . ARG A 1 15  ? -66.466 27.253 -21.721 1.00 27.13 ? 305 ARG A O   1 
ATOM   75   C CB  . ARG A 1 15  ? -65.040 27.000 -24.692 1.00 26.15 ? 305 ARG A CB  1 
ATOM   76   C CG  . ARG A 1 15  ? -64.730 28.447 -24.343 1.00 25.39 ? 305 ARG A CG  1 
ATOM   77   C CD  . ARG A 1 15  ? -64.649 29.347 -25.526 1.00 26.56 ? 305 ARG A CD  1 
ATOM   78   N NE  . ARG A 1 15  ? -64.173 30.705 -25.224 1.00 26.14 ? 305 ARG A NE  1 
ATOM   79   C CZ  . ARG A 1 15  ? -64.894 31.683 -24.671 1.00 26.92 ? 305 ARG A CZ  1 
ATOM   80   N NH1 . ARG A 1 15  ? -64.350 32.875 -24.479 1.00 24.23 ? 305 ARG A NH1 1 
ATOM   81   N NH2 . ARG A 1 15  ? -66.166 31.495 -24.338 1.00 29.60 ? 305 ARG A NH2 1 
ATOM   82   N N   . ALA A 1 16  ? -67.693 26.067 -23.175 1.00 26.40 ? 306 ALA A N   1 
ATOM   83   C CA  . ALA A 1 16  ? -69.015 26.390 -22.608 1.00 27.24 ? 306 ALA A CA  1 
ATOM   84   C C   . ALA A 1 16  ? -69.106 25.904 -21.157 1.00 26.61 ? 306 ALA A C   1 
ATOM   85   O O   . ALA A 1 16  ? -69.642 26.601 -20.290 1.00 27.34 ? 306 ALA A O   1 
ATOM   86   C CB  . ALA A 1 16  ? -70.139 25.761 -23.471 1.00 27.89 ? 306 ALA A CB  1 
ATOM   87   N N   . ALA A 1 17  ? -68.567 24.712 -20.899 1.00 26.27 ? 307 ALA A N   1 
ATOM   88   C CA  . ALA A 1 17  ? -68.518 24.148 -19.536 1.00 27.19 ? 307 ALA A CA  1 
ATOM   89   C C   . ALA A 1 17  ? -67.653 25.001 -18.623 1.00 27.38 ? 307 ALA A C   1 
ATOM   90   O O   . ALA A 1 17  ? -68.055 25.403 -17.512 1.00 28.44 ? 307 ALA A O   1 
ATOM   91   C CB  . ALA A 1 17  ? -68.020 22.705 -19.571 1.00 27.06 ? 307 ALA A CB  1 
ATOM   92   N N   . LEU A 1 18  ? -66.461 25.297 -19.095 1.00 28.60 ? 308 LEU A N   1 
ATOM   93   C CA  . LEU A 1 18  ? -65.549 26.171 -18.372 1.00 28.79 ? 308 LEU A CA  1 
ATOM   94   C C   . LEU A 1 18  ? -66.135 27.561 -18.145 1.00 27.96 ? 308 LEU A C   1 
ATOM   95   O O   . LEU A 1 18  ? -66.022 28.121 -17.052 1.00 27.58 ? 308 LEU A O   1 
ATOM   96   C CB  . LEU A 1 18  ? -64.243 26.277 -19.138 1.00 28.94 ? 308 LEU A CB  1 
ATOM   97   C CG  . LEU A 1 18  ? -63.031 26.818 -18.437 1.00 30.62 ? 308 LEU A CG  1 
ATOM   98   C CD1 . LEU A 1 18  ? -62.748 26.152 -17.105 1.00 28.58 ? 308 LEU A CD1 1 
ATOM   99   C CD2 . LEU A 1 18  ? -61.815 26.663 -19.339 1.00 30.00 ? 308 LEU A CD2 1 
ATOM   100  N N   . GLN A 1 19  ? -66.831 28.112 -19.152 1.00 28.74 ? 309 GLN A N   1 
ATOM   101  C CA  A GLN A 1 19  ? -67.419 29.445 -19.017 0.50 28.23 ? 309 GLN A CA  1 
ATOM   102  C CA  B GLN A 1 19  ? -67.426 29.445 -19.031 0.50 28.14 ? 309 GLN A CA  1 
ATOM   103  C C   . GLN A 1 19  ? -68.382 29.555 -17.850 1.00 28.03 ? 309 GLN A C   1 
ATOM   104  O O   . GLN A 1 19  ? -68.478 30.613 -17.247 1.00 28.71 ? 309 GLN A O   1 
ATOM   105  C CB  A GLN A 1 19  ? -68.090 29.902 -20.312 0.50 27.89 ? 309 GLN A CB  1 
ATOM   106  C CB  B GLN A 1 19  ? -68.109 29.874 -20.342 0.50 27.86 ? 309 GLN A CB  1 
ATOM   107  C CG  A GLN A 1 19  ? -68.700 31.291 -20.240 0.50 28.47 ? 309 GLN A CG  1 
ATOM   108  C CG  B GLN A 1 19  ? -68.201 31.375 -20.550 0.50 28.48 ? 309 GLN A CG  1 
ATOM   109  C CD  A GLN A 1 19  ? -69.056 31.818 -21.604 0.50 28.35 ? 309 GLN A CD  1 
ATOM   110  C CD  B GLN A 1 19  ? -69.511 31.980 -20.072 0.50 28.01 ? 309 GLN A CD  1 
ATOM   111  O OE1 A GLN A 1 19  ? -68.908 31.118 -22.599 0.50 31.30 ? 309 GLN A OE1 1 
ATOM   112  O OE1 B GLN A 1 19  ? -70.607 31.432 -20.330 0.50 29.05 ? 309 GLN A OE1 1 
ATOM   113  N NE2 A GLN A 1 19  ? -69.520 33.049 -21.661 0.50 28.46 ? 309 GLN A NE2 1 
ATOM   114  N NE2 B GLN A 1 19  ? -69.419 33.138 -19.402 0.50 27.76 ? 309 GLN A NE2 1 
ATOM   115  N N   . LEU A 1 20  ? -69.104 28.476 -17.515 1.00 27.78 ? 310 LEU A N   1 
ATOM   116  C CA  . LEU A 1 20  ? -70.028 28.485 -16.368 1.00 27.69 ? 310 LEU A CA  1 
ATOM   117  C C   . LEU A 1 20  ? -69.338 28.611 -15.017 1.00 26.92 ? 310 LEU A C   1 
ATOM   118  O O   . LEU A 1 20  ? -69.981 29.038 -14.060 1.00 25.15 ? 310 LEU A O   1 
ATOM   119  C CB  . LEU A 1 20  ? -70.862 27.203 -16.302 1.00 28.19 ? 310 LEU A CB  1 
ATOM   120  C CG  . LEU A 1 20  ? -71.867 26.906 -17.390 1.00 30.97 ? 310 LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 20  ? -72.508 25.536 -17.107 1.00 28.61 ? 310 LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 20  ? -72.900 27.994 -17.418 1.00 30.87 ? 310 LEU A CD2 1 
ATOM   123  N N   . VAL A 1 21  ? -68.057 28.217 -14.918 1.00 26.69 ? 311 VAL A N   1 
ATOM   124  C CA  . VAL A 1 21  ? -67.367 28.228 -13.622 1.00 26.78 ? 311 VAL A CA  1 
ATOM   125  C C   . VAL A 1 21  ? -66.432 29.417 -13.403 1.00 26.63 ? 311 VAL A C   1 
ATOM   126  O O   . VAL A 1 21  ? -66.117 29.775 -12.252 1.00 27.86 ? 311 VAL A O   1 
ATOM   127  C CB  . VAL A 1 21  ? -66.614 26.878 -13.335 1.00 27.63 ? 311 VAL A CB  1 
ATOM   128  C CG1 . VAL A 1 21  ? -67.623 25.692 -13.309 1.00 28.16 ? 311 VAL A CG1 1 
ATOM   129  C CG2 . VAL A 1 21  ? -65.543 26.612 -14.373 1.00 28.56 ? 311 VAL A CG2 1 
ATOM   130  N N   . VAL A 1 22  ? -66.008 30.074 -14.473 1.00 25.53 ? 312 VAL A N   1 
ATOM   131  C CA  . VAL A 1 22  ? -65.150 31.242 -14.342 1.00 24.63 ? 312 VAL A CA  1 
ATOM   132  C C   . VAL A 1 22  ? -66.028 32.490 -14.112 1.00 23.63 ? 312 VAL A C   1 
ATOM   133  O O   . VAL A 1 22  ? -67.245 32.476 -14.344 1.00 24.80 ? 312 VAL A O   1 
ATOM   134  C CB  . VAL A 1 22  ? -64.255 31.450 -15.590 1.00 25.16 ? 312 VAL A CB  1 
ATOM   135  C CG1 . VAL A 1 22  ? -63.381 30.189 -15.892 1.00 24.57 ? 312 VAL A CG1 1 
ATOM   136  C CG2 . VAL A 1 22  ? -65.074 31.863 -16.819 1.00 25.08 ? 312 VAL A CG2 1 
ATOM   137  N N   . ASP A 1 23  ? -65.395 33.555 -13.668 1.00 21.95 ? 313 ASP A N   1 
ATOM   138  C CA  . ASP A 1 23  ? -66.042 34.874 -13.569 1.00 22.41 ? 313 ASP A CA  1 
ATOM   139  C C   . ASP A 1 23  ? -66.336 35.425 -14.957 1.00 22.89 ? 313 ASP A C   1 
ATOM   140  O O   . ASP A 1 23  ? -65.482 35.350 -15.854 1.00 23.54 ? 313 ASP A O   1 
ATOM   141  C CB  . ASP A 1 23  ? -65.108 35.846 -12.835 1.00 21.40 ? 313 ASP A CB  1 
ATOM   142  C CG  . ASP A 1 23  ? -64.879 35.450 -11.398 1.00 24.59 ? 313 ASP A CG  1 
ATOM   143  O OD1 . ASP A 1 23  ? -65.864 35.437 -10.641 1.00 23.90 ? 313 ASP A OD1 1 
ATOM   144  O OD2 . ASP A 1 23  ? -63.725 35.170 -11.031 1.00 23.78 ? 313 ASP A OD2 1 
ATOM   145  N N   . PRO A 1 24  ? -67.536 35.978 -15.170 1.00 22.46 ? 314 PRO A N   1 
ATOM   146  C CA  . PRO A 1 24  ? -67.749 36.705 -16.413 1.00 23.41 ? 314 PRO A CA  1 
ATOM   147  C C   . PRO A 1 24  ? -66.857 37.956 -16.599 1.00 24.91 ? 314 PRO A C   1 
ATOM   148  O O   . PRO A 1 24  ? -66.385 38.544 -15.630 1.00 24.46 ? 314 PRO A O   1 
ATOM   149  C CB  . PRO A 1 24  ? -69.237 37.114 -16.322 1.00 22.84 ? 314 PRO A CB  1 
ATOM   150  C CG  . PRO A 1 24  ? -69.850 36.123 -15.347 1.00 22.80 ? 314 PRO A CG  1 
ATOM   151  C CD  . PRO A 1 24  ? -68.764 35.891 -14.346 1.00 22.62 ? 314 PRO A CD  1 
ATOM   152  N N   . GLY A 1 25  ? -66.660 38.357 -17.847 1.00 27.12 ? 315 GLY A N   1 
ATOM   153  C CA  . GLY A 1 25  ? -66.009 39.627 -18.164 1.00 28.36 ? 315 GLY A CA  1 
ATOM   154  C C   . GLY A 1 25  ? -64.607 39.504 -18.724 1.00 30.17 ? 315 GLY A C   1 
ATOM   155  O O   . GLY A 1 25  ? -64.059 38.408 -18.889 1.00 28.85 ? 315 GLY A O   1 
ATOM   156  N N   . ASP A 1 26  ? -64.018 40.663 -19.004 1.00 32.17 ? 316 ASP A N   1 
ATOM   157  C CA  . ASP A 1 26  ? -62.667 40.742 -19.555 1.00 33.28 ? 316 ASP A CA  1 
ATOM   158  C C   . ASP A 1 26  ? -61.781 41.395 -18.487 1.00 33.67 ? 316 ASP A C   1 
ATOM   159  O O   . ASP A 1 26  ? -62.018 42.551 -18.118 1.00 33.81 ? 316 ASP A O   1 
ATOM   160  C CB  . ASP A 1 26  ? -62.704 41.589 -20.833 1.00 33.61 ? 316 ASP A CB  1 
ATOM   161  C CG  . ASP A 1 26  ? -61.384 41.579 -21.622 1.00 33.70 ? 316 ASP A CG  1 
ATOM   162  O OD1 . ASP A 1 26  ? -60.318 41.207 -21.104 1.00 34.24 ? 316 ASP A OD1 1 
ATOM   163  O OD2 . ASP A 1 26  ? -61.442 41.986 -22.801 1.00 39.06 ? 316 ASP A OD2 1 
ATOM   164  N N   . PRO A 1 27  ? -60.789 40.657 -17.976 1.00 34.52 ? 317 PRO A N   1 
ATOM   165  C CA  . PRO A 1 27  ? -59.899 41.131 -16.910 1.00 34.55 ? 317 PRO A CA  1 
ATOM   166  C C   . PRO A 1 27  ? -58.930 42.241 -17.334 1.00 34.41 ? 317 PRO A C   1 
ATOM   167  O O   . PRO A 1 27  ? -58.272 42.828 -16.489 1.00 34.14 ? 317 PRO A O   1 
ATOM   168  C CB  . PRO A 1 27  ? -59.113 39.892 -16.566 1.00 35.32 ? 317 PRO A CB  1 
ATOM   169  C CG  . PRO A 1 27  ? -59.115 39.110 -17.836 1.00 35.83 ? 317 PRO A CG  1 
ATOM   170  C CD  . PRO A 1 27  ? -60.446 39.274 -18.366 1.00 34.33 ? 317 PRO A CD  1 
ATOM   171  N N   . ARG A 1 28  ? -58.857 42.526 -18.625 1.00 34.57 ? 318 ARG A N   1 
ATOM   172  C CA  . ARG A 1 28  ? -58.081 43.671 -19.093 1.00 35.21 ? 318 ARG A CA  1 
ATOM   173  C C   . ARG A 1 28  ? -58.813 44.980 -18.788 1.00 34.75 ? 318 ARG A C   1 
ATOM   174  O O   . ARG A 1 28  ? -58.255 46.045 -18.967 1.00 35.38 ? 318 ARG A O   1 
ATOM   175  C CB  . ARG A 1 28  ? -57.764 43.535 -20.577 1.00 34.94 ? 318 ARG A CB  1 
ATOM   176  C CG  . ARG A 1 28  ? -56.943 42.302 -20.864 1.00 36.36 ? 318 ARG A CG  1 
ATOM   177  C CD  . ARG A 1 28  ? -56.707 42.059 -22.314 1.00 37.04 ? 318 ARG A CD  1 
ATOM   178  N NE  . ARG A 1 28  ? -57.925 41.676 -23.020 1.00 37.24 ? 318 ARG A NE  1 
ATOM   179  C CZ  . ARG A 1 28  ? -57.933 41.221 -24.268 1.00 38.63 ? 318 ARG A CZ  1 
ATOM   180  N NH1 . ARG A 1 28  ? -56.791 41.084 -24.936 1.00 38.45 ? 318 ARG A NH1 1 
ATOM   181  N NH2 . ARG A 1 28  ? -59.085 40.912 -24.857 1.00 38.14 ? 318 ARG A NH2 1 
ATOM   182  N N   . SER A 1 29  ? -60.061 44.885 -18.323 1.00 34.65 ? 319 SER A N   1 
ATOM   183  C CA  . SER A 1 29  ? -60.786 46.026 -17.782 1.00 34.64 ? 319 SER A CA  1 
ATOM   184  C C   . SER A 1 29  ? -60.256 46.453 -16.396 1.00 34.56 ? 319 SER A C   1 
ATOM   185  O O   . SER A 1 29  ? -60.426 47.612 -15.999 1.00 34.32 ? 319 SER A O   1 
ATOM   186  C CB  . SER A 1 29  ? -62.285 45.710 -17.712 1.00 34.88 ? 319 SER A CB  1 
ATOM   187  N N   . TYR A 1 30  ? -59.595 45.527 -15.697 1.00 33.95 ? 320 TYR A N   1 
ATOM   188  C CA  . TYR A 1 30  ? -59.158 45.688 -14.295 1.00 33.68 ? 320 TYR A CA  1 
ATOM   189  C C   . TYR A 1 30  ? -57.623 45.688 -14.098 1.00 32.71 ? 320 TYR A C   1 
ATOM   190  O O   . TYR A 1 30  ? -57.104 46.281 -13.145 1.00 32.46 ? 320 TYR A O   1 
ATOM   191  C CB  . TYR A 1 30  ? -59.732 44.525 -13.463 1.00 33.39 ? 320 TYR A CB  1 
ATOM   192  N N   . LEU A 1 31  ? -56.916 45.013 -14.995 1.00 31.87 ? 321 LEU A N   1 
ATOM   193  C CA  . LEU A 1 31  ? -55.501 44.720 -14.817 1.00 31.72 ? 321 LEU A CA  1 
ATOM   194  C C   . LEU A 1 31  ? -54.721 45.366 -15.920 1.00 31.30 ? 321 LEU A C   1 
ATOM   195  O O   . LEU A 1 31  ? -55.171 45.385 -17.055 1.00 31.98 ? 321 LEU A O   1 
ATOM   196  C CB  . LEU A 1 31  ? -55.268 43.210 -14.901 1.00 31.66 ? 321 LEU A CB  1 
ATOM   197  C CG  . LEU A 1 31  ? -55.974 42.402 -13.816 1.00 32.62 ? 321 LEU A CG  1 
ATOM   198  C CD1 . LEU A 1 31  ? -55.713 40.952 -14.069 1.00 33.82 ? 321 LEU A CD1 1 
ATOM   199  C CD2 . LEU A 1 31  ? -55.535 42.816 -12.416 1.00 30.27 ? 321 LEU A CD2 1 
ATOM   200  N N   . ASP A 1 32  ? -53.543 45.871 -15.601 1.00 30.51 ? 322 ASP A N   1 
ATOM   201  C CA  . ASP A 1 32  ? -52.683 46.423 -16.626 1.00 30.72 ? 322 ASP A CA  1 
ATOM   202  C C   . ASP A 1 32  ? -51.206 46.155 -16.286 1.00 30.06 ? 322 ASP A C   1 
ATOM   203  O O   . ASP A 1 32  ? -50.895 45.452 -15.314 1.00 29.65 ? 322 ASP A O   1 
ATOM   204  C CB  . ASP A 1 32  ? -53.000 47.916 -16.844 1.00 31.07 ? 322 ASP A CB  1 
ATOM   205  C CG  . ASP A 1 32  ? -52.654 48.796 -15.642 1.00 33.04 ? 322 ASP A CG  1 
ATOM   206  O OD1 . ASP A 1 32  ? -52.354 48.271 -14.546 1.00 35.07 ? 322 ASP A OD1 1 
ATOM   207  O OD2 . ASP A 1 32  ? -52.672 50.045 -15.799 1.00 34.01 ? 322 ASP A OD2 1 
ATOM   208  N N   . ASN A 1 33  ? -50.301 46.687 -17.103 1.00 29.08 ? 323 ASN A N   1 
ATOM   209  C CA  . ASN A 1 33  ? -48.862 46.553 -16.857 1.00 28.78 ? 323 ASN A CA  1 
ATOM   210  C C   . ASN A 1 33  ? -48.409 45.102 -16.748 1.00 28.67 ? 323 ASN A C   1 
ATOM   211  O O   . ASN A 1 33  ? -47.771 44.690 -15.772 1.00 28.44 ? 323 ASN A O   1 
ATOM   212  C CB  . ASN A 1 33  ? -48.467 47.332 -15.601 1.00 29.22 ? 323 ASN A CB  1 
ATOM   213  C CG  . ASN A 1 33  ? -48.808 48.802 -15.705 1.00 29.13 ? 323 ASN A CG  1 
ATOM   214  O OD1 . ASN A 1 33  ? -48.252 49.517 -16.532 1.00 29.74 ? 323 ASN A OD1 1 
ATOM   215  N ND2 . ASN A 1 33  ? -49.735 49.258 -14.870 1.00 30.88 ? 323 ASN A ND2 1 
ATOM   216  N N   . PHE A 1 34  ? -48.766 44.313 -17.749 1.00 28.21 ? 324 PHE A N   1 
ATOM   217  C CA  . PHE A 1 34  ? -48.442 42.894 -17.733 1.00 27.57 ? 324 PHE A CA  1 
ATOM   218  C C   . PHE A 1 34  ? -46.959 42.698 -17.995 1.00 26.95 ? 324 PHE A C   1 
ATOM   219  O O   . PHE A 1 34  ? -46.391 43.349 -18.877 1.00 26.81 ? 324 PHE A O   1 
ATOM   220  C CB  . PHE A 1 34  ? -49.255 42.164 -18.787 1.00 28.63 ? 324 PHE A CB  1 
ATOM   221  C CG  . PHE A 1 34  ? -50.683 41.942 -18.389 1.00 28.62 ? 324 PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 34  ? -51.646 42.934 -18.585 1.00 30.97 ? 324 PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 34  ? -51.077 40.748 -17.839 1.00 30.55 ? 324 PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 34  ? -52.977 42.722 -18.203 1.00 29.95 ? 324 PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 34  ? -52.400 40.528 -17.470 1.00 29.42 ? 324 PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 34  ? -53.351 41.527 -17.656 1.00 31.08 ? 324 PHE A CZ  1 
ATOM   227  N N   . ILE A 1 35  ? -46.340 41.827 -17.204 1.00 25.80 ? 325 ILE A N   1 
ATOM   228  C CA  . ILE A 1 35  ? -44.928 41.490 -17.323 1.00 26.10 ? 325 ILE A CA  1 
ATOM   229  C C   . ILE A 1 35  ? -44.837 39.955 -17.269 1.00 25.62 ? 325 ILE A C   1 
ATOM   230  O O   . ILE A 1 35  ? -45.284 39.353 -16.289 1.00 26.30 ? 325 ILE A O   1 
ATOM   231  C CB  . ILE A 1 35  ? -44.122 42.071 -16.135 1.00 25.87 ? 325 ILE A CB  1 
ATOM   232  C CG1 . ILE A 1 35  ? -44.223 43.605 -16.097 1.00 26.96 ? 325 ILE A CG1 1 
ATOM   233  C CG2 . ILE A 1 35  ? -42.622 41.645 -16.203 1.00 27.12 ? 325 ILE A CG2 1 
ATOM   234  C CD1 . ILE A 1 35  ? -43.531 44.186 -14.892 1.00 26.56 ? 325 ILE A CD1 1 
ATOM   235  N N   . LYS A 1 36  ? -44.286 39.328 -18.315 1.00 25.24 ? 326 LYS A N   1 
ATOM   236  C CA  . LYS A 1 36  ? -44.099 37.865 -18.319 1.00 24.25 ? 326 LYS A CA  1 
ATOM   237  C C   . LYS A 1 36  ? -43.038 37.439 -17.314 1.00 24.63 ? 326 LYS A C   1 
ATOM   238  O O   . LYS A 1 36  ? -41.935 37.980 -17.300 1.00 23.65 ? 326 LYS A O   1 
ATOM   239  C CB  . LYS A 1 36  ? -43.680 37.370 -19.696 1.00 24.82 ? 326 LYS A CB  1 
ATOM   240  C CG  . LYS A 1 36  ? -43.755 35.862 -19.853 1.00 22.24 ? 326 LYS A CG  1 
ATOM   241  C CD  . LYS A 1 36  ? -43.159 35.416 -21.142 1.00 23.86 ? 326 LYS A CD  1 
ATOM   242  C CE  . LYS A 1 36  ? -43.312 33.921 -21.323 1.00 24.59 ? 326 LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 36  ? -42.447 33.439 -22.460 1.00 23.92 ? 326 LYS A NZ  1 
ATOM   244  N N   . ILE A 1 37  ? -43.366 36.475 -16.457 1.00 23.50 ? 327 ILE A N   1 
ATOM   245  C CA  . ILE A 1 37  ? -42.394 35.968 -15.536 1.00 23.33 ? 327 ILE A CA  1 
ATOM   246  C C   . ILE A 1 37  ? -41.989 34.516 -15.779 1.00 22.28 ? 327 ILE A C   1 
ATOM   247  O O   . ILE A 1 37  ? -40.947 34.078 -15.271 1.00 21.47 ? 327 ILE A O   1 
ATOM   248  C CB  . ILE A 1 37  ? -42.779 36.237 -14.047 1.00 24.06 ? 327 ILE A CB  1 
ATOM   249  C CG1 . ILE A 1 37  ? -43.973 35.416 -13.607 1.00 25.41 ? 327 ILE A CG1 1 
ATOM   250  C CG2 . ILE A 1 37  ? -42.985 37.735 -13.822 1.00 25.93 ? 327 ILE A CG2 1 
ATOM   251  C CD1 . ILE A 1 37  ? -44.172 35.348 -12.053 1.00 25.15 ? 327 ILE A CD1 1 
ATOM   252  N N   . GLY A 1 38  ? -42.743 33.776 -16.586 1.00 21.39 ? 328 GLY A N   1 
ATOM   253  C CA  . GLY A 1 38  ? -42.411 32.393 -16.787 1.00 22.18 ? 328 GLY A CA  1 
ATOM   254  C C   . GLY A 1 38  ? -43.246 31.630 -17.781 1.00 24.53 ? 328 GLY A C   1 
ATOM   255  O O   . GLY A 1 38  ? -44.370 31.988 -18.099 1.00 23.04 ? 328 GLY A O   1 
ATOM   256  N N   . GLU A 1 39  ? -42.633 30.559 -18.265 1.00 27.91 ? 329 GLU A N   1 
ATOM   257  C CA  . GLU A 1 39  ? -43.299 29.482 -18.965 1.00 31.20 ? 329 GLU A CA  1 
ATOM   258  C C   . GLU A 1 39  ? -43.765 28.483 -17.880 1.00 32.19 ? 329 GLU A C   1 
ATOM   259  O O   . GLU A 1 39  ? -42.954 27.995 -17.075 1.00 33.42 ? 329 GLU A O   1 
ATOM   260  C CB  . GLU A 1 39  ? -42.284 28.839 -19.931 1.00 32.04 ? 329 GLU A CB  1 
ATOM   261  C CG  . GLU A 1 39  ? -41.938 29.744 -21.156 1.00 35.13 ? 329 GLU A CG  1 
ATOM   262  C CD  . GLU A 1 39  ? -43.123 29.927 -22.100 1.00 38.35 ? 329 GLU A CD  1 
ATOM   263  O OE1 . GLU A 1 39  ? -43.916 28.975 -22.238 1.00 41.95 ? 329 GLU A OE1 1 
ATOM   264  O OE2 . GLU A 1 39  ? -43.287 31.009 -22.707 1.00 40.80 ? 329 GLU A OE2 1 
ATOM   265  N N   . GLY A 1 40  ? -45.062 28.218 -17.809 1.00 33.63 ? 330 GLY A N   1 
ATOM   266  C CA  . GLY A 1 40  ? -45.606 27.278 -16.819 1.00 33.72 ? 330 GLY A CA  1 
ATOM   267  C C   . GLY A 1 40  ? -45.837 25.849 -17.314 1.00 34.87 ? 330 GLY A C   1 
ATOM   268  O O   . GLY A 1 40  ? -45.241 25.406 -18.311 1.00 35.50 ? 330 GLY A O   1 
ATOM   269  N N   . SER A 1 41  ? -46.732 25.150 -16.609 1.00 34.88 ? 331 SER A N   1 
ATOM   270  C CA  . SER A 1 41  ? -47.015 23.725 -16.807 1.00 35.00 ? 331 SER A CA  1 
ATOM   271  C C   . SER A 1 41  ? -48.124 23.499 -17.852 1.00 34.20 ? 331 SER A C   1 
ATOM   272  O O   . SER A 1 41  ? -48.185 22.436 -18.492 1.00 35.28 ? 331 SER A O   1 
ATOM   273  C CB  . SER A 1 41  ? -47.327 23.052 -15.440 1.00 35.33 ? 331 SER A CB  1 
ATOM   274  O OG  . SER A 1 41  ? -48.401 22.115 -15.470 1.00 37.03 ? 331 SER A OG  1 
ATOM   275  N N   . THR A 1 42  ? -48.997 24.480 -18.033 1.00 33.52 ? 332 THR A N   1 
ATOM   276  C CA  . THR A 1 42  ? -49.982 24.430 -19.113 1.00 31.49 ? 332 THR A CA  1 
ATOM   277  C C   . THR A 1 42  ? -50.105 25.797 -19.839 1.00 30.40 ? 332 THR A C   1 
ATOM   278  O O   . THR A 1 42  ? -51.094 26.031 -20.558 1.00 28.53 ? 332 THR A O   1 
ATOM   279  C CB  . THR A 1 42  ? -51.379 23.866 -18.617 1.00 32.34 ? 332 THR A CB  1 
ATOM   280  O OG1 . THR A 1 42  ? -51.808 24.514 -17.411 1.00 34.97 ? 332 THR A OG1 1 
ATOM   281  C CG2 . THR A 1 42  ? -51.300 22.369 -18.353 1.00 34.03 ? 332 THR A CG2 1 
ATOM   282  N N   . GLY A 1 43  ? -49.100 26.669 -19.716 1.00 28.52 ? 333 GLY A N   1 
ATOM   283  C CA  . GLY A 1 43  ? -49.209 28.048 -20.244 1.00 28.64 ? 333 GLY A CA  1 
ATOM   284  C C   . GLY A 1 43  ? -48.108 29.010 -19.811 1.00 27.53 ? 333 GLY A C   1 
ATOM   285  O O   . GLY A 1 43  ? -46.980 28.591 -19.522 1.00 28.81 ? 333 GLY A O   1 
ATOM   286  N N   . ILE A 1 44  ? -48.420 30.305 -19.801 1.00 25.76 ? 334 ILE A N   1 
ATOM   287  C CA  . ILE A 1 44  ? -47.475 31.307 -19.345 1.00 25.34 ? 334 ILE A CA  1 
ATOM   288  C C   . ILE A 1 44  ? -47.972 31.924 -18.038 1.00 23.42 ? 334 ILE A C   1 
ATOM   289  O O   . ILE A 1 44  ? -49.143 31.824 -17.701 1.00 23.57 ? 334 ILE A O   1 
ATOM   290  C CB  . ILE A 1 44  ? -47.160 32.416 -20.418 1.00 24.86 ? 334 ILE A CB  1 
ATOM   291  C CG1 . ILE A 1 44  ? -48.370 33.294 -20.689 1.00 24.55 ? 334 ILE A CG1 1 
ATOM   292  C CG2 . ILE A 1 44  ? -46.632 31.799 -21.726 1.00 27.19 ? 334 ILE A CG2 1 
ATOM   293  C CD1 . ILE A 1 44  ? -48.052 34.551 -21.515 1.00 26.13 ? 334 ILE A CD1 1 
ATOM   294  N N   . VAL A 1 45  ? -47.055 32.549 -17.297 1.00 22.12 ? 335 VAL A N   1 
ATOM   295  C CA  . VAL A 1 45  ? -47.389 33.264 -16.073 1.00 21.81 ? 335 VAL A CA  1 
ATOM   296  C C   . VAL A 1 45  ? -46.834 34.683 -16.163 1.00 20.47 ? 335 VAL A C   1 
ATOM   297  O O   . VAL A 1 45  ? -45.700 34.878 -16.601 1.00 18.01 ? 335 VAL A O   1 
ATOM   298  C CB  . VAL A 1 45  ? -46.765 32.571 -14.861 1.00 22.78 ? 335 VAL A CB  1 
ATOM   299  C CG1 . VAL A 1 45  ? -47.129 33.314 -13.582 1.00 23.47 ? 335 VAL A CG1 1 
ATOM   300  C CG2 . VAL A 1 45  ? -47.239 31.075 -14.828 1.00 26.36 ? 335 VAL A CG2 1 
ATOM   301  N N   . CYS A 1 46  ? -47.659 35.648 -15.794 1.00 20.73 ? 336 CYS A N   1 
ATOM   302  C CA  . CYS A 1 46  ? -47.309 37.043 -15.796 1.00 22.23 ? 336 CYS A CA  1 
ATOM   303  C C   . CYS A 1 46  ? -47.582 37.597 -14.400 1.00 21.64 ? 336 CYS A C   1 
ATOM   304  O O   . CYS A 1 46  ? -48.263 36.959 -13.568 1.00 22.43 ? 336 CYS A O   1 
ATOM   305  C CB  . CYS A 1 46  ? -48.160 37.800 -16.800 1.00 22.71 ? 336 CYS A CB  1 
ATOM   306  S SG  . CYS A 1 46  ? -47.954 37.233 -18.480 1.00 31.98 ? 336 CYS A SG  1 
ATOM   307  N N   . ILE A 1 47  ? -47.049 38.781 -14.152 1.00 21.11 ? 337 ILE A N   1 
ATOM   308  C CA  . ILE A 1 47  ? -47.547 39.633 -13.097 1.00 21.62 ? 337 ILE A CA  1 
ATOM   309  C C   . ILE A 1 47  ? -48.267 40.804 -13.765 1.00 20.86 ? 337 ILE A C   1 
ATOM   310  O O   . ILE A 1 47  ? -48.037 41.094 -14.943 1.00 21.00 ? 337 ILE A O   1 
ATOM   311  C CB  . ILE A 1 47  ? -46.438 40.069 -12.122 1.00 22.21 ? 337 ILE A CB  1 
ATOM   312  C CG1 . ILE A 1 47  ? -45.356 40.858 -12.851 1.00 22.43 ? 337 ILE A CG1 1 
ATOM   313  C CG2 . ILE A 1 47  ? -45.878 38.804 -11.386 1.00 24.02 ? 337 ILE A CG2 1 
ATOM   314  C CD1 . ILE A 1 47  ? -44.189 41.408 -11.980 1.00 23.40 ? 337 ILE A CD1 1 
ATOM   315  N N   . ALA A 1 48  ? -49.209 41.392 -13.037 1.00 20.19 ? 338 ALA A N   1 
ATOM   316  C CA  . ALA A 1 48  ? -49.992 42.536 -13.496 1.00 20.55 ? 338 ALA A CA  1 
ATOM   317  C C   . ALA A 1 48  ? -50.329 43.381 -12.287 1.00 20.97 ? 338 ALA A C   1 
ATOM   318  O O   . ALA A 1 48  ? -50.298 42.899 -11.174 1.00 20.12 ? 338 ALA A O   1 
ATOM   319  C CB  . ALA A 1 48  ? -51.283 42.061 -14.205 1.00 20.86 ? 338 ALA A CB  1 
ATOM   320  N N   . THR A 1 49  ? -50.656 44.649 -12.500 1.00 21.85 ? 339 THR A N   1 
ATOM   321  C CA  . THR A 1 49  ? -51.096 45.497 -11.408 1.00 22.90 ? 339 THR A CA  1 
ATOM   322  C C   . THR A 1 49  ? -52.614 45.646 -11.524 1.00 22.85 ? 339 THR A C   1 
ATOM   323  O O   . THR A 1 49  ? -53.175 45.737 -12.628 1.00 22.85 ? 339 THR A O   1 
ATOM   324  C CB  . THR A 1 49  ? -50.407 46.857 -11.430 1.00 22.44 ? 339 THR A CB  1 
ATOM   325  O OG1 . THR A 1 49  ? -50.518 47.398 -12.733 1.00 26.49 ? 339 THR A OG1 1 
ATOM   326  C CG2 . THR A 1 49  ? -48.943 46.729 -11.112 1.00 24.40 ? 339 THR A CG2 1 
ATOM   327  N N   . VAL A 1 50  ? -53.284 45.641 -10.385 1.00 24.15 ? 340 VAL A N   1 
ATOM   328  C CA  . VAL A 1 50  ? -54.722 45.830 -10.361 1.00 24.89 ? 340 VAL A CA  1 
ATOM   329  C C   . VAL A 1 50  ? -54.910 47.348 -10.421 1.00 25.49 ? 340 VAL A C   1 
ATOM   330  O O   . VAL A 1 50  ? -54.248 48.079 -9.690  1.00 25.15 ? 340 VAL A O   1 
ATOM   331  C CB  . VAL A 1 50  ? -55.338 45.209 -9.104  1.00 25.44 ? 340 VAL A CB  1 
ATOM   332  C CG1 . VAL A 1 50  ? -56.860 45.435 -9.070  1.00 27.36 ? 340 VAL A CG1 1 
ATOM   333  C CG2 . VAL A 1 50  ? -54.965 43.726 -9.023  1.00 26.12 ? 340 VAL A CG2 1 
ATOM   334  N N   . ARG A 1 51  ? -55.746 47.813 -11.342 1.00 26.10 ? 341 ARG A N   1 
ATOM   335  C CA  . ARG A 1 51  ? -55.797 49.238 -11.662 1.00 27.29 ? 341 ARG A CA  1 
ATOM   336  C C   . ARG A 1 51  ? -55.999 50.096 -10.417 1.00 27.66 ? 341 ARG A C   1 
ATOM   337  O O   . ARG A 1 51  ? -55.260 51.065 -10.181 1.00 28.41 ? 341 ARG A O   1 
ATOM   338  C CB  . ARG A 1 51  ? -56.906 49.516 -12.677 1.00 27.36 ? 341 ARG A CB  1 
ATOM   339  N N   . SER A 1 52  ? -56.996 49.715 -9.622  1.00 28.35 ? 342 SER A N   1 
ATOM   340  C CA  . SER A 1 52  ? -57.487 50.526 -8.506  1.00 28.27 ? 342 SER A CA  1 
ATOM   341  C C   . SER A 1 52  ? -56.550 50.652 -7.290  1.00 28.33 ? 342 SER A C   1 
ATOM   342  O O   . SER A 1 52  ? -56.611 51.663 -6.566  1.00 28.62 ? 342 SER A O   1 
ATOM   343  C CB  . SER A 1 52  ? -58.819 49.957 -8.034  1.00 28.35 ? 342 SER A CB  1 
ATOM   344  O OG  . SER A 1 52  ? -58.657 48.607 -7.641  1.00 30.39 ? 342 SER A OG  1 
ATOM   345  N N   . SER A 1 53  ? -55.707 49.643 -7.062  1.00 28.11 ? 343 SER A N   1 
ATOM   346  C CA  . SER A 1 53  ? -54.859 49.583 -5.866  1.00 27.58 ? 343 SER A CA  1 
ATOM   347  C C   . SER A 1 53  ? -53.370 49.732 -6.167  1.00 27.48 ? 343 SER A C   1 
ATOM   348  O O   . SER A 1 53  ? -52.579 50.109 -5.278  1.00 26.99 ? 343 SER A O   1 
ATOM   349  C CB  . SER A 1 53  ? -55.079 48.244 -5.161  1.00 28.15 ? 343 SER A CB  1 
ATOM   350  O OG  . SER A 1 53  ? -54.695 47.156 -6.004  1.00 28.23 ? 343 SER A OG  1 
ATOM   351  N N   . GLY A 1 54  ? -52.983 49.395 -7.399  1.00 26.78 ? 344 GLY A N   1 
ATOM   352  C CA  . GLY A 1 54  ? -51.568 49.294 -7.761  1.00 26.83 ? 344 GLY A CA  1 
ATOM   353  C C   . GLY A 1 54  ? -50.898 48.075 -7.150  1.00 26.33 ? 344 GLY A C   1 
ATOM   354  O O   . GLY A 1 54  ? -49.654 47.990 -7.118  1.00 26.79 ? 344 GLY A O   1 
ATOM   355  N N   . LYS A 1 55  ? -51.707 47.123 -6.681  1.00 25.89 ? 345 LYS A N   1 
ATOM   356  C CA  . LYS A 1 55  ? -51.187 45.893 -6.084  1.00 25.62 ? 345 LYS A CA  1 
ATOM   357  C C   . LYS A 1 55  ? -50.891 44.873 -7.177  1.00 24.64 ? 345 LYS A C   1 
ATOM   358  O O   . LYS A 1 55  ? -51.658 44.747 -8.135  1.00 24.44 ? 345 LYS A O   1 
ATOM   359  C CB  . LYS A 1 55  ? -52.183 45.302 -5.084  1.00 25.64 ? 345 LYS A CB  1 
ATOM   360  N N   . LEU A 1 56  ? -49.771 44.161 -7.041  1.00 24.73 ? 346 LEU A N   1 
ATOM   361  C CA  . LEU A 1 56  ? -49.420 43.118 -7.986  1.00 24.33 ? 346 LEU A CA  1 
ATOM   362  C C   . LEU A 1 56  ? -50.267 41.884 -7.743  1.00 23.44 ? 346 LEU A C   1 
ATOM   363  O O   . LEU A 1 56  ? -50.595 41.544 -6.607  1.00 23.47 ? 346 LEU A O   1 
ATOM   364  C CB  . LEU A 1 56  ? -47.938 42.690 -7.869  1.00 25.44 ? 346 LEU A CB  1 
ATOM   365  C CG  . LEU A 1 56  ? -46.850 43.448 -8.619  1.00 27.64 ? 346 LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 56  ? -45.487 42.900 -8.165  1.00 28.94 ? 346 LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 56  ? -47.014 43.353 -10.140 1.00 29.19 ? 346 LEU A CD2 1 
ATOM   368  N N   . VAL A 1 57  ? -50.585 41.204 -8.839  1.00 21.72 ? 347 VAL A N   1 
ATOM   369  C CA  . VAL A 1 57  ? -51.185 39.873 -8.835  1.00 20.70 ? 347 VAL A CA  1 
ATOM   370  C C   . VAL A 1 57  ? -50.420 39.038 -9.829  1.00 19.57 ? 347 VAL A C   1 
ATOM   371  O O   . VAL A 1 57  ? -49.696 39.606 -10.643 1.00 20.15 ? 347 VAL A O   1 
ATOM   372  C CB  . VAL A 1 57  ? -52.679 39.915 -9.231  1.00 20.78 ? 347 VAL A CB  1 
ATOM   373  C CG1 . VAL A 1 57  ? -53.457 40.568 -8.094  1.00 21.14 ? 347 VAL A CG1 1 
ATOM   374  C CG2 . VAL A 1 57  ? -52.894 40.685 -10.567 1.00 19.98 ? 347 VAL A CG2 1 
ATOM   375  N N   . ALA A 1 58  ? -50.538 37.715 -9.753  1.00 19.06 ? 348 ALA A N   1 
ATOM   376  C CA  . ALA A 1 58  ? -49.981 36.809 -10.752 1.00 19.17 ? 348 ALA A CA  1 
ATOM   377  C C   . ALA A 1 58  ? -51.150 36.372 -11.623 1.00 20.91 ? 348 ALA A C   1 
ATOM   378  O O   . ALA A 1 58  ? -52.292 36.268 -11.127 1.00 21.44 ? 348 ALA A O   1 
ATOM   379  C CB  . ALA A 1 58  ? -49.366 35.591 -10.086 1.00 20.17 ? 348 ALA A CB  1 
ATOM   380  N N   . VAL A 1 59  ? -50.906 36.207 -12.910 1.00 20.60 ? 349 VAL A N   1 
ATOM   381  C CA  . VAL A 1 59  ? -51.954 35.799 -13.857 1.00 20.80 ? 349 VAL A CA  1 
ATOM   382  C C   . VAL A 1 59  ? -51.394 34.676 -14.713 1.00 21.83 ? 349 VAL A C   1 
ATOM   383  O O   . VAL A 1 59  ? -50.398 34.837 -15.428 1.00 22.84 ? 349 VAL A O   1 
ATOM   384  C CB  . VAL A 1 59  ? -52.409 36.924 -14.812 1.00 21.38 ? 349 VAL A CB  1 
ATOM   385  C CG1 . VAL A 1 59  ? -53.563 36.425 -15.664 1.00 21.66 ? 349 VAL A CG1 1 
ATOM   386  C CG2 . VAL A 1 59  ? -52.804 38.175 -14.033 1.00 18.58 ? 349 VAL A CG2 1 
ATOM   387  N N   . LYS A 1 60  ? -52.036 33.523 -14.632 1.00 22.33 ? 350 LYS A N   1 
ATOM   388  C CA  . LYS A 1 60  ? -51.668 32.390 -15.477 1.00 23.28 ? 350 LYS A CA  1 
ATOM   389  C C   . LYS A 1 60  ? -52.610 32.362 -16.668 1.00 22.43 ? 350 LYS A C   1 
ATOM   390  O O   . LYS A 1 60  ? -53.826 32.473 -16.487 1.00 22.57 ? 350 LYS A O   1 
ATOM   391  C CB  . LYS A 1 60  ? -51.759 31.070 -14.707 1.00 23.18 ? 350 LYS A CB  1 
ATOM   392  C CG  . LYS A 1 60  ? -51.059 31.046 -13.423 1.00 29.10 ? 350 LYS A CG  1 
ATOM   393  C CD  . LYS A 1 60  ? -51.524 29.800 -12.584 1.00 31.06 ? 350 LYS A CD  1 
ATOM   394  C CE  . LYS A 1 60  ? -50.810 28.541 -12.989 1.00 36.74 ? 350 LYS A CE  1 
ATOM   395  N NZ  . LYS A 1 60  ? -50.933 27.451 -11.955 1.00 36.54 ? 350 LYS A NZ  1 
ATOM   396  N N   . LYS A 1 61  ? -52.045 32.224 -17.856 1.00 21.29 ? 351 LYS A N   1 
ATOM   397  C CA  . LYS A 1 61  ? -52.782 32.197 -19.096 1.00 22.45 ? 351 LYS A CA  1 
ATOM   398  C C   . LYS A 1 61  ? -52.560 30.871 -19.814 1.00 23.08 ? 351 LYS A C   1 
ATOM   399  O O   . LYS A 1 61  ? -51.426 30.498 -20.104 1.00 22.29 ? 351 LYS A O   1 
ATOM   400  C CB  . LYS A 1 61  ? -52.344 33.341 -19.981 1.00 22.32 ? 351 LYS A CB  1 
ATOM   401  C CG  . LYS A 1 61  ? -52.387 34.674 -19.267 1.00 24.27 ? 351 LYS A CG  1 
ATOM   402  C CD  . LYS A 1 61  ? -51.997 35.820 -20.161 1.00 26.85 ? 351 LYS A CD  1 
ATOM   403  C CE  . LYS A 1 61  ? -51.753 37.053 -19.323 1.00 31.69 ? 351 LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 61  ? -50.765 36.742 -18.222 1.00 36.70 ? 351 LYS A NZ  1 
ATOM   405  N N   . MET A 1 62  ? -53.661 30.155 -20.065 1.00 23.13 ? 352 MET A N   1 
ATOM   406  C CA  A MET A 1 62  ? -53.625 28.847 -20.715 0.50 24.84 ? 352 MET A CA  1 
ATOM   407  C CA  B MET A 1 62  ? -53.603 28.866 -20.731 0.50 24.38 ? 352 MET A CA  1 
ATOM   408  C C   . MET A 1 62  ? -54.534 28.801 -21.941 1.00 24.63 ? 352 MET A C   1 
ATOM   409  O O   . MET A 1 62  ? -55.735 29.134 -21.861 1.00 23.92 ? 352 MET A O   1 
ATOM   410  C CB  A MET A 1 62  ? -54.041 27.759 -19.722 0.50 24.86 ? 352 MET A CB  1 
ATOM   411  C CB  B MET A 1 62  ? -53.905 27.754 -19.726 0.50 24.99 ? 352 MET A CB  1 
ATOM   412  C CG  A MET A 1 62  ? -53.075 27.571 -18.539 0.50 27.12 ? 352 MET A CG  1 
ATOM   413  C CG  B MET A 1 62  ? -53.066 27.867 -18.439 0.50 28.39 ? 352 MET A CG  1 
ATOM   414  S SD  A MET A 1 62  ? -53.860 26.819 -17.083 0.50 29.05 ? 352 MET A SD  1 
ATOM   415  S SD  B MET A 1 62  ? -53.806 28.968 -17.203 0.50 33.85 ? 352 MET A SD  1 
ATOM   416  C CE  A MET A 1 62  ? -54.963 28.154 -16.610 0.50 26.02 ? 352 MET A CE  1 
ATOM   417  C CE  B MET A 1 62  ? -54.304 27.811 -15.918 0.50 32.03 ? 352 MET A CE  1 
ATOM   418  N N   . ASP A 1 63  ? -53.977 28.380 -23.070 1.00 23.48 ? 353 ASP A N   1 
ATOM   419  C CA  . ASP A 1 63  ? -54.746 28.249 -24.276 1.00 24.28 ? 353 ASP A CA  1 
ATOM   420  C C   . ASP A 1 63  ? -55.533 26.941 -24.292 1.00 23.58 ? 353 ASP A C   1 
ATOM   421  O O   . ASP A 1 63  ? -54.960 25.848 -24.244 1.00 22.85 ? 353 ASP A O   1 
ATOM   422  C CB  . ASP A 1 63  ? -53.840 28.323 -25.490 1.00 24.50 ? 353 ASP A CB  1 
ATOM   423  C CG  . ASP A 1 63  ? -54.613 28.598 -26.771 1.00 27.23 ? 353 ASP A CG  1 
ATOM   424  O OD1 . ASP A 1 63  ? -55.646 27.906 -27.075 1.00 26.73 ? 353 ASP A OD1 1 
ATOM   425  O OD2 . ASP A 1 63  ? -54.170 29.537 -27.500 1.00 31.40 ? 353 ASP A OD2 1 
ATOM   426  N N   . LEU A 1 64  ? -56.856 27.060 -24.352 1.00 23.51 ? 354 LEU A N   1 
ATOM   427  C CA  . LEU A 1 64  ? -57.737 25.910 -24.363 1.00 25.13 ? 354 LEU A CA  1 
ATOM   428  C C   . LEU A 1 64  ? -57.444 24.891 -25.459 1.00 25.39 ? 354 LEU A C   1 
ATOM   429  O O   . LEU A 1 64  ? -57.685 23.700 -25.291 1.00 26.83 ? 354 LEU A O   1 
ATOM   430  C CB  . LEU A 1 64  ? -59.169 26.396 -24.557 1.00 25.58 ? 354 LEU A CB  1 
ATOM   431  C CG  . LEU A 1 64  ? -59.994 26.679 -23.317 1.00 29.55 ? 354 LEU A CG  1 
ATOM   432  C CD1 . LEU A 1 64  ? -59.311 27.579 -22.335 1.00 29.56 ? 354 LEU A CD1 1 
ATOM   433  C CD2 . LEU A 1 64  ? -61.384 27.229 -23.786 1.00 26.35 ? 354 LEU A CD2 1 
ATOM   434  N N   . ARG A 1 65  ? -56.948 25.370 -26.588 1.00 24.82 ? 355 ARG A N   1 
ATOM   435  C CA  . ARG A 1 65  ? -56.729 24.557 -27.769 1.00 26.26 ? 355 ARG A CA  1 
ATOM   436  C C   . ARG A 1 65  ? -55.380 23.853 -27.772 1.00 26.25 ? 355 ARG A C   1 
ATOM   437  O O   . ARG A 1 65  ? -55.085 23.049 -28.660 1.00 27.81 ? 355 ARG A O   1 
ATOM   438  C CB  . ARG A 1 65  ? -56.805 25.473 -28.999 1.00 26.11 ? 355 ARG A CB  1 
ATOM   439  C CG  . ARG A 1 65  ? -58.096 26.296 -29.064 1.00 27.57 ? 355 ARG A CG  1 
ATOM   440  C CD  . ARG A 1 65  ? -57.981 27.465 -30.034 1.00 29.91 ? 355 ARG A CD  1 
ATOM   441  N NE  . ARG A 1 65  ? -56.909 28.395 -29.654 1.00 32.04 ? 355 ARG A NE  1 
ATOM   442  C CZ  . ARG A 1 65  ? -56.431 29.362 -30.442 1.00 33.95 ? 355 ARG A CZ  1 
ATOM   443  N NH1 . ARG A 1 65  ? -56.922 29.569 -31.659 1.00 33.34 ? 355 ARG A NH1 1 
ATOM   444  N NH2 . ARG A 1 65  ? -55.459 30.153 -30.001 1.00 35.14 ? 355 ARG A NH2 1 
ATOM   445  N N   . LYS A 1 66  ? -54.523 24.189 -26.833 1.00 25.70 ? 356 LYS A N   1 
ATOM   446  C CA  . LYS A 1 66  ? -53.173 23.595 -26.826 1.00 27.67 ? 356 LYS A CA  1 
ATOM   447  C C   . LYS A 1 66  ? -52.924 22.748 -25.588 1.00 27.51 ? 356 LYS A C   1 
ATOM   448  O O   . LYS A 1 66  ? -51.797 22.654 -25.117 1.00 30.10 ? 356 LYS A O   1 
ATOM   449  C CB  . LYS A 1 66  ? -52.131 24.713 -26.987 1.00 27.88 ? 356 LYS A CB  1 
ATOM   450  C CG  . LYS A 1 66  ? -52.168 25.262 -28.418 1.00 29.30 ? 356 LYS A CG  1 
ATOM   451  C CD  . LYS A 1 66  ? -51.210 26.438 -28.662 1.00 29.60 ? 356 LYS A CD  1 
ATOM   452  C CE  . LYS A 1 66  ? -51.296 26.909 -30.101 1.00 30.65 ? 356 LYS A CE  1 
ATOM   453  N NZ  . LYS A 1 66  ? -51.060 25.819 -31.054 1.00 29.56 ? 356 LYS A NZ  1 
ATOM   454  N N   . GLN A 1 67  ? -53.973 22.131 -25.055 1.00 27.51 ? 357 GLN A N   1 
ATOM   455  C CA  . GLN A 1 67  ? -53.851 21.288 -23.847 1.00 27.04 ? 357 GLN A CA  1 
ATOM   456  C C   . GLN A 1 67  ? -54.055 19.826 -24.193 1.00 28.17 ? 357 GLN A C   1 
ATOM   457  O O   . GLN A 1 67  ? -55.062 19.497 -24.852 1.00 28.81 ? 357 GLN A O   1 
ATOM   458  C CB  . GLN A 1 67  ? -54.929 21.678 -22.842 1.00 27.04 ? 357 GLN A CB  1 
ATOM   459  C CG  . GLN A 1 67  ? -54.920 23.111 -22.477 1.00 26.72 ? 357 GLN A CG  1 
ATOM   460  C CD  . GLN A 1 67  ? -53.569 23.572 -21.916 1.00 25.12 ? 357 GLN A CD  1 
ATOM   461  O OE1 . GLN A 1 67  ? -52.872 22.824 -21.212 1.00 31.09 ? 357 GLN A OE1 1 
ATOM   462  N NE2 . GLN A 1 67  ? -53.212 24.807 -22.204 1.00 23.27 ? 357 GLN A NE2 1 
ATOM   463  N N   . GLN A 1 68  ? -53.152 18.925 -23.717 1.00 20.00 ? 358 GLN A N   1 
ATOM   464  C CA  . GLN A 1 68  ? -53.317 17.490 -23.908 1.00 20.00 ? 358 GLN A CA  1 
ATOM   465  C C   . GLN A 1 68  ? -54.521 16.965 -23.135 1.00 20.00 ? 358 GLN A C   1 
ATOM   466  O O   . GLN A 1 68  ? -55.249 16.083 -23.573 1.00 30.38 ? 358 GLN A O   1 
ATOM   467  C CB  . GLN A 1 68  ? -52.051 16.744 -23.482 1.00 20.00 ? 358 GLN A CB  1 
ATOM   468  N N   . ARG A 1 69  ? -54.770 17.550 -21.953 1.00 27.04 ? 359 ARG A N   1 
ATOM   469  C CA  . ARG A 1 69  ? -55.869 17.138 -21.097 1.00 26.23 ? 359 ARG A CA  1 
ATOM   470  C C   . ARG A 1 69  ? -56.588 18.419 -20.661 1.00 25.23 ? 359 ARG A C   1 
ATOM   471  O O   . ARG A 1 69  ? -56.225 19.037 -19.666 1.00 24.89 ? 359 ARG A O   1 
ATOM   472  C CB  . ARG A 1 69  ? -55.302 16.356 -19.889 1.00 25.17 ? 359 ARG A CB  1 
ATOM   473  C CG  . ARG A 1 69  ? -56.342 15.641 -19.047 1.00 24.77 ? 359 ARG A CG  1 
ATOM   474  C CD  . ARG A 1 69  ? -56.964 14.514 -19.837 1.00 23.45 ? 359 ARG A CD  1 
ATOM   475  N NE  . ARG A 1 69  ? -57.532 13.470 -18.998 1.00 23.79 ? 359 ARG A NE  1 
ATOM   476  C CZ  . ARG A 1 69  ? -58.830 13.253 -18.809 1.00 26.24 ? 359 ARG A CZ  1 
ATOM   477  N NH1 . ARG A 1 69  ? -59.759 13.999 -19.412 1.00 26.26 ? 359 ARG A NH1 1 
ATOM   478  N NH2 . ARG A 1 69  ? -59.209 12.246 -18.036 1.00 26.14 ? 359 ARG A NH2 1 
ATOM   479  N N   . ARG A 1 70  ? -57.603 18.826 -21.421 1.00 24.84 ? 360 ARG A N   1 
ATOM   480  C CA  . ARG A 1 70  ? -58.268 20.097 -21.151 1.00 24.88 ? 360 ARG A CA  1 
ATOM   481  C C   . ARG A 1 70  ? -58.945 20.093 -19.799 1.00 24.25 ? 360 ARG A C   1 
ATOM   482  O O   . ARG A 1 70  ? -59.031 21.128 -19.148 1.00 25.04 ? 360 ARG A O   1 
ATOM   483  C CB  . ARG A 1 70  ? -59.305 20.441 -22.219 1.00 25.66 ? 360 ARG A CB  1 
ATOM   484  C CG  . ARG A 1 70  ? -58.758 20.606 -23.577 1.00 25.59 ? 360 ARG A CG  1 
ATOM   485  C CD  . ARG A 1 70  ? -59.879 20.619 -24.581 1.00 25.46 ? 360 ARG A CD  1 
ATOM   486  N NE  . ARG A 1 70  ? -60.639 19.360 -24.548 1.00 24.96 ? 360 ARG A NE  1 
ATOM   487  C CZ  . ARG A 1 70  ? -61.659 19.048 -25.346 1.00 26.87 ? 360 ARG A CZ  1 
ATOM   488  N NH1 . ARG A 1 70  ? -62.034 19.852 -26.320 1.00 27.86 ? 360 ARG A NH1 1 
ATOM   489  N NH2 . ARG A 1 70  ? -62.268 17.881 -25.203 1.00 26.48 ? 360 ARG A NH2 1 
ATOM   490  N N   . GLU A 1 71  ? -59.467 18.930 -19.409 1.00 23.98 ? 361 GLU A N   1 
ATOM   491  C CA  . GLU A 1 71  ? -60.135 18.750 -18.122 1.00 24.47 ? 361 GLU A CA  1 
ATOM   492  C C   . GLU A 1 71  ? -59.298 19.326 -16.992 1.00 23.80 ? 361 GLU A C   1 
ATOM   493  O O   . GLU A 1 71  ? -59.827 19.742 -15.962 1.00 22.46 ? 361 GLU A O   1 
ATOM   494  C CB  . GLU A 1 71  ? -60.403 17.262 -17.856 1.00 23.86 ? 361 GLU A CB  1 
ATOM   495  N N   . LEU A 1 72  ? -57.979 19.317 -17.149 1.00 23.55 ? 362 LEU A N   1 
ATOM   496  C CA  . LEU A 1 72  ? -57.117 19.853 -16.104 1.00 23.39 ? 362 LEU A CA  1 
ATOM   497  C C   . LEU A 1 72  ? -57.363 21.336 -15.852 1.00 23.06 ? 362 LEU A C   1 
ATOM   498  O O   . LEU A 1 72  ? -57.138 21.837 -14.739 1.00 23.30 ? 362 LEU A O   1 
ATOM   499  C CB  . LEU A 1 72  ? -55.661 19.660 -16.466 1.00 22.76 ? 362 LEU A CB  1 
ATOM   500  C CG  . LEU A 1 72  ? -55.117 18.247 -16.405 1.00 22.88 ? 362 LEU A CG  1 
ATOM   501  C CD1 . LEU A 1 72  ? -53.702 18.218 -16.918 1.00 21.53 ? 362 LEU A CD1 1 
ATOM   502  C CD2 . LEU A 1 72  ? -55.161 17.718 -14.960 1.00 25.12 ? 362 LEU A CD2 1 
ATOM   503  N N   . LEU A 1 73  ? -57.772 22.059 -16.888 1.00 24.95 ? 363 LEU A N   1 
ATOM   504  C CA  . LEU A 1 73  ? -58.055 23.499 -16.726 1.00 25.01 ? 363 LEU A CA  1 
ATOM   505  C C   . LEU A 1 73  ? -59.247 23.676 -15.805 1.00 24.98 ? 363 LEU A C   1 
ATOM   506  O O   . LEU A 1 73  ? -59.247 24.520 -14.913 1.00 25.17 ? 363 LEU A O   1 
ATOM   507  C CB  . LEU A 1 73  ? -58.294 24.204 -18.066 1.00 24.90 ? 363 LEU A CB  1 
ATOM   508  C CG  . LEU A 1 73  ? -57.179 24.230 -19.114 1.00 28.02 ? 363 LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 73  ? -57.603 24.895 -20.472 1.00 28.68 ? 363 LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 73  ? -55.997 24.862 -18.607 1.00 30.16 ? 363 LEU A CD2 1 
ATOM   511  N N   . PHE A 1 74  ? -60.257 22.854 -16.046 1.00 25.17 ? 364 PHE A N   1 
ATOM   512  C CA  . PHE A 1 74  ? -61.477 22.834 -15.282 1.00 24.73 ? 364 PHE A CA  1 
ATOM   513  C C   . PHE A 1 74  ? -61.177 22.434 -13.824 1.00 24.03 ? 364 PHE A C   1 
ATOM   514  O O   . PHE A 1 74  ? -61.629 23.089 -12.872 1.00 24.38 ? 364 PHE A O   1 
ATOM   515  C CB  . PHE A 1 74  ? -62.433 21.855 -15.966 1.00 25.38 ? 364 PHE A CB  1 
ATOM   516  C CG  . PHE A 1 74  ? -63.798 21.868 -15.407 1.00 25.79 ? 364 PHE A CG  1 
ATOM   517  C CD1 . PHE A 1 74  ? -64.702 22.859 -15.758 1.00 27.55 ? 364 PHE A CD1 1 
ATOM   518  C CD2 . PHE A 1 74  ? -64.180 20.902 -14.479 1.00 27.53 ? 364 PHE A CD2 1 
ATOM   519  C CE1 . PHE A 1 74  ? -65.976 22.887 -15.202 1.00 27.20 ? 364 PHE A CE1 1 
ATOM   520  C CE2 . PHE A 1 74  ? -65.467 20.920 -13.932 1.00 27.96 ? 364 PHE A CE2 1 
ATOM   521  C CZ  . PHE A 1 74  ? -66.352 21.905 -14.289 1.00 27.28 ? 364 PHE A CZ  1 
ATOM   522  N N   . ASN A 1 75  ? -60.375 21.381 -13.646 1.00 23.70 ? 365 ASN A N   1 
ATOM   523  C CA  . ASN A 1 75  ? -59.954 20.968 -12.305 1.00 23.34 ? 365 ASN A CA  1 
ATOM   524  C C   . ASN A 1 75  ? -59.271 22.081 -11.524 1.00 23.74 ? 365 ASN A C   1 
ATOM   525  O O   . ASN A 1 75  ? -59.595 22.318 -10.368 1.00 24.77 ? 365 ASN A O   1 
ATOM   526  C CB  . ASN A 1 75  ? -59.028 19.737 -12.368 1.00 23.21 ? 365 ASN A CB  1 
ATOM   527  C CG  . ASN A 1 75  ? -59.720 18.478 -12.866 1.00 24.06 ? 365 ASN A CG  1 
ATOM   528  O OD1 . ASN A 1 75  ? -60.938 18.464 -13.119 1.00 24.78 ? 365 ASN A OD1 1 
ATOM   529  N ND2 . ASN A 1 75  ? -58.944 17.401 -13.017 1.00 19.31 ? 365 ASN A ND2 1 
ATOM   530  N N   . GLU A 1 76  ? -58.330 22.779 -12.150 1.00 24.22 ? 366 GLU A N   1 
ATOM   531  C CA  . GLU A 1 76  ? -57.576 23.807 -11.455 1.00 24.38 ? 366 GLU A CA  1 
ATOM   532  C C   . GLU A 1 76  ? -58.530 24.897 -10.939 1.00 24.56 ? 366 GLU A C   1 
ATOM   533  O O   . GLU A 1 76  ? -58.480 25.301 -9.773  1.00 25.18 ? 366 GLU A O   1 
ATOM   534  C CB  . GLU A 1 76  ? -56.487 24.392 -12.342 1.00 23.34 ? 366 GLU A CB  1 
ATOM   535  C CG  . GLU A 1 76  ? -55.695 25.497 -11.607 1.00 25.55 ? 366 GLU A CG  1 
ATOM   536  C CD  . GLU A 1 76  ? -54.418 25.927 -12.304 1.00 26.07 ? 366 GLU A CD  1 
ATOM   537  O OE1 . GLU A 1 76  ? -54.292 25.653 -13.513 1.00 28.20 ? 366 GLU A OE1 1 
ATOM   538  O OE2 . GLU A 1 76  ? -53.530 26.529 -11.611 1.00 31.01 ? 366 GLU A OE2 1 
ATOM   539  N N   . VAL A 1 77  ? -59.439 25.331 -11.810 1.00 24.50 ? 367 VAL A N   1 
ATOM   540  C CA  . VAL A 1 77  ? -60.369 26.375 -11.419 1.00 25.21 ? 367 VAL A CA  1 
ATOM   541  C C   . VAL A 1 77  ? -61.287 25.949 -10.305 1.00 25.36 ? 367 VAL A C   1 
ATOM   542  O O   . VAL A 1 77  ? -61.464 26.669 -9.313  1.00 25.88 ? 367 VAL A O   1 
ATOM   543  C CB  . VAL A 1 77  ? -61.146 26.899 -12.608 1.00 25.02 ? 367 VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 77  ? -62.173 27.944 -12.133 1.00 27.29 ? 367 VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 77  ? -60.175 27.539 -13.561 1.00 25.41 ? 367 VAL A CG2 1 
ATOM   546  N N   . VAL A 1 78  ? -61.904 24.785 -10.456 1.00 24.70 ? 368 VAL A N   1 
ATOM   547  C CA  . VAL A 1 78  ? -62.838 24.316 -9.440  1.00 24.69 ? 368 VAL A CA  1 
ATOM   548  C C   . VAL A 1 78  ? -62.154 24.040 -8.088  1.00 24.22 ? 368 VAL A C   1 
ATOM   549  O O   . VAL A 1 78  ? -62.696 24.427 -7.024  1.00 25.50 ? 368 VAL A O   1 
ATOM   550  C CB  . VAL A 1 78  ? -63.638 23.103 -9.950  1.00 23.50 ? 368 VAL A CB  1 
ATOM   551  C CG1 . VAL A 1 78  ? -64.459 22.521 -8.827  1.00 25.37 ? 368 VAL A CG1 1 
ATOM   552  C CG2 . VAL A 1 78  ? -64.513 23.473 -11.197 1.00 24.58 ? 368 VAL A CG2 1 
ATOM   553  N N   . ILE A 1 79  ? -60.967 23.421 -8.080  1.00 24.71 ? 369 ILE A N   1 
ATOM   554  C CA  . ILE A 1 79  ? -60.255 23.140 -6.837  1.00 24.61 ? 369 ILE A CA  1 
ATOM   555  C C   . ILE A 1 79  ? -59.786 24.442 -6.197  1.00 25.03 ? 369 ILE A C   1 
ATOM   556  O O   . ILE A 1 79  ? -59.805 24.592 -4.984  1.00 25.05 ? 369 ILE A O   1 
ATOM   557  C CB  . ILE A 1 79  ? -59.051 22.120 -7.043  1.00 25.63 ? 369 ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 79  ? -59.593 20.738 -7.438  1.00 27.24 ? 369 ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 79  ? -58.089 22.095 -5.843  1.00 25.53 ? 369 ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 79  ? -60.937 20.416 -7.001  1.00 28.27 ? 369 ILE A CD1 1 
ATOM   561  N N   . MET A 1 80  ? -59.346 25.401 -7.003  1.00 25.10 ? 370 MET A N   1 
ATOM   562  C CA  . MET A 1 80  ? -58.959 26.691 -6.439  1.00 25.74 ? 370 MET A CA  1 
ATOM   563  C C   . MET A 1 80  ? -60.184 27.418 -5.849  1.00 24.51 ? 370 MET A C   1 
ATOM   564  O O   . MET A 1 80  ? -60.108 28.058 -4.796  1.00 25.36 ? 370 MET A O   1 
ATOM   565  C CB  . MET A 1 80  ? -58.268 27.578 -7.477  1.00 26.37 ? 370 MET A CB  1 
ATOM   566  C CG  . MET A 1 80  ? -56.903 27.127 -7.905  1.00 27.98 ? 370 MET A CG  1 
ATOM   567  S SD  . MET A 1 80  ? -55.648 27.501 -6.668  1.00 34.46 ? 370 MET A SD  1 
ATOM   568  C CE  . MET A 1 80  ? -55.565 25.906 -5.912  1.00 29.82 ? 370 MET A CE  1 
ATOM   569  N N   . ARG A 1 81  ? -61.325 27.309 -6.513  1.00 24.57 ? 371 ARG A N   1 
ATOM   570  C CA  . ARG A 1 81  ? -62.531 27.926 -6.014  1.00 24.24 ? 371 ARG A CA  1 
ATOM   571  C C   . ARG A 1 81  ? -63.023 27.263 -4.712  1.00 25.01 ? 371 ARG A C   1 
ATOM   572  O O   . ARG A 1 81  ? -63.458 27.951 -3.773  1.00 25.10 ? 371 ARG A O   1 
ATOM   573  C CB  . ARG A 1 81  ? -63.596 27.895 -7.118  1.00 23.99 ? 371 ARG A CB  1 
ATOM   574  C CG  . ARG A 1 81  ? -64.898 28.613 -6.782  1.00 21.73 ? 371 ARG A CG  1 
ATOM   575  C CD  . ARG A 1 81  ? -66.023 28.268 -7.755  1.00 24.27 ? 371 ARG A CD  1 
ATOM   576  N NE  . ARG A 1 81  ? -66.466 26.901 -7.565  1.00 22.38 ? 371 ARG A NE  1 
ATOM   577  C CZ  . ARG A 1 81  ? -67.298 26.281 -8.385  1.00 25.37 ? 371 ARG A CZ  1 
ATOM   578  N NH1 . ARG A 1 81  ? -67.837 26.933 -9.418  1.00 27.18 ? 371 ARG A NH1 1 
ATOM   579  N NH2 . ARG A 1 81  ? -67.624 25.024 -8.148  1.00 24.14 ? 371 ARG A NH2 1 
ATOM   580  N N   . ASP A 1 82  ? -62.985 25.929 -4.644  1.00 25.08 ? 372 ASP A N   1 
ATOM   581  C CA  . ASP A 1 82  ? -63.728 25.225 -3.598  1.00 25.82 ? 372 ASP A CA  1 
ATOM   582  C C   . ASP A 1 82  ? -62.938 24.693 -2.411  1.00 26.41 ? 372 ASP A C   1 
ATOM   583  O O   . ASP A 1 82  ? -63.550 24.368 -1.374  1.00 26.50 ? 372 ASP A O   1 
ATOM   584  C CB  . ASP A 1 82  ? -64.525 24.059 -4.221  1.00 26.01 ? 372 ASP A CB  1 
ATOM   585  C CG  . ASP A 1 82  ? -65.629 24.519 -5.132  1.00 29.12 ? 372 ASP A CG  1 
ATOM   586  O OD1 . ASP A 1 82  ? -66.080 25.695 -5.025  1.00 28.86 ? 372 ASP A OD1 1 
ATOM   587  O OD2 . ASP A 1 82  ? -66.068 23.677 -5.943  1.00 30.49 ? 372 ASP A OD2 1 
ATOM   588  N N   . TYR A 1 83  ? -61.614 24.591 -2.527  1.00 26.59 ? 373 TYR A N   1 
ATOM   589  C CA  . TYR A 1 83  ? -60.815 23.918 -1.494  1.00 27.45 ? 373 TYR A CA  1 
ATOM   590  C C   . TYR A 1 83  ? -59.708 24.825 -0.981  1.00 28.17 ? 373 TYR A C   1 
ATOM   591  O O   . TYR A 1 83  ? -58.528 24.502 -1.093  1.00 29.39 ? 373 TYR A O   1 
ATOM   592  C CB  . TYR A 1 83  ? -60.274 22.567 -2.001  1.00 27.84 ? 373 TYR A CB  1 
ATOM   593  C CG  . TYR A 1 83  ? -61.396 21.605 -2.363  1.00 27.69 ? 373 TYR A CG  1 
ATOM   594  C CD1 . TYR A 1 83  ? -61.757 21.400 -3.679  1.00 29.84 ? 373 TYR A CD1 1 
ATOM   595  C CD2 . TYR A 1 83  ? -62.118 20.928 -1.372  1.00 29.45 ? 373 TYR A CD2 1 
ATOM   596  C CE1 . TYR A 1 83  ? -62.794 20.556 -4.025  1.00 29.48 ? 373 TYR A CE1 1 
ATOM   597  C CE2 . TYR A 1 83  ? -63.164 20.073 -1.705  1.00 29.38 ? 373 TYR A CE2 1 
ATOM   598  C CZ  . TYR A 1 83  ? -63.494 19.897 -3.043  1.00 29.13 ? 373 TYR A CZ  1 
ATOM   599  O OH  . TYR A 1 83  ? -64.519 19.064 -3.397  1.00 29.05 ? 373 TYR A OH  1 
ATOM   600  N N   . GLN A 1 84  ? -60.102 25.936 -0.358  1.00 28.37 ? 374 GLN A N   1 
ATOM   601  C CA  A GLN A 1 84  ? -59.107 26.884 0.143   0.50 28.14 ? 374 GLN A CA  1 
ATOM   602  C CA  B GLN A 1 84  ? -59.171 26.933 0.207   0.50 28.52 ? 374 GLN A CA  1 
ATOM   603  C C   . GLN A 1 84  ? -58.494 26.442 1.483   1.00 27.98 ? 374 GLN A C   1 
ATOM   604  O O   . GLN A 1 84  ? -59.132 25.785 2.317   1.00 28.41 ? 374 GLN A O   1 
ATOM   605  C CB  A GLN A 1 84  ? -59.675 28.302 0.207   0.50 28.03 ? 374 GLN A CB  1 
ATOM   606  C CB  B GLN A 1 84  ? -59.905 28.229 0.556   0.50 28.72 ? 374 GLN A CB  1 
ATOM   607  C CG  A GLN A 1 84  ? -60.007 28.886 -1.193  0.50 27.53 ? 374 GLN A CG  1 
ATOM   608  C CG  B GLN A 1 84  ? -60.305 29.108 -0.635  0.50 29.81 ? 374 GLN A CG  1 
ATOM   609  C CD  A GLN A 1 84  ? -60.527 30.327 -1.144  0.50 28.01 ? 374 GLN A CD  1 
ATOM   610  C CD  B GLN A 1 84  ? -61.473 28.571 -1.457  0.50 30.98 ? 374 GLN A CD  1 
ATOM   611  O OE1 A GLN A 1 84  ? -61.379 30.667 -0.316  0.50 28.16 ? 374 GLN A OE1 1 
ATOM   612  O OE1 B GLN A 1 84  ? -61.427 28.639 -2.670  0.50 31.85 ? 374 GLN A OE1 1 
ATOM   613  N NE2 A GLN A 1 84  ? -60.018 31.175 -2.040  0.50 26.77 ? 374 GLN A NE2 1 
ATOM   614  N NE2 B GLN A 1 84  ? -62.524 28.049 -0.800  0.50 29.12 ? 374 GLN A NE2 1 
ATOM   615  N N   . HIS A 1 85  ? -57.226 26.808 1.656   1.00 27.57 ? 375 HIS A N   1 
ATOM   616  C CA  . HIS A 1 85  ? -56.421 26.457 2.824   1.00 26.89 ? 375 HIS A CA  1 
ATOM   617  C C   . HIS A 1 85  ? -55.360 27.557 3.064   1.00 26.99 ? 375 HIS A C   1 
ATOM   618  O O   . HIS A 1 85  ? -54.862 28.176 2.095   1.00 25.74 ? 375 HIS A O   1 
ATOM   619  C CB  . HIS A 1 85  ? -55.785 25.091 2.597   1.00 27.11 ? 375 HIS A CB  1 
ATOM   620  C CG  . HIS A 1 85  ? -55.119 24.522 3.807   1.00 26.78 ? 375 HIS A CG  1 
ATOM   621  N ND1 . HIS A 1 85  ? -53.822 24.837 4.155   1.00 25.59 ? 375 HIS A ND1 1 
ATOM   622  C CD2 . HIS A 1 85  ? -55.553 23.637 4.736   1.00 28.27 ? 375 HIS A CD2 1 
ATOM   623  C CE1 . HIS A 1 85  ? -53.496 24.192 5.255   1.00 26.99 ? 375 HIS A CE1 1 
ATOM   624  N NE2 . HIS A 1 85  ? -54.528 23.466 5.638   1.00 24.84 ? 375 HIS A NE2 1 
ATOM   625  N N   . GLU A 1 86  ? -55.000 27.796 4.334   1.00 26.30 ? 376 GLU A N   1 
ATOM   626  C CA  . GLU A 1 86  ? -53.951 28.772 4.698   1.00 25.91 ? 376 GLU A CA  1 
ATOM   627  C C   . GLU A 1 86  ? -52.581 28.530 4.046   1.00 25.08 ? 376 GLU A C   1 
ATOM   628  O O   . GLU A 1 86  ? -51.752 29.448 3.914   1.00 24.93 ? 376 GLU A O   1 
ATOM   629  C CB  . GLU A 1 86  ? -53.777 28.808 6.218   1.00 27.26 ? 376 GLU A CB  1 
ATOM   630  C CG  . GLU A 1 86  ? -52.529 29.540 6.709   1.00 29.06 ? 376 GLU A CG  1 
ATOM   631  N N   . ASN A 1 87  ? -52.331 27.285 3.668   1.00 23.31 ? 377 ASN A N   1 
ATOM   632  C CA  . ASN A 1 87  ? -51.092 26.899 3.010   1.00 22.76 ? 377 ASN A CA  1 
ATOM   633  C C   . ASN A 1 87  ? -51.271 26.531 1.528   1.00 21.32 ? 377 ASN A C   1 
ATOM   634  O O   . ASN A 1 87  ? -50.468 25.772 0.957   1.00 21.81 ? 377 ASN A O   1 
ATOM   635  C CB  . ASN A 1 87  ? -50.417 25.767 3.772   1.00 22.48 ? 377 ASN A CB  1 
ATOM   636  C CG  . ASN A 1 87  ? -49.917 26.208 5.156   1.00 25.36 ? 377 ASN A CG  1 
ATOM   637  O OD1 . ASN A 1 87  ? -50.445 25.760 6.154   1.00 26.36 ? 377 ASN A OD1 1 
ATOM   638  N ND2 . ASN A 1 87  ? -48.925 27.138 5.206   1.00 24.70 ? 377 ASN A ND2 1 
ATOM   639  N N   . VAL A 1 88  ? -52.323 27.074 0.902   1.00 19.80 ? 378 VAL A N   1 
ATOM   640  C CA  . VAL A 1 88  ? -52.565 26.929 -0.519  1.00 20.34 ? 378 VAL A CA  1 
ATOM   641  C C   . VAL A 1 88  ? -52.738 28.310 -1.127  1.00 19.79 ? 378 VAL A C   1 
ATOM   642  O O   . VAL A 1 88  ? -53.429 29.168 -0.559  1.00 18.72 ? 378 VAL A O   1 
ATOM   643  C CB  . VAL A 1 88  ? -53.828 26.011 -0.819  1.00 20.57 ? 378 VAL A CB  1 
ATOM   644  C CG1 . VAL A 1 88  ? -54.142 25.942 -2.338  1.00 20.68 ? 378 VAL A CG1 1 
ATOM   645  C CG2 . VAL A 1 88  ? -53.516 24.584 -0.273  1.00 20.14 ? 378 VAL A CG2 1 
ATOM   646  N N   . VAL A 1 89  ? -52.086 28.514 -2.250  1.00 19.40 ? 379 VAL A N   1 
ATOM   647  C CA  A VAL A 1 89  ? -52.140 29.778 -2.964  0.50 19.79 ? 379 VAL A CA  1 
ATOM   648  C CA  B VAL A 1 89  ? -52.132 29.784 -2.963  0.50 20.49 ? 379 VAL A CA  1 
ATOM   649  C C   . VAL A 1 89  ? -53.597 30.138 -3.258  1.00 19.75 ? 379 VAL A C   1 
ATOM   650  O O   . VAL A 1 89  ? -54.412 29.260 -3.615  1.00 21.10 ? 379 VAL A O   1 
ATOM   651  C CB  A VAL A 1 89  ? -51.367 29.717 -4.301  0.50 18.49 ? 379 VAL A CB  1 
ATOM   652  C CB  B VAL A 1 89  ? -51.317 29.731 -4.287  0.50 19.47 ? 379 VAL A CB  1 
ATOM   653  C CG1 A VAL A 1 89  ? -52.051 28.788 -5.304  0.50 16.71 ? 379 VAL A CG1 1 
ATOM   654  C CG1 B VAL A 1 89  ? -51.654 30.912 -5.188  0.50 22.07 ? 379 VAL A CG1 1 
ATOM   655  C CG2 A VAL A 1 89  ? -51.189 31.120 -4.848  0.50 21.33 ? 379 VAL A CG2 1 
ATOM   656  C CG2 B VAL A 1 89  ? -49.789 29.699 -3.976  0.50 22.18 ? 379 VAL A CG2 1 
ATOM   657  N N   . GLU A 1 90  ? -53.929 31.407 -3.095  1.00 20.90 ? 380 GLU A N   1 
ATOM   658  C CA  . GLU A 1 90  ? -55.297 31.874 -3.291  1.00 21.79 ? 380 GLU A CA  1 
ATOM   659  C C   . GLU A 1 90  ? -55.539 32.318 -4.742  1.00 21.06 ? 380 GLU A C   1 
ATOM   660  O O   . GLU A 1 90  ? -54.751 33.102 -5.307  1.00 19.57 ? 380 GLU A O   1 
ATOM   661  C CB  . GLU A 1 90  ? -55.585 33.058 -2.386  1.00 22.57 ? 380 GLU A CB  1 
ATOM   662  C CG  . GLU A 1 90  ? -56.999 33.584 -2.553  1.00 23.22 ? 380 GLU A CG  1 
ATOM   663  C CD  . GLU A 1 90  ? -57.413 34.650 -1.534  1.00 24.90 ? 380 GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 90  ? -56.612 35.000 -0.631  1.00 27.51 ? 380 GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 90  ? -58.558 35.160 -1.695  1.00 26.94 ? 380 GLU A OE2 1 
ATOM   666  N N   . MET A 1 91  ? -56.638 31.820 -5.344  1.00 21.37 ? 381 MET A N   1 
ATOM   667  C CA  . MET A 1 91  ? -57.116 32.319 -6.618  1.00 21.84 ? 381 MET A CA  1 
ATOM   668  C C   . MET A 1 91  ? -58.154 33.417 -6.331  1.00 21.41 ? 381 MET A C   1 
ATOM   669  O O   . MET A 1 91  ? -59.169 33.160 -5.666  1.00 20.70 ? 381 MET A O   1 
ATOM   670  C CB  . MET A 1 91  ? -57.764 31.214 -7.461  1.00 22.38 ? 381 MET A CB  1 
ATOM   671  C CG  . MET A 1 91  ? -58.326 31.725 -8.769  1.00 23.94 ? 381 MET A CG  1 
ATOM   672  S SD  . MET A 1 91  ? -59.048 30.428 -9.794  1.00 23.83 ? 381 MET A SD  1 
ATOM   673  C CE  . MET A 1 91  ? -60.558 30.112 -8.883  1.00 20.68 ? 381 MET A CE  1 
ATOM   674  N N   . TYR A 1 92  ? -57.892 34.631 -6.780  1.00 20.89 ? 382 TYR A N   1 
ATOM   675  C CA  . TYR A 1 92  ? -58.854 35.737 -6.671  1.00 20.56 ? 382 TYR A CA  1 
ATOM   676  C C   . TYR A 1 92  ? -60.037 35.601 -7.670  1.00 20.42 ? 382 TYR A C   1 
ATOM   677  O O   . TYR A 1 92  ? -61.214 35.740 -7.298  1.00 20.23 ? 382 TYR A O   1 
ATOM   678  C CB  . TYR A 1 92  ? -58.156 37.066 -6.909  1.00 22.16 ? 382 TYR A CB  1 
ATOM   679  C CG  . TYR A 1 92  ? -57.121 37.422 -5.844  1.00 22.85 ? 382 TYR A CG  1 
ATOM   680  C CD1 . TYR A 1 92  ? -57.361 37.144 -4.494  1.00 25.88 ? 382 TYR A CD1 1 
ATOM   681  C CD2 . TYR A 1 92  ? -55.916 38.036 -6.192  1.00 25.60 ? 382 TYR A CD2 1 
ATOM   682  C CE1 . TYR A 1 92  ? -56.411 37.482 -3.513  1.00 26.52 ? 382 TYR A CE1 1 
ATOM   683  C CE2 . TYR A 1 92  ? -54.973 38.356 -5.223  1.00 25.93 ? 382 TYR A CE2 1 
ATOM   684  C CZ  . TYR A 1 92  ? -55.232 38.079 -3.898  1.00 26.53 ? 382 TYR A CZ  1 
ATOM   685  O OH  . TYR A 1 92  ? -54.333 38.432 -2.916  1.00 27.28 ? 382 TYR A OH  1 
ATOM   686  N N   . ASN A 1 93  ? -59.710 35.358 -8.930  1.00 19.11 ? 383 ASN A N   1 
ATOM   687  C CA  . ASN A 1 93  ? -60.700 35.323 -10.023 1.00 19.32 ? 383 ASN A CA  1 
ATOM   688  C C   . ASN A 1 93  ? -60.174 34.509 -11.186 1.00 18.49 ? 383 ASN A C   1 
ATOM   689  O O   . ASN A 1 93  ? -58.986 34.237 -11.286 1.00 18.19 ? 383 ASN A O   1 
ATOM   690  C CB  . ASN A 1 93  ? -60.997 36.742 -10.538 1.00 19.00 ? 383 ASN A CB  1 
ATOM   691  C CG  . ASN A 1 93  ? -61.745 37.596 -9.543  1.00 22.88 ? 383 ASN A CG  1 
ATOM   692  O OD1 . ASN A 1 93  ? -62.984 37.512 -9.417  1.00 26.54 ? 383 ASN A OD1 1 
ATOM   693  N ND2 . ASN A 1 93  ? -61.007 38.457 -8.843  1.00 18.86 ? 383 ASN A ND2 1 
ATOM   694  N N   . SER A 1 94  ? -61.063 34.125 -12.091 1.00 17.41 ? 384 SER A N   1 
ATOM   695  C CA  . SER A 1 94  ? -60.679 33.463 -13.345 1.00 17.29 ? 384 SER A CA  1 
ATOM   696  C C   . SER A 1 94  ? -61.603 33.972 -14.442 1.00 18.47 ? 384 SER A C   1 
ATOM   697  O O   . SER A 1 94  ? -62.744 34.379 -14.172 1.00 17.39 ? 384 SER A O   1 
ATOM   698  C CB  . SER A 1 94  ? -60.791 31.937 -13.245 1.00 18.10 ? 384 SER A CB  1 
ATOM   699  O OG  . SER A 1 94  ? -62.112 31.518 -12.879 1.00 19.03 ? 384 SER A OG  1 
ATOM   700  N N   . TYR A 1 95  ? -61.097 33.974 -15.662 1.00 18.69 ? 385 TYR A N   1 
ATOM   701  C CA  . TYR A 1 95  ? -61.772 34.539 -16.795 1.00 19.41 ? 385 TYR A CA  1 
ATOM   702  C C   . TYR A 1 95  ? -61.474 33.732 -18.042 1.00 19.05 ? 385 TYR A C   1 
ATOM   703  O O   . TYR A 1 95  ? -60.448 33.054 -18.125 1.00 19.04 ? 385 TYR A O   1 
ATOM   704  C CB  . TYR A 1 95  ? -61.330 35.981 -17.031 1.00 20.34 ? 385 TYR A CB  1 
ATOM   705  C CG  . TYR A 1 95  ? -61.490 36.868 -15.832 1.00 18.77 ? 385 TYR A CG  1 
ATOM   706  C CD1 . TYR A 1 95  ? -62.688 37.500 -15.566 1.00 20.70 ? 385 TYR A CD1 1 
ATOM   707  C CD2 . TYR A 1 95  ? -60.454 37.021 -14.924 1.00 20.21 ? 385 TYR A CD2 1 
ATOM   708  C CE1 . TYR A 1 95  ? -62.831 38.302 -14.453 1.00 19.30 ? 385 TYR A CE1 1 
ATOM   709  C CE2 . TYR A 1 95  ? -60.580 37.821 -13.825 1.00 21.28 ? 385 TYR A CE2 1 
ATOM   710  C CZ  . TYR A 1 95  ? -61.754 38.451 -13.584 1.00 20.11 ? 385 TYR A CZ  1 
ATOM   711  O OH  . TYR A 1 95  ? -61.894 39.220 -12.470 1.00 23.76 ? 385 TYR A OH  1 
ATOM   712  N N   . LEU A 1 96  ? -62.363 33.863 -19.021 1.00 19.50 ? 386 LEU A N   1 
ATOM   713  C CA  . LEU A 1 96  ? -62.062 33.419 -20.381 1.00 20.41 ? 386 LEU A CA  1 
ATOM   714  C C   . LEU A 1 96  ? -61.864 34.681 -21.203 1.00 21.91 ? 386 LEU A C   1 
ATOM   715  O O   . LEU A 1 96  ? -62.699 35.595 -21.181 1.00 21.32 ? 386 LEU A O   1 
ATOM   716  C CB  . LEU A 1 96  ? -63.171 32.546 -20.968 1.00 20.04 ? 386 LEU A CB  1 
ATOM   717  C CG  . LEU A 1 96  ? -63.237 31.101 -20.526 1.00 22.38 ? 386 LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 96  ? -64.502 30.413 -21.019 1.00 23.09 ? 386 LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 96  ? -61.997 30.317 -20.991 1.00 24.68 ? 386 LEU A CD2 1 
ATOM   720  N N   . VAL A 1 97  ? -60.738 34.736 -21.905 1.00 22.52 ? 387 VAL A N   1 
ATOM   721  C CA  . VAL A 1 97  ? -60.422 35.856 -22.814 1.00 24.06 ? 387 VAL A CA  1 
ATOM   722  C C   . VAL A 1 97  ? -60.157 35.151 -24.142 1.00 23.75 ? 387 VAL A C   1 
ATOM   723  O O   . VAL A 1 97  ? -59.090 34.541 -24.311 1.00 24.50 ? 387 VAL A O   1 
ATOM   724  C CB  . VAL A 1 97  ? -59.151 36.626 -22.346 1.00 24.37 ? 387 VAL A CB  1 
ATOM   725  C CG1 . VAL A 1 97  ? -58.840 37.790 -23.298 1.00 27.07 ? 387 VAL A CG1 1 
ATOM   726  C CG2 . VAL A 1 97  ? -59.240 37.106 -20.854 1.00 26.55 ? 387 VAL A CG2 1 
ATOM   727  N N   . GLY A 1 98  ? -61.125 35.180 -25.052 1.00 24.37 ? 388 GLY A N   1 
ATOM   728  C CA  . GLY A 1 98  ? -61.083 34.383 -26.274 1.00 24.91 ? 388 GLY A CA  1 
ATOM   729  C C   . GLY A 1 98  ? -60.933 32.893 -25.978 1.00 24.30 ? 388 GLY A C   1 
ATOM   730  O O   . GLY A 1 98  ? -61.750 32.312 -25.265 1.00 24.08 ? 388 GLY A O   1 
ATOM   731  N N   . ASP A 1 99  ? -59.910 32.252 -26.530 1.00 24.12 ? 389 ASP A N   1 
ATOM   732  C CA  . ASP A 1 99  ? -59.679 30.834 -26.202 1.00 24.88 ? 389 ASP A CA  1 
ATOM   733  C C   . ASP A 1 99  ? -58.627 30.619 -25.156 1.00 24.08 ? 389 ASP A C   1 
ATOM   734  O O   . ASP A 1 99  ? -58.068 29.517 -25.085 1.00 23.97 ? 389 ASP A O   1 
ATOM   735  C CB  . ASP A 1 99  ? -59.371 30.005 -27.446 1.00 25.47 ? 389 ASP A CB  1 
ATOM   736  C CG  . ASP A 1 99  ? -60.621 29.703 -28.245 1.00 28.03 ? 389 ASP A CG  1 
ATOM   737  O OD1 . ASP A 1 99  ? -61.680 29.448 -27.625 1.00 32.05 ? 389 ASP A OD1 1 
ATOM   738  O OD2 . ASP A 1 99  ? -60.575 29.797 -29.481 1.00 28.82 ? 389 ASP A OD2 1 
ATOM   739  N N   . GLU A 1 100 ? -58.415 31.630 -24.321 1.00 23.25 ? 390 GLU A N   1 
ATOM   740  C CA  . GLU A 1 100 ? -57.545 31.509 -23.169 1.00 23.95 ? 390 GLU A CA  1 
ATOM   741  C C   . GLU A 1 100 ? -58.288 31.545 -21.863 1.00 22.32 ? 390 GLU A C   1 
ATOM   742  O O   . GLU A 1 100 ? -59.192 32.368 -21.700 1.00 21.36 ? 390 GLU A O   1 
ATOM   743  C CB  . GLU A 1 100 ? -56.532 32.641 -23.129 1.00 24.38 ? 390 GLU A CB  1 
ATOM   744  C CG  . GLU A 1 100 ? -55.465 32.473 -24.155 1.00 27.44 ? 390 GLU A CG  1 
ATOM   745  C CD  . GLU A 1 100 ? -54.610 33.717 -24.318 1.00 29.68 ? 390 GLU A CD  1 
ATOM   746  O OE1 . GLU A 1 100 ? -54.464 34.510 -23.351 1.00 31.98 ? 390 GLU A OE1 1 
ATOM   747  O OE2 . GLU A 1 100 ? -54.090 33.888 -25.441 1.00 37.03 ? 390 GLU A OE2 1 
ATOM   748  N N   . LEU A 1 101 ? -57.862 30.683 -20.946 1.00 20.41 ? 391 LEU A N   1 
ATOM   749  C CA  . LEU A 1 101 ? -58.246 30.761 -19.556 1.00 20.37 ? 391 LEU A CA  1 
ATOM   750  C C   . LEU A 1 101 ? -57.214 31.611 -18.845 1.00 20.60 ? 391 LEU A C   1 
ATOM   751  O O   . LEU A 1 101 ? -56.027 31.284 -18.901 1.00 19.97 ? 391 LEU A O   1 
ATOM   752  C CB  . LEU A 1 101 ? -58.274 29.386 -18.917 1.00 20.40 ? 391 LEU A CB  1 
ATOM   753  C CG  . LEU A 1 101 ? -58.519 29.313 -17.419 1.00 21.05 ? 391 LEU A CG  1 
ATOM   754  C CD1 . LEU A 1 101 ? -59.887 29.935 -17.015 1.00 18.70 ? 391 LEU A CD1 1 
ATOM   755  C CD2 . LEU A 1 101 ? -58.422 27.867 -16.893 1.00 22.65 ? 391 LEU A CD2 1 
ATOM   756  N N   . TRP A 1 102 ? -57.653 32.666 -18.171 1.00 20.41 ? 392 TRP A N   1 
ATOM   757  C CA  . TRP A 1 102 ? -56.804 33.447 -17.254 1.00 21.35 ? 392 TRP A CA  1 
ATOM   758  C C   . TRP A 1 102 ? -57.187 33.198 -15.796 1.00 22.60 ? 392 TRP A C   1 
ATOM   759  O O   . TRP A 1 102 ? -58.357 33.328 -15.410 1.00 22.82 ? 392 TRP A O   1 
ATOM   760  C CB  . TRP A 1 102 ? -56.905 34.922 -17.514 1.00 23.48 ? 392 TRP A CB  1 
ATOM   761  C CG  . TRP A 1 102 ? -56.379 35.359 -18.843 1.00 24.63 ? 392 TRP A CG  1 
ATOM   762  C CD1 . TRP A 1 102 ? -56.172 34.593 -19.951 1.00 27.06 ? 392 TRP A CD1 1 
ATOM   763  C CD2 . TRP A 1 102 ? -56.015 36.689 -19.203 1.00 26.79 ? 392 TRP A CD2 1 
ATOM   764  N NE1 . TRP A 1 102 ? -55.712 35.367 -20.981 1.00 28.33 ? 392 TRP A NE1 1 
ATOM   765  C CE2 . TRP A 1 102 ? -55.582 36.655 -20.541 1.00 29.02 ? 392 TRP A CE2 1 
ATOM   766  C CE3 . TRP A 1 102 ? -55.993 37.904 -18.509 1.00 28.03 ? 392 TRP A CE3 1 
ATOM   767  C CZ2 . TRP A 1 102 ? -55.160 37.811 -21.230 1.00 29.21 ? 392 TRP A CZ2 1 
ATOM   768  C CZ3 . TRP A 1 102 ? -55.549 39.040 -19.166 1.00 27.24 ? 392 TRP A CZ3 1 
ATOM   769  C CH2 . TRP A 1 102 ? -55.143 38.987 -20.523 1.00 28.57 ? 392 TRP A CH2 1 
ATOM   770  N N   . VAL A 1 103 ? -56.202 32.814 -14.990 1.00 22.78 ? 393 VAL A N   1 
ATOM   771  C CA  . VAL A 1 103 ? -56.419 32.598 -13.557 1.00 22.71 ? 393 VAL A CA  1 
ATOM   772  C C   . VAL A 1 103 ? -55.612 33.669 -12.813 1.00 22.18 ? 393 VAL A C   1 
ATOM   773  O O   . VAL A 1 103 ? -54.395 33.758 -12.992 1.00 21.83 ? 393 VAL A O   1 
ATOM   774  C CB  . VAL A 1 103 ? -56.068 31.174 -13.156 1.00 23.61 ? 393 VAL A CB  1 
ATOM   775  C CG1 . VAL A 1 103 ? -56.092 31.023 -11.669 1.00 26.59 ? 393 VAL A CG1 1 
ATOM   776  C CG2 . VAL A 1 103 ? -57.029 30.169 -13.832 1.00 26.06 ? 393 VAL A CG2 1 
ATOM   777  N N   . VAL A 1 104 ? -56.312 34.514 -12.053 1.00 21.77 ? 394 VAL A N   1 
ATOM   778  C CA  . VAL A 1 104 ? -55.695 35.600 -11.320 1.00 21.76 ? 394 VAL A CA  1 
ATOM   779  C C   . VAL A 1 104 ? -55.471 35.134 -9.869  1.00 22.19 ? 394 VAL A C   1 
ATOM   780  O O   . VAL A 1 104 ? -56.434 34.891 -9.117  1.00 21.83 ? 394 VAL A O   1 
ATOM   781  C CB  . VAL A 1 104 ? -56.575 36.882 -11.365 1.00 22.19 ? 394 VAL A CB  1 
ATOM   782  C CG1 . VAL A 1 104 ? -55.851 38.050 -10.713 1.00 22.69 ? 394 VAL A CG1 1 
ATOM   783  C CG2 . VAL A 1 104 ? -56.957 37.210 -12.810 1.00 22.01 ? 394 VAL A CG2 1 
ATOM   784  N N   . MET A 1 105 ? -54.204 35.128 -9.461  1.00 22.28 ? 395 MET A N   1 
ATOM   785  C CA  A MET A 1 105 ? -53.687 34.522 -8.233  0.50 21.93 ? 395 MET A CA  1 
ATOM   786  C CA  B MET A 1 105 ? -53.873 34.630 -8.124  0.50 23.97 ? 395 MET A CA  1 
ATOM   787  C C   . MET A 1 105 ? -53.038 35.617 -7.354  1.00 22.52 ? 395 MET A C   1 
ATOM   788  O O   . MET A 1 105 ? -52.553 36.631 -7.867  1.00 20.49 ? 395 MET A O   1 
ATOM   789  C CB  A MET A 1 105 ? -52.572 33.508 -8.611  0.50 21.85 ? 395 MET A CB  1 
ATOM   790  C CB  B MET A 1 105 ? -53.100 33.324 -8.172  0.50 24.36 ? 395 MET A CB  1 
ATOM   791  C CG  A MET A 1 105 ? -52.935 32.502 -9.720  0.50 22.49 ? 395 MET A CG  1 
ATOM   792  C CG  B MET A 1 105 ? -53.804 32.189 -8.881  0.50 27.99 ? 395 MET A CG  1 
ATOM   793  S SD  A MET A 1 105 ? -54.279 31.356 -9.260  0.50 22.53 ? 395 MET A SD  1 
ATOM   794  S SD  B MET A 1 105 ? -52.511 31.196 -9.596  0.50 30.62 ? 395 MET A SD  1 
ATOM   795  C CE  A MET A 1 105 ? -53.702 30.719 -7.689  0.50 20.48 ? 395 MET A CE  1 
ATOM   796  C CE  B MET A 1 105 ? -51.543 32.413 -10.497 0.50 31.90 ? 395 MET A CE  1 
ATOM   797  N N   . GLU A 1 106 ? -52.938 35.364 -6.069  1.00 22.03 ? 396 GLU A N   1 
ATOM   798  C CA  . GLU A 1 106 ? -52.130 36.236 -5.264  1.00 22.33 ? 396 GLU A CA  1 
ATOM   799  C C   . GLU A 1 106 ? -50.667 36.154 -5.715  1.00 20.97 ? 396 GLU A C   1 
ATOM   800  O O   . GLU A 1 106 ? -50.192 35.111 -6.166  1.00 22.24 ? 396 GLU A O   1 
ATOM   801  C CB  . GLU A 1 106 ? -52.260 35.876 -3.804  1.00 23.93 ? 396 GLU A CB  1 
ATOM   802  C CG  . GLU A 1 106 ? -51.792 34.537 -3.466  1.00 23.19 ? 396 GLU A CG  1 
ATOM   803  C CD  . GLU A 1 106 ? -51.940 34.245 -1.993  1.00 27.39 ? 396 GLU A CD  1 
ATOM   804  O OE1 . GLU A 1 106 ? -51.874 35.175 -1.161  1.00 27.40 ? 396 GLU A OE1 1 
ATOM   805  O OE2 . GLU A 1 106 ? -52.134 33.082 -1.691  1.00 23.94 ? 396 GLU A OE2 1 
ATOM   806  N N   . PHE A 1 107 ? -49.964 37.274 -5.585  1.00 21.90 ? 397 PHE A N   1 
ATOM   807  C CA  . PHE A 1 107 ? -48.547 37.342 -5.905  1.00 22.50 ? 397 PHE A CA  1 
ATOM   808  C C   . PHE A 1 107 ? -47.800 37.072 -4.595  1.00 22.35 ? 397 PHE A C   1 
ATOM   809  O O   . PHE A 1 107 ? -48.040 37.745 -3.576  1.00 24.73 ? 397 PHE A O   1 
ATOM   810  C CB  . PHE A 1 107 ? -48.164 38.706 -6.497  1.00 23.78 ? 397 PHE A CB  1 
ATOM   811  C CG  . PHE A 1 107 ? -46.689 38.818 -6.840  1.00 23.59 ? 397 PHE A CG  1 
ATOM   812  C CD1 . PHE A 1 107 ? -46.136 38.095 -7.890  1.00 27.05 ? 397 PHE A CD1 1 
ATOM   813  C CD2 . PHE A 1 107 ? -45.863 39.617 -6.075  1.00 29.01 ? 397 PHE A CD2 1 
ATOM   814  C CE1 . PHE A 1 107 ? -44.759 38.168 -8.174  1.00 29.89 ? 397 PHE A CE1 1 
ATOM   815  C CE2 . PHE A 1 107 ? -44.510 39.701 -6.355  1.00 24.84 ? 397 PHE A CE2 1 
ATOM   816  C CZ  . PHE A 1 107 ? -43.967 39.006 -7.400  1.00 28.07 ? 397 PHE A CZ  1 
ATOM   817  N N   . LEU A 1 108 ? -46.897 36.099 -4.617  1.00 22.50 ? 398 LEU A N   1 
ATOM   818  C CA  . LEU A 1 108 ? -46.174 35.715 -3.403  1.00 23.08 ? 398 LEU A CA  1 
ATOM   819  C C   . LEU A 1 108 ? -44.710 36.178 -3.528  1.00 22.50 ? 398 LEU A C   1 
ATOM   820  O O   . LEU A 1 108 ? -43.956 35.666 -4.359  1.00 23.00 ? 398 LEU A O   1 
ATOM   821  C CB  . LEU A 1 108 ? -46.274 34.211 -3.158  1.00 23.23 ? 398 LEU A CB  1 
ATOM   822  C CG  . LEU A 1 108 ? -47.750 33.856 -2.879  1.00 25.89 ? 398 LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 108 ? -48.027 32.379 -3.133  1.00 30.09 ? 398 LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 108 ? -48.150 34.238 -1.506  1.00 31.09 ? 398 LEU A CD2 1 
ATOM   825  N N   . GLU A 1 109 ? -44.352 37.114 -2.666  1.00 21.20 ? 399 GLU A N   1 
ATOM   826  C CA  . GLU A 1 109 ? -43.104 37.870 -2.811  1.00 23.01 ? 399 GLU A CA  1 
ATOM   827  C C   . GLU A 1 109 ? -41.860 37.054 -2.515  1.00 23.69 ? 399 GLU A C   1 
ATOM   828  O O   . GLU A 1 109 ? -40.760 37.472 -2.888  1.00 24.94 ? 399 GLU A O   1 
ATOM   829  C CB  . GLU A 1 109 ? -43.142 39.088 -1.897  1.00 23.59 ? 399 GLU A CB  1 
ATOM   830  C CG  . GLU A 1 109 ? -44.178 40.088 -2.302  1.00 27.27 ? 399 GLU A CG  1 
ATOM   831  C CD  . GLU A 1 109 ? -44.435 41.185 -1.264  1.00 27.39 ? 399 GLU A CD  1 
ATOM   832  O OE1 . GLU A 1 109 ? -43.571 41.416 -0.404  1.00 32.55 ? 399 GLU A OE1 1 
ATOM   833  O OE2 . GLU A 1 109 ? -45.518 41.811 -1.375  1.00 32.98 ? 399 GLU A OE2 1 
ATOM   834  N N   . GLY A 1 110 ? -42.021 35.955 -1.787  1.00 23.40 ? 400 GLY A N   1 
ATOM   835  C CA  . GLY A 1 110 ? -40.905 35.042 -1.496  1.00 24.41 ? 400 GLY A CA  1 
ATOM   836  C C   . GLY A 1 110 ? -40.402 34.168 -2.626  1.00 24.45 ? 400 GLY A C   1 
ATOM   837  O O   . GLY A 1 110 ? -39.299 33.590 -2.527  1.00 26.13 ? 400 GLY A O   1 
ATOM   838  N N   . GLY A 1 111 ? -41.158 34.073 -3.715  1.00 23.82 ? 401 GLY A N   1 
ATOM   839  C CA  . GLY A 1 111 ? -40.786 33.224 -4.838  1.00 23.88 ? 401 GLY A CA  1 
ATOM   840  C C   . GLY A 1 111 ? -40.921 31.737 -4.523  1.00 23.50 ? 401 GLY A C   1 
ATOM   841  O O   . GLY A 1 111 ? -41.548 31.361 -3.537  1.00 22.54 ? 401 GLY A O   1 
ATOM   842  N N   . ALA A 1 112 ? -40.307 30.903 -5.366  1.00 22.65 ? 402 ALA A N   1 
ATOM   843  C CA  . ALA A 1 112 ? -40.449 29.435 -5.274  1.00 21.19 ? 402 ALA A CA  1 
ATOM   844  C C   . ALA A 1 112 ? -39.341 28.816 -4.443  1.00 20.91 ? 402 ALA A C   1 
ATOM   845  O O   . ALA A 1 112 ? -38.214 29.307 -4.404  1.00 20.13 ? 402 ALA A O   1 
ATOM   846  C CB  . ALA A 1 112 ? -40.477 28.784 -6.652  1.00 22.19 ? 402 ALA A CB  1 
ATOM   847  N N   . LEU A 1 113 ? -39.665 27.690 -3.828  1.00 19.23 ? 403 LEU A N   1 
ATOM   848  C CA  . LEU A 1 113 ? -38.679 26.941 -3.051  1.00 18.92 ? 403 LEU A CA  1 
ATOM   849  C C   . LEU A 1 113 ? -37.479 26.509 -3.912  1.00 18.99 ? 403 LEU A C   1 
ATOM   850  O O   . LEU A 1 113 ? -36.371 26.364 -3.396  1.00 18.90 ? 403 LEU A O   1 
ATOM   851  C CB  . LEU A 1 113 ? -39.312 25.776 -2.346  1.00 19.02 ? 403 LEU A CB  1 
ATOM   852  C CG  . LEU A 1 113 ? -38.482 24.936 -1.406  1.00 18.46 ? 403 LEU A CG  1 
ATOM   853  C CD1 . LEU A 1 113 ? -37.953 25.755 -0.209  1.00 20.91 ? 403 LEU A CD1 1 
ATOM   854  C CD2 . LEU A 1 113 ? -39.375 23.710 -0.987  1.00 17.62 ? 403 LEU A CD2 1 
ATOM   855  N N   . THR A 1 114 ? -37.704 26.244 -5.210  1.00 18.12 ? 404 THR A N   1 
ATOM   856  C CA  . THR A 1 114 ? -36.572 25.888 -6.096  1.00 18.90 ? 404 THR A CA  1 
ATOM   857  C C   . THR A 1 114 ? -35.420 26.854 -5.983  1.00 18.12 ? 404 THR A C   1 
ATOM   858  O O   . THR A 1 114 ? -34.278 26.447 -5.989  1.00 17.68 ? 404 THR A O   1 
ATOM   859  C CB  . THR A 1 114 ? -37.049 25.846 -7.538  1.00 18.85 ? 404 THR A CB  1 
ATOM   860  O OG1 . THR A 1 114 ? -38.203 24.990 -7.566  1.00 21.02 ? 404 THR A OG1 1 
ATOM   861  C CG2 . THR A 1 114 ? -35.928 25.403 -8.506  1.00 20.53 ? 404 THR A CG2 1 
ATOM   862  N N   . ASP A 1 115 ? -35.728 28.143 -5.884  1.00 18.78 ? 405 ASP A N   1 
ATOM   863  C CA  . ASP A 1 115 ? -34.691 29.150 -5.888  1.00 19.86 ? 405 ASP A CA  1 
ATOM   864  C C   . ASP A 1 115 ? -33.828 29.012 -4.645  1.00 20.57 ? 405 ASP A C   1 
ATOM   865  O O   . ASP A 1 115 ? -32.621 29.311 -4.681  1.00 22.24 ? 405 ASP A O   1 
ATOM   866  C CB  . ASP A 1 115 ? -35.278 30.549 -6.019  1.00 20.45 ? 405 ASP A CB  1 
ATOM   867  C CG  . ASP A 1 115 ? -34.229 31.587 -6.406  1.00 22.04 ? 405 ASP A CG  1 
ATOM   868  O OD1 . ASP A 1 115 ? -33.535 31.420 -7.461  1.00 20.95 ? 405 ASP A OD1 1 
ATOM   869  O OD2 . ASP A 1 115 ? -34.034 32.560 -5.639  1.00 24.16 ? 405 ASP A OD2 1 
ATOM   870  N N   . ILE A 1 116 ? -34.433 28.597 -3.531  1.00 19.06 ? 406 ILE A N   1 
ATOM   871  C CA  . ILE A 1 116 ? -33.667 28.358 -2.305  1.00 19.07 ? 406 ILE A CA  1 
ATOM   872  C C   . ILE A 1 116 ? -32.781 27.081 -2.402  1.00 19.77 ? 406 ILE A C   1 
ATOM   873  O O   . ILE A 1 116 ? -31.573 27.141 -2.191  1.00 19.82 ? 406 ILE A O   1 
ATOM   874  C CB  . ILE A 1 116 ? -34.633 28.271 -1.091  1.00 18.71 ? 406 ILE A CB  1 
ATOM   875  C CG1 . ILE A 1 116 ? -35.218 29.661 -0.817  1.00 17.91 ? 406 ILE A CG1 1 
ATOM   876  C CG2 . ILE A 1 116 ? -33.978 27.691 0.152   1.00 18.45 ? 406 ILE A CG2 1 
ATOM   877  C CD1 . ILE A 1 116 ? -36.443 29.669 0.154   1.00 20.61 ? 406 ILE A CD1 1 
ATOM   878  N N   . VAL A 1 117 ? -33.397 25.961 -2.743  1.00 20.26 ? 407 VAL A N   1 
ATOM   879  C CA  . VAL A 1 117 ? -32.678 24.661 -2.761  1.00 20.68 ? 407 VAL A CA  1 
ATOM   880  C C   . VAL A 1 117 ? -31.512 24.602 -3.783  1.00 20.31 ? 407 VAL A C   1 
ATOM   881  O O   . VAL A 1 117 ? -30.553 23.857 -3.570  1.00 21.89 ? 407 VAL A O   1 
ATOM   882  C CB  . VAL A 1 117 ? -33.638 23.444 -2.932  1.00 20.65 ? 407 VAL A CB  1 
ATOM   883  C CG1 . VAL A 1 117 ? -34.771 23.467 -1.891  1.00 21.58 ? 407 VAL A CG1 1 
ATOM   884  C CG2 . VAL A 1 117 ? -34.156 23.359 -4.362  1.00 22.22 ? 407 VAL A CG2 1 
ATOM   885  N N   . THR A 1 118 ? -31.579 25.403 -4.847  1.00 20.80 ? 408 THR A N   1 
ATOM   886  C CA  . THR A 1 118 ? -30.498 25.501 -5.847  1.00 22.51 ? 408 THR A CA  1 
ATOM   887  C C   . THR A 1 118 ? -29.425 26.564 -5.549  1.00 23.17 ? 408 THR A C   1 
ATOM   888  O O   . THR A 1 118 ? -28.384 26.613 -6.243  1.00 25.01 ? 408 THR A O   1 
ATOM   889  C CB  . THR A 1 118 ? -31.045 25.667 -7.282  1.00 22.54 ? 408 THR A CB  1 
ATOM   890  O OG1 . THR A 1 118 ? -31.709 26.929 -7.424  1.00 23.08 ? 408 THR A OG1 1 
ATOM   891  C CG2 . THR A 1 118 ? -32.038 24.545 -7.665  1.00 22.45 ? 408 THR A CG2 1 
ATOM   892  N N   . HIS A 1 119 ? -29.654 27.439 -4.560  1.00 22.72 ? 409 HIS A N   1 
ATOM   893  C CA  . HIS A 1 119 ? -28.699 28.514 -4.240  1.00 22.81 ? 409 HIS A CA  1 
ATOM   894  C C   . HIS A 1 119 ? -28.097 28.468 -2.818  1.00 24.78 ? 409 HIS A C   1 
ATOM   895  O O   . HIS A 1 119 ? -27.066 29.124 -2.551  1.00 25.03 ? 409 HIS A O   1 
ATOM   896  C CB  . HIS A 1 119 ? -29.311 29.877 -4.459  1.00 23.03 ? 409 HIS A CB  1 
ATOM   897  C CG  . HIS A 1 119 ? -29.501 30.222 -5.895  1.00 21.61 ? 409 HIS A CG  1 
ATOM   898  N ND1 . HIS A 1 119 ? -30.627 29.865 -6.610  1.00 23.20 ? 409 HIS A ND1 1 
ATOM   899  C CD2 . HIS A 1 119 ? -28.711 30.920 -6.750  1.00 24.78 ? 409 HIS A CD2 1 
ATOM   900  C CE1 . HIS A 1 119 ? -30.498 30.292 -7.856  1.00 24.69 ? 409 HIS A CE1 1 
ATOM   901  N NE2 . HIS A 1 119 ? -29.350 30.951 -7.965  1.00 26.26 ? 409 HIS A NE2 1 
ATOM   902  N N   . THR A 1 120 ? -28.737 27.756 -1.901  1.00 24.19 ? 410 THR A N   1 
ATOM   903  C CA  . THR A 1 120 ? -28.262 27.688 -0.551  1.00 24.40 ? 410 THR A CA  1 
ATOM   904  C C   . THR A 1 120 ? -28.637 26.365 0.127   1.00 24.62 ? 410 THR A C   1 
ATOM   905  O O   . THR A 1 120 ? -29.244 25.526 -0.507  1.00 26.52 ? 410 THR A O   1 
ATOM   906  C CB  . THR A 1 120 ? -28.728 28.953 0.203   1.00 25.92 ? 410 THR A CB  1 
ATOM   907  O OG1 . THR A 1 120 ? -27.999 29.084 1.429   1.00 26.98 ? 410 THR A OG1 1 
ATOM   908  C CG2 . THR A 1 120 ? -30.218 28.991 0.395   1.00 24.99 ? 410 THR A CG2 1 
ATOM   909  N N   . ARG A 1 121 ? -28.219 26.148 1.377   1.00 24.04 ? 411 ARG A N   1 
ATOM   910  C CA  . ARG A 1 121 ? -28.469 24.910 2.102   1.00 24.11 ? 411 ARG A CA  1 
ATOM   911  C C   . ARG A 1 121 ? -29.381 25.161 3.293   1.00 23.84 ? 411 ARG A C   1 
ATOM   912  O O   . ARG A 1 121 ? -29.037 25.947 4.188   1.00 25.18 ? 411 ARG A O   1 
ATOM   913  C CB  . ARG A 1 121 ? -27.175 24.263 2.611   1.00 25.99 ? 411 ARG A CB  1 
ATOM   914  C CG  . ARG A 1 121 ? -26.312 23.645 1.507   1.00 30.18 ? 411 ARG A CG  1 
ATOM   915  N N   . MET A 1 122 ? -30.531 24.484 3.323   1.00 21.19 ? 412 MET A N   1 
ATOM   916  C CA  . MET A 1 122 ? -31.476 24.618 4.398   1.00 20.38 ? 412 MET A CA  1 
ATOM   917  C C   . MET A 1 122 ? -31.018 23.740 5.555   1.00 19.72 ? 412 MET A C   1 
ATOM   918  O O   . MET A 1 122 ? -30.413 22.691 5.344   1.00 21.84 ? 412 MET A O   1 
ATOM   919  C CB  . MET A 1 122 ? -32.877 24.153 3.963   1.00 20.31 ? 412 MET A CB  1 
ATOM   920  C CG  . MET A 1 122 ? -33.466 24.907 2.752   1.00 20.81 ? 412 MET A CG  1 
ATOM   921  S SD  . MET A 1 122 ? -35.056 24.275 2.180   1.00 21.80 ? 412 MET A SD  1 
ATOM   922  C CE  . MET A 1 122 ? -36.146 24.527 3.596   1.00 20.36 ? 412 MET A CE  1 
ATOM   923  N N   . ASN A 1 123 ? -31.355 24.160 6.762   1.00 18.51 ? 413 ASN A N   1 
ATOM   924  C CA  . ASN A 1 123 ? -31.131 23.376 7.959   1.00 18.80 ? 413 ASN A CA  1 
ATOM   925  C C   . ASN A 1 123 ? -32.362 22.510 8.235   1.00 18.39 ? 413 ASN A C   1 
ATOM   926  O O   . ASN A 1 123 ? -33.374 22.663 7.551   1.00 19.14 ? 413 ASN A O   1 
ATOM   927  C CB  . ASN A 1 123 ? -30.696 24.264 9.128   1.00 18.89 ? 413 ASN A CB  1 
ATOM   928  C CG  . ASN A 1 123 ? -31.790 25.156 9.693   1.00 19.93 ? 413 ASN A CG  1 
ATOM   929  O OD1 . ASN A 1 123 ? -32.944 24.750 9.840   1.00 21.12 ? 413 ASN A OD1 1 
ATOM   930  N ND2 . ASN A 1 123 ? -31.394 26.394 10.098  1.00 19.50 ? 413 ASN A ND2 1 
ATOM   931  N N   . GLU A 1 124 ? -32.316 21.634 9.238   1.00 18.99 ? 414 GLU A N   1 
ATOM   932  C CA  . GLU A 1 124 ? -33.451 20.677 9.418   1.00 18.98 ? 414 GLU A CA  1 
ATOM   933  C C   . GLU A 1 124 ? -34.696 21.338 9.987   1.00 19.04 ? 414 GLU A C   1 
ATOM   934  O O   . GLU A 1 124 ? -35.816 20.868 9.749   1.00 19.33 ? 414 GLU A O   1 
ATOM   935  C CB  . GLU A 1 124 ? -33.019 19.456 10.257  1.00 19.30 ? 414 GLU A CB  1 
ATOM   936  C CG  . GLU A 1 124 ? -32.046 18.571 9.489   1.00 19.13 ? 414 GLU A CG  1 
ATOM   937  C CD  . GLU A 1 124 ? -31.842 17.176 10.081  1.00 21.89 ? 414 GLU A CD  1 
ATOM   938  O OE1 . GLU A 1 124 ? -32.647 16.800 10.933  1.00 19.74 ? 414 GLU A OE1 1 
ATOM   939  O OE2 . GLU A 1 124 ? -30.875 16.510 9.667   1.00 22.47 ? 414 GLU A OE2 1 
ATOM   940  N N   . GLU A 1 125 ? -34.521 22.415 10.757  1.00 18.43 ? 415 GLU A N   1 
ATOM   941  C CA  . GLU A 1 125 ? -35.659 23.164 11.274  1.00 19.37 ? 415 GLU A CA  1 
ATOM   942  C C   . GLU A 1 125 ? -36.447 23.810 10.118  1.00 18.47 ? 415 GLU A C   1 
ATOM   943  O O   . GLU A 1 125 ? -37.682 23.849 10.133  1.00 18.44 ? 415 GLU A O   1 
ATOM   944  C CB  . GLU A 1 125 ? -35.202 24.195 12.325  1.00 18.90 ? 415 GLU A CB  1 
ATOM   945  C CG  . GLU A 1 125 ? -34.561 23.513 13.566  1.00 19.03 ? 415 GLU A CG  1 
ATOM   946  C CD  . GLU A 1 125 ? -34.221 24.431 14.739  1.00 22.14 ? 415 GLU A CD  1 
ATOM   947  O OE1 . GLU A 1 125 ? -34.492 25.647 14.661  1.00 22.85 ? 415 GLU A OE1 1 
ATOM   948  O OE2 . GLU A 1 125 ? -33.685 23.902 15.759  1.00 24.23 ? 415 GLU A OE2 1 
ATOM   949  N N   . GLN A 1 126 ? -35.715 24.299 9.123   1.00 19.05 ? 416 GLN A N   1 
ATOM   950  C CA  . GLN A 1 126 ? -36.311 24.900 7.947   1.00 18.84 ? 416 GLN A CA  1 
ATOM   951  C C   . GLN A 1 126 ? -36.986 23.861 7.089   1.00 18.13 ? 416 GLN A C   1 
ATOM   952  O O   . GLN A 1 126 ? -38.135 24.047 6.652   1.00 18.33 ? 416 GLN A O   1 
ATOM   953  C CB  . GLN A 1 126 ? -35.242 25.649 7.179   1.00 19.17 ? 416 GLN A CB  1 
ATOM   954  C CG  . GLN A 1 126 ? -34.721 26.878 7.956   1.00 17.61 ? 416 GLN A CG  1 
ATOM   955  C CD  . GLN A 1 126 ? -33.443 27.448 7.371   1.00 19.80 ? 416 GLN A CD  1 
ATOM   956  O OE1 . GLN A 1 126 ? -32.613 26.715 6.835   1.00 19.03 ? 416 GLN A OE1 1 
ATOM   957  N NE2 . GLN A 1 126 ? -33.261 28.772 7.514   1.00 18.78 ? 416 GLN A NE2 1 
ATOM   958  N N   . ILE A 1 127 ? -36.301 22.725 6.896   1.00 18.45 ? 417 ILE A N   1 
ATOM   959  C CA  . ILE A 1 127 ? -36.883 21.599 6.175   1.00 18.77 ? 417 ILE A CA  1 
ATOM   960  C C   . ILE A 1 127 ? -38.174 21.134 6.866   1.00 17.98 ? 417 ILE A C   1 
ATOM   961  O O   . ILE A 1 127 ? -39.229 20.946 6.223   1.00 18.97 ? 417 ILE A O   1 
ATOM   962  C CB  . ILE A 1 127 ? -35.875 20.474 6.006   1.00 17.83 ? 417 ILE A CB  1 
ATOM   963  C CG1 . ILE A 1 127 ? -34.749 20.905 5.066   1.00 18.94 ? 417 ILE A CG1 1 
ATOM   964  C CG2 . ILE A 1 127 ? -36.519 19.194 5.381   1.00 18.60 ? 417 ILE A CG2 1 
ATOM   965  C CD1 . ILE A 1 127 ? -33.643 19.920 4.986   1.00 19.54 ? 417 ILE A CD1 1 
ATOM   966  N N   . ALA A 1 128 ? -38.138 20.971 8.190   1.00 18.30 ? 418 ALA A N   1 
ATOM   967  C CA  . ALA A 1 128 ? -39.349 20.564 8.901   1.00 18.77 ? 418 ALA A CA  1 
ATOM   968  C C   . ALA A 1 128 ? -40.489 21.565 8.785   1.00 19.53 ? 418 ALA A C   1 
ATOM   969  O O   . ALA A 1 128 ? -41.625 21.137 8.625   1.00 19.09 ? 418 ALA A O   1 
ATOM   970  C CB  . ALA A 1 128 ? -39.030 20.185 10.389  1.00 19.23 ? 418 ALA A CB  1 
ATOM   971  N N   . ALA A 1 129 ? -40.200 22.867 8.844   1.00 18.44 ? 419 ALA A N   1 
ATOM   972  C CA  . ALA A 1 129 ? -41.205 23.892 8.642   1.00 19.23 ? 419 ALA A CA  1 
ATOM   973  C C   . ALA A 1 129 ? -41.923 23.775 7.287   1.00 18.72 ? 419 ALA A C   1 
ATOM   974  O O   . ALA A 1 129 ? -43.160 23.912 7.226   1.00 19.76 ? 419 ALA A O   1 
ATOM   975  C CB  . ALA A 1 129 ? -40.573 25.293 8.780   1.00 19.65 ? 419 ALA A CB  1 
ATOM   976  N N   . VAL A 1 130 ? -41.141 23.579 6.214   1.00 18.30 ? 420 VAL A N   1 
ATOM   977  C CA  . VAL A 1 130 ? -41.700 23.421 4.851   1.00 18.64 ? 420 VAL A CA  1 
ATOM   978  C C   . VAL A 1 130 ? -42.550 22.141 4.817   1.00 18.56 ? 420 VAL A C   1 
ATOM   979  O O   . VAL A 1 130 ? -43.714 22.182 4.403   1.00 19.74 ? 420 VAL A O   1 
ATOM   980  C CB  . VAL A 1 130 ? -40.590 23.395 3.770   1.00 19.30 ? 420 VAL A CB  1 
ATOM   981  C CG1 . VAL A 1 130 ? -41.203 22.922 2.395   1.00 22.63 ? 420 VAL A CG1 1 
ATOM   982  C CG2 . VAL A 1 130 ? -39.951 24.750 3.661   1.00 20.64 ? 420 VAL A CG2 1 
ATOM   983  N N   . CYS A 1 131 ? -42.011 21.020 5.292   1.00 19.07 ? 421 CYS A N   1 
ATOM   984  C CA  . CYS A 1 131 ? -42.768 19.759 5.282   1.00 19.29 ? 421 CYS A CA  1 
ATOM   985  C C   . CYS A 1 131 ? -44.095 19.845 6.034   1.00 19.26 ? 421 CYS A C   1 
ATOM   986  O O   . CYS A 1 131 ? -45.143 19.325 5.597   1.00 19.28 ? 421 CYS A O   1 
ATOM   987  C CB  . CYS A 1 131 ? -41.927 18.618 5.850   1.00 20.22 ? 421 CYS A CB  1 
ATOM   988  S SG  . CYS A 1 131 ? -40.520 18.161 4.766   1.00 22.57 ? 421 CYS A SG  1 
ATOM   989  N N   . LEU A 1 132 ? -44.036 20.440 7.222   1.00 18.88 ? 422 LEU A N   1 
ATOM   990  C CA  . LEU A 1 132 ? -45.210 20.576 8.057   1.00 19.88 ? 422 LEU A CA  1 
ATOM   991  C C   . LEU A 1 132 ? -46.303 21.326 7.313   1.00 19.47 ? 422 LEU A C   1 
ATOM   992  O O   . LEU A 1 132 ? -47.452 20.876 7.286   1.00 20.39 ? 422 LEU A O   1 
ATOM   993  C CB  . LEU A 1 132 ? -44.829 21.254 9.384   1.00 18.69 ? 422 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 132 ? -45.964 21.614 10.329  1.00 20.46 ? 422 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 132 ? -46.698 20.401 10.786  1.00 19.60 ? 422 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 132 ? -45.456 22.418 11.520  1.00 20.87 ? 422 LEU A CD2 1 
ATOM   997  N N   . ALA A 1 133 ? -45.930 22.445 6.698   1.00 20.15 ? 423 ALA A N   1 
ATOM   998  C CA  . ALA A 1 133 ? -46.903 23.264 6.000   1.00 20.26 ? 423 ALA A CA  1 
ATOM   999  C C   . ALA A 1 133 ? -47.506 22.532 4.783   1.00 19.85 ? 423 ALA A C   1 
ATOM   1000 O O   . ALA A 1 133 ? -48.725 22.564 4.565   1.00 19.77 ? 423 ALA A O   1 
ATOM   1001 C CB  . ALA A 1 133 ? -46.291 24.615 5.612   1.00 19.69 ? 423 ALA A CB  1 
ATOM   1002 N N   . VAL A 1 134 ? -46.660 21.887 4.001   1.00 19.87 ? 424 VAL A N   1 
ATOM   1003 C CA  . VAL A 1 134 ? -47.131 21.096 2.846   1.00 20.56 ? 424 VAL A CA  1 
ATOM   1004 C C   . VAL A 1 134 ? -48.054 19.986 3.320   1.00 19.69 ? 424 VAL A C   1 
ATOM   1005 O O   . VAL A 1 134 ? -49.133 19.773 2.776   1.00 19.03 ? 424 VAL A O   1 
ATOM   1006 C CB  . VAL A 1 134 ? -45.939 20.562 2.036   1.00 20.23 ? 424 VAL A CB  1 
ATOM   1007 C CG1 . VAL A 1 134 ? -46.439 19.628 0.926   1.00 22.26 ? 424 VAL A CG1 1 
ATOM   1008 C CG2 . VAL A 1 134 ? -45.159 21.744 1.410   1.00 20.17 ? 424 VAL A CG2 1 
ATOM   1009 N N   . LEU A 1 135 ? -47.642 19.274 4.372   1.00 18.78 ? 425 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 135 ? -48.472 18.183 4.918   1.00 19.94 ? 425 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 135 ? -49.838 18.626 5.465   1.00 20.24 ? 425 LEU A C   1 
ATOM   1012 O O   . LEU A 1 135 ? -50.844 17.925 5.324   1.00 19.79 ? 425 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 135 ? -47.695 17.365 5.958   1.00 18.75 ? 425 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 135 ? -46.617 16.473 5.342   1.00 20.13 ? 425 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 135 ? -45.701 15.962 6.445   1.00 19.72 ? 425 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 135 ? -47.188 15.253 4.527   1.00 21.33 ? 425 LEU A CD2 1 
ATOM   1017 N N   . GLN A 1 136 ? -49.882 19.809 6.076   1.00 20.73 ? 426 GLN A N   1 
ATOM   1018 C CA  . GLN A 1 136 ? -51.142 20.371 6.561   1.00 21.73 ? 426 GLN A CA  1 
ATOM   1019 C C   . GLN A 1 136 ? -52.139 20.607 5.394   1.00 21.08 ? 426 GLN A C   1 
ATOM   1020 O O   . GLN A 1 136 ? -53.306 20.235 5.481   1.00 20.83 ? 426 GLN A O   1 
ATOM   1021 C CB  . GLN A 1 136 ? -50.852 21.649 7.370   1.00 21.77 ? 426 GLN A CB  1 
ATOM   1022 C CG  . GLN A 1 136 ? -50.291 21.318 8.724   1.00 23.95 ? 426 GLN A CG  1 
ATOM   1023 C CD  . GLN A 1 136 ? -49.801 22.548 9.484   1.00 23.92 ? 426 GLN A CD  1 
ATOM   1024 O OE1 . GLN A 1 136 ? -49.431 23.570 8.868   1.00 26.00 ? 426 GLN A OE1 1 
ATOM   1025 N NE2 . GLN A 1 136 ? -49.768 22.443 10.815  1.00 24.06 ? 426 GLN A NE2 1 
ATOM   1026 N N   . ALA A 1 137 ? -51.651 21.202 4.317   1.00 21.08 ? 427 ALA A N   1 
ATOM   1027 C CA  . ALA A 1 137 ? -52.409 21.372 3.076   1.00 20.75 ? 427 ALA A CA  1 
ATOM   1028 C C   . ALA A 1 137 ? -52.819 20.043 2.500   1.00 20.01 ? 427 ALA A C   1 
ATOM   1029 O O   . ALA A 1 137 ? -54.003 19.833 2.196   1.00 19.55 ? 427 ALA A O   1 
ATOM   1030 C CB  . ALA A 1 137 ? -51.609 22.136 2.072   1.00 20.79 ? 427 ALA A CB  1 
ATOM   1031 N N   . LEU A 1 138 ? -51.847 19.140 2.296   1.00 19.99 ? 428 LEU A N   1 
ATOM   1032 C CA  . LEU A 1 138 ? -52.182 17.815 1.736   1.00 19.64 ? 428 LEU A CA  1 
ATOM   1033 C C   . LEU A 1 138 ? -53.206 17.001 2.539   1.00 19.80 ? 428 LEU A C   1 
ATOM   1034 O O   . LEU A 1 138 ? -54.055 16.296 1.969   1.00 18.77 ? 428 LEU A O   1 
ATOM   1035 C CB  . LEU A 1 138 ? -50.923 16.984 1.505   1.00 19.92 ? 428 LEU A CB  1 
ATOM   1036 C CG  . LEU A 1 138 ? -49.995 17.525 0.446   1.00 17.56 ? 428 LEU A CG  1 
ATOM   1037 C CD1 . LEU A 1 138 ? -48.768 16.623 0.341   1.00 19.62 ? 428 LEU A CD1 1 
ATOM   1038 C CD2 . LEU A 1 138 ? -50.653 17.704 -0.970  1.00 19.44 ? 428 LEU A CD2 1 
ATOM   1039 N N   . SER A 1 139 ? -53.095 17.015 3.866   1.00 19.80 ? 429 SER A N   1 
ATOM   1040 C CA  A SER A 1 139 ? -54.060 16.310 4.700   0.50 20.41 ? 429 SER A CA  1 
ATOM   1041 C CA  B SER A 1 139 ? -54.052 16.326 4.719   0.50 20.46 ? 429 SER A CA  1 
ATOM   1042 C C   . SER A 1 139 ? -55.486 16.764 4.410   1.00 20.22 ? 429 SER A C   1 
ATOM   1043 O O   . SER A 1 139 ? -56.415 15.925 4.336   1.00 22.08 ? 429 SER A O   1 
ATOM   1044 C CB  A SER A 1 139 ? -53.745 16.481 6.186   0.50 20.19 ? 429 SER A CB  1 
ATOM   1045 C CB  B SER A 1 139 ? -53.704 16.545 6.201   0.50 20.19 ? 429 SER A CB  1 
ATOM   1046 O OG  A SER A 1 139 ? -54.676 15.742 6.973   0.50 19.59 ? 429 SER A OG  1 
ATOM   1047 O OG  B SER A 1 139 ? -53.960 17.874 6.635   0.50 20.06 ? 429 SER A OG  1 
ATOM   1048 N N   . VAL A 1 140 ? -55.683 18.068 4.244   1.00 20.38 ? 430 VAL A N   1 
ATOM   1049 C CA  . VAL A 1 140 ? -57.019 18.602 4.010   1.00 20.59 ? 430 VAL A CA  1 
ATOM   1050 C C   . VAL A 1 140 ? -57.496 18.277 2.585   1.00 20.37 ? 430 VAL A C   1 
ATOM   1051 O O   . VAL A 1 140 ? -58.643 17.855 2.364   1.00 20.85 ? 430 VAL A O   1 
ATOM   1052 C CB  . VAL A 1 140 ? -57.041 20.127 4.274   1.00 22.20 ? 430 VAL A CB  1 
ATOM   1053 C CG1 . VAL A 1 140 ? -58.321 20.744 3.759   1.00 23.98 ? 430 VAL A CG1 1 
ATOM   1054 C CG2 . VAL A 1 140 ? -56.777 20.380 5.829   1.00 21.79 ? 430 VAL A CG2 1 
ATOM   1055 N N   . LEU A 1 141 ? -56.600 18.443 1.644   1.00 20.04 ? 431 LEU A N   1 
ATOM   1056 C CA  . LEU A 1 141 ? -56.894 18.172 0.237   1.00 19.62 ? 431 LEU A CA  1 
ATOM   1057 C C   . LEU A 1 141 ? -57.153 16.683 -0.004  1.00 19.44 ? 431 LEU A C   1 
ATOM   1058 O O   . LEU A 1 141 ? -58.153 16.316 -0.607  1.00 19.96 ? 431 LEU A O   1 
ATOM   1059 C CB  . LEU A 1 141 ? -55.758 18.693 -0.635  1.00 19.99 ? 431 LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 141 ? -55.555 20.219 -0.700  1.00 21.18 ? 431 LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 141 ? -54.236 20.506 -1.270  1.00 22.74 ? 431 LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 141 ? -56.703 20.876 -1.530  1.00 21.77 ? 431 LEU A CD2 1 
ATOM   1063 N N   . HIS A 1 142 ? -56.267 15.834 0.500   1.00 18.20 ? 432 HIS A N   1 
ATOM   1064 C CA  . HIS A 1 142 ? -56.427 14.391 0.369   1.00 18.77 ? 432 HIS A CA  1 
ATOM   1065 C C   . HIS A 1 142 ? -57.735 13.848 0.971   1.00 19.47 ? 432 HIS A C   1 
ATOM   1066 O O   . HIS A 1 142 ? -58.391 12.960 0.381   1.00 20.20 ? 432 HIS A O   1 
ATOM   1067 C CB  . HIS A 1 142 ? -55.214 13.670 0.952   1.00 18.33 ? 432 HIS A CB  1 
ATOM   1068 C CG  . HIS A 1 142 ? -53.945 13.825 0.145   1.00 18.86 ? 432 HIS A CG  1 
ATOM   1069 N ND1 . HIS A 1 142 ? -52.742 13.292 0.561   1.00 18.07 ? 432 HIS A ND1 1 
ATOM   1070 C CD2 . HIS A 1 142 ? -53.703 14.396 -1.061  1.00 20.34 ? 432 HIS A CD2 1 
ATOM   1071 C CE1 . HIS A 1 142 ? -51.820 13.512 -0.359  1.00 19.43 ? 432 HIS A CE1 1 
ATOM   1072 N NE2 . HIS A 1 142 ? -52.367 14.207 -1.344  1.00 19.30 ? 432 HIS A NE2 1 
ATOM   1073 N N   . ALA A 1 143 ? -58.134 14.409 2.112   1.00 20.18 ? 433 ALA A N   1 
ATOM   1074 C CA  . ALA A 1 143 ? -59.398 14.056 2.795   1.00 21.03 ? 433 ALA A CA  1 
ATOM   1075 C C   . ALA A 1 143 ? -60.617 14.281 1.877   1.00 21.48 ? 433 ALA A C   1 
ATOM   1076 O O   . ALA A 1 143 ? -61.634 13.585 2.020   1.00 22.22 ? 433 ALA A O   1 
ATOM   1077 C CB  . ALA A 1 143 ? -59.535 14.860 4.081   1.00 20.28 ? 433 ALA A CB  1 
ATOM   1078 N N   . GLN A 1 144 ? -60.516 15.251 0.963   1.00 22.03 ? 434 GLN A N   1 
ATOM   1079 C CA  . GLN A 1 144 ? -61.560 15.555 -0.026  1.00 22.53 ? 434 GLN A CA  1 
ATOM   1080 C C   . GLN A 1 144 ? -61.332 14.886 -1.384  1.00 22.50 ? 434 GLN A C   1 
ATOM   1081 O O   . GLN A 1 144 ? -62.076 15.138 -2.345  1.00 23.21 ? 434 GLN A O   1 
ATOM   1082 C CB  . GLN A 1 144 ? -61.672 17.069 -0.208  1.00 23.81 ? 434 GLN A CB  1 
ATOM   1083 C CG  . GLN A 1 144 ? -62.083 17.786 1.080   1.00 26.55 ? 434 GLN A CG  1 
ATOM   1084 C CD  . GLN A 1 144 ? -63.285 17.147 1.761   1.00 30.68 ? 434 GLN A CD  1 
ATOM   1085 O OE1 . GLN A 1 144 ? -63.266 16.865 2.977   1.00 35.34 ? 434 GLN A OE1 1 
ATOM   1086 N NE2 . GLN A 1 144 ? -64.350 16.891 0.983   1.00 32.49 ? 434 GLN A NE2 1 
ATOM   1087 N N   . GLY A 1 145 ? -60.330 14.009 -1.462  1.00 21.35 ? 435 GLY A N   1 
ATOM   1088 C CA  . GLY A 1 145 ? -60.069 13.277 -2.688  1.00 20.74 ? 435 GLY A CA  1 
ATOM   1089 C C   . GLY A 1 145 ? -59.234 14.046 -3.682  1.00 20.91 ? 435 GLY A C   1 
ATOM   1090 O O   . GLY A 1 145 ? -59.001 13.572 -4.791  1.00 22.13 ? 435 GLY A O   1 
ATOM   1091 N N   . VAL A 1 146 ? -58.725 15.222 -3.313  1.00 20.21 ? 436 VAL A N   1 
ATOM   1092 C CA  . VAL A 1 146 ? -57.952 16.000 -4.279  1.00 19.55 ? 436 VAL A CA  1 
ATOM   1093 C C   . VAL A 1 146 ? -56.502 15.513 -4.259  1.00 20.15 ? 436 VAL A C   1 
ATOM   1094 O O   . VAL A 1 146 ? -55.940 15.393 -3.171  1.00 20.60 ? 436 VAL A O   1 
ATOM   1095 C CB  . VAL A 1 146 ? -57.960 17.505 -3.941  1.00 20.04 ? 436 VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 146 ? -57.017 18.265 -4.841  1.00 21.44 ? 436 VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 146 ? -59.398 18.079 -4.006  1.00 21.14 ? 436 VAL A CG2 1 
ATOM   1098 N N   . ILE A 1 147 ? -55.938 15.247 -5.441  1.00 19.63 ? 437 ILE A N   1 
ATOM   1099 C CA  . ILE A 1 147 ? -54.558 14.831 -5.643  1.00 20.09 ? 437 ILE A CA  1 
ATOM   1100 C C   . ILE A 1 147 ? -53.835 15.915 -6.416  1.00 19.86 ? 437 ILE A C   1 
ATOM   1101 O O   . ILE A 1 147 ? -54.287 16.310 -7.512  1.00 20.00 ? 437 ILE A O   1 
ATOM   1102 C CB  . ILE A 1 147 ? -54.440 13.484 -6.441  1.00 20.43 ? 437 ILE A CB  1 
ATOM   1103 C CG1 . ILE A 1 147 ? -55.467 12.449 -5.957  1.00 21.58 ? 437 ILE A CG1 1 
ATOM   1104 C CG2 . ILE A 1 147 ? -52.963 12.907 -6.325  1.00 20.42 ? 437 ILE A CG2 1 
ATOM   1105 C CD1 . ILE A 1 147 ? -55.535 11.208 -6.772  1.00 20.83 ? 437 ILE A CD1 1 
ATOM   1106 N N   . HIS A 1 148 ? -52.720 16.420 -5.907  1.00 19.70 ? 438 HIS A N   1 
ATOM   1107 C CA  . HIS A 1 148 ? -52.047 17.508 -6.602  1.00 18.58 ? 438 HIS A CA  1 
ATOM   1108 C C   . HIS A 1 148 ? -51.342 17.040 -7.869  1.00 18.59 ? 438 HIS A C   1 
ATOM   1109 O O   . HIS A 1 148 ? -51.454 17.640 -8.936  1.00 19.79 ? 438 HIS A O   1 
ATOM   1110 C CB  . HIS A 1 148 ? -51.054 18.172 -5.630  1.00 19.10 ? 438 HIS A CB  1 
ATOM   1111 C CG  . HIS A 1 148 ? -50.354 19.355 -6.177  1.00 18.14 ? 438 HIS A CG  1 
ATOM   1112 N ND1 . HIS A 1 148 ? -49.268 19.269 -7.042  1.00 18.99 ? 438 HIS A ND1 1 
ATOM   1113 C CD2 . HIS A 1 148 ? -50.532 20.680 -5.919  1.00 21.50 ? 438 HIS A CD2 1 
ATOM   1114 C CE1 . HIS A 1 148 ? -48.865 20.498 -7.330  1.00 22.68 ? 438 HIS A CE1 1 
ATOM   1115 N NE2 . HIS A 1 148 ? -49.634 21.368 -6.679  1.00 19.69 ? 438 HIS A NE2 1 
ATOM   1116 N N   . ARG A 1 149 ? -50.571 15.979 -7.723  1.00 18.60 ? 439 ARG A N   1 
ATOM   1117 C CA  . ARG A 1 149 ? -49.922 15.262 -8.789  1.00 18.29 ? 439 ARG A CA  1 
ATOM   1118 C C   . ARG A 1 149 ? -48.706 15.940 -9.364  1.00 17.89 ? 439 ARG A C   1 
ATOM   1119 O O   . ARG A 1 149 ? -48.112 15.399 -10.289 1.00 20.46 ? 439 ARG A O   1 
ATOM   1120 C CB  . ARG A 1 149 ? -50.873 14.843 -9.926  1.00 17.65 ? 439 ARG A CB  1 
ATOM   1121 C CG  . ARG A 1 149 ? -51.952 13.926 -9.508  1.00 18.52 ? 439 ARG A CG  1 
ATOM   1122 C CD  . ARG A 1 149 ? -52.601 13.166 -10.660 1.00 18.88 ? 439 ARG A CD  1 
ATOM   1123 N NE  . ARG A 1 149 ? -53.255 14.092 -11.589 1.00 19.40 ? 439 ARG A NE  1 
ATOM   1124 C CZ  . ARG A 1 149 ? -54.085 13.727 -12.553 1.00 20.02 ? 439 ARG A CZ  1 
ATOM   1125 N NH1 . ARG A 1 149 ? -54.393 12.439 -12.746 1.00 18.74 ? 439 ARG A NH1 1 
ATOM   1126 N NH2 . ARG A 1 149 ? -54.633 14.661 -13.321 1.00 20.36 ? 439 ARG A NH2 1 
ATOM   1127 N N   . ASP A 1 150 ? -48.261 17.067 -8.774  1.00 18.88 ? 440 ASP A N   1 
ATOM   1128 C CA  . ASP A 1 150 ? -47.054 17.733 -9.236  1.00 18.81 ? 440 ASP A CA  1 
ATOM   1129 C C   . ASP A 1 150 ? -46.292 18.420 -8.111  1.00 19.23 ? 440 ASP A C   1 
ATOM   1130 O O   . ASP A 1 150 ? -45.834 19.537 -8.238  1.00 20.41 ? 440 ASP A O   1 
ATOM   1131 C CB  . ASP A 1 150 ? -47.389 18.712 -10.397 1.00 19.65 ? 440 ASP A CB  1 
ATOM   1132 C CG  . ASP A 1 150 ? -46.185 19.060 -11.240 1.00 22.29 ? 440 ASP A CG  1 
ATOM   1133 O OD1 . ASP A 1 150 ? -45.188 18.301 -11.254 1.00 23.03 ? 440 ASP A OD1 1 
ATOM   1134 O OD2 . ASP A 1 150 ? -46.251 20.091 -11.968 1.00 24.21 ? 440 ASP A OD2 1 
ATOM   1135 N N   . ILE A 1 151 ? -46.116 17.685 -7.011  1.00 18.34 ? 441 ILE A N   1 
ATOM   1136 C CA  . ILE A 1 151 ? -45.349 18.176 -5.881  1.00 18.80 ? 441 ILE A CA  1 
ATOM   1137 C C   . ILE A 1 151 ? -43.863 18.138 -6.234  1.00 18.79 ? 441 ILE A C   1 
ATOM   1138 O O   . ILE A 1 151 ? -43.336 17.116 -6.710  1.00 18.60 ? 441 ILE A O   1 
ATOM   1139 C CB  . ILE A 1 151 ? -45.620 17.362 -4.625  1.00 18.61 ? 441 ILE A CB  1 
ATOM   1140 C CG1 . ILE A 1 151 ? -47.093 17.416 -4.133  1.00 20.50 ? 441 ILE A CG1 1 
ATOM   1141 C CG2 . ILE A 1 151 ? -44.680 17.790 -3.480  1.00 19.87 ? 441 ILE A CG2 1 
ATOM   1142 C CD1 . ILE A 1 151 ? -47.576 18.839 -3.735  1.00 21.75 ? 441 ILE A CD1 1 
ATOM   1143 N N   . LYS A 1 152 ? -43.217 19.261 -6.001  1.00 18.82 ? 442 LYS A N   1 
ATOM   1144 C CA  . LYS A 1 152 ? -41.782 19.503 -6.258  1.00 18.15 ? 442 LYS A CA  1 
ATOM   1145 C C   . LYS A 1 152 ? -41.529 20.916 -5.749  1.00 18.25 ? 442 LYS A C   1 
ATOM   1146 O O   . LYS A 1 152 ? -42.472 21.671 -5.539  1.00 18.17 ? 442 LYS A O   1 
ATOM   1147 C CB  . LYS A 1 152 ? -41.438 19.395 -7.777  1.00 19.18 ? 442 LYS A CB  1 
ATOM   1148 C CG  . LYS A 1 152 ? -42.261 20.262 -8.708  1.00 18.72 ? 442 LYS A CG  1 
ATOM   1149 C CD  . LYS A 1 152 ? -41.901 20.107 -10.201 1.00 20.27 ? 442 LYS A CD  1 
ATOM   1150 C CE  . LYS A 1 152 ? -42.902 20.878 -11.065 1.00 23.15 ? 442 LYS A CE  1 
ATOM   1151 N NZ  . LYS A 1 152 ? -42.681 20.671 -12.502 1.00 24.07 ? 442 LYS A NZ  1 
ATOM   1152 N N   . SER A 1 153 ? -40.270 21.308 -5.572  1.00 18.10 ? 443 SER A N   1 
ATOM   1153 C CA  . SER A 1 153 ? -39.990 22.628 -4.979  1.00 17.88 ? 443 SER A CA  1 
ATOM   1154 C C   . SER A 1 153 ? -40.536 23.762 -5.817  1.00 19.27 ? 443 SER A C   1 
ATOM   1155 O O   . SER A 1 153 ? -40.858 24.840 -5.265  1.00 18.92 ? 443 SER A O   1 
ATOM   1156 C CB  . SER A 1 153 ? -38.481 22.826 -4.808  1.00 17.65 ? 443 SER A CB  1 
ATOM   1157 O OG  . SER A 1 153 ? -37.765 22.785 -6.019  1.00 19.34 ? 443 SER A OG  1 
ATOM   1158 N N   . ASP A 1 154 ? -40.654 23.544 -7.143  1.00 19.12 ? 444 ASP A N   1 
ATOM   1159 C CA  . ASP A 1 154 ? -41.172 24.610 -8.025  1.00 21.18 ? 444 ASP A CA  1 
ATOM   1160 C C   . ASP A 1 154 ? -42.632 25.006 -7.674  1.00 21.58 ? 444 ASP A C   1 
ATOM   1161 O O   . ASP A 1 154 ? -43.064 26.115 -8.007  1.00 21.32 ? 444 ASP A O   1 
ATOM   1162 C CB  . ASP A 1 154 ? -41.137 24.187 -9.498  1.00 21.05 ? 444 ASP A CB  1 
ATOM   1163 C CG  . ASP A 1 154 ? -39.849 23.426 -9.903  1.00 22.77 ? 444 ASP A CG  1 
ATOM   1164 O OD1 . ASP A 1 154 ? -39.168 23.874 -10.850 1.00 22.71 ? 444 ASP A OD1 1 
ATOM   1165 O OD2 . ASP A 1 154 ? -39.511 22.408 -9.261  1.00 20.72 ? 444 ASP A OD2 1 
ATOM   1166 N N   . SER A 1 155 ? -43.395 24.073 -7.094  1.00 19.83 ? 445 SER A N   1 
ATOM   1167 C CA  . SER A 1 155 ? -44.823 24.236 -6.780  1.00 20.62 ? 445 SER A CA  1 
ATOM   1168 C C   . SER A 1 155 ? -45.013 24.806 -5.390  1.00 20.41 ? 445 SER A C   1 
ATOM   1169 O O   . SER A 1 155 ? -46.127 24.941 -4.950  1.00 21.95 ? 445 SER A O   1 
ATOM   1170 C CB  . SER A 1 155 ? -45.515 22.856 -6.860  1.00 21.11 ? 445 SER A CB  1 
ATOM   1171 O OG  . SER A 1 155 ? -45.359 22.314 -8.137  1.00 22.20 ? 445 SER A OG  1 
ATOM   1172 N N   . ILE A 1 156 ? -43.915 25.086 -4.668  1.00 20.01 ? 446 ILE A N   1 
ATOM   1173 C CA  . ILE A 1 156 ? -43.990 25.618 -3.301  1.00 20.28 ? 446 ILE A CA  1 
ATOM   1174 C C   . ILE A 1 156 ? -43.594 27.069 -3.384  1.00 21.26 ? 446 ILE A C   1 
ATOM   1175 O O   . ILE A 1 156 ? -42.438 27.371 -3.705  1.00 22.33 ? 446 ILE A O   1 
ATOM   1176 C CB  . ILE A 1 156 ? -43.065 24.892 -2.298  1.00 20.35 ? 446 ILE A CB  1 
ATOM   1177 C CG1 . ILE A 1 156 ? -43.365 23.388 -2.264  1.00 20.76 ? 446 ILE A CG1 1 
ATOM   1178 C CG2 . ILE A 1 156 ? -43.173 25.555 -0.857  1.00 21.03 ? 446 ILE A CG2 1 
ATOM   1179 C CD1 . ILE A 1 156 ? -44.787 22.994 -2.225  1.00 21.32 ? 446 ILE A CD1 1 
ATOM   1180 N N   . LEU A 1 157 ? -44.541 27.947 -3.116  1.00 20.60 ? 447 LEU A N   1 
ATOM   1181 C CA  . LEU A 1 157 ? -44.277 29.396 -3.098  1.00 20.54 ? 447 LEU A CA  1 
ATOM   1182 C C   . LEU A 1 157 ? -44.233 29.931 -1.664  1.00 20.79 ? 447 LEU A C   1 
ATOM   1183 O O   . LEU A 1 157 ? -44.759 29.321 -0.756  1.00 21.77 ? 447 LEU A O   1 
ATOM   1184 C CB  . LEU A 1 157 ? -45.308 30.172 -3.935  1.00 21.11 ? 447 LEU A CB  1 
ATOM   1185 C CG  . LEU A 1 157 ? -45.360 29.788 -5.433  1.00 23.50 ? 447 LEU A CG  1 
ATOM   1186 C CD1 . LEU A 1 157 ? -46.519 30.505 -6.171  1.00 25.65 ? 447 LEU A CD1 1 
ATOM   1187 C CD2 . LEU A 1 157 ? -44.027 30.006 -6.139  1.00 27.91 ? 447 LEU A CD2 1 
ATOM   1188 N N   . LEU A 1 158 ? -43.547 31.057 -1.472  1.00 20.32 ? 448 LEU A N   1 
ATOM   1189 C CA  . LEU A 1 158 ? -43.327 31.608 -0.131  1.00 20.76 ? 448 LEU A CA  1 
ATOM   1190 C C   . LEU A 1 158 ? -43.794 33.068 -0.049  1.00 22.05 ? 448 LEU A C   1 
ATOM   1191 O O   . LEU A 1 158 ? -43.637 33.827 -0.998  1.00 20.88 ? 448 LEU A O   1 
ATOM   1192 C CB  . LEU A 1 158 ? -41.853 31.524 0.183   1.00 21.23 ? 448 LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 158 ? -41.258 30.132 0.236   1.00 23.24 ? 448 LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 158 ? -39.816 30.268 0.477   1.00 27.66 ? 448 LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 158 ? -41.949 29.366 1.371   1.00 25.50 ? 448 LEU A CD2 1 
ATOM   1196 N N   . THR A 1 159 ? -44.490 33.396 1.026   1.00 23.01 ? 449 THR A N   1 
ATOM   1197 C CA  . THR A 1 159 ? -44.877 34.786 1.295   1.00 23.61 ? 449 THR A CA  1 
ATOM   1198 C C   . THR A 1 159 ? -43.649 35.574 1.747   1.00 23.80 ? 449 THR A C   1 
ATOM   1199 O O   . THR A 1 159 ? -42.575 35.041 2.043   1.00 23.13 ? 449 THR A O   1 
ATOM   1200 C CB  . THR A 1 159 ? -45.951 34.860 2.385   1.00 24.87 ? 449 THR A CB  1 
ATOM   1201 O OG1 . THR A 1 159 ? -45.370 34.492 3.657   1.00 22.39 ? 449 THR A OG1 1 
ATOM   1202 C CG2 . THR A 1 159 ? -47.152 33.971 2.067   1.00 26.00 ? 449 THR A CG2 1 
ATOM   1203 N N   . HIS A 1 160 ? -43.807 36.892 1.819   1.00 24.44 ? 450 HIS A N   1 
ATOM   1204 C CA  . HIS A 1 160 ? -42.729 37.771 2.183   1.00 24.31 ? 450 HIS A CA  1 
ATOM   1205 C C   . HIS A 1 160 ? -42.197 37.448 3.596   1.00 23.99 ? 450 HIS A C   1 
ATOM   1206 O O   . HIS A 1 160 ? -41.024 37.668 3.885   1.00 24.29 ? 450 HIS A O   1 
ATOM   1207 C CB  . HIS A 1 160 ? -43.213 39.222 2.094   1.00 25.71 ? 450 HIS A CB  1 
ATOM   1208 C CG  . HIS A 1 160 ? -44.277 39.550 3.083   1.00 27.64 ? 450 HIS A CG  1 
ATOM   1209 N ND1 . HIS A 1 160 ? -44.003 40.193 4.274   1.00 29.92 ? 450 HIS A ND1 1 
ATOM   1210 C CD2 . HIS A 1 160 ? -45.607 39.303 3.080   1.00 30.36 ? 450 HIS A CD2 1 
ATOM   1211 C CE1 . HIS A 1 160 ? -45.122 40.330 4.962   1.00 31.44 ? 450 HIS A CE1 1 
ATOM   1212 N NE2 . HIS A 1 160 ? -46.113 39.808 4.260   1.00 31.80 ? 450 HIS A NE2 1 
ATOM   1213 N N   . ASP A 1 161 ? -43.076 36.922 4.447   1.00 22.42 ? 451 ASP A N   1 
ATOM   1214 C CA  . ASP A 1 161 ? -42.713 36.580 5.836   1.00 23.72 ? 451 ASP A CA  1 
ATOM   1215 C C   . ASP A 1 161 ? -42.457 35.114 6.054   1.00 22.91 ? 451 ASP A C   1 
ATOM   1216 O O   . ASP A 1 161 ? -42.438 34.647 7.189   1.00 23.35 ? 451 ASP A O   1 
ATOM   1217 C CB  . ASP A 1 161 ? -43.742 37.075 6.853   1.00 24.10 ? 451 ASP A CB  1 
ATOM   1218 C CG  . ASP A 1 161 ? -45.160 36.563 6.607   1.00 26.69 ? 451 ASP A CG  1 
ATOM   1219 O OD1 . ASP A 1 161 ? -45.541 36.204 5.484   1.00 26.90 ? 451 ASP A OD1 1 
ATOM   1220 O OD2 . ASP A 1 161 ? -45.950 36.605 7.580   1.00 30.32 ? 451 ASP A OD2 1 
ATOM   1221 N N   . GLY A 1 162 ? -42.256 34.381 4.972   1.00 23.35 ? 452 GLY A N   1 
ATOM   1222 C CA  . GLY A 1 162 ? -41.774 33.009 5.068   1.00 23.74 ? 452 GLY A CA  1 
ATOM   1223 C C   . GLY A 1 162 ? -42.800 31.913 5.200   1.00 24.38 ? 452 GLY A C   1 
ATOM   1224 O O   . GLY A 1 162 ? -42.430 30.774 5.560   1.00 25.14 ? 452 GLY A O   1 
ATOM   1225 N N   . ARG A 1 163 ? -44.082 32.200 4.949   1.00 23.50 ? 453 ARG A N   1 
ATOM   1226 C CA  . ARG A 1 163 ? -45.100 31.148 4.932   1.00 24.53 ? 453 ARG A CA  1 
ATOM   1227 C C   . ARG A 1 163 ? -45.197 30.376 3.626   1.00 24.88 ? 453 ARG A C   1 
ATOM   1228 O O   . ARG A 1 163 ? -45.164 30.974 2.569   1.00 25.79 ? 453 ARG A O   1 
ATOM   1229 C CB  . ARG A 1 163 ? -46.483 31.715 5.296   1.00 24.46 ? 453 ARG A CB  1 
ATOM   1230 C CG  . ARG A 1 163 ? -46.501 32.223 6.761   1.00 25.43 ? 453 ARG A CG  1 
ATOM   1231 C CD  . ARG A 1 163 ? -47.770 32.919 7.158   1.00 27.67 ? 453 ARG A CD  1 
ATOM   1232 N NE  . ARG A 1 163 ? -47.816 34.195 6.470   1.00 31.65 ? 453 ARG A NE  1 
ATOM   1233 C CZ  . ARG A 1 163 ? -48.706 34.556 5.553   1.00 32.32 ? 453 ARG A CZ  1 
ATOM   1234 N NH1 . ARG A 1 163 ? -49.731 33.762 5.219   1.00 36.04 ? 453 ARG A NH1 1 
ATOM   1235 N NH2 . ARG A 1 163 ? -48.569 35.748 4.979   1.00 33.24 ? 453 ARG A NH2 1 
ATOM   1236 N N   . VAL A 1 164 ? -45.356 29.057 3.731   1.00 22.92 ? 454 VAL A N   1 
ATOM   1237 C CA  . VAL A 1 164 ? -45.525 28.145 2.587   1.00 24.99 ? 454 VAL A CA  1 
ATOM   1238 C C   . VAL A 1 164 ? -46.885 28.169 1.979   1.00 24.91 ? 454 VAL A C   1 
ATOM   1239 O O   . VAL A 1 164 ? -47.908 28.104 2.689   1.00 25.10 ? 454 VAL A O   1 
ATOM   1240 C CB  . VAL A 1 164 ? -45.280 26.656 2.978   1.00 26.62 ? 454 VAL A CB  1 
ATOM   1241 C CG1 . VAL A 1 164 ? -45.972 25.670 1.983   1.00 28.16 ? 454 VAL A CG1 1 
ATOM   1242 C CG2 . VAL A 1 164 ? -43.886 26.406 3.021   1.00 29.76 ? 454 VAL A CG2 1 
ATOM   1243 N N   . LYS A 1 165 ? -46.923 28.260 0.648   1.00 23.99 ? 455 LYS A N   1 
ATOM   1244 C CA  . LYS A 1 165 ? -48.160 28.123 -0.098  1.00 23.91 ? 455 LYS A CA  1 
ATOM   1245 C C   . LYS A 1 165 ? -48.007 27.109 -1.249  1.00 24.84 ? 455 LYS A C   1 
ATOM   1246 O O   . LYS A 1 165 ? -47.276 27.379 -2.232  1.00 26.82 ? 455 LYS A O   1 
ATOM   1247 C CB  . LYS A 1 165 ? -48.603 29.477 -0.670  1.00 25.00 ? 455 LYS A CB  1 
ATOM   1248 C CG  . LYS A 1 165 ? -48.772 30.560 0.356   1.00 26.97 ? 455 LYS A CG  1 
ATOM   1249 C CD  . LYS A 1 165 ? -50.180 30.728 0.823   1.00 24.70 ? 455 LYS A CD  1 
ATOM   1250 C CE  . LYS A 1 165 ? -50.243 31.815 1.909   1.00 27.36 ? 455 LYS A CE  1 
ATOM   1251 N NZ  . LYS A 1 165 ? -51.606 31.858 2.514   1.00 29.06 ? 455 LYS A NZ  1 
ATOM   1252 N N   . LEU A 1 166 ? -48.666 25.948 -1.133  1.00 21.36 ? 456 LEU A N   1 
ATOM   1253 C CA  . LEU A 1 166 ? -48.700 25.005 -2.212  1.00 21.83 ? 456 LEU A CA  1 
ATOM   1254 C C   . LEU A 1 166 ? -49.408 25.659 -3.396  1.00 20.77 ? 456 LEU A C   1 
ATOM   1255 O O   . LEU A 1 166 ? -50.494 26.261 -3.213  1.00 21.71 ? 456 LEU A O   1 
ATOM   1256 C CB  . LEU A 1 166 ? -49.435 23.737 -1.776  1.00 22.14 ? 456 LEU A CB  1 
ATOM   1257 C CG  . LEU A 1 166 ? -49.533 22.591 -2.751  1.00 23.12 ? 456 LEU A CG  1 
ATOM   1258 C CD1 . LEU A 1 166 ? -48.164 22.135 -3.368  1.00 23.96 ? 456 LEU A CD1 1 
ATOM   1259 C CD2 . LEU A 1 166 ? -50.242 21.430 -2.015  1.00 23.61 ? 456 LEU A CD2 1 
ATOM   1260 N N   . SER A 1 167 ? -48.785 25.552 -4.578  1.00 21.39 ? 457 SER A N   1 
ATOM   1261 C CA  A SER A 1 167 ? -49.256 26.243 -5.775  0.50 22.07 ? 457 SER A CA  1 
ATOM   1262 C CA  B SER A 1 167 ? -49.229 26.253 -5.779  0.50 22.23 ? 457 SER A CA  1 
ATOM   1263 C C   . SER A 1 167 ? -49.294 25.316 -6.993  1.00 22.48 ? 457 SER A C   1 
ATOM   1264 O O   . SER A 1 167 ? -49.033 24.096 -6.899  1.00 21.75 ? 457 SER A O   1 
ATOM   1265 C CB  A SER A 1 167 ? -48.359 27.469 -6.028  0.50 23.33 ? 457 SER A CB  1 
ATOM   1266 C CB  B SER A 1 167 ? -48.271 27.436 -6.033  0.50 23.53 ? 457 SER A CB  1 
ATOM   1267 O OG  A SER A 1 167 ? -48.370 28.354 -4.921  0.50 25.75 ? 457 SER A OG  1 
ATOM   1268 O OG  B SER A 1 167 ? -48.774 28.321 -7.023  0.50 26.89 ? 457 SER A OG  1 
ATOM   1269 N N   . ASP A 1 168 ? -49.647 25.849 -8.148  1.00 23.12 ? 458 ASP A N   1 
ATOM   1270 C CA  . ASP A 1 168 ? -49.533 25.069 -9.394  1.00 23.32 ? 458 ASP A CA  1 
ATOM   1271 C C   . ASP A 1 168 ? -50.366 23.776 -9.413  1.00 21.97 ? 458 ASP A C   1 
ATOM   1272 O O   . ASP A 1 168 ? -49.856 22.674 -9.623  1.00 21.63 ? 458 ASP A O   1 
ATOM   1273 C CB  . ASP A 1 168 ? -48.033 24.798 -9.702  1.00 24.10 ? 458 ASP A CB  1 
ATOM   1274 C CG  . ASP A 1 168 ? -47.269 26.071 -10.106 1.00 30.81 ? 458 ASP A CG  1 
ATOM   1275 O OD1 . ASP A 1 168 ? -47.938 27.096 -10.346 1.00 34.92 ? 458 ASP A OD1 1 
ATOM   1276 O OD2 . ASP A 1 168 ? -46.025 26.048 -10.262 1.00 33.78 ? 458 ASP A OD2 1 
ATOM   1277 N N   . PHE A 1 169 ? -51.655 23.955 -9.265  1.00 21.08 ? 459 PHE A N   1 
ATOM   1278 C CA  . PHE A 1 169 ? -52.672 22.876 -9.345  1.00 20.19 ? 459 PHE A CA  1 
ATOM   1279 C C   . PHE A 1 169 ? -53.115 22.517 -10.783 1.00 20.10 ? 459 PHE A C   1 
ATOM   1280 O O   . PHE A 1 169 ? -54.160 21.864 -10.973 1.00 21.51 ? 459 PHE A O   1 
ATOM   1281 C CB  . PHE A 1 169 ? -53.885 23.264 -8.488  1.00 20.16 ? 459 PHE A CB  1 
ATOM   1282 C CG  . PHE A 1 169 ? -53.656 23.121 -6.980  1.00 19.96 ? 459 PHE A CG  1 
ATOM   1283 C CD1 . PHE A 1 169 ? -54.203 22.062 -6.269  1.00 21.18 ? 459 PHE A CD1 1 
ATOM   1284 C CD2 . PHE A 1 169 ? -52.859 24.018 -6.312  1.00 21.26 ? 459 PHE A CD2 1 
ATOM   1285 C CE1 . PHE A 1 169 ? -54.018 21.933 -4.936  1.00 21.30 ? 459 PHE A CE1 1 
ATOM   1286 C CE2 . PHE A 1 169 ? -52.628 23.885 -4.954  1.00 20.58 ? 459 PHE A CE2 1 
ATOM   1287 C CZ  . PHE A 1 169 ? -53.196 22.855 -4.270  1.00 19.22 ? 459 PHE A CZ  1 
ATOM   1288 N N   . GLY A 1 170 ? -52.347 22.937 -11.767 1.00 20.86 ? 460 GLY A N   1 
ATOM   1289 C CA  . GLY A 1 170 ? -52.597 22.668 -13.171 1.00 21.29 ? 460 GLY A CA  1 
ATOM   1290 C C   . GLY A 1 170 ? -52.679 21.213 -13.582 1.00 20.97 ? 460 GLY A C   1 
ATOM   1291 O O   . GLY A 1 170 ? -53.177 20.912 -14.658 1.00 19.98 ? 460 GLY A O   1 
ATOM   1292 N N   . PHE A 1 171 ? -52.146 20.311 -12.745 1.00 21.52 ? 461 PHE A N   1 
ATOM   1293 C CA  . PHE A 1 171 ? -52.184 18.901 -12.993 1.00 21.66 ? 461 PHE A CA  1 
ATOM   1294 C C   . PHE A 1 171 ? -53.024 18.124 -11.989 1.00 21.33 ? 461 PHE A C   1 
ATOM   1295 O O   . PHE A 1 171 ? -52.982 16.913 -12.000 1.00 19.80 ? 461 PHE A O   1 
ATOM   1296 C CB  . PHE A 1 171 ? -50.746 18.316 -12.961 1.00 23.70 ? 461 PHE A CB  1 
ATOM   1297 C CG  . PHE A 1 171 ? -49.972 18.392 -14.264 1.00 26.89 ? 461 PHE A CG  1 
ATOM   1298 C CD1 . PHE A 1 171 ? -50.391 19.058 -15.387 1.00 29.15 ? 461 PHE A CD1 1 
ATOM   1299 C CD2 . PHE A 1 171 ? -48.733 17.760 -14.312 1.00 31.86 ? 461 PHE A CD2 1 
ATOM   1300 C CE1 . PHE A 1 171 ? -49.618 19.093 -16.584 1.00 27.71 ? 461 PHE A CE1 1 
ATOM   1301 C CE2 . PHE A 1 171 ? -47.951 17.773 -15.504 1.00 33.16 ? 461 PHE A CE2 1 
ATOM   1302 C CZ  . PHE A 1 171 ? -48.405 18.449 -16.631 1.00 31.07 ? 461 PHE A CZ  1 
ATOM   1303 N N   . CYS A 1 172 ? -53.857 18.786 -11.189 1.00 20.70 ? 462 CYS A N   1 
ATOM   1304 C CA  . CYS A 1 172 ? -54.567 18.100 -10.114 1.00 20.94 ? 462 CYS A CA  1 
ATOM   1305 C C   . CYS A 1 172 ? -55.738 17.272 -10.641 1.00 20.29 ? 462 CYS A C   1 
ATOM   1306 O O   . CYS A 1 172 ? -56.152 17.404 -11.809 1.00 20.71 ? 462 CYS A O   1 
ATOM   1307 C CB  . CYS A 1 172 ? -55.009 19.094 -9.030  1.00 20.36 ? 462 CYS A CB  1 
ATOM   1308 S SG  . CYS A 1 172 ? -56.462 20.144 -9.457  1.00 22.35 ? 462 CYS A SG  1 
ATOM   1309 N N   . ALA A 1 173 ? -56.210 16.410 -9.759  1.00 19.57 ? 463 ALA A N   1 
ATOM   1310 C CA  . ALA A 1 173 ? -57.346 15.527 -9.989  1.00 20.22 ? 463 ALA A CA  1 
ATOM   1311 C C   . ALA A 1 173 ? -58.168 15.378 -8.724  1.00 20.72 ? 463 ALA A C   1 
ATOM   1312 O O   . ALA A 1 173 ? -57.728 15.738 -7.626  1.00 19.20 ? 463 ALA A O   1 
ATOM   1313 C CB  . ALA A 1 173 ? -56.851 14.156 -10.448 1.00 20.20 ? 463 ALA A CB  1 
ATOM   1314 N N   . GLN A 1 174 ? -59.380 14.866 -8.873  1.00 21.80 ? 464 GLN A N   1 
ATOM   1315 C CA  . GLN A 1 174 ? -60.168 14.552 -7.679  1.00 22.42 ? 464 GLN A CA  1 
ATOM   1316 C C   . GLN A 1 174 ? -60.749 13.166 -7.851  1.00 22.71 ? 464 GLN A C   1 
ATOM   1317 O O   . GLN A 1 174 ? -61.399 12.879 -8.864  1.00 23.50 ? 464 GLN A O   1 
ATOM   1318 C CB  . GLN A 1 174 ? -61.256 15.601 -7.416  1.00 23.14 ? 464 GLN A CB  1 
ATOM   1319 C CG  . GLN A 1 174 ? -61.861 15.505 -6.006  1.00 23.94 ? 464 GLN A CG  1 
ATOM   1320 C CD  . GLN A 1 174 ? -62.803 16.661 -5.684  1.00 24.84 ? 464 GLN A CD  1 
ATOM   1321 O OE1 . GLN A 1 174 ? -63.196 17.426 -6.574  1.00 31.66 ? 464 GLN A OE1 1 
ATOM   1322 N NE2 . GLN A 1 174 ? -63.189 16.772 -4.417  1.00 26.21 ? 464 GLN A NE2 1 
ATOM   1323 N N   . VAL A 1 175 ? -60.513 12.315 -6.871  1.00 22.95 ? 465 VAL A N   1 
ATOM   1324 C CA  . VAL A 1 175 ? -61.146 10.994 -6.795  1.00 23.28 ? 465 VAL A CA  1 
ATOM   1325 C C   . VAL A 1 175 ? -62.389 11.019 -5.882  1.00 24.47 ? 465 VAL A C   1 
ATOM   1326 O O   . VAL A 1 175 ? -62.545 11.898 -5.007  1.00 23.95 ? 465 VAL A O   1 
ATOM   1327 C CB  . VAL A 1 175 ? -60.141 9.893  -6.358  1.00 22.71 ? 465 VAL A CB  1 
ATOM   1328 C CG1 . VAL A 1 175 ? -59.019 9.769  -7.395  1.00 23.94 ? 465 VAL A CG1 1 
ATOM   1329 C CG2 . VAL A 1 175 ? -59.567 10.138 -4.932  1.00 23.69 ? 465 VAL A CG2 1 
ATOM   1330 N N   . SER A 1 176 ? -63.246 10.023 -6.086  1.00 24.91 ? 466 SER A N   1 
ATOM   1331 C CA  . SER A 1 176 ? -64.548 9.962  -5.426  1.00 25.93 ? 466 SER A CA  1 
ATOM   1332 C C   . SER A 1 176 ? -64.859 8.515  -5.049  1.00 26.63 ? 466 SER A C   1 
ATOM   1333 O O   . SER A 1 176 ? -64.133 7.612  -5.439  1.00 26.46 ? 466 SER A O   1 
ATOM   1334 C CB  . SER A 1 176 ? -65.589 10.482 -6.379  1.00 26.06 ? 466 SER A CB  1 
ATOM   1335 O OG  . SER A 1 176 ? -65.644 9.672  -7.540  1.00 26.72 ? 466 SER A OG  1 
ATOM   1336 N N   . LYS A 1 177 ? -65.943 8.298  -4.301  1.00 27.25 ? 467 LYS A N   1 
ATOM   1337 C CA  . LYS A 1 177 ? -66.386 6.939  -4.024  1.00 27.23 ? 467 LYS A CA  1 
ATOM   1338 C C   . LYS A 1 177 ? -66.618 6.229  -5.353  1.00 27.48 ? 467 LYS A C   1 
ATOM   1339 O O   . LYS A 1 177 ? -66.256 5.063  -5.513  1.00 27.99 ? 467 LYS A O   1 
ATOM   1340 C CB  . LYS A 1 177 ? -67.652 6.922  -3.152  1.00 27.81 ? 467 LYS A CB  1 
ATOM   1341 N N   . GLU A 1 178 ? -67.188 6.931  -6.322  1.00 27.41 ? 468 GLU A N   1 
ATOM   1342 C CA  . GLU A 1 178 ? -67.545 6.301  -7.606  1.00 27.63 ? 468 GLU A CA  1 
ATOM   1343 C C   . GLU A 1 178 ? -66.291 5.971  -8.449  1.00 27.68 ? 468 GLU A C   1 
ATOM   1344 O O   . GLU A 1 178 ? -66.217 4.902  -9.076  1.00 28.13 ? 468 GLU A O   1 
ATOM   1345 C CB  . GLU A 1 178 ? -68.498 7.195  -8.409  1.00 27.79 ? 468 GLU A CB  1 
ATOM   1346 N N   . VAL A 1 179 ? -65.313 6.880  -8.455  1.00 26.90 ? 469 VAL A N   1 
ATOM   1347 C CA  . VAL A 1 179 ? -64.097 6.723  -9.253  1.00 25.89 ? 469 VAL A CA  1 
ATOM   1348 C C   . VAL A 1 179 ? -62.916 6.994  -8.318  1.00 24.96 ? 469 VAL A C   1 
ATOM   1349 O O   . VAL A 1 179 ? -62.397 8.092  -8.302  1.00 23.33 ? 469 VAL A O   1 
ATOM   1350 C CB  . VAL A 1 179 ? -64.099 7.719  -10.417 1.00 25.85 ? 469 VAL A CB  1 
ATOM   1351 C CG1 . VAL A 1 179 ? -62.854 7.559  -11.289 1.00 25.94 ? 469 VAL A CG1 1 
ATOM   1352 C CG2 . VAL A 1 179 ? -65.399 7.577  -11.251 1.00 27.11 ? 469 VAL A CG2 1 
ATOM   1353 N N   . PRO A 1 180 ? -62.560 6.011  -7.485  1.00 24.51 ? 470 PRO A N   1 
ATOM   1354 C CA  . PRO A 1 180 ? -61.604 6.232  -6.402  1.00 24.46 ? 470 PRO A CA  1 
ATOM   1355 C C   . PRO A 1 180 ? -60.119 6.327  -6.799  1.00 23.30 ? 470 PRO A C   1 
ATOM   1356 O O   . PRO A 1 180 ? -59.293 6.703  -5.967  1.00 22.98 ? 470 PRO A O   1 
ATOM   1357 C CB  . PRO A 1 180 ? -61.824 5.020  -5.495  1.00 25.25 ? 470 PRO A CB  1 
ATOM   1358 C CG  . PRO A 1 180 ? -62.309 3.964  -6.375  1.00 25.87 ? 470 PRO A CG  1 
ATOM   1359 C CD  . PRO A 1 180 ? -63.091 4.628  -7.483  1.00 25.83 ? 470 PRO A CD  1 
ATOM   1360 N N   . ARG A 1 181 ? -59.778 5.988  -8.034  1.00 22.51 ? 471 ARG A N   1 
ATOM   1361 C CA  . ARG A 1 181 ? -58.374 6.033  -8.470  1.00 23.14 ? 471 ARG A CA  1 
ATOM   1362 C C   . ARG A 1 181 ? -58.256 6.668  -9.846  1.00 22.54 ? 471 ARG A C   1 
ATOM   1363 O O   . ARG A 1 181 ? -59.221 6.630  -10.630 1.00 22.11 ? 471 ARG A O   1 
ATOM   1364 C CB  . ARG A 1 181 ? -57.769 4.614  -8.556  1.00 23.44 ? 471 ARG A CB  1 
ATOM   1365 C CG  . ARG A 1 181 ? -58.051 3.667  -7.395  1.00 28.38 ? 471 ARG A CG  1 
ATOM   1366 C CD  . ARG A 1 181 ? -56.820 3.235  -6.646  1.00 33.83 ? 471 ARG A CD  1 
ATOM   1367 N NE  . ARG A 1 181 ? -56.623 4.084  -5.479  1.00 36.58 ? 471 ARG A NE  1 
ATOM   1368 C CZ  . ARG A 1 181 ? -55.514 4.171  -4.730  1.00 36.98 ? 471 ARG A CZ  1 
ATOM   1369 N NH1 . ARG A 1 181 ? -54.419 3.445  -4.961  1.00 37.90 ? 471 ARG A NH1 1 
ATOM   1370 N NH2 . ARG A 1 181 ? -55.520 5.009  -3.717  1.00 33.71 ? 471 ARG A NH2 1 
ATOM   1371 N N   . ARG A 1 182 ? -57.069 7.222  -10.140 1.00 20.55 ? 472 ARG A N   1 
ATOM   1372 C CA  . ARG A 1 182 ? -56.715 7.687  -11.476 1.00 21.51 ? 472 ARG A CA  1 
ATOM   1373 C C   . ARG A 1 182 ? -55.701 6.734  -12.067 1.00 21.98 ? 472 ARG A C   1 
ATOM   1374 O O   . ARG A 1 182 ? -55.030 6.003  -11.345 1.00 22.89 ? 472 ARG A O   1 
ATOM   1375 C CB  . ARG A 1 182 ? -56.151 9.130  -11.516 1.00 21.98 ? 472 ARG A CB  1 
ATOM   1376 C CG  . ARG A 1 182 ? -57.009 10.237 -10.928 1.00 23.18 ? 472 ARG A CG  1 
ATOM   1377 C CD  . ARG A 1 182 ? -58.460 10.303 -11.428 1.00 25.12 ? 472 ARG A CD  1 
ATOM   1378 N NE  . ARG A 1 182 ? -58.593 10.575 -12.864 1.00 26.66 ? 472 ARG A NE  1 
ATOM   1379 C CZ  . ARG A 1 182 ? -59.768 10.606 -13.496 1.00 29.19 ? 472 ARG A CZ  1 
ATOM   1380 N NH1 . ARG A 1 182 ? -60.879 10.368 -12.824 1.00 30.09 ? 472 ARG A NH1 1 
ATOM   1381 N NH2 . ARG A 1 182 ? -59.843 10.850 -14.800 1.00 29.41 ? 472 ARG A NH2 1 
ATOM   1382 N N   . LYS A 1 183 ? -55.570 6.758  -13.387 1.00 23.41 ? 473 LYS A N   1 
ATOM   1383 C CA  . LYS A 1 183 ? -54.574 5.925  -14.066 1.00 25.63 ? 473 LYS A CA  1 
ATOM   1384 C C   . LYS A 1 183 ? -53.555 6.732  -14.909 1.00 26.46 ? 473 LYS A C   1 
ATOM   1385 O O   . LYS A 1 183 ? -52.535 6.165  -15.423 1.00 28.93 ? 473 LYS A O   1 
ATOM   1386 C CB  . LYS A 1 183 ? -55.291 4.856  -14.915 1.00 26.11 ? 473 LYS A CB  1 
ATOM   1387 C CG  . LYS A 1 183 ? -54.358 3.877  -15.595 1.00 30.03 ? 473 LYS A CG  1 
HETATM 1388 N N   . SEP A 1 184 ? -53.768 8.045  -14.972 1.00 24.84 ? 474 SEP A N   1 
HETATM 1389 C CA  . SEP A 1 184 ? -53.072 8.899  -15.927 1.00 22.79 ? 474 SEP A CA  1 
HETATM 1390 C CB  . SEP A 1 184 ? -53.818 10.208 -16.050 1.00 22.75 ? 474 SEP A CB  1 
HETATM 1391 O OG  . SEP A 1 184 ? -55.156 9.906  -16.276 1.00 23.49 ? 474 SEP A OG  1 
HETATM 1392 C C   . SEP A 1 184 ? -51.617 9.159  -15.571 1.00 22.34 ? 474 SEP A C   1 
HETATM 1393 O O   . SEP A 1 184 ? -51.269 9.473  -14.415 1.00 21.14 ? 474 SEP A O   1 
HETATM 1394 P P   . SEP A 1 184 ? -56.185 11.077 -15.948 1.00 23.21 ? 474 SEP A P   1 
HETATM 1395 O O1P . SEP A 1 184 ? -57.531 10.319 -16.359 1.00 23.05 ? 474 SEP A O1P 1 
HETATM 1396 O O2P . SEP A 1 184 ? -56.351 11.402 -14.426 1.00 22.68 ? 474 SEP A O2P 1 
HETATM 1397 O O3P . SEP A 1 184 ? -55.902 12.340 -16.869 1.00 22.86 ? 474 SEP A O3P 1 
ATOM   1398 N N   . LEU A 1 185 ? -50.756 9.038  -16.575 1.00 20.52 ? 475 LEU A N   1 
ATOM   1399 C CA  . LEU A 1 185 ? -49.326 9.245  -16.367 1.00 21.06 ? 475 LEU A CA  1 
ATOM   1400 C C   . LEU A 1 185 ? -49.016 10.705 -16.553 1.00 20.24 ? 475 LEU A C   1 
ATOM   1401 O O   . LEU A 1 185 ? -48.852 11.196 -17.675 1.00 20.49 ? 475 LEU A O   1 
ATOM   1402 C CB  . LEU A 1 185 ? -48.514 8.316  -17.272 1.00 21.21 ? 475 LEU A CB  1 
ATOM   1403 C CG  . LEU A 1 185 ? -46.978 8.351  -17.302 1.00 23.12 ? 475 LEU A CG  1 
ATOM   1404 C CD1 . LEU A 1 185 ? -46.315 8.561  -15.974 1.00 25.83 ? 475 LEU A CD1 1 
ATOM   1405 C CD2 . LEU A 1 185 ? -46.442 7.139  -18.057 1.00 23.16 ? 475 LEU A CD2 1 
ATOM   1406 N N   A VAL A 1 186 ? -48.943 11.407 -15.423 0.50 20.08 ? 476 VAL A N   1 
ATOM   1407 N N   B VAL A 1 186 ? -48.931 11.410 -15.431 0.50 20.10 ? 476 VAL A N   1 
ATOM   1408 C CA  A VAL A 1 186 ? -48.796 12.865 -15.385 0.50 19.18 ? 476 VAL A CA  1 
ATOM   1409 C CA  B VAL A 1 186 ? -48.758 12.858 -15.425 0.50 19.28 ? 476 VAL A CA  1 
ATOM   1410 C C   A VAL A 1 186 ? -47.939 13.291 -14.205 0.50 19.39 ? 476 VAL A C   1 
ATOM   1411 C C   B VAL A 1 186 ? -47.889 13.253 -14.241 0.50 19.39 ? 476 VAL A C   1 
ATOM   1412 O O   A VAL A 1 186 ? -48.086 12.760 -13.102 0.50 18.75 ? 476 VAL A O   1 
ATOM   1413 O O   B VAL A 1 186 ? -47.958 12.642 -13.178 0.50 19.11 ? 476 VAL A O   1 
ATOM   1414 C CB  A VAL A 1 186 ? -50.157 13.592 -15.274 0.50 19.42 ? 476 VAL A CB  1 
ATOM   1415 C CB  B VAL A 1 186 ? -50.099 13.605 -15.297 0.50 19.39 ? 476 VAL A CB  1 
ATOM   1416 C CG1 A VAL A 1 186 ? -51.019 13.064 -14.101 0.50 17.50 ? 476 VAL A CG1 1 
ATOM   1417 C CG1 B VAL A 1 186 ? -49.934 15.047 -15.680 0.50 20.36 ? 476 VAL A CG1 1 
ATOM   1418 C CG2 A VAL A 1 186 ? -49.947 15.079 -15.117 0.50 20.56 ? 476 VAL A CG2 1 
ATOM   1419 C CG2 B VAL A 1 186 ? -51.190 12.987 -16.176 0.50 18.08 ? 476 VAL A CG2 1 
ATOM   1420 N N   . GLY A 1 187 ? -47.114 14.310 -14.416 1.00 19.77 ? 477 GLY A N   1 
ATOM   1421 C CA  . GLY A 1 187 ? -46.315 14.877 -13.325 1.00 20.16 ? 477 GLY A CA  1 
ATOM   1422 C C   . GLY A 1 187 ? -45.004 15.345 -13.891 1.00 20.88 ? 477 GLY A C   1 
ATOM   1423 O O   . GLY A 1 187 ? -44.915 15.655 -15.099 1.00 22.40 ? 477 GLY A O   1 
ATOM   1424 N N   . THR A 1 188 ? -43.936 15.282 -13.081 1.00 20.00 ? 478 THR A N   1 
ATOM   1425 C CA  . THR A 1 188 ? -42.653 15.715 -13.538 1.00 18.84 ? 478 THR A CA  1 
ATOM   1426 C C   . THR A 1 188 ? -41.735 14.511 -13.297 1.00 19.46 ? 478 THR A C   1 
ATOM   1427 O O   . THR A 1 188 ? -41.632 14.060 -12.159 1.00 19.75 ? 478 THR A O   1 
ATOM   1428 C CB  . THR A 1 188 ? -42.188 16.974 -12.784 1.00 20.85 ? 478 THR A CB  1 
ATOM   1429 O OG1 . THR A 1 188 ? -43.182 18.008 -12.934 1.00 19.49 ? 478 THR A OG1 1 
ATOM   1430 C CG2 . THR A 1 188 ? -40.868 17.432 -13.316 1.00 20.08 ? 478 THR A CG2 1 
ATOM   1431 N N   . PRO A 1 189 ? -41.154 13.936 -14.367 1.00 19.42 ? 479 PRO A N   1 
ATOM   1432 C CA  . PRO A 1 189 ? -40.459 12.656 -14.344 1.00 18.60 ? 479 PRO A CA  1 
ATOM   1433 C C   . PRO A 1 189 ? -39.698 12.291 -13.045 1.00 18.50 ? 479 PRO A C   1 
ATOM   1434 O O   . PRO A 1 189 ? -40.004 11.286 -12.405 1.00 18.39 ? 479 PRO A O   1 
ATOM   1435 C CB  . PRO A 1 189 ? -39.517 12.773 -15.559 1.00 18.44 ? 479 PRO A CB  1 
ATOM   1436 C CG  . PRO A 1 189 ? -40.342 13.451 -16.536 1.00 20.41 ? 479 PRO A CG  1 
ATOM   1437 C CD  . PRO A 1 189 ? -41.135 14.480 -15.750 1.00 19.85 ? 479 PRO A CD  1 
ATOM   1438 N N   . TYR A 1 190 ? -38.773 13.134 -12.612 1.00 17.82 ? 480 TYR A N   1 
ATOM   1439 C CA  . TYR A 1 190 ? -37.919 12.795 -11.459 1.00 18.53 ? 480 TYR A CA  1 
ATOM   1440 C C   . TYR A 1 190 ? -38.681 12.707 -10.117 1.00 17.85 ? 480 TYR A C   1 
ATOM   1441 O O   . TYR A 1 190 ? -38.178 12.111 -9.181  1.00 17.20 ? 480 TYR A O   1 
ATOM   1442 C CB  . TYR A 1 190 ? -36.730 13.783 -11.336 1.00 18.76 ? 480 TYR A CB  1 
ATOM   1443 C CG  . TYR A 1 190 ? -36.034 13.912 -12.669 1.00 19.49 ? 480 TYR A CG  1 
ATOM   1444 C CD1 . TYR A 1 190 ? -36.295 14.986 -13.514 1.00 20.93 ? 480 TYR A CD1 1 
ATOM   1445 C CD2 . TYR A 1 190 ? -35.195 12.925 -13.113 1.00 21.45 ? 480 TYR A CD2 1 
ATOM   1446 C CE1 . TYR A 1 190 ? -35.672 15.087 -14.787 1.00 20.82 ? 480 TYR A CE1 1 
ATOM   1447 C CE2 . TYR A 1 190 ? -34.604 12.998 -14.383 1.00 20.08 ? 480 TYR A CE2 1 
ATOM   1448 C CZ  . TYR A 1 190 ? -34.849 14.104 -15.202 1.00 22.02 ? 480 TYR A CZ  1 
ATOM   1449 O OH  . TYR A 1 190 ? -34.249 14.156 -16.473 1.00 22.42 ? 480 TYR A OH  1 
ATOM   1450 N N   . TRP A 1 191 ? -39.837 13.342 -10.038 1.00 18.31 ? 481 TRP A N   1 
ATOM   1451 C CA  . TRP A 1 191 ? -40.661 13.371 -8.853  1.00 18.45 ? 481 TRP A CA  1 
ATOM   1452 C C   . TRP A 1 191 ? -41.791 12.346 -8.842  1.00 18.10 ? 481 TRP A C   1 
ATOM   1453 O O   . TRP A 1 191 ? -42.546 12.254 -7.879  1.00 17.00 ? 481 TRP A O   1 
ATOM   1454 C CB  . TRP A 1 191 ? -41.248 14.765 -8.735  1.00 18.81 ? 481 TRP A CB  1 
ATOM   1455 C CG  . TRP A 1 191 ? -40.236 15.784 -8.257  1.00 16.47 ? 481 TRP A CG  1 
ATOM   1456 C CD1 . TRP A 1 191 ? -40.012 16.214 -6.951  1.00 18.16 ? 481 TRP A CD1 1 
ATOM   1457 C CD2 . TRP A 1 191 ? -39.371 16.551 -9.079  1.00 16.86 ? 481 TRP A CD2 1 
ATOM   1458 N NE1 . TRP A 1 191 ? -39.056 17.183 -6.945  1.00 17.92 ? 481 TRP A NE1 1 
ATOM   1459 C CE2 . TRP A 1 191 ? -38.630 17.412 -8.223  1.00 19.34 ? 481 TRP A CE2 1 
ATOM   1460 C CE3 . TRP A 1 191 ? -39.148 16.616 -10.467 1.00 19.75 ? 481 TRP A CE3 1 
ATOM   1461 C CZ2 . TRP A 1 191 ? -37.714 18.349 -8.709  1.00 18.24 ? 481 TRP A CZ2 1 
ATOM   1462 C CZ3 . TRP A 1 191 ? -38.222 17.555 -10.962 1.00 20.64 ? 481 TRP A CZ3 1 
ATOM   1463 C CH2 . TRP A 1 191 ? -37.501 18.391 -10.085 1.00 19.68 ? 481 TRP A CH2 1 
ATOM   1464 N N   . MET A 1 192 ? -41.974 11.599 -9.937  1.00 17.46 ? 482 MET A N   1 
ATOM   1465 C CA  . MET A 1 192 ? -43.152 10.766 -10.040 1.00 18.92 ? 482 MET A CA  1 
ATOM   1466 C C   . MET A 1 192 ? -43.093 9.541  -9.163  1.00 18.48 ? 482 MET A C   1 
ATOM   1467 O O   . MET A 1 192 ? -42.031 8.913  -9.078  1.00 16.48 ? 482 MET A O   1 
ATOM   1468 C CB  . MET A 1 192 ? -43.329 10.259 -11.479 1.00 17.66 ? 482 MET A CB  1 
ATOM   1469 C CG  . MET A 1 192 ? -43.869 11.303 -12.408 1.00 20.03 ? 482 MET A CG  1 
ATOM   1470 S SD  . MET A 1 192 ? -43.753 10.713 -14.129 1.00 22.91 ? 482 MET A SD  1 
ATOM   1471 C CE  . MET A 1 192 ? -44.526 12.093 -14.900 1.00 22.79 ? 482 MET A CE  1 
ATOM   1472 N N   . ALA A 1 193 ? -44.255 9.144  -8.619  1.00 18.70 ? 483 ALA A N   1 
ATOM   1473 C CA  . ALA A 1 193 ? -44.377 7.942  -7.796  1.00 18.22 ? 483 ALA A CA  1 
ATOM   1474 C C   . ALA A 1 193 ? -44.245 6.681  -8.666  1.00 17.78 ? 483 ALA A C   1 
ATOM   1475 O O   . ALA A 1 193 ? -44.698 6.652  -9.821  1.00 18.22 ? 483 ALA A O   1 
ATOM   1476 C CB  . ALA A 1 193 ? -45.740 7.887  -7.077  1.00 18.01 ? 483 ALA A CB  1 
ATOM   1477 N N   . PRO A 1 194 ? -43.631 5.619  -8.124  1.00 17.44 ? 484 PRO A N   1 
ATOM   1478 C CA  . PRO A 1 194 ? -43.482 4.398  -8.942  1.00 17.40 ? 484 PRO A CA  1 
ATOM   1479 C C   . PRO A 1 194 ? -44.796 3.796  -9.459  1.00 16.70 ? 484 PRO A C   1 
ATOM   1480 O O   . PRO A 1 194 ? -44.836 3.300  -10.608 1.00 15.94 ? 484 PRO A O   1 
ATOM   1481 C CB  . PRO A 1 194 ? -42.775 3.393  -7.979  1.00 17.73 ? 484 PRO A CB  1 
ATOM   1482 C CG  . PRO A 1 194 ? -42.770 4.050  -6.671  1.00 20.83 ? 484 PRO A CG  1 
ATOM   1483 C CD  . PRO A 1 194 ? -43.078 5.467  -6.772  1.00 18.65 ? 484 PRO A CD  1 
ATOM   1484 N N   . GLU A 1 195 ? -45.879 3.857  -8.666  1.00 17.07 ? 485 GLU A N   1 
ATOM   1485 C CA  . GLU A 1 195 ? -47.174 3.317  -9.136  1.00 16.84 ? 485 GLU A CA  1 
ATOM   1486 C C   . GLU A 1 195 ? -47.755 4.096  -10.333 1.00 17.35 ? 485 GLU A C   1 
ATOM   1487 O O   . GLU A 1 195 ? -48.423 3.527  -11.216 1.00 16.83 ? 485 GLU A O   1 
ATOM   1488 C CB  . GLU A 1 195 ? -48.218 3.211  -8.041  1.00 17.17 ? 485 GLU A CB  1 
ATOM   1489 C CG  . GLU A 1 195 ? -48.671 4.517  -7.407  1.00 17.44 ? 485 GLU A CG  1 
ATOM   1490 C CD  . GLU A 1 195 ? -47.863 4.964  -6.233  1.00 17.70 ? 485 GLU A CD  1 
ATOM   1491 O OE1 . GLU A 1 195 ? -46.601 4.723  -6.165  1.00 18.30 ? 485 GLU A OE1 1 
ATOM   1492 O OE2 . GLU A 1 195 ? -48.467 5.691  -5.399  1.00 17.57 ? 485 GLU A OE2 1 
ATOM   1493 N N   . LEU A 1 196 ? -47.453 5.381  -10.348 1.00 17.55 ? 486 LEU A N   1 
ATOM   1494 C CA  . LEU A 1 196 ? -47.968 6.307  -11.350 1.00 17.94 ? 486 LEU A CA  1 
ATOM   1495 C C   . LEU A 1 196 ? -47.193 6.085  -12.652 1.00 18.21 ? 486 LEU A C   1 
ATOM   1496 O O   . LEU A 1 196 ? -47.791 5.937  -13.721 1.00 17.47 ? 486 LEU A O   1 
ATOM   1497 C CB  . LEU A 1 196 ? -47.898 7.726  -10.812 1.00 18.55 ? 486 LEU A CB  1 
ATOM   1498 C CG  . LEU A 1 196 ? -48.328 8.853  -11.741 1.00 19.42 ? 486 LEU A CG  1 
ATOM   1499 C CD1 . LEU A 1 196 ? -48.979 9.994  -10.978 1.00 19.12 ? 486 LEU A CD1 1 
ATOM   1500 C CD2 . LEU A 1 196 ? -47.113 9.330  -12.489 1.00 19.13 ? 486 LEU A CD2 1 
ATOM   1501 N N   . ILE A 1 197 ? -45.865 5.988  -12.548 1.00 18.10 ? 487 ILE A N   1 
ATOM   1502 C CA  . ILE A 1 197 ? -45.013 5.677  -13.702 1.00 18.59 ? 487 ILE A CA  1 
ATOM   1503 C C   . ILE A 1 197 ? -45.400 4.300  -14.309 1.00 20.19 ? 487 ILE A C   1 
ATOM   1504 O O   . ILE A 1 197 ? -45.350 4.065  -15.527 1.00 20.08 ? 487 ILE A O   1 
ATOM   1505 C CB  . ILE A 1 197 ? -43.525 5.602  -13.279 1.00 18.57 ? 487 ILE A CB  1 
ATOM   1506 C CG1 . ILE A 1 197 ? -42.978 6.960  -12.839 1.00 19.17 ? 487 ILE A CG1 1 
ATOM   1507 C CG2 . ILE A 1 197 ? -42.706 4.979  -14.443 1.00 19.25 ? 487 ILE A CG2 1 
ATOM   1508 C CD1 . ILE A 1 197 ? -41.697 6.888  -12.048 1.00 18.83 ? 487 ILE A CD1 1 
ATOM   1509 N N   . SER A 1 198 ? -45.792 3.395  -13.436 1.00 20.39 ? 488 SER A N   1 
ATOM   1510 C CA  . SER A 1 198 ? -46.190 2.029  -13.840 1.00 21.89 ? 488 SER A CA  1 
ATOM   1511 C C   . SER A 1 198 ? -47.560 1.988  -14.512 1.00 22.98 ? 488 SER A C   1 
ATOM   1512 O O   . SER A 1 198 ? -47.982 0.894  -14.917 1.00 24.85 ? 488 SER A O   1 
ATOM   1513 C CB  . SER A 1 198 ? -46.238 1.111  -12.625 1.00 20.34 ? 488 SER A CB  1 
ATOM   1514 O OG  . SER A 1 198 ? -44.998 0.992  -11.945 1.00 19.82 ? 488 SER A OG  1 
ATOM   1515 N N   . ARG A 1 199 ? -48.240 3.144  -14.590 1.00 24.28 ? 489 ARG A N   1 
ATOM   1516 C CA  . ARG A 1 199 ? -49.623 3.293  -15.085 1.00 24.81 ? 489 ARG A CA  1 
ATOM   1517 C C   . ARG A 1 199 ? -50.641 2.342  -14.420 1.00 24.93 ? 489 ARG A C   1 
ATOM   1518 O O   . ARG A 1 199 ? -51.490 1.719  -15.074 1.00 25.63 ? 489 ARG A O   1 
ATOM   1519 C CB  . ARG A 1 199 ? -49.655 3.186  -16.621 1.00 26.29 ? 489 ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 199 ? -49.372 4.537  -17.299 1.00 27.32 ? 489 ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 199 ? -50.647 5.411  -17.457 1.00 30.89 ? 489 ARG A CD  1 
ATOM   1522 N N   . LEU A 1 200 ? -50.544 2.276  -13.101 1.00 23.22 ? 490 LEU A N   1 
ATOM   1523 C CA  . LEU A 1 200 ? -51.460 1.570  -12.251 1.00 23.14 ? 490 LEU A CA  1 
ATOM   1524 C C   . LEU A 1 200 ? -52.468 2.541  -11.640 1.00 23.52 ? 490 LEU A C   1 
ATOM   1525 O O   . LEU A 1 200 ? -52.171 3.736  -11.483 1.00 23.77 ? 490 LEU A O   1 
ATOM   1526 C CB  . LEU A 1 200 ? -50.674 0.900  -11.127 1.00 22.73 ? 490 LEU A CB  1 
ATOM   1527 C CG  . LEU A 1 200 ? -49.826 -0.295 -11.579 1.00 22.48 ? 490 LEU A CG  1 
ATOM   1528 C CD1 . LEU A 1 200 ? -48.853 -0.648 -10.466 1.00 21.13 ? 490 LEU A CD1 1 
ATOM   1529 C CD2 . LEU A 1 200 ? -50.697 -1.487 -11.942 1.00 22.17 ? 490 LEU A CD2 1 
ATOM   1530 N N   . PRO A 1 201 ? -53.642 2.033  -11.263 1.00 24.03 ? 491 PRO A N   1 
ATOM   1531 C CA  . PRO A 1 201 ? -54.598 2.837  -10.488 1.00 23.71 ? 491 PRO A CA  1 
ATOM   1532 C C   . PRO A 1 201 ? -53.948 3.414  -9.241  1.00 22.80 ? 491 PRO A C   1 
ATOM   1533 O O   . PRO A 1 201 ? -53.412 2.681  -8.416  1.00 23.91 ? 491 PRO A O   1 
ATOM   1534 C CB  . PRO A 1 201 ? -55.710 1.824  -10.118 1.00 24.41 ? 491 PRO A CB  1 
ATOM   1535 C CG  . PRO A 1 201 ? -55.605 0.762  -11.120 1.00 25.04 ? 491 PRO A CG  1 
ATOM   1536 C CD  . PRO A 1 201 ? -54.159 0.678  -11.539 1.00 23.93 ? 491 PRO A CD  1 
ATOM   1537 N N   . TYR A 1 202 ? -53.987 4.730  -9.099  1.00 21.15 ? 492 TYR A N   1 
ATOM   1538 C CA  . TYR A 1 202 ? -53.354 5.365  -7.965  1.00 20.29 ? 492 TYR A CA  1 
ATOM   1539 C C   . TYR A 1 202 ? -54.292 6.406  -7.328  1.00 20.25 ? 492 TYR A C   1 
ATOM   1540 O O   . TYR A 1 202 ? -55.353 6.799  -7.891  1.00 19.75 ? 492 TYR A O   1 
ATOM   1541 C CB  . TYR A 1 202 ? -52.010 5.984  -8.391  1.00 19.98 ? 492 TYR A CB  1 
ATOM   1542 C CG  . TYR A 1 202 ? -52.159 7.094  -9.432  1.00 19.72 ? 492 TYR A CG  1 
ATOM   1543 C CD1 . TYR A 1 202 ? -52.600 8.360  -9.070  1.00 18.59 ? 492 TYR A CD1 1 
ATOM   1544 C CD2 . TYR A 1 202 ? -51.854 6.877  -10.748 1.00 19.45 ? 492 TYR A CD2 1 
ATOM   1545 C CE1 . TYR A 1 202 ? -52.753 9.342  -10.019 1.00 17.67 ? 492 TYR A CE1 1 
ATOM   1546 C CE2 . TYR A 1 202 ? -51.988 7.873  -11.710 1.00 19.88 ? 492 TYR A CE2 1 
ATOM   1547 C CZ  . TYR A 1 202 ? -52.455 9.098  -11.325 1.00 19.08 ? 492 TYR A CZ  1 
ATOM   1548 O OH  . TYR A 1 202 ? -52.607 10.075 -12.270 1.00 19.39 ? 492 TYR A OH  1 
ATOM   1549 N N   . GLY A 1 203 ? -53.888 6.833  -6.143  1.00 21.05 ? 493 GLY A N   1 
ATOM   1550 C CA  . GLY A 1 203 ? -54.582 7.878  -5.407  1.00 21.04 ? 493 GLY A CA  1 
ATOM   1551 C C   . GLY A 1 203 ? -53.665 8.922  -4.805  1.00 20.53 ? 493 GLY A C   1 
ATOM   1552 O O   . GLY A 1 203 ? -52.539 9.163  -5.288  1.00 19.75 ? 493 GLY A O   1 
ATOM   1553 N N   . PRO A 1 204 ? -54.119 9.569  -3.708  1.00 21.08 ? 494 PRO A N   1 
ATOM   1554 C CA  . PRO A 1 204 ? -53.383 10.641 -3.031  1.00 20.77 ? 494 PRO A CA  1 
ATOM   1555 C C   . PRO A 1 204 ? -51.957 10.253 -2.592  1.00 20.38 ? 494 PRO A C   1 
ATOM   1556 O O   . PRO A 1 204 ? -51.084 11.107 -2.445  1.00 19.58 ? 494 PRO A O   1 
ATOM   1557 C CB  . PRO A 1 204 ? -54.281 10.935 -1.810  1.00 22.13 ? 494 PRO A CB  1 
ATOM   1558 C CG  . PRO A 1 204 ? -55.631 10.601 -2.241  1.00 23.05 ? 494 PRO A CG  1 
ATOM   1559 C CD  . PRO A 1 204 ? -55.437 9.333  -3.065  1.00 22.10 ? 494 PRO A CD  1 
ATOM   1560 N N   . GLU A 1 205 ? -51.718 8.952  -2.426  1.00 19.29 ? 495 GLU A N   1 
ATOM   1561 C CA  . GLU A 1 205 ? -50.377 8.493  -2.019  1.00 19.05 ? 495 GLU A CA  1 
ATOM   1562 C C   . GLU A 1 205 ? -49.262 8.983  -2.939  1.00 18.31 ? 495 GLU A C   1 
ATOM   1563 O O   . GLU A 1 205 ? -48.118 9.103  -2.506  1.00 18.28 ? 495 GLU A O   1 
ATOM   1564 C CB  . GLU A 1 205 ? -50.278 6.960  -2.007  1.00 18.98 ? 495 GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 205 ? -51.380 6.223  -1.274  1.00 20.91 ? 495 GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 205 ? -52.452 5.735  -2.236  1.00 27.45 ? 495 GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 205 ? -53.242 6.568  -2.690  1.00 28.38 ? 495 GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 205 ? -52.526 4.521  -2.566  1.00 31.55 ? 495 GLU A OE2 1 
ATOM   1569 N N   . VAL A 1 206 ? -49.570 9.243  -4.210  1.00 18.51 ? 496 VAL A N   1 
ATOM   1570 C CA  . VAL A 1 206 ? -48.530 9.681  -5.152  1.00 17.92 ? 496 VAL A CA  1 
ATOM   1571 C C   . VAL A 1 206 ? -47.880 10.974 -4.673  1.00 17.94 ? 496 VAL A C   1 
ATOM   1572 O O   . VAL A 1 206 ? -46.677 11.214 -4.874  1.00 18.06 ? 496 VAL A O   1 
ATOM   1573 C CB  . VAL A 1 206 ? -49.012 9.769  -6.637  1.00 18.01 ? 496 VAL A CB  1 
ATOM   1574 C CG1 . VAL A 1 206 ? -49.649 8.391  -7.122  1.00 16.54 ? 496 VAL A CG1 1 
ATOM   1575 C CG2 . VAL A 1 206 ? -50.020 10.922 -6.846  1.00 18.15 ? 496 VAL A CG2 1 
ATOM   1576 N N   . ASP A 1 207 ? -48.692 11.830 -4.057  1.00 17.02 ? 497 ASP A N   1 
ATOM   1577 C CA  . ASP A 1 207 ? -48.181 13.132 -3.560  1.00 17.61 ? 497 ASP A CA  1 
ATOM   1578 C C   . ASP A 1 207 ? -47.130 12.940 -2.425  1.00 17.37 ? 497 ASP A C   1 
ATOM   1579 O O   . ASP A 1 207 ? -46.206 13.733 -2.249  1.00 17.20 ? 497 ASP A O   1 
ATOM   1580 C CB  . ASP A 1 207 ? -49.356 13.971 -3.053  1.00 17.40 ? 497 ASP A CB  1 
ATOM   1581 C CG  . ASP A 1 207 ? -50.183 14.594 -4.161  1.00 18.33 ? 497 ASP A CG  1 
ATOM   1582 O OD1 . ASP A 1 207 ? -49.744 14.647 -5.338  1.00 17.06 ? 497 ASP A OD1 1 
ATOM   1583 O OD2 . ASP A 1 207 ? -51.302 15.061 -3.796  1.00 18.17 ? 497 ASP A OD2 1 
ATOM   1584 N N   . ILE A 1 208 ? -47.312 11.915 -1.607  1.00 16.59 ? 498 ILE A N   1 
ATOM   1585 C CA  . ILE A 1 208 ? -46.390 11.628 -0.521  1.00 16.73 ? 498 ILE A CA  1 
ATOM   1586 C C   . ILE A 1 208 ? -45.008 11.212 -1.044  1.00 16.21 ? 498 ILE A C   1 
ATOM   1587 O O   . ILE A 1 208 ? -43.987 11.672 -0.526  1.00 17.92 ? 498 ILE A O   1 
ATOM   1588 C CB  . ILE A 1 208 ? -46.998 10.580 0.458   1.00 17.30 ? 498 ILE A CB  1 
ATOM   1589 C CG1 . ILE A 1 208 ? -48.355 11.057 0.991   1.00 17.97 ? 498 ILE A CG1 1 
ATOM   1590 C CG2 . ILE A 1 208 ? -46.006 10.274 1.627   1.00 16.82 ? 498 ILE A CG2 1 
ATOM   1591 C CD1 . ILE A 1 208 ? -48.347 12.442 1.681   1.00 18.28 ? 498 ILE A CD1 1 
ATOM   1592 N N   . TRP A 1 209 ? -44.969 10.343 -2.050  1.00 16.53 ? 499 TRP A N   1 
ATOM   1593 C CA  . TRP A 1 209 ? -43.722 10.010 -2.714  1.00 16.91 ? 499 TRP A CA  1 
ATOM   1594 C C   . TRP A 1 209 ? -43.066 11.279 -3.252  1.00 16.72 ? 499 TRP A C   1 
ATOM   1595 O O   . TRP A 1 209 ? -41.891 11.522 -3.003  1.00 16.77 ? 499 TRP A O   1 
ATOM   1596 C CB  . TRP A 1 209 ? -43.920 9.000  -3.863  1.00 17.52 ? 499 TRP A CB  1 
ATOM   1597 C CG  . TRP A 1 209 ? -42.627 8.679  -4.550  1.00 16.89 ? 499 TRP A CG  1 
ATOM   1598 C CD1 . TRP A 1 209 ? -42.002 9.413  -5.525  1.00 18.10 ? 499 TRP A CD1 1 
ATOM   1599 C CD2 . TRP A 1 209 ? -41.765 7.557  -4.275  1.00 15.33 ? 499 TRP A CD2 1 
ATOM   1600 N NE1 . TRP A 1 209 ? -40.809 8.831  -5.869  1.00 17.73 ? 499 TRP A NE1 1 
ATOM   1601 C CE2 . TRP A 1 209 ? -40.657 7.667  -5.141  1.00 18.26 ? 499 TRP A CE2 1 
ATOM   1602 C CE3 . TRP A 1 209 ? -41.869 6.427  -3.442  1.00 18.06 ? 499 TRP A CE3 1 
ATOM   1603 C CZ2 . TRP A 1 209 ? -39.642 6.727  -5.159  1.00 19.40 ? 499 TRP A CZ2 1 
ATOM   1604 C CZ3 . TRP A 1 209 ? -40.861 5.493  -3.458  1.00 17.55 ? 499 TRP A CZ3 1 
ATOM   1605 C CH2 . TRP A 1 209 ? -39.758 5.639  -4.295  1.00 17.49 ? 499 TRP A CH2 1 
ATOM   1606 N N   . SER A 1 210 ? -43.824 12.060 -4.048  1.00 16.59 ? 500 SER A N   1 
ATOM   1607 C CA  . SER A 1 210 ? -43.296 13.273 -4.610  1.00 17.35 ? 500 SER A CA  1 
ATOM   1608 C C   . SER A 1 210 ? -42.698 14.212 -3.533  1.00 18.27 ? 500 SER A C   1 
ATOM   1609 O O   . SER A 1 210 ? -41.607 14.803 -3.716  1.00 17.93 ? 500 SER A O   1 
ATOM   1610 C CB  . SER A 1 210 ? -44.342 13.963 -5.440  1.00 17.64 ? 500 SER A CB  1 
ATOM   1611 O OG  . SER A 1 210 ? -44.790 13.164 -6.521  1.00 16.93 ? 500 SER A OG  1 
ATOM   1612 N N   . LEU A 1 211 ? -43.386 14.333 -2.396  1.00 17.73 ? 501 LEU A N   1 
ATOM   1613 C CA  . LEU A 1 211 ? -42.889 15.108 -1.260  1.00 18.02 ? 501 LEU A CA  1 
ATOM   1614 C C   . LEU A 1 211 ? -41.522 14.545 -0.771  1.00 18.86 ? 501 LEU A C   1 
ATOM   1615 O O   . LEU A 1 211 ? -40.627 15.272 -0.435  1.00 16.77 ? 501 LEU A O   1 
ATOM   1616 C CB  . LEU A 1 211 ? -43.892 15.109 -0.107  1.00 19.06 ? 501 LEU A CB  1 
ATOM   1617 C CG  . LEU A 1 211 ? -43.463 15.827 1.183   1.00 19.72 ? 501 LEU A CG  1 
ATOM   1618 C CD1 . LEU A 1 211 ? -42.971 17.246 0.866   1.00 19.97 ? 501 LEU A CD1 1 
ATOM   1619 C CD2 . LEU A 1 211 ? -44.674 15.821 2.183   1.00 21.04 ? 501 LEU A CD2 1 
ATOM   1620 N N   . GLY A 1 212 ? -41.381 13.232 -0.716  1.00 17.79 ? 502 GLY A N   1 
ATOM   1621 C CA  . GLY A 1 212 ? -40.081 12.620 -0.370  1.00 18.25 ? 502 GLY A CA  1 
ATOM   1622 C C   . GLY A 1 212 ? -38.980 13.063 -1.297  1.00 16.93 ? 502 GLY A C   1 
ATOM   1623 O O   . GLY A 1 212 ? -37.825 13.318 -0.878  1.00 16.88 ? 502 GLY A O   1 
ATOM   1624 N N   . ILE A 1 213 ? -39.291 13.093 -2.606  1.00 17.09 ? 503 ILE A N   1 
ATOM   1625 C CA  . ILE A 1 213 ? -38.298 13.534 -3.561  1.00 17.10 ? 503 ILE A CA  1 
ATOM   1626 C C   . ILE A 1 213 ? -37.997 15.008 -3.295  1.00 17.49 ? 503 ILE A C   1 
ATOM   1627 O O   . ILE A 1 213 ? -36.856 15.464 -3.420  1.00 16.77 ? 503 ILE A O   1 
ATOM   1628 C CB  . ILE A 1 213 ? -38.757 13.315 -5.016  1.00 17.85 ? 503 ILE A CB  1 
ATOM   1629 C CG1 . ILE A 1 213 ? -39.037 11.809 -5.341  1.00 16.20 ? 503 ILE A CG1 1 
ATOM   1630 C CG2 . ILE A 1 213 ? -37.729 13.881 -5.984  1.00 17.48 ? 503 ILE A CG2 1 
ATOM   1631 C CD1 . ILE A 1 213 ? -37.805 10.922 -5.245  1.00 16.57 ? 503 ILE A CD1 1 
ATOM   1632 N N   . MET A 1 214 ? -38.999 15.778 -2.891  1.00 18.32 ? 504 MET A N   1 
ATOM   1633 C CA  . MET A 1 214 ? -38.729 17.187 -2.557  1.00 19.03 ? 504 MET A CA  1 
ATOM   1634 C C   . MET A 1 214 ? -37.847 17.331 -1.293  1.00 18.50 ? 504 MET A C   1 
ATOM   1635 O O   . MET A 1 214 ? -36.988 18.252 -1.191  1.00 19.80 ? 504 MET A O   1 
ATOM   1636 C CB  . MET A 1 214 ? -40.049 17.972 -2.362  1.00 19.75 ? 504 MET A CB  1 
ATOM   1637 C CG  . MET A 1 214 ? -39.835 19.411 -2.482  1.00 20.51 ? 504 MET A CG  1 
ATOM   1638 S SD  . MET A 1 214 ? -41.313 20.469 -2.316  1.00 23.13 ? 504 MET A SD  1 
ATOM   1639 C CE  . MET A 1 214 ? -41.485 20.559 -0.551  1.00 24.02 ? 504 MET A CE  1 
ATOM   1640 N N   . VAL A 1 215 ? -38.004 16.412 -0.356  1.00 17.81 ? 505 VAL A N   1 
ATOM   1641 C CA  . VAL A 1 215 ? -37.078 16.349 0.783   1.00 18.76 ? 505 VAL A CA  1 
ATOM   1642 C C   . VAL A 1 215 ? -35.651 16.123 0.312   1.00 19.15 ? 505 VAL A C   1 
ATOM   1643 O O   . VAL A 1 215 ? -34.726 16.752 0.809   1.00 19.46 ? 505 VAL A O   1 
ATOM   1644 C CB  . VAL A 1 215 ? -37.498 15.305 1.839   1.00 18.93 ? 505 VAL A CB  1 
ATOM   1645 C CG1 . VAL A 1 215 ? -36.400 15.164 2.914   1.00 20.81 ? 505 VAL A CG1 1 
ATOM   1646 C CG2 . VAL A 1 215 ? -38.826 15.681 2.493   1.00 20.91 ? 505 VAL A CG2 1 
ATOM   1647 N N   . ILE A 1 216 ? -35.444 15.222 -0.648  1.00 18.85 ? 506 ILE A N   1 
ATOM   1648 C CA  . ILE A 1 216 ? -34.128 15.011 -1.249  1.00 18.94 ? 506 ILE A CA  1 
ATOM   1649 C C   . ILE A 1 216 ? -33.620 16.294 -1.895  1.00 18.85 ? 506 ILE A C   1 
ATOM   1650 O O   . ILE A 1 216 ? -32.458 16.699 -1.693  1.00 19.00 ? 506 ILE A O   1 
ATOM   1651 C CB  . ILE A 1 216 ? -34.146 13.823 -2.239  1.00 18.89 ? 506 ILE A CB  1 
ATOM   1652 C CG1 . ILE A 1 216 ? -34.376 12.503 -1.468  1.00 20.53 ? 506 ILE A CG1 1 
ATOM   1653 C CG2 . ILE A 1 216 ? -32.862 13.776 -3.099  1.00 19.05 ? 506 ILE A CG2 1 
ATOM   1654 C CD1 . ILE A 1 216 ? -34.391 11.274 -2.309  1.00 19.34 ? 506 ILE A CD1 1 
ATOM   1655 N N   . GLU A 1 217 ? -34.502 16.981 -2.615  1.00 18.25 ? 507 GLU A N   1 
ATOM   1656 C CA  . GLU A 1 217 ? -34.117 18.326 -3.096  1.00 18.59 ? 507 GLU A CA  1 
ATOM   1657 C C   . GLU A 1 217 ? -33.609 19.236 -1.984  1.00 19.45 ? 507 GLU A C   1 
ATOM   1658 O O   . GLU A 1 217 ? -32.639 19.975 -2.184  1.00 19.62 ? 507 GLU A O   1 
ATOM   1659 C CB  . GLU A 1 217 ? -35.247 19.086 -3.800  1.00 18.00 ? 507 GLU A CB  1 
ATOM   1660 C CG  . GLU A 1 217 ? -35.856 18.545 -5.084  1.00 19.05 ? 507 GLU A CG  1 
ATOM   1661 C CD  . GLU A 1 217 ? -36.817 19.586 -5.631  1.00 19.94 ? 507 GLU A CD  1 
ATOM   1662 O OE1 . GLU A 1 217 ? -36.296 20.588 -6.205  1.00 19.98 ? 507 GLU A OE1 1 
ATOM   1663 O OE2 . GLU A 1 217 ? -38.054 19.451 -5.404  1.00 19.70 ? 507 GLU A OE2 1 
ATOM   1664 N N   . MET A 1 218 ? -34.325 19.271 -0.862  1.00 19.43 ? 508 MET A N   1 
ATOM   1665 C CA  . MET A 1 218 ? -33.983 20.189 0.223   1.00 19.57 ? 508 MET A CA  1 
ATOM   1666 C C   . MET A 1 218 ? -32.664 19.830 0.923   1.00 21.03 ? 508 MET A C   1 
ATOM   1667 O O   . MET A 1 218 ? -31.951 20.704 1.465   1.00 20.94 ? 508 MET A O   1 
ATOM   1668 C CB  . MET A 1 218 ? -35.124 20.247 1.236   1.00 20.77 ? 508 MET A CB  1 
ATOM   1669 C CG  . MET A 1 218 ? -36.314 21.027 0.706   1.00 20.30 ? 508 MET A CG  1 
ATOM   1670 S SD  . MET A 1 218 ? -37.578 21.382 1.927   1.00 22.24 ? 508 MET A SD  1 
ATOM   1671 C CE  . MET A 1 218 ? -38.490 19.859 1.842   1.00 22.73 ? 508 MET A CE  1 
ATOM   1672 N N   . VAL A 1 219 ? -32.301 18.549 0.866   1.00 20.01 ? 509 VAL A N   1 
ATOM   1673 C CA  . VAL A 1 219 ? -31.039 18.083 1.456   1.00 20.65 ? 509 VAL A CA  1 
ATOM   1674 C C   . VAL A 1 219 ? -29.899 18.175 0.429   1.00 21.73 ? 509 VAL A C   1 
ATOM   1675 O O   . VAL A 1 219 ? -28.797 18.689 0.751   1.00 22.96 ? 509 VAL A O   1 
ATOM   1676 C CB  . VAL A 1 219 ? -31.209 16.638 1.988   1.00 19.98 ? 509 VAL A CB  1 
ATOM   1677 C CG1 . VAL A 1 219 ? -29.838 16.013 2.466   1.00 21.22 ? 509 VAL A CG1 1 
ATOM   1678 C CG2 . VAL A 1 219 ? -32.296 16.630 3.080   1.00 20.60 ? 509 VAL A CG2 1 
ATOM   1679 N N   . ASP A 1 220 ? -30.163 17.694 -0.792  1.00 22.01 ? 510 ASP A N   1 
ATOM   1680 C CA  . ASP A 1 220 ? -29.141 17.497 -1.835  1.00 21.90 ? 510 ASP A CA  1 
ATOM   1681 C C   . ASP A 1 220 ? -29.078 18.576 -2.931  1.00 22.79 ? 510 ASP A C   1 
ATOM   1682 O O   . ASP A 1 220 ? -28.060 18.686 -3.636  1.00 22.81 ? 510 ASP A O   1 
ATOM   1683 C CB  . ASP A 1 220 ? -29.302 16.155 -2.549  1.00 22.41 ? 510 ASP A CB  1 
ATOM   1684 C CG  . ASP A 1 220 ? -28.968 14.943 -1.676  1.00 23.48 ? 510 ASP A CG  1 
ATOM   1685 O OD1 . ASP A 1 220 ? -28.342 15.077 -0.586  1.00 26.70 ? 510 ASP A OD1 1 
ATOM   1686 O OD2 . ASP A 1 220 ? -29.352 13.826 -2.118  1.00 24.83 ? 510 ASP A OD2 1 
ATOM   1687 N N   . GLY A 1 221 ? -30.136 19.351 -3.095  1.00 22.23 ? 511 GLY A N   1 
ATOM   1688 C CA  . GLY A 1 221 ? -30.191 20.413 -4.100  1.00 21.71 ? 511 GLY A CA  1 
ATOM   1689 C C   . GLY A 1 221 ? -30.869 20.030 -5.408  1.00 22.22 ? 511 GLY A C   1 
ATOM   1690 O O   . GLY A 1 221 ? -31.243 20.895 -6.203  1.00 22.00 ? 511 GLY A O   1 
ATOM   1691 N N   . GLU A 1 222 ? -31.031 18.731 -5.626  1.00 21.32 ? 512 GLU A N   1 
ATOM   1692 C CA  . GLU A 1 222 ? -31.622 18.214 -6.850  1.00 22.25 ? 512 GLU A CA  1 
ATOM   1693 C C   . GLU A 1 222 ? -32.284 16.869 -6.545  1.00 21.07 ? 512 GLU A C   1 
ATOM   1694 O O   . GLU A 1 222 ? -31.874 16.176 -5.604  1.00 20.89 ? 512 GLU A O   1 
ATOM   1695 C CB  . GLU A 1 222 ? -30.567 18.126 -7.968  1.00 21.94 ? 512 GLU A CB  1 
ATOM   1696 C CG  . GLU A 1 222 ? -29.431 17.188 -7.764  1.00 25.70 ? 512 GLU A CG  1 
ATOM   1697 C CD  . GLU A 1 222 ? -28.394 17.305 -8.930  1.00 25.24 ? 512 GLU A CD  1 
ATOM   1698 O OE1 . GLU A 1 222 ? -27.955 18.429 -9.225  1.00 30.89 ? 512 GLU A OE1 1 
ATOM   1699 O OE2 . GLU A 1 222 ? -28.045 16.288 -9.546  1.00 29.89 ? 512 GLU A OE2 1 
ATOM   1700 N N   . PRO A 1 223 ? -33.270 16.470 -7.364  1.00 21.48 ? 513 PRO A N   1 
ATOM   1701 C CA  . PRO A 1 223 ? -33.842 15.146 -7.172  1.00 21.74 ? 513 PRO A CA  1 
ATOM   1702 C C   . PRO A 1 223 ? -32.877 14.057 -7.679  1.00 21.27 ? 513 PRO A C   1 
ATOM   1703 O O   . PRO A 1 223 ? -31.902 14.337 -8.417  1.00 22.13 ? 513 PRO A O   1 
ATOM   1704 C CB  . PRO A 1 223 ? -35.087 15.168 -8.037  1.00 22.30 ? 513 PRO A CB  1 
ATOM   1705 C CG  . PRO A 1 223 ? -34.706 16.090 -9.150  1.00 21.55 ? 513 PRO A CG  1 
ATOM   1706 C CD  . PRO A 1 223 ? -33.835 17.144 -8.549  1.00 21.62 ? 513 PRO A CD  1 
ATOM   1707 N N   . PRO A 1 224 ? -33.160 12.810 -7.314  1.00 22.02 ? 514 PRO A N   1 
ATOM   1708 C CA  . PRO A 1 224 ? -32.375 11.703 -7.802  1.00 21.97 ? 514 PRO A CA  1 
ATOM   1709 C C   . PRO A 1 224 ? -32.393 11.590 -9.327  1.00 21.34 ? 514 PRO A C   1 
ATOM   1710 O O   . PRO A 1 224 ? -33.424 11.860 -9.932  1.00 21.64 ? 514 PRO A O   1 
ATOM   1711 C CB  . PRO A 1 224 ? -33.057 10.487 -7.174  1.00 22.12 ? 514 PRO A CB  1 
ATOM   1712 C CG  . PRO A 1 224 ? -33.884 10.994 -6.081  1.00 22.75 ? 514 PRO A CG  1 
ATOM   1713 C CD  . PRO A 1 224 ? -34.256 12.384 -6.432  1.00 20.76 ? 514 PRO A CD  1 
ATOM   1714 N N   . TYR A 1 225 ? -31.279 11.135 -9.921  1.00 21.16 ? 515 TYR A N   1 
ATOM   1715 C CA  . TYR A 1 225 ? -31.216 10.777 -11.347 1.00 21.57 ? 515 TYR A CA  1 
ATOM   1716 C C   . TYR A 1 225 ? -31.396 11.982 -12.317 1.00 21.46 ? 515 TYR A C   1 
ATOM   1717 O O   . TYR A 1 225 ? -31.688 11.798 -13.509 1.00 22.62 ? 515 TYR A O   1 
ATOM   1718 C CB  . TYR A 1 225 ? -32.272 9.710  -11.695 1.00 22.23 ? 515 TYR A CB  1 
ATOM   1719 C CG  . TYR A 1 225 ? -32.336 8.571  -10.700 1.00 22.50 ? 515 TYR A CG  1 
ATOM   1720 C CD1 . TYR A 1 225 ? -31.168 8.017  -10.186 1.00 25.30 ? 515 TYR A CD1 1 
ATOM   1721 C CD2 . TYR A 1 225 ? -33.563 8.079  -10.241 1.00 22.95 ? 515 TYR A CD2 1 
ATOM   1722 C CE1 . TYR A 1 225 ? -31.210 6.946  -9.252  1.00 25.56 ? 515 TYR A CE1 1 
ATOM   1723 C CE2 . TYR A 1 225 ? -33.610 7.008  -9.326  1.00 22.83 ? 515 TYR A CE2 1 
ATOM   1724 C CZ  . TYR A 1 225 ? -32.439 6.467  -8.823  1.00 25.84 ? 515 TYR A CZ  1 
ATOM   1725 O OH  . TYR A 1 225 ? -32.490 5.392  -7.908  1.00 25.54 ? 515 TYR A OH  1 
ATOM   1726 N N   . PHE A 1 226 ? -31.206 13.186 -11.798 1.00 21.91 ? 516 PHE A N   1 
ATOM   1727 C CA  . PHE A 1 226 ? -31.551 14.413 -12.512 1.00 22.23 ? 516 PHE A CA  1 
ATOM   1728 C C   . PHE A 1 226 ? -30.793 14.560 -13.842 1.00 23.91 ? 516 PHE A C   1 
ATOM   1729 O O   . PHE A 1 226 ? -31.298 15.159 -14.789 1.00 24.56 ? 516 PHE A O   1 
ATOM   1730 C CB  . PHE A 1 226 ? -31.324 15.600 -11.578 1.00 22.10 ? 516 PHE A CB  1 
ATOM   1731 C CG  . PHE A 1 226 ? -32.082 16.872 -11.954 1.00 19.33 ? 516 PHE A CG  1 
ATOM   1732 C CD1 . PHE A 1 226 ? -33.405 16.835 -12.348 1.00 20.14 ? 516 PHE A CD1 1 
ATOM   1733 C CD2 . PHE A 1 226 ? -31.477 18.098 -11.803 1.00 24.94 ? 516 PHE A CD2 1 
ATOM   1734 C CE1 . PHE A 1 226 ? -34.089 17.962 -12.644 1.00 20.11 ? 516 PHE A CE1 1 
ATOM   1735 C CE2 . PHE A 1 226 ? -32.147 19.244 -12.103 1.00 21.80 ? 516 PHE A CE2 1 
ATOM   1736 C CZ  . PHE A 1 226 ? -33.486 19.181 -12.505 1.00 23.14 ? 516 PHE A CZ  1 
ATOM   1737 N N   . ASN A 1 227 ? -29.620 13.947 -13.936 1.00 25.56 ? 517 ASN A N   1 
ATOM   1738 C CA  . ASN A 1 227 ? -28.834 13.963 -15.188 1.00 27.03 ? 517 ASN A CA  1 
ATOM   1739 C C   . ASN A 1 227 ? -29.191 12.931 -16.253 1.00 27.52 ? 517 ASN A C   1 
ATOM   1740 O O   . ASN A 1 227 ? -28.550 12.901 -17.314 1.00 27.90 ? 517 ASN A O   1 
ATOM   1741 C CB  . ASN A 1 227 ? -27.356 13.826 -14.854 1.00 28.31 ? 517 ASN A CB  1 
ATOM   1742 C CG  . ASN A 1 227 ? -26.875 14.924 -13.930 1.00 29.99 ? 517 ASN A CG  1 
ATOM   1743 O OD1 . ASN A 1 227 ? -27.087 16.121 -14.185 1.00 35.56 ? 517 ASN A OD1 1 
ATOM   1744 N ND2 . ASN A 1 227 ? -26.178 14.531 -12.873 1.00 35.77 ? 517 ASN A ND2 1 
ATOM   1745 N N   . GLU A 1 228 ? -30.170 12.069 -15.980 1.00 26.13 ? 518 GLU A N   1 
ATOM   1746 C CA  . GLU A 1 228 ? -30.586 11.053 -16.918 1.00 26.37 ? 518 GLU A CA  1 
ATOM   1747 C C   . GLU A 1 228 ? -31.727 11.562 -17.775 1.00 26.65 ? 518 GLU A C   1 
ATOM   1748 O O   . GLU A 1 228 ? -32.493 12.403 -17.312 1.00 26.09 ? 518 GLU A O   1 
ATOM   1749 C CB  . GLU A 1 228 ? -31.060 9.805  -16.164 1.00 27.44 ? 518 GLU A CB  1 
ATOM   1750 C CG  . GLU A 1 228 ? -30.046 9.225  -15.167 1.00 29.24 ? 518 GLU A CG  1 
ATOM   1751 C CD  . GLU A 1 228 ? -28.876 8.467  -15.841 1.00 33.93 ? 518 GLU A CD  1 
ATOM   1752 O OE1 . GLU A 1 228 ? -28.784 8.448  -17.086 1.00 36.40 ? 518 GLU A OE1 1 
ATOM   1753 O OE2 . GLU A 1 228 ? -28.054 7.876  -15.114 1.00 35.45 ? 518 GLU A OE2 1 
ATOM   1754 N N   . PRO A 1 229 ? -31.846 11.070 -19.025 1.00 26.08 ? 519 PRO A N   1 
ATOM   1755 C CA  . PRO A 1 229 ? -33.059 11.371 -19.786 1.00 26.32 ? 519 PRO A CA  1 
ATOM   1756 C C   . PRO A 1 229 ? -34.301 10.981 -18.970 1.00 27.01 ? 519 PRO A C   1 
ATOM   1757 O O   . PRO A 1 229 ? -34.292 9.948  -18.267 1.00 25.93 ? 519 PRO A O   1 
ATOM   1758 C CB  . PRO A 1 229 ? -32.955 10.451 -21.010 1.00 26.66 ? 519 PRO A CB  1 
ATOM   1759 C CG  . PRO A 1 229 ? -31.483 10.186 -21.159 1.00 26.28 ? 519 PRO A CG  1 
ATOM   1760 C CD  . PRO A 1 229 ? -30.924 10.186 -19.767 1.00 25.24 ? 519 PRO A CD  1 
ATOM   1761 N N   . PRO A 1 230 ? -35.389 11.739 -19.112 1.00 27.66 ? 520 PRO A N   1 
ATOM   1762 C CA  . PRO A 1 230 ? -36.557 11.503 -18.224 1.00 27.77 ? 520 PRO A CA  1 
ATOM   1763 C C   . PRO A 1 230 ? -37.098 10.059 -18.184 1.00 28.02 ? 520 PRO A C   1 
ATOM   1764 O O   . PRO A 1 230 ? -37.371 9.532  -17.086 1.00 26.86 ? 520 PRO A O   1 
ATOM   1765 C CB  . PRO A 1 230 ? -37.632 12.454 -18.786 1.00 28.31 ? 520 PRO A CB  1 
ATOM   1766 C CG  . PRO A 1 230 ? -37.127 12.876 -20.161 1.00 28.83 ? 520 PRO A CG  1 
ATOM   1767 C CD  . PRO A 1 230 ? -35.631 12.831 -20.073 1.00 28.39 ? 520 PRO A CD  1 
ATOM   1768 N N   . LEU A 1 231 ? -37.267 9.440  -19.353 1.00 28.53 ? 521 LEU A N   1 
ATOM   1769 C CA  . LEU A 1 231 ? -37.784 8.072  -19.411 1.00 29.16 ? 521 LEU A CA  1 
ATOM   1770 C C   . LEU A 1 231 ? -36.844 7.052  -18.723 1.00 29.07 ? 521 LEU A C   1 
ATOM   1771 O O   . LEU A 1 231 ? -37.318 6.053  -18.184 1.00 28.83 ? 521 LEU A O   1 
ATOM   1772 C CB  . LEU A 1 231 ? -38.101 7.653  -20.852 1.00 29.32 ? 521 LEU A CB  1 
ATOM   1773 C CG  . LEU A 1 231 ? -39.284 8.327  -21.563 1.00 30.62 ? 521 LEU A CG  1 
ATOM   1774 C CD1 . LEU A 1 231 ? -39.291 7.903  -23.025 1.00 32.08 ? 521 LEU A CD1 1 
ATOM   1775 C CD2 . LEU A 1 231 ? -40.634 8.019  -20.923 1.00 31.80 ? 521 LEU A CD2 1 
ATOM   1776 N N   . LYS A 1 232 ? -35.539 7.339  -18.694 1.00 28.69 ? 522 LYS A N   1 
ATOM   1777 C CA  . LYS A 1 232 ? -34.554 6.498  -17.986 1.00 28.45 ? 522 LYS A CA  1 
ATOM   1778 C C   . LYS A 1 232 ? -34.646 6.643  -16.468 1.00 27.27 ? 522 LYS A C   1 
ATOM   1779 O O   . LYS A 1 232 ? -34.576 5.663  -15.711 1.00 24.91 ? 522 LYS A O   1 
ATOM   1780 C CB  . LYS A 1 232 ? -33.143 6.854  -18.456 1.00 29.25 ? 522 LYS A CB  1 
ATOM   1781 C CG  . LYS A 1 232 ? -32.035 5.993  -17.880 1.00 29.54 ? 522 LYS A CG  1 
ATOM   1782 C CD  . LYS A 1 232 ? -30.769 6.072  -18.729 1.00 30.45 ? 522 LYS A CD  1 
ATOM   1783 C CE  . LYS A 1 232 ? -29.768 5.015  -18.296 1.00 32.02 ? 522 LYS A CE  1 
ATOM   1784 N N   . ALA A 1 233 ? -34.813 7.882  -16.018 1.00 24.01 ? 523 ALA A N   1 
ATOM   1785 C CA  . ALA A 1 233 ? -34.996 8.158  -14.605 1.00 24.19 ? 523 ALA A CA  1 
ATOM   1786 C C   . ALA A 1 233 ? -36.259 7.476  -14.115 1.00 22.82 ? 523 ALA A C   1 
ATOM   1787 O O   . ALA A 1 233 ? -36.262 6.870  -13.044 1.00 24.29 ? 523 ALA A O   1 
ATOM   1788 C CB  . ALA A 1 233 ? -35.081 9.662  -14.376 1.00 23.24 ? 523 ALA A CB  1 
ATOM   1789 N N   . MET A 1 234 ? -37.325 7.561  -14.903 1.00 23.14 ? 524 MET A N   1 
ATOM   1790 C CA  . MET A 1 234 ? -38.610 6.981  -14.535 1.00 23.23 ? 524 MET A CA  1 
ATOM   1791 C C   . MET A 1 234 ? -38.462 5.457  -14.416 1.00 23.08 ? 524 MET A C   1 
ATOM   1792 O O   . MET A 1 234 ? -38.964 4.870  -13.455 1.00 21.77 ? 524 MET A O   1 
ATOM   1793 C CB  . MET A 1 234 ? -39.719 7.391  -15.529 1.00 23.34 ? 524 MET A CB  1 
ATOM   1794 C CG  . MET A 1 234 ? -40.072 8.916  -15.509 1.00 24.11 ? 524 MET A CG  1 
ATOM   1795 S SD  . MET A 1 234 ? -40.850 9.496  -17.042 1.00 26.09 ? 524 MET A SD  1 
ATOM   1796 C CE  . MET A 1 234 ? -42.473 8.713  -16.885 1.00 25.69 ? 524 MET A CE  1 
ATOM   1797 N N   . LYS A 1 235 ? -37.720 4.832  -15.338 1.00 23.23 ? 525 LYS A N   1 
ATOM   1798 C CA  . LYS A 1 235 ? -37.423 3.381  -15.220 1.00 24.05 ? 525 LYS A CA  1 
ATOM   1799 C C   . LYS A 1 235 ? -36.703 3.023  -13.901 1.00 24.14 ? 525 LYS A C   1 
ATOM   1800 O O   . LYS A 1 235 ? -37.018 2.019  -13.262 1.00 22.47 ? 525 LYS A O   1 
ATOM   1801 C CB  . LYS A 1 235 ? -36.591 2.931  -16.423 1.00 24.10 ? 525 LYS A CB  1 
ATOM   1802 C CG  . LYS A 1 235 ? -36.339 1.451  -16.551 1.00 25.47 ? 525 LYS A CG  1 
ATOM   1803 C CD  . LYS A 1 235 ? -35.270 1.193  -17.622 1.00 26.74 ? 525 LYS A CD  1 
ATOM   1804 C CE  . LYS A 1 235 ? -34.731 -0.203 -17.529 1.00 32.33 ? 525 LYS A CE  1 
ATOM   1805 N NZ  . LYS A 1 235 ? -33.894 -0.563 -18.697 1.00 33.96 ? 525 LYS A NZ  1 
ATOM   1806 N N   . MET A 1 236 ? -35.721 3.818  -13.489 1.00 23.01 ? 526 MET A N   1 
ATOM   1807 C CA  . MET A 1 236 ? -35.025 3.575  -12.224 1.00 24.48 ? 526 MET A CA  1 
ATOM   1808 C C   . MET A 1 236 ? -35.889 3.774  -10.972 1.00 23.50 ? 526 MET A C   1 
ATOM   1809 O O   . MET A 1 236 ? -35.803 3.021  -9.983  1.00 22.64 ? 526 MET A O   1 
ATOM   1810 C CB  . MET A 1 236 ? -33.780 4.458  -12.156 1.00 24.89 ? 526 MET A CB  1 
ATOM   1811 C CG  . MET A 1 236 ? -32.765 4.203  -13.301 1.00 25.69 ? 526 MET A CG  1 
ATOM   1812 S SD  . MET A 1 236 ? -31.456 5.524  -13.255 1.00 33.52 ? 526 MET A SD  1 
ATOM   1813 C CE  . MET A 1 236 ? -30.468 4.671  -12.015 1.00 28.39 ? 526 MET A CE  1 
ATOM   1814 N N   . ILE A 1 237 ? -36.735 4.790  -10.993 1.00 21.82 ? 527 ILE A N   1 
ATOM   1815 C CA  . ILE A 1 237 ? -37.661 4.975  -9.853  1.00 22.17 ? 527 ILE A CA  1 
ATOM   1816 C C   . ILE A 1 237 ? -38.604 3.760  -9.802  1.00 22.15 ? 527 ILE A C   1 
ATOM   1817 O O   . ILE A 1 237 ? -38.941 3.232  -8.724  1.00 21.32 ? 527 ILE A O   1 
ATOM   1818 C CB  . ILE A 1 237 ? -38.443 6.315  -10.016 1.00 22.32 ? 527 ILE A CB  1 
ATOM   1819 C CG1 . ILE A 1 237 ? -37.489 7.550  -9.791  1.00 22.90 ? 527 ILE A CG1 1 
ATOM   1820 C CG2 . ILE A 1 237 ? -39.609 6.368  -9.083  1.00 21.87 ? 527 ILE A CG2 1 
ATOM   1821 C CD1 . ILE A 1 237 ? -37.109 7.977  -8.213  1.00 24.54 ? 527 ILE A CD1 1 
ATOM   1822 N N   . ARG A 1 238 ? -39.045 3.333  -10.966 1.00 21.56 ? 528 ARG A N   1 
ATOM   1823 C CA  . ARG A 1 238 ? -40.006 2.218  -11.033 1.00 23.25 ? 528 ARG A CA  1 
ATOM   1824 C C   . ARG A 1 238 ? -39.421 0.901  -10.546 1.00 22.69 ? 528 ARG A C   1 
ATOM   1825 O O   . ARG A 1 238 ? -40.115 0.116  -9.886  1.00 22.72 ? 528 ARG A O   1 
ATOM   1826 C CB  . ARG A 1 238 ? -40.485 2.055  -12.456 1.00 23.35 ? 528 ARG A CB  1 
ATOM   1827 C CG  . ARG A 1 238 ? -41.571 1.025  -12.639 1.00 24.85 ? 528 ARG A CG  1 
ATOM   1828 C CD  . ARG A 1 238 ? -41.889 0.901  -14.128 1.00 26.42 ? 528 ARG A CD  1 
ATOM   1829 N NE  . ARG A 1 238 ? -40.802 0.238  -14.837 1.00 28.55 ? 528 ARG A NE  1 
ATOM   1830 C CZ  . ARG A 1 238 ? -40.569 0.309  -16.145 1.00 30.73 ? 528 ARG A CZ  1 
ATOM   1831 N NH1 . ARG A 1 238 ? -41.362 1.001  -16.950 1.00 32.95 ? 528 ARG A NH1 1 
ATOM   1832 N NH2 . ARG A 1 238 ? -39.529 -0.333 -16.661 1.00 30.10 ? 528 ARG A NH2 1 
ATOM   1833 N N   . ASP A 1 239 ? -38.159 0.659  -10.884 1.00 22.18 ? 529 ASP A N   1 
ATOM   1834 C CA  . ASP A 1 239 ? -37.579 -0.680 -10.800 1.00 22.05 ? 529 ASP A CA  1 
ATOM   1835 C C   . ASP A 1 239 ? -36.603 -0.854 -9.665  1.00 21.76 ? 529 ASP A C   1 
ATOM   1836 O O   . ASP A 1 239 ? -36.263 -1.985 -9.316  1.00 20.51 ? 529 ASP A O   1 
ATOM   1837 C CB  . ASP A 1 239 ? -36.824 -1.012 -12.096 1.00 23.18 ? 529 ASP A CB  1 
ATOM   1838 C CG  . ASP A 1 239 ? -37.755 -1.249 -13.275 1.00 25.25 ? 529 ASP A CG  1 
ATOM   1839 O OD1 . ASP A 1 239 ? -38.972 -1.358 -13.039 1.00 28.16 ? 529 ASP A OD1 1 
ATOM   1840 O OD2 . ASP A 1 239 ? -37.264 -1.272 -14.417 1.00 28.43 ? 529 ASP A OD2 1 
ATOM   1841 N N   . ASN A 1 240 ? -36.091 0.250  -9.119  1.00 19.75 ? 530 ASN A N   1 
ATOM   1842 C CA  . ASN A 1 240 ? -35.017 0.155  -8.168  1.00 20.15 ? 530 ASN A CA  1 
ATOM   1843 C C   . ASN A 1 240 ? -35.466 0.418  -6.727  1.00 19.62 ? 530 ASN A C   1 
ATOM   1844 O O   . ASN A 1 240 ? -36.560 0.893  -6.473  1.00 19.34 ? 530 ASN A O   1 
ATOM   1845 C CB  . ASN A 1 240 ? -33.882 1.117  -8.574  1.00 21.51 ? 530 ASN A CB  1 
ATOM   1846 C CG  . ASN A 1 240 ? -33.144 0.670  -9.832  1.00 21.06 ? 530 ASN A CG  1 
ATOM   1847 O OD1 . ASN A 1 240 ? -33.353 -0.423 -10.345 1.00 27.37 ? 530 ASN A OD1 1 
ATOM   1848 N ND2 . ASN A 1 240 ? -32.253 1.524  -10.319 1.00 30.26 ? 530 ASN A ND2 1 
ATOM   1849 N N   . LEU A 1 241 ? -34.576 0.113  -5.795  1.00 19.68 ? 531 LEU A N   1 
ATOM   1850 C CA  . LEU A 1 241 ? -34.815 0.475  -4.416  1.00 20.52 ? 531 LEU A CA  1 
ATOM   1851 C C   . LEU A 1 241 ? -35.001 1.967  -4.346  1.00 21.23 ? 531 LEU A C   1 
ATOM   1852 O O   . LEU A 1 241 ? -34.473 2.687  -5.207  1.00 21.68 ? 531 LEU A O   1 
ATOM   1853 C CB  . LEU A 1 241 ? -33.619 0.097  -3.542  1.00 19.77 ? 531 LEU A CB  1 
ATOM   1854 C CG  . LEU A 1 241 ? -33.360 -1.384 -3.295  1.00 21.28 ? 531 LEU A CG  1 
ATOM   1855 C CD1 . LEU A 1 241 ? -31.966 -1.585 -2.705  1.00 22.58 ? 531 LEU A CD1 1 
ATOM   1856 C CD2 . LEU A 1 241 ? -34.439 -1.945 -2.394  1.00 19.93 ? 531 LEU A CD2 1 
ATOM   1857 N N   . PRO A 1 242 ? -35.724 2.445  -3.325  1.00 20.95 ? 532 PRO A N   1 
ATOM   1858 C CA  . PRO A 1 242 ? -35.905 3.893  -3.232  1.00 20.81 ? 532 PRO A CA  1 
ATOM   1859 C C   . PRO A 1 242 ? -34.591 4.655  -3.196  1.00 21.29 ? 532 PRO A C   1 
ATOM   1860 O O   . PRO A 1 242 ? -33.607 4.185  -2.647  1.00 22.22 ? 532 PRO A O   1 
ATOM   1861 C CB  . PRO A 1 242 ? -36.669 4.086  -1.930  1.00 21.13 ? 532 PRO A CB  1 
ATOM   1862 C CG  . PRO A 1 242 ? -37.241 2.750  -1.611  1.00 21.54 ? 532 PRO A CG  1 
ATOM   1863 C CD  . PRO A 1 242 ? -36.361 1.723  -2.215  1.00 21.40 ? 532 PRO A CD  1 
ATOM   1864 N N   . PRO A 1 243 ? -34.599 5.852  -3.773  1.00 22.05 ? 533 PRO A N   1 
ATOM   1865 C CA  . PRO A 1 243 ? -33.405 6.653  -3.933  1.00 22.28 ? 533 PRO A CA  1 
ATOM   1866 C C   . PRO A 1 243 ? -32.885 7.060  -2.566  1.00 23.48 ? 533 PRO A C   1 
ATOM   1867 O O   . PRO A 1 243 ? -33.670 7.302  -1.638  1.00 24.05 ? 533 PRO A O   1 
ATOM   1868 C CB  . PRO A 1 243 ? -33.903 7.869  -4.736  1.00 22.92 ? 533 PRO A CB  1 
ATOM   1869 C CG  . PRO A 1 243 ? -35.303 7.927  -4.551  1.00 22.92 ? 533 PRO A CG  1 
ATOM   1870 C CD  . PRO A 1 243 ? -35.792 6.532  -4.306  1.00 22.64 ? 533 PRO A CD  1 
ATOM   1871 N N   . ARG A 1 244 ? -31.563 7.148  -2.480  1.00 25.66 ? 534 ARG A N   1 
ATOM   1872 C CA  . ARG A 1 244 ? -30.850 7.486  -1.273  1.00 26.53 ? 534 ARG A CA  1 
ATOM   1873 C C   . ARG A 1 244 ? -30.397 8.964  -1.320  1.00 26.72 ? 534 ARG A C   1 
ATOM   1874 O O   . ARG A 1 244 ? -30.198 9.566  -2.394  1.00 28.09 ? 534 ARG A O   1 
ATOM   1875 C CB  . ARG A 1 244 ? -29.611 6.578  -1.132  1.00 26.59 ? 534 ARG A CB  1 
ATOM   1876 N N   . LEU A 1 245 ? -30.300 9.557  -0.143  1.00 27.23 ? 535 LEU A N   1 
ATOM   1877 C CA  . LEU A 1 245 ? -29.705 10.894 0.007   1.00 27.00 ? 535 LEU A CA  1 
ATOM   1878 C C   . LEU A 1 245 ? -28.221 10.767 -0.336  1.00 27.50 ? 535 LEU A C   1 
ATOM   1879 O O   . LEU A 1 245 ? -27.574 9.818  0.116   1.00 27.69 ? 535 LEU A O   1 
ATOM   1880 C CB  . LEU A 1 245 ? -29.897 11.396 1.438   1.00 26.20 ? 535 LEU A CB  1 
ATOM   1881 C CG  . LEU A 1 245 ? -31.317 11.750 1.886   1.00 26.83 ? 535 LEU A CG  1 
ATOM   1882 C CD1 . LEU A 1 245 ? -31.434 11.824 3.405   1.00 27.87 ? 535 LEU A CD1 1 
ATOM   1883 C CD2 . LEU A 1 245 ? -31.772 13.074 1.227   1.00 26.48 ? 535 LEU A CD2 1 
ATOM   1884 N N   . LYS A 1 246 ? -27.731 11.660 -1.202  1.00 28.10 ? 536 LYS A N   1 
ATOM   1885 C CA  . LYS A 1 246 ? -26.289 11.790 -1.514  1.00 28.74 ? 536 LYS A CA  1 
ATOM   1886 C C   . LYS A 1 246 ? -25.584 12.380 -0.321  1.00 29.84 ? 536 LYS A C   1 
ATOM   1887 O O   . LYS A 1 246 ? -24.456 12.018 -0.027  1.00 30.46 ? 536 LYS A O   1 
ATOM   1888 C CB  . LYS A 1 246 ? -26.053 12.668 -2.752  1.00 28.92 ? 536 LYS A CB  1 
ATOM   1889 N N   . ASN A 1 247 ? -26.259 13.289 0.379   1.00 30.75 ? 537 ASN A N   1 
ATOM   1890 C CA  . ASN A 1 247 ? -25.749 13.832 1.640   1.00 31.98 ? 537 ASN A CA  1 
ATOM   1891 C C   . ASN A 1 247 ? -26.338 13.147 2.869   1.00 32.40 ? 537 ASN A C   1 
ATOM   1892 O O   . ASN A 1 247 ? -26.635 13.818 3.872   1.00 32.64 ? 537 ASN A O   1 
ATOM   1893 C CB  . ASN A 1 247 ? -25.992 15.350 1.691   1.00 31.23 ? 537 ASN A CB  1 
ATOM   1894 C CG  . ASN A 1 247 ? -25.099 16.087 0.737   1.00 32.08 ? 537 ASN A CG  1 
ATOM   1895 O OD1 . ASN A 1 247 ? -23.863 15.950 0.802   1.00 31.77 ? 537 ASN A OD1 1 
ATOM   1896 N ND2 . ASN A 1 247 ? -25.697 16.868 -0.157  1.00 29.09 ? 537 ASN A ND2 1 
ATOM   1897 N N   . LEU A 1 248 ? -26.473 11.813 2.797   1.00 32.81 ? 538 LEU A N   1 
ATOM   1898 C CA  . LEU A 1 248 ? -27.029 11.007 3.908   1.00 33.55 ? 538 LEU A CA  1 
ATOM   1899 C C   . LEU A 1 248 ? -26.234 11.260 5.178   1.00 34.29 ? 538 LEU A C   1 
ATOM   1900 O O   . LEU A 1 248 ? -26.789 11.273 6.280   1.00 34.89 ? 538 LEU A O   1 
ATOM   1901 C CB  . LEU A 1 248 ? -27.011 9.491  3.603   1.00 33.49 ? 538 LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 248 ? -27.588 8.534  4.692   1.00 32.69 ? 538 LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 248 ? -29.069 8.761  4.975   1.00 28.93 ? 538 LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 248 ? -27.367 7.073  4.335   1.00 33.38 ? 538 LEU A CD2 1 
ATOM   1905 N N   . HIS A 1 249 ? -24.937 11.457 5.011   1.00 34.79 ? 539 HIS A N   1 
ATOM   1906 C CA  . HIS A 1 249 ? -24.022 11.611 6.154   1.00 35.42 ? 539 HIS A CA  1 
ATOM   1907 C C   . HIS A 1 249 ? -24.305 12.893 6.968   1.00 34.35 ? 539 HIS A C   1 
ATOM   1908 O O   . HIS A 1 249 ? -23.986 12.982 8.145   1.00 34.49 ? 539 HIS A O   1 
ATOM   1909 C CB  . HIS A 1 249 ? -22.552 11.552 5.672   1.00 36.11 ? 539 HIS A CB  1 
ATOM   1910 C CG  . HIS A 1 249 ? -22.192 12.608 4.667   1.00 39.15 ? 539 HIS A CG  1 
ATOM   1911 N ND1 . HIS A 1 249 ? -22.675 12.609 3.374   1.00 41.09 ? 539 HIS A ND1 1 
ATOM   1912 C CD2 . HIS A 1 249 ? -21.378 13.689 4.764   1.00 40.79 ? 539 HIS A CD2 1 
ATOM   1913 C CE1 . HIS A 1 249 ? -22.188 13.650 2.723   1.00 42.05 ? 539 HIS A CE1 1 
ATOM   1914 N NE2 . HIS A 1 249 ? -21.400 14.323 3.544   1.00 42.34 ? 539 HIS A NE2 1 
ATOM   1915 N N   . LYS A 1 250 ? -24.939 13.869 6.336   1.00 33.55 ? 540 LYS A N   1 
ATOM   1916 C CA  . LYS A 1 250 ? -25.307 15.108 7.014   1.00 31.90 ? 540 LYS A CA  1 
ATOM   1917 C C   . LYS A 1 250 ? -26.603 15.068 7.849   1.00 31.07 ? 540 LYS A C   1 
ATOM   1918 O O   . LYS A 1 250 ? -26.842 15.994 8.609   1.00 31.57 ? 540 LYS A O   1 
ATOM   1919 C CB  . LYS A 1 250 ? -25.533 16.117 6.064   0.00 33.25 ? 540 LYS A CB  1 
ATOM   1920 N N   . VAL A 1 251 ? -27.425 14.020 7.740   1.00 29.66 ? 541 VAL A N   1 
ATOM   1921 C CA  . VAL A 1 251 ? -28.815 14.121 8.247   1.00 27.46 ? 541 VAL A CA  1 
ATOM   1922 C C   . VAL A 1 251 ? -29.045 13.428 9.614   1.00 25.54 ? 541 VAL A C   1 
ATOM   1923 O O   . VAL A 1 251 ? -28.316 12.512 10.002  1.00 26.16 ? 541 VAL A O   1 
ATOM   1924 C CB  . VAL A 1 251 ? -29.867 13.627 7.189   1.00 27.76 ? 541 VAL A CB  1 
ATOM   1925 C CG1 . VAL A 1 251 ? -29.815 14.511 5.893   1.00 28.58 ? 541 VAL A CG1 1 
ATOM   1926 C CG2 . VAL A 1 251 ? -29.673 12.175 6.868   1.00 27.61 ? 541 VAL A CG2 1 
ATOM   1927 N N   . SER A 1 252 ? -30.041 13.904 10.360  1.00 23.73 ? 542 SER A N   1 
ATOM   1928 C CA  . SER A 1 252 ? -30.374 13.350 11.673  1.00 23.56 ? 542 SER A CA  1 
ATOM   1929 C C   . SER A 1 252 ? -31.131 12.036 11.530  1.00 23.29 ? 542 SER A C   1 
ATOM   1930 O O   . SER A 1 252 ? -31.739 11.777 10.451  1.00 21.90 ? 542 SER A O   1 
ATOM   1931 C CB  . SER A 1 252 ? -31.241 14.324 12.456  1.00 23.74 ? 542 SER A CB  1 
ATOM   1932 O OG  . SER A 1 252 ? -32.511 14.447 11.857  1.00 20.01 ? 542 SER A OG  1 
ATOM   1933 N N   . PRO A 1 253 ? -31.105 11.205 12.588  1.00 22.68 ? 543 PRO A N   1 
ATOM   1934 C CA  . PRO A 1 253 ? -32.002 10.038 12.651  1.00 23.46 ? 543 PRO A CA  1 
ATOM   1935 C C   . PRO A 1 253 ? -33.466 10.382 12.447  1.00 22.50 ? 543 PRO A C   1 
ATOM   1936 O O   . PRO A 1 253 ? -34.181 9.605  11.810  1.00 21.69 ? 543 PRO A O   1 
ATOM   1937 C CB  . PRO A 1 253 ? -31.758 9.480  14.077  1.00 23.40 ? 543 PRO A CB  1 
ATOM   1938 C CG  . PRO A 1 253 ? -30.386 9.900  14.399  1.00 24.75 ? 543 PRO A CG  1 
ATOM   1939 C CD  . PRO A 1 253 ? -30.183 11.234 13.739  1.00 23.97 ? 543 PRO A CD  1 
ATOM   1940 N N   . SER A 1 254 ? -33.927 11.516 12.976  1.00 22.41 ? 544 SER A N   1 
ATOM   1941 C CA  . SER A 1 254 ? -35.359 11.884 12.844  1.00 22.02 ? 544 SER A CA  1 
ATOM   1942 C C   . SER A 1 254 ? -35.693 12.144 11.378  1.00 21.70 ? 544 SER A C   1 
ATOM   1943 O O   . SER A 1 254 ? -36.748 11.710 10.889  1.00 23.09 ? 544 SER A O   1 
ATOM   1944 C CB  . SER A 1 254 ? -35.701 13.126 13.676  1.00 21.67 ? 544 SER A CB  1 
ATOM   1945 O OG  . SER A 1 254 ? -35.727 12.832 15.081  1.00 27.71 ? 544 SER A OG  1 
ATOM   1946 N N   . LEU A 1 255 ? -34.824 12.879 10.675  1.00 20.32 ? 545 LEU A N   1 
ATOM   1947 C CA  . LEU A 1 255 ? -35.081 13.161 9.245   1.00 20.50 ? 545 LEU A CA  1 
ATOM   1948 C C   . LEU A 1 255 ? -35.055 11.866 8.404   1.00 20.35 ? 545 LEU A C   1 
ATOM   1949 O O   . LEU A 1 255 ? -35.910 11.661 7.538   1.00 20.13 ? 545 LEU A O   1 
ATOM   1950 C CB  . LEU A 1 255 ? -34.095 14.198 8.708   1.00 20.24 ? 545 LEU A CB  1 
ATOM   1951 C CG  . LEU A 1 255 ? -34.292 14.720 7.258   1.00 22.54 ? 545 LEU A CG  1 
ATOM   1952 C CD1 . LEU A 1 255 ? -33.594 16.067 7.067   1.00 21.69 ? 545 LEU A CD1 1 
ATOM   1953 C CD2 . LEU A 1 255 ? -33.787 13.729 6.228   1.00 26.34 ? 545 LEU A CD2 1 
ATOM   1954 N N   . LYS A 1 256 ? -34.049 11.012 8.624   1.00 21.35 ? 546 LYS A N   1 
ATOM   1955 C CA  . LYS A 1 256 ? -33.933 9.760  7.859   1.00 21.35 ? 546 LYS A CA  1 
ATOM   1956 C C   . LYS A 1 256 ? -35.162 8.890  8.137   1.00 21.10 ? 546 LYS A C   1 
ATOM   1957 O O   . LYS A 1 256 ? -35.741 8.326  7.214   1.00 20.91 ? 546 LYS A O   1 
ATOM   1958 C CB  . LYS A 1 256 ? -32.616 9.040  8.172   1.00 22.89 ? 546 LYS A CB  1 
ATOM   1959 C CG  . LYS A 1 256 ? -32.418 7.628  7.580   1.00 25.51 ? 546 LYS A CG  1 
ATOM   1960 C CD  . LYS A 1 256 ? -32.649 7.457  6.034   1.00 29.12 ? 546 LYS A CD  1 
ATOM   1961 C CE  . LYS A 1 256 ? -32.510 5.933  5.750   1.00 30.02 ? 546 LYS A CE  1 
ATOM   1962 N NZ  . LYS A 1 256 ? -32.766 5.565  4.339   1.00 33.84 ? 546 LYS A NZ  1 
ATOM   1963 N N   . GLY A 1 257 ? -35.592 8.835  9.387   1.00 20.82 ? 547 GLY A N   1 
ATOM   1964 C CA  . GLY A 1 257 ? -36.787 8.067  9.756   1.00 20.68 ? 547 GLY A CA  1 
ATOM   1965 C C   . GLY A 1 257 ? -38.047 8.598  9.083   1.00 20.89 ? 547 GLY A C   1 
ATOM   1966 O O   . GLY A 1 257 ? -38.923 7.836  8.657   1.00 21.20 ? 547 GLY A O   1 
ATOM   1967 N N   . PHE A 1 258 ? -38.146 9.912  9.009   1.00 20.56 ? 548 PHE A N   1 
ATOM   1968 C CA  . PHE A 1 258 ? -39.244 10.573 8.348   1.00 20.28 ? 548 PHE A CA  1 
ATOM   1969 C C   . PHE A 1 258 ? -39.250 10.228 6.849   1.00 20.11 ? 548 PHE A C   1 
ATOM   1970 O O   . PHE A 1 258 ? -40.254 9.779  6.315   1.00 20.37 ? 548 PHE A O   1 
ATOM   1971 C CB  . PHE A 1 258 ? -39.131 12.091 8.597   1.00 21.18 ? 548 PHE A CB  1 
ATOM   1972 C CG  . PHE A 1 258 ? -40.186 12.932 7.925   1.00 21.04 ? 548 PHE A CG  1 
ATOM   1973 C CD1 . PHE A 1 258 ? -41.446 13.068 8.463   1.00 22.81 ? 548 PHE A CD1 1 
ATOM   1974 C CD2 . PHE A 1 258 ? -39.878 13.670 6.798   1.00 21.49 ? 548 PHE A CD2 1 
ATOM   1975 C CE1 . PHE A 1 258 ? -42.391 13.888 7.858   1.00 21.81 ? 548 PHE A CE1 1 
ATOM   1976 C CE2 . PHE A 1 258 ? -40.801 14.493 6.196   1.00 19.33 ? 548 PHE A CE2 1 
ATOM   1977 C CZ  . PHE A 1 258 ? -42.061 14.614 6.707   1.00 21.59 ? 548 PHE A CZ  1 
ATOM   1978 N N   . LEU A 1 259 ? -38.115 10.412 6.194   1.00 20.27 ? 549 LEU A N   1 
ATOM   1979 C CA  . LEU A 1 259 ? -38.021 10.238 4.756   1.00 21.28 ? 549 LEU A CA  1 
ATOM   1980 C C   . LEU A 1 259 ? -38.332 8.779  4.408   1.00 19.93 ? 549 LEU A C   1 
ATOM   1981 O O   . LEU A 1 259 ? -38.959 8.490  3.384   1.00 19.95 ? 549 LEU A O   1 
ATOM   1982 C CB  . LEU A 1 259 ? -36.626 10.649 4.287   1.00 21.71 ? 549 LEU A CB  1 
ATOM   1983 C CG  . LEU A 1 259 ? -36.373 10.585 2.790   1.00 23.35 ? 549 LEU A CG  1 
ATOM   1984 C CD1 . LEU A 1 259 ? -37.446 11.501 1.994   1.00 20.91 ? 549 LEU A CD1 1 
ATOM   1985 C CD2 . LEU A 1 259 ? -34.920 10.985 2.509   1.00 23.74 ? 549 LEU A CD2 1 
ATOM   1986 N N   . ASP A 1 260 ? -37.966 7.870  5.295   1.00 19.86 ? 550 ASP A N   1 
ATOM   1987 C CA  . ASP A 1 260 ? -38.210 6.433  5.089   1.00 20.44 ? 550 ASP A CA  1 
ATOM   1988 C C   . ASP A 1 260 ? -39.700 6.084  5.041   1.00 19.61 ? 550 ASP A C   1 
ATOM   1989 O O   . ASP A 1 260 ? -40.084 5.003  4.554   1.00 21.36 ? 550 ASP A O   1 
ATOM   1990 C CB  . ASP A 1 260 ? -37.527 5.616  6.195   1.00 19.56 ? 550 ASP A CB  1 
ATOM   1991 C CG  . ASP A 1 260 ? -36.033 5.452  6.006   1.00 22.26 ? 550 ASP A CG  1 
ATOM   1992 O OD1 . ASP A 1 260 ? -35.483 5.816  4.940   1.00 25.29 ? 550 ASP A OD1 1 
ATOM   1993 O OD2 . ASP A 1 260 ? -35.387 4.909  6.959   1.00 26.58 ? 550 ASP A OD2 1 
ATOM   1994 N N   . ARG A 1 261 ? -40.554 6.943  5.611   1.00 19.90 ? 551 ARG A N   1 
ATOM   1995 C CA  . ARG A 1 261 ? -42.000 6.748  5.583   1.00 21.00 ? 551 ARG A CA  1 
ATOM   1996 C C   . ARG A 1 261 ? -42.660 7.339  4.321   1.00 20.76 ? 551 ARG A C   1 
ATOM   1997 O O   . ARG A 1 261 ? -43.832 7.004  4.018   1.00 20.72 ? 551 ARG A O   1 
ATOM   1998 C CB  . ARG A 1 261 ? -42.667 7.344  6.842   1.00 21.18 ? 551 ARG A CB  1 
ATOM   1999 C CG  . ARG A 1 261 ? -42.275 6.651  8.147   1.00 23.25 ? 551 ARG A CG  1 
ATOM   2000 C CD  . ARG A 1 261 ? -42.732 5.217  8.207   1.00 25.26 ? 551 ARG A CD  1 
ATOM   2001 N NE  . ARG A 1 261 ? -44.193 5.069  8.059   1.00 26.41 ? 551 ARG A NE  1 
ATOM   2002 C CZ  . ARG A 1 261 ? -44.828 4.315  7.147   1.00 30.07 ? 551 ARG A CZ  1 
ATOM   2003 N NH1 . ARG A 1 261 ? -44.172 3.611  6.235   1.00 31.61 ? 551 ARG A NH1 1 
ATOM   2004 N NH2 . ARG A 1 261 ? -46.163 4.284  7.131   1.00 30.86 ? 551 ARG A NH2 1 
ATOM   2005 N N   . LEU A 1 262 ? -41.932 8.172  3.580   1.00 20.24 ? 552 LEU A N   1 
ATOM   2006 C CA  . LEU A 1 262 ? -42.423 8.824  2.349   1.00 20.38 ? 552 LEU A CA  1 
ATOM   2007 C C   . LEU A 1 262 ? -41.991 8.024  1.096   1.00 19.54 ? 552 LEU A C   1 
ATOM   2008 O O   . LEU A 1 262 ? -42.830 7.747  0.228   1.00 20.54 ? 552 LEU A O   1 
ATOM   2009 C CB  . LEU A 1 262 ? -41.889 10.264 2.245   1.00 20.95 ? 552 LEU A CB  1 
ATOM   2010 C CG  . LEU A 1 262 ? -42.687 11.200 3.207   1.00 22.99 ? 552 LEU A CG  1 
ATOM   2011 C CD1 . LEU A 1 262 ? -41.951 11.198 4.467   1.00 25.50 ? 552 LEU A CD1 1 
ATOM   2012 C CD2 . LEU A 1 262 ? -42.836 12.606 2.644   1.00 28.42 ? 552 LEU A CD2 1 
ATOM   2013 N N   . LEU A 1 263 ? -40.708 7.657  1.050   1.00 19.16 ? 553 LEU A N   1 
ATOM   2014 C CA  . LEU A 1 263 ? -40.115 6.947  -0.102  1.00 19.11 ? 553 LEU A CA  1 
ATOM   2015 C C   . LEU A 1 263 ? -40.254 5.440  0.019   1.00 17.92 ? 553 LEU A C   1 
ATOM   2016 O O   . LEU A 1 263 ? -39.267 4.689  0.097   1.00 19.38 ? 553 LEU A O   1 
ATOM   2017 C CB  . LEU A 1 263 ? -38.662 7.398  -0.321  1.00 18.56 ? 553 LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 263 ? -38.479 8.856  -0.773  1.00 17.60 ? 553 LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 263 ? -37.007 9.210  -0.902  1.00 21.05 ? 553 LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 263 ? -39.219 9.162  -2.098  1.00 22.41 ? 553 LEU A CD2 1 
ATOM   2021 N N   . VAL A 1 264 ? -41.523 5.023  0.025   1.00 19.00 ? 554 VAL A N   1 
ATOM   2022 C CA  . VAL A 1 264 ? -41.929 3.619  0.182   1.00 19.22 ? 554 VAL A CA  1 
ATOM   2023 C C   . VAL A 1 264 ? -42.564 3.210  -1.140  1.00 20.37 ? 554 VAL A C   1 
ATOM   2024 O O   . VAL A 1 264 ? -43.483 3.865  -1.619  1.00 20.11 ? 554 VAL A O   1 
ATOM   2025 C CB  . VAL A 1 264 ? -42.942 3.449  1.344   1.00 19.13 ? 554 VAL A CB  1 
ATOM   2026 C CG1 . VAL A 1 264 ? -43.498 1.982  1.420   1.00 20.46 ? 554 VAL A CG1 1 
ATOM   2027 C CG2 . VAL A 1 264 ? -42.307 3.886  2.670   1.00 19.15 ? 554 VAL A CG2 1 
ATOM   2028 N N   . ARG A 1 265 ? -42.029 2.174  -1.769  1.00 20.69 ? 555 ARG A N   1 
ATOM   2029 C CA  . ARG A 1 265 ? -42.463 1.838  -3.119  1.00 21.94 ? 555 ARG A CA  1 
ATOM   2030 C C   . ARG A 1 265 ? -43.928 1.360  -3.201  1.00 22.29 ? 555 ARG A C   1 
ATOM   2031 O O   . ARG A 1 265 ? -44.669 1.820  -4.076  1.00 23.15 ? 555 ARG A O   1 
ATOM   2032 C CB  . ARG A 1 265 ? -41.554 0.770  -3.701  1.00 22.10 ? 555 ARG A CB  1 
ATOM   2033 C CG  . ARG A 1 265 ? -40.208 1.291  -4.080  1.00 20.78 ? 555 ARG A CG  1 
ATOM   2034 C CD  . ARG A 1 265 ? -39.216 0.171  -4.362  1.00 24.44 ? 555 ARG A CD  1 
ATOM   2035 N NE  . ARG A 1 265 ? -39.748 -0.861 -5.254  1.00 23.25 ? 555 ARG A NE  1 
ATOM   2036 C CZ  . ARG A 1 265 ? -40.010 -0.636 -6.538  1.00 28.55 ? 555 ARG A CZ  1 
ATOM   2037 N NH1 . ARG A 1 265 ? -40.506 -1.597 -7.293  1.00 28.61 ? 555 ARG A NH1 1 
ATOM   2038 N NH2 . ARG A 1 265 ? -39.760 0.532  -7.089  1.00 27.43 ? 555 ARG A NH2 1 
ATOM   2039 N N   . ASP A 1 266 ? -44.338 0.475  -2.286  1.00 23.17 ? 556 ASP A N   1 
ATOM   2040 C CA  . ASP A 1 266 ? -45.730 0.037  -2.224  1.00 22.77 ? 556 ASP A CA  1 
ATOM   2041 C C   . ASP A 1 266 ? -46.609 1.149  -1.627  1.00 23.10 ? 556 ASP A C   1 
ATOM   2042 O O   . ASP A 1 266 ? -46.529 1.438  -0.450  1.00 21.56 ? 556 ASP A O   1 
ATOM   2043 C CB  . ASP A 1 266 ? -45.832 -1.239 -1.375  1.00 23.40 ? 556 ASP A CB  1 
ATOM   2044 C CG  . ASP A 1 266 ? -47.256 -1.754 -1.253  1.00 23.69 ? 556 ASP A CG  1 
ATOM   2045 O OD1 . ASP A 1 266 ? -48.212 -1.123 -1.823  1.00 24.61 ? 556 ASP A OD1 1 
ATOM   2046 O OD2 . ASP A 1 266 ? -47.433 -2.800 -0.579  1.00 24.91 ? 556 ASP A OD2 1 
ATOM   2047 N N   . PRO A 1 267 ? -47.504 1.736  -2.434  1.00 23.48 ? 557 PRO A N   1 
ATOM   2048 C CA  . PRO A 1 267 ? -48.308 2.827  -1.896  1.00 23.27 ? 557 PRO A CA  1 
ATOM   2049 C C   . PRO A 1 267 ? -49.161 2.422  -0.709  1.00 22.95 ? 557 PRO A C   1 
ATOM   2050 O O   . PRO A 1 267 ? -49.433 3.260  0.141   1.00 24.63 ? 557 PRO A O   1 
ATOM   2051 C CB  . PRO A 1 267 ? -49.173 3.254  -3.084  1.00 24.75 ? 557 PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 267 ? -49.163 2.102  -4.007  1.00 23.72 ? 557 PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 267 ? -47.830 1.457  -3.842  1.00 24.69 ? 557 PRO A CD  1 
ATOM   2054 N N   . ALA A 1 268 ? -49.554 1.140  -0.609  1.00 22.85 ? 558 ALA A N   1 
ATOM   2055 C CA  . ALA A 1 268 ? -50.324 0.707  0.527   1.00 23.93 ? 558 ALA A CA  1 
ATOM   2056 C C   . ALA A 1 268 ? -49.539 0.754  1.862   1.00 23.80 ? 558 ALA A C   1 
ATOM   2057 O O   . ALA A 1 268 ? -50.142 0.782  2.952   1.00 25.57 ? 558 ALA A O   1 
ATOM   2058 C CB  . ALA A 1 268 ? -50.857 -0.709 0.262   1.00 23.90 ? 558 ALA A CB  1 
ATOM   2059 N N   . GLN A 1 269 ? -48.210 0.688  1.785   1.00 22.87 ? 559 GLN A N   1 
ATOM   2060 C CA  . GLN A 1 269 ? -47.333 0.785  2.971   1.00 23.38 ? 559 GLN A CA  1 
ATOM   2061 C C   . GLN A 1 269 ? -46.784 2.196  3.255   1.00 22.82 ? 559 GLN A C   1 
ATOM   2062 O O   . GLN A 1 269 ? -46.222 2.457  4.312   1.00 22.74 ? 559 GLN A O   1 
ATOM   2063 C CB  . GLN A 1 269 ? -46.119 -0.114 2.806   1.00 23.77 ? 559 GLN A CB  1 
ATOM   2064 C CG  . GLN A 1 269 ? -46.388 -1.576 2.684   1.00 26.11 ? 559 GLN A CG  1 
ATOM   2065 C CD  . GLN A 1 269 ? -45.089 -2.350 2.902   1.00 26.30 ? 559 GLN A CD  1 
ATOM   2066 O OE1 . GLN A 1 269 ? -45.073 -3.348 3.600   1.00 27.51 ? 559 GLN A OE1 1 
ATOM   2067 N NE2 . GLN A 1 269 ? -43.966 -1.834 2.323   1.00 26.98 ? 559 GLN A NE2 1 
ATOM   2068 N N   . ARG A 1 270 ? -46.987 3.099  2.315   1.00 21.63 ? 560 ARG A N   1 
ATOM   2069 C CA  . ARG A 1 270 ? -46.496 4.469  2.428   1.00 21.06 ? 560 ARG A CA  1 
ATOM   2070 C C   . ARG A 1 270 ? -47.319 5.247  3.466   1.00 21.63 ? 560 ARG A C   1 
ATOM   2071 O O   . ARG A 1 270 ? -48.542 5.034  3.587   1.00 22.85 ? 560 ARG A O   1 
ATOM   2072 C CB  . ARG A 1 270 ? -46.618 5.140  1.050   1.00 20.17 ? 560 ARG A CB  1 
ATOM   2073 C CG  . ARG A 1 270 ? -45.866 6.445  0.880   1.00 20.40 ? 560 ARG A CG  1 
ATOM   2074 C CD  . ARG A 1 270 ? -45.918 6.977  -0.555  1.00 22.11 ? 560 ARG A CD  1 
ATOM   2075 N NE  . ARG A 1 270 ? -45.473 5.978  -1.547  1.00 19.28 ? 560 ARG A NE  1 
ATOM   2076 C CZ  . ARG A 1 270 ? -45.976 5.808  -2.768  1.00 21.36 ? 560 ARG A CZ  1 
ATOM   2077 N NH1 . ARG A 1 270 ? -46.961 6.560  -3.268  1.00 18.55 ? 560 ARG A NH1 1 
ATOM   2078 N NH2 . ARG A 1 270 ? -45.511 4.832  -3.526  1.00 19.88 ? 560 ARG A NH2 1 
ATOM   2079 N N   . ALA A 1 271 ? -46.671 6.139  4.218   1.00 20.74 ? 561 ALA A N   1 
ATOM   2080 C CA  . ALA A 1 271 ? -47.436 6.906  5.197   1.00 21.55 ? 561 ALA A CA  1 
ATOM   2081 C C   . ALA A 1 271 ? -48.395 7.867  4.478   1.00 21.44 ? 561 ALA A C   1 
ATOM   2082 O O   . ALA A 1 271 ? -48.123 8.370  3.374   1.00 21.08 ? 561 ALA A O   1 
ATOM   2083 C CB  . ALA A 1 271 ? -46.513 7.666  6.149   1.00 21.67 ? 561 ALA A CB  1 
ATOM   2084 N N   . THR A 1 272 ? -49.482 8.183  5.159   1.00 20.72 ? 562 THR A N   1 
ATOM   2085 C CA  . THR A 1 272 ? -50.399 9.191  4.697   1.00 21.33 ? 562 THR A CA  1 
ATOM   2086 C C   . THR A 1 272 ? -49.995 10.548 5.284   1.00 21.53 ? 562 THR A C   1 
ATOM   2087 O O   . THR A 1 272 ? -49.238 10.639 6.245   1.00 21.08 ? 562 THR A O   1 
ATOM   2088 C CB  . THR A 1 272 ? -51.839 8.886  5.205   1.00 21.46 ? 562 THR A CB  1 
ATOM   2089 O OG1 . THR A 1 272 ? -51.854 8.951  6.636   1.00 22.57 ? 562 THR A OG1 1 
ATOM   2090 C CG2 . THR A 1 272 ? -52.306 7.532  4.777   1.00 21.68 ? 562 THR A CG2 1 
ATOM   2091 N N   . ALA A 1 273 ? -50.536 11.611 4.710   1.00 21.25 ? 563 ALA A N   1 
ATOM   2092 C CA  . ALA A 1 273 ? -50.288 12.940 5.197   1.00 22.17 ? 563 ALA A CA  1 
ATOM   2093 C C   . ALA A 1 273 ? -50.712 13.070 6.658   1.00 22.63 ? 563 ALA A C   1 
ATOM   2094 O O   . ALA A 1 273 ? -49.999 13.643 7.472   1.00 22.77 ? 563 ALA A O   1 
ATOM   2095 C CB  . ALA A 1 273 ? -50.986 13.961 4.319   1.00 21.09 ? 563 ALA A CB  1 
ATOM   2096 N N   . ALA A 1 274 ? -51.863 12.479 7.005   1.00 23.89 ? 564 ALA A N   1 
ATOM   2097 C CA  . ALA A 1 274 ? -52.399 12.566 8.367   1.00 24.02 ? 564 ALA A CA  1 
ATOM   2098 C C   . ALA A 1 274 ? -51.463 11.878 9.381   1.00 24.82 ? 564 ALA A C   1 
ATOM   2099 O O   . ALA A 1 274 ? -51.222 12.418 10.473  1.00 25.79 ? 564 ALA A O   1 
ATOM   2100 C CB  . ALA A 1 274 ? -53.745 11.956 8.393   1.00 25.09 ? 564 ALA A CB  1 
ATOM   2101 N N   . GLU A 1 275 ? -50.912 10.726 8.998   1.00 23.52 ? 565 GLU A N   1 
ATOM   2102 C CA  A GLU A 1 275 ? -49.934 10.046 9.822   0.50 23.21 ? 565 GLU A CA  1 
ATOM   2103 C CA  B GLU A 1 275 ? -49.885 10.011 9.799   0.50 23.85 ? 565 GLU A CA  1 
ATOM   2104 C C   . GLU A 1 275 ? -48.644 10.853 9.975   1.00 23.62 ? 565 GLU A C   1 
ATOM   2105 O O   . GLU A 1 275 ? -48.107 11.031 11.092  1.00 22.48 ? 565 GLU A O   1 
ATOM   2106 C CB  A GLU A 1 275 ? -49.679 8.659  9.224   0.50 22.91 ? 565 GLU A CB  1 
ATOM   2107 C CB  B GLU A 1 275 ? -49.449 8.648  9.175   0.50 23.70 ? 565 GLU A CB  1 
ATOM   2108 C CG  A GLU A 1 275 ? -50.889 7.712  9.333   0.50 22.33 ? 565 GLU A CG  1 
ATOM   2109 C CG  B GLU A 1 275 ? -47.987 8.247  9.642   0.50 24.47 ? 565 GLU A CG  1 
ATOM   2110 C CD  A GLU A 1 275 ? -50.786 6.501  8.413   0.50 22.46 ? 565 GLU A CD  1 
ATOM   2111 C CD  B GLU A 1 275 ? -47.483 6.812  9.363   0.50 24.71 ? 565 GLU A CD  1 
ATOM   2112 O OE1 A GLU A 1 275 ? -49.860 6.428  7.583   0.50 18.47 ? 565 GLU A OE1 1 
ATOM   2113 O OE1 B GLU A 1 275 ? -48.180 5.965  8.788   0.50 26.01 ? 565 GLU A OE1 1 
ATOM   2114 O OE2 A GLU A 1 275 ? -51.625 5.596  8.552   0.50 22.49 ? 565 GLU A OE2 1 
ATOM   2115 O OE2 B GLU A 1 275 ? -46.320 6.546  9.744   0.50 28.36 ? 565 GLU A OE2 1 
ATOM   2116 N N   . LEU A 1 276 ? -48.158 11.402 8.866   1.00 22.52 ? 566 LEU A N   1 
ATOM   2117 C CA  . LEU A 1 276 ? -46.942 12.149 8.884   1.00 21.10 ? 566 LEU A CA  1 
ATOM   2118 C C   . LEU A 1 276 ? -47.015 13.444 9.738   1.00 21.99 ? 566 LEU A C   1 
ATOM   2119 O O   . LEU A 1 276 ? -45.983 13.886 10.228  1.00 21.29 ? 566 LEU A O   1 
ATOM   2120 C CB  . LEU A 1 276 ? -46.494 12.435 7.437   1.00 21.51 ? 566 LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 276 ? -46.046 11.230 6.604   1.00 19.55 ? 566 LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 276 ? -46.046 11.585 5.081   1.00 23.80 ? 566 LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 276 ? -44.694 10.736 7.076   1.00 23.07 ? 566 LEU A CD2 1 
ATOM   2124 N N   . LEU A 1 277 ? -48.212 14.010 9.927   1.00 21.27 ? 567 LEU A N   1 
ATOM   2125 C CA  . LEU A 1 277 ? -48.334 15.233 10.727  1.00 22.74 ? 567 LEU A CA  1 
ATOM   2126 C C   . LEU A 1 277 ? -47.958 15.022 12.199  1.00 22.92 ? 567 LEU A C   1 
ATOM   2127 O O   . LEU A 1 277 ? -47.629 16.001 12.928  1.00 24.56 ? 567 LEU A O   1 
ATOM   2128 C CB  . LEU A 1 277 ? -49.752 15.788 10.613  1.00 22.79 ? 567 LEU A CB  1 
ATOM   2129 C CG  . LEU A 1 277 ? -49.960 16.566 9.288   1.00 23.03 ? 567 LEU A CG  1 
ATOM   2130 C CD1 . LEU A 1 277 ? -51.484 16.735 9.101   1.00 26.15 ? 567 LEU A CD1 1 
ATOM   2131 C CD2 . LEU A 1 277 ? -49.217 17.876 9.193   1.00 24.58 ? 567 LEU A CD2 1 
ATOM   2132 N N   . LYS A 1 278 ? -47.976 13.759 12.589  1.00 22.07 ? 568 LYS A N   1 
ATOM   2133 C CA  . LYS A 1 278 ? -47.598 13.336 13.953  1.00 23.36 ? 568 LYS A CA  1 
ATOM   2134 C C   . LYS A 1 278 ? -46.154 12.800 14.070  1.00 20.72 ? 568 LYS A C   1 
ATOM   2135 O O   . LYS A 1 278 ? -45.760 12.390 15.140  1.00 20.09 ? 568 LYS A O   1 
ATOM   2136 C CB  . LYS A 1 278 ? -48.576 12.302 14.414  1.00 23.69 ? 568 LYS A CB  1 
ATOM   2137 C CG  . LYS A 1 278 ? -50.041 12.827 14.535  1.00 27.93 ? 568 LYS A CG  1 
ATOM   2138 C CD  . LYS A 1 278 ? -50.992 11.729 14.955  1.00 29.32 ? 568 LYS A CD  1 
ATOM   2139 C CE  . LYS A 1 278 ? -51.376 10.828 13.768  1.00 34.58 ? 568 LYS A CE  1 
ATOM   2140 N NZ  . LYS A 1 278 ? -52.153 9.615  14.173  1.00 35.80 ? 568 LYS A NZ  1 
ATOM   2141 N N   . HIS A 1 279 ? -45.389 12.806 12.981  1.00 20.23 ? 569 HIS A N   1 
ATOM   2142 C CA  . HIS A 1 279 ? -43.997 12.303 13.010  1.00 20.24 ? 569 HIS A CA  1 
ATOM   2143 C C   . HIS A 1 279 ? -43.137 13.295 13.771  1.00 19.33 ? 569 HIS A C   1 
ATOM   2144 O O   . HIS A 1 279 ? -43.232 14.489 13.521  1.00 18.92 ? 569 HIS A O   1 
ATOM   2145 C CB  . HIS A 1 279 ? -43.433 12.074 11.586  1.00 20.64 ? 569 HIS A CB  1 
ATOM   2146 C CG  . HIS A 1 279 ? -42.169 11.289 11.597  1.00 20.02 ? 569 HIS A CG  1 
ATOM   2147 N ND1 . HIS A 1 279 ? -40.962 11.818 12.004  1.00 22.08 ? 569 HIS A ND1 1 
ATOM   2148 C CD2 . HIS A 1 279 ? -41.932 9.988  11.319  1.00 22.71 ? 569 HIS A CD2 1 
ATOM   2149 C CE1 . HIS A 1 279 ? -40.044 10.868 12.004  1.00 20.71 ? 569 HIS A CE1 1 
ATOM   2150 N NE2 . HIS A 1 279 ? -40.618 9.736  11.626  1.00 22.24 ? 569 HIS A NE2 1 
ATOM   2151 N N   . PRO A 1 280 ? -42.302 12.831 14.725  1.00 20.14 ? 570 PRO A N   1 
ATOM   2152 C CA  . PRO A 1 280 ? -41.582 13.768 15.566  1.00 19.31 ? 570 PRO A CA  1 
ATOM   2153 C C   . PRO A 1 280 ? -40.488 14.590 14.844  1.00 19.51 ? 570 PRO A C   1 
ATOM   2154 O O   . PRO A 1 280 ? -40.044 15.627 15.383  1.00 20.44 ? 570 PRO A O   1 
ATOM   2155 C CB  . PRO A 1 280 ? -40.962 12.873 16.651  1.00 19.87 ? 570 PRO A CB  1 
ATOM   2156 C CG  . PRO A 1 280 ? -40.808 11.555 15.981  1.00 20.24 ? 570 PRO A CG  1 
ATOM   2157 C CD  . PRO A 1 280 ? -42.008 11.433 15.068  1.00 20.23 ? 570 PRO A CD  1 
ATOM   2158 N N   . PHE A 1 281 ? -40.101 14.209 13.630  1.00 18.47 ? 571 PHE A N   1 
ATOM   2159 C CA  . PHE A 1 281 ? -39.266 15.120 12.813  1.00 18.47 ? 571 PHE A CA  1 
ATOM   2160 C C   . PHE A 1 281 ? -39.906 16.477 12.725  1.00 18.65 ? 571 PHE A C   1 
ATOM   2161 O O   . PHE A 1 281 ? -39.211 17.469 12.812  1.00 17.83 ? 571 PHE A O   1 
ATOM   2162 C CB  . PHE A 1 281 ? -38.976 14.563 11.426  1.00 20.34 ? 571 PHE A CB  1 
ATOM   2163 C CG  . PHE A 1 281 ? -38.249 15.532 10.527  1.00 18.70 ? 571 PHE A CG  1 
ATOM   2164 C CD1 . PHE A 1 281 ? -36.943 15.905 10.804  1.00 20.94 ? 571 PHE A CD1 1 
ATOM   2165 C CD2 . PHE A 1 281 ? -38.874 16.068 9.393   1.00 19.59 ? 571 PHE A CD2 1 
ATOM   2166 C CE1 . PHE A 1 281 ? -36.290 16.799 9.975   1.00 20.41 ? 571 PHE A CE1 1 
ATOM   2167 C CE2 . PHE A 1 281 ? -38.216 16.961 8.585   1.00 19.94 ? 571 PHE A CE2 1 
ATOM   2168 C CZ  . PHE A 1 281 ? -36.908 17.318 8.898   1.00 20.74 ? 571 PHE A CZ  1 
ATOM   2169 N N   . LEU A 1 282 ? -41.236 16.546 12.598  1.00 18.79 ? 572 LEU A N   1 
ATOM   2170 C CA  . LEU A 1 282 ? -41.862 17.852 12.418  1.00 19.04 ? 572 LEU A CA  1 
ATOM   2171 C C   . LEU A 1 282 ? -41.873 18.728 13.675  1.00 19.32 ? 572 LEU A C   1 
ATOM   2172 O O   . LEU A 1 282 ? -42.190 19.920 13.558  1.00 18.94 ? 572 LEU A O   1 
ATOM   2173 C CB  . LEU A 1 282 ? -43.268 17.707 11.881  1.00 20.03 ? 572 LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 282 ? -43.420 16.973 10.542  1.00 18.90 ? 572 LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 282 ? -44.894 16.883 10.073  1.00 22.37 ? 572 LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 282 ? -42.534 17.627 9.483   1.00 19.76 ? 572 LEU A CD2 1 
ATOM   2177 N N   . ALA A 1 283 ? -41.553 18.151 14.848  1.00 18.51 ? 573 ALA A N   1 
ATOM   2178 C CA  . ALA A 1 283 ? -41.380 18.933 16.092  1.00 20.53 ? 573 ALA A CA  1 
ATOM   2179 C C   . ALA A 1 283 ? -40.224 19.892 16.000  1.00 21.16 ? 573 ALA A C   1 
ATOM   2180 O O   . ALA A 1 283 ? -40.100 20.845 16.825  1.00 23.73 ? 573 ALA A O   1 
ATOM   2181 C CB  . ALA A 1 283 ? -41.183 17.992 17.322  1.00 19.76 ? 573 ALA A CB  1 
ATOM   2182 N N   . LYS A 1 284 ? -39.335 19.647 15.045  1.00 21.68 ? 574 LYS A N   1 
ATOM   2183 C CA  . LYS A 1 284 ? -38.204 20.552 14.758  1.00 23.59 ? 574 LYS A CA  1 
ATOM   2184 C C   . LYS A 1 284 ? -38.595 21.851 14.044  1.00 23.57 ? 574 LYS A C   1 
ATOM   2185 O O   . LYS A 1 284 ? -37.786 22.776 13.958  1.00 23.20 ? 574 LYS A O   1 
ATOM   2186 C CB  . LYS A 1 284 ? -37.155 19.856 13.867  1.00 23.10 ? 574 LYS A CB  1 
ATOM   2187 C CG  . LYS A 1 284 ? -36.552 18.576 14.349  1.00 25.38 ? 574 LYS A CG  1 
ATOM   2188 C CD  . LYS A 1 284 ? -35.162 18.401 13.689  1.00 26.32 ? 574 LYS A CD  1 
ATOM   2189 C CE  . LYS A 1 284 ? -34.503 17.106 14.022  1.00 27.01 ? 574 LYS A CE  1 
ATOM   2190 N NZ  . LYS A 1 284 ? -33.035 17.147 13.771  1.00 25.46 ? 574 LYS A NZ  1 
ATOM   2191 N N   . ALA A 1 285 ? -39.810 21.933 13.471  1.00 23.01 ? 575 ALA A N   1 
ATOM   2192 C CA  . ALA A 1 285 ? -40.134 23.040 12.603  1.00 23.20 ? 575 ALA A CA  1 
ATOM   2193 C C   . ALA A 1 285 ? -39.914 24.395 13.248  1.00 24.36 ? 575 ALA A C   1 
ATOM   2194 O O   . ALA A 1 285 ? -40.455 24.673 14.293  1.00 23.66 ? 575 ALA A O   1 
ATOM   2195 C CB  . ALA A 1 285 ? -41.555 22.937 12.082  1.00 22.81 ? 575 ALA A CB  1 
ATOM   2196 N N   . GLY A 1 286 ? -39.122 25.241 12.588  1.00 24.76 ? 576 GLY A N   1 
ATOM   2197 C CA  . GLY A 1 286 ? -39.035 26.640 12.988  1.00 24.75 ? 576 GLY A CA  1 
ATOM   2198 C C   . GLY A 1 286 ? -40.269 27.431 12.545  1.00 24.50 ? 576 GLY A C   1 
ATOM   2199 O O   . GLY A 1 286 ? -41.093 26.946 11.762  1.00 25.12 ? 576 GLY A O   1 
ATOM   2200 N N   . PRO A 1 287 ? -40.394 28.675 13.022  1.00 23.97 ? 577 PRO A N   1 
ATOM   2201 C CA  . PRO A 1 287 ? -41.470 29.553 12.590  1.00 24.18 ? 577 PRO A CA  1 
ATOM   2202 C C   . PRO A 1 287 ? -41.176 30.114 11.204  1.00 25.29 ? 577 PRO A C   1 
ATOM   2203 O O   . PRO A 1 287 ? -40.093 29.918 10.700  1.00 24.66 ? 577 PRO A O   1 
ATOM   2204 C CB  . PRO A 1 287 ? -41.414 30.683 13.618  1.00 24.85 ? 577 PRO A CB  1 
ATOM   2205 C CG  . PRO A 1 287 ? -39.988 30.778 13.920  1.00 22.90 ? 577 PRO A CG  1 
ATOM   2206 C CD  . PRO A 1 287 ? -39.503 29.360 13.974  1.00 24.32 ? 577 PRO A CD  1 
ATOM   2207 N N   . PRO A 1 288 ? -42.114 30.887 10.617  1.00 26.33 ? 578 PRO A N   1 
ATOM   2208 C CA  . PRO A 1 288 ? -41.877 31.585 9.343   1.00 24.80 ? 578 PRO A CA  1 
ATOM   2209 C C   . PRO A 1 288 ? -40.644 32.482 9.339   1.00 25.68 ? 578 PRO A C   1 
ATOM   2210 O O   . PRO A 1 288 ? -39.987 32.571 8.325   1.00 27.03 ? 578 PRO A O   1 
ATOM   2211 C CB  . PRO A 1 288 ? -43.158 32.409 9.151   1.00 26.47 ? 578 PRO A CB  1 
ATOM   2212 C CG  . PRO A 1 288 ? -44.235 31.538 9.848   1.00 26.99 ? 578 PRO A CG  1 
ATOM   2213 C CD  . PRO A 1 288 ? -43.498 31.082 11.106  1.00 27.13 ? 578 PRO A CD  1 
ATOM   2214 N N   . ALA A 1 289 ? -40.325 33.107 10.458  1.00 25.25 ? 579 ALA A N   1 
ATOM   2215 C CA  . ALA A 1 289 ? -39.109 33.938 10.547  1.00 24.62 ? 579 ALA A CA  1 
ATOM   2216 C C   . ALA A 1 289 ? -37.844 33.130 10.193  1.00 24.13 ? 579 ALA A C   1 
ATOM   2217 O O   . ALA A 1 289 ? -36.837 33.723 9.760   1.00 24.98 ? 579 ALA A O   1 
ATOM   2218 C CB  . ALA A 1 289 ? -38.973 34.597 11.887  1.00 23.99 ? 579 ALA A CB  1 
ATOM   2219 N N   . SER A 1 290 ? -37.887 31.810 10.357  1.00 22.18 ? 580 SER A N   1 
ATOM   2220 C CA  . SER A 1 290 ? -36.707 30.983 10.091  1.00 22.24 ? 580 SER A CA  1 
ATOM   2221 C C   . SER A 1 290 ? -36.438 30.794 8.611   1.00 21.54 ? 580 SER A C   1 
ATOM   2222 O O   . SER A 1 290 ? -35.288 30.577 8.254   1.00 22.29 ? 580 SER A O   1 
ATOM   2223 C CB  . SER A 1 290 ? -36.749 29.623 10.824  1.00 23.61 ? 580 SER A CB  1 
ATOM   2224 O OG  . SER A 1 290 ? -37.664 28.738 10.196  1.00 25.68 ? 580 SER A OG  1 
ATOM   2225 N N   . ILE A 1 291 ? -37.479 30.883 7.767   1.00 20.38 ? 581 ILE A N   1 
ATOM   2226 C CA  . ILE A 1 291 ? -37.369 30.732 6.291   1.00 20.76 ? 581 ILE A CA  1 
ATOM   2227 C C   . ILE A 1 291 ? -36.910 32.017 5.594   1.00 18.98 ? 581 ILE A C   1 
ATOM   2228 O O   . ILE A 1 291 ? -36.196 31.948 4.577   1.00 18.82 ? 581 ILE A O   1 
ATOM   2229 C CB  . ILE A 1 291 ? -38.753 30.340 5.699   1.00 21.73 ? 581 ILE A CB  1 
ATOM   2230 C CG1 . ILE A 1 291 ? -39.145 28.961 6.210   1.00 25.15 ? 581 ILE A CG1 1 
ATOM   2231 C CG2 . ILE A 1 291 ? -38.816 30.387 4.219   1.00 24.19 ? 581 ILE A CG2 1 
ATOM   2232 C CD1 . ILE A 1 291 ? -38.161 27.884 5.906   1.00 25.26 ? 581 ILE A CD1 1 
ATOM   2233 N N   . VAL A 1 292 ? -37.332 33.165 6.123   1.00 19.72 ? 582 VAL A N   1 
ATOM   2234 C CA  . VAL A 1 292 ? -37.065 34.473 5.541   1.00 19.04 ? 582 VAL A CA  1 
ATOM   2235 C C   . VAL A 1 292 ? -35.615 34.648 5.118   1.00 17.77 ? 582 VAL A C   1 
ATOM   2236 O O   . VAL A 1 292 ? -35.381 35.140 4.019   1.00 17.96 ? 582 VAL A O   1 
ATOM   2237 C CB  . VAL A 1 292 ? -37.549 35.609 6.428   1.00 20.22 ? 582 VAL A CB  1 
ATOM   2238 C CG1 . VAL A 1 292 ? -37.137 36.970 5.858   1.00 20.84 ? 582 VAL A CG1 1 
ATOM   2239 C CG2 . VAL A 1 292 ? -39.112 35.524 6.558   1.00 23.37 ? 582 VAL A CG2 1 
ATOM   2240 N N   . PRO A 1 293 ? -34.633 34.298 5.983   1.00 18.13 ? 583 PRO A N   1 
ATOM   2241 C CA  . PRO A 1 293 ? -33.252 34.593 5.561   1.00 18.01 ? 583 PRO A CA  1 
ATOM   2242 C C   . PRO A 1 293 ? -32.726 33.791 4.374   1.00 17.84 ? 583 PRO A C   1 
ATOM   2243 O O   . PRO A 1 293 ? -31.660 34.147 3.884   1.00 18.51 ? 583 PRO A O   1 
ATOM   2244 C CB  . PRO A 1 293 ? -32.414 34.254 6.793   1.00 19.62 ? 583 PRO A CB  1 
ATOM   2245 C CG  . PRO A 1 293 ? -33.372 34.093 7.906   1.00 20.00 ? 583 PRO A CG  1 
ATOM   2246 C CD  . PRO A 1 293 ? -34.674 33.746 7.352   1.00 19.08 ? 583 PRO A CD  1 
ATOM   2247 N N   . LEU A 1 294 ? -33.395 32.697 4.033   1.00 17.58 ? 584 LEU A N   1 
ATOM   2248 C CA  . LEU A 1 294 ? -33.061 31.888 2.842   1.00 18.33 ? 584 LEU A CA  1 
ATOM   2249 C C   . LEU A 1 294 ? -33.455 32.547 1.523   1.00 18.19 ? 584 LEU A C   1 
ATOM   2250 O O   . LEU A 1 294 ? -32.894 32.192 0.504   1.00 17.67 ? 584 LEU A O   1 
ATOM   2251 C CB  . LEU A 1 294 ? -33.757 30.552 2.905   1.00 18.99 ? 584 LEU A CB  1 
ATOM   2252 C CG  . LEU A 1 294 ? -33.471 29.527 4.043   1.00 21.01 ? 584 LEU A CG  1 
ATOM   2253 C CD1 . LEU A 1 294 ? -34.598 28.473 4.159   1.00 23.30 ? 584 LEU A CD1 1 
ATOM   2254 C CD2 . LEU A 1 294 ? -32.210 28.813 3.778   1.00 26.30 ? 584 LEU A CD2 1 
ATOM   2255 N N   . MET A 1 295 ? -34.413 33.469 1.552   1.00 17.90 ? 585 MET A N   1 
ATOM   2256 C CA  A MET A 1 295 ? -35.049 33.971 0.342   0.50 17.96 ? 585 MET A CA  1 
ATOM   2257 C CA  B MET A 1 295 ? -35.019 33.919 0.310   0.50 17.88 ? 585 MET A CA  1 
ATOM   2258 C C   . MET A 1 295 ? -34.066 34.872 -0.418  1.00 16.87 ? 585 MET A C   1 
ATOM   2259 O O   . MET A 1 295 ? -33.272 35.599 0.197   1.00 18.77 ? 585 MET A O   1 
ATOM   2260 C CB  A MET A 1 295 ? -36.297 34.769 0.688   0.50 18.21 ? 585 MET A CB  1 
ATOM   2261 C CB  B MET A 1 295 ? -36.383 34.539 0.539   0.50 17.89 ? 585 MET A CB  1 
ATOM   2262 C CG  A MET A 1 295 ? -37.279 34.046 1.591   0.50 18.98 ? 585 MET A CG  1 
ATOM   2263 C CG  B MET A 1 295 ? -37.450 33.507 0.934   0.50 19.51 ? 585 MET A CG  1 
ATOM   2264 S SD  A MET A 1 295 ? -38.685 35.079 1.931   0.50 21.34 ? 585 MET A SD  1 
ATOM   2265 S SD  B MET A 1 295 ? -39.084 34.200 1.284   0.50 20.40 ? 585 MET A SD  1 
ATOM   2266 C CE  A MET A 1 295 ? -39.746 33.768 2.412   0.50 20.16 ? 585 MET A CE  1 
ATOM   2267 C CE  B MET A 1 295 ? -38.667 35.729 2.127   0.50 22.21 ? 585 MET A CE  1 
ATOM   2268 N N   . ARG A 1 296 ? -34.143 34.877 -1.740  1.00 18.28 ? 586 ARG A N   1 
ATOM   2269 C CA  . ARG A 1 296 ? -33.193 35.651 -2.557  1.00 18.56 ? 586 ARG A CA  1 
ATOM   2270 C C   . ARG A 1 296 ? -33.019 37.080 -2.114  1.00 18.75 ? 586 ARG A C   1 
ATOM   2271 O O   . ARG A 1 296 ? -31.900 37.612 -2.145  1.00 19.53 ? 586 ARG A O   1 
ATOM   2272 C CB  . ARG A 1 296 ? -33.673 35.650 -3.994  1.00 18.83 ? 586 ARG A CB  1 
ATOM   2273 C CG  . ARG A 1 296 ? -32.903 36.458 -4.980  1.00 20.20 ? 586 ARG A CG  1 
ATOM   2274 C CD  . ARG A 1 296 ? -33.440 36.191 -6.416  1.00 20.94 ? 586 ARG A CD  1 
ATOM   2275 N NE  . ARG A 1 296 ? -33.028 34.895 -6.952  1.00 23.03 ? 586 ARG A NE  1 
ATOM   2276 C CZ  . ARG A 1 296 ? -31.988 34.691 -7.771  1.00 22.40 ? 586 ARG A CZ  1 
ATOM   2277 N NH1 . ARG A 1 296 ? -31.242 35.702 -8.179  1.00 24.42 ? 586 ARG A NH1 1 
ATOM   2278 N NH2 . ARG A 1 296 ? -31.705 33.476 -8.153  1.00 22.82 ? 586 ARG A NH2 1 
ATOM   2279 N N   . GLN A 1 297 ? -34.119 37.735 -1.786  1.00 19.64 ? 587 GLN A N   1 
ATOM   2280 C CA  . GLN A 1 297 ? -34.081 39.155 -1.371  1.00 20.24 ? 587 GLN A CA  1 
ATOM   2281 C C   . GLN A 1 297 ? -33.348 39.427 -0.060  1.00 21.22 ? 587 GLN A C   1 
ATOM   2282 O O   . GLN A 1 297 ? -33.047 40.600 0.253   1.00 21.12 ? 587 GLN A O   1 
ATOM   2283 C CB  . GLN A 1 297 ? -35.466 39.802 -1.360  1.00 20.96 ? 587 GLN A CB  1 
ATOM   2284 C CG  . GLN A 1 297 ? -36.466 39.209 -0.408  1.00 23.15 ? 587 GLN A CG  1 
ATOM   2285 C CD  . GLN A 1 297 ? -37.313 38.130 -1.101  1.00 23.21 ? 587 GLN A CD  1 
ATOM   2286 O OE1 . GLN A 1 297 ? -36.796 37.177 -1.709  1.00 22.44 ? 587 GLN A OE1 1 
ATOM   2287 N NE2 . GLN A 1 297 ? -38.656 38.367 -1.125  1.00 28.36 ? 587 GLN A NE2 1 
ATOM   2288 N N   . ASN A 1 298 ? -33.043 38.369 0.695   1.00 19.55 ? 588 ASN A N   1 
ATOM   2289 C CA  . ASN A 1 298 ? -32.347 38.493 1.956   1.00 21.94 ? 588 ASN A CA  1 
ATOM   2290 C C   . ASN A 1 298 ? -30.969 37.854 1.940   1.00 22.25 ? 588 ASN A C   1 
ATOM   2291 O O   . ASN A 1 298 ? -30.196 38.044 2.869   1.00 21.97 ? 588 ASN A O   1 
ATOM   2292 C CB  . ASN A 1 298 ? -33.220 37.892 3.056   1.00 21.86 ? 588 ASN A CB  1 
ATOM   2293 C CG  . ASN A 1 298 ? -34.508 38.647 3.192   1.00 22.27 ? 588 ASN A CG  1 
ATOM   2294 O OD1 . ASN A 1 298 ? -34.466 39.886 3.200   1.00 27.15 ? 588 ASN A OD1 1 
ATOM   2295 N ND2 . ASN A 1 298 ? -35.663 37.960 3.191   1.00 21.25 ? 588 ASN A ND2 1 
ATOM   2296 N N   . ARG A 1 299 ? -30.677 37.078 0.892   1.00 24.51 ? 589 ARG A N   1 
ATOM   2297 C CA  . ARG A 1 299 ? -29.426 36.311 0.795   1.00 25.31 ? 589 ARG A CA  1 
ATOM   2298 C C   . ARG A 1 299 ? -28.230 37.218 0.551   1.00 26.83 ? 589 ARG A C   1 
ATOM   2299 O O   . ARG A 1 299 ? -28.329 38.280 -0.098  1.00 26.11 ? 589 ARG A O   1 
ATOM   2300 C CB  . ARG A 1 299 ? -29.461 35.247 -0.347  1.00 26.33 ? 589 ARG A CB  1 
ATOM   2301 C CG  . ARG A 1 299 ? -30.218 33.967 -0.067  1.00 22.05 ? 589 ARG A CG  1 
ATOM   2302 C CD  . ARG A 1 299 ? -29.928 32.922 -1.126  1.00 22.66 ? 589 ARG A CD  1 
ATOM   2303 N NE  . ARG A 1 299 ? -30.162 33.080 -2.340  0.00 38.66 ? 589 ARG A NE  1 
ATOM   2304 C CZ  . ARG A 1 299 ? -31.234 32.705 -3.020  1.00 24.44 ? 589 ARG A CZ  1 
ATOM   2305 N NH1 . ARG A 1 299 ? -31.372 32.887 -4.332  1.00 25.19 ? 589 ARG A NH1 1 
ATOM   2306 N NH2 . ARG A 1 299 ? -32.244 32.150 -2.341  1.00 19.27 ? 589 ARG A NH2 1 
ATOM   2307 N N   . THR A 1 300 ? -27.086 36.762 1.061   1.00 28.90 ? 590 THR A N   1 
ATOM   2308 C CA  . THR A 1 300 ? -25.779 37.413 0.836   1.00 31.36 ? 590 THR A CA  1 
ATOM   2309 C C   . THR A 1 300 ? -25.071 36.598 -0.248  1.00 33.96 ? 590 THR A C   1 
ATOM   2310 O O   . THR A 1 300 ? -25.673 35.713 -0.872  1.00 35.54 ? 590 THR A O   1 
ATOM   2311 C CB  . THR A 1 300 ? -24.913 37.347 2.110   1.00 30.95 ? 590 THR A CB  1 
ATOM   2312 O OG1 . THR A 1 300 ? -24.564 35.974 2.367   1.00 32.42 ? 590 THR A OG1 1 
ATOM   2313 C CG2 . THR A 1 300 ? -25.659 37.907 3.320   1.00 29.93 ? 590 THR A CG2 1 
ATOM   2314 N N   . ARG A 1 301 ? -23.783 36.837 -0.431  1.00 36.95 ? 591 ARG A N   1 
ATOM   2315 C CA  . ARG A 1 301 ? -22.985 36.027 -1.381  1.00 38.49 ? 591 ARG A CA  1 
ATOM   2316 C C   . ARG A 1 301 ? -23.010 36.674 -2.756  1.00 38.65 ? 591 ARG A C   1 
ATOM   2317 O O   . ARG A 1 301 ? -22.825 37.885 -2.888  1.00 39.05 ? 591 ARG A O   1 
ATOM   2318 C CB  . ARG A 1 301 ? -23.525 34.602 -1.555  1.00 38.44 ? 591 ARG A CB  1 
ATOM   2319 C CG  . ARG A 1 301 ? -23.492 33.707 -0.348  1.00 39.58 ? 591 ARG A CG  1 
ATOM   2320 C CD  . ARG A 1 301 ? -22.245 32.841 -0.357  1.00 39.22 ? 591 ARG A CD  1 
ATOM   2321 N NE  . ARG A 1 301 ? -22.403 31.694 0.533   1.00 38.30 ? 591 ARG A NE  1 
ATOM   2322 C CZ  . ARG A 1 301 ? -21.393 30.954 0.975   1.00 37.59 ? 591 ARG A CZ  1 
ATOM   2323 N NH1 . ARG A 1 301 ? -20.148 31.224 0.605   1.00 37.50 ? 591 ARG A NH1 1 
ATOM   2324 N NH2 . ARG A 1 301 ? -21.629 29.936 1.789   1.00 36.31 ? 591 ARG A NH2 1 
ATOM   2325 O OXT . ARG A 1 301 ? -23.227 35.953 -3.747  1.00 39.77 ? 591 ARG A OXT 1 
ATOM   2326 N N   . ARG B 2 1   ? -31.708 14.727 -17.979 1.00 31.11 ? -5  ARG B N   1 
ATOM   2327 C CA  . ARG B 2 1   ? -31.776 15.936 -18.840 1.00 27.91 ? -5  ARG B CA  1 
ATOM   2328 C C   . ARG B 2 1   ? -32.038 17.193 -18.040 1.00 26.87 ? -5  ARG B C   1 
ATOM   2329 O O   . ARG B 2 1   ? -32.124 18.245 -18.636 1.00 24.44 ? -5  ARG B O   1 
ATOM   2330 C CB  . ARG B 2 1   ? -32.949 15.848 -19.807 1.00 28.13 ? -5  ARG B CB  1 
ATOM   2331 C CG  . ARG B 2 1   ? -32.591 15.301 -21.049 1.00 33.82 ? -5  ARG B CG  1 
ATOM   2332 C CD  . ARG B 2 1   ? -33.663 15.403 -22.082 1.00 38.50 ? -5  ARG B CD  1 
ATOM   2333 N NE  . ARG B 2 1   ? -33.647 14.189 -22.874 1.00 41.07 ? -5  ARG B NE  1 
ATOM   2334 C CZ  . ARG B 2 1   ? -32.586 13.635 -23.433 1.00 35.47 ? -5  ARG B CZ  1 
ATOM   2335 N NH1 . ARG B 2 1   ? -31.360 14.098 -23.307 1.00 39.34 ? -5  ARG B NH1 1 
ATOM   2336 N NH2 . ARG B 2 1   ? -32.763 12.529 -24.106 1.00 38.13 ? -5  ARG B NH2 1 
ATOM   2337 N N   . ARG B 2 2   ? -32.196 17.079 -16.718 1.00 25.06 ? -4  ARG B N   1 
ATOM   2338 C CA  . ARG B 2 2   ? -32.367 18.250 -15.833 1.00 25.61 ? -4  ARG B CA  1 
ATOM   2339 C C   . ARG B 2 2   ? -33.536 19.164 -16.180 1.00 24.11 ? -4  ARG B C   1 
ATOM   2340 O O   . ARG B 2 2   ? -33.536 20.365 -15.836 1.00 24.82 ? -4  ARG B O   1 
ATOM   2341 C CB  . ARG B 2 2   ? -31.067 19.059 -15.774 1.00 25.16 ? -4  ARG B CB  1 
ATOM   2342 C CG  . ARG B 2 2   ? -29.829 18.255 -15.495 1.00 27.54 ? -4  ARG B CG  1 
ATOM   2343 C CD  . ARG B 2 2   ? -28.601 19.136 -15.470 1.00 29.84 ? -4  ARG B CD  1 
ATOM   2344 N NE  . ARG B 2 2   ? -28.705 20.077 -14.367 1.00 35.06 ? -4  ARG B NE  1 
ATOM   2345 C CZ  . ARG B 2 2   ? -28.396 19.798 -13.099 1.00 35.43 ? -4  ARG B CZ  1 
ATOM   2346 N NH1 . ARG B 2 2   ? -27.941 18.599 -12.730 1.00 38.06 ? -4  ARG B NH1 1 
ATOM   2347 N NH2 . ARG B 2 2   ? -28.565 20.735 -12.188 1.00 38.00 ? -4  ARG B NH2 1 
ATOM   2348 N N   . ARG B 2 3   ? -34.556 18.629 -16.826 1.00 22.79 ? -3  ARG B N   1 
ATOM   2349 C CA  . ARG B 2 3   ? -35.698 19.435 -17.142 1.00 23.98 ? -3  ARG B CA  1 
ATOM   2350 C C   . ARG B 2 3   ? -36.717 19.279 -16.024 1.00 22.98 ? -3  ARG B C   1 
ATOM   2351 O O   . ARG B 2 3   ? -36.937 18.184 -15.490 1.00 22.94 ? -3  ARG B O   1 
ATOM   2352 C CB  . ARG B 2 3   ? -36.257 19.112 -18.516 1.00 23.57 ? -3  ARG B CB  1 
ATOM   2353 C CG  . ARG B 2 3   ? -35.231 19.437 -19.624 1.00 25.79 ? -3  ARG B CG  1 
ATOM   2354 C CD  . ARG B 2 3   ? -35.648 19.010 -21.035 1.00 25.67 ? -3  ARG B CD  1 
ATOM   2355 N NE  . ARG B 2 3   ? -34.626 19.472 -21.974 1.00 24.14 ? -3  ARG B NE  1 
ATOM   2356 C CZ  . ARG B 2 3   ? -34.577 20.705 -22.489 1.00 25.14 ? -3  ARG B CZ  1 
ATOM   2357 N NH1 . ARG B 2 3   ? -35.532 21.582 -22.252 1.00 23.47 ? -3  ARG B NH1 1 
ATOM   2358 N NH2 . ARG B 2 3   ? -33.564 21.062 -23.294 1.00 24.11 ? -3  ARG B NH2 1 
ATOM   2359 N N   . ARG B 2 4   ? -37.373 20.392 -15.696 1.00 23.09 ? -2  ARG B N   1 
ATOM   2360 C CA  . ARG B 2 4   ? -38.255 20.457 -14.562 1.00 21.00 ? -2  ARG B CA  1 
ATOM   2361 C C   . ARG B 2 4   ? -39.687 20.605 -15.005 1.00 21.00 ? -2  ARG B C   1 
ATOM   2362 O O   . ARG B 2 4   ? -40.557 20.784 -14.186 1.00 19.56 ? -2  ARG B O   1 
ATOM   2363 C CB  . ARG B 2 4   ? -37.862 21.622 -13.619 1.00 20.81 ? -2  ARG B CB  1 
ATOM   2364 C CG  . ARG B 2 4   ? -36.389 21.718 -13.240 1.00 20.38 ? -2  ARG B CG  1 
ATOM   2365 C CD  . ARG B 2 4   ? -36.060 22.874 -12.261 1.00 19.86 ? -2  ARG B CD  1 
ATOM   2366 N NE  . ARG B 2 4   ? -36.627 22.605 -10.949 1.00 15.39 ? -2  ARG B NE  1 
ATOM   2367 C CZ  . ARG B 2 4   ? -36.021 22.072 -9.895  1.00 15.74 ? -2  ARG B CZ  1 
ATOM   2368 N NH1 . ARG B 2 4   ? -34.737 21.768 -9.895  1.00 17.54 ? -2  ARG B NH1 1 
ATOM   2369 N NH2 . ARG B 2 4   ? -36.741 21.776 -8.815  1.00 13.49 ? -2  ARG B NH2 1 
ATOM   2370 N N   . ARG B 2 5   ? -39.954 20.540 -16.313 1.00 21.69 ? -1  ARG B N   1 
ATOM   2371 C CA  . ARG B 2 5   ? -41.301 20.666 -16.818 1.00 23.57 ? -1  ARG B CA  1 
ATOM   2372 C C   . ARG B 2 5   ? -42.240 19.495 -16.481 1.00 22.19 ? -1  ARG B C   1 
ATOM   2373 O O   . ARG B 2 5   ? -41.886 18.313 -16.604 1.00 21.09 ? -1  ARG B O   1 
ATOM   2374 C CB  . ARG B 2 5   ? -41.241 20.873 -18.363 1.00 24.47 ? -1  ARG B CB  1 
ATOM   2375 C CG  . ARG B 2 5   ? -42.560 21.307 -18.921 1.00 28.26 ? -1  ARG B CG  1 
ATOM   2376 C CD  . ARG B 2 5   ? -42.630 21.297 -20.449 1.00 31.99 ? -1  ARG B CD  1 
ATOM   2377 N NE  . ARG B 2 5   ? -43.592 22.256 -21.017 1.00 40.13 ? -1  ARG B NE  1 
ATOM   2378 C CZ  . ARG B 2 5   ? -44.747 22.646 -20.464 1.00 44.58 ? -1  ARG B CZ  1 
ATOM   2379 N NH1 . ARG B 2 5   ? -45.207 22.139 -19.322 1.00 48.08 ? -1  ARG B NH1 1 
ATOM   2380 N NH2 . ARG B 2 5   ? -45.495 23.548 -21.100 1.00 45.38 ? -1  ARG B NH2 1 
ATOM   2381 N N   . SER B 2 6   ? -43.443 19.855 -16.074 1.00 20.21 ? 0   SER B N   1 
ATOM   2382 C CA  . SER B 2 6   ? -44.542 18.980 -15.867 1.00 21.45 ? 0   SER B CA  1 
ATOM   2383 C C   . SER B 2 6   ? -45.033 18.490 -17.228 1.00 20.65 ? 0   SER B C   1 
ATOM   2384 O O   . SER B 2 6   ? -45.082 19.284 -18.175 1.00 20.99 ? 0   SER B O   1 
ATOM   2385 C CB  . SER B 2 6   ? -45.636 19.738 -15.106 1.00 22.54 ? 0   SER B CB  1 
ATOM   2386 O OG  . SER B 2 6   ? -45.042 20.626 -14.154 1.00 26.68 ? 0   SER B OG  1 
ATOM   2387 N N   . TRP B 2 7   ? -45.435 17.224 -17.319 1.00 20.91 ? 1   TRP B N   1 
ATOM   2388 C CA  . TRP B 2 7   ? -45.871 16.637 -18.583 1.00 19.41 ? 1   TRP B CA  1 
ATOM   2389 C C   . TRP B 2 7   ? -47.010 15.627 -18.441 1.00 20.53 ? 1   TRP B C   1 
ATOM   2390 O O   . TRP B 2 7   ? -47.067 14.883 -17.450 1.00 19.01 ? 1   TRP B O   1 
ATOM   2391 C CB  . TRP B 2 7   ? -44.671 15.954 -19.246 1.00 20.02 ? 1   TRP B CB  1 
ATOM   2392 C CG  . TRP B 2 7   ? -44.849 15.668 -20.722 1.00 19.81 ? 1   TRP B CG  1 
ATOM   2393 C CD1 . TRP B 2 7   ? -44.991 14.461 -21.323 1.00 18.67 ? 1   TRP B CD1 1 
ATOM   2394 C CD2 . TRP B 2 7   ? -44.905 16.644 -21.751 1.00 17.57 ? 1   TRP B CD2 1 
ATOM   2395 N NE1 . TRP B 2 7   ? -45.098 14.615 -22.688 1.00 19.14 ? 1   TRP B NE1 1 
ATOM   2396 C CE2 . TRP B 2 7   ? -45.085 15.964 -22.971 1.00 15.73 ? 1   TRP B CE2 1 
ATOM   2397 C CE3 . TRP B 2 7   ? -44.843 18.039 -21.762 1.00 20.79 ? 1   TRP B CE3 1 
ATOM   2398 C CZ2 . TRP B 2 7   ? -45.174 16.624 -24.188 1.00 19.37 ? 1   TRP B CZ2 1 
ATOM   2399 C CZ3 . TRP B 2 7   ? -44.960 18.687 -22.977 1.00 20.56 ? 1   TRP B CZ3 1 
ATOM   2400 C CH2 . TRP B 2 7   ? -45.119 17.981 -24.170 1.00 19.44 ? 1   TRP B CH2 1 
ATOM   2401 N N   . TYR B 2 8   ? -47.928 15.657 -19.417 1.00 19.37 ? 2   TYR B N   1 
ATOM   2402 C CA  . TYR B 2 8   ? -49.002 14.688 -19.514 1.00 21.22 ? 2   TYR B CA  1 
ATOM   2403 C C   . TYR B 2 8   ? -48.576 13.673 -20.595 1.00 21.73 ? 2   TYR B C   1 
ATOM   2404 O O   . TYR B 2 8   ? -48.473 14.011 -21.789 1.00 21.98 ? 2   TYR B O   1 
ATOM   2405 C CB  . TYR B 2 8   ? -50.354 15.355 -19.817 1.00 21.21 ? 2   TYR B CB  1 
ATOM   2406 C CG  . TYR B 2 8   ? -51.529 14.468 -19.630 1.00 22.36 ? 2   TYR B CG  1 
ATOM   2407 C CD1 . TYR B 2 8   ? -52.289 14.518 -18.451 1.00 20.46 ? 2   TYR B CD1 1 
ATOM   2408 C CD2 . TYR B 2 8   ? -51.904 13.558 -20.622 1.00 24.06 ? 2   TYR B CD2 1 
ATOM   2409 C CE1 . TYR B 2 8   ? -53.345 13.658 -18.243 1.00 23.72 ? 2   TYR B CE1 1 
ATOM   2410 C CE2 . TYR B 2 8   ? -52.990 12.688 -20.422 1.00 25.33 ? 2   TYR B CE2 1 
ATOM   2411 C CZ  . TYR B 2 8   ? -53.700 12.745 -19.243 1.00 23.57 ? 2   TYR B CZ  1 
ATOM   2412 O OH  . TYR B 2 8   ? -54.772 11.890 -19.019 1.00 23.60 ? 2   TYR B OH  1 
ATOM   2413 N N   . PHE B 2 9   ? -48.329 12.430 -20.164 1.00 23.14 ? 3   PHE B N   1 
ATOM   2414 C CA  . PHE B 2 9   ? -47.802 11.356 -21.022 1.00 23.60 ? 3   PHE B CA  1 
ATOM   2415 C C   . PHE B 2 9   ? -48.887 10.420 -21.586 1.00 26.60 ? 3   PHE B C   1 
ATOM   2416 O O   . PHE B 2 9   ? -48.685 9.768  -22.634 1.00 25.56 ? 3   PHE B O   1 
ATOM   2417 C CB  . PHE B 2 9   ? -46.876 10.447 -20.212 1.00 22.96 ? 3   PHE B CB  1 
ATOM   2418 C CG  . PHE B 2 9   ? -45.530 11.014 -19.881 1.00 21.05 ? 3   PHE B CG  1 
ATOM   2419 C CD1 . PHE B 2 9   ? -44.426 10.670 -20.623 1.00 18.97 ? 3   PHE B CD1 1 
ATOM   2420 C CD2 . PHE B 2 9   ? -45.349 11.837 -18.769 1.00 21.58 ? 3   PHE B CD2 1 
ATOM   2421 C CE1 . PHE B 2 9   ? -43.155 11.140 -20.293 1.00 21.19 ? 3   PHE B CE1 1 
ATOM   2422 C CE2 . PHE B 2 9   ? -44.095 12.328 -18.467 1.00 20.09 ? 3   PHE B CE2 1 
ATOM   2423 C CZ  . PHE B 2 9   ? -43.007 11.979 -19.197 1.00 21.80 ? 3   PHE B CZ  1 
ATOM   2424 N N   . ASP B 2 10  ? -49.996 10.289 -20.872 1.00 29.14 ? 4   ASP B N   1 
ATOM   2425 C CA  . ASP B 2 10  ? -51.025 9.288  -21.228 1.00 33.23 ? 4   ASP B CA  1 
ATOM   2426 C C   . ASP B 2 10  ? -52.159 9.269  -20.229 1.00 34.61 ? 4   ASP B C   1 
ATOM   2427 O O   . ASP B 2 10  ? -51.950 9.524  -19.045 1.00 34.66 ? 4   ASP B O   1 
ATOM   2428 C CB  . ASP B 2 10  ? -50.425 7.861  -21.297 1.00 33.66 ? 4   ASP B CB  1 
ATOM   2429 C CG  . ASP B 2 10  ? -51.015 7.012  -22.457 1.00 37.65 ? 4   ASP B CG  1 
ATOM   2430 O OD1 . ASP B 2 10  ? -50.482 5.908  -22.679 1.00 45.74 ? 4   ASP B OD1 1 
ATOM   2431 O OD2 . ASP B 2 10  ? -51.985 7.432  -23.147 1.00 39.99 ? 4   ASP B OD2 1 
ATOM   2432 N N   . GLY B 2 11  ? -53.354 8.950  -20.717 1.00 36.64 ? 5   GLY B N   1 
ATOM   2433 C CA  . GLY B 2 11  ? -54.536 8.816  -19.884 1.00 37.92 ? 5   GLY B CA  1 
ATOM   2434 C C   . GLY B 2 11  ? -54.703 7.385  -19.431 1.00 38.92 ? 5   GLY B C   1 
ATOM   2435 O O   . GLY B 2 11  ? -53.915 6.499  -19.805 1.00 40.38 ? 5   GLY B O   1 
ATOM   2436 O OXT . GLY B 2 11  ? -55.627 7.082  -18.670 1.00 40.38 ? 5   GLY B OXT 1 
HETATM 2437 S S   . SO4 C 3 .   ? -59.899 16.262 -22.449 1.00 35.12 ? 592 SO4 A S   1 
HETATM 2438 O O1  . SO4 C 3 .   ? -58.945 16.964 -23.313 1.00 30.59 ? 592 SO4 A O1  1 
HETATM 2439 O O2  . SO4 C 3 .   ? -61.294 16.686 -22.616 1.00 37.49 ? 592 SO4 A O2  1 
HETATM 2440 O O3  . SO4 C 3 .   ? -59.719 14.852 -22.735 1.00 37.19 ? 592 SO4 A O3  1 
HETATM 2441 O O4  . SO4 C 3 .   ? -59.565 16.525 -21.045 1.00 33.81 ? 592 SO4 A O4  1 
HETATM 2442 C C1  . EDO D 4 .   ? -57.502 15.043 -15.430 1.00 25.95 ? 593 EDO A C1  1 
HETATM 2443 O O1  . EDO D 4 .   ? -56.191 14.484 -15.564 1.00 22.35 ? 593 EDO A O1  1 
HETATM 2444 C C2  . EDO D 4 .   ? -58.271 14.205 -14.422 1.00 29.46 ? 593 EDO A C2  1 
HETATM 2445 O O2  . EDO D 4 .   ? -59.545 14.805 -14.153 1.00 30.97 ? 593 EDO A O2  1 
HETATM 2446 C C1  . EDO E 4 .   ? -29.431 21.119 10.041  1.00 31.58 ? 594 EDO A C1  1 
HETATM 2447 O O1  . EDO E 4 .   ? -30.064 21.319 11.293  1.00 32.33 ? 594 EDO A O1  1 
HETATM 2448 C C2  . EDO E 4 .   ? -27.953 21.077 10.176  1.00 35.51 ? 594 EDO A C2  1 
HETATM 2449 O O2  . EDO E 4 .   ? -27.674 19.705 10.443  1.00 35.82 ? 594 EDO A O2  1 
HETATM 2450 C C1  . EDO F 4 .   ? -41.765 5.541  -19.111 1.00 46.68 ? 595 EDO A C1  1 
HETATM 2451 O O1  . EDO F 4 .   ? -43.171 5.787  -19.071 1.00 45.67 ? 595 EDO A O1  1 
HETATM 2452 C C2  . EDO F 4 .   ? -41.403 4.281  -18.348 1.00 47.20 ? 595 EDO A C2  1 
HETATM 2453 O O2  . EDO F 4 .   ? -40.050 3.922  -18.675 1.00 48.85 ? 595 EDO A O2  1 
HETATM 2454 C C1  . EDO G 4 .   ? -39.913 -0.675 -20.326 1.00 55.56 ? 596 EDO A C1  1 
HETATM 2455 O O1  . EDO G 4 .   ? -39.579 0.684  -20.033 1.00 55.58 ? 596 EDO A O1  1 
HETATM 2456 C C2  . EDO G 4 .   ? -41.429 -0.841 -20.232 1.00 55.89 ? 596 EDO A C2  1 
HETATM 2457 O O2  . EDO G 4 .   ? -41.778 -1.879 -19.301 1.00 55.93 ? 596 EDO A O2  1 
HETATM 2458 C C1  . EDO H 4 .   ? -45.786 34.186 -8.083  1.00 32.51 ? 597 EDO A C1  1 
HETATM 2459 O O1  . EDO H 4 .   ? -46.714 34.554 -7.055  1.00 25.23 ? 597 EDO A O1  1 
HETATM 2460 C C2  . EDO H 4 .   ? -44.421 34.782 -7.775  1.00 34.00 ? 597 EDO A C2  1 
HETATM 2461 O O2  . EDO H 4 .   ? -43.770 34.103 -6.705  1.00 36.08 ? 597 EDO A O2  1 
HETATM 2462 C C1  . EDO I 4 .   ? -38.875 38.054 -14.979 1.00 31.93 ? 598 EDO A C1  1 
HETATM 2463 O O1  . EDO I 4 .   ? -39.190 38.643 -13.721 1.00 32.89 ? 598 EDO A O1  1 
HETATM 2464 C C2  . EDO I 4 .   ? -38.136 36.752 -14.738 1.00 30.58 ? 598 EDO A C2  1 
HETATM 2465 O O2  . EDO I 4 .   ? -36.721 37.020 -14.464 1.00 32.38 ? 598 EDO A O2  1 
HETATM 2466 C C1  . EDO J 4 .   ? -26.142 25.479 -3.125  1.00 53.45 ? 599 EDO A C1  1 
HETATM 2467 O O1  . EDO J 4 .   ? -24.811 25.655 -3.630  1.00 53.63 ? 599 EDO A O1  1 
HETATM 2468 C C2  . EDO J 4 .   ? -26.504 23.998 -3.062  1.00 53.94 ? 599 EDO A C2  1 
HETATM 2469 O O2  . EDO J 4 .   ? -27.034 23.567 -4.322  1.00 54.33 ? 599 EDO A O2  1 
HETATM 2470 C C1  . EDO K 4 .   ? -30.515 19.175 -23.670 1.00 37.96 ? 403 EDO B C1  1 
HETATM 2471 O O1  . EDO K 4 .   ? -31.255 19.343 -24.901 1.00 38.07 ? 403 EDO B O1  1 
HETATM 2472 C C2  . EDO K 4 .   ? -30.785 17.861 -22.917 1.00 36.37 ? 403 EDO B C2  1 
HETATM 2473 O O2  . EDO K 4 .   ? -32.171 17.757 -22.500 1.00 33.96 ? 403 EDO B O2  1 
HETATM 2474 O O   . HOH L 5 .   ? -46.250 37.750 -0.019  1.00 11.27 ? 1   HOH A O   1 
HETATM 2475 O O   . HOH L 5 .   ? -52.455 11.425 2.533   1.00 17.48 ? 2   HOH A O   1 
HETATM 2476 O O   . HOH L 5 .   ? -50.815 28.358 -8.983  1.00 24.28 ? 3   HOH A O   1 
HETATM 2477 O O   . HOH L 5 .   ? -38.648 32.005 -7.355  1.00 34.98 ? 5   HOH A O   1 
HETATM 2478 O O   . HOH L 5 .   ? -63.709 21.023 -31.592 1.00 47.71 ? 6   HOH A O   1 
HETATM 2479 O O   . HOH L 5 .   ? -35.216 32.654 -3.186  1.00 14.49 ? 7   HOH A O   1 
HETATM 2480 O O   . HOH L 5 .   ? -43.735 16.662 -9.502  1.00 12.00 ? 8   HOH A O   1 
HETATM 2481 O O   . HOH L 5 .   ? -63.343 32.436 -10.112 1.00 34.96 ? 9   HOH A O   1 
HETATM 2482 O O   . HOH L 5 .   ? -47.188 14.877 -6.767  1.00 13.48 ? 10  HOH A O   1 
HETATM 2483 O O   . HOH L 5 .   ? -50.985 20.074 -10.118 1.00 16.79 ? 11  HOH A O   1 
HETATM 2484 O O   . HOH L 5 .   ? -49.856 -4.125 -0.440  1.00 35.87 ? 12  HOH A O   1 
HETATM 2485 O O   . HOH L 5 .   ? -44.414 14.139 -10.509 1.00 14.43 ? 13  HOH A O   1 
HETATM 2486 O O   . HOH L 5 .   ? -46.329 11.240 -8.320  1.00 13.22 ? 14  HOH A O   1 
HETATM 2487 O O   . HOH L 5 .   ? -49.767 7.507  1.210   1.00 19.70 ? 15  HOH A O   1 
HETATM 2488 O O   . HOH L 5 .   ? -47.080 12.957 -10.458 1.00 15.76 ? 16  HOH A O   1 
HETATM 2489 O O   . HOH L 5 .   ? -37.576 31.602 -2.807  1.00 16.04 ? 17  HOH A O   1 
HETATM 2490 O O   . HOH L 5 .   ? -51.319 5.560  -5.197  1.00 20.80 ? 18  HOH A O   1 
HETATM 2491 O O   . HOH L 5 .   ? -45.477 28.086 6.508   1.00 23.75 ? 19  HOH A O   1 
HETATM 2492 O O   . HOH L 5 .   ? -47.324 25.303 9.408   1.00 22.79 ? 20  HOH A O   1 
HETATM 2493 O O   A HOH L 5 .   ? -38.470 3.163  3.347   0.50 17.74 ? 21  HOH A O   1 
HETATM 2494 O O   B HOH L 5 .   ? -37.055 4.469  1.635   0.50 18.28 ? 21  HOH A O   1 
HETATM 2495 O O   . HOH L 5 .   ? -39.389 7.144  12.471  1.00 37.81 ? 22  HOH A O   1 
HETATM 2496 O O   . HOH L 5 .   ? -52.686 2.372  -1.230  1.00 32.58 ? 23  HOH A O   1 
HETATM 2497 O O   . HOH L 5 .   ? -29.972 36.159 5.031   1.00 19.60 ? 25  HOH A O   1 
HETATM 2498 O O   . HOH L 5 .   ? -40.685 39.838 -18.925 1.00 31.26 ? 26  HOH A O   1 
HETATM 2499 O O   . HOH L 5 .   ? -50.668 4.947  1.972   1.00 19.44 ? 27  HOH A O   1 
HETATM 2500 O O   . HOH L 5 .   ? -32.422 27.779 -9.835  1.00 23.97 ? 28  HOH A O   1 
HETATM 2501 O O   . HOH L 5 .   ? -33.832 20.751 -7.301  1.00 18.51 ? 29  HOH A O   1 
HETATM 2502 O O   . HOH L 5 .   ? -69.663 23.232 -16.133 1.00 33.09 ? 30  HOH A O   1 
HETATM 2503 O O   . HOH L 5 .   ? -38.238 16.088 17.395  1.00 39.79 ? 31  HOH A O   1 
HETATM 2504 O O   . HOH L 5 .   ? -64.639 39.907 -11.853 1.00 37.96 ? 32  HOH A O   1 
HETATM 2505 O O   . HOH L 5 .   ? -45.664 9.946  15.515  1.00 28.57 ? 33  HOH A O   1 
HETATM 2506 O O   . HOH L 5 .   ? -53.966 11.818 4.930   1.00 20.19 ? 34  HOH A O   1 
HETATM 2507 O O   . HOH L 5 .   ? -64.663 35.634 -18.445 1.00 19.98 ? 35  HOH A O   1 
HETATM 2508 O O   . HOH L 5 .   ? -39.609 9.897  -8.188  1.00 15.72 ? 36  HOH A O   1 
HETATM 2509 O O   . HOH L 5 .   ? -34.544 29.676 -9.424  1.00 21.31 ? 37  HOH A O   1 
HETATM 2510 O O   . HOH L 5 .   ? -33.389 6.836  11.515  1.00 32.01 ? 38  HOH A O   1 
HETATM 2511 O O   . HOH L 5 .   ? -56.185 13.350 4.935   1.00 23.03 ? 39  HOH A O   1 
HETATM 2512 O O   . HOH L 5 .   ? -41.111 26.638 16.255  1.00 40.43 ? 40  HOH A O   1 
HETATM 2513 O O   . HOH L 5 .   ? -53.004 19.394 -20.464 1.00 30.91 ? 41  HOH A O   1 
HETATM 2514 O O   . HOH L 5 .   ? -40.159 0.576  -0.246  1.00 20.73 ? 42  HOH A O   1 
HETATM 2515 O O   . HOH L 5 .   ? -31.553 23.352 0.662   1.00 20.77 ? 43  HOH A O   1 
HETATM 2516 O O   . HOH L 5 .   ? -48.429 21.832 -12.158 1.00 28.87 ? 45  HOH A O   1 
HETATM 2517 O O   . HOH L 5 .   ? -38.506 38.999 3.178   1.00 26.55 ? 46  HOH A O   1 
HETATM 2518 O O   A HOH L 5 .   ? -26.873 33.759 -2.602  0.50 28.91 ? 47  HOH A O   1 
HETATM 2519 O O   B HOH L 5 .   ? -28.830 33.856 -5.194  0.50 22.92 ? 47  HOH A O   1 
HETATM 2520 O O   . HOH L 5 .   ? -59.655 41.200 -12.100 1.00 47.86 ? 48  HOH A O   1 
HETATM 2521 O O   . HOH L 5 .   ? -49.953 24.721 -12.478 1.00 24.49 ? 49  HOH A O   1 
HETATM 2522 O O   . HOH L 5 .   ? -38.014 21.306 18.799  1.00 26.68 ? 50  HOH A O   1 
HETATM 2523 O O   . HOH L 5 .   ? -44.770 23.856 -10.393 1.00 24.15 ? 51  HOH A O   1 
HETATM 2524 O O   . HOH L 5 .   ? -33.329 28.187 11.601  1.00 24.01 ? 52  HOH A O   1 
HETATM 2525 O O   . HOH L 5 .   ? -37.790 3.463  -6.386  1.00 26.76 ? 53  HOH A O   1 
HETATM 2526 O O   . HOH L 5 .   ? -33.385 30.650 10.330  1.00 28.96 ? 54  HOH A O   1 
HETATM 2527 O O   . HOH L 5 .   ? -42.623 -0.876 -0.344  1.00 19.11 ? 55  HOH A O   1 
HETATM 2528 O O   . HOH L 5 .   ? -44.331 -1.513 -11.250 1.00 22.16 ? 56  HOH A O   1 
HETATM 2529 O O   . HOH L 5 .   ? -44.642 25.202 9.254   1.00 27.57 ? 57  HOH A O   1 
HETATM 2530 O O   . HOH L 5 .   ? -58.488 30.167 -3.955  1.00 21.97 ? 58  HOH A O   1 
HETATM 2531 O O   . HOH L 5 .   ? -31.317 8.013  2.166   1.00 31.64 ? 60  HOH A O   1 
HETATM 2532 O O   . HOH L 5 .   ? -39.211 5.386  9.564   1.00 25.69 ? 61  HOH A O   1 
HETATM 2533 O O   . HOH L 5 .   ? -69.853 30.424 -11.687 1.00 26.99 ? 64  HOH A O   1 
HETATM 2534 O O   . HOH L 5 .   ? -66.582 34.402 -20.150 1.00 29.00 ? 65  HOH A O   1 
HETATM 2535 O O   . HOH L 5 .   ? -27.167 34.277 2.882   1.00 24.69 ? 66  HOH A O   1 
HETATM 2536 O O   . HOH L 5 .   ? -37.076 1.605  5.520   1.00 40.51 ? 67  HOH A O   1 
HETATM 2537 O O   . HOH L 5 .   ? -39.534 1.046  2.461   1.00 25.92 ? 68  HOH A O   1 
HETATM 2538 O O   . HOH L 5 .   ? -29.839 21.138 3.213   1.00 25.72 ? 69  HOH A O   1 
HETATM 2539 O O   . HOH L 5 .   ? -60.120 14.289 -11.618 1.00 30.48 ? 70  HOH A O   1 
HETATM 2540 O O   . HOH L 5 .   ? -67.236 39.151 -12.863 1.00 31.08 ? 71  HOH A O   1 
HETATM 2541 O O   . HOH L 5 .   ? -54.389 22.620 8.264   1.00 38.71 ? 72  HOH A O   1 
HETATM 2542 O O   . HOH L 5 .   ? -34.610 4.511  -7.210  1.00 27.69 ? 73  HOH A O   1 
HETATM 2543 O O   . HOH L 5 .   ? -41.895 27.881 -9.691  1.00 24.36 ? 74  HOH A O   1 
HETATM 2544 O O   . HOH L 5 .   ? -69.015 17.783 -28.144 1.00 39.48 ? 75  HOH A O   1 
HETATM 2545 O O   . HOH L 5 .   ? -49.785 -2.526 -3.483  1.00 34.66 ? 76  HOH A O   1 
HETATM 2546 O O   . HOH L 5 .   ? -51.351 27.415 -23.080 1.00 27.78 ? 77  HOH A O   1 
HETATM 2547 O O   . HOH L 5 .   ? -38.597 26.274 -11.726 1.00 32.95 ? 78  HOH A O   1 
HETATM 2548 O O   . HOH L 5 .   ? -29.719 22.859 -1.322  1.00 29.91 ? 79  HOH A O   1 
HETATM 2549 O O   . HOH L 5 .   ? -50.060 45.491 -19.938 1.00 34.82 ? 80  HOH A O   1 
HETATM 2550 O O   . HOH L 5 .   ? -55.840 26.629 6.820   1.00 33.52 ? 81  HOH A O   1 
HETATM 2551 O O   . HOH L 5 .   ? -27.622 19.769 3.638   1.00 42.01 ? 82  HOH A O   1 
HETATM 2552 O O   . HOH L 5 .   ? -56.903 28.187 -3.007  1.00 26.93 ? 83  HOH A O   1 
HETATM 2553 O O   . HOH L 5 .   ? -30.202 39.648 -1.689  1.00 28.57 ? 84  HOH A O   1 
HETATM 2554 O O   . HOH L 5 .   ? -55.317 9.491  5.967   1.00 31.80 ? 85  HOH A O   1 
HETATM 2555 O O   . HOH L 5 .   ? -30.733 30.271 7.121   1.00 32.77 ? 86  HOH A O   1 
HETATM 2556 O O   . HOH L 5 .   ? -35.811 10.623 -9.679  1.00 23.50 ? 87  HOH A O   1 
HETATM 2557 O O   . HOH L 5 .   ? -27.941 20.895 -0.893  1.00 33.66 ? 88  HOH A O   1 
HETATM 2558 O O   . HOH L 5 .   ? -69.792 31.953 -13.779 1.00 34.58 ? 89  HOH A O   1 
HETATM 2559 O O   . HOH L 5 .   ? -47.865 28.152 8.064   1.00 40.47 ? 90  HOH A O   1 
HETATM 2560 O O   . HOH L 5 .   ? -50.694 37.650 -0.914  1.00 34.88 ? 91  HOH A O   1 
HETATM 2561 O O   . HOH L 5 .   ? -53.394 31.776 0.323   1.00 28.46 ? 92  HOH A O   1 
HETATM 2562 O O   . HOH L 5 .   ? -68.114 36.958 -11.048 1.00 29.79 ? 93  HOH A O   1 
HETATM 2563 O O   . HOH L 5 .   ? -32.125 -1.279 -6.274  1.00 31.16 ? 94  HOH A O   1 
HETATM 2564 O O   . HOH L 5 .   ? -64.482 38.915 -7.081  1.00 40.24 ? 95  HOH A O   1 
HETATM 2565 O O   . HOH L 5 .   ? -43.013 28.910 7.471   1.00 32.87 ? 96  HOH A O   1 
HETATM 2566 O O   . HOH L 5 .   ? -29.284 13.965 -9.002  1.00 27.80 ? 97  HOH A O   1 
HETATM 2567 O O   . HOH L 5 .   ? -53.422 22.776 -16.474 1.00 32.93 ? 98  HOH A O   1 
HETATM 2568 O O   . HOH L 5 .   ? -34.181 5.080  9.488   1.00 42.89 ? 99  HOH A O   1 
HETATM 2569 O O   . HOH L 5 .   ? -49.068 37.179 1.270   1.00 36.32 ? 100 HOH A O   1 
HETATM 2570 O O   . HOH L 5 .   ? -33.875 7.089  0.899   1.00 37.68 ? 101 HOH A O   1 
HETATM 2571 O O   . HOH L 5 .   ? -61.236 31.330 -5.641  1.00 37.16 ? 102 HOH A O   1 
HETATM 2572 O O   . HOH L 5 .   ? -56.323 28.838 -0.339  1.00 24.59 ? 103 HOH A O   1 
HETATM 2573 O O   . HOH L 5 .   ? -30.797 38.439 -7.392  1.00 29.63 ? 104 HOH A O   1 
HETATM 2574 O O   . HOH L 5 .   ? -42.343 33.973 12.581  1.00 26.74 ? 105 HOH A O   1 
HETATM 2575 O O   . HOH L 5 .   ? -29.868 27.370 6.567   1.00 29.05 ? 106 HOH A O   1 
HETATM 2576 O O   . HOH L 5 .   ? -30.078 14.168 -5.180  1.00 25.39 ? 107 HOH A O   1 
HETATM 2577 O O   . HOH L 5 .   ? -41.413 2.809  5.705   1.00 26.35 ? 108 HOH A O   1 
HETATM 2578 O O   . HOH L 5 .   ? -37.888 -0.878 -0.895  1.00 31.06 ? 109 HOH A O   1 
HETATM 2579 O O   . HOH L 5 .   ? -40.697 29.084 -15.995 1.00 43.58 ? 110 HOH A O   1 
HETATM 2580 O O   . HOH L 5 .   ? -36.361 36.359 9.894   0.50 24.76 ? 111 HOH A O   1 
HETATM 2581 O O   . HOH L 5 .   ? -39.193 41.470 2.246   1.00 32.50 ? 112 HOH A O   1 
HETATM 2582 O O   . HOH L 5 .   ? -61.771 10.346 -10.087 1.00 28.22 ? 113 HOH A O   1 
HETATM 2583 O O   . HOH L 5 .   ? -57.188 35.617 -26.646 1.00 50.38 ? 115 HOH A O   1 
HETATM 2584 O O   . HOH L 5 .   ? -43.315 -2.259 -14.093 1.00 29.53 ? 116 HOH A O   1 
HETATM 2585 O O   . HOH L 5 .   ? -63.481 36.581 -24.665 1.00 42.11 ? 117 HOH A O   1 
HETATM 2586 O O   . HOH L 5 .   ? -57.726 33.171 -28.085 1.00 43.46 ? 118 HOH A O   1 
HETATM 2587 O O   . HOH L 5 .   ? -29.243 32.731 3.604   1.00 34.10 ? 119 HOH A O   1 
HETATM 2588 O O   . HOH L 5 .   ? -41.653 23.197 16.804  1.00 36.03 ? 120 HOH A O   1 
HETATM 2589 O O   . HOH L 5 .   ? -58.046 6.562  -3.522  1.00 33.12 ? 121 HOH A O   1 
HETATM 2590 O O   . HOH L 5 .   ? -43.872 1.787  -16.960 1.00 27.78 ? 122 HOH A O   1 
HETATM 2591 O O   . HOH L 5 .   ? -68.124 36.960 -19.944 1.00 34.52 ? 123 HOH A O   1 
HETATM 2592 O O   . HOH L 5 .   ? -36.265 10.307 -22.189 1.00 32.89 ? 124 HOH A O   1 
HETATM 2593 O O   . HOH L 5 .   ? -33.039 2.700  -0.506  1.00 30.67 ? 126 HOH A O   1 
HETATM 2594 O O   . HOH L 5 .   ? -68.881 20.574 -16.472 1.00 37.17 ? 127 HOH A O   1 
HETATM 2595 O O   . HOH L 5 .   ? -67.963 29.089 -24.537 1.00 30.74 ? 128 HOH A O   1 
HETATM 2596 O O   . HOH L 5 .   ? -34.904 -1.693 -14.761 1.00 43.31 ? 129 HOH A O   1 
HETATM 2597 O O   . HOH L 5 .   ? -48.345 18.572 13.638  1.00 36.88 ? 130 HOH A O   1 
HETATM 2598 O O   . HOH L 5 .   ? -51.448 -3.632 2.303   1.00 47.20 ? 131 HOH A O   1 
HETATM 2599 O O   . HOH L 5 .   ? -35.680 27.751 13.329  1.00 23.47 ? 132 HOH A O   1 
HETATM 2600 O O   . HOH L 5 .   ? -49.370 8.196  14.400  1.00 55.98 ? 133 HOH A O   1 
HETATM 2601 O O   . HOH L 5 .   ? -35.360 15.955 -18.445 1.00 24.48 ? 135 HOH A O   1 
HETATM 2602 O O   . HOH L 5 .   ? -51.298 39.670 -4.725  1.00 27.79 ? 136 HOH A O   1 
HETATM 2603 O O   . HOH L 5 .   ? -67.975 29.689 -10.287 1.00 28.33 ? 137 HOH A O   1 
HETATM 2604 O O   . HOH L 5 .   ? -29.344 36.926 -3.545  1.00 42.00 ? 138 HOH A O   1 
HETATM 2605 O O   . HOH L 5 .   ? -53.167 4.639  2.745   1.00 30.56 ? 139 HOH A O   1 
HETATM 2606 O O   . HOH L 5 .   ? -54.730 15.267 9.621   1.00 36.44 ? 140 HOH A O   1 
HETATM 2607 O O   . HOH L 5 .   ? -49.501 30.636 -8.294  1.00 34.14 ? 141 HOH A O   1 
HETATM 2608 O O   . HOH L 5 .   ? -68.237 27.461 -26.641 1.00 31.55 ? 142 HOH A O   1 
HETATM 2609 O O   . HOH L 5 .   ? -25.441 29.987 -4.965  1.00 35.30 ? 143 HOH A O   1 
HETATM 2610 O O   . HOH L 5 .   ? -66.789 27.539 -3.269  1.00 40.65 ? 144 HOH A O   1 
HETATM 2611 O O   . HOH L 5 .   ? -40.206 39.556 6.038   1.00 43.15 ? 145 HOH A O   1 
HETATM 2612 O O   . HOH L 5 .   ? -55.536 33.282 1.401   1.00 31.91 ? 146 HOH A O   1 
HETATM 2613 O O   . HOH L 5 .   ? -44.611 -0.660 -15.892 1.00 32.54 ? 147 HOH A O   1 
HETATM 2614 O O   . HOH L 5 .   ? -49.015 22.728 -25.916 1.00 34.55 ? 148 HOH A O   1 
HETATM 2615 O O   . HOH L 5 .   ? -33.474 0.316  -13.654 1.00 52.86 ? 149 HOH A O   1 
HETATM 2616 O O   . HOH L 5 .   ? -47.572 30.362 -10.371 1.00 46.00 ? 150 HOH A O   1 
HETATM 2617 O O   . HOH L 5 .   ? -35.879 26.687 -12.384 1.00 35.51 ? 151 HOH A O   1 
HETATM 2618 O O   . HOH L 5 .   ? -53.046 13.994 11.669  1.00 34.40 ? 152 HOH A O   1 
HETATM 2619 O O   . HOH L 5 .   ? -57.658 7.967  -15.060 1.00 30.08 ? 153 HOH A O   1 
HETATM 2620 O O   . HOH L 5 .   ? -66.067 28.329 -28.856 1.00 54.87 ? 154 HOH A O   1 
HETATM 2621 O O   . HOH L 5 .   ? -43.987 25.792 12.238  1.00 34.20 ? 155 HOH A O   1 
HETATM 2622 O O   . HOH L 5 .   ? -41.516 36.099 9.447   1.00 32.49 ? 156 HOH A O   1 
HETATM 2623 O O   . HOH L 5 .   ? -68.287 33.300 -17.014 1.00 27.56 ? 157 HOH A O   1 
HETATM 2624 O O   . HOH L 5 .   ? -41.153 23.625 -12.936 1.00 27.72 ? 159 HOH A O   1 
HETATM 2625 O O   . HOH L 5 .   ? -29.026 10.369 -8.147  1.00 42.19 ? 160 HOH A O   1 
HETATM 2626 O O   . HOH L 5 .   ? -44.386 24.382 14.404  1.00 35.38 ? 161 HOH A O   1 
HETATM 2627 O O   . HOH L 5 .   ? -32.191 4.764  1.262   1.00 43.70 ? 162 HOH A O   1 
HETATM 2628 O O   . HOH L 5 .   ? -63.603 30.644 -3.632  1.00 37.15 ? 163 HOH A O   1 
HETATM 2629 O O   . HOH L 5 .   ? -57.330 31.195 0.290   1.00 42.77 ? 164 HOH A O   1 
HETATM 2630 O O   . HOH L 5 .   ? -28.123 11.745 -12.593 1.00 33.27 ? 166 HOH A O   1 
HETATM 2631 O O   . HOH L 5 .   ? -38.170 40.391 6.692   1.00 37.30 ? 167 HOH A O   1 
HETATM 2632 O O   . HOH L 5 .   ? -25.446 8.232  -0.485  1.00 59.06 ? 168 HOH A O   1 
HETATM 2633 O O   . HOH L 5 .   ? -27.584 25.523 6.702   1.00 43.12 ? 169 HOH A O   1 
HETATM 2634 O O   . HOH L 5 .   ? -44.124 21.669 14.806  1.00 26.68 ? 170 HOH A O   1 
HETATM 2635 O O   . HOH L 5 .   ? -59.045 24.363 4.633   1.00 36.54 ? 171 HOH A O   1 
HETATM 2636 O O   . HOH L 5 .   ? -63.619 37.962 -21.883 1.00 38.62 ? 173 HOH A O   1 
HETATM 2637 O O   . HOH L 5 .   ? -30.712 3.213  -8.458  1.00 39.21 ? 174 HOH A O   1 
HETATM 2638 O O   . HOH L 5 .   ? -60.293 34.288 -3.280  1.00 34.23 ? 175 HOH A O   1 
HETATM 2639 O O   . HOH L 5 .   ? -69.123 38.131 -8.746  1.00 47.37 ? 176 HOH A O   1 
HETATM 2640 O O   . HOH L 5 .   ? -31.222 3.331  -4.128  1.00 41.52 ? 177 HOH A O   1 
HETATM 2641 O O   . HOH L 5 .   ? -57.193 22.444 8.471   1.00 47.05 ? 178 HOH A O   1 
HETATM 2642 O O   . HOH L 5 .   ? -41.538 41.526 4.678   1.00 38.31 ? 179 HOH A O   1 
HETATM 2643 O O   . HOH L 5 .   ? -57.556 25.339 -3.408  1.00 33.68 ? 180 HOH A O   1 
HETATM 2644 O O   . HOH L 5 .   ? -37.577 -0.833 2.877   1.00 42.33 ? 181 HOH A O   1 
HETATM 2645 O O   . HOH L 5 .   ? -64.873 3.542  -4.052  1.00 47.86 ? 182 HOH A O   1 
HETATM 2646 O O   . HOH L 5 .   ? -35.873 6.813  2.343   1.00 29.49 ? 184 HOH A O   1 
HETATM 2647 O O   . HOH L 5 .   ? -58.617 47.669 -11.265 1.00 48.34 ? 185 HOH A O   1 
HETATM 2648 O O   . HOH L 5 .   ? -68.001 31.304 -7.867  1.00 51.09 ? 186 HOH A O   1 
HETATM 2649 O O   . HOH L 5 .   ? -54.458 32.238 -27.506 1.00 47.20 ? 187 HOH A O   1 
HETATM 2650 O O   . HOH L 5 .   ? -52.562 50.531 -13.006 1.00 48.20 ? 188 HOH A O   1 
HETATM 2651 O O   . HOH L 5 .   ? -63.621 34.142 -6.671  1.00 37.96 ? 194 HOH A O   1 
HETATM 2652 O O   . HOH L 5 .   ? -45.169 31.213 -9.858  1.00 57.02 ? 195 HOH A O   1 
HETATM 2653 O O   . HOH L 5 .   ? -51.804 25.950 -14.579 1.00 30.85 ? 196 HOH A O   1 
HETATM 2654 O O   . HOH L 5 .   ? -61.019 4.359  -10.298 1.00 31.39 ? 197 HOH A O   1 
HETATM 2655 O O   . HOH L 5 .   ? -42.676 30.553 -9.638  1.00 35.54 ? 199 HOH A O   1 
HETATM 2656 O O   . HOH L 5 .   ? -59.837 7.009  -13.817 1.00 41.80 ? 200 HOH A O   1 
HETATM 2657 O O   . HOH L 5 .   ? -53.287 4.345  5.535   1.00 58.86 ? 201 HOH A O   1 
HETATM 2658 O O   . HOH L 5 .   ? -26.564 32.824 0.645   1.00 48.55 ? 202 HOH A O   1 
HETATM 2659 O O   . HOH L 5 .   ? -66.230 21.228 -6.088  1.00 43.19 ? 205 HOH A O   1 
HETATM 2660 O O   . HOH L 5 .   ? -50.101 28.943 -16.943 1.00 39.51 ? 206 HOH A O   1 
HETATM 2661 O O   . HOH L 5 .   ? -35.418 41.309 5.152   1.00 41.69 ? 207 HOH A O   1 
HETATM 2662 O O   . HOH L 5 .   ? -43.573 35.926 11.002  1.00 41.38 ? 208 HOH A O   1 
HETATM 2663 O O   . HOH L 5 .   ? -64.024 15.197 -23.380 1.00 38.55 ? 209 HOH A O   1 
HETATM 2664 O O   . HOH L 5 .   ? -30.606 10.874 -4.608  1.00 43.00 ? 210 HOH A O   1 
HETATM 2665 O O   . HOH L 5 .   ? -56.521 21.246 -26.271 1.00 31.74 ? 211 HOH A O   1 
HETATM 2666 O O   . HOH L 5 .   ? -54.381 8.105  7.567   1.00 35.64 ? 212 HOH A O   1 
HETATM 2667 O O   . HOH L 5 .   ? -26.861 25.014 -8.270  1.00 43.99 ? 213 HOH A O   1 
HETATM 2668 O O   . HOH L 5 .   ? -54.954 31.832 3.286   1.00 38.54 ? 214 HOH A O   1 
HETATM 2669 O O   . HOH L 5 .   ? -70.360 20.200 -29.843 1.00 52.61 ? 215 HOH A O   1 
HETATM 2670 O O   . HOH L 5 .   ? -59.198 10.502 -0.486  1.00 42.73 ? 219 HOH A O   1 
HETATM 2671 O O   . HOH L 5 .   ? -54.815 45.573 -19.973 1.00 44.59 ? 220 HOH A O   1 
HETATM 2672 O O   . HOH L 5 .   ? -24.872 31.954 2.748   1.00 46.07 ? 222 HOH A O   1 
HETATM 2673 O O   . HOH L 5 .   ? -54.222 19.676 8.449   1.00 43.41 ? 224 HOH A O   1 
HETATM 2674 O O   . HOH L 5 .   ? -65.531 17.697 -1.532  1.00 46.61 ? 225 HOH A O   1 
HETATM 2675 O O   . HOH L 5 .   ? -57.500 12.438 7.052   1.00 38.28 ? 226 HOH A O   1 
HETATM 2676 O O   . HOH L 5 .   ? -43.119 27.656 9.869   1.00 28.29 ? 227 HOH A O   1 
HETATM 2677 O O   . HOH L 5 .   ? -47.228 20.226 -19.635 1.00 37.18 ? 228 HOH A O   1 
HETATM 2678 O O   . HOH L 5 .   ? -45.387 27.887 -8.454  1.00 36.47 ? 229 HOH A O   1 
HETATM 2679 O O   . HOH L 5 .   ? -52.834 0.524  3.115   1.00 41.00 ? 231 HOH A O   1 
HETATM 2680 O O   . HOH L 5 .   ? -44.500 8.452  13.541  1.00 39.48 ? 233 HOH A O   1 
HETATM 2681 O O   . HOH L 5 .   ? -38.811 37.827 9.911   0.50 19.67 ? 236 HOH A O   1 
HETATM 2682 O O   . HOH L 5 .   ? -62.846 13.157 -19.151 1.00 48.30 ? 238 HOH A O   1 
HETATM 2683 O O   . HOH L 5 .   ? -60.141 11.241 5.576   1.00 48.25 ? 239 HOH A O   1 
HETATM 2684 O O   A HOH L 5 .   ? -43.167 31.591 -12.808 0.50 24.56 ? 242 HOH A O   1 
HETATM 2685 O O   B HOH L 5 .   ? -43.996 29.485 -13.644 0.50 30.78 ? 242 HOH A O   1 
HETATM 2686 O O   . HOH L 5 .   ? -39.820 2.925  8.111   1.00 31.30 ? 243 HOH A O   1 
HETATM 2687 O O   . HOH L 5 .   ? -62.295 17.019 -29.412 1.00 53.56 ? 244 HOH A O   1 
HETATM 2688 O O   . HOH L 5 .   ? -54.193 7.168  1.329   1.00 37.76 ? 245 HOH A O   1 
HETATM 2689 O O   . HOH L 5 .   ? -30.182 5.997  -5.583  1.00 40.08 ? 246 HOH A O   1 
HETATM 2690 O O   . HOH L 5 .   ? -68.011 41.885 -11.436 1.00 51.85 ? 247 HOH A O   1 
HETATM 2691 O O   . HOH L 5 .   ? -67.847 29.536 -4.576  1.00 41.01 ? 248 HOH A O   1 
HETATM 2692 O O   . HOH L 5 .   ? -47.033 21.011 14.851  1.00 36.18 ? 249 HOH A O   1 
HETATM 2693 O O   . HOH L 5 .   ? -60.995 9.862  1.312   1.00 53.36 ? 250 HOH A O   1 
HETATM 2694 O O   . HOH L 5 .   ? -71.870 22.214 -27.972 1.00 52.17 ? 251 HOH A O   1 
HETATM 2695 O O   . HOH L 5 .   ? -42.316 7.459  14.412  1.00 47.65 ? 252 HOH A O   1 
HETATM 2696 O O   . HOH L 5 .   ? -63.076 3.748  -12.232 1.00 45.55 ? 253 HOH A O   1 
HETATM 2697 O O   . HOH L 5 .   ? -69.405 22.007 -31.776 1.00 55.40 ? 254 HOH A O   1 
HETATM 2698 O O   . HOH L 5 .   ? -71.642 24.230 -26.428 1.00 39.26 ? 256 HOH A O   1 
HETATM 2699 O O   . HOH L 5 .   ? -45.086 8.514  10.671  1.00 47.95 ? 258 HOH A O   1 
HETATM 2700 O O   A HOH L 5 .   ? -60.690 18.041 4.309   0.50 21.10 ? 261 HOH A O   1 
HETATM 2701 O O   B HOH L 5 .   ? -59.923 17.498 6.645   0.50 29.86 ? 261 HOH A O   1 
HETATM 2702 O O   . HOH L 5 .   ? -66.534 34.307 -22.877 1.00 41.66 ? 262 HOH A O   1 
HETATM 2703 O O   . HOH L 5 .   ? -50.960 30.825 -23.273 1.00 51.09 ? 263 HOH A O   1 
HETATM 2704 O O   . HOH L 5 .   ? -53.004 26.678 -8.976  1.00 25.55 ? 264 HOH A O   1 
HETATM 2705 O O   . HOH L 5 .   ? -48.791 33.119 -7.336  1.00 25.75 ? 265 HOH A O   1 
HETATM 2706 O O   . HOH L 5 .   ? -37.415 29.232 -8.918  1.00 24.85 ? 266 HOH A O   1 
HETATM 2707 O O   . HOH L 5 .   ? -67.015 10.623 -2.451  1.00 40.47 ? 267 HOH A O   1 
HETATM 2708 O O   . HOH L 5 .   ? -52.221 9.005  1.201   1.00 20.09 ? 268 HOH A O   1 
HETATM 2709 O O   . HOH L 5 .   ? -37.553 8.781  13.419  1.00 48.90 ? 270 HOH A O   1 
HETATM 2710 O O   . HOH L 5 .   ? -50.878 19.879 12.282  1.00 30.10 ? 271 HOH A O   1 
HETATM 2711 O O   . HOH L 5 .   ? -40.825 -3.741 -16.933 1.00 47.27 ? 272 HOH A O   1 
HETATM 2712 O O   . HOH L 5 .   ? -34.335 37.294 -13.669 1.00 30.41 ? 273 HOH A O   1 
HETATM 2713 O O   . HOH L 5 .   ? -37.189 40.669 -12.143 1.00 38.04 ? 274 HOH A O   1 
HETATM 2714 O O   . HOH L 5 .   ? -37.291 37.877 -11.466 1.00 36.69 ? 275 HOH A O   1 
HETATM 2715 O O   . HOH L 5 .   ? -36.029 39.758 -9.616  1.00 33.49 ? 276 HOH A O   1 
HETATM 2716 O O   . HOH L 5 .   ? -38.217 40.673 -9.567  1.00 46.02 ? 277 HOH A O   1 
HETATM 2717 O O   A HOH M 5 .   ? -48.538 16.317 -23.179 0.50 25.24 ? 24  HOH B O   1 
HETATM 2718 O O   B HOH M 5 .   ? -48.472 17.783 -21.278 0.50 14.57 ? 24  HOH B O   1 
HETATM 2719 O O   . HOH M 5 .   ? -32.639 22.971 -11.494 1.00 19.14 ? 44  HOH B O   1 
HETATM 2720 O O   . HOH M 5 .   ? -44.121 22.776 -16.296 1.00 39.63 ? 59  HOH B O   1 
HETATM 2721 O O   . HOH M 5 .   ? -33.167 25.657 -11.631 1.00 22.62 ? 62  HOH B O   1 
HETATM 2722 O O   . HOH M 5 .   ? -32.822 22.524 -14.533 1.00 22.41 ? 63  HOH B O   1 
HETATM 2723 O O   . HOH M 5 .   ? -47.811 23.640 -22.209 1.00 46.31 ? 125 HOH B O   1 
HETATM 2724 O O   . HOH M 5 .   ? -45.365 26.305 -21.073 1.00 38.68 ? 134 HOH B O   1 
HETATM 2725 O O   . HOH M 5 .   ? -57.490 8.904  -18.818 1.00 37.51 ? 172 HOH B O   1 
HETATM 2726 O O   . HOH M 5 .   ? -60.679 8.364  -18.425 1.00 55.23 ? 189 HOH B O   1 
HETATM 2727 O O   . HOH M 5 .   ? -48.072 25.744 -23.220 1.00 57.35 ? 192 HOH B O   1 
HETATM 2728 O O   . HOH M 5 .   ? -30.003 22.647 -10.560 1.00 37.84 ? 198 HOH B O   1 
HETATM 2729 O O   . HOH M 5 .   ? -30.045 22.730 -14.578 1.00 34.72 ? 235 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   291 ?   ?   ?   A . n 
A 1 2   PRO 2   292 ?   ?   ?   A . n 
A 1 3   GLN 3   293 ?   ?   ?   A . n 
A 1 4   ARG 4   294 ?   ?   ?   A . n 
A 1 5   GLU 5   295 ?   ?   ?   A . n 
A 1 6   PRO 6   296 ?   ?   ?   A . n 
A 1 7   GLN 7   297 ?   ?   ?   A . n 
A 1 8   ARG 8   298 298 ARG ARG A . n 
A 1 9   VAL 9   299 299 VAL VAL A . n 
A 1 10  SER 10  300 300 SER SER A . n 
A 1 11  HIS 11  301 301 HIS HIS A . n 
A 1 12  GLU 12  302 302 GLU GLU A . n 
A 1 13  GLN 13  303 303 GLN GLN A . n 
A 1 14  PHE 14  304 304 PHE PHE A . n 
A 1 15  ARG 15  305 305 ARG ARG A . n 
A 1 16  ALA 16  306 306 ALA ALA A . n 
A 1 17  ALA 17  307 307 ALA ALA A . n 
A 1 18  LEU 18  308 308 LEU LEU A . n 
A 1 19  GLN 19  309 309 GLN GLN A . n 
A 1 20  LEU 20  310 310 LEU LEU A . n 
A 1 21  VAL 21  311 311 VAL VAL A . n 
A 1 22  VAL 22  312 312 VAL VAL A . n 
A 1 23  ASP 23  313 313 ASP ASP A . n 
A 1 24  PRO 24  314 314 PRO PRO A . n 
A 1 25  GLY 25  315 315 GLY GLY A . n 
A 1 26  ASP 26  316 316 ASP ASP A . n 
A 1 27  PRO 27  317 317 PRO PRO A . n 
A 1 28  ARG 28  318 318 ARG ARG A . n 
A 1 29  SER 29  319 319 SER SER A . n 
A 1 30  TYR 30  320 320 TYR TYR A . n 
A 1 31  LEU 31  321 321 LEU LEU A . n 
A 1 32  ASP 32  322 322 ASP ASP A . n 
A 1 33  ASN 33  323 323 ASN ASN A . n 
A 1 34  PHE 34  324 324 PHE PHE A . n 
A 1 35  ILE 35  325 325 ILE ILE A . n 
A 1 36  LYS 36  326 326 LYS LYS A . n 
A 1 37  ILE 37  327 327 ILE ILE A . n 
A 1 38  GLY 38  328 328 GLY GLY A . n 
A 1 39  GLU 39  329 329 GLU GLU A . n 
A 1 40  GLY 40  330 330 GLY GLY A . n 
A 1 41  SER 41  331 331 SER SER A . n 
A 1 42  THR 42  332 332 THR THR A . n 
A 1 43  GLY 43  333 333 GLY GLY A . n 
A 1 44  ILE 44  334 334 ILE ILE A . n 
A 1 45  VAL 45  335 335 VAL VAL A . n 
A 1 46  CYS 46  336 336 CYS CYS A . n 
A 1 47  ILE 47  337 337 ILE ILE A . n 
A 1 48  ALA 48  338 338 ALA ALA A . n 
A 1 49  THR 49  339 339 THR THR A . n 
A 1 50  VAL 50  340 340 VAL VAL A . n 
A 1 51  ARG 51  341 341 ARG ARG A . n 
A 1 52  SER 52  342 342 SER SER A . n 
A 1 53  SER 53  343 343 SER SER A . n 
A 1 54  GLY 54  344 344 GLY GLY A . n 
A 1 55  LYS 55  345 345 LYS LYS A . n 
A 1 56  LEU 56  346 346 LEU LEU A . n 
A 1 57  VAL 57  347 347 VAL VAL A . n 
A 1 58  ALA 58  348 348 ALA ALA A . n 
A 1 59  VAL 59  349 349 VAL VAL A . n 
A 1 60  LYS 60  350 350 LYS LYS A . n 
A 1 61  LYS 61  351 351 LYS LYS A . n 
A 1 62  MET 62  352 352 MET MET A . n 
A 1 63  ASP 63  353 353 ASP ASP A . n 
A 1 64  LEU 64  354 354 LEU LEU A . n 
A 1 65  ARG 65  355 355 ARG ARG A . n 
A 1 66  LYS 66  356 356 LYS LYS A . n 
A 1 67  GLN 67  357 357 GLN GLN A . n 
A 1 68  GLN 68  358 358 GLN GLN A . n 
A 1 69  ARG 69  359 359 ARG ARG A . n 
A 1 70  ARG 70  360 360 ARG ARG A . n 
A 1 71  GLU 71  361 361 GLU GLU A . n 
A 1 72  LEU 72  362 362 LEU LEU A . n 
A 1 73  LEU 73  363 363 LEU LEU A . n 
A 1 74  PHE 74  364 364 PHE PHE A . n 
A 1 75  ASN 75  365 365 ASN ASN A . n 
A 1 76  GLU 76  366 366 GLU GLU A . n 
A 1 77  VAL 77  367 367 VAL VAL A . n 
A 1 78  VAL 78  368 368 VAL VAL A . n 
A 1 79  ILE 79  369 369 ILE ILE A . n 
A 1 80  MET 80  370 370 MET MET A . n 
A 1 81  ARG 81  371 371 ARG ARG A . n 
A 1 82  ASP 82  372 372 ASP ASP A . n 
A 1 83  TYR 83  373 373 TYR TYR A . n 
A 1 84  GLN 84  374 374 GLN GLN A . n 
A 1 85  HIS 85  375 375 HIS HIS A . n 
A 1 86  GLU 86  376 376 GLU GLU A . n 
A 1 87  ASN 87  377 377 ASN ASN A . n 
A 1 88  VAL 88  378 378 VAL VAL A . n 
A 1 89  VAL 89  379 379 VAL VAL A . n 
A 1 90  GLU 90  380 380 GLU GLU A . n 
A 1 91  MET 91  381 381 MET MET A . n 
A 1 92  TYR 92  382 382 TYR TYR A . n 
A 1 93  ASN 93  383 383 ASN ASN A . n 
A 1 94  SER 94  384 384 SER SER A . n 
A 1 95  TYR 95  385 385 TYR TYR A . n 
A 1 96  LEU 96  386 386 LEU LEU A . n 
A 1 97  VAL 97  387 387 VAL VAL A . n 
A 1 98  GLY 98  388 388 GLY GLY A . n 
A 1 99  ASP 99  389 389 ASP ASP A . n 
A 1 100 GLU 100 390 390 GLU GLU A . n 
A 1 101 LEU 101 391 391 LEU LEU A . n 
A 1 102 TRP 102 392 392 TRP TRP A . n 
A 1 103 VAL 103 393 393 VAL VAL A . n 
A 1 104 VAL 104 394 394 VAL VAL A . n 
A 1 105 MET 105 395 395 MET MET A . n 
A 1 106 GLU 106 396 396 GLU GLU A . n 
A 1 107 PHE 107 397 397 PHE PHE A . n 
A 1 108 LEU 108 398 398 LEU LEU A . n 
A 1 109 GLU 109 399 399 GLU GLU A . n 
A 1 110 GLY 110 400 400 GLY GLY A . n 
A 1 111 GLY 111 401 401 GLY GLY A . n 
A 1 112 ALA 112 402 402 ALA ALA A . n 
A 1 113 LEU 113 403 403 LEU LEU A . n 
A 1 114 THR 114 404 404 THR THR A . n 
A 1 115 ASP 115 405 405 ASP ASP A . n 
A 1 116 ILE 116 406 406 ILE ILE A . n 
A 1 117 VAL 117 407 407 VAL VAL A . n 
A 1 118 THR 118 408 408 THR THR A . n 
A 1 119 HIS 119 409 409 HIS HIS A . n 
A 1 120 THR 120 410 410 THR THR A . n 
A 1 121 ARG 121 411 411 ARG ARG A . n 
A 1 122 MET 122 412 412 MET MET A . n 
A 1 123 ASN 123 413 413 ASN ASN A . n 
A 1 124 GLU 124 414 414 GLU GLU A . n 
A 1 125 GLU 125 415 415 GLU GLU A . n 
A 1 126 GLN 126 416 416 GLN GLN A . n 
A 1 127 ILE 127 417 417 ILE ILE A . n 
A 1 128 ALA 128 418 418 ALA ALA A . n 
A 1 129 ALA 129 419 419 ALA ALA A . n 
A 1 130 VAL 130 420 420 VAL VAL A . n 
A 1 131 CYS 131 421 421 CYS CYS A . n 
A 1 132 LEU 132 422 422 LEU LEU A . n 
A 1 133 ALA 133 423 423 ALA ALA A . n 
A 1 134 VAL 134 424 424 VAL VAL A . n 
A 1 135 LEU 135 425 425 LEU LEU A . n 
A 1 136 GLN 136 426 426 GLN GLN A . n 
A 1 137 ALA 137 427 427 ALA ALA A . n 
A 1 138 LEU 138 428 428 LEU LEU A . n 
A 1 139 SER 139 429 429 SER SER A . n 
A 1 140 VAL 140 430 430 VAL VAL A . n 
A 1 141 LEU 141 431 431 LEU LEU A . n 
A 1 142 HIS 142 432 432 HIS HIS A . n 
A 1 143 ALA 143 433 433 ALA ALA A . n 
A 1 144 GLN 144 434 434 GLN GLN A . n 
A 1 145 GLY 145 435 435 GLY GLY A . n 
A 1 146 VAL 146 436 436 VAL VAL A . n 
A 1 147 ILE 147 437 437 ILE ILE A . n 
A 1 148 HIS 148 438 438 HIS HIS A . n 
A 1 149 ARG 149 439 439 ARG ARG A . n 
A 1 150 ASP 150 440 440 ASP ASP A . n 
A 1 151 ILE 151 441 441 ILE ILE A . n 
A 1 152 LYS 152 442 442 LYS LYS A . n 
A 1 153 SER 153 443 443 SER SER A . n 
A 1 154 ASP 154 444 444 ASP ASP A . n 
A 1 155 SER 155 445 445 SER SER A . n 
A 1 156 ILE 156 446 446 ILE ILE A . n 
A 1 157 LEU 157 447 447 LEU LEU A . n 
A 1 158 LEU 158 448 448 LEU LEU A . n 
A 1 159 THR 159 449 449 THR THR A . n 
A 1 160 HIS 160 450 450 HIS HIS A . n 
A 1 161 ASP 161 451 451 ASP ASP A . n 
A 1 162 GLY 162 452 452 GLY GLY A . n 
A 1 163 ARG 163 453 453 ARG ARG A . n 
A 1 164 VAL 164 454 454 VAL VAL A . n 
A 1 165 LYS 165 455 455 LYS LYS A . n 
A 1 166 LEU 166 456 456 LEU LEU A . n 
A 1 167 SER 167 457 457 SER SER A . n 
A 1 168 ASP 168 458 458 ASP ASP A . n 
A 1 169 PHE 169 459 459 PHE PHE A . n 
A 1 170 GLY 170 460 460 GLY GLY A . n 
A 1 171 PHE 171 461 461 PHE PHE A . n 
A 1 172 CYS 172 462 462 CYS CYS A . n 
A 1 173 ALA 173 463 463 ALA ALA A . n 
A 1 174 GLN 174 464 464 GLN GLN A . n 
A 1 175 VAL 175 465 465 VAL VAL A . n 
A 1 176 SER 176 466 466 SER SER A . n 
A 1 177 LYS 177 467 467 LYS LYS A . n 
A 1 178 GLU 178 468 468 GLU GLU A . n 
A 1 179 VAL 179 469 469 VAL VAL A . n 
A 1 180 PRO 180 470 470 PRO PRO A . n 
A 1 181 ARG 181 471 471 ARG ARG A . n 
A 1 182 ARG 182 472 472 ARG ARG A . n 
A 1 183 LYS 183 473 473 LYS LYS A . n 
A 1 184 SEP 184 474 474 SEP SEP A . n 
A 1 185 LEU 185 475 475 LEU LEU A . n 
A 1 186 VAL 186 476 476 VAL VAL A . n 
A 1 187 GLY 187 477 477 GLY GLY A . n 
A 1 188 THR 188 478 478 THR THR A . n 
A 1 189 PRO 189 479 479 PRO PRO A . n 
A 1 190 TYR 190 480 480 TYR TYR A . n 
A 1 191 TRP 191 481 481 TRP TRP A . n 
A 1 192 MET 192 482 482 MET MET A . n 
A 1 193 ALA 193 483 483 ALA ALA A . n 
A 1 194 PRO 194 484 484 PRO PRO A . n 
A 1 195 GLU 195 485 485 GLU GLU A . n 
A 1 196 LEU 196 486 486 LEU LEU A . n 
A 1 197 ILE 197 487 487 ILE ILE A . n 
A 1 198 SER 198 488 488 SER SER A . n 
A 1 199 ARG 199 489 489 ARG ARG A . n 
A 1 200 LEU 200 490 490 LEU LEU A . n 
A 1 201 PRO 201 491 491 PRO PRO A . n 
A 1 202 TYR 202 492 492 TYR TYR A . n 
A 1 203 GLY 203 493 493 GLY GLY A . n 
A 1 204 PRO 204 494 494 PRO PRO A . n 
A 1 205 GLU 205 495 495 GLU GLU A . n 
A 1 206 VAL 206 496 496 VAL VAL A . n 
A 1 207 ASP 207 497 497 ASP ASP A . n 
A 1 208 ILE 208 498 498 ILE ILE A . n 
A 1 209 TRP 209 499 499 TRP TRP A . n 
A 1 210 SER 210 500 500 SER SER A . n 
A 1 211 LEU 211 501 501 LEU LEU A . n 
A 1 212 GLY 212 502 502 GLY GLY A . n 
A 1 213 ILE 213 503 503 ILE ILE A . n 
A 1 214 MET 214 504 504 MET MET A . n 
A 1 215 VAL 215 505 505 VAL VAL A . n 
A 1 216 ILE 216 506 506 ILE ILE A . n 
A 1 217 GLU 217 507 507 GLU GLU A . n 
A 1 218 MET 218 508 508 MET MET A . n 
A 1 219 VAL 219 509 509 VAL VAL A . n 
A 1 220 ASP 220 510 510 ASP ASP A . n 
A 1 221 GLY 221 511 511 GLY GLY A . n 
A 1 222 GLU 222 512 512 GLU GLU A . n 
A 1 223 PRO 223 513 513 PRO PRO A . n 
A 1 224 PRO 224 514 514 PRO PRO A . n 
A 1 225 TYR 225 515 515 TYR TYR A . n 
A 1 226 PHE 226 516 516 PHE PHE A . n 
A 1 227 ASN 227 517 517 ASN ASN A . n 
A 1 228 GLU 228 518 518 GLU GLU A . n 
A 1 229 PRO 229 519 519 PRO PRO A . n 
A 1 230 PRO 230 520 520 PRO PRO A . n 
A 1 231 LEU 231 521 521 LEU LEU A . n 
A 1 232 LYS 232 522 522 LYS LYS A . n 
A 1 233 ALA 233 523 523 ALA ALA A . n 
A 1 234 MET 234 524 524 MET MET A . n 
A 1 235 LYS 235 525 525 LYS LYS A . n 
A 1 236 MET 236 526 526 MET MET A . n 
A 1 237 ILE 237 527 527 ILE ILE A . n 
A 1 238 ARG 238 528 528 ARG ARG A . n 
A 1 239 ASP 239 529 529 ASP ASP A . n 
A 1 240 ASN 240 530 530 ASN ASN A . n 
A 1 241 LEU 241 531 531 LEU LEU A . n 
A 1 242 PRO 242 532 532 PRO PRO A . n 
A 1 243 PRO 243 533 533 PRO PRO A . n 
A 1 244 ARG 244 534 534 ARG ARG A . n 
A 1 245 LEU 245 535 535 LEU LEU A . n 
A 1 246 LYS 246 536 536 LYS LYS A . n 
A 1 247 ASN 247 537 537 ASN ASN A . n 
A 1 248 LEU 248 538 538 LEU LEU A . n 
A 1 249 HIS 249 539 539 HIS HIS A . n 
A 1 250 LYS 250 540 540 LYS LYS A . n 
A 1 251 VAL 251 541 541 VAL VAL A . n 
A 1 252 SER 252 542 542 SER SER A . n 
A 1 253 PRO 253 543 543 PRO PRO A . n 
A 1 254 SER 254 544 544 SER SER A . n 
A 1 255 LEU 255 545 545 LEU LEU A . n 
A 1 256 LYS 256 546 546 LYS LYS A . n 
A 1 257 GLY 257 547 547 GLY GLY A . n 
A 1 258 PHE 258 548 548 PHE PHE A . n 
A 1 259 LEU 259 549 549 LEU LEU A . n 
A 1 260 ASP 260 550 550 ASP ASP A . n 
A 1 261 ARG 261 551 551 ARG ARG A . n 
A 1 262 LEU 262 552 552 LEU LEU A . n 
A 1 263 LEU 263 553 553 LEU LEU A . n 
A 1 264 VAL 264 554 554 VAL VAL A . n 
A 1 265 ARG 265 555 555 ARG ARG A . n 
A 1 266 ASP 266 556 556 ASP ASP A . n 
A 1 267 PRO 267 557 557 PRO PRO A . n 
A 1 268 ALA 268 558 558 ALA ALA A . n 
A 1 269 GLN 269 559 559 GLN GLN A . n 
A 1 270 ARG 270 560 560 ARG ARG A . n 
A 1 271 ALA 271 561 561 ALA ALA A . n 
A 1 272 THR 272 562 562 THR THR A . n 
A 1 273 ALA 273 563 563 ALA ALA A . n 
A 1 274 ALA 274 564 564 ALA ALA A . n 
A 1 275 GLU 275 565 565 GLU GLU A . n 
A 1 276 LEU 276 566 566 LEU LEU A . n 
A 1 277 LEU 277 567 567 LEU LEU A . n 
A 1 278 LYS 278 568 568 LYS LYS A . n 
A 1 279 HIS 279 569 569 HIS HIS A . n 
A 1 280 PRO 280 570 570 PRO PRO A . n 
A 1 281 PHE 281 571 571 PHE PHE A . n 
A 1 282 LEU 282 572 572 LEU LEU A . n 
A 1 283 ALA 283 573 573 ALA ALA A . n 
A 1 284 LYS 284 574 574 LYS LYS A . n 
A 1 285 ALA 285 575 575 ALA ALA A . n 
A 1 286 GLY 286 576 576 GLY GLY A . n 
A 1 287 PRO 287 577 577 PRO PRO A . n 
A 1 288 PRO 288 578 578 PRO PRO A . n 
A 1 289 ALA 289 579 579 ALA ALA A . n 
A 1 290 SER 290 580 580 SER SER A . n 
A 1 291 ILE 291 581 581 ILE ILE A . n 
A 1 292 VAL 292 582 582 VAL VAL A . n 
A 1 293 PRO 293 583 583 PRO PRO A . n 
A 1 294 LEU 294 584 584 LEU LEU A . n 
A 1 295 MET 295 585 585 MET MET A . n 
A 1 296 ARG 296 586 586 ARG ARG A . n 
A 1 297 GLN 297 587 587 GLN GLN A . n 
A 1 298 ASN 298 588 588 ASN ASN A . n 
A 1 299 ARG 299 589 589 ARG ARG A . n 
A 1 300 THR 300 590 590 THR THR A . n 
A 1 301 ARG 301 591 591 ARG ARG A . n 
B 2 1   ARG 1   -5  -5  ARG ARG B . n 
B 2 2   ARG 2   -4  -4  ARG ARG B . n 
B 2 3   ARG 3   -3  -3  ARG ARG B . n 
B 2 4   ARG 4   -2  -2  ARG ARG B . n 
B 2 5   ARG 5   -1  -1  ARG ARG B . n 
B 2 6   SER 6   0   0   SER SER B . n 
B 2 7   TRP 7   1   1   TRP TRP B . n 
B 2 8   TYR 8   2   2   TYR TYR B . n 
B 2 9   PHE 9   3   3   PHE PHE B . n 
B 2 10  ASP 10  4   4   ASP ASP B . n 
B 2 11  GLY 11  5   5   GLY GLY B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   592 301 SO4 SO4 A . 
D 4 EDO 1   593 401 EDO EDO A . 
E 4 EDO 1   594 402 EDO EDO A . 
F 4 EDO 1   595 404 EDO EDO A . 
G 4 EDO 1   596 405 EDO EDO A . 
H 4 EDO 1   597 406 EDO EDO A . 
I 4 EDO 1   598 407 EDO EDO A . 
J 4 EDO 1   599 408 EDO EDO A . 
K 4 EDO 1   403 403 EDO EDO B . 
L 5 HOH 1   1   1   HOH HOH A . 
L 5 HOH 2   2   2   HOH HOH A . 
L 5 HOH 3   3   3   HOH HOH A . 
L 5 HOH 4   5   5   HOH HOH A . 
L 5 HOH 5   6   6   HOH HOH A . 
L 5 HOH 6   7   7   HOH HOH A . 
L 5 HOH 7   8   8   HOH HOH A . 
L 5 HOH 8   9   9   HOH HOH A . 
L 5 HOH 9   10  10  HOH HOH A . 
L 5 HOH 10  11  11  HOH HOH A . 
L 5 HOH 11  12  12  HOH HOH A . 
L 5 HOH 12  13  13  HOH HOH A . 
L 5 HOH 13  14  14  HOH HOH A . 
L 5 HOH 14  15  15  HOH HOH A . 
L 5 HOH 15  16  16  HOH HOH A . 
L 5 HOH 16  17  17  HOH HOH A . 
L 5 HOH 17  18  18  HOH HOH A . 
L 5 HOH 18  19  19  HOH HOH A . 
L 5 HOH 19  20  20  HOH HOH A . 
L 5 HOH 20  21  21  HOH HOH A . 
L 5 HOH 21  22  22  HOH HOH A . 
L 5 HOH 22  23  23  HOH HOH A . 
L 5 HOH 23  25  25  HOH HOH A . 
L 5 HOH 24  26  26  HOH HOH A . 
L 5 HOH 25  27  27  HOH HOH A . 
L 5 HOH 26  28  28  HOH HOH A . 
L 5 HOH 27  29  29  HOH HOH A . 
L 5 HOH 28  30  30  HOH HOH A . 
L 5 HOH 29  31  31  HOH HOH A . 
L 5 HOH 30  32  32  HOH HOH A . 
L 5 HOH 31  33  33  HOH HOH A . 
L 5 HOH 32  34  34  HOH HOH A . 
L 5 HOH 33  35  35  HOH HOH A . 
L 5 HOH 34  36  36  HOH HOH A . 
L 5 HOH 35  37  37  HOH HOH A . 
L 5 HOH 36  38  38  HOH HOH A . 
L 5 HOH 37  39  39  HOH HOH A . 
L 5 HOH 38  40  40  HOH HOH A . 
L 5 HOH 39  41  41  HOH HOH A . 
L 5 HOH 40  42  42  HOH HOH A . 
L 5 HOH 41  43  43  HOH HOH A . 
L 5 HOH 42  45  45  HOH HOH A . 
L 5 HOH 43  46  46  HOH HOH A . 
L 5 HOH 44  47  47  HOH HOH A . 
L 5 HOH 45  48  48  HOH HOH A . 
L 5 HOH 46  49  49  HOH HOH A . 
L 5 HOH 47  50  50  HOH HOH A . 
L 5 HOH 48  51  51  HOH HOH A . 
L 5 HOH 49  52  52  HOH HOH A . 
L 5 HOH 50  53  53  HOH HOH A . 
L 5 HOH 51  54  54  HOH HOH A . 
L 5 HOH 52  55  55  HOH HOH A . 
L 5 HOH 53  56  56  HOH HOH A . 
L 5 HOH 54  57  57  HOH HOH A . 
L 5 HOH 55  58  58  HOH HOH A . 
L 5 HOH 56  60  60  HOH HOH A . 
L 5 HOH 57  61  61  HOH HOH A . 
L 5 HOH 58  64  64  HOH HOH A . 
L 5 HOH 59  65  65  HOH HOH A . 
L 5 HOH 60  66  66  HOH HOH A . 
L 5 HOH 61  67  67  HOH HOH A . 
L 5 HOH 62  68  68  HOH HOH A . 
L 5 HOH 63  69  69  HOH HOH A . 
L 5 HOH 64  70  70  HOH HOH A . 
L 5 HOH 65  71  71  HOH HOH A . 
L 5 HOH 66  72  72  HOH HOH A . 
L 5 HOH 67  73  73  HOH HOH A . 
L 5 HOH 68  74  74  HOH HOH A . 
L 5 HOH 69  75  75  HOH HOH A . 
L 5 HOH 70  76  76  HOH HOH A . 
L 5 HOH 71  77  77  HOH HOH A . 
L 5 HOH 72  78  78  HOH HOH A . 
L 5 HOH 73  79  79  HOH HOH A . 
L 5 HOH 74  80  80  HOH HOH A . 
L 5 HOH 75  81  81  HOH HOH A . 
L 5 HOH 76  82  82  HOH HOH A . 
L 5 HOH 77  83  83  HOH HOH A . 
L 5 HOH 78  84  84  HOH HOH A . 
L 5 HOH 79  85  85  HOH HOH A . 
L 5 HOH 80  86  86  HOH HOH A . 
L 5 HOH 81  87  87  HOH HOH A . 
L 5 HOH 82  88  88  HOH HOH A . 
L 5 HOH 83  89  89  HOH HOH A . 
L 5 HOH 84  90  90  HOH HOH A . 
L 5 HOH 85  91  91  HOH HOH A . 
L 5 HOH 86  92  92  HOH HOH A . 
L 5 HOH 87  93  93  HOH HOH A . 
L 5 HOH 88  94  94  HOH HOH A . 
L 5 HOH 89  95  95  HOH HOH A . 
L 5 HOH 90  96  96  HOH HOH A . 
L 5 HOH 91  97  97  HOH HOH A . 
L 5 HOH 92  98  98  HOH HOH A . 
L 5 HOH 93  99  99  HOH HOH A . 
L 5 HOH 94  100 100 HOH HOH A . 
L 5 HOH 95  101 101 HOH HOH A . 
L 5 HOH 96  102 102 HOH HOH A . 
L 5 HOH 97  103 103 HOH HOH A . 
L 5 HOH 98  104 104 HOH HOH A . 
L 5 HOH 99  105 105 HOH HOH A . 
L 5 HOH 100 106 106 HOH HOH A . 
L 5 HOH 101 107 107 HOH HOH A . 
L 5 HOH 102 108 108 HOH HOH A . 
L 5 HOH 103 109 109 HOH HOH A . 
L 5 HOH 104 110 110 HOH HOH A . 
L 5 HOH 105 111 111 HOH HOH A . 
L 5 HOH 106 112 112 HOH HOH A . 
L 5 HOH 107 113 113 HOH HOH A . 
L 5 HOH 108 115 115 HOH HOH A . 
L 5 HOH 109 116 116 HOH HOH A . 
L 5 HOH 110 117 117 HOH HOH A . 
L 5 HOH 111 118 118 HOH HOH A . 
L 5 HOH 112 119 119 HOH HOH A . 
L 5 HOH 113 120 120 HOH HOH A . 
L 5 HOH 114 121 121 HOH HOH A . 
L 5 HOH 115 122 122 HOH HOH A . 
L 5 HOH 116 123 123 HOH HOH A . 
L 5 HOH 117 124 124 HOH HOH A . 
L 5 HOH 118 126 126 HOH HOH A . 
L 5 HOH 119 127 127 HOH HOH A . 
L 5 HOH 120 128 128 HOH HOH A . 
L 5 HOH 121 129 129 HOH HOH A . 
L 5 HOH 122 130 130 HOH HOH A . 
L 5 HOH 123 131 131 HOH HOH A . 
L 5 HOH 124 132 132 HOH HOH A . 
L 5 HOH 125 133 133 HOH HOH A . 
L 5 HOH 126 135 135 HOH HOH A . 
L 5 HOH 127 136 136 HOH HOH A . 
L 5 HOH 128 137 137 HOH HOH A . 
L 5 HOH 129 138 138 HOH HOH A . 
L 5 HOH 130 139 139 HOH HOH A . 
L 5 HOH 131 140 140 HOH HOH A . 
L 5 HOH 132 141 141 HOH HOH A . 
L 5 HOH 133 142 142 HOH HOH A . 
L 5 HOH 134 143 143 HOH HOH A . 
L 5 HOH 135 144 144 HOH HOH A . 
L 5 HOH 136 145 145 HOH HOH A . 
L 5 HOH 137 146 146 HOH HOH A . 
L 5 HOH 138 147 147 HOH HOH A . 
L 5 HOH 139 148 148 HOH HOH A . 
L 5 HOH 140 149 149 HOH HOH A . 
L 5 HOH 141 150 150 HOH HOH A . 
L 5 HOH 142 151 151 HOH HOH A . 
L 5 HOH 143 152 152 HOH HOH A . 
L 5 HOH 144 153 153 HOH HOH A . 
L 5 HOH 145 154 154 HOH HOH A . 
L 5 HOH 146 155 155 HOH HOH A . 
L 5 HOH 147 156 156 HOH HOH A . 
L 5 HOH 148 157 157 HOH HOH A . 
L 5 HOH 149 159 159 HOH HOH A . 
L 5 HOH 150 160 160 HOH HOH A . 
L 5 HOH 151 161 161 HOH HOH A . 
L 5 HOH 152 162 162 HOH HOH A . 
L 5 HOH 153 163 163 HOH HOH A . 
L 5 HOH 154 164 164 HOH HOH A . 
L 5 HOH 155 166 166 HOH HOH A . 
L 5 HOH 156 167 167 HOH HOH A . 
L 5 HOH 157 168 168 HOH HOH A . 
L 5 HOH 158 169 169 HOH HOH A . 
L 5 HOH 159 170 170 HOH HOH A . 
L 5 HOH 160 171 171 HOH HOH A . 
L 5 HOH 161 173 173 HOH HOH A . 
L 5 HOH 162 174 174 HOH HOH A . 
L 5 HOH 163 175 175 HOH HOH A . 
L 5 HOH 164 176 176 HOH HOH A . 
L 5 HOH 165 177 177 HOH HOH A . 
L 5 HOH 166 178 178 HOH HOH A . 
L 5 HOH 167 179 179 HOH HOH A . 
L 5 HOH 168 180 180 HOH HOH A . 
L 5 HOH 169 181 181 HOH HOH A . 
L 5 HOH 170 182 182 HOH HOH A . 
L 5 HOH 171 184 184 HOH HOH A . 
L 5 HOH 172 185 185 HOH HOH A . 
L 5 HOH 173 186 186 HOH HOH A . 
L 5 HOH 174 187 187 HOH HOH A . 
L 5 HOH 175 188 188 HOH HOH A . 
L 5 HOH 176 194 194 HOH HOH A . 
L 5 HOH 177 195 195 HOH HOH A . 
L 5 HOH 178 196 196 HOH HOH A . 
L 5 HOH 179 197 197 HOH HOH A . 
L 5 HOH 180 199 199 HOH HOH A . 
L 5 HOH 181 200 200 HOH HOH A . 
L 5 HOH 182 201 201 HOH HOH A . 
L 5 HOH 183 202 202 HOH HOH A . 
L 5 HOH 184 205 205 HOH HOH A . 
L 5 HOH 185 206 206 HOH HOH A . 
L 5 HOH 186 207 207 HOH HOH A . 
L 5 HOH 187 208 208 HOH HOH A . 
L 5 HOH 188 209 209 HOH HOH A . 
L 5 HOH 189 210 210 HOH HOH A . 
L 5 HOH 190 211 211 HOH HOH A . 
L 5 HOH 191 212 212 HOH HOH A . 
L 5 HOH 192 213 213 HOH HOH A . 
L 5 HOH 193 214 214 HOH HOH A . 
L 5 HOH 194 215 215 HOH HOH A . 
L 5 HOH 195 219 219 HOH HOH A . 
L 5 HOH 196 220 220 HOH HOH A . 
L 5 HOH 197 222 222 HOH HOH A . 
L 5 HOH 198 224 224 HOH HOH A . 
L 5 HOH 199 225 225 HOH HOH A . 
L 5 HOH 200 226 226 HOH HOH A . 
L 5 HOH 201 227 227 HOH HOH A . 
L 5 HOH 202 228 228 HOH HOH A . 
L 5 HOH 203 229 229 HOH HOH A . 
L 5 HOH 204 231 231 HOH HOH A . 
L 5 HOH 205 233 233 HOH HOH A . 
L 5 HOH 206 236 236 HOH HOH A . 
L 5 HOH 207 238 238 HOH HOH A . 
L 5 HOH 208 239 239 HOH HOH A . 
L 5 HOH 209 242 242 HOH HOH A . 
L 5 HOH 210 243 243 HOH HOH A . 
L 5 HOH 211 244 244 HOH HOH A . 
L 5 HOH 212 245 245 HOH HOH A . 
L 5 HOH 213 246 246 HOH HOH A . 
L 5 HOH 214 247 247 HOH HOH A . 
L 5 HOH 215 248 248 HOH HOH A . 
L 5 HOH 216 249 249 HOH HOH A . 
L 5 HOH 217 250 250 HOH HOH A . 
L 5 HOH 218 251 251 HOH HOH A . 
L 5 HOH 219 252 252 HOH HOH A . 
L 5 HOH 220 253 253 HOH HOH A . 
L 5 HOH 221 254 254 HOH HOH A . 
L 5 HOH 222 256 256 HOH HOH A . 
L 5 HOH 223 258 258 HOH HOH A . 
L 5 HOH 224 261 261 HOH HOH A . 
L 5 HOH 225 262 262 HOH HOH A . 
L 5 HOH 226 263 263 HOH HOH A . 
L 5 HOH 227 264 264 HOH HOH A . 
L 5 HOH 228 265 265 HOH HOH A . 
L 5 HOH 229 266 266 HOH HOH A . 
L 5 HOH 230 267 267 HOH HOH A . 
L 5 HOH 231 268 268 HOH HOH A . 
L 5 HOH 232 270 270 HOH HOH A . 
L 5 HOH 233 271 271 HOH HOH A . 
L 5 HOH 234 272 272 HOH HOH A . 
L 5 HOH 235 273 273 HOH HOH A . 
L 5 HOH 236 274 274 HOH HOH A . 
L 5 HOH 237 275 275 HOH HOH A . 
L 5 HOH 238 276 276 HOH HOH A . 
L 5 HOH 239 277 277 HOH HOH A . 
M 5 HOH 1   24  24  HOH HOH B . 
M 5 HOH 2   44  44  HOH HOH B . 
M 5 HOH 3   59  59  HOH HOH B . 
M 5 HOH 4   62  62  HOH HOH B . 
M 5 HOH 5   63  63  HOH HOH B . 
M 5 HOH 6   125 125 HOH HOH B . 
M 5 HOH 7   134 134 HOH HOH B . 
M 5 HOH 8   172 172 HOH HOH B . 
M 5 HOH 9   189 189 HOH HOH B . 
M 5 HOH 10  192 192 HOH HOH B . 
M 5 HOH 11  198 198 HOH HOH B . 
M 5 HOH 12  235 235 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     184 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      474 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     111 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   L 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
5 'Structure model' 1 4 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Refinement description'    
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
2 4 'Structure model' software                     
3 5 'Structure model' audit_author                 
4 5 'Structure model' citation_author              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_audit_author.name'    
2 5 'Structure model' '_citation_author.name' 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             1.750 
_diffrn_reflns.pdbx_d_res_low              50.000 
_diffrn_reflns.pdbx_number_obs             40410 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.057 
_diffrn_reflns.pdbx_Rsym_value             ? 
_diffrn_reflns.pdbx_chi_squared            1.05 
_diffrn_reflns.av_sigmaI_over_netI         16.30 
_diffrn_reflns.pdbx_redundancy             12.00 
_diffrn_reflns.pdbx_percent_possible_obs   92.50 
_diffrn_reflns.number                      486051 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 3.77 50.00 ? ? 0.037 ? 1.090 12.60 93.70  
1 2.99 3.77  ? ? 0.051 ? 1.071 13.30 86.60  
1 2.61 2.99  ? ? 0.053 ? 1.075 14.10 100.00 
1 2.38 2.61  ? ? 0.065 ? 1.011 14.10 100.00 
1 2.20 2.38  ? ? 0.092 ? 1.049 12.00 65.50  
1 2.07 2.20  ? ? 0.113 ? 1.042 14.10 100.00 
1 1.97 2.07  ? ? 0.150 ? 1.002 13.90 100.00 
1 1.89 1.97  ? ? 0.218 ? 1.071 10.00 84.80  
1 1.81 1.89  ? ? 0.289 ? 1.061 9.80  99.70  
1 1.75 1.81  ? ? 0.355 ? 1.046 5.60  94.20  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -65.7680 24.2970 -22.6970 -0.1931 0.0381  -0.0818 0.0411  -0.0389 -0.0168 7.0806  10.4067 13.7187 -1.4004 0.2770  
7.8267  0.1060 -0.2895 0.1835  0.6041  -0.1796 0.2609  -0.0544 0.3920  0.1361  'X-RAY DIFFRACTION' 
2 ? refined -52.9400 38.2740 -17.4100 -0.1008 -0.0684 -0.0300 -0.0011 -0.0026 0.0697  15.8647 0.4782  4.1101  1.7665  1.2705  
0.9687  0.1349 -0.0103 -0.1246 0.4484  0.4019  0.1795  -0.1105 -0.3964 0.1672  'X-RAY DIFFRACTION' 
3 ? refined -55.7410 29.8580 -13.9780 -0.1550 -0.0136 -0.0457 0.0371  -0.0308 -0.0007 2.2671  2.4377  3.1947  0.2914  0.4807  
0.0434  0.0311 0.0554  -0.0865 0.0451  0.1793  0.1417  -0.0850 -0.0938 0.0028  'X-RAY DIFFRACTION' 
4 ? refined -48.6160 21.1320 -5.2760  -0.1016 -0.0754 -0.0921 -0.0062 -0.0067 -0.0071 1.0690  1.5988  0.9006  -0.1862 0.1669  
-0.4776 0.0522 -0.0381 -0.0142 -0.0534 -0.0403 0.0537  -0.0480 0.0562  -0.1512 'X-RAY DIFFRACTION' 
5 ? refined -36.8100 14.4770 0.1920   -0.1062 -0.1058 0.0092  0.0029  -0.0243 0.0481  0.5979  3.0356  1.0729  0.8161  -0.0451 
0.0898  0.0889 -0.0961 0.0071  -0.1406 -0.2201 -0.5191 0.0335  0.1253  0.0749  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 8   A 22  ? A 298 A 312 'X-RAY DIFFRACTION' ? 
2 2 A 23  A 43  ? A 313 A 333 'X-RAY DIFFRACTION' ? 
3 3 A 44  A 84  ? A 334 A 374 'X-RAY DIFFRACTION' ? 
4 4 A 85  A 213 ? A 375 A 503 'X-RAY DIFFRACTION' ? 
5 5 A 214 A 301 ? A 504 A 591 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     2Q0N 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           32.570 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        32.570 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .     ?                other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC      .     ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
HKL-2000    .     ?                ?       ?                    ?                           'data collection' ? ?          ? 6 
HKL-2000    .     ?                ?       ?                    ?                           'data reduction'  ? ?          ? 7 
HKL-2000    .     ?                ?       ?                    ?                           'data scaling'    ? ?          ? 8 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             589 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             589 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.246 
_pdbx_validate_rmsd_bond.bond_target_value         1.460 
_pdbx_validate_rmsd_bond.bond_deviation            -0.214 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.017 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 560 ? ? CZ A ARG 560 ? ? NH1 A ARG 560 ? ? 123.35 120.30 3.05 0.50 N 
2 1 NE A ARG 589 ? ? CZ A ARG 589 ? ? NH1 A ARG 589 ? ? 123.46 120.30 3.16 0.50 N 
3 1 NE B ARG -5  ? ? CZ B ARG -5  ? ? NH1 B ARG -5  ? ? 124.05 120.30 3.75 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 440 ? ? -147.54 46.89   
2 1 ASN A 537 ? ? -97.73  40.96   
3 1 THR A 590 ? ? -101.00 -167.23 
4 1 ASP B 4   ? ? 176.77  148.71  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 319 ? OG  ? A SER 29  OG  
2  1 Y 1 A TYR 320 ? CG  ? A TYR 30  CG  
3  1 Y 1 A TYR 320 ? CD1 ? A TYR 30  CD1 
4  1 Y 1 A TYR 320 ? CD2 ? A TYR 30  CD2 
5  1 Y 1 A TYR 320 ? CE1 ? A TYR 30  CE1 
6  1 Y 1 A TYR 320 ? CE2 ? A TYR 30  CE2 
7  1 Y 1 A TYR 320 ? CZ  ? A TYR 30  CZ  
8  1 Y 1 A TYR 320 ? OH  ? A TYR 30  OH  
9  1 Y 1 A ARG 341 ? CG  ? A ARG 51  CG  
10 1 Y 1 A ARG 341 ? CD  ? A ARG 51  CD  
11 1 Y 1 A ARG 341 ? NE  ? A ARG 51  NE  
12 1 Y 1 A ARG 341 ? CZ  ? A ARG 51  CZ  
13 1 Y 1 A ARG 341 ? NH1 ? A ARG 51  NH1 
14 1 Y 1 A ARG 341 ? NH2 ? A ARG 51  NH2 
15 1 Y 1 A LYS 345 ? CG  ? A LYS 55  CG  
16 1 Y 1 A LYS 345 ? CD  ? A LYS 55  CD  
17 1 Y 1 A LYS 345 ? CE  ? A LYS 55  CE  
18 1 Y 1 A LYS 345 ? NZ  ? A LYS 55  NZ  
19 1 Y 1 A GLN 358 ? CG  ? A GLN 68  CG  
20 1 Y 1 A GLN 358 ? CD  ? A GLN 68  CD  
21 1 Y 1 A GLN 358 ? OE1 ? A GLN 68  OE1 
22 1 Y 1 A GLN 358 ? NE2 ? A GLN 68  NE2 
23 1 Y 1 A GLU 361 ? CG  ? A GLU 71  CG  
24 1 Y 1 A GLU 361 ? CD  ? A GLU 71  CD  
25 1 Y 1 A GLU 361 ? OE1 ? A GLU 71  OE1 
26 1 Y 1 A GLU 361 ? OE2 ? A GLU 71  OE2 
27 1 Y 1 A GLU 376 ? CD  ? A GLU 86  CD  
28 1 Y 1 A GLU 376 ? OE1 ? A GLU 86  OE1 
29 1 Y 1 A GLU 376 ? OE2 ? A GLU 86  OE2 
30 1 Y 1 A ARG 411 ? CD  ? A ARG 121 CD  
31 1 Y 1 A ARG 411 ? NE  ? A ARG 121 NE  
32 1 Y 1 A ARG 411 ? CZ  ? A ARG 121 CZ  
33 1 Y 1 A ARG 411 ? NH1 ? A ARG 121 NH1 
34 1 Y 1 A ARG 411 ? NH2 ? A ARG 121 NH2 
35 1 Y 1 A LYS 467 ? CG  ? A LYS 177 CG  
36 1 Y 1 A LYS 467 ? CD  ? A LYS 177 CD  
37 1 Y 1 A LYS 467 ? CE  ? A LYS 177 CE  
38 1 Y 1 A LYS 467 ? NZ  ? A LYS 177 NZ  
39 1 Y 1 A GLU 468 ? CG  ? A GLU 178 CG  
40 1 Y 1 A GLU 468 ? CD  ? A GLU 178 CD  
41 1 Y 1 A GLU 468 ? OE1 ? A GLU 178 OE1 
42 1 Y 1 A GLU 468 ? OE2 ? A GLU 178 OE2 
43 1 Y 1 A LYS 473 ? CD  ? A LYS 183 CD  
44 1 Y 1 A LYS 473 ? CE  ? A LYS 183 CE  
45 1 Y 1 A LYS 473 ? NZ  ? A LYS 183 NZ  
46 1 Y 1 A ARG 489 ? NE  ? A ARG 199 NE  
47 1 Y 1 A ARG 489 ? CZ  ? A ARG 199 CZ  
48 1 Y 1 A ARG 489 ? NH1 ? A ARG 199 NH1 
49 1 Y 1 A ARG 489 ? NH2 ? A ARG 199 NH2 
50 1 Y 1 A LYS 522 ? NZ  ? A LYS 232 NZ  
51 1 Y 1 A ARG 534 ? CG  ? A ARG 244 CG  
52 1 Y 1 A ARG 534 ? CD  ? A ARG 244 CD  
53 1 Y 1 A ARG 534 ? NE  ? A ARG 244 NE  
54 1 Y 1 A ARG 534 ? CZ  ? A ARG 244 CZ  
55 1 Y 1 A ARG 534 ? NH1 ? A ARG 244 NH1 
56 1 Y 1 A ARG 534 ? NH2 ? A ARG 244 NH2 
57 1 Y 1 A LYS 536 ? CG  ? A LYS 246 CG  
58 1 Y 1 A LYS 536 ? CD  ? A LYS 246 CD  
59 1 Y 1 A LYS 536 ? CE  ? A LYS 246 CE  
60 1 Y 1 A LYS 536 ? NZ  ? A LYS 246 NZ  
61 1 Y 1 A LYS 540 ? CG  ? A LYS 250 CG  
62 1 Y 1 A LYS 540 ? CD  ? A LYS 250 CD  
63 1 Y 1 A LYS 540 ? CE  ? A LYS 250 CE  
64 1 Y 1 A LYS 540 ? NZ  ? A LYS 250 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 291 ? A SER 1 
2 1 Y 1 A PRO 292 ? A PRO 2 
3 1 Y 1 A GLN 293 ? A GLN 3 
4 1 Y 1 A ARG 294 ? A ARG 4 
5 1 Y 1 A GLU 295 ? A GLU 5 
6 1 Y 1 A PRO 296 ? A PRO 6 
7 1 Y 1 A GLN 297 ? A GLN 7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'  SO4 
4 1,2-ETHANEDIOL EDO 
5 water          HOH 
#