data_2Q53
# 
_entry.id   2Q53 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Q53         
RCSB  RCSB043159   
WWPDB D_1000043159 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
TargetDB GO.35223 .                                                        unspecified   
PDB      2I5T     'Original refinement based on same data and R-free set.' re-refinement 
# 
_pdbx_database_status.entry_id                        2Q53 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-05-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Levin, E.J.'                                      1 
'Kondrashov, D.A.'                                 2 
'Wesenberg, G.E.'                                  3 
'Phillips Jr., G.N.'                               4 
'Center for Eukaryotic Structural Genomics (CESG)' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of Homo sapiens protein LOC79017.'                            Proteins  70 588  591  2008 PSFGEY US 
0887-3585 0867 ? 17932939 10.1002/prot.21719        
1       'Ensemble refinement of protein crystal structures: validation and application.' Structure 15 1040 1052 2007 STRUE6 UK 
0969-2126 2005 ? 17850744 10.1016/j.str.2007.06.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bae, E.'            1 
primary 'Bingman, C.A.'      2 
primary 'Aceti, D.J.'        3 
primary 'Phillips Jr., G.N.' 4 
1       'Levin, E.J.'        5 
1       'Kondrashov, D.A.'   6 
1       'Wesenberg, G.E.'    7 
1       'Phillips Jr., G.N.' 8 
# 
_cell.entry_id           2Q53 
_cell.length_a           35.052 
_cell.length_b           100.138 
_cell.length_c           102.498 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2Q53 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Uncharacterized protein C7orf24' 21173.152 2   ? ? ? ? 
2 water   nat water                             18.015    141 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVW
GVVWK(MSE)NKSNLNSLDEQEGVKSG(MSE)YVVIEVKVATQEGKEITCRSYL(MSE)TNYESAPPSPQYKKIIC
(MSE)GAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVW
GVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKL
KAIEPNDYTGKVSEEIEDIIKKGETQTL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         GO.35223 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   ASN n 
1 4   SER n 
1 5   GLY n 
1 6   CYS n 
1 7   LYS n 
1 8   ASP n 
1 9   VAL n 
1 10  THR n 
1 11  GLY n 
1 12  PRO n 
1 13  ASP n 
1 14  GLU n 
1 15  GLU n 
1 16  SER n 
1 17  PHE n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  ALA n 
1 22  TYR n 
1 23  GLY n 
1 24  SER n 
1 25  ASN n 
1 26  LEU n 
1 27  LEU n 
1 28  THR n 
1 29  GLU n 
1 30  ARG n 
1 31  ILE n 
1 32  HIS n 
1 33  LEU n 
1 34  ARG n 
1 35  ASN n 
1 36  PRO n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  PHE n 
1 41  PHE n 
1 42  CYS n 
1 43  VAL n 
1 44  ALA n 
1 45  ARG n 
1 46  LEU n 
1 47  GLN n 
1 48  ASP n 
1 49  PHE n 
1 50  LYS n 
1 51  LEU n 
1 52  ASP n 
1 53  PHE n 
1 54  GLY n 
1 55  ASN n 
1 56  SER n 
1 57  GLN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  SER n 
1 62  GLN n 
1 63  THR n 
1 64  TRP n 
1 65  HIS n 
1 66  GLY n 
1 67  GLY n 
1 68  ILE n 
1 69  ALA n 
1 70  THR n 
1 71  ILE n 
1 72  PHE n 
1 73  GLN n 
1 74  SER n 
1 75  PRO n 
1 76  GLY n 
1 77  ASP n 
1 78  GLU n 
1 79  VAL n 
1 80  TRP n 
1 81  GLY n 
1 82  VAL n 
1 83  VAL n 
1 84  TRP n 
1 85  LYS n 
1 86  MSE n 
1 87  ASN n 
1 88  LYS n 
1 89  SER n 
1 90  ASN n 
1 91  LEU n 
1 92  ASN n 
1 93  SER n 
1 94  LEU n 
1 95  ASP n 
1 96  GLU n 
1 97  GLN n 
1 98  GLU n 
1 99  GLY n 
1 100 VAL n 
1 101 LYS n 
1 102 SER n 
1 103 GLY n 
1 104 MSE n 
1 105 TYR n 
1 106 VAL n 
1 107 VAL n 
1 108 ILE n 
1 109 GLU n 
1 110 VAL n 
1 111 LYS n 
1 112 VAL n 
1 113 ALA n 
1 114 THR n 
1 115 GLN n 
1 116 GLU n 
1 117 GLY n 
1 118 LYS n 
1 119 GLU n 
1 120 ILE n 
1 121 THR n 
1 122 CYS n 
1 123 ARG n 
1 124 SER n 
1 125 TYR n 
1 126 LEU n 
1 127 MSE n 
1 128 THR n 
1 129 ASN n 
1 130 TYR n 
1 131 GLU n 
1 132 SER n 
1 133 ALA n 
1 134 PRO n 
1 135 PRO n 
1 136 SER n 
1 137 PRO n 
1 138 GLN n 
1 139 TYR n 
1 140 LYS n 
1 141 LYS n 
1 142 ILE n 
1 143 ILE n 
1 144 CYS n 
1 145 MSE n 
1 146 GLY n 
1 147 ALA n 
1 148 LYS n 
1 149 GLU n 
1 150 ASN n 
1 151 GLY n 
1 152 LEU n 
1 153 PRO n 
1 154 LEU n 
1 155 GLU n 
1 156 TYR n 
1 157 GLN n 
1 158 GLU n 
1 159 LYS n 
1 160 LEU n 
1 161 LYS n 
1 162 ALA n 
1 163 ILE n 
1 164 GLU n 
1 165 PRO n 
1 166 ASN n 
1 167 ASP n 
1 168 TYR n 
1 169 THR n 
1 170 GLY n 
1 171 LYS n 
1 172 VAL n 
1 173 SER n 
1 174 GLU n 
1 175 GLU n 
1 176 ILE n 
1 177 GLU n 
1 178 ASP n 
1 179 ILE n 
1 180 ILE n 
1 181 LYS n 
1 182 LYS n 
1 183 GLY n 
1 184 GLU n 
1 185 THR n 
1 186 GLN n 
1 187 THR n 
1 188 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 C7orf24 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL834(DE3) pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVP30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CG024_HUMAN 
_struct_ref.pdbx_db_accession          O75223 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWG
VVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLK
AIEPNDYTGKVSEEIEDIIKKGETQTL
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Q53 A 2 ? 188 ? O75223 2 ? 188 ? 2 188 
2 1 2Q53 B 2 ? 188 ? O75223 2 ? 188 ? 2 188 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Q53 SER A 1   ? UNP O75223 ?   ?   'EXPRESSION TAG'   1   1  
1 2Q53 MSE A 86  ? UNP O75223 MET 86  'MODIFIED RESIDUE' 86  2  
1 2Q53 MSE A 104 ? UNP O75223 MET 104 'MODIFIED RESIDUE' 104 3  
1 2Q53 MSE A 127 ? UNP O75223 MET 127 'MODIFIED RESIDUE' 127 4  
1 2Q53 MSE A 145 ? UNP O75223 MET 145 'MODIFIED RESIDUE' 145 5  
2 2Q53 SER B 1   ? UNP O75223 ?   ?   'EXPRESSION TAG'   1   6  
2 2Q53 MSE B 86  ? UNP O75223 MET 86  'MODIFIED RESIDUE' 86  7  
2 2Q53 MSE B 104 ? UNP O75223 MET 104 'MODIFIED RESIDUE' 104 8  
2 2Q53 MSE B 127 ? UNP O75223 MET 127 'MODIFIED RESIDUE' 127 9  
2 2Q53 MSE B 145 ? UNP O75223 MET 145 'MODIFIED RESIDUE' 145 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   ? 
_exptl.entry_id          2Q53 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.20 
_exptl_crystal.density_percent_sol   42.50 
_exptl_crystal.description           'AUTHOR USED THE SF DATA FROM ENTRY 2I5T.' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 2Q53 
_refine.pdbx_starting_model                      'PDB entry 2I5T' 
_refine.pdbx_method_to_determine_struct          'Re-refinement using ensemble model' 
_refine.pdbx_stereochemistry_target_values       'maximum likelihood using amplitudes' 
_refine.ls_d_res_high                            2.010 
_refine.ls_d_res_low                             44.990 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               1668254.500 
_refine.pdbx_data_cutoff_low_absF                0.000 
_refine.ls_percent_reflns_obs                    97.400 
_refine.ls_number_reflns_obs                     24212 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;This PDB entry is a re-refinement using an ensemble model of the previously 
deposited single-conformer structure 2i5t and 
the first data set in the deposited structure factor file 
for 2i5t along with the R-free set defined therein. The coordinates 
were generated by an automated protocol from an initial model consisting 
of 4 identical copies of the protein and non-water 
hetero-atoms assigned fractional occupancies adding up to one, and a 
single copy of the solvent molecules. Refinement was carried out with 
all the conformers present simultaneously and with the potential energy 
terms corresponding to interactions between the different conformers 
excluded. The helix and sheet records were calculated using coordinates 
from the first conformer only. The structure visualization program 
PYMOL is well-suited for directly viewing the ensemble model 
presented in this PDB file.
;
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1233 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.B_iso_mean                               19.400 
_refine.solvent_model_param_bsol                 41.199 
_refine.solvent_model_param_ksol                 0.383 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.aniso_B[1][1]                            0.000 
_refine.aniso_B[2][2]                            0.000 
_refine.aniso_B[3][3]                            0.000 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.189 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2Q53 
_refine_analyze.Luzzati_coordinate_error_obs    0.210 
_refine_analyze.Luzzati_sigma_a_obs             0.160 
_refine_analyze.Luzzati_d_res_low_obs           5.000 
_refine_analyze.Luzzati_coordinate_error_free   0.270 
_refine_analyze.Luzzati_sigma_a_free            0.170 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2681 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             141 
_refine_hist.number_atoms_total               2822 
_refine_hist.d_res_high                       2.010 
_refine_hist.d_res_low                        44.990 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           ? 0.005  ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        ? 1.100  ?     ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ? 22.400 ?     ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ? 0.680  ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        ? 1.410  1.500 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       ? 2.110  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        ? 2.480  2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       ? 3.520  2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.pdbx_refine_id 
6 2.01 2.14  4065 3567 3414 87.7  0.207 0.263 0.021 153 4.3 . . 'X-RAY DIFFRACTION' 
6 2.14 2.30  4076 3963 3754 97.2  0.187 0.247 0.017 209 5.3 . . 'X-RAY DIFFRACTION' 
6 2.30 2.53  4092 4072 3854 99.5  0.173 0.233 0.016 218 5.4 . . 'X-RAY DIFFRACTION' 
6 2.53 2.90  4111 4107 3906 99.9  0.197 0.256 0.018 201 4.9 . . 'X-RAY DIFFRACTION' 
6 2.90 3.65  4147 4144 3926 99.9  0.206 0.248 0.017 218 5.3 . . 'X-RAY DIFFRACTION' 
6 3.65 44.99 4359 4359 4125 100.0 0.173 0.207 0.014 234 5.4 . . 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2Q53 
_struct.title                     
'Ensemble refinement of the crystal structure of uncharacterized protein loc79017 from Homo sapiens' 
_struct.pdbx_descriptor           'Uncharacterized protein C7orf24' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Q53 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;Ensemble Refinement, Refinement Methodology Development, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 23  ? LEU A 26  ? GLY A 23  LEU A 26  5 ? 4  
HELX_P HELX_P2  2  LEU A 27  ? ASN A 35  ? LEU A 27  ASN A 35  1 ? 9  
HELX_P HELX_P3  3  ASN A 90  ? GLU A 98  ? ASN A 90  GLU A 98  1 ? 9  
HELX_P HELX_P4  4  SER A 136 ? ASN A 150 ? SER A 136 ASN A 150 1 ? 15 
HELX_P HELX_P5  5  PRO A 153 ? ALA A 162 ? PRO A 153 ALA A 162 1 ? 10 
HELX_P HELX_P6  6  SER A 173 ? LYS A 182 ? SER A 173 LYS A 182 1 ? 10 
HELX_P HELX_P7  7  GLY B 23  ? LEU B 26  ? GLY B 23  LEU B 26  5 ? 4  
HELX_P HELX_P8  8  LEU B 27  ? HIS B 32  ? LEU B 27  HIS B 32  1 ? 6  
HELX_P HELX_P9  9  ASN B 90  ? GLU B 98  ? ASN B 90  GLU B 98  1 ? 9  
HELX_P HELX_P10 10 SER B 136 ? ASN B 150 ? SER B 136 ASN B 150 1 ? 15 
HELX_P HELX_P11 11 PRO B 153 ? ILE B 163 ? PRO B 153 ILE B 163 1 ? 11 
HELX_P HELX_P12 12 SER B 173 ? LYS B 181 ? SER B 173 LYS B 181 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A LYS 85  C ? ? ? 1_555 A MSE 86  N ? ? A LYS 85  A MSE 86  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2  covale ? ? A MSE 86  C ? ? ? 1_555 A ASN 87  N ? ? A MSE 86  A ASN 87  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3  covale ? ? A GLY 103 C ? ? ? 1_555 A MSE 104 N ? ? A GLY 103 A MSE 104 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale4  covale ? ? A MSE 104 C ? ? ? 1_555 A TYR 105 N ? ? A MSE 104 A TYR 105 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale5  covale ? ? A LEU 126 C ? ? ? 1_555 A MSE 127 N ? ? A LEU 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale6  covale ? ? A MSE 127 C ? ? ? 1_555 A THR 128 N ? ? A MSE 127 A THR 128 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale7  covale ? ? A CYS 144 C ? ? ? 1_555 A MSE 145 N ? ? A CYS 144 A MSE 145 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8  covale ? ? A MSE 145 C ? ? ? 1_555 A GLY 146 N ? ? A MSE 145 A GLY 146 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale9  covale ? ? B LYS 85  C ? ? ? 1_555 B MSE 86  N ? ? B LYS 85  B MSE 86  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale10 covale ? ? B MSE 86  C ? ? ? 1_555 B ASN 87  N ? ? B MSE 86  B ASN 87  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale11 covale ? ? B GLY 103 C ? ? ? 1_555 B MSE 104 N ? ? B GLY 103 B MSE 104 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12 covale ? ? B MSE 104 C ? ? ? 1_555 B TYR 105 N ? ? B MSE 104 B TYR 105 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale13 covale ? ? B LEU 126 C ? ? ? 1_555 B MSE 127 N ? ? B LEU 126 B MSE 127 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale14 covale ? ? B MSE 127 C ? ? ? 1_555 B THR 128 N ? ? B MSE 127 B THR 128 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale15 covale ? ? B CYS 144 C ? ? ? 1_555 B MSE 145 N ? ? B CYS 144 B MSE 145 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale16 covale ? ? B MSE 145 C ? ? ? 1_555 B GLY 146 N ? ? B MSE 145 B GLY 146 1_555 ? ? ? ? ? ? ? 1.330 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 16  ? ALA A 21  ? SER A 16  ALA A 21  
A 2 ILE A 68  ? ASN A 87  ? ILE A 68  ASN A 87  
A 3 ALA A 39  ? SER A 56  ? ALA A 39  SER A 56  
A 4 TYR A 130 ? SER A 132 ? TYR A 130 SER A 132 
B 1 GLU A 119 ? LEU A 126 ? GLU A 119 LEU A 126 
B 2 VAL A 106 ? ALA A 113 ? VAL A 106 ALA A 113 
B 3 VAL B 106 ? ALA B 113 ? VAL B 106 ALA B 113 
B 4 GLU B 119 ? LEU B 126 ? GLU B 119 LEU B 126 
C 1 SER B 16  ? ALA B 21  ? SER B 16  ALA B 21  
C 2 ILE B 68  ? ASN B 87  ? ILE B 68  ASN B 87  
C 3 ALA B 39  ? SER B 56  ? ALA B 39  SER B 56  
C 4 TYR B 130 ? SER B 132 ? TYR B 130 SER B 132 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 19  ? N TYR A 19  O TRP A 84  ? O TRP A 84  
A 2 3 O VAL A 83  ? O VAL A 83  N CYS A 42  ? N CYS A 42  
A 3 4 N ASN A 55  ? N ASN A 55  O GLU A 131 ? O GLU A 131 
B 1 2 O ILE A 120 ? O ILE A 120 N VAL A 112 ? N VAL A 112 
B 2 3 N VAL A 107 ? N VAL A 107 O GLU B 109 ? O GLU B 109 
B 3 4 N VAL B 110 ? N VAL B 110 O CYS B 122 ? O CYS B 122 
C 1 2 N PHE B 17  ? N PHE B 17  O MSE B 86  ? O MSE B 86  
C 2 3 O VAL B 83  ? O VAL B 83  N CYS B 42  ? N CYS B 42  
C 3 4 N ASN B 55  ? N ASN B 55  O GLU B 131 ? O GLU B 131 
# 
_database_PDB_matrix.entry_id          2Q53 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    2Q53 
_atom_sites.fract_transf_matrix[1][1]   0.028529 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009986 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009756 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLU A 1 14  ? 3.994   81.112  -13.941 0.25 43.55 ? 14  GLU A N   1 
ATOM   2     C  CA  . GLU A 1 14  ? 3.275   81.754  -15.078 0.25 45.42 ? 14  GLU A CA  1 
ATOM   3     C  C   . GLU A 1 14  ? 1.769   81.639  -14.871 0.25 43.27 ? 14  GLU A C   1 
ATOM   4     O  O   . GLU A 1 14  ? 1.017   82.578  -15.141 0.25 42.57 ? 14  GLU A O   1 
ATOM   5     C  CB  . GLU A 1 14  ? 3.670   81.083  -16.395 0.25 50.42 ? 14  GLU A CB  1 
ATOM   6     C  CG  . GLU A 1 14  ? 5.170   80.892  -16.575 0.25 57.67 ? 14  GLU A CG  1 
ATOM   7     C  CD  . GLU A 1 14  ? 5.956   82.187  -16.480 0.25 60.33 ? 14  GLU A CD  1 
ATOM   8     O  OE1 . GLU A 1 14  ? 7.193   82.137  -16.641 0.25 63.21 ? 14  GLU A OE1 1 
ATOM   9     O  OE2 . GLU A 1 14  ? 5.346   83.251  -16.245 0.25 61.97 ? 14  GLU A OE2 1 
ATOM   10    N  N   . GLU A 1 15  ? 1.334   80.476  -14.397 0.25 40.25 ? 15  GLU A N   1 
ATOM   11    C  CA  . GLU A 1 15  ? -0.077  80.236  -14.128 0.25 37.73 ? 15  GLU A CA  1 
ATOM   12    C  C   . GLU A 1 15  ? -0.312  80.491  -12.641 0.25 33.03 ? 15  GLU A C   1 
ATOM   13    O  O   . GLU A 1 15  ? -1.445  80.688  -12.194 0.25 29.77 ? 15  GLU A O   1 
ATOM   14    C  CB  . GLU A 1 15  ? -0.446  78.792  -14.470 0.25 43.23 ? 15  GLU A CB  1 
ATOM   15    C  CG  . GLU A 1 15  ? -1.941  78.521  -14.456 0.25 50.88 ? 15  GLU A CG  1 
ATOM   16    C  CD  . GLU A 1 15  ? -2.278  77.097  -14.841 0.25 54.12 ? 15  GLU A CD  1 
ATOM   17    O  OE1 . GLU A 1 15  ? -1.927  76.177  -14.075 0.25 58.22 ? 15  GLU A OE1 1 
ATOM   18    O  OE2 . GLU A 1 15  ? -2.888  76.896  -15.912 0.25 57.14 ? 15  GLU A OE2 1 
ATOM   19    N  N   . SER A 1 16  ? 0.780   80.484  -11.886 0.25 28.00 ? 16  SER A N   1 
ATOM   20    C  CA  . SER A 1 16  ? 0.742   80.716  -10.448 0.25 24.56 ? 16  SER A CA  1 
ATOM   21    C  C   . SER A 1 16  ? 1.438   82.036  -10.153 0.25 20.24 ? 16  SER A C   1 
ATOM   22    O  O   . SER A 1 16  ? 2.230   82.514  -10.962 0.25 17.04 ? 16  SER A O   1 
ATOM   23    C  CB  . SER A 1 16  ? 1.466   79.588  -9.712  0.25 26.86 ? 16  SER A CB  1 
ATOM   24    O  OG  . SER A 1 16  ? 0.794   78.351  -9.868  0.25 24.72 ? 16  SER A OG  1 
ATOM   25    N  N   . PHE A 1 17  ? 1.145   82.626  -8.998  0.25 16.83 ? 17  PHE A N   1 
ATOM   26    C  CA  . PHE A 1 17  ? 1.777   83.887  -8.634  0.25 14.44 ? 17  PHE A CA  1 
ATOM   27    C  C   . PHE A 1 17  ? 2.549   83.774  -7.333  0.25 13.09 ? 17  PHE A C   1 
ATOM   28    O  O   . PHE A 1 17  ? 2.300   82.877  -6.519  0.25 12.18 ? 17  PHE A O   1 
ATOM   29    C  CB  . PHE A 1 17  ? 0.748   85.022  -8.524  0.25 12.25 ? 17  PHE A CB  1 
ATOM   30    C  CG  . PHE A 1 17  ? -0.142  84.930  -7.314  0.25 13.69 ? 17  PHE A CG  1 
ATOM   31    C  CD1 . PHE A 1 17  ? -1.264  84.110  -7.315  0.25 11.94 ? 17  PHE A CD1 1 
ATOM   32    C  CD2 . PHE A 1 17  ? 0.146   85.665  -6.170  0.25 11.64 ? 17  PHE A CD2 1 
ATOM   33    C  CE1 . PHE A 1 17  ? -2.085  84.026  -6.194  0.25 11.66 ? 17  PHE A CE1 1 
ATOM   34    C  CE2 . PHE A 1 17  ? -0.668  85.586  -5.047  0.25 10.81 ? 17  PHE A CE2 1 
ATOM   35    C  CZ  . PHE A 1 17  ? -1.783  84.767  -5.057  0.25 12.33 ? 17  PHE A CZ  1 
ATOM   36    N  N   . LEU A 1 18  ? 3.488   84.702  -7.151  0.25 11.58 ? 18  LEU A N   1 
ATOM   37    C  CA  . LEU A 1 18  ? 4.328   84.747  -5.973  0.25 10.68 ? 18  LEU A CA  1 
ATOM   38    C  C   . LEU A 1 18  ? 3.845   85.824  -5.007  0.25 10.72 ? 18  LEU A C   1 
ATOM   39    O  O   . LEU A 1 18  ? 3.699   86.995  -5.370  0.25 9.64  ? 18  LEU A O   1 
ATOM   40    C  CB  . LEU A 1 18  ? 5.782   85.005  -6.382  0.25 10.84 ? 18  LEU A CB  1 
ATOM   41    C  CG  . LEU A 1 18  ? 6.352   83.961  -7.354  0.25 7.84  ? 18  LEU A CG  1 
ATOM   42    C  CD1 . LEU A 1 18  ? 7.722   84.388  -7.850  0.25 8.28  ? 18  LEU A CD1 1 
ATOM   43    C  CD2 . LEU A 1 18  ? 6.412   82.607  -6.658  0.25 11.28 ? 18  LEU A CD2 1 
ATOM   44    N  N   . TYR A 1 19  ? 3.594   85.395  -3.776  0.25 7.64  ? 19  TYR A N   1 
ATOM   45    C  CA  . TYR A 1 19  ? 3.118   86.253  -2.705  0.25 7.69  ? 19  TYR A CA  1 
ATOM   46    C  C   . TYR A 1 19  ? 4.185   86.385  -1.623  0.25 7.07  ? 19  TYR A C   1 
ATOM   47    O  O   . TYR A 1 19  ? 4.639   85.383  -1.067  0.25 5.95  ? 19  TYR A O   1 
ATOM   48    C  CB  . TYR A 1 19  ? 1.836   85.652  -2.120  0.25 6.07  ? 19  TYR A CB  1 
ATOM   49    C  CG  . TYR A 1 19  ? 1.449   86.162  -0.745  0.25 9.18  ? 19  TYR A CG  1 
ATOM   50    C  CD1 . TYR A 1 19  ? 1.341   87.530  -0.484  0.25 6.07  ? 19  TYR A CD1 1 
ATOM   51    C  CD2 . TYR A 1 19  ? 1.161   85.267  0.290   0.25 4.77  ? 19  TYR A CD2 1 
ATOM   52    C  CE1 . TYR A 1 19  ? 0.951   87.994  0.784   0.25 9.54  ? 19  TYR A CE1 1 
ATOM   53    C  CE2 . TYR A 1 19  ? 0.771   85.718  1.549   0.25 10.91 ? 19  TYR A CE2 1 
ATOM   54    C  CZ  . TYR A 1 19  ? 0.668   87.077  1.792   0.25 7.38  ? 19  TYR A CZ  1 
ATOM   55    O  OH  . TYR A 1 19  ? 0.283   87.514  3.041   0.25 13.45 ? 19  TYR A OH  1 
ATOM   56    N  N   . PHE A 1 20  ? 4.587   87.622  -1.339  0.25 5.10  ? 20  PHE A N   1 
ATOM   57    C  CA  . PHE A 1 20  ? 5.596   87.905  -0.313  0.25 6.83  ? 20  PHE A CA  1 
ATOM   58    C  C   . PHE A 1 20  ? 4.876   88.431  0.922   0.25 7.22  ? 20  PHE A C   1 
ATOM   59    O  O   . PHE A 1 20  ? 4.242   89.490  0.876   0.25 6.30  ? 20  PHE A O   1 
ATOM   60    C  CB  . PHE A 1 20  ? 6.592   88.963  -0.814  0.25 7.21  ? 20  PHE A CB  1 
ATOM   61    C  CG  . PHE A 1 20  ? 7.602   89.400  0.222   0.25 9.17  ? 20  PHE A CG  1 
ATOM   62    C  CD1 . PHE A 1 20  ? 8.563   88.512  0.699   0.25 10.00 ? 20  PHE A CD1 1 
ATOM   63    C  CD2 . PHE A 1 20  ? 7.596   90.701  0.715   0.25 9.65  ? 20  PHE A CD2 1 
ATOM   64    C  CE1 . PHE A 1 20  ? 9.503   88.913  1.648   0.25 8.59  ? 20  PHE A CE1 1 
ATOM   65    C  CE2 . PHE A 1 20  ? 8.533   91.114  1.666   0.25 9.34  ? 20  PHE A CE2 1 
ATOM   66    C  CZ  . PHE A 1 20  ? 9.489   90.218  2.133   0.25 11.16 ? 20  PHE A CZ  1 
ATOM   67    N  N   . ALA A 1 21  ? 4.971   87.689  2.021   0.25 8.25  ? 21  ALA A N   1 
ATOM   68    C  CA  . ALA A 1 21  ? 4.326   88.073  3.275   0.25 7.78  ? 21  ALA A CA  1 
ATOM   69    C  C   . ALA A 1 21  ? 5.377   88.276  4.356   0.25 8.62  ? 21  ALA A C   1 
ATOM   70    O  O   . ALA A 1 21  ? 6.415   87.617  4.350   0.25 7.38  ? 21  ALA A O   1 
ATOM   71    C  CB  . ALA A 1 21  ? 3.339   87.006  3.704   0.25 8.16  ? 21  ALA A CB  1 
ATOM   72    N  N   . TYR A 1 22  ? 5.100   89.185  5.288   0.25 7.84  ? 22  TYR A N   1 
ATOM   73    C  CA  . TYR A 1 22  ? 6.034   89.491  6.364   0.25 8.97  ? 22  TYR A CA  1 
ATOM   74    C  C   . TYR A 1 22  ? 5.355   89.500  7.728   0.25 9.50  ? 22  TYR A C   1 
ATOM   75    O  O   . TYR A 1 22  ? 5.953   89.921  8.711   0.25 7.93  ? 22  TYR A O   1 
ATOM   76    C  CB  . TYR A 1 22  ? 6.693   90.853  6.096   0.25 8.99  ? 22  TYR A CB  1 
ATOM   77    C  CG  . TYR A 1 22  ? 5.701   91.954  5.790   0.25 6.96  ? 22  TYR A CG  1 
ATOM   78    C  CD1 . TYR A 1 22  ? 5.020   92.612  6.812   0.25 9.00  ? 22  TYR A CD1 1 
ATOM   79    C  CD2 . TYR A 1 22  ? 5.402   92.300  4.473   0.25 7.63  ? 22  TYR A CD2 1 
ATOM   80    C  CE1 . TYR A 1 22  ? 4.061   93.590  6.532   0.25 10.66 ? 22  TYR A CE1 1 
ATOM   81    C  CE2 . TYR A 1 22  ? 4.444   93.274  4.180   0.25 10.36 ? 22  TYR A CE2 1 
ATOM   82    C  CZ  . TYR A 1 22  ? 3.779   93.914  5.215   0.25 10.55 ? 22  TYR A CZ  1 
ATOM   83    O  OH  . TYR A 1 22  ? 2.838   94.878  4.942   0.25 9.22  ? 22  TYR A OH  1 
ATOM   84    N  N   . GLY A 1 23  ? 4.111   89.019  7.779   0.25 11.06 ? 23  GLY A N   1 
ATOM   85    C  CA  . GLY A 1 23  ? 3.367   88.994  9.031   0.25 10.64 ? 23  GLY A CA  1 
ATOM   86    C  C   . GLY A 1 23  ? 2.774   87.646  9.418   0.25 10.28 ? 23  GLY A C   1 
ATOM   87    O  O   . GLY A 1 23  ? 3.467   86.627  9.401   0.25 11.09 ? 23  GLY A O   1 
ATOM   88    N  N   . SER A 1 24  ? 1.489   87.630  9.765   0.25 9.70  ? 24  SER A N   1 
ATOM   89    C  CA  . SER A 1 24  ? 0.839   86.392  10.172  0.25 12.39 ? 24  SER A CA  1 
ATOM   90    C  C   . SER A 1 24  ? 1.042   85.262  9.165   0.25 12.78 ? 24  SER A C   1 
ATOM   91    O  O   . SER A 1 24  ? 1.141   84.096  9.558   0.25 11.14 ? 24  SER A O   1 
ATOM   92    C  CB  . SER A 1 24  ? -0.661  86.610  10.421  0.25 14.42 ? 24  SER A CB  1 
ATOM   93    O  OG  . SER A 1 24  ? -1.336  86.999  9.240   0.25 13.47 ? 24  SER A OG  1 
ATOM   94    N  N   . ASN A 1 25  ? 1.118   85.588  7.874   0.25 11.66 ? 25  ASN A N   1 
ATOM   95    C  CA  . ASN A 1 25  ? 1.327   84.539  6.878   0.25 9.81  ? 25  ASN A CA  1 
ATOM   96    C  C   . ASN A 1 25  ? 2.772   84.053  6.806   0.25 10.72 ? 25  ASN A C   1 
ATOM   97    O  O   . ASN A 1 25  ? 3.191   83.457  5.812   0.25 8.69  ? 25  ASN A O   1 
ATOM   98    C  CB  . ASN A 1 25  ? 0.843   84.972  5.485   0.25 8.91  ? 25  ASN A CB  1 
ATOM   99    C  CG  . ASN A 1 25  ? -0.668  84.837  5.325   0.25 9.54  ? 25  ASN A CG  1 
ATOM   100   O  OD1 . ASN A 1 25  ? -1.313  84.063  6.041   0.25 14.26 ? 25  ASN A OD1 1 
ATOM   101   N  ND2 . ASN A 1 25  ? -1.236  85.576  4.375   0.25 10.72 ? 25  ASN A ND2 1 
ATOM   102   N  N   . LEU A 1 26  ? 3.537   84.323  7.859   0.25 11.25 ? 26  LEU A N   1 
ATOM   103   C  CA  . LEU A 1 26  ? 4.910   83.839  7.941   0.25 13.04 ? 26  LEU A CA  1 
ATOM   104   C  C   . LEU A 1 26  ? 4.817   82.384  8.388   0.25 13.06 ? 26  LEU A C   1 
ATOM   105   O  O   . LEU A 1 26  ? 5.664   81.554  8.046   0.25 12.76 ? 26  LEU A O   1 
ATOM   106   C  CB  . LEU A 1 26  ? 5.710   84.617  8.991   0.25 11.75 ? 26  LEU A CB  1 
ATOM   107   C  CG  . LEU A 1 26  ? 6.464   85.881  8.572   0.25 10.43 ? 26  LEU A CG  1 
ATOM   108   C  CD1 . LEU A 1 26  ? 7.081   86.539  9.797   0.25 10.19 ? 26  LEU A CD1 1 
ATOM   109   C  CD2 . LEU A 1 26  ? 7.549   85.519  7.566   0.25 10.74 ? 26  LEU A CD2 1 
ATOM   110   N  N   . LEU A 1 27  ? 3.770   82.095  9.157   0.25 12.60 ? 27  LEU A N   1 
ATOM   111   C  CA  . LEU A 1 27  ? 3.523   80.761  9.704   0.25 14.29 ? 27  LEU A CA  1 
ATOM   112   C  C   . LEU A 1 27  ? 2.719   79.905  8.734   0.25 13.56 ? 27  LEU A C   1 
ATOM   113   O  O   . LEU A 1 27  ? 1.579   80.230  8.398   0.25 11.70 ? 27  LEU A O   1 
ATOM   114   C  CB  . LEU A 1 27  ? 2.778   80.877  11.040  0.25 11.72 ? 27  LEU A CB  1 
ATOM   115   C  CG  . LEU A 1 27  ? 2.495   79.582  11.813  0.25 12.88 ? 27  LEU A CG  1 
ATOM   116   C  CD1 . LEU A 1 27  ? 3.810   78.908  12.192  0.25 12.71 ? 27  LEU A CD1 1 
ATOM   117   C  CD2 . LEU A 1 27  ? 1.685   79.903  13.061  0.25 13.40 ? 27  LEU A CD2 1 
ATOM   118   N  N   . THR A 1 28  ? 3.323   78.808  8.295   0.25 14.89 ? 28  THR A N   1 
ATOM   119   C  CA  . THR A 1 28  ? 2.701   77.891  7.341   0.25 16.16 ? 28  THR A CA  1 
ATOM   120   C  C   . THR A 1 28  ? 1.314   77.431  7.757   0.25 16.36 ? 28  THR A C   1 
ATOM   121   O  O   . THR A 1 28  ? 0.389   77.406  6.945   0.25 15.18 ? 28  THR A O   1 
ATOM   122   C  CB  . THR A 1 28  ? 3.577   76.653  7.137   0.25 16.10 ? 28  THR A CB  1 
ATOM   123   O  OG1 . THR A 1 28  ? 4.895   77.070  6.775   0.25 13.14 ? 28  THR A OG1 1 
ATOM   124   C  CG2 . THR A 1 28  ? 3.012   75.770  6.030   0.25 16.98 ? 28  THR A CG2 1 
ATOM   125   N  N   . GLU A 1 29  ? 1.180   77.056  9.024   0.25 17.71 ? 29  GLU A N   1 
ATOM   126   C  CA  . GLU A 1 29  ? -0.096  76.597  9.547   0.25 19.96 ? 29  GLU A CA  1 
ATOM   127   C  C   . GLU A 1 29  ? -1.153  77.689  9.425   0.25 19.84 ? 29  GLU A C   1 
ATOM   128   O  O   . GLU A 1 29  ? -2.327  77.402  9.177   0.25 19.34 ? 29  GLU A O   1 
ATOM   129   C  CB  . GLU A 1 29  ? 0.047   76.183  11.016  0.25 21.83 ? 29  GLU A CB  1 
ATOM   130   C  CG  . GLU A 1 29  ? 0.844   74.902  11.243  0.25 26.99 ? 29  GLU A CG  1 
ATOM   131   C  CD  . GLU A 1 29  ? 2.266   74.977  10.710  0.25 28.03 ? 29  GLU A CD  1 
ATOM   132   O  OE1 . GLU A 1 29  ? 2.953   75.990  10.958  0.25 26.26 ? 29  GLU A OE1 1 
ATOM   133   O  OE2 . GLU A 1 29  ? 2.700   74.009  10.049  0.25 30.48 ? 29  GLU A OE2 1 
ATOM   134   N  N   . ARG A 1 30  ? -0.736  78.939  9.605   0.25 17.80 ? 30  ARG A N   1 
ATOM   135   C  CA  . ARG A 1 30  ? -1.661  80.059  9.508   0.25 18.18 ? 30  ARG A CA  1 
ATOM   136   C  C   . ARG A 1 30  ? -2.102  80.309  8.069   0.25 16.40 ? 30  ARG A C   1 
ATOM   137   O  O   . ARG A 1 30  ? -3.287  80.239  7.763   0.25 16.78 ? 30  ARG A O   1 
ATOM   138   C  CB  . ARG A 1 30  ? -1.030  81.329  10.090  0.25 21.03 ? 30  ARG A CB  1 
ATOM   139   C  CG  . ARG A 1 30  ? -1.779  82.612  9.735   0.25 22.63 ? 30  ARG A CG  1 
ATOM   140   C  CD  . ARG A 1 30  ? -3.191  82.621  10.290  0.25 26.88 ? 30  ARG A CD  1 
ATOM   141   N  NE  . ARG A 1 30  ? -3.938  83.788  9.830   0.25 27.92 ? 30  ARG A NE  1 
ATOM   142   C  CZ  . ARG A 1 30  ? -5.157  84.119  10.252  0.25 30.15 ? 30  ARG A CZ  1 
ATOM   143   N  NH1 . ARG A 1 30  ? -5.785  83.372  11.154  0.25 28.67 ? 30  ARG A NH1 1 
ATOM   144   N  NH2 . ARG A 1 30  ? -5.750  85.203  9.770   0.25 30.28 ? 30  ARG A NH2 1 
ATOM   145   N  N   . ILE A 1 31  ? -1.155  80.600  7.182   0.25 14.96 ? 31  ILE A N   1 
ATOM   146   C  CA  . ILE A 1 31  ? -1.513  80.858  5.793   0.25 13.64 ? 31  ILE A CA  1 
ATOM   147   C  C   . ILE A 1 31  ? -2.299  79.695  5.185   0.25 14.47 ? 31  ILE A C   1 
ATOM   148   O  O   . ILE A 1 31  ? -3.083  79.889  4.256   0.25 14.94 ? 31  ILE A O   1 
ATOM   149   C  CB  . ILE A 1 31  ? -0.260  81.146  4.920   0.25 14.15 ? 31  ILE A CB  1 
ATOM   150   C  CG1 . ILE A 1 31  ? -0.693  81.561  3.509   0.25 13.18 ? 31  ILE A CG1 1 
ATOM   151   C  CG2 . ILE A 1 31  ? 0.638   79.929  4.868   0.25 13.21 ? 31  ILE A CG2 1 
ATOM   152   C  CD1 . ILE A 1 31  ? 0.466   81.917  2.585   0.25 8.94  ? 31  ILE A CD1 1 
ATOM   153   N  N   . HIS A 1 32  ? -2.103  78.491  5.715   0.25 14.73 ? 32  HIS A N   1 
ATOM   154   C  CA  . HIS A 1 32  ? -2.810  77.323  5.197   0.25 15.49 ? 32  HIS A CA  1 
ATOM   155   C  C   . HIS A 1 32  ? -4.290  77.265  5.572   0.25 16.70 ? 32  HIS A C   1 
ATOM   156   O  O   . HIS A 1 32  ? -5.075  76.586  4.904   0.25 16.67 ? 32  HIS A O   1 
ATOM   157   C  CB  . HIS A 1 32  ? -2.100  76.036  5.634   0.25 16.01 ? 32  HIS A CB  1 
ATOM   158   C  CG  . HIS A 1 32  ? -0.977  75.635  4.726   0.25 17.62 ? 32  HIS A CG  1 
ATOM   159   N  ND1 . HIS A 1 32  ? -0.167  74.547  4.973   0.25 15.23 ? 32  HIS A ND1 1 
ATOM   160   C  CD2 . HIS A 1 32  ? -0.548  76.165  3.556   0.25 16.05 ? 32  HIS A CD2 1 
ATOM   161   C  CE1 . HIS A 1 32  ? 0.712   74.424  3.993   0.25 17.60 ? 32  HIS A CE1 1 
ATOM   162   N  NE2 . HIS A 1 32  ? 0.503   75.392  3.121   0.25 20.04 ? 32  HIS A NE2 1 
ATOM   163   N  N   . LEU A 1 33  ? -4.676  77.975  6.629   0.25 17.69 ? 33  LEU A N   1 
ATOM   164   C  CA  . LEU A 1 33  ? -6.076  77.992  7.049   0.25 20.26 ? 33  LEU A CA  1 
ATOM   165   C  C   . LEU A 1 33  ? -6.953  78.306  5.840   0.25 19.38 ? 33  LEU A C   1 
ATOM   166   O  O   . LEU A 1 33  ? -7.782  77.491  5.431   0.25 20.16 ? 33  LEU A O   1 
ATOM   167   C  CB  . LEU A 1 33  ? -6.304  79.055  8.130   0.25 21.91 ? 33  LEU A CB  1 
ATOM   168   C  CG  . LEU A 1 33  ? -5.604  78.868  9.479   0.25 25.64 ? 33  LEU A CG  1 
ATOM   169   C  CD1 . LEU A 1 33  ? -5.887  80.067  10.372  0.25 27.06 ? 33  LEU A CD1 1 
ATOM   170   C  CD2 . LEU A 1 33  ? -6.093  77.584  10.140  0.25 27.24 ? 33  LEU A CD2 1 
ATOM   171   N  N   . ARG A 1 34  ? -6.762  79.493  5.271   0.25 18.58 ? 34  ARG A N   1 
ATOM   172   C  CA  . ARG A 1 34  ? -7.527  79.918  4.102   0.25 18.36 ? 34  ARG A CA  1 
ATOM   173   C  C   . ARG A 1 34  ? -6.873  79.457  2.802   0.25 18.34 ? 34  ARG A C   1 
ATOM   174   O  O   . ARG A 1 34  ? -7.562  79.136  1.834   0.25 17.21 ? 34  ARG A O   1 
ATOM   175   C  CB  . ARG A 1 34  ? -7.661  81.447  4.072   0.25 20.65 ? 34  ARG A CB  1 
ATOM   176   C  CG  . ARG A 1 34  ? -8.650  82.036  5.075   0.25 23.36 ? 34  ARG A CG  1 
ATOM   177   C  CD  . ARG A 1 34  ? -10.074 81.583  4.779   0.25 26.09 ? 34  ARG A CD  1 
ATOM   178   N  NE  . ARG A 1 34  ? -10.514 81.952  3.433   0.25 27.05 ? 34  ARG A NE  1 
ATOM   179   C  CZ  . ARG A 1 34  ? -10.889 83.173  3.062   0.25 26.77 ? 34  ARG A CZ  1 
ATOM   180   N  NH1 . ARG A 1 34  ? -10.886 84.170  3.935   0.25 27.51 ? 34  ARG A NH1 1 
ATOM   181   N  NH2 . ARG A 1 34  ? -11.273 83.395  1.813   0.25 29.54 ? 34  ARG A NH2 1 
ATOM   182   N  N   . ASN A 1 35  ? -5.542  79.429  2.778   0.25 15.27 ? 35  ASN A N   1 
ATOM   183   C  CA  . ASN A 1 35  ? -4.809  79.037  1.574   0.25 16.38 ? 35  ASN A CA  1 
ATOM   184   C  C   . ASN A 1 35  ? -4.032  77.755  1.829   0.25 17.64 ? 35  ASN A C   1 
ATOM   185   O  O   . ASN A 1 35  ? -2.802  77.771  1.921   0.25 16.32 ? 35  ASN A O   1 
ATOM   186   C  CB  . ASN A 1 35  ? -3.837  80.146  1.183   0.25 15.55 ? 35  ASN A CB  1 
ATOM   187   C  CG  . ASN A 1 35  ? -4.469  81.514  1.261   0.25 14.81 ? 35  ASN A CG  1 
ATOM   188   O  OD1 . ASN A 1 35  ? -5.258  81.894  0.401   0.25 14.22 ? 35  ASN A OD1 1 
ATOM   189   N  ND2 . ASN A 1 35  ? -4.137  82.260  2.310   0.25 13.13 ? 35  ASN A ND2 1 
ATOM   190   N  N   . PRO A 1 36  ? -4.741  76.622  1.938   0.25 17.67 ? 36  PRO A N   1 
ATOM   191   C  CA  . PRO A 1 36  ? -4.082  75.342  2.188   0.25 17.45 ? 36  PRO A CA  1 
ATOM   192   C  C   . PRO A 1 36  ? -3.224  74.818  1.042   0.25 16.81 ? 36  PRO A C   1 
ATOM   193   O  O   . PRO A 1 36  ? -2.508  73.837  1.213   0.25 20.42 ? 36  PRO A O   1 
ATOM   194   C  CB  . PRO A 1 36  ? -5.251  74.418  2.524   0.25 17.04 ? 36  PRO A CB  1 
ATOM   195   C  CG  . PRO A 1 36  ? -6.351  74.960  1.673   0.25 17.17 ? 36  PRO A CG  1 
ATOM   196   C  CD  . PRO A 1 36  ? -6.204  76.455  1.875   0.25 18.04 ? 36  PRO A CD  1 
ATOM   197   N  N   . SER A 1 37  ? -3.281  75.463  -0.121  0.25 18.99 ? 37  SER A N   1 
ATOM   198   C  CA  . SER A 1 37  ? -2.480  75.007  -1.258  0.25 18.45 ? 37  SER A CA  1 
ATOM   199   C  C   . SER A 1 37  ? -1.214  75.839  -1.473  0.25 18.63 ? 37  SER A C   1 
ATOM   200   O  O   . SER A 1 37  ? -0.450  75.584  -2.406  0.25 18.37 ? 37  SER A O   1 
ATOM   201   C  CB  . SER A 1 37  ? -3.313  75.002  -2.548  0.25 20.93 ? 37  SER A CB  1 
ATOM   202   O  OG  . SER A 1 37  ? -3.487  76.309  -3.063  0.25 21.64 ? 37  SER A OG  1 
ATOM   203   N  N   . ALA A 1 38  ? -0.988  76.829  -0.611  0.25 17.15 ? 38  ALA A N   1 
ATOM   204   C  CA  . ALA A 1 38  ? 0.196   77.679  -0.729  0.25 15.78 ? 38  ALA A CA  1 
ATOM   205   C  C   . ALA A 1 38  ? 1.457   76.838  -0.558  0.25 15.92 ? 38  ALA A C   1 
ATOM   206   O  O   . ALA A 1 38  ? 1.509   75.956  0.301   0.25 17.57 ? 38  ALA A O   1 
ATOM   207   C  CB  . ALA A 1 38  ? 0.160   78.785  0.322   0.25 16.05 ? 38  ALA A CB  1 
ATOM   208   N  N   . ALA A 1 39  ? 2.469   77.116  -1.377  0.25 14.09 ? 39  ALA A N   1 
ATOM   209   C  CA  . ALA A 1 39  ? 3.727   76.384  -1.319  0.25 13.67 ? 39  ALA A CA  1 
ATOM   210   C  C   . ALA A 1 39  ? 4.896   77.303  -1.002  0.25 14.43 ? 39  ALA A C   1 
ATOM   211   O  O   . ALA A 1 39  ? 5.095   78.331  -1.660  0.25 14.74 ? 39  ALA A O   1 
ATOM   212   C  CB  . ALA A 1 39  ? 3.979   75.663  -2.650  0.25 12.76 ? 39  ALA A CB  1 
ATOM   213   N  N   . PHE A 1 40  ? 5.664   76.938  0.020   0.25 14.05 ? 40  PHE A N   1 
ATOM   214   C  CA  . PHE A 1 40  ? 6.832   77.724  0.406   0.25 13.20 ? 40  PHE A CA  1 
ATOM   215   C  C   . PHE A 1 40  ? 7.697   77.858  -0.836  0.25 14.54 ? 40  PHE A C   1 
ATOM   216   O  O   . PHE A 1 40  ? 7.938   76.873  -1.540  0.25 13.66 ? 40  PHE A O   1 
ATOM   217   C  CB  . PHE A 1 40  ? 7.628   77.006  1.504   0.25 13.54 ? 40  PHE A CB  1 
ATOM   218   C  CG  . PHE A 1 40  ? 8.940   77.674  1.843   0.25 15.03 ? 40  PHE A CG  1 
ATOM   219   C  CD1 . PHE A 1 40  ? 8.984   78.761  2.709   0.25 12.81 ? 40  PHE A CD1 1 
ATOM   220   C  CD2 . PHE A 1 40  ? 10.129  77.227  1.273   0.25 13.21 ? 40  PHE A CD2 1 
ATOM   221   C  CE1 . PHE A 1 40  ? 10.195  79.400  3.005   0.25 15.07 ? 40  PHE A CE1 1 
ATOM   222   C  CE2 . PHE A 1 40  ? 11.344  77.855  1.560   0.25 16.23 ? 40  PHE A CE2 1 
ATOM   223   C  CZ  . PHE A 1 40  ? 11.376  78.945  2.428   0.25 13.94 ? 40  PHE A CZ  1 
ATOM   224   N  N   . PHE A 1 41  ? 8.156   79.073  -1.113  0.25 13.99 ? 41  PHE A N   1 
ATOM   225   C  CA  . PHE A 1 41  ? 8.993   79.296  -2.277  0.25 15.68 ? 41  PHE A CA  1 
ATOM   226   C  C   . PHE A 1 41  ? 10.394  79.660  -1.814  0.25 15.09 ? 41  PHE A C   1 
ATOM   227   O  O   . PHE A 1 41  ? 11.371  79.046  -2.242  0.25 14.75 ? 41  PHE A O   1 
ATOM   228   C  CB  . PHE A 1 41  ? 8.421   80.411  -3.151  0.25 15.84 ? 41  PHE A CB  1 
ATOM   229   C  CG  . PHE A 1 41  ? 9.044   80.484  -4.509  0.25 14.95 ? 41  PHE A CG  1 
ATOM   230   C  CD1 . PHE A 1 41  ? 8.820   79.479  -5.442  0.25 18.23 ? 41  PHE A CD1 1 
ATOM   231   C  CD2 . PHE A 1 41  ? 9.866   81.546  -4.854  0.25 14.84 ? 41  PHE A CD2 1 
ATOM   232   C  CE1 . PHE A 1 41  ? 9.407   79.529  -6.707  0.25 18.93 ? 41  PHE A CE1 1 
ATOM   233   C  CE2 . PHE A 1 41  ? 10.458  81.608  -6.114  0.25 18.29 ? 41  PHE A CE2 1 
ATOM   234   C  CZ  . PHE A 1 41  ? 10.229  80.597  -7.042  0.25 18.39 ? 41  PHE A CZ  1 
ATOM   235   N  N   . CYS A 1 42  ? 10.494  80.653  -0.934  0.25 13.78 ? 42  CYS A N   1 
ATOM   236   C  CA  . CYS A 1 42  ? 11.799  81.052  -0.414  0.25 13.30 ? 42  CYS A CA  1 
ATOM   237   C  C   . CYS A 1 42  ? 11.716  82.171  0.611   0.25 14.58 ? 42  CYS A C   1 
ATOM   238   O  O   . CYS A 1 42  ? 10.683  82.826  0.762   0.25 12.66 ? 42  CYS A O   1 
ATOM   239   C  CB  . CYS A 1 42  ? 12.720  81.496  -1.556  0.25 14.43 ? 42  CYS A CB  1 
ATOM   240   S  SG  . CYS A 1 42  ? 12.268  83.069  -2.313  0.25 19.43 ? 42  CYS A SG  1 
ATOM   241   N  N   . VAL A 1 43  ? 12.813  82.370  1.332   0.25 13.39 ? 43  VAL A N   1 
ATOM   242   C  CA  . VAL A 1 43  ? 12.902  83.437  2.318   0.25 13.08 ? 43  VAL A CA  1 
ATOM   243   C  C   . VAL A 1 43  ? 13.596  84.584  1.586   0.25 12.60 ? 43  VAL A C   1 
ATOM   244   O  O   . VAL A 1 43  ? 14.511  84.344  0.801   0.25 13.38 ? 43  VAL A O   1 
ATOM   245   C  CB  . VAL A 1 43  ? 13.754  83.007  3.529   0.25 14.60 ? 43  VAL A CB  1 
ATOM   246   C  CG1 . VAL A 1 43  ? 14.116  84.217  4.357   0.25 12.64 ? 43  VAL A CG1 1 
ATOM   247   C  CG2 . VAL A 1 43  ? 12.986  81.984  4.367   0.25 12.46 ? 43  VAL A CG2 1 
ATOM   248   N  N   . ALA A 1 44  ? 13.174  85.819  1.843   0.25 10.20 ? 44  ALA A N   1 
ATOM   249   C  CA  . ALA A 1 44  ? 13.767  86.971  1.163   0.25 12.74 ? 44  ALA A CA  1 
ATOM   250   C  C   . ALA A 1 44  ? 13.753  88.247  1.995   0.25 12.47 ? 44  ALA A C   1 
ATOM   251   O  O   . ALA A 1 44  ? 13.004  88.362  2.964   0.25 11.93 ? 44  ALA A O   1 
ATOM   252   C  CB  . ALA A 1 44  ? 13.044  87.215  -0.156  0.25 10.02 ? 44  ALA A CB  1 
ATOM   253   N  N   . ARG A 1 45  ? 14.571  89.213  1.584   0.25 14.23 ? 45  ARG A N   1 
ATOM   254   C  CA  . ARG A 1 45  ? 14.682  90.490  2.284   0.25 16.07 ? 45  ARG A CA  1 
ATOM   255   C  C   . ARG A 1 45  ? 14.128  91.660  1.471   0.25 13.52 ? 45  ARG A C   1 
ATOM   256   O  O   . ARG A 1 45  ? 14.311  91.722  0.257   0.25 12.91 ? 45  ARG A O   1 
ATOM   257   C  CB  . ARG A 1 45  ? 16.153  90.776  2.619   0.25 17.96 ? 45  ARG A CB  1 
ATOM   258   C  CG  . ARG A 1 45  ? 16.357  92.027  3.464   0.25 24.99 ? 45  ARG A CG  1 
ATOM   259   C  CD  . ARG A 1 45  ? 17.827  92.434  3.573   0.25 32.22 ? 45  ARG A CD  1 
ATOM   260   N  NE  . ARG A 1 45  ? 18.357  92.925  2.305   0.25 40.83 ? 45  ARG A NE  1 
ATOM   261   C  CZ  . ARG A 1 45  ? 19.554  93.485  2.158   0.25 45.05 ? 45  ARG A CZ  1 
ATOM   262   N  NH1 . ARG A 1 45  ? 20.357  93.629  3.205   0.25 49.31 ? 45  ARG A NH1 1 
ATOM   263   N  NH2 . ARG A 1 45  ? 19.952  93.903  0.964   0.25 47.82 ? 45  ARG A NH2 1 
ATOM   264   N  N   . LEU A 1 46  ? 13.448  92.581  2.151   0.25 12.74 ? 46  LEU A N   1 
ATOM   265   C  CA  . LEU A 1 46  ? 12.894  93.775  1.517   0.25 12.78 ? 46  LEU A CA  1 
ATOM   266   C  C   . LEU A 1 46  ? 13.609  94.985  2.109   0.25 13.87 ? 46  LEU A C   1 
ATOM   267   O  O   . LEU A 1 46  ? 13.314  95.409  3.228   0.25 14.45 ? 46  LEU A O   1 
ATOM   268   C  CB  . LEU A 1 46  ? 11.386  93.889  1.776   0.25 11.68 ? 46  LEU A CB  1 
ATOM   269   C  CG  . LEU A 1 46  ? 10.708  95.166  1.265   0.25 10.82 ? 46  LEU A CG  1 
ATOM   270   C  CD1 . LEU A 1 46  ? 11.061  95.405  -0.194  0.25 13.14 ? 46  LEU A CD1 1 
ATOM   271   C  CD2 . LEU A 1 46  ? 9.194   95.049  1.437   0.25 12.70 ? 46  LEU A CD2 1 
ATOM   272   N  N   . GLN A 1 47  ? 14.548  95.540  1.351   0.25 14.96 ? 47  GLN A N   1 
ATOM   273   C  CA  . GLN A 1 47  ? 15.326  96.685  1.814   0.25 14.59 ? 47  GLN A CA  1 
ATOM   274   C  C   . GLN A 1 47  ? 14.569  98.003  1.723   0.25 13.66 ? 47  GLN A C   1 
ATOM   275   O  O   . GLN A 1 47  ? 13.624  98.146  0.948   0.25 12.44 ? 47  GLN A O   1 
ATOM   276   C  CB  . GLN A 1 47  ? 16.622  96.782  1.007   0.25 15.41 ? 47  GLN A CB  1 
ATOM   277   C  CG  . GLN A 1 47  ? 17.570  97.891  1.439   0.25 16.12 ? 47  GLN A CG  1 
ATOM   278   C  CD  . GLN A 1 47  ? 18.119  97.706  2.849   0.25 16.56 ? 47  GLN A CD  1 
ATOM   279   O  OE1 . GLN A 1 47  ? 18.569  96.622  3.218   0.25 19.21 ? 47  GLN A OE1 1 
ATOM   280   N  NE2 . GLN A 1 47  ? 18.099  98.774  3.635   0.25 13.32 ? 47  GLN A NE2 1 
ATOM   281   N  N   . ASP A 1 48  ? 14.998  98.961  2.536   0.25 13.83 ? 48  ASP A N   1 
ATOM   282   C  CA  . ASP A 1 48  ? 14.405  100.286 2.569   0.25 12.58 ? 48  ASP A CA  1 
ATOM   283   C  C   . ASP A 1 48  ? 12.933  100.298 2.967   0.25 11.89 ? 48  ASP A C   1 
ATOM   284   O  O   . ASP A 1 48  ? 12.215  101.257 2.690   0.25 12.82 ? 48  ASP A O   1 
ATOM   285   C  CB  . ASP A 1 48  ? 14.623  100.990 1.221   0.25 14.48 ? 48  ASP A CB  1 
ATOM   286   C  CG  . ASP A 1 48  ? 16.042  101.535 1.072   0.25 18.35 ? 48  ASP A CG  1 
ATOM   287   O  OD1 . ASP A 1 48  ? 17.005  100.801 1.388   0.25 22.10 ? 48  ASP A OD1 1 
ATOM   288   O  OD2 . ASP A 1 48  ? 16.199  102.694 0.635   0.25 20.56 ? 48  ASP A OD2 1 
ATOM   289   N  N   . PHE A 1 49  ? 12.493  99.221  3.616   0.25 10.87 ? 49  PHE A N   1 
ATOM   290   C  CA  . PHE A 1 49  ? 11.130  99.114  4.129   0.25 10.79 ? 49  PHE A CA  1 
ATOM   291   C  C   . PHE A 1 49  ? 11.243  98.749  5.598   0.25 11.11 ? 49  PHE A C   1 
ATOM   292   O  O   . PHE A 1 49  ? 12.037  97.880  5.968   0.25 11.39 ? 49  PHE A O   1 
ATOM   293   C  CB  . PHE A 1 49  ? 10.325  98.028  3.414   0.25 11.26 ? 49  PHE A CB  1 
ATOM   294   C  CG  . PHE A 1 49  ? 9.517   98.532  2.257   0.25 10.82 ? 49  PHE A CG  1 
ATOM   295   C  CD1 . PHE A 1 49  ? 9.979   98.392  0.953   0.25 11.52 ? 49  PHE A CD1 1 
ATOM   296   C  CD2 . PHE A 1 49  ? 8.286   99.140  2.471   0.25 9.75  ? 49  PHE A CD2 1 
ATOM   297   C  CE1 . PHE A 1 49  ? 9.226   98.847  -0.125  0.25 10.94 ? 49  PHE A CE1 1 
ATOM   298   C  CE2 . PHE A 1 49  ? 7.523   99.602  1.402   0.25 9.91  ? 49  PHE A CE2 1 
ATOM   299   C  CZ  . PHE A 1 49  ? 7.993   99.454  0.100   0.25 9.72  ? 49  PHE A CZ  1 
ATOM   300   N  N   . LYS A 1 50  ? 10.463  99.431  6.432   0.25 11.36 ? 50  LYS A N   1 
ATOM   301   C  CA  . LYS A 1 50  ? 10.463  99.183  7.868   0.25 12.13 ? 50  LYS A CA  1 
ATOM   302   C  C   . LYS A 1 50  ? 9.137   98.558  8.268   0.25 12.12 ? 50  LYS A C   1 
ATOM   303   O  O   . LYS A 1 50  ? 8.093   98.901  7.716   0.25 10.98 ? 50  LYS A O   1 
ATOM   304   C  CB  . LYS A 1 50  ? 10.659  100.495 8.634   0.25 13.06 ? 50  LYS A CB  1 
ATOM   305   C  CG  . LYS A 1 50  ? 10.550  100.366 10.153  0.25 20.22 ? 50  LYS A CG  1 
ATOM   306   C  CD  . LYS A 1 50  ? 10.723  101.724 10.825  0.25 25.50 ? 50  LYS A CD  1 
ATOM   307   C  CE  . LYS A 1 50  ? 10.744  101.607 12.343  0.25 29.33 ? 50  LYS A CE  1 
ATOM   308   N  NZ  . LYS A 1 50  ? 11.916  100.829 12.832  0.25 32.02 ? 50  LYS A NZ  1 
ATOM   309   N  N   . LEU A 1 51  ? 9.185   97.631  9.220   0.25 10.37 ? 51  LEU A N   1 
ATOM   310   C  CA  . LEU A 1 51  ? 7.977   96.977  9.712   0.25 11.19 ? 51  LEU A CA  1 
ATOM   311   C  C   . LEU A 1 51  ? 7.313   97.888  10.743  0.25 11.89 ? 51  LEU A C   1 
ATOM   312   O  O   . LEU A 1 51  ? 7.933   98.821  11.252  0.25 12.62 ? 51  LEU A O   1 
ATOM   313   C  CB  . LEU A 1 51  ? 8.326   95.642  10.374  0.25 10.76 ? 51  LEU A CB  1 
ATOM   314   C  CG  . LEU A 1 51  ? 7.173   94.816  10.949  0.25 11.73 ? 51  LEU A CG  1 
ATOM   315   C  CD1 . LEU A 1 51  ? 6.334   94.245  9.807   0.25 8.77  ? 51  LEU A CD1 1 
ATOM   316   C  CD2 . LEU A 1 51  ? 7.738   93.683  11.810  0.25 10.98 ? 51  LEU A CD2 1 
ATOM   317   N  N   . ASP A 1 52  ? 6.049   97.610  11.039  0.25 12.04 ? 52  ASP A N   1 
ATOM   318   C  CA  . ASP A 1 52  ? 5.290   98.372  12.020  0.25 11.78 ? 52  ASP A CA  1 
ATOM   319   C  C   . ASP A 1 52  ? 3.922   97.719  12.163  0.25 12.09 ? 52  ASP A C   1 
ATOM   320   O  O   . ASP A 1 52  ? 3.569   96.841  11.377  0.25 10.79 ? 52  ASP A O   1 
ATOM   321   C  CB  . ASP A 1 52  ? 5.144   99.831  11.572  0.25 13.00 ? 52  ASP A CB  1 
ATOM   322   C  CG  . ASP A 1 52  ? 4.387   100.682 12.584  0.25 14.10 ? 52  ASP A CG  1 
ATOM   323   O  OD1 . ASP A 1 52  ? 4.500   100.409 13.800  0.25 8.82  ? 52  ASP A OD1 1 
ATOM   324   O  OD2 . ASP A 1 52  ? 3.687   101.630 12.164  0.25 14.93 ? 52  ASP A OD2 1 
ATOM   325   N  N   . PHE A 1 53  ? 3.165   98.124  13.176  0.25 10.53 ? 53  PHE A N   1 
ATOM   326   C  CA  . PHE A 1 53  ? 1.830   97.576  13.390  0.25 10.27 ? 53  PHE A CA  1 
ATOM   327   C  C   . PHE A 1 53  ? 0.855   98.710  13.646  0.25 10.19 ? 53  PHE A C   1 
ATOM   328   O  O   . PHE A 1 53  ? 1.251   99.787  14.090  0.25 6.61  ? 53  PHE A O   1 
ATOM   329   C  CB  . PHE A 1 53  ? 1.826   96.611  14.576  0.25 11.28 ? 53  PHE A CB  1 
ATOM   330   C  CG  . PHE A 1 53  ? 2.774   95.462  14.413  0.25 11.12 ? 53  PHE A CG  1 
ATOM   331   C  CD1 . PHE A 1 53  ? 4.143   95.640  14.604  0.25 11.35 ? 53  PHE A CD1 1 
ATOM   332   C  CD2 . PHE A 1 53  ? 2.307   94.211  14.026  0.25 10.20 ? 53  PHE A CD2 1 
ATOM   333   C  CE1 . PHE A 1 53  ? 5.032   94.588  14.409  0.25 12.48 ? 53  PHE A CE1 1 
ATOM   334   C  CE2 . PHE A 1 53  ? 3.189   93.149  13.827  0.25 9.95  ? 53  PHE A CE2 1 
ATOM   335   C  CZ  . PHE A 1 53  ? 4.555   93.339  14.019  0.25 12.58 ? 53  PHE A CZ  1 
ATOM   336   N  N   . GLY A 1 54  ? -0.424  98.479  13.368  0.25 11.27 ? 54  GLY A N   1 
ATOM   337   C  CA  . GLY A 1 54  ? -1.381  99.545  13.587  0.25 12.40 ? 54  GLY A CA  1 
ATOM   338   C  C   . GLY A 1 54  ? -2.833  99.216  13.333  0.25 13.34 ? 54  GLY A C   1 
ATOM   339   O  O   . GLY A 1 54  ? -3.192  98.096  12.953  0.25 13.88 ? 54  GLY A O   1 
ATOM   340   N  N   . ASN A 1 55  ? -3.673  100.220 13.554  0.25 13.30 ? 55  ASN A N   1 
ATOM   341   C  CA  . ASN A 1 55  ? -5.107  100.089 13.371  0.25 15.76 ? 55  ASN A CA  1 
ATOM   342   C  C   . ASN A 1 55  ? -5.548  100.768 12.079  0.25 16.51 ? 55  ASN A C   1 
ATOM   343   O  O   . ASN A 1 55  ? -5.472  101.993 11.956  0.25 14.28 ? 55  ASN A O   1 
ATOM   344   C  CB  . ASN A 1 55  ? -5.843  100.720 14.565  0.25 13.50 ? 55  ASN A CB  1 
ATOM   345   C  CG  . ASN A 1 55  ? -5.584  99.981  15.872  0.25 16.19 ? 55  ASN A CG  1 
ATOM   346   O  OD1 . ASN A 1 55  ? -5.718  98.760  15.945  0.25 13.37 ? 55  ASN A OD1 1 
ATOM   347   N  ND2 . ASN A 1 55  ? -5.224  100.725 16.912  0.25 14.40 ? 55  ASN A ND2 1 
ATOM   348   N  N   . SER A 1 56  ? -6.000  99.968  11.118  0.25 18.87 ? 56  SER A N   1 
ATOM   349   C  CA  . SER A 1 56  ? -6.470  100.491 9.840   0.25 23.04 ? 56  SER A CA  1 
ATOM   350   C  C   . SER A 1 56  ? -7.616  101.473 10.046  0.25 24.55 ? 56  SER A C   1 
ATOM   351   O  O   . SER A 1 56  ? -8.573  101.172 10.755  0.25 23.98 ? 56  SER A O   1 
ATOM   352   C  CB  . SER A 1 56  ? -6.956  99.356  8.944   0.25 23.21 ? 56  SER A CB  1 
ATOM   353   O  OG  . SER A 1 56  ? -7.716  99.871  7.863   0.25 24.87 ? 56  SER A OG  1 
ATOM   354   N  N   . GLN A 1 57  ? -7.518  102.637 9.413   0.25 26.55 ? 57  GLN A N   1 
ATOM   355   C  CA  . GLN A 1 57  ? -8.544  103.669 9.528   0.25 29.33 ? 57  GLN A CA  1 
ATOM   356   C  C   . GLN A 1 57  ? -8.955  103.847 10.992  0.25 29.66 ? 57  GLN A C   1 
ATOM   357   O  O   . GLN A 1 57  ? -10.112 104.146 11.284  0.25 28.22 ? 57  GLN A O   1 
ATOM   358   C  CB  . GLN A 1 57  ? -9.784  103.303 8.698   0.25 31.92 ? 57  GLN A CB  1 
ATOM   359   C  CG  . GLN A 1 57  ? -9.529  102.923 7.237   0.25 34.62 ? 57  GLN A CG  1 
ATOM   360   C  CD  . GLN A 1 57  ? -8.974  104.064 6.395   0.25 36.37 ? 57  GLN A CD  1 
ATOM   361   O  OE1 . GLN A 1 57  ? -9.500  105.176 6.405   0.25 35.32 ? 57  GLN A OE1 1 
ATOM   362   N  NE2 . GLN A 1 57  ? -7.912  103.783 5.648   0.25 39.02 ? 57  GLN A NE2 1 
ATOM   363   N  N   . GLY A 1 58  ? -8.007  103.648 11.906  0.25 29.30 ? 58  GLY A N   1 
ATOM   364   C  CA  . GLY A 1 58  ? -8.288  103.799 13.323  0.25 28.13 ? 58  GLY A CA  1 
ATOM   365   C  C   . GLY A 1 58  ? -9.057  102.660 13.970  0.25 28.40 ? 58  GLY A C   1 
ATOM   366   O  O   . GLY A 1 58  ? -9.327  102.696 15.169  0.25 29.28 ? 58  GLY A O   1 
ATOM   367   N  N   . LYS A 1 59  ? -9.411  101.648 13.187  0.25 27.76 ? 59  LYS A N   1 
ATOM   368   C  CA  . LYS A 1 59  ? -10.161 100.505 13.702  0.25 28.87 ? 59  LYS A CA  1 
ATOM   369   C  C   . LYS A 1 59  ? -9.243  99.438  14.289  0.25 26.76 ? 59  LYS A C   1 
ATOM   370   O  O   . LYS A 1 59  ? -8.158  99.189  13.767  0.25 24.45 ? 59  LYS A O   1 
ATOM   371   C  CB  . LYS A 1 59  ? -10.997 99.869  12.588  0.25 31.72 ? 59  LYS A CB  1 
ATOM   372   C  CG  . LYS A 1 59  ? -12.028 100.782 11.955  0.25 36.29 ? 59  LYS A CG  1 
ATOM   373   C  CD  . LYS A 1 59  ? -12.805 100.030 10.879  0.25 39.97 ? 59  LYS A CD  1 
ATOM   374   C  CE  . LYS A 1 59  ? -13.841 100.915 10.209  0.25 41.92 ? 59  LYS A CE  1 
ATOM   375   N  NZ  . LYS A 1 59  ? -14.592 100.176 9.158   0.25 44.57 ? 59  LYS A NZ  1 
ATOM   376   N  N   . THR A 1 60  ? -9.687  98.810  15.373  0.25 25.79 ? 60  THR A N   1 
ATOM   377   C  CA  . THR A 1 60  ? -8.911  97.756  16.018  0.25 24.81 ? 60  THR A CA  1 
ATOM   378   C  C   . THR A 1 60  ? -9.426  96.381  15.603  0.25 23.80 ? 60  THR A C   1 
ATOM   379   O  O   . THR A 1 60  ? -10.592 96.052  15.826  0.25 22.77 ? 60  THR A O   1 
ATOM   380   C  CB  . THR A 1 60  ? -8.980  97.865  17.555  0.25 25.56 ? 60  THR A CB  1 
ATOM   381   O  OG1 . THR A 1 60  ? -8.295  99.050  17.982  0.25 25.53 ? 60  THR A OG1 1 
ATOM   382   C  CG2 . THR A 1 60  ? -8.333  96.647  18.209  0.25 26.58 ? 60  THR A CG2 1 
ATOM   383   N  N   . SER A 1 61  ? -8.550  95.587  14.993  0.25 21.76 ? 61  SER A N   1 
ATOM   384   C  CA  . SER A 1 61  ? -8.900  94.241  14.546  0.25 20.93 ? 61  SER A CA  1 
ATOM   385   C  C   . SER A 1 61  ? -9.525  93.434  15.673  0.25 21.47 ? 61  SER A C   1 
ATOM   386   O  O   . SER A 1 61  ? -8.941  93.311  16.753  0.25 17.88 ? 61  SER A O   1 
ATOM   387   C  CB  . SER A 1 61  ? -7.657  93.504  14.051  0.25 19.84 ? 61  SER A CB  1 
ATOM   388   O  OG  . SER A 1 61  ? -7.914  92.115  13.943  0.25 18.65 ? 61  SER A OG  1 
ATOM   389   N  N   . GLN A 1 62  ? -10.706 92.878  15.418  0.25 21.35 ? 62  GLN A N   1 
ATOM   390   C  CA  . GLN A 1 62  ? -11.392 92.078  16.427  0.25 24.17 ? 62  GLN A CA  1 
ATOM   391   C  C   . GLN A 1 62  ? -10.946 90.627  16.361  0.25 23.10 ? 62  GLN A C   1 
ATOM   392   O  O   . GLN A 1 62  ? -11.302 89.813  17.209  0.25 21.83 ? 62  GLN A O   1 
ATOM   393   C  CB  . GLN A 1 62  ? -12.908 92.183  16.251  0.25 27.67 ? 62  GLN A CB  1 
ATOM   394   C  CG  . GLN A 1 62  ? -13.433 93.578  16.552  0.25 32.28 ? 62  GLN A CG  1 
ATOM   395   C  CD  . GLN A 1 62  ? -13.010 94.069  17.929  0.25 33.77 ? 62  GLN A CD  1 
ATOM   396   O  OE1 . GLN A 1 62  ? -13.466 93.558  18.952  0.25 34.82 ? 62  GLN A OE1 1 
ATOM   397   N  NE2 . GLN A 1 62  ? -12.126 95.060  17.957  0.25 35.25 ? 62  GLN A NE2 1 
ATOM   398   N  N   . THR A 1 63  ? -10.161 90.310  15.340  0.25 20.90 ? 63  THR A N   1 
ATOM   399   C  CA  . THR A 1 63  ? -9.632  88.967  15.187  0.25 20.66 ? 63  THR A CA  1 
ATOM   400   C  C   . THR A 1 63  ? -8.352  88.842  16.011  0.25 20.41 ? 63  THR A C   1 
ATOM   401   O  O   . THR A 1 63  ? -8.153  87.856  16.725  0.25 20.18 ? 63  THR A O   1 
ATOM   402   C  CB  . THR A 1 63  ? -9.299  88.658  13.717  0.25 21.51 ? 63  THR A CB  1 
ATOM   403   O  OG1 . THR A 1 63  ? -10.511 88.607  12.955  0.25 23.87 ? 63  THR A OG1 1 
ATOM   404   C  CG2 . THR A 1 63  ? -8.574  87.319  13.604  0.25 22.78 ? 63  THR A CG2 1 
ATOM   405   N  N   . TRP A 1 64  ? -7.499  89.861  15.919  0.25 17.66 ? 64  TRP A N   1 
ATOM   406   C  CA  . TRP A 1 64  ? -6.220  89.875  16.625  0.25 17.71 ? 64  TRP A CA  1 
ATOM   407   C  C   . TRP A 1 64  ? -6.181  90.670  17.924  0.25 18.55 ? 64  TRP A C   1 
ATOM   408   O  O   . TRP A 1 64  ? -5.342  90.406  18.789  0.25 19.31 ? 64  TRP A O   1 
ATOM   409   C  CB  . TRP A 1 64  ? -5.131  90.402  15.695  0.25 14.92 ? 64  TRP A CB  1 
ATOM   410   C  CG  . TRP A 1 64  ? -4.895  89.503  14.539  0.25 15.89 ? 64  TRP A CG  1 
ATOM   411   C  CD1 . TRP A 1 64  ? -5.181  89.751  13.226  0.25 14.91 ? 64  TRP A CD1 1 
ATOM   412   C  CD2 . TRP A 1 64  ? -4.325  88.194  14.588  0.25 14.91 ? 64  TRP A CD2 1 
ATOM   413   N  NE1 . TRP A 1 64  ? -4.819  88.673  12.452  0.25 16.23 ? 64  TRP A NE1 1 
ATOM   414   C  CE2 . TRP A 1 64  ? -4.288  87.703  13.265  0.25 15.67 ? 64  TRP A CE2 1 
ATOM   415   C  CE3 . TRP A 1 64  ? -3.836  87.386  15.625  0.25 15.69 ? 64  TRP A CE3 1 
ATOM   416   C  CZ2 . TRP A 1 64  ? -3.781  86.440  12.949  0.25 16.14 ? 64  TRP A CZ2 1 
ATOM   417   C  CZ3 . TRP A 1 64  ? -3.332  86.128  15.310  0.25 15.79 ? 64  TRP A CZ3 1 
ATOM   418   C  CH2 . TRP A 1 64  ? -3.308  85.670  13.982  0.25 15.87 ? 64  TRP A CH2 1 
ATOM   419   N  N   . HIS A 1 65  ? -7.076  91.643  18.050  0.25 18.03 ? 65  HIS A N   1 
ATOM   420   C  CA  . HIS A 1 65  ? -7.151  92.490  19.235  0.25 18.68 ? 65  HIS A CA  1 
ATOM   421   C  C   . HIS A 1 65  ? -5.870  93.286  19.473  0.25 16.73 ? 65  HIS A C   1 
ATOM   422   O  O   . HIS A 1 65  ? -5.465  93.521  20.611  0.25 15.30 ? 65  HIS A O   1 
ATOM   423   C  CB  . HIS A 1 65  ? -7.490  91.649  20.469  0.25 20.40 ? 65  HIS A CB  1 
ATOM   424   C  CG  . HIS A 1 65  ? -8.773  90.891  20.339  0.25 18.93 ? 65  HIS A CG  1 
ATOM   425   N  ND1 . HIS A 1 65  ? -8.818  89.560  19.984  0.25 21.35 ? 65  HIS A ND1 1 
ATOM   426   C  CD2 . HIS A 1 65  ? -10.060 91.292  20.461  0.25 19.39 ? 65  HIS A CD2 1 
ATOM   427   C  CE1 . HIS A 1 65  ? -10.079 89.173  19.894  0.25 19.57 ? 65  HIS A CE1 1 
ATOM   428   N  NE2 . HIS A 1 65  ? -10.852 90.205  20.177  0.25 20.07 ? 65  HIS A NE2 1 
ATOM   429   N  N   . GLY A 1 66  ? -5.244  93.705  18.383  0.25 15.54 ? 66  GLY A N   1 
ATOM   430   C  CA  . GLY A 1 66  ? -4.023  94.480  18.473  0.25 12.80 ? 66  GLY A CA  1 
ATOM   431   C  C   . GLY A 1 66  ? -3.679  95.012  17.098  0.25 12.89 ? 66  GLY A C   1 
ATOM   432   O  O   . GLY A 1 66  ? -4.358  94.697  16.120  0.25 11.67 ? 66  GLY A O   1 
ATOM   433   N  N   . GLY A 1 67  ? -2.631  95.821  17.012  0.25 12.45 ? 67  GLY A N   1 
ATOM   434   C  CA  . GLY A 1 67  ? -2.245  96.352  15.721  0.25 11.64 ? 67  GLY A CA  1 
ATOM   435   C  C   . GLY A 1 67  ? -1.946  95.222  14.754  0.25 11.96 ? 67  GLY A C   1 
ATOM   436   O  O   . GLY A 1 67  ? -1.532  94.136  15.162  0.25 11.71 ? 67  GLY A O   1 
ATOM   437   N  N   . ILE A 1 68  ? -2.172  95.467  13.468  0.25 13.15 ? 68  ILE A N   1 
ATOM   438   C  CA  . ILE A 1 68  ? -1.896  94.467  12.446  0.25 12.23 ? 68  ILE A CA  1 
ATOM   439   C  C   . ILE A 1 68  ? -0.692  94.953  11.636  0.25 11.46 ? 68  ILE A C   1 
ATOM   440   O  O   . ILE A 1 68  ? -0.463  96.160  11.505  0.25 9.98  ? 68  ILE A O   1 
ATOM   441   C  CB  . ILE A 1 68  ? -3.139  94.225  11.554  0.25 13.70 ? 68  ILE A CB  1 
ATOM   442   C  CG1 . ILE A 1 68  ? -3.604  95.531  10.909  0.25 15.27 ? 68  ILE A CG1 1 
ATOM   443   C  CG2 . ILE A 1 68  ? -4.268  93.646  12.409  0.25 14.61 ? 68  ILE A CG2 1 
ATOM   444   C  CD1 . ILE A 1 68  ? -4.878  95.379  10.096  0.25 17.57 ? 68  ILE A CD1 1 
ATOM   445   N  N   . ALA A 1 69  ? 0.075   94.009  11.100  0.25 9.76  ? 69  ALA A N   1 
ATOM   446   C  CA  . ALA A 1 69  ? 1.298   94.333  10.375  0.25 8.87  ? 69  ALA A CA  1 
ATOM   447   C  C   . ALA A 1 69  ? 1.190   95.097  9.063   0.25 8.63  ? 69  ALA A C   1 
ATOM   448   O  O   . ALA A 1 69  ? 0.341   94.815  8.220   0.25 7.75  ? 69  ALA A O   1 
ATOM   449   C  CB  . ALA A 1 69  ? 2.108   93.062  10.151  0.25 8.94  ? 69  ALA A CB  1 
ATOM   450   N  N   . THR A 1 70  ? 2.082   96.071  8.908   0.25 8.84  ? 70  THR A N   1 
ATOM   451   C  CA  . THR A 1 70  ? 2.163   96.863  7.693   0.25 8.54  ? 70  THR A CA  1 
ATOM   452   C  C   . THR A 1 70  ? 3.603   97.334  7.550   0.25 10.45 ? 70  THR A C   1 
ATOM   453   O  O   . THR A 1 70  ? 4.405   97.211  8.482   0.25 10.79 ? 70  THR A O   1 
ATOM   454   C  CB  . THR A 1 70  ? 1.211   98.076  7.719   0.25 9.57  ? 70  THR A CB  1 
ATOM   455   O  OG1 . THR A 1 70  ? 1.277   98.756  6.456   0.25 9.09  ? 70  THR A OG1 1 
ATOM   456   C  CG2 . THR A 1 70  ? 1.586   99.039  8.845   0.25 6.76  ? 70  THR A CG2 1 
ATOM   457   N  N   . ILE A 1 71  ? 3.941   97.851  6.377   0.25 9.69  ? 71  ILE A N   1 
ATOM   458   C  CA  . ILE A 1 71  ? 5.289   98.326  6.139   0.25 8.90  ? 71  ILE A CA  1 
ATOM   459   C  C   . ILE A 1 71  ? 5.275   99.656  5.412   0.25 9.02  ? 71  ILE A C   1 
ATOM   460   O  O   . ILE A 1 71  ? 4.294   100.011 4.762   0.25 8.25  ? 71  ILE A O   1 
ATOM   461   C  CB  . ILE A 1 71  ? 6.106   97.310  5.292   0.25 8.10  ? 71  ILE A CB  1 
ATOM   462   C  CG1 . ILE A 1 71  ? 5.339   96.943  4.014   0.25 8.80  ? 71  ILE A CG1 1 
ATOM   463   C  CG2 . ILE A 1 71  ? 6.396   96.057  6.110   0.25 11.85 ? 71  ILE A CG2 1 
ATOM   464   C  CD1 . ILE A 1 71  ? 6.103   95.999  3.083   0.25 8.79  ? 71  ILE A CD1 1 
ATOM   465   N  N   . PHE A 1 72  ? 6.368   100.397 5.538   0.25 10.60 ? 72  PHE A N   1 
ATOM   466   C  CA  . PHE A 1 72  ? 6.504   101.668 4.849   0.25 10.22 ? 72  PHE A CA  1 
ATOM   467   C  C   . PHE A 1 72  ? 7.968   101.848 4.456   0.25 12.29 ? 72  PHE A C   1 
ATOM   468   O  O   . PHE A 1 72  ? 8.858   101.213 5.030   0.25 10.99 ? 72  PHE A O   1 
ATOM   469   C  CB  . PHE A 1 72  ? 5.986   102.831 5.719   0.25 9.28  ? 72  PHE A CB  1 
ATOM   470   C  CG  . PHE A 1 72  ? 6.733   103.027 7.014   0.25 12.67 ? 72  PHE A CG  1 
ATOM   471   C  CD1 . PHE A 1 72  ? 7.994   103.614 7.029   0.25 11.47 ? 72  PHE A CD1 1 
ATOM   472   C  CD2 . PHE A 1 72  ? 6.155   102.659 8.222   0.25 10.68 ? 72  PHE A CD2 1 
ATOM   473   C  CE1 . PHE A 1 72  ? 8.668   103.835 8.235   0.25 14.11 ? 72  PHE A CE1 1 
ATOM   474   C  CE2 . PHE A 1 72  ? 6.818   102.875 9.432   0.25 13.95 ? 72  PHE A CE2 1 
ATOM   475   C  CZ  . PHE A 1 72  ? 8.077   103.465 9.437   0.25 13.96 ? 72  PHE A CZ  1 
ATOM   476   N  N   . GLN A 1 73  ? 8.215   102.693 3.463   0.25 12.93 ? 73  GLN A N   1 
ATOM   477   C  CA  . GLN A 1 73  ? 9.568   102.925 2.979   0.25 14.05 ? 73  GLN A CA  1 
ATOM   478   C  C   . GLN A 1 73  ? 10.416  103.725 3.952   0.25 14.88 ? 73  GLN A C   1 
ATOM   479   O  O   . GLN A 1 73  ? 10.067  104.837 4.334   0.25 13.74 ? 73  GLN A O   1 
ATOM   480   C  CB  . GLN A 1 73  ? 9.501   103.608 1.614   0.25 12.29 ? 73  GLN A CB  1 
ATOM   481   C  CG  . GLN A 1 73  ? 8.871   102.694 0.570   0.25 17.48 ? 73  GLN A CG  1 
ATOM   482   C  CD  . GLN A 1 73  ? 8.350   103.441 -0.638  0.25 17.59 ? 73  GLN A CD  1 
ATOM   483   O  OE1 . GLN A 1 73  ? 7.461   104.284 -0.523  0.25 18.73 ? 73  GLN A OE1 1 
ATOM   484   N  NE2 . GLN A 1 73  ? 8.897   103.131 -1.805  0.25 16.34 ? 73  GLN A NE2 1 
ATOM   485   N  N   . SER A 1 74  ? 11.544  103.139 4.339   0.25 16.51 ? 74  SER A N   1 
ATOM   486   C  CA  . SER A 1 74  ? 12.453  103.752 5.294   0.25 16.63 ? 74  SER A CA  1 
ATOM   487   C  C   . SER A 1 74  ? 13.894  103.352 4.960   0.25 17.86 ? 74  SER A C   1 
ATOM   488   O  O   . SER A 1 74  ? 14.271  102.186 5.087   0.25 16.76 ? 74  SER A O   1 
ATOM   489   C  CB  . SER A 1 74  ? 12.078  103.276 6.704   0.25 17.98 ? 74  SER A CB  1 
ATOM   490   O  OG  . SER A 1 74  ? 12.818  103.941 7.709   0.25 16.99 ? 74  SER A OG  1 
ATOM   491   N  N   . PRO A 1 75  ? 14.715  104.315 4.512   0.25 18.87 ? 75  PRO A N   1 
ATOM   492   C  CA  . PRO A 1 75  ? 16.108  104.024 4.168   0.25 18.73 ? 75  PRO A CA  1 
ATOM   493   C  C   . PRO A 1 75  ? 16.845  103.359 5.324   0.25 18.64 ? 75  PRO A C   1 
ATOM   494   O  O   . PRO A 1 75  ? 16.687  103.758 6.476   0.25 15.31 ? 75  PRO A O   1 
ATOM   495   C  CB  . PRO A 1 75  ? 16.671  105.402 3.835   0.25 19.49 ? 75  PRO A CB  1 
ATOM   496   C  CG  . PRO A 1 75  ? 15.491  106.091 3.224   0.25 20.20 ? 75  PRO A CG  1 
ATOM   497   C  CD  . PRO A 1 75  ? 14.379  105.712 4.184   0.25 20.19 ? 75  PRO A CD  1 
ATOM   498   N  N   . GLY A 1 76  ? 17.636  102.337 5.015   0.25 19.39 ? 76  GLY A N   1 
ATOM   499   C  CA  . GLY A 1 76  ? 18.385  101.646 6.050   0.25 19.12 ? 76  GLY A CA  1 
ATOM   500   C  C   . GLY A 1 76  ? 17.661  100.452 6.641   0.25 20.59 ? 76  GLY A C   1 
ATOM   501   O  O   . GLY A 1 76  ? 18.270  99.402  6.855   0.25 21.09 ? 76  GLY A O   1 
ATOM   502   N  N   . ASP A 1 77  ? 16.366  100.607 6.913   0.25 18.14 ? 77  ASP A N   1 
ATOM   503   C  CA  . ASP A 1 77  ? 15.562  99.522  7.479   0.25 17.04 ? 77  ASP A CA  1 
ATOM   504   C  C   . ASP A 1 77  ? 15.425  98.355  6.502   0.25 14.90 ? 77  ASP A C   1 
ATOM   505   O  O   . ASP A 1 77  ? 15.728  98.483  5.312   0.25 12.85 ? 77  ASP A O   1 
ATOM   506   C  CB  . ASP A 1 77  ? 14.150  100.015 7.825   0.25 17.14 ? 77  ASP A CB  1 
ATOM   507   C  CG  . ASP A 1 77  ? 14.137  101.064 8.927   0.25 21.68 ? 77  ASP A CG  1 
ATOM   508   O  OD1 . ASP A 1 77  ? 14.588  102.205 8.677   0.25 19.64 ? 77  ASP A OD1 1 
ATOM   509   O  OD2 . ASP A 1 77  ? 13.668  100.744 10.043  0.25 17.84 ? 77  ASP A OD2 1 
ATOM   510   N  N   . GLU A 1 78  ? 14.965  97.214  7.009   0.25 14.18 ? 78  GLU A N   1 
ATOM   511   C  CA  . GLU A 1 78  ? 14.740  96.044  6.163   0.25 14.64 ? 78  GLU A CA  1 
ATOM   512   C  C   . GLU A 1 78  ? 13.670  95.144  6.758   0.25 14.73 ? 78  GLU A C   1 
ATOM   513   O  O   . GLU A 1 78  ? 13.472  95.115  7.970   0.25 13.85 ? 78  GLU A O   1 
ATOM   514   C  CB  . GLU A 1 78  ? 16.032  95.241  5.949   0.25 17.84 ? 78  GLU A CB  1 
ATOM   515   C  CG  . GLU A 1 78  ? 16.661  94.671  7.208   0.25 22.25 ? 78  GLU A CG  1 
ATOM   516   C  CD  . GLU A 1 78  ? 17.945  93.911  6.914   0.25 23.44 ? 78  GLU A CD  1 
ATOM   517   O  OE1 . GLU A 1 78  ? 18.804  94.458  6.189   0.25 25.95 ? 78  GLU A OE1 1 
ATOM   518   O  OE2 . GLU A 1 78  ? 18.097  92.774  7.410   0.25 24.45 ? 78  GLU A OE2 1 
ATOM   519   N  N   . VAL A 1 79  ? 12.969  94.425  5.888   0.25 13.09 ? 79  VAL A N   1 
ATOM   520   C  CA  . VAL A 1 79  ? 11.923  93.508  6.308   0.25 12.72 ? 79  VAL A CA  1 
ATOM   521   C  C   . VAL A 1 79  ? 12.201  92.138  5.705   0.25 13.43 ? 79  VAL A C   1 
ATOM   522   O  O   . VAL A 1 79  ? 12.442  92.020  4.496   0.25 13.12 ? 79  VAL A O   1 
ATOM   523   C  CB  . VAL A 1 79  ? 10.527  93.980  5.823   0.25 13.36 ? 79  VAL A CB  1 
ATOM   524   C  CG1 . VAL A 1 79  ? 9.474   92.913  6.137   0.25 8.63  ? 79  VAL A CG1 1 
ATOM   525   C  CG2 . VAL A 1 79  ? 10.157  95.300  6.492   0.25 10.37 ? 79  VAL A CG2 1 
ATOM   526   N  N   . TRP A 1 80  ? 12.179  91.104  6.541   0.25 12.25 ? 80  TRP A N   1 
ATOM   527   C  CA  . TRP A 1 80  ? 12.394  89.749  6.048   0.25 11.23 ? 80  TRP A CA  1 
ATOM   528   C  C   . TRP A 1 80  ? 11.075  88.982  6.057   0.25 10.96 ? 80  TRP A C   1 
ATOM   529   O  O   . TRP A 1 80  ? 10.284  89.081  7.004   0.25 11.41 ? 80  TRP A O   1 
ATOM   530   C  CB  . TRP A 1 80  ? 13.434  89.005  6.900   0.25 12.86 ? 80  TRP A CB  1 
ATOM   531   C  CG  . TRP A 1 80  ? 14.863  89.409  6.632   0.25 12.15 ? 80  TRP A CG  1 
ATOM   532   C  CD1 . TRP A 1 80  ? 15.570  90.398  7.253   0.25 13.06 ? 80  TRP A CD1 1 
ATOM   533   C  CD2 . TRP A 1 80  ? 15.753  88.824  5.671   0.25 11.77 ? 80  TRP A CD2 1 
ATOM   534   N  NE1 . TRP A 1 80  ? 16.846  90.464  6.744   0.25 14.04 ? 80  TRP A NE1 1 
ATOM   535   C  CE2 . TRP A 1 80  ? 16.987  89.510  5.770   0.25 14.03 ? 80  TRP A CE2 1 
ATOM   536   C  CE3 . TRP A 1 80  ? 15.628  87.787  4.734   0.25 13.55 ? 80  TRP A CE3 1 
ATOM   537   C  CZ2 . TRP A 1 80  ? 18.092  89.192  4.969   0.25 12.34 ? 80  TRP A CZ2 1 
ATOM   538   C  CZ3 . TRP A 1 80  ? 16.729  87.469  3.933   0.25 13.37 ? 80  TRP A CZ3 1 
ATOM   539   C  CH2 . TRP A 1 80  ? 17.944  88.172  4.059   0.25 10.53 ? 80  TRP A CH2 1 
ATOM   540   N  N   . GLY A 1 81  ? 10.830  88.222  4.995   0.25 10.05 ? 81  GLY A N   1 
ATOM   541   C  CA  . GLY A 1 81  ? 9.603   87.457  4.931   0.25 10.26 ? 81  GLY A CA  1 
ATOM   542   C  C   . GLY A 1 81  ? 9.778   86.141  4.212   0.25 10.49 ? 81  GLY A C   1 
ATOM   543   O  O   . GLY A 1 81  ? 10.867  85.570  4.178   0.25 10.20 ? 81  GLY A O   1 
ATOM   544   N  N   . VAL A 1 82  ? 8.689   85.663  3.628   0.25 10.04 ? 82  VAL A N   1 
ATOM   545   C  CA  . VAL A 1 82  ? 8.700   84.405  2.899   0.25 10.56 ? 82  VAL A CA  1 
ATOM   546   C  C   . VAL A 1 82  ? 7.910   84.557  1.617   0.25 11.33 ? 82  VAL A C   1 
ATOM   547   O  O   . VAL A 1 82  ? 6.832   85.154  1.611   0.25 13.43 ? 82  VAL A O   1 
ATOM   548   C  CB  . VAL A 1 82  ? 8.070   83.266  3.745   0.25 10.18 ? 82  VAL A CB  1 
ATOM   549   C  CG1 . VAL A 1 82  ? 7.744   82.064  2.860   0.25 9.07  ? 82  VAL A CG1 1 
ATOM   550   C  CG2 . VAL A 1 82  ? 9.030   82.862  4.865   0.25 8.03  ? 82  VAL A CG2 1 
ATOM   551   N  N   . VAL A 1 83  ? 8.455   84.032  0.524   0.25 12.09 ? 83  VAL A N   1 
ATOM   552   C  CA  . VAL A 1 83  ? 7.762   84.080  -0.753  0.25 10.78 ? 83  VAL A CA  1 
ATOM   553   C  C   . VAL A 1 83  ? 6.978   82.771  -0.873  0.25 11.49 ? 83  VAL A C   1 
ATOM   554   O  O   . VAL A 1 83  ? 7.554   81.685  -0.803  0.25 12.24 ? 83  VAL A O   1 
ATOM   555   C  CB  . VAL A 1 83  ? 8.762   84.199  -1.936  0.25 12.06 ? 83  VAL A CB  1 
ATOM   556   C  CG1 . VAL A 1 83  ? 8.007   84.378  -3.247  0.25 8.55  ? 83  VAL A CG1 1 
ATOM   557   C  CG2 . VAL A 1 83  ? 9.700   85.375  -1.714  0.25 9.43  ? 83  VAL A CG2 1 
ATOM   558   N  N   . TRP A 1 84  ? 5.660   82.879  -1.011  0.25 10.73 ? 84  TRP A N   1 
ATOM   559   C  CA  . TRP A 1 84  ? 4.804   81.708  -1.151  0.25 9.14  ? 84  TRP A CA  1 
ATOM   560   C  C   . TRP A 1 84  ? 4.287   81.620  -2.572  0.25 11.54 ? 84  TRP A C   1 
ATOM   561   O  O   . TRP A 1 84  ? 3.789   82.609  -3.115  0.25 10.05 ? 84  TRP A O   1 
ATOM   562   C  CB  . TRP A 1 84  ? 3.591   81.787  -0.222  0.25 10.10 ? 84  TRP A CB  1 
ATOM   563   C  CG  . TRP A 1 84  ? 3.888   81.568  1.226   0.25 9.88  ? 84  TRP A CG  1 
ATOM   564   C  CD1 . TRP A 1 84  ? 4.206   82.514  2.152   0.25 11.85 ? 84  TRP A CD1 1 
ATOM   565   C  CD2 . TRP A 1 84  ? 3.890   80.313  1.914   0.25 9.80  ? 84  TRP A CD2 1 
ATOM   566   N  NE1 . TRP A 1 84  ? 4.407   81.927  3.379   0.25 9.07  ? 84  TRP A NE1 1 
ATOM   567   C  CE2 . TRP A 1 84  ? 4.219   80.576  3.261   0.25 9.52  ? 84  TRP A CE2 1 
ATOM   568   C  CE3 . TRP A 1 84  ? 3.645   78.991  1.521   0.25 6.44  ? 84  TRP A CE3 1 
ATOM   569   C  CZ2 . TRP A 1 84  ? 4.312   79.562  4.220   0.25 5.22  ? 84  TRP A CZ2 1 
ATOM   570   C  CZ3 . TRP A 1 84  ? 3.738   77.983  2.473   0.25 6.29  ? 84  TRP A CZ3 1 
ATOM   571   C  CH2 . TRP A 1 84  ? 4.069   78.274  3.807   0.25 11.54 ? 84  TRP A CH2 1 
ATOM   572   N  N   . LYS A 1 85  ? 4.395   80.446  -3.184  0.25 11.71 ? 85  LYS A N   1 
ATOM   573   C  CA  . LYS A 1 85  ? 3.885   80.298  -4.537  0.25 14.56 ? 85  LYS A CA  1 
ATOM   574   C  C   . LYS A 1 85  ? 2.422   79.864  -4.450  0.25 14.22 ? 85  LYS A C   1 
ATOM   575   O  O   . LYS A 1 85  ? 2.099   78.880  -3.790  0.25 13.31 ? 85  LYS A O   1 
ATOM   576   C  CB  . LYS A 1 85  ? 4.706   79.269  -5.314  0.25 16.51 ? 85  LYS A CB  1 
ATOM   577   C  CG  . LYS A 1 85  ? 4.339   79.190  -6.785  0.25 18.05 ? 85  LYS A CG  1 
ATOM   578   C  CD  . LYS A 1 85  ? 5.382   78.404  -7.562  0.25 22.59 ? 85  LYS A CD  1 
ATOM   579   C  CE  . LYS A 1 85  ? 5.069   78.389  -9.048  0.25 26.45 ? 85  LYS A CE  1 
ATOM   580   N  NZ  . LYS A 1 85  ? 6.176   77.785  -9.841  0.25 27.54 ? 85  LYS A NZ  1 
HETATM 581   N  N   . MSE A 1 86  ? 1.545   80.608  -5.115  0.25 14.85 ? 86  MSE A N   1 
HETATM 582   C  CA  . MSE A 1 86  ? 0.114   80.314  -5.103  0.25 16.53 ? 86  MSE A CA  1 
HETATM 583   C  C   . MSE A 1 86  ? -0.449  80.298  -6.515  0.25 18.16 ? 86  MSE A C   1 
HETATM 584   O  O   . MSE A 1 86  ? 0.152   80.857  -7.431  0.25 14.97 ? 86  MSE A O   1 
HETATM 585   C  CB  . MSE A 1 86  ? -0.624  81.374  -4.289  0.25 18.64 ? 86  MSE A CB  1 
HETATM 586   C  CG  . MSE A 1 86  ? -0.253  81.402  -2.817  0.25 20.40 ? 86  MSE A CG  1 
HETATM 587   SE SE  . MSE A 1 86  ? -0.879  83.010  -1.954  0.25 24.43 ? 86  MSE A SE  1 
HETATM 588   C  CE  . MSE A 1 86  ? -2.769  82.626  -1.888  0.25 23.62 ? 86  MSE A CE  1 
ATOM   589   N  N   . ASN A 1 87  ? -1.602  79.655  -6.688  0.25 19.63 ? 87  ASN A N   1 
ATOM   590   C  CA  . ASN A 1 87  ? -2.236  79.595  -7.998  0.25 21.86 ? 87  ASN A CA  1 
ATOM   591   C  C   . ASN A 1 87  ? -2.891  80.945  -8.267  0.25 20.97 ? 87  ASN A C   1 
ATOM   592   O  O   . ASN A 1 87  ? -3.439  81.563  -7.353  0.25 17.71 ? 87  ASN A O   1 
ATOM   593   C  CB  . ASN A 1 87  ? -3.293  78.490  -8.032  0.25 26.25 ? 87  ASN A CB  1 
ATOM   594   C  CG  . ASN A 1 87  ? -3.925  78.332  -9.403  0.25 30.12 ? 87  ASN A CG  1 
ATOM   595   O  OD1 . ASN A 1 87  ? -4.548  79.257  -9.926  0.25 31.54 ? 87  ASN A OD1 1 
ATOM   596   N  ND2 . ASN A 1 87  ? -3.763  77.155  -9.994  0.25 33.26 ? 87  ASN A ND2 1 
ATOM   597   N  N   . LYS A 1 88  ? -2.829  81.407  -9.513  0.25 20.35 ? 88  LYS A N   1 
ATOM   598   C  CA  . LYS A 1 88  ? -3.425  82.693  -9.861  0.25 23.22 ? 88  LYS A CA  1 
ATOM   599   C  C   . LYS A 1 88  ? -4.918  82.742  -9.561  0.25 23.46 ? 88  LYS A C   1 
ATOM   600   O  O   . LYS A 1 88  ? -5.497  83.821  -9.444  0.25 21.30 ? 88  LYS A O   1 
ATOM   601   C  CB  . LYS A 1 88  ? -3.178  83.025  -11.336 0.25 25.18 ? 88  LYS A CB  1 
ATOM   602   C  CG  . LYS A 1 88  ? -1.793  83.591  -11.613 0.25 28.22 ? 88  LYS A CG  1 
ATOM   603   C  CD  . LYS A 1 88  ? -1.653  84.028  -13.062 0.25 30.50 ? 88  LYS A CD  1 
ATOM   604   C  CE  . LYS A 1 88  ? -0.303  84.676  -13.316 0.25 29.34 ? 88  LYS A CE  1 
ATOM   605   N  NZ  . LYS A 1 88  ? -0.149  85.100  -14.732 0.25 32.49 ? 88  LYS A NZ  1 
ATOM   606   N  N   . SER A 1 89  ? -5.539  81.575  -9.425  0.25 24.09 ? 89  SER A N   1 
ATOM   607   C  CA  . SER A 1 89  ? -6.964  81.513  -9.123  0.25 24.57 ? 89  SER A CA  1 
ATOM   608   C  C   . SER A 1 89  ? -7.225  81.975  -7.689  0.25 25.11 ? 89  SER A C   1 
ATOM   609   O  O   . SER A 1 89  ? -8.373  82.173  -7.291  0.25 23.43 ? 89  SER A O   1 
ATOM   610   C  CB  . SER A 1 89  ? -7.481  80.086  -9.290  0.25 25.35 ? 89  SER A CB  1 
ATOM   611   O  OG  . SER A 1 89  ? -6.914  79.227  -8.316  0.25 24.43 ? 89  SER A OG  1 
ATOM   612   N  N   . ASN A 1 90  ? -6.155  82.143  -6.917  0.25 24.58 ? 90  ASN A N   1 
ATOM   613   C  CA  . ASN A 1 90  ? -6.271  82.568  -5.525  0.25 24.46 ? 90  ASN A CA  1 
ATOM   614   C  C   . ASN A 1 90  ? -6.169  84.085  -5.412  0.25 23.09 ? 90  ASN A C   1 
ATOM   615   O  O   . ASN A 1 90  ? -6.426  84.659  -4.353  0.25 22.40 ? 90  ASN A O   1 
ATOM   616   C  CB  . ASN A 1 90  ? -5.166  81.921  -4.684  0.25 26.96 ? 90  ASN A CB  1 
ATOM   617   C  CG  . ASN A 1 90  ? -5.050  80.430  -4.922  0.25 28.55 ? 90  ASN A CG  1 
ATOM   618   O  OD1 . ASN A 1 90  ? -4.815  79.988  -6.045  0.25 30.96 ? 90  ASN A OD1 1 
ATOM   619   N  ND2 . ASN A 1 90  ? -5.212  79.646  -3.864  0.25 31.98 ? 90  ASN A ND2 1 
ATOM   620   N  N   . LEU A 1 91  ? -5.796  84.722  -6.516  0.25 21.79 ? 91  LEU A N   1 
ATOM   621   C  CA  . LEU A 1 91  ? -5.634  86.171  -6.579  0.25 20.39 ? 91  LEU A CA  1 
ATOM   622   C  C   . LEU A 1 91  ? -6.724  86.927  -5.814  0.25 20.83 ? 91  LEU A C   1 
ATOM   623   O  O   . LEU A 1 91  ? -6.452  87.554  -4.786  0.25 19.31 ? 91  LEU A O   1 
ATOM   624   C  CB  . LEU A 1 91  ? -5.614  86.613  -8.046  0.25 20.31 ? 91  LEU A CB  1 
ATOM   625   C  CG  . LEU A 1 91  ? -4.475  87.517  -8.538  0.25 22.34 ? 91  LEU A CG  1 
ATOM   626   C  CD1 . LEU A 1 91  ? -3.126  86.966  -8.111  0.25 21.21 ? 91  LEU A CD1 1 
ATOM   627   C  CD2 . LEU A 1 91  ? -4.546  87.628  -10.059 0.25 21.10 ? 91  LEU A CD2 1 
ATOM   628   N  N   . ASN A 1 92  ? -7.955  86.866  -6.310  0.25 18.56 ? 92  ASN A N   1 
ATOM   629   C  CA  . ASN A 1 92  ? -9.066  87.556  -5.660  0.25 19.97 ? 92  ASN A CA  1 
ATOM   630   C  C   . ASN A 1 92  ? -9.276  87.087  -4.233  0.25 18.29 ? 92  ASN A C   1 
ATOM   631   O  O   . ASN A 1 92  ? -9.575  87.885  -3.346  0.25 17.65 ? 92  ASN A O   1 
ATOM   632   C  CB  . ASN A 1 92  ? -10.359 87.363  -6.453  0.25 20.68 ? 92  ASN A CB  1 
ATOM   633   C  CG  . ASN A 1 92  ? -10.288 87.990  -7.827  0.25 24.34 ? 92  ASN A CG  1 
ATOM   634   O  OD1 . ASN A 1 92  ? -9.910  89.154  -7.970  0.25 24.04 ? 92  ASN A OD1 1 
ATOM   635   N  ND2 . ASN A 1 92  ? -10.653 87.224  -8.848  0.25 23.39 ? 92  ASN A ND2 1 
ATOM   636   N  N   . SER A 1 93  ? -9.126  85.788  -4.009  0.25 16.96 ? 93  SER A N   1 
ATOM   637   C  CA  . SER A 1 93  ? -9.295  85.248  -2.672  0.25 16.10 ? 93  SER A CA  1 
ATOM   638   C  C   . SER A 1 93  ? -8.299  85.900  -1.711  0.25 15.47 ? 93  SER A C   1 
ATOM   639   O  O   . SER A 1 93  ? -8.664  86.309  -0.610  0.25 14.75 ? 93  SER A O   1 
ATOM   640   C  CB  . SER A 1 93  ? -9.086  83.734  -2.684  0.25 16.33 ? 93  SER A CB  1 
ATOM   641   O  OG  . SER A 1 93  ? -9.202  83.209  -1.374  0.25 18.75 ? 93  SER A OG  1 
ATOM   642   N  N   . LEU A 1 94  ? -7.040  86.004  -2.131  0.25 14.46 ? 94  LEU A N   1 
ATOM   643   C  CA  . LEU A 1 94  ? -6.019  86.596  -1.278  0.25 11.96 ? 94  LEU A CA  1 
ATOM   644   C  C   . LEU A 1 94  ? -6.302  88.077  -1.048  0.25 11.78 ? 94  LEU A C   1 
ATOM   645   O  O   . LEU A 1 94  ? -6.184  88.570  0.076   0.25 11.99 ? 94  LEU A O   1 
ATOM   646   C  CB  . LEU A 1 94  ? -4.631  86.398  -1.896  0.25 13.46 ? 94  LEU A CB  1 
ATOM   647   C  CG  . LEU A 1 94  ? -3.418  86.787  -1.042  0.25 12.76 ? 94  LEU A CG  1 
ATOM   648   C  CD1 . LEU A 1 94  ? -3.423  85.988  0.253   0.25 14.45 ? 94  LEU A CD1 1 
ATOM   649   C  CD2 . LEU A 1 94  ? -2.135  86.517  -1.819  0.25 13.78 ? 94  LEU A CD2 1 
ATOM   650   N  N   . ASP A 1 95  ? -6.686  88.786  -2.108  0.25 13.26 ? 95  ASP A N   1 
ATOM   651   C  CA  . ASP A 1 95  ? -7.006  90.209  -1.996  0.25 13.67 ? 95  ASP A CA  1 
ATOM   652   C  C   . ASP A 1 95  ? -8.119  90.430  -0.971  0.25 14.46 ? 95  ASP A C   1 
ATOM   653   O  O   . ASP A 1 95  ? -7.975  91.215  -0.029  0.25 12.51 ? 95  ASP A O   1 
ATOM   654   C  CB  . ASP A 1 95  ? -7.449  90.765  -3.357  0.25 13.65 ? 95  ASP A CB  1 
ATOM   655   C  CG  . ASP A 1 95  ? -6.275  91.051  -4.286  0.25 18.91 ? 95  ASP A CG  1 
ATOM   656   O  OD1 . ASP A 1 95  ? -5.120  90.743  -3.906  0.25 14.93 ? 95  ASP A OD1 1 
ATOM   657   O  OD2 . ASP A 1 95  ? -6.513  91.585  -5.393  0.25 17.22 ? 95  ASP A OD2 1 
ATOM   658   N  N   . GLU A 1 96  ? -9.233  89.731  -1.156  0.25 13.89 ? 96  GLU A N   1 
ATOM   659   C  CA  . GLU A 1 96  ? -10.360 89.863  -0.241  0.25 15.13 ? 96  GLU A CA  1 
ATOM   660   C  C   . GLU A 1 96  ? -9.923  89.377  1.147   0.25 14.04 ? 96  GLU A C   1 
ATOM   661   O  O   . GLU A 1 96  ? -10.440 89.825  2.170   0.25 12.99 ? 96  GLU A O   1 
ATOM   662   C  CB  . GLU A 1 96  ? -11.550 89.050  -0.767  0.25 16.37 ? 96  GLU A CB  1 
ATOM   663   C  CG  . GLU A 1 96  ? -12.909 89.468  -0.221  0.25 22.64 ? 96  GLU A CG  1 
ATOM   664   C  CD  . GLU A 1 96  ? -13.060 89.187  1.258   0.25 24.05 ? 96  GLU A CD  1 
ATOM   665   O  OE1 . GLU A 1 96  ? -12.698 88.072  1.688   0.25 33.02 ? 96  GLU A OE1 1 
ATOM   666   O  OE2 . GLU A 1 96  ? -13.551 90.070  1.992   0.25 29.91 ? 96  GLU A OE2 1 
ATOM   667   N  N   . GLN A 1 97  ? -8.952  88.469  1.174   0.25 13.88 ? 97  GLN A N   1 
ATOM   668   C  CA  . GLN A 1 97  ? -8.425  87.940  2.429   0.25 15.78 ? 97  GLN A CA  1 
ATOM   669   C  C   . GLN A 1 97  ? -7.612  88.993  3.178   0.25 16.60 ? 97  GLN A C   1 
ATOM   670   O  O   . GLN A 1 97  ? -7.520  88.967  4.410   0.25 17.39 ? 97  GLN A O   1 
ATOM   671   C  CB  . GLN A 1 97  ? -7.530  86.735  2.160   0.25 15.44 ? 97  GLN A CB  1 
ATOM   672   C  CG  . GLN A 1 97  ? -8.246  85.406  2.157   0.25 15.67 ? 97  GLN A CG  1 
ATOM   673   C  CD  . GLN A 1 97  ? -7.282  84.264  1.941   0.25 15.41 ? 97  GLN A CD  1 
ATOM   674   O  OE1 . GLN A 1 97  ? -6.220  84.209  2.563   0.25 18.38 ? 97  GLN A OE1 1 
ATOM   675   N  NE2 . GLN A 1 97  ? -7.645  83.343  1.061   0.25 10.94 ? 97  GLN A NE2 1 
ATOM   676   N  N   . GLU A 1 98  ? -7.022  89.913  2.423   0.25 16.12 ? 98  GLU A N   1 
ATOM   677   C  CA  . GLU A 1 98  ? -6.205  90.983  2.991   0.25 18.73 ? 98  GLU A CA  1 
ATOM   678   C  C   . GLU A 1 98  ? -6.977  92.302  3.079   0.25 18.96 ? 98  GLU A C   1 
ATOM   679   O  O   . GLU A 1 98  ? -6.379  93.374  3.161   0.25 20.11 ? 98  GLU A O   1 
ATOM   680   C  CB  . GLU A 1 98  ? -4.948  91.179  2.139   0.25 21.12 ? 98  GLU A CB  1 
ATOM   681   C  CG  . GLU A 1 98  ? -3.983  89.997  2.156   0.25 21.98 ? 98  GLU A CG  1 
ATOM   682   C  CD  . GLU A 1 98  ? -3.196  89.895  3.458   0.25 26.54 ? 98  GLU A CD  1 
ATOM   683   O  OE1 . GLU A 1 98  ? -2.679  90.938  3.920   0.25 25.54 ? 98  GLU A OE1 1 
ATOM   684   O  OE2 . GLU A 1 98  ? -3.086  88.777  4.013   0.25 23.03 ? 98  GLU A OE2 1 
ATOM   685   N  N   . GLY A 1 99  ? -8.304  92.210  3.041   0.25 18.95 ? 99  GLY A N   1 
ATOM   686   C  CA  . GLY A 1 99  ? -9.156  93.387  3.138   0.25 17.91 ? 99  GLY A CA  1 
ATOM   687   C  C   . GLY A 1 99  ? -8.863  94.547  2.202   0.25 17.53 ? 99  GLY A C   1 
ATOM   688   O  O   . GLY A 1 99  ? -8.821  95.697  2.631   0.25 16.83 ? 99  GLY A O   1 
ATOM   689   N  N   . VAL A 1 100 ? -8.674  94.264  0.921   0.25 17.92 ? 100 VAL A N   1 
ATOM   690   C  CA  . VAL A 1 100 ? -8.394  95.328  -0.032  0.25 18.34 ? 100 VAL A CA  1 
ATOM   691   C  C   . VAL A 1 100 ? -9.643  96.143  -0.355  0.25 21.28 ? 100 VAL A C   1 
ATOM   692   O  O   . VAL A 1 100 ? -9.581  97.369  -0.453  0.25 22.14 ? 100 VAL A O   1 
ATOM   693   C  CB  . VAL A 1 100 ? -7.807  94.758  -1.338  0.25 17.15 ? 100 VAL A CB  1 
ATOM   694   C  CG1 . VAL A 1 100 ? -7.613  95.874  -2.365  0.25 16.92 ? 100 VAL A CG1 1 
ATOM   695   C  CG2 . VAL A 1 100 ? -6.474  94.076  -1.039  0.25 17.74 ? 100 VAL A CG2 1 
ATOM   696   N  N   . LYS A 1 101 ? -10.779 95.466  -0.498  0.25 23.28 ? 101 LYS A N   1 
ATOM   697   C  CA  . LYS A 1 101 ? -12.035 96.138  -0.829  0.25 25.96 ? 101 LYS A CA  1 
ATOM   698   C  C   . LYS A 1 101 ? -12.491 97.177  0.191   0.25 25.71 ? 101 LYS A C   1 
ATOM   699   O  O   . LYS A 1 101 ? -13.055 98.208  -0.180  0.25 25.45 ? 101 LYS A O   1 
ATOM   700   C  CB  . LYS A 1 101 ? -13.150 95.106  -1.051  0.25 28.42 ? 101 LYS A CB  1 
ATOM   701   C  CG  . LYS A 1 101 ? -12.985 94.294  -2.331  0.25 30.53 ? 101 LYS A CG  1 
ATOM   702   C  CD  . LYS A 1 101 ? -14.203 93.423  -2.629  0.25 33.53 ? 101 LYS A CD  1 
ATOM   703   C  CE  . LYS A 1 101 ? -14.003 92.607  -3.909  0.25 34.34 ? 101 LYS A CE  1 
ATOM   704   N  NZ  . LYS A 1 101 ? -15.198 91.792  -4.294  0.25 34.47 ? 101 LYS A NZ  1 
ATOM   705   N  N   . SER A 1 102 ? -12.239 96.918  1.470   0.25 24.29 ? 102 SER A N   1 
ATOM   706   C  CA  . SER A 1 102 ? -12.642 97.840  2.529   0.25 22.72 ? 102 SER A CA  1 
ATOM   707   C  C   . SER A 1 102 ? -11.584 98.894  2.872   0.25 21.91 ? 102 SER A C   1 
ATOM   708   O  O   . SER A 1 102 ? -11.709 99.612  3.864   0.25 22.71 ? 102 SER A O   1 
ATOM   709   C  CB  . SER A 1 102 ? -13.011 97.050  3.787   0.25 23.42 ? 102 SER A CB  1 
ATOM   710   O  OG  . SER A 1 102 ? -11.966 96.170  4.153   0.25 25.07 ? 102 SER A OG  1 
ATOM   711   N  N   . GLY A 1 103 ? -10.540 98.982  2.055   0.25 18.73 ? 103 GLY A N   1 
ATOM   712   C  CA  . GLY A 1 103 ? -9.499  99.965  2.296   0.25 17.66 ? 103 GLY A CA  1 
ATOM   713   C  C   . GLY A 1 103 ? -8.497  99.573  3.366   0.25 16.19 ? 103 GLY A C   1 
ATOM   714   O  O   . GLY A 1 103 ? -7.612  100.363 3.713   0.25 16.54 ? 103 GLY A O   1 
HETATM 715   N  N   . MSE A 1 104 ? -8.626  98.358  3.894   0.25 13.73 ? 104 MSE A N   1 
HETATM 716   C  CA  . MSE A 1 104 ? -7.713  97.892  4.929   0.25 13.05 ? 104 MSE A CA  1 
HETATM 717   C  C   . MSE A 1 104 ? -6.297  97.864  4.370   0.25 12.45 ? 104 MSE A C   1 
HETATM 718   O  O   . MSE A 1 104 ? -5.408  98.545  4.879   0.25 12.61 ? 104 MSE A O   1 
HETATM 719   C  CB  . MSE A 1 104 ? -8.126  96.498  5.412   0.25 14.13 ? 104 MSE A CB  1 
HETATM 720   C  CG  . MSE A 1 104 ? -9.485  96.444  6.119   0.25 13.43 ? 104 MSE A CG  1 
HETATM 721   SE SE  . MSE A 1 104 ? -9.509  97.243  7.899   0.25 18.58 ? 104 MSE A SE  1 
HETATM 722   C  CE  . MSE A 1 104 ? -10.955 98.519  7.654   0.25 15.85 ? 104 MSE A CE  1 
ATOM   723   N  N   . TYR A 1 105 ? -6.093  97.072  3.324   0.25 10.50 ? 105 TYR A N   1 
ATOM   724   C  CA  . TYR A 1 105 ? -4.784  96.971  2.683   0.25 10.59 ? 105 TYR A CA  1 
ATOM   725   C  C   . TYR A 1 105 ? -4.908  97.297  1.209   0.25 9.63  ? 105 TYR A C   1 
ATOM   726   O  O   . TYR A 1 105 ? -5.985  97.178  0.627   0.25 8.71  ? 105 TYR A O   1 
ATOM   727   C  CB  . TYR A 1 105 ? -4.203  95.557  2.803   0.25 8.94  ? 105 TYR A CB  1 
ATOM   728   C  CG  . TYR A 1 105 ? -3.666  95.201  4.169   0.25 8.93  ? 105 TYR A CG  1 
ATOM   729   C  CD1 . TYR A 1 105 ? -4.491  94.635  5.139   0.25 10.67 ? 105 TYR A CD1 1 
ATOM   730   C  CD2 . TYR A 1 105 ? -2.327  95.427  4.491   0.25 9.86  ? 105 TYR A CD2 1 
ATOM   731   C  CE1 . TYR A 1 105 ? -4.001  94.301  6.396   0.25 10.16 ? 105 TYR A CE1 1 
ATOM   732   C  CE2 . TYR A 1 105 ? -1.825  95.095  5.748   0.25 10.79 ? 105 TYR A CE2 1 
ATOM   733   C  CZ  . TYR A 1 105 ? -2.669  94.533  6.693   0.25 9.14  ? 105 TYR A CZ  1 
ATOM   734   O  OH  . TYR A 1 105 ? -2.187  94.208  7.942   0.25 12.40 ? 105 TYR A OH  1 
ATOM   735   N  N   . VAL A 1 106 ? -3.799  97.721  0.617   0.25 8.36  ? 106 VAL A N   1 
ATOM   736   C  CA  . VAL A 1 106 ? -3.753  98.014  -0.802  0.25 8.26  ? 106 VAL A CA  1 
ATOM   737   C  C   . VAL A 1 106 ? -2.760  97.003  -1.366  0.25 7.84  ? 106 VAL A C   1 
ATOM   738   O  O   . VAL A 1 106 ? -1.851  96.562  -0.655  0.25 7.59  ? 106 VAL A O   1 
ATOM   739   C  CB  . VAL A 1 106 ? -3.248  99.460  -1.081  0.25 9.87  ? 106 VAL A CB  1 
ATOM   740   C  CG1 . VAL A 1 106 ? -1.804  99.612  -0.636  0.25 10.80 ? 106 VAL A CG1 1 
ATOM   741   C  CG2 . VAL A 1 106 ? -3.385  99.786  -2.581  0.25 10.40 ? 106 VAL A CG2 1 
ATOM   742   N  N   . VAL A 1 107 ? -2.959  96.607  -2.619  0.25 3.85  ? 107 VAL A N   1 
ATOM   743   C  CA  . VAL A 1 107 ? -2.056  95.669  -3.276  0.25 6.68  ? 107 VAL A CA  1 
ATOM   744   C  C   . VAL A 1 107 ? -0.755  96.381  -3.650  0.25 7.25  ? 107 VAL A C   1 
ATOM   745   O  O   . VAL A 1 107 ? -0.773  97.528  -4.081  0.25 6.19  ? 107 VAL A O   1 
ATOM   746   C  CB  . VAL A 1 107 ? -2.663  95.120  -4.591  0.25 5.69  ? 107 VAL A CB  1 
ATOM   747   C  CG1 . VAL A 1 107 ? -1.638  94.238  -5.300  0.25 8.80  ? 107 VAL A CG1 1 
ATOM   748   C  CG2 . VAL A 1 107 ? -3.939  94.314  -4.307  0.25 7.07  ? 107 VAL A CG2 1 
ATOM   749   N  N   . ILE A 1 108 ? 0.374   95.705  -3.480  0.25 6.52  ? 108 ILE A N   1 
ATOM   750   C  CA  . ILE A 1 108 ? 1.650   96.294  -3.865  0.25 6.38  ? 108 ILE A CA  1 
ATOM   751   C  C   . ILE A 1 108 ? 2.495   95.262  -4.584  0.25 7.37  ? 108 ILE A C   1 
ATOM   752   O  O   . ILE A 1 108 ? 2.285   94.061  -4.438  0.25 7.97  ? 108 ILE A O   1 
ATOM   753   C  CB  . ILE A 1 108 ? 2.489   96.800  -2.656  0.25 7.29  ? 108 ILE A CB  1 
ATOM   754   C  CG1 . ILE A 1 108 ? 2.610   95.703  -1.593  0.25 3.24  ? 108 ILE A CG1 1 
ATOM   755   C  CG2 . ILE A 1 108 ? 1.888   98.075  -2.082  0.25 3.05  ? 108 ILE A CG2 1 
ATOM   756   C  CD1 . ILE A 1 108 ? 3.595   96.060  -0.477  0.25 9.10  ? 108 ILE A CD1 1 
ATOM   757   N  N   . GLU A 1 109 ? 3.433   95.745  -5.387  0.25 9.14  ? 109 GLU A N   1 
ATOM   758   C  CA  . GLU A 1 109 ? 4.368   94.876  -6.080  0.25 10.05 ? 109 GLU A CA  1 
ATOM   759   C  C   . GLU A 1 109 ? 5.679   95.176  -5.381  0.25 9.86  ? 109 GLU A C   1 
ATOM   760   O  O   . GLU A 1 109 ? 6.012   96.340  -5.154  0.25 8.97  ? 109 GLU A O   1 
ATOM   761   C  CB  . GLU A 1 109 ? 4.487   95.243  -7.556  0.25 11.80 ? 109 GLU A CB  1 
ATOM   762   C  CG  . GLU A 1 109 ? 5.645   94.554  -8.260  0.25 13.31 ? 109 GLU A CG  1 
ATOM   763   C  CD  . GLU A 1 109 ? 5.724   94.906  -9.736  0.25 16.22 ? 109 GLU A CD  1 
ATOM   764   O  OE1 . GLU A 1 109 ? 4.843   94.471  -10.506 0.25 14.51 ? 109 GLU A OE1 1 
ATOM   765   O  OE2 . GLU A 1 109 ? 6.663   95.628  -10.126 0.25 17.98 ? 109 GLU A OE2 1 
ATOM   766   N  N   . VAL A 1 110 ? 6.411   94.130  -5.019  0.25 9.84  ? 110 VAL A N   1 
ATOM   767   C  CA  . VAL A 1 110 ? 7.687   94.307  -4.346  0.25 10.38 ? 110 VAL A CA  1 
ATOM   768   C  C   . VAL A 1 110 ? 8.773   93.496  -5.026  0.25 10.88 ? 110 VAL A C   1 
ATOM   769   O  O   . VAL A 1 110 ? 8.509   92.481  -5.664  0.25 12.71 ? 110 VAL A O   1 
ATOM   770   C  CB  . VAL A 1 110 ? 7.629   93.857  -2.872  0.25 10.18 ? 110 VAL A CB  1 
ATOM   771   C  CG1 . VAL A 1 110 ? 6.614   94.686  -2.107  0.25 7.90  ? 110 VAL A CG1 1 
ATOM   772   C  CG2 . VAL A 1 110 ? 7.293   92.377  -2.798  0.25 10.75 ? 110 VAL A CG2 1 
ATOM   773   N  N   . LYS A 1 111 ? 10.003  93.965  -4.887  0.25 12.96 ? 111 LYS A N   1 
ATOM   774   C  CA  . LYS A 1 111 ? 11.143  93.277  -5.453  0.25 13.64 ? 111 LYS A CA  1 
ATOM   775   C  C   . LYS A 1 111 ? 12.045  92.961  -4.282  0.25 14.07 ? 111 LYS A C   1 
ATOM   776   O  O   . LYS A 1 111 ? 12.662  93.858  -3.704  0.25 14.49 ? 111 LYS A O   1 
ATOM   777   C  CB  . LYS A 1 111 ? 11.851  94.165  -6.477  0.25 15.80 ? 111 LYS A CB  1 
ATOM   778   C  CG  . LYS A 1 111 ? 10.987  94.439  -7.702  0.25 15.79 ? 111 LYS A CG  1 
ATOM   779   C  CD  . LYS A 1 111 ? 11.767  95.086  -8.828  0.25 21.30 ? 111 LYS A CD  1 
ATOM   780   C  CE  . LYS A 1 111 ? 10.923  95.129  -10.097 0.25 20.94 ? 111 LYS A CE  1 
ATOM   781   N  NZ  . LYS A 1 111 ? 11.652  95.685  -11.262 0.25 23.84 ? 111 LYS A NZ  1 
ATOM   782   N  N   . VAL A 1 112 ? 12.075  91.682  -3.916  0.25 14.18 ? 112 VAL A N   1 
ATOM   783   C  CA  . VAL A 1 112 ? 12.886  91.198  -2.807  0.25 13.41 ? 112 VAL A CA  1 
ATOM   784   C  C   . VAL A 1 112 ? 13.950  90.242  -3.338  0.25 15.08 ? 112 VAL A C   1 
ATOM   785   O  O   . VAL A 1 112 ? 13.985  89.951  -4.531  0.25 12.81 ? 112 VAL A O   1 
ATOM   786   C  CB  . VAL A 1 112 ? 12.018  90.465  -1.768  0.25 12.47 ? 112 VAL A CB  1 
ATOM   787   C  CG1 . VAL A 1 112 ? 10.989  91.432  -1.179  0.25 12.86 ? 112 VAL A CG1 1 
ATOM   788   C  CG2 . VAL A 1 112 ? 11.312  89.287  -2.420  0.25 11.86 ? 112 VAL A CG2 1 
ATOM   789   N  N   . ALA A 1 113 ? 14.811  89.750  -2.452  0.25 15.50 ? 113 ALA A N   1 
ATOM   790   C  CA  . ALA A 1 113 ? 15.877  88.843  -2.864  0.25 15.44 ? 113 ALA A CA  1 
ATOM   791   C  C   . ALA A 1 113 ? 16.302  87.898  -1.753  0.25 15.09 ? 113 ALA A C   1 
ATOM   792   O  O   . ALA A 1 113 ? 16.468  88.308  -0.605  0.25 15.75 ? 113 ALA A O   1 
ATOM   793   C  CB  . ALA A 1 113 ? 17.079  89.642  -3.338  0.25 15.50 ? 113 ALA A CB  1 
ATOM   794   N  N   . THR A 1 114 ? 16.490  86.632  -2.110  0.25 15.46 ? 114 THR A N   1 
ATOM   795   C  CA  . THR A 1 114 ? 16.910  85.610  -1.161  0.25 16.81 ? 114 THR A CA  1 
ATOM   796   C  C   . THR A 1 114 ? 18.282  85.990  -0.610  0.25 18.46 ? 114 THR A C   1 
ATOM   797   O  O   . THR A 1 114 ? 18.907  86.936  -1.089  0.25 16.15 ? 114 THR A O   1 
ATOM   798   C  CB  . THR A 1 114 ? 17.032  84.244  -1.847  0.25 16.15 ? 114 THR A CB  1 
ATOM   799   O  OG1 . THR A 1 114 ? 18.275  84.177  -2.559  0.25 16.59 ? 114 THR A OG1 1 
ATOM   800   C  CG2 . THR A 1 114 ? 15.893  84.052  -2.837  0.25 17.52 ? 114 THR A CG2 1 
ATOM   801   N  N   . GLN A 1 115 ? 18.750  85.247  0.388   0.25 19.59 ? 115 GLN A N   1 
ATOM   802   C  CA  . GLN A 1 115 ? 20.050  85.522  0.984   0.25 22.33 ? 115 GLN A CA  1 
ATOM   803   C  C   . GLN A 1 115 ? 21.190  85.223  0.012   0.25 21.99 ? 115 GLN A C   1 
ATOM   804   O  O   . GLN A 1 115 ? 22.349  85.532  0.293   0.25 20.37 ? 115 GLN A O   1 
ATOM   805   C  CB  . GLN A 1 115 ? 20.228  84.716  2.278   0.25 25.82 ? 115 GLN A CB  1 
ATOM   806   C  CG  . GLN A 1 115 ? 19.217  85.078  3.359   0.25 29.93 ? 115 GLN A CG  1 
ATOM   807   C  CD  . GLN A 1 115 ? 19.499  84.406  4.693   0.25 31.98 ? 115 GLN A CD  1 
ATOM   808   O  OE1 . GLN A 1 115 ? 20.517  84.669  5.334   0.25 34.72 ? 115 GLN A OE1 1 
ATOM   809   N  NE2 . GLN A 1 115 ? 18.592  83.534  5.118   0.25 35.48 ? 115 GLN A NE2 1 
ATOM   810   N  N   . GLU A 1 116 ? 20.858  84.621  -1.128  0.25 21.61 ? 116 GLU A N   1 
ATOM   811   C  CA  . GLU A 1 116 ? 21.857  84.308  -2.148  0.25 23.31 ? 116 GLU A CA  1 
ATOM   812   C  C   . GLU A 1 116 ? 22.036  85.492  -3.096  0.25 21.40 ? 116 GLU A C   1 
ATOM   813   O  O   . GLU A 1 116 ? 22.901  85.477  -3.970  0.25 21.78 ? 116 GLU A O   1 
ATOM   814   C  CB  . GLU A 1 116 ? 21.437  83.081  -2.958  0.25 26.76 ? 116 GLU A CB  1 
ATOM   815   C  CG  . GLU A 1 116 ? 22.284  81.849  -2.700  0.25 31.43 ? 116 GLU A CG  1 
ATOM   816   C  CD  . GLU A 1 116 ? 22.175  81.357  -1.277  0.25 33.17 ? 116 GLU A CD  1 
ATOM   817   O  OE1 . GLU A 1 116 ? 21.088  80.874  -0.900  0.25 34.05 ? 116 GLU A OE1 1 
ATOM   818   O  OE2 . GLU A 1 116 ? 23.175  81.456  -0.537  0.25 33.51 ? 116 GLU A OE2 1 
ATOM   819   N  N   . GLY A 1 117 ? 21.202  86.512  -2.927  0.25 20.80 ? 117 GLY A N   1 
ATOM   820   C  CA  . GLY A 1 117 ? 21.296  87.684  -3.779  0.25 20.88 ? 117 GLY A CA  1 
ATOM   821   C  C   . GLY A 1 117 ? 20.436  87.597  -5.026  0.25 21.10 ? 117 GLY A C   1 
ATOM   822   O  O   . GLY A 1 117 ? 20.613  88.382  -5.959  0.25 22.00 ? 117 GLY A O   1 
ATOM   823   N  N   . LYS A 1 118 ? 19.508  86.645  -5.052  0.25 21.36 ? 118 LYS A N   1 
ATOM   824   C  CA  . LYS A 1 118 ? 18.623  86.492  -6.201  0.25 24.03 ? 118 LYS A CA  1 
ATOM   825   C  C   . LYS A 1 118 ? 17.350  87.310  -5.991  0.25 24.20 ? 118 LYS A C   1 
ATOM   826   O  O   . LYS A 1 118 ? 16.594  87.075  -5.044  0.25 22.25 ? 118 LYS A O   1 
ATOM   827   C  CB  . LYS A 1 118 ? 18.260  85.020  -6.410  0.25 27.69 ? 118 LYS A CB  1 
ATOM   828   C  CG  . LYS A 1 118 ? 17.355  84.792  -7.613  0.25 33.23 ? 118 LYS A CG  1 
ATOM   829   C  CD  . LYS A 1 118 ? 16.907  83.341  -7.718  0.25 37.26 ? 118 LYS A CD  1 
ATOM   830   C  CE  . LYS A 1 118 ? 15.921  83.159  -8.865  0.25 40.24 ? 118 LYS A CE  1 
ATOM   831   N  NZ  . LYS A 1 118 ? 15.441  81.755  -8.981  0.25 44.35 ? 118 LYS A NZ  1 
ATOM   832   N  N   . GLU A 1 119 ? 17.122  88.270  -6.881  0.25 23.28 ? 119 GLU A N   1 
ATOM   833   C  CA  . GLU A 1 119 ? 15.958  89.136  -6.795  0.25 25.03 ? 119 GLU A CA  1 
ATOM   834   C  C   . GLU A 1 119 ? 14.703  88.435  -7.298  0.25 22.54 ? 119 GLU A C   1 
ATOM   835   O  O   . GLU A 1 119 ? 14.757  87.636  -8.228  0.25 20.90 ? 119 GLU A O   1 
ATOM   836   C  CB  . GLU A 1 119 ? 16.212  90.421  -7.591  0.25 27.92 ? 119 GLU A CB  1 
ATOM   837   C  CG  . GLU A 1 119 ? 15.126  91.470  -7.456  0.25 32.83 ? 119 GLU A CG  1 
ATOM   838   C  CD  . GLU A 1 119 ? 15.602  92.851  -7.877  0.25 35.17 ? 119 GLU A CD  1 
ATOM   839   O  OE1 . GLU A 1 119 ? 16.503  93.398  -7.206  0.25 37.24 ? 119 GLU A OE1 1 
ATOM   840   O  OE2 . GLU A 1 119 ? 15.079  93.387  -8.877  0.25 35.63 ? 119 GLU A OE2 1 
ATOM   841   N  N   . ILE A 1 120 ? 13.573  88.741  -6.671  0.25 21.77 ? 120 ILE A N   1 
ATOM   842   C  CA  . ILE A 1 120 ? 12.295  88.140  -7.033  0.25 20.85 ? 120 ILE A CA  1 
ATOM   843   C  C   . ILE A 1 120 ? 11.195  89.200  -6.948  0.25 19.72 ? 120 ILE A C   1 
ATOM   844   O  O   . ILE A 1 120 ? 11.205  90.038  -6.042  0.25 19.34 ? 120 ILE A O   1 
ATOM   845   C  CB  . ILE A 1 120 ? 11.949  86.983  -6.063  0.25 22.74 ? 120 ILE A CB  1 
ATOM   846   C  CG1 . ILE A 1 120 ? 13.091  85.968  -6.040  0.25 24.41 ? 120 ILE A CG1 1 
ATOM   847   C  CG2 . ILE A 1 120 ? 10.652  86.313  -6.479  0.25 23.24 ? 120 ILE A CG2 1 
ATOM   848   C  CD1 . ILE A 1 120 ? 12.974  84.948  -4.942  0.25 27.02 ? 120 ILE A CD1 1 
ATOM   849   N  N   . THR A 1 121 ? 10.257  89.162  -7.893  0.25 15.63 ? 121 THR A N   1 
ATOM   850   C  CA  . THR A 1 121 ? 9.148   90.112  -7.912  0.25 15.07 ? 121 THR A CA  1 
ATOM   851   C  C   . THR A 1 121 ? 7.934   89.456  -7.261  0.25 15.03 ? 121 THR A C   1 
ATOM   852   O  O   . THR A 1 121 ? 7.538   88.350  -7.634  0.25 14.48 ? 121 THR A O   1 
ATOM   853   C  CB  . THR A 1 121 ? 8.792   90.534  -9.355  0.25 14.29 ? 121 THR A CB  1 
ATOM   854   O  OG1 . THR A 1 121 ? 9.944   91.105  -9.979  0.25 9.49  ? 121 THR A OG1 1 
ATOM   855   C  CG2 . THR A 1 121 ? 7.677   91.570  -9.358  0.25 11.91 ? 121 THR A CG2 1 
ATOM   856   N  N   . CYS A 1 122 ? 7.339   90.139  -6.288  0.25 13.64 ? 122 CYS A N   1 
ATOM   857   C  CA  . CYS A 1 122 ? 6.192   89.578  -5.585  0.25 12.62 ? 122 CYS A CA  1 
ATOM   858   C  C   . CYS A 1 122 ? 5.006   90.511  -5.430  0.25 12.05 ? 122 CYS A C   1 
ATOM   859   O  O   . CYS A 1 122 ? 5.074   91.707  -5.712  0.25 11.55 ? 122 CYS A O   1 
ATOM   860   C  CB  . CYS A 1 122 ? 6.604   89.131  -4.182  0.25 13.80 ? 122 CYS A CB  1 
ATOM   861   S  SG  . CYS A 1 122 ? 7.968   87.958  -4.120  0.25 16.82 ? 122 CYS A SG  1 
ATOM   862   N  N   . ARG A 1 123 ? 3.912   89.928  -4.958  0.25 11.13 ? 123 ARG A N   1 
ATOM   863   C  CA  . ARG A 1 123 ? 2.698   90.663  -4.677  0.25 9.71  ? 123 ARG A CA  1 
ATOM   864   C  C   . ARG A 1 123 ? 2.667   90.689  -3.146  0.25 9.85  ? 123 ARG A C   1 
ATOM   865   O  O   . ARG A 1 123 ? 2.974   89.683  -2.500  0.25 5.55  ? 123 ARG A O   1 
ATOM   866   C  CB  . ARG A 1 123 ? 1.488   89.898  -5.212  0.25 12.24 ? 123 ARG A CB  1 
ATOM   867   C  CG  . ARG A 1 123 ? 0.155   90.609  -5.043  0.25 12.51 ? 123 ARG A CG  1 
ATOM   868   C  CD  . ARG A 1 123 ? -0.983  89.660  -5.380  0.25 9.72  ? 123 ARG A CD  1 
ATOM   869   N  NE  . ARG A 1 123 ? -2.280  90.329  -5.446  0.25 11.90 ? 123 ARG A NE  1 
ATOM   870   C  CZ  . ARG A 1 123 ? -2.669  91.099  -6.455  0.25 12.07 ? 123 ARG A CZ  1 
ATOM   871   N  NH1 . ARG A 1 123 ? -1.860  91.302  -7.487  0.25 12.69 ? 123 ARG A NH1 1 
ATOM   872   N  NH2 . ARG A 1 123 ? -3.871  91.657  -6.438  0.25 14.50 ? 123 ARG A NH2 1 
ATOM   873   N  N   . SER A 1 124 ? 2.335   91.835  -2.563  0.25 7.86  ? 124 SER A N   1 
ATOM   874   C  CA  . SER A 1 124 ? 2.258   91.931  -1.113  0.25 6.46  ? 124 SER A CA  1 
ATOM   875   C  C   . SER A 1 124 ? 1.160   92.918  -0.719  0.25 6.64  ? 124 SER A C   1 
ATOM   876   O  O   . SER A 1 124 ? 0.284   93.235  -1.527  0.25 7.10  ? 124 SER A O   1 
ATOM   877   C  CB  . SER A 1 124 ? 3.606   92.364  -0.527  0.25 3.56  ? 124 SER A CB  1 
ATOM   878   O  OG  . SER A 1 124 ? 3.662   92.064  0.862   0.25 2.90  ? 124 SER A OG  1 
ATOM   879   N  N   . TYR A 1 125 ? 1.204   93.416  0.510   0.25 4.89  ? 125 TYR A N   1 
ATOM   880   C  CA  . TYR A 1 125 ? 0.163   94.331  0.968   0.25 8.46  ? 125 TYR A CA  1 
ATOM   881   C  C   . TYR A 1 125 ? 0.661   95.296  2.032   0.25 7.72  ? 125 TYR A C   1 
ATOM   882   O  O   . TYR A 1 125 ? 1.552   94.962  2.810   0.25 9.46  ? 125 TYR A O   1 
ATOM   883   C  CB  . TYR A 1 125 ? -1.006  93.526  1.561   0.25 5.77  ? 125 TYR A CB  1 
ATOM   884   C  CG  . TYR A 1 125 ? -1.661  92.557  0.598   0.25 9.03  ? 125 TYR A CG  1 
ATOM   885   C  CD1 . TYR A 1 125 ? -2.745  92.949  -0.192  0.25 5.29  ? 125 TYR A CD1 1 
ATOM   886   C  CD2 . TYR A 1 125 ? -1.180  91.250  0.462   0.25 8.21  ? 125 TYR A CD2 1 
ATOM   887   C  CE1 . TYR A 1 125 ? -3.339  92.058  -1.099  0.25 7.25  ? 125 TYR A CE1 1 
ATOM   888   C  CE2 . TYR A 1 125 ? -1.762  90.356  -0.441  0.25 9.21  ? 125 TYR A CE2 1 
ATOM   889   C  CZ  . TYR A 1 125 ? -2.836  90.766  -1.214  0.25 8.10  ? 125 TYR A CZ  1 
ATOM   890   O  OH  . TYR A 1 125 ? -3.395  89.888  -2.109  0.25 10.40 ? 125 TYR A OH  1 
ATOM   891   N  N   . LEU A 1 126 ? 0.083   96.494  2.058   0.25 8.48  ? 126 LEU A N   1 
ATOM   892   C  CA  . LEU A 1 126 ? 0.418   97.485  3.083   0.25 8.77  ? 126 LEU A CA  1 
ATOM   893   C  C   . LEU A 1 126 ? -0.715  98.491  3.217   0.25 9.73  ? 126 LEU A C   1 
ATOM   894   O  O   . LEU A 1 126 ? -1.402  98.802  2.241   0.25 8.93  ? 126 LEU A O   1 
ATOM   895   C  CB  . LEU A 1 126 ? 1.754   98.189  2.775   0.25 7.79  ? 126 LEU A CB  1 
ATOM   896   C  CG  . LEU A 1 126 ? 2.052   98.803  1.404   0.25 8.28  ? 126 LEU A CG  1 
ATOM   897   C  CD1 . LEU A 1 126 ? 1.253   100.085 1.197   0.25 6.54  ? 126 LEU A CD1 1 
ATOM   898   C  CD2 . LEU A 1 126 ? 3.542   99.096  1.324   0.25 7.39  ? 126 LEU A CD2 1 
HETATM 899   N  N   . MSE A 1 127 ? -0.934  98.974  4.436   0.25 9.06  ? 127 MSE A N   1 
HETATM 900   C  CA  . MSE A 1 127 ? -1.991  99.943  4.688   0.25 10.15 ? 127 MSE A CA  1 
HETATM 901   C  C   . MSE A 1 127 ? -1.489  101.349 4.385   0.25 9.06  ? 127 MSE A C   1 
HETATM 902   O  O   . MSE A 1 127 ? -0.329  101.663 4.645   0.25 8.18  ? 127 MSE A O   1 
HETATM 903   C  CB  . MSE A 1 127 ? -2.446  99.855  6.145   0.25 11.45 ? 127 MSE A CB  1 
HETATM 904   C  CG  . MSE A 1 127 ? -2.865  98.458  6.557   0.25 11.22 ? 127 MSE A CG  1 
HETATM 905   SE SE  . MSE A 1 127 ? -3.660  98.453  8.300   0.25 11.75 ? 127 MSE A SE  1 
HETATM 906   C  CE  . MSE A 1 127 ? -2.058  98.805  9.294   0.25 8.67  ? 127 MSE A CE  1 
ATOM   907   N  N   . THR A 1 128 ? -2.366  102.190 3.845   0.25 8.29  ? 128 THR A N   1 
ATOM   908   C  CA  . THR A 1 128 ? -1.993  103.553 3.491   0.25 9.28  ? 128 THR A CA  1 
ATOM   909   C  C   . THR A 1 128 ? -2.526  104.597 4.467   0.25 12.43 ? 128 THR A C   1 
ATOM   910   O  O   . THR A 1 128 ? -2.060  105.736 4.481   0.25 16.23 ? 128 THR A O   1 
ATOM   911   C  CB  . THR A 1 128 ? -2.497  103.909 2.079   0.25 8.86  ? 128 THR A CB  1 
ATOM   912   O  OG1 . THR A 1 128 ? -3.930  103.876 2.066   0.25 8.86  ? 128 THR A OG1 1 
ATOM   913   C  CG2 . THR A 1 128 ? -1.959  102.914 1.046   0.25 7.85  ? 128 THR A CG2 1 
ATOM   914   N  N   . ASN A 1 129 ? -3.499  104.205 5.281   0.25 12.75 ? 129 ASN A N   1 
ATOM   915   C  CA  . ASN A 1 129 ? -4.104  105.108 6.255   0.25 13.62 ? 129 ASN A CA  1 
ATOM   916   C  C   . ASN A 1 129 ? -4.242  104.368 7.576   0.25 14.02 ? 129 ASN A C   1 
ATOM   917   O  O   . ASN A 1 129 ? -5.165  103.569 7.752   0.25 14.66 ? 129 ASN A O   1 
ATOM   918   C  CB  . ASN A 1 129 ? -5.491  105.555 5.779   0.25 12.83 ? 129 ASN A CB  1 
ATOM   919   C  CG  . ASN A 1 129 ? -6.101  106.630 6.671   0.25 16.95 ? 129 ASN A CG  1 
ATOM   920   O  OD1 . ASN A 1 129 ? -5.773  106.729 7.852   0.25 12.24 ? 129 ASN A OD1 1 
ATOM   921   N  ND2 . ASN A 1 129 ? -7.006  107.428 6.110   0.25 14.84 ? 129 ASN A ND2 1 
ATOM   922   N  N   . TYR A 1 130 ? -3.327  104.624 8.505   0.25 11.67 ? 130 TYR A N   1 
ATOM   923   C  CA  . TYR A 1 130 ? -3.385  103.943 9.787   0.25 13.97 ? 130 TYR A CA  1 
ATOM   924   C  C   . TYR A 1 130 ? -2.651  104.695 10.882  0.25 14.09 ? 130 TYR A C   1 
ATOM   925   O  O   . TYR A 1 130 ? -1.906  105.639 10.622  0.25 12.36 ? 130 TYR A O   1 
ATOM   926   C  CB  . TYR A 1 130 ? -2.782  102.539 9.678   0.25 11.31 ? 130 TYR A CB  1 
ATOM   927   C  CG  . TYR A 1 130 ? -1.268  102.526 9.727   0.25 13.54 ? 130 TYR A CG  1 
ATOM   928   C  CD1 . TYR A 1 130 ? -0.508  102.887 8.613   0.25 14.11 ? 130 TYR A CD1 1 
ATOM   929   C  CD2 . TYR A 1 130 ? -0.593  102.183 10.903  0.25 11.26 ? 130 TYR A CD2 1 
ATOM   930   C  CE1 . TYR A 1 130 ? 0.888   102.909 8.667   0.25 12.18 ? 130 TYR A CE1 1 
ATOM   931   C  CE2 . TYR A 1 130 ? 0.797   102.201 10.971  0.25 10.63 ? 130 TYR A CE2 1 
ATOM   932   C  CZ  . TYR A 1 130 ? 1.531   102.564 9.852   0.25 13.61 ? 130 TYR A CZ  1 
ATOM   933   O  OH  . TYR A 1 130 ? 2.905   102.574 9.918   0.25 15.38 ? 130 TYR A OH  1 
ATOM   934   N  N   . GLU A 1 131 ? -2.874  104.248 12.112  0.25 15.25 ? 131 GLU A N   1 
ATOM   935   C  CA  . GLU A 1 131 ? -2.232  104.827 13.280  0.25 17.63 ? 131 GLU A CA  1 
ATOM   936   C  C   . GLU A 1 131 ? -1.511  103.687 13.997  0.25 16.19 ? 131 GLU A C   1 
ATOM   937   O  O   . GLU A 1 131 ? -2.110  102.650 14.278  0.25 15.39 ? 131 GLU A O   1 
ATOM   938   C  CB  . GLU A 1 131 ? -3.276  105.460 14.207  0.25 20.62 ? 131 GLU A CB  1 
ATOM   939   C  CG  . GLU A 1 131 ? -4.094  106.575 13.560  0.25 24.96 ? 131 GLU A CG  1 
ATOM   940   C  CD  . GLU A 1 131 ? -5.098  107.197 14.516  0.25 26.89 ? 131 GLU A CD  1 
ATOM   941   O  OE1 . GLU A 1 131 ? -4.679  107.644 15.602  0.25 30.84 ? 131 GLU A OE1 1 
ATOM   942   O  OE2 . GLU A 1 131 ? -6.304  107.245 14.187  0.25 32.06 ? 131 GLU A OE2 1 
ATOM   943   N  N   . SER A 1 132 ? -0.225  103.883 14.269  0.25 16.08 ? 132 SER A N   1 
ATOM   944   C  CA  . SER A 1 132 ? 0.591   102.889 14.948  0.25 16.72 ? 132 SER A CA  1 
ATOM   945   C  C   . SER A 1 132 ? -0.080  102.363 16.213  0.25 16.90 ? 132 SER A C   1 
ATOM   946   O  O   . SER A 1 132 ? -0.681  103.117 16.977  0.25 16.88 ? 132 SER A O   1 
ATOM   947   C  CB  . SER A 1 132 ? 1.957   103.484 15.302  0.25 19.02 ? 132 SER A CB  1 
ATOM   948   O  OG  . SER A 1 132 ? 2.671   103.845 14.131  0.25 18.31 ? 132 SER A OG  1 
ATOM   949   N  N   . ALA A 1 133 ? 0.031   101.058 16.423  0.25 17.04 ? 133 ALA A N   1 
ATOM   950   C  CA  . ALA A 1 133 ? -0.560  100.415 17.589  0.25 16.83 ? 133 ALA A CA  1 
ATOM   951   C  C   . ALA A 1 133 ? 0.134   99.078  17.778  0.25 16.58 ? 133 ALA A C   1 
ATOM   952   O  O   . ALA A 1 133 ? 0.296   98.315  16.823  0.25 15.80 ? 133 ALA A O   1 
ATOM   953   C  CB  . ALA A 1 133 ? -2.058  100.206 17.373  0.25 18.38 ? 133 ALA A CB  1 
ATOM   954   N  N   . PRO A 1 134 ? 0.564   98.777  19.013  0.25 15.44 ? 134 PRO A N   1 
ATOM   955   C  CA  . PRO A 1 134 ? 1.242   97.503  19.254  0.25 14.40 ? 134 PRO A CA  1 
ATOM   956   C  C   . PRO A 1 134 ? 0.370   96.281  19.000  0.25 13.32 ? 134 PRO A C   1 
ATOM   957   O  O   . PRO A 1 134 ? -0.861  96.339  19.110  0.25 13.16 ? 134 PRO A O   1 
ATOM   958   C  CB  . PRO A 1 134 ? 1.694   97.618  20.711  0.25 13.89 ? 134 PRO A CB  1 
ATOM   959   C  CG  . PRO A 1 134 ? 0.662   98.532  21.316  0.25 17.04 ? 134 PRO A CG  1 
ATOM   960   C  CD  . PRO A 1 134 ? 0.490   99.579  20.248  0.25 14.57 ? 134 PRO A CD  1 
ATOM   961   N  N   . PRO A 1 135 ? 1.003   95.156  18.638  0.25 12.36 ? 135 PRO A N   1 
ATOM   962   C  CA  . PRO A 1 135 ? 0.300   93.904  18.363  0.25 11.56 ? 135 PRO A CA  1 
ATOM   963   C  C   . PRO A 1 135 ? -0.065  93.169  19.643  0.25 13.92 ? 135 PRO A C   1 
ATOM   964   O  O   . PRO A 1 135 ? 0.557   93.368  20.694  0.25 12.52 ? 135 PRO A O   1 
ATOM   965   C  CB  . PRO A 1 135 ? 1.308   93.126  17.535  0.25 11.03 ? 135 PRO A CB  1 
ATOM   966   C  CG  . PRO A 1 135 ? 2.607   93.528  18.159  0.25 13.32 ? 135 PRO A CG  1 
ATOM   967   C  CD  . PRO A 1 135 ? 2.442   95.025  18.332  0.25 12.66 ? 135 PRO A CD  1 
ATOM   968   N  N   . SER A 1 136 ? -1.082  92.323  19.556  0.25 13.48 ? 136 SER A N   1 
ATOM   969   C  CA  . SER A 1 136 ? -1.497  91.540  20.707  0.25 14.31 ? 136 SER A CA  1 
ATOM   970   C  C   . SER A 1 136 ? -0.428  90.473  20.926  0.25 15.93 ? 136 SER A C   1 
ATOM   971   O  O   . SER A 1 136 ? 0.295   90.107  19.992  0.25 13.42 ? 136 SER A O   1 
ATOM   972   C  CB  . SER A 1 136 ? -2.837  90.866  20.424  0.25 15.38 ? 136 SER A CB  1 
ATOM   973   O  OG  . SER A 1 136 ? -2.723  89.985  19.321  0.25 13.28 ? 136 SER A OG  1 
ATOM   974   N  N   . PRO A 1 137 ? -0.298  89.969  22.166  0.25 15.22 ? 137 PRO A N   1 
ATOM   975   C  CA  . PRO A 1 137 ? 0.713   88.938  22.399  0.25 14.72 ? 137 PRO A CA  1 
ATOM   976   C  C   . PRO A 1 137 ? 0.476   87.727  21.497  0.25 14.93 ? 137 PRO A C   1 
ATOM   977   O  O   . PRO A 1 137 ? 1.414   87.013  21.159  0.25 14.15 ? 137 PRO A O   1 
ATOM   978   C  CB  . PRO A 1 137 ? 0.530   88.599  23.879  0.25 15.10 ? 137 PRO A CB  1 
ATOM   979   C  CG  . PRO A 1 137 ? 0.114   89.909  24.469  0.25 14.34 ? 137 PRO A CG  1 
ATOM   980   C  CD  . PRO A 1 137 ? -0.901  90.409  23.438  0.25 14.79 ? 137 PRO A CD  1 
ATOM   981   N  N   . GLN A 1 138 ? -0.775  87.498  21.098  0.25 13.97 ? 138 GLN A N   1 
ATOM   982   C  CA  . GLN A 1 138 ? -1.081  86.356  20.244  0.25 13.27 ? 138 GLN A CA  1 
ATOM   983   C  C   . GLN A 1 138 ? -0.637  86.567  18.797  0.25 13.79 ? 138 GLN A C   1 
ATOM   984   O  O   . GLN A 1 138 ? -0.123  85.646  18.157  0.25 14.87 ? 138 GLN A O   1 
ATOM   985   C  CB  . GLN A 1 138 ? -2.576  86.033  20.286  0.25 17.35 ? 138 GLN A CB  1 
ATOM   986   C  CG  . GLN A 1 138 ? -3.090  85.693  21.684  0.25 17.08 ? 138 GLN A CG  1 
ATOM   987   C  CD  . GLN A 1 138 ? -3.580  86.916  22.433  0.25 19.97 ? 138 GLN A CD  1 
ATOM   988   O  OE1 . GLN A 1 138 ? -3.068  88.019  22.242  0.25 18.85 ? 138 GLN A OE1 1 
ATOM   989   N  NE2 . GLN A 1 138 ? -4.571  86.725  23.301  0.25 19.17 ? 138 GLN A NE2 1 
ATOM   990   N  N   . TYR A 1 139 ? -0.842  87.775  18.285  0.25 12.92 ? 139 TYR A N   1 
ATOM   991   C  CA  . TYR A 1 139 ? -0.443  88.096  16.920  0.25 13.12 ? 139 TYR A CA  1 
ATOM   992   C  C   . TYR A 1 139 ? 1.072   87.986  16.857  0.25 14.00 ? 139 TYR A C   1 
ATOM   993   O  O   . TYR A 1 139 ? 1.627   87.438  15.905  0.25 12.48 ? 139 TYR A O   1 
ATOM   994   C  CB  . TYR A 1 139 ? -0.875  89.520  16.563  0.25 11.50 ? 139 TYR A CB  1 
ATOM   995   C  CG  . TYR A 1 139 ? -0.676  89.895  15.110  0.25 14.36 ? 139 TYR A CG  1 
ATOM   996   C  CD1 . TYR A 1 139 ? -1.230  89.123  14.087  0.25 12.19 ? 139 TYR A CD1 1 
ATOM   997   C  CD2 . TYR A 1 139 ? 0.018   91.052  14.761  0.25 13.10 ? 139 TYR A CD2 1 
ATOM   998   C  CE1 . TYR A 1 139 ? -1.102  89.501  12.743  0.25 13.57 ? 139 TYR A CE1 1 
ATOM   999   C  CE2 . TYR A 1 139 ? 0.152   91.440  13.425  0.25 14.38 ? 139 TYR A CE2 1 
ATOM   1000  C  CZ  . TYR A 1 139 ? -0.411  90.659  12.425  0.25 13.85 ? 139 TYR A CZ  1 
ATOM   1001  O  OH  . TYR A 1 139 ? -0.276  91.035  11.114  0.25 11.94 ? 139 TYR A OH  1 
ATOM   1002  N  N   . LYS A 1 140 ? 1.741   88.496  17.888  0.25 12.99 ? 140 LYS A N   1 
ATOM   1003  C  CA  . LYS A 1 140 ? 3.196   88.436  17.929  0.25 14.20 ? 140 LYS A CA  1 
ATOM   1004  C  C   . LYS A 1 140 ? 3.718   87.000  17.916  0.25 14.30 ? 140 LYS A C   1 
ATOM   1005  O  O   . LYS A 1 140 ? 4.677   86.696  17.202  0.25 15.72 ? 140 LYS A O   1 
ATOM   1006  C  CB  . LYS A 1 140 ? 3.746   89.158  19.164  0.25 13.58 ? 140 LYS A CB  1 
ATOM   1007  C  CG  . LYS A 1 140 ? 5.258   89.031  19.287  0.25 14.26 ? 140 LYS A CG  1 
ATOM   1008  C  CD  . LYS A 1 140 ? 5.820   89.841  20.447  0.25 15.31 ? 140 LYS A CD  1 
ATOM   1009  C  CE  . LYS A 1 140 ? 7.281   89.490  20.681  0.25 13.85 ? 140 LYS A CE  1 
ATOM   1010  N  NZ  . LYS A 1 140 ? 7.858   90.205  21.852  0.25 16.27 ? 140 LYS A NZ  1 
ATOM   1011  N  N   . LYS A 1 141 ? 3.101   86.122  18.706  0.25 15.62 ? 141 LYS A N   1 
ATOM   1012  C  CA  . LYS A 1 141 ? 3.536   84.725  18.762  0.25 16.29 ? 141 LYS A CA  1 
ATOM   1013  C  C   . LYS A 1 141 ? 3.396   84.058  17.401  0.25 15.13 ? 141 LYS A C   1 
ATOM   1014  O  O   . LYS A 1 141 ? 4.214   83.222  17.025  0.25 13.73 ? 141 LYS A O   1 
ATOM   1015  C  CB  . LYS A 1 141 ? 2.723   83.928  19.792  0.25 18.02 ? 141 LYS A CB  1 
ATOM   1016  C  CG  . LYS A 1 141 ? 2.963   84.313  21.243  0.25 25.32 ? 141 LYS A CG  1 
ATOM   1017  C  CD  . LYS A 1 141 ? 2.312   83.307  22.191  0.25 29.45 ? 141 LYS A CD  1 
ATOM   1018  C  CE  . LYS A 1 141 ? 2.537   83.678  23.650  0.25 30.61 ? 141 LYS A CE  1 
ATOM   1019  N  NZ  . LYS A 1 141 ? 1.919   84.989  24.001  0.25 31.15 ? 141 LYS A NZ  1 
ATOM   1020  N  N   . ILE A 1 142 ? 2.353   84.428  16.667  0.25 13.47 ? 142 ILE A N   1 
ATOM   1021  C  CA  . ILE A 1 142 ? 2.114   83.852  15.344  0.25 13.24 ? 142 ILE A CA  1 
ATOM   1022  C  C   . ILE A 1 142 ? 3.288   84.127  14.408  0.25 13.34 ? 142 ILE A C   1 
ATOM   1023  O  O   . ILE A 1 142 ? 3.849   83.209  13.801  0.25 12.59 ? 142 ILE A O   1 
ATOM   1024  C  CB  . ILE A 1 142 ? 0.827   84.426  14.722  0.25 14.28 ? 142 ILE A CB  1 
ATOM   1025  C  CG1 . ILE A 1 142 ? -0.369  84.102  15.623  0.25 13.69 ? 142 ILE A CG1 1 
ATOM   1026  C  CG2 . ILE A 1 142 ? 0.623   83.861  13.318  0.25 11.10 ? 142 ILE A CG2 1 
ATOM   1027  C  CD1 . ILE A 1 142 ? -0.611  82.611  15.839  0.25 15.69 ? 142 ILE A CD1 1 
ATOM   1028  N  N   . ILE A 1 143 ? 3.649   85.400  14.290  0.25 13.05 ? 143 ILE A N   1 
ATOM   1029  C  CA  . ILE A 1 143 ? 4.755   85.815  13.437  0.25 12.15 ? 143 ILE A CA  1 
ATOM   1030  C  C   . ILE A 1 143 ? 6.079   85.184  13.890  0.25 12.47 ? 143 ILE A C   1 
ATOM   1031  O  O   . ILE A 1 143 ? 6.856   84.689  13.072  0.25 10.68 ? 143 ILE A O   1 
ATOM   1032  C  CB  . ILE A 1 143 ? 4.887   87.359  13.439  0.25 10.86 ? 143 ILE A CB  1 
ATOM   1033  C  CG1 . ILE A 1 143 ? 3.666   87.985  12.760  0.25 10.27 ? 143 ILE A CG1 1 
ATOM   1034  C  CG2 . ILE A 1 143 ? 6.162   87.778  12.727  0.25 13.58 ? 143 ILE A CG2 1 
ATOM   1035  C  CD1 . ILE A 1 143 ? 3.648   89.513  12.801  0.25 7.57  ? 143 ILE A CD1 1 
ATOM   1036  N  N   . CYS A 1 144 ? 6.331   85.201  15.195  0.25 14.00 ? 144 CYS A N   1 
ATOM   1037  C  CA  . CYS A 1 144 ? 7.560   84.627  15.734  0.25 14.62 ? 144 CYS A CA  1 
ATOM   1038  C  C   . CYS A 1 144 ? 7.635   83.140  15.398  0.25 14.76 ? 144 CYS A C   1 
ATOM   1039  O  O   . CYS A 1 144 ? 8.693   82.630  15.026  0.25 15.25 ? 144 CYS A O   1 
ATOM   1040  C  CB  . CYS A 1 144 ? 7.625   84.856  17.249  0.25 15.57 ? 144 CYS A CB  1 
ATOM   1041  S  SG  . CYS A 1 144 ? 7.813   86.613  17.693  0.25 19.13 ? 144 CYS A SG  1 
HETATM 1042  N  N   . MSE A 1 145 ? 6.503   82.453  15.512  0.25 14.39 ? 145 MSE A N   1 
HETATM 1043  C  CA  . MSE A 1 145 ? 6.436   81.031  15.189  0.25 14.04 ? 145 MSE A CA  1 
HETATM 1044  C  C   . MSE A 1 145 ? 6.705   80.844  13.693  0.25 13.62 ? 145 MSE A C   1 
HETATM 1045  O  O   . MSE A 1 145 ? 7.197   79.802  13.261  0.25 11.87 ? 145 MSE A O   1 
HETATM 1046  C  CB  . MSE A 1 145 ? 5.052   80.470  15.544  0.25 15.84 ? 145 MSE A CB  1 
HETATM 1047  C  CG  . MSE A 1 145 ? 4.792   80.323  17.042  0.25 17.94 ? 145 MSE A CG  1 
HETATM 1048  SE SE  . MSE A 1 145 ? 2.976   79.765  17.465  0.25 19.60 ? 145 MSE A SE  1 
HETATM 1049  C  CE  . MSE A 1 145 ? 3.087   77.924  16.879  0.25 19.09 ? 145 MSE A CE  1 
ATOM   1050  N  N   . GLY A 1 146 ? 6.383   81.865  12.903  0.25 10.79 ? 146 GLY A N   1 
ATOM   1051  C  CA  . GLY A 1 146 ? 6.607   81.782  11.471  0.25 11.34 ? 146 GLY A CA  1 
ATOM   1052  C  C   . GLY A 1 146 ? 8.054   82.066  11.119  0.25 12.01 ? 146 GLY A C   1 
ATOM   1053  O  O   . GLY A 1 146 ? 8.681   81.335  10.344  0.25 12.61 ? 146 GLY A O   1 
ATOM   1054  N  N   . ALA A 1 147 ? 8.593   83.133  11.699  0.25 13.09 ? 147 ALA A N   1 
ATOM   1055  C  CA  . ALA A 1 147 ? 9.976   83.519  11.453  0.25 13.21 ? 147 ALA A CA  1 
ATOM   1056  C  C   . ALA A 1 147 ? 10.936  82.385  11.823  0.25 14.06 ? 147 ALA A C   1 
ATOM   1057  O  O   . ALA A 1 147 ? 11.889  82.104  11.092  0.25 13.95 ? 147 ALA A O   1 
ATOM   1058  C  CB  . ALA A 1 147 ? 10.308  84.771  12.251  0.25 11.80 ? 147 ALA A CB  1 
ATOM   1059  N  N   . LYS A 1 148 ? 10.680  81.739  12.958  0.25 15.60 ? 148 LYS A N   1 
ATOM   1060  C  CA  . LYS A 1 148 ? 11.520  80.633  13.418  0.25 18.58 ? 148 LYS A CA  1 
ATOM   1061  C  C   . LYS A 1 148 ? 11.394  79.451  12.469  0.25 19.02 ? 148 LYS A C   1 
ATOM   1062  O  O   . LYS A 1 148 ? 12.388  78.934  11.956  0.25 18.22 ? 148 LYS A O   1 
ATOM   1063  C  CB  . LYS A 1 148 ? 11.100  80.187  14.823  0.25 20.72 ? 148 LYS A CB  1 
ATOM   1064  C  CG  . LYS A 1 148 ? 11.989  79.093  15.415  0.25 25.10 ? 148 LYS A CG  1 
ATOM   1065  C  CD  . LYS A 1 148 ? 11.539  78.708  16.815  0.25 29.37 ? 148 LYS A CD  1 
ATOM   1066  C  CE  . LYS A 1 148 ? 12.496  77.707  17.453  0.25 31.80 ? 148 LYS A CE  1 
ATOM   1067  N  NZ  . LYS A 1 148 ? 12.621  76.459  16.652  0.25 35.88 ? 148 LYS A NZ  1 
ATOM   1068  N  N   . GLU A 1 149 ? 10.152  79.036  12.247  0.25 19.77 ? 149 GLU A N   1 
ATOM   1069  C  CA  . GLU A 1 149 ? 9.836   77.915  11.379  0.25 19.97 ? 149 GLU A CA  1 
ATOM   1070  C  C   . GLU A 1 149 ? 10.523  77.957  10.022  0.25 19.31 ? 149 GLU A C   1 
ATOM   1071  O  O   . GLU A 1 149 ? 11.325  77.078  9.688   0.25 18.87 ? 149 GLU A O   1 
ATOM   1072  C  CB  . GLU A 1 149 ? 8.325   77.842  11.159  0.25 22.19 ? 149 GLU A CB  1 
ATOM   1073  C  CG  . GLU A 1 149 ? 7.884   76.654  10.317  0.25 24.37 ? 149 GLU A CG  1 
ATOM   1074  C  CD  . GLU A 1 149 ? 6.391   76.641  10.081  0.25 25.65 ? 149 GLU A CD  1 
ATOM   1075  O  OE1 . GLU A 1 149 ? 5.909   77.453  9.262   0.25 25.39 ? 149 GLU A OE1 1 
ATOM   1076  O  OE2 . GLU A 1 149 ? 5.697   75.826  10.725  0.25 26.36 ? 149 GLU A OE2 1 
ATOM   1077  N  N   . ASN A 1 150 ? 10.200  78.971  9.231   0.25 17.68 ? 150 ASN A N   1 
ATOM   1078  C  CA  . ASN A 1 150 ? 10.771  79.077  7.898   0.25 16.35 ? 150 ASN A CA  1 
ATOM   1079  C  C   . ASN A 1 150 ? 12.195  79.594  7.855   0.25 15.36 ? 150 ASN A C   1 
ATOM   1080  O  O   . ASN A 1 150 ? 12.728  79.899  6.787   0.25 15.93 ? 150 ASN A O   1 
ATOM   1081  C  CB  . ASN A 1 150 ? 9.848   79.909  7.007   0.25 17.22 ? 150 ASN A CB  1 
ATOM   1082  C  CG  . ASN A 1 150 ? 8.543   79.199  6.736   0.25 18.48 ? 150 ASN A CG  1 
ATOM   1083  O  OD1 . ASN A 1 150 ? 8.536   78.004  6.448   0.25 17.96 ? 150 ASN A OD1 1 
ATOM   1084  N  ND2 . ASN A 1 150 ? 7.432   79.922  6.825   0.25 22.45 ? 150 ASN A ND2 1 
ATOM   1085  N  N   . GLY A 1 151 ? 12.810  79.682  9.027   0.25 14.59 ? 151 GLY A N   1 
ATOM   1086  C  CA  . GLY A 1 151 ? 14.194  80.108  9.116   0.25 15.08 ? 151 GLY A CA  1 
ATOM   1087  C  C   . GLY A 1 151 ? 14.608  81.474  8.599   0.25 15.07 ? 151 GLY A C   1 
ATOM   1088  O  O   . GLY A 1 151 ? 15.572  81.584  7.844   0.25 15.09 ? 151 GLY A O   1 
ATOM   1089  N  N   . LEU A 1 152 ? 13.887  82.520  8.988   0.25 13.89 ? 152 LEU A N   1 
ATOM   1090  C  CA  . LEU A 1 152 ? 14.275  83.857  8.583   0.25 14.42 ? 152 LEU A CA  1 
ATOM   1091  C  C   . LEU A 1 152 ? 15.590  84.091  9.331   0.25 14.90 ? 152 LEU A C   1 
ATOM   1092  O  O   . LEU A 1 152 ? 15.889  83.388  10.295  0.25 15.60 ? 152 LEU A O   1 
ATOM   1093  C  CB  . LEU A 1 152 ? 13.215  84.879  9.012   0.25 13.36 ? 152 LEU A CB  1 
ATOM   1094  C  CG  . LEU A 1 152 ? 12.204  85.309  7.939   0.25 13.88 ? 152 LEU A CG  1 
ATOM   1095  C  CD1 . LEU A 1 152 ? 11.491  84.094  7.354   0.25 12.63 ? 152 LEU A CD1 1 
ATOM   1096  C  CD2 . LEU A 1 152 ? 11.203  86.277  8.551   0.25 10.20 ? 152 LEU A CD2 1 
ATOM   1097  N  N   . PRO A 1 153 ? 16.396  85.068  8.898   0.25 14.98 ? 153 PRO A N   1 
ATOM   1098  C  CA  . PRO A 1 153 ? 17.667  85.317  9.590   0.25 15.48 ? 153 PRO A CA  1 
ATOM   1099  C  C   . PRO A 1 153 ? 17.497  85.407  11.102  0.25 15.82 ? 153 PRO A C   1 
ATOM   1100  O  O   . PRO A 1 153 ? 16.635  86.133  11.599  0.25 14.43 ? 153 PRO A O   1 
ATOM   1101  C  CB  . PRO A 1 153 ? 18.139  86.631  8.977   0.25 15.92 ? 153 PRO A CB  1 
ATOM   1102  C  CG  . PRO A 1 153 ? 17.610  86.537  7.569   0.25 14.19 ? 153 PRO A CG  1 
ATOM   1103  C  CD  . PRO A 1 153 ? 16.206  86.016  7.788   0.25 14.69 ? 153 PRO A CD  1 
ATOM   1104  N  N   . LEU A 1 154 ? 18.331  84.668  11.825  0.25 15.83 ? 154 LEU A N   1 
ATOM   1105  C  CA  . LEU A 1 154 ? 18.273  84.642  13.279  0.25 18.34 ? 154 LEU A CA  1 
ATOM   1106  C  C   . LEU A 1 154 ? 18.263  86.030  13.900  0.25 17.17 ? 154 LEU A C   1 
ATOM   1107  O  O   . LEU A 1 154 ? 17.578  86.258  14.898  0.25 15.96 ? 154 LEU A O   1 
ATOM   1108  C  CB  . LEU A 1 154 ? 19.445  83.830  13.836  0.25 21.38 ? 154 LEU A CB  1 
ATOM   1109  C  CG  . LEU A 1 154 ? 19.512  82.388  13.325  0.25 23.53 ? 154 LEU A CG  1 
ATOM   1110  C  CD1 . LEU A 1 154 ? 20.614  81.641  14.062  0.25 24.26 ? 154 LEU A CD1 1 
ATOM   1111  C  CD2 . LEU A 1 154 ? 18.171  81.698  13.531  0.25 23.65 ? 154 LEU A CD2 1 
ATOM   1112  N  N   . GLU A 1 155 ? 19.012  86.956  13.309  0.25 18.36 ? 155 GLU A N   1 
ATOM   1113  C  CA  . GLU A 1 155 ? 19.073  88.320  13.824  0.25 19.92 ? 155 GLU A CA  1 
ATOM   1114  C  C   . GLU A 1 155 ? 17.748  89.041  13.604  0.25 16.62 ? 155 GLU A C   1 
ATOM   1115  O  O   . GLU A 1 155 ? 17.285  89.772  14.476  0.25 15.04 ? 155 GLU A O   1 
ATOM   1116  C  CB  . GLU A 1 155 ? 20.197  89.099  13.141  0.25 26.94 ? 155 GLU A CB  1 
ATOM   1117  C  CG  . GLU A 1 155 ? 20.589  90.392  13.844  0.25 37.07 ? 155 GLU A CG  1 
ATOM   1118  C  CD  . GLU A 1 155 ? 19.491  91.446  13.838  0.25 42.06 ? 155 GLU A CD  1 
ATOM   1119  O  OE1 . GLU A 1 155 ? 19.058  91.855  12.738  0.25 46.33 ? 155 GLU A OE1 1 
ATOM   1120  O  OE2 . GLU A 1 155 ? 19.066  91.867  14.936  0.25 43.80 ? 155 GLU A OE2 1 
ATOM   1121  N  N   . TYR A 1 156 ? 17.137  88.847  12.440  0.25 14.00 ? 156 TYR A N   1 
ATOM   1122  C  CA  . TYR A 1 156 ? 15.862  89.501  12.171  0.25 12.49 ? 156 TYR A CA  1 
ATOM   1123  C  C   . TYR A 1 156 ? 14.834  89.008  13.178  0.25 11.82 ? 156 TYR A C   1 
ATOM   1124  O  O   . TYR A 1 156 ? 13.993  89.773  13.646  0.25 13.22 ? 156 TYR A O   1 
ATOM   1125  C  CB  . TYR A 1 156 ? 15.367  89.204  10.755  0.25 11.61 ? 156 TYR A CB  1 
ATOM   1126  C  CG  . TYR A 1 156 ? 14.102  89.967  10.413  0.25 10.56 ? 156 TYR A CG  1 
ATOM   1127  C  CD1 . TYR A 1 156 ? 14.139  91.341  10.159  0.25 12.12 ? 156 TYR A CD1 1 
ATOM   1128  C  CD2 . TYR A 1 156 ? 12.867  89.325  10.382  0.25 11.44 ? 156 TYR A CD2 1 
ATOM   1129  C  CE1 . TYR A 1 156 ? 12.970  92.059  9.885   0.25 10.25 ? 156 TYR A CE1 1 
ATOM   1130  C  CE2 . TYR A 1 156 ? 11.695  90.026  10.107  0.25 9.97  ? 156 TYR A CE2 1 
ATOM   1131  C  CZ  . TYR A 1 156 ? 11.750  91.391  9.861   0.25 10.36 ? 156 TYR A CZ  1 
ATOM   1132  O  OH  . TYR A 1 156 ? 10.592  92.084  9.597   0.25 13.91 ? 156 TYR A OH  1 
ATOM   1133  N  N   . GLN A 1 157 ? 14.900  87.722  13.507  0.25 11.47 ? 157 GLN A N   1 
ATOM   1134  C  CA  . GLN A 1 157 ? 13.978  87.153  14.480  0.25 12.97 ? 157 GLN A CA  1 
ATOM   1135  C  C   . GLN A 1 157 ? 14.146  87.889  15.801  0.25 14.43 ? 157 GLN A C   1 
ATOM   1136  O  O   . GLN A 1 157 ? 13.182  88.077  16.544  0.25 14.49 ? 157 GLN A O   1 
ATOM   1137  C  CB  . GLN A 1 157 ? 14.254  85.665  14.693  0.25 12.92 ? 157 GLN A CB  1 
ATOM   1138  C  CG  . GLN A 1 157 ? 13.964  84.788  13.490  0.25 14.72 ? 157 GLN A CG  1 
ATOM   1139  C  CD  . GLN A 1 157 ? 14.067  83.311  13.826  0.25 14.50 ? 157 GLN A CD  1 
ATOM   1140  O  OE1 . GLN A 1 157 ? 13.368  82.818  14.706  0.25 14.34 ? 157 GLN A OE1 1 
ATOM   1141  N  NE2 . GLN A 1 157 ? 14.941  82.599  13.125  0.25 14.65 ? 157 GLN A NE2 1 
ATOM   1142  N  N   . GLU A 1 158 ? 15.375  88.304  16.097  0.25 15.58 ? 158 GLU A N   1 
ATOM   1143  C  CA  . GLU A 1 158 ? 15.632  89.027  17.338  0.25 18.13 ? 158 GLU A CA  1 
ATOM   1144  C  C   . GLU A 1 158 ? 14.831  90.314  17.385  0.25 16.97 ? 158 GLU A C   1 
ATOM   1145  O  O   . GLU A 1 158 ? 14.375  90.724  18.450  0.25 18.12 ? 158 GLU A O   1 
ATOM   1146  C  CB  . GLU A 1 158 ? 17.120  89.345  17.498  0.25 21.88 ? 158 GLU A CB  1 
ATOM   1147  C  CG  . GLU A 1 158 ? 17.905  88.221  18.135  0.25 29.55 ? 158 GLU A CG  1 
ATOM   1148  C  CD  . GLU A 1 158 ? 17.341  87.839  19.488  0.25 32.59 ? 158 GLU A CD  1 
ATOM   1149  O  OE1 . GLU A 1 158 ? 17.293  88.717  20.374  0.25 34.31 ? 158 GLU A OE1 1 
ATOM   1150  O  OE2 . GLU A 1 158 ? 16.943  86.668  19.664  0.25 35.50 ? 158 GLU A OE2 1 
ATOM   1151  N  N   . LYS A 1 159 ? 14.660  90.954  16.233  0.25 16.46 ? 159 LYS A N   1 
ATOM   1152  C  CA  . LYS A 1 159 ? 13.893  92.190  16.188  0.25 18.55 ? 159 LYS A CA  1 
ATOM   1153  C  C   . LYS A 1 159 ? 12.415  91.890  16.422  0.25 17.13 ? 159 LYS A C   1 
ATOM   1154  O  O   . LYS A 1 159 ? 11.729  92.644  17.108  0.25 16.46 ? 159 LYS A O   1 
ATOM   1155  C  CB  . LYS A 1 159 ? 14.095  92.898  14.849  0.25 21.65 ? 159 LYS A CB  1 
ATOM   1156  C  CG  . LYS A 1 159 ? 15.540  93.288  14.591  0.25 27.84 ? 159 LYS A CG  1 
ATOM   1157  C  CD  . LYS A 1 159 ? 15.673  94.277  13.445  0.25 32.17 ? 159 LYS A CD  1 
ATOM   1158  C  CE  . LYS A 1 159 ? 15.026  95.610  13.790  0.25 34.69 ? 159 LYS A CE  1 
ATOM   1159  N  NZ  . LYS A 1 159 ? 15.311  96.645  12.759  0.25 37.84 ? 159 LYS A NZ  1 
ATOM   1160  N  N   . LEU A 1 160 ? 11.932  90.781  15.863  0.25 15.94 ? 160 LEU A N   1 
ATOM   1161  C  CA  . LEU A 1 160 ? 10.535  90.386  16.038  0.25 14.99 ? 160 LEU A CA  1 
ATOM   1162  C  C   . LEU A 1 160 ? 10.249  90.006  17.494  0.25 14.97 ? 160 LEU A C   1 
ATOM   1163  O  O   . LEU A 1 160 ? 9.219   90.376  18.057  0.25 14.34 ? 160 LEU A O   1 
ATOM   1164  C  CB  . LEU A 1 160 ? 10.197  89.191  15.136  0.25 12.70 ? 160 LEU A CB  1 
ATOM   1165  C  CG  . LEU A 1 160 ? 10.149  89.427  13.625  0.25 12.29 ? 160 LEU A CG  1 
ATOM   1166  C  CD1 . LEU A 1 160 ? 9.860   88.117  12.901  0.25 13.08 ? 160 LEU A CD1 1 
ATOM   1167  C  CD2 . LEU A 1 160 ? 9.075   90.455  13.308  0.25 10.72 ? 160 LEU A CD2 1 
ATOM   1168  N  N   . LYS A 1 161 ? 11.165  89.258  18.098  0.25 15.46 ? 161 LYS A N   1 
ATOM   1169  C  CA  . LYS A 1 161 ? 10.995  88.816  19.479  0.25 17.19 ? 161 LYS A CA  1 
ATOM   1170  C  C   . LYS A 1 161 ? 11.061  89.969  20.476  0.25 16.08 ? 161 LYS A C   1 
ATOM   1171  O  O   . LYS A 1 161 ? 10.544  89.859  21.592  0.25 16.05 ? 161 LYS A O   1 
ATOM   1172  C  CB  . LYS A 1 161 ? 12.061  87.770  19.825  0.25 17.89 ? 161 LYS A CB  1 
ATOM   1173  C  CG  . LYS A 1 161 ? 12.020  86.555  18.919  0.25 21.67 ? 161 LYS A CG  1 
ATOM   1174  C  CD  . LYS A 1 161 ? 13.255  85.675  19.074  0.25 23.56 ? 161 LYS A CD  1 
ATOM   1175  C  CE  . LYS A 1 161 ? 13.272  84.931  20.394  0.25 25.62 ? 161 LYS A CE  1 
ATOM   1176  N  NZ  . LYS A 1 161 ? 14.470  84.047  20.472  0.25 25.57 ? 161 LYS A NZ  1 
ATOM   1177  N  N   . ALA A 1 162 ? 11.684  91.073  20.067  0.25 15.10 ? 162 ALA A N   1 
ATOM   1178  C  CA  . ALA A 1 162 ? 11.830  92.250  20.923  0.25 15.51 ? 162 ALA A CA  1 
ATOM   1179  C  C   . ALA A 1 162 ? 10.638  93.201  20.831  0.25 15.96 ? 162 ALA A C   1 
ATOM   1180  O  O   . ALA A 1 162 ? 10.610  94.246  21.487  0.25 14.57 ? 162 ALA A O   1 
ATOM   1181  C  CB  . ALA A 1 162 ? 13.115  92.997  20.559  0.25 16.05 ? 162 ALA A CB  1 
ATOM   1182  N  N   . ILE A 1 163 ? 9.651   92.840  20.020  0.25 14.90 ? 163 ILE A N   1 
ATOM   1183  C  CA  . ILE A 1 163 ? 8.473   93.680  19.858  0.25 14.85 ? 163 ILE A CA  1 
ATOM   1184  C  C   . ILE A 1 163 ? 7.627   93.725  21.125  0.25 16.08 ? 163 ILE A C   1 
ATOM   1185  O  O   . ILE A 1 163 ? 7.255   92.689  21.678  0.25 15.54 ? 163 ILE A O   1 
ATOM   1186  C  CB  . ILE A 1 163 ? 7.584   93.182  18.699  0.25 14.35 ? 163 ILE A CB  1 
ATOM   1187  C  CG1 . ILE A 1 163 ? 8.362   93.235  17.386  0.25 11.73 ? 163 ILE A CG1 1 
ATOM   1188  C  CG2 . ILE A 1 163 ? 6.321   94.052  18.603  0.25 14.09 ? 163 ILE A CG2 1 
ATOM   1189  C  CD1 . ILE A 1 163 ? 7.631   92.608  16.211  0.25 15.13 ? 163 ILE A CD1 1 
ATOM   1190  N  N   . GLU A 1 164 ? 7.326   94.932  21.589  0.25 16.67 ? 164 GLU A N   1 
ATOM   1191  C  CA  . GLU A 1 164 ? 6.505   95.078  22.781  0.25 18.05 ? 164 GLU A CA  1 
ATOM   1192  C  C   . GLU A 1 164 ? 5.046   94.939  22.372  0.25 16.74 ? 164 GLU A C   1 
ATOM   1193  O  O   . GLU A 1 164 ? 4.535   95.733  21.583  0.25 16.34 ? 164 GLU A O   1 
ATOM   1194  C  CB  . GLU A 1 164 ? 6.754   96.441  23.439  0.25 22.72 ? 164 GLU A CB  1 
ATOM   1195  C  CG  . GLU A 1 164 ? 8.039   96.503  24.269  0.25 27.60 ? 164 GLU A CG  1 
ATOM   1196  C  CD  . GLU A 1 164 ? 8.347   97.902  24.785  0.25 31.27 ? 164 GLU A CD  1 
ATOM   1197  O  OE1 . GLU A 1 164 ? 7.407   98.603  25.216  0.25 32.34 ? 164 GLU A OE1 1 
ATOM   1198  O  OE2 . GLU A 1 164 ? 9.533   98.299  24.768  0.25 32.15 ? 164 GLU A OE2 1 
ATOM   1199  N  N   . PRO A 1 165 ? 4.361   93.909  22.893  0.25 16.55 ? 165 PRO A N   1 
ATOM   1200  C  CA  . PRO A 1 165 ? 2.952   93.648  22.590  0.25 15.51 ? 165 PRO A CA  1 
ATOM   1201  C  C   . PRO A 1 165 ? 2.042   94.510  23.455  0.25 17.48 ? 165 PRO A C   1 
ATOM   1202  O  O   . PRO A 1 165 ? 2.521   95.315  24.255  0.25 15.25 ? 165 PRO A O   1 
ATOM   1203  C  CB  . PRO A 1 165 ? 2.811   92.166  22.912  0.25 15.20 ? 165 PRO A CB  1 
ATOM   1204  C  CG  . PRO A 1 165 ? 3.686   92.030  24.121  0.25 16.79 ? 165 PRO A CG  1 
ATOM   1205  C  CD  . PRO A 1 165 ? 4.918   92.844  23.750  0.25 15.81 ? 165 PRO A CD  1 
ATOM   1206  N  N   . ASN A 1 166 ? 0.732   94.350  23.290  0.25 18.66 ? 166 ASN A N   1 
ATOM   1207  C  CA  . ASN A 1 166 ? -0.213  95.109  24.097  0.25 19.14 ? 166 ASN A CA  1 
ATOM   1208  C  C   . ASN A 1 166 ? -0.648  94.218  25.258  0.25 19.93 ? 166 ASN A C   1 
ATOM   1209  O  O   . ASN A 1 166 ? -0.177  93.084  25.379  0.25 19.56 ? 166 ASN A O   1 
ATOM   1210  C  CB  . ASN A 1 166 ? -1.419  95.561  23.259  0.25 16.72 ? 166 ASN A CB  1 
ATOM   1211  C  CG  . ASN A 1 166 ? -2.325  94.416  22.859  0.25 13.97 ? 166 ASN A CG  1 
ATOM   1212  O  OD1 . ASN A 1 166 ? -2.018  93.249  23.097  0.25 13.37 ? 166 ASN A OD1 1 
ATOM   1213  N  ND2 . ASN A 1 166 ? -3.455  94.749  22.235  0.25 13.18 ? 166 ASN A ND2 1 
ATOM   1214  N  N   . ASP A 1 167 ? -1.542  94.719  26.105  0.25 21.75 ? 167 ASP A N   1 
ATOM   1215  C  CA  . ASP A 1 167 ? -1.994  93.962  27.274  0.25 24.13 ? 167 ASP A CA  1 
ATOM   1216  C  C   . ASP A 1 167 ? -3.261  93.132  27.078  0.25 23.80 ? 167 ASP A C   1 
ATOM   1217  O  O   . ASP A 1 167 ? -4.185  93.205  27.886  0.25 22.45 ? 167 ASP A O   1 
ATOM   1218  C  CB  . ASP A 1 167 ? -2.200  94.916  28.456  0.25 26.58 ? 167 ASP A CB  1 
ATOM   1219  C  CG  . ASP A 1 167 ? -3.164  96.044  28.131  0.25 29.51 ? 167 ASP A CG  1 
ATOM   1220  O  OD1 . ASP A 1 167 ? -4.249  95.755  27.587  0.25 28.62 ? 167 ASP A OD1 1 
ATOM   1221  O  OD2 . ASP A 1 167 ? -2.842  97.217  28.421  0.25 30.56 ? 167 ASP A OD2 1 
ATOM   1222  N  N   . TYR A 1 168 ? -3.304  92.330  26.022  0.25 21.22 ? 168 TYR A N   1 
ATOM   1223  C  CA  . TYR A 1 168 ? -4.477  91.503  25.768  0.25 21.23 ? 168 TYR A CA  1 
ATOM   1224  C  C   . TYR A 1 168 ? -4.245  90.046  26.171  0.25 21.98 ? 168 TYR A C   1 
ATOM   1225  O  O   . TYR A 1 168 ? -3.234  89.446  25.804  0.25 19.95 ? 168 TYR A O   1 
ATOM   1226  C  CB  . TYR A 1 168 ? -4.852  91.556  24.284  0.25 20.95 ? 168 TYR A CB  1 
ATOM   1227  C  CG  . TYR A 1 168 ? -6.157  90.867  23.973  0.25 20.81 ? 168 TYR A CG  1 
ATOM   1228  C  CD1 . TYR A 1 168 ? -7.371  91.528  24.144  0.25 19.79 ? 168 TYR A CD1 1 
ATOM   1229  C  CD2 . TYR A 1 168 ? -6.184  89.536  23.550  0.25 19.68 ? 168 TYR A CD2 1 
ATOM   1230  C  CE1 . TYR A 1 168 ? -8.581  90.883  23.905  0.25 19.87 ? 168 TYR A CE1 1 
ATOM   1231  C  CE2 . TYR A 1 168 ? -7.391  88.882  23.310  0.25 19.63 ? 168 TYR A CE2 1 
ATOM   1232  C  CZ  . TYR A 1 168 ? -8.585  89.563  23.490  0.25 18.68 ? 168 TYR A CZ  1 
ATOM   1233  O  OH  . TYR A 1 168 ? -9.784  88.927  23.262  0.25 18.65 ? 168 TYR A OH  1 
ATOM   1234  N  N   . THR A 1 169 ? -5.184  89.486  26.930  0.25 20.39 ? 169 THR A N   1 
ATOM   1235  C  CA  . THR A 1 169 ? -5.098  88.092  27.366  0.25 21.27 ? 169 THR A CA  1 
ATOM   1236  C  C   . THR A 1 169 ? -6.490  87.473  27.345  0.25 21.54 ? 169 THR A C   1 
ATOM   1237  O  O   . THR A 1 169 ? -6.717  86.398  27.904  0.25 18.29 ? 169 THR A O   1 
ATOM   1238  C  CB  . THR A 1 169 ? -4.530  87.967  28.798  0.25 20.72 ? 169 THR A CB  1 
ATOM   1239  O  OG1 . THR A 1 169 ? -5.368  88.683  29.710  0.25 17.14 ? 169 THR A OG1 1 
ATOM   1240  C  CG2 . THR A 1 169 ? -3.116  88.522  28.864  0.25 20.82 ? 169 THR A CG2 1 
ATOM   1241  N  N   . GLY A 1 170 ? -7.422  88.164  26.697  0.25 23.38 ? 170 GLY A N   1 
ATOM   1242  C  CA  . GLY A 1 170 ? -8.783  87.671  26.616  0.25 25.38 ? 170 GLY A CA  1 
ATOM   1243  C  C   . GLY A 1 170 ? -8.925  86.594  25.563  0.25 28.23 ? 170 GLY A C   1 
ATOM   1244  O  O   . GLY A 1 170 ? -7.984  86.307  24.825  0.25 27.18 ? 170 GLY A O   1 
ATOM   1245  N  N   . LYS A 1 171 ? -10.108 85.995  25.500  0.25 32.09 ? 171 LYS A N   1 
ATOM   1246  C  CA  . LYS A 1 171 ? -10.388 84.943  24.535  0.25 35.99 ? 171 LYS A CA  1 
ATOM   1247  C  C   . LYS A 1 171 ? -9.905  85.342  23.138  0.25 35.40 ? 171 LYS A C   1 
ATOM   1248  O  O   . LYS A 1 171 ? -9.921  86.518  22.780  0.25 35.37 ? 171 LYS A O   1 
ATOM   1249  C  CB  . LYS A 1 171 ? -11.894 84.663  24.512  0.25 39.30 ? 171 LYS A CB  1 
ATOM   1250  C  CG  . LYS A 1 171 ? -12.295 83.512  23.617  0.25 45.98 ? 171 LYS A CG  1 
ATOM   1251  C  CD  . LYS A 1 171 ? -13.795 83.283  23.649  0.25 50.45 ? 171 LYS A CD  1 
ATOM   1252  C  CE  . LYS A 1 171 ? -14.190 82.130  22.739  0.25 53.86 ? 171 LYS A CE  1 
ATOM   1253  N  NZ  . LYS A 1 171 ? -15.659 81.895  22.750  0.25 56.87 ? 171 LYS A NZ  1 
ATOM   1254  N  N   . VAL A 1 172 ? -9.462  84.359  22.358  0.25 35.09 ? 172 VAL A N   1 
ATOM   1255  C  CA  . VAL A 1 172 ? -8.983  84.607  20.999  0.25 33.85 ? 172 VAL A CA  1 
ATOM   1256  C  C   . VAL A 1 172 ? -9.432  83.492  20.054  0.25 33.05 ? 172 VAL A C   1 
ATOM   1257  O  O   . VAL A 1 172 ? -9.979  82.482  20.495  0.25 31.48 ? 172 VAL A O   1 
ATOM   1258  C  CB  . VAL A 1 172 ? -7.442  84.704  20.955  0.25 34.40 ? 172 VAL A CB  1 
ATOM   1259  C  CG1 . VAL A 1 172 ? -6.970  85.807  21.878  0.25 32.12 ? 172 VAL A CG1 1 
ATOM   1260  C  CG2 . VAL A 1 172 ? -6.821  83.373  21.348  0.25 34.23 ? 172 VAL A CG2 1 
ATOM   1261  N  N   . SER A 1 173 ? -9.205  83.683  18.755  0.25 31.86 ? 173 SER A N   1 
ATOM   1262  C  CA  . SER A 1 173 ? -9.586  82.689  17.753  0.25 30.09 ? 173 SER A CA  1 
ATOM   1263  C  C   . SER A 1 173 ? -9.221  81.269  18.187  0.25 30.01 ? 173 SER A C   1 
ATOM   1264  O  O   . SER A 1 173 ? -8.047  80.948  18.385  0.25 27.85 ? 173 SER A O   1 
ATOM   1265  C  CB  . SER A 1 173 ? -8.911  83.004  16.420  0.25 30.11 ? 173 SER A CB  1 
ATOM   1266  O  OG  . SER A 1 173 ? -9.049  81.926  15.511  0.25 27.12 ? 173 SER A OG  1 
ATOM   1267  N  N   . GLU A 1 174 ? -10.235 80.423  18.329  0.25 31.64 ? 174 GLU A N   1 
ATOM   1268  C  CA  . GLU A 1 174 ? -10.024 79.041  18.744  0.25 34.50 ? 174 GLU A CA  1 
ATOM   1269  C  C   . GLU A 1 174 ? -9.020  78.296  17.873  0.25 33.99 ? 174 GLU A C   1 
ATOM   1270  O  O   . GLU A 1 174 ? -8.103  77.656  18.389  0.25 33.97 ? 174 GLU A O   1 
ATOM   1271  C  CB  . GLU A 1 174 ? -11.350 78.277  18.752  0.25 37.99 ? 174 GLU A CB  1 
ATOM   1272  C  CG  . GLU A 1 174 ? -12.337 78.750  19.799  0.25 44.33 ? 174 GLU A CG  1 
ATOM   1273  C  CD  . GLU A 1 174 ? -13.506 77.797  19.962  0.25 46.69 ? 174 GLU A CD  1 
ATOM   1274  O  OE1 . GLU A 1 174 ? -14.184 77.504  18.954  0.25 49.21 ? 174 GLU A OE1 1 
ATOM   1275  O  OE2 . GLU A 1 174 ? -13.745 77.339  21.100  0.25 50.10 ? 174 GLU A OE2 1 
ATOM   1276  N  N   . GLU A 1 175 ? -9.191  78.375  16.557  0.25 33.25 ? 175 GLU A N   1 
ATOM   1277  C  CA  . GLU A 1 175 ? -8.289  77.686  15.639  0.25 34.59 ? 175 GLU A CA  1 
ATOM   1278  C  C   . GLU A 1 175 ? -6.888  78.286  15.646  0.25 33.66 ? 175 GLU A C   1 
ATOM   1279  O  O   . GLU A 1 175 ? -5.971  77.750  15.022  0.25 33.27 ? 175 GLU A O   1 
ATOM   1280  C  CB  . GLU A 1 175 ? -8.863  77.692  14.219  0.25 36.73 ? 175 GLU A CB  1 
ATOM   1281  C  CG  . GLU A 1 175 ? -9.077  79.063  13.616  0.25 38.74 ? 175 GLU A CG  1 
ATOM   1282  C  CD  . GLU A 1 175 ? -9.952  79.007  12.377  0.25 39.65 ? 175 GLU A CD  1 
ATOM   1283  O  OE1 . GLU A 1 175 ? -9.631  78.227  11.456  0.25 39.05 ? 175 GLU A OE1 1 
ATOM   1284  O  OE2 . GLU A 1 175 ? -10.963 79.743  12.328  0.25 41.48 ? 175 GLU A OE2 1 
ATOM   1285  N  N   . ILE A 1 176 ? -6.729  79.401  16.351  0.25 32.39 ? 176 ILE A N   1 
ATOM   1286  C  CA  . ILE A 1 176 ? -5.431  80.053  16.467  0.25 31.30 ? 176 ILE A CA  1 
ATOM   1287  C  C   . ILE A 1 176 ? -4.861  79.742  17.848  0.25 31.25 ? 176 ILE A C   1 
ATOM   1288  O  O   . ILE A 1 176 ? -3.646  79.750  18.051  0.25 30.65 ? 176 ILE A O   1 
ATOM   1289  C  CB  . ILE A 1 176 ? -5.543  81.587  16.291  0.25 30.70 ? 176 ILE A CB  1 
ATOM   1290  C  CG1 . ILE A 1 176 ? -5.944  81.916  14.849  0.25 31.21 ? 176 ILE A CG1 1 
ATOM   1291  C  CG2 . ILE A 1 176 ? -4.213  82.253  16.643  0.25 29.28 ? 176 ILE A CG2 1 
ATOM   1292  C  CD1 . ILE A 1 176 ? -6.031  83.404  14.547  0.25 31.93 ? 176 ILE A CD1 1 
ATOM   1293  N  N   . GLU A 1 177 ? -5.753  79.458  18.793  0.25 33.09 ? 177 GLU A N   1 
ATOM   1294  C  CA  . GLU A 1 177 ? -5.355  79.133  20.157  0.25 34.81 ? 177 GLU A CA  1 
ATOM   1295  C  C   . GLU A 1 177 ? -4.497  77.881  20.154  0.25 33.77 ? 177 GLU A C   1 
ATOM   1296  O  O   . GLU A 1 177 ? -3.406  77.855  20.725  0.25 32.10 ? 177 GLU A O   1 
ATOM   1297  C  CB  . GLU A 1 177 ? -6.583  78.871  21.030  0.25 39.25 ? 177 GLU A CB  1 
ATOM   1298  C  CG  . GLU A 1 177 ? -7.576  80.005  21.100  0.25 45.85 ? 177 GLU A CG  1 
ATOM   1299  C  CD  . GLU A 1 177 ? -8.768  79.663  21.972  0.25 48.66 ? 177 GLU A CD  1 
ATOM   1300  O  OE1 . GLU A 1 177 ? -9.446  78.652  21.689  0.25 50.15 ? 177 GLU A OE1 1 
ATOM   1301  O  OE2 . GLU A 1 177 ? -9.025  80.403  22.945  0.25 51.28 ? 177 GLU A OE2 1 
ATOM   1302  N  N   . ASP A 1 178 ? -5.007  76.841  19.502  0.25 33.31 ? 178 ASP A N   1 
ATOM   1303  C  CA  . ASP A 1 178 ? -4.312  75.565  19.429  0.25 34.37 ? 178 ASP A CA  1 
ATOM   1304  C  C   . ASP A 1 178 ? -2.997  75.654  18.673  0.25 33.33 ? 178 ASP A C   1 
ATOM   1305  O  O   . ASP A 1 178 ? -2.038  74.952  19.002  0.25 30.68 ? 178 ASP A O   1 
ATOM   1306  C  CB  . ASP A 1 178 ? -5.224  74.516  18.795  0.25 38.14 ? 178 ASP A CB  1 
ATOM   1307  C  CG  . ASP A 1 178 ? -6.436  74.210  19.656  0.25 40.97 ? 178 ASP A CG  1 
ATOM   1308  O  OD1 . ASP A 1 178 ? -6.257  73.655  20.761  0.25 41.32 ? 178 ASP A OD1 1 
ATOM   1309  O  OD2 . ASP A 1 178 ? -7.567  74.531  19.232  0.25 43.14 ? 178 ASP A OD2 1 
ATOM   1310  N  N   . ILE A 1 179 ? -2.946  76.512  17.659  0.25 32.27 ? 179 ILE A N   1 
ATOM   1311  C  CA  . ILE A 1 179 ? -1.713  76.676  16.899  0.25 30.84 ? 179 ILE A CA  1 
ATOM   1312  C  C   . ILE A 1 179 ? -0.664  77.205  17.863  0.25 30.70 ? 179 ILE A C   1 
ATOM   1313  O  O   . ILE A 1 179 ? 0.478   76.749  17.866  0.25 30.86 ? 179 ILE A O   1 
ATOM   1314  C  CB  . ILE A 1 179 ? -1.878  77.683  15.735  0.25 29.49 ? 179 ILE A CB  1 
ATOM   1315  C  CG1 . ILE A 1 179 ? -2.808  77.101  14.664  0.25 29.67 ? 179 ILE A CG1 1 
ATOM   1316  C  CG2 . ILE A 1 179 ? -0.518  78.008  15.136  0.25 28.48 ? 179 ILE A CG2 1 
ATOM   1317  C  CD1 . ILE A 1 179 ? -3.000  77.997  13.452  0.25 28.35 ? 179 ILE A CD1 1 
ATOM   1318  N  N   . ILE A 1 180 ? -1.072  78.161  18.693  0.25 31.97 ? 180 ILE A N   1 
ATOM   1319  C  CA  . ILE A 1 180 ? -0.178  78.769  19.671  0.25 34.63 ? 180 ILE A CA  1 
ATOM   1320  C  C   . ILE A 1 180 ? 0.145   77.822  20.823  0.25 38.24 ? 180 ILE A C   1 
ATOM   1321  O  O   . ILE A 1 180 ? 1.279   77.786  21.299  0.25 38.33 ? 180 ILE A O   1 
ATOM   1322  C  CB  . ILE A 1 180 ? -0.787  80.066  20.246  0.25 33.99 ? 180 ILE A CB  1 
ATOM   1323  C  CG1 . ILE A 1 180 ? -1.022  81.069  19.114  0.25 31.84 ? 180 ILE A CG1 1 
ATOM   1324  C  CG2 . ILE A 1 180 ? 0.139   80.666  21.295  0.25 32.98 ? 180 ILE A CG2 1 
ATOM   1325  C  CD1 . ILE A 1 180 ? -1.716  82.330  19.555  0.25 30.26 ? 180 ILE A CD1 1 
ATOM   1326  N  N   . LYS A 1 181 ? -0.847  77.057  21.270  0.25 42.03 ? 181 LYS A N   1 
ATOM   1327  C  CA  . LYS A 1 181 ? -0.634  76.120  22.368  0.25 45.15 ? 181 LYS A CA  1 
ATOM   1328  C  C   . LYS A 1 181 ? 0.524   75.166  22.096  0.25 45.56 ? 181 LYS A C   1 
ATOM   1329  O  O   . LYS A 1 181 ? 1.469   75.094  22.880  0.25 46.69 ? 181 LYS A O   1 
ATOM   1330  C  CB  . LYS A 1 181 ? -1.901  75.305  22.645  0.25 47.87 ? 181 LYS A CB  1 
ATOM   1331  C  CG  . LYS A 1 181 ? -2.999  76.057  23.383  0.25 51.93 ? 181 LYS A CG  1 
ATOM   1332  C  CD  . LYS A 1 181 ? -4.064  75.087  23.884  0.25 54.62 ? 181 LYS A CD  1 
ATOM   1333  C  CE  . LYS A 1 181 ? -5.155  75.792  24.675  0.25 56.22 ? 181 LYS A CE  1 
ATOM   1334  N  NZ  . LYS A 1 181 ? -5.936  76.732  23.830  0.25 59.09 ? 181 LYS A NZ  1 
ATOM   1335  N  N   . LYS A 1 182 ? 0.454   74.439  20.984  0.25 45.64 ? 182 LYS A N   1 
ATOM   1336  C  CA  . LYS A 1 182 ? 1.502   73.484  20.633  0.25 46.74 ? 182 LYS A CA  1 
ATOM   1337  C  C   . LYS A 1 182 ? 2.877   74.138  20.497  0.25 45.97 ? 182 LYS A C   1 
ATOM   1338  O  O   . LYS A 1 182 ? 3.693   73.975  21.430  0.25 43.28 ? 182 LYS A O   1 
ATOM   1339  C  CB  . LYS A 1 182 ? 1.141   72.754  19.330  0.25 47.85 ? 182 LYS A CB  1 
ATOM   1340  C  CG  . LYS A 1 182 ? 0.951   73.662  18.121  0.25 51.97 ? 182 LYS A CG  1 
ATOM   1341  C  CD  . LYS A 1 182 ? 0.772   72.855  16.843  0.25 55.12 ? 182 LYS A CD  1 
ATOM   1342  C  CE  . LYS A 1 182 ? -0.528  72.065  16.849  0.25 55.87 ? 182 LYS A CE  1 
ATOM   1343  N  NZ  . LYS A 1 182 ? -1.717  72.961  16.867  0.25 57.64 ? 182 LYS A NZ  1 
ATOM   1344  N  N   . GLU B 1 15  ? 2.903   91.989  -23.462 0.25 31.12 ? 15  GLU B N   1 
ATOM   1345  C  CA  . GLU B 1 15  ? 2.843   93.054  -24.504 0.25 32.41 ? 15  GLU B CA  1 
ATOM   1346  C  C   . GLU B 1 15  ? 2.649   94.448  -23.899 0.25 28.90 ? 15  GLU B C   1 
ATOM   1347  O  O   . GLU B 1 15  ? 3.541   95.295  -23.975 0.25 26.84 ? 15  GLU B O   1 
ATOM   1348  C  CB  . GLU B 1 15  ? 1.713   92.752  -25.490 0.25 36.38 ? 15  GLU B CB  1 
ATOM   1349  C  CG  . GLU B 1 15  ? 0.360   92.526  -24.838 0.25 45.20 ? 15  GLU B CG  1 
ATOM   1350  C  CD  . GLU B 1 15  ? -0.705  92.132  -25.839 0.25 48.02 ? 15  GLU B CD  1 
ATOM   1351  O  OE1 . GLU B 1 15  ? -0.941  92.906  -26.791 0.25 51.44 ? 15  GLU B OE1 1 
ATOM   1352  O  OE2 . GLU B 1 15  ? -1.306  91.049  -25.674 0.25 51.82 ? 15  GLU B OE2 1 
ATOM   1353  N  N   . SER B 1 16  ? 1.490   94.684  -23.293 0.25 25.33 ? 16  SER B N   1 
ATOM   1354  C  CA  . SER B 1 16  ? 1.210   95.982  -22.693 0.25 23.08 ? 16  SER B CA  1 
ATOM   1355  C  C   . SER B 1 16  ? 0.647   95.874  -21.284 0.25 20.88 ? 16  SER B C   1 
ATOM   1356  O  O   . SER B 1 16  ? 0.286   94.788  -20.820 0.25 20.82 ? 16  SER B O   1 
ATOM   1357  C  CB  . SER B 1 16  ? 0.215   96.764  -23.558 0.25 23.44 ? 16  SER B CB  1 
ATOM   1358  O  OG  . SER B 1 16  ? 0.755   97.064  -24.832 0.25 25.56 ? 16  SER B OG  1 
ATOM   1359  N  N   . PHE B 1 17  ? 0.584   97.015  -20.605 0.25 17.65 ? 17  PHE B N   1 
ATOM   1360  C  CA  . PHE B 1 17  ? 0.023   97.079  -19.265 0.25 14.75 ? 17  PHE B CA  1 
ATOM   1361  C  C   . PHE B 1 17  ? -0.736  98.385  -19.129 0.25 14.04 ? 17  PHE B C   1 
ATOM   1362  O  O   . PHE B 1 17  ? -0.526  99.321  -19.907 0.25 12.14 ? 17  PHE B O   1 
ATOM   1363  C  CB  . PHE B 1 17  ? 1.111   96.978  -18.179 0.25 14.17 ? 17  PHE B CB  1 
ATOM   1364  C  CG  . PHE B 1 17  ? 1.980   98.202  -18.047 0.25 12.00 ? 17  PHE B CG  1 
ATOM   1365  C  CD1 . PHE B 1 17  ? 3.170   98.311  -18.756 0.25 12.29 ? 17  PHE B CD1 1 
ATOM   1366  C  CD2 . PHE B 1 17  ? 1.623   99.235  -17.184 0.25 12.11 ? 17  PHE B CD2 1 
ATOM   1367  C  CE1 . PHE B 1 17  ? 3.997   99.433  -18.604 0.25 11.08 ? 17  PHE B CE1 1 
ATOM   1368  C  CE2 . PHE B 1 17  ? 2.437   100.354 -17.026 0.25 9.71  ? 17  PHE B CE2 1 
ATOM   1369  C  CZ  . PHE B 1 17  ? 3.628   100.454 -17.738 0.25 8.96  ? 17  PHE B CZ  1 
ATOM   1370  N  N   . LEU B 1 18  ? -1.624  98.446  -18.145 0.25 10.80 ? 18  LEU B N   1 
ATOM   1371  C  CA  . LEU B 1 18  ? -2.411  99.644  -17.926 0.25 11.06 ? 18  LEU B CA  1 
ATOM   1372  C  C   . LEU B 1 18  ? -1.876  100.397 -16.721 0.25 12.21 ? 18  LEU B C   1 
ATOM   1373  O  O   . LEU B 1 18  ? -1.669  99.815  -15.649 0.25 8.64  ? 18  LEU B O   1 
ATOM   1374  C  CB  . LEU B 1 18  ? -3.885  99.284  -17.718 0.25 8.49  ? 18  LEU B CB  1 
ATOM   1375  C  CG  . LEU B 1 18  ? -4.509  98.479  -18.858 0.25 11.30 ? 18  LEU B CG  1 
ATOM   1376  C  CD1 . LEU B 1 18  ? -5.988  98.245  -18.558 0.25 10.27 ? 18  LEU B CD1 1 
ATOM   1377  C  CD2 . LEU B 1 18  ? -4.342  99.228  -20.177 0.25 11.57 ? 18  LEU B CD2 1 
ATOM   1378  N  N   . TYR B 1 19  ? -1.657  101.696 -16.921 0.25 10.55 ? 19  TYR B N   1 
ATOM   1379  C  CA  . TYR B 1 19  ? -1.129  102.588 -15.894 0.25 11.42 ? 19  TYR B CA  1 
ATOM   1380  C  C   . TYR B 1 19  ? -2.155  103.665 -15.535 0.25 11.12 ? 19  TYR B C   1 
ATOM   1381  O  O   . TYR B 1 19  ? -2.599  104.424 -16.405 0.25 11.41 ? 19  TYR B O   1 
ATOM   1382  C  CB  . TYR B 1 19  ? 0.172   103.229 -16.407 0.25 10.82 ? 19  TYR B CB  1 
ATOM   1383  C  CG  . TYR B 1 19  ? 0.613   104.471 -15.668 0.25 10.49 ? 19  TYR B CG  1 
ATOM   1384  C  CD1 . TYR B 1 19  ? 0.765   104.472 -14.283 0.25 11.68 ? 19  TYR B CD1 1 
ATOM   1385  C  CD2 . TYR B 1 19  ? 0.870   105.657 -16.360 0.25 11.23 ? 19  TYR B CD2 1 
ATOM   1386  C  CE1 . TYR B 1 19  ? 1.159   105.630 -13.598 0.25 12.25 ? 19  TYR B CE1 1 
ATOM   1387  C  CE2 . TYR B 1 19  ? 1.268   106.817 -15.687 0.25 11.51 ? 19  TYR B CE2 1 
ATOM   1388  C  CZ  . TYR B 1 19  ? 1.406   106.798 -14.309 0.25 12.35 ? 19  TYR B CZ  1 
ATOM   1389  O  OH  . TYR B 1 19  ? 1.769   107.956 -13.650 0.25 14.38 ? 19  TYR B OH  1 
ATOM   1390  N  N   . PHE B 1 20  ? -2.535  103.712 -14.257 0.25 10.28 ? 20  PHE B N   1 
ATOM   1391  C  CA  . PHE B 1 20  ? -3.512  104.690 -13.761 0.25 7.99  ? 20  PHE B CA  1 
ATOM   1392  C  C   . PHE B 1 20  ? -2.767  105.853 -13.119 0.25 8.10  ? 20  PHE B C   1 
ATOM   1393  O  O   . PHE B 1 20  ? -2.254  105.739 -12.003 0.25 6.45  ? 20  PHE B O   1 
ATOM   1394  C  CB  . PHE B 1 20  ? -4.446  104.044 -12.725 0.25 8.81  ? 20  PHE B CB  1 
ATOM   1395  C  CG  . PHE B 1 20  ? -5.487  104.983 -12.163 0.25 9.14  ? 20  PHE B CG  1 
ATOM   1396  C  CD1 . PHE B 1 20  ? -6.537  105.442 -12.957 0.25 10.23 ? 20  PHE B CD1 1 
ATOM   1397  C  CD2 . PHE B 1 20  ? -5.424  105.398 -10.833 0.25 9.51  ? 20  PHE B CD2 1 
ATOM   1398  C  CE1 . PHE B 1 20  ? -7.515  106.301 -12.438 0.25 9.81  ? 20  PHE B CE1 1 
ATOM   1399  C  CE2 . PHE B 1 20  ? -6.398  106.261 -10.299 0.25 11.97 ? 20  PHE B CE2 1 
ATOM   1400  C  CZ  . PHE B 1 20  ? -7.443  106.711 -11.104 0.25 11.22 ? 20  PHE B CZ  1 
ATOM   1401  N  N   . ALA B 1 21  ? -2.710  106.970 -13.834 0.25 6.24  ? 21  ALA B N   1 
ATOM   1402  C  CA  . ALA B 1 21  ? -2.019  108.162 -13.354 0.25 7.67  ? 21  ALA B CA  1 
ATOM   1403  C  C   . ALA B 1 21  ? -3.002  109.109 -12.669 0.25 8.37  ? 21  ALA B C   1 
ATOM   1404  O  O   . ALA B 1 21  ? -4.198  109.078 -12.953 0.25 7.71  ? 21  ALA B O   1 
ATOM   1405  C  CB  . ALA B 1 21  ? -1.345  108.875 -14.534 0.25 9.05  ? 21  ALA B CB  1 
ATOM   1406  N  N   . TYR B 1 22  ? -2.494  109.950 -11.769 0.25 7.20  ? 22  TYR B N   1 
ATOM   1407  C  CA  . TYR B 1 22  ? -3.337  110.914 -11.064 0.25 7.87  ? 22  TYR B CA  1 
ATOM   1408  C  C   . TYR B 1 22  ? -2.588  112.203 -10.731 0.25 8.29  ? 22  TYR B C   1 
ATOM   1409  O  O   . TYR B 1 22  ? -3.191  113.185 -10.301 0.25 11.09 ? 22  TYR B O   1 
ATOM   1410  C  CB  . TYR B 1 22  ? -3.931  110.283 -9.792  0.25 10.31 ? 22  TYR B CB  1 
ATOM   1411  C  CG  . TYR B 1 22  ? -2.913  109.791 -8.787  0.25 6.85  ? 22  TYR B CG  1 
ATOM   1412  C  CD1 . TYR B 1 22  ? -2.317  110.665 -7.885  0.25 10.02 ? 22  TYR B CD1 1 
ATOM   1413  C  CD2 . TYR B 1 22  ? -2.545  108.447 -8.743  0.25 9.52  ? 22  TYR B CD2 1 
ATOM   1414  C  CE1 . TYR B 1 22  ? -1.372  110.210 -6.949  0.25 8.22  ? 22  TYR B CE1 1 
ATOM   1415  C  CE2 . TYR B 1 22  ? -1.603  107.980 -7.818  0.25 8.19  ? 22  TYR B CE2 1 
ATOM   1416  C  CZ  . TYR B 1 22  ? -1.024  108.870 -6.925  0.25 9.09  ? 22  TYR B CZ  1 
ATOM   1417  O  OH  . TYR B 1 22  ? -0.108  108.416 -6.006  0.25 7.33  ? 22  TYR B OH  1 
ATOM   1418  N  N   . GLY B 1 23  ? -1.275  112.197 -10.958 0.25 8.62  ? 23  GLY B N   1 
ATOM   1419  C  CA  . GLY B 1 23  ? -0.446  113.363 -10.696 0.25 7.75  ? 23  GLY B CA  1 
ATOM   1420  C  C   . GLY B 1 23  ? -0.315  114.240 -11.929 0.25 8.11  ? 23  GLY B C   1 
ATOM   1421  O  O   . GLY B 1 23  ? -1.320  114.663 -12.496 0.25 9.74  ? 23  GLY B O   1 
ATOM   1422  N  N   . SER B 1 24  ? 0.918   114.509 -12.351 0.25 10.32 ? 24  SER B N   1 
ATOM   1423  C  CA  . SER B 1 24  ? 1.149   115.338 -13.527 0.25 11.21 ? 24  SER B CA  1 
ATOM   1424  C  C   . SER B 1 24  ? 0.984   114.562 -14.832 0.25 12.09 ? 24  SER B C   1 
ATOM   1425  O  O   . SER B 1 24  ? 0.813   115.164 -15.893 0.25 12.10 ? 24  SER B O   1 
ATOM   1426  C  CB  . SER B 1 24  ? 2.539   115.990 -13.468 0.25 10.07 ? 24  SER B CB  1 
ATOM   1427  O  OG  . SER B 1 24  ? 3.564   115.057 -13.169 0.25 9.83  ? 24  SER B OG  1 
ATOM   1428  N  N   . ASN B 1 25  ? 1.028   113.231 -14.770 0.25 10.97 ? 25  ASN B N   1 
ATOM   1429  C  CA  . ASN B 1 25  ? 0.853   112.452 -15.990 0.25 10.44 ? 25  ASN B CA  1 
ATOM   1430  C  C   . ASN B 1 25  ? -0.594  112.420 -16.494 0.25 11.16 ? 25  ASN B C   1 
ATOM   1431  O  O   . ASN B 1 25  ? -0.950  111.600 -17.344 0.25 9.62  ? 25  ASN B O   1 
ATOM   1432  C  CB  . ASN B 1 25  ? 1.407   111.029 -15.831 0.25 11.02 ? 25  ASN B CB  1 
ATOM   1433  C  CG  . ASN B 1 25  ? 2.922   110.979 -15.977 0.25 13.73 ? 25  ASN B CG  1 
ATOM   1434  O  OD1 . ASN B 1 25  ? 3.513   111.796 -16.692 0.25 12.68 ? 25  ASN B OD1 1 
ATOM   1435  N  ND2 . ASN B 1 25  ? 3.557   110.013 -15.314 0.25 12.43 ? 25  ASN B ND2 1 
ATOM   1436  N  N   . LEU B 1 26  ? -1.433  113.310 -15.967 0.25 10.12 ? 26  LEU B N   1 
ATOM   1437  C  CA  . LEU B 1 26  ? -2.806  113.410 -16.455 0.25 9.29  ? 26  LEU B CA  1 
ATOM   1438  C  C   . LEU B 1 26  ? -2.693  114.105 -17.816 0.25 10.22 ? 26  LEU B C   1 
ATOM   1439  O  O   . LEU B 1 26  ? -3.560  113.962 -18.675 0.25 10.70 ? 26  LEU B O   1 
ATOM   1440  C  CB  . LEU B 1 26  ? -3.666  114.281 -15.534 0.25 9.86  ? 26  LEU B CB  1 
ATOM   1441  C  CG  . LEU B 1 26  ? -4.166  113.741 -14.195 0.25 9.42  ? 26  LEU B CG  1 
ATOM   1442  C  CD1 . LEU B 1 26  ? -4.904  114.858 -13.457 0.25 8.99  ? 26  LEU B CD1 1 
ATOM   1443  C  CD2 . LEU B 1 26  ? -5.097  112.554 -14.430 0.25 12.36 ? 26  LEU B CD2 1 
ATOM   1444  N  N   . LEU B 1 27  ? -1.602  114.848 -18.001 0.25 8.41  ? 27  LEU B N   1 
ATOM   1445  C  CA  . LEU B 1 27  ? -1.360  115.591 -19.239 0.25 10.33 ? 27  LEU B CA  1 
ATOM   1446  C  C   . LEU B 1 27  ? -0.686  114.748 -20.324 0.25 10.99 ? 27  LEU B C   1 
ATOM   1447  O  O   . LEU B 1 27  ? 0.348   114.120 -20.098 0.25 9.77  ? 27  LEU B O   1 
ATOM   1448  C  CB  . LEU B 1 27  ? -0.503  116.829 -18.943 0.25 11.14 ? 27  LEU B CB  1 
ATOM   1449  C  CG  . LEU B 1 27  ? -0.288  117.781 -20.122 0.25 13.47 ? 27  LEU B CG  1 
ATOM   1450  C  CD1 . LEU B 1 27  ? -1.631  118.353 -20.546 0.25 11.74 ? 27  LEU B CD1 1 
ATOM   1451  C  CD2 . LEU B 1 27  ? 0.670   118.898 -19.734 0.25 11.27 ? 27  LEU B CD2 1 
ATOM   1452  N  N   . THR B 1 28  ? -1.276  114.749 -21.514 0.25 12.66 ? 28  THR B N   1 
ATOM   1453  C  CA  . THR B 1 28  ? -0.746  113.977 -22.630 0.25 12.62 ? 28  THR B CA  1 
ATOM   1454  C  C   . THR B 1 28  ? 0.705   114.318 -22.936 0.25 14.30 ? 28  THR B C   1 
ATOM   1455  O  O   . THR B 1 28  ? 1.579   113.456 -22.862 0.25 14.87 ? 28  THR B O   1 
ATOM   1456  C  CB  . THR B 1 28  ? -1.572  114.208 -23.899 0.25 13.87 ? 28  THR B CB  1 
ATOM   1457  O  OG1 . THR B 1 28  ? -2.965  114.092 -23.588 0.25 8.77  ? 28  THR B OG1 1 
ATOM   1458  C  CG2 . THR B 1 28  ? -1.209  113.174 -24.960 0.25 11.69 ? 28  THR B CG2 1 
ATOM   1459  N  N   . GLU B 1 29  ? 0.957   115.576 -23.280 0.25 15.78 ? 29  GLU B N   1 
ATOM   1460  C  CA  . GLU B 1 29  ? 2.306   116.015 -23.608 0.25 16.07 ? 29  GLU B CA  1 
ATOM   1461  C  C   . GLU B 1 29  ? 3.260   115.725 -22.456 0.25 14.91 ? 29  GLU B C   1 
ATOM   1462  O  O   . GLU B 1 29  ? 4.458   115.533 -22.661 0.25 13.14 ? 29  GLU B O   1 
ATOM   1463  C  CB  . GLU B 1 29  ? 2.319   117.516 -23.927 0.25 18.05 ? 29  GLU B CB  1 
ATOM   1464  C  CG  . GLU B 1 29  ? 3.549   117.964 -24.706 0.25 24.35 ? 29  GLU B CG  1 
ATOM   1465  C  CD  . GLU B 1 29  ? 3.713   119.474 -24.742 0.25 27.03 ? 29  GLU B CD  1 
ATOM   1466  O  OE1 . GLU B 1 29  ? 2.707   120.176 -24.973 0.25 27.29 ? 29  GLU B OE1 1 
ATOM   1467  O  OE2 . GLU B 1 29  ? 4.853   119.956 -24.546 0.25 29.05 ? 29  GLU B OE2 1 
ATOM   1468  N  N   . ARG B 1 30  ? 2.720   115.693 -21.242 0.25 13.72 ? 30  ARG B N   1 
ATOM   1469  C  CA  . ARG B 1 30  ? 3.520   115.426 -20.054 0.25 14.48 ? 30  ARG B CA  1 
ATOM   1470  C  C   . ARG B 1 30  ? 4.008   113.979 -19.979 0.25 12.03 ? 30  ARG B C   1 
ATOM   1471  O  O   . ARG B 1 30  ? 5.208   113.727 -19.871 0.25 14.05 ? 30  ARG B O   1 
ATOM   1472  C  CB  . ARG B 1 30  ? 2.721   115.773 -18.789 0.25 16.91 ? 30  ARG B CB  1 
ATOM   1473  C  CG  . ARG B 1 30  ? 3.393   115.340 -17.489 0.25 19.67 ? 30  ARG B CG  1 
ATOM   1474  C  CD  . ARG B 1 30  ? 4.813   115.876 -17.384 0.25 22.43 ? 30  ARG B CD  1 
ATOM   1475  N  NE  . ARG B 1 30  ? 5.532   115.268 -16.268 0.25 24.44 ? 30  ARG B NE  1 
ATOM   1476  C  CZ  . ARG B 1 30  ? 6.811   115.493 -15.988 0.25 25.31 ? 30  ARG B CZ  1 
ATOM   1477  N  NH1 . ARG B 1 30  ? 7.526   116.318 -16.746 0.25 25.93 ? 30  ARG B NH1 1 
ATOM   1478  N  NH2 . ARG B 1 30  ? 7.374   114.893 -14.949 0.25 25.06 ? 30  ARG B NH2 1 
ATOM   1479  N  N   . ILE B 1 31  ? 3.089   113.025 -20.034 0.25 11.79 ? 31  ILE B N   1 
ATOM   1480  C  CA  . ILE B 1 31  ? 3.490   111.627 -19.956 0.25 10.64 ? 31  ILE B CA  1 
ATOM   1481  C  C   . ILE B 1 31  ? 4.382   111.241 -21.137 0.25 11.81 ? 31  ILE B C   1 
ATOM   1482  O  O   . ILE B 1 31  ? 5.182   110.312 -21.037 0.25 12.58 ? 31  ILE B O   1 
ATOM   1483  C  CB  . ILE B 1 31  ? 2.273   110.679 -19.918 0.25 9.77  ? 31  ILE B CB  1 
ATOM   1484  C  CG1 . ILE B 1 31  ? 2.745   109.258 -19.592 0.25 7.37  ? 31  ILE B CG1 1 
ATOM   1485  C  CG2 . ILE B 1 31  ? 1.550   110.693 -21.260 0.25 5.46  ? 31  ILE B CG2 1 
ATOM   1486  C  CD1 . ILE B 1 31  ? 1.617   108.269 -19.337 0.25 10.50 ? 31  ILE B CD1 1 
ATOM   1487  N  N   . HIS B 1 32  ? 4.257   111.974 -22.241 0.25 12.50 ? 32  HIS B N   1 
ATOM   1488  C  CA  . HIS B 1 32  ? 5.042   111.702 -23.442 0.25 13.62 ? 32  HIS B CA  1 
ATOM   1489  C  C   . HIS B 1 32  ? 6.511   112.110 -23.370 0.25 15.48 ? 32  HIS B C   1 
ATOM   1490  O  O   . HIS B 1 32  ? 7.286   111.770 -24.267 0.25 16.49 ? 32  HIS B O   1 
ATOM   1491  C  CB  . HIS B 1 32  ? 4.403   112.381 -24.659 0.25 13.71 ? 32  HIS B CB  1 
ATOM   1492  C  CG  . HIS B 1 32  ? 3.168   111.697 -25.157 0.25 10.99 ? 32  HIS B CG  1 
ATOM   1493  N  ND1 . HIS B 1 32  ? 2.365   112.236 -26.138 0.25 12.13 ? 32  HIS B ND1 1 
ATOM   1494  C  CD2 . HIS B 1 32  ? 2.595   110.521 -24.807 0.25 10.18 ? 32  HIS B CD2 1 
ATOM   1495  C  CE1 . HIS B 1 32  ? 1.348   111.424 -26.369 0.25 6.50  ? 32  HIS B CE1 1 
ATOM   1496  N  NE2 . HIS B 1 32  ? 1.464   110.376 -25.574 0.25 13.29 ? 32  HIS B NE2 1 
ATOM   1497  N  N   . LEU B 1 33  ? 6.902   112.839 -22.330 0.25 15.09 ? 33  LEU B N   1 
ATOM   1498  C  CA  . LEU B 1 33  ? 8.297   113.256 -22.213 0.25 16.32 ? 33  LEU B CA  1 
ATOM   1499  C  C   . LEU B 1 33  ? 9.218   112.043 -22.090 0.25 17.04 ? 33  LEU B C   1 
ATOM   1500  O  O   . LEU B 1 33  ? 10.117  111.853 -22.911 0.25 16.35 ? 33  LEU B O   1 
ATOM   1501  C  CB  . LEU B 1 33  ? 8.496   114.191 -21.010 0.25 16.99 ? 33  LEU B CB  1 
ATOM   1502  C  CG  . LEU B 1 33  ? 7.986   115.633 -21.141 0.25 21.58 ? 33  LEU B CG  1 
ATOM   1503  C  CD1 . LEU B 1 33  ? 8.300   116.400 -19.867 0.25 21.91 ? 33  LEU B CD1 1 
ATOM   1504  C  CD2 . LEU B 1 33  ? 8.640   116.318 -22.335 0.25 23.32 ? 33  LEU B CD2 1 
ATOM   1505  N  N   . ARG B 1 34  ? 8.987   111.224 -21.068 0.25 15.82 ? 34  ARG B N   1 
ATOM   1506  C  CA  . ARG B 1 34  ? 9.785   110.022 -20.838 0.25 15.92 ? 34  ARG B CA  1 
ATOM   1507  C  C   . ARG B 1 34  ? 9.106   108.781 -21.421 0.25 15.29 ? 34  ARG B C   1 
ATOM   1508  O  O   . ARG B 1 34  ? 9.756   107.766 -21.664 0.25 15.31 ? 34  ARG B O   1 
ATOM   1509  C  CB  . ARG B 1 34  ? 9.999   109.805 -19.331 0.25 20.14 ? 34  ARG B CB  1 
ATOM   1510  C  CG  . ARG B 1 34  ? 10.937  110.802 -18.641 0.25 22.96 ? 34  ARG B CG  1 
ATOM   1511  C  CD  . ARG B 1 34  ? 12.369  110.648 -19.139 0.25 25.31 ? 34  ARG B CD  1 
ATOM   1512  N  NE  . ARG B 1 34  ? 12.845  109.272 -19.013 0.25 26.15 ? 34  ARG B NE  1 
ATOM   1513  C  CZ  . ARG B 1 34  ? 13.132  108.674 -17.860 0.25 27.17 ? 34  ARG B CZ  1 
ATOM   1514  N  NH1 . ARG B 1 34  ? 13.000  109.329 -16.714 0.25 28.99 ? 34  ARG B NH1 1 
ATOM   1515  N  NH2 . ARG B 1 34  ? 13.536  107.410 -17.853 0.25 26.70 ? 34  ARG B NH2 1 
ATOM   1516  N  N   . ASN B 1 35  ? 7.798   108.863 -21.647 0.25 12.77 ? 35  ASN B N   1 
ATOM   1517  C  CA  . ASN B 1 35  ? 7.040   107.725 -22.170 0.25 11.89 ? 35  ASN B CA  1 
ATOM   1518  C  C   . ASN B 1 35  ? 6.337   108.082 -23.482 0.25 11.37 ? 35  ASN B C   1 
ATOM   1519  O  O   . ASN B 1 35  ? 5.105   108.117 -23.550 0.25 10.47 ? 35  ASN B O   1 
ATOM   1520  C  CB  . ASN B 1 35  ? 5.998   107.298 -21.135 0.25 12.10 ? 35  ASN B CB  1 
ATOM   1521  C  CG  . ASN B 1 35  ? 6.557   107.273 -19.727 0.25 14.53 ? 35  ASN B CG  1 
ATOM   1522  O  OD1 . ASN B 1 35  ? 7.275   106.353 -19.349 0.25 12.84 ? 35  ASN B OD1 1 
ATOM   1523  N  ND2 . ASN B 1 35  ? 6.240   108.302 -18.946 0.25 11.22 ? 35  ASN B ND2 1 
ATOM   1524  N  N   . PRO B 1 36  ? 7.113   108.328 -24.547 0.25 11.10 ? 36  PRO B N   1 
ATOM   1525  C  CA  . PRO B 1 36  ? 6.559   108.690 -25.856 0.25 11.87 ? 36  PRO B CA  1 
ATOM   1526  C  C   . PRO B 1 36  ? 5.499   107.764 -26.436 0.25 12.35 ? 36  PRO B C   1 
ATOM   1527  O  O   . PRO B 1 36  ? 4.555   108.233 -27.077 0.25 11.88 ? 36  PRO B O   1 
ATOM   1528  C  CB  . PRO B 1 36  ? 7.804   108.792 -26.747 0.25 12.62 ? 36  PRO B CB  1 
ATOM   1529  C  CG  . PRO B 1 36  ? 8.776   107.836 -26.086 0.25 13.35 ? 36  PRO B CG  1 
ATOM   1530  C  CD  . PRO B 1 36  ? 8.573   108.142 -24.623 0.25 10.04 ? 36  PRO B CD  1 
ATOM   1531  N  N   . SER B 1 37  ? 5.632   106.460 -26.214 0.25 12.59 ? 37  SER B N   1 
ATOM   1532  C  CA  . SER B 1 37  ? 4.652   105.521 -26.766 0.25 14.02 ? 37  SER B CA  1 
ATOM   1533  C  C   . SER B 1 37  ? 3.406   105.310 -25.900 0.25 13.58 ? 37  SER B C   1 
ATOM   1534  O  O   . SER B 1 37  ? 2.556   104.477 -26.221 0.25 12.78 ? 37  SER B O   1 
ATOM   1535  C  CB  . SER B 1 37  ? 5.313   104.163 -27.059 0.25 14.46 ? 37  SER B CB  1 
ATOM   1536  O  OG  . SER B 1 37  ? 5.797   103.547 -25.882 0.25 17.73 ? 37  SER B OG  1 
ATOM   1537  N  N   . ALA B 1 38  ? 3.289   106.063 -24.810 0.25 13.09 ? 38  ALA B N   1 
ATOM   1538  C  CA  . ALA B 1 38  ? 2.128   105.928 -23.934 0.25 13.76 ? 38  ALA B CA  1 
ATOM   1539  C  C   . ALA B 1 38  ? 0.871   106.275 -24.723 0.25 13.51 ? 38  ALA B C   1 
ATOM   1540  O  O   . ALA B 1 38  ? 0.814   107.307 -25.396 0.25 14.37 ? 38  ALA B O   1 
ATOM   1541  C  CB  . ALA B 1 38  ? 2.262   106.857 -22.720 0.25 12.26 ? 38  ALA B CB  1 
ATOM   1542  N  N   . ALA B 1 39  ? -0.134  105.410 -24.641 0.25 11.90 ? 39  ALA B N   1 
ATOM   1543  C  CA  . ALA B 1 39  ? -1.380  105.637 -25.359 0.25 12.99 ? 39  ALA B CA  1 
ATOM   1544  C  C   . ALA B 1 39  ? -2.528  105.876 -24.393 0.25 12.54 ? 39  ALA B C   1 
ATOM   1545  O  O   . ALA B 1 39  ? -2.733  105.104 -23.455 0.25 10.30 ? 39  ALA B O   1 
ATOM   1546  C  CB  . ALA B 1 39  ? -1.694  104.431 -26.271 0.25 14.59 ? 39  ALA B CB  1 
ATOM   1547  N  N   . PHE B 1 40  ? -3.263  106.961 -24.621 0.25 11.79 ? 40  PHE B N   1 
ATOM   1548  C  CA  . PHE B 1 40  ? -4.403  107.309 -23.783 0.25 11.88 ? 40  PHE B CA  1 
ATOM   1549  C  C   . PHE B 1 40  ? -5.393  106.161 -23.839 0.25 11.19 ? 40  PHE B C   1 
ATOM   1550  O  O   . PHE B 1 40  ? -5.817  105.760 -24.922 0.25 9.96  ? 40  PHE B O   1 
ATOM   1551  C  CB  . PHE B 1 40  ? -5.094  108.575 -24.306 0.25 12.25 ? 40  PHE B CB  1 
ATOM   1552  C  CG  . PHE B 1 40  ? -6.351  108.940 -23.549 0.25 12.45 ? 40  PHE B CG  1 
ATOM   1553  C  CD1 . PHE B 1 40  ? -6.293  109.771 -22.435 0.25 9.59  ? 40  PHE B CD1 1 
ATOM   1554  C  CD2 . PHE B 1 40  ? -7.590  108.449 -23.955 0.25 12.56 ? 40  PHE B CD2 1 
ATOM   1555  C  CE1 . PHE B 1 40  ? -7.453  110.114 -21.737 0.25 13.94 ? 40  PHE B CE1 1 
ATOM   1556  C  CE2 . PHE B 1 40  ? -8.754  108.782 -23.266 0.25 14.20 ? 40  PHE B CE2 1 
ATOM   1557  C  CZ  . PHE B 1 40  ? -8.688  109.618 -22.154 0.25 13.25 ? 40  PHE B CZ  1 
ATOM   1558  N  N   . PHE B 1 41  ? -5.761  105.631 -22.682 0.25 10.85 ? 41  PHE B N   1 
ATOM   1559  C  CA  . PHE B 1 41  ? -6.717  104.533 -22.644 0.25 11.31 ? 41  PHE B CA  1 
ATOM   1560  C  C   . PHE B 1 41  ? -8.096  105.126 -22.383 0.25 12.66 ? 41  PHE B C   1 
ATOM   1561  O  O   . PHE B 1 41  ? -8.903  105.270 -23.302 0.25 10.70 ? 41  PHE B O   1 
ATOM   1562  C  CB  . PHE B 1 41  ? -6.350  103.533 -21.540 0.25 13.64 ? 41  PHE B CB  1 
ATOM   1563  C  CG  . PHE B 1 41  ? -7.173  102.270 -21.566 0.25 16.09 ? 41  PHE B CG  1 
ATOM   1564  C  CD1 . PHE B 1 41  ? -6.963  101.308 -22.552 0.25 17.30 ? 41  PHE B CD1 1 
ATOM   1565  C  CD2 . PHE B 1 41  ? -8.161  102.048 -20.613 0.25 15.80 ? 41  PHE B CD2 1 
ATOM   1566  C  CE1 . PHE B 1 41  ? -7.724  100.142 -22.585 0.25 17.43 ? 41  PHE B CE1 1 
ATOM   1567  C  CE2 . PHE B 1 41  ? -8.930  100.884 -20.636 0.25 18.20 ? 41  PHE B CE2 1 
ATOM   1568  C  CZ  . PHE B 1 41  ? -8.712  99.928  -21.625 0.25 19.05 ? 41  PHE B CZ  1 
ATOM   1569  N  N   . CYS B 1 42  ? -8.356  105.490 -21.130 0.25 13.34 ? 42  CYS B N   1 
ATOM   1570  C  CA  . CYS B 1 42  ? -9.640  106.075 -20.760 0.25 13.88 ? 42  CYS B CA  1 
ATOM   1571  C  C   . CYS B 1 42  ? -9.532  106.824 -19.441 0.25 13.33 ? 42  CYS B C   1 
ATOM   1572  O  O   . CYS B 1 42  ? -8.510  106.761 -18.759 0.25 12.23 ? 42  CYS B O   1 
ATOM   1573  C  CB  . CYS B 1 42  ? -10.704 104.983 -20.616 0.25 16.82 ? 42  CYS B CB  1 
ATOM   1574  S  SG  . CYS B 1 42  ? -10.565 103.986 -19.107 0.25 20.57 ? 42  CYS B SG  1 
ATOM   1575  N  N   . VAL B 1 43  ? -10.595 107.541 -19.092 0.25 13.28 ? 43  VAL B N   1 
ATOM   1576  C  CA  . VAL B 1 43  ? -10.652 108.274 -17.833 0.25 13.13 ? 43  VAL B CA  1 
ATOM   1577  C  C   . VAL B 1 43  ? -11.331 107.320 -16.859 0.25 13.68 ? 43  VAL B C   1 
ATOM   1578  O  O   . VAL B 1 43  ? -12.266 106.606 -17.235 0.25 12.53 ? 43  VAL B O   1 
ATOM   1579  C  CB  . VAL B 1 43  ? -11.478 109.571 -17.983 0.25 15.22 ? 43  VAL B CB  1 
ATOM   1580  C  CG1 . VAL B 1 43  ? -11.868 110.119 -16.616 0.25 13.83 ? 43  VAL B CG1 1 
ATOM   1581  C  CG2 . VAL B 1 43  ? -10.658 110.609 -18.747 0.25 15.51 ? 43  VAL B CG2 1 
ATOM   1582  N  N   . ALA B 1 44  ? -10.863 107.290 -15.614 0.25 11.54 ? 44  ALA B N   1 
ATOM   1583  C  CA  . ALA B 1 44  ? -11.447 106.379 -14.642 0.25 10.46 ? 44  ALA B CA  1 
ATOM   1584  C  C   . ALA B 1 44  ? -11.472 106.915 -13.219 0.25 10.92 ? 44  ALA B C   1 
ATOM   1585  O  O   . ALA B 1 44  ? -10.758 107.852 -12.873 0.25 11.49 ? 44  ALA B O   1 
ATOM   1586  C  CB  . ALA B 1 44  ? -10.711 105.046 -14.681 0.25 9.76  ? 44  ALA B CB  1 
ATOM   1587  N  N   . ARG B 1 45  ? -12.306 106.292 -12.398 0.25 12.03 ? 45  ARG B N   1 
ATOM   1588  C  CA  . ARG B 1 45  ? -12.472 106.688 -11.009 0.25 11.41 ? 45  ARG B CA  1 
ATOM   1589  C  C   . ARG B 1 45  ? -11.890 105.649 -10.060 0.25 10.92 ? 45  ARG B C   1 
ATOM   1590  O  O   . ARG B 1 45  ? -12.046 104.454 -10.270 0.25 7.94  ? 45  ARG B O   1 
ATOM   1591  C  CB  . ARG B 1 45  ? -13.965 106.877 -10.711 0.25 12.33 ? 45  ARG B CB  1 
ATOM   1592  C  CG  . ARG B 1 45  ? -14.325 107.019 -9.237  0.25 19.25 ? 45  ARG B CG  1 
ATOM   1593  C  CD  . ARG B 1 45  ? -15.828 107.285 -9.070  0.25 22.21 ? 45  ARG B CD  1 
ATOM   1594  N  NE  . ARG B 1 45  ? -16.645 106.215 -9.633  0.25 27.49 ? 45  ARG B NE  1 
ATOM   1595  C  CZ  . ARG B 1 45  ? -16.895 105.057 -9.028  0.25 31.95 ? 45  ARG B CZ  1 
ATOM   1596  N  NH1 . ARG B 1 45  ? -16.396 104.808 -7.822  0.25 35.45 ? 45  ARG B NH1 1 
ATOM   1597  N  NH2 . ARG B 1 45  ? -17.640 104.141 -9.634  0.25 34.00 ? 45  ARG B NH2 1 
ATOM   1598  N  N   . LEU B 1 46  ? -11.208 106.125 -9.026  0.25 11.64 ? 46  LEU B N   1 
ATOM   1599  C  CA  . LEU B 1 46  ? -10.636 105.263 -8.007  0.25 11.42 ? 46  LEU B CA  1 
ATOM   1600  C  C   . LEU B 1 46  ? -11.389 105.608 -6.728  0.25 12.04 ? 46  LEU B C   1 
ATOM   1601  O  O   . LEU B 1 46  ? -11.126 106.632 -6.092  0.25 11.90 ? 46  LEU B O   1 
ATOM   1602  C  CB  . LEU B 1 46  ? -9.136  105.537 -7.839  0.25 9.83  ? 46  LEU B CB  1 
ATOM   1603  C  CG  . LEU B 1 46  ? -8.477  104.867 -6.625  0.25 11.55 ? 46  LEU B CG  1 
ATOM   1604  C  CD1 . LEU B 1 46  ? -8.752  103.371 -6.632  0.25 10.15 ? 46  LEU B CD1 1 
ATOM   1605  C  CD2 . LEU B 1 46  ? -6.985  105.143 -6.643  0.25 11.77 ? 46  LEU B CD2 1 
ATOM   1606  N  N   . GLN B 1 47  ? -12.341 104.752 -6.371  0.25 12.32 ? 47  GLN B N   1 
ATOM   1607  C  CA  . GLN B 1 47  ? -13.173 104.946 -5.195  0.25 14.12 ? 47  GLN B CA  1 
ATOM   1608  C  C   . GLN B 1 47  ? -12.457 104.620 -3.884  0.25 13.72 ? 47  GLN B C   1 
ATOM   1609  O  O   . GLN B 1 47  ? -11.589 103.752 -3.835  0.25 13.03 ? 47  GLN B O   1 
ATOM   1610  C  CB  . GLN B 1 47  ? -14.429 104.077 -5.315  0.25 16.83 ? 47  GLN B CB  1 
ATOM   1611  C  CG  . GLN B 1 47  ? -15.473 104.330 -4.238  0.25 17.81 ? 47  GLN B CG  1 
ATOM   1612  C  CD  . GLN B 1 47  ? -16.014 105.749 -4.280  0.25 19.72 ? 47  GLN B CD  1 
ATOM   1613  O  OE1 . GLN B 1 47  ? -16.491 106.209 -5.319  0.25 18.89 ? 47  GLN B OE1 1 
ATOM   1614  N  NE2 . GLN B 1 47  ? -15.945 106.448 -3.147  0.25 18.07 ? 47  GLN B NE2 1 
ATOM   1615  N  N   . ASP B 1 48  ? -12.843 105.329 -2.828  0.25 13.07 ? 48  ASP B N   1 
ATOM   1616  C  CA  . ASP B 1 48  ? -12.293 105.140 -1.489  0.25 12.70 ? 48  ASP B CA  1 
ATOM   1617  C  C   . ASP B 1 48  ? -10.820 105.487 -1.293  0.25 12.24 ? 48  ASP B C   1 
ATOM   1618  O  O   . ASP B 1 48  ? -10.167 104.996 -0.369  0.25 10.46 ? 48  ASP B O   1 
ATOM   1619  C  CB  . ASP B 1 48  ? -12.580 103.716 -1.011  0.25 13.64 ? 48  ASP B CB  1 
ATOM   1620  C  CG  . ASP B 1 48  ? -14.073 103.430 -0.930  0.25 18.71 ? 48  ASP B CG  1 
ATOM   1621  O  OD1 . ASP B 1 48  ? -14.823 104.332 -0.495  0.25 15.67 ? 48  ASP B OD1 1 
ATOM   1622  O  OD2 . ASP B 1 48  ? -14.497 102.314 -1.293  0.25 18.04 ? 48  ASP B OD2 1 
ATOM   1623  N  N   . PHE B 1 49  ? -10.300 106.336 -2.172  0.25 11.14 ? 49  PHE B N   1 
ATOM   1624  C  CA  . PHE B 1 49  ? -8.929  106.811 -2.055  0.25 12.89 ? 49  PHE B CA  1 
ATOM   1625  C  C   . PHE B 1 49  ? -9.018  108.328 -2.044  0.25 12.48 ? 49  PHE B C   1 
ATOM   1626  O  O   . PHE B 1 49  ? -9.931  108.906 -2.633  0.25 14.61 ? 49  PHE B O   1 
ATOM   1627  C  CB  . PHE B 1 49  ? -8.059  106.376 -3.239  0.25 11.79 ? 49  PHE B CB  1 
ATOM   1628  C  CG  . PHE B 1 49  ? -7.431  105.023 -3.076  0.25 11.82 ? 49  PHE B CG  1 
ATOM   1629  C  CD1 . PHE B 1 49  ? -8.166  103.864 -3.300  0.25 11.62 ? 49  PHE B CD1 1 
ATOM   1630  C  CD2 . PHE B 1 49  ? -6.089  104.908 -2.718  0.25 12.19 ? 49  PHE B CD2 1 
ATOM   1631  C  CE1 . PHE B 1 49  ? -7.573  102.606 -3.173  0.25 11.19 ? 49  PHE B CE1 1 
ATOM   1632  C  CE2 . PHE B 1 49  ? -5.486  103.655 -2.586  0.25 12.01 ? 49  PHE B CE2 1 
ATOM   1633  C  CZ  . PHE B 1 49  ? -6.229  102.504 -2.814  0.25 7.54  ? 49  PHE B CZ  1 
ATOM   1634  N  N   . LYS B 1 50  ? -8.070  108.969 -1.375  0.25 13.74 ? 50  LYS B N   1 
ATOM   1635  C  CA  . LYS B 1 50  ? -8.047  110.421 -1.299  0.25 12.49 ? 50  LYS B CA  1 
ATOM   1636  C  C   . LYS B 1 50  ? -6.696  110.961 -1.753  0.25 12.24 ? 50  LYS B C   1 
ATOM   1637  O  O   . LYS B 1 50  ? -5.644  110.511 -1.291  0.25 10.53 ? 50  LYS B O   1 
ATOM   1638  C  CB  . LYS B 1 50  ? -8.319  110.875 0.133   0.25 12.91 ? 50  LYS B CB  1 
ATOM   1639  C  CG  . LYS B 1 50  ? -8.327  112.391 0.316   0.25 14.97 ? 50  LYS B CG  1 
ATOM   1640  C  CD  . LYS B 1 50  ? -8.705  112.744 1.748   0.25 18.22 ? 50  LYS B CD  1 
ATOM   1641  C  CE  . LYS B 1 50  ? -8.747  114.245 1.974   0.25 20.77 ? 50  LYS B CE  1 
ATOM   1642  N  NZ  . LYS B 1 50  ? -9.094  114.561 3.391   0.25 18.40 ? 50  LYS B NZ  1 
ATOM   1643  N  N   . LEU B 1 51  ? -6.733  111.935 -2.655  0.25 9.78  ? 51  LEU B N   1 
ATOM   1644  C  CA  . LEU B 1 51  ? -5.514  112.546 -3.169  0.25 10.47 ? 51  LEU B CA  1 
ATOM   1645  C  C   . LEU B 1 51  ? -4.878  113.405 -2.091  0.25 10.31 ? 51  LEU B C   1 
ATOM   1646  O  O   . LEU B 1 51  ? -5.570  113.936 -1.218  0.25 7.79  ? 51  LEU B O   1 
ATOM   1647  C  CB  . LEU B 1 51  ? -5.829  113.418 -4.385  0.25 10.08 ? 51  LEU B CB  1 
ATOM   1648  C  CG  . LEU B 1 51  ? -4.738  114.372 -4.883  0.25 9.08  ? 51  LEU B CG  1 
ATOM   1649  C  CD1 . LEU B 1 51  ? -3.584  113.584 -5.480  0.25 7.52  ? 51  LEU B CD1 1 
ATOM   1650  C  CD2 . LEU B 1 51  ? -5.332  115.320 -5.923  0.25 8.78  ? 51  LEU B CD2 1 
ATOM   1651  N  N   . ASP B 1 52  ? -3.557  113.530 -2.148  0.25 9.11  ? 52  ASP B N   1 
ATOM   1652  C  CA  . ASP B 1 52  ? -2.837  114.355 -1.189  0.25 11.11 ? 52  ASP B CA  1 
ATOM   1653  C  C   . ASP B 1 52  ? -1.512  114.770 -1.823  0.25 11.83 ? 52  ASP B C   1 
ATOM   1654  O  O   . ASP B 1 52  ? -1.080  114.175 -2.815  0.25 10.78 ? 52  ASP B O   1 
ATOM   1655  C  CB  . ASP B 1 52  ? -2.595  113.570 0.110   0.25 8.97  ? 52  ASP B CB  1 
ATOM   1656  C  CG  . ASP B 1 52  ? -2.181  114.466 1.279   0.25 12.69 ? 52  ASP B CG  1 
ATOM   1657  O  OD1 . ASP B 1 52  ? -2.665  115.614 1.355   0.25 9.34  ? 52  ASP B OD1 1 
ATOM   1658  O  OD2 . ASP B 1 52  ? -1.386  114.017 2.134   0.25 9.52  ? 52  ASP B OD2 1 
ATOM   1659  N  N   . PHE B 1 53  ? -0.879  115.800 -1.271  0.25 12.24 ? 53  PHE B N   1 
ATOM   1660  C  CA  . PHE B 1 53  ? 0.402   116.252 -1.795  0.25 11.70 ? 53  PHE B CA  1 
ATOM   1661  C  C   . PHE B 1 53  ? 1.398   116.312 -0.649  0.25 11.95 ? 53  PHE B C   1 
ATOM   1662  O  O   . PHE B 1 53  ? 1.023   116.611 0.484   0.25 10.09 ? 53  PHE B O   1 
ATOM   1663  C  CB  . PHE B 1 53  ? 0.267   117.632 -2.453  0.25 12.54 ? 53  PHE B CB  1 
ATOM   1664  C  CG  . PHE B 1 53  ? -0.629  117.640 -3.662  0.25 11.83 ? 53  PHE B CG  1 
ATOM   1665  C  CD1 . PHE B 1 53  ? -2.013  117.677 -3.521  0.25 11.38 ? 53  PHE B CD1 1 
ATOM   1666  C  CD2 . PHE B 1 53  ? -0.088  117.566 -4.942  0.25 9.09  ? 53  PHE B CD2 1 
ATOM   1667  C  CE1 . PHE B 1 53  ? -2.843  117.638 -4.639  0.25 12.38 ? 53  PHE B CE1 1 
ATOM   1668  C  CE2 . PHE B 1 53  ? -0.907  117.527 -6.063  0.25 11.42 ? 53  PHE B CE2 1 
ATOM   1669  C  CZ  . PHE B 1 53  ? -2.289  117.562 -5.912  0.25 10.68 ? 53  PHE B CZ  1 
ATOM   1670  N  N   . GLY B 1 54  ? 2.666   116.018 -0.930  0.25 13.62 ? 54  GLY B N   1 
ATOM   1671  C  CA  . GLY B 1 54  ? 3.650   116.061 0.136   0.25 13.84 ? 54  GLY B CA  1 
ATOM   1672  C  C   . GLY B 1 54  ? 5.082   115.724 -0.223  0.25 14.36 ? 54  GLY B C   1 
ATOM   1673  O  O   . GLY B 1 54  ? 5.412   115.454 -1.381  0.25 12.36 ? 54  GLY B O   1 
ATOM   1674  N  N   . ASN B 1 55  ? 5.941   115.743 0.791   0.25 14.74 ? 55  ASN B N   1 
ATOM   1675  C  CA  . ASN B 1 55  ? 7.353   115.446 0.606   0.25 17.09 ? 55  ASN B CA  1 
ATOM   1676  C  C   . ASN B 1 55  ? 7.656   114.015 1.022   0.25 18.49 ? 55  ASN B C   1 
ATOM   1677  O  O   . ASN B 1 55  ? 7.629   113.684 2.211   0.25 18.15 ? 55  ASN B O   1 
ATOM   1678  C  CB  . ASN B 1 55  ? 8.219   116.413 1.422   0.25 15.67 ? 55  ASN B CB  1 
ATOM   1679  C  CG  . ASN B 1 55  ? 8.085   117.854 0.958   0.25 15.86 ? 55  ASN B CG  1 
ATOM   1680  O  OD1 . ASN B 1 55  ? 8.060   118.131 -0.239  0.25 14.47 ? 55  ASN B OD1 1 
ATOM   1681  N  ND2 . ASN B 1 55  ? 8.015   118.780 1.910   0.25 12.63 ? 55  ASN B ND2 1 
ATOM   1682  N  N   . SER B 1 56  ? 7.943   113.170 0.037   0.25 20.90 ? 56  SER B N   1 
ATOM   1683  C  CA  . SER B 1 56  ? 8.250   111.774 0.302   0.25 23.69 ? 56  SER B CA  1 
ATOM   1684  C  C   . SER B 1 56  ? 9.511   111.711 1.153   0.25 24.87 ? 56  SER B C   1 
ATOM   1685  O  O   . SER B 1 56  ? 10.525  112.316 0.814   0.25 25.10 ? 56  SER B O   1 
ATOM   1686  C  CB  . SER B 1 56  ? 8.467   111.023 -1.015  0.25 24.97 ? 56  SER B CB  1 
ATOM   1687  O  OG  . SER B 1 56  ? 8.496   109.622 -0.806  0.25 26.66 ? 56  SER B OG  1 
ATOM   1688  N  N   . GLN B 1 57  ? 9.444   110.983 2.263   0.25 26.90 ? 57  GLN B N   1 
ATOM   1689  C  CA  . GLN B 1 57  ? 10.589  110.861 3.157   0.25 28.21 ? 57  GLN B CA  1 
ATOM   1690  C  C   . GLN B 1 57  ? 11.066  112.258 3.544   0.25 28.64 ? 57  GLN B C   1 
ATOM   1691  O  O   . GLN B 1 57  ? 12.264  112.494 3.707   0.25 28.74 ? 57  GLN B O   1 
ATOM   1692  C  CB  . GLN B 1 57  ? 11.722  110.102 2.461   0.25 30.16 ? 57  GLN B CB  1 
ATOM   1693  C  CG  . GLN B 1 57  ? 11.293  108.780 1.837   0.25 32.93 ? 57  GLN B CG  1 
ATOM   1694  C  CD  . GLN B 1 57  ? 11.090  107.676 2.858   0.25 33.40 ? 57  GLN B CD  1 
ATOM   1695  O  OE1 . GLN B 1 57  ? 10.608  107.916 3.964   0.25 33.42 ? 57  GLN B OE1 1 
ATOM   1696  N  NE2 . GLN B 1 57  ? 11.443  106.454 2.482   0.25 34.16 ? 57  GLN B NE2 1 
ATOM   1697  N  N   . GLY B 1 58  ? 10.120  113.183 3.681   0.25 27.85 ? 58  GLY B N   1 
ATOM   1698  C  CA  . GLY B 1 58  ? 10.463  114.548 4.042   0.25 28.07 ? 58  GLY B CA  1 
ATOM   1699  C  C   . GLY B 1 58  ? 11.406  115.187 3.037   0.25 27.71 ? 58  GLY B C   1 
ATOM   1700  O  O   . GLY B 1 58  ? 12.210  116.050 3.386   0.25 27.30 ? 58  GLY B O   1 
ATOM   1701  N  N   . LYS B 1 59  ? 11.303  114.762 1.782   0.25 28.00 ? 59  LYS B N   1 
ATOM   1702  C  CA  . LYS B 1 59  ? 12.154  115.287 0.720   0.25 28.85 ? 59  LYS B CA  1 
ATOM   1703  C  C   . LYS B 1 59  ? 11.360  116.166 -0.243  0.25 26.99 ? 59  LYS B C   1 
ATOM   1704  O  O   . LYS B 1 59  ? 10.392  115.715 -0.856  0.25 26.83 ? 59  LYS B O   1 
ATOM   1705  C  CB  . LYS B 1 59  ? 12.800  114.129 -0.046  0.25 31.54 ? 59  LYS B CB  1 
ATOM   1706  C  CG  . LYS B 1 59  ? 13.624  113.207 0.837   0.25 35.51 ? 59  LYS B CG  1 
ATOM   1707  C  CD  . LYS B 1 59  ? 14.241  112.061 0.052   0.25 37.76 ? 59  LYS B CD  1 
ATOM   1708  C  CE  . LYS B 1 59  ? 15.112  111.201 0.958   0.25 39.75 ? 59  LYS B CE  1 
ATOM   1709  N  NZ  . LYS B 1 59  ? 15.818  110.117 0.223   0.25 42.20 ? 59  LYS B NZ  1 
ATOM   1710  N  N   . THR B 1 60  ? 11.777  117.423 -0.366  0.25 24.08 ? 60  THR B N   1 
ATOM   1711  C  CA  . THR B 1 60  ? 11.118  118.375 -1.250  0.25 23.83 ? 60  THR B CA  1 
ATOM   1712  C  C   . THR B 1 60  ? 11.511  118.144 -2.707  0.25 23.09 ? 60  THR B C   1 
ATOM   1713  O  O   . THR B 1 60  ? 12.695  118.055 -3.037  0.25 23.08 ? 60  THR B O   1 
ATOM   1714  C  CB  . THR B 1 60  ? 11.480  119.827 -0.875  0.25 23.23 ? 60  THR B CB  1 
ATOM   1715  O  OG1 . THR B 1 60  ? 11.072  120.089 0.474   0.25 23.68 ? 60  THR B OG1 1 
ATOM   1716  C  CG2 . THR B 1 60  ? 10.788  120.808 -1.810  0.25 23.22 ? 60  THR B CG2 1 
ATOM   1717  N  N   . SER B 1 61  ? 10.510  118.053 -3.574  0.25 21.37 ? 61  SER B N   1 
ATOM   1718  C  CA  . SER B 1 61  ? 10.744  117.844 -4.997  0.25 21.96 ? 61  SER B CA  1 
ATOM   1719  C  C   . SER B 1 61  ? 11.659  118.928 -5.555  0.25 21.30 ? 61  SER B C   1 
ATOM   1720  O  O   . SER B 1 61  ? 11.377  120.115 -5.409  0.25 21.76 ? 61  SER B O   1 
ATOM   1721  C  CB  . SER B 1 61  ? 9.414   117.860 -5.757  0.25 19.73 ? 61  SER B CB  1 
ATOM   1722  O  OG  . SER B 1 61  ? 9.630   117.903 -7.158  0.25 18.38 ? 61  SER B OG  1 
ATOM   1723  N  N   . GLN B 1 62  ? 12.756  118.517 -6.186  0.25 22.40 ? 62  GLN B N   1 
ATOM   1724  C  CA  . GLN B 1 62  ? 13.699  119.466 -6.771  0.25 23.15 ? 62  GLN B CA  1 
ATOM   1725  C  C   . GLN B 1 62  ? 13.327  119.770 -8.215  0.25 21.57 ? 62  GLN B C   1 
ATOM   1726  O  O   . GLN B 1 62  ? 13.981  120.566 -8.887  0.25 23.45 ? 62  GLN B O   1 
ATOM   1727  C  CB  . GLN B 1 62  ? 15.126  118.922 -6.697  0.25 25.14 ? 62  GLN B CB  1 
ATOM   1728  C  CG  . GLN B 1 62  ? 15.674  118.881 -5.281  0.25 30.49 ? 62  GLN B CG  1 
ATOM   1729  C  CD  . GLN B 1 62  ? 15.470  120.201 -4.549  0.25 31.87 ? 62  GLN B CD  1 
ATOM   1730  O  OE1 . GLN B 1 62  ? 15.998  121.237 -4.953  0.25 33.73 ? 62  GLN B OE1 1 
ATOM   1731  N  NE2 . GLN B 1 62  ? 14.690  120.167 -3.473  0.25 33.17 ? 62  GLN B NE2 1 
ATOM   1732  N  N   . THR B 1 63  ? 12.272  119.118 -8.684  0.25 20.36 ? 63  THR B N   1 
ATOM   1733  C  CA  . THR B 1 63  ? 11.771  119.324 -10.035 0.25 19.95 ? 63  THR B CA  1 
ATOM   1734  C  C   . THR B 1 63  ? 10.556  120.236 -9.940  0.25 18.42 ? 63  THR B C   1 
ATOM   1735  O  O   . THR B 1 63  ? 10.418  121.202 -10.695 0.25 16.51 ? 63  THR B O   1 
ATOM   1736  C  CB  . THR B 1 63  ? 11.308  118.000 -10.678 0.25 20.80 ? 63  THR B CB  1 
ATOM   1737  O  OG1 . THR B 1 63  ? 12.413  117.093 -10.770 0.25 22.36 ? 63  THR B OG1 1 
ATOM   1738  C  CG2 . THR B 1 63  ? 10.736  118.256 -12.071 0.25 22.26 ? 63  THR B CG2 1 
ATOM   1739  N  N   . TRP B 1 64  ? 9.683   119.923 -8.987  0.25 16.19 ? 64  TRP B N   1 
ATOM   1740  C  CA  . TRP B 1 64  ? 8.450   120.673 -8.789  0.25 15.45 ? 64  TRP B CA  1 
ATOM   1741  C  C   . TRP B 1 64  ? 8.481   121.772 -7.728  0.25 16.29 ? 64  TRP B C   1 
ATOM   1742  O  O   . TRP B 1 64  ? 7.664   122.692 -7.765  0.25 16.22 ? 64  TRP B O   1 
ATOM   1743  C  CB  . TRP B 1 64  ? 7.318   119.691 -8.489  0.25 14.38 ? 64  TRP B CB  1 
ATOM   1744  C  CG  . TRP B 1 64  ? 7.068   118.772 -9.634  0.25 15.00 ? 64  TRP B CG  1 
ATOM   1745  C  CD1 . TRP B 1 64  ? 7.257   117.419 -9.664  0.25 13.21 ? 64  TRP B CD1 1 
ATOM   1746  C  CD2 . TRP B 1 64  ? 6.609   119.143 -10.941 0.25 14.64 ? 64  TRP B CD2 1 
ATOM   1747  N  NE1 . TRP B 1 64  ? 6.944   116.926 -10.909 0.25 12.92 ? 64  TRP B NE1 1 
ATOM   1748  C  CE2 . TRP B 1 64  ? 6.542   117.963 -11.712 0.25 15.63 ? 64  TRP B CE2 1 
ATOM   1749  C  CE3 . TRP B 1 64  ? 6.244   120.363 -11.534 0.25 17.62 ? 64  TRP B CE3 1 
ATOM   1750  C  CZ2 . TRP B 1 64  ? 6.127   117.961 -13.049 0.25 15.64 ? 64  TRP B CZ2 1 
ATOM   1751  C  CZ3 . TRP B 1 64  ? 5.830   120.363 -12.862 0.25 15.34 ? 64  TRP B CZ3 1 
ATOM   1752  C  CH2 . TRP B 1 64  ? 5.775   119.168 -13.605 0.25 16.01 ? 64  TRP B CH2 1 
ATOM   1753  N  N   . HIS B 1 65  ? 9.413   121.678 -6.786  0.25 16.73 ? 65  HIS B N   1 
ATOM   1754  C  CA  . HIS B 1 65  ? 9.539   122.674 -5.724  0.25 17.75 ? 65  HIS B CA  1 
ATOM   1755  C  C   . HIS B 1 65  ? 8.240   122.843 -4.938  0.25 17.02 ? 65  HIS B C   1 
ATOM   1756  O  O   . HIS B 1 65  ? 7.795   123.958 -4.655  0.25 15.29 ? 65  HIS B O   1 
ATOM   1757  C  CB  . HIS B 1 65  ? 9.981   124.020 -6.311  0.25 20.86 ? 65  HIS B CB  1 
ATOM   1758  C  CG  . HIS B 1 65  ? 11.292  123.958 -7.031  0.25 21.90 ? 65  HIS B CG  1 
ATOM   1759  N  ND1 . HIS B 1 65  ? 11.398  123.612 -8.362  0.25 24.08 ? 65  HIS B ND1 1 
ATOM   1760  C  CD2 . HIS B 1 65  ? 12.559  124.151 -6.593  0.25 23.17 ? 65  HIS B CD2 1 
ATOM   1761  C  CE1 . HIS B 1 65  ? 12.671  123.595 -8.712  0.25 23.70 ? 65  HIS B CE1 1 
ATOM   1762  N  NE2 . HIS B 1 65  ? 13.397  123.917 -7.656  0.25 24.41 ? 65  HIS B NE2 1 
ATOM   1763  N  N   . GLY B 1 66  ? 7.643   121.711 -4.589  0.25 15.42 ? 66  GLY B N   1 
ATOM   1764  C  CA  . GLY B 1 66  ? 6.409   121.707 -3.832  0.25 13.76 ? 66  GLY B CA  1 
ATOM   1765  C  C   . GLY B 1 66  ? 6.069   120.257 -3.560  0.25 13.44 ? 66  GLY B C   1 
ATOM   1766  O  O   . GLY B 1 66  ? 6.806   119.361 -3.978  0.25 13.37 ? 66  GLY B O   1 
ATOM   1767  N  N   . GLY B 1 67  ? 4.968   120.014 -2.860  0.25 10.93 ? 67  GLY B N   1 
ATOM   1768  C  CA  . GLY B 1 67  ? 4.584   118.646 -2.584  0.25 10.35 ? 67  GLY B CA  1 
ATOM   1769  C  C   . GLY B 1 67  ? 4.100   117.994 -3.863  0.25 10.46 ? 67  GLY B C   1 
ATOM   1770  O  O   . GLY B 1 67  ? 3.492   118.649 -4.714  0.25 9.39  ? 67  GLY B O   1 
ATOM   1771  N  N   . ILE B 1 68  ? 4.376   116.707 -4.024  0.25 10.49 ? 68  ILE B N   1 
ATOM   1772  C  CA  . ILE B 1 68  ? 3.916   116.021 -5.220  0.25 9.52  ? 68  ILE B CA  1 
ATOM   1773  C  C   . ILE B 1 68  ? 2.755   115.096 -4.861  0.25 8.56  ? 68  ILE B C   1 
ATOM   1774  O  O   . ILE B 1 68  ? 2.586   114.702 -3.704  0.25 9.23  ? 68  ILE B O   1 
ATOM   1775  C  CB  . ILE B 1 68  ? 5.074   115.273 -5.922  0.25 10.81 ? 68  ILE B CB  1 
ATOM   1776  C  CG1 . ILE B 1 68  ? 5.840   114.405 -4.929  0.25 10.92 ? 68  ILE B CG1 1 
ATOM   1777  C  CG2 . ILE B 1 68  ? 6.029   116.292 -6.555  0.25 11.39 ? 68  ILE B CG2 1 
ATOM   1778  C  CD1 . ILE B 1 68  ? 6.949   113.595 -5.580  0.25 11.26 ? 68  ILE B CD1 1 
ATOM   1779  N  N   . ALA B 1 69  ? 1.937   114.778 -5.856  0.25 7.47  ? 69  ALA B N   1 
ATOM   1780  C  CA  . ALA B 1 69  ? 0.741   113.970 -5.657  0.25 5.46  ? 69  ALA B CA  1 
ATOM   1781  C  C   . ALA B 1 69  ? 0.890   112.523 -5.189  0.25 6.48  ? 69  ALA B C   1 
ATOM   1782  O  O   . ALA B 1 69  ? 1.772   111.793 -5.625  0.25 7.18  ? 69  ALA B O   1 
ATOM   1783  C  CB  . ALA B 1 69  ? -0.103  114.010 -6.928  0.25 4.56  ? 69  ALA B CB  1 
ATOM   1784  N  N   . THR B 1 70  ? -0.006  112.123 -4.295  0.25 6.15  ? 70  THR B N   1 
ATOM   1785  C  CA  . THR B 1 70  ? -0.048  110.764 -3.780  0.25 6.97  ? 70  THR B CA  1 
ATOM   1786  C  C   . THR B 1 70  ? -1.507  110.474 -3.425  0.25 7.02  ? 70  THR B C   1 
ATOM   1787  O  O   . THR B 1 70  ? -2.366  111.361 -3.508  0.25 6.58  ? 70  THR B O   1 
ATOM   1788  C  CB  . THR B 1 70  ? 0.847   110.605 -2.529  0.25 8.64  ? 70  THR B CB  1 
ATOM   1789  O  OG1 . THR B 1 70  ? 0.864   109.231 -2.123  0.25 8.45  ? 70  THR B OG1 1 
ATOM   1790  C  CG2 . THR B 1 70  ? 0.334   111.480 -1.385  0.25 9.89  ? 70  THR B CG2 1 
ATOM   1791  N  N   . ILE B 1 71  ? -1.794  109.234 -3.051  0.25 6.83  ? 71  ILE B N   1 
ATOM   1792  C  CA  . ILE B 1 71  ? -3.153  108.856 -2.682  0.25 7.02  ? 71  ILE B CA  1 
ATOM   1793  C  C   . ILE B 1 71  ? -3.129  107.861 -1.535  0.25 8.76  ? 71  ILE B C   1 
ATOM   1794  O  O   . ILE B 1 71  ? -2.232  107.015 -1.454  0.25 8.36  ? 71  ILE B O   1 
ATOM   1795  C  CB  . ILE B 1 71  ? -3.903  108.193 -3.859  0.25 8.12  ? 71  ILE B CB  1 
ATOM   1796  C  CG1 . ILE B 1 71  ? -3.131  106.955 -4.333  0.25 5.99  ? 71  ILE B CG1 1 
ATOM   1797  C  CG2 . ILE B 1 71  ? -4.072  109.192 -5.003  0.25 7.96  ? 71  ILE B CG2 1 
ATOM   1798  C  CD1 . ILE B 1 71  ? -3.859  106.124 -5.376  0.25 7.19  ? 71  ILE B CD1 1 
ATOM   1799  N  N   . PHE B 1 72  ? -4.116  107.968 -0.649  0.25 8.46  ? 72  PHE B N   1 
ATOM   1800  C  CA  . PHE B 1 72  ? -4.234  107.055 0.472   0.25 10.13 ? 72  PHE B CA  1 
ATOM   1801  C  C   . PHE B 1 72  ? -5.695  106.617 0.588   0.25 11.16 ? 72  PHE B C   1 
ATOM   1802  O  O   . PHE B 1 72  ? -6.598  107.305 0.102   0.25 10.08 ? 72  PHE B O   1 
ATOM   1803  C  CB  . PHE B 1 72  ? -3.726  107.715 1.767   0.25 10.67 ? 72  PHE B CB  1 
ATOM   1804  C  CG  . PHE B 1 72  ? -4.536  108.904 2.222   0.25 13.67 ? 72  PHE B CG  1 
ATOM   1805  C  CD1 . PHE B 1 72  ? -5.792  108.734 2.800   0.25 14.13 ? 72  PHE B CD1 1 
ATOM   1806  C  CD2 . PHE B 1 72  ? -4.023  110.192 2.109   0.25 14.42 ? 72  PHE B CD2 1 
ATOM   1807  C  CE1 . PHE B 1 72  ? -6.523  109.827 3.266   0.25 13.57 ? 72  PHE B CE1 1 
ATOM   1808  C  CE2 . PHE B 1 72  ? -4.745  111.296 2.572   0.25 13.05 ? 72  PHE B CE2 1 
ATOM   1809  C  CZ  . PHE B 1 72  ? -5.996  111.113 3.150   0.25 12.36 ? 72  PHE B CZ  1 
ATOM   1810  N  N   . GLN B 1 73  ? -5.915  105.458 1.204   0.25 11.07 ? 73  GLN B N   1 
ATOM   1811  C  CA  . GLN B 1 73  ? -7.256  104.898 1.362   0.25 10.86 ? 73  GLN B CA  1 
ATOM   1812  C  C   . GLN B 1 73  ? -8.114  105.652 2.369   0.25 12.00 ? 73  GLN B C   1 
ATOM   1813  O  O   . GLN B 1 73  ? -7.686  105.925 3.494   0.25 8.82  ? 73  GLN B O   1 
ATOM   1814  C  CB  . GLN B 1 73  ? -7.155  103.421 1.761   0.25 10.71 ? 73  GLN B CB  1 
ATOM   1815  C  CG  . GLN B 1 73  ? -6.455  102.551 0.711   0.25 10.94 ? 73  GLN B CG  1 
ATOM   1816  C  CD  . GLN B 1 73  ? -5.916  101.248 1.287   0.25 13.96 ? 73  GLN B CD  1 
ATOM   1817  O  OE1 . GLN B 1 73  ? -5.036  101.254 2.154   0.25 11.82 ? 73  GLN B OE1 1 
ATOM   1818  N  NE2 . GLN B 1 73  ? -6.441  100.124 0.808   0.25 11.13 ? 73  GLN B NE2 1 
ATOM   1819  N  N   . SER B 1 74  ? -9.340  105.960 1.954   0.25 11.87 ? 74  SER B N   1 
ATOM   1820  C  CA  . SER B 1 74  ? -10.294 106.698 2.771   0.25 14.38 ? 74  SER B CA  1 
ATOM   1821  C  C   . SER B 1 74  ? -11.701 106.474 2.213   0.25 15.10 ? 74  SER B C   1 
ATOM   1822  O  O   . SER B 1 74  ? -12.090 107.085 1.218   0.25 13.15 ? 74  SER B O   1 
ATOM   1823  C  CB  . SER B 1 74  ? -9.940  108.187 2.734   0.25 14.67 ? 74  SER B CB  1 
ATOM   1824  O  OG  . SER B 1 74  ? -10.907 108.978 3.397   0.25 19.04 ? 74  SER B OG  1 
ATOM   1825  N  N   . PRO B 1 75  ? -12.482 105.585 2.847   0.25 15.20 ? 75  PRO B N   1 
ATOM   1826  C  CA  . PRO B 1 75  ? -13.846 105.293 2.391   0.25 14.99 ? 75  PRO B CA  1 
ATOM   1827  C  C   . PRO B 1 75  ? -14.675 106.552 2.149   0.25 13.90 ? 75  PRO B C   1 
ATOM   1828  O  O   . PRO B 1 75  ? -14.623 107.493 2.933   0.25 10.16 ? 75  PRO B O   1 
ATOM   1829  C  CB  . PRO B 1 75  ? -14.417 104.447 3.526   0.25 14.62 ? 75  PRO B CB  1 
ATOM   1830  C  CG  . PRO B 1 75  ? -13.213 103.734 4.052   0.25 15.81 ? 75  PRO B CG  1 
ATOM   1831  C  CD  . PRO B 1 75  ? -12.170 104.836 4.078   0.25 16.65 ? 75  PRO B CD  1 
ATOM   1832  N  N   . GLY B 1 76  ? -15.433 106.565 1.057   0.25 13.87 ? 76  GLY B N   1 
ATOM   1833  C  CA  . GLY B 1 76  ? -16.268 107.716 0.769   0.25 14.68 ? 76  GLY B CA  1 
ATOM   1834  C  C   . GLY B 1 76  ? -15.594 108.792 -0.056  0.25 16.52 ? 76  GLY B C   1 
ATOM   1835  O  O   . GLY B 1 76  ? -16.238 109.757 -0.461  0.25 15.24 ? 76  GLY B O   1 
ATOM   1836  N  N   . ASP B 1 77  ? -14.295 108.641 -0.298  0.25 14.14 ? 77  ASP B N   1 
ATOM   1837  C  CA  . ASP B 1 77  ? -13.569 109.617 -1.103  0.25 15.11 ? 77  ASP B CA  1 
ATOM   1838  C  C   . ASP B 1 77  ? -13.254 109.039 -2.478  0.25 13.64 ? 77  ASP B C   1 
ATOM   1839  O  O   . ASP B 1 77  ? -13.355 107.828 -2.689  0.25 15.33 ? 77  ASP B O   1 
ATOM   1840  C  CB  . ASP B 1 77  ? -12.275 110.032 -0.403  0.25 15.63 ? 77  ASP B CB  1 
ATOM   1841  C  CG  . ASP B 1 77  ? -12.528 110.907 0.806   0.25 19.31 ? 77  ASP B CG  1 
ATOM   1842  O  OD1 . ASP B 1 77  ? -13.194 111.951 0.644   0.25 18.50 ? 77  ASP B OD1 1 
ATOM   1843  O  OD2 . ASP B 1 77  ? -12.062 110.556 1.910   0.25 15.60 ? 77  ASP B OD2 1 
ATOM   1844  N  N   . GLU B 1 78  ? -12.887 109.903 -3.416  0.25 12.94 ? 78  GLU B N   1 
ATOM   1845  C  CA  . GLU B 1 78  ? -12.557 109.442 -4.755  0.25 11.72 ? 78  GLU B CA  1 
ATOM   1846  C  C   . GLU B 1 78  ? -11.427 110.219 -5.403  0.25 10.41 ? 78  GLU B C   1 
ATOM   1847  O  O   . GLU B 1 78  ? -11.111 111.348 -5.024  0.25 10.40 ? 78  GLU B O   1 
ATOM   1848  C  CB  . GLU B 1 78  ? -13.784 109.494 -5.667  0.25 14.27 ? 78  GLU B CB  1 
ATOM   1849  C  CG  . GLU B 1 78  ? -14.427 110.862 -5.758  0.25 19.25 ? 78  GLU B CG  1 
ATOM   1850  C  CD  . GLU B 1 78  ? -15.622 110.876 -6.692  0.25 20.61 ? 78  GLU B CD  1 
ATOM   1851  O  OE1 . GLU B 1 78  ? -16.435 109.929 -6.635  0.25 22.79 ? 78  GLU B OE1 1 
ATOM   1852  O  OE2 . GLU B 1 78  ? -15.750 111.839 -7.473  0.25 18.10 ? 78  GLU B OE2 1 
ATOM   1853  N  N   . VAL B 1 79  ? -10.825 109.580 -6.395  0.25 8.09  ? 79  VAL B N   1 
ATOM   1854  C  CA  . VAL B 1 79  ? -9.730  110.146 -7.159  0.25 6.59  ? 79  VAL B CA  1 
ATOM   1855  C  C   . VAL B 1 79  ? -9.945  109.676 -8.585  0.25 8.44  ? 79  VAL B C   1 
ATOM   1856  O  O   . VAL B 1 79  ? -10.048 108.471 -8.840  0.25 9.06  ? 79  VAL B O   1 
ATOM   1857  C  CB  . VAL B 1 79  ? -8.360  109.617 -6.662  0.25 6.85  ? 79  VAL B CB  1 
ATOM   1858  C  CG1 . VAL B 1 79  ? -7.253  110.031 -7.628  0.25 6.48  ? 79  VAL B CG1 1 
ATOM   1859  C  CG2 . VAL B 1 79  ? -8.082  110.137 -5.259  0.25 6.26  ? 79  VAL B CG2 1 
ATOM   1860  N  N   . TRP B 1 80  ? -10.043 110.625 -9.510  0.25 7.52  ? 80  TRP B N   1 
ATOM   1861  C  CA  . TRP B 1 80  ? -10.215 110.283 -10.911 0.25 9.39  ? 80  TRP B CA  1 
ATOM   1862  C  C   . TRP B 1 80  ? -8.859  110.454 -11.567 0.25 11.49 ? 80  TRP B C   1 
ATOM   1863  O  O   . TRP B 1 80  ? -8.042  111.260 -11.117 0.25 11.84 ? 80  TRP B O   1 
ATOM   1864  C  CB  . TRP B 1 80  ? -11.233 111.207 -11.586 0.25 11.67 ? 80  TRP B CB  1 
ATOM   1865  C  CG  . TRP B 1 80  ? -12.658 110.931 -11.198 0.25 11.84 ? 80  TRP B CG  1 
ATOM   1866  C  CD1 . TRP B 1 80  ? -13.292 111.319 -10.043 0.25 14.18 ? 80  TRP B CD1 1 
ATOM   1867  C  CD2 . TRP B 1 80  ? -13.623 110.203 -11.962 0.25 14.22 ? 80  TRP B CD2 1 
ATOM   1868  N  NE1 . TRP B 1 80  ? -14.599 110.874 -10.049 0.25 14.08 ? 80  TRP B NE1 1 
ATOM   1869  C  CE2 . TRP B 1 80  ? -14.825 110.186 -11.214 0.25 15.59 ? 80  TRP B CE2 1 
ATOM   1870  C  CE3 . TRP B 1 80  ? -13.589 109.559 -13.208 0.25 15.44 ? 80  TRP B CE3 1 
ATOM   1871  C  CZ2 . TRP B 1 80  ? -15.988 109.553 -11.680 0.25 15.51 ? 80  TRP B CZ2 1 
ATOM   1872  C  CZ3 . TRP B 1 80  ? -14.744 108.930 -13.670 0.25 14.65 ? 80  TRP B CZ3 1 
ATOM   1873  C  CH2 . TRP B 1 80  ? -15.926 108.931 -12.903 0.25 16.24 ? 80  TRP B CH2 1 
ATOM   1874  N  N   . GLY B 1 81  ? -8.616  109.693 -12.625 0.25 10.67 ? 81  GLY B N   1 
ATOM   1875  C  CA  . GLY B 1 81  ? -7.347  109.802 -13.306 0.25 9.99  ? 81  GLY B CA  1 
ATOM   1876  C  C   . GLY B 1 81  ? -7.423  109.307 -14.731 0.25 10.28 ? 81  GLY B C   1 
ATOM   1877  O  O   . GLY B 1 81  ? -8.459  108.816 -15.180 0.25 10.41 ? 81  GLY B O   1 
ATOM   1878  N  N   . VAL B 1 82  ? -6.316  109.457 -15.445 0.25 10.04 ? 82  VAL B N   1 
ATOM   1879  C  CA  . VAL B 1 82  ? -6.224  109.012 -16.822 0.25 9.02  ? 82  VAL B CA  1 
ATOM   1880  C  C   . VAL B 1 82  ? -5.550  107.653 -16.834 0.25 9.29  ? 82  VAL B C   1 
ATOM   1881  O  O   . VAL B 1 82  ? -4.448  107.486 -16.303 0.25 10.19 ? 82  VAL B O   1 
ATOM   1882  C  CB  . VAL B 1 82  ? -5.378  109.977 -17.679 0.25 10.72 ? 82  VAL B CB  1 
ATOM   1883  C  CG1 . VAL B 1 82  ? -5.106  109.357 -19.048 0.25 7.91  ? 82  VAL B CG1 1 
ATOM   1884  C  CG2 . VAL B 1 82  ? -6.107  111.309 -17.840 0.25 6.94  ? 82  VAL B CG2 1 
ATOM   1885  N  N   . VAL B 1 83  ? -6.229  106.671 -17.407 0.25 8.09  ? 83  VAL B N   1 
ATOM   1886  C  CA  . VAL B 1 83  ? -5.653  105.350 -17.510 0.25 8.15  ? 83  VAL B CA  1 
ATOM   1887  C  C   . VAL B 1 83  ? -4.896  105.380 -18.831 0.25 8.76  ? 83  VAL B C   1 
ATOM   1888  O  O   . VAL B 1 83  ? -5.411  105.884 -19.834 0.25 9.00  ? 83  VAL B O   1 
ATOM   1889  C  CB  . VAL B 1 83  ? -6.736  104.268 -17.552 0.25 8.71  ? 83  VAL B CB  1 
ATOM   1890  C  CG1 . VAL B 1 83  ? -6.096  102.894 -17.557 0.25 11.15 ? 83  VAL B CG1 1 
ATOM   1891  C  CG2 . VAL B 1 83  ? -7.659  104.415 -16.354 0.25 8.70  ? 83  VAL B CG2 1 
ATOM   1892  N  N   . TRP B 1 84  ? -3.666  104.875 -18.819 0.25 8.84  ? 84  TRP B N   1 
ATOM   1893  C  CA  . TRP B 1 84  ? -2.829  104.839 -20.014 0.25 10.69 ? 84  TRP B CA  1 
ATOM   1894  C  C   . TRP B 1 84  ? -2.466  103.403 -20.367 0.25 11.87 ? 84  TRP B C   1 
ATOM   1895  O  O   . TRP B 1 84  ? -2.367  102.545 -19.487 0.25 9.63  ? 84  TRP B O   1 
ATOM   1896  C  CB  . TRP B 1 84  ? -1.524  105.620 -19.795 0.25 9.41  ? 84  TRP B CB  1 
ATOM   1897  C  CG  . TRP B 1 84  ? -1.681  107.097 -19.671 0.25 11.46 ? 84  TRP B CG  1 
ATOM   1898  C  CD1 . TRP B 1 84  ? -1.900  107.811 -18.525 0.25 8.72  ? 84  TRP B CD1 1 
ATOM   1899  C  CD2 . TRP B 1 84  ? -1.628  108.054 -20.735 0.25 10.35 ? 84  TRP B CD2 1 
ATOM   1900  N  NE1 . TRP B 1 84  ? -1.983  109.152 -18.812 0.25 10.80 ? 84  TRP B NE1 1 
ATOM   1901  C  CE2 . TRP B 1 84  ? -1.821  109.330 -20.162 0.25 9.82  ? 84  TRP B CE2 1 
ATOM   1902  C  CE3 . TRP B 1 84  ? -1.437  107.957 -22.121 0.25 9.86  ? 84  TRP B CE3 1 
ATOM   1903  C  CZ2 . TRP B 1 84  ? -1.829  110.504 -20.926 0.25 12.68 ? 84  TRP B CZ2 1 
ATOM   1904  C  CZ3 . TRP B 1 84  ? -1.445  109.123 -22.881 0.25 13.62 ? 84  TRP B CZ3 1 
ATOM   1905  C  CH2 . TRP B 1 84  ? -1.640  110.380 -22.280 0.25 11.63 ? 84  TRP B CH2 1 
ATOM   1906  N  N   . LYS B 1 85  ? -2.263  103.146 -21.658 0.25 13.49 ? 85  LYS B N   1 
ATOM   1907  C  CA  . LYS B 1 85  ? -1.876  101.819 -22.117 0.25 13.74 ? 85  LYS B CA  1 
ATOM   1908  C  C   . LYS B 1 85  ? -0.422  101.923 -22.550 0.25 13.76 ? 85  LYS B C   1 
ATOM   1909  O  O   . LYS B 1 85  ? -0.085  102.731 -23.414 0.25 13.74 ? 85  LYS B O   1 
ATOM   1910  C  CB  . LYS B 1 85  ? -2.748  101.373 -23.294 0.25 15.50 ? 85  LYS B CB  1 
ATOM   1911  C  CG  . LYS B 1 85  ? -2.555  99.906  -23.666 0.25 20.06 ? 85  LYS B CG  1 
ATOM   1912  C  CD  . LYS B 1 85  ? -3.563  99.450  -24.705 0.25 25.30 ? 85  LYS B CD  1 
ATOM   1913  C  CE  . LYS B 1 85  ? -3.453  97.954  -24.938 0.25 28.16 ? 85  LYS B CE  1 
ATOM   1914  N  NZ  . LYS B 1 85  ? -4.497  97.459  -25.876 0.25 31.40 ? 85  LYS B NZ  1 
HETATM 1915  N  N   . MSE B 1 86  ? 0.440   101.116 -21.942 0.25 13.48 ? 86  MSE B N   1 
HETATM 1916  C  CA  . MSE B 1 86  ? 1.867   101.159 -22.257 0.25 16.40 ? 86  MSE B CA  1 
HETATM 1917  C  C   . MSE B 1 86  ? 2.468   99.781  -22.474 0.25 16.71 ? 86  MSE B C   1 
HETATM 1918  O  O   . MSE B 1 86  ? 1.896   98.770  -22.063 0.25 15.41 ? 86  MSE B O   1 
HETATM 1919  C  CB  . MSE B 1 86  ? 2.622   101.866 -21.125 0.25 18.14 ? 86  MSE B CB  1 
HETATM 1920  C  CG  . MSE B 1 86  ? 2.167   103.309 -20.898 0.25 23.57 ? 86  MSE B CG  1 
HETATM 1921  SE SE  . MSE B 1 86  ? 3.093   104.219 -19.463 0.25 28.03 ? 86  MSE B SE  1 
HETATM 1922  C  CE  . MSE B 1 86  ? 4.866   104.222 -20.229 0.25 28.11 ? 86  MSE B CE  1 
ATOM   1923  N  N   . ASN B 1 87  ? 3.629   99.753  -23.121 0.25 18.70 ? 87  ASN B N   1 
ATOM   1924  C  CA  . ASN B 1 87  ? 4.345   98.511  -23.386 0.25 20.58 ? 87  ASN B CA  1 
ATOM   1925  C  C   . ASN B 1 87  ? 4.903   97.993  -22.070 0.25 19.22 ? 87  ASN B C   1 
ATOM   1926  O  O   . ASN B 1 87  ? 5.305   98.786  -21.213 0.25 15.98 ? 87  ASN B O   1 
ATOM   1927  C  CB  . ASN B 1 87  ? 5.501   98.774  -24.357 0.25 24.71 ? 87  ASN B CB  1 
ATOM   1928  C  CG  . ASN B 1 87  ? 5.023   99.235  -25.718 0.25 30.23 ? 87  ASN B CG  1 
ATOM   1929  O  OD1 . ASN B 1 87  ? 5.730   99.947  -26.433 0.25 30.45 ? 87  ASN B OD1 1 
ATOM   1930  N  ND2 . ASN B 1 87  ? 3.817   98.821  -26.088 0.25 31.37 ? 87  ASN B ND2 1 
ATOM   1931  N  N   . LYS B 1 88  ? 4.923   96.673  -21.898 0.25 18.75 ? 88  LYS B N   1 
ATOM   1932  C  CA  . LYS B 1 88  ? 5.459   96.093  -20.672 0.25 20.37 ? 88  LYS B CA  1 
ATOM   1933  C  C   . LYS B 1 88  ? 6.962   96.316  -20.600 0.25 19.36 ? 88  LYS B C   1 
ATOM   1934  O  O   . LYS B 1 88  ? 7.563   96.203  -19.538 0.25 17.81 ? 88  LYS B O   1 
ATOM   1935  C  CB  . LYS B 1 88  ? 5.152   94.596  -20.582 0.25 22.56 ? 88  LYS B CB  1 
ATOM   1936  C  CG  . LYS B 1 88  ? 3.824   94.278  -19.902 0.25 26.67 ? 88  LYS B CG  1 
ATOM   1937  C  CD  . LYS B 1 88  ? 3.699   92.794  -19.599 0.25 29.24 ? 88  LYS B CD  1 
ATOM   1938  C  CE  . LYS B 1 88  ? 2.415   92.490  -18.846 0.25 30.62 ? 88  LYS B CE  1 
ATOM   1939  N  NZ  . LYS B 1 88  ? 2.316   91.049  -18.485 0.25 33.52 ? 88  LYS B NZ  1 
ATOM   1940  N  N   . SER B 1 89  ? 7.569   96.634  -21.737 0.25 19.65 ? 89  SER B N   1 
ATOM   1941  C  CA  . SER B 1 89  ? 8.998   96.896  -21.762 0.25 19.89 ? 89  SER B CA  1 
ATOM   1942  C  C   . SER B 1 89  ? 9.245   98.263  -21.127 0.25 20.83 ? 89  SER B C   1 
ATOM   1943  O  O   . SER B 1 89  ? 10.392  98.687  -20.977 0.25 19.65 ? 89  SER B O   1 
ATOM   1944  C  CB  . SER B 1 89  ? 9.520   96.891  -23.202 0.25 20.75 ? 89  SER B CB  1 
ATOM   1945  O  OG  . SER B 1 89  ? 8.904   97.909  -23.972 0.25 21.54 ? 89  SER B OG  1 
ATOM   1946  N  N   . ASN B 1 90  ? 8.161   98.942  -20.753 0.25 20.33 ? 90  ASN B N   1 
ATOM   1947  C  CA  . ASN B 1 90  ? 8.241   100.272 -20.138 0.25 21.01 ? 90  ASN B CA  1 
ATOM   1948  C  C   . ASN B 1 90  ? 8.319   100.232 -18.607 0.25 18.51 ? 90  ASN B C   1 
ATOM   1949  O  O   . ASN B 1 90  ? 8.764   101.199 -17.975 0.25 16.67 ? 90  ASN B O   1 
ATOM   1950  C  CB  . ASN B 1 90  ? 7.024   101.118 -20.544 0.25 22.40 ? 90  ASN B CB  1 
ATOM   1951  C  CG  . ASN B 1 90  ? 6.862   101.237 -22.050 0.25 24.92 ? 90  ASN B CG  1 
ATOM   1952  O  OD1 . ASN B 1 90  ? 5.912   101.854 -22.536 0.25 26.77 ? 90  ASN B OD1 1 
ATOM   1953  N  ND2 . ASN B 1 90  ? 7.787   100.646 -22.797 0.25 28.52 ? 90  ASN B ND2 1 
ATOM   1954  N  N   . LEU B 1 91  ? 7.887   99.120  -18.018 0.25 16.06 ? 91  LEU B N   1 
ATOM   1955  C  CA  . LEU B 1 91  ? 7.885   98.964  -16.563 0.25 15.76 ? 91  LEU B CA  1 
ATOM   1956  C  C   . LEU B 1 91  ? 9.137   99.471  -15.866 0.25 13.97 ? 91  LEU B C   1 
ATOM   1957  O  O   . LEU B 1 91  ? 9.037   100.165 -14.857 0.25 13.14 ? 91  LEU B O   1 
ATOM   1958  C  CB  . LEU B 1 91  ? 7.652   97.499  -16.170 0.25 14.69 ? 91  LEU B CB  1 
ATOM   1959  C  CG  . LEU B 1 91  ? 6.239   96.951  -16.393 0.25 17.16 ? 91  LEU B CG  1 
ATOM   1960  C  CD1 . LEU B 1 91  ? 6.210   95.447  -16.098 0.25 16.77 ? 91  LEU B CD1 1 
ATOM   1961  C  CD2 . LEU B 1 91  ? 5.254   97.696  -15.498 0.25 16.56 ? 91  LEU B CD2 1 
ATOM   1962  N  N   . ASN B 1 92  ? 10.313  99.130  -16.387 0.25 13.07 ? 92  ASN B N   1 
ATOM   1963  C  CA  . ASN B 1 92  ? 11.548  99.585  -15.758 0.25 15.00 ? 92  ASN B CA  1 
ATOM   1964  C  C   . ASN B 1 92  ? 11.638  101.104 -15.714 0.25 14.35 ? 92  ASN B C   1 
ATOM   1965  O  O   . ASN B 1 92  ? 11.852  101.684 -14.650 0.25 16.50 ? 92  ASN B O   1 
ATOM   1966  C  CB  . ASN B 1 92  ? 12.776  99.017  -16.476 0.25 15.82 ? 92  ASN B CB  1 
ATOM   1967  C  CG  . ASN B 1 92  ? 12.948  97.532  -16.247 0.25 18.57 ? 92  ASN B CG  1 
ATOM   1968  O  OD1 . ASN B 1 92  ? 12.844  97.051  -15.117 0.25 21.34 ? 92  ASN B OD1 1 
ATOM   1969  N  ND2 . ASN B 1 92  ? 13.227  96.793  -17.320 0.25 23.95 ? 92  ASN B ND2 1 
ATOM   1970  N  N   . SER B 1 93  ? 11.472  101.748 -16.864 0.25 12.41 ? 93  SER B N   1 
ATOM   1971  C  CA  . SER B 1 93  ? 11.539  103.204 -16.924 0.25 12.98 ? 93  SER B CA  1 
ATOM   1972  C  C   . SER B 1 93  ? 10.455  103.849 -16.059 0.25 12.75 ? 93  SER B C   1 
ATOM   1973  O  O   . SER B 1 93  ? 10.750  104.694 -15.215 0.25 10.19 ? 93  SER B O   1 
ATOM   1974  C  CB  . SER B 1 93  ? 11.392  103.683 -18.369 0.25 15.04 ? 93  SER B CB  1 
ATOM   1975  O  OG  . SER B 1 93  ? 11.547  105.089 -18.453 0.25 12.53 ? 93  SER B OG  1 
ATOM   1976  N  N   . LEU B 1 94  ? 9.203   103.446 -16.266 0.25 11.94 ? 94  LEU B N   1 
ATOM   1977  C  CA  . LEU B 1 94  ? 8.103   104.004 -15.490 0.25 11.84 ? 94  LEU B CA  1 
ATOM   1978  C  C   . LEU B 1 94  ? 8.391   103.803 -13.999 0.25 11.71 ? 94  LEU B C   1 
ATOM   1979  O  O   . LEU B 1 94  ? 8.158   104.696 -13.186 0.25 12.35 ? 94  LEU B O   1 
ATOM   1980  C  CB  . LEU B 1 94  ? 6.776   103.348 -15.890 0.25 11.95 ? 94  LEU B CB  1 
ATOM   1981  C  CG  . LEU B 1 94  ? 5.517   104.120 -15.472 0.25 14.22 ? 94  LEU B CG  1 
ATOM   1982  C  CD1 . LEU B 1 94  ? 5.575   105.527 -16.055 0.25 11.40 ? 94  LEU B CD1 1 
ATOM   1983  C  CD2 . LEU B 1 94  ? 4.258   103.398 -15.960 0.25 11.39 ? 94  LEU B CD2 1 
ATOM   1984  N  N   . ASP B 1 95  ? 8.908   102.631 -13.642 0.25 11.94 ? 95  ASP B N   1 
ATOM   1985  C  CA  . ASP B 1 95  ? 9.258   102.359 -12.254 0.25 12.58 ? 95  ASP B CA  1 
ATOM   1986  C  C   . ASP B 1 95  ? 10.362  103.327 -11.823 0.25 11.19 ? 95  ASP B C   1 
ATOM   1987  O  O   . ASP B 1 95  ? 10.189  104.092 -10.881 0.25 8.61  ? 95  ASP B O   1 
ATOM   1988  C  CB  . ASP B 1 95  ? 9.750   100.916 -12.095 0.25 11.53 ? 95  ASP B CB  1 
ATOM   1989  C  CG  . ASP B 1 95  ? 8.621   99.935  -11.830 0.25 16.07 ? 95  ASP B CG  1 
ATOM   1990  O  OD1 . ASP B 1 95  ? 7.535   100.093 -12.431 0.25 15.11 ? 95  ASP B OD1 1 
ATOM   1991  O  OD2 . ASP B 1 95  ? 8.826   98.997  -11.024 0.25 14.52 ? 95  ASP B OD2 1 
ATOM   1992  N  N   . GLU B 1 96  ? 11.494  103.289 -12.523 0.25 13.96 ? 96  GLU B N   1 
ATOM   1993  C  CA  . GLU B 1 96  ? 12.628  104.163 -12.204 0.25 15.12 ? 96  GLU B CA  1 
ATOM   1994  C  C   . GLU B 1 96  ? 12.194  105.624 -12.122 0.25 13.59 ? 96  GLU B C   1 
ATOM   1995  O  O   . GLU B 1 96  ? 12.668  106.367 -11.267 0.25 13.14 ? 96  GLU B O   1 
ATOM   1996  C  CB  . GLU B 1 96  ? 13.722  104.020 -13.270 0.25 17.84 ? 96  GLU B CB  1 
ATOM   1997  C  CG  . GLU B 1 96  ? 15.109  104.531 -12.861 0.25 24.24 ? 96  GLU B CG  1 
ATOM   1998  C  CD  . GLU B 1 96  ? 15.147  106.015 -12.540 0.25 27.50 ? 96  GLU B CD  1 
ATOM   1999  O  OE1 . GLU B 1 96  ? 14.801  106.835 -13.419 0.25 34.69 ? 96  GLU B OE1 1 
ATOM   2000  O  OE2 . GLU B 1 96  ? 15.534  106.363 -11.404 0.25 32.35 ? 96  GLU B OE2 1 
ATOM   2001  N  N   . GLN B 1 97  ? 11.307  106.039 -13.021 0.25 12.90 ? 97  GLN B N   1 
ATOM   2002  C  CA  . GLN B 1 97  ? 10.826  107.423 -13.038 0.25 13.97 ? 97  GLN B CA  1 
ATOM   2003  C  C   . GLN B 1 97  ? 10.142  107.778 -11.726 0.25 14.62 ? 97  GLN B C   1 
ATOM   2004  O  O   . GLN B 1 97  ? 10.371  108.849 -11.166 0.25 15.09 ? 97  GLN B O   1 
ATOM   2005  C  CB  . GLN B 1 97  ? 9.839   107.637 -14.192 0.25 13.74 ? 97  GLN B CB  1 
ATOM   2006  C  CG  . GLN B 1 97  ? 10.471  107.597 -15.582 0.25 15.51 ? 97  GLN B CG  1 
ATOM   2007  C  CD  . GLN B 1 97  ? 9.435   107.555 -16.688 0.25 14.12 ? 97  GLN B CD  1 
ATOM   2008  O  OE1 . GLN B 1 97  ? 8.489   108.345 -16.701 0.25 16.50 ? 97  GLN B OE1 1 
ATOM   2009  N  NE2 . GLN B 1 97  ? 9.609   106.632 -17.626 0.25 13.50 ? 97  GLN B NE2 1 
ATOM   2010  N  N   . GLU B 1 98  ? 9.304   106.867 -11.242 0.25 14.17 ? 98  GLU B N   1 
ATOM   2011  C  CA  . GLU B 1 98  ? 8.563   107.081 -10.005 0.25 16.94 ? 98  GLU B CA  1 
ATOM   2012  C  C   . GLU B 1 98  ? 9.418   106.941 -8.745  0.25 17.08 ? 98  GLU B C   1 
ATOM   2013  O  O   . GLU B 1 98  ? 8.890   106.896 -7.630  0.25 18.25 ? 98  GLU B O   1 
ATOM   2014  C  CB  . GLU B 1 98  ? 7.378   106.112 -9.943  0.25 17.43 ? 98  GLU B CB  1 
ATOM   2015  C  CG  . GLU B 1 98  ? 6.345   106.337 -11.043 0.25 23.46 ? 98  GLU B CG  1 
ATOM   2016  C  CD  . GLU B 1 98  ? 5.729   107.728 -10.998 0.25 28.13 ? 98  GLU B CD  1 
ATOM   2017  O  OE1 . GLU B 1 98  ? 5.059   108.056 -9.996  0.25 27.26 ? 98  GLU B OE1 1 
ATOM   2018  O  OE2 . GLU B 1 98  ? 5.918   108.496 -11.967 0.25 30.63 ? 98  GLU B OE2 1 
ATOM   2019  N  N   . GLY B 1 99  ? 10.735  106.870 -8.925  0.25 15.23 ? 99  GLY B N   1 
ATOM   2020  C  CA  . GLY B 1 99  ? 11.639  106.750 -7.791  0.25 14.79 ? 99  GLY B CA  1 
ATOM   2021  C  C   . GLY B 1 99  ? 11.402  105.557 -6.879  0.25 14.75 ? 99  GLY B C   1 
ATOM   2022  O  O   . GLY B 1 99  ? 11.608  105.645 -5.666  0.25 13.64 ? 99  GLY B O   1 
ATOM   2023  N  N   . VAL B 1 100 ? 10.986  104.430 -7.449  0.25 13.23 ? 100 VAL B N   1 
ATOM   2024  C  CA  . VAL B 1 100 ? 10.742  103.250 -6.632  0.25 14.00 ? 100 VAL B CA  1 
ATOM   2025  C  C   . VAL B 1 100 ? 12.017  102.818 -5.901  0.25 16.51 ? 100 VAL B C   1 
ATOM   2026  O  O   . VAL B 1 100 ? 11.962  102.381 -4.749  0.25 14.80 ? 100 VAL B O   1 
ATOM   2027  C  CB  . VAL B 1 100 ? 10.204  102.073 -7.485  0.25 14.25 ? 100 VAL B CB  1 
ATOM   2028  C  CG1 . VAL B 1 100 ? 9.959   100.857 -6.598  0.25 13.06 ? 100 VAL B CG1 1 
ATOM   2029  C  CG2 . VAL B 1 100 ? 8.908   102.482 -8.173  0.25 14.13 ? 100 VAL B CG2 1 
ATOM   2030  N  N   . LYS B 1 101 ? 13.165  102.960 -6.561  0.25 18.54 ? 101 LYS B N   1 
ATOM   2031  C  CA  . LYS B 1 101 ? 14.447  102.581 -5.965  0.25 20.90 ? 101 LYS B CA  1 
ATOM   2032  C  C   . LYS B 1 101 ? 14.758  103.374 -4.699  0.25 21.14 ? 101 LYS B C   1 
ATOM   2033  O  O   . LYS B 1 101 ? 15.074  102.797 -3.658  0.25 21.53 ? 101 LYS B O   1 
ATOM   2034  C  CB  . LYS B 1 101 ? 15.587  102.776 -6.971  0.25 26.23 ? 101 LYS B CB  1 
ATOM   2035  C  CG  . LYS B 1 101 ? 15.537  101.847 -8.182  0.25 32.34 ? 101 LYS B CG  1 
ATOM   2036  C  CD  . LYS B 1 101 ? 15.607  100.376 -7.781  0.25 37.29 ? 101 LYS B CD  1 
ATOM   2037  C  CE  . LYS B 1 101 ? 15.533  99.478  -9.011  0.25 41.16 ? 101 LYS B CE  1 
ATOM   2038  N  NZ  . LYS B 1 101 ? 15.608  98.027  -8.682  0.25 44.10 ? 101 LYS B NZ  1 
ATOM   2039  N  N   . SER B 1 102 ? 14.680  104.697 -4.794  0.25 21.34 ? 102 SER B N   1 
ATOM   2040  C  CA  . SER B 1 102 ? 14.951  105.558 -3.651  0.25 20.28 ? 102 SER B CA  1 
ATOM   2041  C  C   . SER B 1 102 ? 13.849  105.448 -2.599  0.25 19.57 ? 102 SER B C   1 
ATOM   2042  O  O   . SER B 1 102 ? 14.049  105.811 -1.444  0.25 19.87 ? 102 SER B O   1 
ATOM   2043  C  CB  . SER B 1 102 ? 15.101  107.013 -4.105  0.25 21.21 ? 102 SER B CB  1 
ATOM   2044  O  OG  . SER B 1 102 ? 13.942  107.461 -4.782  0.25 21.45 ? 102 SER B OG  1 
ATOM   2045  N  N   . GLY B 1 103 ? 12.685  104.952 -3.005  0.25 17.87 ? 103 GLY B N   1 
ATOM   2046  C  CA  . GLY B 1 103 ? 11.582  104.790 -2.069  0.25 16.38 ? 103 GLY B CA  1 
ATOM   2047  C  C   . GLY B 1 103 ? 10.605  105.951 -1.969  0.25 15.44 ? 103 GLY B C   1 
ATOM   2048  O  O   . GLY B 1 103 ? 9.885   106.081 -0.972  0.25 15.60 ? 103 GLY B O   1 
HETATM 2049  N  N   . MSE B 1 104 ? 10.562  106.793 -2.995  0.25 13.83 ? 104 MSE B N   1 
HETATM 2050  C  CA  . MSE B 1 104 ? 9.661   107.942 -2.988  0.25 12.92 ? 104 MSE B CA  1 
HETATM 2051  C  C   . MSE B 1 104 ? 8.242   107.514 -3.341  0.25 12.03 ? 104 MSE B C   1 
HETATM 2052  O  O   . MSE B 1 104 ? 7.273   108.180 -2.983  0.25 11.06 ? 104 MSE B O   1 
HETATM 2053  C  CB  . MSE B 1 104 ? 10.150  109.005 -3.976  0.25 14.37 ? 104 MSE B CB  1 
HETATM 2054  C  CG  . MSE B 1 104 ? 11.561  109.511 -3.695  0.25 17.03 ? 104 MSE B CG  1 
HETATM 2055  SE SE  . MSE B 1 104 ? 11.775  110.386 -1.971  0.25 20.83 ? 104 MSE B SE  1 
HETATM 2056  C  CE  . MSE B 1 104 ? 12.891  109.084 -1.086  0.25 13.14 ? 104 MSE B CE  1 
ATOM   2057  N  N   . TYR B 1 105 ? 8.134   106.400 -4.059  0.25 10.05 ? 105 TYR B N   1 
ATOM   2058  C  CA  . TYR B 1 105 ? 6.844   105.839 -4.456  0.25 10.98 ? 105 TYR B CA  1 
ATOM   2059  C  C   . TYR B 1 105 ? 6.944   104.324 -4.471  0.25 9.68  ? 105 TYR B C   1 
ATOM   2060  O  O   . TYR B 1 105 ? 7.954   103.773 -4.908  0.25 7.97  ? 105 TYR B O   1 
ATOM   2061  C  CB  . TYR B 1 105 ? 6.443   106.267 -5.870  0.25 9.67  ? 105 TYR B CB  1 
ATOM   2062  C  CG  . TYR B 1 105 ? 5.839   107.640 -6.000  0.25 12.02 ? 105 TYR B CG  1 
ATOM   2063  C  CD1 . TYR B 1 105 ? 6.615   108.726 -6.396  0.25 11.24 ? 105 TYR B CD1 1 
ATOM   2064  C  CD2 . TYR B 1 105 ? 4.478   107.847 -5.767  0.25 11.05 ? 105 TYR B CD2 1 
ATOM   2065  C  CE1 . TYR B 1 105 ? 6.053   109.987 -6.564  0.25 12.73 ? 105 TYR B CE1 1 
ATOM   2066  C  CE2 . TYR B 1 105 ? 3.905   109.104 -5.932  0.25 11.28 ? 105 TYR B CE2 1 
ATOM   2067  C  CZ  . TYR B 1 105 ? 4.701   110.168 -6.331  0.25 12.81 ? 105 TYR B CZ  1 
ATOM   2068  O  OH  . TYR B 1 105 ? 4.149   111.410 -6.506  0.25 11.53 ? 105 TYR B OH  1 
ATOM   2069  N  N   . VAL B 1 106 ? 5.896   103.660 -3.996  0.25 9.37  ? 106 VAL B N   1 
ATOM   2070  C  CA  . VAL B 1 106 ? 5.848   102.208 -4.013  0.25 8.52  ? 106 VAL B CA  1 
ATOM   2071  C  C   . VAL B 1 106 ? 4.823   101.824 -5.096  0.25 7.78  ? 106 VAL B C   1 
ATOM   2072  O  O   . VAL B 1 106 ? 3.866   102.567 -5.349  0.25 5.95  ? 106 VAL B O   1 
ATOM   2073  C  CB  . VAL B 1 106 ? 5.419   101.638 -2.631  0.25 9.22  ? 106 VAL B CB  1 
ATOM   2074  C  CG1 . VAL B 1 106 ? 3.903   101.656 -2.486  0.25 9.75  ? 106 VAL B CG1 1 
ATOM   2075  C  CG2 . VAL B 1 106 ? 5.958   100.231 -2.470  0.25 6.59  ? 106 VAL B CG2 1 
ATOM   2076  N  N   . VAL B 1 107 ? 5.034   100.687 -5.753  0.25 6.86  ? 107 VAL B N   1 
ATOM   2077  C  CA  . VAL B 1 107 ? 4.112   100.226 -6.794  0.25 7.39  ? 107 VAL B CA  1 
ATOM   2078  C  C   . VAL B 1 107 ? 2.843   99.648  -6.171  0.25 7.77  ? 107 VAL B C   1 
ATOM   2079  O  O   . VAL B 1 107 ? 2.902   98.973  -5.149  0.25 8.24  ? 107 VAL B O   1 
ATOM   2080  C  CB  . VAL B 1 107 ? 4.736   99.101  -7.667  0.25 8.50  ? 107 VAL B CB  1 
ATOM   2081  C  CG1 . VAL B 1 107 ? 3.674   98.530  -8.598  0.25 3.90  ? 107 VAL B CG1 1 
ATOM   2082  C  CG2 . VAL B 1 107 ? 5.913   99.643  -8.486  0.25 9.75  ? 107 VAL B CG2 1 
ATOM   2083  N  N   . ILE B 1 108 ? 1.697   99.903  -6.796  0.25 6.51  ? 108 ILE B N   1 
ATOM   2084  C  CA  . ILE B 1 108 ? 0.439   99.364  -6.300  0.25 5.97  ? 108 ILE B CA  1 
ATOM   2085  C  C   . ILE B 1 108 ? -0.436  98.852  -7.439  0.25 7.93  ? 108 ILE B C   1 
ATOM   2086  O  O   . ILE B 1 108 ? -0.238  99.203  -8.609  0.25 6.36  ? 108 ILE B O   1 
ATOM   2087  C  CB  . ILE B 1 108 ? -0.383  100.426 -5.530  0.25 8.19  ? 108 ILE B CB  1 
ATOM   2088  C  CG1 . ILE B 1 108 ? -0.512  101.698 -6.377  0.25 8.67  ? 108 ILE B CG1 1 
ATOM   2089  C  CG2 . ILE B 1 108 ? 0.271   100.736 -4.185  0.25 4.47  ? 108 ILE B CG2 1 
ATOM   2090  C  CD1 . ILE B 1 108 ? -1.353  102.790 -5.724  0.25 8.40  ? 108 ILE B CD1 1 
ATOM   2091  N  N   . GLU B 1 109 ? -1.376  97.980  -7.096  0.25 7.51  ? 109 GLU B N   1 
ATOM   2092  C  CA  . GLU B 1 109 ? -2.339  97.497  -8.075  0.25 10.51 ? 109 GLU B CA  1 
ATOM   2093  C  C   . GLU B 1 109 ? -3.640  98.152  -7.644  0.25 10.24 ? 109 GLU B C   1 
ATOM   2094  O  O   . GLU B 1 109 ? -3.938  98.212  -6.445  0.25 9.52  ? 109 GLU B O   1 
ATOM   2095  C  CB  . GLU B 1 109 ? -2.516  95.973  -8.031  0.25 9.81  ? 109 GLU B CB  1 
ATOM   2096  C  CG  . GLU B 1 109 ? -3.733  95.524  -8.839  0.25 15.46 ? 109 GLU B CG  1 
ATOM   2097  C  CD  . GLU B 1 109 ? -4.066  94.055  -8.669  0.25 16.25 ? 109 GLU B CD  1 
ATOM   2098  O  OE1 . GLU B 1 109 ? -3.346  93.207  -9.240  0.25 16.83 ? 109 GLU B OE1 1 
ATOM   2099  O  OE2 . GLU B 1 109 ? -5.047  93.750  -7.958  0.25 19.59 ? 109 GLU B OE2 1 
ATOM   2100  N  N   . VAL B 1 110 ? -4.402  98.663  -8.604  0.25 10.14 ? 110 VAL B N   1 
ATOM   2101  C  CA  . VAL B 1 110 ? -5.678  99.286  -8.289  0.25 11.82 ? 110 VAL B CA  1 
ATOM   2102  C  C   . VAL B 1 110 ? -6.715  98.964  -9.349  0.25 12.88 ? 110 VAL B C   1 
ATOM   2103  O  O   . VAL B 1 110 ? -6.396  98.872  -10.535 0.25 14.23 ? 110 VAL B O   1 
ATOM   2104  C  CB  . VAL B 1 110 ? -5.571  100.828 -8.192  0.25 12.71 ? 110 VAL B CB  1 
ATOM   2105  C  CG1 . VAL B 1 110 ? -4.621  101.217 -7.084  0.25 11.34 ? 110 VAL B CG1 1 
ATOM   2106  C  CG2 . VAL B 1 110 ? -5.125  101.409 -9.527  0.25 12.80 ? 110 VAL B CG2 1 
ATOM   2107  N  N   . LYS B 1 111 ? -7.954  98.774  -8.911  0.25 13.66 ? 111 LYS B N   1 
ATOM   2108  C  CA  . LYS B 1 111 ? -9.045  98.497  -9.830  0.25 14.47 ? 111 LYS B CA  1 
ATOM   2109  C  C   . LYS B 1 111 ? -9.873  99.767  -9.887  0.25 13.58 ? 111 LYS B C   1 
ATOM   2110  O  O   . LYS B 1 111 ? -10.357 100.259 -8.866  0.25 12.54 ? 111 LYS B O   1 
ATOM   2111  C  CB  . LYS B 1 111 ? -9.885  97.315  -9.342  0.25 15.23 ? 111 LYS B CB  1 
ATOM   2112  C  CG  . LYS B 1 111 ? -9.138  95.987  -9.368  0.25 18.05 ? 111 LYS B CG  1 
ATOM   2113  C  CD  . LYS B 1 111 ? -10.031 94.833  -8.927  0.25 21.45 ? 111 LYS B CD  1 
ATOM   2114  C  CE  . LYS B 1 111 ? -9.226  93.560  -8.680  0.25 20.46 ? 111 LYS B CE  1 
ATOM   2115  N  NZ  . LYS B 1 111 ? -8.464  93.147  -9.885  0.25 23.78 ? 111 LYS B NZ  1 
ATOM   2116  N  N   . VAL B 1 112 ? -10.002 100.320 -11.084 0.25 11.07 ? 112 VAL B N   1 
ATOM   2117  C  CA  . VAL B 1 112 ? -10.754 101.546 -11.259 0.25 10.35 ? 112 VAL B CA  1 
ATOM   2118  C  C   . VAL B 1 112 ? -11.981 101.294 -12.126 0.25 11.71 ? 112 VAL B C   1 
ATOM   2119  O  O   . VAL B 1 112 ? -12.159 100.195 -12.649 0.25 13.90 ? 112 VAL B O   1 
ATOM   2120  C  CB  . VAL B 1 112 ? -9.866  102.651 -11.885 0.25 10.53 ? 112 VAL B CB  1 
ATOM   2121  C  CG1 . VAL B 1 112 ? -8.752  103.035 -10.910 0.25 10.64 ? 112 VAL B CG1 1 
ATOM   2122  C  CG2 . VAL B 1 112 ? -9.263  102.162 -13.196 0.25 8.27  ? 112 VAL B CG2 1 
ATOM   2123  N  N   . ALA B 1 113 ? -12.828 102.307 -12.273 0.25 12.28 ? 113 ALA B N   1 
ATOM   2124  C  CA  . ALA B 1 113 ? -14.039 102.156 -13.068 0.25 13.33 ? 113 ALA B CA  1 
ATOM   2125  C  C   . ALA B 1 113 ? -14.325 103.368 -13.945 0.25 12.39 ? 113 ALA B C   1 
ATOM   2126  O  O   . ALA B 1 113 ? -14.306 104.506 -13.482 0.25 11.88 ? 113 ALA B O   1 
ATOM   2127  C  CB  . ALA B 1 113 ? -15.228 101.882 -12.148 0.25 14.04 ? 113 ALA B CB  1 
ATOM   2128  N  N   . THR B 1 114 ? -14.587 103.107 -15.220 0.25 14.11 ? 114 THR B N   1 
ATOM   2129  C  CA  . THR B 1 114 ? -14.893 104.162 -16.173 0.25 16.84 ? 114 THR B CA  1 
ATOM   2130  C  C   . THR B 1 114 ? -16.263 104.721 -15.818 0.25 19.54 ? 114 THR B C   1 
ATOM   2131  O  O   . THR B 1 114 ? -16.980 104.146 -14.996 0.25 18.93 ? 114 THR B O   1 
ATOM   2132  C  CB  . THR B 1 114 ? -14.957 103.610 -17.602 0.25 17.28 ? 114 THR B CB  1 
ATOM   2133  O  OG1 . THR B 1 114 ? -16.082 102.731 -17.717 0.25 16.06 ? 114 THR B OG1 1 
ATOM   2134  C  CG2 . THR B 1 114 ? -13.691 102.838 -17.928 0.25 17.66 ? 114 THR B CG2 1 
ATOM   2135  N  N   . GLN B 1 115 ? -16.629 105.837 -16.433 0.25 22.58 ? 115 GLN B N   1 
ATOM   2136  C  CA  . GLN B 1 115 ? -17.928 106.439 -16.160 0.25 26.37 ? 115 GLN B CA  1 
ATOM   2137  C  C   . GLN B 1 115 ? -19.063 105.520 -16.607 0.25 26.26 ? 115 GLN B C   1 
ATOM   2138  O  O   . GLN B 1 115 ? -20.208 105.691 -16.193 0.25 25.84 ? 115 GLN B O   1 
ATOM   2139  C  CB  . GLN B 1 115 ? -18.034 107.801 -16.846 0.25 29.48 ? 115 GLN B CB  1 
ATOM   2140  C  CG  . GLN B 1 115 ? -16.984 108.789 -16.370 0.25 34.67 ? 115 GLN B CG  1 
ATOM   2141  C  CD  . GLN B 1 115 ? -17.186 110.177 -16.939 0.25 37.13 ? 115 GLN B CD  1 
ATOM   2142  O  OE1 . GLN B 1 115 ? -18.189 110.832 -16.666 0.25 38.39 ? 115 GLN B OE1 1 
ATOM   2143  N  NE2 . GLN B 1 115 ? -16.229 110.632 -17.739 0.25 39.42 ? 115 GLN B NE2 1 
ATOM   2144  N  N   . GLU B 1 116 ? -18.741 104.541 -17.449 0.25 26.68 ? 116 GLU B N   1 
ATOM   2145  C  CA  . GLU B 1 116 ? -19.740 103.579 -17.913 0.25 28.63 ? 116 GLU B CA  1 
ATOM   2146  C  C   . GLU B 1 116 ? -19.786 102.416 -16.927 0.25 26.44 ? 116 GLU B C   1 
ATOM   2147  O  O   . GLU B 1 116 ? -20.484 101.432 -17.145 0.25 24.29 ? 116 GLU B O   1 
ATOM   2148  C  CB  . GLU B 1 116 ? -19.389 103.044 -19.303 0.25 32.77 ? 116 GLU B CB  1 
ATOM   2149  C  CG  . GLU B 1 116 ? -19.410 104.081 -20.417 0.25 40.36 ? 116 GLU B CG  1 
ATOM   2150  C  CD  . GLU B 1 116 ? -18.309 105.116 -20.282 0.25 42.94 ? 116 GLU B CD  1 
ATOM   2151  O  OE1 . GLU B 1 116 ? -17.133 104.721 -20.131 0.25 44.52 ? 116 GLU B OE1 1 
ATOM   2152  O  OE2 . GLU B 1 116 ? -18.618 106.326 -20.335 0.25 45.88 ? 116 GLU B OE2 1 
ATOM   2153  N  N   . GLY B 1 117 ? -19.024 102.538 -15.845 0.25 25.30 ? 117 GLY B N   1 
ATOM   2154  C  CA  . GLY B 1 117 ? -18.994 101.497 -14.832 0.25 26.51 ? 117 GLY B CA  1 
ATOM   2155  C  C   . GLY B 1 117 ? -18.354 100.189 -15.265 0.25 26.33 ? 117 GLY B C   1 
ATOM   2156  O  O   . GLY B 1 117 ? -18.957 99.128  -15.127 0.25 26.17 ? 117 GLY B O   1 
ATOM   2157  N  N   . LYS B 1 118 ? -17.133 100.262 -15.784 0.25 27.21 ? 118 LYS B N   1 
ATOM   2158  C  CA  . LYS B 1 118 ? -16.408 99.071  -16.221 0.25 28.60 ? 118 LYS B CA  1 
ATOM   2159  C  C   . LYS B 1 118 ? -15.118 98.953  -15.415 0.25 26.00 ? 118 LYS B C   1 
ATOM   2160  O  O   . LYS B 1 118 ? -14.337 99.896  -15.359 0.25 25.03 ? 118 LYS B O   1 
ATOM   2161  C  CB  . LYS B 1 118 ? -16.064 99.175  -17.709 0.25 32.10 ? 118 LYS B CB  1 
ATOM   2162  C  CG  . LYS B 1 118 ? -17.241 99.551  -18.596 0.25 38.20 ? 118 LYS B CG  1 
ATOM   2163  C  CD  . LYS B 1 118 ? -16.819 99.659  -20.055 0.25 42.17 ? 118 LYS B CD  1 
ATOM   2164  C  CE  . LYS B 1 118 ? -17.941 100.224 -20.916 0.25 46.15 ? 118 LYS B CE  1 
ATOM   2165  N  NZ  . LYS B 1 118 ? -19.183 99.415  -20.817 0.25 48.16 ? 118 LYS B NZ  1 
ATOM   2166  N  N   . GLU B 1 119 ? -14.894 97.797  -14.799 0.25 25.14 ? 119 GLU B N   1 
ATOM   2167  C  CA  . GLU B 1 119 ? -13.690 97.581  -13.999 0.25 24.13 ? 119 GLU B CA  1 
ATOM   2168  C  C   . GLU B 1 119 ? -12.420 97.513  -14.850 0.25 22.38 ? 119 GLU B C   1 
ATOM   2169  O  O   . GLU B 1 119 ? -12.397 96.872  -15.898 0.25 19.87 ? 119 GLU B O   1 
ATOM   2170  C  CB  . GLU B 1 119 ? -13.820 96.294  -13.180 0.25 24.30 ? 119 GLU B CB  1 
ATOM   2171  C  CG  . GLU B 1 119 ? -12.543 95.895  -12.443 0.25 27.44 ? 119 GLU B CG  1 
ATOM   2172  C  CD  . GLU B 1 119 ? -12.664 94.558  -11.725 0.25 26.69 ? 119 GLU B CD  1 
ATOM   2173  O  OE1 . GLU B 1 119 ? -13.386 94.483  -10.707 0.25 29.84 ? 119 GLU B OE1 1 
ATOM   2174  O  OE2 . GLU B 1 119 ? -12.040 93.580  -12.182 0.25 24.20 ? 119 GLU B OE2 1 
ATOM   2175  N  N   . ILE B 1 120 ? -11.370 98.181  -14.380 0.25 19.79 ? 120 ILE B N   1 
ATOM   2176  C  CA  . ILE B 1 120 ? -10.081 98.210  -15.065 0.25 18.48 ? 120 ILE B CA  1 
ATOM   2177  C  C   . ILE B 1 120 ? -8.962  98.048  -14.036 0.25 17.24 ? 120 ILE B C   1 
ATOM   2178  O  O   . ILE B 1 120 ? -8.715  98.961  -13.243 0.25 16.44 ? 120 ILE B O   1 
ATOM   2179  C  CB  . ILE B 1 120 ? -9.846  99.560  -15.782 0.25 17.61 ? 120 ILE B CB  1 
ATOM   2180  C  CG1 . ILE B 1 120 ? -10.982 99.855  -16.763 0.25 20.91 ? 120 ILE B CG1 1 
ATOM   2181  C  CG2 . ILE B 1 120 ? -8.516  99.530  -16.509 0.25 17.65 ? 120 ILE B CG2 1 
ATOM   2182  C  CD1 . ILE B 1 120 ? -11.127 98.831  -17.867 0.25 22.17 ? 120 ILE B CD1 1 
ATOM   2183  N  N   . THR B 1 121 ? -8.289  96.900  -14.051 0.25 15.00 ? 121 THR B N   1 
ATOM   2184  C  CA  . THR B 1 121 ? -7.186  96.647  -13.123 0.25 14.99 ? 121 THR B CA  1 
ATOM   2185  C  C   . THR B 1 121 ? -5.923  97.260  -13.710 0.25 13.69 ? 121 THR B C   1 
ATOM   2186  O  O   . THR B 1 121 ? -5.529  96.922  -14.831 0.25 10.69 ? 121 THR B O   1 
ATOM   2187  C  CB  . THR B 1 121 ? -6.952  95.141  -12.917 0.25 15.51 ? 121 THR B CB  1 
ATOM   2188  O  OG1 . THR B 1 121 ? -8.135  94.543  -12.381 0.25 17.56 ? 121 THR B OG1 1 
ATOM   2189  C  CG2 . THR B 1 121 ? -5.792  94.904  -11.952 0.25 15.12 ? 121 THR B CG2 1 
ATOM   2190  N  N   . CYS B 1 122 ? -5.282  98.150  -12.954 0.25 11.58 ? 122 CYS B N   1 
ATOM   2191  C  CA  . CYS B 1 122 ? -4.082  98.819  -13.446 0.25 11.13 ? 122 CYS B CA  1 
ATOM   2192  C  C   . CYS B 1 122 ? -2.957  98.957  -12.432 0.25 10.65 ? 122 CYS B C   1 
ATOM   2193  O  O   . CYS B 1 122 ? -3.141  98.758  -11.230 0.25 11.43 ? 122 CYS B O   1 
ATOM   2194  C  CB  . CYS B 1 122 ? -4.440  100.222 -13.933 0.25 11.00 ? 122 CYS B CB  1 
ATOM   2195  S  SG  . CYS B 1 122 ? -6.210  100.512 -14.152 0.25 14.43 ? 122 CYS B SG  1 
ATOM   2196  N  N   . ARG B 1 123 ? -1.787  99.314  -12.943 0.25 8.96  ? 123 ARG B N   1 
ATOM   2197  C  CA  . ARG B 1 123 ? -0.617  99.549  -12.118 0.25 7.82  ? 123 ARG B CA  1 
ATOM   2198  C  C   . ARG B 1 123 ? -0.646  101.040 -11.818 0.25 8.70  ? 123 ARG B C   1 
ATOM   2199  O  O   . ARG B 1 123 ? -1.110  101.829 -12.642 0.25 9.60  ? 123 ARG B O   1 
ATOM   2200  C  CB  . ARG B 1 123 ? 0.653   99.213  -12.907 0.25 7.54  ? 123 ARG B CB  1 
ATOM   2201  C  CG  . ARG B 1 123 ? 1.967   99.364  -12.132 0.25 7.90  ? 123 ARG B CG  1 
ATOM   2202  C  CD  . ARG B 1 123 ? 3.144   99.227  -13.103 0.25 9.78  ? 123 ARG B CD  1 
ATOM   2203  N  NE  . ARG B 1 123 ? 4.455   99.155  -12.456 0.25 6.49  ? 123 ARG B NE  1 
ATOM   2204  C  CZ  . ARG B 1 123 ? 4.982   98.047  -11.945 0.25 9.34  ? 123 ARG B CZ  1 
ATOM   2205  N  NH1 . ARG B 1 123 ? 4.311   96.904  -11.994 0.25 9.08  ? 123 ARG B NH1 1 
ATOM   2206  N  NH2 . ARG B 1 123 ? 6.197   98.074  -11.410 0.25 10.31 ? 123 ARG B NH2 1 
ATOM   2207  N  N   . SER B 1 124 ? -0.180  101.430 -10.637 0.25 6.95  ? 124 SER B N   1 
ATOM   2208  C  CA  . SER B 1 124 ? -0.125  102.844 -10.287 0.25 6.53  ? 124 SER B CA  1 
ATOM   2209  C  C   . SER B 1 124 ? 0.990   102.999 -9.252  0.25 7.32  ? 124 SER B C   1 
ATOM   2210  O  O   . SER B 1 124 ? 1.844   102.113 -9.118  0.25 6.24  ? 124 SER B O   1 
ATOM   2211  C  CB  . SER B 1 124 ? -1.478  103.322 -9.732  0.25 6.42  ? 124 SER B CB  1 
ATOM   2212  O  OG  . SER B 1 124 ? -1.562  104.741 -9.712  0.25 4.50  ? 124 SER B OG  1 
ATOM   2213  N  N   . TYR B 1 125 ? 0.988   104.110 -8.525  0.25 6.29  ? 125 TYR B N   1 
ATOM   2214  C  CA  . TYR B 1 125 ? 2.029   104.365 -7.527  0.25 6.26  ? 125 TYR B CA  1 
ATOM   2215  C  C   . TYR B 1 125 ? 1.481   105.231 -6.401  0.25 5.10  ? 125 TYR B C   1 
ATOM   2216  O  O   . TYR B 1 125 ? 0.560   106.011 -6.621  0.25 3.35  ? 125 TYR B O   1 
ATOM   2217  C  CB  . TYR B 1 125 ? 3.208   105.110 -8.178  0.25 7.22  ? 125 TYR B CB  1 
ATOM   2218  C  CG  . TYR B 1 125 ? 3.826   104.395 -9.361  0.25 8.14  ? 125 TYR B CG  1 
ATOM   2219  C  CD1 . TYR B 1 125 ? 4.850   103.462 -9.184  0.25 11.33 ? 125 TYR B CD1 1 
ATOM   2220  C  CD2 . TYR B 1 125 ? 3.357   104.621 -10.649 0.25 10.04 ? 125 TYR B CD2 1 
ATOM   2221  C  CE1 . TYR B 1 125 ? 5.391   102.770 -10.269 0.25 10.10 ? 125 TYR B CE1 1 
ATOM   2222  C  CE2 . TYR B 1 125 ? 3.887   103.934 -11.743 0.25 11.17 ? 125 TYR B CE2 1 
ATOM   2223  C  CZ  . TYR B 1 125 ? 4.902   103.012 -11.545 0.25 9.13  ? 125 TYR B CZ  1 
ATOM   2224  O  OH  . TYR B 1 125 ? 5.430   102.339 -12.617 0.25 12.89 ? 125 TYR B OH  1 
ATOM   2225  N  N   . LEU B 1 126 ? 2.043   105.081 -5.202  0.25 4.82  ? 126 LEU B N   1 
ATOM   2226  C  CA  . LEU B 1 126 ? 1.652   105.894 -4.052  0.25 5.73  ? 126 LEU B CA  1 
ATOM   2227  C  C   . LEU B 1 126 ? 2.739   105.887 -2.987  0.25 6.88  ? 126 LEU B C   1 
ATOM   2228  O  O   . LEU B 1 126 ? 3.251   104.834 -2.610  0.25 7.60  ? 126 LEU B O   1 
ATOM   2229  C  CB  . LEU B 1 126 ? 0.308   105.432 -3.457  0.25 7.10  ? 126 LEU B CB  1 
ATOM   2230  C  CG  . LEU B 1 126 ? 0.097   104.079 -2.763  0.25 5.38  ? 126 LEU B CG  1 
ATOM   2231  C  CD1 . LEU B 1 126 ? 0.802   104.021 -1.402  0.25 5.05  ? 126 LEU B CD1 1 
ATOM   2232  C  CD2 . LEU B 1 126 ? -1.395  103.890 -2.561  0.25 6.12  ? 126 LEU B CD2 1 
HETATM 2233  N  N   . MSE B 1 127 ? 3.103   107.073 -2.512  0.25 8.35  ? 127 MSE B N   1 
HETATM 2234  C  CA  . MSE B 1 127 ? 4.134   107.194 -1.489  0.25 9.31  ? 127 MSE B CA  1 
HETATM 2235  C  C   . MSE B 1 127 ? 3.638   106.568 -0.185  0.25 9.06  ? 127 MSE B C   1 
HETATM 2236  O  O   . MSE B 1 127 ? 2.443   106.585 0.101   0.25 6.54  ? 127 MSE B O   1 
HETATM 2237  C  CB  . MSE B 1 127 ? 4.473   108.668 -1.253  0.25 11.13 ? 127 MSE B CB  1 
HETATM 2238  C  CG  . MSE B 1 127 ? 4.712   109.471 -2.532  0.25 10.12 ? 127 MSE B CG  1 
HETATM 2239  SE SE  . MSE B 1 127 ? 5.269   111.292 -2.144  0.25 20.71 ? 127 MSE B SE  1 
HETATM 2240  C  CE  . MSE B 1 127 ? 3.868   111.737 -0.941  0.25 7.68  ? 127 MSE B CE  1 
ATOM   2241  N  N   . THR B 1 128 ? 4.560   106.017 0.601   0.25 10.32 ? 128 THR B N   1 
ATOM   2242  C  CA  . THR B 1 128 ? 4.199   105.386 1.866   0.25 11.48 ? 128 THR B CA  1 
ATOM   2243  C  C   . THR B 1 128 ? 4.756   106.146 3.067   0.25 13.50 ? 128 THR B C   1 
ATOM   2244  O  O   . THR B 1 128 ? 4.222   106.046 4.167   0.25 15.46 ? 128 THR B O   1 
ATOM   2245  C  CB  . THR B 1 128 ? 4.717   103.935 1.946   0.25 11.91 ? 128 THR B CB  1 
ATOM   2246  O  OG1 . THR B 1 128 ? 6.149   103.937 1.936   0.25 9.60  ? 128 THR B OG1 1 
ATOM   2247  C  CG2 . THR B 1 128 ? 4.195   103.119 0.772   0.25 10.87 ? 128 THR B CG2 1 
ATOM   2248  N  N   . ASN B 1 129 ? 5.831   106.901 2.861   0.25 12.03 ? 129 ASN B N   1 
ATOM   2249  C  CA  . ASN B 1 129 ? 6.427   107.662 3.958   0.25 15.50 ? 129 ASN B CA  1 
ATOM   2250  C  C   . ASN B 1 129 ? 6.559   109.113 3.537   0.25 14.57 ? 129 ASN B C   1 
ATOM   2251  O  O   . ASN B 1 129 ? 7.447   109.465 2.760   0.25 15.60 ? 129 ASN B O   1 
ATOM   2252  C  CB  . ASN B 1 129 ? 7.809   107.110 4.311   0.25 16.17 ? 129 ASN B CB  1 
ATOM   2253  C  CG  . ASN B 1 129 ? 8.345   107.674 5.617   0.25 20.22 ? 129 ASN B CG  1 
ATOM   2254  O  OD1 . ASN B 1 129 ? 8.049   108.813 5.985   0.25 17.28 ? 129 ASN B OD1 1 
ATOM   2255  N  ND2 . ASN B 1 129 ? 9.150   106.881 6.317   0.25 19.76 ? 129 ASN B ND2 1 
ATOM   2256  N  N   . TYR B 1 130 ? 5.681   109.964 4.048   0.25 13.81 ? 130 TYR B N   1 
ATOM   2257  C  CA  . TYR B 1 130 ? 5.737   111.362 3.658   0.25 13.83 ? 130 TYR B CA  1 
ATOM   2258  C  C   . TYR B 1 130 ? 5.085   112.306 4.651   0.25 14.98 ? 130 TYR B C   1 
ATOM   2259  O  O   . TYR B 1 130 ? 4.371   111.888 5.562   0.25 12.68 ? 130 TYR B O   1 
ATOM   2260  C  CB  . TYR B 1 130 ? 5.067   111.553 2.296   0.25 13.43 ? 130 TYR B CB  1 
ATOM   2261  C  CG  . TYR B 1 130 ? 3.560   111.411 2.328   0.25 12.68 ? 130 TYR B CG  1 
ATOM   2262  C  CD1 . TYR B 1 130 ? 2.953   110.158 2.258   0.25 13.16 ? 130 TYR B CD1 1 
ATOM   2263  C  CD2 . TYR B 1 130 ? 2.740   112.533 2.430   0.25 10.80 ? 130 TYR B CD2 1 
ATOM   2264  C  CE1 . TYR B 1 130 ? 1.561   110.026 2.287   0.25 13.88 ? 130 TYR B CE1 1 
ATOM   2265  C  CE2 . TYR B 1 130 ? 1.349   112.413 2.459   0.25 13.91 ? 130 TYR B CE2 1 
ATOM   2266  C  CZ  . TYR B 1 130 ? 0.769   111.155 2.388   0.25 14.03 ? 130 TYR B CZ  1 
ATOM   2267  O  OH  . TYR B 1 130 ? -0.604  111.025 2.424   0.25 17.05 ? 130 TYR B OH  1 
ATOM   2268  N  N   . GLU B 1 131 ? 5.351   113.592 4.449   0.25 15.40 ? 131 GLU B N   1 
ATOM   2269  C  CA  . GLU B 1 131 ? 4.791   114.655 5.271   0.25 18.78 ? 131 GLU B CA  1 
ATOM   2270  C  C   . GLU B 1 131 ? 4.084   115.591 4.298   0.25 17.83 ? 131 GLU B C   1 
ATOM   2271  O  O   . GLU B 1 131 ? 4.675   116.043 3.314   0.25 17.14 ? 131 GLU B O   1 
ATOM   2272  C  CB  . GLU B 1 131 ? 5.901   115.387 6.023   0.25 22.20 ? 131 GLU B CB  1 
ATOM   2273  C  CG  . GLU B 1 131 ? 6.602   114.521 7.062   0.25 28.69 ? 131 GLU B CG  1 
ATOM   2274  C  CD  . GLU B 1 131 ? 7.782   115.219 7.706   0.25 32.63 ? 131 GLU B CD  1 
ATOM   2275  O  OE1 . GLU B 1 131 ? 7.624   116.385 8.123   0.25 36.48 ? 131 GLU B OE1 1 
ATOM   2276  O  OE2 . GLU B 1 131 ? 8.865   114.602 7.804   0.25 34.15 ? 131 GLU B OE2 1 
ATOM   2277  N  N   . SER B 1 132 ? 2.810   115.852 4.564   0.25 16.52 ? 132 SER B N   1 
ATOM   2278  C  CA  . SER B 1 132 ? 2.000   116.705 3.707   0.25 16.79 ? 132 SER B CA  1 
ATOM   2279  C  C   . SER B 1 132 ? 2.653   118.044 3.384   0.25 17.07 ? 132 SER B C   1 
ATOM   2280  O  O   . SER B 1 132 ? 3.318   118.650 4.226   0.25 14.47 ? 132 SER B O   1 
ATOM   2281  C  CB  . SER B 1 132 ? 0.629   116.932 4.352   0.25 17.66 ? 132 SER B CB  1 
ATOM   2282  O  OG  . SER B 1 132 ? -0.056  115.702 4.522   0.25 13.00 ? 132 SER B OG  1 
ATOM   2283  N  N   . ALA B 1 133 ? 2.454   118.493 2.149   0.25 17.37 ? 133 ALA B N   1 
ATOM   2284  C  CA  . ALA B 1 133 ? 3.004   119.763 1.689   0.25 16.96 ? 133 ALA B CA  1 
ATOM   2285  C  C   . ALA B 1 133 ? 2.234   120.210 0.456   0.25 16.94 ? 133 ALA B C   1 
ATOM   2286  O  O   . ALA B 1 133 ? 1.874   119.386 -0.387  0.25 17.89 ? 133 ALA B O   1 
ATOM   2287  C  CB  . ALA B 1 133 ? 4.484   119.606 1.358   0.25 17.43 ? 133 ALA B CB  1 
ATOM   2288  N  N   . PRO B 1 134 ? 1.966   121.520 0.331   0.25 15.49 ? 134 PRO B N   1 
ATOM   2289  C  CA  . PRO B 1 134 ? 1.225   122.024 -0.827  0.25 15.45 ? 134 PRO B CA  1 
ATOM   2290  C  C   . PRO B 1 134 ? 1.975   121.980 -2.157  0.25 14.11 ? 134 PRO B C   1 
ATOM   2291  O  O   . PRO B 1 134 ? 3.200   122.114 -2.204  0.25 11.86 ? 134 PRO B O   1 
ATOM   2292  C  CB  . PRO B 1 134 ? 0.870   123.449 -0.413  0.25 16.70 ? 134 PRO B CB  1 
ATOM   2293  C  CG  . PRO B 1 134 ? 2.033   123.837 0.451   0.25 16.75 ? 134 PRO B CG  1 
ATOM   2294  C  CD  . PRO B 1 134 ? 2.236   122.603 1.293   0.25 15.90 ? 134 PRO B CD  1 
ATOM   2295  N  N   . PRO B 1 135 ? 1.236   121.794 -3.260  0.25 12.83 ? 135 PRO B N   1 
ATOM   2296  C  CA  . PRO B 1 135 ? 1.823   121.736 -4.604  0.25 13.99 ? 135 PRO B CA  1 
ATOM   2297  C  C   . PRO B 1 135 ? 2.277   123.113 -5.091  0.25 15.68 ? 135 PRO B C   1 
ATOM   2298  O  O   . PRO B 1 135 ? 1.533   124.089 -4.993  0.25 15.88 ? 135 PRO B O   1 
ATOM   2299  C  CB  . PRO B 1 135 ? 0.682   121.185 -5.450  0.25 13.47 ? 135 PRO B CB  1 
ATOM   2300  C  CG  . PRO B 1 135 ? -0.533  121.773 -4.779  0.25 12.36 ? 135 PRO B CG  1 
ATOM   2301  C  CD  . PRO B 1 135 ? -0.218  121.548 -3.311  0.25 12.89 ? 135 PRO B CD  1 
ATOM   2302  N  N   . SER B 1 136 ? 3.501   123.196 -5.602  0.25 14.86 ? 136 SER B N   1 
ATOM   2303  C  CA  . SER B 1 136 ? 3.999   124.464 -6.118  0.25 15.24 ? 136 SER B CA  1 
ATOM   2304  C  C   . SER B 1 136 ? 3.019   124.877 -7.213  0.25 16.36 ? 136 SER B C   1 
ATOM   2305  O  O   . SER B 1 136 ? 2.298   124.034 -7.753  0.25 17.05 ? 136 SER B O   1 
ATOM   2306  C  CB  . SER B 1 136 ? 5.402   124.289 -6.707  0.25 14.12 ? 136 SER B CB  1 
ATOM   2307  O  OG  . SER B 1 136 ? 5.373   123.474 -7.867  0.25 13.72 ? 136 SER B OG  1 
ATOM   2308  N  N   . PRO B 1 137 ? 2.962   126.177 -7.544  0.25 16.66 ? 137 PRO B N   1 
ATOM   2309  C  CA  . PRO B 1 137 ? 2.042   126.642 -8.586  0.25 16.38 ? 137 PRO B CA  1 
ATOM   2310  C  C   . PRO B 1 137 ? 2.208   125.918 -9.916  0.25 15.64 ? 137 PRO B C   1 
ATOM   2311  O  O   . PRO B 1 137 ? 1.223   125.643 -10.604 0.25 15.82 ? 137 PRO B O   1 
ATOM   2312  C  CB  . PRO B 1 137 ? 2.373   128.127 -8.696  0.25 17.93 ? 137 PRO B CB  1 
ATOM   2313  C  CG  . PRO B 1 137 ? 2.743   128.480 -7.287  0.25 15.97 ? 137 PRO B CG  1 
ATOM   2314  C  CD  . PRO B 1 137 ? 3.625   127.317 -6.887  0.25 17.65 ? 137 PRO B CD  1 
ATOM   2315  N  N   . GLN B 1 138 ? 3.450   125.607 -10.278 0.25 15.53 ? 138 GLN B N   1 
ATOM   2316  C  CA  . GLN B 1 138 ? 3.713   124.929 -11.546 0.25 16.58 ? 138 GLN B CA  1 
ATOM   2317  C  C   . GLN B 1 138 ? 3.212   123.494 -11.564 0.25 15.31 ? 138 GLN B C   1 
ATOM   2318  O  O   . GLN B 1 138 ? 2.727   123.016 -12.588 0.25 14.61 ? 138 GLN B O   1 
ATOM   2319  C  CB  . GLN B 1 138 ? 5.209   124.930 -11.876 0.25 19.14 ? 138 GLN B CB  1 
ATOM   2320  C  CG  . GLN B 1 138 ? 5.832   126.307 -11.952 0.25 20.60 ? 138 GLN B CG  1 
ATOM   2321  C  CD  . GLN B 1 138 ? 6.334   126.779 -10.609 0.25 22.97 ? 138 GLN B CD  1 
ATOM   2322  O  OE1 . GLN B 1 138 ? 5.583   126.837 -9.634  0.25 22.66 ? 138 GLN B OE1 1 
ATOM   2323  N  NE2 . GLN B 1 138 ? 7.616   127.119 -10.548 0.25 22.57 ? 138 GLN B NE2 1 
ATOM   2324  N  N   . TYR B 1 139 ? 3.340   122.801 -10.439 0.25 14.83 ? 139 TYR B N   1 
ATOM   2325  C  CA  . TYR B 1 139 ? 2.882   121.422 -10.369 0.25 14.56 ? 139 TYR B CA  1 
ATOM   2326  C  C   . TYR B 1 139 ? 1.361   121.412 -10.445 0.25 14.41 ? 139 TYR B C   1 
ATOM   2327  O  O   . TYR B 1 139 ? 0.769   120.623 -11.191 0.25 14.78 ? 139 TYR B O   1 
ATOM   2328  C  CB  . TYR B 1 139 ? 3.362   120.765 -9.072  0.25 13.85 ? 139 TYR B CB  1 
ATOM   2329  C  CG  . TYR B 1 139 ? 3.134   119.267 -9.014  0.25 13.47 ? 139 TYR B CG  1 
ATOM   2330  C  CD1 . TYR B 1 139 ? 3.620   118.426 -10.015 0.25 17.01 ? 139 TYR B CD1 1 
ATOM   2331  C  CD2 . TYR B 1 139 ? 2.460   118.689 -7.940  0.25 15.44 ? 139 TYR B CD2 1 
ATOM   2332  C  CE1 . TYR B 1 139 ? 3.444   117.039 -9.946  0.25 14.39 ? 139 TYR B CE1 1 
ATOM   2333  C  CE2 . TYR B 1 139 ? 2.276   117.312 -7.860  0.25 14.09 ? 139 TYR B CE2 1 
ATOM   2334  C  CZ  . TYR B 1 139 ? 2.771   116.493 -8.863  0.25 14.39 ? 139 TYR B CZ  1 
ATOM   2335  O  OH  . TYR B 1 139 ? 2.608   115.132 -8.764  0.25 13.70 ? 139 TYR B OH  1 
ATOM   2336  N  N   . LYS B 1 140 ? 0.721   122.297 -9.686  0.25 12.90 ? 140 LYS B N   1 
ATOM   2337  C  CA  . LYS B 1 140 ? -0.737  122.371 -9.714  0.25 13.13 ? 140 LYS B CA  1 
ATOM   2338  C  C   . LYS B 1 140 ? -1.181  122.734 -11.126 0.25 13.38 ? 140 LYS B C   1 
ATOM   2339  O  O   . LYS B 1 140 ? -2.260  122.339 -11.577 0.25 13.59 ? 140 LYS B O   1 
ATOM   2340  C  CB  . LYS B 1 140 ? -1.256  123.432 -8.734  0.25 13.71 ? 140 LYS B CB  1 
ATOM   2341  C  CG  . LYS B 1 140 ? -2.768  123.611 -8.805  0.25 15.01 ? 140 LYS B CG  1 
ATOM   2342  C  CD  . LYS B 1 140 ? -3.272  124.741 -7.920  0.25 15.30 ? 140 LYS B CD  1 
ATOM   2343  C  CE  . LYS B 1 140 ? -4.783  124.862 -8.031  0.25 16.18 ? 140 LYS B CE  1 
ATOM   2344  N  NZ  . LYS B 1 140 ? -5.324  125.999 -7.247  0.25 15.42 ? 140 LYS B NZ  1 
ATOM   2345  N  N   . LYS B 1 141 ? -0.337  123.487 -11.823 0.25 13.43 ? 141 LYS B N   1 
ATOM   2346  C  CA  . LYS B 1 141 ? -0.645  123.917 -13.182 0.25 15.91 ? 141 LYS B CA  1 
ATOM   2347  C  C   . LYS B 1 141 ? -0.658  122.733 -14.139 0.25 13.16 ? 141 LYS B C   1 
ATOM   2348  O  O   . LYS B 1 141 ? -1.573  122.593 -14.955 0.25 11.28 ? 141 LYS B O   1 
ATOM   2349  C  CB  . LYS B 1 141 ? 0.379   124.952 -13.659 0.25 18.48 ? 141 LYS B CB  1 
ATOM   2350  C  CG  . LYS B 1 141 ? 0.075   125.553 -15.022 0.25 24.01 ? 141 LYS B CG  1 
ATOM   2351  C  CD  . LYS B 1 141 ? -1.217  126.360 -15.000 0.25 27.36 ? 141 LYS B CD  1 
ATOM   2352  C  CE  . LYS B 1 141 ? -1.472  127.032 -16.344 0.25 30.76 ? 141 LYS B CE  1 
ATOM   2353  N  NZ  . LYS B 1 141 ? -2.766  127.776 -16.365 0.25 34.17 ? 141 LYS B NZ  1 
ATOM   2354  N  N   . ILE B 1 142 ? 0.357   121.882 -14.041 0.25 13.13 ? 142 ILE B N   1 
ATOM   2355  C  CA  . ILE B 1 142 ? 0.439   120.715 -14.907 0.25 13.08 ? 142 ILE B CA  1 
ATOM   2356  C  C   . ILE B 1 142 ? -0.780  119.826 -14.676 0.25 12.71 ? 142 ILE B C   1 
ATOM   2357  O  O   . ILE B 1 142 ? -1.536  119.529 -15.602 0.25 11.96 ? 142 ILE B O   1 
ATOM   2358  C  CB  . ILE B 1 142 ? 1.715   119.895 -14.625 0.25 12.53 ? 142 ILE B CB  1 
ATOM   2359  C  CG1 . ILE B 1 142 ? 2.956   120.768 -14.832 0.25 14.24 ? 142 ILE B CG1 1 
ATOM   2360  C  CG2 . ILE B 1 142 ? 1.749   118.669 -15.529 0.25 12.98 ? 142 ILE B CG2 1 
ATOM   2361  C  CD1 . ILE B 1 142 ? 3.182   121.230 -16.261 0.25 10.85 ? 142 ILE B CD1 1 
ATOM   2362  N  N   . ILE B 1 143 ? -0.971  119.408 -13.432 0.25 11.61 ? 143 ILE B N   1 
ATOM   2363  C  CA  . ILE B 1 143 ? -2.098  118.555 -13.086 0.25 13.25 ? 143 ILE B CA  1 
ATOM   2364  C  C   . ILE B 1 143 ? -3.407  119.161 -13.582 0.25 13.62 ? 143 ILE B C   1 
ATOM   2365  O  O   . ILE B 1 143 ? -4.253  118.459 -14.147 0.25 13.97 ? 143 ILE B O   1 
ATOM   2366  C  CB  . ILE B 1 143 ? -2.146  118.331 -11.556 0.25 11.11 ? 143 ILE B CB  1 
ATOM   2367  C  CG1 . ILE B 1 143 ? -0.926  117.496 -11.143 0.25 10.21 ? 143 ILE B CG1 1 
ATOM   2368  C  CG2 . ILE B 1 143 ? -3.439  117.633 -11.155 0.25 12.27 ? 143 ILE B CG2 1 
ATOM   2369  C  CD1 . ILE B 1 143 ? -0.630  117.501 -9.663  0.25 10.03 ? 143 ILE B CD1 1 
ATOM   2370  N  N   . CYS B 1 144 ? -3.561  120.468 -13.388 0.25 13.79 ? 144 CYS B N   1 
ATOM   2371  C  CA  . CYS B 1 144 ? -4.766  121.170 -13.819 0.25 15.04 ? 144 CYS B CA  1 
ATOM   2372  C  C   . CYS B 1 144 ? -4.945  121.133 -15.336 0.25 13.33 ? 144 CYS B C   1 
ATOM   2373  O  O   . CYS B 1 144 ? -6.000  120.739 -15.839 0.25 12.06 ? 144 CYS B O   1 
ATOM   2374  C  CB  . CYS B 1 144 ? -4.726  122.624 -13.353 0.25 17.32 ? 144 CYS B CB  1 
ATOM   2375  S  SG  . CYS B 1 144 ? -6.112  123.589 -13.960 0.25 25.55 ? 144 CYS B SG  1 
HETATM 2376  N  N   . MSE B 1 145 ? -3.920  121.564 -16.060 0.25 12.46 ? 145 MSE B N   1 
HETATM 2377  C  CA  . MSE B 1 145 ? -3.978  121.562 -17.517 0.25 14.07 ? 145 MSE B CA  1 
HETATM 2378  C  C   . MSE B 1 145 ? -4.248  120.146 -18.010 0.25 13.29 ? 145 MSE B C   1 
HETATM 2379  O  O   . MSE B 1 145 ? -5.001  119.941 -18.962 0.25 13.65 ? 145 MSE B O   1 
HETATM 2380  C  CB  . MSE B 1 145 ? -2.657  122.073 -18.097 0.25 15.26 ? 145 MSE B CB  1 
HETATM 2381  C  CG  . MSE B 1 145 ? -2.408  123.550 -17.848 0.25 19.00 ? 145 MSE B CG  1 
HETATM 2382  SE SE  . MSE B 1 145 ? -0.620  124.109 -18.339 0.25 20.86 ? 145 MSE B SE  1 
HETATM 2383  C  CE  . MSE B 1 145 ? -0.870  124.250 -20.255 0.25 21.96 ? 145 MSE B CE  1 
ATOM   2384  N  N   . GLY B 1 146 ? -3.637  119.170 -17.345 0.25 12.22 ? 146 GLY B N   1 
ATOM   2385  C  CA  . GLY B 1 146 ? -3.825  117.783 -17.730 0.25 10.40 ? 146 GLY B CA  1 
ATOM   2386  C  C   . GLY B 1 146 ? -5.250  117.318 -17.502 0.25 10.84 ? 146 GLY B C   1 
ATOM   2387  O  O   . GLY B 1 146 ? -5.831  116.625 -18.341 0.25 12.10 ? 146 GLY B O   1 
ATOM   2388  N  N   . ALA B 1 147 ? -5.812  117.692 -16.358 0.25 9.94  ? 147 ALA B N   1 
ATOM   2389  C  CA  . ALA B 1 147 ? -7.180  117.322 -16.011 0.25 11.03 ? 147 ALA B CA  1 
ATOM   2390  C  C   . ALA B 1 147 ? -8.165  117.866 -17.036 0.25 11.31 ? 147 ALA B C   1 
ATOM   2391  O  O   . ALA B 1 147 ? -9.069  117.160 -17.491 0.25 11.44 ? 147 ALA B O   1 
ATOM   2392  C  CB  . ALA B 1 147 ? -7.531  117.862 -14.630 0.25 8.88  ? 147 ALA B CB  1 
ATOM   2393  N  N   . LYS B 1 148 ? -7.990  119.132 -17.385 0.25 11.79 ? 148 LYS B N   1 
ATOM   2394  C  CA  . LYS B 1 148 ? -8.869  119.772 -18.352 0.25 14.87 ? 148 LYS B CA  1 
ATOM   2395  C  C   . LYS B 1 148 ? -8.689  119.119 -19.719 0.25 14.23 ? 148 LYS B C   1 
ATOM   2396  O  O   . LYS B 1 148 ? -9.661  118.812 -20.408 0.25 13.73 ? 148 LYS B O   1 
ATOM   2397  C  CB  . LYS B 1 148 ? -8.554  121.269 -18.436 0.25 17.19 ? 148 LYS B CB  1 
ATOM   2398  C  CG  . LYS B 1 148 ? -9.498  122.045 -19.353 0.25 23.22 ? 148 LYS B CG  1 
ATOM   2399  C  CD  . LYS B 1 148 ? -9.160  123.526 -19.386 0.25 25.45 ? 148 LYS B CD  1 
ATOM   2400  C  CE  . LYS B 1 148 ? -10.072 124.274 -20.355 0.25 29.57 ? 148 LYS B CE  1 
ATOM   2401  N  NZ  . LYS B 1 148 ? -9.670  125.701 -20.522 0.25 31.52 ? 148 LYS B NZ  1 
ATOM   2402  N  N   . GLU B 1 149 ? -7.436  118.888 -20.092 0.25 15.86 ? 149 GLU B N   1 
ATOM   2403  C  CA  . GLU B 1 149 ? -7.116  118.285 -21.382 0.25 17.35 ? 149 GLU B CA  1 
ATOM   2404  C  C   . GLU B 1 149 ? -7.866  116.993 -21.670 0.25 17.12 ? 149 GLU B C   1 
ATOM   2405  O  O   . GLU B 1 149 ? -8.630  116.911 -22.633 0.25 16.10 ? 149 GLU B O   1 
ATOM   2406  C  CB  . GLU B 1 149 ? -5.618  118.012 -21.481 0.25 18.43 ? 149 GLU B CB  1 
ATOM   2407  C  CG  . GLU B 1 149 ? -5.201  117.458 -22.831 0.25 21.66 ? 149 GLU B CG  1 
ATOM   2408  C  CD  . GLU B 1 149 ? -3.716  117.216 -22.925 0.25 21.79 ? 149 GLU B CD  1 
ATOM   2409  O  OE1 . GLU B 1 149 ? -3.210  116.324 -22.210 0.25 24.08 ? 149 GLU B OE1 1 
ATOM   2410  O  OE2 . GLU B 1 149 ? -3.053  117.923 -23.711 0.25 22.39 ? 149 GLU B OE2 1 
ATOM   2411  N  N   . ASN B 1 150 ? -7.636  115.981 -20.839 0.25 15.90 ? 150 ASN B N   1 
ATOM   2412  C  CA  . ASN B 1 150 ? -8.284  114.690 -21.024 0.25 15.67 ? 150 ASN B CA  1 
ATOM   2413  C  C   . ASN B 1 150 ? -9.676  114.637 -20.415 0.25 15.03 ? 150 ASN B C   1 
ATOM   2414  O  O   . ASN B 1 150 ? -10.276 113.573 -20.289 0.25 16.15 ? 150 ASN B O   1 
ATOM   2415  C  CB  . ASN B 1 150 ? -7.396  113.579 -20.468 0.25 16.48 ? 150 ASN B CB  1 
ATOM   2416  C  CG  . ASN B 1 150 ? -6.166  113.354 -21.322 0.25 18.32 ? 150 ASN B CG  1 
ATOM   2417  O  OD1 . ASN B 1 150 ? -5.033  113.568 -20.884 0.25 15.68 ? 150 ASN B OD1 1 
ATOM   2418  N  ND2 . ASN B 1 150 ? -6.387  112.931 -22.563 0.25 13.36 ? 150 ASN B ND2 1 
ATOM   2419  N  N   . GLY B 1 151 ? -10.178 115.809 -20.048 0.25 15.80 ? 151 GLY B N   1 
ATOM   2420  C  CA  . GLY B 1 151 ? -11.512 115.928 -19.490 0.25 15.82 ? 151 GLY B CA  1 
ATOM   2421  C  C   . GLY B 1 151 ? -11.975 114.948 -18.425 0.25 17.18 ? 151 GLY B C   1 
ATOM   2422  O  O   . GLY B 1 151 ? -12.663 113.967 -18.724 0.25 16.70 ? 151 GLY B O   1 
ATOM   2423  N  N   . LEU B 1 152 ? -11.604 115.211 -17.178 0.25 15.87 ? 152 LEU B N   1 
ATOM   2424  C  CA  . LEU B 1 152 ? -12.047 114.372 -16.072 0.25 16.97 ? 152 LEU B CA  1 
ATOM   2425  C  C   . LEU B 1 152 ? -13.427 114.923 -15.695 0.25 16.99 ? 152 LEU B C   1 
ATOM   2426  O  O   . LEU B 1 152 ? -13.837 115.963 -16.209 0.25 16.80 ? 152 LEU B O   1 
ATOM   2427  C  CB  . LEU B 1 152 ? -11.069 114.488 -14.897 0.25 15.61 ? 152 LEU B CB  1 
ATOM   2428  C  CG  . LEU B 1 152 ? -9.759  113.693 -15.012 0.25 16.79 ? 152 LEU B CG  1 
ATOM   2429  C  CD1 . LEU B 1 152 ? -9.021  114.062 -16.286 0.25 15.70 ? 152 LEU B CD1 1 
ATOM   2430  C  CD2 . LEU B 1 152 ? -8.883  113.964 -13.787 0.25 14.96 ? 152 LEU B CD2 1 
ATOM   2431  N  N   . PRO B 1 153 ? -14.171 114.236 -14.813 0.25 18.69 ? 153 PRO B N   1 
ATOM   2432  C  CA  . PRO B 1 153 ? -15.491 114.771 -14.456 0.25 19.00 ? 153 PRO B CA  1 
ATOM   2433  C  C   . PRO B 1 153 ? -15.432 116.252 -14.082 0.25 19.98 ? 153 PRO B C   1 
ATOM   2434  O  O   . PRO B 1 153 ? -14.494 116.702 -13.419 0.25 18.19 ? 153 PRO B O   1 
ATOM   2435  C  CB  . PRO B 1 153 ? -15.911 113.888 -13.289 0.25 20.02 ? 153 PRO B CB  1 
ATOM   2436  C  CG  . PRO B 1 153 ? -15.313 112.566 -13.666 0.25 18.08 ? 153 PRO B CG  1 
ATOM   2437  C  CD  . PRO B 1 153 ? -13.926 112.950 -14.138 0.25 17.35 ? 153 PRO B CD  1 
ATOM   2438  N  N   . LEU B 1 154 ? -16.442 117.001 -14.516 0.25 20.26 ? 154 LEU B N   1 
ATOM   2439  C  CA  . LEU B 1 154 ? -16.517 118.432 -14.256 0.25 20.61 ? 154 LEU B CA  1 
ATOM   2440  C  C   . LEU B 1 154 ? -16.414 118.746 -12.771 0.25 19.83 ? 154 LEU B C   1 
ATOM   2441  O  O   . LEU B 1 154 ? -15.843 119.767 -12.387 0.25 18.44 ? 154 LEU B O   1 
ATOM   2442  C  CB  . LEU B 1 154 ? -17.828 118.998 -14.810 0.25 23.84 ? 154 LEU B CB  1 
ATOM   2443  C  CG  . LEU B 1 154 ? -17.729 120.325 -15.569 0.25 27.47 ? 154 LEU B CG  1 
ATOM   2444  C  CD1 . LEU B 1 154 ? -17.130 121.400 -14.671 0.25 26.56 ? 154 LEU B CD1 1 
ATOM   2445  C  CD2 . LEU B 1 154 ? -16.878 120.131 -16.818 0.25 29.08 ? 154 LEU B CD2 1 
ATOM   2446  N  N   . GLU B 1 155 ? -16.969 117.867 -11.942 0.25 19.51 ? 155 GLU B N   1 
ATOM   2447  C  CA  . GLU B 1 155 ? -16.935 118.046 -10.492 0.25 22.25 ? 155 GLU B CA  1 
ATOM   2448  C  C   . GLU B 1 155 ? -15.523 117.896 -9.937  0.25 18.87 ? 155 GLU B C   1 
ATOM   2449  O  O   . GLU B 1 155 ? -15.076 118.711 -9.129  0.25 18.15 ? 155 GLU B O   1 
ATOM   2450  C  CB  . GLU B 1 155 ? -17.852 117.032 -9.799  0.25 24.99 ? 155 GLU B CB  1 
ATOM   2451  C  CG  . GLU B 1 155 ? -19.346 117.320 -9.923  0.25 34.62 ? 155 GLU B CG  1 
ATOM   2452  C  CD  . GLU B 1 155 ? -19.828 117.354 -11.361 0.25 37.68 ? 155 GLU B CD  1 
ATOM   2453  O  OE1 . GLU B 1 155 ? -19.494 116.422 -12.126 0.25 41.93 ? 155 GLU B OE1 1 
ATOM   2454  O  OE2 . GLU B 1 155 ? -20.549 118.307 -11.724 0.25 39.66 ? 155 GLU B OE2 1 
ATOM   2455  N  N   . TYR B 1 156 ? -14.826 116.848 -10.369 0.25 17.08 ? 156 TYR B N   1 
ATOM   2456  C  CA  . TYR B 1 156 ? -13.466 116.604 -9.898  0.25 16.06 ? 156 TYR B CA  1 
ATOM   2457  C  C   . TYR B 1 156 ? -12.569 117.758 -10.320 0.25 14.26 ? 156 TYR B C   1 
ATOM   2458  O  O   . TYR B 1 156 ? -11.808 118.288 -9.514  0.25 15.22 ? 156 TYR B O   1 
ATOM   2459  C  CB  . TYR B 1 156 ? -12.917 115.290 -10.465 0.25 13.99 ? 156 TYR B CB  1 
ATOM   2460  C  CG  . TYR B 1 156 ? -11.617 114.847 -9.816  0.25 15.36 ? 156 TYR B CG  1 
ATOM   2461  C  CD1 . TYR B 1 156 ? -11.589 114.422 -8.486  0.25 12.34 ? 156 TYR B CD1 1 
ATOM   2462  C  CD2 . TYR B 1 156 ? -10.414 114.861 -10.529 0.25 13.54 ? 156 TYR B CD2 1 
ATOM   2463  C  CE1 . TYR B 1 156 ? -10.395 114.019 -7.880  0.25 13.85 ? 156 TYR B CE1 1 
ATOM   2464  C  CE2 . TYR B 1 156 ? -9.213  114.462 -9.935  0.25 12.48 ? 156 TYR B CE2 1 
ATOM   2465  C  CZ  . TYR B 1 156 ? -9.211  114.041 -8.612  0.25 11.51 ? 156 TYR B CZ  1 
ATOM   2466  O  OH  . TYR B 1 156 ? -8.037  113.626 -8.025  0.25 13.37 ? 156 TYR B OH  1 
ATOM   2467  N  N   . GLN B 1 157 ? -12.665 118.148 -11.587 0.25 15.08 ? 157 GLN B N   1 
ATOM   2468  C  CA  . GLN B 1 157 ? -11.863 119.250 -12.096 0.25 14.25 ? 157 GLN B CA  1 
ATOM   2469  C  C   . GLN B 1 157 ? -12.084 120.499 -11.240 0.25 15.99 ? 157 GLN B C   1 
ATOM   2470  O  O   . GLN B 1 157 ? -11.151 121.262 -10.990 0.25 12.65 ? 157 GLN B O   1 
ATOM   2471  C  CB  . GLN B 1 157 ? -12.217 119.547 -13.558 0.25 12.63 ? 157 GLN B CB  1 
ATOM   2472  C  CG  . GLN B 1 157 ? -11.841 118.431 -14.543 0.25 11.56 ? 157 GLN B CG  1 
ATOM   2473  C  CD  . GLN B 1 157 ? -11.983 118.858 -16.001 0.25 16.00 ? 157 GLN B CD  1 
ATOM   2474  O  OE1 . GLN B 1 157 ? -11.385 119.847 -16.431 0.25 14.75 ? 157 GLN B OE1 1 
ATOM   2475  N  NE2 . GLN B 1 157 ? -12.772 118.112 -16.766 0.25 13.80 ? 157 GLN B NE2 1 
ATOM   2476  N  N   . GLU B 1 158 ? -13.316 120.707 -10.782 0.25 17.92 ? 158 GLU B N   1 
ATOM   2477  C  CA  . GLU B 1 158 ? -13.597 121.873 -9.956  0.25 19.56 ? 158 GLU B CA  1 
ATOM   2478  C  C   . GLU B 1 158 ? -12.777 121.797 -8.677  0.25 17.44 ? 158 GLU B C   1 
ATOM   2479  O  O   . GLU B 1 158 ? -12.287 122.810 -8.185  0.25 15.10 ? 158 GLU B O   1 
ATOM   2480  C  CB  . GLU B 1 158 ? -15.086 121.960 -9.619  0.25 24.52 ? 158 GLU B CB  1 
ATOM   2481  C  CG  . GLU B 1 158 ? -15.973 122.178 -10.828 0.25 33.69 ? 158 GLU B CG  1 
ATOM   2482  C  CD  . GLU B 1 158 ? -15.449 123.269 -11.740 0.25 35.37 ? 158 GLU B CD  1 
ATOM   2483  O  OE1 . GLU B 1 158 ? -15.297 124.418 -11.274 0.25 39.67 ? 158 GLU B OE1 1 
ATOM   2484  O  OE2 . GLU B 1 158 ? -15.186 122.975 -12.925 0.25 38.45 ? 158 GLU B OE2 1 
ATOM   2485  N  N   . LYS B 1 159 ? -12.626 120.586 -8.145  0.25 18.68 ? 159 LYS B N   1 
ATOM   2486  C  CA  . LYS B 1 159 ? -11.850 120.391 -6.927  0.25 20.14 ? 159 LYS B CA  1 
ATOM   2487  C  C   . LYS B 1 159 ? -10.384 120.741 -7.172  0.25 18.96 ? 159 LYS B C   1 
ATOM   2488  O  O   . LYS B 1 159 ? -9.817  121.576 -6.471  0.25 17.98 ? 159 LYS B O   1 
ATOM   2489  C  CB  . LYS B 1 159 ? -11.965 118.943 -6.436  0.25 23.96 ? 159 LYS B CB  1 
ATOM   2490  C  CG  . LYS B 1 159 ? -13.286 118.607 -5.761  0.25 29.25 ? 159 LYS B CG  1 
ATOM   2491  C  CD  . LYS B 1 159 ? -13.227 117.227 -5.123  0.25 32.93 ? 159 LYS B CD  1 
ATOM   2492  C  CE  . LYS B 1 159 ? -14.492 116.909 -4.343  0.25 36.10 ? 159 LYS B CE  1 
ATOM   2493  N  NZ  . LYS B 1 159 ? -14.422 115.558 -3.716  0.25 37.41 ? 159 LYS B NZ  1 
ATOM   2494  N  N   . LEU B 1 160 ? -9.769  120.109 -8.167  0.25 16.41 ? 160 LEU B N   1 
ATOM   2495  C  CA  . LEU B 1 160 ? -8.369  120.393 -8.475  0.25 16.02 ? 160 LEU B CA  1 
ATOM   2496  C  C   . LEU B 1 160 ? -8.156  121.903 -8.592  0.25 17.26 ? 160 LEU B C   1 
ATOM   2497  O  O   . LEU B 1 160 ? -7.072  122.413 -8.307  0.25 16.95 ? 160 LEU B O   1 
ATOM   2498  C  CB  . LEU B 1 160 ? -7.955  119.709 -9.786  0.25 15.24 ? 160 LEU B CB  1 
ATOM   2499  C  CG  . LEU B 1 160 ? -7.935  118.176 -9.823  0.25 15.83 ? 160 LEU B CG  1 
ATOM   2500  C  CD1 . LEU B 1 160 ? -7.736  117.704 -11.262 0.25 15.76 ? 160 LEU B CD1 1 
ATOM   2501  C  CD2 . LEU B 1 160 ? -6.821  117.644 -8.927  0.25 13.86 ? 160 LEU B CD2 1 
ATOM   2502  N  N   . LYS B 1 161 ? -9.199  122.614 -9.010  0.25 17.50 ? 161 LYS B N   1 
ATOM   2503  C  CA  . LYS B 1 161 ? -9.119  124.060 -9.161  0.25 22.07 ? 161 LYS B CA  1 
ATOM   2504  C  C   . LYS B 1 161 ? -8.860  124.751 -7.824  0.25 20.54 ? 161 LYS B C   1 
ATOM   2505  O  O   . LYS B 1 161 ? -7.977  125.599 -7.713  0.25 19.57 ? 161 LYS B O   1 
ATOM   2506  C  CB  . LYS B 1 161 ? -10.416 124.602 -9.769  0.25 25.38 ? 161 LYS B CB  1 
ATOM   2507  C  CG  . LYS B 1 161 ? -10.695 124.123 -11.181 0.25 31.78 ? 161 LYS B CG  1 
ATOM   2508  C  CD  . LYS B 1 161 ? -11.944 124.781 -11.742 0.25 36.36 ? 161 LYS B CD  1 
ATOM   2509  C  CE  . LYS B 1 161 ? -12.136 124.460 -13.214 0.25 37.96 ? 161 LYS B CE  1 
ATOM   2510  N  NZ  . LYS B 1 161 ? -13.251 125.253 -13.792 0.25 41.60 ? 161 LYS B NZ  1 
ATOM   2511  N  N   . ALA B 1 162 ? -9.631  124.373 -6.810  0.25 20.05 ? 162 ALA B N   1 
ATOM   2512  C  CA  . ALA B 1 162 ? -9.504  124.965 -5.482  0.25 20.50 ? 162 ALA B CA  1 
ATOM   2513  C  C   . ALA B 1 162 ? -8.288  124.488 -4.696  0.25 20.59 ? 162 ALA B C   1 
ATOM   2514  O  O   . ALA B 1 162 ? -8.084  124.906 -3.554  0.25 20.10 ? 162 ALA B O   1 
ATOM   2515  C  CB  . ALA B 1 162 ? -10.768 124.701 -4.680  0.25 21.12 ? 162 ALA B CB  1 
ATOM   2516  N  N   . ILE B 1 163 ? -7.483  123.616 -5.294  0.25 19.08 ? 163 ILE B N   1 
ATOM   2517  C  CA  . ILE B 1 163 ? -6.300  123.112 -4.608  0.25 18.70 ? 163 ILE B CA  1 
ATOM   2518  C  C   . ILE B 1 163 ? -5.420  124.260 -4.127  0.25 17.01 ? 163 ILE B C   1 
ATOM   2519  O  O   . ILE B 1 163 ? -4.916  125.039 -4.931  0.25 16.84 ? 163 ILE B O   1 
ATOM   2520  C  CB  . ILE B 1 163 ? -5.458  122.196 -5.524  0.25 17.03 ? 163 ILE B CB  1 
ATOM   2521  C  CG1 . ILE B 1 163 ? -6.231  120.910 -5.823  0.25 19.67 ? 163 ILE B CG1 1 
ATOM   2522  C  CG2 . ILE B 1 163 ? -4.126  121.873 -4.853  0.25 18.04 ? 163 ILE B CG2 1 
ATOM   2523  C  CD1 . ILE B 1 163 ? -5.499  119.947 -6.734  0.25 15.21 ? 163 ILE B CD1 1 
ATOM   2524  N  N   . GLU B 1 164 ? -5.238  124.357 -2.812  0.25 18.12 ? 164 GLU B N   1 
ATOM   2525  C  CA  . GLU B 1 164 ? -4.410  125.410 -2.227  0.25 19.28 ? 164 GLU B CA  1 
ATOM   2526  C  C   . GLU B 1 164 ? -2.931  125.133 -2.508  0.25 19.84 ? 164 GLU B C   1 
ATOM   2527  O  O   . GLU B 1 164 ? -2.369  124.178 -1.988  0.25 19.12 ? 164 GLU B O   1 
ATOM   2528  C  CB  . GLU B 1 164 ? -4.649  125.486 -0.708  0.25 19.95 ? 164 GLU B CB  1 
ATOM   2529  C  CG  . GLU B 1 164 ? -3.758  126.484 0.026   0.25 20.26 ? 164 GLU B CG  1 
ATOM   2530  C  CD  . GLU B 1 164 ? -4.089  126.631 1.512   0.25 20.44 ? 164 GLU B CD  1 
ATOM   2531  O  OE1 . GLU B 1 164 ? -3.485  127.508 2.167   0.25 24.09 ? 164 GLU B OE1 1 
ATOM   2532  O  OE2 . GLU B 1 164 ? -4.941  125.882 2.035   0.25 21.02 ? 164 GLU B OE2 1 
ATOM   2533  N  N   . PRO B 1 165 ? -2.285  125.964 -3.344  0.25 20.23 ? 165 PRO B N   1 
ATOM   2534  C  CA  . PRO B 1 165 ? -0.866  125.761 -3.657  0.25 20.77 ? 165 PRO B CA  1 
ATOM   2535  C  C   . PRO B 1 165 ? 0.035   126.446 -2.629  0.25 21.30 ? 165 PRO B C   1 
ATOM   2536  O  O   . PRO B 1 165 ? -0.452  127.151 -1.745  0.25 19.11 ? 165 PRO B O   1 
ATOM   2537  C  CB  . PRO B 1 165 ? -0.734  126.403 -5.030  0.25 20.79 ? 165 PRO B CB  1 
ATOM   2538  C  CG  . PRO B 1 165 ? -1.630  127.604 -4.889  0.25 22.29 ? 165 PRO B CG  1 
ATOM   2539  C  CD  . PRO B 1 165 ? -2.860  127.027 -4.191  0.25 21.28 ? 165 PRO B CD  1 
ATOM   2540  N  N   . ASN B 1 166 ? 1.342   126.231 -2.734  0.25 21.49 ? 166 ASN B N   1 
ATOM   2541  C  CA  . ASN B 1 166 ? 2.264   126.894 -1.824  0.25 22.51 ? 166 ASN B CA  1 
ATOM   2542  C  C   . ASN B 1 166 ? 2.570   128.248 -2.462  0.25 23.61 ? 166 ASN B C   1 
ATOM   2543  O  O   . ASN B 1 166 ? 1.922   128.631 -3.438  0.25 24.15 ? 166 ASN B O   1 
ATOM   2544  C  CB  . ASN B 1 166 ? 3.552   126.078 -1.621  0.25 20.32 ? 166 ASN B CB  1 
ATOM   2545  C  CG  . ASN B 1 166 ? 4.361   125.913 -2.892  0.25 19.13 ? 166 ASN B CG  1 
ATOM   2546  O  OD1 . ASN B 1 166 ? 4.170   126.636 -3.869  0.25 15.68 ? 166 ASN B OD1 1 
ATOM   2547  N  ND2 . ASN B 1 166 ? 5.288   124.963 -2.876  0.25 16.52 ? 166 ASN B ND2 1 
ATOM   2548  N  N   . ASP B 1 167 ? 3.544   128.975 -1.929  0.25 26.78 ? 167 ASP B N   1 
ATOM   2549  C  CA  . ASP B 1 167 ? 3.869   130.286 -2.480  0.25 29.05 ? 167 ASP B CA  1 
ATOM   2550  C  C   . ASP B 1 167 ? 5.186   130.346 -3.249  0.25 28.39 ? 167 ASP B C   1 
ATOM   2551  O  O   . ASP B 1 167 ? 5.813   131.404 -3.336  0.25 28.57 ? 167 ASP B O   1 
ATOM   2552  C  CB  . ASP B 1 167 ? 3.866   131.335 -1.363  0.25 32.46 ? 167 ASP B CB  1 
ATOM   2553  C  CG  . ASP B 1 167 ? 4.721   130.930 -0.184  0.25 35.92 ? 167 ASP B CG  1 
ATOM   2554  O  OD1 . ASP B 1 167 ? 5.934   130.712 -0.381  0.25 37.82 ? 167 ASP B OD1 1 
ATOM   2555  O  OD2 . ASP B 1 167 ? 4.181   130.830 0.938   0.25 36.95 ? 167 ASP B OD2 1 
ATOM   2556  N  N   . TYR B 1 168 ? 5.605   129.214 -3.811  0.25 26.09 ? 168 TYR B N   1 
ATOM   2557  C  CA  . TYR B 1 168 ? 6.843   129.181 -4.583  0.25 25.81 ? 168 TYR B CA  1 
ATOM   2558  C  C   . TYR B 1 168 ? 6.706   130.198 -5.710  0.25 26.80 ? 168 TYR B C   1 
ATOM   2559  O  O   . TYR B 1 168 ? 5.649   130.305 -6.336  0.25 25.89 ? 168 TYR B O   1 
ATOM   2560  C  CB  . TYR B 1 168 ? 7.081   127.778 -5.163  0.25 23.65 ? 168 TYR B CB  1 
ATOM   2561  C  CG  . TYR B 1 168 ? 8.370   127.633 -5.953  0.25 20.70 ? 168 TYR B CG  1 
ATOM   2562  C  CD1 . TYR B 1 168 ? 9.616   127.766 -5.335  0.25 18.62 ? 168 TYR B CD1 1 
ATOM   2563  C  CD2 . TYR B 1 168 ? 8.342   127.355 -7.318  0.25 19.13 ? 168 TYR B CD2 1 
ATOM   2564  C  CE1 . TYR B 1 168 ? 10.802  127.626 -6.066  0.25 20.55 ? 168 TYR B CE1 1 
ATOM   2565  C  CE2 . TYR B 1 168 ? 9.516   127.211 -8.055  0.25 19.21 ? 168 TYR B CE2 1 
ATOM   2566  C  CZ  . TYR B 1 168 ? 10.739  127.346 -7.425  0.25 18.48 ? 168 TYR B CZ  1 
ATOM   2567  O  OH  . TYR B 1 168 ? 11.892  127.177 -8.159  0.25 20.24 ? 168 TYR B OH  1 
ATOM   2568  N  N   . THR B 1 169 ? 7.769   130.957 -5.953  0.25 28.00 ? 169 THR B N   1 
ATOM   2569  C  CA  . THR B 1 169 ? 7.753   131.966 -7.003  0.25 29.74 ? 169 THR B CA  1 
ATOM   2570  C  C   . THR B 1 169 ? 8.939   131.800 -7.942  0.25 30.13 ? 169 THR B C   1 
ATOM   2571  O  O   . THR B 1 169 ? 9.111   132.574 -8.884  0.25 30.58 ? 169 THR B O   1 
ATOM   2572  C  CB  . THR B 1 169 ? 7.757   133.394 -6.406  0.25 30.91 ? 169 THR B CB  1 
ATOM   2573  O  OG1 . THR B 1 169 ? 8.729   133.474 -5.353  0.25 30.91 ? 169 THR B OG1 1 
ATOM   2574  C  CG2 . THR B 1 169 ? 6.382   133.740 -5.851  0.25 31.65 ? 169 THR B CG2 1 
ATOM   2575  N  N   . GLY B 1 170 ? 9.752   130.781 -7.681  0.25 29.68 ? 170 GLY B N   1 
ATOM   2576  C  CA  . GLY B 1 170 ? 10.904  130.519 -8.523  0.25 29.14 ? 170 GLY B CA  1 
ATOM   2577  C  C   . GLY B 1 170 ? 10.463  129.889 -9.828  0.25 29.40 ? 170 GLY B C   1 
ATOM   2578  O  O   . GLY B 1 170 ? 9.350   130.133 -10.293 0.25 28.98 ? 170 GLY B O   1 
ATOM   2579  N  N   . LYS B 1 171 ? 11.322  129.069 -10.422 0.25 30.03 ? 171 LYS B N   1 
ATOM   2580  C  CA  . LYS B 1 171 ? 10.980  128.425 -11.683 0.25 32.58 ? 171 LYS B CA  1 
ATOM   2581  C  C   . LYS B 1 171 ? 11.265  126.931 -11.690 0.25 30.50 ? 171 LYS B C   1 
ATOM   2582  O  O   . LYS B 1 171 ? 11.851  126.387 -10.755 0.25 29.26 ? 171 LYS B O   1 
ATOM   2583  C  CB  . LYS B 1 171 ? 11.740  129.091 -12.838 0.25 36.64 ? 171 LYS B CB  1 
ATOM   2584  C  CG  . LYS B 1 171 ? 11.431  130.566 -13.010 0.25 43.16 ? 171 LYS B CG  1 
ATOM   2585  C  CD  . LYS B 1 171 ? 12.144  131.155 -14.211 0.25 48.35 ? 171 LYS B CD  1 
ATOM   2586  C  CE  . LYS B 1 171 ? 11.771  132.620 -14.397 0.25 52.36 ? 171 LYS B CE  1 
ATOM   2587  N  NZ  . LYS B 1 171 ? 12.414  133.218 -15.599 0.25 56.68 ? 171 LYS B NZ  1 
ATOM   2588  N  N   . VAL B 1 172 ? 10.826  126.275 -12.759 0.25 30.08 ? 172 VAL B N   1 
ATOM   2589  C  CA  . VAL B 1 172 ? 11.043  124.848 -12.947 0.25 29.43 ? 172 VAL B CA  1 
ATOM   2590  C  C   . VAL B 1 172 ? 11.717  124.699 -14.309 0.25 29.26 ? 172 VAL B C   1 
ATOM   2591  O  O   . VAL B 1 172 ? 11.941  125.696 -14.996 0.25 28.20 ? 172 VAL B O   1 
ATOM   2592  C  CB  . VAL B 1 172 ? 9.708   124.064 -12.920 0.25 29.55 ? 172 VAL B CB  1 
ATOM   2593  C  CG1 . VAL B 1 172 ? 9.189   123.977 -11.494 0.25 29.72 ? 172 VAL B CG1 1 
ATOM   2594  C  CG2 . VAL B 1 172 ? 8.679   124.749 -13.801 0.25 30.17 ? 172 VAL B CG2 1 
ATOM   2595  N  N   . SER B 1 173 ? 12.043  123.471 -14.702 0.25 28.58 ? 173 SER B N   1 
ATOM   2596  C  CA  . SER B 1 173 ? 12.706  123.250 -15.985 0.25 28.75 ? 173 SER B CA  1 
ATOM   2597  C  C   . SER B 1 173 ? 12.026  124.018 -17.114 0.25 29.31 ? 173 SER B C   1 
ATOM   2598  O  O   . SER B 1 173 ? 10.847  124.372 -17.018 0.25 28.12 ? 173 SER B O   1 
ATOM   2599  C  CB  . SER B 1 173 ? 12.735  121.755 -16.327 0.25 27.84 ? 173 SER B CB  1 
ATOM   2600  O  OG  . SER B 1 173 ? 11.442  121.266 -16.629 0.25 27.31 ? 173 SER B OG  1 
ATOM   2601  N  N   . GLU B 1 174 ? 12.778  124.278 -18.181 0.25 30.61 ? 174 GLU B N   1 
ATOM   2602  C  CA  . GLU B 1 174 ? 12.251  125.004 -19.328 0.25 33.34 ? 174 GLU B CA  1 
ATOM   2603  C  C   . GLU B 1 174 ? 11.119  124.249 -20.021 0.25 33.33 ? 174 GLU B C   1 
ATOM   2604  O  O   . GLU B 1 174 ? 10.141  124.858 -20.453 0.25 32.76 ? 174 GLU B O   1 
ATOM   2605  C  CB  . GLU B 1 174 ? 13.365  125.288 -20.340 0.25 36.93 ? 174 GLU B CB  1 
ATOM   2606  C  CG  . GLU B 1 174 ? 14.383  126.328 -19.888 0.25 41.83 ? 174 GLU B CG  1 
ATOM   2607  C  CD  . GLU B 1 174 ? 15.360  126.706 -20.991 0.25 43.80 ? 174 GLU B CD  1 
ATOM   2608  O  OE1 . GLU B 1 174 ? 14.902  127.169 -22.057 0.25 47.04 ? 174 GLU B OE1 1 
ATOM   2609  O  OE2 . GLU B 1 174 ? 16.585  126.543 -20.794 0.25 45.00 ? 174 GLU B OE2 1 
ATOM   2610  N  N   . GLU B 1 175 ? 11.252  122.930 -20.135 0.25 33.67 ? 175 GLU B N   1 
ATOM   2611  C  CA  . GLU B 1 175 ? 10.222  122.124 -20.784 0.25 35.56 ? 175 GLU B CA  1 
ATOM   2612  C  C   . GLU B 1 175 ? 8.878   122.331 -20.103 0.25 33.27 ? 175 GLU B C   1 
ATOM   2613  O  O   . GLU B 1 175 ? 7.865   122.571 -20.759 0.25 31.70 ? 175 GLU B O   1 
ATOM   2614  C  CB  . GLU B 1 175 ? 10.582  120.639 -20.736 0.25 40.53 ? 175 GLU B CB  1 
ATOM   2615  C  CG  . GLU B 1 175 ? 11.879  120.288 -21.432 0.25 48.16 ? 175 GLU B CG  1 
ATOM   2616  C  CD  . GLU B 1 175 ? 12.079  118.790 -21.556 0.25 51.53 ? 175 GLU B CD  1 
ATOM   2617  O  OE1 . GLU B 1 175 ? 12.013  118.091 -20.521 0.25 53.89 ? 175 GLU B OE1 1 
ATOM   2618  O  OE2 . GLU B 1 175 ? 12.305  118.314 -22.689 0.25 53.06 ? 175 GLU B OE2 1 
ATOM   2619  N  N   . ILE B 1 176 ? 8.879   122.228 -18.780 0.25 31.51 ? 176 ILE B N   1 
ATOM   2620  C  CA  . ILE B 1 176 ? 7.663   122.410 -18.002 0.25 30.98 ? 176 ILE B CA  1 
ATOM   2621  C  C   . ILE B 1 176 ? 7.085   123.802 -18.240 0.25 30.57 ? 176 ILE B C   1 
ATOM   2622  O  O   . ILE B 1 176 ? 5.908   123.947 -18.564 0.25 29.41 ? 176 ILE B O   1 
ATOM   2623  C  CB  . ILE B 1 176 ? 7.943   122.236 -16.496 0.25 30.45 ? 176 ILE B CB  1 
ATOM   2624  C  CG1 . ILE B 1 176 ? 8.494   120.831 -16.233 0.25 31.68 ? 176 ILE B CG1 1 
ATOM   2625  C  CG2 . ILE B 1 176 ? 6.665   122.483 -15.694 0.25 30.38 ? 176 ILE B CG2 1 
ATOM   2626  C  CD1 . ILE B 1 176 ? 8.911   120.582 -14.784 0.25 31.15 ? 176 ILE B CD1 1 
ATOM   2627  N  N   . GLU B 1 177 ? 7.918   124.825 -18.077 0.25 31.16 ? 177 GLU B N   1 
ATOM   2628  C  CA  . GLU B 1 177 ? 7.482   126.202 -18.276 0.25 32.41 ? 177 GLU B CA  1 
ATOM   2629  C  C   . GLU B 1 177 ? 6.906   126.411 -19.674 0.25 32.29 ? 177 GLU B C   1 
ATOM   2630  O  O   . GLU B 1 177 ? 5.933   127.142 -19.843 0.25 31.71 ? 177 GLU B O   1 
ATOM   2631  C  CB  . GLU B 1 177 ? 8.649   127.167 -18.050 0.25 33.30 ? 177 GLU B CB  1 
ATOM   2632  C  CG  . GLU B 1 177 ? 9.061   127.333 -16.591 0.25 35.18 ? 177 GLU B CG  1 
ATOM   2633  C  CD  . GLU B 1 177 ? 7.971   127.971 -15.739 0.25 36.66 ? 177 GLU B CD  1 
ATOM   2634  O  OE1 . GLU B 1 177 ? 7.335   128.933 -16.215 0.25 37.22 ? 177 GLU B OE1 1 
ATOM   2635  O  OE2 . GLU B 1 177 ? 7.758   127.524 -14.592 0.25 36.49 ? 177 GLU B OE2 1 
ATOM   2636  N  N   . ASP B 1 178 ? 7.502   125.766 -20.672 0.25 33.47 ? 178 ASP B N   1 
ATOM   2637  C  CA  . ASP B 1 178 ? 7.025   125.901 -22.044 0.25 34.75 ? 178 ASP B CA  1 
ATOM   2638  C  C   . ASP B 1 178 ? 5.666   125.246 -22.247 0.25 34.21 ? 178 ASP B C   1 
ATOM   2639  O  O   . ASP B 1 178 ? 4.799   125.806 -22.917 0.25 32.70 ? 178 ASP B O   1 
ATOM   2640  C  CB  . ASP B 1 178 ? 8.033   125.308 -23.028 0.25 37.37 ? 178 ASP B CB  1 
ATOM   2641  C  CG  . ASP B 1 178 ? 9.312   126.115 -23.103 0.25 40.53 ? 178 ASP B CG  1 
ATOM   2642  O  OD1 . ASP B 1 178 ? 9.220   127.359 -23.175 0.25 41.06 ? 178 ASP B OD1 1 
ATOM   2643  O  OD2 . ASP B 1 178 ? 10.404  125.510 -23.100 0.25 42.11 ? 178 ASP B OD2 1 
ATOM   2644  N  N   . ILE B 1 179 ? 5.476   124.062 -21.673 0.25 33.55 ? 179 ILE B N   1 
ATOM   2645  C  CA  . ILE B 1 179 ? 4.198   123.371 -21.808 0.25 33.65 ? 179 ILE B CA  1 
ATOM   2646  C  C   . ILE B 1 179 ? 3.097   124.220 -21.179 0.25 34.01 ? 179 ILE B C   1 
ATOM   2647  O  O   . ILE B 1 179 ? 1.915   124.039 -21.467 0.25 35.77 ? 179 ILE B O   1 
ATOM   2648  C  CB  . ILE B 1 179 ? 4.213   121.992 -21.113 0.25 32.57 ? 179 ILE B CB  1 
ATOM   2649  C  CG1 . ILE B 1 179 ? 5.322   121.119 -21.702 0.25 31.95 ? 179 ILE B CG1 1 
ATOM   2650  C  CG2 . ILE B 1 179 ? 2.860   121.303 -21.300 0.25 31.30 ? 179 ILE B CG2 1 
ATOM   2651  C  CD1 . ILE B 1 179 ? 5.429   119.747 -21.061 0.25 30.58 ? 179 ILE B CD1 1 
ATOM   2652  N  N   . ILE B 1 180 ? 3.490   125.155 -20.322 0.25 33.30 ? 180 ILE B N   1 
ATOM   2653  C  CA  . ILE B 1 180 ? 2.528   126.023 -19.659 0.25 34.72 ? 180 ILE B CA  1 
ATOM   2654  C  C   . ILE B 1 180 ? 2.305   127.333 -20.413 0.25 38.29 ? 180 ILE B C   1 
ATOM   2655  O  O   . ILE B 1 180 ? 1.167   127.779 -20.571 0.25 38.58 ? 180 ILE B O   1 
ATOM   2656  C  CB  . ILE B 1 180 ? 2.980   126.342 -18.223 0.25 31.74 ? 180 ILE B CB  1 
ATOM   2657  C  CG1 . ILE B 1 180 ? 3.058   125.046 -17.411 0.25 28.34 ? 180 ILE B CG1 1 
ATOM   2658  C  CG2 . ILE B 1 180 ? 2.019   127.331 -17.579 0.25 31.21 ? 180 ILE B CG2 1 
ATOM   2659  C  CD1 . ILE B 1 180 ? 3.562   125.228 -15.997 0.25 23.96 ? 180 ILE B CD1 1 
ATOM   2660  N  N   . LYS B 1 181 ? 3.389   127.945 -20.883 0.25 42.26 ? 181 LYS B N   1 
ATOM   2661  C  CA  . LYS B 1 181 ? 3.300   129.211 -21.606 0.25 45.96 ? 181 LYS B CA  1 
ATOM   2662  C  C   . LYS B 1 181 ? 2.579   129.100 -22.941 0.25 47.57 ? 181 LYS B C   1 
ATOM   2663  O  O   . LYS B 1 181 ? 2.641   130.016 -23.759 0.25 48.32 ? 181 LYS B O   1 
ATOM   2664  C  CB  . LYS B 1 181 ? 4.699   129.788 -21.836 0.25 48.05 ? 181 LYS B CB  1 
ATOM   2665  C  CG  . LYS B 1 181 ? 5.414   130.192 -20.559 0.25 52.00 ? 181 LYS B CG  1 
ATOM   2666  C  CD  . LYS B 1 181 ? 6.793   130.769 -20.839 0.25 53.93 ? 181 LYS B CD  1 
ATOM   2667  C  CE  . LYS B 1 181 ? 7.496   131.152 -19.546 0.25 55.25 ? 181 LYS B CE  1 
ATOM   2668  N  NZ  . LYS B 1 181 ? 8.842   131.733 -19.793 0.25 57.31 ? 181 LYS B NZ  1 
ATOM   2669  N  N   . LYS B 1 182 ? 1.888   127.988 -23.161 0.25 49.99 ? 182 LYS B N   1 
ATOM   2670  C  CA  . LYS B 1 182 ? 1.166   127.780 -24.411 0.25 51.20 ? 182 LYS B CA  1 
ATOM   2671  C  C   . LYS B 1 182 ? -0.332  128.028 -24.252 0.25 50.29 ? 182 LYS B C   1 
ATOM   2672  O  O   . LYS B 1 182 ? -1.089  127.941 -25.220 0.25 50.79 ? 182 LYS B O   1 
ATOM   2673  C  CB  . LYS B 1 182 ? 1.404   126.356 -24.916 0.25 54.28 ? 182 LYS B CB  1 
ATOM   2674  C  CG  . LYS B 1 182 ? 2.870   126.028 -25.140 0.25 57.14 ? 182 LYS B CG  1 
ATOM   2675  C  CD  . LYS B 1 182 ? 3.085   124.545 -25.395 0.25 58.86 ? 182 LYS B CD  1 
ATOM   2676  C  CE  . LYS B 1 182 ? 4.568   124.223 -25.501 0.25 59.92 ? 182 LYS B CE  1 
ATOM   2677  N  NZ  . LYS B 1 182 ? 4.822   122.764 -25.633 0.25 61.19 ? 182 LYS B NZ  1 
ATOM   2678  N  N   . GLY B 1 183 ? -0.752  128.342 -23.030 0.25 47.71 ? 183 GLY B N   1 
ATOM   2679  C  CA  . GLY B 1 183 ? -2.159  128.593 -22.774 0.25 46.57 ? 183 GLY B CA  1 
ATOM   2680  C  C   . GLY B 1 183 ? -2.414  129.809 -21.903 0.25 45.87 ? 183 GLY B C   1 
ATOM   2681  O  O   . GLY B 1 183 ? -2.886  129.629 -20.760 0.25 43.00 ? 183 GLY B O   1 
HETATM 2682  O  O   . HOH C 2 .   ? -2.435  92.406  17.010  0.25 15.94 ? 189 HOH A O   1 
HETATM 2683  O  O   . HOH C 2 .   ? 7.369   98.886  -5.427  0.25 8.87  ? 190 HOH A O   1 
HETATM 2684  O  O   . HOH C 2 .   ? -5.695  96.548  14.420  0.25 14.89 ? 191 HOH A O   1 
HETATM 2685  O  O   . HOH C 2 .   ? 5.327   97.897  20.163  0.25 17.01 ? 192 HOH A O   1 
HETATM 2686  O  O   . HOH C 2 .   ? 14.972  80.212  0.916   0.25 18.23 ? 193 HOH A O   1 
HETATM 2687  O  O   . HOH C 2 .   ? -5.171  81.670  6.199   0.25 16.44 ? 194 HOH A O   1 
HETATM 2688  O  O   . HOH C 2 .   ? 2.213   101.132 5.903   0.25 15.93 ? 195 HOH A O   1 
HETATM 2689  O  O   . HOH C 2 .   ? -2.816  97.543  20.423  0.25 12.76 ? 196 HOH A O   1 
HETATM 2690  O  O   . HOH C 2 .   ? 8.016   97.398  20.033  0.25 22.47 ? 197 HOH A O   1 
HETATM 2691  O  O   . HOH C 2 .   ? 9.122   99.137  -3.440  0.25 14.11 ? 198 HOH A O   1 
HETATM 2692  O  O   . HOH C 2 .   ? 8.537   90.213  9.003   0.25 14.77 ? 199 HOH A O   1 
HETATM 2693  O  O   . HOH C 2 .   ? 15.028  89.753  21.068  0.25 17.13 ? 200 HOH A O   1 
HETATM 2694  O  O   . HOH C 2 .   ? -5.238  77.489  -1.491  0.25 24.68 ? 201 HOH A O   1 
HETATM 2695  O  O   . HOH C 2 .   ? -8.589  99.630  -1.570  0.25 17.05 ? 202 HOH A O   1 
HETATM 2696  O  O   . HOH C 2 .   ? 14.754  79.399  12.738  0.25 16.95 ? 203 HOH A O   1 
HETATM 2697  O  O   . HOH C 2 .   ? 1.570   92.953  -7.328  0.25 17.82 ? 204 HOH A O   1 
HETATM 2698  O  O   . HOH C 2 .   ? -5.055  91.960  29.960  0.25 19.60 ? 205 HOH A O   1 
HETATM 2699  O  O   . HOH C 2 .   ? 12.741  78.299  -4.609  0.25 28.69 ? 206 HOH A O   1 
HETATM 2700  O  O   . HOH C 2 .   ? 11.689  96.494  9.987   0.25 15.25 ? 207 HOH A O   1 
HETATM 2701  O  O   . HOH C 2 .   ? 7.160   106.816 0.197   0.25 17.02 ? 208 HOH A O   1 
HETATM 2702  O  O   . HOH C 2 .   ? 12.172  102.114 -0.245  0.25 20.39 ? 209 HOH A O   1 
HETATM 2703  O  O   . HOH C 2 .   ? -11.025 90.097  -4.016  0.25 18.45 ? 210 HOH A O   1 
HETATM 2704  O  O   . HOH C 2 .   ? 14.356  94.785  -2.042  0.25 15.34 ? 211 HOH A O   1 
HETATM 2705  O  O   . HOH C 2 .   ? 6.479   89.156  24.176  0.25 17.79 ? 212 HOH A O   1 
HETATM 2706  O  O   . HOH C 2 .   ? -3.242  85.302  7.958   0.25 32.73 ? 213 HOH A O   1 
HETATM 2707  O  O   . HOH C 2 .   ? 7.852   76.190  -4.041  0.25 23.56 ? 214 HOH A O   1 
HETATM 2708  O  O   . HOH C 2 .   ? 7.197   86.942  -10.131 0.25 26.14 ? 215 HOH A O   1 
HETATM 2709  O  O   . HOH C 2 .   ? 4.460   98.171  17.480  0.25 21.22 ? 216 HOH A O   1 
HETATM 2710  O  O   . HOH C 2 .   ? -1.385  106.355 7.792   0.25 29.50 ? 217 HOH A O   1 
HETATM 2711  O  O   . HOH C 2 .   ? 4.898   74.723  1.412   0.25 23.40 ? 218 HOH A O   1 
HETATM 2712  O  O   . HOH C 2 .   ? 1.510   91.783  27.217  0.25 21.87 ? 219 HOH A O   1 
HETATM 2713  O  O   . HOH C 2 .   ? 10.578  87.313  -10.090 0.25 23.51 ? 220 HOH A O   1 
HETATM 2714  O  O   . HOH C 2 .   ? -7.081  99.241  -3.634  0.25 12.31 ? 221 HOH A O   1 
HETATM 2715  O  O   . HOH C 2 .   ? 7.711   74.025  -0.711  0.25 24.43 ? 222 HOH A O   1 
HETATM 2716  O  O   . HOH C 2 .   ? 18.278  82.284  -4.321  0.25 20.76 ? 223 HOH A O   1 
HETATM 2717  O  O   . HOH C 2 .   ? 20.582  83.707  10.759  0.25 22.29 ? 224 HOH A O   1 
HETATM 2718  O  O   . HOH C 2 .   ? 8.983   97.502  -6.925  0.25 18.30 ? 225 HOH A O   1 
HETATM 2719  O  O   . HOH C 2 .   ? -8.039  92.266  11.393  0.25 28.81 ? 226 HOH A O   1 
HETATM 2720  O  O   . HOH C 2 .   ? 19.188  89.294  0.879   0.25 29.46 ? 227 HOH A O   1 
HETATM 2721  O  O   . HOH C 2 .   ? -6.876  82.810  7.936   0.25 32.87 ? 228 HOH A O   1 
HETATM 2722  O  O   . HOH C 2 .   ? 11.278  83.788  15.842  0.25 18.99 ? 229 HOH A O   1 
HETATM 2723  O  O   . HOH C 2 .   ? 3.618   87.170  22.384  0.25 23.07 ? 230 HOH A O   1 
HETATM 2724  O  O   . HOH C 2 .   ? 16.827  83.123  1.154   0.25 26.05 ? 231 HOH A O   1 
HETATM 2725  O  O   . HOH C 2 .   ? 10.703  82.770  18.201  0.25 26.26 ? 232 HOH A O   1 
HETATM 2726  O  O   . HOH C 2 .   ? 10.933  87.733  23.482  0.25 36.02 ? 233 HOH A O   1 
HETATM 2727  O  O   . HOH C 2 .   ? 18.500  88.443  -9.308  0.25 27.97 ? 234 HOH A O   1 
HETATM 2728  O  O   . HOH C 2 .   ? -5.978  106.038 10.531  0.25 30.15 ? 235 HOH A O   1 
HETATM 2729  O  O   . HOH C 2 .   ? 13.191  98.116  -1.939  0.25 25.88 ? 236 HOH A O   1 
HETATM 2730  O  O   . HOH C 2 .   ? -9.060  101.541 17.864  0.25 30.65 ? 237 HOH A O   1 
HETATM 2731  O  O   . HOH C 2 .   ? 10.700  96.738  -4.153  0.25 27.58 ? 238 HOH A O   1 
HETATM 2732  O  O   . HOH C 2 .   ? 0.024   73.622  7.456   0.25 34.45 ? 239 HOH A O   1 
HETATM 2733  O  O   . HOH C 2 .   ? -8.442  95.468  11.375  0.25 43.41 ? 240 HOH A O   1 
HETATM 2734  O  O   . HOH C 2 .   ? 7.917   101.004 13.348  0.25 34.66 ? 241 HOH A O   1 
HETATM 2735  O  O   . HOH C 2 .   ? 7.917   94.758  -12.467 0.25 26.65 ? 242 HOH A O   1 
HETATM 2736  O  O   . HOH C 2 .   ? 6.334   88.397  -11.911 0.25 38.04 ? 243 HOH A O   1 
HETATM 2737  O  O   . HOH C 2 .   ? 4.137   72.969  8.228   0.25 33.04 ? 244 HOH A O   1 
HETATM 2738  O  O   . HOH C 2 .   ? 11.856  95.161  17.287  0.25 35.34 ? 245 HOH A O   1 
HETATM 2739  O  O   . HOH C 2 .   ? -5.945  103.531 16.907  0.25 27.96 ? 246 HOH A O   1 
HETATM 2740  O  O   . HOH C 2 .   ? 21.199  86.512  11.551  0.25 30.61 ? 247 HOH A O   1 
HETATM 2741  O  O   . HOH C 2 .   ? 10.262  98.056  13.207  0.25 26.36 ? 248 HOH A O   1 
HETATM 2742  O  O   . HOH C 2 .   ? -6.546  97.314  11.899  0.25 22.79 ? 249 HOH A O   1 
HETATM 2743  O  O   . HOH C 2 .   ? 4.370   86.400  -9.365  0.25 36.04 ? 250 HOH A O   1 
HETATM 2744  O  O   . HOH C 2 .   ? -4.972  97.860  18.660  0.25 29.31 ? 251 HOH A O   1 
HETATM 2745  O  O   . HOH C 2 .   ? -9.750  83.567  -5.584  0.25 31.79 ? 252 HOH A O   1 
HETATM 2746  O  O   . HOH C 2 .   ? 11.580  94.600  12.250  0.25 35.51 ? 253 HOH A O   1 
HETATM 2747  O  O   . HOH C 2 .   ? -11.765 79.305  15.223  0.25 38.02 ? 254 HOH A O   1 
HETATM 2748  O  O   . HOH C 2 .   ? 7.931   103.416 13.025  0.25 35.73 ? 255 HOH A O   1 
HETATM 2749  O  O   . HOH C 2 .   ? -2.929  99.264  22.028  0.25 28.03 ? 256 HOH A O   1 
HETATM 2750  O  O   . HOH C 2 .   ? -7.115  90.466  -7.764  0.25 25.83 ? 257 HOH A O   1 
HETATM 2751  O  O   . HOH C 2 .   ? 11.549  98.186  -10.429 0.25 32.71 ? 258 HOH A O   1 
HETATM 2752  O  O   . HOH C 2 .   ? -2.058  87.099  25.703  0.25 38.21 ? 259 HOH A O   1 
HETATM 2753  O  O   . HOH C 2 .   ? -4.165  84.958  26.549  0.25 36.11 ? 260 HOH A O   1 
HETATM 2754  O  O   . HOH C 2 .   ? 22.471  90.347  -6.311  0.25 37.94 ? 261 HOH A O   1 
HETATM 2755  O  O   . HOH C 2 .   ? 0.615   89.616  -8.739  0.25 39.80 ? 262 HOH A O   1 
HETATM 2756  O  O   . HOH C 2 .   ? 16.513  80.414  5.552   0.25 32.99 ? 263 HOH A O   1 
HETATM 2757  O  O   . HOH C 2 .   ? -4.085  83.741  5.275   0.25 30.05 ? 264 HOH A O   1 
HETATM 2758  O  O   . HOH D 2 .   ? -5.157  97.490  -4.109  0.25 13.40 ? 189 HOH B O   1 
HETATM 2759  O  O   . HOH D 2 .   ? 4.656   120.570 -6.346  0.25 13.18 ? 190 HOH B O   1 
HETATM 2760  O  O   . HOH D 2 .   ? -6.350  113.280 -9.873  0.25 13.46 ? 191 HOH B O   1 
HETATM 2761  O  O   . HOH D 2 .   ? -9.584  112.899 -3.457  0.25 11.68 ? 192 HOH B O   1 
HETATM 2762  O  O   . HOH D 2 .   ? 5.034   122.933 -0.601  0.25 16.06 ? 193 HOH B O   1 
HETATM 2763  O  O   . HOH D 2 .   ? -9.990  102.092 0.028   0.25 20.95 ? 194 HOH B O   1 
HETATM 2764  O  O   . HOH D 2 .   ? 0.099   108.128 0.130   0.25 16.65 ? 195 HOH B O   1 
HETATM 2765  O  O   . HOH D 2 .   ? 8.080   117.158 -2.714  0.25 18.58 ? 196 HOH B O   1 
HETATM 2766  O  O   . HOH D 2 .   ? 7.316   111.973 -18.891 0.25 17.36 ? 197 HOH B O   1 
HETATM 2767  O  O   . HOH D 2 .   ? -3.048  122.521 -0.435  0.25 20.13 ? 198 HOH B O   1 
HETATM 2768  O  O   . HOH D 2 .   ? 0.483   96.710  -10.264 0.25 18.87 ? 199 HOH B O   1 
HETATM 2769  O  O   . HOH D 2 .   ? 5.260   113.277 -14.851 0.25 34.23 ? 200 HOH B O   1 
HETATM 2770  O  O   . HOH D 2 .   ? 13.385  100.361 -12.391 0.25 17.70 ? 201 HOH B O   1 
HETATM 2771  O  O   . HOH D 2 .   ? -9.556  121.024 -3.581  0.25 26.29 ? 202 HOH B O   1 
HETATM 2772  O  O   . HOH D 2 .   ? -8.573  99.424  -5.937  0.25 17.38 ? 203 HOH B O   1 
HETATM 2773  O  O   . HOH D 2 .   ? -5.021  101.240 4.725   0.25 19.44 ? 204 HOH B O   1 
HETATM 2774  O  O   . HOH D 2 .   ? 7.345   104.929 -24.191 0.25 27.94 ? 205 HOH B O   1 
HETATM 2775  O  O   . HOH D 2 .   ? 8.754   114.630 -2.529  0.25 21.90 ? 206 HOH B O   1 
HETATM 2776  O  O   . HOH D 2 .   ? 10.666  96.697  -17.939 0.25 30.03 ? 207 HOH B O   1 
HETATM 2777  O  O   . HOH D 2 .   ? -12.146 102.000 -7.437  0.25 22.32 ? 208 HOH B O   1 
HETATM 2778  O  O   . HOH D 2 .   ? -0.782  117.732 -23.917 0.25 19.00 ? 209 HOH B O   1 
HETATM 2779  O  O   . HOH D 2 .   ? 6.076   95.604  -24.220 0.25 39.37 ? 210 HOH B O   1 
HETATM 2780  O  O   . HOH D 2 .   ? -6.705  95.725  -5.985  0.25 23.33 ? 211 HOH B O   1 
HETATM 2781  O  O   . HOH D 2 .   ? -2.427  96.156  -16.894 0.25 25.26 ? 212 HOH B O   1 
HETATM 2782  O  O   . HOH D 2 .   ? -12.415 119.172 -19.939 0.25 20.34 ? 213 HOH B O   1 
HETATM 2783  O  O   . HOH D 2 .   ? 4.436   110.862 -28.127 0.25 29.30 ? 214 HOH B O   1 
HETATM 2784  O  O   . HOH D 2 .   ? -18.626 116.300 -15.835 0.25 29.85 ? 215 HOH B O   1 
HETATM 2785  O  O   . HOH D 2 .   ? 10.984  100.987 -2.746  0.25 21.19 ? 216 HOH B O   1 
HETATM 2786  O  O   . HOH D 2 .   ? 11.814  99.715  -19.021 0.25 23.70 ? 217 HOH B O   1 
HETATM 2787  O  O   . HOH D 2 .   ? 13.204  103.060 -9.080  0.25 40.90 ? 218 HOH B O   1 
HETATM 2788  O  O   . HOH D 2 .   ? -15.963 102.444 -20.462 0.25 35.70 ? 219 HOH B O   1 
HETATM 2789  O  O   . HOH D 2 .   ? 8.301   111.795 5.616   0.25 36.68 ? 220 HOH B O   1 
HETATM 2790  O  O   . HOH D 2 .   ? -8.984  121.265 -15.015 0.25 16.16 ? 221 HOH B O   1 
HETATM 2791  O  O   . HOH D 2 .   ? -8.416  95.208  -16.475 0.25 30.31 ? 222 HOH B O   1 
HETATM 2792  O  O   . HOH D 2 .   ? 5.198   124.313 1.823   0.25 20.77 ? 223 HOH B O   1 
HETATM 2793  O  O   . HOH D 2 .   ? -2.021  120.106 -0.579  0.25 33.38 ? 224 HOH B O   1 
HETATM 2794  O  O   . HOH D 2 .   ? 6.193   115.647 -24.773 0.25 25.35 ? 225 HOH B O   1 
HETATM 2795  O  O   . HOH D 2 .   ? 4.852   115.050 -26.903 0.25 26.54 ? 226 HOH B O   1 
HETATM 2796  O  O   . HOH D 2 .   ? -10.325 94.389  -13.770 0.25 29.00 ? 227 HOH B O   1 
HETATM 2797  O  O   . HOH D 2 .   ? -1.311  127.256 -10.587 0.25 25.79 ? 228 HOH B O   1 
HETATM 2798  O  O   . HOH D 2 .   ? 3.592   108.977 5.792   0.25 26.28 ? 229 HOH B O   1 
HETATM 2799  O  O   . HOH D 2 .   ? -15.722 116.841 -18.182 0.25 34.34 ? 230 HOH B O   1 
HETATM 2800  O  O   . HOH D 2 .   ? 8.319   118.297 4.467   0.25 25.02 ? 231 HOH B O   1 
HETATM 2801  O  O   . HOH D 2 .   ? 8.117   121.581 -23.516 0.25 37.58 ? 232 HOH B O   1 
HETATM 2802  O  O   . HOH D 2 .   ? -5.965  122.547 -0.803  0.25 34.85 ? 233 HOH B O   1 
HETATM 2803  O  O   . HOH D 2 .   ? -12.960 112.723 -2.586  0.25 24.81 ? 234 HOH B O   1 
HETATM 2804  O  O   . HOH D 2 .   ? 11.485  121.260 -13.044 0.25 33.71 ? 235 HOH B O   1 
HETATM 2805  O  O   . HOH D 2 .   ? 9.255   96.789  -12.968 0.25 27.57 ? 236 HOH B O   1 
HETATM 2806  O  O   . HOH D 2 .   ? 1.722   111.756 5.833   0.25 37.10 ? 237 HOH B O   1 
HETATM 2807  O  O   . HOH D 2 .   ? -16.474 120.000 -7.035  0.25 33.46 ? 238 HOH B O   1 
HETATM 2808  O  O   . HOH D 2 .   ? 5.590   129.336 -17.807 0.25 44.98 ? 239 HOH B O   1 
HETATM 2809  O  O   . HOH D 2 .   ? -4.795  112.789 -24.530 0.25 29.46 ? 240 HOH B O   1 
HETATM 2810  O  O   . HOH D 2 .   ? 0.594   123.816 -23.484 0.25 35.48 ? 241 HOH B O   1 
HETATM 2811  O  O   . HOH D 2 .   ? -5.808  124.273 -16.834 0.25 33.08 ? 242 HOH B O   1 
HETATM 2812  O  O   . HOH D 2 .   ? 5.467   129.710 -9.348  0.25 37.26 ? 243 HOH B O   1 
HETATM 2813  O  O   . HOH D 2 .   ? -5.112  118.736 -1.733  0.25 29.56 ? 244 HOH B O   1 
HETATM 2814  O  O   . HOH D 2 .   ? -11.503 127.211 -10.376 0.25 55.74 ? 245 HOH B O   1 
HETATM 2815  O  O   . HOH D 2 .   ? 15.520  123.738 -17.627 0.25 32.98 ? 246 HOH B O   1 
HETATM 2816  O  O   . HOH D 2 .   ? -14.414 106.627 -18.851 0.25 44.70 ? 247 HOH B O   1 
HETATM 2817  O  O   . HOH D 2 .   ? 7.286   121.193 -0.606  0.25 24.60 ? 248 HOH B O   1 
HETATM 2818  O  O   . HOH D 2 .   ? 1.008   101.731 -25.791 0.25 34.55 ? 249 HOH B O   1 
HETATM 2819  O  O   . HOH D 2 .   ? -5.574  121.537 -20.822 0.25 24.62 ? 250 HOH B O   1 
HETATM 2820  O  O   . HOH D 2 .   ? -3.033  108.693 -26.859 0.25 24.68 ? 251 HOH B O   1 
HETATM 2821  O  O   . HOH D 2 .   ? 1.869   114.709 6.826   0.25 33.90 ? 252 HOH B O   1 
HETATM 2822  O  O   . HOH D 2 .   ? 9.977   114.866 -7.648  0.25 34.41 ? 253 HOH B O   1 
ATOM   2823  N  N   . GLU A 1 14  ? 3.933   81.387  -14.747 0.25 44.11 ? 14  GLU A N   2 
ATOM   2824  C  CA  . GLU A 1 14  ? 3.069   81.780  -15.896 0.25 45.06 ? 14  GLU A CA  2 
ATOM   2825  C  C   . GLU A 1 14  ? 1.629   81.325  -15.679 0.25 42.25 ? 14  GLU A C   2 
ATOM   2826  O  O   . GLU A 1 14  ? 0.730   81.694  -16.434 0.25 40.87 ? 14  GLU A O   2 
ATOM   2827  C  CB  . GLU A 1 14  ? 3.619   81.184  -17.193 0.25 50.28 ? 14  GLU A CB  2 
ATOM   2828  C  CG  . GLU A 1 14  ? 5.047   81.613  -17.498 0.25 57.67 ? 14  GLU A CG  2 
ATOM   2829  C  CD  . GLU A 1 14  ? 5.560   81.059  -18.812 0.25 60.93 ? 14  GLU A CD  2 
ATOM   2830  O  OE1 . GLU A 1 14  ? 6.738   81.311  -19.142 0.25 63.15 ? 14  GLU A OE1 2 
ATOM   2831  O  OE2 . GLU A 1 14  ? 4.787   80.375  -19.516 0.25 64.02 ? 14  GLU A OE2 2 
ATOM   2832  N  N   . GLU A 1 15  ? 1.424   80.518  -14.643 0.25 39.59 ? 15  GLU A N   2 
ATOM   2833  C  CA  . GLU A 1 15  ? 0.099   80.024  -14.286 0.25 37.87 ? 15  GLU A CA  2 
ATOM   2834  C  C   . GLU A 1 15  ? -0.097  80.165  -12.780 0.25 33.99 ? 15  GLU A C   2 
ATOM   2835  O  O   . GLU A 1 15  ? -1.009  79.574  -12.201 0.25 32.96 ? 15  GLU A O   2 
ATOM   2836  C  CB  . GLU A 1 15  ? -0.065  78.556  -14.692 0.25 43.03 ? 15  GLU A CB  2 
ATOM   2837  C  CG  . GLU A 1 15  ? -0.133  78.332  -16.194 0.25 50.39 ? 15  GLU A CG  2 
ATOM   2838  C  CD  . GLU A 1 15  ? -0.573  76.926  -16.558 0.25 53.06 ? 15  GLU A CD  2 
ATOM   2839  O  OE1 . GLU A 1 15  ? -1.700  76.539  -16.185 0.25 55.90 ? 15  GLU A OE1 2 
ATOM   2840  O  OE2 . GLU A 1 15  ? 0.206   76.209  -17.218 0.25 55.96 ? 15  GLU A OE2 2 
ATOM   2841  N  N   . SER A 1 16  ? 0.766   80.958  -12.155 0.25 28.43 ? 16  SER A N   2 
ATOM   2842  C  CA  . SER A 1 16  ? 0.708   81.183  -10.715 0.25 25.16 ? 16  SER A CA  2 
ATOM   2843  C  C   . SER A 1 16  ? 1.355   82.520  -10.383 0.25 21.14 ? 16  SER A C   2 
ATOM   2844  O  O   . SER A 1 16  ? 1.726   83.270  -11.281 0.25 19.47 ? 16  SER A O   2 
ATOM   2845  C  CB  . SER A 1 16  ? 1.451   80.065  -9.985  0.25 26.06 ? 16  SER A CB  2 
ATOM   2846  O  OG  . SER A 1 16  ? 2.816   80.032  -10.363 0.25 22.13 ? 16  SER A OG  2 
ATOM   2847  N  N   . PHE A 1 17  ? 1.484   82.822  -9.095  0.25 17.82 ? 17  PHE A N   2 
ATOM   2848  C  CA  . PHE A 1 17  ? 2.116   84.071  -8.684  0.25 14.93 ? 17  PHE A CA  2 
ATOM   2849  C  C   . PHE A 1 17  ? 2.805   83.929  -7.335  0.25 13.65 ? 17  PHE A C   2 
ATOM   2850  O  O   . PHE A 1 17  ? 2.570   82.961  -6.604  0.25 12.29 ? 17  PHE A O   2 
ATOM   2851  C  CB  . PHE A 1 17  ? 1.100   85.223  -8.625  0.25 12.43 ? 17  PHE A CB  2 
ATOM   2852  C  CG  . PHE A 1 17  ? 0.138   85.134  -7.472  0.25 13.72 ? 17  PHE A CG  2 
ATOM   2853  C  CD1 . PHE A 1 17  ? -1.003  84.343  -7.557  0.25 12.33 ? 17  PHE A CD1 2 
ATOM   2854  C  CD2 . PHE A 1 17  ? 0.380   85.834  -6.294  0.25 12.41 ? 17  PHE A CD2 2 
ATOM   2855  C  CE1 . PHE A 1 17  ? -1.886  84.255  -6.487  0.25 10.17 ? 17  PHE A CE1 2 
ATOM   2856  C  CE2 . PHE A 1 17  ? -0.498  85.747  -5.222  0.25 10.91 ? 17  PHE A CE2 2 
ATOM   2857  C  CZ  . PHE A 1 17  ? -1.630  84.959  -5.317  0.25 12.28 ? 17  PHE A CZ  2 
ATOM   2858  N  N   . LEU A 1 18  ? 3.658   84.904  -7.020  0.25 10.79 ? 18  LEU A N   2 
ATOM   2859  C  CA  . LEU A 1 18  ? 4.403   84.916  -5.775  0.25 10.99 ? 18  LEU A CA  2 
ATOM   2860  C  C   . LEU A 1 18  ? 3.897   86.022  -4.849  0.25 10.50 ? 18  LEU A C   2 
ATOM   2861  O  O   . LEU A 1 18  ? 3.613   87.141  -5.282  0.25 9.54  ? 18  LEU A O   2 
ATOM   2862  C  CB  . LEU A 1 18  ? 5.897   85.104  -6.062  0.25 10.38 ? 18  LEU A CB  2 
ATOM   2863  C  CG  . LEU A 1 18  ? 6.502   84.081  -7.033  0.25 9.96  ? 18  LEU A CG  2 
ATOM   2864  C  CD1 . LEU A 1 18  ? 7.956   84.422  -7.295  0.25 11.33 ? 18  LEU A CD1 2 
ATOM   2865  C  CD2 . LEU A 1 18  ? 6.360   82.673  -6.456  0.25 12.41 ? 18  LEU A CD2 2 
ATOM   2866  N  N   . TYR A 1 19  ? 3.790   85.681  -3.570  0.25 8.25  ? 19  TYR A N   2 
ATOM   2867  C  CA  . TYR A 1 19  ? 3.308   86.580  -2.533  0.25 9.41  ? 19  TYR A CA  2 
ATOM   2868  C  C   . TYR A 1 19  ? 4.341   86.698  -1.414  0.25 9.05  ? 19  TYR A C   2 
ATOM   2869  O  O   . TYR A 1 19  ? 4.929   85.696  -1.005  0.25 9.83  ? 19  TYR A O   2 
ATOM   2870  C  CB  . TYR A 1 19  ? 1.987   86.036  -1.984  0.25 8.07  ? 19  TYR A CB  2 
ATOM   2871  C  CG  . TYR A 1 19  ? 1.638   86.491  -0.583  0.25 8.76  ? 19  TYR A CG  2 
ATOM   2872  C  CD1 . TYR A 1 19  ? 1.515   87.847  -0.272  0.25 7.29  ? 19  TYR A CD1 2 
ATOM   2873  C  CD2 . TYR A 1 19  ? 1.415   85.556  0.433   0.25 7.20  ? 19  TYR A CD2 2 
ATOM   2874  C  CE1 . TYR A 1 19  ? 1.177   88.260  1.028   0.25 7.54  ? 19  TYR A CE1 2 
ATOM   2875  C  CE2 . TYR A 1 19  ? 1.078   85.956  1.723   0.25 10.27 ? 19  TYR A CE2 2 
ATOM   2876  C  CZ  . TYR A 1 19  ? 0.960   87.303  2.015   0.25 8.11  ? 19  TYR A CZ  2 
ATOM   2877  O  OH  . TYR A 1 19  ? 0.626   87.683  3.296   0.25 12.74 ? 19  TYR A OH  2 
ATOM   2878  N  N   . PHE A 1 20  ? 4.551   87.915  -0.917  0.25 7.51  ? 20  PHE A N   2 
ATOM   2879  C  CA  . PHE A 1 20  ? 5.525   88.157  0.153   0.25 8.47  ? 20  PHE A CA  2 
ATOM   2880  C  C   . PHE A 1 20  ? 4.830   88.411  1.488   0.25 8.97  ? 20  PHE A C   2 
ATOM   2881  O  O   . PHE A 1 20  ? 4.246   89.478  1.703   0.25 9.12  ? 20  PHE A O   2 
ATOM   2882  C  CB  . PHE A 1 20  ? 6.407   89.365  -0.200  0.25 8.38  ? 20  PHE A CB  2 
ATOM   2883  C  CG  . PHE A 1 20  ? 7.437   89.702  0.851   0.25 7.76  ? 20  PHE A CG  2 
ATOM   2884  C  CD1 . PHE A 1 20  ? 8.480   88.823  1.133   0.25 7.13  ? 20  PHE A CD1 2 
ATOM   2885  C  CD2 . PHE A 1 20  ? 7.378   90.910  1.540   0.25 6.35  ? 20  PHE A CD2 2 
ATOM   2886  C  CE1 . PHE A 1 20  ? 9.452   89.141  2.083   0.25 9.63  ? 20  PHE A CE1 2 
ATOM   2887  C  CE2 . PHE A 1 20  ? 8.348   91.241  2.498   0.25 7.36  ? 20  PHE A CE2 2 
ATOM   2888  C  CZ  . PHE A 1 20  ? 9.386   90.355  2.767   0.25 10.69 ? 20  PHE A CZ  2 
ATOM   2889  N  N   . ALA A 1 21  ? 4.900   87.425  2.378   0.25 9.25  ? 21  ALA A N   2 
ATOM   2890  C  CA  . ALA A 1 21  ? 4.285   87.514  3.698   0.25 7.42  ? 21  ALA A CA  2 
ATOM   2891  C  C   . ALA A 1 21  ? 5.292   88.021  4.722   0.25 8.26  ? 21  ALA A C   2 
ATOM   2892  O  O   . ALA A 1 21  ? 6.423   87.545  4.785   0.25 6.30  ? 21  ALA A O   2 
ATOM   2893  C  CB  . ALA A 1 21  ? 3.765   86.143  4.125   0.25 7.31  ? 21  ALA A CB  2 
ATOM   2894  N  N   . TYR A 1 22  ? 4.875   88.984  5.534   0.25 8.17  ? 22  TYR A N   2 
ATOM   2895  C  CA  . TYR A 1 22  ? 5.759   89.538  6.545   0.25 10.29 ? 22  TYR A CA  2 
ATOM   2896  C  C   . TYR A 1 22  ? 5.060   89.605  7.895   0.25 11.27 ? 22  TYR A C   2 
ATOM   2897  O  O   . TYR A 1 22  ? 5.672   89.974  8.892   0.25 11.04 ? 22  TYR A O   2 
ATOM   2898  C  CB  . TYR A 1 22  ? 6.241   90.928  6.108   0.25 10.51 ? 22  TYR A CB  2 
ATOM   2899  C  CG  . TYR A 1 22  ? 5.126   91.911  5.829   0.25 7.93  ? 22  TYR A CG  2 
ATOM   2900  C  CD1 . TYR A 1 22  ? 4.444   92.532  6.874   0.25 10.13 ? 22  TYR A CD1 2 
ATOM   2901  C  CD2 . TYR A 1 22  ? 4.754   92.224  4.522   0.25 5.19  ? 22  TYR A CD2 2 
ATOM   2902  C  CE1 . TYR A 1 22  ? 3.420   93.448  6.628   0.25 8.11  ? 22  TYR A CE1 2 
ATOM   2903  C  CE2 . TYR A 1 22  ? 3.728   93.139  4.264   0.25 7.40  ? 22  TYR A CE2 2 
ATOM   2904  C  CZ  . TYR A 1 22  ? 3.072   93.746  5.324   0.25 8.51  ? 22  TYR A CZ  2 
ATOM   2905  O  OH  . TYR A 1 22  ? 2.081   94.671  5.090   0.25 7.89  ? 22  TYR A OH  2 
ATOM   2906  N  N   . GLY A 1 23  ? 3.781   89.224  7.917   0.25 11.64 ? 23  GLY A N   2 
ATOM   2907  C  CA  . GLY A 1 23  ? 3.003   89.247  9.147   0.25 11.14 ? 23  GLY A CA  2 
ATOM   2908  C  C   . GLY A 1 23  ? 2.677   87.877  9.730   0.25 10.41 ? 23  GLY A C   2 
ATOM   2909  O  O   . GLY A 1 23  ? 3.583   87.109  10.058  0.25 11.96 ? 23  GLY A O   2 
ATOM   2910  N  N   . SER A 1 24  ? 1.390   87.559  9.863   0.25 8.48  ? 24  SER A N   2 
ATOM   2911  C  CA  . SER A 1 24  ? 1.002   86.272  10.429  0.25 10.60 ? 24  SER A CA  2 
ATOM   2912  C  C   . SER A 1 24  ? 0.999   85.139  9.406   0.25 11.85 ? 24  SER A C   2 
ATOM   2913  O  O   . SER A 1 24  ? 0.921   83.971  9.785   0.25 10.39 ? 24  SER A O   2 
ATOM   2914  C  CB  . SER A 1 24  ? -0.370  86.358  11.124  0.25 8.16  ? 24  SER A CB  2 
ATOM   2915  O  OG  . SER A 1 24  ? -1.402  86.730  10.229  0.25 9.14  ? 24  SER A OG  2 
ATOM   2916  N  N   . ASN A 1 25  ? 1.084   85.464  8.115   0.25 12.40 ? 25  ASN A N   2 
ATOM   2917  C  CA  . ASN A 1 25  ? 1.112   84.402  7.111   0.25 11.84 ? 25  ASN A CA  2 
ATOM   2918  C  C   . ASN A 1 25  ? 2.495   83.770  6.991   0.25 13.35 ? 25  ASN A C   2 
ATOM   2919  O  O   . ASN A 1 25  ? 2.695   82.837  6.208   0.25 14.33 ? 25  ASN A O   2 
ATOM   2920  C  CB  . ASN A 1 25  ? 0.629   84.895  5.740   0.25 10.85 ? 25  ASN A CB  2 
ATOM   2921  C  CG  . ASN A 1 25  ? -0.892  84.989  5.659   0.25 11.12 ? 25  ASN A CG  2 
ATOM   2922  O  OD1 . ASN A 1 25  ? -1.611  84.271  6.366   0.25 12.81 ? 25  ASN A OD1 2 
ATOM   2923  N  ND2 . ASN A 1 25  ? -1.387  85.861  4.787   0.25 12.86 ? 25  ASN A ND2 2 
ATOM   2924  N  N   . LEU A 1 26  ? 3.457   84.285  7.751   0.25 12.81 ? 26  LEU A N   2 
ATOM   2925  C  CA  . LEU A 1 26  ? 4.790   83.692  7.752   0.25 13.19 ? 26  LEU A CA  2 
ATOM   2926  C  C   . LEU A 1 26  ? 4.610   82.249  8.218   0.25 12.53 ? 26  LEU A C   2 
ATOM   2927  O  O   . LEU A 1 26  ? 5.275   81.331  7.732   0.25 12.60 ? 26  LEU A O   2 
ATOM   2928  C  CB  . LEU A 1 26  ? 5.717   84.405  8.746   0.25 11.62 ? 26  LEU A CB  2 
ATOM   2929  C  CG  . LEU A 1 26  ? 6.292   85.782  8.405   0.25 10.66 ? 26  LEU A CG  2 
ATOM   2930  C  CD1 . LEU A 1 26  ? 7.123   86.298  9.578   0.25 10.85 ? 26  LEU A CD1 2 
ATOM   2931  C  CD2 . LEU A 1 26  ? 7.148   85.676  7.152   0.25 10.77 ? 26  LEU A CD2 2 
ATOM   2932  N  N   . LEU A 1 27  ? 3.698   82.068  9.169   0.25 12.25 ? 27  LEU A N   2 
ATOM   2933  C  CA  . LEU A 1 27  ? 3.409   80.756  9.746   0.25 14.15 ? 27  LEU A CA  2 
ATOM   2934  C  C   . LEU A 1 27  ? 2.579   79.910  8.791   0.25 13.58 ? 27  LEU A C   2 
ATOM   2935  O  O   . LEU A 1 27  ? 1.426   80.228  8.497   0.25 12.32 ? 27  LEU A O   2 
ATOM   2936  C  CB  . LEU A 1 27  ? 2.671   80.918  11.079  0.25 11.32 ? 27  LEU A CB  2 
ATOM   2937  C  CG  . LEU A 1 27  ? 2.386   79.631  11.865  0.25 12.55 ? 27  LEU A CG  2 
ATOM   2938  C  CD1 . LEU A 1 27  ? 3.695   78.946  12.239  0.25 12.38 ? 27  LEU A CD1 2 
ATOM   2939  C  CD2 . LEU A 1 27  ? 1.591   79.969  13.116  0.25 12.88 ? 27  LEU A CD2 2 
ATOM   2940  N  N   . THR A 1 28  ? 3.183   78.827  8.317   0.25 14.77 ? 28  THR A N   2 
ATOM   2941  C  CA  . THR A 1 28  ? 2.548   77.913  7.369   0.25 15.88 ? 28  THR A CA  2 
ATOM   2942  C  C   . THR A 1 28  ? 1.161   77.464  7.789   0.25 16.37 ? 28  THR A C   2 
ATOM   2943  O  O   . THR A 1 28  ? 0.230   77.459  6.982   0.25 15.39 ? 28  THR A O   2 
ATOM   2944  C  CB  . THR A 1 28  ? 3.418   76.671  7.164   0.25 15.64 ? 28  THR A CB  2 
ATOM   2945  O  OG1 . THR A 1 28  ? 4.739   77.083  6.806   0.25 10.81 ? 28  THR A OG1 2 
ATOM   2946  C  CG2 . THR A 1 28  ? 2.851   75.794  6.055   0.25 16.62 ? 28  THR A CG2 2 
ATOM   2947  N  N   . GLU A 1 29  ? 1.030   77.075  9.051   0.25 17.70 ? 29  GLU A N   2 
ATOM   2948  C  CA  . GLU A 1 29  ? -0.248  76.623  9.574   0.25 19.91 ? 29  GLU A CA  2 
ATOM   2949  C  C   . GLU A 1 29  ? -1.300  77.720  9.463   0.25 19.74 ? 29  GLU A C   2 
ATOM   2950  O  O   . GLU A 1 29  ? -2.490  77.435  9.327   0.25 18.60 ? 29  GLU A O   2 
ATOM   2951  C  CB  . GLU A 1 29  ? -0.102  76.192  11.038  0.25 21.57 ? 29  GLU A CB  2 
ATOM   2952  C  CG  . GLU A 1 29  ? 0.699   74.909  11.240  0.25 27.06 ? 29  GLU A CG  2 
ATOM   2953  C  CD  . GLU A 1 29  ? 2.109   74.990  10.677  0.25 28.36 ? 29  GLU A CD  2 
ATOM   2954  O  OE1 . GLU A 1 29  ? 2.810   75.991  10.942  0.25 26.93 ? 29  GLU A OE1 2 
ATOM   2955  O  OE2 . GLU A 1 29  ? 2.522   74.041  9.975   0.25 31.26 ? 29  GLU A OE2 2 
ATOM   2956  N  N   . ARG A 1 30  ? -0.859  78.974  9.522   0.25 17.94 ? 30  ARG A N   2 
ATOM   2957  C  CA  . ARG A 1 30  ? -1.782  80.098  9.422   0.25 18.37 ? 30  ARG A CA  2 
ATOM   2958  C  C   . ARG A 1 30  ? -2.213  80.375  7.985   0.25 16.68 ? 30  ARG A C   2 
ATOM   2959  O  O   . ARG A 1 30  ? -3.397  80.549  7.715   0.25 17.12 ? 30  ARG A O   2 
ATOM   2960  C  CB  . ARG A 1 30  ? -1.157  81.362  10.025  0.25 21.26 ? 30  ARG A CB  2 
ATOM   2961  C  CG  . ARG A 1 30  ? -1.934  82.640  9.721   0.25 22.29 ? 30  ARG A CG  2 
ATOM   2962  C  CD  . ARG A 1 30  ? -3.329  82.598  10.316  0.25 26.98 ? 30  ARG A CD  2 
ATOM   2963  N  NE  . ARG A 1 30  ? -4.110  83.777  9.953   0.25 28.40 ? 30  ARG A NE  2 
ATOM   2964  C  CZ  . ARG A 1 30  ? -5.325  84.047  10.425  0.25 29.44 ? 30  ARG A CZ  2 
ATOM   2965  N  NH1 . ARG A 1 30  ? -5.912  83.222  11.284  0.25 27.53 ? 30  ARG A NH1 2 
ATOM   2966  N  NH2 . ARG A 1 30  ? -5.955  85.147  10.039  0.25 29.52 ? 30  ARG A NH2 2 
ATOM   2967  N  N   . ILE A 1 31  ? -1.260  80.424  7.059   0.25 15.36 ? 31  ILE A N   2 
ATOM   2968  C  CA  . ILE A 1 31  ? -1.606  80.688  5.669   0.25 13.87 ? 31  ILE A CA  2 
ATOM   2969  C  C   . ILE A 1 31  ? -2.350  79.502  5.059   0.25 14.95 ? 31  ILE A C   2 
ATOM   2970  O  O   . ILE A 1 31  ? -3.047  79.648  4.056   0.25 15.59 ? 31  ILE A O   2 
ATOM   2971  C  CB  . ILE A 1 31  ? -0.352  81.001  4.808   0.25 14.07 ? 31  ILE A CB  2 
ATOM   2972  C  CG1 . ILE A 1 31  ? -0.780  81.659  3.491   0.25 12.37 ? 31  ILE A CG1 2 
ATOM   2973  C  CG2 . ILE A 1 31  ? 0.421   79.729  4.515   0.25 12.88 ? 31  ILE A CG2 2 
ATOM   2974  C  CD1 . ILE A 1 31  ? 0.385   82.040  2.586   0.25 8.88  ? 31  ILE A CD1 2 
ATOM   2975  N  N   . HIS A 1 32  ? -2.210  78.330  5.669   0.25 15.17 ? 32  HIS A N   2 
ATOM   2976  C  CA  . HIS A 1 32  ? -2.882  77.138  5.164   0.25 15.43 ? 32  HIS A CA  2 
ATOM   2977  C  C   . HIS A 1 32  ? -4.288  76.938  5.728   0.25 16.57 ? 32  HIS A C   2 
ATOM   2978  O  O   . HIS A 1 32  ? -4.947  75.937  5.429   0.25 15.70 ? 32  HIS A O   2 
ATOM   2979  C  CB  . HIS A 1 32  ? -2.020  75.897  5.423   0.25 16.49 ? 32  HIS A CB  2 
ATOM   2980  C  CG  . HIS A 1 32  ? -0.916  75.712  4.424   0.25 16.92 ? 32  HIS A CG  2 
ATOM   2981  N  ND1 . HIS A 1 32  ? 0.084   74.778  4.584   0.25 16.83 ? 32  HIS A ND1 2 
ATOM   2982  C  CD2 . HIS A 1 32  ? -0.675  76.324  3.239   0.25 14.49 ? 32  HIS A CD2 2 
ATOM   2983  C  CE1 . HIS A 1 32  ? 0.896   74.823  3.540   0.25 17.48 ? 32  HIS A CE1 2 
ATOM   2984  N  NE2 . HIS A 1 32  ? 0.457   75.752  2.710   0.25 16.71 ? 32  HIS A NE2 2 
ATOM   2985  N  N   . LEU A 1 33  ? -4.745  77.892  6.537   0.25 17.66 ? 33  LEU A N   2 
ATOM   2986  C  CA  . LEU A 1 33  ? -6.085  77.830  7.120   0.25 20.02 ? 33  LEU A CA  2 
ATOM   2987  C  C   . LEU A 1 33  ? -7.089  78.408  6.125   0.25 19.21 ? 33  LEU A C   2 
ATOM   2988  O  O   . LEU A 1 33  ? -8.301  78.260  6.286   0.25 17.28 ? 33  LEU A O   2 
ATOM   2989  C  CB  . LEU A 1 33  ? -6.143  78.630  8.428   0.25 22.79 ? 33  LEU A CB  2 
ATOM   2990  C  CG  . LEU A 1 33  ? -5.334  78.080  9.609   0.25 26.39 ? 33  LEU A CG  2 
ATOM   2991  C  CD1 . LEU A 1 33  ? -5.458  79.006  10.814  0.25 26.88 ? 33  LEU A CD1 2 
ATOM   2992  C  CD2 . LEU A 1 33  ? -5.840  76.684  9.956   0.25 25.95 ? 33  LEU A CD2 2 
ATOM   2993  N  N   . ARG A 1 34  ? -6.568  79.078  5.101   0.25 18.92 ? 34  ARG A N   2 
ATOM   2994  C  CA  . ARG A 1 34  ? -7.396  79.676  4.057   0.25 18.81 ? 34  ARG A CA  2 
ATOM   2995  C  C   . ARG A 1 34  ? -6.785  79.440  2.679   0.25 18.56 ? 34  ARG A C   2 
ATOM   2996  O  O   . ARG A 1 34  ? -7.478  79.528  1.664   0.25 17.63 ? 34  ARG A O   2 
ATOM   2997  C  CB  . ARG A 1 34  ? -7.544  81.189  4.277   0.25 21.08 ? 34  ARG A CB  2 
ATOM   2998  C  CG  . ARG A 1 34  ? -8.643  81.613  5.246   0.25 24.15 ? 34  ARG A CG  2 
ATOM   2999  C  CD  . ARG A 1 34  ? -10.022 81.200  4.742   0.25 26.04 ? 34  ARG A CD  2 
ATOM   3000  N  NE  . ARG A 1 34  ? -10.322 81.713  3.403   0.25 27.78 ? 34  ARG A NE  2 
ATOM   3001  C  CZ  . ARG A 1 34  ? -10.685 82.963  3.127   0.25 26.69 ? 34  ARG A CZ  2 
ATOM   3002  N  NH1 . ARG A 1 34  ? -10.803 83.861  4.094   0.25 28.22 ? 34  ARG A NH1 2 
ATOM   3003  N  NH2 . ARG A 1 34  ? -10.939 83.314  1.873   0.25 29.86 ? 34  ARG A NH2 2 
ATOM   3004  N  N   . ASN A 1 35  ? -5.487  79.147  2.641   0.25 14.76 ? 35  ASN A N   2 
ATOM   3005  C  CA  . ASN A 1 35  ? -4.798  78.934  1.366   0.25 14.87 ? 35  ASN A CA  2 
ATOM   3006  C  C   . ASN A 1 35  ? -3.920  77.689  1.404   0.25 15.52 ? 35  ASN A C   2 
ATOM   3007  O  O   . ASN A 1 35  ? -2.694  77.781  1.326   0.25 13.09 ? 35  ASN A O   2 
ATOM   3008  C  CB  . ASN A 1 35  ? -3.928  80.146  1.050   0.25 14.84 ? 35  ASN A CB  2 
ATOM   3009  C  CG  . ASN A 1 35  ? -4.645  81.450  1.304   0.25 14.31 ? 35  ASN A CG  2 
ATOM   3010  O  OD1 . ASN A 1 35  ? -5.539  81.831  0.558   0.25 14.83 ? 35  ASN A OD1 2 
ATOM   3011  N  ND2 . ASN A 1 35  ? -4.264  82.136  2.377   0.25 12.38 ? 35  ASN A ND2 2 
ATOM   3012  N  N   . PRO A 1 36  ? -4.537  76.505  1.521   0.25 16.40 ? 36  PRO A N   2 
ATOM   3013  C  CA  . PRO A 1 36  ? -3.770  75.259  1.569   0.25 16.57 ? 36  PRO A CA  2 
ATOM   3014  C  C   . PRO A 1 36  ? -2.945  74.997  0.313   0.25 17.46 ? 36  PRO A C   2 
ATOM   3015  O  O   . PRO A 1 36  ? -2.147  74.062  0.277   0.25 19.24 ? 36  PRO A O   2 
ATOM   3016  C  CB  . PRO A 1 36  ? -4.848  74.201  1.803   0.25 18.55 ? 36  PRO A CB  2 
ATOM   3017  C  CG  . PRO A 1 36  ? -6.055  74.791  1.129   0.25 17.17 ? 36  PRO A CG  2 
ATOM   3018  C  CD  . PRO A 1 36  ? -5.985  76.237  1.558   0.25 17.21 ? 36  PRO A CD  2 
ATOM   3019  N  N   . SER A 1 37  ? -3.124  75.831  -0.709  0.25 18.90 ? 37  SER A N   2 
ATOM   3020  C  CA  . SER A 1 37  ? -2.387  75.670  -1.964  0.25 18.30 ? 37  SER A CA  2 
ATOM   3021  C  C   . SER A 1 37  ? -1.033  76.379  -1.962  0.25 18.13 ? 37  SER A C   2 
ATOM   3022  O  O   . SER A 1 37  ? -0.126  75.998  -2.706  0.25 16.19 ? 37  SER A O   2 
ATOM   3023  C  CB  . SER A 1 37  ? -3.213  76.197  -3.140  0.25 19.13 ? 37  SER A CB  2 
ATOM   3024  O  OG  . SER A 1 37  ? -3.311  77.612  -3.090  0.25 23.02 ? 37  SER A OG  2 
ATOM   3025  N  N   . ALA A 1 38  ? -0.900  77.416  -1.139  0.25 16.68 ? 38  ALA A N   2 
ATOM   3026  C  CA  . ALA A 1 38  ? 0.348   78.168  -1.065  0.25 15.30 ? 38  ALA A CA  2 
ATOM   3027  C  C   . ALA A 1 38  ? 1.525   77.224  -0.844  0.25 15.62 ? 38  ALA A C   2 
ATOM   3028  O  O   . ALA A 1 38  ? 1.439   76.294  -0.043  0.25 16.88 ? 38  ALA A O   2 
ATOM   3029  C  CB  . ALA A 1 38  ? 0.278   79.190  0.065   0.25 16.06 ? 38  ALA A CB  2 
ATOM   3030  N  N   . ALA A 1 39  ? 2.617   77.465  -1.566  0.25 13.51 ? 39  ALA A N   2 
ATOM   3031  C  CA  . ALA A 1 39  ? 3.811   76.641  -1.452  0.25 12.79 ? 39  ALA A CA  2 
ATOM   3032  C  C   . ALA A 1 39  ? 5.010   77.469  -1.016  0.25 13.56 ? 39  ALA A C   2 
ATOM   3033  O  O   . ALA A 1 39  ? 5.353   78.476  -1.649  0.25 11.58 ? 39  ALA A O   2 
ATOM   3034  C  CB  . ALA A 1 39  ? 4.112   75.954  -2.795  0.25 11.87 ? 39  ALA A CB  2 
ATOM   3035  N  N   . PHE A 1 40  ? 5.639   77.053  0.078   0.25 13.16 ? 40  PHE A N   2 
ATOM   3036  C  CA  . PHE A 1 40  ? 6.817   77.753  0.573   0.25 12.85 ? 40  PHE A CA  2 
ATOM   3037  C  C   . PHE A 1 40  ? 7.771   77.874  -0.602  0.25 14.45 ? 40  PHE A C   2 
ATOM   3038  O  O   . PHE A 1 40  ? 8.068   76.879  -1.271  0.25 14.30 ? 40  PHE A O   2 
ATOM   3039  C  CB  . PHE A 1 40  ? 7.488   76.953  1.695   0.25 12.52 ? 40  PHE A CB  2 
ATOM   3040  C  CG  . PHE A 1 40  ? 8.827   77.505  2.119   0.25 14.66 ? 40  PHE A CG  2 
ATOM   3041  C  CD1 . PHE A 1 40  ? 8.908   78.648  2.905   0.25 13.05 ? 40  PHE A CD1 2 
ATOM   3042  C  CD2 . PHE A 1 40  ? 10.006  76.883  1.722   0.25 14.35 ? 40  PHE A CD2 2 
ATOM   3043  C  CE1 . PHE A 1 40  ? 10.144  79.167  3.290   0.25 15.26 ? 40  PHE A CE1 2 
ATOM   3044  C  CE2 . PHE A 1 40  ? 11.248  77.392  2.101   0.25 15.60 ? 40  PHE A CE2 2 
ATOM   3045  C  CZ  . PHE A 1 40  ? 11.316  78.536  2.887   0.25 15.97 ? 40  PHE A CZ  2 
ATOM   3046  N  N   . PHE A 1 41  ? 8.239   79.089  -0.866  0.25 14.34 ? 41  PHE A N   2 
ATOM   3047  C  CA  . PHE A 1 41  ? 9.156   79.295  -1.969  0.25 15.96 ? 41  PHE A CA  2 
ATOM   3048  C  C   . PHE A 1 41  ? 10.535  79.664  -1.455  0.25 15.81 ? 41  PHE A C   2 
ATOM   3049  O  O   . PHE A 1 41  ? 11.525  79.028  -1.819  0.25 15.09 ? 41  PHE A O   2 
ATOM   3050  C  CB  . PHE A 1 41  ? 8.648   80.387  -2.912  0.25 16.41 ? 41  PHE A CB  2 
ATOM   3051  C  CG  . PHE A 1 41  ? 9.456   80.510  -4.168  0.25 14.71 ? 41  PHE A CG  2 
ATOM   3052  C  CD1 . PHE A 1 41  ? 9.581   79.429  -5.032  0.25 16.43 ? 41  PHE A CD1 2 
ATOM   3053  C  CD2 . PHE A 1 41  ? 10.113  81.691  -4.477  0.25 15.19 ? 41  PHE A CD2 2 
ATOM   3054  C  CE1 . PHE A 1 41  ? 10.353  79.520  -6.187  0.25 17.45 ? 41  PHE A CE1 2 
ATOM   3055  C  CE2 . PHE A 1 41  ? 10.887  81.794  -5.629  0.25 18.24 ? 41  PHE A CE2 2 
ATOM   3056  C  CZ  . PHE A 1 41  ? 11.007  80.704  -6.487  0.25 18.65 ? 41  PHE A CZ  2 
ATOM   3057  N  N   . CYS A 1 42  ? 10.610  80.686  -0.606  0.25 14.26 ? 42  CYS A N   2 
ATOM   3058  C  CA  . CYS A 1 42  ? 11.907  81.080  -0.067  0.25 12.98 ? 42  CYS A CA  2 
ATOM   3059  C  C   . CYS A 1 42  ? 11.855  82.158  1.003   0.25 14.34 ? 42  CYS A C   2 
ATOM   3060  O  O   . CYS A 1 42  ? 10.799  82.712  1.324   0.25 11.50 ? 42  CYS A O   2 
ATOM   3061  C  CB  . CYS A 1 42  ? 12.819  81.578  -1.192  0.25 14.38 ? 42  CYS A CB  2 
ATOM   3062  S  SG  . CYS A 1 42  ? 12.536  83.304  -1.663  0.25 18.00 ? 42  CYS A SG  2 
ATOM   3063  N  N   . VAL A 1 43  ? 13.029  82.434  1.559   0.25 12.44 ? 43  VAL A N   2 
ATOM   3064  C  CA  . VAL A 1 43  ? 13.202  83.479  2.554   0.25 12.86 ? 43  VAL A CA  2 
ATOM   3065  C  C   . VAL A 1 43  ? 13.687  84.656  1.713   0.25 12.49 ? 43  VAL A C   2 
ATOM   3066  O  O   . VAL A 1 43  ? 14.496  84.465  0.807   0.25 14.22 ? 43  VAL A O   2 
ATOM   3067  C  CB  . VAL A 1 43  ? 14.300  83.112  3.573   0.25 12.47 ? 43  VAL A CB  2 
ATOM   3068  C  CG1 . VAL A 1 43  ? 14.558  84.279  4.487   0.25 12.99 ? 43  VAL A CG1 2 
ATOM   3069  C  CG2 . VAL A 1 43  ? 13.881  81.877  4.371   0.25 12.21 ? 43  VAL A CG2 2 
ATOM   3070  N  N   . ALA A 1 44  ? 13.210  85.861  2.002   0.25 9.93  ? 44  ALA A N   2 
ATOM   3071  C  CA  . ALA A 1 44  ? 13.618  87.022  1.215   0.25 12.73 ? 44  ALA A CA  2 
ATOM   3072  C  C   . ALA A 1 44  ? 13.664  88.315  2.009   0.25 12.43 ? 44  ALA A C   2 
ATOM   3073  O  O   . ALA A 1 44  ? 12.981  88.463  3.021   0.25 11.94 ? 44  ALA A O   2 
ATOM   3074  C  CB  . ALA A 1 44  ? 12.689  87.190  0.024   0.25 9.53  ? 44  ALA A CB  2 
ATOM   3075  N  N   . ARG A 1 45  ? 14.460  89.258  1.516   0.25 14.02 ? 45  ARG A N   2 
ATOM   3076  C  CA  . ARG A 1 45  ? 14.624  90.551  2.164   0.25 15.75 ? 45  ARG A CA  2 
ATOM   3077  C  C   . ARG A 1 45  ? 14.122  91.701  1.297   0.25 13.15 ? 45  ARG A C   2 
ATOM   3078  O  O   . ARG A 1 45  ? 14.434  91.771  0.109   0.25 12.40 ? 45  ARG A O   2 
ATOM   3079  C  CB  . ARG A 1 45  ? 16.105  90.777  2.497   0.25 17.78 ? 45  ARG A CB  2 
ATOM   3080  C  CG  . ARG A 1 45  ? 16.398  92.130  3.124   0.25 24.62 ? 45  ARG A CG  2 
ATOM   3081  C  CD  . ARG A 1 45  ? 17.879  92.287  3.452   0.25 32.11 ? 45  ARG A CD  2 
ATOM   3082  N  NE  . ARG A 1 45  ? 18.714  92.352  2.257   0.25 40.60 ? 45  ARG A NE  2 
ATOM   3083  C  CZ  . ARG A 1 45  ? 20.041  92.445  2.276   0.25 44.89 ? 45  ARG A CZ  2 
ATOM   3084  N  NH1 . ARG A 1 45  ? 20.689  92.481  3.433   0.25 48.89 ? 45  ARG A NH1 2 
ATOM   3085  N  NH2 . ARG A 1 45  ? 20.720  92.511  1.139   0.25 48.77 ? 45  ARG A NH2 2 
ATOM   3086  N  N   . LEU A 1 46  ? 13.335  92.591  1.895   0.25 12.17 ? 46  LEU A N   2 
ATOM   3087  C  CA  . LEU A 1 46  ? 12.817  93.760  1.192   0.25 12.54 ? 46  LEU A CA  2 
ATOM   3088  C  C   . LEU A 1 46  ? 13.684  94.932  1.636   0.25 13.51 ? 46  LEU A C   2 
ATOM   3089  O  O   . LEU A 1 46  ? 13.634  95.343  2.798   0.25 14.27 ? 46  LEU A O   2 
ATOM   3090  C  CB  . LEU A 1 46  ? 11.352  94.021  1.571   0.25 11.46 ? 46  LEU A CB  2 
ATOM   3091  C  CG  . LEU A 1 46  ? 10.657  95.217  0.906   0.25 10.75 ? 46  LEU A CG  2 
ATOM   3092  C  CD1 . LEU A 1 46  ? 10.703  95.085  -0.615  0.25 12.84 ? 46  LEU A CD1 2 
ATOM   3093  C  CD2 . LEU A 1 46  ? 9.208   95.286  1.380   0.25 11.98 ? 46  LEU A CD2 2 
ATOM   3094  N  N   . GLN A 1 47  ? 14.484  95.464  0.717   0.25 14.20 ? 47  GLN A N   2 
ATOM   3095  C  CA  . GLN A 1 47  ? 15.370  96.573  1.049   0.25 14.16 ? 47  GLN A CA  2 
ATOM   3096  C  C   . GLN A 1 47  ? 14.625  97.888  1.265   0.25 13.44 ? 47  GLN A C   2 
ATOM   3097  O  O   . GLN A 1 47  ? 13.612  98.166  0.625   0.25 12.34 ? 47  GLN A O   2 
ATOM   3098  C  CB  . GLN A 1 47  ? 16.432  96.753  -0.039  0.25 12.14 ? 47  GLN A CB  2 
ATOM   3099  C  CG  . GLN A 1 47  ? 17.483  97.824  0.282   0.25 16.07 ? 47  GLN A CG  2 
ATOM   3100  C  CD  . GLN A 1 47  ? 18.621  97.321  1.159   0.25 16.99 ? 47  GLN A CD  2 
ATOM   3101  O  OE1 . GLN A 1 47  ? 19.412  96.475  0.742   0.25 16.90 ? 47  GLN A OE1 2 
ATOM   3102  N  NE2 . GLN A 1 47  ? 18.709  97.845  2.383   0.25 20.89 ? 47  GLN A NE2 2 
ATOM   3103  N  N   . ASP A 1 48  ? 15.147  98.683  2.191   0.25 14.23 ? 48  ASP A N   2 
ATOM   3104  C  CA  . ASP A 1 48  ? 14.596  99.983  2.539   0.25 12.44 ? 48  ASP A CA  2 
ATOM   3105  C  C   . ASP A 1 48  ? 13.115  100.039 2.892   0.25 11.21 ? 48  ASP A C   2 
ATOM   3106  O  O   . ASP A 1 48  ? 12.392  100.907 2.411   0.25 9.92  ? 48  ASP A O   2 
ATOM   3107  C  CB  . ASP A 1 48  ? 14.908  101.011 1.441   0.25 13.89 ? 48  ASP A CB  2 
ATOM   3108  C  CG  . ASP A 1 48  ? 16.377  101.425 1.428   0.25 17.17 ? 48  ASP A CG  2 
ATOM   3109  O  OD1 . ASP A 1 48  ? 17.003  101.429 2.513   0.25 18.24 ? 48  ASP A OD1 2 
ATOM   3110  O  OD2 . ASP A 1 48  ? 16.902  101.756 0.342   0.25 17.10 ? 48  ASP A OD2 2 
ATOM   3111  N  N   . PHE A 1 49  ? 12.675  99.104  3.731   0.25 10.58 ? 49  PHE A N   2 
ATOM   3112  C  CA  . PHE A 1 49  ? 11.303  99.069  4.233   0.25 10.67 ? 49  PHE A CA  2 
ATOM   3113  C  C   . PHE A 1 49  ? 11.392  98.741  5.714   0.25 11.29 ? 49  PHE A C   2 
ATOM   3114  O  O   . PHE A 1 49  ? 12.241  97.949  6.127   0.25 10.89 ? 49  PHE A O   2 
ATOM   3115  C  CB  . PHE A 1 49  ? 10.455  98.001  3.541   0.25 11.74 ? 49  PHE A CB  2 
ATOM   3116  C  CG  . PHE A 1 49  ? 9.734   98.490  2.319   0.25 11.45 ? 49  PHE A CG  2 
ATOM   3117  C  CD1 . PHE A 1 49  ? 10.381  98.555  1.090   0.25 12.34 ? 49  PHE A CD1 2 
ATOM   3118  C  CD2 . PHE A 1 49  ? 8.397   98.865  2.393   0.25 10.85 ? 49  PHE A CD2 2 
ATOM   3119  C  CE1 . PHE A 1 49  ? 9.705   98.982  -0.055  0.25 12.39 ? 49  PHE A CE1 2 
ATOM   3120  C  CE2 . PHE A 1 49  ? 7.709   99.295  1.257   0.25 11.69 ? 49  PHE A CE2 2 
ATOM   3121  C  CZ  . PHE A 1 49  ? 8.364   99.353  0.030   0.25 11.46 ? 49  PHE A CZ  2 
ATOM   3122  N  N   . LYS A 1 50  ? 10.529  99.369  6.510   0.25 11.53 ? 50  LYS A N   2 
ATOM   3123  C  CA  . LYS A 1 50  ? 10.502  99.142  7.952   0.25 12.22 ? 50  LYS A CA  2 
ATOM   3124  C  C   . LYS A 1 50  ? 9.177   98.492  8.319   0.25 12.16 ? 50  LYS A C   2 
ATOM   3125  O  O   . LYS A 1 50  ? 8.137   98.833  7.756   0.25 11.16 ? 50  LYS A O   2 
ATOM   3126  C  CB  . LYS A 1 50  ? 10.658  100.471 8.699   0.25 13.37 ? 50  LYS A CB  2 
ATOM   3127  C  CG  . LYS A 1 50  ? 10.822  100.341 10.216  0.25 20.95 ? 50  LYS A CG  2 
ATOM   3128  C  CD  . LYS A 1 50  ? 11.131  101.704 10.837  0.25 25.86 ? 50  LYS A CD  2 
ATOM   3129  C  CE  . LYS A 1 50  ? 11.556  101.589 12.294  0.25 28.39 ? 50  LYS A CE  2 
ATOM   3130  N  NZ  . LYS A 1 50  ? 10.487  101.012 13.151  0.25 31.33 ? 50  LYS A NZ  2 
ATOM   3131  N  N   . LEU A 1 51  ? 9.223   97.549  9.256   0.25 10.05 ? 51  LEU A N   2 
ATOM   3132  C  CA  . LEU A 1 51  ? 8.025   96.848  9.712   0.25 10.95 ? 51  LEU A CA  2 
ATOM   3133  C  C   . LEU A 1 51  ? 7.335   97.627  10.831  0.25 11.29 ? 51  LEU A C   2 
ATOM   3134  O  O   . LEU A 1 51  ? 7.986   98.120  11.749  0.25 11.51 ? 51  LEU A O   2 
ATOM   3135  C  CB  . LEU A 1 51  ? 8.399   95.458  10.227  0.25 10.88 ? 51  LEU A CB  2 
ATOM   3136  C  CG  . LEU A 1 51  ? 7.265   94.555  10.714  0.25 12.63 ? 51  LEU A CG  2 
ATOM   3137  C  CD1 . LEU A 1 51  ? 6.417   94.120  9.524   0.25 7.59  ? 51  LEU A CD1 2 
ATOM   3138  C  CD2 . LEU A 1 51  ? 7.854   93.334  11.426  0.25 10.58 ? 51  LEU A CD2 2 
ATOM   3139  N  N   . ASP A 1 52  ? 6.013   97.732  10.755  0.25 11.30 ? 52  ASP A N   2 
ATOM   3140  C  CA  . ASP A 1 52  ? 5.251   98.435  11.776  0.25 11.13 ? 52  ASP A CA  2 
ATOM   3141  C  C   . ASP A 1 52  ? 3.967   97.663  12.049  0.25 11.39 ? 52  ASP A C   2 
ATOM   3142  O  O   . ASP A 1 52  ? 3.696   96.661  11.391  0.25 9.46  ? 52  ASP A O   2 
ATOM   3143  C  CB  . ASP A 1 52  ? 4.924   99.859  11.309  0.25 12.62 ? 52  ASP A CB  2 
ATOM   3144  C  CG  . ASP A 1 52  ? 4.268   100.693 12.398  0.25 14.79 ? 52  ASP A CG  2 
ATOM   3145  O  OD1 . ASP A 1 52  ? 4.756   100.651 13.548  0.25 11.38 ? 52  ASP A OD1 2 
ATOM   3146  O  OD2 . ASP A 1 52  ? 3.274   101.391 12.106  0.25 14.51 ? 52  ASP A OD2 2 
ATOM   3147  N  N   . PHE A 1 53  ? 3.194   98.112  13.034  0.25 10.43 ? 53  PHE A N   2 
ATOM   3148  C  CA  . PHE A 1 53  ? 1.926   97.469  13.366  0.25 10.17 ? 53  PHE A CA  2 
ATOM   3149  C  C   . PHE A 1 53  ? 0.871   98.531  13.625  0.25 9.73  ? 53  PHE A C   2 
ATOM   3150  O  O   . PHE A 1 53  ? 1.197   99.650  14.025  0.25 6.06  ? 53  PHE A O   2 
ATOM   3151  C  CB  . PHE A 1 53  ? 2.068   96.582  14.605  0.25 12.12 ? 53  PHE A CB  2 
ATOM   3152  C  CG  . PHE A 1 53  ? 3.024   95.445  14.422  0.25 11.93 ? 53  PHE A CG  2 
ATOM   3153  C  CD1 . PHE A 1 53  ? 4.398   95.646  14.527  0.25 10.90 ? 53  PHE A CD1 2 
ATOM   3154  C  CD2 . PHE A 1 53  ? 2.554   94.174  14.110  0.25 11.34 ? 53  PHE A CD2 2 
ATOM   3155  C  CE1 . PHE A 1 53  ? 5.290   94.595  14.322  0.25 12.10 ? 53  PHE A CE1 2 
ATOM   3156  C  CE2 . PHE A 1 53  ? 3.436   93.116  13.902  0.25 10.74 ? 53  PHE A CE2 2 
ATOM   3157  C  CZ  . PHE A 1 53  ? 4.808   93.327  14.008  0.25 12.07 ? 53  PHE A CZ  2 
ATOM   3158  N  N   . GLY A 1 54  ? -0.394  98.191  13.400  0.25 9.95  ? 54  GLY A N   2 
ATOM   3159  C  CA  . GLY A 1 54  ? -1.431  99.178  13.630  0.25 11.37 ? 54  GLY A CA  2 
ATOM   3160  C  C   . GLY A 1 54  ? -2.845  98.782  13.261  0.25 12.13 ? 54  GLY A C   2 
ATOM   3161  O  O   . GLY A 1 54  ? -3.118  97.645  12.858  0.25 10.35 ? 54  GLY A O   2 
ATOM   3162  N  N   . ASN A 1 55  ? -3.748  99.745  13.410  0.25 12.23 ? 55  ASN A N   2 
ATOM   3163  C  CA  . ASN A 1 55  ? -5.156  99.549  13.113  0.25 14.44 ? 55  ASN A CA  2 
ATOM   3164  C  C   . ASN A 1 55  ? -5.504  100.388 11.886  0.25 15.91 ? 55  ASN A C   2 
ATOM   3165  O  O   . ASN A 1 55  ? -5.607  101.614 11.973  0.25 14.29 ? 55  ASN A O   2 
ATOM   3166  C  CB  . ASN A 1 55  ? -6.007  99.993  14.313  0.25 15.82 ? 55  ASN A CB  2 
ATOM   3167  C  CG  . ASN A 1 55  ? -5.394  99.586  15.649  0.25 16.30 ? 55  ASN A CG  2 
ATOM   3168  O  OD1 . ASN A 1 55  ? -4.848  98.494  15.786  0.25 13.03 ? 55  ASN A OD1 2 
ATOM   3169  N  ND2 . ASN A 1 55  ? -5.494  100.465 16.641  0.25 16.07 ? 55  ASN A ND2 2 
ATOM   3170  N  N   . SER A 1 56  ? -5.671  99.730  10.743  0.25 17.82 ? 56  SER A N   2 
ATOM   3171  C  CA  . SER A 1 56  ? -6.002  100.435 9.512   0.25 21.85 ? 56  SER A CA  2 
ATOM   3172  C  C   . SER A 1 56  ? -7.383  101.072 9.636   0.25 23.82 ? 56  SER A C   2 
ATOM   3173  O  O   . SER A 1 56  ? -8.309  100.473 10.184  0.25 22.77 ? 56  SER A O   2 
ATOM   3174  C  CB  . SER A 1 56  ? -5.974  99.476  8.319   0.25 22.12 ? 56  SER A CB  2 
ATOM   3175  O  OG  . SER A 1 56  ? -5.781  100.180 7.104   0.25 21.89 ? 56  SER A OG  2 
ATOM   3176  N  N   . GLN A 1 57  ? -7.507  102.292 9.123   0.25 26.50 ? 57  GLN A N   2 
ATOM   3177  C  CA  . GLN A 1 57  ? -8.754  103.045 9.179   0.25 29.77 ? 57  GLN A CA  2 
ATOM   3178  C  C   . GLN A 1 57  ? -9.112  103.291 10.644  0.25 29.30 ? 57  GLN A C   2 
ATOM   3179  O  O   . GLN A 1 57  ? -10.263 103.575 10.970  0.25 26.86 ? 57  GLN A O   2 
ATOM   3180  C  CB  . GLN A 1 57  ? -9.897  102.279 8.492   0.25 32.78 ? 57  GLN A CB  2 
ATOM   3181  C  CG  . GLN A 1 57  ? -9.551  101.636 7.149   0.25 35.61 ? 57  GLN A CG  2 
ATOM   3182  C  CD  . GLN A 1 57  ? -8.994  102.615 6.132   0.25 38.83 ? 57  GLN A CD  2 
ATOM   3183  O  OE1 . GLN A 1 57  ? -9.655  103.581 5.747   0.25 39.77 ? 57  GLN A OE1 2 
ATOM   3184  N  NE2 . GLN A 1 57  ? -7.768  102.363 5.687   0.25 39.13 ? 57  GLN A NE2 2 
ATOM   3185  N  N   . GLY A 1 58  ? -8.115  103.171 11.520  0.25 29.43 ? 58  GLY A N   2 
ATOM   3186  C  CA  . GLY A 1 58  ? -8.332  103.385 12.942  0.25 28.33 ? 58  GLY A CA  2 
ATOM   3187  C  C   . GLY A 1 58  ? -9.232  102.340 13.577  0.25 27.95 ? 58  GLY A C   2 
ATOM   3188  O  O   . GLY A 1 58  ? -9.768  102.547 14.663  0.25 28.50 ? 58  GLY A O   2 
ATOM   3189  N  N   . LYS A 1 59  ? -9.394  101.209 12.902  0.25 28.25 ? 59  LYS A N   2 
ATOM   3190  C  CA  . LYS A 1 59  ? -10.245 100.134 13.401  0.25 29.00 ? 59  LYS A CA  2 
ATOM   3191  C  C   . LYS A 1 59  ? -9.425  99.038  14.071  0.25 26.81 ? 59  LYS A C   2 
ATOM   3192  O  O   . LYS A 1 59  ? -8.442  98.562  13.510  0.25 24.95 ? 59  LYS A O   2 
ATOM   3193  C  CB  . LYS A 1 59  ? -11.047 99.525  12.249  0.25 31.50 ? 59  LYS A CB  2 
ATOM   3194  C  CG  . LYS A 1 59  ? -11.843 100.529 11.437  0.25 36.46 ? 59  LYS A CG  2 
ATOM   3195  C  CD  . LYS A 1 59  ? -12.491 99.863  10.231  0.25 39.33 ? 59  LYS A CD  2 
ATOM   3196  C  CE  . LYS A 1 59  ? -13.201 100.879 9.350   0.25 41.74 ? 59  LYS A CE  2 
ATOM   3197  N  NZ  . LYS A 1 59  ? -13.737 100.260 8.107   0.25 43.46 ? 59  LYS A NZ  2 
ATOM   3198  N  N   . THR A 1 60  ? -9.837  98.637  15.269  0.25 25.99 ? 60  THR A N   2 
ATOM   3199  C  CA  . THR A 1 60  ? -9.139  97.584  15.999  0.25 24.80 ? 60  THR A CA  2 
ATOM   3200  C  C   . THR A 1 60  ? -9.583  96.201  15.532  0.25 23.69 ? 60  THR A C   2 
ATOM   3201  O  O   . THR A 1 60  ? -10.746 95.827  15.687  0.25 22.87 ? 60  THR A O   2 
ATOM   3202  C  CB  . THR A 1 60  ? -9.387  97.694  17.519  0.25 25.13 ? 60  THR A CB  2 
ATOM   3203  O  OG1 . THR A 1 60  ? -8.649  98.806  18.042  0.25 26.73 ? 60  THR A OG1 2 
ATOM   3204  C  CG2 . THR A 1 60  ? -8.953  96.415  18.232  0.25 24.74 ? 60  THR A CG2 2 
ATOM   3205  N  N   . SER A 1 61  ? -8.648  95.450  14.956  0.25 21.60 ? 61  SER A N   2 
ATOM   3206  C  CA  . SER A 1 61  ? -8.925  94.100  14.475  0.25 20.68 ? 61  SER A CA  2 
ATOM   3207  C  C   . SER A 1 61  ? -9.511  93.251  15.591  0.25 21.03 ? 61  SER A C   2 
ATOM   3208  O  O   . SER A 1 61  ? -8.894  93.101  16.648  0.25 17.63 ? 61  SER A O   2 
ATOM   3209  C  CB  . SER A 1 61  ? -7.643  93.433  13.986  0.25 19.71 ? 61  SER A CB  2 
ATOM   3210  O  OG  . SER A 1 61  ? -7.814  92.028  13.912  0.25 18.61 ? 61  SER A OG  2 
ATOM   3211  N  N   . GLN A 1 62  ? -10.693 92.691  15.354  0.25 20.63 ? 62  GLN A N   2 
ATOM   3212  C  CA  . GLN A 1 62  ? -11.338 91.852  16.359  0.25 23.09 ? 62  GLN A CA  2 
ATOM   3213  C  C   . GLN A 1 62  ? -10.897 90.405  16.195  0.25 21.79 ? 62  GLN A C   2 
ATOM   3214  O  O   . GLN A 1 62  ? -11.233 89.543  17.003  0.25 19.20 ? 62  GLN A O   2 
ATOM   3215  C  CB  . GLN A 1 62  ? -12.860 91.966  16.251  0.25 26.83 ? 62  GLN A CB  2 
ATOM   3216  C  CG  . GLN A 1 62  ? -13.367 93.371  16.544  0.25 32.17 ? 62  GLN A CG  2 
ATOM   3217  C  CD  . GLN A 1 62  ? -12.906 93.887  17.898  0.25 33.51 ? 62  GLN A CD  2 
ATOM   3218  O  OE1 . GLN A 1 62  ? -13.351 93.410  18.944  0.25 35.17 ? 62  GLN A OE1 2 
ATOM   3219  N  NE2 . GLN A 1 62  ? -12.002 94.861  17.883  0.25 34.92 ? 62  GLN A NE2 2 
ATOM   3220  N  N   . THR A 1 63  ? -10.134 90.150  15.140  0.25 19.58 ? 63  THR A N   2 
ATOM   3221  C  CA  . THR A 1 63  ? -9.616  88.816  14.889  0.25 20.48 ? 63  THR A CA  2 
ATOM   3222  C  C   . THR A 1 63  ? -8.367  88.576  15.731  0.25 20.52 ? 63  THR A C   2 
ATOM   3223  O  O   . THR A 1 63  ? -8.164  87.477  16.253  0.25 20.67 ? 63  THR A O   2 
ATOM   3224  C  CB  . THR A 1 63  ? -9.246  88.627  13.412  0.25 21.53 ? 63  THR A CB  2 
ATOM   3225  O  OG1 . THR A 1 63  ? -10.440 88.602  12.623  0.25 24.17 ? 63  THR A OG1 2 
ATOM   3226  C  CG2 . THR A 1 63  ? -8.482  87.321  13.218  0.25 23.19 ? 63  THR A CG2 2 
ATOM   3227  N  N   . TRP A 1 64  ? -7.540  89.610  15.863  0.25 17.95 ? 64  TRP A N   2 
ATOM   3228  C  CA  . TRP A 1 64  ? -6.303  89.510  16.632  0.25 17.40 ? 64  TRP A CA  2 
ATOM   3229  C  C   . TRP A 1 64  ? -6.260  90.385  17.873  0.25 17.99 ? 64  TRP A C   2 
ATOM   3230  O  O   . TRP A 1 64  ? -5.363  90.240  18.705  0.25 17.77 ? 64  TRP A O   2 
ATOM   3231  C  CB  . TRP A 1 64  ? -5.111  89.869  15.752  0.25 16.67 ? 64  TRP A CB  2 
ATOM   3232  C  CG  . TRP A 1 64  ? -4.885  88.896  14.666  0.25 16.80 ? 64  TRP A CG  2 
ATOM   3233  C  CD1 . TRP A 1 64  ? -5.314  88.986  13.376  0.25 17.59 ? 64  TRP A CD1 2 
ATOM   3234  C  CD2 . TRP A 1 64  ? -4.167  87.668  14.769  0.25 16.25 ? 64  TRP A CD2 2 
ATOM   3235  N  NE1 . TRP A 1 64  ? -4.901  87.887  12.663  0.25 17.40 ? 64  TRP A NE1 2 
ATOM   3236  C  CE2 . TRP A 1 64  ? -4.193  87.061  13.496  0.25 15.95 ? 64  TRP A CE2 2 
ATOM   3237  C  CE3 . TRP A 1 64  ? -3.499  87.019  15.817  0.25 16.26 ? 64  TRP A CE3 2 
ATOM   3238  C  CZ2 . TRP A 1 64  ? -3.575  85.834  13.238  0.25 17.07 ? 64  TRP A CZ2 2 
ATOM   3239  C  CZ3 . TRP A 1 64  ? -2.884  85.799  15.561  0.25 15.98 ? 64  TRP A CZ3 2 
ATOM   3240  C  CH2 . TRP A 1 64  ? -2.927  85.220  14.281  0.25 14.99 ? 64  TRP A CH2 2 
ATOM   3241  N  N   . HIS A 1 65  ? -7.221  91.295  17.985  0.25 17.29 ? 65  HIS A N   2 
ATOM   3242  C  CA  . HIS A 1 65  ? -7.300  92.213  19.113  0.25 18.99 ? 65  HIS A CA  2 
ATOM   3243  C  C   . HIS A 1 65  ? -5.996  92.970  19.327  0.25 17.87 ? 65  HIS A C   2 
ATOM   3244  O  O   . HIS A 1 65  ? -5.372  92.876  20.383  0.25 18.54 ? 65  HIS A O   2 
ATOM   3245  C  CB  . HIS A 1 65  ? -7.684  91.460  20.390  0.25 20.05 ? 65  HIS A CB  2 
ATOM   3246  C  CG  . HIS A 1 65  ? -8.951  90.676  20.263  0.25 19.38 ? 65  HIS A CG  2 
ATOM   3247  N  ND1 . HIS A 1 65  ? -8.975  89.372  19.819  0.25 21.59 ? 65  HIS A ND1 2 
ATOM   3248  C  CD2 . HIS A 1 65  ? -10.241 91.027  20.474  0.25 19.74 ? 65  HIS A CD2 2 
ATOM   3249  C  CE1 . HIS A 1 65  ? -10.227 88.952  19.763  0.25 18.97 ? 65  HIS A CE1 2 
ATOM   3250  N  NE2 . HIS A 1 65  ? -11.014 89.938  20.154  0.25 20.45 ? 65  HIS A NE2 2 
ATOM   3251  N  N   . GLY A 1 66  ? -5.598  93.730  18.315  0.25 16.86 ? 66  GLY A N   2 
ATOM   3252  C  CA  . GLY A 1 66  ? -4.371  94.498  18.400  0.25 13.79 ? 66  GLY A CA  2 
ATOM   3253  C  C   . GLY A 1 66  ? -3.928  94.913  17.013  0.25 13.43 ? 66  GLY A C   2 
ATOM   3254  O  O   . GLY A 1 66  ? -4.415  94.386  16.012  0.25 11.02 ? 66  GLY A O   2 
ATOM   3255  N  N   . GLY A 1 67  ? -3.007  95.864  16.947  0.25 12.52 ? 67  GLY A N   2 
ATOM   3256  C  CA  . GLY A 1 67  ? -2.525  96.305  15.654  0.25 12.01 ? 67  GLY A CA  2 
ATOM   3257  C  C   . GLY A 1 67  ? -1.948  95.147  14.863  0.25 12.26 ? 67  GLY A C   2 
ATOM   3258  O  O   . GLY A 1 67  ? -1.447  94.174  15.433  0.25 12.61 ? 67  GLY A O   2 
ATOM   3259  N  N   . ILE A 1 68  ? -2.031  95.243  13.542  0.25 13.68 ? 68  ILE A N   2 
ATOM   3260  C  CA  . ILE A 1 68  ? -1.490  94.213  12.672  0.25 12.61 ? 68  ILE A CA  2 
ATOM   3261  C  C   . ILE A 1 68  ? -0.399  94.837  11.795  0.25 12.33 ? 68  ILE A C   2 
ATOM   3262  O  O   . ILE A 1 68  ? -0.403  96.045  11.535  0.25 11.18 ? 68  ILE A O   2 
ATOM   3263  C  CB  . ILE A 1 68  ? -2.605  93.553  11.825  0.25 13.94 ? 68  ILE A CB  2 
ATOM   3264  C  CG1 . ILE A 1 68  ? -3.350  94.602  10.998  0.25 14.75 ? 68  ILE A CG1 2 
ATOM   3265  C  CG2 . ILE A 1 68  ? -3.581  92.829  12.753  0.25 14.21 ? 68  ILE A CG2 2 
ATOM   3266  C  CD1 . ILE A 1 68  ? -4.486  94.037  10.165  0.25 14.71 ? 68  ILE A CD1 2 
ATOM   3267  N  N   . ALA A 1 69  ? 0.537   94.001  11.355  0.25 11.04 ? 69  ALA A N   2 
ATOM   3268  C  CA  . ALA A 1 69  ? 1.682   94.440  10.568  0.25 8.40  ? 69  ALA A CA  2 
ATOM   3269  C  C   . ALA A 1 69  ? 1.430   95.235  9.293   0.25 7.98  ? 69  ALA A C   2 
ATOM   3270  O  O   . ALA A 1 69  ? 0.385   95.129  8.652   0.25 6.31  ? 69  ALA A O   2 
ATOM   3271  C  CB  . ALA A 1 69  ? 2.563   93.240  10.242  0.25 6.76  ? 69  ALA A CB  2 
ATOM   3272  N  N   . THR A 1 70  ? 2.429   96.038  8.950   0.25 8.32  ? 70  THR A N   2 
ATOM   3273  C  CA  . THR A 1 70  ? 2.433   96.839  7.739   0.25 8.45  ? 70  THR A CA  2 
ATOM   3274  C  C   . THR A 1 70  ? 3.881   97.210  7.487   0.25 10.09 ? 70  THR A C   2 
ATOM   3275  O  O   . THR A 1 70  ? 4.696   97.240  8.413   0.25 9.02  ? 70  THR A O   2 
ATOM   3276  C  CB  . THR A 1 70  ? 1.613   98.125  7.872   0.25 10.33 ? 70  THR A CB  2 
ATOM   3277  O  OG1 . THR A 1 70  ? 1.641   98.829  6.621   0.25 11.33 ? 70  THR A OG1 2 
ATOM   3278  C  CG2 . THR A 1 70  ? 2.183   99.013  8.967   0.25 9.97  ? 70  THR A CG2 2 
ATOM   3279  N  N   . ILE A 1 71  ? 4.206   97.477  6.231   0.25 10.05 ? 71  ILE A N   2 
ATOM   3280  C  CA  . ILE A 1 71  ? 5.560   97.854  5.881   0.25 9.78  ? 71  ILE A CA  2 
ATOM   3281  C  C   . ILE A 1 71  ? 5.529   99.158  5.108   0.25 11.86 ? 71  ILE A C   2 
ATOM   3282  O  O   . ILE A 1 71  ? 4.553   99.458  4.414   0.25 12.07 ? 71  ILE A O   2 
ATOM   3283  C  CB  . ILE A 1 71  ? 6.240   96.774  4.998   0.25 8.75  ? 71  ILE A CB  2 
ATOM   3284  C  CG1 . ILE A 1 71  ? 5.438   96.564  3.709   0.25 6.81  ? 71  ILE A CG1 2 
ATOM   3285  C  CG2 . ILE A 1 71  ? 6.335   95.454  5.759   0.25 8.23  ? 71  ILE A CG2 2 
ATOM   3286  C  CD1 . ILE A 1 71  ? 6.088   95.579  2.743   0.25 4.67  ? 71  ILE A CD1 2 
ATOM   3287  N  N   . PHE A 1 72  ? 6.589   99.945  5.241   0.25 12.76 ? 72  PHE A N   2 
ATOM   3288  C  CA  . PHE A 1 72  ? 6.676   101.192 4.498   0.25 11.63 ? 72  PHE A CA  2 
ATOM   3289  C  C   . PHE A 1 72  ? 8.130   101.589 4.279   0.25 12.92 ? 72  PHE A C   2 
ATOM   3290  O  O   . PHE A 1 72  ? 9.009   101.267 5.082   0.25 11.48 ? 72  PHE A O   2 
ATOM   3291  C  CB  . PHE A 1 72  ? 5.860   102.308 5.182   0.25 9.62  ? 72  PHE A CB  2 
ATOM   3292  C  CG  . PHE A 1 72  ? 6.386   102.748 6.521   0.25 13.12 ? 72  PHE A CG  2 
ATOM   3293  C  CD1 . PHE A 1 72  ? 7.492   103.589 6.613   0.25 12.04 ? 72  PHE A CD1 2 
ATOM   3294  C  CD2 . PHE A 1 72  ? 5.738   102.369 7.690   0.25 11.50 ? 72  PHE A CD2 2 
ATOM   3295  C  CE1 . PHE A 1 72  ? 7.935   104.049 7.848   0.25 13.02 ? 72  PHE A CE1 2 
ATOM   3296  C  CE2 . PHE A 1 72  ? 6.177   102.825 8.928   0.25 12.34 ? 72  PHE A CE2 2 
ATOM   3297  C  CZ  . PHE A 1 72  ? 7.277   103.668 9.006   0.25 13.26 ? 72  PHE A CZ  2 
ATOM   3298  N  N   . GLN A 1 73  ? 8.377   102.258 3.160   0.25 13.76 ? 73  GLN A N   2 
ATOM   3299  C  CA  . GLN A 1 73  ? 9.713   102.692 2.788   0.25 14.28 ? 73  GLN A CA  2 
ATOM   3300  C  C   . GLN A 1 73  ? 10.423  103.454 3.889   0.25 15.09 ? 73  GLN A C   2 
ATOM   3301  O  O   . GLN A 1 73  ? 9.845   104.324 4.535   0.25 14.26 ? 73  GLN A O   2 
ATOM   3302  C  CB  . GLN A 1 73  ? 9.628   103.523 1.509   0.25 12.86 ? 73  GLN A CB  2 
ATOM   3303  C  CG  . GLN A 1 73  ? 9.127   102.686 0.341   0.25 17.98 ? 73  GLN A CG  2 
ATOM   3304  C  CD  . GLN A 1 73  ? 8.416   103.503 -0.713  0.25 17.45 ? 73  GLN A CD  2 
ATOM   3305  O  OE1 . GLN A 1 73  ? 7.402   104.145 -0.437  0.25 17.77 ? 73  GLN A OE1 2 
ATOM   3306  N  NE2 . GLN A 1 73  ? 8.941   103.481 -1.928  0.25 17.12 ? 73  GLN A NE2 2 
ATOM   3307  N  N   . SER A 1 74  ? 11.690  103.110 4.089   0.25 15.67 ? 74  SER A N   2 
ATOM   3308  C  CA  . SER A 1 74  ? 12.517  103.715 5.121   0.25 16.24 ? 74  SER A CA  2 
ATOM   3309  C  C   . SER A 1 74  ? 13.968  103.344 4.797   0.25 17.56 ? 74  SER A C   2 
ATOM   3310  O  O   . SER A 1 74  ? 14.408  102.227 5.069   0.25 16.03 ? 74  SER A O   2 
ATOM   3311  C  CB  . SER A 1 74  ? 12.111  103.150 6.490   0.25 17.48 ? 74  SER A CB  2 
ATOM   3312  O  OG  . SER A 1 74  ? 12.741  103.830 7.561   0.25 17.70 ? 74  SER A OG  2 
ATOM   3313  N  N   . PRO A 1 75  ? 14.721  104.275 4.187   0.25 18.93 ? 75  PRO A N   2 
ATOM   3314  C  CA  . PRO A 1 75  ? 16.119  104.026 3.828   0.25 18.48 ? 75  PRO A CA  2 
ATOM   3315  C  C   . PRO A 1 75  ? 16.930  103.460 4.986   0.25 18.63 ? 75  PRO A C   2 
ATOM   3316  O  O   . PRO A 1 75  ? 16.708  103.818 6.142   0.25 15.51 ? 75  PRO A O   2 
ATOM   3317  C  CB  . PRO A 1 75  ? 16.608  105.403 3.394   0.25 19.33 ? 75  PRO A CB  2 
ATOM   3318  C  CG  . PRO A 1 75  ? 15.389  105.985 2.749   0.25 18.78 ? 75  PRO A CG  2 
ATOM   3319  C  CD  . PRO A 1 75  ? 14.301  105.617 3.744   0.25 20.00 ? 75  PRO A CD  2 
ATOM   3320  N  N   . GLY A 1 76  ? 17.860  102.565 4.668   0.25 18.61 ? 76  GLY A N   2 
ATOM   3321  C  CA  . GLY A 1 76  ? 18.693  101.970 5.697   0.25 17.95 ? 76  GLY A CA  2 
ATOM   3322  C  C   . GLY A 1 76  ? 18.019  100.843 6.455   0.25 18.43 ? 76  GLY A C   2 
ATOM   3323  O  O   . GLY A 1 76  ? 18.691  100.065 7.128   0.25 17.35 ? 76  GLY A O   2 
ATOM   3324  N  N   . ASP A 1 77  ? 16.694  100.756 6.355   0.25 16.96 ? 77  ASP A N   2 
ATOM   3325  C  CA  . ASP A 1 77  ? 15.941  99.701  7.036   0.25 17.55 ? 77  ASP A CA  2 
ATOM   3326  C  C   . ASP A 1 77  ? 15.607  98.544  6.094   0.25 15.94 ? 77  ASP A C   2 
ATOM   3327  O  O   . ASP A 1 77  ? 15.724  98.661  4.873   0.25 14.11 ? 77  ASP A O   2 
ATOM   3328  C  CB  . ASP A 1 77  ? 14.633  100.257 7.608   0.25 16.64 ? 77  ASP A CB  2 
ATOM   3329  C  CG  . ASP A 1 77  ? 14.845  101.098 8.853   0.25 21.60 ? 77  ASP A CG  2 
ATOM   3330  O  OD1 . ASP A 1 77  ? 15.345  100.552 9.862   0.25 16.45 ? 77  ASP A OD1 2 
ATOM   3331  O  OD2 . ASP A 1 77  ? 14.504  102.304 8.821   0.25 18.82 ? 77  ASP A OD2 2 
ATOM   3332  N  N   . GLU A 1 78  ? 15.194  97.419  6.668   0.25 15.95 ? 78  GLU A N   2 
ATOM   3333  C  CA  . GLU A 1 78  ? 14.812  96.265  5.859   0.25 15.82 ? 78  GLU A CA  2 
ATOM   3334  C  C   . GLU A 1 78  ? 13.925  95.317  6.640   0.25 14.74 ? 78  GLU A C   2 
ATOM   3335  O  O   . GLU A 1 78  ? 14.036  95.212  7.858   0.25 12.69 ? 78  GLU A O   2 
ATOM   3336  C  CB  . GLU A 1 78  ? 16.050  95.520  5.340   0.25 19.71 ? 78  GLU A CB  2 
ATOM   3337  C  CG  . GLU A 1 78  ? 16.969  94.965  6.407   0.25 24.36 ? 78  GLU A CG  2 
ATOM   3338  C  CD  . GLU A 1 78  ? 18.256  94.412  5.819   0.25 27.66 ? 78  GLU A CD  2 
ATOM   3339  O  OE1 . GLU A 1 78  ? 18.925  95.146  5.059   0.25 26.57 ? 78  GLU A OE1 2 
ATOM   3340  O  OE2 . GLU A 1 78  ? 18.598  93.248  6.116   0.25 27.27 ? 78  GLU A OE2 2 
ATOM   3341  N  N   . VAL A 1 79  ? 13.026  94.648  5.924   0.25 13.20 ? 79  VAL A N   2 
ATOM   3342  C  CA  . VAL A 1 79  ? 12.110  93.681  6.512   0.25 12.60 ? 79  VAL A CA  2 
ATOM   3343  C  C   . VAL A 1 79  ? 12.367  92.345  5.824   0.25 12.32 ? 79  VAL A C   2 
ATOM   3344  O  O   . VAL A 1 79  ? 12.666  92.305  4.624   0.25 12.03 ? 79  VAL A O   2 
ATOM   3345  C  CB  . VAL A 1 79  ? 10.626  94.086  6.268   0.25 14.87 ? 79  VAL A CB  2 
ATOM   3346  C  CG1 . VAL A 1 79  ? 9.690   92.930  6.622   0.25 12.57 ? 79  VAL A CG1 2 
ATOM   3347  C  CG2 . VAL A 1 79  ? 10.274  95.312  7.097   0.25 13.01 ? 79  VAL A CG2 2 
ATOM   3348  N  N   . TRP A 1 80  ? 12.269  91.256  6.580   0.25 11.20 ? 80  TRP A N   2 
ATOM   3349  C  CA  . TRP A 1 80  ? 12.458  89.927  6.007   0.25 10.87 ? 80  TRP A CA  2 
ATOM   3350  C  C   . TRP A 1 80  ? 11.128  89.180  6.024   0.25 11.09 ? 80  TRP A C   2 
ATOM   3351  O  O   . TRP A 1 80  ? 10.281  89.424  6.889   0.25 12.39 ? 80  TRP A O   2 
ATOM   3352  C  CB  . TRP A 1 80  ? 13.508  89.131  6.792   0.25 12.66 ? 80  TRP A CB  2 
ATOM   3353  C  CG  . TRP A 1 80  ? 14.929  89.559  6.542   0.25 11.76 ? 80  TRP A CG  2 
ATOM   3354  C  CD1 . TRP A 1 80  ? 15.587  90.608  7.117   0.25 12.65 ? 80  TRP A CD1 2 
ATOM   3355  C  CD2 . TRP A 1 80  ? 15.866  88.937  5.653   0.25 11.69 ? 80  TRP A CD2 2 
ATOM   3356  N  NE1 . TRP A 1 80  ? 16.878  90.677  6.647   0.25 13.11 ? 80  TRP A NE1 2 
ATOM   3357  C  CE2 . TRP A 1 80  ? 17.077  89.663  5.745   0.25 13.59 ? 80  TRP A CE2 2 
ATOM   3358  C  CE3 . TRP A 1 80  ? 15.802  87.837  4.785   0.25 13.99 ? 80  TRP A CE3 2 
ATOM   3359  C  CZ2 . TRP A 1 80  ? 18.217  89.324  5.004   0.25 11.63 ? 80  TRP A CZ2 2 
ATOM   3360  C  CZ3 . TRP A 1 80  ? 16.936  87.498  4.045   0.25 13.45 ? 80  TRP A CZ3 2 
ATOM   3361  C  CH2 . TRP A 1 80  ? 18.127  88.241  4.161   0.25 10.66 ? 80  TRP A CH2 2 
ATOM   3362  N  N   . GLY A 1 81  ? 10.937  88.273  5.071   0.25 10.59 ? 81  GLY A N   2 
ATOM   3363  C  CA  . GLY A 1 81  ? 9.698   87.525  5.041   0.25 10.70 ? 81  GLY A CA  2 
ATOM   3364  C  C   . GLY A 1 81  ? 9.747   86.248  4.234   0.25 10.91 ? 81  GLY A C   2 
ATOM   3365  O  O   . GLY A 1 81  ? 10.799  85.832  3.742   0.25 10.00 ? 81  GLY A O   2 
ATOM   3366  N  N   . VAL A 1 82  ? 8.587   85.621  4.104   0.25 10.58 ? 82  VAL A N   2 
ATOM   3367  C  CA  . VAL A 1 82  ? 8.465   84.382  3.355   0.25 10.79 ? 82  VAL A CA  2 
ATOM   3368  C  C   . VAL A 1 82  ? 7.709   84.637  2.068   0.25 10.64 ? 82  VAL A C   2 
ATOM   3369  O  O   . VAL A 1 82  ? 6.704   85.356  2.063   0.25 10.72 ? 82  VAL A O   2 
ATOM   3370  C  CB  . VAL A 1 82  ? 7.695   83.308  4.164   0.25 9.47  ? 82  VAL A CB  2 
ATOM   3371  C  CG1 . VAL A 1 82  ? 7.369   82.115  3.270   0.25 6.80  ? 82  VAL A CG1 2 
ATOM   3372  C  CG2 . VAL A 1 82  ? 8.531   82.862  5.369   0.25 7.12  ? 82  VAL A CG2 2 
ATOM   3373  N  N   . VAL A 1 83  ? 8.207   84.059  0.979   0.25 12.32 ? 83  VAL A N   2 
ATOM   3374  C  CA  . VAL A 1 83  ? 7.564   84.168  -0.325  0.25 11.18 ? 83  VAL A CA  2 
ATOM   3375  C  C   . VAL A 1 83  ? 6.793   82.863  -0.535  0.25 11.39 ? 83  VAL A C   2 
ATOM   3376  O  O   . VAL A 1 83  ? 7.337   81.773  -0.332  0.25 11.28 ? 83  VAL A O   2 
ATOM   3377  C  CB  . VAL A 1 83  ? 8.606   84.326  -1.462  0.25 12.77 ? 83  VAL A CB  2 
ATOM   3378  C  CG1 . VAL A 1 83  ? 7.904   84.330  -2.819  0.25 10.98 ? 83  VAL A CG1 2 
ATOM   3379  C  CG2 . VAL A 1 83  ? 9.389   85.621  -1.284  0.25 13.34 ? 83  VAL A CG2 2 
ATOM   3380  N  N   . TRP A 1 84  ? 5.524   82.977  -0.915  0.25 10.88 ? 84  TRP A N   2 
ATOM   3381  C  CA  . TRP A 1 84  ? 4.681   81.812  -1.156  0.25 9.20  ? 84  TRP A CA  2 
ATOM   3382  C  C   . TRP A 1 84  ? 4.271   81.750  -2.617  0.25 12.10 ? 84  TRP A C   2 
ATOM   3383  O  O   . TRP A 1 84  ? 4.071   82.785  -3.257  0.25 10.43 ? 84  TRP A O   2 
ATOM   3384  C  CB  . TRP A 1 84  ? 3.399   81.872  -0.319  0.25 9.32  ? 84  TRP A CB  2 
ATOM   3385  C  CG  . TRP A 1 84  ? 3.623   81.994  1.156   0.25 8.96  ? 84  TRP A CG  2 
ATOM   3386  C  CD1 . TRP A 1 84  ? 3.637   83.140  1.894   0.25 9.76  ? 84  TRP A CD1 2 
ATOM   3387  C  CD2 . TRP A 1 84  ? 3.897   80.925  2.065   0.25 11.11 ? 84  TRP A CD2 2 
ATOM   3388  N  NE1 . TRP A 1 84  ? 3.908   82.851  3.213   0.25 9.89  ? 84  TRP A NE1 2 
ATOM   3389  C  CE2 . TRP A 1 84  ? 4.072   81.496  3.343   0.25 9.37  ? 84  TRP A CE2 2 
ATOM   3390  C  CE3 . TRP A 1 84  ? 4.012   79.535  1.922   0.25 9.86  ? 84  TRP A CE3 2 
ATOM   3391  C  CZ2 . TRP A 1 84  ? 4.360   80.728  4.475   0.25 12.09 ? 84  TRP A CZ2 2 
ATOM   3392  C  CZ3 . TRP A 1 84  ? 4.299   78.772  3.046   0.25 12.27 ? 84  TRP A CZ3 2 
ATOM   3393  C  CH2 . TRP A 1 84  ? 4.471   79.374  4.308   0.25 7.14  ? 84  TRP A CH2 2 
ATOM   3394  N  N   . LYS A 1 85  ? 4.147   80.538  -3.147  0.25 13.18 ? 85  LYS A N   2 
ATOM   3395  C  CA  . LYS A 1 85  ? 3.713   80.379  -4.526  0.25 15.17 ? 85  LYS A CA  2 
ATOM   3396  C  C   . LYS A 1 85  ? 2.252   79.935  -4.514  0.25 14.69 ? 85  LYS A C   2 
ATOM   3397  O  O   . LYS A 1 85  ? 1.890   79.001  -3.806  0.25 13.54 ? 85  LYS A O   2 
ATOM   3398  C  CB  . LYS A 1 85  ? 4.564   79.335  -5.246  0.25 16.97 ? 85  LYS A CB  2 
ATOM   3399  C  CG  . LYS A 1 85  ? 4.102   79.057  -6.666  0.25 16.94 ? 85  LYS A CG  2 
ATOM   3400  C  CD  . LYS A 1 85  ? 4.928   77.951  -7.296  0.25 22.44 ? 85  LYS A CD  2 
ATOM   3401  C  CE  . LYS A 1 85  ? 4.431   77.614  -8.687  0.25 21.97 ? 85  LYS A CE  2 
ATOM   3402  N  NZ  . LYS A 1 85  ? 5.248   76.534  -9.304  0.25 27.57 ? 85  LYS A NZ  2 
HETATM 3403  N  N   . MSE A 1 86  ? 1.418   80.605  -5.298  0.25 15.03 ? 86  MSE A N   2 
HETATM 3404  C  CA  . MSE A 1 86  ? 0.000   80.269  -5.365  0.25 17.25 ? 86  MSE A CA  2 
HETATM 3405  C  C   . MSE A 1 86  ? -0.500  80.380  -6.792  0.25 18.90 ? 86  MSE A C   2 
HETATM 3406  O  O   . MSE A 1 86  ? 0.091   81.091  -7.603  0.25 16.18 ? 86  MSE A O   2 
HETATM 3407  C  CB  . MSE A 1 86  ? -0.809  81.213  -4.481  0.25 18.70 ? 86  MSE A CB  2 
HETATM 3408  C  CG  . MSE A 1 86  ? -0.676  80.947  -2.994  0.25 21.10 ? 86  MSE A CG  2 
HETATM 3409  SE SE  . MSE A 1 86  ? -1.422  82.387  -1.955  0.25 27.18 ? 86  MSE A SE  2 
HETATM 3410  C  CE  . MSE A 1 86  ? 0.233   83.212  -1.433  0.25 25.09 ? 86  MSE A CE  2 
ATOM   3411  N  N   . ASN A 1 87  ? -1.587  79.678  -7.100  0.25 21.11 ? 87  ASN A N   2 
ATOM   3412  C  CA  . ASN A 1 87  ? -2.145  79.742  -8.442  0.25 22.91 ? 87  ASN A CA  2 
ATOM   3413  C  C   . ASN A 1 87  ? -2.853  81.082  -8.582  0.25 21.66 ? 87  ASN A C   2 
ATOM   3414  O  O   . ASN A 1 87  ? -3.433  81.586  -7.616  0.25 19.14 ? 87  ASN A O   2 
ATOM   3415  C  CB  . ASN A 1 87  ? -3.136  78.602  -8.673  0.25 27.41 ? 87  ASN A CB  2 
ATOM   3416  C  CG  . ASN A 1 87  ? -3.672  78.581  -10.094 0.25 30.16 ? 87  ASN A CG  2 
ATOM   3417  O  OD1 . ASN A 1 87  ? -4.351  79.510  -10.527 0.25 31.60 ? 87  ASN A OD1 2 
ATOM   3418  N  ND2 . ASN A 1 87  ? -3.358  77.520  -10.829 0.25 32.61 ? 87  ASN A ND2 2 
ATOM   3419  N  N   . LYS A 1 88  ? -2.803  81.661  -9.777  0.25 21.00 ? 88  LYS A N   2 
ATOM   3420  C  CA  . LYS A 1 88  ? -3.440  82.951  -10.017 0.25 23.25 ? 88  LYS A CA  2 
ATOM   3421  C  C   . LYS A 1 88  ? -4.937  82.928  -9.737  0.25 23.35 ? 88  LYS A C   2 
ATOM   3422  O  O   . LYS A 1 88  ? -5.559  83.978  -9.591  0.25 21.64 ? 88  LYS A O   2 
ATOM   3423  C  CB  . LYS A 1 88  ? -3.184  83.420  -11.453 0.25 24.82 ? 88  LYS A CB  2 
ATOM   3424  C  CG  . LYS A 1 88  ? -1.763  83.903  -11.694 0.25 27.79 ? 88  LYS A CG  2 
ATOM   3425  C  CD  . LYS A 1 88  ? -1.595  84.440  -13.106 0.25 30.17 ? 88  LYS A CD  2 
ATOM   3426  C  CE  . LYS A 1 88  ? -0.177  84.924  -13.348 0.25 29.57 ? 88  LYS A CE  2 
ATOM   3427  N  NZ  . LYS A 1 88  ? 0.005   85.432  -14.734 0.25 33.29 ? 88  LYS A NZ  2 
ATOM   3428  N  N   . SER A 1 89  ? -5.513  81.733  -9.653  0.25 23.95 ? 89  SER A N   2 
ATOM   3429  C  CA  . SER A 1 89  ? -6.939  81.601  -9.376  0.25 24.68 ? 89  SER A CA  2 
ATOM   3430  C  C   . SER A 1 89  ? -7.283  82.134  -7.984  0.25 25.45 ? 89  SER A C   2 
ATOM   3431  O  O   . SER A 1 89  ? -8.328  82.754  -7.785  0.25 24.43 ? 89  SER A O   2 
ATOM   3432  C  CB  . SER A 1 89  ? -7.360  80.136  -9.466  0.25 25.30 ? 89  SER A CB  2 
ATOM   3433  O  OG  . SER A 1 89  ? -6.756  79.376  -8.433  0.25 25.30 ? 89  SER A OG  2 
ATOM   3434  N  N   . ASN A 1 90  ? -6.398  81.887  -7.023  0.25 24.65 ? 90  ASN A N   2 
ATOM   3435  C  CA  . ASN A 1 90  ? -6.611  82.330  -5.649  0.25 24.53 ? 90  ASN A CA  2 
ATOM   3436  C  C   . ASN A 1 90  ? -6.233  83.794  -5.454  0.25 22.79 ? 90  ASN A C   2 
ATOM   3437  O  O   . ASN A 1 90  ? -6.259  84.306  -4.336  0.25 22.02 ? 90  ASN A O   2 
ATOM   3438  C  CB  . ASN A 1 90  ? -5.799  81.456  -4.690  0.25 26.81 ? 90  ASN A CB  2 
ATOM   3439  C  CG  . ASN A 1 90  ? -6.279  80.015  -4.665  0.25 30.00 ? 90  ASN A CG  2 
ATOM   3440  O  OD1 . ASN A 1 90  ? -5.589  79.125  -4.165  0.25 30.51 ? 90  ASN A OD1 2 
ATOM   3441  N  ND2 . ASN A 1 90  ? -7.474  79.780  -5.200  0.25 31.16 ? 90  ASN A ND2 2 
ATOM   3442  N  N   . LEU A 1 91  ? -5.897  84.464  -6.551  0.25 21.78 ? 91  LEU A N   2 
ATOM   3443  C  CA  . LEU A 1 91  ? -5.497  85.866  -6.513  0.25 20.62 ? 91  LEU A CA  2 
ATOM   3444  C  C   . LEU A 1 91  ? -6.571  86.737  -5.855  0.25 21.38 ? 91  LEU A C   2 
ATOM   3445  O  O   . LEU A 1 91  ? -6.277  87.522  -4.949  0.25 20.19 ? 91  LEU A O   2 
ATOM   3446  C  CB  . LEU A 1 91  ? -5.210  86.348  -7.940  0.25 21.73 ? 91  LEU A CB  2 
ATOM   3447  C  CG  . LEU A 1 91  ? -4.267  87.532  -8.188  0.25 22.47 ? 91  LEU A CG  2 
ATOM   3448  C  CD1 . LEU A 1 91  ? -2.954  87.352  -7.441  0.25 22.51 ? 91  LEU A CD1 2 
ATOM   3449  C  CD2 . LEU A 1 91  ? -4.007  87.643  -9.686  0.25 23.17 ? 91  LEU A CD2 2 
ATOM   3450  N  N   . ASN A 1 92  ? -7.816  86.594  -6.298  0.25 19.04 ? 92  ASN A N   2 
ATOM   3451  C  CA  . ASN A 1 92  ? -8.910  87.375  -5.729  0.25 19.99 ? 92  ASN A CA  2 
ATOM   3452  C  C   . ASN A 1 92  ? -9.188  86.986  -4.289  0.25 18.32 ? 92  ASN A C   2 
ATOM   3453  O  O   . ASN A 1 92  ? -9.498  87.836  -3.455  0.25 17.46 ? 92  ASN A O   2 
ATOM   3454  C  CB  . ASN A 1 92  ? -10.185 87.206  -6.556  0.25 21.17 ? 92  ASN A CB  2 
ATOM   3455  C  CG  . ASN A 1 92  ? -10.066 87.829  -7.928  0.25 24.11 ? 92  ASN A CG  2 
ATOM   3456  O  OD1 . ASN A 1 92  ? -9.696  88.997  -8.060  0.25 23.54 ? 92  ASN A OD1 2 
ATOM   3457  N  ND2 . ASN A 1 92  ? -10.382 87.055  -8.959  0.25 23.59 ? 92  ASN A ND2 2 
ATOM   3458  N  N   . SER A 1 93  ? -9.086  85.696  -3.995  0.25 16.98 ? 93  SER A N   2 
ATOM   3459  C  CA  . SER A 1 93  ? -9.317  85.227  -2.640  0.25 16.18 ? 93  SER A CA  2 
ATOM   3460  C  C   . SER A 1 93  ? -8.272  85.830  -1.700  0.25 15.57 ? 93  SER A C   2 
ATOM   3461  O  O   . SER A 1 93  ? -8.589  86.232  -0.581  0.25 14.71 ? 93  SER A O   2 
ATOM   3462  C  CB  . SER A 1 93  ? -9.237  83.702  -2.586  0.25 16.78 ? 93  SER A CB  2 
ATOM   3463  O  OG  . SER A 1 93  ? -9.384  83.250  -1.252  0.25 19.31 ? 93  SER A OG  2 
ATOM   3464  N  N   . LEU A 1 94  ? -7.024  85.894  -2.158  0.25 14.28 ? 94  LEU A N   2 
ATOM   3465  C  CA  . LEU A 1 94  ? -5.962  86.443  -1.328  0.25 11.79 ? 94  LEU A CA  2 
ATOM   3466  C  C   . LEU A 1 94  ? -6.249  87.913  -1.043  0.25 11.21 ? 94  LEU A C   2 
ATOM   3467  O  O   . LEU A 1 94  ? -6.038  88.386  0.075   0.25 11.91 ? 94  LEU A O   2 
ATOM   3468  C  CB  . LEU A 1 94  ? -4.604  86.272  -2.017  0.25 12.35 ? 94  LEU A CB  2 
ATOM   3469  C  CG  . LEU A 1 94  ? -3.357  86.652  -1.206  0.25 12.77 ? 94  LEU A CG  2 
ATOM   3470  C  CD1 . LEU A 1 94  ? -3.293  85.830  0.071   0.25 13.00 ? 94  LEU A CD1 2 
ATOM   3471  C  CD2 . LEU A 1 94  ? -2.110  86.409  -2.047  0.25 12.05 ? 94  LEU A CD2 2 
ATOM   3472  N  N   . ASP A 1 95  ? -6.747  88.631  -2.047  0.25 13.13 ? 95  ASP A N   2 
ATOM   3473  C  CA  . ASP A 1 95  ? -7.081  90.046  -1.880  0.25 13.34 ? 95  ASP A CA  2 
ATOM   3474  C  C   . ASP A 1 95  ? -8.268  90.212  -0.925  0.25 13.83 ? 95  ASP A C   2 
ATOM   3475  O  O   . ASP A 1 95  ? -8.414  91.246  -0.268  0.25 9.89  ? 95  ASP A O   2 
ATOM   3476  C  CB  . ASP A 1 95  ? -7.423  90.686  -3.235  0.25 14.06 ? 95  ASP A CB  2 
ATOM   3477  C  CG  . ASP A 1 95  ? -6.197  90.893  -4.118  0.25 19.43 ? 95  ASP A CG  2 
ATOM   3478  O  OD1 . ASP A 1 95  ? -5.061  90.666  -3.639  0.25 12.84 ? 95  ASP A OD1 2 
ATOM   3479  O  OD2 . ASP A 1 95  ? -6.373  91.294  -5.294  0.25 18.68 ? 95  ASP A OD2 2 
ATOM   3480  N  N   . GLU A 1 96  ? -9.118  89.193  -0.850  0.25 13.54 ? 96  GLU A N   2 
ATOM   3481  C  CA  . GLU A 1 96  ? -10.284 89.250  0.035   0.25 16.31 ? 96  GLU A CA  2 
ATOM   3482  C  C   . GLU A 1 96  ? -9.830  89.143  1.492   0.25 13.69 ? 96  GLU A C   2 
ATOM   3483  O  O   . GLU A 1 96  ? -10.419 89.749  2.386   0.25 12.09 ? 96  GLU A O   2 
ATOM   3484  C  CB  . GLU A 1 96  ? -11.263 88.114  -0.311  0.25 20.20 ? 96  GLU A CB  2 
ATOM   3485  C  CG  . GLU A 1 96  ? -12.626 88.160  0.402   0.25 24.27 ? 96  GLU A CG  2 
ATOM   3486  C  CD  . GLU A 1 96  ? -12.569 87.725  1.870   0.25 27.68 ? 96  GLU A CD  2 
ATOM   3487  O  OE1 . GLU A 1 96  ? -11.699 86.896  2.221   0.25 25.86 ? 96  GLU A OE1 2 
ATOM   3488  O  OE2 . GLU A 1 96  ? -13.413 88.199  2.670   0.25 28.78 ? 96  GLU A OE2 2 
ATOM   3489  N  N   . GLN A 1 97  ? -8.765  88.385  1.720   0.25 14.17 ? 97  GLN A N   2 
ATOM   3490  C  CA  . GLN A 1 97  ? -8.220  88.195  3.063   0.25 15.61 ? 97  GLN A CA  2 
ATOM   3491  C  C   . GLN A 1 97  ? -7.475  89.431  3.576   0.25 16.48 ? 97  GLN A C   2 
ATOM   3492  O  O   . GLN A 1 97  ? -7.446  89.697  4.787   0.25 14.63 ? 97  GLN A O   2 
ATOM   3493  C  CB  . GLN A 1 97  ? -7.279  86.995  3.055   0.25 16.35 ? 97  GLN A CB  2 
ATOM   3494  C  CG  . GLN A 1 97  ? -7.953  85.714  2.595   0.25 17.78 ? 97  GLN A CG  2 
ATOM   3495  C  CD  . GLN A 1 97  ? -6.959  84.626  2.264   0.25 17.17 ? 97  GLN A CD  2 
ATOM   3496  O  OE1 . GLN A 1 97  ? -6.020  84.380  3.020   0.25 18.53 ? 97  GLN A OE1 2 
ATOM   3497  N  NE2 . GLN A 1 97  ? -7.164  83.961  1.131   0.25 13.82 ? 97  GLN A NE2 2 
ATOM   3498  N  N   . GLU A 1 98  ? -6.883  90.183  2.651   0.25 15.95 ? 98  GLU A N   2 
ATOM   3499  C  CA  . GLU A 1 98  ? -6.122  91.392  2.987   0.25 18.56 ? 98  GLU A CA  2 
ATOM   3500  C  C   . GLU A 1 98  ? -6.998  92.628  3.219   0.25 18.87 ? 98  GLU A C   2 
ATOM   3501  O  O   . GLU A 1 98  ? -6.486  93.701  3.539   0.25 21.04 ? 98  GLU A O   2 
ATOM   3502  C  CB  . GLU A 1 98  ? -5.116  91.703  1.874   0.25 20.16 ? 98  GLU A CB  2 
ATOM   3503  C  CG  . GLU A 1 98  ? -4.033  90.646  1.668   0.25 22.59 ? 98  GLU A CG  2 
ATOM   3504  C  CD  . GLU A 1 98  ? -3.099  90.511  2.862   0.25 25.37 ? 98  GLU A CD  2 
ATOM   3505  O  OE1 . GLU A 1 98  ? -2.867  91.526  3.558   0.25 24.10 ? 98  GLU A OE1 2 
ATOM   3506  O  OE2 . GLU A 1 98  ? -2.584  89.394  3.096   0.25 24.71 ? 98  GLU A OE2 2 
ATOM   3507  N  N   . GLY A 1 99  ? -8.307  92.481  3.036   0.25 18.76 ? 99  GLY A N   2 
ATOM   3508  C  CA  . GLY A 1 99  ? -9.221  93.593  3.247   0.25 17.10 ? 99  GLY A CA  2 
ATOM   3509  C  C   . GLY A 1 99  ? -9.130  94.733  2.246   0.25 16.83 ? 99  GLY A C   2 
ATOM   3510  O  O   . GLY A 1 99  ? -9.552  95.856  2.531   0.25 15.53 ? 99  GLY A O   2 
ATOM   3511  N  N   . VAL A 1 100 ? -8.588  94.454  1.068   0.25 17.32 ? 100 VAL A N   2 
ATOM   3512  C  CA  . VAL A 1 100 ? -8.463  95.480  0.043   0.25 17.86 ? 100 VAL A CA  2 
ATOM   3513  C  C   . VAL A 1 100 ? -9.818  96.133  -0.231  0.25 20.65 ? 100 VAL A C   2 
ATOM   3514  O  O   . VAL A 1 100 ? -9.953  97.355  -0.144  0.25 20.51 ? 100 VAL A O   2 
ATOM   3515  C  CB  . VAL A 1 100 ? -7.899  94.882  -1.261  0.25 16.72 ? 100 VAL A CB  2 
ATOM   3516  C  CG1 . VAL A 1 100 ? -7.772  95.964  -2.333  0.25 17.26 ? 100 VAL A CG1 2 
ATOM   3517  C  CG2 . VAL A 1 100 ? -6.539  94.250  -0.981  0.25 17.62 ? 100 VAL A CG2 2 
ATOM   3518  N  N   . LYS A 1 101 ? -10.825 95.317  -0.537  0.25 22.82 ? 101 LYS A N   2 
ATOM   3519  C  CA  . LYS A 1 101 ? -12.160 95.835  -0.825  0.25 25.97 ? 101 LYS A CA  2 
ATOM   3520  C  C   . LYS A 1 101 ? -12.682 96.755  0.269   0.25 25.85 ? 101 LYS A C   2 
ATOM   3521  O  O   . LYS A 1 101 ? -13.269 97.797  -0.018  0.25 27.07 ? 101 LYS A O   2 
ATOM   3522  C  CB  . LYS A 1 101 ? -13.154 94.688  -1.053  0.25 27.60 ? 101 LYS A CB  2 
ATOM   3523  C  CG  . LYS A 1 101 ? -13.005 94.009  -2.408  0.25 30.86 ? 101 LYS A CG  2 
ATOM   3524  C  CD  . LYS A 1 101 ? -14.165 93.061  -2.707  0.25 33.67 ? 101 LYS A CD  2 
ATOM   3525  C  CE  . LYS A 1 101 ? -14.001 92.397  -4.076  0.25 33.79 ? 101 LYS A CE  2 
ATOM   3526  N  NZ  . LYS A 1 101 ? -15.180 91.567  -4.475  0.25 33.32 ? 101 LYS A NZ  2 
ATOM   3527  N  N   . SER A 1 102 ? -12.456 96.377  1.521   0.25 25.35 ? 102 SER A N   2 
ATOM   3528  C  CA  . SER A 1 102 ? -12.911 97.176  2.652   0.25 23.86 ? 102 SER A CA  2 
ATOM   3529  C  C   . SER A 1 102 ? -11.904 98.242  3.073   0.25 23.04 ? 102 SER A C   2 
ATOM   3530  O  O   . SER A 1 102 ? -12.020 98.820  4.152   0.25 22.86 ? 102 SER A O   2 
ATOM   3531  C  CB  . SER A 1 102 ? -13.230 96.267  3.841   0.25 23.95 ? 102 SER A CB  2 
ATOM   3532  O  OG  . SER A 1 102 ? -12.166 95.365  4.088   0.25 25.36 ? 102 SER A OG  2 
ATOM   3533  N  N   . GLY A 1 103 ? -10.912 98.490  2.222   0.25 20.23 ? 103 GLY A N   2 
ATOM   3534  C  CA  . GLY A 1 103 ? -9.911  99.498  2.518   0.25 17.18 ? 103 GLY A CA  2 
ATOM   3535  C  C   . GLY A 1 103 ? -8.977  99.198  3.676   0.25 15.28 ? 103 GLY A C   2 
ATOM   3536  O  O   . GLY A 1 103 ? -8.657  100.096 4.460   0.25 15.75 ? 103 GLY A O   2 
HETATM 3537  N  N   . MSE A 1 104 ? -8.530  97.951  3.792   0.25 12.09 ? 104 MSE A N   2 
HETATM 3538  C  CA  . MSE A 1 104 ? -7.616  97.586  4.871   0.25 12.12 ? 104 MSE A CA  2 
HETATM 3539  C  C   . MSE A 1 104 ? -6.172  97.788  4.417   0.25 11.96 ? 104 MSE A C   2 
HETATM 3540  O  O   . MSE A 1 104 ? -5.387  98.462  5.087   0.25 12.43 ? 104 MSE A O   2 
HETATM 3541  C  CB  . MSE A 1 104 ? -7.833  96.127  5.296   0.25 11.60 ? 104 MSE A CB  2 
HETATM 3542  C  CG  . MSE A 1 104 ? -7.144  95.766  6.608   0.25 11.84 ? 104 MSE A CG  2 
HETATM 3543  SE SE  . MSE A 1 104 ? -7.644  94.033  7.338   0.25 13.45 ? 104 MSE A SE  2 
HETATM 3544  C  CE  . MSE A 1 104 ? -9.551  94.292  7.410   0.25 13.08 ? 104 MSE A CE  2 
ATOM   3545  N  N   . TYR A 1 105 ? -5.830  97.193  3.281   0.25 10.87 ? 105 TYR A N   2 
ATOM   3546  C  CA  . TYR A 1 105 ? -4.483  97.307  2.715   0.25 9.64  ? 105 TYR A CA  2 
ATOM   3547  C  C   . TYR A 1 105 ? -4.585  97.679  1.249   0.25 8.70  ? 105 TYR A C   2 
ATOM   3548  O  O   . TYR A 1 105 ? -5.661  97.602  0.658   0.25 9.79  ? 105 TYR A O   2 
ATOM   3549  C  CB  . TYR A 1 105 ? -3.729  95.974  2.775   0.25 8.44  ? 105 TYR A CB  2 
ATOM   3550  C  CG  . TYR A 1 105 ? -3.228  95.539  4.131   0.25 7.84  ? 105 TYR A CG  2 
ATOM   3551  C  CD1 . TYR A 1 105 ? -4.105  95.066  5.100   0.25 9.98  ? 105 TYR A CD1 2 
ATOM   3552  C  CD2 . TYR A 1 105 ? -1.863  95.553  4.426   0.25 7.60  ? 105 TYR A CD2 2 
ATOM   3553  C  CE1 . TYR A 1 105 ? -3.645  94.611  6.330   0.25 9.85  ? 105 TYR A CE1 2 
ATOM   3554  C  CE2 . TYR A 1 105 ? -1.389  95.100  5.658   0.25 9.12  ? 105 TYR A CE2 2 
ATOM   3555  C  CZ  . TYR A 1 105 ? -2.291  94.629  6.603   0.25 9.25  ? 105 TYR A CZ  2 
ATOM   3556  O  OH  . TYR A 1 105 ? -1.842  94.172  7.824   0.25 11.76 ? 105 TYR A OH  2 
ATOM   3557  N  N   . VAL A 1 106 ? -3.455  98.073  0.670   0.25 5.99  ? 106 VAL A N   2 
ATOM   3558  C  CA  . VAL A 1 106 ? -3.387  98.388  -0.747  0.25 6.75  ? 106 VAL A CA  2 
ATOM   3559  C  C   . VAL A 1 106 ? -2.437  97.345  -1.349  0.25 8.13  ? 106 VAL A C   2 
ATOM   3560  O  O   . VAL A 1 106 ? -1.354  97.088  -0.801  0.25 8.24  ? 106 VAL A O   2 
ATOM   3561  C  CB  . VAL A 1 106 ? -2.845  99.829  -1.003  0.25 6.32  ? 106 VAL A CB  2 
ATOM   3562  C  CG1 . VAL A 1 106 ? -1.367  99.923  -0.639  0.25 7.51  ? 106 VAL A CG1 2 
ATOM   3563  C  CG2 . VAL A 1 106 ? -3.066  100.214 -2.476  0.25 8.16  ? 106 VAL A CG2 2 
ATOM   3564  N  N   . VAL A 1 107 ? -2.859  96.713  -2.443  0.25 5.51  ? 107 VAL A N   2 
ATOM   3565  C  CA  . VAL A 1 107 ? -2.031  95.710  -3.110  0.25 8.69  ? 107 VAL A CA  2 
ATOM   3566  C  C   . VAL A 1 107 ? -0.820  96.352  -3.790  0.25 9.01  ? 107 VAL A C   2 
ATOM   3567  O  O   . VAL A 1 107 ? -0.973  97.120  -4.737  0.25 9.25  ? 107 VAL A O   2 
ATOM   3568  C  CB  . VAL A 1 107 ? -2.818  94.959  -4.209  0.25 9.15  ? 107 VAL A CB  2 
ATOM   3569  C  CG1 . VAL A 1 107 ? -1.963  93.826  -4.768  0.25 10.80 ? 107 VAL A CG1 2 
ATOM   3570  C  CG2 . VAL A 1 107 ? -4.139  94.415  -3.655  0.25 9.71  ? 107 VAL A CG2 2 
ATOM   3571  N  N   . ILE A 1 108 ? 0.381   96.039  -3.320  0.25 7.02  ? 108 ILE A N   2 
ATOM   3572  C  CA  . ILE A 1 108 ? 1.576   96.595  -3.947  0.25 5.66  ? 108 ILE A CA  2 
ATOM   3573  C  C   . ILE A 1 108 ? 2.324   95.491  -4.671  0.25 6.25  ? 108 ILE A C   2 
ATOM   3574  O  O   . ILE A 1 108 ? 1.862   94.352  -4.756  0.25 5.20  ? 108 ILE A O   2 
ATOM   3575  C  CB  . ILE A 1 108 ? 2.572   97.197  -2.920  0.25 5.40  ? 108 ILE A CB  2 
ATOM   3576  C  CG1 . ILE A 1 108 ? 3.108   96.092  -2.002  0.25 4.32  ? 108 ILE A CG1 2 
ATOM   3577  C  CG2 . ILE A 1 108 ? 1.908   98.305  -2.115  0.25 1.55  ? 108 ILE A CG2 2 
ATOM   3578  C  CD1 . ILE A 1 108 ? 4.075   96.594  -0.925  0.25 3.74  ? 108 ILE A CD1 2 
ATOM   3579  N  N   . GLU A 1 109 ? 3.485   95.867  -5.195  0.25 9.06  ? 109 GLU A N   2 
ATOM   3580  C  CA  . GLU A 1 109 ? 4.403   94.966  -5.873  0.25 10.25 ? 109 GLU A CA  2 
ATOM   3581  C  C   . GLU A 1 109 ? 5.757   95.373  -5.322  0.25 10.15 ? 109 GLU A C   2 
ATOM   3582  O  O   . GLU A 1 109 ? 6.026   96.560  -5.139  0.25 8.83  ? 109 GLU A O   2 
ATOM   3583  C  CB  . GLU A 1 109 ? 4.398   95.181  -7.386  0.25 12.14 ? 109 GLU A CB  2 
ATOM   3584  C  CG  . GLU A 1 109 ? 5.521   94.440  -8.103  0.25 13.04 ? 109 GLU A CG  2 
ATOM   3585  C  CD  . GLU A 1 109 ? 5.535   94.688  -9.603  0.25 16.21 ? 109 GLU A CD  2 
ATOM   3586  O  OE1 . GLU A 1 109 ? 4.586   94.259  -10.289 0.25 16.09 ? 109 GLU A OE1 2 
ATOM   3587  O  OE2 . GLU A 1 109 ? 6.493   95.318  -10.096 0.25 16.84 ? 109 GLU A OE2 2 
ATOM   3588  N  N   . VAL A 1 110 ? 6.600   94.389  -5.038  0.25 10.36 ? 110 VAL A N   2 
ATOM   3589  C  CA  . VAL A 1 110 ? 7.929   94.660  -4.518  0.25 10.65 ? 110 VAL A CA  2 
ATOM   3590  C  C   . VAL A 1 110 ? 8.903   93.614  -5.029  0.25 11.05 ? 110 VAL A C   2 
ATOM   3591  O  O   . VAL A 1 110 ? 8.509   92.537  -5.469  0.25 12.28 ? 110 VAL A O   2 
ATOM   3592  C  CB  . VAL A 1 110 ? 7.975   94.621  -2.971  0.25 11.74 ? 110 VAL A CB  2 
ATOM   3593  C  CG1 . VAL A 1 110 ? 7.148   95.743  -2.386  0.25 8.31  ? 110 VAL A CG1 2 
ATOM   3594  C  CG2 . VAL A 1 110 ? 7.486   93.275  -2.470  0.25 8.71  ? 110 VAL A CG2 2 
ATOM   3595  N  N   . LYS A 1 111 ? 10.182  93.952  -4.978  0.25 12.99 ? 111 LYS A N   2 
ATOM   3596  C  CA  . LYS A 1 111 ? 11.225  93.040  -5.396  0.25 13.78 ? 111 LYS A CA  2 
ATOM   3597  C  C   . LYS A 1 111 ? 12.042  92.794  -4.147  0.25 14.30 ? 111 LYS A C   2 
ATOM   3598  O  O   . LYS A 1 111 ? 12.498  93.740  -3.502  0.25 14.18 ? 111 LYS A O   2 
ATOM   3599  C  CB  . LYS A 1 111 ? 12.065  93.669  -6.511  0.25 16.30 ? 111 LYS A CB  2 
ATOM   3600  C  CG  . LYS A 1 111 ? 11.267  93.823  -7.809  0.25 16.57 ? 111 LYS A CG  2 
ATOM   3601  C  CD  . LYS A 1 111 ? 12.074  94.442  -8.932  0.25 21.35 ? 111 LYS A CD  2 
ATOM   3602  C  CE  . LYS A 1 111 ? 11.226  94.520  -10.197 0.25 20.96 ? 111 LYS A CE  2 
ATOM   3603  N  NZ  . LYS A 1 111 ? 11.908  95.225  -11.309 0.25 24.03 ? 111 LYS A NZ  2 
ATOM   3604  N  N   . VAL A 1 112 ? 12.178  91.521  -3.784  0.25 14.30 ? 112 VAL A N   2 
ATOM   3605  C  CA  . VAL A 1 112 ? 12.927  91.125  -2.599  0.25 13.42 ? 112 VAL A CA  2 
ATOM   3606  C  C   . VAL A 1 112 ? 14.209  90.397  -2.988  0.25 15.17 ? 112 VAL A C   2 
ATOM   3607  O  O   . VAL A 1 112 ? 14.380  89.996  -4.141  0.25 13.11 ? 112 VAL A O   2 
ATOM   3608  C  CB  . VAL A 1 112 ? 12.084  90.212  -1.697  0.25 12.37 ? 112 VAL A CB  2 
ATOM   3609  C  CG1 . VAL A 1 112 ? 10.932  91.008  -1.093  0.25 13.50 ? 112 VAL A CG1 2 
ATOM   3610  C  CG2 . VAL A 1 112 ? 11.539  89.046  -2.510  0.25 12.61 ? 112 VAL A CG2 2 
ATOM   3611  N  N   . ALA A 1 113 ? 15.104  90.219  -2.021  0.25 15.12 ? 113 ALA A N   2 
ATOM   3612  C  CA  . ALA A 1 113 ? 16.375  89.554  -2.289  0.25 15.69 ? 113 ALA A CA  2 
ATOM   3613  C  C   . ALA A 1 113 ? 16.578  88.309  -1.441  0.25 15.37 ? 113 ALA A C   2 
ATOM   3614  O  O   . ALA A 1 113 ? 16.422  88.345  -0.220  0.25 16.52 ? 113 ALA A O   2 
ATOM   3615  C  CB  . ALA A 1 113 ? 17.520  90.527  -2.062  0.25 12.95 ? 113 ALA A CB  2 
ATOM   3616  N  N   . THR A 1 114 ? 16.928  87.210  -2.102  0.25 16.45 ? 114 THR A N   2 
ATOM   3617  C  CA  . THR A 1 114 ? 17.170  85.942  -1.429  0.25 17.60 ? 114 THR A CA  2 
ATOM   3618  C  C   . THR A 1 114 ? 18.554  85.983  -0.789  0.25 19.88 ? 114 THR A C   2 
ATOM   3619  O  O   . THR A 1 114 ? 19.204  87.029  -0.760  0.25 17.98 ? 114 THR A O   2 
ATOM   3620  C  CB  . THR A 1 114 ? 17.136  84.769  -2.422  0.25 16.43 ? 114 THR A CB  2 
ATOM   3621  O  OG1 . THR A 1 114 ? 18.323  84.788  -3.228  0.25 15.31 ? 114 THR A OG1 2 
ATOM   3622  C  CG2 . THR A 1 114 ? 15.922  84.877  -3.325  0.25 14.02 ? 114 THR A CG2 2 
ATOM   3623  N  N   . GLN A 1 115 ? 19.000  84.838  -0.285  0.25 21.36 ? 115 GLN A N   2 
ATOM   3624  C  CA  . GLN A 1 115 ? 20.308  84.743  0.348   0.25 24.04 ? 115 GLN A CA  2 
ATOM   3625  C  C   . GLN A 1 115 ? 21.416  84.583  -0.686  0.25 23.49 ? 115 GLN A C   2 
ATOM   3626  O  O   . GLN A 1 115 ? 22.599  84.554  -0.346  0.25 24.07 ? 115 GLN A O   2 
ATOM   3627  C  CB  . GLN A 1 115 ? 20.330  83.572  1.326   0.25 26.91 ? 115 GLN A CB  2 
ATOM   3628  C  CG  . GLN A 1 115 ? 19.421  83.767  2.521   0.25 32.29 ? 115 GLN A CG  2 
ATOM   3629  C  CD  . GLN A 1 115 ? 19.359  82.542  3.402   0.25 34.64 ? 115 GLN A CD  2 
ATOM   3630  O  OE1 . GLN A 1 115 ? 20.387  82.049  3.868   0.25 33.91 ? 115 GLN A OE1 2 
ATOM   3631  N  NE2 . GLN A 1 115 ? 18.148  82.042  3.640   0.25 36.34 ? 115 GLN A NE2 2 
ATOM   3632  N  N   . GLU A 1 116 ? 21.023  84.478  -1.950  0.25 23.88 ? 116 GLU A N   2 
ATOM   3633  C  CA  . GLU A 1 116 ? 21.978  84.346  -3.046  0.25 24.14 ? 116 GLU A CA  2 
ATOM   3634  C  C   . GLU A 1 116 ? 22.018  85.643  -3.850  0.25 22.66 ? 116 GLU A C   2 
ATOM   3635  O  O   . GLU A 1 116 ? 22.583  85.697  -4.947  0.25 20.89 ? 116 GLU A O   2 
ATOM   3636  C  CB  . GLU A 1 116 ? 21.585  83.182  -3.957  0.25 25.67 ? 116 GLU A CB  2 
ATOM   3637  C  CG  . GLU A 1 116 ? 21.978  81.814  -3.412  0.25 32.78 ? 116 GLU A CG  2 
ATOM   3638  C  CD  . GLU A 1 116 ? 21.416  81.548  -2.031  0.25 32.99 ? 116 GLU A CD  2 
ATOM   3639  O  OE1 . GLU A 1 116 ? 20.177  81.523  -1.886  0.25 35.40 ? 116 GLU A OE1 2 
ATOM   3640  O  OE2 . GLU A 1 116 ? 22.217  81.365  -1.090  0.25 33.73 ? 116 GLU A OE2 2 
ATOM   3641  N  N   . GLY A 1 117 ? 21.403  86.682  -3.294  0.25 22.15 ? 117 GLY A N   2 
ATOM   3642  C  CA  . GLY A 1 117 ? 21.377  87.976  -3.952  0.25 21.57 ? 117 GLY A CA  2 
ATOM   3643  C  C   . GLY A 1 117 ? 20.383  88.090  -5.093  0.25 22.00 ? 117 GLY A C   2 
ATOM   3644  O  O   . GLY A 1 117 ? 20.199  89.177  -5.644  0.25 22.20 ? 117 GLY A O   2 
ATOM   3645  N  N   . LYS A 1 118 ? 19.735  86.984  -5.448  0.25 21.97 ? 118 LYS A N   2 
ATOM   3646  C  CA  . LYS A 1 118 ? 18.771  87.001  -6.543  0.25 23.86 ? 118 LYS A CA  2 
ATOM   3647  C  C   . LYS A 1 118 ? 17.560  87.868  -6.210  0.25 23.69 ? 118 LYS A C   2 
ATOM   3648  O  O   . LYS A 1 118 ? 17.155  87.978  -5.052  0.25 22.92 ? 118 LYS A O   2 
ATOM   3649  C  CB  . LYS A 1 118 ? 18.319  85.579  -6.884  0.25 27.69 ? 118 LYS A CB  2 
ATOM   3650  C  CG  . LYS A 1 118 ? 17.439  85.499  -8.125  0.25 32.46 ? 118 LYS A CG  2 
ATOM   3651  C  CD  . LYS A 1 118 ? 17.090  84.064  -8.482  0.25 36.64 ? 118 LYS A CD  2 
ATOM   3652  C  CE  . LYS A 1 118 ? 16.184  84.004  -9.708  0.25 39.19 ? 118 LYS A CE  2 
ATOM   3653  N  NZ  . LYS A 1 118 ? 15.853  82.604  -10.112 0.25 42.49 ? 118 LYS A NZ  2 
ATOM   3654  N  N   . GLU A 1 119 ? 16.977  88.476  -7.235  0.25 22.95 ? 119 GLU A N   2 
ATOM   3655  C  CA  . GLU A 1 119 ? 15.829  89.342  -7.038  0.25 24.87 ? 119 GLU A CA  2 
ATOM   3656  C  C   . GLU A 1 119 ? 14.532  88.660  -7.451  0.25 22.45 ? 119 GLU A C   2 
ATOM   3657  O  O   . GLU A 1 119 ? 14.424  88.113  -8.545  0.25 20.23 ? 119 GLU A O   2 
ATOM   3658  C  CB  . GLU A 1 119 ? 16.029  90.642  -7.823  0.25 27.39 ? 119 GLU A CB  2 
ATOM   3659  C  CG  . GLU A 1 119 ? 14.975  91.699  -7.569  0.25 33.05 ? 119 GLU A CG  2 
ATOM   3660  C  CD  . GLU A 1 119 ? 15.465  93.094  -7.916  0.25 34.82 ? 119 GLU A CD  2 
ATOM   3661  O  OE1 . GLU A 1 119 ? 16.360  93.603  -7.208  0.25 36.84 ? 119 GLU A OE1 2 
ATOM   3662  O  OE2 . GLU A 1 119 ? 14.961  93.679  -8.897  0.25 35.85 ? 119 GLU A OE2 2 
ATOM   3663  N  N   . ILE A 1 120 ? 13.552  88.693  -6.557  0.25 21.56 ? 120 ILE A N   2 
ATOM   3664  C  CA  . ILE A 1 120 ? 12.253  88.083  -6.814  0.25 20.67 ? 120 ILE A CA  2 
ATOM   3665  C  C   . ILE A 1 120 ? 11.169  89.160  -6.788  0.25 19.57 ? 120 ILE A C   2 
ATOM   3666  O  O   . ILE A 1 120 ? 11.111  89.964  -5.853  0.25 19.04 ? 120 ILE A O   2 
ATOM   3667  C  CB  . ILE A 1 120 ? 11.921  87.022  -5.738  0.25 21.95 ? 120 ILE A CB  2 
ATOM   3668  C  CG1 . ILE A 1 120 ? 13.008  85.950  -5.709  0.25 23.48 ? 120 ILE A CG1 2 
ATOM   3669  C  CG2 . ILE A 1 120 ? 10.565  86.399  -6.016  0.25 21.68 ? 120 ILE A CG2 2 
ATOM   3670  C  CD1 . ILE A 1 120 ? 12.840  84.956  -4.590  0.25 26.38 ? 120 ILE A CD1 2 
ATOM   3671  N  N   . THR A 1 121 ? 10.323  89.177  -7.816  0.25 15.63 ? 121 THR A N   2 
ATOM   3672  C  CA  . THR A 1 121 ? 9.238   90.150  -7.899  0.25 15.03 ? 121 THR A CA  2 
ATOM   3673  C  C   . THR A 1 121 ? 7.944   89.473  -7.471  0.25 14.74 ? 121 THR A C   2 
ATOM   3674  O  O   . THR A 1 121 ? 7.523   88.483  -8.068  0.25 14.12 ? 121 THR A O   2 
ATOM   3675  C  CB  . THR A 1 121 ? 9.061   90.689  -9.333  0.25 13.87 ? 121 THR A CB  2 
ATOM   3676  O  OG1 . THR A 1 121 ? 10.295  91.246  -9.790  0.25 12.37 ? 121 THR A OG1 2 
ATOM   3677  C  CG2 . THR A 1 121 ? 7.993   91.775  -9.367  0.25 10.70 ? 121 THR A CG2 2 
ATOM   3678  N  N   . CYS A 1 122 ? 7.305   90.008  -6.438  0.25 13.73 ? 122 CYS A N   2 
ATOM   3679  C  CA  . CYS A 1 122 ? 6.076   89.404  -5.950  0.25 12.15 ? 122 CYS A CA  2 
ATOM   3680  C  C   . CYS A 1 122 ? 5.040   90.368  -5.403  0.25 11.16 ? 122 CYS A C   2 
ATOM   3681  O  O   . CYS A 1 122 ? 5.359   91.458  -4.919  0.25 11.25 ? 122 CYS A O   2 
ATOM   3682  C  CB  . CYS A 1 122 ? 6.410   88.362  -4.885  0.25 14.71 ? 122 CYS A CB  2 
ATOM   3683  S  SG  . CYS A 1 122 ? 7.953   88.692  -3.996  0.25 16.93 ? 122 CYS A SG  2 
ATOM   3684  N  N   . ARG A 1 123 ? 3.786   89.941  -5.483  0.25 8.15  ? 123 ARG A N   2 
ATOM   3685  C  CA  . ARG A 1 123 ? 2.671   90.723  -4.985  0.25 8.09  ? 123 ARG A CA  2 
ATOM   3686  C  C   . ARG A 1 123 ? 2.814   90.861  -3.465  0.25 8.52  ? 123 ARG A C   2 
ATOM   3687  O  O   . ARG A 1 123 ? 3.360   89.976  -2.792  0.25 6.71  ? 123 ARG A O   2 
ATOM   3688  C  CB  . ARG A 1 123 ? 1.371   89.995  -5.325  0.25 10.65 ? 123 ARG A CB  2 
ATOM   3689  C  CG  . ARG A 1 123 ? 0.086   90.783  -5.135  0.25 11.67 ? 123 ARG A CG  2 
ATOM   3690  C  CD  . ARG A 1 123 ? -1.096  89.850  -5.366  0.25 10.37 ? 123 ARG A CD  2 
ATOM   3691  N  NE  . ARG A 1 123 ? -2.365  90.551  -5.538  0.25 10.71 ? 123 ARG A NE  2 
ATOM   3692  C  CZ  . ARG A 1 123 ? -2.699  91.228  -6.631  0.25 12.55 ? 123 ARG A CZ  2 
ATOM   3693  N  NH1 . ARG A 1 123 ? -1.856  91.301  -7.654  0.25 11.97 ? 123 ARG A NH1 2 
ATOM   3694  N  NH2 . ARG A 1 123 ? -3.879  91.828  -6.707  0.25 14.00 ? 123 ARG A NH2 2 
ATOM   3695  N  N   . SER A 1 124 ? 2.337   91.983  -2.936  0.25 7.58  ? 124 SER A N   2 
ATOM   3696  C  CA  . SER A 1 124 ? 2.358   92.241  -1.503  0.25 6.62  ? 124 SER A CA  2 
ATOM   3697  C  C   . SER A 1 124 ? 1.239   93.212  -1.164  0.25 6.40  ? 124 SER A C   2 
ATOM   3698  O  O   . SER A 1 124 ? 0.496   93.654  -2.049  0.25 5.63  ? 124 SER A O   2 
ATOM   3699  C  CB  . SER A 1 124 ? 3.698   92.821  -1.053  0.25 5.62  ? 124 SER A CB  2 
ATOM   3700  O  OG  . SER A 1 124 ? 4.698   91.825  -1.064  0.25 9.05  ? 124 SER A OG  2 
ATOM   3701  N  N   . TYR A 1 125 ? 1.139   93.548  0.117   0.25 3.88  ? 125 TYR A N   2 
ATOM   3702  C  CA  . TYR A 1 125 ? 0.091   94.434  0.607   0.25 7.09  ? 125 TYR A CA  2 
ATOM   3703  C  C   . TYR A 1 125 ? 0.601   95.253  1.786   0.25 5.77  ? 125 TYR A C   2 
ATOM   3704  O  O   . TYR A 1 125 ? 1.350   94.738  2.617   0.25 7.51  ? 125 TYR A O   2 
ATOM   3705  C  CB  . TYR A 1 125 ? -1.091  93.591  1.091   0.25 7.37  ? 125 TYR A CB  2 
ATOM   3706  C  CG  . TYR A 1 125 ? -1.543  92.536  0.106   0.25 9.59  ? 125 TYR A CG  2 
ATOM   3707  C  CD1 . TYR A 1 125 ? -2.518  92.822  -0.846  0.25 8.45  ? 125 TYR A CD1 2 
ATOM   3708  C  CD2 . TYR A 1 125 ? -0.982  91.251  0.118   0.25 8.13  ? 125 TYR A CD2 2 
ATOM   3709  C  CE1 . TYR A 1 125 ? -2.932  91.857  -1.768  0.25 8.79  ? 125 TYR A CE1 2 
ATOM   3710  C  CE2 . TYR A 1 125 ? -1.386  90.280  -0.800  0.25 8.01  ? 125 TYR A CE2 2 
ATOM   3711  C  CZ  . TYR A 1 125 ? -2.360  90.591  -1.739  0.25 8.33  ? 125 TYR A CZ  2 
ATOM   3712  O  OH  . TYR A 1 125 ? -2.749  89.649  -2.659  0.25 5.73  ? 125 TYR A OH  2 
ATOM   3713  N  N   . LEU A 1 126 ? 0.206   96.521  1.857   0.25 5.98  ? 126 LEU A N   2 
ATOM   3714  C  CA  . LEU A 1 126 ? 0.581   97.368  2.992   0.25 7.41  ? 126 LEU A CA  2 
ATOM   3715  C  C   . LEU A 1 126 ? -0.594  98.281  3.307   0.25 8.10  ? 126 LEU A C   2 
ATOM   3716  O  O   . LEU A 1 126 ? -1.530  98.394  2.506   0.25 6.45  ? 126 LEU A O   2 
ATOM   3717  C  CB  . LEU A 1 126 ? 1.851   98.192  2.700   0.25 7.44  ? 126 LEU A CB  2 
ATOM   3718  C  CG  . LEU A 1 126 ? 1.899   99.229  1.573   0.25 8.86  ? 126 LEU A CG  2 
ATOM   3719  C  CD1 . LEU A 1 126 ? 1.057   100.448 1.931   0.25 8.53  ? 126 LEU A CD1 2 
ATOM   3720  C  CD2 . LEU A 1 126 ? 3.346   99.638  1.345   0.25 8.91  ? 126 LEU A CD2 2 
HETATM 3721  N  N   . MSE A 1 127 ? -0.564  98.909  4.478   0.25 7.95  ? 127 MSE A N   2 
HETATM 3722  C  CA  . MSE A 1 127 ? -1.632  99.818  4.873   0.25 9.89  ? 127 MSE A CA  2 
HETATM 3723  C  C   . MSE A 1 127 ? -1.241  101.258 4.572   0.25 9.32  ? 127 MSE A C   2 
HETATM 3724  O  O   . MSE A 1 127 ? -0.067  101.608 4.639   0.25 8.95  ? 127 MSE A O   2 
HETATM 3725  C  CB  . MSE A 1 127 ? -1.925  99.684  6.365   0.25 11.98 ? 127 MSE A CB  2 
HETATM 3726  C  CG  . MSE A 1 127 ? -2.288  98.287  6.802   0.25 11.38 ? 127 MSE A CG  2 
HETATM 3727  SE SE  . MSE A 1 127 ? -3.005  98.359  8.579   0.25 23.89 ? 127 MSE A SE  2 
HETATM 3728  C  CE  . MSE A 1 127 ? -1.412  98.895  9.485   0.25 11.59 ? 127 MSE A CE  2 
ATOM   3729  N  N   . THR A 1 128 ? -2.230  102.088 4.251   0.25 8.46  ? 128 THR A N   2 
ATOM   3730  C  CA  . THR A 1 128 ? -1.980  103.491 3.947   0.25 8.53  ? 128 THR A CA  2 
ATOM   3731  C  C   . THR A 1 128 ? -2.752  104.382 4.917   0.25 10.40 ? 128 THR A C   2 
ATOM   3732  O  O   . THR A 1 128 ? -2.383  105.527 5.160   0.25 10.99 ? 128 THR A O   2 
ATOM   3733  C  CB  . THR A 1 128 ? -2.432  103.844 2.522   0.25 9.29  ? 128 THR A CB  2 
ATOM   3734  O  OG1 . THR A 1 128 ? -3.852  103.690 2.429   0.25 8.43  ? 128 THR A OG1 2 
ATOM   3735  C  CG2 . THR A 1 128 ? -1.757  102.941 1.494   0.25 10.26 ? 128 THR A CG2 2 
ATOM   3736  N  N   . ASN A 1 129 ? -3.825  103.845 5.479   0.25 12.72 ? 129 ASN A N   2 
ATOM   3737  C  CA  . ASN A 1 129 ? -4.651  104.609 6.404   0.25 14.20 ? 129 ASN A CA  2 
ATOM   3738  C  C   . ASN A 1 129 ? -4.797  103.811 7.686   0.25 15.25 ? 129 ASN A C   2 
ATOM   3739  O  O   . ASN A 1 129 ? -5.586  102.871 7.749   0.25 15.04 ? 129 ASN A O   2 
ATOM   3740  C  CB  . ASN A 1 129 ? -6.029  104.862 5.778   0.25 12.87 ? 129 ASN A CB  2 
ATOM   3741  C  CG  . ASN A 1 129 ? -6.891  105.792 6.610   0.25 16.56 ? 129 ASN A CG  2 
ATOM   3742  O  OD1 . ASN A 1 129 ? -7.076  105.577 7.807   0.25 17.57 ? 129 ASN A OD1 2 
ATOM   3743  N  ND2 . ASN A 1 129 ? -7.432  106.832 5.975   0.25 14.61 ? 129 ASN A ND2 2 
ATOM   3744  N  N   . TYR A 1 130 ? -4.031  104.177 8.707   0.25 15.09 ? 130 TYR A N   2 
ATOM   3745  C  CA  . TYR A 1 130 ? -4.103  103.455 9.967   0.25 15.13 ? 130 TYR A CA  2 
ATOM   3746  C  C   . TYR A 1 130 ? -3.522  104.236 11.132  0.25 15.36 ? 130 TYR A C   2 
ATOM   3747  O  O   . TYR A 1 130 ? -3.025  105.346 10.971  0.25 13.41 ? 130 TYR A O   2 
ATOM   3748  C  CB  . TYR A 1 130 ? -3.360  102.119 9.864   0.25 12.97 ? 130 TYR A CB  2 
ATOM   3749  C  CG  . TYR A 1 130 ? -1.856  102.247 9.823   0.25 14.68 ? 130 TYR A CG  2 
ATOM   3750  C  CD1 . TYR A 1 130 ? -1.188  102.496 8.625   0.25 14.49 ? 130 TYR A CD1 2 
ATOM   3751  C  CD2 . TYR A 1 130 ? -1.097  102.125 10.992  0.25 14.08 ? 130 TYR A CD2 2 
ATOM   3752  C  CE1 . TYR A 1 130 ? 0.203   102.617 8.591   0.25 14.44 ? 130 TYR A CE1 2 
ATOM   3753  C  CE2 . TYR A 1 130 ? 0.284   102.246 10.971  0.25 12.43 ? 130 TYR A CE2 2 
ATOM   3754  C  CZ  . TYR A 1 130 ? 0.929   102.490 9.770   0.25 15.36 ? 130 TYR A CZ  2 
ATOM   3755  O  OH  . TYR A 1 130 ? 2.298   102.603 9.749   0.25 15.41 ? 130 TYR A OH  2 
ATOM   3756  N  N   . GLU A 1 131 ? -3.580  103.619 12.304  0.25 14.98 ? 131 GLU A N   2 
ATOM   3757  C  CA  . GLU A 1 131 ? -3.055  104.210 13.523  0.25 18.86 ? 131 GLU A CA  2 
ATOM   3758  C  C   . GLU A 1 131 ? -2.108  103.214 14.176  0.25 16.92 ? 131 GLU A C   2 
ATOM   3759  O  O   . GLU A 1 131 ? -2.446  102.039 14.327  0.25 16.34 ? 131 GLU A O   2 
ATOM   3760  C  CB  . GLU A 1 131 ? -4.201  104.552 14.486  0.25 19.28 ? 131 GLU A CB  2 
ATOM   3761  C  CG  . GLU A 1 131 ? -4.990  105.797 14.088  0.25 26.91 ? 131 GLU A CG  2 
ATOM   3762  C  CD  . GLU A 1 131 ? -6.214  106.035 14.963  0.25 28.42 ? 131 GLU A CD  2 
ATOM   3763  O  OE1 . GLU A 1 131 ? -6.111  105.865 16.195  0.25 32.43 ? 131 GLU A OE1 2 
ATOM   3764  O  OE2 . GLU A 1 131 ? -7.276  106.405 14.419  0.25 30.31 ? 131 GLU A OE2 2 
ATOM   3765  N  N   . SER A 1 132 ? -0.918  103.684 14.540  0.25 16.46 ? 132 SER A N   2 
ATOM   3766  C  CA  . SER A 1 132 ? 0.074   102.844 15.194  0.25 17.28 ? 132 SER A CA  2 
ATOM   3767  C  C   . SER A 1 132 ? -0.581  102.182 16.400  0.25 16.32 ? 132 SER A C   2 
ATOM   3768  O  O   . SER A 1 132 ? -1.419  102.784 17.065  0.25 14.73 ? 132 SER A O   2 
ATOM   3769  C  CB  . SER A 1 132 ? 1.268   103.688 15.652  0.25 17.79 ? 132 SER A CB  2 
ATOM   3770  O  OG  . SER A 1 132 ? 2.026   104.144 14.545  0.25 23.65 ? 132 SER A OG  2 
ATOM   3771  N  N   . ALA A 1 133 ? -0.200  100.941 16.674  0.25 17.37 ? 133 ALA A N   2 
ATOM   3772  C  CA  . ALA A 1 133 ? -0.767  100.203 17.798  0.25 16.48 ? 133 ALA A CA  2 
ATOM   3773  C  C   . ALA A 1 133 ? -0.051  98.872  17.927  0.25 16.31 ? 133 ALA A C   2 
ATOM   3774  O  O   . ALA A 1 133 ? 0.137   98.158  16.938  0.25 15.54 ? 133 ALA A O   2 
ATOM   3775  C  CB  . ALA A 1 133 ? -2.262  99.971  17.578  0.25 17.63 ? 133 ALA A CB  2 
ATOM   3776  N  N   . PRO A 1 134 ? 0.358   98.515  19.153  0.25 15.13 ? 134 PRO A N   2 
ATOM   3777  C  CA  . PRO A 1 134 ? 1.060   97.248  19.364  0.25 13.75 ? 134 PRO A CA  2 
ATOM   3778  C  C   . PRO A 1 134 ? 0.246   96.012  19.005  0.25 12.79 ? 134 PRO A C   2 
ATOM   3779  O  O   . PRO A 1 134 ? -0.989  96.045  18.976  0.25 11.87 ? 134 PRO A O   2 
ATOM   3780  C  CB  . PRO A 1 134 ? 1.425   97.298  20.846  0.25 13.35 ? 134 PRO A CB  2 
ATOM   3781  C  CG  . PRO A 1 134 ? 0.303   98.119  21.439  0.25 16.74 ? 134 PRO A CG  2 
ATOM   3782  C  CD  . PRO A 1 134 ? 0.162   99.230  20.426  0.25 14.88 ? 134 PRO A CD  2 
ATOM   3783  N  N   . PRO A 1 135 ? 0.937   94.900  18.716  0.25 11.80 ? 135 PRO A N   2 
ATOM   3784  C  CA  . PRO A 1 135 ? 0.271   93.649  18.360  0.25 11.23 ? 135 PRO A CA  2 
ATOM   3785  C  C   . PRO A 1 135 ? -0.137  92.872  19.605  0.25 13.80 ? 135 PRO A C   2 
ATOM   3786  O  O   . PRO A 1 135 ? 0.466   93.020  20.674  0.25 12.77 ? 135 PRO A O   2 
ATOM   3787  C  CB  . PRO A 1 135 ? 1.336   92.918  17.561  0.25 10.41 ? 135 PRO A CB  2 
ATOM   3788  C  CG  . PRO A 1 135 ? 2.587   93.298  18.282  0.25 12.81 ? 135 PRO A CG  2 
ATOM   3789  C  CD  . PRO A 1 135 ? 2.399   94.784  18.538  0.25 12.54 ? 135 PRO A CD  2 
ATOM   3790  N  N   . SER A 1 136 ? -1.171  92.053  19.472  0.25 13.60 ? 136 SER A N   2 
ATOM   3791  C  CA  . SER A 1 136 ? -1.614  91.244  20.593  0.25 14.62 ? 136 SER A CA  2 
ATOM   3792  C  C   . SER A 1 136 ? -0.558  90.162  20.796  0.25 15.94 ? 136 SER A C   2 
ATOM   3793  O  O   . SER A 1 136 ? 0.184   89.826  19.866  0.25 12.82 ? 136 SER A O   2 
ATOM   3794  C  CB  . SER A 1 136 ? -2.951  90.585  20.274  0.25 15.54 ? 136 SER A CB  2 
ATOM   3795  O  OG  . SER A 1 136 ? -2.796  89.641  19.232  0.25 14.57 ? 136 SER A OG  2 
ATOM   3796  N  N   . PRO A 1 137 ? -0.464  89.610  22.017  0.25 15.20 ? 137 PRO A N   2 
ATOM   3797  C  CA  . PRO A 1 137 ? 0.526   88.563  22.270  0.25 14.51 ? 137 PRO A CA  2 
ATOM   3798  C  C   . PRO A 1 137 ? 0.420   87.436  21.240  0.25 14.82 ? 137 PRO A C   2 
ATOM   3799  O  O   . PRO A 1 137 ? 1.423   87.025  20.661  0.25 13.60 ? 137 PRO A O   2 
ATOM   3800  C  CB  . PRO A 1 137 ? 0.177   88.095  23.681  0.25 14.48 ? 137 PRO A CB  2 
ATOM   3801  C  CG  . PRO A 1 137 ? -0.282  89.366  24.336  0.25 14.90 ? 137 PRO A CG  2 
ATOM   3802  C  CD  . PRO A 1 137 ? -1.172  89.978  23.259  0.25 14.37 ? 137 PRO A CD  2 
ATOM   3803  N  N   . GLN A 1 138 ? -0.800  86.959  20.999  0.25 13.70 ? 138 GLN A N   2 
ATOM   3804  C  CA  . GLN A 1 138 ? -1.022  85.871  20.058  0.25 14.13 ? 138 GLN A CA  2 
ATOM   3805  C  C   . GLN A 1 138 ? -0.510  86.175  18.650  0.25 14.29 ? 138 GLN A C   2 
ATOM   3806  O  O   . GLN A 1 138 ? 0.094   85.314  18.004  0.25 14.39 ? 138 GLN A O   2 
ATOM   3807  C  CB  . GLN A 1 138 ? -2.509  85.505  20.008  0.25 16.78 ? 138 GLN A CB  2 
ATOM   3808  C  CG  . GLN A 1 138 ? -3.088  85.107  21.368  0.25 17.97 ? 138 GLN A CG  2 
ATOM   3809  C  CD  . GLN A 1 138 ? -3.612  86.293  22.154  0.25 19.06 ? 138 GLN A CD  2 
ATOM   3810  O  OE1 . GLN A 1 138 ? -2.968  87.340  22.225  0.25 19.98 ? 138 GLN A OE1 2 
ATOM   3811  N  NE2 . GLN A 1 138 ? -4.786  86.129  22.759  0.25 20.23 ? 138 GLN A NE2 2 
ATOM   3812  N  N   . TYR A 1 139 ? -0.750  87.396  18.185  0.25 12.71 ? 139 TYR A N   2 
ATOM   3813  C  CA  . TYR A 1 139 ? -0.306  87.813  16.858  0.25 12.99 ? 139 TYR A CA  2 
ATOM   3814  C  C   . TYR A 1 139 ? 1.211   87.700  16.804  0.25 14.19 ? 139 TYR A C   2 
ATOM   3815  O  O   . TYR A 1 139 ? 1.771   87.166  15.848  0.25 12.37 ? 139 TYR A O   2 
ATOM   3816  C  CB  . TYR A 1 139 ? -0.733  89.259  16.598  0.25 11.08 ? 139 TYR A CB  2 
ATOM   3817  C  CG  . TYR A 1 139 ? -0.618  89.715  15.161  0.25 13.58 ? 139 TYR A CG  2 
ATOM   3818  C  CD1 . TYR A 1 139 ? -1.263  89.022  14.133  0.25 11.54 ? 139 TYR A CD1 2 
ATOM   3819  C  CD2 . TYR A 1 139 ? 0.073   90.879  14.837  0.25 12.36 ? 139 TYR A CD2 2 
ATOM   3820  C  CE1 . TYR A 1 139 ? -1.227  89.487  12.812  0.25 13.26 ? 139 TYR A CE1 2 
ATOM   3821  C  CE2 . TYR A 1 139 ? 0.116   91.354  13.525  0.25 14.28 ? 139 TYR A CE2 2 
ATOM   3822  C  CZ  . TYR A 1 139 ? -0.537  90.653  12.520  0.25 13.30 ? 139 TYR A CZ  2 
ATOM   3823  O  OH  . TYR A 1 139 ? -0.502  91.122  11.231  0.25 11.08 ? 139 TYR A OH  2 
ATOM   3824  N  N   . LYS A 1 140 ? 1.879   88.195  17.844  0.25 14.24 ? 140 LYS A N   2 
ATOM   3825  C  CA  . LYS A 1 140 ? 3.334   88.128  17.888  0.25 14.64 ? 140 LYS A CA  2 
ATOM   3826  C  C   . LYS A 1 140 ? 3.847   86.690  17.850  0.25 15.32 ? 140 LYS A C   2 
ATOM   3827  O  O   . LYS A 1 140 ? 4.761   86.372  17.081  0.25 15.68 ? 140 LYS A O   2 
ATOM   3828  C  CB  . LYS A 1 140 ? 3.876   88.829  19.141  0.25 14.25 ? 140 LYS A CB  2 
ATOM   3829  C  CG  . LYS A 1 140 ? 5.392   88.754  19.254  0.25 13.15 ? 140 LYS A CG  2 
ATOM   3830  C  CD  . LYS A 1 140 ? 5.934   89.655  20.359  0.25 16.16 ? 140 LYS A CD  2 
ATOM   3831  C  CE  . LYS A 1 140 ? 7.417   89.402  20.575  0.25 13.62 ? 140 LYS A CE  2 
ATOM   3832  N  NZ  . LYS A 1 140 ? 8.001   90.265  21.640  0.25 15.75 ? 140 LYS A NZ  2 
ATOM   3833  N  N   . LYS A 1 141 ? 3.262   85.820  18.673  0.25 16.24 ? 141 LYS A N   2 
ATOM   3834  C  CA  . LYS A 1 141 ? 3.686   84.420  18.722  0.25 16.71 ? 141 LYS A CA  2 
ATOM   3835  C  C   . LYS A 1 141 ? 3.629   83.755  17.351  0.25 15.67 ? 141 LYS A C   2 
ATOM   3836  O  O   . LYS A 1 141 ? 4.536   83.016  16.976  0.25 14.98 ? 141 LYS A O   2 
ATOM   3837  C  CB  . LYS A 1 141 ? 2.821   83.617  19.704  0.25 17.49 ? 141 LYS A CB  2 
ATOM   3838  C  CG  . LYS A 1 141 ? 3.025   83.968  21.167  0.25 24.94 ? 141 LYS A CG  2 
ATOM   3839  C  CD  . LYS A 1 141 ? 2.292   82.986  22.074  0.25 28.78 ? 141 LYS A CD  2 
ATOM   3840  C  CE  . LYS A 1 141 ? 2.452   83.350  23.543  0.25 30.52 ? 141 LYS A CE  2 
ATOM   3841  N  NZ  . LYS A 1 141 ? 1.874   84.690  23.859  0.25 32.21 ? 141 LYS A NZ  2 
ATOM   3842  N  N   . ILE A 1 142 ? 2.559   84.017  16.607  0.25 14.35 ? 142 ILE A N   2 
ATOM   3843  C  CA  . ILE A 1 142 ? 2.389   83.433  15.276  0.25 13.37 ? 142 ILE A CA  2 
ATOM   3844  C  C   . ILE A 1 142 ? 3.445   83.959  14.313  0.25 12.84 ? 142 ILE A C   2 
ATOM   3845  O  O   . ILE A 1 142 ? 3.991   83.215  13.490  0.25 11.37 ? 142 ILE A O   2 
ATOM   3846  C  CB  . ILE A 1 142 ? 0.991   83.750  14.711  0.25 13.64 ? 142 ILE A CB  2 
ATOM   3847  C  CG1 . ILE A 1 142 ? -0.079  83.073  15.573  0.25 14.92 ? 142 ILE A CG1 2 
ATOM   3848  C  CG2 . ILE A 1 142 ? 0.896   83.309  13.252  0.25 12.71 ? 142 ILE A CG2 2 
ATOM   3849  C  CD1 . ILE A 1 142 ? 0.014   81.558  15.619  0.25 12.54 ? 142 ILE A CD1 2 
ATOM   3850  N  N   . ILE A 1 143 ? 3.719   85.253  14.417  0.25 12.91 ? 143 ILE A N   2 
ATOM   3851  C  CA  . ILE A 1 143 ? 4.711   85.900  13.574  0.25 12.36 ? 143 ILE A CA  2 
ATOM   3852  C  C   . ILE A 1 143 ? 6.109   85.379  13.929  0.25 13.03 ? 143 ILE A C   2 
ATOM   3853  O  O   . ILE A 1 143 ? 6.972   85.236  13.063  0.25 12.32 ? 143 ILE A O   2 
ATOM   3854  C  CB  . ILE A 1 143 ? 4.642   87.436  13.760  0.25 10.44 ? 143 ILE A CB  2 
ATOM   3855  C  CG1 . ILE A 1 143 ? 3.319   87.956  13.189  0.25 10.75 ? 143 ILE A CG1 2 
ATOM   3856  C  CG2 . ILE A 1 143 ? 5.830   88.103  13.088  0.25 12.87 ? 143 ILE A CG2 2 
ATOM   3857  C  CD1 . ILE A 1 143 ? 3.051   89.433  13.458  0.25 7.81  ? 143 ILE A CD1 2 
ATOM   3858  N  N   . CYS A 1 144 ? 6.320   85.082  15.207  0.25 14.52 ? 144 CYS A N   2 
ATOM   3859  C  CA  . CYS A 1 144 ? 7.608   84.577  15.668  0.25 14.81 ? 144 CYS A CA  2 
ATOM   3860  C  C   . CYS A 1 144 ? 7.782   83.107  15.290  0.25 14.92 ? 144 CYS A C   2 
ATOM   3861  O  O   . CYS A 1 144 ? 8.860   82.692  14.857  0.25 14.96 ? 144 CYS A O   2 
ATOM   3862  C  CB  . CYS A 1 144 ? 7.734   84.780  17.182  0.25 16.09 ? 144 CYS A CB  2 
ATOM   3863  S  SG  . CYS A 1 144 ? 7.838   86.538  17.646  0.25 19.58 ? 144 CYS A SG  2 
HETATM 3864  N  N   . MSE A 1 145 ? 6.717   82.327  15.440  0.25 14.45 ? 145 MSE A N   2 
HETATM 3865  C  CA  . MSE A 1 145 ? 6.754   80.912  15.081  0.25 13.56 ? 145 MSE A CA  2 
HETATM 3866  C  C   . MSE A 1 145 ? 7.041   80.777  13.584  0.25 13.39 ? 145 MSE A C   2 
HETATM 3867  O  O   . MSE A 1 145 ? 7.858   79.953  13.166  0.25 10.98 ? 145 MSE A O   2 
HETATM 3868  C  CB  . MSE A 1 145 ? 5.413   80.242  15.411  0.25 16.44 ? 145 MSE A CB  2 
HETATM 3869  C  CG  . MSE A 1 145 ? 5.184   79.966  16.893  0.25 18.01 ? 145 MSE A CG  2 
HETATM 3870  SE SE  . MSE A 1 145 ? 3.429   79.229  17.250  0.25 20.75 ? 145 MSE A SE  2 
HETATM 3871  C  CE  . MSE A 1 145 ? 3.715   77.438  16.597  0.25 19.07 ? 145 MSE A CE  2 
ATOM   3872  N  N   . GLY A 1 146 ? 6.365   81.594  12.779  0.25 10.77 ? 146 GLY A N   2 
ATOM   3873  C  CA  . GLY A 1 146 ? 6.575   81.546  11.343  0.25 11.24 ? 146 GLY A CA  2 
ATOM   3874  C  C   . GLY A 1 146 ? 8.019   81.860  11.004  0.25 11.92 ? 146 GLY A C   2 
ATOM   3875  O  O   . GLY A 1 146 ? 8.670   81.141  10.238  0.25 12.05 ? 146 GLY A O   2 
ATOM   3876  N  N   . ALA A 1 147 ? 8.523   82.942  11.586  0.25 12.77 ? 147 ALA A N   2 
ATOM   3877  C  CA  . ALA A 1 147 ? 9.899   83.365  11.363  0.25 12.92 ? 147 ALA A CA  2 
ATOM   3878  C  C   . ALA A 1 147 ? 10.876  82.238  11.712  0.25 13.86 ? 147 ALA A C   2 
ATOM   3879  O  O   . ALA A 1 147 ? 11.891  82.050  11.036  0.25 13.78 ? 147 ALA A O   2 
ATOM   3880  C  CB  . ALA A 1 147 ? 10.197  84.603  12.203  0.25 11.52 ? 147 ALA A CB  2 
ATOM   3881  N  N   . LYS A 1 148 ? 10.565  81.494  12.771  0.25 15.49 ? 148 LYS A N   2 
ATOM   3882  C  CA  . LYS A 1 148 ? 11.411  80.381  13.206  0.25 18.39 ? 148 LYS A CA  2 
ATOM   3883  C  C   . LYS A 1 148 ? 11.224  79.198  12.267  0.25 19.40 ? 148 LYS A C   2 
ATOM   3884  O  O   . LYS A 1 148 ? 12.185  78.646  11.730  0.25 19.01 ? 148 LYS A O   2 
ATOM   3885  C  CB  . LYS A 1 148 ? 11.040  79.950  14.630  0.25 20.11 ? 148 LYS A CB  2 
ATOM   3886  C  CG  . LYS A 1 148 ? 11.924  78.839  15.191  0.25 24.43 ? 148 LYS A CG  2 
ATOM   3887  C  CD  . LYS A 1 148 ? 11.509  78.455  16.601  0.25 28.86 ? 148 LYS A CD  2 
ATOM   3888  C  CE  . LYS A 1 148 ? 12.438  77.400  17.189  0.25 31.17 ? 148 LYS A CE  2 
ATOM   3889  N  NZ  . LYS A 1 148 ? 12.473  76.158  16.364  0.25 35.49 ? 148 LYS A NZ  2 
ATOM   3890  N  N   . GLU A 1 149 ? 9.966   78.821  12.081  0.25 19.51 ? 149 GLU A N   2 
ATOM   3891  C  CA  . GLU A 1 149 ? 9.595   77.712  11.225  0.25 20.04 ? 149 GLU A CA  2 
ATOM   3892  C  C   . GLU A 1 149 ? 10.240  77.766  9.847   0.25 19.11 ? 149 GLU A C   2 
ATOM   3893  O  O   . GLU A 1 149 ? 10.654  76.737  9.306   0.25 17.11 ? 149 GLU A O   2 
ATOM   3894  C  CB  . GLU A 1 149 ? 8.077   77.677  11.056  0.25 22.32 ? 149 GLU A CB  2 
ATOM   3895  C  CG  . GLU A 1 149 ? 7.581   76.518  10.213  0.25 24.46 ? 149 GLU A CG  2 
ATOM   3896  C  CD  . GLU A 1 149 ? 6.089   76.578  9.987   0.25 25.90 ? 149 GLU A CD  2 
ATOM   3897  O  OE1 . GLU A 1 149 ? 5.640   77.459  9.225   0.25 25.58 ? 149 GLU A OE1 2 
ATOM   3898  O  OE2 . GLU A 1 149 ? 5.365   75.751  10.581  0.25 27.19 ? 149 GLU A OE2 2 
ATOM   3899  N  N   . ASN A 1 150 ? 10.331  78.961  9.278   0.25 17.44 ? 150 ASN A N   2 
ATOM   3900  C  CA  . ASN A 1 150 ? 10.898  79.090  7.944   0.25 16.10 ? 150 ASN A CA  2 
ATOM   3901  C  C   . ASN A 1 150 ? 12.329  79.583  7.880   0.25 15.53 ? 150 ASN A C   2 
ATOM   3902  O  O   . ASN A 1 150 ? 12.848  79.882  6.803   0.25 15.51 ? 150 ASN A O   2 
ATOM   3903  C  CB  . ASN A 1 150 ? 9.980   79.958  7.087   0.25 17.36 ? 150 ASN A CB  2 
ATOM   3904  C  CG  . ASN A 1 150 ? 8.645   79.301  6.856   0.25 17.88 ? 150 ASN A CG  2 
ATOM   3905  O  OD1 . ASN A 1 150 ? 8.582   78.170  6.379   0.25 17.57 ? 150 ASN A OD1 2 
ATOM   3906  N  ND2 . ASN A 1 150 ? 7.567   79.993  7.203   0.25 22.36 ? 150 ASN A ND2 2 
ATOM   3907  N  N   . GLY A 1 151 ? 12.969  79.660  9.039   0.25 14.82 ? 151 GLY A N   2 
ATOM   3908  C  CA  . GLY A 1 151 ? 14.360  80.067  9.092   0.25 15.18 ? 151 GLY A CA  2 
ATOM   3909  C  C   . GLY A 1 151 ? 14.754  81.451  8.609   0.25 15.31 ? 151 GLY A C   2 
ATOM   3910  O  O   . GLY A 1 151 ? 15.757  81.596  7.909   0.25 15.48 ? 151 GLY A O   2 
ATOM   3911  N  N   . LEU A 1 152 ? 13.977  82.469  8.957   0.25 13.93 ? 152 LEU A N   2 
ATOM   3912  C  CA  . LEU A 1 152 ? 14.346  83.820  8.582   0.25 14.31 ? 152 LEU A CA  2 
ATOM   3913  C  C   . LEU A 1 152 ? 15.655  84.043  9.347   0.25 14.67 ? 152 LEU A C   2 
ATOM   3914  O  O   . LEU A 1 152 ? 15.932  83.338  10.316  0.25 15.47 ? 152 LEU A O   2 
ATOM   3915  C  CB  . LEU A 1 152 ? 13.272  84.819  9.032   0.25 13.41 ? 152 LEU A CB  2 
ATOM   3916  C  CG  . LEU A 1 152 ? 12.294  85.307  7.952   0.25 13.79 ? 152 LEU A CG  2 
ATOM   3917  C  CD1 . LEU A 1 152 ? 11.606  84.126  7.277   0.25 12.36 ? 152 LEU A CD1 2 
ATOM   3918  C  CD2 . LEU A 1 152 ? 11.268  86.239  8.583   0.25 10.20 ? 152 LEU A CD2 2 
ATOM   3919  N  N   . PRO A 1 153 ? 16.478  85.010  8.925   0.25 14.77 ? 153 PRO A N   2 
ATOM   3920  C  CA  . PRO A 1 153 ? 17.743  85.245  9.634   0.25 15.09 ? 153 PRO A CA  2 
ATOM   3921  C  C   . PRO A 1 153 ? 17.553  85.306  11.146  0.25 15.55 ? 153 PRO A C   2 
ATOM   3922  O  O   . PRO A 1 153 ? 16.466  85.623  11.627  0.25 15.27 ? 153 PRO A O   2 
ATOM   3923  C  CB  . PRO A 1 153 ? 18.220  86.572  9.053   0.25 15.30 ? 153 PRO A CB  2 
ATOM   3924  C  CG  . PRO A 1 153 ? 17.688  86.520  7.640   0.25 14.03 ? 153 PRO A CG  2 
ATOM   3925  C  CD  . PRO A 1 153 ? 16.284  85.995  7.848   0.25 14.24 ? 153 PRO A CD  2 
ATOM   3926  N  N   . LEU A 1 154 ? 18.613  85.004  11.889  0.25 15.07 ? 154 LEU A N   2 
ATOM   3927  C  CA  . LEU A 1 154 ? 18.545  85.017  13.344  0.25 17.81 ? 154 LEU A CA  2 
ATOM   3928  C  C   . LEU A 1 154 ? 18.431  86.416  13.930  0.25 16.99 ? 154 LEU A C   2 
ATOM   3929  O  O   . LEU A 1 154 ? 17.678  86.629  14.882  0.25 17.01 ? 154 LEU A O   2 
ATOM   3930  C  CB  . LEU A 1 154 ? 19.759  84.295  13.941  0.25 20.35 ? 154 LEU A CB  2 
ATOM   3931  C  CG  . LEU A 1 154 ? 19.756  82.777  13.723  0.25 23.89 ? 154 LEU A CG  2 
ATOM   3932  C  CD1 . LEU A 1 154 ? 21.015  82.160  14.314  0.25 25.70 ? 154 LEU A CD1 2 
ATOM   3933  C  CD2 . LEU A 1 154 ? 18.518  82.172  14.368  0.25 24.48 ? 154 LEU A CD2 2 
ATOM   3934  N  N   . GLU A 1 155 ? 19.167  87.370  13.367  0.25 18.23 ? 155 GLU A N   2 
ATOM   3935  C  CA  . GLU A 1 155 ? 19.116  88.742  13.861  0.25 19.47 ? 155 GLU A CA  2 
ATOM   3936  C  C   . GLU A 1 155 ? 17.741  89.358  13.613  0.25 15.88 ? 155 GLU A C   2 
ATOM   3937  O  O   . GLU A 1 155 ? 17.388  90.367  14.222  0.25 13.64 ? 155 GLU A O   2 
ATOM   3938  C  CB  . GLU A 1 155 ? 20.188  89.605  13.192  0.25 25.97 ? 155 GLU A CB  2 
ATOM   3939  C  CG  . GLU A 1 155 ? 20.248  91.026  13.737  0.25 38.10 ? 155 GLU A CG  2 
ATOM   3940  C  CD  . GLU A 1 155 ? 21.270  91.900  13.025  0.25 42.88 ? 155 GLU A CD  2 
ATOM   3941  O  OE1 . GLU A 1 155 ? 22.468  91.539  13.011  0.25 46.60 ? 155 GLU A OE1 2 
ATOM   3942  O  OE2 . GLU A 1 155 ? 20.872  92.955  12.486  0.25 46.70 ? 155 GLU A OE2 2 
ATOM   3943  N  N   . TYR A 1 156 ? 16.967  88.762  12.714  0.25 13.68 ? 156 TYR A N   2 
ATOM   3944  C  CA  . TYR A 1 156 ? 15.634  89.283  12.438  0.25 11.96 ? 156 TYR A CA  2 
ATOM   3945  C  C   . TYR A 1 156 ? 14.646  88.609  13.376  0.25 11.89 ? 156 TYR A C   2 
ATOM   3946  O  O   . TYR A 1 156 ? 13.711  89.241  13.863  0.25 12.27 ? 156 TYR A O   2 
ATOM   3947  C  CB  . TYR A 1 156 ? 15.220  89.023  10.988  0.25 11.86 ? 156 TYR A CB  2 
ATOM   3948  C  CG  . TYR A 1 156 ? 13.960  89.771  10.606  0.25 10.27 ? 156 TYR A CG  2 
ATOM   3949  C  CD1 . TYR A 1 156 ? 13.983  91.151  10.397  0.25 12.36 ? 156 TYR A CD1 2 
ATOM   3950  C  CD2 . TYR A 1 156 ? 12.740  89.109  10.496  0.25 11.43 ? 156 TYR A CD2 2 
ATOM   3951  C  CE1 . TYR A 1 156 ? 12.818  91.857  10.091  0.25 11.81 ? 156 TYR A CE1 2 
ATOM   3952  C  CE2 . TYR A 1 156 ? 11.571  89.799  10.189  0.25 10.15 ? 156 TYR A CE2 2 
ATOM   3953  C  CZ  . TYR A 1 156 ? 11.616  91.172  9.990   0.25 10.26 ? 156 TYR A CZ  2 
ATOM   3954  O  OH  . TYR A 1 156 ? 10.463  91.862  9.699   0.25 14.46 ? 156 TYR A OH  2 
ATOM   3955  N  N   . GLN A 1 157 ? 14.855  87.320  13.625  0.25 12.01 ? 157 GLN A N   2 
ATOM   3956  C  CA  . GLN A 1 157 ? 13.979  86.584  14.527  0.25 13.60 ? 157 GLN A CA  2 
ATOM   3957  C  C   . GLN A 1 157 ? 14.094  87.185  15.917  0.25 14.59 ? 157 GLN A C   2 
ATOM   3958  O  O   . GLN A 1 157 ? 13.148  87.142  16.698  0.25 13.10 ? 157 GLN A O   2 
ATOM   3959  C  CB  . GLN A 1 157 ? 14.358  85.106  14.575  0.25 14.52 ? 157 GLN A CB  2 
ATOM   3960  C  CG  . GLN A 1 157 ? 14.119  84.363  13.272  0.25 15.83 ? 157 GLN A CG  2 
ATOM   3961  C  CD  . GLN A 1 157 ? 14.316  82.865  13.418  0.25 15.73 ? 157 GLN A CD  2 
ATOM   3962  O  OE1 . GLN A 1 157 ? 13.620  82.208  14.189  0.25 14.21 ? 157 GLN A OE1 2 
ATOM   3963  N  NE2 . GLN A 1 157 ? 15.268  82.318  12.675  0.25 16.53 ? 157 GLN A NE2 2 
ATOM   3964  N  N   . GLU A 1 158 ? 15.261  87.739  16.229  0.25 16.37 ? 158 GLU A N   2 
ATOM   3965  C  CA  . GLU A 1 158 ? 15.448  88.362  17.533  0.25 18.78 ? 158 GLU A CA  2 
ATOM   3966  C  C   . GLU A 1 158 ? 14.726  89.695  17.534  0.25 16.94 ? 158 GLU A C   2 
ATOM   3967  O  O   . GLU A 1 158 ? 14.179  90.106  18.553  0.25 16.38 ? 158 GLU A O   2 
ATOM   3968  C  CB  . GLU A 1 158 ? 16.931  88.571  17.842  0.25 23.22 ? 158 GLU A CB  2 
ATOM   3969  C  CG  . GLU A 1 158 ? 17.633  87.306  18.302  0.25 29.54 ? 158 GLU A CG  2 
ATOM   3970  C  CD  . GLU A 1 158 ? 16.907  86.638  19.458  0.25 32.18 ? 158 GLU A CD  2 
ATOM   3971  O  OE1 . GLU A 1 158 ? 16.613  87.329  20.457  0.25 34.51 ? 158 GLU A OE1 2 
ATOM   3972  O  OE2 . GLU A 1 158 ? 16.630  85.424  19.368  0.25 33.36 ? 158 GLU A OE2 2 
ATOM   3973  N  N   . LYS A 1 159 ? 14.725  90.360  16.381  0.25 16.78 ? 159 LYS A N   2 
ATOM   3974  C  CA  . LYS A 1 159 ? 14.048  91.640  16.242  0.25 18.23 ? 159 LYS A CA  2 
ATOM   3975  C  C   . LYS A 1 159 ? 12.553  91.468  16.504  0.25 16.96 ? 159 LYS A C   2 
ATOM   3976  O  O   . LYS A 1 159 ? 11.970  92.205  17.299  0.25 14.05 ? 159 LYS A O   2 
ATOM   3977  C  CB  . LYS A 1 159 ? 14.270  92.213  14.842  0.25 21.02 ? 159 LYS A CB  2 
ATOM   3978  C  CG  . LYS A 1 159 ? 15.638  92.852  14.640  0.25 27.76 ? 159 LYS A CG  2 
ATOM   3979  C  CD  . LYS A 1 159 ? 15.821  93.369  13.214  0.25 32.08 ? 159 LYS A CD  2 
ATOM   3980  C  CE  . LYS A 1 159 ? 14.764  94.402  12.841  0.25 33.81 ? 159 LYS A CE  2 
ATOM   3981  N  NZ  . LYS A 1 159 ? 14.891  94.836  11.419  0.25 37.57 ? 159 LYS A NZ  2 
ATOM   3982  N  N   . LEU A 1 160 ? 11.937  90.492  15.840  0.25 15.32 ? 160 LEU A N   2 
ATOM   3983  C  CA  . LEU A 1 160 ? 10.509  90.237  16.024  0.25 14.99 ? 160 LEU A CA  2 
ATOM   3984  C  C   . LEU A 1 160 ? 10.170  89.934  17.486  0.25 14.99 ? 160 LEU A C   2 
ATOM   3985  O  O   . LEU A 1 160 ? 9.247   90.514  18.056  0.25 15.07 ? 160 LEU A O   2 
ATOM   3986  C  CB  . LEU A 1 160 ? 10.058  89.058  15.151  0.25 12.02 ? 160 LEU A CB  2 
ATOM   3987  C  CG  . LEU A 1 160 ? 10.066  89.262  13.634  0.25 11.95 ? 160 LEU A CG  2 
ATOM   3988  C  CD1 . LEU A 1 160 ? 9.640   87.974  12.932  0.25 12.36 ? 160 LEU A CD1 2 
ATOM   3989  C  CD2 . LEU A 1 160 ? 9.127   90.400  13.269  0.25 10.69 ? 160 LEU A CD2 2 
ATOM   3990  N  N   . LYS A 1 161 ? 10.923  89.021  18.089  0.25 15.56 ? 161 LYS A N   2 
ATOM   3991  C  CA  . LYS A 1 161 ? 10.684  88.633  19.475  0.25 16.33 ? 161 LYS A CA  2 
ATOM   3992  C  C   . LYS A 1 161 ? 10.953  89.755  20.472  0.25 15.52 ? 161 LYS A C   2 
ATOM   3993  O  O   . LYS A 1 161 ? 10.605  89.637  21.650  0.25 15.07 ? 161 LYS A O   2 
ATOM   3994  C  CB  . LYS A 1 161 ? 11.543  87.415  19.825  0.25 17.69 ? 161 LYS A CB  2 
ATOM   3995  C  CG  . LYS A 1 161 ? 11.234  86.198  18.979  0.25 19.96 ? 161 LYS A CG  2 
ATOM   3996  C  CD  . LYS A 1 161 ? 12.264  85.095  19.180  0.25 23.99 ? 161 LYS A CD  2 
ATOM   3997  C  CE  . LYS A 1 161 ? 12.239  84.547  20.593  0.25 23.04 ? 161 LYS A CE  2 
ATOM   3998  N  NZ  . LYS A 1 161 ? 13.206  83.429  20.741  0.25 26.22 ? 161 LYS A NZ  2 
ATOM   3999  N  N   . ALA A 1 162 ? 11.557  90.842  19.997  0.25 14.98 ? 162 ALA A N   2 
ATOM   4000  C  CA  . ALA A 1 162 ? 11.883  91.985  20.849  0.25 16.03 ? 162 ALA A CA  2 
ATOM   4001  C  C   . ALA A 1 162 ? 10.865  93.122  20.754  0.25 16.55 ? 162 ALA A C   2 
ATOM   4002  O  O   . ALA A 1 162 ? 11.104  94.223  21.257  0.25 16.05 ? 162 ALA A O   2 
ATOM   4003  C  CB  . ALA A 1 162 ? 13.275  92.507  20.498  0.25 17.35 ? 162 ALA A CB  2 
ATOM   4004  N  N   . ILE A 1 163 ? 9.730   92.859  20.114  0.25 15.58 ? 163 ILE A N   2 
ATOM   4005  C  CA  . ILE A 1 163 ? 8.695   93.876  19.973  0.25 15.07 ? 163 ILE A CA  2 
ATOM   4006  C  C   . ILE A 1 163 ? 7.720   93.816  21.150  0.25 16.33 ? 163 ILE A C   2 
ATOM   4007  O  O   . ILE A 1 163 ? 7.330   92.735  21.592  0.25 16.31 ? 163 ILE A O   2 
ATOM   4008  C  CB  . ILE A 1 163 ? 7.905   93.693  18.652  0.25 14.90 ? 163 ILE A CB  2 
ATOM   4009  C  CG1 . ILE A 1 163 ? 8.860   93.736  17.458  0.25 12.81 ? 163 ILE A CG1 2 
ATOM   4010  C  CG2 . ILE A 1 163 ? 6.858   94.797  18.518  0.25 13.35 ? 163 ILE A CG2 2 
ATOM   4011  C  CD1 . ILE A 1 163 ? 8.181   93.567  16.116  0.25 14.92 ? 163 ILE A CD1 2 
ATOM   4012  N  N   . GLU A 1 164 ? 7.329   94.978  21.662  0.25 16.70 ? 164 GLU A N   2 
ATOM   4013  C  CA  . GLU A 1 164 ? 6.402   95.017  22.788  0.25 17.74 ? 164 GLU A CA  2 
ATOM   4014  C  C   . GLU A 1 164 ? 4.963   94.860  22.316  0.25 16.45 ? 164 GLU A C   2 
ATOM   4015  O  O   . GLU A 1 164 ? 4.498   95.605  21.456  0.25 15.73 ? 164 GLU A O   2 
ATOM   4016  C  CB  . GLU A 1 164 ? 6.558   96.329  23.567  0.25 22.21 ? 164 GLU A CB  2 
ATOM   4017  C  CG  . GLU A 1 164 ? 7.818   96.395  24.431  0.25 27.71 ? 164 GLU A CG  2 
ATOM   4018  C  CD  . GLU A 1 164 ? 7.956   97.717  25.170  0.25 30.87 ? 164 GLU A CD  2 
ATOM   4019  O  OE1 . GLU A 1 164 ? 6.975   98.143  25.819  0.25 34.12 ? 164 GLU A OE1 2 
ATOM   4020  O  OE2 . GLU A 1 164 ? 9.046   98.327  25.108  0.25 32.24 ? 164 GLU A OE2 2 
ATOM   4021  N  N   . PRO A 1 165 ? 4.244   93.872  22.874  0.25 16.62 ? 165 PRO A N   2 
ATOM   4022  C  CA  . PRO A 1 165 ? 2.849   93.580  22.539  0.25 15.93 ? 165 PRO A CA  2 
ATOM   4023  C  C   . PRO A 1 165 ? 1.888   94.285  23.491  0.25 18.14 ? 165 PRO A C   2 
ATOM   4024  O  O   . PRO A 1 165 ? 2.297   94.754  24.556  0.25 16.95 ? 165 PRO A O   2 
ATOM   4025  C  CB  . PRO A 1 165 ? 2.784   92.068  22.695  0.25 15.52 ? 165 PRO A CB  2 
ATOM   4026  C  CG  . PRO A 1 165 ? 3.617   91.862  23.924  0.25 17.58 ? 165 PRO A CG  2 
ATOM   4027  C  CD  . PRO A 1 165 ? 4.814   92.791  23.703  0.25 16.30 ? 165 PRO A CD  2 
ATOM   4028  N  N   . ASN A 1 166 ? 0.614   94.366  23.114  0.25 19.01 ? 166 ASN A N   2 
ATOM   4029  C  CA  . ASN A 1 166 ? -0.365  94.993  23.992  0.25 19.33 ? 166 ASN A CA  2 
ATOM   4030  C  C   . ASN A 1 166 ? -0.617  94.026  25.145  0.25 19.65 ? 166 ASN A C   2 
ATOM   4031  O  O   . ASN A 1 166 ? -0.098  92.907  25.142  0.25 18.73 ? 166 ASN A O   2 
ATOM   4032  C  CB  . ASN A 1 166 ? -1.674  95.305  23.250  0.25 17.05 ? 166 ASN A CB  2 
ATOM   4033  C  CG  . ASN A 1 166 ? -2.245  94.103  22.529  0.25 17.09 ? 166 ASN A CG  2 
ATOM   4034  O  OD1 . ASN A 1 166 ? -2.324  93.010  23.085  0.25 15.70 ? 166 ASN A OD1 2 
ATOM   4035  N  ND2 . ASN A 1 166 ? -2.662  94.306  21.279  0.25 18.16 ? 166 ASN A ND2 2 
ATOM   4036  N  N   . ASP A 1 167 ? -1.409  94.447  26.127  0.25 21.60 ? 167 ASP A N   2 
ATOM   4037  C  CA  . ASP A 1 167 ? -1.679  93.602  27.291  0.25 23.35 ? 167 ASP A CA  2 
ATOM   4038  C  C   . ASP A 1 167 ? -2.924  92.733  27.138  0.25 23.26 ? 167 ASP A C   2 
ATOM   4039  O  O   . ASP A 1 167 ? -3.342  92.069  28.085  0.25 22.50 ? 167 ASP A O   2 
ATOM   4040  C  CB  . ASP A 1 167 ? -1.823  94.469  28.545  0.25 26.00 ? 167 ASP A CB  2 
ATOM   4041  C  CG  . ASP A 1 167 ? -3.178  95.143  28.633  0.25 29.19 ? 167 ASP A CG  2 
ATOM   4042  O  OD1 . ASP A 1 167 ? -3.614  95.748  27.629  0.25 27.44 ? 167 ASP A OD1 2 
ATOM   4043  O  OD2 . ASP A 1 167 ? -3.806  95.067  29.712  0.25 32.29 ? 167 ASP A OD2 2 
ATOM   4044  N  N   . TYR A 1 168 ? -3.517  92.735  25.952  0.25 20.51 ? 168 TYR A N   2 
ATOM   4045  C  CA  . TYR A 1 168 ? -4.709  91.930  25.723  0.25 20.63 ? 168 TYR A CA  2 
ATOM   4046  C  C   . TYR A 1 168 ? -4.455  90.468  26.089  0.25 21.42 ? 168 TYR A C   2 
ATOM   4047  O  O   . TYR A 1 168 ? -3.513  89.848  25.588  0.25 19.86 ? 168 TYR A O   2 
ATOM   4048  C  CB  . TYR A 1 168 ? -5.137  92.012  24.255  0.25 20.12 ? 168 TYR A CB  2 
ATOM   4049  C  CG  . TYR A 1 168 ? -6.350  91.169  23.947  0.25 20.70 ? 168 TYR A CG  2 
ATOM   4050  C  CD1 . TYR A 1 168 ? -7.635  91.658  24.171  0.25 19.30 ? 168 TYR A CD1 2 
ATOM   4051  C  CD2 . TYR A 1 168 ? -6.214  89.858  23.484  0.25 20.10 ? 168 TYR A CD2 2 
ATOM   4052  C  CE1 . TYR A 1 168 ? -8.756  90.862  23.947  0.25 20.19 ? 168 TYR A CE1 2 
ATOM   4053  C  CE2 . TYR A 1 168 ? -7.330  89.055  23.257  0.25 20.06 ? 168 TYR A CE2 2 
ATOM   4054  C  CZ  . TYR A 1 168 ? -8.597  89.564  23.492  0.25 18.91 ? 168 TYR A CZ  2 
ATOM   4055  O  OH  . TYR A 1 168 ? -9.706  88.774  23.285  0.25 19.06 ? 168 TYR A OH  2 
ATOM   4056  N  N   . THR A 1 169 ? -5.292  89.921  26.966  0.25 20.14 ? 169 THR A N   2 
ATOM   4057  C  CA  . THR A 1 169 ? -5.161  88.526  27.376  0.25 21.51 ? 169 THR A CA  2 
ATOM   4058  C  C   . THR A 1 169 ? -6.518  87.842  27.267  0.25 22.05 ? 169 THR A C   2 
ATOM   4059  O  O   . THR A 1 169 ? -6.729  86.749  27.798  0.25 17.99 ? 169 THR A O   2 
ATOM   4060  C  CB  . THR A 1 169 ? -4.644  88.397  28.831  0.25 21.32 ? 169 THR A CB  2 
ATOM   4061  O  OG1 . THR A 1 169 ? -5.550  89.047  29.726  0.25 19.56 ? 169 THR A OG1 2 
ATOM   4062  C  CG2 . THR A 1 169 ? -3.266  89.031  28.963  0.25 21.90 ? 169 THR A CG2 2 
ATOM   4063  N  N   . GLY A 1 170 ? -7.436  88.502  26.567  0.25 23.78 ? 170 GLY A N   2 
ATOM   4064  C  CA  . GLY A 1 170 ? -8.766  87.954  26.391  0.25 26.38 ? 170 GLY A CA  2 
ATOM   4065  C  C   . GLY A 1 170 ? -8.769  86.775  25.441  0.25 29.05 ? 170 GLY A C   2 
ATOM   4066  O  O   . GLY A 1 170 ? -7.723  86.341  24.961  0.25 28.51 ? 170 GLY A O   2 
ATOM   4067  N  N   . LYS A 1 171 ? -9.960  86.264  25.162  0.25 33.05 ? 171 LYS A N   2 
ATOM   4068  C  CA  . LYS A 1 171 ? -10.119 85.122  24.278  0.25 36.79 ? 171 LYS A CA  2 
ATOM   4069  C  C   . LYS A 1 171 ? -10.062 85.486  22.792  0.25 36.26 ? 171 LYS A C   2 
ATOM   4070  O  O   . LYS A 1 171 ? -10.571 86.527  22.377  0.25 36.90 ? 171 LYS A O   2 
ATOM   4071  C  CB  . LYS A 1 171 ? -11.450 84.429  24.590  0.25 40.30 ? 171 LYS A CB  2 
ATOM   4072  C  CG  . LYS A 1 171 ? -11.723 83.202  23.748  0.25 46.69 ? 171 LYS A CG  2 
ATOM   4073  C  CD  . LYS A 1 171 ? -13.048 82.560  24.115  0.25 51.14 ? 171 LYS A CD  2 
ATOM   4074  C  CE  . LYS A 1 171 ? -13.314 81.337  23.251  0.25 54.20 ? 171 LYS A CE  2 
ATOM   4075  N  NZ  . LYS A 1 171 ? -14.617 80.700  23.574  0.25 57.17 ? 171 LYS A NZ  2 
ATOM   4076  N  N   . VAL A 1 172 ? -9.425  84.625  22.001  0.25 35.53 ? 172 VAL A N   2 
ATOM   4077  C  CA  . VAL A 1 172 ? -9.325  84.809  20.553  0.25 34.41 ? 172 VAL A CA  2 
ATOM   4078  C  C   . VAL A 1 172 ? -9.871  83.535  19.902  0.25 33.00 ? 172 VAL A C   2 
ATOM   4079  O  O   . VAL A 1 172 ? -10.118 82.546  20.591  0.25 31.29 ? 172 VAL A O   2 
ATOM   4080  C  CB  . VAL A 1 172 ? -7.864  85.039  20.096  0.25 35.13 ? 172 VAL A CB  2 
ATOM   4081  C  CG1 . VAL A 1 172 ? -7.335  86.335  20.686  0.25 36.67 ? 172 VAL A CG1 2 
ATOM   4082  C  CG2 . VAL A 1 172 ? -6.995  83.872  20.514  0.25 34.98 ? 172 VAL A CG2 2 
ATOM   4083  N  N   . SER A 1 173 ? -10.063 83.552  18.586  0.25 31.16 ? 173 SER A N   2 
ATOM   4084  C  CA  . SER A 1 173 ? -10.600 82.383  17.890  0.25 30.17 ? 173 SER A CA  2 
ATOM   4085  C  C   . SER A 1 173 ? -9.838  81.091  18.194  0.25 30.11 ? 173 SER A C   2 
ATOM   4086  O  O   . SER A 1 173 ? -8.626  81.102  18.416  0.25 28.97 ? 173 SER A O   2 
ATOM   4087  C  CB  . SER A 1 173 ? -10.617 82.629  16.381  0.25 28.06 ? 173 SER A CB  2 
ATOM   4088  O  OG  . SER A 1 173 ? -9.312  82.854  15.892  0.25 29.58 ? 173 SER A OG  2 
ATOM   4089  N  N   . GLU A 1 174 ? -10.563 79.976  18.205  0.25 32.22 ? 174 GLU A N   2 
ATOM   4090  C  CA  . GLU A 1 174 ? -9.967  78.673  18.483  0.25 34.83 ? 174 GLU A CA  2 
ATOM   4091  C  C   . GLU A 1 174 ? -8.852  78.301  17.512  0.25 33.93 ? 174 GLU A C   2 
ATOM   4092  O  O   . GLU A 1 174 ? -7.816  77.778  17.923  0.25 33.62 ? 174 GLU A O   2 
ATOM   4093  C  CB  . GLU A 1 174 ? -11.041 77.579  18.464  0.25 38.82 ? 174 GLU A CB  2 
ATOM   4094  C  CG  . GLU A 1 174 ? -11.938 77.561  19.691  0.25 44.52 ? 174 GLU A CG  2 
ATOM   4095  C  CD  . GLU A 1 174 ? -12.871 76.363  19.711  0.25 46.91 ? 174 GLU A CD  2 
ATOM   4096  O  OE1 . GLU A 1 174 ? -13.754 76.276  18.830  0.25 49.41 ? 174 GLU A OE1 2 
ATOM   4097  O  OE2 . GLU A 1 174 ? -12.717 75.505  20.608  0.25 49.19 ? 174 GLU A OE2 2 
ATOM   4098  N  N   . GLU A 1 175 ? -9.061  78.564  16.227  0.25 33.05 ? 175 GLU A N   2 
ATOM   4099  C  CA  . GLU A 1 175 ? -8.050  78.240  15.225  0.25 33.91 ? 175 GLU A CA  2 
ATOM   4100  C  C   . GLU A 1 175 ? -6.723  78.901  15.567  0.25 32.98 ? 175 GLU A C   2 
ATOM   4101  O  O   . GLU A 1 175 ? -5.657  78.327  15.345  0.25 32.49 ? 175 GLU A O   2 
ATOM   4102  C  CB  . GLU A 1 175 ? -8.509  78.686  13.837  0.25 35.06 ? 175 GLU A CB  2 
ATOM   4103  C  CG  . GLU A 1 175 ? -8.885  80.149  13.744  0.25 38.28 ? 175 GLU A CG  2 
ATOM   4104  C  CD  . GLU A 1 175 ? -9.397  80.522  12.369  0.25 38.78 ? 175 GLU A CD  2 
ATOM   4105  O  OE1 . GLU A 1 175 ? -8.619  80.413  11.397  0.25 38.94 ? 175 GLU A OE1 2 
ATOM   4106  O  OE2 . GLU A 1 175 ? -10.579 80.916  12.260  0.25 40.89 ? 175 GLU A OE2 2 
ATOM   4107  N  N   . ILE A 1 176 ? -6.791  80.109  16.114  0.25 31.92 ? 176 ILE A N   2 
ATOM   4108  C  CA  . ILE A 1 176 ? -5.583  80.829  16.492  0.25 31.58 ? 176 ILE A CA  2 
ATOM   4109  C  C   . ILE A 1 176 ? -5.006  80.236  17.777  0.25 31.45 ? 176 ILE A C   2 
ATOM   4110  O  O   . ILE A 1 176 ? -3.816  79.928  17.853  0.25 30.92 ? 176 ILE A O   2 
ATOM   4111  C  CB  . ILE A 1 176 ? -5.871  82.329  16.715  0.25 30.69 ? 176 ILE A CB  2 
ATOM   4112  C  CG1 . ILE A 1 176 ? -6.425  82.951  15.428  0.25 31.64 ? 176 ILE A CG1 2 
ATOM   4113  C  CG2 . ILE A 1 176 ? -4.594  83.040  17.147  0.25 31.26 ? 176 ILE A CG2 2 
ATOM   4114  C  CD1 . ILE A 1 176 ? -6.775  84.433  15.541  0.25 29.80 ? 176 ILE A CD1 2 
ATOM   4115  N  N   . GLU A 1 177 ? -5.860  80.073  18.781  0.25 32.98 ? 177 GLU A N   2 
ATOM   4116  C  CA  . GLU A 1 177 ? -5.443  79.522  20.063  0.25 34.71 ? 177 GLU A CA  2 
ATOM   4117  C  C   . GLU A 1 177 ? -4.828  78.140  19.944  0.25 33.13 ? 177 GLU A C   2 
ATOM   4118  O  O   . GLU A 1 177 ? -3.815  77.850  20.583  0.25 31.61 ? 177 GLU A O   2 
ATOM   4119  C  CB  . GLU A 1 177 ? -6.630  79.467  21.027  0.25 38.96 ? 177 GLU A CB  2 
ATOM   4120  C  CG  . GLU A 1 177 ? -6.895  80.775  21.742  0.25 46.64 ? 177 GLU A CG  2 
ATOM   4121  C  CD  . GLU A 1 177 ? -5.695  81.243  22.543  0.25 49.52 ? 177 GLU A CD  2 
ATOM   4122  O  OE1 . GLU A 1 177 ? -5.166  80.440  23.342  0.25 52.22 ? 177 GLU A OE1 2 
ATOM   4123  O  OE2 . GLU A 1 177 ? -5.281  82.409  22.378  0.25 51.12 ? 177 GLU A OE2 2 
ATOM   4124  N  N   . ASP A 1 178 ? -5.437  77.288  19.126  0.25 32.26 ? 178 ASP A N   2 
ATOM   4125  C  CA  . ASP A 1 178 ? -4.935  75.936  18.946  0.25 33.87 ? 178 ASP A CA  2 
ATOM   4126  C  C   . ASP A 1 178 ? -3.537  75.927  18.345  0.25 33.11 ? 178 ASP A C   2 
ATOM   4127  O  O   . ASP A 1 178 ? -2.673  75.169  18.789  0.25 31.72 ? 178 ASP A O   2 
ATOM   4128  C  CB  . ASP A 1 178 ? -5.886  75.123  18.064  0.25 37.94 ? 178 ASP A CB  2 
ATOM   4129  C  CG  . ASP A 1 178 ? -7.286  75.035  18.646  0.25 41.66 ? 178 ASP A CG  2 
ATOM   4130  O  OD1 . ASP A 1 178 ? -7.410  74.983  19.888  0.25 42.27 ? 178 ASP A OD1 2 
ATOM   4131  O  OD2 . ASP A 1 178 ? -8.260  75.004  17.862  0.25 44.54 ? 178 ASP A OD2 2 
ATOM   4132  N  N   . ILE A 1 179 ? -3.311  76.765  17.338  0.25 31.77 ? 179 ILE A N   2 
ATOM   4133  C  CA  . ILE A 1 179 ? -1.999  76.827  16.702  0.25 30.72 ? 179 ILE A CA  2 
ATOM   4134  C  C   . ILE A 1 179 ? -0.936  77.118  17.749  0.25 30.19 ? 179 ILE A C   2 
ATOM   4135  O  O   . ILE A 1 179 ? 0.113   76.477  17.773  0.25 29.65 ? 179 ILE A O   2 
ATOM   4136  C  CB  . ILE A 1 179 ? -1.936  77.921  15.613  0.25 29.25 ? 179 ILE A CB  2 
ATOM   4137  C  CG1 . ILE A 1 179 ? -2.855  77.550  14.446  0.25 30.03 ? 179 ILE A CG1 2 
ATOM   4138  C  CG2 . ILE A 1 179 ? -0.504  78.080  15.125  0.25 28.56 ? 179 ILE A CG2 2 
ATOM   4139  C  CD1 . ILE A 1 179 ? -2.855  78.557  13.313  0.25 28.26 ? 179 ILE A CD1 2 
ATOM   4140  N  N   . ILE A 1 180 ? -1.214  78.084  18.617  0.25 31.56 ? 180 ILE A N   2 
ATOM   4141  C  CA  . ILE A 1 180 ? -0.277  78.447  19.671  0.25 34.36 ? 180 ILE A CA  2 
ATOM   4142  C  C   . ILE A 1 180 ? -0.141  77.305  20.674  0.25 37.96 ? 180 ILE A C   2 
ATOM   4143  O  O   . ILE A 1 180 ? 0.969   76.843  20.946  0.25 37.37 ? 180 ILE A O   2 
ATOM   4144  C  CB  . ILE A 1 180 ? -0.730  79.734  20.395  0.25 33.72 ? 180 ILE A CB  2 
ATOM   4145  C  CG1 . ILE A 1 180 ? -0.679  80.912  19.420  0.25 31.65 ? 180 ILE A CG1 2 
ATOM   4146  C  CG2 . ILE A 1 180 ? 0.162   80.009  21.595  0.25 33.98 ? 180 ILE A CG2 2 
ATOM   4147  C  CD1 . ILE A 1 180 ? -1.153  82.216  20.005  0.25 29.38 ? 180 ILE A CD1 2 
ATOM   4148  N  N   . LYS A 1 181 ? -1.269  76.844  21.211  0.25 41.59 ? 181 LYS A N   2 
ATOM   4149  C  CA  . LYS A 1 181 ? -1.262  75.746  22.174  0.25 44.66 ? 181 LYS A CA  2 
ATOM   4150  C  C   . LYS A 1 181 ? -0.285  74.649  21.767  0.25 44.79 ? 181 LYS A C   2 
ATOM   4151  O  O   . LYS A 1 181 ? 0.716   74.423  22.445  0.25 45.47 ? 181 LYS A O   2 
ATOM   4152  C  CB  . LYS A 1 181 ? -2.662  75.144  22.318  0.25 48.40 ? 181 LYS A CB  2 
ATOM   4153  C  CG  . LYS A 1 181 ? -3.550  75.828  23.348  0.25 52.35 ? 181 LYS A CG  2 
ATOM   4154  C  CD  . LYS A 1 181 ? -4.840  75.039  23.551  0.25 54.75 ? 181 LYS A CD  2 
ATOM   4155  C  CE  . LYS A 1 181 ? -5.638  75.553  24.738  0.25 56.05 ? 181 LYS A CE  2 
ATOM   4156  N  NZ  . LYS A 1 181 ? -6.048  76.971  24.566  0.25 59.20 ? 181 LYS A NZ  2 
ATOM   4157  N  N   . LYS A 1 182 ? -0.575  73.971  20.660  0.25 44.67 ? 182 LYS A N   2 
ATOM   4158  C  CA  . LYS A 1 182 ? 0.290   72.898  20.178  0.25 46.61 ? 182 LYS A CA  2 
ATOM   4159  C  C   . LYS A 1 182 ? 1.727   73.374  19.978  0.25 46.52 ? 182 LYS A C   2 
ATOM   4160  O  O   . LYS A 1 182 ? 2.637   72.734  20.548  0.25 43.46 ? 182 LYS A O   2 
ATOM   4161  C  CB  . LYS A 1 182 ? -0.249  72.318  18.865  0.25 47.76 ? 182 LYS A CB  2 
ATOM   4162  C  CG  . LYS A 1 182 ? -0.436  73.335  17.748  0.25 52.29 ? 182 LYS A CG  2 
ATOM   4163  C  CD  . LYS A 1 182 ? -0.744  72.652  16.418  0.25 55.19 ? 182 LYS A CD  2 
ATOM   4164  C  CE  . LYS A 1 182 ? -1.980  71.766  16.501  0.25 56.09 ? 182 LYS A CE  2 
ATOM   4165  N  NZ  . LYS A 1 182 ? -3.207  72.536  16.840  0.25 57.97 ? 182 LYS A NZ  2 
ATOM   4166  N  N   . GLU B 1 15  ? 1.406   91.546  -23.427 0.25 31.17 ? 15  GLU B N   2 
ATOM   4167  C  CA  . GLU B 1 15  ? 2.655   92.303  -23.725 0.25 32.74 ? 15  GLU B CA  2 
ATOM   4168  C  C   . GLU B 1 15  ? 2.581   93.744  -23.224 0.25 29.33 ? 15  GLU B C   2 
ATOM   4169  O  O   . GLU B 1 15  ? 3.565   94.481  -23.294 0.25 28.86 ? 15  GLU B O   2 
ATOM   4170  C  CB  . GLU B 1 15  ? 2.921   92.325  -25.231 0.25 36.66 ? 15  GLU B CB  2 
ATOM   4171  C  CG  . GLU B 1 15  ? 1.880   93.088  -26.032 0.25 44.60 ? 15  GLU B CG  2 
ATOM   4172  C  CD  . GLU B 1 15  ? 2.312   93.331  -27.466 0.25 48.08 ? 15  GLU B CD  2 
ATOM   4173  O  OE1 . GLU B 1 15  ? 3.303   94.065  -27.670 0.25 50.84 ? 15  GLU B OE1 2 
ATOM   4174  O  OE2 . GLU B 1 15  ? 1.665   92.787  -28.387 0.25 51.37 ? 15  GLU B OE2 2 
ATOM   4175  N  N   . SER B 1 16  ? 1.416   94.150  -22.734 0.25 25.59 ? 16  SER B N   2 
ATOM   4176  C  CA  . SER B 1 16  ? 1.252   95.513  -22.239 0.25 22.56 ? 16  SER B CA  2 
ATOM   4177  C  C   . SER B 1 16  ? 0.508   95.550  -20.913 0.25 20.40 ? 16  SER B C   2 
ATOM   4178  O  O   . SER B 1 16  ? 0.004   94.527  -20.437 0.25 17.86 ? 16  SER B O   2 
ATOM   4179  C  CB  . SER B 1 16  ? 0.486   96.356  -23.260 0.25 23.00 ? 16  SER B CB  2 
ATOM   4180  O  OG  . SER B 1 16  ? -0.864  95.935  -23.360 0.25 19.57 ? 16  SER B OG  2 
ATOM   4181  N  N   . PHE B 1 17  ? 0.449   96.737  -20.316 0.25 17.41 ? 17  PHE B N   2 
ATOM   4182  C  CA  . PHE B 1 17  ? -0.260  96.923  -19.059 0.25 14.78 ? 17  PHE B CA  2 
ATOM   4183  C  C   . PHE B 1 17  ? -0.922  98.288  -19.060 0.25 13.85 ? 17  PHE B C   2 
ATOM   4184  O  O   . PHE B 1 17  ? -0.621  99.138  -19.904 0.25 12.20 ? 17  PHE B O   2 
ATOM   4185  C  CB  . PHE B 1 17  ? 0.688   96.792  -17.852 0.25 13.17 ? 17  PHE B CB  2 
ATOM   4186  C  CG  . PHE B 1 17  ? 1.674   97.921  -17.714 0.25 11.26 ? 17  PHE B CG  2 
ATOM   4187  C  CD1 . PHE B 1 17  ? 2.739   98.050  -18.598 0.25 11.76 ? 17  PHE B CD1 2 
ATOM   4188  C  CD2 . PHE B 1 17  ? 1.529   98.864  -16.700 0.25 12.48 ? 17  PHE B CD2 2 
ATOM   4189  C  CE1 . PHE B 1 17  ? 3.649   99.105  -18.475 0.25 11.73 ? 17  PHE B CE1 2 
ATOM   4190  C  CE2 . PHE B 1 17  ? 2.430   99.922  -16.569 0.25 9.89  ? 17  PHE B CE2 2 
ATOM   4191  C  CZ  . PHE B 1 17  ? 3.493   100.044 -17.458 0.25 11.51 ? 17  PHE B CZ  2 
ATOM   4192  N  N   . LEU B 1 18  ? -1.829  98.491  -18.114 0.25 11.22 ? 18  LEU B N   2 
ATOM   4193  C  CA  . LEU B 1 18  ? -2.545  99.747  -18.010 0.25 11.46 ? 18  LEU B CA  2 
ATOM   4194  C  C   . LEU B 1 18  ? -2.024  100.513 -16.808 0.25 12.62 ? 18  LEU B C   2 
ATOM   4195  O  O   . LEU B 1 18  ? -1.826  99.940  -15.728 0.25 9.77  ? 18  LEU B O   2 
ATOM   4196  C  CB  . LEU B 1 18  ? -4.046  99.489  -17.870 0.25 8.16  ? 18  LEU B CB  2 
ATOM   4197  C  CG  . LEU B 1 18  ? -4.657  98.738  -19.051 0.25 13.04 ? 18  LEU B CG  2 
ATOM   4198  C  CD1 . LEU B 1 18  ? -6.106  98.388  -18.739 0.25 10.80 ? 18  LEU B CD1 2 
ATOM   4199  C  CD2 . LEU B 1 18  ? -4.569  99.598  -20.313 0.25 10.34 ? 18  LEU B CD2 2 
ATOM   4200  N  N   . TYR B 1 19  ? -1.801  101.809 -17.019 0.25 10.03 ? 19  TYR B N   2 
ATOM   4201  C  CA  . TYR B 1 19  ? -1.276  102.703 -15.992 0.25 11.17 ? 19  TYR B CA  2 
ATOM   4202  C  C   . TYR B 1 19  ? -2.315  103.759 -15.612 0.25 10.94 ? 19  TYR B C   2 
ATOM   4203  O  O   . TYR B 1 19  ? -2.863  104.444 -16.484 0.25 10.34 ? 19  TYR B O   2 
ATOM   4204  C  CB  . TYR B 1 19  ? 0.012   103.359 -16.519 0.25 10.49 ? 19  TYR B CB  2 
ATOM   4205  C  CG  . TYR B 1 19  ? 0.491   104.569 -15.752 0.25 10.82 ? 19  TYR B CG  2 
ATOM   4206  C  CD1 . TYR B 1 19  ? 0.663   104.528 -14.368 0.25 11.99 ? 19  TYR B CD1 2 
ATOM   4207  C  CD2 . TYR B 1 19  ? 0.768   105.766 -16.415 0.25 10.96 ? 19  TYR B CD2 2 
ATOM   4208  C  CE1 . TYR B 1 19  ? 1.095   105.658 -13.659 0.25 12.38 ? 19  TYR B CE1 2 
ATOM   4209  C  CE2 . TYR B 1 19  ? 1.204   106.897 -15.717 0.25 11.84 ? 19  TYR B CE2 2 
ATOM   4210  C  CZ  . TYR B 1 19  ? 1.361   106.838 -14.343 0.25 12.35 ? 19  TYR B CZ  2 
ATOM   4211  O  OH  . TYR B 1 19  ? 1.757   107.970 -13.658 0.25 14.22 ? 19  TYR B OH  2 
ATOM   4212  N  N   . PHE B 1 20  ? -2.594  103.867 -14.311 0.25 10.34 ? 20  PHE B N   2 
ATOM   4213  C  CA  . PHE B 1 20  ? -3.571  104.831 -13.795 0.25 8.20  ? 20  PHE B CA  2 
ATOM   4214  C  C   . PHE B 1 20  ? -2.839  106.039 -13.234 0.25 8.82  ? 20  PHE B C   2 
ATOM   4215  O  O   . PHE B 1 20  ? -2.286  105.995 -12.129 0.25 8.04  ? 20  PHE B O   2 
ATOM   4216  C  CB  . PHE B 1 20  ? -4.432  104.202 -12.689 0.25 8.76  ? 20  PHE B CB  2 
ATOM   4217  C  CG  . PHE B 1 20  ? -5.466  105.137 -12.109 0.25 8.96  ? 20  PHE B CG  2 
ATOM   4218  C  CD1 . PHE B 1 20  ? -6.538  105.579 -12.881 0.25 10.23 ? 20  PHE B CD1 2 
ATOM   4219  C  CD2 . PHE B 1 20  ? -5.368  105.572 -10.789 0.25 9.81  ? 20  PHE B CD2 2 
ATOM   4220  C  CE1 . PHE B 1 20  ? -7.507  106.441 -12.349 0.25 9.69  ? 20  PHE B CE1 2 
ATOM   4221  C  CE2 . PHE B 1 20  ? -6.331  106.439 -10.240 0.25 11.45 ? 20  PHE B CE2 2 
ATOM   4222  C  CZ  . PHE B 1 20  ? -7.400  106.873 -11.023 0.25 10.75 ? 20  PHE B CZ  2 
ATOM   4223  N  N   . ALA B 1 21  ? -2.841  107.116 -14.007 0.25 6.97  ? 21  ALA B N   2 
ATOM   4224  C  CA  . ALA B 1 21  ? -2.174  108.352 -13.614 0.25 8.64  ? 21  ALA B CA  2 
ATOM   4225  C  C   . ALA B 1 21  ? -3.186  109.314 -13.006 0.25 8.66  ? 21  ALA B C   2 
ATOM   4226  O  O   . ALA B 1 21  ? -4.245  109.551 -13.587 0.25 7.96  ? 21  ALA B O   2 
ATOM   4227  C  CB  . ALA B 1 21  ? -1.513  108.997 -14.841 0.25 6.32  ? 21  ALA B CB  2 
ATOM   4228  N  N   . TYR B 1 22  ? -2.852  109.876 -11.845 0.25 8.62  ? 22  TYR B N   2 
ATOM   4229  C  CA  . TYR B 1 22  ? -3.753  110.814 -11.186 0.25 7.95  ? 22  TYR B CA  2 
ATOM   4230  C  C   . TYR B 1 22  ? -3.099  112.156 -10.855 0.25 6.94  ? 22  TYR B C   2 
ATOM   4231  O  O   . TYR B 1 22  ? -3.685  112.974 -10.154 0.25 8.37  ? 22  TYR B O   2 
ATOM   4232  C  CB  . TYR B 1 22  ? -4.353  110.174 -9.918  0.25 8.61  ? 22  TYR B CB  2 
ATOM   4233  C  CG  . TYR B 1 22  ? -3.341  109.745 -8.873  0.25 7.12  ? 22  TYR B CG  2 
ATOM   4234  C  CD1 . TYR B 1 22  ? -2.769  110.668 -8.005  0.25 6.43  ? 22  TYR B CD1 2 
ATOM   4235  C  CD2 . TYR B 1 22  ? -2.956  108.410 -8.761  0.25 9.17  ? 22  TYR B CD2 2 
ATOM   4236  C  CE1 . TYR B 1 22  ? -1.831  110.271 -7.037  0.25 10.87 ? 22  TYR B CE1 2 
ATOM   4237  C  CE2 . TYR B 1 22  ? -2.019  107.999 -7.803  0.25 11.05 ? 22  TYR B CE2 2 
ATOM   4238  C  CZ  . TYR B 1 22  ? -1.463  108.938 -6.943  0.25 10.10 ? 22  TYR B CZ  2 
ATOM   4239  O  OH  . TYR B 1 22  ? -0.549  108.540 -5.995  0.25 8.55  ? 22  TYR B OH  2 
ATOM   4240  N  N   . GLY B 1 23  ? -1.902  112.392 -11.394 0.25 7.37  ? 23  GLY B N   2 
ATOM   4241  C  CA  . GLY B 1 23  ? -1.195  113.639 -11.143 0.25 8.21  ? 23  GLY B CA  2 
ATOM   4242  C  C   . GLY B 1 23  ? -0.549  114.254 -12.376 0.25 8.07  ? 23  GLY B C   2 
ATOM   4243  O  O   . GLY B 1 23  ? -1.226  114.516 -13.369 0.25 9.62  ? 23  GLY B O   2 
ATOM   4244  N  N   . SER B 1 24  ? 0.761   114.481 -12.322 0.25 10.48 ? 24  SER B N   2 
ATOM   4245  C  CA  . SER B 1 24  ? 1.476   115.074 -13.449 0.25 11.99 ? 24  SER B CA  2 
ATOM   4246  C  C   . SER B 1 24  ? 1.224   114.330 -14.757 0.25 11.71 ? 24  SER B C   2 
ATOM   4247  O  O   . SER B 1 24  ? 0.921   114.953 -15.779 0.25 11.47 ? 24  SER B O   2 
ATOM   4248  C  CB  . SER B 1 24  ? 2.984   115.133 -13.168 0.25 13.85 ? 24  SER B CB  2 
ATOM   4249  O  OG  . SER B 1 24  ? 3.518   113.846 -12.921 0.25 15.39 ? 24  SER B OG  2 
ATOM   4250  N  N   . ASN B 1 25  ? 1.346   113.004 -14.744 0.25 9.19  ? 25  ASN B N   2 
ATOM   4251  C  CA  . ASN B 1 25  ? 1.105   112.246 -15.966 0.25 9.55  ? 25  ASN B CA  2 
ATOM   4252  C  C   . ASN B 1 25  ? -0.358  112.274 -16.424 0.25 10.66 ? 25  ASN B C   2 
ATOM   4253  O  O   . ASN B 1 25  ? -0.769  111.476 -17.271 0.25 10.48 ? 25  ASN B O   2 
ATOM   4254  C  CB  . ASN B 1 25  ? 1.605   110.798 -15.831 0.25 9.27  ? 25  ASN B CB  2 
ATOM   4255  C  CG  . ASN B 1 25  ? 3.131   110.700 -15.864 0.25 12.42 ? 25  ASN B CG  2 
ATOM   4256  O  OD1 . ASN B 1 25  ? 3.817   111.625 -16.315 0.25 12.34 ? 25  ASN B OD1 2 
ATOM   4257  N  ND2 . ASN B 1 25  ? 3.667   109.571 -15.403 0.25 8.32  ? 25  ASN B ND2 2 
ATOM   4258  N  N   . LEU B 1 26  ? -1.150  113.184 -15.862 0.25 10.39 ? 26  LEU B N   2 
ATOM   4259  C  CA  . LEU B 1 26  ? -2.534  113.334 -16.306 0.25 9.73  ? 26  LEU B CA  2 
ATOM   4260  C  C   . LEU B 1 26  ? -2.493  114.136 -17.611 0.25 10.48 ? 26  LEU B C   2 
ATOM   4261  O  O   . LEU B 1 26  ? -3.472  114.175 -18.355 0.25 11.39 ? 26  LEU B O   2 
ATOM   4262  C  CB  . LEU B 1 26  ? -3.366  114.114 -15.287 0.25 11.52 ? 26  LEU B CB  2 
ATOM   4263  C  CG  . LEU B 1 26  ? -3.927  113.402 -14.058 0.25 9.44  ? 26  LEU B CG  2 
ATOM   4264  C  CD1 . LEU B 1 26  ? -4.607  114.426 -13.159 0.25 12.20 ? 26  LEU B CD1 2 
ATOM   4265  C  CD2 . LEU B 1 26  ? -4.918  112.336 -14.500 0.25 13.78 ? 26  LEU B CD2 2 
ATOM   4266  N  N   . LEU B 1 27  ? -1.355  114.776 -17.879 0.25 8.07  ? 27  LEU B N   2 
ATOM   4267  C  CA  . LEU B 1 27  ? -1.194  115.589 -19.087 0.25 10.63 ? 27  LEU B CA  2 
ATOM   4268  C  C   . LEU B 1 27  ? -0.342  114.890 -20.145 0.25 11.09 ? 27  LEU B C   2 
ATOM   4269  O  O   . LEU B 1 27  ? 0.847   114.653 -19.945 0.25 10.00 ? 27  LEU B O   2 
ATOM   4270  C  CB  . LEU B 1 27  ? -0.558  116.940 -18.743 0.25 10.70 ? 27  LEU B CB  2 
ATOM   4271  C  CG  . LEU B 1 27  ? -0.534  117.916 -19.924 0.25 13.79 ? 27  LEU B CG  2 
ATOM   4272  C  CD1 . LEU B 1 27  ? -1.963  118.329 -20.239 0.25 11.09 ? 27  LEU B CD1 2 
ATOM   4273  C  CD2 . LEU B 1 27  ? 0.318   119.138 -19.607 0.25 11.54 ? 27  LEU B CD2 2 
ATOM   4274  N  N   . THR B 1 28  ? -0.964  114.580 -21.277 0.25 12.95 ? 28  THR B N   2 
ATOM   4275  C  CA  . THR B 1 28  ? -0.297  113.902 -22.383 0.25 12.96 ? 28  THR B CA  2 
ATOM   4276  C  C   . THR B 1 28  ? 1.073   114.486 -22.711 0.25 14.12 ? 28  THR B C   2 
ATOM   4277  O  O   . THR B 1 28  ? 2.058   113.758 -22.814 0.25 14.07 ? 28  THR B O   2 
ATOM   4278  C  CB  . THR B 1 28  ? -1.158  113.960 -23.651 0.25 13.83 ? 28  THR B CB  2 
ATOM   4279  O  OG1 . THR B 1 28  ? -2.473  113.467 -23.361 0.25 12.00 ? 28  THR B OG1 2 
ATOM   4280  C  CG2 . THR B 1 28  ? -0.534  113.117 -24.750 0.25 12.80 ? 28  THR B CG2 2 
ATOM   4281  N  N   . GLU B 1 29  ? 1.131   115.801 -22.880 0.25 16.40 ? 29  GLU B N   2 
ATOM   4282  C  CA  . GLU B 1 29  ? 2.385   116.466 -23.206 0.25 17.73 ? 29  GLU B CA  2 
ATOM   4283  C  C   . GLU B 1 29  ? 3.458   116.173 -22.158 0.25 16.69 ? 29  GLU B C   2 
ATOM   4284  O  O   . GLU B 1 29  ? 4.652   116.298 -22.430 0.25 15.57 ? 29  GLU B O   2 
ATOM   4285  C  CB  . GLU B 1 29  ? 2.162   117.978 -23.322 0.25 20.37 ? 29  GLU B CB  2 
ATOM   4286  C  CG  . GLU B 1 29  ? 3.336   118.729 -23.916 0.25 26.25 ? 29  GLU B CG  2 
ATOM   4287  C  CD  . GLU B 1 29  ? 3.066   120.216 -24.062 0.25 28.20 ? 29  GLU B CD  2 
ATOM   4288  O  OE1 . GLU B 1 29  ? 2.086   120.578 -24.744 0.25 30.30 ? 29  GLU B OE1 2 
ATOM   4289  O  OE2 . GLU B 1 29  ? 3.838   121.023 -23.497 0.25 30.98 ? 29  GLU B OE2 2 
ATOM   4290  N  N   . ARG B 1 30  ? 3.029   115.781 -20.962 0.25 14.69 ? 30  ARG B N   2 
ATOM   4291  C  CA  . ARG B 1 30  ? 3.962   115.471 -19.882 0.25 14.44 ? 30  ARG B CA  2 
ATOM   4292  C  C   . ARG B 1 30  ? 4.333   113.985 -19.831 0.25 12.21 ? 30  ARG B C   2 
ATOM   4293  O  O   . ARG B 1 30  ? 5.514   113.638 -19.748 0.25 13.39 ? 30  ARG B O   2 
ATOM   4294  C  CB  . ARG B 1 30  ? 3.371   115.913 -18.533 0.25 16.25 ? 30  ARG B CB  2 
ATOM   4295  C  CG  . ARG B 1 30  ? 4.176   115.474 -17.313 0.25 18.92 ? 30  ARG B CG  2 
ATOM   4296  C  CD  . ARG B 1 30  ? 5.580   116.058 -17.330 0.25 21.73 ? 30  ARG B CD  2 
ATOM   4297  N  NE  . ARG B 1 30  ? 6.360   115.648 -16.165 0.25 23.91 ? 30  ARG B NE  2 
ATOM   4298  C  CZ  . ARG B 1 30  ? 7.571   116.119 -15.877 0.25 25.44 ? 30  ARG B CZ  2 
ATOM   4299  N  NH1 . ARG B 1 30  ? 8.141   117.016 -16.669 0.25 21.81 ? 30  ARG B NH1 2 
ATOM   4300  N  NH2 . ARG B 1 30  ? 8.209   115.700 -14.794 0.25 24.01 ? 30  ARG B NH2 2 
ATOM   4301  N  N   . ILE B 1 31  ? 3.341   113.103 -19.887 0.25 11.81 ? 31  ILE B N   2 
ATOM   4302  C  CA  . ILE B 1 31  ? 3.637   111.674 -19.828 0.25 11.05 ? 31  ILE B CA  2 
ATOM   4303  C  C   . ILE B 1 31  ? 4.491   111.227 -21.015 0.25 12.04 ? 31  ILE B C   2 
ATOM   4304  O  O   . ILE B 1 31  ? 5.372   110.381 -20.864 0.25 12.67 ? 31  ILE B O   2 
ATOM   4305  C  CB  . ILE B 1 31  ? 2.356   110.809 -19.783 0.25 10.30 ? 31  ILE B CB  2 
ATOM   4306  C  CG1 . ILE B 1 31  ? 2.738   109.358 -19.471 0.25 8.20  ? 31  ILE B CG1 2 
ATOM   4307  C  CG2 . ILE B 1 31  ? 1.619   110.868 -21.117 0.25 7.17  ? 31  ILE B CG2 2 
ATOM   4308  C  CD1 . ILE B 1 31  ? 1.548   108.438 -19.233 0.25 11.46 ? 31  ILE B CD1 2 
ATOM   4309  N  N   . HIS B 1 32  ? 4.235   111.809 -22.185 0.25 12.39 ? 32  HIS B N   2 
ATOM   4310  C  CA  . HIS B 1 32  ? 4.974   111.468 -23.396 0.25 12.99 ? 32  HIS B CA  2 
ATOM   4311  C  C   . HIS B 1 32  ? 6.418   111.954 -23.376 0.25 15.09 ? 32  HIS B C   2 
ATOM   4312  O  O   . HIS B 1 32  ? 7.162   111.722 -24.331 0.25 15.87 ? 32  HIS B O   2 
ATOM   4313  C  CB  . HIS B 1 32  ? 4.272   112.045 -24.632 0.25 13.17 ? 32  HIS B CB  2 
ATOM   4314  C  CG  . HIS B 1 32  ? 3.109   111.229 -25.106 0.25 9.82  ? 32  HIS B CG  2 
ATOM   4315  N  ND1 . HIS B 1 32  ? 2.204   111.695 -26.034 0.25 9.90  ? 32  HIS B ND1 2 
ATOM   4316  C  CD2 . HIS B 1 32  ? 2.707   109.977 -24.783 0.25 7.19  ? 32  HIS B CD2 2 
ATOM   4317  C  CE1 . HIS B 1 32  ? 1.291   110.766 -26.261 0.25 8.38  ? 32  HIS B CE1 2 
ATOM   4318  N  NE2 . HIS B 1 32  ? 1.573   109.714 -25.515 0.25 10.25 ? 32  HIS B NE2 2 
ATOM   4319  N  N   . LEU B 1 33  ? 6.818   112.630 -22.303 0.25 14.55 ? 33  LEU B N   2 
ATOM   4320  C  CA  . LEU B 1 33  ? 8.188   113.125 -22.210 0.25 15.63 ? 33  LEU B CA  2 
ATOM   4321  C  C   . LEU B 1 33  ? 9.150   111.944 -22.101 0.25 17.04 ? 33  LEU B C   2 
ATOM   4322  O  O   . LEU B 1 33  ? 10.106  111.837 -22.871 0.25 16.57 ? 33  LEU B O   2 
ATOM   4323  C  CB  . LEU B 1 33  ? 8.349   114.053 -20.996 0.25 16.09 ? 33  LEU B CB  2 
ATOM   4324  C  CG  . LEU B 1 33  ? 9.685   114.798 -20.892 0.25 17.88 ? 33  LEU B CG  2 
ATOM   4325  C  CD1 . LEU B 1 33  ? 9.901   115.633 -22.141 0.25 19.79 ? 33  LEU B CD1 2 
ATOM   4326  C  CD2 . LEU B 1 33  ? 9.694   115.691 -19.660 0.25 19.02 ? 33  LEU B CD2 2 
ATOM   4327  N  N   . ARG B 1 34  ? 8.884   111.055 -21.148 0.25 16.24 ? 34  ARG B N   2 
ATOM   4328  C  CA  . ARG B 1 34  ? 9.707   109.868 -20.930 0.25 16.17 ? 34  ARG B CA  2 
ATOM   4329  C  C   . ARG B 1 34  ? 9.004   108.627 -21.491 0.25 15.51 ? 34  ARG B C   2 
ATOM   4330  O  O   . ARG B 1 34  ? 9.623   107.579 -21.673 0.25 15.09 ? 34  ARG B O   2 
ATOM   4331  C  CB  . ARG B 1 34  ? 9.959   109.663 -19.427 0.25 20.28 ? 34  ARG B CB  2 
ATOM   4332  C  CG  . ARG B 1 34  ? 10.863  110.705 -18.758 0.25 23.70 ? 34  ARG B CG  2 
ATOM   4333  C  CD  . ARG B 1 34  ? 12.298  110.598 -19.259 0.25 25.55 ? 34  ARG B CD  2 
ATOM   4334  N  NE  . ARG B 1 34  ? 12.827  109.244 -19.105 0.25 26.40 ? 34  ARG B NE  2 
ATOM   4335  C  CZ  . ARG B 1 34  ? 13.127  108.679 -17.939 0.25 27.25 ? 34  ARG B CZ  2 
ATOM   4336  N  NH1 . ARG B 1 34  ? 12.961  109.350 -16.807 0.25 29.40 ? 34  ARG B NH1 2 
ATOM   4337  N  NH2 . ARG B 1 34  ? 13.576  107.432 -17.904 0.25 26.94 ? 34  ARG B NH2 2 
ATOM   4338  N  N   . ASN B 1 35  ? 7.709   108.754 -21.767 0.25 12.87 ? 35  ASN B N   2 
ATOM   4339  C  CA  . ASN B 1 35  ? 6.913   107.636 -22.280 0.25 11.43 ? 35  ASN B CA  2 
ATOM   4340  C  C   . ASN B 1 35  ? 6.211   107.980 -23.595 0.25 10.89 ? 35  ASN B C   2 
ATOM   4341  O  O   . ASN B 1 35  ? 4.982   108.098 -23.646 0.25 9.41  ? 35  ASN B O   2 
ATOM   4342  C  CB  . ASN B 1 35  ? 5.872   107.240 -21.233 0.25 11.82 ? 35  ASN B CB  2 
ATOM   4343  C  CG  . ASN B 1 35  ? 6.502   106.784 -19.941 0.25 12.50 ? 35  ASN B CG  2 
ATOM   4344  O  OD1 . ASN B 1 35  ? 7.017   105.675 -19.858 0.25 12.67 ? 35  ASN B OD1 2 
ATOM   4345  N  ND2 . ASN B 1 35  ? 6.481   107.646 -18.926 0.25 14.04 ? 35  ASN B ND2 2 
ATOM   4346  N  N   . PRO B 1 36  ? 6.980   108.115 -24.684 0.25 10.52 ? 36  PRO B N   2 
ATOM   4347  C  CA  . PRO B 1 36  ? 6.424   108.454 -26.000 0.25 11.73 ? 36  PRO B CA  2 
ATOM   4348  C  C   . PRO B 1 36  ? 5.360   107.527 -26.572 0.25 13.08 ? 36  PRO B C   2 
ATOM   4349  O  O   . PRO B 1 36  ? 4.456   107.984 -27.280 0.25 12.69 ? 36  PRO B O   2 
ATOM   4350  C  CB  . PRO B 1 36  ? 7.667   108.535 -26.895 0.25 12.08 ? 36  PRO B CB  2 
ATOM   4351  C  CG  . PRO B 1 36  ? 8.623   107.559 -26.235 0.25 13.29 ? 36  PRO B CG  2 
ATOM   4352  C  CD  . PRO B 1 36  ? 8.433   107.874 -24.766 0.25 10.30 ? 36  PRO B CD  2 
ATOM   4353  N  N   . SER B 1 37  ? 5.443   106.235 -26.273 0.25 13.60 ? 37  SER B N   2 
ATOM   4354  C  CA  . SER B 1 37  ? 4.464   105.299 -26.823 0.25 14.14 ? 37  SER B CA  2 
ATOM   4355  C  C   . SER B 1 37  ? 3.147   105.174 -26.044 0.25 13.14 ? 37  SER B C   2 
ATOM   4356  O  O   . SER B 1 37  ? 2.172   104.634 -26.565 0.25 11.33 ? 37  SER B O   2 
ATOM   4357  C  CB  . SER B 1 37  ? 5.097   103.910 -27.003 0.25 14.37 ? 37  SER B CB  2 
ATOM   4358  O  OG  . SER B 1 37  ? 5.478   103.339 -25.765 0.25 17.51 ? 37  SER B OG  2 
ATOM   4359  N  N   . ALA B 1 38  ? 3.111   105.673 -24.811 0.25 12.60 ? 38  ALA B N   2 
ATOM   4360  C  CA  . ALA B 1 38  ? 1.896   105.599 -23.999 0.25 12.72 ? 38  ALA B CA  2 
ATOM   4361  C  C   . ALA B 1 38  ? 0.708   106.146 -24.790 0.25 12.40 ? 38  ALA B C   2 
ATOM   4362  O  O   . ALA B 1 38  ? 0.832   107.142 -25.505 0.25 13.59 ? 38  ALA B O   2 
ATOM   4363  C  CB  . ALA B 1 38  ? 2.074   106.395 -22.699 0.25 12.80 ? 38  ALA B CB  2 
ATOM   4364  N  N   . ALA B 1 39  ? -0.441  105.493 -24.658 0.25 11.05 ? 39  ALA B N   2 
ATOM   4365  C  CA  . ALA B 1 39  ? -1.642  105.916 -25.370 0.25 11.78 ? 39  ALA B CA  2 
ATOM   4366  C  C   . ALA B 1 39  ? -2.842  105.953 -24.440 0.25 12.54 ? 39  ALA B C   2 
ATOM   4367  O  O   . ALA B 1 39  ? -2.992  105.094 -23.566 0.25 10.80 ? 39  ALA B O   2 
ATOM   4368  C  CB  . ALA B 1 39  ? -1.919  104.965 -26.547 0.25 14.33 ? 39  ALA B CB  2 
ATOM   4369  N  N   . PHE B 1 40  ? -3.690  106.959 -24.633 0.25 11.69 ? 40  PHE B N   2 
ATOM   4370  C  CA  . PHE B 1 40  ? -4.891  107.130 -23.826 0.25 12.57 ? 40  PHE B CA  2 
ATOM   4371  C  C   . PHE B 1 40  ? -5.730  105.874 -23.911 0.25 12.05 ? 40  PHE B C   2 
ATOM   4372  O  O   . PHE B 1 40  ? -5.914  105.320 -24.993 0.25 11.23 ? 40  PHE B O   2 
ATOM   4373  C  CB  . PHE B 1 40  ? -5.727  108.302 -24.349 0.25 12.57 ? 40  PHE B CB  2 
ATOM   4374  C  CG  . PHE B 1 40  ? -7.002  108.528 -23.578 0.25 11.51 ? 40  PHE B CG  2 
ATOM   4375  C  CD1 . PHE B 1 40  ? -7.005  109.303 -22.424 0.25 11.70 ? 40  PHE B CD1 2 
ATOM   4376  C  CD2 . PHE B 1 40  ? -8.199  107.954 -24.002 0.25 10.75 ? 40  PHE B CD2 2 
ATOM   4377  C  CE1 . PHE B 1 40  ? -8.187  109.507 -21.700 0.25 14.51 ? 40  PHE B CE1 2 
ATOM   4378  C  CE2 . PHE B 1 40  ? -9.382  108.149 -23.290 0.25 12.53 ? 40  PHE B CE2 2 
ATOM   4379  C  CZ  . PHE B 1 40  ? -9.378  108.928 -22.136 0.25 10.91 ? 40  PHE B CZ  2 
ATOM   4380  N  N   . PHE B 1 41  ? -6.252  105.427 -22.778 0.25 11.26 ? 41  PHE B N   2 
ATOM   4381  C  CA  . PHE B 1 41  ? -7.085  104.237 -22.782 0.25 11.71 ? 41  PHE B CA  2 
ATOM   4382  C  C   . PHE B 1 41  ? -8.498  104.638 -22.372 0.25 13.01 ? 41  PHE B C   2 
ATOM   4383  O  O   . PHE B 1 41  ? -9.448  104.455 -23.130 0.25 12.04 ? 41  PHE B O   2 
ATOM   4384  C  CB  . PHE B 1 41  ? -6.515  103.189 -21.830 0.25 13.62 ? 41  PHE B CB  2 
ATOM   4385  C  CG  . PHE B 1 41  ? -6.950  101.790 -22.148 0.25 16.18 ? 41  PHE B CG  2 
ATOM   4386  C  CD1 . PHE B 1 41  ? -6.569  101.186 -23.344 0.25 15.86 ? 41  PHE B CD1 2 
ATOM   4387  C  CD2 . PHE B 1 41  ? -7.740  101.076 -21.259 0.25 15.14 ? 41  PHE B CD2 2 
ATOM   4388  C  CE1 . PHE B 1 41  ? -6.970  99.889  -23.647 0.25 16.69 ? 41  PHE B CE1 2 
ATOM   4389  C  CE2 . PHE B 1 41  ? -8.148  99.777  -21.552 0.25 16.58 ? 41  PHE B CE2 2 
ATOM   4390  C  CZ  . PHE B 1 41  ? -7.762  99.182  -22.749 0.25 17.20 ? 41  PHE B CZ  2 
ATOM   4391  N  N   . CYS B 1 42  ? -8.631  105.198 -21.174 0.25 13.40 ? 42  CYS B N   2 
ATOM   4392  C  CA  . CYS B 1 42  ? -9.926  105.650 -20.685 0.25 13.35 ? 42  CYS B CA  2 
ATOM   4393  C  C   . CYS B 1 42  ? -9.788  106.335 -19.335 0.25 13.97 ? 42  CYS B C   2 
ATOM   4394  O  O   . CYS B 1 42  ? -9.033  105.882 -18.472 0.25 13.74 ? 42  CYS B O   2 
ATOM   4395  C  CB  . CYS B 1 42  ? -10.911 104.477 -20.561 0.25 15.73 ? 42  CYS B CB  2 
ATOM   4396  S  SG  . CYS B 1 42  ? -10.571 103.302 -19.219 0.25 16.13 ? 42  CYS B SG  2 
ATOM   4397  N  N   . VAL B 1 43  ? -10.498 107.446 -19.166 0.25 13.65 ? 43  VAL B N   2 
ATOM   4398  C  CA  . VAL B 1 43  ? -10.474 108.160 -17.898 0.25 13.28 ? 43  VAL B CA  2 
ATOM   4399  C  C   . VAL B 1 43  ? -11.147 107.208 -16.921 0.25 13.51 ? 43  VAL B C   2 
ATOM   4400  O  O   . VAL B 1 43  ? -11.966 106.378 -17.327 0.25 11.35 ? 43  VAL B O   2 
ATOM   4401  C  CB  . VAL B 1 43  ? -11.263 109.483 -17.994 0.25 15.40 ? 43  VAL B CB  2 
ATOM   4402  C  CG1 . VAL B 1 43  ? -11.528 110.052 -16.605 0.25 15.67 ? 43  VAL B CG1 2 
ATOM   4403  C  CG2 . VAL B 1 43  ? -10.474 110.484 -18.829 0.25 14.97 ? 43  VAL B CG2 2 
ATOM   4404  N  N   . ALA B 1 44  ? -10.800 107.303 -15.641 0.25 11.53 ? 44  ALA B N   2 
ATOM   4405  C  CA  . ALA B 1 44  ? -11.394 106.408 -14.663 0.25 10.61 ? 44  ALA B CA  2 
ATOM   4406  C  C   . ALA B 1 44  ? -11.438 106.985 -13.259 0.25 11.16 ? 44  ALA B C   2 
ATOM   4407  O  O   . ALA B 1 44  ? -10.846 108.023 -12.975 0.25 12.39 ? 44  ALA B O   2 
ATOM   4408  C  CB  . ALA B 1 44  ? -10.647 105.080 -14.658 0.25 9.86  ? 44  ALA B CB  2 
ATOM   4409  N  N   . ARG B 1 45  ? -12.145 106.284 -12.382 0.25 12.07 ? 45  ARG B N   2 
ATOM   4410  C  CA  . ARG B 1 45  ? -12.309 106.711 -11.002 0.25 11.21 ? 45  ARG B CA  2 
ATOM   4411  C  C   . ARG B 1 45  ? -11.938 105.608 -10.020 0.25 10.43 ? 45  ARG B C   2 
ATOM   4412  O  O   . ARG B 1 45  ? -12.430 104.491 -10.118 0.25 7.34  ? 45  ARG B O   2 
ATOM   4413  C  CB  . ARG B 1 45  ? -13.764 107.128 -10.766 0.25 12.80 ? 45  ARG B CB  2 
ATOM   4414  C  CG  . ARG B 1 45  ? -14.142 107.350 -9.308  0.25 19.11 ? 45  ARG B CG  2 
ATOM   4415  C  CD  . ARG B 1 45  ? -15.621 107.733 -9.187  0.25 23.27 ? 45  ARG B CD  2 
ATOM   4416  N  NE  . ARG B 1 45  ? -16.504 106.714 -9.750  0.25 27.61 ? 45  ARG B NE  2 
ATOM   4417  C  CZ  . ARG B 1 45  ? -16.784 105.552 -9.168  0.25 31.14 ? 45  ARG B CZ  2 
ATOM   4418  N  NH1 . ARG B 1 45  ? -16.256 105.248 -7.989  0.25 36.56 ? 45  ARG B NH1 2 
ATOM   4419  N  NH2 . ARG B 1 45  ? -17.589 104.687 -9.772  0.25 34.52 ? 45  ARG B NH2 2 
ATOM   4420  N  N   . LEU B 1 46  ? -11.067 105.938 -9.077  0.25 10.73 ? 46  LEU B N   2 
ATOM   4421  C  CA  . LEU B 1 46  ? -10.658 105.004 -8.044  0.25 11.07 ? 46  LEU B CA  2 
ATOM   4422  C  C   . LEU B 1 46  ? -11.476 105.387 -6.814  0.25 12.06 ? 46  LEU B C   2 
ATOM   4423  O  O   . LEU B 1 46  ? -11.318 106.482 -6.272  0.25 11.67 ? 46  LEU B O   2 
ATOM   4424  C  CB  . LEU B 1 46  ? -9.161  105.157 -7.753  0.25 11.17 ? 46  LEU B CB  2 
ATOM   4425  C  CG  . LEU B 1 46  ? -8.635  104.335 -6.572  0.25 11.28 ? 46  LEU B CG  2 
ATOM   4426  C  CD1 . LEU B 1 46  ? -8.701  102.855 -6.900  0.25 12.77 ? 46  LEU B CD1 2 
ATOM   4427  C  CD2 . LEU B 1 46  ? -7.208  104.750 -6.258  0.25 11.89 ? 46  LEU B CD2 2 
ATOM   4428  N  N   . GLN B 1 47  ? -12.360 104.492 -6.386  0.25 12.41 ? 47  GLN B N   2 
ATOM   4429  C  CA  . GLN B 1 47  ? -13.218 104.745 -5.238  0.25 14.15 ? 47  GLN B CA  2 
ATOM   4430  C  C   . GLN B 1 47  ? -12.526 104.471 -3.901  0.25 14.04 ? 47  GLN B C   2 
ATOM   4431  O  O   . GLN B 1 47  ? -11.730 103.542 -3.779  0.25 13.20 ? 47  GLN B O   2 
ATOM   4432  C  CB  . GLN B 1 47  ? -14.484 103.887 -5.342  0.25 16.41 ? 47  GLN B CB  2 
ATOM   4433  C  CG  . GLN B 1 47  ? -15.534 104.188 -4.280  0.25 17.52 ? 47  GLN B CG  2 
ATOM   4434  C  CD  . GLN B 1 47  ? -16.022 105.626 -4.337  0.25 19.50 ? 47  GLN B CD  2 
ATOM   4435  O  OE1 . GLN B 1 47  ? -16.484 106.093 -5.380  0.25 18.15 ? 47  GLN B OE1 2 
ATOM   4436  N  NE2 . GLN B 1 47  ? -15.923 106.335 -3.211  0.25 18.57 ? 47  GLN B NE2 2 
ATOM   4437  N  N   . ASP B 1 48  ? -12.847 105.295 -2.907  0.25 13.37 ? 48  ASP B N   2 
ATOM   4438  C  CA  . ASP B 1 48  ? -12.307 105.179 -1.556  0.25 13.02 ? 48  ASP B CA  2 
ATOM   4439  C  C   . ASP B 1 48  ? -10.825 105.491 -1.374  0.25 12.47 ? 48  ASP B C   2 
ATOM   4440  O  O   . ASP B 1 48  ? -10.122 104.852 -0.586  0.25 10.47 ? 48  ASP B O   2 
ATOM   4441  C  CB  . ASP B 1 48  ? -12.646 103.807 -0.975  0.25 13.62 ? 48  ASP B CB  2 
ATOM   4442  C  CG  . ASP B 1 48  ? -14.147 103.600 -0.839  0.25 18.15 ? 48  ASP B CG  2 
ATOM   4443  O  OD1 . ASP B 1 48  ? -14.865 104.612 -0.675  0.25 12.42 ? 48  ASP B OD1 2 
ATOM   4444  O  OD2 . ASP B 1 48  ? -14.608 102.439 -0.887  0.25 18.27 ? 48  ASP B OD2 2 
ATOM   4445  N  N   . PHE B 1 49  ? -10.364 106.489 -2.119  0.25 11.52 ? 49  PHE B N   2 
ATOM   4446  C  CA  . PHE B 1 49  ? -9.000  106.986 -2.031  0.25 12.53 ? 49  PHE B CA  2 
ATOM   4447  C  C   . PHE B 1 49  ? -9.136  108.495 -2.158  0.25 12.12 ? 49  PHE B C   2 
ATOM   4448  O  O   . PHE B 1 49  ? -10.030 108.987 -2.848  0.25 13.66 ? 49  PHE B O   2 
ATOM   4449  C  CB  . PHE B 1 49  ? -8.114  106.478 -3.175  0.25 11.85 ? 49  PHE B CB  2 
ATOM   4450  C  CG  . PHE B 1 49  ? -7.522  105.117 -2.944  0.25 11.29 ? 49  PHE B CG  2 
ATOM   4451  C  CD1 . PHE B 1 49  ? -8.265  103.966 -3.183  0.25 11.55 ? 49  PHE B CD1 2 
ATOM   4452  C  CD2 . PHE B 1 49  ? -6.195  104.986 -2.539  0.25 12.13 ? 49  PHE B CD2 2 
ATOM   4453  C  CE1 . PHE B 1 49  ? -7.692  102.699 -3.026  0.25 12.33 ? 49  PHE B CE1 2 
ATOM   4454  C  CE2 . PHE B 1 49  ? -5.613  103.727 -2.377  0.25 12.70 ? 49  PHE B CE2 2 
ATOM   4455  C  CZ  . PHE B 1 49  ? -6.361  102.582 -2.622  0.25 7.95  ? 49  PHE B CZ  2 
ATOM   4456  N  N   . LYS B 1 50  ? -8.251  109.225 -1.494  0.25 12.90 ? 50  LYS B N   2 
ATOM   4457  C  CA  . LYS B 1 50  ? -8.271  110.679 -1.541  0.25 11.99 ? 50  LYS B CA  2 
ATOM   4458  C  C   . LYS B 1 50  ? -6.933  111.201 -2.041  0.25 11.86 ? 50  LYS B C   2 
ATOM   4459  O  O   . LYS B 1 50  ? -5.887  110.594 -1.794  0.25 11.88 ? 50  LYS B O   2 
ATOM   4460  C  CB  . LYS B 1 50  ? -8.548  111.240 -0.151  0.25 14.08 ? 50  LYS B CB  2 
ATOM   4461  C  CG  . LYS B 1 50  ? -8.592  112.759 -0.088  0.25 13.95 ? 50  LYS B CG  2 
ATOM   4462  C  CD  . LYS B 1 50  ? -8.970  113.218 1.306   0.25 18.64 ? 50  LYS B CD  2 
ATOM   4463  C  CE  . LYS B 1 50  ? -8.990  114.732 1.419   0.25 20.02 ? 50  LYS B CE  2 
ATOM   4464  N  NZ  . LYS B 1 50  ? -9.388  115.149 2.796   0.25 24.24 ? 50  LYS B NZ  2 
ATOM   4465  N  N   . LEU B 1 51  ? -6.968  112.336 -2.728  0.25 9.43  ? 51  LEU B N   2 
ATOM   4466  C  CA  . LEU B 1 51  ? -5.752  112.934 -3.264  0.25 10.85 ? 51  LEU B CA  2 
ATOM   4467  C  C   . LEU B 1 51  ? -5.093  113.844 -2.244  0.25 11.32 ? 51  LEU B C   2 
ATOM   4468  O  O   . LEU B 1 51  ? -5.746  114.695 -1.640  0.25 8.60  ? 51  LEU B O   2 
ATOM   4469  C  CB  . LEU B 1 51  ? -6.066  113.743 -4.520  0.25 11.15 ? 51  LEU B CB  2 
ATOM   4470  C  CG  . LEU B 1 51  ? -4.889  114.440 -5.207  0.25 10.67 ? 51  LEU B CG  2 
ATOM   4471  C  CD1 . LEU B 1 51  ? -4.026  113.411 -5.917  0.25 8.21  ? 51  LEU B CD1 2 
ATOM   4472  C  CD2 . LEU B 1 51  ? -5.417  115.464 -6.204  0.25 8.63  ? 51  LEU B CD2 2 
ATOM   4473  N  N   . ASP B 1 52  ? -3.793  113.658 -2.048  0.25 10.61 ? 52  ASP B N   2 
ATOM   4474  C  CA  . ASP B 1 52  ? -3.052  114.496 -1.118  0.25 11.51 ? 52  ASP B CA  2 
ATOM   4475  C  C   . ASP B 1 52  ? -1.735  114.860 -1.794  0.25 11.95 ? 52  ASP B C   2 
ATOM   4476  O  O   . ASP B 1 52  ? -1.397  114.297 -2.839  0.25 10.68 ? 52  ASP B O   2 
ATOM   4477  C  CB  . ASP B 1 52  ? -2.807  113.735 0.194   0.25 9.76  ? 52  ASP B CB  2 
ATOM   4478  C  CG  . ASP B 1 52  ? -2.198  114.613 1.287   0.25 13.06 ? 52  ASP B CG  2 
ATOM   4479  O  OD1 . ASP B 1 52  ? -2.461  115.834 1.299   0.25 11.22 ? 52  ASP B OD1 2 
ATOM   4480  O  OD2 . ASP B 1 52  ? -1.465  114.078 2.149   0.25 9.48  ? 52  ASP B OD2 2 
ATOM   4481  N  N   . PHE B 1 53  ? -1.003  115.814 -1.225  0.25 12.02 ? 53  PHE B N   2 
ATOM   4482  C  CA  . PHE B 1 53  ? 0.280   116.209 -1.791  0.25 11.39 ? 53  PHE B CA  2 
ATOM   4483  C  C   . PHE B 1 53  ? 1.322   116.210 -0.684  0.25 11.56 ? 53  PHE B C   2 
ATOM   4484  O  O   . PHE B 1 53  ? 1.007   116.529 0.461   0.25 9.75  ? 53  PHE B O   2 
ATOM   4485  C  CB  . PHE B 1 53  ? 0.188   117.597 -2.438  0.25 12.56 ? 53  PHE B CB  2 
ATOM   4486  C  CG  . PHE B 1 53  ? -0.735  117.648 -3.627  0.25 11.79 ? 53  PHE B CG  2 
ATOM   4487  C  CD1 . PHE B 1 53  ? -2.115  117.724 -3.453  0.25 11.28 ? 53  PHE B CD1 2 
ATOM   4488  C  CD2 . PHE B 1 53  ? -0.225  117.573 -4.921  0.25 9.46  ? 53  PHE B CD2 2 
ATOM   4489  C  CE1 . PHE B 1 53  ? -2.972  117.720 -4.553  0.25 12.56 ? 53  PHE B CE1 2 
ATOM   4490  C  CE2 . PHE B 1 53  ? -1.071  117.568 -6.023  0.25 11.57 ? 53  PHE B CE2 2 
ATOM   4491  C  CZ  . PHE B 1 53  ? -2.449  117.641 -5.840  0.25 10.82 ? 53  PHE B CZ  2 
ATOM   4492  N  N   . GLY B 1 54  ? 2.561   115.850 -1.013  0.25 13.26 ? 54  GLY B N   2 
ATOM   4493  C  CA  . GLY B 1 54  ? 3.583   115.827 0.017   0.25 13.36 ? 54  GLY B CA  2 
ATOM   4494  C  C   . GLY B 1 54  ? 5.026   115.678 -0.415  0.25 14.05 ? 54  GLY B C   2 
ATOM   4495  O  O   . GLY B 1 54  ? 5.341   115.588 -1.607  0.25 11.80 ? 54  GLY B O   2 
ATOM   4496  N  N   . ASN B 1 55  ? 5.912   115.650 0.576   0.25 14.51 ? 55  ASN B N   2 
ATOM   4497  C  CA  . ASN B 1 55  ? 7.340   115.520 0.331   0.25 16.80 ? 55  ASN B CA  2 
ATOM   4498  C  C   . ASN B 1 55  ? 7.843   114.158 0.787   0.25 18.10 ? 55  ASN B C   2 
ATOM   4499  O  O   . ASN B 1 55  ? 7.818   113.844 1.978   0.25 18.09 ? 55  ASN B O   2 
ATOM   4500  C  CB  . ASN B 1 55  ? 8.112   116.619 1.069   0.25 16.19 ? 55  ASN B CB  2 
ATOM   4501  C  CG  . ASN B 1 55  ? 7.629   118.015 0.714   0.25 14.93 ? 55  ASN B CG  2 
ATOM   4502  O  OD1 . ASN B 1 55  ? 7.342   118.309 -0.441  0.25 14.08 ? 55  ASN B OD1 2 
ATOM   4503  N  ND2 . ASN B 1 55  ? 7.555   118.887 1.714   0.25 13.89 ? 55  ASN B ND2 2 
ATOM   4504  N  N   . SER B 1 56  ? 8.303   113.354 -0.165  0.25 19.97 ? 56  SER B N   2 
ATOM   4505  C  CA  . SER B 1 56  ? 8.812   112.027 0.143   0.25 22.80 ? 56  SER B CA  2 
ATOM   4506  C  C   . SER B 1 56  ? 9.942   112.090 1.163   0.25 24.27 ? 56  SER B C   2 
ATOM   4507  O  O   . SER B 1 56  ? 10.875  112.880 1.026   0.25 24.16 ? 56  SER B O   2 
ATOM   4508  C  CB  . SER B 1 56  ? 9.313   111.349 -1.130  0.25 23.20 ? 56  SER B CB  2 
ATOM   4509  O  OG  . SER B 1 56  ? 9.862   110.078 -0.835  0.25 26.41 ? 56  SER B OG  2 
ATOM   4510  N  N   . GLN B 1 57  ? 9.852   111.249 2.187   0.25 26.71 ? 57  GLN B N   2 
ATOM   4511  C  CA  . GLN B 1 57  ? 10.866  111.206 3.233   0.25 28.15 ? 57  GLN B CA  2 
ATOM   4512  C  C   . GLN B 1 57  ? 11.106  112.609 3.791   0.25 28.80 ? 57  GLN B C   2 
ATOM   4513  O  O   . GLN B 1 57  ? 12.161  112.889 4.360   0.25 28.32 ? 57  GLN B O   2 
ATOM   4514  C  CB  . GLN B 1 57  ? 12.181  110.648 2.676   0.25 30.15 ? 57  GLN B CB  2 
ATOM   4515  C  CG  . GLN B 1 57  ? 12.047  109.407 1.792   0.25 33.35 ? 57  GLN B CG  2 
ATOM   4516  C  CD  . GLN B 1 57  ? 11.438  108.213 2.508   0.25 34.31 ? 57  GLN B CD  2 
ATOM   4517  O  OE1 . GLN B 1 57  ? 11.862  107.847 3.603   0.25 33.53 ? 57  GLN B OE1 2 
ATOM   4518  N  NE2 . GLN B 1 57  ? 10.445  107.591 1.880   0.25 35.46 ? 57  GLN B NE2 2 
ATOM   4519  N  N   . GLY B 1 58  ? 10.125  113.491 3.616   0.25 28.10 ? 58  GLY B N   2 
ATOM   4520  C  CA  . GLY B 1 58  ? 10.256  114.852 4.110   0.25 28.55 ? 58  GLY B CA  2 
ATOM   4521  C  C   . GLY B 1 58  ? 11.091  115.764 3.224   0.25 28.20 ? 58  GLY B C   2 
ATOM   4522  O  O   . GLY B 1 58  ? 11.365  116.909 3.585   0.25 28.26 ? 58  GLY B O   2 
ATOM   4523  N  N   . LYS B 1 59  ? 11.496  115.264 2.062   0.25 28.07 ? 59  LYS B N   2 
ATOM   4524  C  CA  . LYS B 1 59  ? 12.305  116.047 1.132   0.25 28.44 ? 59  LYS B CA  2 
ATOM   4525  C  C   . LYS B 1 59  ? 11.436  116.673 0.040   0.25 26.42 ? 59  LYS B C   2 
ATOM   4526  O  O   . LYS B 1 59  ? 10.550  116.017 -0.507  0.25 25.47 ? 59  LYS B O   2 
ATOM   4527  C  CB  . LYS B 1 59  ? 13.367  115.160 0.480   0.25 31.26 ? 59  LYS B CB  2 
ATOM   4528  C  CG  . LYS B 1 59  ? 14.270  114.429 1.459   0.25 35.67 ? 59  LYS B CG  2 
ATOM   4529  C  CD  . LYS B 1 59  ? 15.218  113.496 0.720   0.25 38.59 ? 59  LYS B CD  2 
ATOM   4530  C  CE  . LYS B 1 59  ? 16.107  112.720 1.681   0.25 40.25 ? 59  LYS B CE  2 
ATOM   4531  N  NZ  . LYS B 1 59  ? 17.056  111.834 0.950   0.25 42.60 ? 59  LYS B NZ  2 
ATOM   4532  N  N   . THR B 1 60  ? 11.693  117.941 -0.268  0.25 23.40 ? 60  THR B N   2 
ATOM   4533  C  CA  . THR B 1 60  ? 10.948  118.648 -1.304  0.25 23.54 ? 60  THR B CA  2 
ATOM   4534  C  C   . THR B 1 60  ? 11.475  118.259 -2.685  0.25 23.14 ? 60  THR B C   2 
ATOM   4535  O  O   . THR B 1 60  ? 12.685  118.166 -2.894  0.25 23.43 ? 60  THR B O   2 
ATOM   4536  C  CB  . THR B 1 60  ? 11.084  120.183 -1.159  0.25 22.74 ? 60  THR B CB  2 
ATOM   4537  O  OG1 . THR B 1 60  ? 10.560  120.599 0.108   0.25 21.46 ? 60  THR B OG1 2 
ATOM   4538  C  CG2 . THR B 1 60  ? 10.323  120.892 -2.274  0.25 22.42 ? 60  THR B CG2 2 
ATOM   4539  N  N   . SER B 1 61  ? 10.563  118.036 -3.623  0.25 21.54 ? 61  SER B N   2 
ATOM   4540  C  CA  . SER B 1 61  ? 10.939  117.670 -4.984  0.25 21.97 ? 61  SER B CA  2 
ATOM   4541  C  C   . SER B 1 61  ? 11.839  118.730 -5.608  0.25 21.35 ? 61  SER B C   2 
ATOM   4542  O  O   . SER B 1 61  ? 11.550  119.921 -5.521  0.25 21.31 ? 61  SER B O   2 
ATOM   4543  C  CB  . SER B 1 61  ? 9.687   117.502 -5.851  0.25 20.49 ? 61  SER B CB  2 
ATOM   4544  O  OG  . SER B 1 61  ? 10.021  117.545 -7.230  0.25 17.57 ? 61  SER B OG  2 
ATOM   4545  N  N   . GLN B 1 62  ? 12.933  118.297 -6.228  0.25 22.50 ? 62  GLN B N   2 
ATOM   4546  C  CA  . GLN B 1 62  ? 13.850  119.228 -6.878  0.25 23.02 ? 62  GLN B CA  2 
ATOM   4547  C  C   . GLN B 1 62  ? 13.334  119.591 -8.263  0.25 21.20 ? 62  GLN B C   2 
ATOM   4548  O  O   . GLN B 1 62  ? 13.777  120.565 -8.869  0.25 22.85 ? 62  GLN B O   2 
ATOM   4549  C  CB  . GLN B 1 62  ? 15.249  118.622 -6.988  0.25 24.60 ? 62  GLN B CB  2 
ATOM   4550  C  CG  . GLN B 1 62  ? 16.080  118.806 -5.735  0.25 30.40 ? 62  GLN B CG  2 
ATOM   4551  C  CD  . GLN B 1 62  ? 16.186  120.267 -5.333  0.25 32.07 ? 62  GLN B CD  2 
ATOM   4552  O  OE1 . GLN B 1 62  ? 16.661  121.103 -6.104  0.25 34.20 ? 62  GLN B OE1 2 
ATOM   4553  N  NE2 . GLN B 1 62  ? 15.735  120.583 -4.123  0.25 34.34 ? 62  GLN B NE2 2 
ATOM   4554  N  N   . THR B 1 63  ? 12.399  118.795 -8.764  0.25 19.75 ? 63  THR B N   2 
ATOM   4555  C  CA  . THR B 1 63  ? 11.810  119.055 -10.068 0.25 19.64 ? 63  THR B CA  2 
ATOM   4556  C  C   . THR B 1 63  ? 10.711  120.097 -9.906  0.25 18.27 ? 63  THR B C   2 
ATOM   4557  O  O   . THR B 1 63  ? 10.635  121.066 -10.663 0.25 16.86 ? 63  THR B O   2 
ATOM   4558  C  CB  . THR B 1 63  ? 11.168  117.787 -10.669 0.25 20.03 ? 63  THR B CB  2 
ATOM   4559  O  OG1 . THR B 1 63  ? 12.165  116.771 -10.835 0.25 19.71 ? 63  THR B OG1 2 
ATOM   4560  C  CG2 . THR B 1 63  ? 10.534  118.102 -12.025 0.25 22.25 ? 63  THR B CG2 2 
ATOM   4561  N  N   . TRP B 1 64  ? 9.870   119.900 -8.897  0.25 16.37 ? 64  TRP B N   2 
ATOM   4562  C  CA  . TRP B 1 64  ? 8.754   120.804 -8.662  0.25 15.64 ? 64  TRP B CA  2 
ATOM   4563  C  C   . TRP B 1 64  ? 8.900   121.843 -7.550  0.25 16.03 ? 64  TRP B C   2 
ATOM   4564  O  O   . TRP B 1 64  ? 8.475   122.984 -7.720  0.25 15.49 ? 64  TRP B O   2 
ATOM   4565  C  CB  . TRP B 1 64  ? 7.484   119.979 -8.444  0.25 15.93 ? 64  TRP B CB  2 
ATOM   4566  C  CG  . TRP B 1 64  ? 7.156   119.145 -9.634  0.25 15.84 ? 64  TRP B CG  2 
ATOM   4567  C  CD1 . TRP B 1 64  ? 7.430   117.816 -9.812  0.25 15.82 ? 64  TRP B CD1 2 
ATOM   4568  C  CD2 . TRP B 1 64  ? 6.548   119.597 -10.850 0.25 15.73 ? 64  TRP B CD2 2 
ATOM   4569  N  NE1 . TRP B 1 64  ? 7.030   117.416 -11.066 0.25 15.76 ? 64  TRP B NE1 2 
ATOM   4570  C  CE2 . TRP B 1 64  ? 6.485   118.490 -11.724 0.25 15.56 ? 64  TRP B CE2 2 
ATOM   4571  C  CE3 . TRP B 1 64  ? 6.048   120.835 -11.287 0.25 15.41 ? 64  TRP B CE3 2 
ATOM   4572  C  CZ2 . TRP B 1 64  ? 5.944   118.579 -13.011 0.25 15.24 ? 64  TRP B CZ2 2 
ATOM   4573  C  CZ3 . TRP B 1 64  ? 5.509   120.924 -12.568 0.25 13.71 ? 64  TRP B CZ3 2 
ATOM   4574  C  CH2 . TRP B 1 64  ? 5.461   119.801 -13.414 0.25 13.57 ? 64  TRP B CH2 2 
ATOM   4575  N  N   . HIS B 1 65  ? 9.492   121.458 -6.423  0.25 16.97 ? 65  HIS B N   2 
ATOM   4576  C  CA  . HIS B 1 65  ? 9.665   122.374 -5.293  0.25 17.96 ? 65  HIS B CA  2 
ATOM   4577  C  C   . HIS B 1 65  ? 8.322   122.611 -4.609  0.25 16.77 ? 65  HIS B C   2 
ATOM   4578  O  O   . HIS B 1 65  ? 8.081   123.655 -4.001  0.25 14.40 ? 65  HIS B O   2 
ATOM   4579  C  CB  . HIS B 1 65  ? 10.253  123.713 -5.753  0.25 21.78 ? 65  HIS B CB  2 
ATOM   4580  C  CG  . HIS B 1 65  ? 11.694  123.635 -6.160  0.25 23.32 ? 65  HIS B CG  2 
ATOM   4581  N  ND1 . HIS B 1 65  ? 12.114  122.982 -7.297  0.25 23.94 ? 65  HIS B ND1 2 
ATOM   4582  C  CD2 . HIS B 1 65  ? 12.811  124.122 -5.570  0.25 23.68 ? 65  HIS B CD2 2 
ATOM   4583  C  CE1 . HIS B 1 65  ? 13.429  123.069 -7.393  0.25 24.91 ? 65  HIS B CE1 2 
ATOM   4584  N  NE2 . HIS B 1 65  ? 13.877  123.755 -6.358  0.25 23.77 ? 65  HIS B NE2 2 
ATOM   4585  N  N   . GLY B 1 66  ? 7.445   121.625 -4.733  0.25 14.94 ? 66  GLY B N   2 
ATOM   4586  C  CA  . GLY B 1 66  ? 6.134   121.694 -4.123  0.25 13.63 ? 66  GLY B CA  2 
ATOM   4587  C  C   . GLY B 1 66  ? 5.715   120.259 -3.883  0.25 13.65 ? 66  GLY B C   2 
ATOM   4588  O  O   . GLY B 1 66  ? 6.117   119.372 -4.637  0.25 14.16 ? 66  GLY B O   2 
ATOM   4589  N  N   . GLY B 1 67  ? 4.927   120.018 -2.840  0.25 11.34 ? 67  GLY B N   2 
ATOM   4590  C  CA  . GLY B 1 67  ? 4.494   118.663 -2.565  0.25 10.72 ? 67  GLY B CA  2 
ATOM   4591  C  C   . GLY B 1 67  ? 3.913   118.023 -3.810  0.25 10.83 ? 67  GLY B C   2 
ATOM   4592  O  O   . GLY B 1 67  ? 3.223   118.683 -4.593  0.25 9.70  ? 67  GLY B O   2 
ATOM   4593  N  N   . ILE B 1 68  ? 4.199   116.744 -4.019  0.25 10.72 ? 68  ILE B N   2 
ATOM   4594  C  CA  . ILE B 1 68  ? 3.653   116.067 -5.184  0.25 9.43  ? 68  ILE B CA  2 
ATOM   4595  C  C   . ILE B 1 68  ? 2.524   115.115 -4.776  0.25 8.80  ? 68  ILE B C   2 
ATOM   4596  O  O   . ILE B 1 68  ? 2.389   114.749 -3.606  0.25 8.56  ? 68  ILE B O   2 
ATOM   4597  C  CB  . ILE B 1 68  ? 4.764   115.351 -5.990  0.25 10.49 ? 68  ILE B CB  2 
ATOM   4598  C  CG1 . ILE B 1 68  ? 5.699   114.576 -5.061  0.25 10.14 ? 68  ILE B CG1 2 
ATOM   4599  C  CG2 . ILE B 1 68  ? 5.572   116.388 -6.772  0.25 11.53 ? 68  ILE B CG2 2 
ATOM   4600  C  CD1 . ILE B 1 68  ? 6.784   113.811 -5.805  0.25 10.48 ? 68  ILE B CD1 2 
ATOM   4601  N  N   . ALA B 1 69  ? 1.696   114.747 -5.745  0.25 7.86  ? 69  ALA B N   2 
ATOM   4602  C  CA  . ALA B 1 69  ? 0.535   113.903 -5.499  0.25 6.26  ? 69  ALA B CA  2 
ATOM   4603  C  C   . ALA B 1 69  ? 0.775   112.497 -4.953  0.25 7.05  ? 69  ALA B C   2 
ATOM   4604  O  O   . ALA B 1 69  ? 1.853   111.934 -5.076  0.25 7.55  ? 69  ALA B O   2 
ATOM   4605  C  CB  . ALA B 1 69  ? -0.300  113.823 -6.771  0.25 5.29  ? 69  ALA B CB  2 
ATOM   4606  N  N   . THR B 1 70  ? -0.269  111.946 -4.348  0.25 6.96  ? 70  THR B N   2 
ATOM   4607  C  CA  . THR B 1 70  ? -0.255  110.600 -3.795  0.25 7.13  ? 70  THR B CA  2 
ATOM   4608  C  C   . THR B 1 70  ? -1.686  110.305 -3.352  0.25 7.26  ? 70  THR B C   2 
ATOM   4609  O  O   . THR B 1 70  ? -2.560  111.173 -3.437  0.25 6.97  ? 70  THR B O   2 
ATOM   4610  C  CB  . THR B 1 70  ? 0.706   110.489 -2.588  0.25 8.70  ? 70  THR B CB  2 
ATOM   4611  O  OG1 . THR B 1 70  ? 0.809   109.118 -2.182  0.25 8.74  ? 70  THR B OG1 2 
ATOM   4612  C  CG2 . THR B 1 70  ? 0.207   111.342 -1.418  0.25 10.56 ? 70  THR B CG2 2 
ATOM   4613  N  N   . ILE B 1 71  ? -1.931  109.082 -2.898  0.25 6.71  ? 71  ILE B N   2 
ATOM   4614  C  CA  . ILE B 1 71  ? -3.262  108.698 -2.442  0.25 6.85  ? 71  ILE B CA  2 
ATOM   4615  C  C   . ILE B 1 71  ? -3.160  107.681 -1.316  0.25 8.93  ? 71  ILE B C   2 
ATOM   4616  O  O   . ILE B 1 71  ? -2.082  107.145 -1.044  0.25 8.90  ? 71  ILE B O   2 
ATOM   4617  C  CB  . ILE B 1 71  ? -4.092  108.057 -3.578  0.25 6.28  ? 71  ILE B CB  2 
ATOM   4618  C  CG1 . ILE B 1 71  ? -3.313  106.885 -4.188  0.25 6.02  ? 71  ILE B CG1 2 
ATOM   4619  C  CG2 . ILE B 1 71  ? -4.431  109.105 -4.635  0.25 8.11  ? 71  ILE B CG2 2 
ATOM   4620  C  CD1 . ILE B 1 71  ? -4.089  106.083 -5.226  0.25 6.88  ? 71  ILE B CD1 2 
ATOM   4621  N  N   . PHE B 1 72  ? -4.291  107.421 -0.667  0.25 8.44  ? 72  PHE B N   2 
ATOM   4622  C  CA  . PHE B 1 72  ? -4.351  106.448 0.407   0.25 10.74 ? 72  PHE B CA  2 
ATOM   4623  C  C   . PHE B 1 72  ? -5.813  106.076 0.674   0.25 11.74 ? 72  PHE B C   2 
ATOM   4624  O  O   . PHE B 1 72  ? -6.732  106.740 0.183   0.25 10.17 ? 72  PHE B O   2 
ATOM   4625  C  CB  . PHE B 1 72  ? -3.653  106.998 1.665   0.25 10.66 ? 72  PHE B CB  2 
ATOM   4626  C  CG  . PHE B 1 72  ? -4.219  108.299 2.172   0.25 14.60 ? 72  PHE B CG  2 
ATOM   4627  C  CD1 . PHE B 1 72  ? -5.314  108.310 3.033   0.25 14.32 ? 72  PHE B CD1 2 
ATOM   4628  C  CD2 . PHE B 1 72  ? -3.647  109.513 1.802   0.25 14.18 ? 72  PHE B CD2 2 
ATOM   4629  C  CE1 . PHE B 1 72  ? -5.830  109.509 3.522   0.25 13.66 ? 72  PHE B CE1 2 
ATOM   4630  C  CE2 . PHE B 1 72  ? -4.158  110.722 2.286   0.25 15.61 ? 72  PHE B CE2 2 
ATOM   4631  C  CZ  . PHE B 1 72  ? -5.250  110.719 3.148   0.25 14.53 ? 72  PHE B CZ  2 
ATOM   4632  N  N   . GLN B 1 73  ? -6.026  104.990 1.408   0.25 11.72 ? 73  GLN B N   2 
ATOM   4633  C  CA  . GLN B 1 73  ? -7.378  104.542 1.724   0.25 12.42 ? 73  GLN B CA  2 
ATOM   4634  C  C   . GLN B 1 73  ? -8.156  105.678 2.380   0.25 13.31 ? 73  GLN B C   2 
ATOM   4635  O  O   . GLN B 1 73  ? -7.610  106.409 3.203   0.25 12.67 ? 73  GLN B O   2 
ATOM   4636  C  CB  . GLN B 1 73  ? -7.332  103.340 2.669   0.25 12.19 ? 73  GLN B CB  2 
ATOM   4637  C  CG  . GLN B 1 73  ? -7.395  101.967 2.007   0.25 15.03 ? 73  GLN B CG  2 
ATOM   4638  C  CD  . GLN B 1 73  ? -6.122  101.566 1.275   0.25 17.51 ? 73  GLN B CD  2 
ATOM   4639  O  OE1 . GLN B 1 73  ? -5.023  101.599 1.837   0.25 14.55 ? 73  GLN B OE1 2 
ATOM   4640  N  NE2 . GLN B 1 73  ? -6.271  101.161 0.020   0.25 17.36 ? 73  GLN B NE2 2 
ATOM   4641  N  N   . SER B 1 74  ? -9.429  105.816 2.018   0.25 12.20 ? 74  SER B N   2 
ATOM   4642  C  CA  . SER B 1 74  ? -10.281 106.866 2.568   0.25 13.56 ? 74  SER B CA  2 
ATOM   4643  C  C   . SER B 1 74  ? -11.728 106.579 2.168   0.25 14.34 ? 74  SER B C   2 
ATOM   4644  O  O   . SER B 1 74  ? -12.196 107.022 1.120   0.25 12.00 ? 74  SER B O   2 
ATOM   4645  C  CB  . SER B 1 74  ? -9.845  108.235 2.025   0.25 12.94 ? 74  SER B CB  2 
ATOM   4646  O  OG  . SER B 1 74  ? -10.478 109.303 2.719   0.25 14.01 ? 74  SER B OG  2 
ATOM   4647  N  N   . PRO B 1 75  ? -12.453 105.813 2.997   0.25 14.88 ? 75  PRO B N   2 
ATOM   4648  C  CA  . PRO B 1 75  ? -13.848 105.485 2.689   0.25 15.19 ? 75  PRO B CA  2 
ATOM   4649  C  C   . PRO B 1 75  ? -14.665 106.717 2.304   0.25 14.31 ? 75  PRO B C   2 
ATOM   4650  O  O   . PRO B 1 75  ? -14.752 107.667 3.072   0.25 12.29 ? 75  PRO B O   2 
ATOM   4651  C  CB  . PRO B 1 75  ? -14.344 104.850 3.985   0.25 14.60 ? 75  PRO B CB  2 
ATOM   4652  C  CG  . PRO B 1 75  ? -13.119 104.180 4.518   0.25 16.78 ? 75  PRO B CG  2 
ATOM   4653  C  CD  . PRO B 1 75  ? -12.043 105.222 4.286   0.25 15.01 ? 75  PRO B CD  2 
ATOM   4654  N  N   . GLY B 1 76  ? -15.250 106.705 1.111   0.25 14.58 ? 76  GLY B N   2 
ATOM   4655  C  CA  . GLY B 1 76  ? -16.059 107.837 0.695   0.25 15.52 ? 76  GLY B CA  2 
ATOM   4656  C  C   . GLY B 1 76  ? -15.448 108.731 -0.366  0.25 17.25 ? 76  GLY B C   2 
ATOM   4657  O  O   . GLY B 1 76  ? -16.160 109.213 -1.245  0.25 15.65 ? 76  GLY B O   2 
ATOM   4658  N  N   . ASP B 1 77  ? -14.141 108.971 -0.289  0.25 15.17 ? 77  ASP B N   2 
ATOM   4659  C  CA  . ASP B 1 77  ? -13.481 109.819 -1.283  0.25 15.07 ? 77  ASP B CA  2 
ATOM   4660  C  C   . ASP B 1 77  ? -13.210 109.036 -2.567  0.25 13.73 ? 77  ASP B C   2 
ATOM   4661  O  O   . ASP B 1 77  ? -13.381 107.815 -2.608  0.25 15.28 ? 77  ASP B O   2 
ATOM   4662  C  CB  . ASP B 1 77  ? -12.159 110.369 -0.738  0.25 15.09 ? 77  ASP B CB  2 
ATOM   4663  C  CG  . ASP B 1 77  ? -12.356 111.496 0.258   0.25 18.59 ? 77  ASP B CG  2 
ATOM   4664  O  OD1 . ASP B 1 77  ? -13.002 112.502 -0.099  0.25 16.05 ? 77  ASP B OD1 2 
ATOM   4665  O  OD2 . ASP B 1 77  ? -11.855 111.382 1.397   0.25 16.51 ? 77  ASP B OD2 2 
ATOM   4666  N  N   . GLU B 1 78  ? -12.799 109.740 -3.618  0.25 12.93 ? 78  GLU B N   2 
ATOM   4667  C  CA  . GLU B 1 78  ? -12.487 109.090 -4.887  0.25 11.48 ? 78  GLU B CA  2 
ATOM   4668  C  C   . GLU B 1 78  ? -11.396 109.815 -5.658  0.25 9.93  ? 78  GLU B C   2 
ATOM   4669  O  O   . GLU B 1 78  ? -11.156 111.004 -5.456  0.25 9.14  ? 78  GLU B O   2 
ATOM   4670  C  CB  . GLU B 1 78  ? -13.736 108.969 -5.766  0.25 13.60 ? 78  GLU B CB  2 
ATOM   4671  C  CG  . GLU B 1 78  ? -14.408 110.276 -6.115  0.25 18.56 ? 78  GLU B CG  2 
ATOM   4672  C  CD  . GLU B 1 78  ? -15.760 110.059 -6.769  0.25 21.19 ? 78  GLU B CD  2 
ATOM   4673  O  OE1 . GLU B 1 78  ? -16.561 109.268 -6.225  0.25 23.60 ? 78  GLU B OE1 2 
ATOM   4674  O  OE2 . GLU B 1 78  ? -16.026 110.681 -7.817  0.25 20.76 ? 78  GLU B OE2 2 
ATOM   4675  N  N   . VAL B 1 79  ? -10.728 109.086 -6.542  0.25 8.12  ? 79  VAL B N   2 
ATOM   4676  C  CA  . VAL B 1 79  ? -9.667  109.668 -7.346  0.25 7.11  ? 79  VAL B CA  2 
ATOM   4677  C  C   . VAL B 1 79  ? -9.989  109.492 -8.819  0.25 9.43  ? 79  VAL B C   2 
ATOM   4678  O  O   . VAL B 1 79  ? -10.294 108.382 -9.270  0.25 10.31 ? 79  VAL B O   2 
ATOM   4679  C  CB  . VAL B 1 79  ? -8.295  109.003 -7.040  0.25 6.05  ? 79  VAL B CB  2 
ATOM   4680  C  CG1 . VAL B 1 79  ? -7.212  109.585 -7.948  0.25 2.89  ? 79  VAL B CG1 2 
ATOM   4681  C  CG2 . VAL B 1 79  ? -7.931  109.221 -5.583  0.25 5.50  ? 79  VAL B CG2 2 
ATOM   4682  N  N   . TRP B 1 80  ? -9.934  110.598 -9.559  0.25 8.58  ? 80  TRP B N   2 
ATOM   4683  C  CA  . TRP B 1 80  ? -10.186 110.574 -10.991 0.25 10.18 ? 80  TRP B CA  2 
ATOM   4684  C  C   . TRP B 1 80  ? -8.860  110.727 -11.713 0.25 11.92 ? 80  TRP B C   2 
ATOM   4685  O  O   . TRP B 1 80  ? -8.016  111.537 -11.323 0.25 12.31 ? 80  TRP B O   2 
ATOM   4686  C  CB  . TRP B 1 80  ? -11.123 111.712 -11.407 0.25 10.77 ? 80  TRP B CB  2 
ATOM   4687  C  CG  . TRP B 1 80  ? -12.570 111.432 -11.135 0.25 11.09 ? 80  TRP B CG  2 
ATOM   4688  C  CD1 . TRP B 1 80  ? -13.295 111.824 -10.041 0.25 12.41 ? 80  TRP B CD1 2 
ATOM   4689  C  CD2 . TRP B 1 80  ? -13.464 110.684 -11.966 0.25 13.62 ? 80  TRP B CD2 2 
ATOM   4690  N  NE1 . TRP B 1 80  ? -14.591 111.365 -10.144 0.25 13.62 ? 80  TRP B NE1 2 
ATOM   4691  C  CE2 . TRP B 1 80  ? -14.721 110.663 -11.317 0.25 15.32 ? 80  TRP B CE2 2 
ATOM   4692  C  CE3 . TRP B 1 80  ? -13.328 110.028 -13.199 0.25 15.54 ? 80  TRP B CE3 2 
ATOM   4693  C  CZ2 . TRP B 1 80  ? -15.838 110.011 -11.862 0.25 15.56 ? 80  TRP B CZ2 2 
ATOM   4694  C  CZ3 . TRP B 1 80  ? -14.440 109.377 -13.740 0.25 15.24 ? 80  TRP B CZ3 2 
ATOM   4695  C  CH2 . TRP B 1 80  ? -15.677 109.377 -13.069 0.25 16.16 ? 80  TRP B CH2 2 
ATOM   4696  N  N   . GLY B 1 81  ? -8.678  109.938 -12.762 0.25 11.34 ? 81  GLY B N   2 
ATOM   4697  C  CA  . GLY B 1 81  ? -7.452  110.007 -13.521 0.25 10.01 ? 81  GLY B CA  2 
ATOM   4698  C  C   . GLY B 1 81  ? -7.633  109.356 -14.872 0.25 10.11 ? 81  GLY B C   2 
ATOM   4699  O  O   . GLY B 1 81  ? -8.754  109.046 -15.276 0.25 10.12 ? 81  GLY B O   2 
ATOM   4700  N  N   . VAL B 1 82  ? -6.519  109.151 -15.563 0.25 8.97  ? 82  VAL B N   2 
ATOM   4701  C  CA  . VAL B 1 82  ? -6.522  108.532 -16.879 0.25 8.90  ? 82  VAL B CA  2 
ATOM   4702  C  C   . VAL B 1 82  ? -5.730  107.232 -16.883 0.25 8.85  ? 82  VAL B C   2 
ATOM   4703  O  O   . VAL B 1 82  ? -4.690  107.116 -16.230 0.25 8.71  ? 82  VAL B O   2 
ATOM   4704  C  CB  . VAL B 1 82  ? -5.898  109.465 -17.939 0.25 10.62 ? 82  VAL B CB  2 
ATOM   4705  C  CG1 . VAL B 1 82  ? -5.707  108.714 -19.254 0.25 10.48 ? 82  VAL B CG1 2 
ATOM   4706  C  CG2 . VAL B 1 82  ? -6.786  110.681 -18.152 0.25 8.60  ? 82  VAL B CG2 2 
ATOM   4707  N  N   . VAL B 1 83  ? -6.243  106.248 -17.610 0.25 8.19  ? 83  VAL B N   2 
ATOM   4708  C  CA  . VAL B 1 83  ? -5.556  104.980 -17.744 0.25 9.56  ? 83  VAL B CA  2 
ATOM   4709  C  C   . VAL B 1 83  ? -4.804  105.066 -19.069 0.25 10.89 ? 83  VAL B C   2 
ATOM   4710  O  O   . VAL B 1 83  ? -5.396  105.379 -20.105 0.25 13.27 ? 83  VAL B O   2 
ATOM   4711  C  CB  . VAL B 1 83  ? -6.541  103.807 -17.793 0.25 10.61 ? 83  VAL B CB  2 
ATOM   4712  C  CG1 . VAL B 1 83  ? -5.796  102.516 -18.108 0.25 11.69 ? 83  VAL B CG1 2 
ATOM   4713  C  CG2 . VAL B 1 83  ? -7.260  103.687 -16.465 0.25 9.92  ? 83  VAL B CG2 2 
ATOM   4714  N  N   . TRP B 1 84  ? -3.500  104.817 -19.026 0.25 10.63 ? 84  TRP B N   2 
ATOM   4715  C  CA  . TRP B 1 84  ? -2.666  104.864 -20.223 0.25 11.49 ? 84  TRP B CA  2 
ATOM   4716  C  C   . TRP B 1 84  ? -2.135  103.472 -20.535 0.25 12.48 ? 84  TRP B C   2 
ATOM   4717  O  O   . TRP B 1 84  ? -1.505  102.847 -19.679 0.25 10.79 ? 84  TRP B O   2 
ATOM   4718  C  CB  . TRP B 1 84  ? -1.464  105.793 -20.018 0.25 9.60  ? 84  TRP B CB  2 
ATOM   4719  C  CG  . TRP B 1 84  ? -1.807  107.187 -19.637 0.25 11.62 ? 84  TRP B CG  2 
ATOM   4720  C  CD1 . TRP B 1 84  ? -2.004  107.668 -18.374 0.25 8.24  ? 84  TRP B CD1 2 
ATOM   4721  C  CD2 . TRP B 1 84  ? -1.977  108.301 -20.523 0.25 9.46  ? 84  TRP B CD2 2 
ATOM   4722  N  NE1 . TRP B 1 84  ? -2.281  109.012 -18.419 0.25 10.11 ? 84  TRP B NE1 2 
ATOM   4723  C  CE2 . TRP B 1 84  ? -2.270  109.426 -19.724 0.25 11.02 ? 84  TRP B CE2 2 
ATOM   4724  C  CE3 . TRP B 1 84  ? -1.908  108.456 -21.913 0.25 10.76 ? 84  TRP B CE3 2 
ATOM   4725  C  CZ2 . TRP B 1 84  ? -2.496  110.696 -20.271 0.25 11.35 ? 84  TRP B CZ2 2 
ATOM   4726  C  CZ3 . TRP B 1 84  ? -2.133  109.720 -22.457 0.25 10.87 ? 84  TRP B CZ3 2 
ATOM   4727  C  CH2 . TRP B 1 84  ? -2.423  110.822 -21.635 0.25 10.37 ? 84  TRP B CH2 2 
ATOM   4728  N  N   . LYS B 1 85  ? -2.384  102.984 -21.750 0.25 13.84 ? 85  LYS B N   2 
ATOM   4729  C  CA  . LYS B 1 85  ? -1.886  101.667 -22.127 0.25 13.83 ? 85  LYS B CA  2 
ATOM   4730  C  C   . LYS B 1 85  ? -0.414  101.808 -22.475 0.25 13.64 ? 85  LYS B C   2 
ATOM   4731  O  O   . LYS B 1 85  ? -0.028  102.719 -23.208 0.25 13.87 ? 85  LYS B O   2 
ATOM   4732  C  CB  . LYS B 1 85  ? -2.638  101.099 -23.335 0.25 15.90 ? 85  LYS B CB  2 
ATOM   4733  C  CG  . LYS B 1 85  ? -2.147  99.698  -23.713 0.25 19.23 ? 85  LYS B CG  2 
ATOM   4734  C  CD  . LYS B 1 85  ? -2.826  99.140  -24.950 0.25 24.96 ? 85  LYS B CD  2 
ATOM   4735  C  CE  . LYS B 1 85  ? -2.216  97.793  -25.321 0.25 26.58 ? 85  LYS B CE  2 
ATOM   4736  N  NZ  . LYS B 1 85  ? -2.842  97.171  -26.521 0.25 31.06 ? 85  LYS B NZ  2 
HETATM 4737  N  N   . MSE B 1 86  ? 0.407   100.909 -21.947 0.25 12.83 ? 86  MSE B N   2 
HETATM 4738  C  CA  . MSE B 1 86  ? 1.844   100.959 -22.198 0.25 16.06 ? 86  MSE B CA  2 
HETATM 4739  C  C   . MSE B 1 86  ? 2.397   99.570  -22.461 0.25 16.61 ? 86  MSE B C   2 
HETATM 4740  O  O   . MSE B 1 86  ? 2.002   98.602  -21.806 0.25 14.70 ? 86  MSE B O   2 
HETATM 4741  C  CB  . MSE B 1 86  ? 2.557   101.572 -20.990 0.25 16.85 ? 86  MSE B CB  2 
HETATM 4742  C  CG  . MSE B 1 86  ? 1.962   102.901 -20.556 0.25 23.21 ? 86  MSE B CG  2 
HETATM 4743  SE SE  . MSE B 1 86  ? 2.925   103.726 -19.116 0.25 29.24 ? 86  MSE B SE  2 
HETATM 4744  C  CE  . MSE B 1 86  ? 4.519   104.192 -20.095 0.25 28.55 ? 86  MSE B CE  2 
ATOM   4745  N  N   . ASN B 1 87  ? 3.311   99.475  -23.422 0.25 19.04 ? 87  ASN B N   2 
ATOM   4746  C  CA  . ASN B 1 87  ? 3.923   98.194  -23.749 0.25 21.59 ? 87  ASN B CA  2 
ATOM   4747  C  C   . ASN B 1 87  ? 4.751   97.817  -22.527 0.25 20.18 ? 87  ASN B C   2 
ATOM   4748  O  O   . ASN B 1 87  ? 5.347   98.689  -21.889 0.25 17.81 ? 87  ASN B O   2 
ATOM   4749  C  CB  . ASN B 1 87  ? 4.831   98.335  -24.977 0.25 25.86 ? 87  ASN B CB  2 
ATOM   4750  C  CG  . ASN B 1 87  ? 4.863   97.078  -25.833 0.25 29.44 ? 87  ASN B CG  2 
ATOM   4751  O  OD1 . ASN B 1 87  ? 5.691   96.950  -26.734 0.25 31.88 ? 87  ASN B OD1 2 
ATOM   4752  N  ND2 . ASN B 1 87  ? 3.955   96.149  -25.559 0.25 30.11 ? 87  ASN B ND2 2 
ATOM   4753  N  N   . LYS B 1 88  ? 4.780   96.530  -22.197 0.25 19.41 ? 88  LYS B N   2 
ATOM   4754  C  CA  . LYS B 1 88  ? 5.524   96.043  -21.036 0.25 20.31 ? 88  LYS B CA  2 
ATOM   4755  C  C   . LYS B 1 88  ? 7.022   96.341  -21.056 0.25 19.29 ? 88  LYS B C   2 
ATOM   4756  O  O   . LYS B 1 88  ? 7.709   96.117  -20.062 0.25 16.08 ? 88  LYS B O   2 
ATOM   4757  C  CB  . LYS B 1 88  ? 5.316   94.535  -20.866 0.25 22.40 ? 88  LYS B CB  2 
ATOM   4758  C  CG  . LYS B 1 88  ? 3.927   94.141  -20.377 0.25 27.26 ? 88  LYS B CG  2 
ATOM   4759  C  CD  . LYS B 1 88  ? 3.770   92.627  -20.332 0.25 28.92 ? 88  LYS B CD  2 
ATOM   4760  C  CE  . LYS B 1 88  ? 2.364   92.223  -19.916 0.25 31.34 ? 88  LYS B CE  2 
ATOM   4761  N  NZ  . LYS B 1 88  ? 2.159   90.751  -20.017 0.25 31.90 ? 88  LYS B NZ  2 
ATOM   4762  N  N   . SER B 1 89  ? 7.532   96.843  -22.174 0.25 19.02 ? 89  SER B N   2 
ATOM   4763  C  CA  . SER B 1 89  ? 8.954   97.155  -22.254 0.25 20.01 ? 89  SER B CA  2 
ATOM   4764  C  C   . SER B 1 89  ? 9.313   98.405  -21.443 0.25 20.72 ? 89  SER B C   2 
ATOM   4765  O  O   . SER B 1 89  ? 10.487  98.650  -21.163 0.25 18.95 ? 89  SER B O   2 
ATOM   4766  C  CB  . SER B 1 89  ? 9.381   97.344  -23.714 0.25 21.18 ? 89  SER B CB  2 
ATOM   4767  O  OG  . SER B 1 89  ? 8.720   98.447  -24.313 0.25 21.11 ? 89  SER B OG  2 
ATOM   4768  N  N   . ASN B 1 90  ? 8.302   99.185  -21.061 0.25 19.97 ? 90  ASN B N   2 
ATOM   4769  C  CA  . ASN B 1 90  ? 8.518   100.413 -20.285 0.25 20.94 ? 90  ASN B CA  2 
ATOM   4770  C  C   . ASN B 1 90  ? 8.375   100.255 -18.772 0.25 18.92 ? 90  ASN B C   2 
ATOM   4771  O  O   . ASN B 1 90  ? 8.754   101.153 -18.009 0.25 17.35 ? 90  ASN B O   2 
ATOM   4772  C  CB  . ASN B 1 90  ? 7.553   101.506 -20.747 0.25 22.00 ? 90  ASN B CB  2 
ATOM   4773  C  CG  . ASN B 1 90  ? 8.004   102.179 -22.020 0.25 24.84 ? 90  ASN B CG  2 
ATOM   4774  O  OD1 . ASN B 1 90  ? 7.304   103.035 -22.558 0.25 24.42 ? 90  ASN B OD1 2 
ATOM   4775  N  ND2 . ASN B 1 90  ? 9.183   101.804 -22.508 0.25 25.84 ? 90  ASN B ND2 2 
ATOM   4776  N  N   . LEU B 1 91  ? 7.820   99.127  -18.343 0.25 16.68 ? 91  LEU B N   2 
ATOM   4777  C  CA  . LEU B 1 91  ? 7.615   98.862  -16.923 0.25 16.90 ? 91  LEU B CA  2 
ATOM   4778  C  C   . LEU B 1 91  ? 8.771   99.322  -16.048 0.25 14.42 ? 91  LEU B C   2 
ATOM   4779  O  O   . LEU B 1 91  ? 8.597   100.185 -15.193 0.25 12.84 ? 91  LEU B O   2 
ATOM   4780  C  CB  . LEU B 1 91  ? 7.365   97.369  -16.690 0.25 16.08 ? 91  LEU B CB  2 
ATOM   4781  C  CG  . LEU B 1 91  ? 5.956   96.851  -16.988 0.25 17.40 ? 91  LEU B CG  2 
ATOM   4782  C  CD1 . LEU B 1 91  ? 5.971   95.325  -17.052 0.25 16.03 ? 91  LEU B CD1 2 
ATOM   4783  C  CD2 . LEU B 1 91  ? 4.992   97.336  -15.905 0.25 17.45 ? 91  LEU B CD2 2 
ATOM   4784  N  N   . ASN B 1 92  ? 9.954   98.757  -16.259 0.25 14.35 ? 92  ASN B N   2 
ATOM   4785  C  CA  . ASN B 1 92  ? 11.097  99.143  -15.446 0.25 15.40 ? 92  ASN B CA  2 
ATOM   4786  C  C   . ASN B 1 92  ? 11.444  100.614 -15.587 0.25 14.84 ? 92  ASN B C   2 
ATOM   4787  O  O   . ASN B 1 92  ? 11.949  101.226 -14.646 0.25 15.45 ? 92  ASN B O   2 
ATOM   4788  C  CB  . ASN B 1 92  ? 12.308  98.273  -15.779 0.25 16.02 ? 92  ASN B CB  2 
ATOM   4789  C  CG  . ASN B 1 92  ? 12.128  96.848  -15.307 0.25 18.69 ? 92  ASN B CG  2 
ATOM   4790  O  OD1 . ASN B 1 92  ? 11.724  96.612  -14.170 0.25 15.81 ? 92  ASN B OD1 2 
ATOM   4791  N  ND2 . ASN B 1 92  ? 12.427  95.890  -16.176 0.25 20.85 ? 92  ASN B ND2 2 
ATOM   4792  N  N   . SER B 1 93  ? 11.168  101.183 -16.756 0.25 12.98 ? 93  SER B N   2 
ATOM   4793  C  CA  . SER B 1 93  ? 11.437  102.595 -16.981 0.25 14.26 ? 93  SER B CA  2 
ATOM   4794  C  C   . SER B 1 93  ? 10.466  103.455 -16.172 0.25 14.44 ? 93  SER B C   2 
ATOM   4795  O  O   . SER B 1 93  ? 10.816  104.548 -15.726 0.25 12.87 ? 93  SER B O   2 
ATOM   4796  C  CB  . SER B 1 93  ? 11.292  102.935 -18.463 0.25 14.75 ? 93  SER B CB  2 
ATOM   4797  O  OG  . SER B 1 93  ? 11.448  104.332 -18.663 0.25 17.60 ? 93  SER B OG  2 
ATOM   4798  N  N   . LEU B 1 94  ? 9.244   102.959 -15.987 0.25 13.10 ? 94  LEU B N   2 
ATOM   4799  C  CA  . LEU B 1 94  ? 8.246   103.701 -15.231 0.25 11.40 ? 94  LEU B CA  2 
ATOM   4800  C  C   . LEU B 1 94  ? 8.607   103.712 -13.746 0.25 10.80 ? 94  LEU B C   2 
ATOM   4801  O  O   . LEU B 1 94  ? 8.495   104.739 -13.079 0.25 8.61  ? 94  LEU B O   2 
ATOM   4802  C  CB  . LEU B 1 94  ? 6.855   103.097 -15.441 0.25 13.04 ? 94  LEU B CB  2 
ATOM   4803  C  CG  . LEU B 1 94  ? 5.699   103.884 -14.815 0.25 12.47 ? 94  LEU B CG  2 
ATOM   4804  C  CD1 . LEU B 1 94  ? 5.792   105.345 -15.248 0.25 13.38 ? 94  LEU B CD1 2 
ATOM   4805  C  CD2 . LEU B 1 94  ? 4.357   103.276 -15.237 0.25 13.65 ? 94  LEU B CD2 2 
ATOM   4806  N  N   . ASP B 1 95  ? 9.051   102.571 -13.229 0.25 11.44 ? 95  ASP B N   2 
ATOM   4807  C  CA  . ASP B 1 95  ? 9.447   102.490 -11.828 0.25 13.51 ? 95  ASP B CA  2 
ATOM   4808  C  C   . ASP B 1 95  ? 10.593  103.464 -11.544 0.25 13.03 ? 95  ASP B C   2 
ATOM   4809  O  O   . ASP B 1 95  ? 10.713  103.986 -10.440 0.25 12.02 ? 95  ASP B O   2 
ATOM   4810  C  CB  . ASP B 1 95  ? 9.887   101.065 -11.480 0.25 11.69 ? 95  ASP B CB  2 
ATOM   4811  C  CG  . ASP B 1 95  ? 8.719   100.104 -11.352 0.25 15.37 ? 95  ASP B CG  2 
ATOM   4812  O  OD1 . ASP B 1 95  ? 7.564   100.520 -11.603 0.25 14.25 ? 95  ASP B OD1 2 
ATOM   4813  O  OD2 . ASP B 1 95  ? 8.958   98.927  -10.997 0.25 13.29 ? 95  ASP B OD2 2 
ATOM   4814  N  N   . GLU B 1 96  ? 11.439  103.697 -12.544 0.25 16.33 ? 96  GLU B N   2 
ATOM   4815  C  CA  . GLU B 1 96  ? 12.572  104.611 -12.390 0.25 16.41 ? 96  GLU B CA  2 
ATOM   4816  C  C   . GLU B 1 96  ? 12.074  106.046 -12.271 0.25 14.57 ? 96  GLU B C   2 
ATOM   4817  O  O   . GLU B 1 96  ? 12.596  106.825 -11.477 0.25 13.52 ? 96  GLU B O   2 
ATOM   4818  C  CB  . GLU B 1 96  ? 13.517  104.496 -13.594 0.25 18.56 ? 96  GLU B CB  2 
ATOM   4819  C  CG  . GLU B 1 96  ? 14.865  105.222 -13.468 0.25 23.46 ? 96  GLU B CG  2 
ATOM   4820  C  CD  . GLU B 1 96  ? 14.757  106.750 -13.481 0.25 27.27 ? 96  GLU B CD  2 
ATOM   4821  O  OE1 . GLU B 1 96  ? 13.840  107.297 -14.135 0.25 24.29 ? 96  GLU B OE1 2 
ATOM   4822  O  OE2 . GLU B 1 96  ? 15.614  107.407 -12.848 0.25 27.59 ? 96  GLU B OE2 2 
ATOM   4823  N  N   . GLN B 1 97  ? 11.076  106.393 -13.079 0.25 13.69 ? 97  GLN B N   2 
ATOM   4824  C  CA  . GLN B 1 97  ? 10.504  107.742 -13.068 0.25 13.38 ? 97  GLN B CA  2 
ATOM   4825  C  C   . GLN B 1 97  ? 9.812   108.015 -11.741 0.25 14.49 ? 97  GLN B C   2 
ATOM   4826  O  O   . GLN B 1 97  ? 9.726   109.161 -11.301 0.25 15.14 ? 97  GLN B O   2 
ATOM   4827  C  CB  . GLN B 1 97  ? 9.481   107.897 -14.197 0.25 11.52 ? 97  GLN B CB  2 
ATOM   4828  C  CG  . GLN B 1 97  ? 10.058  107.744 -15.601 0.25 15.76 ? 97  GLN B CG  2 
ATOM   4829  C  CD  . GLN B 1 97  ? 8.984   107.508 -16.644 0.25 15.55 ? 97  GLN B CD  2 
ATOM   4830  O  OE1 . GLN B 1 97  ? 7.967   108.206 -16.678 0.25 15.89 ? 97  GLN B OE1 2 
ATOM   4831  N  NE2 . GLN B 1 97  ? 9.203   106.519 -17.504 0.25 14.79 ? 97  GLN B NE2 2 
ATOM   4832  N  N   . GLU B 1 98  ? 9.319   106.954 -11.110 0.25 14.62 ? 98  GLU B N   2 
ATOM   4833  C  CA  . GLU B 1 98  ? 8.615   107.078 -9.841  0.25 17.00 ? 98  GLU B CA  2 
ATOM   4834  C  C   . GLU B 1 98  ? 9.513   106.818 -8.628  0.25 17.12 ? 98  GLU B C   2 
ATOM   4835  O  O   . GLU B 1 98  ? 9.025   106.582 -7.519  0.25 17.10 ? 98  GLU B O   2 
ATOM   4836  C  CB  . GLU B 1 98  ? 7.417   106.123 -9.829  0.25 17.77 ? 98  GLU B CB  2 
ATOM   4837  C  CG  . GLU B 1 98  ? 6.415   106.386 -10.950 0.25 23.39 ? 98  GLU B CG  2 
ATOM   4838  C  CD  . GLU B 1 98  ? 5.824   107.789 -10.897 0.25 27.77 ? 98  GLU B CD  2 
ATOM   4839  O  OE1 . GLU B 1 98  ? 5.110   108.103 -9.919  0.25 27.01 ? 98  GLU B OE1 2 
ATOM   4840  O  OE2 . GLU B 1 98  ? 6.076   108.580 -11.833 0.25 29.85 ? 98  GLU B OE2 2 
ATOM   4841  N  N   . GLY B 1 99  ? 10.824  106.865 -8.847  0.25 15.30 ? 99  GLY B N   2 
ATOM   4842  C  CA  . GLY B 1 99  ? 11.775  106.648 -7.767  0.25 14.59 ? 99  GLY B CA  2 
ATOM   4843  C  C   . GLY B 1 99  ? 11.461  105.491 -6.832  0.25 14.55 ? 99  GLY B C   2 
ATOM   4844  O  O   . GLY B 1 99  ? 11.705  105.575 -5.626  0.25 12.66 ? 99  GLY B O   2 
ATOM   4845  N  N   . VAL B 1 100 ? 10.936  104.398 -7.376  0.25 13.09 ? 100 VAL B N   2 
ATOM   4846  C  CA  . VAL B 1 100 ? 10.609  103.252 -6.539  0.25 13.82 ? 100 VAL B CA  2 
ATOM   4847  C  C   . VAL B 1 100 ? 11.837  102.773 -5.759  0.25 16.56 ? 100 VAL B C   2 
ATOM   4848  O  O   . VAL B 1 100 ? 11.770  102.575 -4.544  0.25 14.25 ? 100 VAL B O   2 
ATOM   4849  C  CB  . VAL B 1 100 ? 10.037  102.084 -7.382  0.25 13.98 ? 100 VAL B CB  2 
ATOM   4850  C  CG1 . VAL B 1 100 ? 9.772   100.877 -6.491  0.25 12.43 ? 100 VAL B CG1 2 
ATOM   4851  C  CG2 . VAL B 1 100 ? 8.745   102.522 -8.062  0.25 12.86 ? 100 VAL B CG2 2 
ATOM   4852  N  N   . LYS B 1 101 ? 12.961  102.607 -6.452  0.25 18.65 ? 101 LYS B N   2 
ATOM   4853  C  CA  . LYS B 1 101 ? 14.196  102.152 -5.814  0.25 21.10 ? 101 LYS B CA  2 
ATOM   4854  C  C   . LYS B 1 101 ? 14.659  103.112 -4.717  0.25 21.09 ? 101 LYS B C   2 
ATOM   4855  O  O   . LYS B 1 101 ? 15.092  102.684 -3.647  0.25 21.47 ? 101 LYS B O   2 
ATOM   4856  C  CB  . LYS B 1 101 ? 15.311  102.013 -6.852  0.25 26.11 ? 101 LYS B CB  2 
ATOM   4857  C  CG  . LYS B 1 101 ? 15.016  101.051 -7.994  0.25 32.63 ? 101 LYS B CG  2 
ATOM   4858  C  CD  . LYS B 1 101 ? 15.141  99.597  -7.577  0.25 36.66 ? 101 LYS B CD  2 
ATOM   4859  C  CE  . LYS B 1 101 ? 14.961  98.677  -8.780  0.25 40.39 ? 101 LYS B CE  2 
ATOM   4860  N  NZ  . LYS B 1 101 ? 15.173  97.239  -8.445  0.25 44.38 ? 101 LYS B NZ  2 
ATOM   4861  N  N   . SER B 1 102 ? 14.573  104.410 -4.992  0.25 21.34 ? 102 SER B N   2 
ATOM   4862  C  CA  . SER B 1 102 ? 14.990  105.429 -4.034  0.25 19.86 ? 102 SER B CA  2 
ATOM   4863  C  C   . SER B 1 102 ? 13.988  105.622 -2.896  0.25 19.18 ? 102 SER B C   2 
ATOM   4864  O  O   . SER B 1 102 ? 14.215  106.427 -1.992  0.25 19.02 ? 102 SER B O   2 
ATOM   4865  C  CB  . SER B 1 102 ? 15.218  106.762 -4.750  0.25 21.14 ? 102 SER B CB  2 
ATOM   4866  O  OG  . SER B 1 102 ? 14.026  107.221 -5.361  0.25 21.73 ? 102 SER B OG  2 
ATOM   4867  N  N   . GLY B 1 103 ? 12.875  104.896 -2.955  0.25 17.28 ? 103 GLY B N   2 
ATOM   4868  C  CA  . GLY B 1 103 ? 11.868  104.986 -1.908  0.25 16.17 ? 103 GLY B CA  2 
ATOM   4869  C  C   . GLY B 1 103 ? 10.813  106.075 -2.044  0.25 15.60 ? 103 GLY B C   2 
ATOM   4870  O  O   . GLY B 1 103 ? 9.981   106.247 -1.146  0.25 16.43 ? 103 GLY B O   2 
HETATM 4871  N  N   . MSE B 1 104 ? 10.832  106.812 -3.151  0.25 14.34 ? 104 MSE B N   2 
HETATM 4872  C  CA  . MSE B 1 104 ? 9.859   107.883 -3.354  0.25 13.95 ? 104 MSE B CA  2 
HETATM 4873  C  C   . MSE B 1 104 ? 8.446   107.315 -3.342  0.25 12.86 ? 104 MSE B C   2 
HETATM 4874  O  O   . MSE B 1 104 ? 7.651   107.630 -2.458  0.25 12.49 ? 104 MSE B O   2 
HETATM 4875  C  CB  . MSE B 1 104 ? 10.116  108.603 -4.683  0.25 14.46 ? 104 MSE B CB  2 
HETATM 4876  C  CG  . MSE B 1 104 ? 11.495  109.246 -4.801  0.25 15.88 ? 104 MSE B CG  2 
HETATM 4877  SE SE  . MSE B 1 104 ? 11.828  110.660 -3.507  0.25 23.06 ? 104 MSE B SE  2 
HETATM 4878  C  CE  . MSE B 1 104 ? 12.692  109.578 -2.153  0.25 14.33 ? 104 MSE B CE  2 
ATOM   4879  N  N   . TYR B 1 105 ? 8.140   106.480 -4.331  0.25 10.45 ? 105 TYR B N   2 
ATOM   4880  C  CA  . TYR B 1 105 ? 6.828   105.847 -4.428  0.25 11.46 ? 105 TYR B CA  2 
ATOM   4881  C  C   . TYR B 1 105 ? 6.974   104.337 -4.366  0.25 10.59 ? 105 TYR B C   2 
ATOM   4882  O  O   . TYR B 1 105 ? 8.068   103.797 -4.526  0.25 10.12 ? 105 TYR B O   2 
ATOM   4883  C  CB  . TYR B 1 105 ? 6.140   106.159 -5.760  0.25 8.98  ? 105 TYR B CB  2 
ATOM   4884  C  CG  . TYR B 1 105 ? 5.635   107.565 -5.931  0.25 11.67 ? 105 TYR B CG  2 
ATOM   4885  C  CD1 . TYR B 1 105 ? 6.477   108.580 -6.379  0.25 11.03 ? 105 TYR B CD1 2 
ATOM   4886  C  CD2 . TYR B 1 105 ? 4.298   107.876 -5.681  0.25 10.43 ? 105 TYR B CD2 2 
ATOM   4887  C  CE1 . TYR B 1 105 ? 6.000   109.872 -6.580  0.25 12.66 ? 105 TYR B CE1 2 
ATOM   4888  C  CE2 . TYR B 1 105 ? 3.810   109.162 -5.877  0.25 10.78 ? 105 TYR B CE2 2 
ATOM   4889  C  CZ  . TYR B 1 105 ? 4.668   110.154 -6.328  0.25 12.74 ? 105 TYR B CZ  2 
ATOM   4890  O  OH  . TYR B 1 105 ? 4.194   111.423 -6.530  0.25 11.57 ? 105 TYR B OH  2 
ATOM   4891  N  N   . VAL B 1 106 ? 5.847   103.673 -4.144  0.25 10.49 ? 106 VAL B N   2 
ATOM   4892  C  CA  . VAL B 1 106 ? 5.781   102.224 -4.114  0.25 9.09  ? 106 VAL B CA  2 
ATOM   4893  C  C   . VAL B 1 106 ? 4.863   101.851 -5.286  0.25 7.39  ? 106 VAL B C   2 
ATOM   4894  O  O   . VAL B 1 106 ? 3.955   102.613 -5.640  0.25 4.14  ? 106 VAL B O   2 
ATOM   4895  C  CB  . VAL B 1 106 ? 5.166   101.714 -2.790  0.25 10.42 ? 106 VAL B CB  2 
ATOM   4896  C  CG1 . VAL B 1 106 ? 3.736   102.223 -2.646  0.25 12.17 ? 106 VAL B CG1 2 
ATOM   4897  C  CG2 . VAL B 1 106 ? 5.196   100.192 -2.759  0.25 10.20 ? 106 VAL B CG2 2 
ATOM   4898  N  N   . VAL B 1 107 ? 5.112   100.706 -5.909  0.25 6.67  ? 107 VAL B N   2 
ATOM   4899  C  CA  . VAL B 1 107 ? 4.275   100.257 -7.018  0.25 7.85  ? 107 VAL B CA  2 
ATOM   4900  C  C   . VAL B 1 107 ? 3.084   99.499  -6.448  0.25 8.10  ? 107 VAL B C   2 
ATOM   4901  O  O   . VAL B 1 107 ? 3.269   98.519  -5.727  0.25 7.57  ? 107 VAL B O   2 
ATOM   4902  C  CB  . VAL B 1 107 ? 5.021   99.270  -7.955  0.25 10.43 ? 107 VAL B CB  2 
ATOM   4903  C  CG1 . VAL B 1 107 ? 4.066   98.763  -9.034  0.25 7.63  ? 107 VAL B CG1 2 
ATOM   4904  C  CG2 . VAL B 1 107 ? 6.229   99.947  -8.596  0.25 9.39  ? 107 VAL B CG2 2 
ATOM   4905  N  N   . ILE B 1 108 ? 1.869   99.949  -6.758  0.25 7.05  ? 108 ILE B N   2 
ATOM   4906  C  CA  . ILE B 1 108 ? 0.674   99.256  -6.293  0.25 6.16  ? 108 ILE B CA  2 
ATOM   4907  C  C   . ILE B 1 108 ? -0.137  98.803  -7.507  0.25 7.60  ? 108 ILE B C   2 
ATOM   4908  O  O   . ILE B 1 108 ? 0.272   98.987  -8.658  0.25 3.91  ? 108 ILE B O   2 
ATOM   4909  C  CB  . ILE B 1 108 ? -0.250  100.166 -5.424  0.25 8.10  ? 108 ILE B CB  2 
ATOM   4910  C  CG1 . ILE B 1 108 ? -0.903  101.247 -6.292  0.25 11.08 ? 108 ILE B CG1 2 
ATOM   4911  C  CG2 . ILE B 1 108 ? 0.552   100.830 -4.304  0.25 6.26  ? 108 ILE B CG2 2 
ATOM   4912  C  CD1 . ILE B 1 108 ? -1.828  102.201 -5.511  0.25 9.01  ? 108 ILE B CD1 2 
ATOM   4913  N  N   . GLU B 1 109 ? -1.276  98.182  -7.230  0.25 7.58  ? 109 GLU B N   2 
ATOM   4914  C  CA  . GLU B 1 109 ? -2.209  97.753  -8.265  0.25 10.46 ? 109 GLU B CA  2 
ATOM   4915  C  C   . GLU B 1 109 ? -3.556  98.266  -7.775  0.25 9.81  ? 109 GLU B C   2 
ATOM   4916  O  O   . GLU B 1 109 ? -3.824  98.246  -6.568  0.25 9.36  ? 109 GLU B O   2 
ATOM   4917  C  CB  . GLU B 1 109 ? -2.256  96.222  -8.385  0.25 11.15 ? 109 GLU B CB  2 
ATOM   4918  C  CG  . GLU B 1 109 ? -3.308  95.722  -9.371  0.25 14.66 ? 109 GLU B CG  2 
ATOM   4919  C  CD  . GLU B 1 109 ? -3.410  94.205  -9.394  0.25 17.39 ? 109 GLU B CD  2 
ATOM   4920  O  OE1 . GLU B 1 109 ? -2.444  93.545  -9.835  0.25 17.87 ? 109 GLU B OE1 2 
ATOM   4921  O  OE2 . GLU B 1 109 ? -4.454  93.675  -8.964  0.25 15.95 ? 109 GLU B OE2 2 
ATOM   4922  N  N   . VAL B 1 110 ? -4.389  98.747  -8.692  0.25 9.69  ? 110 VAL B N   2 
ATOM   4923  C  CA  . VAL B 1 110 ? -5.705  99.250  -8.316  0.25 11.33 ? 110 VAL B CA  2 
ATOM   4924  C  C   . VAL B 1 110 ? -6.765  98.894  -9.344  0.25 12.43 ? 110 VAL B C   2 
ATOM   4925  O  O   . VAL B 1 110 ? -6.457  98.631  -10.508 0.25 13.48 ? 110 VAL B O   2 
ATOM   4926  C  CB  . VAL B 1 110 ? -5.716  100.793 -8.156  0.25 12.45 ? 110 VAL B CB  2 
ATOM   4927  C  CG1 . VAL B 1 110 ? -4.785  101.212 -7.043  0.25 10.43 ? 110 VAL B CG1 2 
ATOM   4928  C  CG2 . VAL B 1 110 ? -5.333  101.460 -9.471  0.25 12.25 ? 110 VAL B CG2 2 
ATOM   4929  N  N   . LYS B 1 111 ? -8.016  98.878  -8.898  0.25 13.09 ? 111 LYS B N   2 
ATOM   4930  C  CA  . LYS B 1 111 ? -9.142  98.592  -9.772  0.25 14.30 ? 111 LYS B CA  2 
ATOM   4931  C  C   . LYS B 1 111 ? -9.922  99.895  -9.867  0.25 13.40 ? 111 LYS B C   2 
ATOM   4932  O  O   . LYS B 1 111 ? -10.363 100.445 -8.855  0.25 11.65 ? 111 LYS B O   2 
ATOM   4933  C  CB  . LYS B 1 111 ? -10.010 97.475  -9.186  0.25 15.59 ? 111 LYS B CB  2 
ATOM   4934  C  CG  . LYS B 1 111 ? -9.285  96.137  -9.062  0.25 20.30 ? 111 LYS B CG  2 
ATOM   4935  C  CD  . LYS B 1 111 ? -10.172 95.080  -8.407  0.25 22.13 ? 111 LYS B CD  2 
ATOM   4936  C  CE  . LYS B 1 111 ? -9.388  93.824  -8.026  0.25 21.00 ? 111 LYS B CE  2 
ATOM   4937  N  NZ  . LYS B 1 111 ? -8.782  93.134  -9.191  0.25 20.08 ? 111 LYS B NZ  2 
ATOM   4938  N  N   . VAL B 1 112 ? -10.058 100.407 -11.083 0.25 11.03 ? 112 VAL B N   2 
ATOM   4939  C  CA  . VAL B 1 112 ? -10.763 101.659 -11.287 0.25 10.61 ? 112 VAL B CA  2 
ATOM   4940  C  C   . VAL B 1 112 ? -11.995 101.466 -12.165 0.25 12.03 ? 112 VAL B C   2 
ATOM   4941  O  O   . VAL B 1 112 ? -12.002 100.624 -13.063 0.25 13.54 ? 112 VAL B O   2 
ATOM   4942  C  CB  . VAL B 1 112 ? -9.827  102.721 -11.914 0.25 10.62 ? 112 VAL B CB  2 
ATOM   4943  C  CG1 . VAL B 1 112 ? -8.707  103.070 -10.931 0.25 10.51 ? 112 VAL B CG1 2 
ATOM   4944  C  CG2 . VAL B 1 112 ? -9.234  102.197 -13.215 0.25 8.22  ? 112 VAL B CG2 2 
ATOM   4945  N  N   . ALA B 1 113 ? -13.031 102.256 -11.897 0.25 11.95 ? 113 ALA B N   2 
ATOM   4946  C  CA  . ALA B 1 113 ? -14.286 102.166 -12.638 0.25 13.37 ? 113 ALA B CA  2 
ATOM   4947  C  C   . ALA B 1 113 ? -14.325 103.075 -13.868 0.25 12.34 ? 113 ALA B C   2 
ATOM   4948  O  O   . ALA B 1 113 ? -14.082 104.275 -13.771 0.25 11.23 ? 113 ALA B O   2 
ATOM   4949  C  CB  . ALA B 1 113 ? -15.449 102.493 -11.703 0.25 11.88 ? 113 ALA B CB  2 
ATOM   4950  N  N   . THR B 1 114 ? -14.637 102.496 -15.024 0.25 14.23 ? 114 THR B N   2 
ATOM   4951  C  CA  . THR B 1 114 ? -14.709 103.266 -16.263 0.25 17.62 ? 114 THR B CA  2 
ATOM   4952  C  C   . THR B 1 114 ? -15.853 104.276 -16.201 0.25 20.61 ? 114 THR B C   2 
ATOM   4953  O  O   . THR B 1 114 ? -16.219 104.750 -15.128 0.25 21.70 ? 114 THR B O   2 
ATOM   4954  C  CB  . THR B 1 114 ? -14.930 102.344 -17.483 0.25 17.30 ? 114 THR B CB  2 
ATOM   4955  O  OG1 . THR B 1 114 ? -16.158 101.624 -17.327 0.25 14.98 ? 114 THR B OG1 2 
ATOM   4956  C  CG2 . THR B 1 114 ? -13.792 101.356 -17.611 0.25 17.29 ? 114 THR B CG2 2 
ATOM   4957  N  N   . GLN B 1 115 ? -16.414 104.612 -17.355 0.25 23.12 ? 115 GLN B N   2 
ATOM   4958  C  CA  . GLN B 1 115 ? -17.513 105.561 -17.387 0.25 26.82 ? 115 GLN B CA  2 
ATOM   4959  C  C   . GLN B 1 115 ? -18.827 104.806 -17.525 0.25 26.01 ? 115 GLN B C   2 
ATOM   4960  O  O   . GLN B 1 115 ? -19.903 105.385 -17.423 0.25 25.36 ? 115 GLN B O   2 
ATOM   4961  C  CB  . GLN B 1 115 ? -17.331 106.554 -18.540 0.25 29.82 ? 115 GLN B CB  2 
ATOM   4962  C  CG  . GLN B 1 115 ? -18.204 107.796 -18.423 0.25 35.46 ? 115 GLN B CG  2 
ATOM   4963  C  CD  . GLN B 1 115 ? -17.774 108.908 -19.365 0.25 38.63 ? 115 GLN B CD  2 
ATOM   4964  O  OE1 . GLN B 1 115 ? -17.773 108.741 -20.586 0.25 38.11 ? 115 GLN B OE1 2 
ATOM   4965  N  NE2 . GLN B 1 115 ? -17.402 110.051 -18.797 0.25 40.79 ? 115 GLN B NE2 2 
ATOM   4966  N  N   . GLU B 1 116 ? -18.727 103.501 -17.750 0.25 27.68 ? 116 GLU B N   2 
ATOM   4967  C  CA  . GLU B 1 116 ? -19.902 102.649 -17.882 0.25 28.82 ? 116 GLU B CA  2 
ATOM   4968  C  C   . GLU B 1 116 ? -19.912 101.567 -16.811 0.25 27.28 ? 116 GLU B C   2 
ATOM   4969  O  O   . GLU B 1 116 ? -20.616 100.568 -16.928 0.25 26.81 ? 116 GLU B O   2 
ATOM   4970  C  CB  . GLU B 1 116 ? -19.946 102.012 -19.272 0.25 32.60 ? 116 GLU B CB  2 
ATOM   4971  C  CG  . GLU B 1 116 ? -20.732 102.822 -20.287 0.25 39.50 ? 116 GLU B CG  2 
ATOM   4972  C  CD  . GLU B 1 116 ? -20.214 104.238 -20.440 0.25 40.92 ? 116 GLU B CD  2 
ATOM   4973  O  OE1 . GLU B 1 116 ? -19.121 104.409 -21.018 0.25 45.62 ? 116 GLU B OE1 2 
ATOM   4974  O  OE2 . GLU B 1 116 ? -20.895 105.178 -19.978 0.25 42.86 ? 116 GLU B OE2 2 
ATOM   4975  N  N   . GLY B 1 117 ? -19.120 101.768 -15.765 0.25 27.06 ? 117 GLY B N   2 
ATOM   4976  C  CA  . GLY B 1 117 ? -19.072 100.801 -14.683 0.25 27.02 ? 117 GLY B CA  2 
ATOM   4977  C  C   . GLY B 1 117 ? -18.027 99.707  -14.811 0.25 26.27 ? 117 GLY B C   2 
ATOM   4978  O  O   . GLY B 1 117 ? -17.653 99.094  -13.813 0.25 26.08 ? 117 GLY B O   2 
ATOM   4979  N  N   . LYS B 1 118 ? -17.555 99.450  -16.027 0.25 26.17 ? 118 LYS B N   2 
ATOM   4980  C  CA  . LYS B 1 118 ? -16.543 98.415  -16.235 0.25 27.24 ? 118 LYS B CA  2 
ATOM   4981  C  C   . LYS B 1 118 ? -15.367 98.633  -15.294 0.25 24.97 ? 118 LYS B C   2 
ATOM   4982  O  O   . LYS B 1 118 ? -14.893 99.755  -15.139 0.25 21.80 ? 118 LYS B O   2 
ATOM   4983  C  CB  . LYS B 1 118 ? -16.028 98.435  -17.678 0.25 31.04 ? 118 LYS B CB  2 
ATOM   4984  C  CG  . LYS B 1 118 ? -17.033 97.990  -18.729 0.25 37.55 ? 118 LYS B CG  2 
ATOM   4985  C  CD  . LYS B 1 118 ? -16.411 98.057  -20.120 0.25 41.48 ? 118 LYS B CD  2 
ATOM   4986  C  CE  . LYS B 1 118 ? -17.345 97.511  -21.191 0.25 46.53 ? 118 LYS B CE  2 
ATOM   4987  N  NZ  . LYS B 1 118 ? -17.615 96.058  -21.011 0.25 48.65 ? 118 LYS B NZ  2 
ATOM   4988  N  N   . GLU B 1 119 ? -14.897 97.559  -14.671 0.25 24.44 ? 119 GLU B N   2 
ATOM   4989  C  CA  . GLU B 1 119 ? -13.768 97.649  -13.756 0.25 24.07 ? 119 GLU B CA  2 
ATOM   4990  C  C   . GLU B 1 119 ? -12.469 97.325  -14.495 0.25 22.76 ? 119 GLU B C   2 
ATOM   4991  O  O   . GLU B 1 119 ? -12.350 96.288  -15.142 0.25 21.00 ? 119 GLU B O   2 
ATOM   4992  C  CB  . GLU B 1 119 ? -13.969 96.693  -12.575 0.25 24.65 ? 119 GLU B CB  2 
ATOM   4993  C  CG  . GLU B 1 119 ? -12.784 96.597  -11.621 0.25 27.61 ? 119 GLU B CG  2 
ATOM   4994  C  CD  . GLU B 1 119 ? -13.139 95.905  -10.312 0.25 28.79 ? 119 GLU B CD  2 
ATOM   4995  O  OE1 . GLU B 1 119 ? -13.837 96.523  -9.481  0.25 29.07 ? 119 GLU B OE1 2 
ATOM   4996  O  OE2 . GLU B 1 119 ? -12.728 94.741  -10.114 0.25 30.32 ? 119 GLU B OE2 2 
ATOM   4997  N  N   . ILE B 1 120 ? -11.508 98.237  -14.403 0.25 19.91 ? 120 ILE B N   2 
ATOM   4998  C  CA  . ILE B 1 120 ? -10.215 98.074  -15.053 0.25 18.44 ? 120 ILE B CA  2 
ATOM   4999  C  C   . ILE B 1 120 ? -9.145  97.894  -13.983 0.25 17.18 ? 120 ILE B C   2 
ATOM   5000  O  O   . ILE B 1 120 ? -9.265  98.439  -12.887 0.25 17.07 ? 120 ILE B O   2 
ATOM   5001  C  CB  . ILE B 1 120 ? -9.851  99.327  -15.882 0.25 17.66 ? 120 ILE B CB  2 
ATOM   5002  C  CG1 . ILE B 1 120 ? -10.977 99.653  -16.864 0.25 21.58 ? 120 ILE B CG1 2 
ATOM   5003  C  CG2 . ILE B 1 120 ? -8.552  99.105  -16.619 0.25 17.83 ? 120 ILE B CG2 2 
ATOM   5004  C  CD1 . ILE B 1 120 ? -11.349 98.503  -17.780 0.25 22.06 ? 120 ILE B CD1 2 
ATOM   5005  N  N   . THR B 1 121 ? -8.101  97.134  -14.299 0.25 15.69 ? 121 THR B N   2 
ATOM   5006  C  CA  . THR B 1 121 ? -7.008  96.929  -13.357 0.25 16.40 ? 121 THR B CA  2 
ATOM   5007  C  C   . THR B 1 121 ? -5.821  97.761  -13.832 0.25 15.64 ? 121 THR B C   2 
ATOM   5008  O  O   . THR B 1 121 ? -5.491  97.759  -15.024 0.25 15.13 ? 121 THR B O   2 
ATOM   5009  C  CB  . THR B 1 121 ? -6.610  95.444  -13.275 0.25 17.22 ? 121 THR B CB  2 
ATOM   5010  O  OG1 . THR B 1 121 ? -7.719  94.686  -12.780 0.25 16.14 ? 121 THR B OG1 2 
ATOM   5011  C  CG2 . THR B 1 121 ? -5.422  95.256  -12.335 0.25 17.20 ? 121 THR B CG2 2 
ATOM   5012  N  N   . CYS B 1 122 ? -5.186  98.477  -12.908 0.25 12.48 ? 122 CYS B N   2 
ATOM   5013  C  CA  . CYS B 1 122 ? -4.053  99.324  -13.266 0.25 11.23 ? 122 CYS B CA  2 
ATOM   5014  C  C   . CYS B 1 122 ? -2.882  99.277  -12.299 0.25 11.00 ? 122 CYS B C   2 
ATOM   5015  O  O   . CYS B 1 122 ? -3.004  98.862  -11.148 0.25 11.46 ? 122 CYS B O   2 
ATOM   5016  C  CB  . CYS B 1 122 ? -4.491  100.786 -13.369 0.25 7.52  ? 122 CYS B CB  2 
ATOM   5017  S  SG  . CYS B 1 122 ? -5.759  101.160 -14.601 0.25 12.03 ? 122 CYS B SG  2 
ATOM   5018  N  N   . ARG B 1 123 ? -1.740  99.729  -12.796 0.25 10.78 ? 123 ARG B N   2 
ATOM   5019  C  CA  . ARG B 1 123 ? -0.533  99.830  -12.006 0.25 8.55  ? 123 ARG B CA  2 
ATOM   5020  C  C   . ARG B 1 123 ? -0.468  101.315 -11.682 0.25 10.53 ? 123 ARG B C   2 
ATOM   5021  O  O   . ARG B 1 123 ? -0.553  102.151 -12.585 0.25 12.14 ? 123 ARG B O   2 
ATOM   5022  C  CB  . ARG B 1 123 ? 0.683   99.436  -12.846 0.25 8.01  ? 123 ARG B CB  2 
ATOM   5023  C  CG  . ARG B 1 123 ? 2.024   99.477  -12.106 0.25 7.36  ? 123 ARG B CG  2 
ATOM   5024  C  CD  . ARG B 1 123 ? 3.157   99.330  -13.124 0.25 10.12 ? 123 ARG B CD  2 
ATOM   5025  N  NE  . ARG B 1 123 ? 4.480   99.066  -12.554 0.25 7.04  ? 123 ARG B NE  2 
ATOM   5026  C  CZ  . ARG B 1 123 ? 4.874   97.889  -12.076 0.25 9.50  ? 123 ARG B CZ  2 
ATOM   5027  N  NH1 . ARG B 1 123 ? 4.043   96.856  -12.081 0.25 8.74  ? 123 ARG B NH1 2 
ATOM   5028  N  NH2 . ARG B 1 123 ? 6.116   97.731  -11.635 0.25 8.23  ? 123 ARG B NH2 2 
ATOM   5029  N  N   . SER B 1 124 ? -0.350  101.659 -10.407 0.25 8.10  ? 124 SER B N   2 
ATOM   5030  C  CA  . SER B 1 124 ? -0.243  103.066 -10.050 0.25 7.88  ? 124 SER B CA  2 
ATOM   5031  C  C   . SER B 1 124 ? 0.872   103.199 -9.021  0.25 8.45  ? 124 SER B C   2 
ATOM   5032  O  O   . SER B 1 124 ? 1.522   102.211 -8.660  0.25 8.15  ? 124 SER B O   2 
ATOM   5033  C  CB  . SER B 1 124 ? -1.567  103.594 -9.480  0.25 7.40  ? 124 SER B CB  2 
ATOM   5034  O  OG  . SER B 1 124 ? -1.602  103.495 -8.066  0.25 5.57  ? 124 SER B OG  2 
ATOM   5035  N  N   . TYR B 1 125 ? 1.094   104.417 -8.550  0.25 7.95  ? 125 TYR B N   2 
ATOM   5036  C  CA  . TYR B 1 125 ? 2.154   104.659 -7.578  0.25 7.57  ? 125 TYR B CA  2 
ATOM   5037  C  C   . TYR B 1 125 ? 1.671   105.578 -6.473  0.25 6.63  ? 125 TYR B C   2 
ATOM   5038  O  O   . TYR B 1 125 ? 0.917   106.511 -6.730  0.25 4.65  ? 125 TYR B O   2 
ATOM   5039  C  CB  . TYR B 1 125 ? 3.358   105.308 -8.271  0.25 7.22  ? 125 TYR B CB  2 
ATOM   5040  C  CG  . TYR B 1 125 ? 3.937   104.478 -9.393  0.25 7.42  ? 125 TYR B CG  2 
ATOM   5041  C  CD1 . TYR B 1 125 ? 5.037   103.645 -9.177  0.25 10.21 ? 125 TYR B CD1 2 
ATOM   5042  C  CD2 . TYR B 1 125 ? 3.354   104.486 -10.653 0.25 9.71  ? 125 TYR B CD2 2 
ATOM   5043  C  CE1 . TYR B 1 125 ? 5.541   102.837 -10.198 0.25 9.77  ? 125 TYR B CE1 2 
ATOM   5044  C  CE2 . TYR B 1 125 ? 3.844   103.683 -11.682 0.25 10.85 ? 125 TYR B CE2 2 
ATOM   5045  C  CZ  . TYR B 1 125 ? 4.935   102.862 -11.446 0.25 8.42  ? 125 TYR B CZ  2 
ATOM   5046  O  OH  . TYR B 1 125 ? 5.413   102.063 -12.452 0.25 12.92 ? 125 TYR B OH  2 
ATOM   5047  N  N   . LEU B 1 126 ? 2.098   105.297 -5.245  0.25 6.36  ? 126 LEU B N   2 
ATOM   5048  C  CA  . LEU B 1 126 ? 1.752   106.135 -4.105  0.25 6.99  ? 126 LEU B CA  2 
ATOM   5049  C  C   . LEU B 1 126 ? 2.917   106.125 -3.130  0.25 7.18  ? 126 LEU B C   2 
ATOM   5050  O  O   . LEU B 1 126 ? 3.760   105.232 -3.172  0.25 7.53  ? 126 LEU B O   2 
ATOM   5051  C  CB  . LEU B 1 126 ? 0.459   105.655 -3.423  0.25 7.09  ? 126 LEU B CB  2 
ATOM   5052  C  CG  . LEU B 1 126 ? 0.330   104.287 -2.741  0.25 6.83  ? 126 LEU B CG  2 
ATOM   5053  C  CD1 . LEU B 1 126 ? 1.109   104.258 -1.422  0.25 6.39  ? 126 LEU B CD1 2 
ATOM   5054  C  CD2 . LEU B 1 126 ? -1.144  104.029 -2.469  0.25 5.61  ? 126 LEU B CD2 2 
HETATM 5055  N  N   . MSE B 1 127 ? 2.986   107.136 -2.271  0.25 8.83  ? 127 MSE B N   2 
HETATM 5056  C  CA  . MSE B 1 127 ? 4.062   107.205 -1.292  0.25 9.89  ? 127 MSE B CA  2 
HETATM 5057  C  C   . MSE B 1 127 ? 3.588   106.666 0.055   0.25 9.42  ? 127 MSE B C   2 
HETATM 5058  O  O   . MSE B 1 127 ? 2.399   106.708 0.366   0.25 8.04  ? 127 MSE B O   2 
HETATM 5059  C  CB  . MSE B 1 127 ? 4.545   108.648 -1.115  0.25 10.58 ? 127 MSE B CB  2 
HETATM 5060  C  CG  . MSE B 1 127 ? 5.104   109.293 -2.378  0.25 11.19 ? 127 MSE B CG  2 
HETATM 5061  SE SE  . MSE B 1 127 ? 5.876   111.021 -1.972  0.25 16.97 ? 127 MSE B SE  2 
HETATM 5062  C  CE  . MSE B 1 127 ? 4.269   111.873 -1.379  0.25 11.87 ? 127 MSE B CE  2 
ATOM   5063  N  N   . THR B 1 128 ? 4.529   106.162 0.847   0.25 10.48 ? 128 THR B N   2 
ATOM   5064  C  CA  . THR B 1 128 ? 4.219   105.621 2.164   0.25 11.00 ? 128 THR B CA  2 
ATOM   5065  C  C   . THR B 1 128 ? 4.997   106.378 3.238   0.25 12.30 ? 128 THR B C   2 
ATOM   5066  O  O   . THR B 1 128 ? 4.843   106.115 4.428   0.25 13.54 ? 128 THR B O   2 
ATOM   5067  C  CB  . THR B 1 128 ? 4.577   104.123 2.259   0.25 11.61 ? 128 THR B CB  2 
ATOM   5068  O  OG1 . THR B 1 128 ? 5.982   103.948 2.043   0.25 9.34  ? 128 THR B OG1 2 
ATOM   5069  C  CG2 . THR B 1 128 ? 3.790   103.321 1.225   0.25 10.44 ? 128 THR B CG2 2 
ATOM   5070  N  N   . ASN B 1 129 ? 5.836   107.318 2.815   0.25 10.90 ? 129 ASN B N   2 
ATOM   5071  C  CA  . ASN B 1 129 ? 6.622   108.110 3.763   0.25 14.50 ? 129 ASN B CA  2 
ATOM   5072  C  C   . ASN B 1 129 ? 6.791   109.521 3.223   0.25 14.32 ? 129 ASN B C   2 
ATOM   5073  O  O   . ASN B 1 129 ? 7.600   109.761 2.327   0.25 14.11 ? 129 ASN B O   2 
ATOM   5074  C  CB  . ASN B 1 129 ? 8.003   107.486 3.978   0.25 15.85 ? 129 ASN B CB  2 
ATOM   5075  C  CG  . ASN B 1 129 ? 8.711   108.052 5.198   0.25 20.65 ? 129 ASN B CG  2 
ATOM   5076  O  OD1 . ASN B 1 129 ? 8.575   109.236 5.518   0.25 20.20 ? 129 ASN B OD1 2 
ATOM   5077  N  ND2 . ASN B 1 129 ? 9.481   107.209 5.880   0.25 18.83 ? 129 ASN B ND2 2 
ATOM   5078  N  N   . TYR B 1 130 ? 6.033   110.460 3.773   0.25 14.01 ? 130 TYR B N   2 
ATOM   5079  C  CA  . TYR B 1 130 ? 6.112   111.832 3.302   0.25 14.79 ? 130 TYR B CA  2 
ATOM   5080  C  C   . TYR B 1 130 ? 5.453   112.820 4.252   0.25 15.50 ? 130 TYR B C   2 
ATOM   5081  O  O   . TYR B 1 130 ? 4.632   112.444 5.093   0.25 16.30 ? 130 TYR B O   2 
ATOM   5082  C  CB  . TYR B 1 130 ? 5.432   111.954 1.935   0.25 14.63 ? 130 TYR B CB  2 
ATOM   5083  C  CG  . TYR B 1 130 ? 3.918   111.868 1.999   0.25 14.56 ? 130 TYR B CG  2 
ATOM   5084  C  CD1 . TYR B 1 130 ? 3.268   110.644 2.137   0.25 13.61 ? 130 TYR B CD1 2 
ATOM   5085  C  CD2 . TYR B 1 130 ? 3.138   113.018 1.918   0.25 14.29 ? 130 TYR B CD2 2 
ATOM   5086  C  CE1 . TYR B 1 130 ? 1.870   110.570 2.188   0.25 13.14 ? 130 TYR B CE1 2 
ATOM   5087  C  CE2 . TYR B 1 130 ? 1.748   112.959 1.968   0.25 14.78 ? 130 TYR B CE2 2 
ATOM   5088  C  CZ  . TYR B 1 130 ? 1.120   111.735 2.103   0.25 13.63 ? 130 TYR B CZ  2 
ATOM   5089  O  OH  . TYR B 1 130 ? -0.253  111.686 2.154   0.25 13.90 ? 130 TYR B OH  2 
ATOM   5090  N  N   . GLU B 1 131 ? 5.825   114.087 4.112   0.25 15.75 ? 131 GLU B N   2 
ATOM   5091  C  CA  . GLU B 1 131 ? 5.237   115.147 4.919   0.25 18.63 ? 131 GLU B CA  2 
ATOM   5092  C  C   . GLU B 1 131 ? 4.163   115.779 4.052   0.25 17.14 ? 131 GLU B C   2 
ATOM   5093  O  O   . GLU B 1 131 ? 4.395   116.057 2.874   0.25 15.71 ? 131 GLU B O   2 
ATOM   5094  C  CB  . GLU B 1 131 ? 6.280   116.200 5.288   0.25 22.71 ? 131 GLU B CB  2 
ATOM   5095  C  CG  . GLU B 1 131 ? 7.254   115.769 6.369   0.25 29.86 ? 131 GLU B CG  2 
ATOM   5096  C  CD  . GLU B 1 131 ? 8.276   116.843 6.676   0.25 31.74 ? 131 GLU B CD  2 
ATOM   5097  O  OE1 . GLU B 1 131 ? 7.867   117.992 6.953   0.25 36.86 ? 131 GLU B OE1 2 
ATOM   5098  O  OE2 . GLU B 1 131 ? 9.488   116.542 6.638   0.25 35.98 ? 131 GLU B OE2 2 
ATOM   5099  N  N   . SER B 1 132 ? 2.984   115.986 4.626   0.25 15.82 ? 132 SER B N   2 
ATOM   5100  C  CA  . SER B 1 132 ? 1.888   116.583 3.884   0.25 16.64 ? 132 SER B CA  2 
ATOM   5101  C  C   . SER B 1 132 ? 2.215   118.046 3.609   0.25 16.53 ? 132 SER B C   2 
ATOM   5102  O  O   . SER B 1 132 ? 2.187   118.885 4.509   0.25 12.32 ? 132 SER B O   2 
ATOM   5103  C  CB  . SER B 1 132 ? 0.583   116.471 4.680   0.25 17.88 ? 132 SER B CB  2 
ATOM   5104  O  OG  . SER B 1 132 ? -0.523  116.841 3.880   0.25 18.93 ? 132 SER B OG  2 
ATOM   5105  N  N   . ALA B 1 133 ? 2.541   118.347 2.359   0.25 16.94 ? 133 ALA B N   2 
ATOM   5106  C  CA  . ALA B 1 133 ? 2.872   119.716 1.990   0.25 16.72 ? 133 ALA B CA  2 
ATOM   5107  C  C   . ALA B 1 133 ? 2.193   120.060 0.675   0.25 16.75 ? 133 ALA B C   2 
ATOM   5108  O  O   . ALA B 1 133 ? 2.099   119.218 -0.219  0.25 17.81 ? 133 ALA B O   2 
ATOM   5109  C  CB  . ALA B 1 133 ? 4.385   119.872 1.871   0.25 16.39 ? 133 ALA B CB  2 
ATOM   5110  N  N   . PRO B 1 134 ? 1.699   121.303 0.541   0.25 16.11 ? 134 PRO B N   2 
ATOM   5111  C  CA  . PRO B 1 134 ? 1.024   121.729 -0.686  0.25 15.82 ? 134 PRO B CA  2 
ATOM   5112  C  C   . PRO B 1 134 ? 1.914   121.792 -1.929  0.25 14.48 ? 134 PRO B C   2 
ATOM   5113  O  O   . PRO B 1 134 ? 3.130   121.968 -1.833  0.25 12.98 ? 134 PRO B O   2 
ATOM   5114  C  CB  . PRO B 1 134 ? 0.450   123.093 -0.305  0.25 16.76 ? 134 PRO B CB  2 
ATOM   5115  C  CG  . PRO B 1 134 ? 1.427   123.595 0.719   0.25 17.43 ? 134 PRO B CG  2 
ATOM   5116  C  CD  . PRO B 1 134 ? 1.671   122.371 1.556   0.25 16.28 ? 134 PRO B CD  2 
ATOM   5117  N  N   . PRO B 1 135 ? 1.309   121.641 -3.117  0.25 12.69 ? 135 PRO B N   2 
ATOM   5118  C  CA  . PRO B 1 135 ? 2.012   121.677 -4.407  0.25 14.01 ? 135 PRO B CA  2 
ATOM   5119  C  C   . PRO B 1 135 ? 2.371   123.094 -4.853  0.25 15.29 ? 135 PRO B C   2 
ATOM   5120  O  O   . PRO B 1 135 ? 1.822   124.073 -4.346  0.25 14.72 ? 135 PRO B O   2 
ATOM   5121  C  CB  . PRO B 1 135 ? 1.014   121.031 -5.356  0.25 12.87 ? 135 PRO B CB  2 
ATOM   5122  C  CG  . PRO B 1 135 ? -0.307  121.509 -4.802  0.25 12.98 ? 135 PRO B CG  2 
ATOM   5123  C  CD  . PRO B 1 135 ? -0.117  121.308 -3.306  0.25 12.55 ? 135 PRO B CD  2 
ATOM   5124  N  N   . SER B 1 136 ? 3.298   123.195 -5.801  0.25 14.87 ? 136 SER B N   2 
ATOM   5125  C  CA  . SER B 1 136 ? 3.704   124.488 -6.337  0.25 14.94 ? 136 SER B CA  2 
ATOM   5126  C  C   . SER B 1 136 ? 2.651   124.870 -7.372  0.25 16.03 ? 136 SER B C   2 
ATOM   5127  O  O   . SER B 1 136 ? 1.896   124.013 -7.838  0.25 15.99 ? 136 SER B O   2 
ATOM   5128  C  CB  . SER B 1 136 ? 5.069   124.380 -7.017  0.25 14.72 ? 136 SER B CB  2 
ATOM   5129  O  OG  . SER B 1 136 ? 4.991   123.575 -8.182  0.25 12.63 ? 136 SER B OG  2 
ATOM   5130  N  N   . PRO B 1 137 ? 2.577   126.160 -7.738  0.25 16.16 ? 137 PRO B N   2 
ATOM   5131  C  CA  . PRO B 1 137 ? 1.588   126.587 -8.730  0.25 15.90 ? 137 PRO B CA  2 
ATOM   5132  C  C   . PRO B 1 137 ? 1.783   125.890 -10.071 0.25 15.75 ? 137 PRO B C   2 
ATOM   5133  O  O   . PRO B 1 137 ? 0.810   125.493 -10.716 0.25 14.40 ? 137 PRO B O   2 
ATOM   5134  C  CB  . PRO B 1 137 ? 1.821   128.092 -8.824  0.25 17.33 ? 137 PRO B CB  2 
ATOM   5135  C  CG  . PRO B 1 137 ? 2.264   128.441 -7.424  0.25 16.54 ? 137 PRO B CG  2 
ATOM   5136  C  CD  . PRO B 1 137 ? 3.232   127.324 -7.115  0.25 16.57 ? 137 PRO B CD  2 
ATOM   5137  N  N   . GLN B 1 138 ? 3.037   125.731 -10.487 0.25 15.79 ? 138 GLN B N   2 
ATOM   5138  C  CA  . GLN B 1 138 ? 3.321   125.081 -11.765 0.25 16.28 ? 138 GLN B CA  2 
ATOM   5139  C  C   . GLN B 1 138 ? 2.834   123.639 -11.792 0.25 15.77 ? 138 GLN B C   2 
ATOM   5140  O  O   . GLN B 1 138 ? 2.268   123.191 -12.787 0.25 15.46 ? 138 GLN B O   2 
ATOM   5141  C  CB  . GLN B 1 138 ? 4.820   125.111 -12.084 0.25 18.58 ? 138 GLN B CB  2 
ATOM   5142  C  CG  . GLN B 1 138 ? 5.358   126.491 -12.414 0.25 18.81 ? 138 GLN B CG  2 
ATOM   5143  C  CD  . GLN B 1 138 ? 6.104   127.114 -11.258 0.25 20.34 ? 138 GLN B CD  2 
ATOM   5144  O  OE1 . GLN B 1 138 ? 5.625   127.113 -10.122 0.25 22.22 ? 138 GLN B OE1 2 
ATOM   5145  N  NE2 . GLN B 1 138 ? 7.285   127.654 -11.540 0.25 18.12 ? 138 GLN B NE2 2 
ATOM   5146  N  N   . TYR B 1 139 ? 3.059   122.914 -10.702 0.25 15.29 ? 139 TYR B N   2 
ATOM   5147  C  CA  . TYR B 1 139 ? 2.629   121.523 -10.619 0.25 14.32 ? 139 TYR B CA  2 
ATOM   5148  C  C   . TYR B 1 139 ? 1.103   121.467 -10.652 0.25 14.51 ? 139 TYR B C   2 
ATOM   5149  O  O   . TYR B 1 139 ? 0.510   120.711 -11.434 0.25 12.27 ? 139 TYR B O   2 
ATOM   5150  C  CB  . TYR B 1 139 ? 3.161   120.890 -9.329  0.25 14.50 ? 139 TYR B CB  2 
ATOM   5151  C  CG  . TYR B 1 139 ? 2.972   119.388 -9.236  0.25 13.47 ? 139 TYR B CG  2 
ATOM   5152  C  CD1 . TYR B 1 139 ? 3.481   118.535 -10.218 0.25 16.81 ? 139 TYR B CD1 2 
ATOM   5153  C  CD2 . TYR B 1 139 ? 2.311   118.818 -8.149  0.25 16.13 ? 139 TYR B CD2 2 
ATOM   5154  C  CE1 . TYR B 1 139 ? 3.340   117.146 -10.114 0.25 14.83 ? 139 TYR B CE1 2 
ATOM   5155  C  CE2 . TYR B 1 139 ? 2.162   117.439 -8.036  0.25 14.57 ? 139 TYR B CE2 2 
ATOM   5156  C  CZ  . TYR B 1 139 ? 2.679   116.609 -9.018  0.25 14.19 ? 139 TYR B CZ  2 
ATOM   5157  O  OH  . TYR B 1 139 ? 2.543   115.247 -8.889  0.25 14.37 ? 139 TYR B OH  2 
ATOM   5158  N  N   . LYS B 1 140 ? 0.464   122.278 -9.814  0.25 13.40 ? 140 LYS B N   2 
ATOM   5159  C  CA  . LYS B 1 140 ? -0.996  122.308 -9.775  0.25 13.67 ? 140 LYS B CA  2 
ATOM   5160  C  C   . LYS B 1 140 ? -1.563  122.675 -11.144 0.25 14.41 ? 140 LYS B C   2 
ATOM   5161  O  O   . LYS B 1 140 ? -2.654  122.235 -11.519 0.25 13.75 ? 140 LYS B O   2 
ATOM   5162  C  CB  . LYS B 1 140 ? -1.490  123.325 -8.739  0.25 14.01 ? 140 LYS B CB  2 
ATOM   5163  C  CG  . LYS B 1 140 ? -3.011  123.391 -8.647  0.25 14.52 ? 140 LYS B CG  2 
ATOM   5164  C  CD  . LYS B 1 140 ? -3.489  124.597 -7.856  0.25 14.36 ? 140 LYS B CD  2 
ATOM   5165  C  CE  . LYS B 1 140 ? -5.003  124.677 -7.870  0.25 16.03 ? 140 LYS B CE  2 
ATOM   5166  N  NZ  . LYS B 1 140 ? -5.496  125.925 -7.238  0.25 15.23 ? 140 LYS B NZ  2 
ATOM   5167  N  N   . LYS B 1 141 ? -0.819  123.485 -11.891 0.25 14.36 ? 141 LYS B N   2 
ATOM   5168  C  CA  . LYS B 1 141 ? -1.265  123.913 -13.212 0.25 16.36 ? 141 LYS B CA  2 
ATOM   5169  C  C   . LYS B 1 141 ? -1.233  122.765 -14.217 0.25 14.44 ? 141 LYS B C   2 
ATOM   5170  O  O   . LYS B 1 141 ? -2.193  122.559 -14.965 0.25 14.15 ? 141 LYS B O   2 
ATOM   5171  C  CB  . LYS B 1 141 ? -0.391  125.068 -13.718 0.25 18.54 ? 141 LYS B CB  2 
ATOM   5172  C  CG  . LYS B 1 141 ? -0.741  125.552 -15.119 0.25 23.52 ? 141 LYS B CG  2 
ATOM   5173  C  CD  . LYS B 1 141 ? -2.148  126.129 -15.181 0.25 27.12 ? 141 LYS B CD  2 
ATOM   5174  C  CE  . LYS B 1 141 ? -2.463  126.657 -16.577 0.25 31.14 ? 141 LYS B CE  2 
ATOM   5175  N  NZ  . LYS B 1 141 ? -3.808  127.291 -16.659 0.25 33.60 ? 141 LYS B NZ  2 
ATOM   5176  N  N   . ILE B 1 142 ? -0.130  122.023 -14.240 0.25 13.95 ? 142 ILE B N   2 
ATOM   5177  C  CA  . ILE B 1 142 ? -0.002  120.901 -15.168 0.25 13.48 ? 142 ILE B CA  2 
ATOM   5178  C  C   . ILE B 1 142 ? -1.102  119.871 -14.913 0.25 13.06 ? 142 ILE B C   2 
ATOM   5179  O  O   . ILE B 1 142 ? -1.678  119.322 -15.848 0.25 12.02 ? 142 ILE B O   2 
ATOM   5180  C  CB  . ILE B 1 142 ? 1.386   120.217 -15.048 0.25 13.21 ? 142 ILE B CB  2 
ATOM   5181  C  CG1 . ILE B 1 142 ? 2.483   121.158 -15.556 0.25 14.46 ? 142 ILE B CG1 2 
ATOM   5182  C  CG2 . ILE B 1 142 ? 1.397   118.913 -15.850 0.25 12.59 ? 142 ILE B CG2 2 
ATOM   5183  C  CD1 . ILE B 1 142 ? 2.394   121.488 -17.047 0.25 12.61 ? 142 ILE B CD1 2 
ATOM   5184  N  N   . ILE B 1 143 ? -1.397  119.615 -13.645 0.25 11.70 ? 143 ILE B N   2 
ATOM   5185  C  CA  . ILE B 1 143 ? -2.437  118.653 -13.306 0.25 12.97 ? 143 ILE B CA  2 
ATOM   5186  C  C   . ILE B 1 143 ? -3.804  119.100 -13.833 0.25 13.31 ? 143 ILE B C   2 
ATOM   5187  O  O   . ILE B 1 143 ? -4.522  118.316 -14.468 0.25 12.16 ? 143 ILE B O   2 
ATOM   5188  C  CB  . ILE B 1 143 ? -2.483  118.427 -11.772 0.25 11.44 ? 143 ILE B CB  2 
ATOM   5189  C  CG1 . ILE B 1 143 ? -1.264  117.588 -11.360 0.25 11.27 ? 143 ILE B CG1 2 
ATOM   5190  C  CG2 . ILE B 1 143 ? -3.783  117.729 -11.375 0.25 11.34 ? 143 ILE B CG2 2 
ATOM   5191  C  CD1 . ILE B 1 143 ? -0.962  117.589 -9.880  0.25 12.94 ? 143 ILE B CD1 2 
ATOM   5192  N  N   . CYS B 1 144 ? -4.156  120.360 -13.585 0.25 13.88 ? 144 CYS B N   2 
ATOM   5193  C  CA  . CYS B 1 144 ? -5.436  120.903 -14.044 0.25 13.06 ? 144 CYS B CA  2 
ATOM   5194  C  C   . CYS B 1 144 ? -5.553  120.857 -15.571 0.25 12.29 ? 144 CYS B C   2 
ATOM   5195  O  O   . CYS B 1 144 ? -6.628  120.594 -16.117 0.25 9.81  ? 144 CYS B O   2 
ATOM   5196  C  CB  . CYS B 1 144 ? -5.602  122.349 -13.560 0.25 15.35 ? 144 CYS B CB  2 
ATOM   5197  S  SG  . CYS B 1 144 ? -5.803  122.536 -11.770 0.25 10.29 ? 144 CYS B SG  2 
HETATM 5198  N  N   . MSE B 1 145 ? -4.448  121.120 -16.260 0.25 12.70 ? 145 MSE B N   2 
HETATM 5199  C  CA  . MSE B 1 145 ? -4.450  121.091 -17.720 0.25 13.88 ? 145 MSE B CA  2 
HETATM 5200  C  C   . MSE B 1 145 ? -4.671  119.669 -18.221 0.25 14.09 ? 145 MSE B C   2 
HETATM 5201  O  O   . MSE B 1 145 ? -5.334  119.452 -19.234 0.25 12.70 ? 145 MSE B O   2 
HETATM 5202  C  CB  . MSE B 1 145 ? -3.124  121.629 -18.268 0.25 15.67 ? 145 MSE B CB  2 
HETATM 5203  C  CG  . MSE B 1 145 ? -2.939  123.134 -18.105 0.25 16.80 ? 145 MSE B CG  2 
HETATM 5204  SE SE  . MSE B 1 145 ? -1.196  123.739 -18.683 0.25 19.07 ? 145 MSE B SE  2 
HETATM 5205  C  CE  . MSE B 1 145 ? -1.445  123.622 -20.601 0.25 18.53 ? 145 MSE B CE  2 
ATOM   5206  N  N   . GLY B 1 146 ? -4.112  118.698 -17.506 0.25 13.23 ? 146 GLY B N   2 
ATOM   5207  C  CA  . GLY B 1 146 ? -4.270  117.314 -17.912 0.25 10.23 ? 146 GLY B CA  2 
ATOM   5208  C  C   . GLY B 1 146 ? -5.685  116.814 -17.691 0.25 10.06 ? 146 GLY B C   2 
ATOM   5209  O  O   . GLY B 1 146 ? -6.255  116.122 -18.543 0.25 10.05 ? 146 GLY B O   2 
ATOM   5210  N  N   . ALA B 1 147 ? -6.252  117.158 -16.538 0.25 8.79  ? 147 ALA B N   2 
ATOM   5211  C  CA  . ALA B 1 147 ? -7.612  116.746 -16.196 0.25 9.65  ? 147 ALA B CA  2 
ATOM   5212  C  C   . ALA B 1 147 ? -8.608  117.389 -17.154 0.25 11.14 ? 147 ALA B C   2 
ATOM   5213  O  O   . ALA B 1 147 ? -9.637  116.800 -17.485 0.25 11.53 ? 147 ALA B O   2 
ATOM   5214  C  CB  . ALA B 1 147 ? -7.936  117.152 -14.759 0.25 10.34 ? 147 ALA B CB  2 
ATOM   5215  N  N   . LYS B 1 148 ? -8.296  118.605 -17.590 0.25 11.70 ? 148 LYS B N   2 
ATOM   5216  C  CA  . LYS B 1 148 ? -9.159  119.324 -18.521 0.25 14.47 ? 148 LYS B CA  2 
ATOM   5217  C  C   . LYS B 1 148 ? -8.987  118.741 -19.919 0.25 14.01 ? 148 LYS B C   2 
ATOM   5218  O  O   . LYS B 1 148 ? -9.963  118.459 -20.615 0.25 12.67 ? 148 LYS B O   2 
ATOM   5219  C  CB  . LYS B 1 148 ? -8.802  120.816 -18.530 0.25 17.45 ? 148 LYS B CB  2 
ATOM   5220  C  CG  . LYS B 1 148 ? -9.681  121.664 -19.452 0.25 22.81 ? 148 LYS B CG  2 
ATOM   5221  C  CD  . LYS B 1 148 ? -9.315  123.142 -19.373 0.25 26.15 ? 148 LYS B CD  2 
ATOM   5222  C  CE  . LYS B 1 148 ? -10.195 123.979 -20.299 0.25 30.00 ? 148 LYS B CE  2 
ATOM   5223  N  NZ  . LYS B 1 148 ? -9.792  125.415 -20.315 0.25 32.01 ? 148 LYS B NZ  2 
ATOM   5224  N  N   . GLU B 1 149 ? -7.734  118.553 -20.318 0.25 15.95 ? 149 GLU B N   2 
ATOM   5225  C  CA  . GLU B 1 149 ? -7.416  118.007 -21.632 0.25 17.48 ? 149 GLU B CA  2 
ATOM   5226  C  C   . GLU B 1 149 ? -8.059  116.650 -21.875 0.25 17.30 ? 149 GLU B C   2 
ATOM   5227  O  O   . GLU B 1 149 ? -8.603  116.396 -22.950 0.25 16.63 ? 149 GLU B O   2 
ATOM   5228  C  CB  . GLU B 1 149 ? -5.903  117.858 -21.796 0.25 18.93 ? 149 GLU B CB  2 
ATOM   5229  C  CG  . GLU B 1 149 ? -5.494  117.263 -23.140 0.25 21.43 ? 149 GLU B CG  2 
ATOM   5230  C  CD  . GLU B 1 149 ? -4.044  116.824 -23.170 0.25 21.34 ? 149 GLU B CD  2 
ATOM   5231  O  OE1 . GLU B 1 149 ? -3.703  115.841 -22.477 0.25 24.02 ? 149 GLU B OE1 2 
ATOM   5232  O  OE2 . GLU B 1 149 ? -3.243  117.465 -23.883 0.25 22.78 ? 149 GLU B OE2 2 
ATOM   5233  N  N   . ASN B 1 150 ? -7.997  115.777 -20.873 0.25 15.83 ? 150 ASN B N   2 
ATOM   5234  C  CA  . ASN B 1 150 ? -8.549  114.436 -21.014 0.25 15.90 ? 150 ASN B CA  2 
ATOM   5235  C  C   . ASN B 1 150 ? -9.964  114.224 -20.491 0.25 15.67 ? 150 ASN B C   2 
ATOM   5236  O  O   . ASN B 1 150 ? -10.384 113.096 -20.238 0.25 18.54 ? 150 ASN B O   2 
ATOM   5237  C  CB  . ASN B 1 150 ? -7.578  113.429 -20.399 0.25 16.67 ? 150 ASN B CB  2 
ATOM   5238  C  CG  . ASN B 1 150 ? -6.315  113.283 -21.227 0.25 18.15 ? 150 ASN B CG  2 
ATOM   5239  O  OD1 . ASN B 1 150 ? -5.197  113.437 -20.727 0.25 17.61 ? 150 ASN B OD1 2 
ATOM   5240  N  ND2 . ASN B 1 150 ? -6.491  112.990 -22.513 0.25 12.91 ? 150 ASN B ND2 2 
ATOM   5241  N  N   . GLY B 1 151 ? -10.702 115.318 -20.342 0.25 15.61 ? 151 GLY B N   2 
ATOM   5242  C  CA  . GLY B 1 151 ? -12.083 115.236 -19.904 0.25 14.49 ? 151 GLY B CA  2 
ATOM   5243  C  C   . GLY B 1 151 ? -12.434 114.627 -18.557 0.25 15.78 ? 151 GLY B C   2 
ATOM   5244  O  O   . GLY B 1 151 ? -13.388 113.851 -18.466 0.25 13.99 ? 151 GLY B O   2 
ATOM   5245  N  N   . LEU B 1 152 ? -11.681 114.952 -17.509 0.25 15.29 ? 152 LEU B N   2 
ATOM   5246  C  CA  . LEU B 1 152 ? -12.027 114.433 -16.192 0.25 17.08 ? 152 LEU B CA  2 
ATOM   5247  C  C   . LEU B 1 152 ? -13.334 115.143 -15.826 0.25 17.24 ? 152 LEU B C   2 
ATOM   5248  O  O   . LEU B 1 152 ? -13.604 116.245 -16.312 0.25 17.83 ? 152 LEU B O   2 
ATOM   5249  C  CB  . LEU B 1 152 ? -10.923 114.760 -15.179 0.25 15.18 ? 152 LEU B CB  2 
ATOM   5250  C  CG  . LEU B 1 152 ? -10.055 113.572 -14.739 0.25 17.29 ? 152 LEU B CG  2 
ATOM   5251  C  CD1 . LEU B 1 152 ? -9.519  112.834 -15.956 0.25 12.94 ? 152 LEU B CD1 2 
ATOM   5252  C  CD2 . LEU B 1 152 ? -8.911  114.066 -13.853 0.25 15.36 ? 152 LEU B CD2 2 
ATOM   5253  N  N   . PRO B 1 153 ? -14.175 114.521 -14.985 0.25 18.87 ? 153 PRO B N   2 
ATOM   5254  C  CA  . PRO B 1 153 ? -15.437 115.172 -14.615 0.25 18.85 ? 153 PRO B CA  2 
ATOM   5255  C  C   . PRO B 1 153 ? -15.256 116.630 -14.181 0.25 19.77 ? 153 PRO B C   2 
ATOM   5256  O  O   . PRO B 1 153 ? -14.304 116.968 -13.476 0.25 17.83 ? 153 PRO B O   2 
ATOM   5257  C  CB  . PRO B 1 153 ? -15.960 114.289 -13.486 0.25 19.64 ? 153 PRO B CB  2 
ATOM   5258  C  CG  . PRO B 1 153 ? -15.456 112.928 -13.882 0.25 18.38 ? 153 PRO B CG  2 
ATOM   5259  C  CD  . PRO B 1 153 ? -14.038 113.217 -14.313 0.25 17.38 ? 153 PRO B CD  2 
ATOM   5260  N  N   . LEU B 1 154 ? -16.180 117.482 -14.615 0.25 20.24 ? 154 LEU B N   2 
ATOM   5261  C  CA  . LEU B 1 154 ? -16.154 118.901 -14.289 0.25 21.15 ? 154 LEU B CA  2 
ATOM   5262  C  C   . LEU B 1 154 ? -16.074 119.133 -12.789 0.25 20.08 ? 154 LEU B C   2 
ATOM   5263  O  O   . LEU B 1 154 ? -15.399 120.057 -12.330 0.25 18.39 ? 154 LEU B O   2 
ATOM   5264  C  CB  . LEU B 1 154 ? -17.405 119.587 -14.850 0.25 25.36 ? 154 LEU B CB  2 
ATOM   5265  C  CG  . LEU B 1 154 ? -17.266 120.306 -16.197 0.25 28.02 ? 154 LEU B CG  2 
ATOM   5266  C  CD1 . LEU B 1 154 ? -16.475 121.589 -15.997 0.25 29.74 ? 154 LEU B CD1 2 
ATOM   5267  C  CD2 . LEU B 1 154 ? -16.586 119.405 -17.213 0.25 28.94 ? 154 LEU B CD2 2 
ATOM   5268  N  N   . GLU B 1 155 ? -16.770 118.291 -12.030 0.25 19.75 ? 155 GLU B N   2 
ATOM   5269  C  CA  . GLU B 1 155 ? -16.778 118.389 -10.574 0.25 22.18 ? 155 GLU B CA  2 
ATOM   5270  C  C   . GLU B 1 155 ? -15.387 118.139 -9.997  0.25 18.75 ? 155 GLU B C   2 
ATOM   5271  O  O   . GLU B 1 155 ? -15.017 118.724 -8.978  0.25 17.85 ? 155 GLU B O   2 
ATOM   5272  C  CB  . GLU B 1 155 ? -17.755 117.371 -9.968  0.25 25.96 ? 155 GLU B CB  2 
ATOM   5273  C  CG  . GLU B 1 155 ? -19.234 117.636 -10.245 0.25 34.92 ? 155 GLU B CG  2 
ATOM   5274  C  CD  . GLU B 1 155 ? -19.595 117.539 -11.717 0.25 38.14 ? 155 GLU B CD  2 
ATOM   5275  O  OE1 . GLU B 1 155 ? -19.153 116.576 -12.382 0.25 41.23 ? 155 GLU B OE1 2 
ATOM   5276  O  OE2 . GLU B 1 155 ? -20.333 118.421 -12.205 0.25 40.87 ? 155 GLU B OE2 2 
ATOM   5277  N  N   . TYR B 1 156 ? -14.621 117.265 -10.647 0.25 16.76 ? 156 TYR B N   2 
ATOM   5278  C  CA  . TYR B 1 156 ? -13.276 116.946 -10.172 0.25 15.54 ? 156 TYR B CA  2 
ATOM   5279  C  C   . TYR B 1 156 ? -12.301 118.051 -10.538 0.25 14.48 ? 156 TYR B C   2 
ATOM   5280  O  O   . TYR B 1 156 ? -11.432 118.406 -9.745  0.25 15.14 ? 156 TYR B O   2 
ATOM   5281  C  CB  . TYR B 1 156 ? -12.786 115.616 -10.757 0.25 13.68 ? 156 TYR B CB  2 
ATOM   5282  C  CG  . TYR B 1 156 ? -11.546 115.083 -10.065 0.25 14.99 ? 156 TYR B CG  2 
ATOM   5283  C  CD1 . TYR B 1 156 ? -11.601 114.644 -8.739  0.25 13.01 ? 156 TYR B CD1 2 
ATOM   5284  C  CD2 . TYR B 1 156 ? -10.316 115.034 -10.726 0.25 12.95 ? 156 TYR B CD2 2 
ATOM   5285  C  CE1 . TYR B 1 156 ? -10.462 114.170 -8.088  0.25 14.27 ? 156 TYR B CE1 2 
ATOM   5286  C  CE2 . TYR B 1 156 ? -9.168  114.560 -10.085 0.25 12.56 ? 156 TYR B CE2 2 
ATOM   5287  C  CZ  . TYR B 1 156 ? -9.249  114.130 -8.767  0.25 11.37 ? 156 TYR B CZ  2 
ATOM   5288  O  OH  . TYR B 1 156 ? -8.129  113.651 -8.130  0.25 13.25 ? 156 TYR B OH  2 
ATOM   5289  N  N   . GLN B 1 157 ? -12.441 118.591 -11.744 0.25 15.23 ? 157 GLN B N   2 
ATOM   5290  C  CA  . GLN B 1 157 ? -11.572 119.675 -12.175 0.25 15.04 ? 157 GLN B CA  2 
ATOM   5291  C  C   . GLN B 1 157 ? -11.761 120.874 -11.245 0.25 16.15 ? 157 GLN B C   2 
ATOM   5292  O  O   . GLN B 1 157 ? -10.800 121.550 -10.891 0.25 13.18 ? 157 GLN B O   2 
ATOM   5293  C  CB  . GLN B 1 157 ? -11.882 120.075 -13.620 0.25 13.15 ? 157 GLN B CB  2 
ATOM   5294  C  CG  . GLN B 1 157 ? -11.478 119.030 -14.664 0.25 13.09 ? 157 GLN B CG  2 
ATOM   5295  C  CD  . GLN B 1 157 ? -11.591 119.557 -16.091 0.25 14.73 ? 157 GLN B CD  2 
ATOM   5296  O  OE1 . GLN B 1 157 ? -10.942 120.541 -16.454 0.25 16.50 ? 157 GLN B OE1 2 
ATOM   5297  N  NE2 . GLN B 1 157 ? -12.417 118.902 -16.905 0.25 11.80 ? 157 GLN B NE2 2 
ATOM   5298  N  N   . GLU B 1 158 ? -13.001 121.126 -10.837 0.25 18.55 ? 158 GLU B N   2 
ATOM   5299  C  CA  . GLU B 1 158 ? -13.270 122.243 -9.941  0.25 19.71 ? 158 GLU B CA  2 
ATOM   5300  C  C   . GLU B 1 158 ? -12.586 122.039 -8.599  0.25 17.66 ? 158 GLU B C   2 
ATOM   5301  O  O   . GLU B 1 158 ? -12.069 122.985 -8.010  0.25 17.30 ? 158 GLU B O   2 
ATOM   5302  C  CB  . GLU B 1 158 ? -14.776 122.425 -9.745  0.25 24.06 ? 158 GLU B CB  2 
ATOM   5303  C  CG  . GLU B 1 158 ? -15.479 122.937 -10.987 0.25 32.04 ? 158 GLU B CG  2 
ATOM   5304  C  CD  . GLU B 1 158 ? -14.815 124.182 -11.552 0.25 34.90 ? 158 GLU B CD  2 
ATOM   5305  O  OE1 . GLU B 1 158 ? -14.730 125.197 -10.828 0.25 38.08 ? 158 GLU B OE1 2 
ATOM   5306  O  OE2 . GLU B 1 158 ? -14.376 124.144 -12.720 0.25 36.91 ? 158 GLU B OE2 2 
ATOM   5307  N  N   . LYS B 1 159 ? -12.577 120.799 -8.120  0.25 18.94 ? 159 LYS B N   2 
ATOM   5308  C  CA  . LYS B 1 159 ? -11.934 120.491 -6.849  0.25 19.39 ? 159 LYS B CA  2 
ATOM   5309  C  C   . LYS B 1 159 ? -10.418 120.609 -6.997  0.25 18.03 ? 159 LYS B C   2 
ATOM   5310  O  O   . LYS B 1 159 ? -9.721  120.982 -6.053  0.25 15.48 ? 159 LYS B O   2 
ATOM   5311  C  CB  . LYS B 1 159 ? -12.303 119.080 -6.385  0.25 23.36 ? 159 LYS B CB  2 
ATOM   5312  C  CG  . LYS B 1 159 ? -13.746 118.926 -5.943  0.25 28.36 ? 159 LYS B CG  2 
ATOM   5313  C  CD  . LYS B 1 159 ? -13.998 117.525 -5.410  0.25 32.93 ? 159 LYS B CD  2 
ATOM   5314  C  CE  . LYS B 1 159 ? -15.424 117.366 -4.913  0.25 35.36 ? 159 LYS B CE  2 
ATOM   5315  N  NZ  . LYS B 1 159 ? -15.664 115.995 -4.385  0.25 39.20 ? 159 LYS B NZ  2 
ATOM   5316  N  N   . LEU B 1 160 ? -9.908  120.289 -8.181  0.25 16.03 ? 160 LEU B N   2 
ATOM   5317  C  CA  . LEU B 1 160 ? -8.473  120.388 -8.424  0.25 16.34 ? 160 LEU B CA  2 
ATOM   5318  C  C   . LEU B 1 160 ? -8.070  121.862 -8.422  0.25 17.93 ? 160 LEU B C   2 
ATOM   5319  O  O   . LEU B 1 160 ? -7.043  122.234 -7.853  0.25 18.27 ? 160 LEU B O   2 
ATOM   5320  C  CB  . LEU B 1 160 ? -8.104  119.748 -9.769  0.25 15.79 ? 160 LEU B CB  2 
ATOM   5321  C  CG  . LEU B 1 160 ? -8.382  118.252 -9.968  0.25 15.90 ? 160 LEU B CG  2 
ATOM   5322  C  CD1 . LEU B 1 160 ? -8.015  117.859 -11.400 0.25 16.64 ? 160 LEU B CD1 2 
ATOM   5323  C  CD2 . LEU B 1 160 ? -7.583  117.424 -8.973  0.25 15.24 ? 160 LEU B CD2 2 
ATOM   5324  N  N   . LYS B 1 161 ? -8.887  122.701 -9.056  0.25 18.01 ? 161 LYS B N   2 
ATOM   5325  C  CA  . LYS B 1 161 ? -8.604  124.131 -9.115  0.25 22.37 ? 161 LYS B CA  2 
ATOM   5326  C  C   . LYS B 1 161 ? -8.668  124.728 -7.713  0.25 20.87 ? 161 LYS B C   2 
ATOM   5327  O  O   . LYS B 1 161 ? -8.040  125.745 -7.431  0.25 19.97 ? 161 LYS B O   2 
ATOM   5328  C  CB  . LYS B 1 161 ? -9.617  124.842 -10.021 0.25 25.35 ? 161 LYS B CB  2 
ATOM   5329  C  CG  . LYS B 1 161 ? -9.599  124.377 -11.470 0.25 32.33 ? 161 LYS B CG  2 
ATOM   5330  C  CD  . LYS B 1 161 ? -10.681 125.076 -12.281 0.25 36.77 ? 161 LYS B CD  2 
ATOM   5331  C  CE  . LYS B 1 161 ? -10.710 124.589 -13.721 0.25 38.61 ? 161 LYS B CE  2 
ATOM   5332  N  NZ  . LYS B 1 161 ? -11.817 125.229 -14.486 0.25 41.85 ? 161 LYS B NZ  2 
ATOM   5333  N  N   . ALA B 1 162 ? -9.427  124.077 -6.838  0.25 20.68 ? 162 ALA B N   2 
ATOM   5334  C  CA  . ALA B 1 162 ? -9.588  124.539 -5.464  0.25 20.81 ? 162 ALA B CA  2 
ATOM   5335  C  C   . ALA B 1 162 ? -8.361  124.273 -4.596  0.25 20.94 ? 162 ALA B C   2 
ATOM   5336  O  O   . ALA B 1 162 ? -8.153  124.948 -3.587  0.25 20.44 ? 162 ALA B O   2 
ATOM   5337  C  CB  . ALA B 1 162 ? -10.811 123.888 -4.842  0.25 20.93 ? 162 ALA B CB  2 
ATOM   5338  N  N   . ILE B 1 163 ? -7.555  123.286 -4.979  0.25 19.13 ? 163 ILE B N   2 
ATOM   5339  C  CA  . ILE B 1 163 ? -6.357  122.954 -4.211  0.25 17.95 ? 163 ILE B CA  2 
ATOM   5340  C  C   . ILE B 1 163 ? -5.510  124.196 -3.968  0.25 16.65 ? 163 ILE B C   2 
ATOM   5341  O  O   . ILE B 1 163 ? -5.252  124.965 -4.888  0.25 15.61 ? 163 ILE B O   2 
ATOM   5342  C  CB  . ILE B 1 163 ? -5.489  121.911 -4.944  0.25 17.40 ? 163 ILE B CB  2 
ATOM   5343  C  CG1 . ILE B 1 163 ? -6.262  120.598 -5.087  0.25 16.25 ? 163 ILE B CG1 2 
ATOM   5344  C  CG2 . ILE B 1 163 ? -4.185  121.688 -4.177  0.25 15.29 ? 163 ILE B CG2 2 
ATOM   5345  C  CD1 . ILE B 1 163 ? -5.600  119.607 -6.015  0.25 16.78 ? 163 ILE B CD1 2 
ATOM   5346  N  N   . GLU B 1 164 ? -5.079  124.382 -2.724  0.25 17.72 ? 164 GLU B N   2 
ATOM   5347  C  CA  . GLU B 1 164 ? -4.251  125.530 -2.358  0.25 19.16 ? 164 GLU B CA  2 
ATOM   5348  C  C   . GLU B 1 164 ? -2.773  125.219 -2.601  0.25 19.74 ? 164 GLU B C   2 
ATOM   5349  O  O   . GLU B 1 164 ? -2.242  124.255 -2.059  0.25 19.09 ? 164 GLU B O   2 
ATOM   5350  C  CB  . GLU B 1 164 ? -4.464  125.878 -0.878  0.25 19.87 ? 164 GLU B CB  2 
ATOM   5351  C  CG  . GLU B 1 164 ? -3.571  126.997 -0.362  0.25 21.33 ? 164 GLU B CG  2 
ATOM   5352  C  CD  . GLU B 1 164 ? -3.759  127.276 1.124   0.25 20.05 ? 164 GLU B CD  2 
ATOM   5353  O  OE1 . GLU B 1 164 ? -3.132  128.234 1.627   0.25 19.99 ? 164 GLU B OE1 2 
ATOM   5354  O  OE2 . GLU B 1 164 ? -4.525  126.545 1.792   0.25 19.63 ? 164 GLU B OE2 2 
ATOM   5355  N  N   . PRO B 1 165 ? -2.092  126.031 -3.426  0.25 20.09 ? 165 PRO B N   2 
ATOM   5356  C  CA  . PRO B 1 165 ? -0.670  125.812 -3.717  0.25 20.72 ? 165 PRO B CA  2 
ATOM   5357  C  C   . PRO B 1 165 ? 0.229   126.500 -2.688  0.25 21.24 ? 165 PRO B C   2 
ATOM   5358  O  O   . PRO B 1 165 ? -0.262  127.130 -1.752  0.25 18.82 ? 165 PRO B O   2 
ATOM   5359  C  CB  . PRO B 1 165 ? -0.515  126.436 -5.096  0.25 20.41 ? 165 PRO B CB  2 
ATOM   5360  C  CG  . PRO B 1 165 ? -1.401  127.643 -4.986  0.25 21.82 ? 165 PRO B CG  2 
ATOM   5361  C  CD  . PRO B 1 165 ? -2.647  127.083 -4.301  0.25 21.13 ? 165 PRO B CD  2 
ATOM   5362  N  N   . ASN B 1 166 ? 1.542   126.367 -2.855  0.25 21.78 ? 166 ASN B N   2 
ATOM   5363  C  CA  . ASN B 1 166 ? 2.468   127.040 -1.955  0.25 22.67 ? 166 ASN B CA  2 
ATOM   5364  C  C   . ASN B 1 166 ? 2.852   128.354 -2.632  0.25 23.69 ? 166 ASN B C   2 
ATOM   5365  O  O   . ASN B 1 166 ? 2.601   128.540 -3.824  0.25 24.50 ? 166 ASN B O   2 
ATOM   5366  C  CB  . ASN B 1 166 ? 3.715   126.186 -1.662  0.25 20.54 ? 166 ASN B CB  2 
ATOM   5367  C  CG  . ASN B 1 166 ? 4.515   125.846 -2.904  0.25 19.06 ? 166 ASN B CG  2 
ATOM   5368  O  OD1 . ASN B 1 166 ? 4.486   126.564 -3.902  0.25 14.68 ? 166 ASN B OD1 2 
ATOM   5369  N  ND2 . ASN B 1 166 ? 5.259   124.749 -2.835  0.25 16.77 ? 166 ASN B ND2 2 
ATOM   5370  N  N   . ASP B 1 167 ? 3.448   129.268 -1.877  0.25 26.78 ? 167 ASP B N   2 
ATOM   5371  C  CA  . ASP B 1 167 ? 3.824   130.568 -2.423  0.25 29.01 ? 167 ASP B CA  2 
ATOM   5372  C  C   . ASP B 1 167 ? 5.130   130.597 -3.218  0.25 28.47 ? 167 ASP B C   2 
ATOM   5373  O  O   . ASP B 1 167 ? 5.784   131.638 -3.306  0.25 28.84 ? 167 ASP B O   2 
ATOM   5374  C  CB  . ASP B 1 167 ? 3.876   131.600 -1.293  0.25 32.27 ? 167 ASP B CB  2 
ATOM   5375  C  CG  . ASP B 1 167 ? 4.673   131.117 -0.102  0.25 36.06 ? 167 ASP B CG  2 
ATOM   5376  O  OD1 . ASP B 1 167 ? 5.881   130.851 -0.267  0.25 37.98 ? 167 ASP B OD1 2 
ATOM   5377  O  OD2 . ASP B 1 167 ? 4.090   131.002 0.998   0.25 37.14 ? 167 ASP B OD2 2 
ATOM   5378  N  N   . TYR B 1 168 ? 5.509   129.464 -3.802  0.25 26.61 ? 168 TYR B N   2 
ATOM   5379  C  CA  . TYR B 1 168 ? 6.731   129.408 -4.599  0.25 25.94 ? 168 TYR B CA  2 
ATOM   5380  C  C   . TYR B 1 168 ? 6.510   130.280 -5.834  0.25 26.75 ? 168 TYR B C   2 
ATOM   5381  O  O   . TYR B 1 168 ? 5.423   130.276 -6.413  0.25 25.48 ? 168 TYR B O   2 
ATOM   5382  C  CB  . TYR B 1 168 ? 7.028   127.962 -5.021  0.25 24.21 ? 168 TYR B CB  2 
ATOM   5383  C  CG  . TYR B 1 168 ? 8.351   127.767 -5.739  0.25 20.98 ? 168 TYR B CG  2 
ATOM   5384  C  CD1 . TYR B 1 168 ? 9.567   127.898 -5.063  0.25 17.76 ? 168 TYR B CD1 2 
ATOM   5385  C  CD2 . TYR B 1 168 ? 8.384   127.446 -7.095  0.25 18.74 ? 168 TYR B CD2 2 
ATOM   5386  C  CE1 . TYR B 1 168 ? 10.783  127.713 -5.727  0.25 19.87 ? 168 TYR B CE1 2 
ATOM   5387  C  CE2 . TYR B 1 168 ? 9.589   127.259 -7.765  0.25 19.18 ? 168 TYR B CE2 2 
ATOM   5388  C  CZ  . TYR B 1 168 ? 10.783  127.391 -7.078  0.25 18.69 ? 168 TYR B CZ  2 
ATOM   5389  O  OH  . TYR B 1 168 ? 11.966  127.177 -7.745  0.25 19.98 ? 168 TYR B OH  2 
ATOM   5390  N  N   . THR B 1 169 ? 7.527   131.045 -6.221  0.25 27.58 ? 169 THR B N   2 
ATOM   5391  C  CA  . THR B 1 169 ? 7.416   131.904 -7.396  0.25 29.24 ? 169 THR B CA  2 
ATOM   5392  C  C   . THR B 1 169 ? 8.647   131.743 -8.277  0.25 29.75 ? 169 THR B C   2 
ATOM   5393  O  O   . THR B 1 169 ? 8.883   132.539 -9.185  0.25 30.37 ? 169 THR B O   2 
ATOM   5394  C  CB  . THR B 1 169 ? 7.264   133.396 -7.012  0.25 29.34 ? 169 THR B CB  2 
ATOM   5395  O  OG1 . THR B 1 169 ? 8.477   133.870 -6.415  0.25 31.20 ? 169 THR B OG1 2 
ATOM   5396  C  CG2 . THR B 1 169 ? 6.114   133.577 -6.031  0.25 30.82 ? 169 THR B CG2 2 
ATOM   5397  N  N   . GLY B 1 170 ? 9.430   130.707 -7.994  0.25 29.40 ? 170 GLY B N   2 
ATOM   5398  C  CA  . GLY B 1 170 ? 10.621  130.443 -8.776  0.25 28.47 ? 170 GLY B CA  2 
ATOM   5399  C  C   . GLY B 1 170 ? 10.239  129.753 -10.068 0.25 28.72 ? 170 GLY B C   2 
ATOM   5400  O  O   . GLY B 1 170 ? 9.071   129.756 -10.457 0.25 27.24 ? 170 GLY B O   2 
ATOM   5401  N  N   . LYS B 1 171 ? 11.213  129.148 -10.735 0.25 29.60 ? 171 LYS B N   2 
ATOM   5402  C  CA  . LYS B 1 171 ? 10.940  128.469 -11.992 0.25 32.06 ? 171 LYS B CA  2 
ATOM   5403  C  C   . LYS B 1 171 ? 11.107  126.960 -11.890 0.25 30.05 ? 171 LYS B C   2 
ATOM   5404  O  O   . LYS B 1 171 ? 11.790  126.455 -11.000 0.25 28.64 ? 171 LYS B O   2 
ATOM   5405  C  CB  . LYS B 1 171 ? 11.861  129.008 -13.093 0.25 35.82 ? 171 LYS B CB  2 
ATOM   5406  C  CG  . LYS B 1 171 ? 11.713  130.495 -13.343 0.25 42.28 ? 171 LYS B CG  2 
ATOM   5407  C  CD  . LYS B 1 171 ? 12.599  130.958 -14.483 0.25 48.07 ? 171 LYS B CD  2 
ATOM   5408  C  CE  . LYS B 1 171 ? 12.396  132.439 -14.764 0.25 52.84 ? 171 LYS B CE  2 
ATOM   5409  N  NZ  . LYS B 1 171 ? 13.229  132.904 -15.907 0.25 56.87 ? 171 LYS B NZ  2 
ATOM   5410  N  N   . VAL B 1 172 ? 10.458  126.245 -12.803 0.25 29.48 ? 172 VAL B N   2 
ATOM   5411  C  CA  . VAL B 1 172 ? 10.557  124.795 -12.857 0.25 29.19 ? 172 VAL B CA  2 
ATOM   5412  C  C   . VAL B 1 172 ? 11.393  124.483 -14.097 0.25 28.99 ? 172 VAL B C   2 
ATOM   5413  O  O   . VAL B 1 172 ? 12.060  125.373 -14.626 0.25 28.32 ? 172 VAL B O   2 
ATOM   5414  C  CB  . VAL B 1 172 ? 9.163   124.131 -12.965 0.25 29.45 ? 172 VAL B CB  2 
ATOM   5415  C  CG1 . VAL B 1 172 ? 8.421   124.266 -11.642 0.25 30.06 ? 172 VAL B CG1 2 
ATOM   5416  C  CG2 . VAL B 1 172 ? 8.359   124.780 -14.075 0.25 30.30 ? 172 VAL B CG2 2 
ATOM   5417  N  N   . SER B 1 173 ? 11.365  123.239 -14.566 0.25 27.84 ? 173 SER B N   2 
ATOM   5418  C  CA  . SER B 1 173 ? 12.150  122.879 -15.743 0.25 28.93 ? 173 SER B CA  2 
ATOM   5419  C  C   . SER B 1 173 ? 11.793  123.769 -16.929 0.25 29.21 ? 173 SER B C   2 
ATOM   5420  O  O   . SER B 1 173 ? 10.695  124.329 -16.992 0.25 27.95 ? 173 SER B O   2 
ATOM   5421  C  CB  . SER B 1 173 ? 11.925  121.410 -16.121 0.25 28.91 ? 173 SER B CB  2 
ATOM   5422  O  OG  . SER B 1 173 ? 10.667  121.220 -16.744 0.25 29.78 ? 173 SER B OG  2 
ATOM   5423  N  N   . GLU B 1 174 ? 12.728  123.892 -17.866 0.25 30.75 ? 174 GLU B N   2 
ATOM   5424  C  CA  . GLU B 1 174 ? 12.530  124.706 -19.056 0.25 32.69 ? 174 GLU B CA  2 
ATOM   5425  C  C   . GLU B 1 174 ? 11.391  124.144 -19.905 0.25 32.86 ? 174 GLU B C   2 
ATOM   5426  O  O   . GLU B 1 174 ? 10.566  124.897 -20.421 0.25 31.72 ? 174 GLU B O   2 
ATOM   5427  C  CB  . GLU B 1 174 ? 13.825  124.749 -19.871 0.25 35.80 ? 174 GLU B CB  2 
ATOM   5428  C  CG  . GLU B 1 174 ? 13.836  125.767 -21.005 0.25 41.48 ? 174 GLU B CG  2 
ATOM   5429  C  CD  . GLU B 1 174 ? 15.212  125.918 -21.637 0.25 42.86 ? 174 GLU B CD  2 
ATOM   5430  O  OE1 . GLU B 1 174 ? 15.741  124.917 -22.165 0.25 43.83 ? 174 GLU B OE1 2 
ATOM   5431  O  OE2 . GLU B 1 174 ? 15.768  127.037 -21.603 0.25 45.62 ? 174 GLU B OE2 2 
ATOM   5432  N  N   . GLU B 1 175 ? 11.347  122.821 -20.044 0.25 33.36 ? 175 GLU B N   2 
ATOM   5433  C  CA  . GLU B 1 175 ? 10.303  122.169 -20.831 0.25 35.58 ? 175 GLU B CA  2 
ATOM   5434  C  C   . GLU B 1 175 ? 8.926   122.457 -20.252 0.25 33.43 ? 175 GLU B C   2 
ATOM   5435  O  O   . GLU B 1 175 ? 7.992   122.801 -20.977 0.25 32.34 ? 175 GLU B O   2 
ATOM   5436  C  CB  . GLU B 1 175 ? 10.521  120.655 -20.865 0.25 40.49 ? 175 GLU B CB  2 
ATOM   5437  C  CG  . GLU B 1 175 ? 11.842  120.230 -21.471 0.25 48.15 ? 175 GLU B CG  2 
ATOM   5438  C  CD  . GLU B 1 175 ? 11.957  118.725 -21.601 0.25 51.52 ? 175 GLU B CD  2 
ATOM   5439  O  OE1 . GLU B 1 175 ? 11.808  118.024 -20.576 0.25 53.88 ? 175 GLU B OE1 2 
ATOM   5440  O  OE2 . GLU B 1 175 ? 12.199  118.244 -22.729 0.25 53.10 ? 175 GLU B OE2 2 
ATOM   5441  N  N   . ILE B 1 176 ? 8.804   122.305 -18.940 0.25 31.44 ? 176 ILE B N   2 
ATOM   5442  C  CA  . ILE B 1 176 ? 7.541   122.558 -18.263 0.25 30.46 ? 176 ILE B CA  2 
ATOM   5443  C  C   . ILE B 1 176 ? 7.222   124.049 -18.293 0.25 30.24 ? 176 ILE B C   2 
ATOM   5444  O  O   . ILE B 1 176 ? 6.075   124.442 -18.497 0.25 28.86 ? 176 ILE B O   2 
ATOM   5445  C  CB  . ILE B 1 176 ? 7.595   122.088 -16.798 0.25 29.44 ? 176 ILE B CB  2 
ATOM   5446  C  CG1 . ILE B 1 176 ? 7.802   120.572 -16.753 0.25 29.54 ? 176 ILE B CG1 2 
ATOM   5447  C  CG2 . ILE B 1 176 ? 6.312   122.491 -16.072 0.25 29.07 ? 176 ILE B CG2 2 
ATOM   5448  C  CD1 . ILE B 1 176 ? 8.056   120.021 -15.361 0.25 31.47 ? 176 ILE B CD1 2 
ATOM   5449  N  N   . GLU B 1 177 ? 8.245   124.874 -18.086 0.25 31.04 ? 177 GLU B N   2 
ATOM   5450  C  CA  . GLU B 1 177 ? 8.074   126.323 -18.094 0.25 32.46 ? 177 GLU B CA  2 
ATOM   5451  C  C   . GLU B 1 177 ? 7.330   126.784 -19.341 0.25 32.24 ? 177 GLU B C   2 
ATOM   5452  O  O   . GLU B 1 177 ? 6.587   127.759 -19.298 0.25 31.13 ? 177 GLU B O   2 
ATOM   5453  C  CB  . GLU B 1 177 ? 9.435   127.022 -18.028 0.25 33.13 ? 177 GLU B CB  2 
ATOM   5454  C  CG  . GLU B 1 177 ? 10.033  127.131 -16.632 0.25 34.60 ? 177 GLU B CG  2 
ATOM   5455  C  CD  . GLU B 1 177 ? 9.304   128.136 -15.757 0.25 36.41 ? 177 GLU B CD  2 
ATOM   5456  O  OE1 . GLU B 1 177 ? 9.131   129.294 -16.201 0.25 37.99 ? 177 GLU B OE1 2 
ATOM   5457  O  OE2 . GLU B 1 177 ? 8.910   127.777 -14.626 0.25 35.88 ? 177 GLU B OE2 2 
ATOM   5458  N  N   . ASP B 1 178 ? 7.529   126.076 -20.449 0.25 33.75 ? 178 ASP B N   2 
ATOM   5459  C  CA  . ASP B 1 178 ? 6.875   126.427 -21.705 0.25 35.20 ? 178 ASP B CA  2 
ATOM   5460  C  C   . ASP B 1 178 ? 5.500   125.785 -21.850 0.25 34.77 ? 178 ASP B C   2 
ATOM   5461  O  O   . ASP B 1 178 ? 4.603   126.360 -22.468 0.25 33.67 ? 178 ASP B O   2 
ATOM   5462  C  CB  . ASP B 1 178 ? 7.756   126.030 -22.888 0.25 37.99 ? 178 ASP B CB  2 
ATOM   5463  C  CG  . ASP B 1 178 ? 9.084   126.758 -22.889 0.25 40.39 ? 178 ASP B CG  2 
ATOM   5464  O  OD1 . ASP B 1 178 ? 9.078   127.998 -22.737 0.25 41.05 ? 178 ASP B OD1 2 
ATOM   5465  O  OD2 . ASP B 1 178 ? 10.130  126.094 -23.045 0.25 41.66 ? 178 ASP B OD2 2 
ATOM   5466  N  N   . ILE B 1 179 ? 5.336   124.593 -21.284 0.25 33.73 ? 179 ILE B N   2 
ATOM   5467  C  CA  . ILE B 1 179 ? 4.054   123.902 -21.352 0.25 33.07 ? 179 ILE B CA  2 
ATOM   5468  C  C   . ILE B 1 179 ? 2.992   124.829 -20.782 0.25 33.14 ? 179 ILE B C   2 
ATOM   5469  O  O   . ILE B 1 179 ? 1.933   125.038 -21.377 0.25 33.90 ? 179 ILE B O   2 
ATOM   5470  C  CB  . ILE B 1 179 ? 4.067   122.606 -20.520 0.25 31.92 ? 179 ILE B CB  2 
ATOM   5471  C  CG1 . ILE B 1 179 ? 5.179   121.682 -21.020 0.25 30.78 ? 179 ILE B CG1 2 
ATOM   5472  C  CG2 . ILE B 1 179 ? 2.704   121.920 -20.605 0.25 30.84 ? 179 ILE B CG2 2 
ATOM   5473  C  CD1 . ILE B 1 179 ? 5.297   120.377 -20.259 0.25 29.76 ? 179 ILE B CD1 2 
ATOM   5474  N  N   . ILE B 1 180 ? 3.296   125.390 -19.621 0.25 33.01 ? 180 ILE B N   2 
ATOM   5475  C  CA  . ILE B 1 180 ? 2.389   126.300 -18.946 0.25 34.81 ? 180 ILE B CA  2 
ATOM   5476  C  C   . ILE B 1 180 ? 2.102   127.528 -19.806 0.25 38.49 ? 180 ILE B C   2 
ATOM   5477  O  O   . ILE B 1 180 ? 0.953   127.954 -19.923 0.25 38.78 ? 180 ILE B O   2 
ATOM   5478  C  CB  . ILE B 1 180 ? 2.988   126.741 -17.602 0.25 32.71 ? 180 ILE B CB  2 
ATOM   5479  C  CG1 . ILE B 1 180 ? 3.253   125.503 -16.738 0.25 29.69 ? 180 ILE B CG1 2 
ATOM   5480  C  CG2 . ILE B 1 180 ? 2.048   127.713 -16.902 0.25 30.87 ? 180 ILE B CG2 2 
ATOM   5481  C  CD1 . ILE B 1 180 ? 3.910   125.800 -15.408 0.25 25.60 ? 180 ILE B CD1 2 
ATOM   5482  N  N   . LYS B 1 181 ? 3.146   128.083 -20.417 0.25 42.53 ? 181 LYS B N   2 
ATOM   5483  C  CA  . LYS B 1 181 ? 3.005   129.268 -21.260 0.25 46.16 ? 181 LYS B CA  2 
ATOM   5484  C  C   . LYS B 1 181 ? 2.125   129.037 -22.482 0.25 47.61 ? 181 LYS B C   2 
ATOM   5485  O  O   . LYS B 1 181 ? 1.320   129.895 -22.843 0.25 47.85 ? 181 LYS B O   2 
ATOM   5486  C  CB  . LYS B 1 181 ? 4.380   129.766 -21.710 0.25 48.06 ? 181 LYS B CB  2 
ATOM   5487  C  CG  . LYS B 1 181 ? 5.242   130.277 -20.569 0.25 52.07 ? 181 LYS B CG  2 
ATOM   5488  C  CD  . LYS B 1 181 ? 6.585   130.796 -21.055 0.25 54.14 ? 181 LYS B CD  2 
ATOM   5489  C  CE  . LYS B 1 181 ? 7.427   131.294 -19.891 0.25 55.72 ? 181 LYS B CE  2 
ATOM   5490  N  NZ  . LYS B 1 181 ? 8.735   131.840 -20.340 0.25 57.76 ? 181 LYS B NZ  2 
ATOM   5491  N  N   . LYS B 1 182 ? 2.280   127.881 -23.117 0.25 49.82 ? 182 LYS B N   2 
ATOM   5492  C  CA  . LYS B 1 182 ? 1.495   127.551 -24.302 0.25 51.28 ? 182 LYS B CA  2 
ATOM   5493  C  C   . LYS B 1 182 ? 0.000   127.684 -24.023 0.25 50.30 ? 182 LYS B C   2 
ATOM   5494  O  O   . LYS B 1 182 ? -0.795  127.893 -24.941 0.25 51.29 ? 182 LYS B O   2 
ATOM   5495  C  CB  . LYS B 1 182 ? 1.811   126.127 -24.757 0.25 54.39 ? 182 LYS B CB  2 
ATOM   5496  C  CG  . LYS B 1 182 ? 3.283   125.891 -25.048 0.25 57.27 ? 182 LYS B CG  2 
ATOM   5497  C  CD  . LYS B 1 182 ? 3.588   124.413 -25.229 0.25 58.74 ? 182 LYS B CD  2 
ATOM   5498  C  CE  . LYS B 1 182 ? 5.086   124.179 -25.353 0.25 59.78 ? 182 LYS B CE  2 
ATOM   5499  N  NZ  . LYS B 1 182 ? 5.431   122.732 -25.417 0.25 60.07 ? 182 LYS B NZ  2 
ATOM   5500  N  N   . GLY B 1 183 ? -0.374  127.563 -22.753 0.25 47.50 ? 183 GLY B N   2 
ATOM   5501  C  CA  . GLY B 1 183 ? -1.772  127.678 -22.376 0.25 46.00 ? 183 GLY B CA  2 
ATOM   5502  C  C   . GLY B 1 183 ? -2.008  128.716 -21.294 0.25 44.97 ? 183 GLY B C   2 
ATOM   5503  O  O   . GLY B 1 183 ? -2.548  128.352 -20.229 0.25 41.95 ? 183 GLY B O   2 
HETATM 5504  O  O   . HOH C 2 .   ? -2.435  92.406  17.010  0.25 15.94 ? 189 HOH A O   2 
HETATM 5505  O  O   . HOH C 2 .   ? 7.369   98.886  -5.427  0.25 8.87  ? 190 HOH A O   2 
HETATM 5506  O  O   . HOH C 2 .   ? -5.695  96.548  14.420  0.25 14.89 ? 191 HOH A O   2 
HETATM 5507  O  O   . HOH C 2 .   ? 5.327   97.897  20.163  0.25 17.01 ? 192 HOH A O   2 
HETATM 5508  O  O   . HOH C 2 .   ? 14.972  80.212  0.916   0.25 18.23 ? 193 HOH A O   2 
HETATM 5509  O  O   . HOH C 2 .   ? -5.171  81.670  6.199   0.25 16.44 ? 194 HOH A O   2 
HETATM 5510  O  O   . HOH C 2 .   ? 2.213   101.132 5.903   0.25 15.93 ? 195 HOH A O   2 
HETATM 5511  O  O   . HOH C 2 .   ? -2.816  97.543  20.423  0.25 12.76 ? 196 HOH A O   2 
HETATM 5512  O  O   . HOH C 2 .   ? 8.016   97.398  20.033  0.25 22.47 ? 197 HOH A O   2 
HETATM 5513  O  O   . HOH C 2 .   ? 9.122   99.137  -3.440  0.25 14.11 ? 198 HOH A O   2 
HETATM 5514  O  O   . HOH C 2 .   ? 8.537   90.213  9.003   0.25 14.77 ? 199 HOH A O   2 
HETATM 5515  O  O   . HOH C 2 .   ? 15.028  89.753  21.068  0.25 17.13 ? 200 HOH A O   2 
HETATM 5516  O  O   . HOH C 2 .   ? -5.238  77.489  -1.491  0.25 24.68 ? 201 HOH A O   2 
HETATM 5517  O  O   . HOH C 2 .   ? -8.589  99.630  -1.570  0.25 17.05 ? 202 HOH A O   2 
HETATM 5518  O  O   . HOH C 2 .   ? 14.754  79.399  12.738  0.25 16.95 ? 203 HOH A O   2 
HETATM 5519  O  O   . HOH C 2 .   ? 1.570   92.953  -7.328  0.25 17.82 ? 204 HOH A O   2 
HETATM 5520  O  O   . HOH C 2 .   ? -5.055  91.960  29.960  0.25 19.60 ? 205 HOH A O   2 
HETATM 5521  O  O   . HOH C 2 .   ? 12.741  78.299  -4.609  0.25 28.69 ? 206 HOH A O   2 
HETATM 5522  O  O   . HOH C 2 .   ? 11.689  96.494  9.987   0.25 15.25 ? 207 HOH A O   2 
HETATM 5523  O  O   . HOH C 2 .   ? 7.160   106.816 0.197   0.25 17.02 ? 208 HOH A O   2 
HETATM 5524  O  O   . HOH C 2 .   ? 12.172  102.114 -0.245  0.25 20.39 ? 209 HOH A O   2 
HETATM 5525  O  O   . HOH C 2 .   ? -11.025 90.097  -4.016  0.25 18.45 ? 210 HOH A O   2 
HETATM 5526  O  O   . HOH C 2 .   ? -5.021  101.240 4.725   0.25 19.44 ? 211 HOH A O   2 
HETATM 5527  O  O   . HOH C 2 .   ? 14.356  94.785  -2.042  0.25 15.34 ? 212 HOH A O   2 
HETATM 5528  O  O   . HOH C 2 .   ? 6.479   89.156  24.176  0.25 17.79 ? 213 HOH A O   2 
HETATM 5529  O  O   . HOH C 2 .   ? -3.242  85.302  7.958   0.25 32.73 ? 214 HOH A O   2 
HETATM 5530  O  O   . HOH C 2 .   ? 7.852   76.190  -4.041  0.25 23.56 ? 215 HOH A O   2 
HETATM 5531  O  O   . HOH C 2 .   ? 7.197   86.942  -10.131 0.25 26.14 ? 216 HOH A O   2 
HETATM 5532  O  O   . HOH C 2 .   ? 4.460   98.171  17.480  0.25 21.22 ? 217 HOH A O   2 
HETATM 5533  O  O   . HOH C 2 .   ? -1.385  106.355 7.792   0.25 29.50 ? 218 HOH A O   2 
HETATM 5534  O  O   . HOH C 2 .   ? 4.898   74.723  1.412   0.25 23.40 ? 219 HOH A O   2 
HETATM 5535  O  O   . HOH C 2 .   ? 1.510   91.783  27.217  0.25 21.87 ? 220 HOH A O   2 
HETATM 5536  O  O   . HOH C 2 .   ? 10.578  87.313  -10.090 0.25 23.51 ? 221 HOH A O   2 
HETATM 5537  O  O   . HOH C 2 .   ? -7.081  99.241  -3.634  0.25 12.31 ? 222 HOH A O   2 
HETATM 5538  O  O   . HOH C 2 .   ? 7.711   74.025  -0.711  0.25 24.43 ? 223 HOH A O   2 
HETATM 5539  O  O   . HOH C 2 .   ? 18.278  82.284  -4.321  0.25 20.76 ? 224 HOH A O   2 
HETATM 5540  O  O   . HOH C 2 .   ? 20.582  83.707  10.759  0.25 22.29 ? 225 HOH A O   2 
HETATM 5541  O  O   . HOH C 2 .   ? 8.983   97.502  -6.925  0.25 18.30 ? 226 HOH A O   2 
HETATM 5542  O  O   . HOH C 2 .   ? -8.039  92.266  11.393  0.25 28.81 ? 227 HOH A O   2 
HETATM 5543  O  O   . HOH C 2 .   ? 19.188  89.294  0.879   0.25 29.46 ? 228 HOH A O   2 
HETATM 5544  O  O   . HOH C 2 .   ? -6.876  82.810  7.936   0.25 32.87 ? 229 HOH A O   2 
HETATM 5545  O  O   . HOH C 2 .   ? 11.278  83.788  15.842  0.25 18.99 ? 230 HOH A O   2 
HETATM 5546  O  O   . HOH C 2 .   ? 3.618   87.170  22.384  0.25 23.07 ? 231 HOH A O   2 
HETATM 5547  O  O   . HOH C 2 .   ? 16.827  83.123  1.154   0.25 26.05 ? 232 HOH A O   2 
HETATM 5548  O  O   . HOH C 2 .   ? 10.703  82.770  18.201  0.25 26.26 ? 233 HOH A O   2 
HETATM 5549  O  O   . HOH C 2 .   ? 10.933  87.733  23.482  0.25 36.02 ? 234 HOH A O   2 
HETATM 5550  O  O   . HOH C 2 .   ? 18.500  88.443  -9.308  0.25 27.97 ? 235 HOH A O   2 
HETATM 5551  O  O   . HOH C 2 .   ? -5.978  106.038 10.531  0.25 30.15 ? 236 HOH A O   2 
HETATM 5552  O  O   . HOH C 2 .   ? 13.191  98.116  -1.939  0.25 25.88 ? 237 HOH A O   2 
HETATM 5553  O  O   . HOH C 2 .   ? -9.060  101.541 17.864  0.25 30.65 ? 238 HOH A O   2 
HETATM 5554  O  O   . HOH C 2 .   ? 10.700  96.738  -4.153  0.25 27.58 ? 239 HOH A O   2 
HETATM 5555  O  O   . HOH C 2 .   ? 0.024   73.622  7.456   0.25 34.45 ? 240 HOH A O   2 
HETATM 5556  O  O   . HOH C 2 .   ? -8.442  95.468  11.375  0.25 43.41 ? 241 HOH A O   2 
HETATM 5557  O  O   . HOH C 2 .   ? 7.917   101.004 13.348  0.25 34.66 ? 242 HOH A O   2 
HETATM 5558  O  O   . HOH C 2 .   ? 7.917   94.758  -12.467 0.25 26.65 ? 243 HOH A O   2 
HETATM 5559  O  O   . HOH C 2 .   ? 6.334   88.397  -11.911 0.25 38.04 ? 244 HOH A O   2 
HETATM 5560  O  O   . HOH C 2 .   ? 4.137   72.969  8.228   0.25 33.04 ? 245 HOH A O   2 
HETATM 5561  O  O   . HOH C 2 .   ? 11.856  95.161  17.287  0.25 35.34 ? 246 HOH A O   2 
HETATM 5562  O  O   . HOH C 2 .   ? -5.945  103.531 16.907  0.25 27.96 ? 247 HOH A O   2 
HETATM 5563  O  O   . HOH C 2 .   ? 21.199  86.512  11.551  0.25 30.61 ? 248 HOH A O   2 
HETATM 5564  O  O   . HOH C 2 .   ? 10.262  98.056  13.207  0.25 26.36 ? 249 HOH A O   2 
HETATM 5565  O  O   . HOH C 2 .   ? -6.546  97.314  11.899  0.25 22.79 ? 250 HOH A O   2 
HETATM 5566  O  O   . HOH C 2 .   ? 4.370   86.400  -9.365  0.25 36.04 ? 251 HOH A O   2 
HETATM 5567  O  O   . HOH C 2 .   ? -4.972  97.860  18.660  0.25 29.31 ? 252 HOH A O   2 
HETATM 5568  O  O   . HOH C 2 .   ? -9.750  83.567  -5.584  0.25 31.79 ? 253 HOH A O   2 
HETATM 5569  O  O   . HOH C 2 .   ? 11.580  94.600  12.250  0.25 35.51 ? 254 HOH A O   2 
HETATM 5570  O  O   . HOH C 2 .   ? -11.765 79.305  15.223  0.25 38.02 ? 255 HOH A O   2 
HETATM 5571  O  O   . HOH C 2 .   ? 7.931   103.416 13.025  0.25 35.73 ? 256 HOH A O   2 
HETATM 5572  O  O   . HOH C 2 .   ? -2.929  99.264  22.028  0.25 28.03 ? 257 HOH A O   2 
HETATM 5573  O  O   . HOH C 2 .   ? -7.115  90.466  -7.764  0.25 25.83 ? 258 HOH A O   2 
HETATM 5574  O  O   . HOH C 2 .   ? -2.058  87.099  25.703  0.25 38.21 ? 259 HOH A O   2 
HETATM 5575  O  O   . HOH C 2 .   ? -4.165  84.958  26.549  0.25 36.11 ? 260 HOH A O   2 
HETATM 5576  O  O   . HOH C 2 .   ? 22.471  90.347  -6.311  0.25 37.94 ? 261 HOH A O   2 
HETATM 5577  O  O   . HOH C 2 .   ? 0.615   89.616  -8.739  0.25 39.80 ? 262 HOH A O   2 
HETATM 5578  O  O   . HOH C 2 .   ? 16.513  80.414  5.552   0.25 32.99 ? 263 HOH A O   2 
HETATM 5579  O  O   . HOH C 2 .   ? -4.085  83.741  5.275   0.25 30.05 ? 264 HOH A O   2 
HETATM 5580  O  O   . HOH D 2 .   ? -5.157  97.490  -4.109  0.25 13.40 ? 189 HOH B O   2 
HETATM 5581  O  O   . HOH D 2 .   ? 4.656   120.570 -6.346  0.25 13.18 ? 190 HOH B O   2 
HETATM 5582  O  O   . HOH D 2 .   ? -6.350  113.280 -9.873  0.25 13.46 ? 191 HOH B O   2 
HETATM 5583  O  O   . HOH D 2 .   ? -9.584  112.899 -3.457  0.25 11.68 ? 192 HOH B O   2 
HETATM 5584  O  O   . HOH D 2 .   ? 5.034   122.933 -0.601  0.25 16.06 ? 193 HOH B O   2 
HETATM 5585  O  O   . HOH D 2 .   ? -9.990  102.092 0.028   0.25 20.95 ? 194 HOH B O   2 
HETATM 5586  O  O   . HOH D 2 .   ? 0.099   108.128 0.130   0.25 16.65 ? 195 HOH B O   2 
HETATM 5587  O  O   . HOH D 2 .   ? 8.080   117.158 -2.714  0.25 18.58 ? 196 HOH B O   2 
HETATM 5588  O  O   . HOH D 2 .   ? 7.316   111.973 -18.891 0.25 17.36 ? 197 HOH B O   2 
HETATM 5589  O  O   . HOH D 2 .   ? -3.048  122.521 -0.435  0.25 20.13 ? 198 HOH B O   2 
HETATM 5590  O  O   . HOH D 2 .   ? 0.483   96.710  -10.264 0.25 18.87 ? 199 HOH B O   2 
HETATM 5591  O  O   . HOH D 2 .   ? 5.260   113.277 -14.851 0.25 34.23 ? 200 HOH B O   2 
HETATM 5592  O  O   . HOH D 2 .   ? 13.385  100.361 -12.391 0.25 17.70 ? 201 HOH B O   2 
HETATM 5593  O  O   . HOH D 2 .   ? -9.556  121.024 -3.581  0.25 26.29 ? 202 HOH B O   2 
HETATM 5594  O  O   . HOH D 2 .   ? -8.573  99.424  -5.937  0.25 17.38 ? 203 HOH B O   2 
HETATM 5595  O  O   . HOH D 2 .   ? 7.345   104.929 -24.191 0.25 27.94 ? 204 HOH B O   2 
HETATM 5596  O  O   . HOH D 2 .   ? 8.754   114.630 -2.529  0.25 21.90 ? 205 HOH B O   2 
HETATM 5597  O  O   . HOH D 2 .   ? 10.666  96.697  -17.939 0.25 30.03 ? 206 HOH B O   2 
HETATM 5598  O  O   . HOH D 2 .   ? -12.146 102.000 -7.437  0.25 22.32 ? 207 HOH B O   2 
HETATM 5599  O  O   . HOH D 2 .   ? -0.782  117.732 -23.917 0.25 19.00 ? 208 HOH B O   2 
HETATM 5600  O  O   . HOH D 2 .   ? 6.076   95.604  -24.220 0.25 39.37 ? 209 HOH B O   2 
HETATM 5601  O  O   . HOH D 2 .   ? -6.705  95.725  -5.985  0.25 23.33 ? 210 HOH B O   2 
HETATM 5602  O  O   . HOH D 2 .   ? -2.427  96.156  -16.894 0.25 25.26 ? 211 HOH B O   2 
HETATM 5603  O  O   . HOH D 2 .   ? -12.415 119.172 -19.939 0.25 20.34 ? 212 HOH B O   2 
HETATM 5604  O  O   . HOH D 2 .   ? 4.436   110.862 -28.127 0.25 29.30 ? 213 HOH B O   2 
HETATM 5605  O  O   . HOH D 2 .   ? -18.626 116.300 -15.835 0.25 29.85 ? 214 HOH B O   2 
HETATM 5606  O  O   . HOH D 2 .   ? 10.984  100.987 -2.746  0.25 21.19 ? 215 HOH B O   2 
HETATM 5607  O  O   . HOH D 2 .   ? 11.814  99.715  -19.021 0.25 23.70 ? 216 HOH B O   2 
HETATM 5608  O  O   . HOH D 2 .   ? 13.204  103.060 -9.080  0.25 40.90 ? 217 HOH B O   2 
HETATM 5609  O  O   . HOH D 2 .   ? -15.963 102.444 -20.462 0.25 35.70 ? 218 HOH B O   2 
HETATM 5610  O  O   . HOH D 2 .   ? 8.301   111.795 5.616   0.25 36.68 ? 219 HOH B O   2 
HETATM 5611  O  O   . HOH D 2 .   ? -8.984  121.265 -15.015 0.25 16.16 ? 220 HOH B O   2 
HETATM 5612  O  O   . HOH D 2 .   ? -8.416  95.208  -16.475 0.25 30.31 ? 221 HOH B O   2 
HETATM 5613  O  O   . HOH D 2 .   ? 5.198   124.313 1.823   0.25 20.77 ? 222 HOH B O   2 
HETATM 5614  O  O   . HOH D 2 .   ? -2.021  120.106 -0.579  0.25 33.38 ? 223 HOH B O   2 
HETATM 5615  O  O   . HOH D 2 .   ? 6.193   115.647 -24.773 0.25 25.35 ? 224 HOH B O   2 
HETATM 5616  O  O   . HOH D 2 .   ? 4.852   115.050 -26.903 0.25 26.54 ? 225 HOH B O   2 
HETATM 5617  O  O   . HOH D 2 .   ? -10.325 94.389  -13.770 0.25 29.00 ? 226 HOH B O   2 
HETATM 5618  O  O   . HOH D 2 .   ? -1.311  127.256 -10.587 0.25 25.79 ? 227 HOH B O   2 
HETATM 5619  O  O   . HOH D 2 .   ? 3.592   108.977 5.792   0.25 26.28 ? 228 HOH B O   2 
HETATM 5620  O  O   . HOH D 2 .   ? -15.722 116.841 -18.182 0.25 34.34 ? 229 HOH B O   2 
HETATM 5621  O  O   . HOH D 2 .   ? 8.319   118.297 4.467   0.25 25.02 ? 230 HOH B O   2 
HETATM 5622  O  O   . HOH D 2 .   ? 8.117   121.581 -23.516 0.25 37.58 ? 231 HOH B O   2 
HETATM 5623  O  O   . HOH D 2 .   ? -5.965  122.547 -0.803  0.25 34.85 ? 232 HOH B O   2 
HETATM 5624  O  O   . HOH D 2 .   ? -12.960 112.723 -2.586  0.25 24.81 ? 233 HOH B O   2 
HETATM 5625  O  O   . HOH D 2 .   ? 11.485  121.260 -13.044 0.25 33.71 ? 234 HOH B O   2 
HETATM 5626  O  O   . HOH D 2 .   ? 9.255   96.789  -12.968 0.25 27.57 ? 235 HOH B O   2 
HETATM 5627  O  O   . HOH D 2 .   ? 1.722   111.756 5.833   0.25 37.10 ? 236 HOH B O   2 
HETATM 5628  O  O   . HOH D 2 .   ? -16.474 120.000 -7.035  0.25 33.46 ? 237 HOH B O   2 
HETATM 5629  O  O   . HOH D 2 .   ? 5.590   129.336 -17.807 0.25 44.98 ? 238 HOH B O   2 
HETATM 5630  O  O   . HOH D 2 .   ? -4.795  112.789 -24.530 0.25 29.46 ? 239 HOH B O   2 
HETATM 5631  O  O   . HOH D 2 .   ? 0.594   123.816 -23.484 0.25 35.48 ? 240 HOH B O   2 
HETATM 5632  O  O   . HOH D 2 .   ? -5.808  124.273 -16.834 0.25 33.08 ? 241 HOH B O   2 
HETATM 5633  O  O   . HOH D 2 .   ? 5.467   129.710 -9.348  0.25 37.26 ? 242 HOH B O   2 
HETATM 5634  O  O   . HOH D 2 .   ? -5.112  118.736 -1.733  0.25 29.56 ? 243 HOH B O   2 
HETATM 5635  O  O   . HOH D 2 .   ? -11.503 127.211 -10.376 0.25 55.74 ? 244 HOH B O   2 
HETATM 5636  O  O   . HOH D 2 .   ? 15.520  123.738 -17.627 0.25 32.98 ? 245 HOH B O   2 
HETATM 5637  O  O   . HOH D 2 .   ? -14.414 106.627 -18.851 0.25 44.70 ? 246 HOH B O   2 
HETATM 5638  O  O   . HOH D 2 .   ? 7.286   121.193 -0.606  0.25 24.60 ? 247 HOH B O   2 
HETATM 5639  O  O   . HOH D 2 .   ? 1.008   101.731 -25.791 0.25 34.55 ? 248 HOH B O   2 
HETATM 5640  O  O   . HOH D 2 .   ? -5.574  121.537 -20.822 0.25 24.62 ? 249 HOH B O   2 
HETATM 5641  O  O   . HOH D 2 .   ? 11.549  98.186  -10.429 0.25 32.71 ? 250 HOH B O   2 
HETATM 5642  O  O   . HOH D 2 .   ? -3.033  108.693 -26.859 0.25 24.68 ? 251 HOH B O   2 
HETATM 5643  O  O   . HOH D 2 .   ? 1.869   114.709 6.826   0.25 33.90 ? 252 HOH B O   2 
HETATM 5644  O  O   . HOH D 2 .   ? 9.977   114.866 -7.648  0.25 34.41 ? 253 HOH B O   2 
ATOM   5645  N  N   . GLU A 1 14  ? 3.512   81.491  -15.138 0.25 43.90 ? 14  GLU A N   3 
ATOM   5646  C  CA  . GLU A 1 14  ? 2.473   82.151  -15.978 0.25 45.11 ? 14  GLU A CA  3 
ATOM   5647  C  C   . GLU A 1 14  ? 1.095   82.080  -15.326 0.25 42.26 ? 14  GLU A C   3 
ATOM   5648  O  O   . GLU A 1 14  ? 0.391   83.087  -15.239 0.25 40.54 ? 14  GLU A O   3 
ATOM   5649  C  CB  . GLU A 1 14  ? 2.429   81.506  -17.365 0.25 49.57 ? 14  GLU A CB  3 
ATOM   5650  C  CG  . GLU A 1 14  ? 3.708   81.693  -18.168 0.25 57.69 ? 14  GLU A CG  3 
ATOM   5651  C  CD  . GLU A 1 14  ? 3.613   81.119  -19.569 0.25 60.78 ? 14  GLU A CD  3 
ATOM   5652  O  OE1 . GLU A 1 14  ? 4.585   81.265  -20.341 0.25 63.85 ? 14  GLU A OE1 3 
ATOM   5653  O  OE2 . GLU A 1 14  ? 2.568   80.521  -19.898 0.25 63.53 ? 14  GLU A OE2 3 
ATOM   5654  N  N   . GLU A 1 15  ? 0.709   80.893  -14.867 0.25 39.45 ? 15  GLU A N   3 
ATOM   5655  C  CA  . GLU A 1 15  ? -0.585  80.731  -14.216 0.25 37.34 ? 15  GLU A CA  3 
ATOM   5656  C  C   . GLU A 1 15  ? -0.432  80.908  -12.707 0.25 32.45 ? 15  GLU A C   3 
ATOM   5657  O  O   . GLU A 1 15  ? -1.415  80.886  -11.965 0.25 28.72 ? 15  GLU A O   3 
ATOM   5658  C  CB  . GLU A 1 15  ? -1.169  79.349  -14.515 0.25 43.78 ? 15  GLU A CB  3 
ATOM   5659  C  CG  . GLU A 1 15  ? -2.582  79.159  -13.985 0.25 50.64 ? 15  GLU A CG  3 
ATOM   5660  C  CD  . GLU A 1 15  ? -3.142  77.783  -14.281 0.25 53.85 ? 15  GLU A CD  3 
ATOM   5661  O  OE1 . GLU A 1 15  ? -2.557  76.788  -13.809 0.25 57.30 ? 15  GLU A OE1 3 
ATOM   5662  O  OE2 . GLU A 1 15  ? -4.169  77.698  -14.986 0.25 57.02 ? 15  GLU A OE2 3 
ATOM   5663  N  N   . SER A 1 16  ? 0.809   81.088  -12.266 0.25 26.90 ? 16  SER A N   3 
ATOM   5664  C  CA  . SER A 1 16  ? 1.108   81.266  -10.848 0.25 24.95 ? 16  SER A CA  3 
ATOM   5665  C  C   . SER A 1 16  ? 1.597   82.676  -10.556 0.25 21.31 ? 16  SER A C   3 
ATOM   5666  O  O   . SER A 1 16  ? 1.806   83.473  -11.466 0.25 20.40 ? 16  SER A O   3 
ATOM   5667  C  CB  . SER A 1 16  ? 2.183   80.270  -10.408 0.25 24.48 ? 16  SER A CB  3 
ATOM   5668  O  OG  . SER A 1 16  ? 1.752   78.936  -10.597 0.25 26.96 ? 16  SER A OG  3 
ATOM   5669  N  N   . PHE A 1 17  ? 1.766   82.982  -9.274  0.25 18.65 ? 17  PHE A N   3 
ATOM   5670  C  CA  . PHE A 1 17  ? 2.271   84.285  -8.855  0.25 15.39 ? 17  PHE A CA  3 
ATOM   5671  C  C   . PHE A 1 17  ? 2.946   84.119  -7.501  0.25 14.22 ? 17  PHE A C   3 
ATOM   5672  O  O   . PHE A 1 17  ? 2.689   83.142  -6.793  0.25 12.28 ? 17  PHE A O   3 
ATOM   5673  C  CB  . PHE A 1 17  ? 1.146   85.330  -8.763  0.25 12.81 ? 17  PHE A CB  3 
ATOM   5674  C  CG  . PHE A 1 17  ? 0.223   85.143  -7.589  0.25 13.77 ? 17  PHE A CG  3 
ATOM   5675  C  CD1 . PHE A 1 17  ? -0.837  84.246  -7.651  0.25 12.74 ? 17  PHE A CD1 3 
ATOM   5676  C  CD2 . PHE A 1 17  ? 0.416   85.869  -6.417  0.25 12.71 ? 17  PHE A CD2 3 
ATOM   5677  C  CE1 . PHE A 1 17  ? -1.690  84.079  -6.563  0.25 10.96 ? 17  PHE A CE1 3 
ATOM   5678  C  CE2 . PHE A 1 17  ? -0.431  85.705  -5.328  0.25 11.04 ? 17  PHE A CE2 3 
ATOM   5679  C  CZ  . PHE A 1 17  ? -1.484  84.812  -5.400  0.25 12.51 ? 17  PHE A CZ  3 
ATOM   5680  N  N   . LEU A 1 18  ? 3.814   85.069  -7.154  0.25 10.68 ? 18  LEU A N   3 
ATOM   5681  C  CA  . LEU A 1 18  ? 4.536   85.024  -5.895  0.25 10.59 ? 18  LEU A CA  3 
ATOM   5682  C  C   . LEU A 1 18  ? 4.034   86.092  -4.926  0.25 10.17 ? 18  LEU A C   3 
ATOM   5683  O  O   . LEU A 1 18  ? 3.888   87.265  -5.283  0.25 9.12  ? 18  LEU A O   3 
ATOM   5684  C  CB  . LEU A 1 18  ? 6.037   85.196  -6.145  0.25 9.93  ? 18  LEU A CB  3 
ATOM   5685  C  CG  . LEU A 1 18  ? 6.631   84.226  -7.176  0.25 9.21  ? 18  LEU A CG  3 
ATOM   5686  C  CD1 . LEU A 1 18  ? 8.101   84.537  -7.383  0.25 11.17 ? 18  LEU A CD1 3 
ATOM   5687  C  CD2 . LEU A 1 18  ? 6.433   82.789  -6.711  0.25 11.91 ? 18  LEU A CD2 3 
ATOM   5688  N  N   . TYR A 1 19  ? 3.771   85.654  -3.701  0.25 7.49  ? 19  TYR A N   3 
ATOM   5689  C  CA  . TYR A 1 19  ? 3.270   86.500  -2.628  0.25 8.69  ? 19  TYR A CA  3 
ATOM   5690  C  C   . TYR A 1 19  ? 4.306   86.626  -1.514  0.25 8.28  ? 19  TYR A C   3 
ATOM   5691  O  O   . TYR A 1 19  ? 4.807   85.620  -1.012  0.25 8.61  ? 19  TYR A O   3 
ATOM   5692  C  CB  . TYR A 1 19  ? 1.973   85.894  -2.080  0.25 7.02  ? 19  TYR A CB  3 
ATOM   5693  C  CG  . TYR A 1 19  ? 1.616   86.319  -0.670  0.25 9.05  ? 19  TYR A CG  3 
ATOM   5694  C  CD1 . TYR A 1 19  ? 1.512   87.670  -0.325  0.25 7.30  ? 19  TYR A CD1 3 
ATOM   5695  C  CD2 . TYR A 1 19  ? 1.379   85.363  0.323   0.25 5.71  ? 19  TYR A CD2 3 
ATOM   5696  C  CE1 . TYR A 1 19  ? 1.182   88.057  0.986   0.25 8.74  ? 19  TYR A CE1 3 
ATOM   5697  C  CE2 . TYR A 1 19  ? 1.048   85.738  1.625   0.25 10.81 ? 19  TYR A CE2 3 
ATOM   5698  C  CZ  . TYR A 1 19  ? 0.953   87.081  1.951   0.25 7.69  ? 19  TYR A CZ  3 
ATOM   5699  O  OH  . TYR A 1 19  ? 0.640   87.438  3.245   0.25 11.92 ? 19  TYR A OH  3 
ATOM   5700  N  N   . PHE A 1 20  ? 4.616   87.862  -1.128  0.25 6.80  ? 20  PHE A N   3 
ATOM   5701  C  CA  . PHE A 1 20  ? 5.597   88.125  -0.071  0.25 8.30  ? 20  PHE A CA  3 
ATOM   5702  C  C   . PHE A 1 20  ? 4.881   88.393  1.247   0.25 8.73  ? 20  PHE A C   3 
ATOM   5703  O  O   . PHE A 1 20  ? 4.286   89.459  1.437   0.25 8.98  ? 20  PHE A O   3 
ATOM   5704  C  CB  . PHE A 1 20  ? 6.461   89.343  -0.435  0.25 8.10  ? 20  PHE A CB  3 
ATOM   5705  C  CG  . PHE A 1 20  ? 7.498   89.696  0.607   0.25 8.22  ? 20  PHE A CG  3 
ATOM   5706  C  CD1 . PHE A 1 20  ? 8.633   88.908  0.776   0.25 8.02  ? 20  PHE A CD1 3 
ATOM   5707  C  CD2 . PHE A 1 20  ? 7.343   90.825  1.409   0.25 6.41  ? 20  PHE A CD2 3 
ATOM   5708  C  CE1 . PHE A 1 20  ? 9.603   89.238  1.724   0.25 9.04  ? 20  PHE A CE1 3 
ATOM   5709  C  CE2 . PHE A 1 20  ? 8.311   91.165  2.366   0.25 7.85  ? 20  PHE A CE2 3 
ATOM   5710  C  CZ  . PHE A 1 20  ? 9.442   90.370  2.521   0.25 10.45 ? 20  PHE A CZ  3 
ATOM   5711  N  N   . ALA A 1 21  ? 4.940   87.419  2.150   0.25 9.43  ? 21  ALA A N   3 
ATOM   5712  C  CA  . ALA A 1 21  ? 4.303   87.528  3.459   0.25 7.81  ? 21  ALA A CA  3 
ATOM   5713  C  C   . ALA A 1 21  ? 5.326   88.011  4.480   0.25 8.80  ? 21  ALA A C   3 
ATOM   5714  O  O   . ALA A 1 21  ? 6.475   87.576  4.466   0.25 7.47  ? 21  ALA A O   3 
ATOM   5715  C  CB  . ALA A 1 21  ? 3.750   86.172  3.881   0.25 8.40  ? 21  ALA A CB  3 
ATOM   5716  N  N   . TYR A 1 22  ? 4.905   88.906  5.368   0.25 8.52  ? 22  TYR A N   3 
ATOM   5717  C  CA  . TYR A 1 22  ? 5.803   89.441  6.382   0.25 10.15 ? 22  TYR A CA  3 
ATOM   5718  C  C   . TYR A 1 22  ? 5.136   89.485  7.750   0.25 10.96 ? 22  TYR A C   3 
ATOM   5719  O  O   . TYR A 1 22  ? 5.764   89.866  8.733   0.25 9.62  ? 22  TYR A O   3 
ATOM   5720  C  CB  . TYR A 1 22  ? 6.277   90.843  5.971   0.25 10.71 ? 22  TYR A CB  3 
ATOM   5721  C  CG  . TYR A 1 22  ? 5.158   91.837  5.738   0.25 7.84  ? 22  TYR A CG  3 
ATOM   5722  C  CD1 . TYR A 1 22  ? 4.488   92.426  6.809   0.25 10.14 ? 22  TYR A CD1 3 
ATOM   5723  C  CD2 . TYR A 1 22  ? 4.770   92.189  4.446   0.25 4.90  ? 22  TYR A CD2 3 
ATOM   5724  C  CE1 . TYR A 1 22  ? 3.460   93.347  6.602   0.25 8.32  ? 22  TYR A CE1 3 
ATOM   5725  C  CE2 . TYR A 1 22  ? 3.740   93.110  4.227   0.25 7.30  ? 22  TYR A CE2 3 
ATOM   5726  C  CZ  . TYR A 1 22  ? 3.095   93.684  5.311   0.25 8.40  ? 22  TYR A CZ  3 
ATOM   5727  O  OH  . TYR A 1 22  ? 2.100   94.612  5.115   0.25 8.23  ? 22  TYR A OH  3 
ATOM   5728  N  N   . GLY A 1 23  ? 3.866   89.078  7.800   0.25 11.54 ? 23  GLY A N   3 
ATOM   5729  C  CA  . GLY A 1 23  ? 3.115   89.076  9.048   0.25 11.08 ? 23  GLY A CA  3 
ATOM   5730  C  C   . GLY A 1 23  ? 2.707   87.692  9.536   0.25 10.29 ? 23  GLY A C   3 
ATOM   5731  O  O   . GLY A 1 23  ? 3.522   86.768  9.544   0.25 11.79 ? 23  GLY A O   3 
ATOM   5732  N  N   . SER A 1 24  ? 1.446   87.534  9.935   0.25 8.80  ? 24  SER A N   3 
ATOM   5733  C  CA  . SER A 1 24  ? 0.988   86.242  10.435  0.25 11.06 ? 24  SER A CA  3 
ATOM   5734  C  C   . SER A 1 24  ? 1.069   85.144  9.377   0.25 12.03 ? 24  SER A C   3 
ATOM   5735  O  O   . SER A 1 24  ? 0.973   83.962  9.708   0.25 10.68 ? 24  SER A O   3 
ATOM   5736  C  CB  . SER A 1 24  ? -0.443  86.334  11.001  0.25 9.46  ? 24  SER A CB  3 
ATOM   5737  O  OG  . SER A 1 24  ? -1.375  86.787  10.036  0.25 10.74 ? 24  SER A OG  3 
ATOM   5738  N  N   . ASN A 1 25  ? 1.252   85.518  8.109   0.25 12.19 ? 25  ASN A N   3 
ATOM   5739  C  CA  . ASN A 1 25  ? 1.361   84.501  7.068   0.25 10.53 ? 25  ASN A CA  3 
ATOM   5740  C  C   . ASN A 1 25  ? 2.795   84.020  6.859   0.25 11.42 ? 25  ASN A C   3 
ATOM   5741  O  O   . ASN A 1 25  ? 3.141   83.484  5.805   0.25 9.41  ? 25  ASN A O   3 
ATOM   5742  C  CB  . ASN A 1 25  ? 0.756   84.977  5.739   0.25 10.58 ? 25  ASN A CB  3 
ATOM   5743  C  CG  . ASN A 1 25  ? -0.770  84.986  5.766   0.25 11.12 ? 25  ASN A CG  3 
ATOM   5744  O  OD1 . ASN A 1 25  ? -1.400  84.143  6.418   0.25 13.10 ? 25  ASN A OD1 3 
ATOM   5745  N  ND2 . ASN A 1 25  ? -1.370  85.930  5.047   0.25 12.31 ? 25  ASN A ND2 3 
ATOM   5746  N  N   . LEU A 1 26  ? 3.629   84.231  7.871   0.25 11.79 ? 26  LEU A N   3 
ATOM   5747  C  CA  . LEU A 1 26  ? 5.003   83.746  7.842   0.25 13.07 ? 26  LEU A CA  3 
ATOM   5748  C  C   . LEU A 1 26  ? 4.907   82.294  8.301   0.25 12.89 ? 26  LEU A C   3 
ATOM   5749  O  O   . LEU A 1 26  ? 5.761   81.464  7.982   0.25 12.18 ? 26  LEU A O   3 
ATOM   5750  C  CB  . LEU A 1 26  ? 5.883   84.508  8.838   0.25 11.86 ? 26  LEU A CB  3 
ATOM   5751  C  CG  . LEU A 1 26  ? 6.394   85.908  8.498   0.25 10.48 ? 26  LEU A CG  3 
ATOM   5752  C  CD1 . LEU A 1 26  ? 7.141   86.481  9.699   0.25 10.35 ? 26  LEU A CD1 3 
ATOM   5753  C  CD2 . LEU A 1 26  ? 7.311   85.837  7.284   0.25 11.18 ? 26  LEU A CD2 3 
ATOM   5754  N  N   . LEU A 1 27  ? 3.846   82.012  9.055   0.25 12.24 ? 27  LEU A N   3 
ATOM   5755  C  CA  . LEU A 1 27  ? 3.586   80.685  9.615   0.25 14.25 ? 27  LEU A CA  3 
ATOM   5756  C  C   . LEU A 1 27  ? 2.771   79.834  8.649   0.25 13.47 ? 27  LEU A C   3 
ATOM   5757  O  O   . LEU A 1 27  ? 1.632   80.165  8.320   0.25 11.63 ? 27  LEU A O   3 
ATOM   5758  C  CB  . LEU A 1 27  ? 2.838   80.821  10.948  0.25 12.05 ? 27  LEU A CB  3 
ATOM   5759  C  CG  . LEU A 1 27  ? 2.552   79.537  11.737  0.25 13.29 ? 27  LEU A CG  3 
ATOM   5760  C  CD1 . LEU A 1 27  ? 3.865   78.878  12.145  0.25 12.99 ? 27  LEU A CD1 3 
ATOM   5761  C  CD2 . LEU A 1 27  ? 1.723   79.870  12.968  0.25 13.82 ? 27  LEU A CD2 3 
ATOM   5762  N  N   . THR A 1 28  ? 3.366   78.733  8.206   0.25 15.21 ? 28  THR A N   3 
ATOM   5763  C  CA  . THR A 1 28  ? 2.731   77.820  7.256   0.25 16.13 ? 28  THR A CA  3 
ATOM   5764  C  C   . THR A 1 28  ? 1.339   77.369  7.666   0.25 16.19 ? 28  THR A C   3 
ATOM   5765  O  O   . THR A 1 28  ? 0.428   77.312  6.839   0.25 14.41 ? 28  THR A O   3 
ATOM   5766  C  CB  . THR A 1 28  ? 3.598   76.577  7.044   0.25 16.53 ? 28  THR A CB  3 
ATOM   5767  O  OG1 . THR A 1 28  ? 4.911   76.986  6.651   0.25 14.60 ? 28  THR A OG1 3 
ATOM   5768  C  CG2 . THR A 1 28  ? 3.007   75.688  5.956   0.25 16.73 ? 28  THR A CG2 3 
ATOM   5769  N  N   . GLU A 1 29  ? 1.182   77.035  8.942   0.25 17.56 ? 29  GLU A N   3 
ATOM   5770  C  CA  . GLU A 1 29  ? -0.104  76.587  9.453   0.25 19.82 ? 29  GLU A CA  3 
ATOM   5771  C  C   . GLU A 1 29  ? -1.153  77.683  9.317   0.25 19.77 ? 29  GLU A C   3 
ATOM   5772  O  O   . GLU A 1 29  ? -2.305  77.412  8.969   0.25 19.31 ? 29  GLU A O   3 
ATOM   5773  C  CB  . GLU A 1 29  ? 0.019   76.177  10.925  0.25 21.91 ? 29  GLU A CB  3 
ATOM   5774  C  CG  . GLU A 1 29  ? 0.807   74.894  11.170  0.25 26.87 ? 29  GLU A CG  3 
ATOM   5775  C  CD  . GLU A 1 29  ? 2.241   74.969  10.675  0.25 28.12 ? 29  GLU A CD  3 
ATOM   5776  O  OE1 . GLU A 1 29  ? 2.918   75.988  10.934  0.25 26.36 ? 29  GLU A OE1 3 
ATOM   5777  O  OE2 . GLU A 1 29  ? 2.697   73.998  10.035  0.25 30.50 ? 29  GLU A OE2 3 
ATOM   5778  N  N   . ARG A 1 30  ? -0.755  78.921  9.598   0.25 17.80 ? 30  ARG A N   3 
ATOM   5779  C  CA  . ARG A 1 30  ? -1.675  80.047  9.506   0.25 18.25 ? 30  ARG A CA  3 
ATOM   5780  C  C   . ARG A 1 30  ? -2.124  80.333  8.077   0.25 16.55 ? 30  ARG A C   3 
ATOM   5781  O  O   . ARG A 1 30  ? -3.319  80.398  7.805   0.25 17.13 ? 30  ARG A O   3 
ATOM   5782  C  CB  . ARG A 1 30  ? -1.040  81.304  10.114  0.25 20.96 ? 30  ARG A CB  3 
ATOM   5783  C  CG  . ARG A 1 30  ? -1.750  82.600  9.739   0.25 22.64 ? 30  ARG A CG  3 
ATOM   5784  C  CD  . ARG A 1 30  ? -3.174  82.649  10.259  0.25 26.76 ? 30  ARG A CD  3 
ATOM   5785  N  NE  . ARG A 1 30  ? -3.881  83.820  9.748   0.25 27.51 ? 30  ARG A NE  3 
ATOM   5786  C  CZ  . ARG A 1 30  ? -5.097  84.199  10.134  0.25 30.16 ? 30  ARG A CZ  3 
ATOM   5787  N  NH1 . ARG A 1 30  ? -5.765  83.502  11.047  0.25 29.11 ? 30  ARG A NH1 3 
ATOM   5788  N  NH2 . ARG A 1 30  ? -5.647  85.282  9.602   0.25 29.97 ? 30  ARG A NH2 3 
ATOM   5789  N  N   . ILE A 1 31  ? -1.178  80.507  7.159   0.25 15.12 ? 31  ILE A N   3 
ATOM   5790  C  CA  . ILE A 1 31  ? -1.548  80.794  5.779   0.25 13.63 ? 31  ILE A CA  3 
ATOM   5791  C  C   . ILE A 1 31  ? -2.346  79.650  5.149   0.25 14.48 ? 31  ILE A C   3 
ATOM   5792  O  O   . ILE A 1 31  ? -3.175  79.879  4.269   0.25 14.66 ? 31  ILE A O   3 
ATOM   5793  C  CB  . ILE A 1 31  ? -0.304  81.097  4.899   0.25 14.15 ? 31  ILE A CB  3 
ATOM   5794  C  CG1 . ILE A 1 31  ? -0.750  81.607  3.525   0.25 12.85 ? 31  ILE A CG1 3 
ATOM   5795  C  CG2 . ILE A 1 31  ? 0.553   79.857  4.749   0.25 13.31 ? 31  ILE A CG2 3 
ATOM   5796  C  CD1 . ILE A 1 31  ? 0.403   81.982  2.600   0.25 9.15  ? 31  ILE A CD1 3 
ATOM   5797  N  N   . HIS A 1 32  ? -2.111  78.424  5.607   0.25 14.86 ? 32  HIS A N   3 
ATOM   5798  C  CA  . HIS A 1 32  ? -2.823  77.273  5.058   0.25 15.69 ? 32  HIS A CA  3 
ATOM   5799  C  C   . HIS A 1 32  ? -4.285  77.162  5.491   0.25 16.98 ? 32  HIS A C   3 
ATOM   5800  O  O   . HIS A 1 32  ? -5.055  76.405  4.896   0.25 17.07 ? 32  HIS A O   3 
ATOM   5801  C  CB  . HIS A 1 32  ? -2.073  75.978  5.392   0.25 16.59 ? 32  HIS A CB  3 
ATOM   5802  C  CG  . HIS A 1 32  ? -0.953  75.673  4.443   0.25 17.17 ? 32  HIS A CG  3 
ATOM   5803  N  ND1 . HIS A 1 32  ? -0.066  74.638  4.643   0.25 16.14 ? 32  HIS A ND1 3 
ATOM   5804  C  CD2 . HIS A 1 32  ? -0.592  76.257  3.274   0.25 14.90 ? 32  HIS A CD2 3 
ATOM   5805  C  CE1 . HIS A 1 32  ? 0.793   74.596  3.638   0.25 17.20 ? 32  HIS A CE1 3 
ATOM   5806  N  NE2 . HIS A 1 32  ? 0.496   75.568  2.795   0.25 17.94 ? 32  HIS A NE2 3 
ATOM   5807  N  N   . LEU A 1 33  ? -4.673  77.914  6.517   0.25 17.81 ? 33  LEU A N   3 
ATOM   5808  C  CA  . LEU A 1 33  ? -6.058  77.883  6.982   0.25 20.28 ? 33  LEU A CA  3 
ATOM   5809  C  C   . LEU A 1 33  ? -6.985  78.283  5.837   0.25 19.39 ? 33  LEU A C   3 
ATOM   5810  O  O   . LEU A 1 33  ? -7.885  77.532  5.458   0.25 20.09 ? 33  LEU A O   3 
ATOM   5811  C  CB  . LEU A 1 33  ? -6.258  78.849  8.157   0.25 22.46 ? 33  LEU A CB  3 
ATOM   5812  C  CG  . LEU A 1 33  ? -5.549  78.520  9.474   0.25 26.16 ? 33  LEU A CG  3 
ATOM   5813  C  CD1 . LEU A 1 33  ? -5.832  79.611  10.498  0.25 27.94 ? 33  LEU A CD1 3 
ATOM   5814  C  CD2 . LEU A 1 33  ? -6.033  77.168  9.991   0.25 27.14 ? 33  LEU A CD2 3 
ATOM   5815  N  N   . ARG A 1 34  ? -6.755  79.472  5.286   0.25 18.56 ? 34  ARG A N   3 
ATOM   5816  C  CA  . ARG A 1 34  ? -7.568  79.982  4.185   0.25 18.17 ? 34  ARG A CA  3 
ATOM   5817  C  C   . ARG A 1 34  ? -6.927  79.698  2.826   0.25 18.21 ? 34  ARG A C   3 
ATOM   5818  O  O   . ARG A 1 34  ? -7.583  79.819  1.789   0.25 16.41 ? 34  ARG A O   3 
ATOM   5819  C  CB  . ARG A 1 34  ? -7.774  81.495  4.339   0.25 20.68 ? 34  ARG A CB  3 
ATOM   5820  C  CG  . ARG A 1 34  ? -8.504  81.921  5.612   0.25 22.66 ? 34  ARG A CG  3 
ATOM   5821  C  CD  . ARG A 1 34  ? -10.005 81.669  5.527   0.25 24.93 ? 34  ARG A CD  3 
ATOM   5822  N  NE  . ARG A 1 34  ? -10.679 82.615  4.636   0.25 29.04 ? 34  ARG A NE  3 
ATOM   5823  C  CZ  . ARG A 1 34  ? -10.860 83.905  4.908   0.25 28.73 ? 34  ARG A CZ  3 
ATOM   5824  N  NH1 . ARG A 1 34  ? -10.420 84.415  6.054   0.25 30.01 ? 34  ARG A NH1 3 
ATOM   5825  N  NH2 . ARG A 1 34  ? -11.483 84.688  4.035   0.25 26.94 ? 34  ARG A NH2 3 
ATOM   5826  N  N   . ASN A 1 35  ? -5.647  79.328  2.827   0.25 15.04 ? 35  ASN A N   3 
ATOM   5827  C  CA  . ASN A 1 35  ? -4.937  79.056  1.575   0.25 16.03 ? 35  ASN A CA  3 
ATOM   5828  C  C   . ASN A 1 35  ? -4.091  77.798  1.713   0.25 17.25 ? 35  ASN A C   3 
ATOM   5829  O  O   . ASN A 1 35  ? -2.862  77.852  1.636   0.25 15.13 ? 35  ASN A O   3 
ATOM   5830  C  CB  . ASN A 1 35  ? -4.033  80.237  1.230   0.25 16.15 ? 35  ASN A CB  3 
ATOM   5831  C  CG  . ASN A 1 35  ? -4.780  81.549  1.215   0.25 14.78 ? 35  ASN A CG  3 
ATOM   5832  O  OD1 . ASN A 1 35  ? -5.507  81.846  0.274   0.25 16.44 ? 35  ASN A OD1 3 
ATOM   5833  N  ND2 . ASN A 1 35  ? -4.615  82.339  2.271   0.25 13.13 ? 35  ASN A ND2 3 
ATOM   5834  N  N   . PRO A 1 36  ? -4.743  76.643  1.908   0.25 17.37 ? 36  PRO A N   3 
ATOM   5835  C  CA  . PRO A 1 36  ? -4.024  75.378  2.061   0.25 17.00 ? 36  PRO A CA  3 
ATOM   5836  C  C   . PRO A 1 36  ? -3.140  74.958  0.891   0.25 16.33 ? 36  PRO A C   3 
ATOM   5837  O  O   . PRO A 1 36  ? -2.260  74.122  1.064   0.25 18.56 ? 36  PRO A O   3 
ATOM   5838  C  CB  . PRO A 1 36  ? -5.147  74.380  2.349   0.25 17.62 ? 36  PRO A CB  3 
ATOM   5839  C  CG  . PRO A 1 36  ? -6.309  74.956  1.605   0.25 17.20 ? 36  PRO A CG  3 
ATOM   5840  C  CD  . PRO A 1 36  ? -6.200  76.426  1.940   0.25 18.02 ? 36  PRO A CD  3 
ATOM   5841  N  N   . SER A 1 37  ? -3.350  75.537  -0.289  0.25 18.48 ? 37  SER A N   3 
ATOM   5842  C  CA  . SER A 1 37  ? -2.535  75.164  -1.448  0.25 18.40 ? 37  SER A CA  3 
ATOM   5843  C  C   . SER A 1 37  ? -1.264  76.001  -1.617  0.25 18.47 ? 37  SER A C   3 
ATOM   5844  O  O   . SER A 1 37  ? -0.496  75.784  -2.558  0.25 18.42 ? 37  SER A O   3 
ATOM   5845  C  CB  . SER A 1 37  ? -3.362  75.235  -2.741  0.25 20.27 ? 37  SER A CB  3 
ATOM   5846  O  OG  . SER A 1 37  ? -3.584  76.572  -3.142  0.25 22.88 ? 37  SER A OG  3 
ATOM   5847  N  N   . ALA A 1 38  ? -1.036  76.953  -0.715  0.25 17.07 ? 38  ALA A N   3 
ATOM   5848  C  CA  . ALA A 1 38  ? 0.157   77.793  -0.798  0.25 15.61 ? 38  ALA A CA  3 
ATOM   5849  C  C   . ALA A 1 38  ? 1.399   76.928  -0.602  0.25 15.81 ? 38  ALA A C   3 
ATOM   5850  O  O   . ALA A 1 38  ? 1.400   76.018  0.228   0.25 17.19 ? 38  ALA A O   3 
ATOM   5851  C  CB  . ALA A 1 38  ? 0.110   78.887  0.264   0.25 16.31 ? 38  ALA A CB  3 
ATOM   5852  N  N   . ALA A 1 39  ? 2.449   77.214  -1.369  0.25 14.11 ? 39  ALA A N   3 
ATOM   5853  C  CA  . ALA A 1 39  ? 3.694   76.464  -1.280  0.25 13.64 ? 39  ALA A CA  3 
ATOM   5854  C  C   . ALA A 1 39  ? 4.871   77.373  -0.962  0.25 14.42 ? 39  ALA A C   3 
ATOM   5855  O  O   . ALA A 1 39  ? 5.081   78.397  -1.624  0.25 14.28 ? 39  ALA A O   3 
ATOM   5856  C  CB  . ALA A 1 39  ? 3.955   75.714  -2.596  0.25 13.46 ? 39  ALA A CB  3 
ATOM   5857  N  N   . PHE A 1 40  ? 5.634   77.004  0.063   0.25 13.93 ? 40  PHE A N   3 
ATOM   5858  C  CA  . PHE A 1 40  ? 6.808   77.781  0.448   0.25 13.15 ? 40  PHE A CA  3 
ATOM   5859  C  C   . PHE A 1 40  ? 7.673   77.912  -0.793  0.25 14.55 ? 40  PHE A C   3 
ATOM   5860  O  O   . PHE A 1 40  ? 7.882   76.933  -1.515  0.25 13.90 ? 40  PHE A O   3 
ATOM   5861  C  CB  . PHE A 1 40  ? 7.602   77.057  1.544   0.25 13.61 ? 40  PHE A CB  3 
ATOM   5862  C  CG  . PHE A 1 40  ? 8.924   77.713  1.874   0.25 14.98 ? 40  PHE A CG  3 
ATOM   5863  C  CD1 . PHE A 1 40  ? 8.978   78.830  2.701   0.25 13.12 ? 40  PHE A CD1 3 
ATOM   5864  C  CD2 . PHE A 1 40  ? 10.110  77.225  1.333   0.25 13.45 ? 40  PHE A CD2 3 
ATOM   5865  C  CE1 . PHE A 1 40  ? 10.199  79.457  2.988   0.25 15.04 ? 40  PHE A CE1 3 
ATOM   5866  C  CE2 . PHE A 1 40  ? 11.333  77.841  1.612   0.25 16.24 ? 40  PHE A CE2 3 
ATOM   5867  C  CZ  . PHE A 1 40  ? 11.376  78.961  2.441   0.25 13.93 ? 40  PHE A CZ  3 
ATOM   5868  N  N   . PHE A 1 41  ? 8.167   79.117  -1.049  0.25 14.03 ? 41  PHE A N   3 
ATOM   5869  C  CA  . PHE A 1 41  ? 9.007   79.336  -2.210  0.25 15.67 ? 41  PHE A CA  3 
ATOM   5870  C  C   . PHE A 1 41  ? 10.398  79.746  -1.763  0.25 15.00 ? 41  PHE A C   3 
ATOM   5871  O  O   . PHE A 1 41  ? 11.394  79.220  -2.261  0.25 14.64 ? 41  PHE A O   3 
ATOM   5872  C  CB  . PHE A 1 41  ? 8.414   80.413  -3.117  0.25 15.91 ? 41  PHE A CB  3 
ATOM   5873  C  CG  . PHE A 1 41  ? 9.062   80.477  -4.467  0.25 14.97 ? 41  PHE A CG  3 
ATOM   5874  C  CD1 . PHE A 1 41  ? 8.907   79.435  -5.373  0.25 18.19 ? 41  PHE A CD1 3 
ATOM   5875  C  CD2 . PHE A 1 41  ? 9.839   81.567  -4.829  0.25 14.87 ? 41  PHE A CD2 3 
ATOM   5876  C  CE1 . PHE A 1 41  ? 9.518   79.475  -6.627  0.25 19.27 ? 41  PHE A CE1 3 
ATOM   5877  C  CE2 . PHE A 1 41  ? 10.455  81.620  -6.078  0.25 18.36 ? 41  PHE A CE2 3 
ATOM   5878  C  CZ  . PHE A 1 41  ? 10.295  80.571  -6.979  0.25 18.62 ? 41  PHE A CZ  3 
ATOM   5879  N  N   . CYS A 1 42  ? 10.472  80.682  -0.819  0.25 13.58 ? 42  CYS A N   3 
ATOM   5880  C  CA  . CYS A 1 42  ? 11.771  81.121  -0.320  0.25 12.82 ? 42  CYS A CA  3 
ATOM   5881  C  C   . CYS A 1 42  ? 11.691  82.149  0.799   0.25 14.37 ? 42  CYS A C   3 
ATOM   5882  O  O   . CYS A 1 42  ? 10.627  82.698  1.098   0.25 12.14 ? 42  CYS A O   3 
ATOM   5883  C  CB  . CYS A 1 42  ? 12.601  81.715  -1.458  0.25 14.01 ? 42  CYS A CB  3 
ATOM   5884  S  SG  . CYS A 1 42  ? 12.039  83.348  -1.976  0.25 18.41 ? 42  CYS A SG  3 
ATOM   5885  N  N   . VAL A 1 43  ? 12.839  82.394  1.419   0.25 13.16 ? 43  VAL A N   3 
ATOM   5886  C  CA  . VAL A 1 43  ? 12.958  83.384  2.477   0.25 12.93 ? 43  VAL A CA  3 
ATOM   5887  C  C   . VAL A 1 43  ? 13.675  84.576  1.845   0.25 12.53 ? 43  VAL A C   3 
ATOM   5888  O  O   . VAL A 1 43  ? 14.804  84.441  1.378   0.25 11.21 ? 43  VAL A O   3 
ATOM   5889  C  CB  . VAL A 1 43  ? 13.806  82.851  3.645   0.25 15.00 ? 43  VAL A CB  3 
ATOM   5890  C  CG1 . VAL A 1 43  ? 14.223  83.994  4.541   0.25 13.78 ? 43  VAL A CG1 3 
ATOM   5891  C  CG2 . VAL A 1 43  ? 13.014  81.811  4.428   0.25 11.47 ? 43  VAL A CG2 3 
ATOM   5892  N  N   . ALA A 1 44  ? 13.026  85.735  1.838   0.25 10.29 ? 44  ALA A N   3 
ATOM   5893  C  CA  . ALA A 1 44  ? 13.614  86.926  1.234   0.25 12.88 ? 44  ALA A CA  3 
ATOM   5894  C  C   . ALA A 1 44  ? 13.505  88.173  2.101   0.25 12.27 ? 44  ALA A C   3 
ATOM   5895  O  O   . ALA A 1 44  ? 12.666  88.255  2.999   0.25 10.18 ? 44  ALA A O   3 
ATOM   5896  C  CB  . ALA A 1 44  ? 12.968  87.190  -0.120  0.25 10.34 ? 44  ALA A CB  3 
ATOM   5897  N  N   . ARG A 1 45  ? 14.355  89.148  1.796   0.25 13.97 ? 45  ARG A N   3 
ATOM   5898  C  CA  . ARG A 1 45  ? 14.405  90.412  2.519   0.25 15.84 ? 45  ARG A CA  3 
ATOM   5899  C  C   . ARG A 1 45  ? 14.026  91.604  1.641   0.25 13.37 ? 45  ARG A C   3 
ATOM   5900  O  O   . ARG A 1 45  ? 14.609  91.810  0.581   0.25 12.89 ? 45  ARG A O   3 
ATOM   5901  C  CB  . ARG A 1 45  ? 15.819  90.623  3.082   0.25 18.46 ? 45  ARG A CB  3 
ATOM   5902  C  CG  . ARG A 1 45  ? 16.218  92.084  3.264   0.25 24.67 ? 45  ARG A CG  3 
ATOM   5903  C  CD  . ARG A 1 45  ? 17.595  92.214  3.906   0.25 33.14 ? 45  ARG A CD  3 
ATOM   5904  N  NE  . ARG A 1 45  ? 18.628  91.494  3.166   0.25 39.46 ? 45  ARG A NE  3 
ATOM   5905  C  CZ  . ARG A 1 45  ? 19.883  91.354  3.582   0.25 42.51 ? 45  ARG A CZ  3 
ATOM   5906  N  NH1 . ARG A 1 45  ? 20.267  91.884  4.734   0.25 47.06 ? 45  ARG A NH1 3 
ATOM   5907  N  NH2 . ARG A 1 45  ? 20.755  90.675  2.850   0.25 46.60 ? 45  ARG A NH2 3 
ATOM   5908  N  N   . LEU A 1 46  ? 13.040  92.381  2.081   0.25 12.22 ? 46  LEU A N   3 
ATOM   5909  C  CA  . LEU A 1 46  ? 12.626  93.573  1.347   0.25 12.37 ? 46  LEU A CA  3 
ATOM   5910  C  C   . LEU A 1 46  ? 13.558  94.666  1.852   0.25 12.85 ? 46  LEU A C   3 
ATOM   5911  O  O   . LEU A 1 46  ? 13.684  94.864  3.062   0.25 12.62 ? 46  LEU A O   3 
ATOM   5912  C  CB  . LEU A 1 46  ? 11.170  93.934  1.670   0.25 10.96 ? 46  LEU A CB  3 
ATOM   5913  C  CG  . LEU A 1 46  ? 10.562  95.148  0.954   0.25 11.24 ? 46  LEU A CG  3 
ATOM   5914  C  CD1 . LEU A 1 46  ? 10.615  94.959  -0.559  0.25 12.91 ? 46  LEU A CD1 3 
ATOM   5915  C  CD2 . LEU A 1 46  ? 9.113   95.324  1.406   0.25 11.10 ? 46  LEU A CD2 3 
ATOM   5916  N  N   . GLN A 1 47  ? 14.217  95.373  0.941   0.25 13.83 ? 47  GLN A N   3 
ATOM   5917  C  CA  . GLN A 1 47  ? 15.147  96.414  1.360   0.25 14.12 ? 47  GLN A CA  3 
ATOM   5918  C  C   . GLN A 1 47  ? 14.539  97.806  1.429   0.25 13.15 ? 47  GLN A C   3 
ATOM   5919  O  O   . GLN A 1 47  ? 13.756  98.206  0.570   0.25 11.23 ? 47  GLN A O   3 
ATOM   5920  C  CB  . GLN A 1 47  ? 16.368  96.447  0.438   0.25 13.23 ? 47  GLN A CB  3 
ATOM   5921  C  CG  . GLN A 1 47  ? 17.491  97.364  0.934   0.25 14.22 ? 47  GLN A CG  3 
ATOM   5922  C  CD  . GLN A 1 47  ? 18.136  96.878  2.232   0.25 15.54 ? 47  GLN A CD  3 
ATOM   5923  O  OE1 . GLN A 1 47  ? 18.593  95.734  2.322   0.25 14.80 ? 47  GLN A OE1 3 
ATOM   5924  N  NE2 . GLN A 1 47  ? 18.186  97.753  3.238   0.25 13.69 ? 47  GLN A NE2 3 
ATOM   5925  N  N   . ASP A 1 48  ? 14.910  98.532  2.476   0.25 13.38 ? 48  ASP A N   3 
ATOM   5926  C  CA  . ASP A 1 48  ? 14.456  99.897  2.680   0.25 13.10 ? 48  ASP A CA  3 
ATOM   5927  C  C   . ASP A 1 48  ? 12.990  100.064 3.077   0.25 12.07 ? 48  ASP A C   3 
ATOM   5928  O  O   . ASP A 1 48  ? 12.349  101.044 2.706   0.25 12.26 ? 48  ASP A O   3 
ATOM   5929  C  CB  . ASP A 1 48  ? 14.786  100.741 1.441   0.25 15.10 ? 48  ASP A CB  3 
ATOM   5930  C  CG  . ASP A 1 48  ? 16.289  100.829 1.181   0.25 20.69 ? 48  ASP A CG  3 
ATOM   5931  O  OD1 . ASP A 1 48  ? 17.024  101.269 2.093   0.25 20.09 ? 48  ASP A OD1 3 
ATOM   5932  O  OD2 . ASP A 1 48  ? 16.736  100.456 0.072   0.25 18.31 ? 48  ASP A OD2 3 
ATOM   5933  N  N   . PHE A 1 49  ? 12.471  99.095  3.830   0.25 10.76 ? 49  PHE A N   3 
ATOM   5934  C  CA  . PHE A 1 49  ? 11.108  99.145  4.357   0.25 10.51 ? 49  PHE A CA  3 
ATOM   5935  C  C   . PHE A 1 49  ? 11.230  98.819  5.838   0.25 11.28 ? 49  PHE A C   3 
ATOM   5936  O  O   . PHE A 1 49  ? 12.199  98.174  6.252   0.25 11.47 ? 49  PHE A O   3 
ATOM   5937  C  CB  . PHE A 1 49  ? 10.193  98.108  3.704   0.25 10.59 ? 49  PHE A CB  3 
ATOM   5938  C  CG  . PHE A 1 49  ? 9.644   98.527  2.372   0.25 10.85 ? 49  PHE A CG  3 
ATOM   5939  C  CD1 . PHE A 1 49  ? 10.453  98.542  1.239   0.25 11.71 ? 49  PHE A CD1 3 
ATOM   5940  C  CD2 . PHE A 1 49  ? 8.303   98.867  2.242   0.25 10.84 ? 49  PHE A CD2 3 
ATOM   5941  C  CE1 . PHE A 1 49  ? 9.927   98.884  -0.011  0.25 12.17 ? 49  PHE A CE1 3 
ATOM   5942  C  CE2 . PHE A 1 49  ? 7.766   99.212  1.000   0.25 11.92 ? 49  PHE A CE2 3 
ATOM   5943  C  CZ  . PHE A 1 49  ? 8.579   99.219  -0.129  0.25 11.68 ? 49  PHE A CZ  3 
ATOM   5944  N  N   . LYS A 1 50  ? 10.264  99.270  6.635   0.25 11.70 ? 50  LYS A N   3 
ATOM   5945  C  CA  . LYS A 1 50  ? 10.287  99.007  8.070   0.25 12.07 ? 50  LYS A CA  3 
ATOM   5946  C  C   . LYS A 1 50  ? 8.959   98.444  8.551   0.25 12.64 ? 50  LYS A C   3 
ATOM   5947  O  O   . LYS A 1 50  ? 7.893   98.978  8.242   0.25 12.08 ? 50  LYS A O   3 
ATOM   5948  C  CB  . LYS A 1 50  ? 10.613  100.286 8.849   0.25 13.17 ? 50  LYS A CB  3 
ATOM   5949  C  CG  . LYS A 1 50  ? 10.749  100.069 10.361  0.25 19.14 ? 50  LYS A CG  3 
ATOM   5950  C  CD  . LYS A 1 50  ? 11.205  101.338 11.069  0.25 25.47 ? 50  LYS A CD  3 
ATOM   5951  C  CE  . LYS A 1 50  ? 11.392  101.114 12.564  0.25 28.24 ? 50  LYS A CE  3 
ATOM   5952  N  NZ  . LYS A 1 50  ? 12.428  100.080 12.859  0.25 31.82 ? 50  LYS A NZ  3 
ATOM   5953  N  N   . LEU A 1 51  ? 9.030   97.356  9.311   0.25 10.10 ? 51  LEU A N   3 
ATOM   5954  C  CA  . LEU A 1 51  ? 7.833   96.725  9.850   0.25 10.35 ? 51  LEU A CA  3 
ATOM   5955  C  C   . LEU A 1 51  ? 7.231   97.589  10.953  0.25 10.66 ? 51  LEU A C   3 
ATOM   5956  O  O   . LEU A 1 51  ? 7.925   98.004  11.879  0.25 10.17 ? 51  LEU A O   3 
ATOM   5957  C  CB  . LEU A 1 51  ? 8.176   95.353  10.424  0.25 10.51 ? 51  LEU A CB  3 
ATOM   5958  C  CG  . LEU A 1 51  ? 7.009   94.565  11.019  0.25 11.77 ? 51  LEU A CG  3 
ATOM   5959  C  CD1 . LEU A 1 51  ? 6.058   94.146  9.902   0.25 8.21  ? 51  LEU A CD1 3 
ATOM   5960  C  CD2 . LEU A 1 51  ? 7.549   93.338  11.750  0.25 9.35  ? 51  LEU A CD2 3 
ATOM   5961  N  N   . ASP A 1 52  ? 5.936   97.859  10.854  0.25 10.31 ? 52  ASP A N   3 
ATOM   5962  C  CA  . ASP A 1 52  ? 5.257   98.657  11.862  0.25 10.68 ? 52  ASP A CA  3 
ATOM   5963  C  C   . ASP A 1 52  ? 3.985   97.921  12.266  0.25 11.45 ? 52  ASP A C   3 
ATOM   5964  O  O   . ASP A 1 52  ? 3.653   96.886  11.686  0.25 9.96  ? 52  ASP A O   3 
ATOM   5965  C  CB  . ASP A 1 52  ? 4.919   100.044 11.298  0.25 11.55 ? 52  ASP A CB  3 
ATOM   5966  C  CG  . ASP A 1 52  ? 4.373   100.993 12.357  0.25 13.32 ? 52  ASP A CG  3 
ATOM   5967  O  OD1 . ASP A 1 52  ? 4.496   100.679 13.565  0.25 10.18 ? 52  ASP A OD1 3 
ATOM   5968  O  OD2 . ASP A 1 52  ? 3.832   102.056 11.983  0.25 12.86 ? 52  ASP A OD2 3 
ATOM   5969  N  N   . PHE A 1 53  ? 3.294   98.435  13.278  0.25 10.67 ? 53  PHE A N   3 
ATOM   5970  C  CA  . PHE A 1 53  ? 2.044   97.836  13.732  0.25 12.41 ? 53  PHE A CA  3 
ATOM   5971  C  C   . PHE A 1 53  ? 1.030   98.929  14.020  0.25 13.12 ? 53  PHE A C   3 
ATOM   5972  O  O   . PHE A 1 53  ? 1.252   99.791  14.867  0.25 12.24 ? 53  PHE A O   3 
ATOM   5973  C  CB  . PHE A 1 53  ? 2.266   96.989  14.987  0.25 12.14 ? 53  PHE A CB  3 
ATOM   5974  C  CG  . PHE A 1 53  ? 3.137   95.793  14.753  0.25 12.60 ? 53  PHE A CG  3 
ATOM   5975  C  CD1 . PHE A 1 53  ? 4.521   95.920  14.716  0.25 9.56  ? 53  PHE A CD1 3 
ATOM   5976  C  CD2 . PHE A 1 53  ? 2.571   94.542  14.527  0.25 10.71 ? 53  PHE A CD2 3 
ATOM   5977  C  CE1 . PHE A 1 53  ? 5.330   94.815  14.456  0.25 12.45 ? 53  PHE A CE1 3 
ATOM   5978  C  CE2 . PHE A 1 53  ? 3.373   93.429  14.264  0.25 12.48 ? 53  PHE A CE2 3 
ATOM   5979  C  CZ  . PHE A 1 53  ? 4.756   93.569  14.229  0.25 13.26 ? 53  PHE A CZ  3 
ATOM   5980  N  N   . GLY A 1 54  ? -0.091  98.892  13.314  0.25 14.15 ? 54  GLY A N   3 
ATOM   5981  C  CA  . GLY A 1 54  ? -1.093  99.915  13.523  0.25 13.22 ? 54  GLY A CA  3 
ATOM   5982  C  C   . GLY A 1 54  ? -2.504  99.490  13.206  0.25 13.23 ? 54  GLY A C   3 
ATOM   5983  O  O   . GLY A 1 54  ? -2.746  98.399  12.684  0.25 13.71 ? 54  GLY A O   3 
ATOM   5984  N  N   . ASN A 1 55  ? -3.436  100.373 13.533  0.25 12.57 ? 55  ASN A N   3 
ATOM   5985  C  CA  . ASN A 1 55  ? -4.849  100.138 13.310  0.25 14.55 ? 55  ASN A CA  3 
ATOM   5986  C  C   . ASN A 1 55  ? -5.311  100.888 12.063  0.25 15.53 ? 55  ASN A C   3 
ATOM   5987  O  O   . ASN A 1 55  ? -5.245  102.118 12.013  0.25 13.17 ? 55  ASN A O   3 
ATOM   5988  C  CB  . ASN A 1 55  ? -5.650  100.619 14.528  0.25 12.82 ? 55  ASN A CB  3 
ATOM   5989  C  CG  . ASN A 1 55  ? -5.158  100.010 15.831  0.25 14.98 ? 55  ASN A CG  3 
ATOM   5990  O  OD1 . ASN A 1 55  ? -4.850  98.819  15.898  0.25 11.54 ? 55  ASN A OD1 3 
ATOM   5991  N  ND2 . ASN A 1 55  ? -5.098  100.823 16.879  0.25 14.31 ? 55  ASN A ND2 3 
ATOM   5992  N  N   . SER A 1 56  ? -5.770  100.148 11.059  0.25 18.24 ? 56  SER A N   3 
ATOM   5993  C  CA  . SER A 1 56  ? -6.252  100.758 9.826   0.25 23.19 ? 56  SER A CA  3 
ATOM   5994  C  C   . SER A 1 56  ? -7.556  101.507 10.088  0.25 24.69 ? 56  SER A C   3 
ATOM   5995  O  O   . SER A 1 56  ? -8.511  100.933 10.610  0.25 23.80 ? 56  SER A O   3 
ATOM   5996  C  CB  . SER A 1 56  ? -6.494  99.690  8.760   0.25 25.01 ? 56  SER A CB  3 
ATOM   5997  O  OG  . SER A 1 56  ? -7.034  100.269 7.585   0.25 29.14 ? 56  SER A OG  3 
ATOM   5998  N  N   . GLN A 1 57  ? -7.589  102.784 9.718   0.25 26.67 ? 57  GLN A N   3 
ATOM   5999  C  CA  . GLN A 1 57  ? -8.771  103.620 9.915   0.25 29.82 ? 57  GLN A CA  3 
ATOM   6000  C  C   . GLN A 1 57  ? -9.081  103.840 11.393  0.25 30.19 ? 57  GLN A C   3 
ATOM   6001  O  O   . GLN A 1 57  ? -10.186 104.248 11.745  0.25 29.79 ? 57  GLN A O   3 
ATOM   6002  C  CB  . GLN A 1 57  ? -9.995  103.000 9.230   0.25 32.67 ? 57  GLN A CB  3 
ATOM   6003  C  CG  . GLN A 1 57  ? -9.995  103.106 7.713   0.25 34.23 ? 57  GLN A CG  3 
ATOM   6004  C  CD  . GLN A 1 57  ? -10.007 104.544 7.232   0.25 37.42 ? 57  GLN A CD  3 
ATOM   6005  O  OE1 . GLN A 1 57  ? -10.849 105.342 7.648   0.25 38.33 ? 57  GLN A OE1 3 
ATOM   6006  N  NE2 . GLN A 1 57  ? -9.074  104.882 6.348   0.25 34.78 ? 57  GLN A NE2 3 
ATOM   6007  N  N   . GLY A 1 58  ? -8.104  103.571 12.253  0.25 29.40 ? 58  GLY A N   3 
ATOM   6008  C  CA  . GLY A 1 58  ? -8.308  103.753 13.677  0.25 28.46 ? 58  GLY A CA  3 
ATOM   6009  C  C   . GLY A 1 58  ? -9.062  102.612 14.333  0.25 28.70 ? 58  GLY A C   3 
ATOM   6010  O  O   . GLY A 1 58  ? -9.292  102.631 15.540  0.25 29.25 ? 58  GLY A O   3 
ATOM   6011  N  N   . LYS A 1 59  ? -9.452  101.620 13.540  0.25 27.72 ? 59  LYS A N   3 
ATOM   6012  C  CA  . LYS A 1 59  ? -10.182 100.465 14.058  0.25 28.66 ? 59  LYS A CA  3 
ATOM   6013  C  C   . LYS A 1 59  ? -9.205  99.373  14.485  0.25 26.57 ? 59  LYS A C   3 
ATOM   6014  O  O   . LYS A 1 59  ? -8.200  99.139  13.816  0.25 24.18 ? 59  LYS A O   3 
ATOM   6015  C  CB  . LYS A 1 59  ? -11.114 99.890  12.988  0.25 31.88 ? 59  LYS A CB  3 
ATOM   6016  C  CG  . LYS A 1 59  ? -12.184 100.834 12.469  0.25 36.19 ? 59  LYS A CG  3 
ATOM   6017  C  CD  . LYS A 1 59  ? -13.067 100.108 11.455  0.25 40.61 ? 59  LYS A CD  3 
ATOM   6018  C  CE  . LYS A 1 59  ? -14.162 101.005 10.905  0.25 42.53 ? 59  LYS A CE  3 
ATOM   6019  N  NZ  . LYS A 1 59  ? -15.034 100.277 9.939   0.25 44.33 ? 59  LYS A NZ  3 
ATOM   6020  N  N   . THR A 1 60  ? -9.502  98.708  15.598  0.25 25.34 ? 60  THR A N   3 
ATOM   6021  C  CA  . THR A 1 60  ? -8.647  97.629  16.086  0.25 24.62 ? 60  THR A CA  3 
ATOM   6022  C  C   . THR A 1 60  ? -9.127  96.292  15.525  0.25 23.85 ? 60  THR A C   3 
ATOM   6023  O  O   . THR A 1 60  ? -10.327 96.012  15.510  0.25 23.39 ? 60  THR A O   3 
ATOM   6024  C  CB  . THR A 1 60  ? -8.656  97.552  17.626  0.25 25.22 ? 60  THR A CB  3 
ATOM   6025  O  OG1 . THR A 1 60  ? -8.111  98.760  18.169  0.25 24.27 ? 60  THR A OG1 3 
ATOM   6026  C  CG2 . THR A 1 60  ? -7.825  96.368  18.108  0.25 26.11 ? 60  THR A CG2 3 
ATOM   6027  N  N   . SER A 1 61  ? -8.186  95.475  15.058  0.25 22.04 ? 61  SER A N   3 
ATOM   6028  C  CA  . SER A 1 61  ? -8.506  94.165  14.493  0.25 21.14 ? 61  SER A CA  3 
ATOM   6029  C  C   . SER A 1 61  ? -9.460  93.384  15.381  0.25 21.65 ? 61  SER A C   3 
ATOM   6030  O  O   . SER A 1 61  ? -9.154  93.117  16.546  0.25 19.52 ? 61  SER A O   3 
ATOM   6031  C  CB  . SER A 1 61  ? -7.236  93.339  14.302  0.25 19.86 ? 61  SER A CB  3 
ATOM   6032  O  OG  . SER A 1 61  ? -7.565  91.988  14.035  0.25 18.64 ? 61  SER A OG  3 
ATOM   6033  N  N   . GLN A 1 62  ? -10.607 93.010  14.820  0.25 20.45 ? 62  GLN A N   3 
ATOM   6034  C  CA  . GLN A 1 62  ? -11.615 92.261  15.558  0.25 23.25 ? 62  GLN A CA  3 
ATOM   6035  C  C   . GLN A 1 62  ? -11.212 90.807  15.747  0.25 21.79 ? 62  GLN A C   3 
ATOM   6036  O  O   . GLN A 1 62  ? -11.870 90.058  16.464  0.25 20.53 ? 62  GLN A O   3 
ATOM   6037  C  CB  . GLN A 1 62  ? -12.964 92.337  14.841  0.25 25.35 ? 62  GLN A CB  3 
ATOM   6038  C  CG  . GLN A 1 62  ? -13.555 93.730  14.829  0.25 31.40 ? 62  GLN A CG  3 
ATOM   6039  C  CD  . GLN A 1 62  ? -13.645 94.319  16.222  0.25 33.52 ? 62  GLN A CD  3 
ATOM   6040  O  OE1 . GLN A 1 62  ? -14.381 93.819  17.074  0.25 36.04 ? 62  GLN A OE1 3 
ATOM   6041  N  NE2 . GLN A 1 62  ? -12.886 95.381  16.465  0.25 38.19 ? 62  GLN A NE2 3 
ATOM   6042  N  N   . THR A 1 63  ? -10.130 90.412  15.093  0.25 19.98 ? 63  THR A N   3 
ATOM   6043  C  CA  . THR A 1 63  ? -9.631  89.053  15.210  0.25 20.04 ? 63  THR A CA  3 
ATOM   6044  C  C   . THR A 1 63  ? -8.352  89.031  16.046  0.25 19.90 ? 63  THR A C   3 
ATOM   6045  O  O   . THR A 1 63  ? -8.154  88.136  16.872  0.25 19.51 ? 63  THR A O   3 
ATOM   6046  C  CB  . THR A 1 63  ? -9.329  88.448  13.823  0.25 21.51 ? 63  THR A CB  3 
ATOM   6047  O  OG1 . THR A 1 63  ? -10.553 88.289  13.095  0.25 23.06 ? 63  THR A OG1 3 
ATOM   6048  C  CG2 . THR A 1 63  ? -8.650  87.088  13.966  0.25 21.83 ? 63  THR A CG2 3 
ATOM   6049  N  N   . TRP A 1 64  ? -7.502  90.036  15.841  0.25 17.20 ? 64  TRP A N   3 
ATOM   6050  C  CA  . TRP A 1 64  ? -6.225  90.135  16.545  0.25 17.88 ? 64  TRP A CA  3 
ATOM   6051  C  C   . TRP A 1 64  ? -6.236  90.988  17.809  0.25 18.86 ? 64  TRP A C   3 
ATOM   6052  O  O   . TRP A 1 64  ? -5.356  90.852  18.660  0.25 21.09 ? 64  TRP A O   3 
ATOM   6053  C  CB  . TRP A 1 64  ? -5.165  90.677  15.589  0.25 14.12 ? 64  TRP A CB  3 
ATOM   6054  C  CG  . TRP A 1 64  ? -5.043  89.857  14.349  0.25 14.82 ? 64  TRP A CG  3 
ATOM   6055  C  CD1 . TRP A 1 64  ? -5.296  90.258  13.067  0.25 12.45 ? 64  TRP A CD1 3 
ATOM   6056  C  CD2 . TRP A 1 64  ? -4.643  88.486  14.271  0.25 14.35 ? 64  TRP A CD2 3 
ATOM   6057  N  NE1 . TRP A 1 64  ? -5.076  89.219  12.194  0.25 13.44 ? 64  TRP A NE1 3 
ATOM   6058  C  CE2 . TRP A 1 64  ? -4.672  88.120  12.907  0.25 15.74 ? 64  TRP A CE2 3 
ATOM   6059  C  CE3 . TRP A 1 64  ? -4.260  87.531  15.222  0.25 15.96 ? 64  TRP A CE3 3 
ATOM   6060  C  CZ2 . TRP A 1 64  ? -4.331  86.838  12.470  0.25 17.08 ? 64  TRP A CZ2 3 
ATOM   6061  C  CZ3 . TRP A 1 64  ? -3.921  86.256  14.788  0.25 16.88 ? 64  TRP A CZ3 3 
ATOM   6062  C  CH2 . TRP A 1 64  ? -3.959  85.923  13.422  0.25 17.76 ? 64  TRP A CH2 3 
ATOM   6063  N  N   . HIS A 1 65  ? -7.228  91.865  17.926  0.25 18.58 ? 65  HIS A N   3 
ATOM   6064  C  CA  . HIS A 1 65  ? -7.353  92.749  19.079  0.25 18.75 ? 65  HIS A CA  3 
ATOM   6065  C  C   . HIS A 1 65  ? -6.032  93.421  19.442  0.25 16.85 ? 65  HIS A C   3 
ATOM   6066  O  O   . HIS A 1 65  ? -5.655  93.505  20.610  0.25 15.73 ? 65  HIS A O   3 
ATOM   6067  C  CB  . HIS A 1 65  ? -7.905  91.975  20.283  0.25 20.84 ? 65  HIS A CB  3 
ATOM   6068  C  CG  . HIS A 1 65  ? -9.324  91.529  20.108  0.25 19.16 ? 65  HIS A CG  3 
ATOM   6069  N  ND1 . HIS A 1 65  ? -9.689  90.545  19.216  0.25 20.80 ? 65  HIS A ND1 3 
ATOM   6070  C  CD2 . HIS A 1 65  ? -10.471 91.961  20.682  0.25 21.31 ? 65  HIS A CD2 3 
ATOM   6071  C  CE1 . HIS A 1 65  ? -11.001 90.390  19.248  0.25 21.63 ? 65  HIS A CE1 3 
ATOM   6072  N  NE2 . HIS A 1 65  ? -11.499 91.238  20.128  0.25 19.47 ? 65  HIS A NE2 3 
ATOM   6073  N  N   . GLY A 1 66  ? -5.337  93.903  18.421  0.25 15.58 ? 66  GLY A N   3 
ATOM   6074  C  CA  . GLY A 1 66  ? -4.069  94.576  18.622  0.25 12.25 ? 66  GLY A CA  3 
ATOM   6075  C  C   . GLY A 1 66  ? -3.667  95.213  17.309  0.25 12.19 ? 66  GLY A C   3 
ATOM   6076  O  O   . GLY A 1 66  ? -4.516  95.458  16.452  0.25 9.47  ? 66  GLY A O   3 
ATOM   6077  N  N   . GLY A 1 67  ? -2.381  95.483  17.138  0.25 11.73 ? 67  GLY A N   3 
ATOM   6078  C  CA  . GLY A 1 67  ? -1.941  96.077  15.892  0.25 12.12 ? 67  GLY A CA  3 
ATOM   6079  C  C   . GLY A 1 67  ? -1.728  94.996  14.847  0.25 12.23 ? 67  GLY A C   3 
ATOM   6080  O  O   . GLY A 1 67  ? -1.274  93.896  15.168  0.25 11.79 ? 67  GLY A O   3 
ATOM   6081  N  N   . ILE A 1 68  ? -2.076  95.299  13.601  0.25 13.51 ? 68  ILE A N   3 
ATOM   6082  C  CA  . ILE A 1 68  ? -1.893  94.356  12.504  0.25 12.14 ? 68  ILE A CA  3 
ATOM   6083  C  C   . ILE A 1 68  ? -0.692  94.848  11.692  0.25 11.55 ? 68  ILE A C   3 
ATOM   6084  O  O   . ILE A 1 68  ? -0.431  96.053  11.618  0.25 10.46 ? 68  ILE A O   3 
ATOM   6085  C  CB  . ILE A 1 68  ? -3.169  94.256  11.632  0.25 13.66 ? 68  ILE A CB  3 
ATOM   6086  C  CG1 . ILE A 1 68  ? -3.512  95.617  11.021  0.25 15.19 ? 68  ILE A CG1 3 
ATOM   6087  C  CG2 . ILE A 1 68  ? -4.334  93.771  12.496  0.25 12.98 ? 68  ILE A CG2 3 
ATOM   6088  C  CD1 . ILE A 1 68  ? -4.795  95.607  10.215  0.25 18.56 ? 68  ILE A CD1 3 
ATOM   6089  N  N   . ALA A 1 69  ? 0.035   93.915  11.085  0.25 9.55  ? 69  ALA A N   3 
ATOM   6090  C  CA  . ALA A 1 69  ? 1.250   94.251  10.353  0.25 8.86  ? 69  ALA A CA  3 
ATOM   6091  C  C   . ALA A 1 69  ? 1.133   95.016  9.041   0.25 8.85  ? 69  ALA A C   3 
ATOM   6092  O  O   . ALA A 1 69  ? 0.303   94.709  8.188   0.25 8.22  ? 69  ALA A O   3 
ATOM   6093  C  CB  . ALA A 1 69  ? 2.071   92.987  10.124  0.25 9.10  ? 69  ALA A CB  3 
ATOM   6094  N  N   . THR A 1 70  ? 1.996   96.016  8.898   0.25 9.14  ? 70  THR A N   3 
ATOM   6095  C  CA  . THR A 1 70  ? 2.066   96.814  7.685   0.25 8.74  ? 70  THR A CA  3 
ATOM   6096  C  C   . THR A 1 70  ? 3.513   97.254  7.520   0.25 10.37 ? 70  THR A C   3 
ATOM   6097  O  O   . THR A 1 70  ? 4.352   97.014  8.397   0.25 10.85 ? 70  THR A O   3 
ATOM   6098  C  CB  . THR A 1 70  ? 1.139   98.046  7.738   0.25 9.50  ? 70  THR A CB  3 
ATOM   6099  O  OG1 . THR A 1 70  ? 1.177   98.723  6.472   0.25 9.46  ? 70  THR A OG1 3 
ATOM   6100  C  CG2 . THR A 1 70  ? 1.569   99.004  8.848   0.25 6.81  ? 70  THR A CG2 3 
ATOM   6101  N  N   . ILE A 1 71  ? 3.815   97.882  6.392   0.25 9.66  ? 71  ILE A N   3 
ATOM   6102  C  CA  . ILE A 1 71  ? 5.169   98.336  6.135   0.25 8.67  ? 71  ILE A CA  3 
ATOM   6103  C  C   . ILE A 1 71  ? 5.177   99.671  5.414   0.25 8.65  ? 71  ILE A C   3 
ATOM   6104  O  O   . ILE A 1 71  ? 4.267   99.980  4.647   0.25 8.16  ? 71  ILE A O   3 
ATOM   6105  C  CB  . ILE A 1 71  ? 5.954   97.300  5.281   0.25 8.13  ? 71  ILE A CB  3 
ATOM   6106  C  CG1 . ILE A 1 71  ? 5.107   96.848  4.081   0.25 7.60  ? 71  ILE A CG1 3 
ATOM   6107  C  CG2 . ILE A 1 71  ? 6.338   96.096  6.135   0.25 11.72 ? 71  ILE A CG2 3 
ATOM   6108  C  CD1 . ILE A 1 71  ? 5.840   95.898  3.135   0.25 8.82  ? 71  ILE A CD1 3 
ATOM   6109  N  N   . PHE A 1 72  ? 6.204   100.469 5.677   0.25 9.97  ? 72  PHE A N   3 
ATOM   6110  C  CA  . PHE A 1 72  ? 6.350   101.753 5.012   0.25 9.62  ? 72  PHE A CA  3 
ATOM   6111  C  C   . PHE A 1 72  ? 7.804   101.900 4.565   0.25 11.85 ? 72  PHE A C   3 
ATOM   6112  O  O   . PHE A 1 72  ? 8.700   101.248 5.110   0.25 10.89 ? 72  PHE A O   3 
ATOM   6113  C  CB  . PHE A 1 72  ? 5.910   102.909 5.932   0.25 9.38  ? 72  PHE A CB  3 
ATOM   6114  C  CG  . PHE A 1 72  ? 6.709   103.037 7.207   0.25 12.16 ? 72  PHE A CG  3 
ATOM   6115  C  CD1 . PHE A 1 72  ? 7.999   103.555 7.193   0.25 12.00 ? 72  PHE A CD1 3 
ATOM   6116  C  CD2 . PHE A 1 72  ? 6.153   102.670 8.426   0.25 11.11 ? 72  PHE A CD2 3 
ATOM   6117  C  CE1 . PHE A 1 72  ? 8.724   103.712 8.379   0.25 13.64 ? 72  PHE A CE1 3 
ATOM   6118  C  CE2 . PHE A 1 72  ? 6.867   102.822 9.620   0.25 13.67 ? 72  PHE A CE2 3 
ATOM   6119  C  CZ  . PHE A 1 72  ? 8.156   103.345 9.593   0.25 13.71 ? 72  PHE A CZ  3 
ATOM   6120  N  N   . GLN A 1 73  ? 8.034   102.738 3.561   0.25 12.18 ? 73  GLN A N   3 
ATOM   6121  C  CA  . GLN A 1 73  ? 9.377   102.940 3.029   0.25 13.47 ? 73  GLN A CA  3 
ATOM   6122  C  C   . GLN A 1 73  ? 10.223  103.859 3.887   0.25 14.21 ? 73  GLN A C   3 
ATOM   6123  O  O   . GLN A 1 73  ? 9.744   104.872 4.388   0.25 13.36 ? 73  GLN A O   3 
ATOM   6124  C  CB  . GLN A 1 73  ? 9.283   103.485 1.605   0.25 12.52 ? 73  GLN A CB  3 
ATOM   6125  C  CG  . GLN A 1 73  ? 8.604   102.509 0.656   0.25 15.82 ? 73  GLN A CG  3 
ATOM   6126  C  CD  . GLN A 1 73  ? 8.106   103.170 -0.611  0.25 16.51 ? 73  GLN A CD  3 
ATOM   6127  O  OE1 . GLN A 1 73  ? 7.265   104.067 -0.564  0.25 17.14 ? 73  GLN A OE1 3 
ATOM   6128  N  NE2 . GLN A 1 73  ? 8.619   102.728 -1.752  0.25 13.98 ? 73  GLN A NE2 3 
ATOM   6129  N  N   . SER A 1 74  ? 11.492  103.497 4.043   0.25 16.07 ? 74  SER A N   3 
ATOM   6130  C  CA  . SER A 1 74  ? 12.422  104.269 4.852   0.25 17.36 ? 74  SER A CA  3 
ATOM   6131  C  C   . SER A 1 74  ? 13.813  103.643 4.741   0.25 18.68 ? 74  SER A C   3 
ATOM   6132  O  O   . SER A 1 74  ? 14.167  102.752 5.515   0.25 17.98 ? 74  SER A O   3 
ATOM   6133  C  CB  . SER A 1 74  ? 11.955  104.271 6.309   0.25 18.94 ? 74  SER A CB  3 
ATOM   6134  O  OG  . SER A 1 74  ? 12.768  105.103 7.112   0.25 22.61 ? 74  SER A OG  3 
ATOM   6135  N  N   . PRO A 1 75  ? 14.616  104.103 3.764   0.25 19.88 ? 75  PRO A N   3 
ATOM   6136  C  CA  . PRO A 1 75  ? 15.973  103.609 3.521   0.25 18.84 ? 75  PRO A CA  3 
ATOM   6137  C  C   . PRO A 1 75  ? 16.753  103.366 4.805   0.25 19.30 ? 75  PRO A C   3 
ATOM   6138  O  O   . PRO A 1 75  ? 16.626  104.119 5.768   0.25 16.42 ? 75  PRO A O   3 
ATOM   6139  C  CB  . PRO A 1 75  ? 16.582  104.710 2.667   0.25 19.28 ? 75  PRO A CB  3 
ATOM   6140  C  CG  . PRO A 1 75  ? 15.414  105.142 1.830   0.25 18.98 ? 75  PRO A CG  3 
ATOM   6141  C  CD  . PRO A 1 75  ? 14.297  105.219 2.851   0.25 19.72 ? 75  PRO A CD  3 
ATOM   6142  N  N   . GLY A 1 76  ? 17.552  102.303 4.815   0.25 19.11 ? 76  GLY A N   3 
ATOM   6143  C  CA  . GLY A 1 76  ? 18.340  101.985 5.993   0.25 18.57 ? 76  GLY A CA  3 
ATOM   6144  C  C   . GLY A 1 76  ? 17.712  100.912 6.861   0.25 18.92 ? 76  GLY A C   3 
ATOM   6145  O  O   . GLY A 1 76  ? 18.315  100.466 7.837   0.25 16.87 ? 76  GLY A O   3 
ATOM   6146  N  N   . ASP A 1 77  ? 16.496  100.502 6.508   0.25 17.30 ? 77  ASP A N   3 
ATOM   6147  C  CA  . ASP A 1 77  ? 15.777  99.463  7.246   0.25 16.88 ? 77  ASP A CA  3 
ATOM   6148  C  C   . ASP A 1 77  ? 15.476  98.271  6.336   0.25 14.53 ? 77  ASP A C   3 
ATOM   6149  O  O   . ASP A 1 77  ? 15.608  98.363  5.112   0.25 11.75 ? 77  ASP A O   3 
ATOM   6150  C  CB  . ASP A 1 77  ? 14.457  100.017 7.793   0.25 16.79 ? 77  ASP A CB  3 
ATOM   6151  C  CG  . ASP A 1 77  ? 14.658  100.988 8.943   0.25 21.61 ? 77  ASP A CG  3 
ATOM   6152  O  OD1 . ASP A 1 77  ? 15.210  100.566 9.983   0.25 16.56 ? 77  ASP A OD1 3 
ATOM   6153  O  OD2 . ASP A 1 77  ? 14.261  102.170 8.805   0.25 19.11 ? 77  ASP A OD2 3 
ATOM   6154  N  N   . GLU A 1 78  ? 15.074  97.150  6.933   0.25 13.79 ? 78  GLU A N   3 
ATOM   6155  C  CA  . GLU A 1 78  ? 14.728  95.966  6.147   0.25 14.10 ? 78  GLU A CA  3 
ATOM   6156  C  C   . GLU A 1 78  ? 13.628  95.146  6.806   0.25 14.34 ? 78  GLU A C   3 
ATOM   6157  O  O   . GLU A 1 78  ? 13.409  95.234  8.012   0.25 13.26 ? 78  GLU A O   3 
ATOM   6158  C  CB  . GLU A 1 78  ? 15.959  95.077  5.907   0.25 16.82 ? 78  GLU A CB  3 
ATOM   6159  C  CG  . GLU A 1 78  ? 16.641  94.573  7.166   0.25 21.99 ? 78  GLU A CG  3 
ATOM   6160  C  CD  . GLU A 1 78  ? 17.871  93.733  6.864   0.25 23.58 ? 78  GLU A CD  3 
ATOM   6161  O  OE1 . GLU A 1 78  ? 18.713  94.183  6.057   0.25 26.97 ? 78  GLU A OE1 3 
ATOM   6162  O  OE2 . GLU A 1 78  ? 17.999  92.628  7.435   0.25 24.56 ? 78  GLU A OE2 3 
ATOM   6163  N  N   . VAL A 1 79  ? 12.930  94.361  5.989   0.25 12.98 ? 79  VAL A N   3 
ATOM   6164  C  CA  . VAL A 1 79  ? 11.855  93.497  6.457   0.25 13.12 ? 79  VAL A CA  3 
ATOM   6165  C  C   . VAL A 1 79  ? 12.023  92.123  5.819   0.25 14.02 ? 79  VAL A C   3 
ATOM   6166  O  O   . VAL A 1 79  ? 11.940  91.988  4.589   0.25 15.14 ? 79  VAL A O   3 
ATOM   6167  C  CB  . VAL A 1 79  ? 10.461  94.046  6.051   0.25 14.14 ? 79  VAL A CB  3 
ATOM   6168  C  CG1 . VAL A 1 79  ? 9.375   93.019  6.389   0.25 9.63  ? 79  VAL A CG1 3 
ATOM   6169  C  CG2 . VAL A 1 79  ? 10.182  95.360  6.768   0.25 11.12 ? 79  VAL A CG2 3 
ATOM   6170  N  N   . TRP A 1 80  ? 12.267  91.106  6.641   0.25 12.35 ? 80  TRP A N   3 
ATOM   6171  C  CA  . TRP A 1 80  ? 12.412  89.750  6.122   0.25 11.32 ? 80  TRP A CA  3 
ATOM   6172  C  C   . TRP A 1 80  ? 11.047  89.070  6.083   0.25 11.12 ? 80  TRP A C   3 
ATOM   6173  O  O   . TRP A 1 80  ? 10.197  89.302  6.951   0.25 11.69 ? 80  TRP A O   3 
ATOM   6174  C  CB  . TRP A 1 80  ? 13.370  88.920  6.990   0.25 12.47 ? 80  TRP A CB  3 
ATOM   6175  C  CG  . TRP A 1 80  ? 14.830  89.182  6.732   0.25 11.81 ? 80  TRP A CG  3 
ATOM   6176  C  CD1 . TRP A 1 80  ? 15.603  90.159  7.292   0.25 12.66 ? 80  TRP A CD1 3 
ATOM   6177  C  CD2 . TRP A 1 80  ? 15.687  88.455  5.842   0.25 10.90 ? 80  TRP A CD2 3 
ATOM   6178  N  NE1 . TRP A 1 80  ? 16.888  90.084  6.810   0.25 13.92 ? 80  TRP A NE1 3 
ATOM   6179  C  CE2 . TRP A 1 80  ? 16.968  89.049  5.916   0.25 13.54 ? 80  TRP A CE2 3 
ATOM   6180  C  CE3 . TRP A 1 80  ? 15.495  87.361  4.985   0.25 12.51 ? 80  TRP A CE3 3 
ATOM   6181  C  CZ2 . TRP A 1 80  ? 18.059  88.582  5.167   0.25 12.28 ? 80  TRP A CZ2 3 
ATOM   6182  C  CZ3 . TRP A 1 80  ? 16.580  86.896  4.237   0.25 13.21 ? 80  TRP A CZ3 3 
ATOM   6183  C  CH2 . TRP A 1 80  ? 17.846  87.510  4.335   0.25 11.24 ? 80  TRP A CH2 3 
ATOM   6184  N  N   . GLY A 1 81  ? 10.834  88.228  5.078   0.25 10.52 ? 81  GLY A N   3 
ATOM   6185  C  CA  . GLY A 1 81  ? 9.563   87.543  4.985   0.25 10.88 ? 81  GLY A CA  3 
ATOM   6186  C  C   . GLY A 1 81  ? 9.601   86.272  4.171   0.25 11.05 ? 81  GLY A C   3 
ATOM   6187  O  O   . GLY A 1 81  ? 10.610  85.926  3.549   0.25 10.42 ? 81  GLY A O   3 
ATOM   6188  N  N   . VAL A 1 82  ? 8.483   85.562  4.190   0.25 10.83 ? 82  VAL A N   3 
ATOM   6189  C  CA  . VAL A 1 82  ? 8.360   84.327  3.442   0.25 10.68 ? 82  VAL A CA  3 
ATOM   6190  C  C   . VAL A 1 82  ? 7.659   84.632  2.135   0.25 10.44 ? 82  VAL A C   3 
ATOM   6191  O  O   . VAL A 1 82  ? 6.596   85.262  2.127   0.25 10.29 ? 82  VAL A O   3 
ATOM   6192  C  CB  . VAL A 1 82  ? 7.531   83.275  4.213   0.25 8.73  ? 82  VAL A CB  3 
ATOM   6193  C  CG1 . VAL A 1 82  ? 7.204   82.099  3.297   0.25 6.24  ? 82  VAL A CG1 3 
ATOM   6194  C  CG2 . VAL A 1 82  ? 8.312   82.793  5.442   0.25 7.12  ? 82  VAL A CG2 3 
ATOM   6195  N  N   . VAL A 1 83  ? 8.272   84.208  1.035   0.25 12.01 ? 83  VAL A N   3 
ATOM   6196  C  CA  . VAL A 1 83  ? 7.693   84.383  -0.291  0.25 11.57 ? 83  VAL A CA  3 
ATOM   6197  C  C   . VAL A 1 83  ? 7.017   83.058  -0.640  0.25 11.99 ? 83  VAL A C   3 
ATOM   6198  O  O   . VAL A 1 83  ? 7.669   82.013  -0.683  0.25 13.50 ? 83  VAL A O   3 
ATOM   6199  C  CB  . VAL A 1 83  ? 8.786   84.702  -1.351  0.25 12.61 ? 83  VAL A CB  3 
ATOM   6200  C  CG1 . VAL A 1 83  ? 8.172   84.736  -2.753  0.25 10.30 ? 83  VAL A CG1 3 
ATOM   6201  C  CG2 . VAL A 1 83  ? 9.432   86.049  -1.043  0.25 12.22 ? 83  VAL A CG2 3 
ATOM   6202  N  N   . TRP A 1 84  ? 5.705   83.096  -0.852  0.25 11.55 ? 84  TRP A N   3 
ATOM   6203  C  CA  . TRP A 1 84  ? 4.951   81.897  -1.194  0.25 9.13  ? 84  TRP A CA  3 
ATOM   6204  C  C   . TRP A 1 84  ? 4.664   81.879  -2.685  0.25 11.83 ? 84  TRP A C   3 
ATOM   6205  O  O   . TRP A 1 84  ? 4.751   82.910  -3.355  0.25 9.29  ? 84  TRP A O   3 
ATOM   6206  C  CB  . TRP A 1 84  ? 3.608   81.860  -0.459  0.25 9.03  ? 84  TRP A CB  3 
ATOM   6207  C  CG  . TRP A 1 84  ? 3.705   81.984  1.029   0.25 9.17  ? 84  TRP A CG  3 
ATOM   6208  C  CD1 . TRP A 1 84  ? 3.726   83.135  1.760   0.25 9.55  ? 84  TRP A CD1 3 
ATOM   6209  C  CD2 . TRP A 1 84  ? 3.823   80.909  1.965   0.25 11.38 ? 84  TRP A CD2 3 
ATOM   6210  N  NE1 . TRP A 1 84  ? 3.854   82.843  3.100   0.25 11.28 ? 84  TRP A NE1 3 
ATOM   6211  C  CE2 . TRP A 1 84  ? 3.916   81.484  3.251   0.25 10.01 ? 84  TRP A CE2 3 
ATOM   6212  C  CE3 . TRP A 1 84  ? 3.860   79.515  1.839   0.25 9.14  ? 84  TRP A CE3 3 
ATOM   6213  C  CZ2 . TRP A 1 84  ? 4.045   80.711  4.407   0.25 13.38 ? 84  TRP A CZ2 3 
ATOM   6214  C  CZ3 . TRP A 1 84  ? 3.989   78.747  2.988   0.25 12.10 ? 84  TRP A CZ3 3 
ATOM   6215  C  CH2 . TRP A 1 84  ? 4.081   79.351  4.258   0.25 9.70  ? 84  TRP A CH2 3 
ATOM   6216  N  N   . LYS A 1 85  ? 4.319   80.705  -3.202  0.25 13.01 ? 85  LYS A N   3 
ATOM   6217  C  CA  . LYS A 1 85  ? 3.977   80.587  -4.609  0.25 14.70 ? 85  LYS A CA  3 
ATOM   6218  C  C   . LYS A 1 85  ? 2.525   80.127  -4.697  0.25 14.52 ? 85  LYS A C   3 
ATOM   6219  O  O   . LYS A 1 85  ? 2.128   79.177  -4.025  0.25 12.02 ? 85  LYS A O   3 
ATOM   6220  C  CB  . LYS A 1 85  ? 4.893   79.577  -5.304  0.25 16.58 ? 85  LYS A CB  3 
ATOM   6221  C  CG  . LYS A 1 85  ? 4.629   79.433  -6.793  0.25 18.48 ? 85  LYS A CG  3 
ATOM   6222  C  CD  . LYS A 1 85  ? 5.701   78.582  -7.454  0.25 21.75 ? 85  LYS A CD  3 
ATOM   6223  C  CE  . LYS A 1 85  ? 5.495   78.503  -8.955  0.25 26.41 ? 85  LYS A CE  3 
ATOM   6224  N  NZ  . LYS A 1 85  ? 6.618   77.799  -9.628  0.25 26.81 ? 85  LYS A NZ  3 
HETATM 6225  N  N   . MSE A 1 86  ? 1.728   80.807  -5.512  0.25 14.48 ? 86  MSE A N   3 
HETATM 6226  C  CA  . MSE A 1 86  ? 0.328   80.432  -5.660  0.25 18.12 ? 86  MSE A CA  3 
HETATM 6227  C  C   . MSE A 1 86  ? -0.149  80.594  -7.091  0.25 19.62 ? 86  MSE A C   3 
HETATM 6228  O  O   . MSE A 1 86  ? 0.431   81.350  -7.863  0.25 18.88 ? 86  MSE A O   3 
HETATM 6229  C  CB  . MSE A 1 86  ? -0.557  81.279  -4.747  0.25 18.15 ? 86  MSE A CB  3 
HETATM 6230  C  CG  . MSE A 1 86  ? -0.386  81.000  -3.262  0.25 21.90 ? 86  MSE A CG  3 
HETATM 6231  SE SE  . MSE A 1 86  ? -1.679  81.982  -2.224  0.25 26.71 ? 86  MSE A SE  3 
HETATM 6232  C  CE  . MSE A 1 86  ? -0.673  83.606  -1.975  0.25 26.60 ? 86  MSE A CE  3 
ATOM   6233  N  N   . ASN A 1 87  ? -1.210  79.873  -7.438  0.25 22.60 ? 87  ASN A N   3 
ATOM   6234  C  CA  . ASN A 1 87  ? -1.778  79.959  -8.774  0.25 23.58 ? 87  ASN A CA  3 
ATOM   6235  C  C   . ASN A 1 87  ? -2.678  81.188  -8.787  0.25 22.12 ? 87  ASN A C   3 
ATOM   6236  O  O   . ASN A 1 87  ? -3.336  81.492  -7.787  0.25 20.59 ? 87  ASN A O   3 
ATOM   6237  C  CB  . ASN A 1 87  ? -2.593  78.704  -9.085  0.25 27.53 ? 87  ASN A CB  3 
ATOM   6238  C  CG  . ASN A 1 87  ? -3.171  78.717  -10.486 0.25 29.73 ? 87  ASN A CG  3 
ATOM   6239  O  OD1 . ASN A 1 87  ? -3.934  79.613  -10.849 0.25 30.82 ? 87  ASN A OD1 3 
ATOM   6240  N  ND2 . ASN A 1 87  ? -2.812  77.717  -11.282 0.25 31.50 ? 87  ASN A ND2 3 
ATOM   6241  N  N   . LYS A 1 88  ? -2.700  81.901  -9.907  0.25 21.48 ? 88  LYS A N   3 
ATOM   6242  C  CA  . LYS A 1 88  ? -3.518  83.102  -10.019 0.25 22.80 ? 88  LYS A CA  3 
ATOM   6243  C  C   . LYS A 1 88  ? -4.998  82.817  -9.800  0.25 22.82 ? 88  LYS A C   3 
ATOM   6244  O  O   . LYS A 1 88  ? -5.785  83.735  -9.588  0.25 21.30 ? 88  LYS A O   3 
ATOM   6245  C  CB  . LYS A 1 88  ? -3.305  83.774  -11.380 0.25 23.84 ? 88  LYS A CB  3 
ATOM   6246  C  CG  . LYS A 1 88  ? -1.942  84.436  -11.528 0.25 25.92 ? 88  LYS A CG  3 
ATOM   6247  C  CD  . LYS A 1 88  ? -1.806  85.158  -12.861 0.25 28.17 ? 88  LYS A CD  3 
ATOM   6248  C  CE  . LYS A 1 88  ? -0.421  85.767  -13.020 0.25 29.32 ? 88  LYS A CE  3 
ATOM   6249  N  NZ  . LYS A 1 88  ? -0.270  86.517  -14.301 0.25 32.65 ? 88  LYS A NZ  3 
ATOM   6250  N  N   . SER A 1 89  ? -5.372  81.543  -9.830  0.25 22.99 ? 89  SER A N   3 
ATOM   6251  C  CA  . SER A 1 89  ? -6.763  81.160  -9.628  0.25 24.36 ? 89  SER A CA  3 
ATOM   6252  C  C   . SER A 1 89  ? -7.294  81.613  -8.268  0.25 25.16 ? 89  SER A C   3 
ATOM   6253  O  O   . SER A 1 89  ? -8.504  81.699  -8.068  0.25 25.09 ? 89  SER A O   3 
ATOM   6254  C  CB  . SER A 1 89  ? -6.916  79.646  -9.745  0.25 25.92 ? 89  SER A CB  3 
ATOM   6255  O  OG  . SER A 1 89  ? -6.264  78.993  -8.673  0.25 27.10 ? 89  SER A OG  3 
ATOM   6256  N  N   . ASN A 1 90  ? -6.393  81.901  -7.333  0.25 24.42 ? 90  ASN A N   3 
ATOM   6257  C  CA  . ASN A 1 90  ? -6.805  82.338  -6.001  0.25 24.44 ? 90  ASN A CA  3 
ATOM   6258  C  C   . ASN A 1 90  ? -6.292  83.740  -5.696  0.25 22.73 ? 90  ASN A C   3 
ATOM   6259  O  O   . ASN A 1 90  ? -6.183  84.135  -4.535  0.25 21.70 ? 90  ASN A O   3 
ATOM   6260  C  CB  . ASN A 1 90  ? -6.291  81.364  -4.937  0.25 26.92 ? 90  ASN A CB  3 
ATOM   6261  C  CG  . ASN A 1 90  ? -6.722  79.933  -5.200  0.25 29.55 ? 90  ASN A CG  3 
ATOM   6262  O  OD1 . ASN A 1 90  ? -6.282  79.310  -6.166  0.25 29.70 ? 90  ASN A OD1 3 
ATOM   6263  N  ND2 . ASN A 1 90  ? -7.591  79.406  -4.342  0.25 28.10 ? 90  ASN A ND2 3 
ATOM   6264  N  N   . LEU A 1 91  ? -5.992  84.489  -6.750  0.25 21.86 ? 91  LEU A N   3 
ATOM   6265  C  CA  . LEU A 1 91  ? -5.476  85.847  -6.625  0.25 20.88 ? 91  LEU A CA  3 
ATOM   6266  C  C   . LEU A 1 91  ? -6.529  86.801  -6.054  0.25 21.69 ? 91  LEU A C   3 
ATOM   6267  O  O   . LEU A 1 91  ? -6.204  87.725  -5.306  0.25 20.83 ? 91  LEU A O   3 
ATOM   6268  C  CB  . LEU A 1 91  ? -5.001  86.330  -8.001  0.25 21.99 ? 91  LEU A CB  3 
ATOM   6269  C  CG  . LEU A 1 91  ? -4.055  87.529  -8.135  0.25 21.91 ? 91  LEU A CG  3 
ATOM   6270  C  CD1 . LEU A 1 91  ? -2.815  87.342  -7.279  0.25 22.47 ? 91  LEU A CD1 3 
ATOM   6271  C  CD2 . LEU A 1 91  ? -3.663  87.679  -9.599  0.25 22.79 ? 91  LEU A CD2 3 
ATOM   6272  N  N   . ASN A 1 92  ? -7.792  86.569  -6.397  0.25 19.67 ? 92  ASN A N   3 
ATOM   6273  C  CA  . ASN A 1 92  ? -8.878  87.414  -5.909  0.25 20.82 ? 92  ASN A CA  3 
ATOM   6274  C  C   . ASN A 1 92  ? -9.245  87.130  -4.463  0.25 19.08 ? 92  ASN A C   3 
ATOM   6275  O  O   . ASN A 1 92  ? -9.755  88.001  -3.762  0.25 18.65 ? 92  ASN A O   3 
ATOM   6276  C  CB  . ASN A 1 92  ? -10.118 87.257  -6.792  0.25 22.32 ? 92  ASN A CB  3 
ATOM   6277  C  CG  . ASN A 1 92  ? -10.288 88.413  -7.756  0.25 24.70 ? 92  ASN A CG  3 
ATOM   6278  O  OD1 . ASN A 1 92  ? -9.310  88.932  -8.294  0.25 23.21 ? 92  ASN A OD1 3 
ATOM   6279  N  ND2 . ASN A 1 92  ? -11.533 88.819  -7.984  0.25 24.67 ? 92  ASN A ND2 3 
ATOM   6280  N  N   . SER A 1 93  ? -8.991  85.909  -4.012  0.25 17.53 ? 93  SER A N   3 
ATOM   6281  C  CA  . SER A 1 93  ? -9.301  85.553  -2.637  0.25 16.01 ? 93  SER A CA  3 
ATOM   6282  C  C   . SER A 1 93  ? -8.314  86.184  -1.657  0.25 14.89 ? 93  SER A C   3 
ATOM   6283  O  O   . SER A 1 93  ? -8.679  86.520  -0.531  0.25 14.10 ? 93  SER A O   3 
ATOM   6284  C  CB  . SER A 1 93  ? -9.280  84.038  -2.460  0.25 16.44 ? 93  SER A CB  3 
ATOM   6285  O  OG  . SER A 1 93  ? -9.405  83.706  -1.088  0.25 16.32 ? 93  SER A OG  3 
ATOM   6286  N  N   . LEU A 1 94  ? -7.062  86.341  -2.079  0.25 14.22 ? 94  LEU A N   3 
ATOM   6287  C  CA  . LEU A 1 94  ? -6.059  86.914  -1.194  0.25 11.74 ? 94  LEU A CA  3 
ATOM   6288  C  C   . LEU A 1 94  ? -6.390  88.367  -0.871  0.25 12.45 ? 94  LEU A C   3 
ATOM   6289  O  O   . LEU A 1 94  ? -6.296  88.787  0.285   0.25 11.05 ? 94  LEU A O   3 
ATOM   6290  C  CB  . LEU A 1 94  ? -4.665  86.801  -1.819  0.25 14.97 ? 94  LEU A CB  3 
ATOM   6291  C  CG  . LEU A 1 94  ? -3.467  87.041  -0.894  0.25 12.69 ? 94  LEU A CG  3 
ATOM   6292  C  CD1 . LEU A 1 94  ? -3.527  86.072  0.277   0.25 15.30 ? 94  LEU A CD1 3 
ATOM   6293  C  CD2 . LEU A 1 94  ? -2.168  86.848  -1.666  0.25 15.83 ? 94  LEU A CD2 3 
ATOM   6294  N  N   . ASP A 1 95  ? -6.790  89.137  -1.881  0.25 13.50 ? 95  ASP A N   3 
ATOM   6295  C  CA  . ASP A 1 95  ? -7.145  90.535  -1.650  0.25 13.41 ? 95  ASP A CA  3 
ATOM   6296  C  C   . ASP A 1 95  ? -8.271  90.609  -0.610  0.25 14.20 ? 95  ASP A C   3 
ATOM   6297  O  O   . ASP A 1 95  ? -8.301  91.510  0.232   0.25 9.28  ? 95  ASP A O   3 
ATOM   6298  C  CB  . ASP A 1 95  ? -7.595  91.207  -2.958  0.25 14.08 ? 95  ASP A CB  3 
ATOM   6299  C  CG  . ASP A 1 95  ? -6.492  91.251  -4.013  0.25 18.32 ? 95  ASP A CG  3 
ATOM   6300  O  OD1 . ASP A 1 95  ? -5.296  91.160  -3.643  0.25 15.63 ? 95  ASP A OD1 3 
ATOM   6301  O  OD2 . ASP A 1 95  ? -6.823  91.392  -5.214  0.25 17.27 ? 95  ASP A OD2 3 
ATOM   6302  N  N   . GLU A 1 96  ? -9.189  89.647  -0.662  0.25 15.27 ? 96  GLU A N   3 
ATOM   6303  C  CA  . GLU A 1 96  ? -10.309 89.611  0.281   0.25 17.21 ? 96  GLU A CA  3 
ATOM   6304  C  C   . GLU A 1 96  ? -9.786  89.466  1.715   0.25 14.97 ? 96  GLU A C   3 
ATOM   6305  O  O   . GLU A 1 96  ? -10.199 90.200  2.611   0.25 13.39 ? 96  GLU A O   3 
ATOM   6306  C  CB  . GLU A 1 96  ? -11.253 88.450  -0.074  0.25 21.29 ? 96  GLU A CB  3 
ATOM   6307  C  CG  . GLU A 1 96  ? -12.604 88.431  0.659   0.25 23.57 ? 96  GLU A CG  3 
ATOM   6308  C  CD  . GLU A 1 96  ? -12.531 87.836  2.068   0.25 26.76 ? 96  GLU A CD  3 
ATOM   6309  O  OE1 . GLU A 1 96  ? -11.619 87.020  2.333   0.25 24.61 ? 96  GLU A OE1 3 
ATOM   6310  O  OE2 . GLU A 1 96  ? -13.405 88.168  2.905   0.25 25.97 ? 96  GLU A OE2 3 
ATOM   6311  N  N   . GLN A 1 97  ? -8.867  88.531  1.928   0.25 14.72 ? 97  GLN A N   3 
ATOM   6312  C  CA  . GLN A 1 97  ? -8.294  88.319  3.259   0.25 15.16 ? 97  GLN A CA  3 
ATOM   6313  C  C   . GLN A 1 97  ? -7.690  89.608  3.824   0.25 16.08 ? 97  GLN A C   3 
ATOM   6314  O  O   . GLN A 1 97  ? -7.807  89.893  5.021   0.25 10.97 ? 97  GLN A O   3 
ATOM   6315  C  CB  . GLN A 1 97  ? -7.206  87.249  3.201   0.25 15.48 ? 97  GLN A CB  3 
ATOM   6316  C  CG  . GLN A 1 97  ? -7.666  85.936  2.606   0.25 18.75 ? 97  GLN A CG  3 
ATOM   6317  C  CD  . GLN A 1 97  ? -6.600  84.871  2.688   0.25 17.64 ? 97  GLN A CD  3 
ATOM   6318  O  OE1 . GLN A 1 97  ? -6.080  84.579  3.767   0.25 17.86 ? 97  GLN A OE1 3 
ATOM   6319  N  NE2 . GLN A 1 97  ? -6.270  84.275  1.546   0.25 19.12 ? 97  GLN A NE2 3 
ATOM   6320  N  N   . GLU A 1 98  ? -7.040  90.378  2.954   0.25 16.02 ? 98  GLU A N   3 
ATOM   6321  C  CA  . GLU A 1 98  ? -6.398  91.636  3.347   0.25 18.57 ? 98  GLU A CA  3 
ATOM   6322  C  C   . GLU A 1 98  ? -7.358  92.831  3.273   0.25 18.58 ? 98  GLU A C   3 
ATOM   6323  O  O   . GLU A 1 98  ? -6.926  93.984  3.284   0.25 20.28 ? 98  GLU A O   3 
ATOM   6324  C  CB  . GLU A 1 98  ? -5.189  91.904  2.447   0.25 20.47 ? 98  GLU A CB  3 
ATOM   6325  C  CG  . GLU A 1 98  ? -4.168  90.765  2.395   0.25 25.60 ? 98  GLU A CG  3 
ATOM   6326  C  CD  . GLU A 1 98  ? -3.409  90.593  3.703   0.25 27.77 ? 98  GLU A CD  3 
ATOM   6327  O  OE1 . GLU A 1 98  ? -2.956  91.614  4.262   0.25 24.33 ? 98  GLU A OE1 3 
ATOM   6328  O  OE2 . GLU A 1 98  ? -3.254  89.438  4.166   0.25 29.26 ? 98  GLU A OE2 3 
ATOM   6329  N  N   . GLY A 1 99  ? -8.654  92.548  3.186   0.25 18.77 ? 99  GLY A N   3 
ATOM   6330  C  CA  . GLY A 1 99  ? -9.657  93.601  3.121   0.25 16.54 ? 99  GLY A CA  3 
ATOM   6331  C  C   . GLY A 1 99  ? -9.342  94.766  2.200   0.25 16.44 ? 99  GLY A C   3 
ATOM   6332  O  O   . GLY A 1 99  ? -9.681  95.914  2.497   0.25 14.79 ? 99  GLY A O   3 
ATOM   6333  N  N   . VAL A 1 100 ? -8.695  94.480  1.078   0.25 17.18 ? 100 VAL A N   3 
ATOM   6334  C  CA  . VAL A 1 100 ? -8.357  95.528  0.126   0.25 18.00 ? 100 VAL A CA  3 
ATOM   6335  C  C   . VAL A 1 100 ? -9.607  96.315  -0.258  0.25 21.26 ? 100 VAL A C   3 
ATOM   6336  O  O   . VAL A 1 100 ? -9.585  97.545  -0.295  0.25 21.77 ? 100 VAL A O   3 
ATOM   6337  C  CB  . VAL A 1 100 ? -7.714  94.933  -1.142  0.25 16.75 ? 100 VAL A CB  3 
ATOM   6338  C  CG1 . VAL A 1 100 ? -7.436  96.035  -2.163  0.25 17.33 ? 100 VAL A CG1 3 
ATOM   6339  C  CG2 . VAL A 1 100 ? -6.420  94.216  -0.766  0.25 16.43 ? 100 VAL A CG2 3 
ATOM   6340  N  N   . LYS A 1 101 ? -10.702 95.606  -0.522  0.25 23.28 ? 101 LYS A N   3 
ATOM   6341  C  CA  . LYS A 1 101 ? -11.954 96.255  -0.906  0.25 25.84 ? 101 LYS A CA  3 
ATOM   6342  C  C   . LYS A 1 101 ? -12.374 97.327  0.092   0.25 25.44 ? 101 LYS A C   3 
ATOM   6343  O  O   . LYS A 1 101 ? -12.771 98.427  -0.299  0.25 23.92 ? 101 LYS A O   3 
ATOM   6344  C  CB  . LYS A 1 101 ? -13.076 95.218  -1.060  0.25 28.54 ? 101 LYS A CB  3 
ATOM   6345  C  CG  . LYS A 1 101 ? -12.931 94.339  -2.295  0.25 30.51 ? 101 LYS A CG  3 
ATOM   6346  C  CD  . LYS A 1 101 ? -14.173 93.489  -2.551  0.25 33.49 ? 101 LYS A CD  3 
ATOM   6347  C  CE  . LYS A 1 101 ? -14.003 92.620  -3.799  0.25 34.39 ? 101 LYS A CE  3 
ATOM   6348  N  NZ  . LYS A 1 101 ? -15.226 91.831  -4.147  0.25 35.03 ? 101 LYS A NZ  3 
ATOM   6349  N  N   . SER A 1 102 ? -12.274 97.009  1.379   0.25 24.05 ? 102 SER A N   3 
ATOM   6350  C  CA  . SER A 1 102 ? -12.644 97.948  2.433   0.25 22.51 ? 102 SER A CA  3 
ATOM   6351  C  C   . SER A 1 102 ? -11.591 99.041  2.643   0.25 21.79 ? 102 SER A C   3 
ATOM   6352  O  O   . SER A 1 102 ? -11.856 100.044 3.300   0.25 22.16 ? 102 SER A O   3 
ATOM   6353  C  CB  . SER A 1 102 ? -12.881 97.192  3.743   0.25 23.41 ? 102 SER A CB  3 
ATOM   6354  O  OG  . SER A 1 102 ? -11.763 96.391  4.070   0.25 24.07 ? 102 SER A OG  3 
ATOM   6355  N  N   . GLY A 1 103 ? -10.396 98.836  2.097   0.25 19.04 ? 103 GLY A N   3 
ATOM   6356  C  CA  . GLY A 1 103 ? -9.344  99.832  2.226   0.25 18.14 ? 103 GLY A CA  3 
ATOM   6357  C  C   . GLY A 1 103 ? -8.373  99.653  3.381   0.25 16.34 ? 103 GLY A C   3 
ATOM   6358  O  O   . GLY A 1 103 ? -7.673  100.599 3.755   0.25 16.22 ? 103 GLY A O   3 
HETATM 6359  N  N   . MSE A 1 104 ? -8.312  98.450  3.945   0.25 13.94 ? 104 MSE A N   3 
HETATM 6360  C  CA  . MSE A 1 104 ? -7.411  98.200  5.065   0.25 12.50 ? 104 MSE A CA  3 
HETATM 6361  C  C   . MSE A 1 104 ? -5.975  98.017  4.581   0.25 11.47 ? 104 MSE A C   3 
HETATM 6362  O  O   . MSE A 1 104 ? -5.019  98.301  5.311   0.25 8.08  ? 104 MSE A O   3 
HETATM 6363  C  CB  . MSE A 1 104 ? -7.873  96.965  5.841   0.25 14.84 ? 104 MSE A CB  3 
HETATM 6364  C  CG  . MSE A 1 104 ? -9.336  97.027  6.285   0.25 15.89 ? 104 MSE A CG  3 
HETATM 6365  SE SE  . MSE A 1 104 ? -9.763  98.561  7.401   0.25 22.09 ? 104 MSE A SE  3 
HETATM 6366  C  CE  . MSE A 1 104 ? -10.450 99.728  6.020   0.25 19.22 ? 104 MSE A CE  3 
ATOM   6367  N  N   . TYR A 1 105 ? -5.834  97.530  3.352   0.25 10.06 ? 105 TYR A N   3 
ATOM   6368  C  CA  . TYR A 1 105 ? -4.523  97.316  2.739   0.25 9.85  ? 105 TYR A CA  3 
ATOM   6369  C  C   . TYR A 1 105 ? -4.600  97.565  1.245   0.25 9.10  ? 105 TYR A C   3 
ATOM   6370  O  O   . TYR A 1 105 ? -5.648  97.369  0.632   0.25 9.50  ? 105 TYR A O   3 
ATOM   6371  C  CB  . TYR A 1 105 ? -4.034  95.874  2.928   0.25 9.66  ? 105 TYR A CB  3 
ATOM   6372  C  CG  . TYR A 1 105 ? -3.560  95.521  4.317   0.25 9.12  ? 105 TYR A CG  3 
ATOM   6373  C  CD1 . TYR A 1 105 ? -4.468  95.228  5.330   0.25 13.03 ? 105 TYR A CD1 3 
ATOM   6374  C  CD2 . TYR A 1 105 ? -2.199  95.458  4.612   0.25 10.83 ? 105 TYR A CD2 3 
ATOM   6375  C  CE1 . TYR A 1 105 ? -4.040  94.877  6.604   0.25 11.95 ? 105 TYR A CE1 3 
ATOM   6376  C  CE2 . TYR A 1 105 ? -1.756  95.107  5.886   0.25 10.96 ? 105 TYR A CE2 3 
ATOM   6377  C  CZ  . TYR A 1 105 ? -2.685  94.818  6.876   0.25 11.17 ? 105 TYR A CZ  3 
ATOM   6378  O  OH  . TYR A 1 105 ? -2.266  94.481  8.144   0.25 11.82 ? 105 TYR A OH  3 
ATOM   6379  N  N   . VAL A 1 106 ? -3.483  97.995  0.667   0.25 6.78  ? 106 VAL A N   3 
ATOM   6380  C  CA  . VAL A 1 106 ? -3.403  98.212  -0.766  0.25 7.11  ? 106 VAL A CA  3 
ATOM   6381  C  C   . VAL A 1 106 ? -2.412  97.177  -1.303  0.25 8.10  ? 106 VAL A C   3 
ATOM   6382  O  O   . VAL A 1 106 ? -1.408  96.870  -0.646  0.25 7.45  ? 106 VAL A O   3 
ATOM   6383  C  CB  . VAL A 1 106 ? -2.902  99.644  -1.112  0.25 7.85  ? 106 VAL A CB  3 
ATOM   6384  C  CG1 . VAL A 1 106 ? -1.447  99.819  -0.692  0.25 8.47  ? 106 VAL A CG1 3 
ATOM   6385  C  CG2 . VAL A 1 106 ? -3.064  99.903  -2.619  0.25 8.32  ? 106 VAL A CG2 3 
ATOM   6386  N  N   . VAL A 1 107 ? -2.708  96.615  -2.472  0.25 4.72  ? 107 VAL A N   3 
ATOM   6387  C  CA  . VAL A 1 107 ? -1.818  95.639  -3.096  0.25 7.22  ? 107 VAL A CA  3 
ATOM   6388  C  C   . VAL A 1 107 ? -0.562  96.331  -3.630  0.25 6.84  ? 107 VAL A C   3 
ATOM   6389  O  O   . VAL A 1 107 ? -0.650  97.362  -4.290  0.25 5.17  ? 107 VAL A O   3 
ATOM   6390  C  CB  . VAL A 1 107 ? -2.492  94.938  -4.299  0.25 7.57  ? 107 VAL A CB  3 
ATOM   6391  C  CG1 . VAL A 1 107 ? -1.453  94.158  -5.093  0.25 9.45  ? 107 VAL A CG1 3 
ATOM   6392  C  CG2 . VAL A 1 107 ? -3.593  93.992  -3.821  0.25 8.71  ? 107 VAL A CG2 3 
ATOM   6393  N  N   . ILE A 1 108 ? 0.605   95.768  -3.348  0.25 5.30  ? 108 ILE A N   3 
ATOM   6394  C  CA  . ILE A 1 108 ? 1.836   96.350  -3.864  0.25 5.29  ? 108 ILE A CA  3 
ATOM   6395  C  C   . ILE A 1 108 ? 2.589   95.288  -4.647  0.25 6.79  ? 108 ILE A C   3 
ATOM   6396  O  O   . ILE A 1 108 ? 2.222   94.115  -4.634  0.25 7.51  ? 108 ILE A O   3 
ATOM   6397  C  CB  . ILE A 1 108 ? 2.784   96.853  -2.742  0.25 4.84  ? 108 ILE A CB  3 
ATOM   6398  C  CG1 . ILE A 1 108 ? 3.130   95.701  -1.792  0.25 3.37  ? 108 ILE A CG1 3 
ATOM   6399  C  CG2 . ILE A 1 108 ? 2.149   98.020  -1.986  0.25 0.54  ? 108 ILE A CG2 3 
ATOM   6400  C  CD1 . ILE A 1 108 ? 4.094   96.106  -0.668  0.25 4.65  ? 108 ILE A CD1 3 
ATOM   6401  N  N   . GLU A 1 109 ? 3.631   95.723  -5.344  0.25 9.88  ? 109 GLU A N   3 
ATOM   6402  C  CA  . GLU A 1 109 ? 4.499   94.830  -6.092  0.25 11.10 ? 109 GLU A CA  3 
ATOM   6403  C  C   . GLU A 1 109 ? 5.897   95.275  -5.701  0.25 11.89 ? 109 GLU A C   3 
ATOM   6404  O  O   . GLU A 1 109 ? 6.355   96.341  -6.110  0.25 11.90 ? 109 GLU A O   3 
ATOM   6405  C  CB  . GLU A 1 109 ? 4.321   94.995  -7.601  0.25 12.01 ? 109 GLU A CB  3 
ATOM   6406  C  CG  . GLU A 1 109 ? 5.253   94.105  -8.414  0.25 12.35 ? 109 GLU A CG  3 
ATOM   6407  C  CD  . GLU A 1 109 ? 5.331   94.504  -9.877  0.25 13.85 ? 109 GLU A CD  3 
ATOM   6408  O  OE1 . GLU A 1 109 ? 4.302   94.433  -10.581 0.25 15.30 ? 109 GLU A OE1 3 
ATOM   6409  O  OE2 . GLU A 1 109 ? 6.427   94.896  -10.326 0.25 12.77 ? 109 GLU A OE2 3 
ATOM   6410  N  N   . VAL A 1 110 ? 6.563   94.472  -4.880  0.25 11.27 ? 110 VAL A N   3 
ATOM   6411  C  CA  . VAL A 1 110 ? 7.911   94.798  -4.447  0.25 10.85 ? 110 VAL A CA  3 
ATOM   6412  C  C   . VAL A 1 110 ? 8.897   93.744  -4.927  0.25 11.13 ? 110 VAL A C   3 
ATOM   6413  O  O   . VAL A 1 110 ? 8.522   92.617  -5.236  0.25 11.67 ? 110 VAL A O   3 
ATOM   6414  C  CB  . VAL A 1 110 ? 8.023   94.877  -2.903  0.25 11.20 ? 110 VAL A CB  3 
ATOM   6415  C  CG1 . VAL A 1 110 ? 7.140   95.979  -2.367  0.25 9.03  ? 110 VAL A CG1 3 
ATOM   6416  C  CG2 . VAL A 1 110 ? 7.651   93.538  -2.282  0.25 8.74  ? 110 VAL A CG2 3 
ATOM   6417  N  N   . LYS A 1 111 ? 10.161  94.133  -5.001  0.25 12.83 ? 111 LYS A N   3 
ATOM   6418  C  CA  . LYS A 1 111 ? 11.213  93.220  -5.405  0.25 13.19 ? 111 LYS A CA  3 
ATOM   6419  C  C   . LYS A 1 111 ? 11.962  92.916  -4.125  0.25 13.21 ? 111 LYS A C   3 
ATOM   6420  O  O   . LYS A 1 111 ? 12.338  93.831  -3.393  0.25 11.24 ? 111 LYS A O   3 
ATOM   6421  C  CB  . LYS A 1 111 ? 12.127  93.883  -6.440  0.25 15.42 ? 111 LYS A CB  3 
ATOM   6422  C  CG  . LYS A 1 111 ? 11.414  94.143  -7.766  0.25 17.52 ? 111 LYS A CG  3 
ATOM   6423  C  CD  . LYS A 1 111 ? 12.328  94.752  -8.813  0.25 21.02 ? 111 LYS A CD  3 
ATOM   6424  C  CE  . LYS A 1 111 ? 11.574  94.934  -10.129 0.25 22.42 ? 111 LYS A CE  3 
ATOM   6425  N  NZ  . LYS A 1 111 ? 12.380  95.640  -11.159 0.25 26.26 ? 111 LYS A NZ  3 
ATOM   6426  N  N   . VAL A 1 112 ? 12.139  91.629  -3.837  0.25 13.57 ? 112 VAL A N   3 
ATOM   6427  C  CA  . VAL A 1 112 ? 12.839  91.202  -2.632  0.25 13.11 ? 112 VAL A CA  3 
ATOM   6428  C  C   . VAL A 1 112 ? 14.139  90.493  -2.988  0.25 15.16 ? 112 VAL A C   3 
ATOM   6429  O  O   . VAL A 1 112 ? 14.333  90.066  -4.128  0.25 13.17 ? 112 VAL A O   3 
ATOM   6430  C  CB  . VAL A 1 112 ? 11.966  90.258  -1.791  0.25 12.58 ? 112 VAL A CB  3 
ATOM   6431  C  CG1 . VAL A 1 112 ? 10.753  91.017  -1.259  0.25 12.94 ? 112 VAL A CG1 3 
ATOM   6432  C  CG2 . VAL A 1 112 ? 11.515  89.076  -2.636  0.25 12.15 ? 112 VAL A CG2 3 
ATOM   6433  N  N   . ALA A 1 113 ? 15.027  90.364  -2.007  0.25 15.08 ? 113 ALA A N   3 
ATOM   6434  C  CA  . ALA A 1 113 ? 16.313  89.719  -2.242  0.25 15.91 ? 113 ALA A CA  3 
ATOM   6435  C  C   . ALA A 1 113 ? 16.490  88.463  -1.407  0.25 15.40 ? 113 ALA A C   3 
ATOM   6436  O  O   . ALA A 1 113 ? 16.287  88.479  -0.191  0.25 15.97 ? 113 ALA A O   3 
ATOM   6437  C  CB  . ALA A 1 113 ? 17.440  90.698  -1.953  0.25 12.89 ? 113 ALA A CB  3 
ATOM   6438  N  N   . THR A 1 114 ? 16.863  87.374  -2.073  0.25 16.39 ? 114 THR A N   3 
ATOM   6439  C  CA  . THR A 1 114 ? 17.095  86.102  -1.407  0.25 17.34 ? 114 THR A CA  3 
ATOM   6440  C  C   . THR A 1 114 ? 18.444  86.195  -0.708  0.25 19.18 ? 114 THR A C   3 
ATOM   6441  O  O   . THR A 1 114 ? 19.192  87.152  -0.912  0.25 17.21 ? 114 THR A O   3 
ATOM   6442  C  CB  . THR A 1 114 ? 17.164  84.944  -2.413  0.25 16.58 ? 114 THR A CB  3 
ATOM   6443  O  OG1 . THR A 1 114 ? 18.374  85.047  -3.178  0.25 15.44 ? 114 THR A OG1 3 
ATOM   6444  C  CG2 . THR A 1 114 ? 15.973  84.985  -3.351  0.25 14.06 ? 114 THR A CG2 3 
ATOM   6445  N  N   . GLN A 1 115 ? 18.757  85.195  0.107   0.25 20.21 ? 115 GLN A N   3 
ATOM   6446  C  CA  . GLN A 1 115 ? 20.022  85.180  0.823   0.25 22.80 ? 115 GLN A CA  3 
ATOM   6447  C  C   . GLN A 1 115 ? 21.197  84.945  -0.125  0.25 21.98 ? 115 GLN A C   3 
ATOM   6448  O  O   . GLN A 1 115 ? 22.350  85.179  0.239   0.25 21.10 ? 115 GLN A O   3 
ATOM   6449  C  CB  . GLN A 1 115 ? 19.982  84.116  1.922   0.25 26.34 ? 115 GLN A CB  3 
ATOM   6450  C  CG  . GLN A 1 115 ? 18.871  84.369  2.936   0.25 31.97 ? 115 GLN A CG  3 
ATOM   6451  C  CD  . GLN A 1 115 ? 18.746  83.267  3.968   0.25 34.60 ? 115 GLN A CD  3 
ATOM   6452  O  OE1 . GLN A 1 115 ? 19.650  83.049  4.776   0.25 36.20 ? 115 GLN A OE1 3 
ATOM   6453  N  NE2 . GLN A 1 115 ? 17.618  82.562  3.944   0.25 34.19 ? 115 GLN A NE2 3 
ATOM   6454  N  N   . GLU A 1 116 ? 20.902  84.488  -1.340  0.25 21.59 ? 116 GLU A N   3 
ATOM   6455  C  CA  . GLU A 1 116 ? 21.939  84.257  -2.347  0.25 23.03 ? 116 GLU A CA  3 
ATOM   6456  C  C   . GLU A 1 116 ? 22.090  85.495  -3.229  0.25 21.23 ? 116 GLU A C   3 
ATOM   6457  O  O   . GLU A 1 116 ? 22.945  85.541  -4.113  0.25 21.35 ? 116 GLU A O   3 
ATOM   6458  C  CB  . GLU A 1 116 ? 21.582  83.064  -3.237  0.25 26.36 ? 116 GLU A CB  3 
ATOM   6459  C  CG  . GLU A 1 116 ? 21.611  81.712  -2.543  0.25 31.35 ? 116 GLU A CG  3 
ATOM   6460  C  CD  . GLU A 1 116 ? 20.534  81.570  -1.494  0.25 34.36 ? 116 GLU A CD  3 
ATOM   6461  O  OE1 . GLU A 1 116 ? 19.346  81.781  -1.823  0.25 35.63 ? 116 GLU A OE1 3 
ATOM   6462  O  OE2 . GLU A 1 116 ? 20.876  81.242  -0.340  0.25 36.20 ? 116 GLU A OE2 3 
ATOM   6463  N  N   . GLY A 1 117 ? 21.244  86.491  -2.994  0.25 20.69 ? 117 GLY A N   3 
ATOM   6464  C  CA  . GLY A 1 117 ? 21.308  87.710  -3.782  0.25 20.83 ? 117 GLY A CA  3 
ATOM   6465  C  C   . GLY A 1 117 ? 20.454  87.662  -5.036  0.25 21.06 ? 117 GLY A C   3 
ATOM   6466  O  O   . GLY A 1 117 ? 20.705  88.400  -5.989  0.25 21.80 ? 117 GLY A O   3 
ATOM   6467  N  N   . LYS A 1 118 ? 19.448  86.792  -5.042  0.25 21.26 ? 118 LYS A N   3 
ATOM   6468  C  CA  . LYS A 1 118 ? 18.555  86.674  -6.189  0.25 23.77 ? 118 LYS A CA  3 
ATOM   6469  C  C   . LYS A 1 118 ? 17.315  87.551  -6.006  0.25 23.59 ? 118 LYS A C   3 
ATOM   6470  O  O   . LYS A 1 118 ? 16.655  87.510  -4.962  0.25 21.65 ? 118 LYS A O   3 
ATOM   6471  C  CB  . LYS A 1 118 ? 18.134  85.216  -6.390  0.25 27.68 ? 118 LYS A CB  3 
ATOM   6472  C  CG  . LYS A 1 118 ? 17.116  85.022  -7.506  0.25 32.97 ? 118 LYS A CG  3 
ATOM   6473  C  CD  . LYS A 1 118 ? 16.744  83.556  -7.675  0.25 37.04 ? 118 LYS A CD  3 
ATOM   6474  C  CE  . LYS A 1 118 ? 15.589  83.386  -8.654  0.25 39.40 ? 118 LYS A CE  3 
ATOM   6475  N  NZ  . LYS A 1 118 ? 15.879  83.985  -9.986  0.25 42.84 ? 118 LYS A NZ  3 
ATOM   6476  N  N   . GLU A 1 119 ? 17.001  88.337  -7.030  0.25 22.78 ? 119 GLU A N   3 
ATOM   6477  C  CA  . GLU A 1 119 ? 15.855  89.232  -6.988  0.25 24.92 ? 119 GLU A CA  3 
ATOM   6478  C  C   . GLU A 1 119 ? 14.576  88.491  -7.357  0.25 22.48 ? 119 GLU A C   3 
ATOM   6479  O  O   . GLU A 1 119 ? 14.556  87.699  -8.295  0.25 20.82 ? 119 GLU A O   3 
ATOM   6480  C  CB  . GLU A 1 119 ? 16.087  90.410  -7.940  0.25 27.57 ? 119 GLU A CB  3 
ATOM   6481  C  CG  . GLU A 1 119 ? 15.058  91.525  -7.837  0.25 33.47 ? 119 GLU A CG  3 
ATOM   6482  C  CD  . GLU A 1 119 ? 13.741  91.177  -8.498  0.25 34.90 ? 119 GLU A CD  3 
ATOM   6483  O  OE1 . GLU A 1 119 ? 13.741  90.897  -9.715  0.25 37.19 ? 119 GLU A OE1 3 
ATOM   6484  O  OE2 . GLU A 1 119 ? 12.704  91.188  -7.801  0.25 38.38 ? 119 GLU A OE2 3 
ATOM   6485  N  N   . ILE A 1 120 ? 13.510  88.756  -6.609  0.25 21.69 ? 120 ILE A N   3 
ATOM   6486  C  CA  . ILE A 1 120 ? 12.222  88.112  -6.847  0.25 20.69 ? 120 ILE A CA  3 
ATOM   6487  C  C   . ILE A 1 120 ? 11.090  89.139  -6.772  0.25 19.50 ? 120 ILE A C   3 
ATOM   6488  O  O   . ILE A 1 120 ? 10.995  89.894  -5.801  0.25 18.94 ? 120 ILE A O   3 
ATOM   6489  C  CB  . ILE A 1 120 ? 11.962  87.008  -5.795  0.25 22.09 ? 120 ILE A CB  3 
ATOM   6490  C  CG1 . ILE A 1 120 ? 13.052  85.942  -5.884  0.25 23.89 ? 120 ILE A CG1 3 
ATOM   6491  C  CG2 . ILE A 1 120 ? 10.591  86.394  -6.003  0.25 21.65 ? 120 ILE A CG2 3 
ATOM   6492  C  CD1 . ILE A 1 120 ? 12.965  84.901  -4.802  0.25 27.00 ? 120 ILE A CD1 3 
ATOM   6493  N  N   . THR A 1 121 ? 10.243  89.165  -7.801  0.25 15.70 ? 121 THR A N   3 
ATOM   6494  C  CA  . THR A 1 121 ? 9.117   90.092  -7.847  0.25 15.21 ? 121 THR A CA  3 
ATOM   6495  C  C   . THR A 1 121 ? 7.895   89.428  -7.218  0.25 15.13 ? 121 THR A C   3 
ATOM   6496  O  O   . THR A 1 121 ? 7.506   88.325  -7.606  0.25 14.56 ? 121 THR A O   3 
ATOM   6497  C  CB  . THR A 1 121 ? 8.789   90.504  -9.300  0.25 14.47 ? 121 THR A CB  3 
ATOM   6498  O  OG1 . THR A 1 121 ? 9.953   91.072  -9.906  0.25 9.16  ? 121 THR A OG1 3 
ATOM   6499  C  CG2 . THR A 1 121 ? 7.674   91.538  -9.334  0.25 12.17 ? 121 THR A CG2 3 
ATOM   6500  N  N   . CYS A 1 122 ? 7.288   90.103  -6.248  0.25 13.63 ? 122 CYS A N   3 
ATOM   6501  C  CA  . CYS A 1 122 ? 6.131   89.541  -5.563  0.25 12.33 ? 122 CYS A CA  3 
ATOM   6502  C  C   . CYS A 1 122 ? 4.947   90.482  -5.435  0.25 11.68 ? 122 CYS A C   3 
ATOM   6503  O  O   . CYS A 1 122 ? 5.040   91.683  -5.688  0.25 10.94 ? 122 CYS A O   3 
ATOM   6504  C  CB  . CYS A 1 122 ? 6.517   89.096  -4.152  0.25 13.54 ? 122 CYS A CB  3 
ATOM   6505  S  SG  . CYS A 1 122 ? 7.857   87.894  -4.062  0.25 16.24 ? 122 CYS A SG  3 
ATOM   6506  N  N   . ARG A 1 123 ? 3.828   89.904  -5.020  0.25 10.60 ? 123 ARG A N   3 
ATOM   6507  C  CA  . ARG A 1 123 ? 2.616   90.656  -4.773  0.25 10.02 ? 123 ARG A CA  3 
ATOM   6508  C  C   . ARG A 1 123 ? 2.508   90.658  -3.245  0.25 10.67 ? 123 ARG A C   3 
ATOM   6509  O  O   . ARG A 1 123 ? 2.501   89.594  -2.613  0.25 8.73  ? 123 ARG A O   3 
ATOM   6510  C  CB  . ARG A 1 123 ? 1.416   89.936  -5.384  0.25 11.62 ? 123 ARG A CB  3 
ATOM   6511  C  CG  . ARG A 1 123 ? 0.098   90.689  -5.272  0.25 11.97 ? 123 ARG A CG  3 
ATOM   6512  C  CD  . ARG A 1 123 ? -1.055  89.774  -5.648  0.25 8.67  ? 123 ARG A CD  3 
ATOM   6513  N  NE  . ARG A 1 123 ? -2.339  90.468  -5.712  0.25 11.01 ? 123 ARG A NE  3 
ATOM   6514  C  CZ  . ARG A 1 123 ? -2.707  91.266  -6.709  0.25 12.61 ? 123 ARG A CZ  3 
ATOM   6515  N  NH1 . ARG A 1 123 ? -1.887  91.477  -7.732  0.25 11.66 ? 123 ARG A NH1 3 
ATOM   6516  N  NH2 . ARG A 1 123 ? -3.898  91.846  -6.691  0.25 14.15 ? 123 ARG A NH2 3 
ATOM   6517  N  N   . SER A 1 124 ? 2.470   91.841  -2.643  0.25 8.19  ? 124 SER A N   3 
ATOM   6518  C  CA  . SER A 1 124 ? 2.343   91.924  -1.197  0.25 6.23  ? 124 SER A CA  3 
ATOM   6519  C  C   . SER A 1 124 ? 1.263   92.942  -0.840  0.25 6.36  ? 124 SER A C   3 
ATOM   6520  O  O   . SER A 1 124 ? 0.472   93.345  -1.697  0.25 6.20  ? 124 SER A O   3 
ATOM   6521  C  CB  . SER A 1 124 ? 3.677   92.314  -0.555  0.25 3.16  ? 124 SER A CB  3 
ATOM   6522  O  OG  . SER A 1 124 ? 3.664   92.020  0.837   0.25 3.01  ? 124 SER A OG  3 
ATOM   6523  N  N   . TYR A 1 125 ? 1.240   93.368  0.417   0.25 4.64  ? 125 TYR A N   3 
ATOM   6524  C  CA  . TYR A 1 125 ? 0.226   94.310  0.876   0.25 8.49  ? 125 TYR A CA  3 
ATOM   6525  C  C   . TYR A 1 125 ? 0.784   95.244  1.939   0.25 7.64  ? 125 TYR A C   3 
ATOM   6526  O  O   . TYR A 1 125 ? 1.813   94.957  2.547   0.25 9.09  ? 125 TYR A O   3 
ATOM   6527  C  CB  . TYR A 1 125 ? -0.954  93.538  1.485   0.25 6.32  ? 125 TYR A CB  3 
ATOM   6528  C  CG  . TYR A 1 125 ? -1.615  92.552  0.545   0.25 9.35  ? 125 TYR A CG  3 
ATOM   6529  C  CD1 . TYR A 1 125 ? -2.728  92.919  -0.214  0.25 5.65  ? 125 TYR A CD1 3 
ATOM   6530  C  CD2 . TYR A 1 125 ? -1.110  91.255  0.396   0.25 8.18  ? 125 TYR A CD2 3 
ATOM   6531  C  CE1 . TYR A 1 125 ? -3.327  92.016  -1.102  0.25 7.42  ? 125 TYR A CE1 3 
ATOM   6532  C  CE2 . TYR A 1 125 ? -1.698  90.348  -0.489  0.25 9.22  ? 125 TYR A CE2 3 
ATOM   6533  C  CZ  . TYR A 1 125 ? -2.801  90.736  -1.232  0.25 8.17  ? 125 TYR A CZ  3 
ATOM   6534  O  OH  . TYR A 1 125 ? -3.369  89.852  -2.114  0.25 10.57 ? 125 TYR A OH  3 
ATOM   6535  N  N   . LEU A 1 126 ? 0.097   96.364  2.145   0.25 8.71  ? 126 LEU A N   3 
ATOM   6536  C  CA  . LEU A 1 126 ? 0.456   97.327  3.191   0.25 8.07  ? 126 LEU A CA  3 
ATOM   6537  C  C   . LEU A 1 126 ? -0.727  98.262  3.384   0.25 8.37  ? 126 LEU A C   3 
ATOM   6538  O  O   . LEU A 1 126 ? -1.610  98.340  2.522   0.25 5.57  ? 126 LEU A O   3 
ATOM   6539  C  CB  . LEU A 1 126 ? 1.729   98.119  2.836   0.25 8.31  ? 126 LEU A CB  3 
ATOM   6540  C  CG  . LEU A 1 126 ? 1.760   99.143  1.698   0.25 9.51  ? 126 LEU A CG  3 
ATOM   6541  C  CD1 . LEU A 1 126 ? 0.960   100.387 2.075   0.25 8.42  ? 126 LEU A CD1 3 
ATOM   6542  C  CD2 . LEU A 1 126 ? 3.205   99.516  1.418   0.25 8.39  ? 126 LEU A CD2 3 
HETATM 6543  N  N   . MSE A 1 127 ? -0.757  98.956  4.517   0.25 7.77  ? 127 MSE A N   3 
HETATM 6544  C  CA  . MSE A 1 127 ? -1.842  99.883  4.809   0.25 9.77  ? 127 MSE A CA  3 
HETATM 6545  C  C   . MSE A 1 127 ? -1.419  101.308 4.472   0.25 9.07  ? 127 MSE A C   3 
HETATM 6546  O  O   . MSE A 1 127 ? -0.265  101.677 4.678   0.25 8.53  ? 127 MSE A O   3 
HETATM 6547  C  CB  . MSE A 1 127 ? -2.223  99.789  6.286   0.25 11.50 ? 127 MSE A CB  3 
HETATM 6548  C  CG  . MSE A 1 127 ? -2.500  98.372  6.739   0.25 10.50 ? 127 MSE A CG  3 
HETATM 6549  SE SE  . MSE A 1 127 ? -3.512  98.346  8.369   0.25 16.19 ? 127 MSE A SE  3 
HETATM 6550  C  CE  . MSE A 1 127 ? -2.063  98.662  9.583   0.25 9.33  ? 127 MSE A CE  3 
ATOM   6551  N  N   . THR A 1 128 ? -2.356  102.104 3.964   0.25 8.26  ? 128 THR A N   3 
ATOM   6552  C  CA  . THR A 1 128 ? -2.061  103.480 3.586   0.25 9.04  ? 128 THR A CA  3 
ATOM   6553  C  C   . THR A 1 128 ? -2.666  104.504 4.541   0.25 12.02 ? 128 THR A C   3 
ATOM   6554  O  O   . THR A 1 128 ? -2.333  105.686 4.487   0.25 16.09 ? 128 THR A O   3 
ATOM   6555  C  CB  . THR A 1 128 ? -2.578  103.784 2.167   0.25 8.64  ? 128 THR A CB  3 
ATOM   6556  O  OG1 . THR A 1 128 ? -4.007  103.679 2.151   0.25 8.23  ? 128 THR A OG1 3 
ATOM   6557  C  CG2 . THR A 1 128 ? -1.986  102.801 1.151   0.25 7.85  ? 128 THR A CG2 3 
ATOM   6558  N  N   . ASN A 1 129 ? -3.552  104.050 5.418   0.25 12.65 ? 129 ASN A N   3 
ATOM   6559  C  CA  . ASN A 1 129 ? -4.203  104.940 6.375   0.25 13.63 ? 129 ASN A CA  3 
ATOM   6560  C  C   . ASN A 1 129 ? -4.374  104.181 7.679   0.25 14.30 ? 129 ASN A C   3 
ATOM   6561  O  O   . ASN A 1 129 ? -5.277  103.350 7.805   0.25 14.38 ? 129 ASN A O   3 
ATOM   6562  C  CB  . ASN A 1 129 ? -5.580  105.373 5.853   0.25 12.36 ? 129 ASN A CB  3 
ATOM   6563  C  CG  . ASN A 1 129 ? -6.180  106.517 6.662   0.25 17.19 ? 129 ASN A CG  3 
ATOM   6564  O  OD1 . ASN A 1 129 ? -5.832  106.715 7.826   0.25 12.29 ? 129 ASN A OD1 3 
ATOM   6565  N  ND2 . ASN A 1 129 ? -7.097  107.264 6.051   0.25 14.61 ? 129 ASN A ND2 3 
ATOM   6566  N  N   . TYR A 1 130 ? -3.511  104.453 8.651   0.25 12.62 ? 130 TYR A N   3 
ATOM   6567  C  CA  . TYR A 1 130 ? -3.614  103.746 9.918   0.25 14.70 ? 130 TYR A CA  3 
ATOM   6568  C  C   . TYR A 1 130 ? -2.949  104.468 11.076  0.25 15.00 ? 130 TYR A C   3 
ATOM   6569  O  O   . TYR A 1 130 ? -2.136  105.371 10.885  0.25 13.20 ? 130 TYR A O   3 
ATOM   6570  C  CB  . TYR A 1 130 ? -2.996  102.349 9.803   0.25 11.70 ? 130 TYR A CB  3 
ATOM   6571  C  CG  . TYR A 1 130 ? -1.484  102.362 9.757   0.25 14.25 ? 130 TYR A CG  3 
ATOM   6572  C  CD1 . TYR A 1 130 ? -0.804  102.609 8.565   0.25 14.32 ? 130 TYR A CD1 3 
ATOM   6573  C  CD2 . TYR A 1 130 ? -0.731  102.155 10.918  0.25 12.25 ? 130 TYR A CD2 3 
ATOM   6574  C  CE1 . TYR A 1 130 ? 0.591   102.650 8.527   0.25 13.71 ? 130 TYR A CE1 3 
ATOM   6575  C  CE2 . TYR A 1 130 ? 0.658   102.193 10.894  0.25 11.91 ? 130 TYR A CE2 3 
ATOM   6576  C  CZ  . TYR A 1 130 ? 1.313   102.440 9.697   0.25 14.66 ? 130 TYR A CZ  3 
ATOM   6577  O  OH  . TYR A 1 130 ? 2.687   102.468 9.665   0.25 15.73 ? 130 TYR A OH  3 
ATOM   6578  N  N   . GLU A 1 131 ? -3.302  104.036 12.280  0.25 15.47 ? 131 GLU A N   3 
ATOM   6579  C  CA  . GLU A 1 131 ? -2.745  104.591 13.504  0.25 18.68 ? 131 GLU A CA  3 
ATOM   6580  C  C   . GLU A 1 131 ? -1.941  103.461 14.138  0.25 16.86 ? 131 GLU A C   3 
ATOM   6581  O  O   . GLU A 1 131 ? -2.501  102.422 14.480  0.25 16.08 ? 131 GLU A O   3 
ATOM   6582  C  CB  . GLU A 1 131 ? -3.874  105.024 14.449  0.25 20.27 ? 131 GLU A CB  3 
ATOM   6583  C  CG  . GLU A 1 131 ? -4.946  105.879 13.776  0.25 26.02 ? 131 GLU A CG  3 
ATOM   6584  C  CD  . GLU A 1 131 ? -6.056  106.304 14.728  0.25 28.55 ? 131 GLU A CD  3 
ATOM   6585  O  OE1 . GLU A 1 131 ? -6.603  105.434 15.438  0.25 28.30 ? 131 GLU A OE1 3 
ATOM   6586  O  OE2 . GLU A 1 131 ? -6.388  107.509 14.759  0.25 29.24 ? 131 GLU A OE2 3 
ATOM   6587  N  N   . SER A 1 132 ? -0.633  103.660 14.279  0.25 16.49 ? 132 SER A N   3 
ATOM   6588  C  CA  . SER A 1 132 ? 0.234   102.648 14.865  0.25 17.32 ? 132 SER A CA  3 
ATOM   6589  C  C   . SER A 1 132 ? -0.260  102.237 16.251  0.25 16.98 ? 132 SER A C   3 
ATOM   6590  O  O   . SER A 1 132 ? -0.776  103.056 17.010  0.25 16.78 ? 132 SER A O   3 
ATOM   6591  C  CB  . SER A 1 132 ? 1.671   103.169 14.956  0.25 20.14 ? 132 SER A CB  3 
ATOM   6592  O  OG  . SER A 1 132 ? 2.571   102.127 15.297  0.25 18.92 ? 132 SER A OG  3 
ATOM   6593  N  N   . ALA A 1 133 ? -0.099  100.959 16.570  0.25 17.35 ? 133 ALA A N   3 
ATOM   6594  C  CA  . ALA A 1 133 ? -0.527  100.420 17.856  0.25 16.31 ? 133 ALA A CA  3 
ATOM   6595  C  C   . ALA A 1 133 ? 0.060   99.025  17.999  0.25 16.30 ? 133 ALA A C   3 
ATOM   6596  O  O   . ALA A 1 133 ? 0.002   98.220  17.066  0.25 15.98 ? 133 ALA A O   3 
ATOM   6597  C  CB  . ALA A 1 133 ? -2.051  100.357 17.921  0.25 18.11 ? 133 ALA A CB  3 
ATOM   6598  N  N   . PRO A 1 134 ? 0.635   98.717  19.171  0.25 14.99 ? 134 PRO A N   3 
ATOM   6599  C  CA  . PRO A 1 134 ? 1.223   97.391  19.369  0.25 13.93 ? 134 PRO A CA  3 
ATOM   6600  C  C   . PRO A 1 134 ? 0.268   96.237  19.094  0.25 13.32 ? 134 PRO A C   3 
ATOM   6601  O  O   . PRO A 1 134 ? -0.956  96.380  19.199  0.25 12.55 ? 134 PRO A O   3 
ATOM   6602  C  CB  . PRO A 1 134 ? 1.707   97.435  20.820  0.25 13.12 ? 134 PRO A CB  3 
ATOM   6603  C  CG  . PRO A 1 134 ? 0.792   98.446  21.463  0.25 16.21 ? 134 PRO A CG  3 
ATOM   6604  C  CD  . PRO A 1 134 ? 0.700   99.515  20.407  0.25 14.02 ? 134 PRO A CD  3 
ATOM   6605  N  N   . PRO A 1 135 ? 0.822   95.072  18.726  0.25 12.45 ? 135 PRO A N   3 
ATOM   6606  C  CA  . PRO A 1 135 ? 0.027   93.882  18.432  0.25 11.94 ? 135 PRO A CA  3 
ATOM   6607  C  C   . PRO A 1 135 ? -0.378  93.135  19.696  0.25 13.73 ? 135 PRO A C   3 
ATOM   6608  O  O   . PRO A 1 135 ? 0.007   93.505  20.810  0.25 12.22 ? 135 PRO A O   3 
ATOM   6609  C  CB  . PRO A 1 135 ? 0.970   93.059  17.572  0.25 10.89 ? 135 PRO A CB  3 
ATOM   6610  C  CG  . PRO A 1 135 ? 2.290   93.325  18.216  0.25 13.92 ? 135 PRO A CG  3 
ATOM   6611  C  CD  . PRO A 1 135 ? 2.253   94.824  18.456  0.25 13.75 ? 135 PRO A CD  3 
ATOM   6612  N  N   . SER A 1 136 ? -1.157  92.078  19.514  0.25 13.51 ? 136 SER A N   3 
ATOM   6613  C  CA  . SER A 1 136 ? -1.583  91.257  20.634  0.25 14.49 ? 136 SER A CA  3 
ATOM   6614  C  C   . SER A 1 136 ? -0.524  90.175  20.824  0.25 15.93 ? 136 SER A C   3 
ATOM   6615  O  O   . SER A 1 136 ? 0.210   89.844  19.886  0.25 12.80 ? 136 SER A O   3 
ATOM   6616  C  CB  . SER A 1 136 ? -2.924  90.598  20.325  0.25 15.46 ? 136 SER A CB  3 
ATOM   6617  O  OG  . SER A 1 136 ? -2.786  89.679  19.257  0.25 14.32 ? 136 SER A OG  3 
ATOM   6618  N  N   . PRO A 1 137 ? -0.421  89.616  22.041  0.25 15.18 ? 137 PRO A N   3 
ATOM   6619  C  CA  . PRO A 1 137 ? 0.572   88.569  22.280  0.25 14.60 ? 137 PRO A CA  3 
ATOM   6620  C  C   . PRO A 1 137 ? 0.440   87.439  21.256  0.25 14.92 ? 137 PRO A C   3 
ATOM   6621  O  O   . PRO A 1 137 ? 1.434   86.999  20.683  0.25 13.81 ? 137 PRO A O   3 
ATOM   6622  C  CB  . PRO A 1 137 ? 0.248   88.106  23.700  0.25 14.53 ? 137 PRO A CB  3 
ATOM   6623  C  CG  . PRO A 1 137 ? -0.203  89.378  24.359  0.25 14.78 ? 137 PRO A CG  3 
ATOM   6624  C  CD  . PRO A 1 137 ? -1.113  89.982  23.292  0.25 14.50 ? 137 PRO A CD  3 
ATOM   6625  N  N   . GLN A 1 138 ? -0.791  86.993  21.013  0.25 13.87 ? 138 GLN A N   3 
ATOM   6626  C  CA  . GLN A 1 138 ? -1.037  85.908  20.075  0.25 14.16 ? 138 GLN A CA  3 
ATOM   6627  C  C   . GLN A 1 138 ? -0.549  86.219  18.662  0.25 14.34 ? 138 GLN A C   3 
ATOM   6628  O  O   . GLN A 1 138 ? 0.090   85.380  18.020  0.25 14.67 ? 138 GLN A O   3 
ATOM   6629  C  CB  . GLN A 1 138 ? -2.528  85.555  20.049  0.25 16.95 ? 138 GLN A CB  3 
ATOM   6630  C  CG  . GLN A 1 138 ? -3.089  85.168  21.418  0.25 17.75 ? 138 GLN A CG  3 
ATOM   6631  C  CD  . GLN A 1 138 ? -3.619  86.359  22.191  0.25 19.21 ? 138 GLN A CD  3 
ATOM   6632  O  OE1 . GLN A 1 138 ? -2.990  87.417  22.233  0.25 19.83 ? 138 GLN A OE1 3 
ATOM   6633  N  NE2 . GLN A 1 138 ? -4.780  86.189  22.818  0.25 20.13 ? 138 GLN A NE2 3 
ATOM   6634  N  N   . TYR A 1 139 ? -0.852  87.421  18.186  0.25 12.78 ? 139 TYR A N   3 
ATOM   6635  C  CA  . TYR A 1 139 ? -0.437  87.845  16.854  0.25 12.82 ? 139 TYR A CA  3 
ATOM   6636  C  C   . TYR A 1 139 ? 1.083   87.852  16.811  0.25 13.58 ? 139 TYR A C   3 
ATOM   6637  O  O   . TYR A 1 139 ? 1.690   87.257  15.920  0.25 11.80 ? 139 TYR A O   3 
ATOM   6638  C  CB  . TYR A 1 139 ? -0.971  89.246  16.560  0.25 11.29 ? 139 TYR A CB  3 
ATOM   6639  C  CG  . TYR A 1 139 ? -0.816  89.697  15.126  0.25 14.37 ? 139 TYR A CG  3 
ATOM   6640  C  CD1 . TYR A 1 139 ? -1.375  88.964  14.077  0.25 11.41 ? 139 TYR A CD1 3 
ATOM   6641  C  CD2 . TYR A 1 139 ? -0.169  90.894  14.822  0.25 12.93 ? 139 TYR A CD2 3 
ATOM   6642  C  CE1 . TYR A 1 139 ? -1.299  89.419  12.754  0.25 12.93 ? 139 TYR A CE1 3 
ATOM   6643  C  CE2 . TYR A 1 139 ? -0.087  91.358  13.510  0.25 13.90 ? 139 TYR A CE2 3 
ATOM   6644  C  CZ  . TYR A 1 139 ? -0.655  90.617  12.484  0.25 12.61 ? 139 TYR A CZ  3 
ATOM   6645  O  OH  . TYR A 1 139 ? -0.584  91.081  11.195  0.25 10.66 ? 139 TYR A OH  3 
ATOM   6646  N  N   . LYS A 1 140 ? 1.701   88.521  17.783  0.25 12.68 ? 140 LYS A N   3 
ATOM   6647  C  CA  . LYS A 1 140 ? 3.156   88.575  17.829  0.25 13.80 ? 140 LYS A CA  3 
ATOM   6648  C  C   . LYS A 1 140 ? 3.768   87.177  17.873  0.25 13.72 ? 140 LYS A C   3 
ATOM   6649  O  O   . LYS A 1 140 ? 4.794   86.926  17.238  0.25 14.47 ? 140 LYS A O   3 
ATOM   6650  C  CB  . LYS A 1 140 ? 3.644   89.366  19.049  0.25 13.29 ? 140 LYS A CB  3 
ATOM   6651  C  CG  . LYS A 1 140 ? 5.162   89.327  19.195  0.25 14.75 ? 140 LYS A CG  3 
ATOM   6652  C  CD  . LYS A 1 140 ? 5.649   90.043  20.445  0.25 14.48 ? 140 LYS A CD  3 
ATOM   6653  C  CE  . LYS A 1 140 ? 7.126   89.760  20.684  0.25 14.28 ? 140 LYS A CE  3 
ATOM   6654  N  NZ  . LYS A 1 140 ? 7.590   90.273  22.003  0.25 16.48 ? 140 LYS A NZ  3 
ATOM   6655  N  N   . LYS A 1 141 ? 3.139   86.271  18.621  0.25 15.35 ? 141 LYS A N   3 
ATOM   6656  C  CA  . LYS A 1 141 ? 3.641   84.902  18.753  0.25 16.25 ? 141 LYS A CA  3 
ATOM   6657  C  C   . LYS A 1 141 ? 3.641   84.145  17.429  0.25 15.96 ? 141 LYS A C   3 
ATOM   6658  O  O   . LYS A 1 141 ? 4.603   83.449  17.108  0.25 15.86 ? 141 LYS A O   3 
ATOM   6659  C  CB  . LYS A 1 141 ? 2.815   84.116  19.781  0.25 17.47 ? 141 LYS A CB  3 
ATOM   6660  C  CG  . LYS A 1 141 ? 3.195   82.645  19.864  0.25 20.93 ? 141 LYS A CG  3 
ATOM   6661  C  CD  . LYS A 1 141 ? 2.275   81.841  20.772  0.25 27.28 ? 141 LYS A CD  3 
ATOM   6662  C  CE  . LYS A 1 141 ? 2.601   82.015  22.249  0.25 28.60 ? 141 LYS A CE  3 
ATOM   6663  N  NZ  . LYS A 1 141 ? 2.348   83.391  22.749  0.25 33.25 ? 141 LYS A NZ  3 
ATOM   6664  N  N   . ILE A 1 142 ? 2.561   84.275  16.666  0.25 14.04 ? 142 ILE A N   3 
ATOM   6665  C  CA  . ILE A 1 142 ? 2.447   83.589  15.378  0.25 13.45 ? 142 ILE A CA  3 
ATOM   6666  C  C   . ILE A 1 142 ? 3.506   84.071  14.395  0.25 12.79 ? 142 ILE A C   3 
ATOM   6667  O  O   . ILE A 1 142 ? 4.033   83.294  13.591  0.25 11.60 ? 142 ILE A O   3 
ATOM   6668  C  CB  . ILE A 1 142 ? 1.049   83.805  14.762  0.25 13.41 ? 142 ILE A CB  3 
ATOM   6669  C  CG1 . ILE A 1 142 ? -0.005  83.092  15.615  0.25 14.79 ? 142 ILE A CG1 3 
ATOM   6670  C  CG2 . ILE A 1 142 ? 1.019   83.307  13.318  0.25 13.00 ? 142 ILE A CG2 3 
ATOM   6671  C  CD1 . ILE A 1 142 ? 0.146   81.580  15.668  0.25 12.64 ? 142 ILE A CD1 3 
ATOM   6672  N  N   . ILE A 1 143 ? 3.808   85.361  14.458  0.25 13.01 ? 143 ILE A N   3 
ATOM   6673  C  CA  . ILE A 1 143 ? 4.809   85.955  13.585  0.25 12.36 ? 143 ILE A CA  3 
ATOM   6674  C  C   . ILE A 1 143 ? 6.198   85.387  13.900  0.25 12.77 ? 143 ILE A C   3 
ATOM   6675  O  O   . ILE A 1 143 ? 6.896   84.892  13.014  0.25 11.82 ? 143 ILE A O   3 
ATOM   6676  C  CB  . ILE A 1 143 ? 4.806   87.494  13.743  0.25 10.51 ? 143 ILE A CB  3 
ATOM   6677  C  CG1 . ILE A 1 143 ? 3.495   88.056  13.185  0.25 10.96 ? 143 ILE A CG1 3 
ATOM   6678  C  CG2 . ILE A 1 143 ? 6.003   88.101  13.034  0.25 12.87 ? 143 ILE A CG2 3 
ATOM   6679  C  CD1 . ILE A 1 143 ? 3.333   89.560  13.353  0.25 6.66  ? 143 ILE A CD1 3 
ATOM   6680  N  N   . CYS A 1 144 ? 6.591   85.448  15.167  0.25 14.15 ? 144 CYS A N   3 
ATOM   6681  C  CA  . CYS A 1 144 ? 7.892   84.930  15.575  0.25 13.65 ? 144 CYS A CA  3 
ATOM   6682  C  C   . CYS A 1 144 ? 7.985   83.434  15.296  0.25 14.39 ? 144 CYS A C   3 
ATOM   6683  O  O   . CYS A 1 144 ? 9.016   82.944  14.828  0.25 14.13 ? 144 CYS A O   3 
ATOM   6684  C  CB  . CYS A 1 144 ? 8.130   85.224  17.058  0.25 15.57 ? 144 CYS A CB  3 
ATOM   6685  S  SG  . CYS A 1 144 ? 8.473   86.975  17.385  0.25 13.69 ? 144 CYS A SG  3 
HETATM 6686  N  N   . MSE A 1 145 ? 6.903   82.712  15.572  0.25 13.26 ? 145 MSE A N   3 
HETATM 6687  C  CA  . MSE A 1 145 ? 6.864   81.276  15.314  0.25 13.47 ? 145 MSE A CA  3 
HETATM 6688  C  C   . MSE A 1 145 ? 7.096   81.037  13.820  0.25 13.51 ? 145 MSE A C   3 
HETATM 6689  O  O   . MSE A 1 145 ? 7.824   80.122  13.429  0.25 12.65 ? 145 MSE A O   3 
HETATM 6690  C  CB  . MSE A 1 145 ? 5.506   80.695  15.740  0.25 15.47 ? 145 MSE A CB  3 
HETATM 6691  C  CG  . MSE A 1 145 ? 5.344   80.528  17.254  0.25 17.59 ? 145 MSE A CG  3 
HETATM 6692  SE SE  . MSE A 1 145 ? 3.631   79.805  17.828  0.25 19.32 ? 145 MSE A SE  3 
HETATM 6693  C  CE  . MSE A 1 145 ? 3.905   77.962  17.328  0.25 19.98 ? 145 MSE A CE  3 
ATOM   6694  N  N   . GLY A 1 146 ? 6.482   81.874  12.987  0.25 10.84 ? 146 GLY A N   3 
ATOM   6695  C  CA  . GLY A 1 146 ? 6.648   81.730  11.552  0.25 11.25 ? 146 GLY A CA  3 
ATOM   6696  C  C   . GLY A 1 146 ? 8.073   82.026  11.128  0.25 12.00 ? 146 GLY A C   3 
ATOM   6697  O  O   . GLY A 1 146 ? 8.671   81.292  10.333  0.25 12.56 ? 146 GLY A O   3 
ATOM   6698  N  N   . ALA A 1 147 ? 8.626   83.107  11.669  0.25 13.07 ? 147 ALA A N   3 
ATOM   6699  C  CA  . ALA A 1 147 ? 9.991   83.510  11.355  0.25 13.13 ? 147 ALA A CA  3 
ATOM   6700  C  C   . ALA A 1 147 ? 10.990  82.394  11.676  0.25 14.11 ? 147 ALA A C   3 
ATOM   6701  O  O   . ALA A 1 147 ? 11.892  82.108  10.885  0.25 13.75 ? 147 ALA A O   3 
ATOM   6702  C  CB  . ALA A 1 147 ? 10.344  84.773  12.132  0.25 11.84 ? 147 ALA A CB  3 
ATOM   6703  N  N   . LYS A 1 148 ? 10.828  81.766  12.838  0.25 16.04 ? 148 LYS A N   3 
ATOM   6704  C  CA  . LYS A 1 148 ? 11.724  80.684  13.245  0.25 18.99 ? 148 LYS A CA  3 
ATOM   6705  C  C   . LYS A 1 148 ? 11.465  79.433  12.418  0.25 19.39 ? 148 LYS A C   3 
ATOM   6706  O  O   . LYS A 1 148 ? 12.393  78.805  11.905  0.25 18.55 ? 148 LYS A O   3 
ATOM   6707  C  CB  . LYS A 1 148 ? 11.524  80.350  14.727  0.25 22.16 ? 148 LYS A CB  3 
ATOM   6708  C  CG  . LYS A 1 148 ? 12.588  79.412  15.296  0.25 24.72 ? 148 LYS A CG  3 
ATOM   6709  C  CD  . LYS A 1 148 ? 12.343  79.113  16.764  0.25 28.40 ? 148 LYS A CD  3 
ATOM   6710  C  CE  . LYS A 1 148 ? 13.517  78.369  17.384  0.25 30.02 ? 148 LYS A CE  3 
ATOM   6711  N  NZ  . LYS A 1 148 ? 13.850  77.116  16.652  0.25 33.34 ? 148 LYS A NZ  3 
ATOM   6712  N  N   . GLU A 1 149 ? 10.189  79.087  12.292  0.25 19.92 ? 149 GLU A N   3 
ATOM   6713  C  CA  . GLU A 1 149 ? 9.763   77.913  11.551  0.25 19.84 ? 149 GLU A CA  3 
ATOM   6714  C  C   . GLU A 1 149 ? 10.117  77.902  10.070  0.25 19.16 ? 149 GLU A C   3 
ATOM   6715  O  O   . GLU A 1 149 ? 10.371  76.838  9.501   0.25 18.43 ? 149 GLU A O   3 
ATOM   6716  C  CB  . GLU A 1 149 ? 8.250   77.736  11.674  0.25 21.88 ? 149 GLU A CB  3 
ATOM   6717  C  CG  . GLU A 1 149 ? 7.713   76.558  10.875  0.25 24.39 ? 149 GLU A CG  3 
ATOM   6718  C  CD  . GLU A 1 149 ? 6.215   76.616  10.682  0.25 24.60 ? 149 GLU A CD  3 
ATOM   6719  O  OE1 . GLU A 1 149 ? 5.735   77.561  10.019  0.25 26.14 ? 149 GLU A OE1 3 
ATOM   6720  O  OE2 . GLU A 1 149 ? 5.518   75.716  11.194  0.25 24.46 ? 149 GLU A OE2 3 
ATOM   6721  N  N   . ASN A 1 150 ? 10.134  79.065  9.433   0.25 17.29 ? 150 ASN A N   3 
ATOM   6722  C  CA  . ASN A 1 150 ? 10.416  79.077  8.006   0.25 17.05 ? 150 ASN A CA  3 
ATOM   6723  C  C   . ASN A 1 150 ? 11.776  79.525  7.500   0.25 15.72 ? 150 ASN A C   3 
ATOM   6724  O  O   . ASN A 1 150 ? 11.927  79.808  6.313   0.25 16.36 ? 150 ASN A O   3 
ATOM   6725  C  CB  . ASN A 1 150 ? 9.306   79.831  7.269   0.25 15.86 ? 150 ASN A CB  3 
ATOM   6726  C  CG  . ASN A 1 150 ? 8.216   78.902  6.779   0.25 17.90 ? 150 ASN A CG  3 
ATOM   6727  O  OD1 . ASN A 1 150 ? 8.494   77.959  6.040   0.25 18.76 ? 150 ASN A OD1 3 
ATOM   6728  N  ND2 . ASN A 1 150 ? 6.974   79.154  7.186   0.25 13.44 ? 150 ASN A ND2 3 
ATOM   6729  N  N   . GLY A 1 151 ? 12.767  79.595  8.379   0.25 15.38 ? 151 GLY A N   3 
ATOM   6730  C  CA  . GLY A 1 151 ? 14.100  79.957  7.921   0.25 14.33 ? 151 GLY A CA  3 
ATOM   6731  C  C   . GLY A 1 151 ? 14.600  81.385  8.042   0.25 13.57 ? 151 GLY A C   3 
ATOM   6732  O  O   . GLY A 1 151 ? 15.790  81.629  7.842   0.25 14.19 ? 151 GLY A O   3 
ATOM   6733  N  N   . LEU A 1 152 ? 13.722  82.335  8.345   0.25 12.24 ? 152 LEU A N   3 
ATOM   6734  C  CA  . LEU A 1 152 ? 14.170  83.708  8.489   0.25 12.71 ? 152 LEU A CA  3 
ATOM   6735  C  C   . LEU A 1 152 ? 15.400  83.714  9.393   0.25 13.54 ? 152 LEU A C   3 
ATOM   6736  O  O   . LEU A 1 152 ? 15.436  83.022  10.412  0.25 14.79 ? 152 LEU A O   3 
ATOM   6737  C  CB  . LEU A 1 152 ? 13.063  84.583  9.086   0.25 12.24 ? 152 LEU A CB  3 
ATOM   6738  C  CG  . LEU A 1 152 ? 12.135  85.246  8.060   0.25 13.72 ? 152 LEU A CG  3 
ATOM   6739  C  CD1 . LEU A 1 152 ? 11.407  84.184  7.247   0.25 11.86 ? 152 LEU A CD1 3 
ATOM   6740  C  CD2 . LEU A 1 152 ? 11.145  86.150  8.776   0.25 10.71 ? 152 LEU A CD2 3 
ATOM   6741  N  N   . PRO A 1 153 ? 16.433  84.480  9.016   0.25 13.43 ? 153 PRO A N   3 
ATOM   6742  C  CA  . PRO A 1 153 ? 17.673  84.571  9.793   0.25 13.54 ? 153 PRO A CA  3 
ATOM   6743  C  C   . PRO A 1 153 ? 17.389  84.819  11.269  0.25 14.43 ? 153 PRO A C   3 
ATOM   6744  O  O   . PRO A 1 153 ? 16.417  85.488  11.615  0.25 14.35 ? 153 PRO A O   3 
ATOM   6745  C  CB  . PRO A 1 153 ? 18.404  85.736  9.135   0.25 14.69 ? 153 PRO A CB  3 
ATOM   6746  C  CG  . PRO A 1 153 ? 17.962  85.621  7.694   0.25 14.48 ? 153 PRO A CG  3 
ATOM   6747  C  CD  . PRO A 1 153 ? 16.480  85.371  7.843   0.25 13.85 ? 153 PRO A CD  3 
ATOM   6748  N  N   . LEU A 1 154 ? 18.240  84.277  12.134  0.25 15.39 ? 154 LEU A N   3 
ATOM   6749  C  CA  . LEU A 1 154 ? 18.073  84.435  13.574  0.25 18.38 ? 154 LEU A CA  3 
ATOM   6750  C  C   . LEU A 1 154 ? 18.091  85.899  13.980  0.25 17.27 ? 154 LEU A C   3 
ATOM   6751  O  O   . LEU A 1 154 ? 17.359  86.310  14.885  0.25 15.57 ? 154 LEU A O   3 
ATOM   6752  C  CB  . LEU A 1 154 ? 19.178  83.683  14.320  0.25 21.82 ? 154 LEU A CB  3 
ATOM   6753  C  CG  . LEU A 1 154 ? 19.249  82.183  14.034  0.25 24.25 ? 154 LEU A CG  3 
ATOM   6754  C  CD1 . LEU A 1 154 ? 20.372  81.563  14.849  0.25 23.95 ? 154 LEU A CD1 3 
ATOM   6755  C  CD2 . LEU A 1 154 ? 17.919  81.531  14.370  0.25 25.46 ? 154 LEU A CD2 3 
ATOM   6756  N  N   . GLU A 1 155 ? 18.928  86.679  13.304  0.25 18.33 ? 155 GLU A N   3 
ATOM   6757  C  CA  . GLU A 1 155 ? 19.054  88.106  13.577  0.25 20.15 ? 155 GLU A CA  3 
ATOM   6758  C  C   . GLU A 1 155 ? 17.701  88.804  13.528  0.25 16.79 ? 155 GLU A C   3 
ATOM   6759  O  O   . GLU A 1 155 ? 17.307  89.478  14.477  0.25 14.35 ? 155 GLU A O   3 
ATOM   6760  C  CB  . GLU A 1 155 ? 19.995  88.752  12.560  0.25 27.15 ? 155 GLU A CB  3 
ATOM   6761  C  CG  . GLU A 1 155 ? 20.173  90.247  12.730  0.25 37.27 ? 155 GLU A CG  3 
ATOM   6762  C  CD  . GLU A 1 155 ? 21.226  90.813  11.796  0.25 41.34 ? 155 GLU A CD  3 
ATOM   6763  O  OE1 . GLU A 1 155 ? 22.409  90.430  11.927  0.25 45.05 ? 155 GLU A OE1 3 
ATOM   6764  O  OE2 . GLU A 1 155 ? 20.871  91.640  10.929  0.25 45.97 ? 155 GLU A OE2 3 
ATOM   6765  N  N   . TYR A 1 156 ? 16.990  88.639  12.418  0.25 14.54 ? 156 TYR A N   3 
ATOM   6766  C  CA  . TYR A 1 156 ? 15.684  89.268  12.265  0.25 12.67 ? 156 TYR A CA  3 
ATOM   6767  C  C   . TYR A 1 156 ? 14.696  88.721  13.287  0.25 12.32 ? 156 TYR A C   3 
ATOM   6768  O  O   . TYR A 1 156 ? 13.831  89.447  13.774  0.25 13.33 ? 156 TYR A O   3 
ATOM   6769  C  CB  . TYR A 1 156 ? 15.135  89.039  10.856  0.25 11.95 ? 156 TYR A CB  3 
ATOM   6770  C  CG  . TYR A 1 156 ? 13.876  89.832  10.574  0.25 9.85  ? 156 TYR A CG  3 
ATOM   6771  C  CD1 . TYR A 1 156 ? 13.926  91.216  10.386  0.25 12.00 ? 156 TYR A CD1 3 
ATOM   6772  C  CD2 . TYR A 1 156 ? 12.635  89.205  10.514  0.25 11.02 ? 156 TYR A CD2 3 
ATOM   6773  C  CE1 . TYR A 1 156 ? 12.763  91.956  10.145  0.25 11.50 ? 156 TYR A CE1 3 
ATOM   6774  C  CE2 . TYR A 1 156 ? 11.471  89.928  10.272  0.25 10.12 ? 156 TYR A CE2 3 
ATOM   6775  C  CZ  . TYR A 1 156 ? 11.541  91.301  10.090  0.25 9.85  ? 156 TYR A CZ  3 
ATOM   6776  O  OH  . TYR A 1 156 ? 10.391  92.015  9.854   0.25 15.01 ? 156 TYR A OH  3 
ATOM   6777  N  N   . GLN A 1 157 ? 14.821  87.437  13.606  0.25 12.16 ? 157 GLN A N   3 
ATOM   6778  C  CA  . GLN A 1 157 ? 13.932  86.822  14.584  0.25 14.02 ? 157 GLN A CA  3 
ATOM   6779  C  C   . GLN A 1 157 ? 14.026  87.552  15.914  0.25 15.73 ? 157 GLN A C   3 
ATOM   6780  O  O   . GLN A 1 157 ? 13.022  88.026  16.442  0.25 16.49 ? 157 GLN A O   3 
ATOM   6781  C  CB  . GLN A 1 157 ? 14.280  85.349  14.788  0.25 13.34 ? 157 GLN A CB  3 
ATOM   6782  C  CG  . GLN A 1 157 ? 13.920  84.457  13.615  0.25 15.36 ? 157 GLN A CG  3 
ATOM   6783  C  CD  . GLN A 1 157 ? 14.005  82.984  13.970  0.25 13.80 ? 157 GLN A CD  3 
ATOM   6784  O  OE1 . GLN A 1 157 ? 13.382  82.534  14.929  0.25 16.01 ? 157 GLN A OE1 3 
ATOM   6785  N  NE2 . GLN A 1 157 ? 14.772  82.226  13.197  0.25 13.53 ? 157 GLN A NE2 3 
ATOM   6786  N  N   . GLU A 1 158 ? 15.236  87.647  16.456  0.25 17.34 ? 158 GLU A N   3 
ATOM   6787  C  CA  . GLU A 1 158 ? 15.420  88.336  17.728  0.25 19.13 ? 158 GLU A CA  3 
ATOM   6788  C  C   . GLU A 1 158 ? 14.817  89.728  17.653  0.25 17.07 ? 158 GLU A C   3 
ATOM   6789  O  O   . GLU A 1 158 ? 14.277  90.225  18.638  0.25 16.99 ? 158 GLU A O   3 
ATOM   6790  C  CB  . GLU A 1 158 ? 16.902  88.440  18.092  0.25 23.17 ? 158 GLU A CB  3 
ATOM   6791  C  CG  . GLU A 1 158 ? 17.530  87.116  18.487  0.25 29.85 ? 158 GLU A CG  3 
ATOM   6792  C  CD  . GLU A 1 158 ? 16.735  86.397  19.565  0.25 31.71 ? 158 GLU A CD  3 
ATOM   6793  O  OE1 . GLU A 1 158 ? 16.428  87.021  20.603  0.25 33.81 ? 158 GLU A OE1 3 
ATOM   6794  O  OE2 . GLU A 1 158 ? 16.418  85.204  19.374  0.25 33.63 ? 158 GLU A OE2 3 
ATOM   6795  N  N   . LYS A 1 159 ? 14.907  90.351  16.480  0.25 16.64 ? 159 LYS A N   3 
ATOM   6796  C  CA  . LYS A 1 159 ? 14.355  91.684  16.288  0.25 17.95 ? 159 LYS A CA  3 
ATOM   6797  C  C   . LYS A 1 159 ? 12.833  91.643  16.365  0.25 17.08 ? 159 LYS A C   3 
ATOM   6798  O  O   . LYS A 1 159 ? 12.197  92.637  16.715  0.25 14.03 ? 159 LYS A O   3 
ATOM   6799  C  CB  . LYS A 1 159 ? 14.797  92.260  14.942  0.25 21.01 ? 159 LYS A CB  3 
ATOM   6800  C  CG  . LYS A 1 159 ? 16.305  92.435  14.817  0.25 26.97 ? 159 LYS A CG  3 
ATOM   6801  C  CD  . LYS A 1 159 ? 16.688  93.340  13.646  0.25 31.84 ? 159 LYS A CD  3 
ATOM   6802  C  CE  . LYS A 1 159 ? 16.276  94.782  13.901  0.25 34.13 ? 159 LYS A CE  3 
ATOM   6803  N  NZ  . LYS A 1 159 ? 16.731  95.696  12.817  0.25 39.98 ? 159 LYS A NZ  3 
ATOM   6804  N  N   . LEU A 1 160 ? 12.256  90.489  16.037  0.25 15.98 ? 160 LEU A N   3 
ATOM   6805  C  CA  . LEU A 1 160 ? 10.807  90.313  16.089  0.25 15.74 ? 160 LEU A CA  3 
ATOM   6806  C  C   . LEU A 1 160 ? 10.381  89.939  17.509  0.25 15.54 ? 160 LEU A C   3 
ATOM   6807  O  O   . LEU A 1 160 ? 9.301   90.306  17.967  0.25 14.89 ? 160 LEU A O   3 
ATOM   6808  C  CB  . LEU A 1 160 ? 10.367  89.204  15.126  0.25 13.21 ? 160 LEU A CB  3 
ATOM   6809  C  CG  . LEU A 1 160 ? 10.474  89.465  13.622  0.25 12.69 ? 160 LEU A CG  3 
ATOM   6810  C  CD1 . LEU A 1 160 ? 10.049  88.219  12.854  0.25 13.20 ? 160 LEU A CD1 3 
ATOM   6811  C  CD2 . LEU A 1 160 ? 9.597   90.651  13.246  0.25 11.04 ? 160 LEU A CD2 3 
ATOM   6812  N  N   . LYS A 1 161 ? 11.241  89.202  18.202  0.25 15.86 ? 161 LYS A N   3 
ATOM   6813  C  CA  . LYS A 1 161 ? 10.951  88.760  19.563  0.25 16.92 ? 161 LYS A CA  3 
ATOM   6814  C  C   . LYS A 1 161 ? 10.957  89.906  20.572  0.25 15.61 ? 161 LYS A C   3 
ATOM   6815  O  O   . LYS A 1 161 ? 10.366  89.792  21.651  0.25 14.77 ? 161 LYS A O   3 
ATOM   6816  C  CB  . LYS A 1 161 ? 11.967  87.692  19.979  0.25 17.60 ? 161 LYS A CB  3 
ATOM   6817  C  CG  . LYS A 1 161 ? 12.060  86.550  18.985  0.25 21.36 ? 161 LYS A CG  3 
ATOM   6818  C  CD  . LYS A 1 161 ? 13.281  85.671  19.220  0.25 22.98 ? 161 LYS A CD  3 
ATOM   6819  C  CE  . LYS A 1 161 ? 13.124  84.787  20.439  0.25 25.16 ? 161 LYS A CE  3 
ATOM   6820  N  NZ  . LYS A 1 161 ? 14.301  83.881  20.570  0.25 26.48 ? 161 LYS A NZ  3 
ATOM   6821  N  N   . ALA A 1 162 ? 11.612  91.008  20.213  0.25 14.84 ? 162 ALA A N   3 
ATOM   6822  C  CA  . ALA A 1 162 ? 11.710  92.177  21.088  0.25 15.19 ? 162 ALA A CA  3 
ATOM   6823  C  C   . ALA A 1 162 ? 10.537  93.143  20.927  0.25 15.77 ? 162 ALA A C   3 
ATOM   6824  O  O   . ALA A 1 162 ? 10.508  94.211  21.545  0.25 14.12 ? 162 ALA A O   3 
ATOM   6825  C  CB  . ALA A 1 162 ? 13.024  92.914  20.822  0.25 16.88 ? 162 ALA A CB  3 
ATOM   6826  N  N   . ILE A 1 163 ? 9.568   92.770  20.100  0.25 14.53 ? 163 ILE A N   3 
ATOM   6827  C  CA  . ILE A 1 163 ? 8.412   93.625  19.880  0.25 14.48 ? 163 ILE A CA  3 
ATOM   6828  C  C   . ILE A 1 163 ? 7.565   93.761  21.140  0.25 15.61 ? 163 ILE A C   3 
ATOM   6829  O  O   . ILE A 1 163 ? 7.223   92.768  21.783  0.25 14.61 ? 163 ILE A O   3 
ATOM   6830  C  CB  . ILE A 1 163 ? 7.515   93.082  18.750  0.25 14.04 ? 163 ILE A CB  3 
ATOM   6831  C  CG1 . ILE A 1 163 ? 8.280   93.094  17.428  0.25 11.22 ? 163 ILE A CG1 3 
ATOM   6832  C  CG2 . ILE A 1 163 ? 6.243   93.939  18.640  0.25 14.21 ? 163 ILE A CG2 3 
ATOM   6833  C  CD1 . ILE A 1 163 ? 7.537   92.432  16.279  0.25 13.68 ? 163 ILE A CD1 3 
ATOM   6834  N  N   . GLU A 1 164 ? 7.231   94.996  21.492  0.25 16.11 ? 164 GLU A N   3 
ATOM   6835  C  CA  . GLU A 1 164 ? 6.407   95.236  22.667  0.25 18.24 ? 164 GLU A CA  3 
ATOM   6836  C  C   . GLU A 1 164 ? 4.944   95.268  22.240  0.25 17.35 ? 164 GLU A C   3 
ATOM   6837  O  O   . GLU A 1 164 ? 4.485   96.231  21.631  0.25 17.16 ? 164 GLU A O   3 
ATOM   6838  C  CB  . GLU A 1 164 ? 6.800   96.560  23.333  0.25 22.66 ? 164 GLU A CB  3 
ATOM   6839  C  CG  . GLU A 1 164 ? 8.106   96.496  24.130  0.25 27.49 ? 164 GLU A CG  3 
ATOM   6840  C  CD  . GLU A 1 164 ? 8.532   97.851  24.682  0.25 31.49 ? 164 GLU A CD  3 
ATOM   6841  O  OE1 . GLU A 1 164 ? 7.661   98.597  25.177  0.25 32.08 ? 164 GLU A OE1 3 
ATOM   6842  O  OE2 . GLU A 1 164 ? 9.741   98.167  24.632  0.25 32.13 ? 164 GLU A OE2 3 
ATOM   6843  N  N   . PRO A 1 165 ? 4.193   94.198  22.546  0.25 17.12 ? 165 PRO A N   3 
ATOM   6844  C  CA  . PRO A 1 165 ? 2.775   94.099  22.197  0.25 16.87 ? 165 PRO A CA  3 
ATOM   6845  C  C   . PRO A 1 165 ? 1.919   94.774  23.262  0.25 17.83 ? 165 PRO A C   3 
ATOM   6846  O  O   . PRO A 1 165 ? 2.445   95.242  24.274  0.25 15.54 ? 165 PRO A O   3 
ATOM   6847  C  CB  . PRO A 1 165 ? 2.554   92.597  22.157  0.25 17.73 ? 165 PRO A CB  3 
ATOM   6848  C  CG  . PRO A 1 165 ? 3.367   92.141  23.321  0.25 17.85 ? 165 PRO A CG  3 
ATOM   6849  C  CD  . PRO A 1 165 ? 4.658   92.949  23.180  0.25 18.60 ? 165 PRO A CD  3 
ATOM   6850  N  N   . ASN A 1 166 ? 0.608   94.838  23.041  0.25 18.38 ? 166 ASN A N   3 
ATOM   6851  C  CA  . ASN A 1 166 ? -0.268  95.433  24.043  0.25 18.53 ? 166 ASN A CA  3 
ATOM   6852  C  C   . ASN A 1 166 ? -0.468  94.387  25.141  0.25 19.26 ? 166 ASN A C   3 
ATOM   6853  O  O   . ASN A 1 166 ? 0.290   93.417  25.212  0.25 18.74 ? 166 ASN A O   3 
ATOM   6854  C  CB  . ASN A 1 166 ? -1.619  95.849  23.440  0.25 16.49 ? 166 ASN A CB  3 
ATOM   6855  C  CG  . ASN A 1 166 ? -2.356  94.699  22.786  0.25 13.78 ? 166 ASN A CG  3 
ATOM   6856  O  OD1 . ASN A 1 166 ? -2.315  93.565  23.263  0.25 13.91 ? 166 ASN A OD1 3 
ATOM   6857  N  ND2 . ASN A 1 166 ? -3.058  94.993  21.691  0.25 14.19 ? 166 ASN A ND2 3 
ATOM   6858  N  N   . ASP A 1 167 ? -1.480  94.564  25.986  0.25 20.85 ? 167 ASP A N   3 
ATOM   6859  C  CA  . ASP A 1 167 ? -1.708  93.613  27.077  0.25 23.10 ? 167 ASP A CA  3 
ATOM   6860  C  C   . ASP A 1 167 ? -3.021  92.842  26.964  0.25 22.93 ? 167 ASP A C   3 
ATOM   6861  O  O   . ASP A 1 167 ? -3.540  92.336  27.957  0.25 21.96 ? 167 ASP A O   3 
ATOM   6862  C  CB  . ASP A 1 167 ? -1.661  94.344  28.423  0.25 25.84 ? 167 ASP A CB  3 
ATOM   6863  C  CG  . ASP A 1 167 ? -2.952  95.077  28.734  0.25 28.67 ? 167 ASP A CG  3 
ATOM   6864  O  OD1 . ASP A 1 167 ? -3.522  95.707  27.813  0.25 28.60 ? 167 ASP A OD1 3 
ATOM   6865  O  OD2 . ASP A 1 167 ? -3.393  95.026  29.903  0.25 30.00 ? 167 ASP A OD2 3 
ATOM   6866  N  N   . TYR A 1 168 ? -3.561  92.751  25.756  0.25 20.33 ? 168 TYR A N   3 
ATOM   6867  C  CA  . TYR A 1 168 ? -4.807  92.024  25.557  0.25 20.59 ? 168 TYR A CA  3 
ATOM   6868  C  C   . TYR A 1 168 ? -4.607  90.551  25.910  0.25 21.15 ? 168 TYR A C   3 
ATOM   6869  O  O   . TYR A 1 168 ? -3.922  89.819  25.189  0.25 18.88 ? 168 TYR A O   3 
ATOM   6870  C  CB  . TYR A 1 168 ? -5.265  92.139  24.101  0.25 19.96 ? 168 TYR A CB  3 
ATOM   6871  C  CG  . TYR A 1 168 ? -6.516  91.349  23.798  0.25 21.06 ? 168 TYR A CG  3 
ATOM   6872  C  CD1 . TYR A 1 168 ? -7.777  91.852  24.117  0.25 19.19 ? 168 TYR A CD1 3 
ATOM   6873  C  CD2 . TYR A 1 168 ? -6.439  90.078  23.223  0.25 21.51 ? 168 TYR A CD2 3 
ATOM   6874  C  CE1 . TYR A 1 168 ? -8.932  91.107  23.871  0.25 20.73 ? 168 TYR A CE1 3 
ATOM   6875  C  CE2 . TYR A 1 168 ? -7.588  89.328  22.974  0.25 20.62 ? 168 TYR A CE2 3 
ATOM   6876  C  CZ  . TYR A 1 168 ? -8.829  89.847  23.300  0.25 19.10 ? 168 TYR A CZ  3 
ATOM   6877  O  OH  . TYR A 1 168 ? -9.966  89.106  23.063  0.25 18.05 ? 168 TYR A OH  3 
ATOM   6878  N  N   . THR A 1 169 ? -5.193  90.120  27.024  0.25 20.27 ? 169 THR A N   3 
ATOM   6879  C  CA  . THR A 1 169 ? -5.080  88.729  27.451  0.25 21.75 ? 169 THR A CA  3 
ATOM   6880  C  C   . THR A 1 169 ? -6.408  88.024  27.221  0.25 22.75 ? 169 THR A C   3 
ATOM   6881  O  O   . THR A 1 169 ? -6.649  86.925  27.729  0.25 18.84 ? 169 THR A O   3 
ATOM   6882  C  CB  . THR A 1 169 ? -4.685  88.617  28.945  0.25 21.37 ? 169 THR A CB  3 
ATOM   6883  O  OG1 . THR A 1 169 ? -5.562  89.420  29.741  0.25 20.31 ? 169 THR A OG1 3 
ATOM   6884  C  CG2 . THR A 1 169 ? -3.252  89.084  29.150  0.25 21.74 ? 169 THR A CG2 3 
ATOM   6885  N  N   . GLY A 1 170 ? -7.268  88.673  26.443  0.25 24.45 ? 170 GLY A N   3 
ATOM   6886  C  CA  . GLY A 1 170 ? -8.565  88.106  26.141  0.25 27.47 ? 170 GLY A CA  3 
ATOM   6887  C  C   . GLY A 1 170 ? -8.445  86.870  25.275  0.25 29.73 ? 170 GLY A C   3 
ATOM   6888  O  O   . GLY A 1 170 ? -7.354  86.336  25.071  0.25 29.96 ? 170 GLY A O   3 
ATOM   6889  N  N   . LYS A 1 171 ? -9.577  86.425  24.750  0.25 33.42 ? 171 LYS A N   3 
ATOM   6890  C  CA  . LYS A 1 171 ? -9.627  85.237  23.916  0.25 36.58 ? 171 LYS A CA  3 
ATOM   6891  C  C   . LYS A 1 171 ? -9.614  85.540  22.415  0.25 35.70 ? 171 LYS A C   3 
ATOM   6892  O  O   . LYS A 1 171 ? -10.256 86.484  21.955  0.25 36.07 ? 171 LYS A O   3 
ATOM   6893  C  CB  . LYS A 1 171 ? -10.883 84.435  24.277  0.25 41.07 ? 171 LYS A CB  3 
ATOM   6894  C  CG  . LYS A 1 171 ? -11.131 83.211  23.420  0.25 47.12 ? 171 LYS A CG  3 
ATOM   6895  C  CD  . LYS A 1 171 ? -12.424 82.520  23.828  0.25 51.50 ? 171 LYS A CD  3 
ATOM   6896  C  CE  . LYS A 1 171 ? -12.712 81.318  22.940  0.25 54.06 ? 171 LYS A CE  3 
ATOM   6897  N  NZ  . LYS A 1 171 ? -13.976 80.636  23.328  0.25 56.87 ? 171 LYS A NZ  3 
ATOM   6898  N  N   . VAL A 1 172 ? -8.862  84.740  21.661  0.25 34.42 ? 172 VAL A N   3 
ATOM   6899  C  CA  . VAL A 1 172 ? -8.794  84.870  20.206  0.25 33.39 ? 172 VAL A CA  3 
ATOM   6900  C  C   . VAL A 1 172 ? -9.507  83.637  19.646  0.25 32.42 ? 172 VAL A C   3 
ATOM   6901  O  O   . VAL A 1 172 ? -9.869  82.738  20.407  0.25 31.04 ? 172 VAL A O   3 
ATOM   6902  C  CB  . VAL A 1 172 ? -7.336  84.903  19.691  0.25 33.66 ? 172 VAL A CB  3 
ATOM   6903  C  CG1 . VAL A 1 172 ? -6.713  86.261  19.979  0.25 34.57 ? 172 VAL A CG1 3 
ATOM   6904  C  CG2 . VAL A 1 172 ? -6.527  83.801  20.350  0.25 34.60 ? 172 VAL A CG2 3 
ATOM   6905  N  N   . SER A 1 173 ? -9.711  83.581  18.333  0.25 30.61 ? 173 SER A N   3 
ATOM   6906  C  CA  . SER A 1 173 ? -10.406 82.439  17.740  0.25 29.57 ? 173 SER A CA  3 
ATOM   6907  C  C   . SER A 1 173 ? -9.780  81.100  18.138  0.25 29.78 ? 173 SER A C   3 
ATOM   6908  O  O   . SER A 1 173 ? -8.580  81.014  18.410  0.25 28.45 ? 173 SER A O   3 
ATOM   6909  C  CB  . SER A 1 173 ? -10.429 82.556  16.216  0.25 27.67 ? 173 SER A CB  3 
ATOM   6910  O  OG  . SER A 1 173 ? -9.163  82.250  15.667  0.25 27.56 ? 173 SER A OG  3 
ATOM   6911  N  N   . GLU A 1 174 ? -10.603 80.056  18.170  0.25 32.08 ? 174 GLU A N   3 
ATOM   6912  C  CA  . GLU A 1 174 ? -10.135 78.723  18.531  0.25 34.91 ? 174 GLU A CA  3 
ATOM   6913  C  C   . GLU A 1 174 ? -8.947  78.271  17.690  0.25 34.34 ? 174 GLU A C   3 
ATOM   6914  O  O   . GLU A 1 174 ? -7.896  77.923  18.229  0.25 34.68 ? 174 GLU A O   3 
ATOM   6915  C  CB  . GLU A 1 174 ? -11.266 77.699  18.395  0.25 38.57 ? 174 GLU A CB  3 
ATOM   6916  C  CG  . GLU A 1 174 ? -12.259 77.702  19.544  0.25 44.37 ? 174 GLU A CG  3 
ATOM   6917  C  CD  . GLU A 1 174 ? -13.215 76.522  19.486  0.25 46.96 ? 174 GLU A CD  3 
ATOM   6918  O  OE1 . GLU A 1 174 ? -14.011 76.444  18.526  0.25 48.58 ? 174 GLU A OE1 3 
ATOM   6919  O  OE2 . GLU A 1 174 ? -13.163 75.670  20.400  0.25 49.85 ? 174 GLU A OE2 3 
ATOM   6920  N  N   . GLU A 1 175 ? -9.115  78.276  16.373  0.25 33.50 ? 175 GLU A N   3 
ATOM   6921  C  CA  . GLU A 1 175 ? -8.047  77.850  15.474  0.25 34.34 ? 175 GLU A CA  3 
ATOM   6922  C  C   . GLU A 1 175 ? -6.765  78.644  15.689  0.25 33.32 ? 175 GLU A C   3 
ATOM   6923  O  O   . GLU A 1 175 ? -5.668  78.136  15.454  0.25 32.70 ? 175 GLU A O   3 
ATOM   6924  C  CB  . GLU A 1 175 ? -8.506  77.955  14.017  0.25 36.11 ? 175 GLU A CB  3 
ATOM   6925  C  CG  . GLU A 1 175 ? -8.999  79.324  13.601  0.25 38.67 ? 175 GLU A CG  3 
ATOM   6926  C  CD  . GLU A 1 175 ? -9.980  79.247  12.445  0.25 40.02 ? 175 GLU A CD  3 
ATOM   6927  O  OE1 . GLU A 1 175 ? -9.668  78.566  11.444  0.25 40.10 ? 175 GLU A OE1 3 
ATOM   6928  O  OE2 . GLU A 1 175 ? -11.062 79.867  12.540  0.25 40.90 ? 175 GLU A OE2 3 
ATOM   6929  N  N   . ILE A 1 176 ? -6.899  79.887  16.138  0.25 31.99 ? 176 ILE A N   3 
ATOM   6930  C  CA  . ILE A 1 176 ? -5.722  80.705  16.399  0.25 31.56 ? 176 ILE A CA  3 
ATOM   6931  C  C   . ILE A 1 176 ? -5.033  80.181  17.658  0.25 31.57 ? 176 ILE A C   3 
ATOM   6932  O  O   . ILE A 1 176 ? -3.830  79.919  17.659  0.25 31.32 ? 176 ILE A O   3 
ATOM   6933  C  CB  . ILE A 1 176 ? -6.091  82.194  16.609  0.25 30.30 ? 176 ILE A CB  3 
ATOM   6934  C  CG1 . ILE A 1 176 ? -6.498  82.827  15.274  0.25 31.39 ? 176 ILE A CG1 3 
ATOM   6935  C  CG2 . ILE A 1 176 ? -4.905  82.944  17.210  0.25 31.33 ? 176 ILE A CG2 3 
ATOM   6936  C  CD1 . ILE A 1 176 ? -6.895  84.300  15.370  0.25 29.83 ? 176 ILE A CD1 3 
ATOM   6937  N  N   . GLU A 1 177 ? -5.807  80.021  18.726  0.25 33.12 ? 177 GLU A N   3 
ATOM   6938  C  CA  . GLU A 1 177 ? -5.269  79.534  19.989  0.25 34.93 ? 177 GLU A CA  3 
ATOM   6939  C  C   . GLU A 1 177 ? -4.736  78.115  19.897  0.25 33.39 ? 177 GLU A C   3 
ATOM   6940  O  O   . GLU A 1 177 ? -3.767  77.768  20.573  0.25 31.92 ? 177 GLU A O   3 
ATOM   6941  C  CB  . GLU A 1 177 ? -6.331  79.610  21.086  0.25 39.34 ? 177 GLU A CB  3 
ATOM   6942  C  CG  . GLU A 1 177 ? -6.080  80.718  22.089  0.25 47.10 ? 177 GLU A CG  3 
ATOM   6943  C  CD  . GLU A 1 177 ? -4.655  80.708  22.614  0.25 48.94 ? 177 GLU A CD  3 
ATOM   6944  O  OE1 . GLU A 1 177 ? -4.177  79.629  23.027  0.25 50.21 ? 177 GLU A OE1 3 
ATOM   6945  O  OE2 . GLU A 1 177 ? -4.013  81.780  22.617  0.25 50.94 ? 177 GLU A OE2 3 
ATOM   6946  N  N   . ASP A 1 178 ? -5.365  77.295  19.060  0.25 32.40 ? 178 ASP A N   3 
ATOM   6947  C  CA  . ASP A 1 178 ? -4.926  75.917  18.901  0.25 34.04 ? 178 ASP A CA  3 
ATOM   6948  C  C   . ASP A 1 178 ? -3.504  75.878  18.356  0.25 33.24 ? 178 ASP A C   3 
ATOM   6949  O  O   . ASP A 1 178 ? -2.644  75.179  18.895  0.25 31.74 ? 178 ASP A O   3 
ATOM   6950  C  CB  . ASP A 1 178 ? -5.863  75.154  17.962  0.25 38.08 ? 178 ASP A CB  3 
ATOM   6951  C  CG  . ASP A 1 178 ? -7.299  75.143  18.454  0.25 42.00 ? 178 ASP A CG  3 
ATOM   6952  O  OD1 . ASP A 1 178 ? -7.506  75.044  19.683  0.25 42.17 ? 178 ASP A OD1 3 
ATOM   6953  O  OD2 . ASP A 1 178 ? -8.220  75.223  17.611  0.25 44.93 ? 178 ASP A OD2 3 
ATOM   6954  N  N   . ILE A 1 179 ? -3.259  76.629  17.286  0.25 32.01 ? 179 ILE A N   3 
ATOM   6955  C  CA  . ILE A 1 179 ? -1.928  76.676  16.687  0.25 30.69 ? 179 ILE A CA  3 
ATOM   6956  C  C   . ILE A 1 179 ? -0.927  77.127  17.739  0.25 30.31 ? 179 ILE A C   3 
ATOM   6957  O  O   . ILE A 1 179 ? 0.176   76.593  17.832  0.25 29.70 ? 179 ILE A O   3 
ATOM   6958  C  CB  . ILE A 1 179 ? -1.874  77.660  15.492  0.25 29.27 ? 179 ILE A CB  3 
ATOM   6959  C  CG1 . ILE A 1 179 ? -2.722  77.122  14.334  0.25 28.77 ? 179 ILE A CG1 3 
ATOM   6960  C  CG2 . ILE A 1 179 ? -0.432  77.862  15.049  0.25 28.75 ? 179 ILE A CG2 3 
ATOM   6961  C  CD1 . ILE A 1 179 ? -2.763  78.030  13.119  0.25 26.88 ? 179 ILE A CD1 3 
ATOM   6962  N  N   . ILE A 1 180 ? -1.331  78.110  18.537  0.25 31.71 ? 180 ILE A N   3 
ATOM   6963  C  CA  . ILE A 1 180 ? -0.484  78.649  19.593  0.25 34.58 ? 180 ILE A CA  3 
ATOM   6964  C  C   . ILE A 1 180 ? -0.165  77.612  20.665  0.25 38.27 ? 180 ILE A C   3 
ATOM   6965  O  O   . ILE A 1 180 ? 0.999   77.269  20.876  0.25 38.11 ? 180 ILE A O   3 
ATOM   6966  C  CB  . ILE A 1 180 ? -1.154  79.873  20.255  0.25 34.17 ? 180 ILE A CB  3 
ATOM   6967  C  CG1 . ILE A 1 180 ? -1.154  81.047  19.273  0.25 32.20 ? 180 ILE A CG1 3 
ATOM   6968  C  CG2 . ILE A 1 180 ? -0.440  80.238  21.548  0.25 32.82 ? 180 ILE A CG2 3 
ATOM   6969  C  CD1 . ILE A 1 180 ? -1.872  82.265  19.784  0.25 30.68 ? 180 ILE A CD1 3 
ATOM   6970  N  N   . LYS A 1 181 ? -1.199  77.111  21.334  0.25 41.86 ? 181 LYS A N   3 
ATOM   6971  C  CA  . LYS A 1 181 ? -1.019  76.123  22.391  0.25 44.96 ? 181 LYS A CA  3 
ATOM   6972  C  C   . LYS A 1 181 ? -0.050  75.012  21.998  0.25 45.27 ? 181 LYS A C   3 
ATOM   6973  O  O   . LYS A 1 181 ? 0.585   74.408  22.860  0.25 46.39 ? 181 LYS A O   3 
ATOM   6974  C  CB  . LYS A 1 181 ? -2.369  75.520  22.788  0.25 48.18 ? 181 LYS A CB  3 
ATOM   6975  C  CG  . LYS A 1 181 ? -2.301  74.601  23.999  0.25 51.95 ? 181 LYS A CG  3 
ATOM   6976  C  CD  . LYS A 1 181 ? -3.685  74.117  24.408  0.25 54.62 ? 181 LYS A CD  3 
ATOM   6977  C  CE  . LYS A 1 181 ? -3.612  73.165  25.593  0.25 56.83 ? 181 LYS A CE  3 
ATOM   6978  N  NZ  . LYS A 1 181 ? -2.989  73.799  26.788  0.25 58.92 ? 181 LYS A NZ  3 
ATOM   6979  N  N   . LYS A 1 182 ? 0.068   74.742  20.700  0.25 45.29 ? 182 LYS A N   3 
ATOM   6980  C  CA  . LYS A 1 182 ? 0.984   73.707  20.227  0.25 46.33 ? 182 LYS A CA  3 
ATOM   6981  C  C   . LYS A 1 182 ? 2.230   74.325  19.591  0.25 45.07 ? 182 LYS A C   3 
ATOM   6982  O  O   . LYS A 1 182 ? 2.577   73.941  18.452  0.25 41.64 ? 182 LYS A O   3 
ATOM   6983  C  CB  . LYS A 1 182 ? 0.285   72.786  19.219  0.25 47.48 ? 182 LYS A CB  3 
ATOM   6984  C  CG  . LYS A 1 182 ? -0.271  73.488  17.989  0.25 52.10 ? 182 LYS A CG  3 
ATOM   6985  C  CD  . LYS A 1 182 ? -0.712  72.485  16.928  0.25 55.02 ? 182 LYS A CD  3 
ATOM   6986  C  CE  . LYS A 1 182 ? -1.793  71.546  17.443  0.25 55.85 ? 182 LYS A CE  3 
ATOM   6987  N  NZ  . LYS A 1 182 ? -3.034  72.277  17.818  0.25 58.10 ? 182 LYS A NZ  3 
ATOM   6988  N  N   . GLU B 1 15  ? 1.271   92.100  -24.224 0.25 31.67 ? 15  GLU B N   3 
ATOM   6989  C  CA  . GLU B 1 15  ? 2.544   92.875  -24.263 0.25 32.79 ? 15  GLU B CA  3 
ATOM   6990  C  C   . GLU B 1 15  ? 2.347   94.310  -23.774 0.25 29.06 ? 15  GLU B C   3 
ATOM   6991  O  O   . GLU B 1 15  ? 3.234   95.152  -23.920 0.25 26.57 ? 15  GLU B O   3 
ATOM   6992  C  CB  . GLU B 1 15  ? 3.103   92.896  -25.686 0.25 37.03 ? 15  GLU B CB  3 
ATOM   6993  C  CG  . GLU B 1 15  ? 2.180   93.540  -26.706 0.25 45.26 ? 15  GLU B CG  3 
ATOM   6994  C  CD  . GLU B 1 15  ? 2.733   93.470  -28.117 0.25 48.16 ? 15  GLU B CD  3 
ATOM   6995  O  OE1 . GLU B 1 15  ? 3.822   94.030  -28.358 0.25 50.66 ? 15  GLU B OE1 3 
ATOM   6996  O  OE2 . GLU B 1 15  ? 2.078   92.854  -28.985 0.25 51.04 ? 15  GLU B OE2 3 
ATOM   6997  N  N   . SER B 1 16  ? 1.185   94.586  -23.193 0.25 24.81 ? 16  SER B N   3 
ATOM   6998  C  CA  . SER B 1 16  ? 0.898   95.925  -22.696 0.25 22.55 ? 16  SER B CA  3 
ATOM   6999  C  C   . SER B 1 16  ? 0.338   95.922  -21.283 0.25 20.46 ? 16  SER B C   3 
ATOM   7000  O  O   . SER B 1 16  ? -0.265  94.940  -20.841 0.25 20.05 ? 16  SER B O   3 
ATOM   7001  C  CB  . SER B 1 16  ? -0.098  96.632  -23.619 0.25 22.79 ? 16  SER B CB  3 
ATOM   7002  O  OG  . SER B 1 16  ? 0.453   96.840  -24.907 0.25 24.74 ? 16  SER B OG  3 
ATOM   7003  N  N   . PHE B 1 17  ? 0.545   97.025  -20.572 0.25 17.34 ? 17  PHE B N   3 
ATOM   7004  C  CA  . PHE B 1 17  ? 0.025   97.154  -19.222 0.25 14.73 ? 17  PHE B CA  3 
ATOM   7005  C  C   . PHE B 1 17  ? -0.753  98.452  -19.112 0.25 14.06 ? 17  PHE B C   3 
ATOM   7006  O  O   . PHE B 1 17  ? -0.542  99.381  -19.897 0.25 12.31 ? 17  PHE B O   3 
ATOM   7007  C  CB  . PHE B 1 17  ? 1.149   97.113  -18.173 0.25 14.17 ? 17  PHE B CB  3 
ATOM   7008  C  CG  . PHE B 1 17  ? 2.061   98.310  -18.188 0.25 12.62 ? 17  PHE B CG  3 
ATOM   7009  C  CD1 . PHE B 1 17  ? 3.011   98.473  -19.190 0.25 13.44 ? 17  PHE B CD1 3 
ATOM   7010  C  CD2 . PHE B 1 17  ? 1.995   99.257  -17.169 0.25 12.48 ? 17  PHE B CD2 3 
ATOM   7011  C  CE1 . PHE B 1 17  ? 3.890   99.564  -19.170 0.25 11.52 ? 17  PHE B CE1 3 
ATOM   7012  C  CE2 . PHE B 1 17  ? 2.865   100.346 -17.141 0.25 10.53 ? 17  PHE B CE2 3 
ATOM   7013  C  CZ  . PHE B 1 17  ? 3.814   100.499 -18.141 0.25 10.01 ? 17  PHE B CZ  3 
ATOM   7014  N  N   . LEU B 1 18  ? -1.657  98.510  -18.142 0.25 10.75 ? 18  LEU B N   3 
ATOM   7015  C  CA  . LEU B 1 18  ? -2.472  99.694  -17.946 0.25 10.94 ? 18  LEU B CA  3 
ATOM   7016  C  C   . LEU B 1 18  ? -1.986  100.460 -16.727 0.25 12.20 ? 18  LEU B C   3 
ATOM   7017  O  O   . LEU B 1 18  ? -1.847  99.895  -15.632 0.25 8.68  ? 18  LEU B O   3 
ATOM   7018  C  CB  . LEU B 1 18  ? -3.943  99.300  -17.785 0.25 7.92  ? 18  LEU B CB  3 
ATOM   7019  C  CG  . LEU B 1 18  ? -4.458  98.403  -18.911 0.25 10.30 ? 18  LEU B CG  3 
ATOM   7020  C  CD1 . LEU B 1 18  ? -5.947  98.133  -18.707 0.25 9.92  ? 18  LEU B CD1 3 
ATOM   7021  C  CD2 . LEU B 1 18  ? -4.218  99.076  -20.259 0.25 10.18 ? 18  LEU B CD2 3 
ATOM   7022  N  N   . TYR B 1 19  ? -1.730  101.750 -16.941 0.25 10.21 ? 19  TYR B N   3 
ATOM   7023  C  CA  . TYR B 1 19  ? -1.228  102.653 -15.910 0.25 11.13 ? 19  TYR B CA  3 
ATOM   7024  C  C   . TYR B 1 19  ? -2.261  103.727 -15.558 0.25 10.79 ? 19  TYR B C   3 
ATOM   7025  O  O   . TYR B 1 19  ? -2.875  104.326 -16.450 0.25 10.32 ? 19  TYR B O   3 
ATOM   7026  C  CB  . TYR B 1 19  ? 0.080   103.292 -16.411 0.25 10.75 ? 19  TYR B CB  3 
ATOM   7027  C  CG  . TYR B 1 19  ? 0.524   104.530 -15.669 0.25 10.83 ? 19  TYR B CG  3 
ATOM   7028  C  CD1 . TYR B 1 19  ? 0.664   104.531 -14.282 0.25 12.28 ? 19  TYR B CD1 3 
ATOM   7029  C  CD2 . TYR B 1 19  ? 0.796   105.713 -16.359 0.25 11.41 ? 19  TYR B CD2 3 
ATOM   7030  C  CE1 . TYR B 1 19  ? 1.058   105.688 -13.596 0.25 12.16 ? 19  TYR B CE1 3 
ATOM   7031  C  CE2 . TYR B 1 19  ? 1.195   106.870 -15.684 0.25 11.80 ? 19  TYR B CE2 3 
ATOM   7032  C  CZ  . TYR B 1 19  ? 1.319   106.852 -14.306 0.25 12.29 ? 19  TYR B CZ  3 
ATOM   7033  O  OH  . TYR B 1 19  ? 1.678   108.009 -13.645 0.25 13.23 ? 19  TYR B OH  3 
ATOM   7034  N  N   . PHE B 1 20  ? -2.456  103.950 -14.257 0.25 10.04 ? 20  PHE B N   3 
ATOM   7035  C  CA  . PHE B 1 20  ? -3.418  104.944 -13.764 0.25 8.37  ? 20  PHE B CA  3 
ATOM   7036  C  C   . PHE B 1 20  ? -2.666  106.176 -13.288 0.25 9.18  ? 20  PHE B C   3 
ATOM   7037  O  O   . PHE B 1 20  ? -1.914  106.125 -12.309 0.25 8.16  ? 20  PHE B O   3 
ATOM   7038  C  CB  . PHE B 1 20  ? -4.248  104.366 -12.605 0.25 8.88  ? 20  PHE B CB  3 
ATOM   7039  C  CG  . PHE B 1 20  ? -5.275  105.322 -12.043 0.25 8.60  ? 20  PHE B CG  3 
ATOM   7040  C  CD1 . PHE B 1 20  ? -6.339  105.768 -12.826 0.25 10.24 ? 20  PHE B CD1 3 
ATOM   7041  C  CD2 . PHE B 1 20  ? -5.184  105.765 -10.725 0.25 9.91  ? 20  PHE B CD2 3 
ATOM   7042  C  CE1 . PHE B 1 20  ? -7.304  106.643 -12.304 0.25 10.60 ? 20  PHE B CE1 3 
ATOM   7043  C  CE2 . PHE B 1 20  ? -6.146  106.645 -10.187 0.25 10.87 ? 20  PHE B CE2 3 
ATOM   7044  C  CZ  . PHE B 1 20  ? -7.204  107.082 -10.979 0.25 10.45 ? 20  PHE B CZ  3 
ATOM   7045  N  N   . ALA B 1 21  ? -2.879  107.284 -13.984 0.25 7.61  ? 21  ALA B N   3 
ATOM   7046  C  CA  . ALA B 1 21  ? -2.215  108.540 -13.655 0.25 9.06  ? 21  ALA B CA  3 
ATOM   7047  C  C   . ALA B 1 21  ? -3.176  109.487 -12.955 0.25 9.22  ? 21  ALA B C   3 
ATOM   7048  O  O   . ALA B 1 21  ? -4.296  109.696 -13.421 0.25 9.37  ? 21  ALA B O   3 
ATOM   7049  C  CB  . ALA B 1 21  ? -1.679  109.196 -14.933 0.25 4.77  ? 21  ALA B CB  3 
ATOM   7050  N  N   . TYR B 1 22  ? -2.733  110.068 -11.841 0.25 8.81  ? 22  TYR B N   3 
ATOM   7051  C  CA  . TYR B 1 22  ? -3.573  110.998 -11.097 0.25 8.40  ? 22  TYR B CA  3 
ATOM   7052  C  C   . TYR B 1 22  ? -2.894  112.342 -10.851 0.25 8.41  ? 22  TYR B C   3 
ATOM   7053  O  O   . TYR B 1 22  ? -3.531  113.284 -10.385 0.25 10.12 ? 22  TYR B O   3 
ATOM   7054  C  CB  . TYR B 1 22  ? -4.028  110.366 -9.770  0.25 10.46 ? 22  TYR B CB  3 
ATOM   7055  C  CG  . TYR B 1 22  ? -2.910  109.864 -8.880  0.25 6.84  ? 22  TYR B CG  3 
ATOM   7056  C  CD1 . TYR B 1 22  ? -2.158  110.742 -8.107  0.25 9.03  ? 22  TYR B CD1 3 
ATOM   7057  C  CD2 . TYR B 1 22  ? -2.606  108.505 -8.815  0.25 9.14  ? 22  TYR B CD2 3 
ATOM   7058  C  CE1 . TYR B 1 22  ? -1.122  110.275 -7.279  0.25 7.49  ? 22  TYR B CE1 3 
ATOM   7059  C  CE2 . TYR B 1 22  ? -1.578  108.027 -7.996  0.25 7.81  ? 22  TYR B CE2 3 
ATOM   7060  C  CZ  . TYR B 1 22  ? -0.842  108.919 -7.229  0.25 8.57  ? 22  TYR B CZ  3 
ATOM   7061  O  OH  . TYR B 1 22  ? 0.159   108.448 -6.410  0.25 6.11  ? 22  TYR B OH  3 
ATOM   7062  N  N   . GLY B 1 23  ? -1.613  112.433 -11.207 0.25 7.94  ? 23  GLY B N   3 
ATOM   7063  C  CA  . GLY B 1 23  ? -0.856  113.660 -11.020 0.25 8.70  ? 23  GLY B CA  3 
ATOM   7064  C  C   . GLY B 1 23  ? -0.458  114.350 -12.316 0.25 7.86  ? 23  GLY B C   3 
ATOM   7065  O  O   . GLY B 1 23  ? -1.286  114.524 -13.210 0.25 9.91  ? 23  GLY B O   3 
ATOM   7066  N  N   . SER B 1 24  ? 0.810   114.738 -12.428 0.25 10.20 ? 24  SER B N   3 
ATOM   7067  C  CA  . SER B 1 24  ? 1.282   115.424 -13.628 0.25 10.74 ? 24  SER B CA  3 
ATOM   7068  C  C   . SER B 1 24  ? 1.189   114.585 -14.900 0.25 11.73 ? 24  SER B C   3 
ATOM   7069  O  O   . SER B 1 24  ? 1.295   115.124 -16.006 0.25 10.56 ? 24  SER B O   3 
ATOM   7070  C  CB  . SER B 1 24  ? 2.719   115.938 -13.440 0.25 10.19 ? 24  SER B CB  3 
ATOM   7071  O  OG  . SER B 1 24  ? 3.602   114.931 -12.978 0.25 9.29  ? 24  SER B OG  3 
ATOM   7072  N  N   . ASN B 1 25  ? 0.999   113.273 -14.762 0.25 10.94 ? 25  ASN B N   3 
ATOM   7073  C  CA  . ASN B 1 25  ? 0.866   112.440 -15.951 0.25 10.72 ? 25  ASN B CA  3 
ATOM   7074  C  C   . ASN B 1 25  ? -0.567  112.430 -16.493 0.25 11.64 ? 25  ASN B C   3 
ATOM   7075  O  O   . ASN B 1 25  ? -0.920  111.602 -17.338 0.25 10.19 ? 25  ASN B O   3 
ATOM   7076  C  CB  . ASN B 1 25  ? 1.370   111.012 -15.701 0.25 11.44 ? 25  ASN B CB  3 
ATOM   7077  C  CG  . ASN B 1 25  ? 2.889   110.913 -15.777 0.25 14.01 ? 25  ASN B CG  3 
ATOM   7078  O  OD1 . ASN B 1 25  ? 3.533   111.664 -16.519 0.25 14.39 ? 25  ASN B OD1 3 
ATOM   7079  N  ND2 . ASN B 1 25  ? 3.468   109.980 -15.023 0.25 12.96 ? 25  ASN B ND2 3 
ATOM   7080  N  N   . LEU B 1 26  ? -1.396  113.349 -16.002 0.25 10.73 ? 26  LEU B N   3 
ATOM   7081  C  CA  . LEU B 1 26  ? -2.755  113.479 -16.523 0.25 9.73  ? 26  LEU B CA  3 
ATOM   7082  C  C   . LEU B 1 26  ? -2.593  114.217 -17.857 0.25 10.42 ? 26  LEU B C   3 
ATOM   7083  O  O   . LEU B 1 26  ? -3.454  114.142 -18.732 0.25 10.87 ? 26  LEU B O   3 
ATOM   7084  C  CB  . LEU B 1 26  ? -3.633  114.329 -15.596 0.25 10.08 ? 26  LEU B CB  3 
ATOM   7085  C  CG  . LEU B 1 26  ? -4.178  113.747 -14.291 0.25 9.72  ? 26  LEU B CG  3 
ATOM   7086  C  CD1 . LEU B 1 26  ? -4.923  114.846 -13.531 0.25 9.12  ? 26  LEU B CD1 3 
ATOM   7087  C  CD2 . LEU B 1 26  ? -5.115  112.582 -14.596 0.25 11.93 ? 26  LEU B CD2 3 
ATOM   7088  N  N   . LEU B 1 27  ? -1.471  114.921 -18.005 0.25 8.62  ? 27  LEU B N   3 
ATOM   7089  C  CA  . LEU B 1 27  ? -1.191  115.687 -19.220 0.25 10.60 ? 27  LEU B CA  3 
ATOM   7090  C  C   . LEU B 1 27  ? -0.396  114.882 -20.248 0.25 11.21 ? 27  LEU B C   3 
ATOM   7091  O  O   . LEU B 1 27  ? 0.735   114.473 -20.000 0.25 10.31 ? 27  LEU B O   3 
ATOM   7092  C  CB  . LEU B 1 27  ? -0.427  116.969 -18.874 0.25 10.91 ? 27  LEU B CB  3 
ATOM   7093  C  CG  . LEU B 1 27  ? -0.160  117.876 -20.079 0.25 13.31 ? 27  LEU B CG  3 
ATOM   7094  C  CD1 . LEU B 1 27  ? -1.489  118.326 -20.668 0.25 11.55 ? 27  LEU B CD1 3 
ATOM   7095  C  CD2 . LEU B 1 27  ? 0.674   119.074 -19.668 0.25 11.23 ? 27  LEU B CD2 3 
ATOM   7096  N  N   . THR B 1 28  ? -0.999  114.677 -21.414 0.25 12.89 ? 28  THR B N   3 
ATOM   7097  C  CA  . THR B 1 28  ? -0.382  113.912 -22.491 0.25 12.85 ? 28  THR B CA  3 
ATOM   7098  C  C   . THR B 1 28  ? 1.070   114.287 -22.778 0.25 14.05 ? 28  THR B C   3 
ATOM   7099  O  O   . THR B 1 28  ? 1.942   113.421 -22.827 0.25 14.73 ? 28  THR B O   3 
ATOM   7100  C  CB  . THR B 1 28  ? -1.188  114.067 -23.786 0.25 14.00 ? 28  THR B CB  3 
ATOM   7101  O  OG1 . THR B 1 28  ? -2.569  113.775 -23.528 0.25 11.32 ? 28  THR B OG1 3 
ATOM   7102  C  CG2 . THR B 1 28  ? -0.663  113.117 -24.852 0.25 12.69 ? 28  THR B CG2 3 
ATOM   7103  N  N   . GLU B 1 29  ? 1.327   115.575 -22.971 0.25 15.69 ? 29  GLU B N   3 
ATOM   7104  C  CA  . GLU B 1 29  ? 2.674   116.043 -23.270 0.25 16.62 ? 29  GLU B CA  3 
ATOM   7105  C  C   . GLU B 1 29  ? 3.686   115.784 -22.154 0.25 15.66 ? 29  GLU B C   3 
ATOM   7106  O  O   . GLU B 1 29  ? 4.865   115.559 -22.424 0.25 13.86 ? 29  GLU B O   3 
ATOM   7107  C  CB  . GLU B 1 29  ? 2.644   117.536 -23.628 0.25 19.49 ? 29  GLU B CB  3 
ATOM   7108  C  CG  . GLU B 1 29  ? 4.019   118.186 -23.709 0.25 24.81 ? 29  GLU B CG  3 
ATOM   7109  C  CD  . GLU B 1 29  ? 4.019   119.466 -24.530 0.25 28.02 ? 29  GLU B CD  3 
ATOM   7110  O  OE1 . GLU B 1 29  ? 3.006   120.199 -24.501 0.25 28.18 ? 29  GLU B OE1 3 
ATOM   7111  O  OE2 . GLU B 1 29  ? 5.041   119.744 -25.196 0.25 27.74 ? 29  GLU B OE2 3 
ATOM   7112  N  N   . ARG B 1 30  ? 3.236   115.814 -20.903 0.25 14.07 ? 30  ARG B N   3 
ATOM   7113  C  CA  . ARG B 1 30  ? 4.141   115.572 -19.782 0.25 13.98 ? 30  ARG B CA  3 
ATOM   7114  C  C   . ARG B 1 30  ? 4.566   114.101 -19.699 0.25 12.55 ? 30  ARG B C   3 
ATOM   7115  O  O   . ARG B 1 30  ? 5.760   113.796 -19.630 0.25 13.54 ? 30  ARG B O   3 
ATOM   7116  C  CB  . ARG B 1 30  ? 3.483   116.008 -18.463 0.25 15.48 ? 30  ARG B CB  3 
ATOM   7117  C  CG  . ARG B 1 30  ? 4.154   115.455 -17.207 0.25 17.91 ? 30  ARG B CG  3 
ATOM   7118  C  CD  . ARG B 1 30  ? 5.593   115.932 -17.069 0.25 21.09 ? 30  ARG B CD  3 
ATOM   7119  N  NE  . ARG B 1 30  ? 6.257   115.316 -15.922 0.25 23.17 ? 30  ARG B NE  3 
ATOM   7120  C  CZ  . ARG B 1 30  ? 7.470   115.648 -15.492 0.25 25.46 ? 30  ARG B CZ  3 
ATOM   7121  N  NH1 . ARG B 1 30  ? 8.166   116.595 -16.110 0.25 23.98 ? 30  ARG B NH1 3 
ATOM   7122  N  NH2 . ARG B 1 30  ? 7.991   115.029 -14.442 0.25 26.47 ? 30  ARG B NH2 3 
ATOM   7123  N  N   . ILE B 1 31  ? 3.599   113.189 -19.719 0.25 11.64 ? 31  ILE B N   3 
ATOM   7124  C  CA  . ILE B 1 31  ? 3.922   111.766 -19.628 0.25 11.17 ? 31  ILE B CA  3 
ATOM   7125  C  C   . ILE B 1 31  ? 4.785   111.297 -20.802 0.25 12.40 ? 31  ILE B C   3 
ATOM   7126  O  O   . ILE B 1 31  ? 5.671   110.458 -20.629 0.25 12.25 ? 31  ILE B O   3 
ATOM   7127  C  CB  . ILE B 1 31  ? 2.645   110.889 -19.565 0.25 10.38 ? 31  ILE B CB  3 
ATOM   7128  C  CG1 . ILE B 1 31  ? 3.036   109.439 -19.263 0.25 6.62  ? 31  ILE B CG1 3 
ATOM   7129  C  CG2 . ILE B 1 31  ? 1.886   110.959 -20.880 0.25 8.37  ? 31  ILE B CG2 3 
ATOM   7130  C  CD1 . ILE B 1 31  ? 1.852   108.494 -19.113 0.25 11.44 ? 31  ILE B CD1 3 
ATOM   7131  N  N   . HIS B 1 32  ? 4.531   111.853 -21.986 0.25 12.78 ? 32  HIS B N   3 
ATOM   7132  C  CA  . HIS B 1 32  ? 5.275   111.493 -23.190 0.25 13.78 ? 32  HIS B CA  3 
ATOM   7133  C  C   . HIS B 1 32  ? 6.752   111.862 -23.139 0.25 15.17 ? 32  HIS B C   3 
ATOM   7134  O  O   . HIS B 1 32  ? 7.545   111.336 -23.921 0.25 16.51 ? 32  HIS B O   3 
ATOM   7135  C  CB  . HIS B 1 32  ? 4.645   112.147 -24.425 0.25 13.40 ? 32  HIS B CB  3 
ATOM   7136  C  CG  . HIS B 1 32  ? 3.492   111.380 -24.997 0.25 11.35 ? 32  HIS B CG  3 
ATOM   7137  N  ND1 . HIS B 1 32  ? 2.656   111.904 -25.956 0.25 10.42 ? 32  HIS B ND1 3 
ATOM   7138  C  CD2 . HIS B 1 32  ? 3.031   110.133 -24.735 0.25 8.52  ? 32  HIS B CD2 3 
ATOM   7139  C  CE1 . HIS B 1 32  ? 1.725   111.016 -26.260 0.25 10.05 ? 32  HIS B CE1 3 
ATOM   7140  N  NE2 . HIS B 1 32  ? 1.930   109.933 -25.532 0.25 12.20 ? 32  HIS B NE2 3 
ATOM   7141  N  N   . LEU B 1 33  ? 7.124   112.770 -22.241 0.25 14.86 ? 33  LEU B N   3 
ATOM   7142  C  CA  . LEU B 1 33  ? 8.520   113.181 -22.126 0.25 16.50 ? 33  LEU B CA  3 
ATOM   7143  C  C   . LEU B 1 33  ? 9.434   111.974 -21.905 0.25 17.15 ? 33  LEU B C   3 
ATOM   7144  O  O   . LEU B 1 33  ? 10.527  111.901 -22.468 0.25 16.72 ? 33  LEU B O   3 
ATOM   7145  C  CB  . LEU B 1 33  ? 8.700   114.188 -20.981 0.25 16.83 ? 33  LEU B CB  3 
ATOM   7146  C  CG  . LEU B 1 33  ? 8.138   115.602 -21.180 0.25 21.37 ? 33  LEU B CG  3 
ATOM   7147  C  CD1 . LEU B 1 33  ? 8.415   116.433 -19.937 0.25 21.70 ? 33  LEU B CD1 3 
ATOM   7148  C  CD2 . LEU B 1 33  ? 8.772   116.256 -22.400 0.25 23.04 ? 33  LEU B CD2 3 
ATOM   7149  N  N   . ARG B 1 34  ? 8.979   111.031 -21.086 0.25 16.12 ? 34  ARG B N   3 
ATOM   7150  C  CA  . ARG B 1 34  ? 9.744   109.822 -20.795 0.25 15.97 ? 34  ARG B CA  3 
ATOM   7151  C  C   . ARG B 1 34  ? 9.013   108.584 -21.321 0.25 15.29 ? 34  ARG B C   3 
ATOM   7152  O  O   . ARG B 1 34  ? 9.570   107.489 -21.343 0.25 14.47 ? 34  ARG B O   3 
ATOM   7153  C  CB  . ARG B 1 34  ? 9.951   109.668 -19.278 0.25 20.08 ? 34  ARG B CB  3 
ATOM   7154  C  CG  . ARG B 1 34  ? 10.880  110.696 -18.623 0.25 23.00 ? 34  ARG B CG  3 
ATOM   7155  C  CD  . ARG B 1 34  ? 12.310  110.566 -19.138 0.25 25.47 ? 34  ARG B CD  3 
ATOM   7156  N  NE  . ARG B 1 34  ? 12.818  109.204 -18.998 0.25 26.28 ? 34  ARG B NE  3 
ATOM   7157  C  CZ  . ARG B 1 34  ? 13.132  108.630 -17.841 0.25 27.27 ? 34  ARG B CZ  3 
ATOM   7158  N  NH1 . ARG B 1 34  ? 13.002  109.299 -16.702 0.25 29.04 ? 34  ARG B NH1 3 
ATOM   7159  N  NH2 . ARG B 1 34  ? 13.564  107.376 -17.821 0.25 26.79 ? 34  ARG B NH2 3 
ATOM   7160  N  N   . ASN B 1 35  ? 7.765   108.761 -21.747 0.25 12.78 ? 35  ASN B N   3 
ATOM   7161  C  CA  . ASN B 1 35  ? 6.962   107.640 -22.240 0.25 11.67 ? 35  ASN B CA  3 
ATOM   7162  C  C   . ASN B 1 35  ? 6.246   107.991 -23.547 0.25 11.04 ? 35  ASN B C   3 
ATOM   7163  O  O   . ASN B 1 35  ? 5.013   107.953 -23.623 0.25 9.33  ? 35  ASN B O   3 
ATOM   7164  C  CB  . ASN B 1 35  ? 5.924   107.264 -21.183 0.25 11.99 ? 35  ASN B CB  3 
ATOM   7165  C  CG  . ASN B 1 35  ? 6.522   107.164 -19.798 0.25 14.29 ? 35  ASN B CG  3 
ATOM   7166  O  OD1 . ASN B 1 35  ? 7.196   106.193 -19.474 0.25 12.32 ? 35  ASN B OD1 3 
ATOM   7167  N  ND2 . ASN B 1 35  ? 6.288   108.183 -18.975 0.25 12.23 ? 35  ASN B ND2 3 
ATOM   7168  N  N   . PRO B 1 36  ? 7.011   108.313 -24.601 0.25 10.95 ? 36  PRO B N   3 
ATOM   7169  C  CA  . PRO B 1 36  ? 6.433   108.677 -25.900 0.25 11.96 ? 36  PRO B CA  3 
ATOM   7170  C  C   . PRO B 1 36  ? 5.419   107.717 -26.511 0.25 12.95 ? 36  PRO B C   3 
ATOM   7171  O  O   . PRO B 1 36  ? 4.577   108.137 -27.309 0.25 12.99 ? 36  PRO B O   3 
ATOM   7172  C  CB  . PRO B 1 36  ? 7.667   108.875 -26.791 0.25 12.34 ? 36  PRO B CB  3 
ATOM   7173  C  CG  . PRO B 1 36  ? 8.705   107.979 -26.147 0.25 13.79 ? 36  PRO B CG  3 
ATOM   7174  C  CD  . PRO B 1 36  ? 8.481   108.235 -24.678 0.25 10.41 ? 36  PRO B CD  3 
ATOM   7175  N  N   . SER B 1 37  ? 5.471   106.440 -26.144 0.25 13.41 ? 37  SER B N   3 
ATOM   7176  C  CA  . SER B 1 37  ? 4.525   105.483 -26.725 0.25 14.26 ? 37  SER B CA  3 
ATOM   7177  C  C   . SER B 1 37  ? 3.231   105.254 -25.931 0.25 13.39 ? 37  SER B C   3 
ATOM   7178  O  O   . SER B 1 37  ? 2.371   104.485 -26.358 0.25 12.21 ? 37  SER B O   3 
ATOM   7179  C  CB  . SER B 1 37  ? 5.217   104.134 -26.981 0.25 14.84 ? 37  SER B CB  3 
ATOM   7180  O  OG  . SER B 1 37  ? 5.638   103.520 -25.778 0.25 18.34 ? 37  SER B OG  3 
ATOM   7181  N  N   . ALA B 1 38  ? 3.084   105.920 -24.789 0.25 12.70 ? 38  ALA B N   3 
ATOM   7182  C  CA  . ALA B 1 38  ? 1.879   105.759 -23.973 0.25 12.94 ? 38  ALA B CA  3 
ATOM   7183  C  C   . ALA B 1 38  ? 0.645   106.134 -24.792 0.25 12.43 ? 38  ALA B C   3 
ATOM   7184  O  O   . ALA B 1 38  ? 0.661   107.112 -25.542 0.25 13.41 ? 38  ALA B O   3 
ATOM   7185  C  CB  . ALA B 1 38  ? 1.964   106.637 -22.717 0.25 11.93 ? 38  ALA B CB  3 
ATOM   7186  N  N   . ALA B 1 39  ? -0.425  105.361 -24.646 0.25 11.25 ? 39  ALA B N   3 
ATOM   7187  C  CA  . ALA B 1 39  ? -1.651  105.626 -25.392 0.25 12.15 ? 39  ALA B CA  3 
ATOM   7188  C  C   . ALA B 1 39  ? -2.843  105.782 -24.465 0.25 12.27 ? 39  ALA B C   3 
ATOM   7189  O  O   . ALA B 1 39  ? -2.996  105.029 -23.500 0.25 10.11 ? 39  ALA B O   3 
ATOM   7190  C  CB  . ALA B 1 39  ? -1.909  104.490 -26.400 0.25 13.14 ? 39  ALA B CB  3 
ATOM   7191  N  N   . PHE B 1 40  ? -3.686  106.767 -24.765 0.25 11.51 ? 40  PHE B N   3 
ATOM   7192  C  CA  . PHE B 1 40  ? -4.871  107.037 -23.961 0.25 12.15 ? 40  PHE B CA  3 
ATOM   7193  C  C   . PHE B 1 40  ? -5.781  105.829 -23.953 0.25 11.48 ? 40  PHE B C   3 
ATOM   7194  O  O   . PHE B 1 40  ? -6.253  105.393 -25.004 0.25 9.14  ? 40  PHE B O   3 
ATOM   7195  C  CB  . PHE B 1 40  ? -5.657  108.223 -24.526 0.25 11.52 ? 40  PHE B CB  3 
ATOM   7196  C  CG  . PHE B 1 40  ? -6.894  108.561 -23.730 0.25 11.53 ? 40  PHE B CG  3 
ATOM   7197  C  CD1 . PHE B 1 40  ? -6.817  109.395 -22.619 0.25 10.43 ? 40  PHE B CD1 3 
ATOM   7198  C  CD2 . PHE B 1 40  ? -8.133  108.034 -24.088 0.25 10.75 ? 40  PHE B CD2 3 
ATOM   7199  C  CE1 . PHE B 1 40  ? -7.961  109.704 -21.875 0.25 14.69 ? 40  PHE B CE1 3 
ATOM   7200  C  CE2 . PHE B 1 40  ? -9.280  108.333 -23.354 0.25 12.63 ? 40  PHE B CE2 3 
ATOM   7201  C  CZ  . PHE B 1 40  ? -9.196  109.171 -22.244 0.25 11.10 ? 40  PHE B CZ  3 
ATOM   7202  N  N   . PHE B 1 41  ? -6.042  105.290 -22.772 0.25 11.15 ? 41  PHE B N   3 
ATOM   7203  C  CA  . PHE B 1 41  ? -6.920  104.139 -22.686 0.25 11.76 ? 41  PHE B CA  3 
ATOM   7204  C  C   . PHE B 1 41  ? -8.313  104.613 -22.291 0.25 13.20 ? 41  PHE B C   3 
ATOM   7205  O  O   . PHE B 1 41  ? -9.301  104.245 -22.922 0.25 12.29 ? 41  PHE B O   3 
ATOM   7206  C  CB  . PHE B 1 41  ? -6.394  103.133 -21.664 0.25 13.33 ? 41  PHE B CB  3 
ATOM   7207  C  CG  . PHE B 1 41  ? -7.039  101.782 -21.771 0.25 15.37 ? 41  PHE B CG  3 
ATOM   7208  C  CD1 . PHE B 1 41  ? -6.737  100.937 -22.836 0.25 15.88 ? 41  PHE B CD1 3 
ATOM   7209  C  CD2 . PHE B 1 41  ? -7.967  101.366 -20.827 0.25 14.91 ? 41  PHE B CD2 3 
ATOM   7210  C  CE1 . PHE B 1 41  ? -7.353  99.695  -22.957 0.25 16.57 ? 41  PHE B CE1 3 
ATOM   7211  C  CE2 . PHE B 1 41  ? -8.591  100.124 -20.938 0.25 17.31 ? 41  PHE B CE2 3 
ATOM   7212  C  CZ  . PHE B 1 41  ? -8.284  99.287  -22.005 0.25 16.58 ? 41  PHE B CZ  3 
ATOM   7213  N  N   . CYS B 1 42  ? -8.388  105.441 -21.252 0.25 13.76 ? 42  CYS B N   3 
ATOM   7214  C  CA  . CYS B 1 42  ? -9.668  105.967 -20.788 0.25 13.76 ? 42  CYS B CA  3 
ATOM   7215  C  C   . CYS B 1 42  ? -9.501  106.802 -19.527 0.25 13.21 ? 42  CYS B C   3 
ATOM   7216  O  O   . CYS B 1 42  ? -8.396  106.973 -19.018 0.25 12.02 ? 42  CYS B O   3 
ATOM   7217  C  CB  . CYS B 1 42  ? -10.639 104.826 -20.485 0.25 16.47 ? 42  CYS B CB  3 
ATOM   7218  S  SG  . CYS B 1 42  ? -10.228 103.884 -18.996 0.25 20.16 ? 42  CYS B SG  3 
ATOM   7219  N  N   . VAL B 1 43  ? -10.621 107.319 -19.034 0.25 13.18 ? 43  VAL B N   3 
ATOM   7220  C  CA  . VAL B 1 43  ? -10.650 108.112 -17.814 0.25 12.99 ? 43  VAL B CA  3 
ATOM   7221  C  C   . VAL B 1 43  ? -11.412 107.275 -16.796 0.25 13.55 ? 43  VAL B C   3 
ATOM   7222  O  O   . VAL B 1 43  ? -12.413 106.636 -17.134 0.25 12.30 ? 43  VAL B O   3 
ATOM   7223  C  CB  . VAL B 1 43  ? -11.364 109.456 -18.048 0.25 15.12 ? 43  VAL B CB  3 
ATOM   7224  C  CG1 . VAL B 1 43  ? -11.697 110.129 -16.719 0.25 14.31 ? 43  VAL B CG1 3 
ATOM   7225  C  CG2 . VAL B 1 43  ? -10.469 110.359 -18.885 0.25 14.55 ? 43  VAL B CG2 3 
ATOM   7226  N  N   . ALA B 1 44  ? -10.940 107.262 -15.553 0.25 11.16 ? 44  ALA B N   3 
ATOM   7227  C  CA  . ALA B 1 44  ? -11.594 106.462 -14.533 0.25 10.21 ? 44  ALA B CA  3 
ATOM   7228  C  C   . ALA B 1 44  ? -11.379 106.976 -13.116 0.25 10.51 ? 44  ALA B C   3 
ATOM   7229  O  O   . ALA B 1 44  ? -10.375 107.614 -12.808 0.25 11.37 ? 44  ALA B O   3 
ATOM   7230  C  CB  . ALA B 1 44  ? -11.125 105.015 -14.643 0.25 10.10 ? 44  ALA B CB  3 
ATOM   7231  N  N   . ARG B 1 45  ? -12.345 106.672 -12.258 0.25 11.84 ? 45  ARG B N   3 
ATOM   7232  C  CA  . ARG B 1 45  ? -12.329 107.086 -10.868 0.25 10.67 ? 45  ARG B CA  3 
ATOM   7233  C  C   . ARG B 1 45  ? -11.823 105.948 -9.990  0.25 10.60 ? 45  ARG B C   3 
ATOM   7234  O  O   . ARG B 1 45  ? -12.172 104.792 -10.199 0.25 4.20  ? 45  ARG B O   3 
ATOM   7235  C  CB  . ARG B 1 45  ? -13.751 107.464 -10.440 0.25 13.96 ? 45  ARG B CB  3 
ATOM   7236  C  CG  . ARG B 1 45  ? -13.881 108.095 -9.064  0.25 18.04 ? 45  ARG B CG  3 
ATOM   7237  C  CD  . ARG B 1 45  ? -15.338 108.499 -8.791  0.25 23.74 ? 45  ARG B CD  3 
ATOM   7238  N  NE  . ARG B 1 45  ? -16.220 107.350 -8.573  0.25 26.37 ? 45  ARG B NE  3 
ATOM   7239  C  CZ  . ARG B 1 45  ? -16.267 106.646 -7.445  0.25 29.41 ? 45  ARG B CZ  3 
ATOM   7240  N  NH1 . ARG B 1 45  ? -15.485 106.972 -6.426  0.25 32.31 ? 45  ARG B NH1 3 
ATOM   7241  N  NH2 . ARG B 1 45  ? -17.099 105.616 -7.329  0.25 30.93 ? 45  ARG B NH2 3 
ATOM   7242  N  N   . LEU B 1 46  ? -10.986 106.280 -9.017  0.25 11.17 ? 46  LEU B N   3 
ATOM   7243  C  CA  . LEU B 1 46  ? -10.486 105.277 -8.096  0.25 11.82 ? 46  LEU B CA  3 
ATOM   7244  C  C   . LEU B 1 46  ? -11.350 105.418 -6.848  0.25 12.48 ? 46  LEU B C   3 
ATOM   7245  O  O   . LEU B 1 46  ? -11.351 106.466 -6.200  0.25 12.30 ? 46  LEU B O   3 
ATOM   7246  C  CB  . LEU B 1 46  ? -9.014  105.536 -7.762  0.25 10.00 ? 46  LEU B CB  3 
ATOM   7247  C  CG  . LEU B 1 46  ? -8.388  104.523 -6.796  0.25 11.68 ? 46  LEU B CG  3 
ATOM   7248  C  CD1 . LEU B 1 46  ? -8.342  103.148 -7.450  0.25 11.25 ? 46  LEU B CD1 3 
ATOM   7249  C  CD2 . LEU B 1 46  ? -6.992  104.978 -6.410  0.25 11.89 ? 46  LEU B CD2 3 
ATOM   7250  N  N   . GLN B 1 47  ? -12.099 104.369 -6.522  0.25 13.01 ? 47  GLN B N   3 
ATOM   7251  C  CA  . GLN B 1 47  ? -12.987 104.388 -5.365  0.25 14.35 ? 47  GLN B CA  3 
ATOM   7252  C  C   . GLN B 1 47  ? -12.252 104.408 -4.024  0.25 14.13 ? 47  GLN B C   3 
ATOM   7253  O  O   . GLN B 1 47  ? -11.201 103.793 -3.862  0.25 14.58 ? 47  GLN B O   3 
ATOM   7254  C  CB  . GLN B 1 47  ? -13.930 103.179 -5.410  0.25 14.81 ? 47  GLN B CB  3 
ATOM   7255  C  CG  . GLN B 1 47  ? -14.851 103.060 -4.205  0.25 20.50 ? 47  GLN B CG  3 
ATOM   7256  C  CD  . GLN B 1 47  ? -15.924 104.122 -4.175  0.25 19.38 ? 47  GLN B CD  3 
ATOM   7257  O  OE1 . GLN B 1 47  ? -16.843 104.112 -4.994  0.25 21.17 ? 47  GLN B OE1 3 
ATOM   7258  N  NE2 . GLN B 1 47  ? -15.812 105.052 -3.231  0.25 25.64 ? 47  GLN B NE2 3 
ATOM   7259  N  N   . ASP B 1 48  ? -12.835 105.122 -3.066  0.25 13.58 ? 48  ASP B N   3 
ATOM   7260  C  CA  . ASP B 1 48  ? -12.301 105.255 -1.715  0.25 13.16 ? 48  ASP B CA  3 
ATOM   7261  C  C   . ASP B 1 48  ? -10.804 105.489 -1.556  0.25 12.59 ? 48  ASP B C   3 
ATOM   7262  O  O   . ASP B 1 48  ? -10.090 104.692 -0.943  0.25 10.46 ? 48  ASP B O   3 
ATOM   7263  C  CB  . ASP B 1 48  ? -12.729 104.059 -0.866  0.25 13.41 ? 48  ASP B CB  3 
ATOM   7264  C  CG  . ASP B 1 48  ? -14.238 103.969 -0.718  0.25 16.61 ? 48  ASP B CG  3 
ATOM   7265  O  OD1 . ASP B 1 48  ? -14.883 105.035 -0.616  0.25 9.71  ? 48  ASP B OD1 3 
ATOM   7266  O  OD2 . ASP B 1 48  ? -14.777 102.839 -0.697  0.25 16.34 ? 48  ASP B OD2 3 
ATOM   7267  N  N   . PHE B 1 49  ? -10.347 106.601 -2.119  0.25 11.82 ? 49  PHE B N   3 
ATOM   7268  C  CA  . PHE B 1 49  ? -8.964  107.044 -2.019  0.25 12.91 ? 49  PHE B CA  3 
ATOM   7269  C  C   . PHE B 1 49  ? -9.046  108.560 -1.994  0.25 12.56 ? 49  PHE B C   3 
ATOM   7270  O  O   . PHE B 1 49  ? -9.959  109.149 -2.574  0.25 14.10 ? 49  PHE B O   3 
ATOM   7271  C  CB  . PHE B 1 49  ? -8.119  106.617 -3.225  0.25 12.12 ? 49  PHE B CB  3 
ATOM   7272  C  CG  . PHE B 1 49  ? -7.484  105.262 -3.086  0.25 11.58 ? 49  PHE B CG  3 
ATOM   7273  C  CD1 . PHE B 1 49  ? -8.222  104.103 -3.299  0.25 11.17 ? 49  PHE B CD1 3 
ATOM   7274  C  CD2 . PHE B 1 49  ? -6.129  105.146 -2.779  0.25 12.09 ? 49  PHE B CD2 3 
ATOM   7275  C  CE1 . PHE B 1 49  ? -7.619  102.844 -3.214  0.25 11.34 ? 49  PHE B CE1 3 
ATOM   7276  C  CE2 . PHE B 1 49  ? -5.517  103.893 -2.689  0.25 12.91 ? 49  PHE B CE2 3 
ATOM   7277  C  CZ  . PHE B 1 49  ? -6.263  102.742 -2.908  0.25 8.11  ? 49  PHE B CZ  3 
ATOM   7278  N  N   . LYS B 1 50  ? -8.092  109.189 -1.325  0.25 13.61 ? 50  LYS B N   3 
ATOM   7279  C  CA  . LYS B 1 50  ? -8.064  110.639 -1.231  0.25 12.50 ? 50  LYS B CA  3 
ATOM   7280  C  C   . LYS B 1 50  ? -6.763  111.171 -1.819  0.25 12.30 ? 50  LYS B C   3 
ATOM   7281  O  O   . LYS B 1 50  ? -5.684  110.636 -1.550  0.25 11.51 ? 50  LYS B O   3 
ATOM   7282  C  CB  . LYS B 1 50  ? -8.173  111.063 0.229   0.25 13.03 ? 50  LYS B CB  3 
ATOM   7283  C  CG  . LYS B 1 50  ? -8.138  112.568 0.441   0.25 14.39 ? 50  LYS B CG  3 
ATOM   7284  C  CD  . LYS B 1 50  ? -8.251  112.886 1.923   0.25 18.49 ? 50  LYS B CD  3 
ATOM   7285  C  CE  . LYS B 1 50  ? -8.162  114.377 2.187   0.25 20.28 ? 50  LYS B CE  3 
ATOM   7286  N  NZ  . LYS B 1 50  ? -8.151  114.665 3.650   0.25 18.89 ? 50  LYS B NZ  3 
ATOM   7287  N  N   . LEU B 1 51  ? -6.870  112.233 -2.609  0.25 9.60  ? 51  LEU B N   3 
ATOM   7288  C  CA  . LEU B 1 51  ? -5.699  112.834 -3.234  0.25 10.76 ? 51  LEU B CA  3 
ATOM   7289  C  C   . LEU B 1 51  ? -4.997  113.767 -2.262  0.25 10.94 ? 51  LEU B C   3 
ATOM   7290  O  O   . LEU B 1 51  ? -5.608  114.696 -1.728  0.25 8.86  ? 51  LEU B O   3 
ATOM   7291  C  CB  . LEU B 1 51  ? -6.107  113.625 -4.476  0.25 10.88 ? 51  LEU B CB  3 
ATOM   7292  C  CG  . LEU B 1 51  ? -4.991  114.210 -5.343  0.25 9.77  ? 51  LEU B CG  3 
ATOM   7293  C  CD1 . LEU B 1 51  ? -4.405  113.125 -6.230  0.25 6.11  ? 51  LEU B CD1 3 
ATOM   7294  C  CD2 . LEU B 1 51  ? -5.552  115.339 -6.199  0.25 9.12  ? 51  LEU B CD2 3 
ATOM   7295  N  N   . ASP B 1 52  ? -3.714  113.517 -2.024  0.25 9.48  ? 52  ASP B N   3 
ATOM   7296  C  CA  . ASP B 1 52  ? -2.948  114.373 -1.128  0.25 10.94 ? 52  ASP B CA  3 
ATOM   7297  C  C   . ASP B 1 52  ? -1.758  114.909 -1.913  0.25 11.25 ? 52  ASP B C   3 
ATOM   7298  O  O   . ASP B 1 52  ? -1.608  114.615 -3.098  0.25 10.30 ? 52  ASP B O   3 
ATOM   7299  C  CB  . ASP B 1 52  ? -2.439  113.575 0.075   0.25 9.51  ? 52  ASP B CB  3 
ATOM   7300  C  CG  . ASP B 1 52  ? -2.141  114.455 1.285   0.25 13.97 ? 52  ASP B CG  3 
ATOM   7301  O  OD1 . ASP B 1 52  ? -1.845  115.662 1.116   0.25 13.24 ? 52  ASP B OD1 3 
ATOM   7302  O  OD2 . ASP B 1 52  ? -2.188  113.926 2.412   0.25 12.05 ? 52  ASP B OD2 3 
ATOM   7303  N  N   . PHE B 1 53  ? -0.917  115.698 -1.250  0.25 11.95 ? 53  PHE B N   3 
ATOM   7304  C  CA  . PHE B 1 53  ? 0.280   116.245 -1.873  0.25 11.18 ? 53  PHE B CA  3 
ATOM   7305  C  C   . PHE B 1 53  ? 1.361   116.295 -0.806  0.25 11.52 ? 53  PHE B C   3 
ATOM   7306  O  O   . PHE B 1 53  ? 1.066   116.569 0.356   0.25 9.44  ? 53  PHE B O   3 
ATOM   7307  C  CB  . PHE B 1 53  ? 0.023   117.653 -2.423  0.25 12.70 ? 53  PHE B CB  3 
ATOM   7308  C  CG  . PHE B 1 53  ? -1.004  117.695 -3.519  0.25 11.50 ? 53  PHE B CG  3 
ATOM   7309  C  CD1 . PHE B 1 53  ? -2.364  117.755 -3.217  0.25 10.09 ? 53  PHE B CD1 3 
ATOM   7310  C  CD2 . PHE B 1 53  ? -0.615  117.630 -4.855  0.25 10.10 ? 53  PHE B CD2 3 
ATOM   7311  C  CE1 . PHE B 1 53  ? -3.318  117.745 -4.233  0.25 11.96 ? 53  PHE B CE1 3 
ATOM   7312  C  CE2 . PHE B 1 53  ? -1.558  117.619 -5.874  0.25 11.29 ? 53  PHE B CE2 3 
ATOM   7313  C  CZ  . PHE B 1 53  ? -2.914  117.677 -5.564  0.25 11.34 ? 53  PHE B CZ  3 
ATOM   7314  N  N   . GLY B 1 54  ? 2.609   116.020 -1.182  0.25 12.68 ? 54  GLY B N   3 
ATOM   7315  C  CA  . GLY B 1 54  ? 3.663   116.057 -0.185  0.25 12.30 ? 54  GLY B CA  3 
ATOM   7316  C  C   . GLY B 1 54  ? 5.074   115.739 -0.633  0.25 13.39 ? 54  GLY B C   3 
ATOM   7317  O  O   . GLY B 1 54  ? 5.348   115.549 -1.823  0.25 10.31 ? 54  GLY B O   3 
ATOM   7318  N  N   . ASN B 1 55  ? 5.976   115.687 0.343   0.25 14.37 ? 55  ASN B N   3 
ATOM   7319  C  CA  . ASN B 1 55  ? 7.379   115.400 0.087   0.25 17.08 ? 55  ASN B CA  3 
ATOM   7320  C  C   . ASN B 1 55  ? 7.720   114.034 0.673   0.25 18.89 ? 55  ASN B C   3 
ATOM   7321  O  O   . ASN B 1 55  ? 7.960   113.909 1.875   0.25 18.88 ? 55  ASN B O   3 
ATOM   7322  C  CB  . ASN B 1 55  ? 8.274   116.468 0.734   0.25 16.62 ? 55  ASN B CB  3 
ATOM   7323  C  CG  . ASN B 1 55  ? 7.768   117.886 0.502   0.25 14.83 ? 55  ASN B CG  3 
ATOM   7324  O  OD1 . ASN B 1 55  ? 7.328   118.232 -0.590  0.25 14.87 ? 55  ASN B OD1 3 
ATOM   7325  N  ND2 . ASN B 1 55  ? 7.850   118.719 1.537   0.25 15.07 ? 55  ASN B ND2 3 
ATOM   7326  N  N   . SER B 1 56  ? 7.732   113.009 -0.174  0.25 21.37 ? 56  SER B N   3 
ATOM   7327  C  CA  . SER B 1 56  ? 8.038   111.659 0.282   0.25 24.16 ? 56  SER B CA  3 
ATOM   7328  C  C   . SER B 1 56  ? 9.423   111.668 0.912   0.25 25.49 ? 56  SER B C   3 
ATOM   7329  O  O   . SER B 1 56  ? 10.301  112.406 0.472   0.25 26.71 ? 56  SER B O   3 
ATOM   7330  C  CB  . SER B 1 56  ? 8.006   110.678 -0.895  0.25 25.16 ? 56  SER B CB  3 
ATOM   7331  O  OG  . SER B 1 56  ? 8.137   109.336 -0.458  0.25 25.63 ? 56  SER B OG  3 
ATOM   7332  N  N   . GLN B 1 57  ? 9.616   110.858 1.948   0.25 27.53 ? 57  GLN B N   3 
ATOM   7333  C  CA  . GLN B 1 57  ? 10.907  110.792 2.623   0.25 28.30 ? 57  GLN B CA  3 
ATOM   7334  C  C   . GLN B 1 57  ? 11.246  112.169 3.191   0.25 28.68 ? 57  GLN B C   3 
ATOM   7335  O  O   . GLN B 1 57  ? 12.403  112.457 3.498   0.25 28.19 ? 57  GLN B O   3 
ATOM   7336  C  CB  . GLN B 1 57  ? 11.999  110.371 1.633   0.25 31.36 ? 57  GLN B CB  3 
ATOM   7337  C  CG  . GLN B 1 57  ? 11.651  109.157 0.774   0.25 32.29 ? 57  GLN B CG  3 
ATOM   7338  C  CD  . GLN B 1 57  ? 11.833  107.838 1.500   0.25 33.85 ? 57  GLN B CD  3 
ATOM   7339  O  OE1 . GLN B 1 57  ? 11.233  107.598 2.548   0.25 35.34 ? 57  GLN B OE1 3 
ATOM   7340  N  NE2 . GLN B 1 57  ? 12.667  106.972 0.940   0.25 34.02 ? 57  GLN B NE2 3 
ATOM   7341  N  N   . GLY B 1 58  ? 10.230  113.020 3.316   0.25 28.00 ? 58  GLY B N   3 
ATOM   7342  C  CA  . GLY B 1 58  ? 10.441  114.356 3.845   0.25 28.32 ? 58  GLY B CA  3 
ATOM   7343  C  C   . GLY B 1 58  ? 11.280  115.253 2.948   0.25 27.89 ? 58  GLY B C   3 
ATOM   7344  O  O   . GLY B 1 58  ? 11.674  116.347 3.349   0.25 27.71 ? 58  GLY B O   3 
ATOM   7345  N  N   . LYS B 1 59  ? 11.554  114.796 1.730   0.25 28.08 ? 59  LYS B N   3 
ATOM   7346  C  CA  . LYS B 1 59  ? 12.352  115.574 0.788   0.25 28.75 ? 59  LYS B CA  3 
ATOM   7347  C  C   . LYS B 1 59  ? 11.477  116.267 -0.252  0.25 26.84 ? 59  LYS B C   3 
ATOM   7348  O  O   . LYS B 1 59  ? 10.682  115.619 -0.934  0.25 26.45 ? 59  LYS B O   3 
ATOM   7349  C  CB  . LYS B 1 59  ? 13.359  114.670 0.075   0.25 31.83 ? 59  LYS B CB  3 
ATOM   7350  C  CG  . LYS B 1 59  ? 14.351  113.989 0.997   0.25 35.81 ? 59  LYS B CG  3 
ATOM   7351  C  CD  . LYS B 1 59  ? 15.357  113.177 0.202   0.25 38.37 ? 59  LYS B CD  3 
ATOM   7352  C  CE  . LYS B 1 59  ? 16.375  112.509 1.110   0.25 40.24 ? 59  LYS B CE  3 
ATOM   7353  N  NZ  . LYS B 1 59  ? 17.405  111.781 0.323   0.25 41.59 ? 59  LYS B NZ  3 
ATOM   7354  N  N   . THR B 1 60  ? 11.629  117.584 -0.367  0.25 23.90 ? 60  THR B N   3 
ATOM   7355  C  CA  . THR B 1 60  ? 10.861  118.360 -1.333  0.25 24.01 ? 60  THR B CA  3 
ATOM   7356  C  C   . THR B 1 60  ? 11.420  118.155 -2.737  0.25 23.16 ? 60  THR B C   3 
ATOM   7357  O  O   . THR B 1 60  ? 12.627  118.260 -2.958  0.25 23.36 ? 60  THR B O   3 
ATOM   7358  C  CB  . THR B 1 60  ? 10.913  119.871 -1.023  0.25 24.03 ? 60  THR B CB  3 
ATOM   7359  O  OG1 . THR B 1 60  ? 10.427  120.113 0.303   0.25 25.01 ? 60  THR B OG1 3 
ATOM   7360  C  CG2 . THR B 1 60  ? 10.060  120.644 -2.020  0.25 23.03 ? 60  THR B CG2 3 
ATOM   7361  N  N   . SER B 1 61  ? 10.538  117.864 -3.685  0.25 21.44 ? 61  SER B N   3 
ATOM   7362  C  CA  . SER B 1 61  ? 10.950  117.663 -5.067  0.25 21.73 ? 61  SER B CA  3 
ATOM   7363  C  C   . SER B 1 61  ? 11.612  118.925 -5.601  0.25 20.99 ? 61  SER B C   3 
ATOM   7364  O  O   . SER B 1 61  ? 11.144  120.032 -5.339  0.25 20.81 ? 61  SER B O   3 
ATOM   7365  C  CB  . SER B 1 61  ? 9.741   117.328 -5.942  0.25 20.34 ? 61  SER B CB  3 
ATOM   7366  O  OG  . SER B 1 61  ? 10.066  117.477 -7.315  0.25 17.26 ? 61  SER B OG  3 
ATOM   7367  N  N   . GLN B 1 62  ? 12.702  118.753 -6.343  0.25 22.01 ? 62  GLN B N   3 
ATOM   7368  C  CA  . GLN B 1 62  ? 13.414  119.885 -6.926  0.25 23.00 ? 62  GLN B CA  3 
ATOM   7369  C  C   . GLN B 1 62  ? 12.935  120.123 -8.352  0.25 21.39 ? 62  GLN B C   3 
ATOM   7370  O  O   . GLN B 1 62  ? 13.317  121.096 -8.999  0.25 22.77 ? 62  GLN B O   3 
ATOM   7371  C  CB  . GLN B 1 62  ? 14.924  119.640 -6.910  0.25 25.22 ? 62  GLN B CB  3 
ATOM   7372  C  CG  . GLN B 1 62  ? 15.527  119.692 -5.514  0.25 30.90 ? 62  GLN B CG  3 
ATOM   7373  C  CD  . GLN B 1 62  ? 15.121  120.946 -4.750  0.25 32.11 ? 62  GLN B CD  3 
ATOM   7374  O  OE1 . GLN B 1 62  ? 15.416  122.066 -5.167  0.25 32.18 ? 62  GLN B OE1 3 
ATOM   7375  N  NE2 . GLN B 1 62  ? 14.435  120.760 -3.626  0.25 33.01 ? 62  GLN B NE2 3 
ATOM   7376  N  N   . THR B 1 63  ? 12.094  119.221 -8.838  0.25 20.77 ? 63  THR B N   3 
ATOM   7377  C  CA  . THR B 1 63  ? 11.536  119.352 -10.175 0.25 19.93 ? 63  THR B CA  3 
ATOM   7378  C  C   . THR B 1 63  ? 10.342  120.297 -10.111 0.25 18.87 ? 63  THR B C   3 
ATOM   7379  O  O   . THR B 1 63  ? 10.275  121.290 -10.841 0.25 16.68 ? 63  THR B O   3 
ATOM   7380  C  CB  . THR B 1 63  ? 11.033  118.000 -10.717 0.25 20.72 ? 63  THR B CB  3 
ATOM   7381  O  OG1 . THR B 1 63  ? 12.121  117.069 -10.789 0.25 20.54 ? 63  THR B OG1 3 
ATOM   7382  C  CG2 . THR B 1 63  ? 10.423  118.179 -12.108 0.25 21.85 ? 63  THR B CG2 3 
ATOM   7383  N  N   . TRP B 1 64  ? 9.405   119.985 -9.219  0.25 16.72 ? 64  TRP B N   3 
ATOM   7384  C  CA  . TRP B 1 64  ? 8.187   120.776 -9.073  0.25 15.23 ? 64  TRP B CA  3 
ATOM   7385  C  C   . TRP B 1 64  ? 8.182   121.790 -7.927  0.25 15.93 ? 64  TRP B C   3 
ATOM   7386  O  O   . TRP B 1 64  ? 7.241   122.579 -7.796  0.25 12.74 ? 64  TRP B O   3 
ATOM   7387  C  CB  . TRP B 1 64  ? 6.991   119.837 -8.920  0.25 15.97 ? 64  TRP B CB  3 
ATOM   7388  C  CG  . TRP B 1 64  ? 6.805   118.914 -10.084 0.25 15.46 ? 64  TRP B CG  3 
ATOM   7389  C  CD1 . TRP B 1 64  ? 7.149   117.592 -10.148 0.25 15.07 ? 64  TRP B CD1 3 
ATOM   7390  C  CD2 . TRP B 1 64  ? 6.220   119.239 -11.351 0.25 15.24 ? 64  TRP B CD2 3 
ATOM   7391  N  NE1 . TRP B 1 64  ? 6.806   117.073 -11.375 0.25 13.90 ? 64  TRP B NE1 3 
ATOM   7392  C  CE2 . TRP B 1 64  ? 6.232   118.063 -12.133 0.25 15.73 ? 64  TRP B CE2 3 
ATOM   7393  C  CE3 . TRP B 1 64  ? 5.677   120.413 -11.901 0.25 15.67 ? 64  TRP B CE3 3 
ATOM   7394  C  CZ2 . TRP B 1 64  ? 5.728   118.022 -13.439 0.25 14.54 ? 64  TRP B CZ2 3 
ATOM   7395  C  CZ3 . TRP B 1 64  ? 5.173   120.373 -13.202 0.25 11.95 ? 64  TRP B CZ3 3 
ATOM   7396  C  CH2 . TRP B 1 64  ? 5.202   119.183 -13.955 0.25 13.35 ? 64  TRP B CH2 3 
ATOM   7397  N  N   . HIS B 1 65  ? 9.223   121.760 -7.103  0.25 15.81 ? 65  HIS B N   3 
ATOM   7398  C  CA  . HIS B 1 65  ? 9.356   122.673 -5.970  0.25 17.76 ? 65  HIS B CA  3 
ATOM   7399  C  C   . HIS B 1 65  ? 8.090   122.786 -5.119  0.25 17.53 ? 65  HIS B C   3 
ATOM   7400  O  O   . HIS B 1 65  ? 7.438   123.833 -5.073  0.25 17.73 ? 65  HIS B O   3 
ATOM   7401  C  CB  . HIS B 1 65  ? 9.781   124.061 -6.459  0.25 20.46 ? 65  HIS B CB  3 
ATOM   7402  C  CG  . HIS B 1 65  ? 11.040  124.051 -7.270  0.25 21.89 ? 65  HIS B CG  3 
ATOM   7403  N  ND1 . HIS B 1 65  ? 11.053  123.784 -8.622  0.25 24.70 ? 65  HIS B ND1 3 
ATOM   7404  C  CD2 . HIS B 1 65  ? 12.331  124.242 -6.912  0.25 23.39 ? 65  HIS B CD2 3 
ATOM   7405  C  CE1 . HIS B 1 65  ? 12.298  123.813 -9.063  0.25 22.87 ? 65  HIS B CE1 3 
ATOM   7406  N  NE2 . HIS B 1 65  ? 13.093  124.088 -8.045  0.25 25.07 ? 65  HIS B NE2 3 
ATOM   7407  N  N   . GLY B 1 66  ? 7.765   121.694 -4.436  0.25 16.16 ? 66  GLY B N   3 
ATOM   7408  C  CA  . GLY B 1 66  ? 6.593   121.652 -3.583  0.25 14.11 ? 66  GLY B CA  3 
ATOM   7409  C  C   . GLY B 1 66  ? 6.198   120.202 -3.395  0.25 13.48 ? 66  GLY B C   3 
ATOM   7410  O  O   . GLY B 1 66  ? 6.938   119.301 -3.796  0.25 13.28 ? 66  GLY B O   3 
ATOM   7411  N  N   . GLY B 1 67  ? 5.042   119.965 -2.784  0.25 10.97 ? 67  GLY B N   3 
ATOM   7412  C  CA  . GLY B 1 67  ? 4.598   118.599 -2.590  0.25 10.28 ? 67  GLY B CA  3 
ATOM   7413  C  C   . GLY B 1 67  ? 4.137   118.031 -3.918  0.25 10.37 ? 67  GLY B C   3 
ATOM   7414  O  O   . GLY B 1 67  ? 3.697   118.774 -4.798  0.25 9.30  ? 67  GLY B O   3 
ATOM   7415  N  N   . ILE B 1 68  ? 4.240   116.720 -4.086  0.25 10.21 ? 68  ILE B N   3 
ATOM   7416  C  CA  . ILE B 1 68  ? 3.799   116.120 -5.335  0.25 8.43  ? 68  ILE B CA  3 
ATOM   7417  C  C   . ILE B 1 68  ? 2.680   115.103 -5.124  0.25 7.84  ? 68  ILE B C   3 
ATOM   7418  O  O   . ILE B 1 68  ? 2.393   114.693 -3.999  0.25 6.90  ? 68  ILE B O   3 
ATOM   7419  C  CB  . ILE B 1 68  ? 4.986   115.489 -6.105  0.25 9.93  ? 68  ILE B CB  3 
ATOM   7420  C  CG1 . ILE B 1 68  ? 5.775   114.544 -5.201  0.25 9.61  ? 68  ILE B CG1 3 
ATOM   7421  C  CG2 . ILE B 1 68  ? 5.906   116.595 -6.623  0.25 9.67  ? 68  ILE B CG2 3 
ATOM   7422  C  CD1 . ILE B 1 68  ? 6.875   113.797 -5.934  0.25 9.36  ? 68  ILE B CD1 3 
ATOM   7423  N  N   . ALA B 1 69  ? 2.027   114.731 -6.217  0.25 7.04  ? 69  ALA B N   3 
ATOM   7424  C  CA  . ALA B 1 69  ? 0.903   113.802 -6.194  0.25 6.97  ? 69  ALA B CA  3 
ATOM   7425  C  C   . ALA B 1 69  ? 1.060   112.548 -5.331  0.25 8.43  ? 69  ALA B C   3 
ATOM   7426  O  O   . ALA B 1 69  ? 2.108   111.915 -5.313  0.25 10.37 ? 69  ALA B O   3 
ATOM   7427  C  CB  . ALA B 1 69  ? 0.555   113.398 -7.629  0.25 6.90  ? 69  ALA B CB  3 
ATOM   7428  N  N   . THR B 1 70  ? -0.006  112.197 -4.621  0.25 8.77  ? 70  THR B N   3 
ATOM   7429  C  CA  . THR B 1 70  ? -0.030  111.004 -3.792  0.25 7.87  ? 70  THR B CA  3 
ATOM   7430  C  C   . THR B 1 70  ? -1.488  110.688 -3.447  0.25 7.72  ? 70  THR B C   3 
ATOM   7431  O  O   . THR B 1 70  ? -2.355  111.570 -3.484  0.25 6.08  ? 70  THR B O   3 
ATOM   7432  C  CB  . THR B 1 70  ? 0.802   111.196 -2.500  0.25 9.94  ? 70  THR B CB  3 
ATOM   7433  O  OG1 . THR B 1 70  ? 1.057   109.919 -1.902  0.25 8.37  ? 70  THR B OG1 3 
ATOM   7434  C  CG2 . THR B 1 70  ? 0.066   112.085 -1.513  0.25 7.15  ? 70  THR B CG2 3 
ATOM   7435  N  N   . ILE B 1 71  ? -1.760  109.427 -3.137  0.25 6.96  ? 71  ILE B N   3 
ATOM   7436  C  CA  . ILE B 1 71  ? -3.111  109.005 -2.789  0.25 6.73  ? 71  ILE B CA  3 
ATOM   7437  C  C   . ILE B 1 71  ? -3.067  107.961 -1.685  0.25 8.28  ? 71  ILE B C   3 
ATOM   7438  O  O   . ILE B 1 71  ? -2.190  107.091 -1.677  0.25 7.36  ? 71  ILE B O   3 
ATOM   7439  C  CB  . ILE B 1 71  ? -3.832  108.378 -4.000  0.25 8.45  ? 71  ILE B CB  3 
ATOM   7440  C  CG1 . ILE B 1 71  ? -3.055  107.147 -4.482  0.25 5.52  ? 71  ILE B CG1 3 
ATOM   7441  C  CG2 . ILE B 1 71  ? -3.944  109.400 -5.132  0.25 6.36  ? 71  ILE B CG2 3 
ATOM   7442  C  CD1 . ILE B 1 71  ? -3.735  106.379 -5.593  0.25 6.47  ? 71  ILE B CD1 3 
ATOM   7443  N  N   . PHE B 1 72  ? -4.014  108.052 -0.754  0.25 8.25  ? 72  PHE B N   3 
ATOM   7444  C  CA  . PHE B 1 72  ? -4.107  107.096 0.334   0.25 9.78  ? 72  PHE B CA  3 
ATOM   7445  C  C   . PHE B 1 72  ? -5.570  106.679 0.502   0.25 11.12 ? 72  PHE B C   3 
ATOM   7446  O  O   . PHE B 1 72  ? -6.481  107.441 0.165   0.25 10.26 ? 72  PHE B O   3 
ATOM   7447  C  CB  . PHE B 1 72  ? -3.529  107.694 1.630   0.25 9.67  ? 72  PHE B CB  3 
ATOM   7448  C  CG  . PHE B 1 72  ? -4.275  108.903 2.148   0.25 13.39 ? 72  PHE B CG  3 
ATOM   7449  C  CD1 . PHE B 1 72  ? -5.508  108.763 2.782   0.25 13.49 ? 72  PHE B CD1 3 
ATOM   7450  C  CD2 . PHE B 1 72  ? -3.722  110.175 2.037   0.25 14.26 ? 72  PHE B CD2 3 
ATOM   7451  C  CE1 . PHE B 1 72  ? -6.178  109.871 3.303   0.25 13.86 ? 72  PHE B CE1 3 
ATOM   7452  C  CE2 . PHE B 1 72  ? -4.386  111.294 2.556   0.25 12.89 ? 72  PHE B CE2 3 
ATOM   7453  C  CZ  . PHE B 1 72  ? -5.615  111.140 3.190   0.25 12.39 ? 72  PHE B CZ  3 
ATOM   7454  N  N   . GLN B 1 73  ? -5.789  105.459 0.993   0.25 11.53 ? 73  GLN B N   3 
ATOM   7455  C  CA  . GLN B 1 73  ? -7.140  104.926 1.184   0.25 11.10 ? 73  GLN B CA  3 
ATOM   7456  C  C   . GLN B 1 73  ? -7.930  105.693 2.232   0.25 12.26 ? 73  GLN B C   3 
ATOM   7457  O  O   . GLN B 1 73  ? -7.415  106.009 3.307   0.25 8.93  ? 73  GLN B O   3 
ATOM   7458  C  CB  . GLN B 1 73  ? -7.072  103.440 1.564   0.25 11.67 ? 73  GLN B CB  3 
ATOM   7459  C  CG  . GLN B 1 73  ? -6.427  102.562 0.487   0.25 9.61  ? 73  GLN B CG  3 
ATOM   7460  C  CD  . GLN B 1 73  ? -6.120  101.149 0.971   0.25 13.73 ? 73  GLN B CD  3 
ATOM   7461  O  OE1 . GLN B 1 73  ? -5.372  100.957 1.934   0.25 13.65 ? 73  GLN B OE1 3 
ATOM   7462  N  NE2 . GLN B 1 73  ? -6.691  100.153 0.297   0.25 9.78  ? 73  GLN B NE2 3 
ATOM   7463  N  N   . SER B 1 74  ? -9.195  105.961 1.912   0.25 12.29 ? 74  SER B N   3 
ATOM   7464  C  CA  . SER B 1 74  ? -10.096 106.708 2.782   0.25 14.69 ? 74  SER B CA  3 
ATOM   7465  C  C   . SER B 1 74  ? -11.534 106.537 2.285   0.25 15.45 ? 74  SER B C   3 
ATOM   7466  O  O   . SER B 1 74  ? -11.946 107.182 1.322   0.25 14.24 ? 74  SER B O   3 
ATOM   7467  C  CB  . SER B 1 74  ? -9.706  108.189 2.757   0.25 14.97 ? 74  SER B CB  3 
ATOM   7468  O  OG  . SER B 1 74  ? -10.682 109.005 3.374   0.25 18.29 ? 74  SER B OG  3 
ATOM   7469  N  N   . PRO B 1 75  ? -12.315 105.657 2.935   0.25 15.66 ? 75  PRO B N   3 
ATOM   7470  C  CA  . PRO B 1 75  ? -13.705 105.426 2.525   0.25 15.65 ? 75  PRO B CA  3 
ATOM   7471  C  C   . PRO B 1 75  ? -14.490 106.730 2.423   0.25 14.92 ? 75  PRO B C   3 
ATOM   7472  O  O   . PRO B 1 75  ? -14.513 107.510 3.367   0.25 13.57 ? 75  PRO B O   3 
ATOM   7473  C  CB  . PRO B 1 75  ? -14.249 104.524 3.630   0.25 14.61 ? 75  PRO B CB  3 
ATOM   7474  C  CG  . PRO B 1 75  ? -13.041 103.772 4.085   0.25 16.52 ? 75  PRO B CG  3 
ATOM   7475  C  CD  . PRO B 1 75  ? -11.978 104.852 4.124   0.25 15.85 ? 75  PRO B CD  3 
ATOM   7476  N  N   . GLY B 1 76  ? -15.128 106.964 1.281   0.25 15.20 ? 76  GLY B N   3 
ATOM   7477  C  CA  . GLY B 1 76  ? -15.903 108.182 1.121   0.25 15.34 ? 76  GLY B CA  3 
ATOM   7478  C  C   . GLY B 1 76  ? -15.294 109.174 0.151   0.25 16.15 ? 76  GLY B C   3 
ATOM   7479  O  O   . GLY B 1 76  ? -16.016 109.922 -0.508  0.25 14.95 ? 76  GLY B O   3 
ATOM   7480  N  N   . ASP B 1 77  ? -13.968 109.192 0.066   0.25 13.69 ? 77  ASP B N   3 
ATOM   7481  C  CA  . ASP B 1 77  ? -13.281 110.099 -0.852  0.25 13.55 ? 77  ASP B CA  3 
ATOM   7482  C  C   . ASP B 1 77  ? -13.231 109.496 -2.251  0.25 12.38 ? 77  ASP B C   3 
ATOM   7483  O  O   . ASP B 1 77  ? -13.804 108.437 -2.506  0.25 13.93 ? 77  ASP B O   3 
ATOM   7484  C  CB  . ASP B 1 77  ? -11.849 110.365 -0.376  0.25 14.45 ? 77  ASP B CB  3 
ATOM   7485  C  CG  . ASP B 1 77  ? -11.787 111.347 0.777   0.25 16.74 ? 77  ASP B CG  3 
ATOM   7486  O  OD1 . ASP B 1 77  ? -12.154 112.525 0.572   0.25 16.59 ? 77  ASP B OD1 3 
ATOM   7487  O  OD2 . ASP B 1 77  ? -11.372 110.940 1.884   0.25 14.60 ? 77  ASP B OD2 3 
ATOM   7488  N  N   . GLU B 1 78  ? -12.553 110.188 -3.158  0.25 13.07 ? 78  GLU B N   3 
ATOM   7489  C  CA  . GLU B 1 78  ? -12.390 109.714 -4.522  0.25 11.99 ? 78  GLU B CA  3 
ATOM   7490  C  C   . GLU B 1 78  ? -11.331 110.510 -5.268  0.25 10.16 ? 78  GLU B C   3 
ATOM   7491  O  O   . GLU B 1 78  ? -11.090 111.686 -4.989  0.25 9.16  ? 78  GLU B O   3 
ATOM   7492  C  CB  . GLU B 1 78  ? -13.713 109.755 -5.294  0.25 16.53 ? 78  GLU B CB  3 
ATOM   7493  C  CG  . GLU B 1 78  ? -14.341 111.128 -5.434  0.25 20.16 ? 78  GLU B CG  3 
ATOM   7494  C  CD  . GLU B 1 78  ? -15.527 111.123 -6.390  0.25 22.28 ? 78  GLU B CD  3 
ATOM   7495  O  OE1 . GLU B 1 78  ? -16.396 110.232 -6.265  0.25 24.13 ? 78  GLU B OE1 3 
ATOM   7496  O  OE2 . GLU B 1 78  ? -15.594 112.013 -7.263  0.25 18.56 ? 78  GLU B OE2 3 
ATOM   7497  N  N   . VAL B 1 79  ? -10.694 109.839 -6.216  0.25 7.57  ? 79  VAL B N   3 
ATOM   7498  C  CA  . VAL B 1 79  ? -9.650  110.427 -7.035  0.25 5.60  ? 79  VAL B CA  3 
ATOM   7499  C  C   . VAL B 1 79  ? -9.986  110.108 -8.481  0.25 7.28  ? 79  VAL B C   3 
ATOM   7500  O  O   . VAL B 1 79  ? -10.453 109.007 -8.785  0.25 8.52  ? 79  VAL B O   3 
ATOM   7501  C  CB  . VAL B 1 79  ? -8.269  109.810 -6.689  0.25 5.91  ? 79  VAL B CB  3 
ATOM   7502  C  CG1 . VAL B 1 79  ? -7.225  110.225 -7.720  0.25 6.09  ? 79  VAL B CG1 3 
ATOM   7503  C  CG2 . VAL B 1 79  ? -7.850  110.237 -5.293  0.25 5.74  ? 79  VAL B CG2 3 
ATOM   7504  N  N   . TRP B 1 80  ? -9.773  111.081 -9.362  0.25 6.53  ? 80  TRP B N   3 
ATOM   7505  C  CA  . TRP B 1 80  ? -10.020 110.886 -10.783 0.25 9.14  ? 80  TRP B CA  3 
ATOM   7506  C  C   . TRP B 1 80  ? -8.685  110.956 -11.507 0.25 10.82 ? 80  TRP B C   3 
ATOM   7507  O  O   . TRP B 1 80  ? -7.825  111.768 -11.162 0.25 10.20 ? 80  TRP B O   3 
ATOM   7508  C  CB  . TRP B 1 80  ? -10.958 111.963 -11.338 0.25 9.38  ? 80  TRP B CB  3 
ATOM   7509  C  CG  . TRP B 1 80  ? -12.414 111.706 -11.077 0.25 10.43 ? 80  TRP B CG  3 
ATOM   7510  C  CD1 . TRP B 1 80  ? -13.130 112.064 -9.965  0.25 11.17 ? 80  TRP B CD1 3 
ATOM   7511  C  CD2 . TRP B 1 80  ? -13.329 111.023 -11.942 0.25 12.05 ? 80  TRP B CD2 3 
ATOM   7512  N  NE1 . TRP B 1 80  ? -14.437 111.647 -10.089 0.25 13.21 ? 80  TRP B NE1 3 
ATOM   7513  C  CE2 . TRP B 1 80  ? -14.586 111.005 -11.295 0.25 14.41 ? 80  TRP B CE2 3 
ATOM   7514  C  CE3 . TRP B 1 80  ? -13.210 110.422 -13.204 0.25 14.53 ? 80  TRP B CE3 3 
ATOM   7515  C  CZ2 . TRP B 1 80  ? -15.720 110.410 -11.867 0.25 14.10 ? 80  TRP B CZ2 3 
ATOM   7516  C  CZ3 . TRP B 1 80  ? -14.340 109.827 -13.774 0.25 15.47 ? 80  TRP B CZ3 3 
ATOM   7517  C  CH2 . TRP B 1 80  ? -15.577 109.829 -13.102 0.25 15.20 ? 80  TRP B CH2 3 
ATOM   7518  N  N   . GLY B 1 81  ? -8.515  110.097 -12.506 0.25 10.11 ? 81  GLY B N   3 
ATOM   7519  C  CA  . GLY B 1 81  ? -7.280  110.088 -13.256 0.25 9.59  ? 81  GLY B CA  3 
ATOM   7520  C  C   . GLY B 1 81  ? -7.460  109.561 -14.662 0.25 9.91  ? 81  GLY B C   3 
ATOM   7521  O  O   . GLY B 1 81  ? -8.583  109.382 -15.135 0.25 9.48  ? 81  GLY B O   3 
ATOM   7522  N  N   . VAL B 1 82  ? -6.334  109.317 -15.322 0.25 9.41  ? 82  VAL B N   3 
ATOM   7523  C  CA  . VAL B 1 82  ? -6.311  108.808 -16.685 0.25 9.33  ? 82  VAL B CA  3 
ATOM   7524  C  C   . VAL B 1 82  ? -5.570  107.481 -16.733 0.25 9.53  ? 82  VAL B C   3 
ATOM   7525  O  O   . VAL B 1 82  ? -4.544  107.301 -16.071 0.25 9.33  ? 82  VAL B O   3 
ATOM   7526  C  CB  . VAL B 1 82  ? -5.587  109.788 -17.635 0.25 11.01 ? 82  VAL B CB  3 
ATOM   7527  C  CG1 . VAL B 1 82  ? -5.406  109.150 -19.010 0.25 10.11 ? 82  VAL B CG1 3 
ATOM   7528  C  CG2 . VAL B 1 82  ? -6.376  111.088 -17.751 0.25 8.72  ? 82  VAL B CG2 3 
ATOM   7529  N  N   . VAL B 1 83  ? -6.102  106.548 -17.509 0.25 8.88  ? 83  VAL B N   3 
ATOM   7530  C  CA  . VAL B 1 83  ? -5.465  105.257 -17.668 0.25 9.77  ? 83  VAL B CA  3 
ATOM   7531  C  C   . VAL B 1 83  ? -4.699  105.291 -18.989 0.25 10.43 ? 83  VAL B C   3 
ATOM   7532  O  O   . VAL B 1 83  ? -5.278  105.576 -20.041 0.25 12.92 ? 83  VAL B O   3 
ATOM   7533  C  CB  . VAL B 1 83  ? -6.500  104.129 -17.705 0.25 9.52  ? 83  VAL B CB  3 
ATOM   7534  C  CG1 . VAL B 1 83  ? -5.806  102.789 -17.884 0.25 12.27 ? 83  VAL B CG1 3 
ATOM   7535  C  CG2 . VAL B 1 83  ? -7.311  104.135 -16.423 0.25 9.63  ? 83  VAL B CG2 3 
ATOM   7536  N  N   . TRP B 1 84  ? -3.396  105.029 -18.921 0.25 10.19 ? 84  TRP B N   3 
ATOM   7537  C  CA  . TRP B 1 84  ? -2.539  105.016 -20.104 0.25 10.78 ? 84  TRP B CA  3 
ATOM   7538  C  C   . TRP B 1 84  ? -2.141  103.582 -20.447 0.25 11.60 ? 84  TRP B C   3 
ATOM   7539  O  O   . TRP B 1 84  ? -2.047  102.732 -19.558 0.25 9.71  ? 84  TRP B O   3 
ATOM   7540  C  CB  . TRP B 1 84  ? -1.260  105.829 -19.863 0.25 8.34  ? 84  TRP B CB  3 
ATOM   7541  C  CG  . TRP B 1 84  ? -1.482  107.281 -19.608 0.25 11.67 ? 84  TRP B CG  3 
ATOM   7542  C  CD1 . TRP B 1 84  ? -1.462  107.917 -18.398 0.25 8.16  ? 84  TRP B CD1 3 
ATOM   7543  C  CD2 . TRP B 1 84  ? -1.742  108.293 -20.588 0.25 9.50  ? 84  TRP B CD2 3 
ATOM   7544  N  NE1 . TRP B 1 84  ? -1.689  109.261 -18.565 0.25 9.76  ? 84  TRP B NE1 3 
ATOM   7545  C  CE2 . TRP B 1 84  ? -1.865  109.520 -19.900 0.25 9.98  ? 84  TRP B CE2 3 
ATOM   7546  C  CE3 . TRP B 1 84  ? -1.883  108.283 -21.983 0.25 10.88 ? 84  TRP B CE3 3 
ATOM   7547  C  CZ2 . TRP B 1 84  ? -2.124  110.729 -20.560 0.25 11.22 ? 84  TRP B CZ2 3 
ATOM   7548  C  CZ3 . TRP B 1 84  ? -2.141  109.485 -22.637 0.25 11.58 ? 84  TRP B CZ3 3 
ATOM   7549  C  CH2 . TRP B 1 84  ? -2.258  110.690 -21.924 0.25 11.12 ? 84  TRP B CH2 3 
ATOM   7550  N  N   . LYS B 1 85  ? -1.906  103.320 -21.732 0.25 13.18 ? 85  LYS B N   3 
ATOM   7551  C  CA  . LYS B 1 85  ? -1.502  101.989 -22.176 0.25 13.97 ? 85  LYS B CA  3 
ATOM   7552  C  C   . LYS B 1 85  ? -0.045  102.039 -22.611 0.25 14.44 ? 85  LYS B C   3 
ATOM   7553  O  O   . LYS B 1 85  ? 0.356   102.934 -23.354 0.25 14.62 ? 85  LYS B O   3 
ATOM   7554  C  CB  . LYS B 1 85  ? -2.375  101.508 -23.341 0.25 15.86 ? 85  LYS B CB  3 
ATOM   7555  C  CG  . LYS B 1 85  ? -2.094  100.058 -23.750 0.25 20.80 ? 85  LYS B CG  3 
ATOM   7556  C  CD  . LYS B 1 85  ? -3.063  99.559  -24.811 0.25 25.75 ? 85  LYS B CD  3 
ATOM   7557  C  CE  . LYS B 1 85  ? -2.748  98.121  -25.195 0.25 28.58 ? 85  LYS B CE  3 
ATOM   7558  N  NZ  . LYS B 1 85  ? -3.711  97.577  -26.192 0.25 33.28 ? 85  LYS B NZ  3 
HETATM 7559  N  N   . MSE B 1 86  ? 0.750   101.084 -22.141 0.25 14.33 ? 86  MSE B N   3 
HETATM 7560  C  CA  . MSE B 1 86  ? 2.171   101.052 -22.483 0.25 16.28 ? 86  MSE B CA  3 
HETATM 7561  C  C   . MSE B 1 86  ? 2.699   99.640  -22.663 0.25 17.08 ? 86  MSE B C   3 
HETATM 7562  O  O   . MSE B 1 86  ? 1.997   98.663  -22.403 0.25 17.15 ? 86  MSE B O   3 
HETATM 7563  C  CB  . MSE B 1 86  ? 2.989   101.759 -21.400 0.25 17.82 ? 86  MSE B CB  3 
HETATM 7564  C  CG  . MSE B 1 86  ? 2.791   103.268 -21.357 0.25 24.13 ? 86  MSE B CG  3 
HETATM 7565  SE SE  . MSE B 1 86  ? 3.708   104.096 -19.877 0.25 30.56 ? 86  MSE B SE  3 
HETATM 7566  C  CE  . MSE B 1 86  ? 5.527   103.838 -20.471 0.25 29.95 ? 86  MSE B CE  3 
ATOM   7567  N  N   . ASN B 1 87  ? 3.952   99.555  -23.100 0.25 19.04 ? 87  ASN B N   3 
ATOM   7568  C  CA  . ASN B 1 87  ? 4.637   98.289  -23.331 0.25 21.17 ? 87  ASN B CA  3 
ATOM   7569  C  C   . ASN B 1 87  ? 5.199   97.764  -22.014 0.25 19.72 ? 87  ASN B C   3 
ATOM   7570  O  O   . ASN B 1 87  ? 5.899   98.495  -21.308 0.25 17.41 ? 87  ASN B O   3 
ATOM   7571  C  CB  . ASN B 1 87  ? 5.791   98.511  -24.315 0.25 25.11 ? 87  ASN B CB  3 
ATOM   7572  C  CG  . ASN B 1 87  ? 5.346   99.205  -25.586 0.25 30.78 ? 87  ASN B CG  3 
ATOM   7573  O  OD1 . ASN B 1 87  ? 6.157   99.789  -26.307 0.25 32.57 ? 87  ASN B OD1 3 
ATOM   7574  N  ND2 . ASN B 1 87  ? 4.053   99.138  -25.874 0.25 32.62 ? 87  ASN B ND2 3 
ATOM   7575  N  N   . LYS B 1 88  ? 4.905   96.509  -21.680 0.25 19.44 ? 88  LYS B N   3 
ATOM   7576  C  CA  . LYS B 1 88  ? 5.419   95.938  -20.437 0.25 20.77 ? 88  LYS B CA  3 
ATOM   7577  C  C   . LYS B 1 88  ? 6.936   96.044  -20.391 0.25 19.82 ? 88  LYS B C   3 
ATOM   7578  O  O   . LYS B 1 88  ? 7.549   95.843  -19.347 0.25 20.63 ? 88  LYS B O   3 
ATOM   7579  C  CB  . LYS B 1 88  ? 5.001   94.474  -20.281 0.25 22.73 ? 88  LYS B CB  3 
ATOM   7580  C  CG  . LYS B 1 88  ? 3.592   94.292  -19.735 0.25 25.98 ? 88  LYS B CG  3 
ATOM   7581  C  CD  . LYS B 1 88  ? 3.315   92.842  -19.392 0.25 28.87 ? 88  LYS B CD  3 
ATOM   7582  C  CE  . LYS B 1 88  ? 1.909   92.666  -18.847 0.25 30.06 ? 88  LYS B CE  3 
ATOM   7583  N  NZ  . LYS B 1 88  ? 1.630   91.252  -18.479 0.25 33.82 ? 88  LYS B NZ  3 
ATOM   7584  N  N   . SER B 1 89  ? 7.541   96.357  -21.530 0.25 19.76 ? 89  SER B N   3 
ATOM   7585  C  CA  . SER B 1 89  ? 8.983   96.513  -21.591 0.25 19.62 ? 89  SER B CA  3 
ATOM   7586  C  C   . SER B 1 89  ? 9.375   97.785  -20.841 0.25 20.02 ? 89  SER B C   3 
ATOM   7587  O  O   . SER B 1 89  ? 10.517  97.935  -20.413 0.25 18.49 ? 89  SER B O   3 
ATOM   7588  C  CB  . SER B 1 89  ? 9.441   96.603  -23.049 0.25 20.77 ? 89  SER B CB  3 
ATOM   7589  O  OG  . SER B 1 89  ? 8.753   97.636  -23.732 0.25 22.32 ? 89  SER B OG  3 
ATOM   7590  N  N   . ASN B 1 90  ? 8.411   98.690  -20.675 0.25 19.86 ? 90  ASN B N   3 
ATOM   7591  C  CA  . ASN B 1 90  ? 8.644   99.966  -19.991 0.25 20.71 ? 90  ASN B CA  3 
ATOM   7592  C  C   . ASN B 1 90  ? 8.301   99.967  -18.500 0.25 18.28 ? 90  ASN B C   3 
ATOM   7593  O  O   . ASN B 1 90  ? 8.087   101.032 -17.917 0.25 17.24 ? 90  ASN B O   3 
ATOM   7594  C  CB  . ASN B 1 90  ? 7.841   101.080 -20.676 0.25 22.64 ? 90  ASN B CB  3 
ATOM   7595  C  CG  . ASN B 1 90  ? 8.385   101.442 -22.044 0.25 25.23 ? 90  ASN B CG  3 
ATOM   7596  O  OD1 . ASN B 1 90  ? 7.668   101.996 -22.878 0.25 25.94 ? 90  ASN B OD1 3 
ATOM   7597  N  ND2 . ASN B 1 90  ? 9.659   101.148 -22.277 0.25 26.50 ? 90  ASN B ND2 3 
ATOM   7598  N  N   . LEU B 1 91  ? 8.255   98.795  -17.876 0.25 16.10 ? 91  LEU B N   3 
ATOM   7599  C  CA  . LEU B 1 91  ? 7.924   98.720  -16.452 0.25 15.97 ? 91  LEU B CA  3 
ATOM   7600  C  C   . LEU B 1 91  ? 9.007   99.264  -15.535 0.25 14.12 ? 91  LEU B C   3 
ATOM   7601  O  O   . LEU B 1 91  ? 8.706   99.892  -14.520 0.25 12.91 ? 91  LEU B O   3 
ATOM   7602  C  CB  . LEU B 1 91  ? 7.610   97.279  -16.040 0.25 14.10 ? 91  LEU B CB  3 
ATOM   7603  C  CG  . LEU B 1 91  ? 6.233   96.728  -16.422 0.25 17.69 ? 91  LEU B CG  3 
ATOM   7604  C  CD1 . LEU B 1 91  ? 6.193   95.223  -16.142 0.25 14.77 ? 91  LEU B CD1 3 
ATOM   7605  C  CD2 . LEU B 1 91  ? 5.145   97.454  -15.633 0.25 16.77 ? 91  LEU B CD2 3 
ATOM   7606  N  N   . ASN B 1 92  ? 10.267  99.020  -15.878 0.25 14.06 ? 92  ASN B N   3 
ATOM   7607  C  CA  . ASN B 1 92  ? 11.356  99.497  -15.038 0.25 14.91 ? 92  ASN B CA  3 
ATOM   7608  C  C   . ASN B 1 92  ? 11.612  100.986 -15.212 0.25 14.74 ? 92  ASN B C   3 
ATOM   7609  O  O   . ASN B 1 92  ? 11.968  101.674 -14.254 0.25 16.17 ? 92  ASN B O   3 
ATOM   7610  C  CB  . ASN B 1 92  ? 12.632  98.696  -15.314 0.25 14.73 ? 92  ASN B CB  3 
ATOM   7611  C  CG  . ASN B 1 92  ? 12.491  97.244  -14.913 0.25 17.09 ? 92  ASN B CG  3 
ATOM   7612  O  OD1 . ASN B 1 92  ? 11.746  96.917  -13.990 0.25 14.73 ? 92  ASN B OD1 3 
ATOM   7613  N  ND2 . ASN B 1 92  ? 13.216  96.364  -15.595 0.25 15.31 ? 92  ASN B ND2 3 
ATOM   7614  N  N   . SER B 1 93  ? 11.427  101.487 -16.429 0.25 12.67 ? 93  SER B N   3 
ATOM   7615  C  CA  . SER B 1 93  ? 11.621  102.906 -16.687 0.25 13.58 ? 93  SER B CA  3 
ATOM   7616  C  C   . SER B 1 93  ? 10.555  103.706 -15.940 0.25 13.54 ? 93  SER B C   3 
ATOM   7617  O  O   . SER B 1 93  ? 10.848  104.740 -15.345 0.25 11.91 ? 93  SER B O   3 
ATOM   7618  C  CB  . SER B 1 93  ? 11.520  103.197 -18.185 0.25 15.15 ? 93  SER B CB  3 
ATOM   7619  O  OG  . SER B 1 93  ? 11.654  104.588 -18.433 0.25 15.48 ? 93  SER B OG  3 
ATOM   7620  N  N   . LEU B 1 94  ? 9.315   103.222 -15.971 0.25 12.93 ? 94  LEU B N   3 
ATOM   7621  C  CA  . LEU B 1 94  ? 8.234   103.913 -15.285 0.25 12.05 ? 94  LEU B CA  3 
ATOM   7622  C  C   . LEU B 1 94  ? 8.477   103.900 -13.775 0.25 11.79 ? 94  LEU B C   3 
ATOM   7623  O  O   . LEU B 1 94  ? 8.244   104.896 -13.094 0.25 11.05 ? 94  LEU B O   3 
ATOM   7624  C  CB  . LEU B 1 94  ? 6.883   103.270 -15.618 0.25 13.09 ? 94  LEU B CB  3 
ATOM   7625  C  CG  . LEU B 1 94  ? 5.660   104.005 -15.057 0.25 13.82 ? 94  LEU B CG  3 
ATOM   7626  C  CD1 . LEU B 1 94  ? 5.688   105.457 -15.525 0.25 13.31 ? 94  LEU B CD1 3 
ATOM   7627  C  CD2 . LEU B 1 94  ? 4.369   103.318 -15.517 0.25 13.67 ? 94  LEU B CD2 3 
ATOM   7628  N  N   . ASP B 1 95  ? 8.956   102.777 -13.251 0.25 12.16 ? 95  ASP B N   3 
ATOM   7629  C  CA  . ASP B 1 95  ? 9.238   102.686 -11.824 0.25 13.94 ? 95  ASP B CA  3 
ATOM   7630  C  C   . ASP B 1 95  ? 10.333  103.673 -11.429 0.25 12.96 ? 95  ASP B C   3 
ATOM   7631  O  O   . ASP B 1 95  ? 10.313  104.232 -10.337 0.25 13.29 ? 95  ASP B O   3 
ATOM   7632  C  CB  . ASP B 1 95  ? 9.674   101.269 -11.442 0.25 12.01 ? 95  ASP B CB  3 
ATOM   7633  C  CG  . ASP B 1 95  ? 8.588   100.238 -11.681 0.25 16.37 ? 95  ASP B CG  3 
ATOM   7634  O  OD1 . ASP B 1 95  ? 7.396   100.567 -11.485 0.25 12.70 ? 95  ASP B OD1 3 
ATOM   7635  O  OD2 . ASP B 1 95  ? 8.929   99.094  -12.051 0.25 16.08 ? 95  ASP B OD2 3 
ATOM   7636  N  N   . GLU B 1 96  ? 11.296  103.879 -12.322 0.25 16.33 ? 96  GLU B N   3 
ATOM   7637  C  CA  . GLU B 1 96  ? 12.395  104.803 -12.057 0.25 16.47 ? 96  GLU B CA  3 
ATOM   7638  C  C   . GLU B 1 96  ? 11.921  106.249 -12.108 0.25 14.78 ? 96  GLU B C   3 
ATOM   7639  O  O   . GLU B 1 96  ? 12.417  107.091 -11.364 0.25 14.73 ? 96  GLU B O   3 
ATOM   7640  C  CB  . GLU B 1 96  ? 13.525  104.607 -13.073 0.25 18.75 ? 96  GLU B CB  3 
ATOM   7641  C  CG  . GLU B 1 96  ? 14.270  103.294 -12.941 0.25 26.01 ? 96  GLU B CG  3 
ATOM   7642  C  CD  . GLU B 1 96  ? 15.039  103.182 -11.636 0.25 25.34 ? 96  GLU B CD  3 
ATOM   7643  O  OE1 . GLU B 1 96  ? 15.918  104.034 -11.384 0.25 25.75 ? 96  GLU B OE1 3 
ATOM   7644  O  OE2 . GLU B 1 96  ? 14.765  102.237 -10.867 0.25 28.99 ? 96  GLU B OE2 3 
ATOM   7645  N  N   . GLN B 1 97  ? 10.980  106.542 -13.002 0.25 14.00 ? 97  GLN B N   3 
ATOM   7646  C  CA  . GLN B 1 97  ? 10.443  107.900 -13.128 0.25 12.52 ? 97  GLN B CA  3 
ATOM   7647  C  C   . GLN B 1 97  ? 9.820   108.299 -11.800 0.25 13.75 ? 97  GLN B C   3 
ATOM   7648  O  O   . GLN B 1 97  ? 9.945   109.439 -11.354 0.25 13.61 ? 97  GLN B O   3 
ATOM   7649  C  CB  . GLN B 1 97  ? 9.367   107.954 -14.216 0.25 10.56 ? 97  GLN B CB  3 
ATOM   7650  C  CG  . GLN B 1 97  ? 9.876   107.688 -15.629 0.25 15.39 ? 97  GLN B CG  3 
ATOM   7651  C  CD  . GLN B 1 97  ? 8.750   107.425 -16.611 0.25 15.77 ? 97  GLN B CD  3 
ATOM   7652  O  OE1 . GLN B 1 97  ? 7.755   108.154 -16.646 0.25 14.41 ? 97  GLN B OE1 3 
ATOM   7653  N  NE2 . GLN B 1 97  ? 8.902   106.380 -17.417 0.25 14.71 ? 97  GLN B NE2 3 
ATOM   7654  N  N   . GLU B 1 98  ? 9.148   107.337 -11.176 0.25 14.17 ? 98  GLU B N   3 
ATOM   7655  C  CA  . GLU B 1 98  ? 8.481   107.547 -9.902  0.25 16.26 ? 98  GLU B CA  3 
ATOM   7656  C  C   . GLU B 1 98  ? 9.466   107.506 -8.735  0.25 15.76 ? 98  GLU B C   3 
ATOM   7657  O  O   . GLU B 1 98  ? 9.138   107.915 -7.617  0.25 16.24 ? 98  GLU B O   3 
ATOM   7658  C  CB  . GLU B 1 98  ? 7.401   106.476 -9.716  0.25 18.86 ? 98  GLU B CB  3 
ATOM   7659  C  CG  . GLU B 1 98  ? 6.336   106.485 -10.807 0.25 24.08 ? 98  GLU B CG  3 
ATOM   7660  C  CD  . GLU B 1 98  ? 5.564   107.796 -10.860 0.25 27.76 ? 98  GLU B CD  3 
ATOM   7661  O  OE1 . GLU B 1 98  ? 4.929   108.158 -9.846  0.25 26.54 ? 98  GLU B OE1 3 
ATOM   7662  O  OE2 . GLU B 1 98  ? 5.593   108.466 -11.916 0.25 30.51 ? 98  GLU B OE2 3 
ATOM   7663  N  N   . GLY B 1 99  ? 10.672  107.007 -8.999  0.25 14.04 ? 99  GLY B N   3 
ATOM   7664  C  CA  . GLY B 1 99  ? 11.686  106.918 -7.960  0.25 15.06 ? 99  GLY B CA  3 
ATOM   7665  C  C   . GLY B 1 99  ? 11.358  105.919 -6.866  0.25 15.62 ? 99  GLY B C   3 
ATOM   7666  O  O   . GLY B 1 99  ? 11.427  106.245 -5.682  0.25 15.79 ? 99  GLY B O   3 
ATOM   7667  N  N   . VAL B 1 100 ? 11.017  104.693 -7.254  0.25 15.35 ? 100 VAL B N   3 
ATOM   7668  C  CA  . VAL B 1 100 ? 10.682  103.665 -6.276  0.25 15.37 ? 100 VAL B CA  3 
ATOM   7669  C  C   . VAL B 1 100 ? 11.900  103.197 -5.473  0.25 17.95 ? 100 VAL B C   3 
ATOM   7670  O  O   . VAL B 1 100 ? 11.803  102.971 -4.265  0.25 15.60 ? 100 VAL B O   3 
ATOM   7671  C  CB  . VAL B 1 100 ? 10.025  102.442 -6.956  0.25 15.26 ? 100 VAL B CB  3 
ATOM   7672  C  CG1 . VAL B 1 100 ? 9.715   101.369 -5.916  0.25 12.50 ? 100 VAL B CG1 3 
ATOM   7673  C  CG2 . VAL B 1 100 ? 8.748   102.871 -7.677  0.25 12.73 ? 100 VAL B CG2 3 
ATOM   7674  N  N   . LYS B 1 101 ? 13.047  103.058 -6.133  0.25 19.67 ? 101 LYS B N   3 
ATOM   7675  C  CA  . LYS B 1 101 ? 14.260  102.606 -5.450  0.25 20.66 ? 101 LYS B CA  3 
ATOM   7676  C  C   . LYS B 1 101 ? 14.827  103.636 -4.468  0.25 20.16 ? 101 LYS B C   3 
ATOM   7677  O  O   . LYS B 1 101 ? 15.906  103.446 -3.908  0.25 17.89 ? 101 LYS B O   3 
ATOM   7678  C  CB  . LYS B 1 101 ? 15.335  102.232 -6.472  0.25 25.66 ? 101 LYS B CB  3 
ATOM   7679  C  CG  . LYS B 1 101 ? 15.031  100.971 -7.267  0.25 30.63 ? 101 LYS B CG  3 
ATOM   7680  C  CD  . LYS B 1 101 ? 16.103  100.711 -8.316  0.25 37.17 ? 101 LYS B CD  3 
ATOM   7681  C  CE  . LYS B 1 101 ? 15.775  99.486  -9.157  0.25 40.81 ? 101 LYS B CE  3 
ATOM   7682  N  NZ  . LYS B 1 101 ? 16.770  99.275  -10.245 0.25 43.57 ? 101 LYS B NZ  3 
ATOM   7683  N  N   . SER B 1 102 ? 14.094  104.723 -4.253  0.25 19.90 ? 102 SER B N   3 
ATOM   7684  C  CA  . SER B 1 102 ? 14.537  105.767 -3.340  0.25 19.87 ? 102 SER B CA  3 
ATOM   7685  C  C   . SER B 1 102 ? 13.516  105.972 -2.226  0.25 19.49 ? 102 SER B C   3 
ATOM   7686  O  O   . SER B 1 102 ? 13.584  106.951 -1.483  0.25 18.70 ? 102 SER B O   3 
ATOM   7687  C  CB  . SER B 1 102 ? 14.748  107.078 -4.105  0.25 20.94 ? 102 SER B CB  3 
ATOM   7688  O  OG  . SER B 1 102 ? 15.675  106.898 -5.162  0.25 20.90 ? 102 SER B OG  3 
ATOM   7689  N  N   . GLY B 1 103 ? 12.570  105.041 -2.127  0.25 17.67 ? 103 GLY B N   3 
ATOM   7690  C  CA  . GLY B 1 103 ? 11.538  105.113 -1.108  0.25 16.04 ? 103 GLY B CA  3 
ATOM   7691  C  C   . GLY B 1 103 ? 10.485  106.188 -1.331  0.25 15.56 ? 103 GLY B C   3 
ATOM   7692  O  O   . GLY B 1 103 ? 9.724   106.514 -0.419  0.25 13.41 ? 103 GLY B O   3 
HETATM 7693  N  N   . MSE B 1 104 ? 10.423  106.735 -2.540  0.25 14.36 ? 104 MSE B N   3 
HETATM 7694  C  CA  . MSE B 1 104 ? 9.452   107.784 -2.842  0.25 13.58 ? 104 MSE B CA  3 
HETATM 7695  C  C   . MSE B 1 104 ? 8.040   107.233 -3.011  0.25 13.37 ? 104 MSE B C   3 
HETATM 7696  O  O   . MSE B 1 104 ? 7.092   107.745 -2.418  0.25 12.43 ? 104 MSE B O   3 
HETATM 7697  C  CB  . MSE B 1 104 ? 9.879   108.546 -4.103  0.25 15.57 ? 104 MSE B CB  3 
HETATM 7698  C  CG  . MSE B 1 104 ? 11.116  109.403 -3.891  0.25 16.51 ? 104 MSE B CG  3 
HETATM 7699  SE SE  . MSE B 1 104 ? 11.809  110.232 -5.492  0.25 21.43 ? 104 MSE B SE  3 
HETATM 7700  C  CE  . MSE B 1 104 ? 10.235  111.235 -5.992  0.25 16.15 ? 104 MSE B CE  3 
ATOM   7701  N  N   . TYR B 1 105 ? 7.907   106.188 -3.822  0.25 11.06 ? 105 TYR B N   3 
ATOM   7702  C  CA  . TYR B 1 105 ? 6.611   105.557 -4.066  0.25 10.95 ? 105 TYR B CA  3 
ATOM   7703  C  C   . TYR B 1 105 ? 6.776   104.049 -4.155  0.25 9.62  ? 105 TYR B C   3 
ATOM   7704  O  O   . TYR B 1 105 ? 7.842   103.560 -4.517  0.25 9.50  ? 105 TYR B O   3 
ATOM   7705  C  CB  . TYR B 1 105 ? 6.013   106.003 -5.404  0.25 9.83  ? 105 TYR B CB  3 
ATOM   7706  C  CG  . TYR B 1 105 ? 5.615   107.449 -5.517  0.25 12.41 ? 105 TYR B CG  3 
ATOM   7707  C  CD1 . TYR B 1 105 ? 6.573   108.462 -5.515  0.25 12.47 ? 105 TYR B CD1 3 
ATOM   7708  C  CD2 . TYR B 1 105 ? 4.278   107.802 -5.701  0.25 11.08 ? 105 TYR B CD2 3 
ATOM   7709  C  CE1 . TYR B 1 105 ? 6.208   109.794 -5.704  0.25 14.00 ? 105 TYR B CE1 3 
ATOM   7710  C  CE2 . TYR B 1 105 ? 3.902   109.126 -5.891  0.25 11.73 ? 105 TYR B CE2 3 
ATOM   7711  C  CZ  . TYR B 1 105 ? 4.872   110.115 -5.895  0.25 14.13 ? 105 TYR B CZ  3 
ATOM   7712  O  OH  . TYR B 1 105 ? 4.511   111.418 -6.113  0.25 11.76 ? 105 TYR B OH  3 
ATOM   7713  N  N   . VAL B 1 106 ? 5.715   103.318 -3.827  0.25 8.69  ? 106 VAL B N   3 
ATOM   7714  C  CA  . VAL B 1 106 ? 5.730   101.871 -3.953  0.25 8.78  ? 106 VAL B CA  3 
ATOM   7715  C  C   . VAL B 1 106 ? 4.805   101.549 -5.132  0.25 8.27  ? 106 VAL B C   3 
ATOM   7716  O  O   . VAL B 1 106 ? 3.800   102.238 -5.345  0.25 8.12  ? 106 VAL B O   3 
ATOM   7717  C  CB  . VAL B 1 106 ? 5.202   101.167 -2.673  0.25 9.65  ? 106 VAL B CB  3 
ATOM   7718  C  CG1 . VAL B 1 106 ? 3.771   101.594 -2.380  0.25 9.45  ? 106 VAL B CG1 3 
ATOM   7719  C  CG2 . VAL B 1 106 ? 5.266   99.664  -2.854  0.25 7.74  ? 106 VAL B CG2 3 
ATOM   7720  N  N   . VAL B 1 107 ? 5.154   100.538 -5.920  0.25 7.42  ? 107 VAL B N   3 
ATOM   7721  C  CA  . VAL B 1 107 ? 4.307   100.146 -7.045  0.25 7.85  ? 107 VAL B CA  3 
ATOM   7722  C  C   . VAL B 1 107 ? 3.003   99.616  -6.462  0.25 8.61  ? 107 VAL B C   3 
ATOM   7723  O  O   . VAL B 1 107 ? 3.022   98.857  -5.494  0.25 8.71  ? 107 VAL B O   3 
ATOM   7724  C  CB  . VAL B 1 107 ? 4.935   98.992  -7.881  0.25 8.21  ? 107 VAL B CB  3 
ATOM   7725  C  CG1 . VAL B 1 107 ? 3.891   98.429  -8.839  0.25 5.44  ? 107 VAL B CG1 3 
ATOM   7726  C  CG2 . VAL B 1 107 ? 6.142   99.496  -8.679  0.25 6.64  ? 107 VAL B CG2 3 
ATOM   7727  N  N   . ILE B 1 108 ? 1.872   100.012 -7.037  0.25 7.98  ? 108 ILE B N   3 
ATOM   7728  C  CA  . ILE B 1 108 ? 0.594   99.515  -6.553  0.25 7.15  ? 108 ILE B CA  3 
ATOM   7729  C  C   . ILE B 1 108 ? -0.268  99.020  -7.710  0.25 8.94  ? 108 ILE B C   3 
ATOM   7730  O  O   . ILE B 1 108 ? 0.003   99.305  -8.881  0.25 5.85  ? 108 ILE B O   3 
ATOM   7731  C  CB  . ILE B 1 108 ? -0.207  100.607 -5.796  0.25 9.87  ? 108 ILE B CB  3 
ATOM   7732  C  CG1 . ILE B 1 108 ? -0.657  101.701 -6.772  0.25 7.77  ? 108 ILE B CG1 3 
ATOM   7733  C  CG2 . ILE B 1 108 ? 0.649   101.222 -4.686  0.25 6.26  ? 108 ILE B CG2 3 
ATOM   7734  C  CD1 . ILE B 1 108 ? -1.534  102.780 -6.129  0.25 10.04 ? 108 ILE B CD1 3 
ATOM   7735  N  N   . GLU B 1 109 ? -1.287  98.241  -7.370  0.25 8.77  ? 109 GLU B N   3 
ATOM   7736  C  CA  . GLU B 1 109 ? -2.248  97.757  -8.351  0.25 11.00 ? 109 GLU B CA  3 
ATOM   7737  C  C   . GLU B 1 109 ? -3.584  98.274  -7.839  0.25 10.19 ? 109 GLU B C   3 
ATOM   7738  O  O   . GLU B 1 109 ? -3.832  98.262  -6.627  0.25 10.07 ? 109 GLU B O   3 
ATOM   7739  C  CB  . GLU B 1 109 ? -2.282  96.222  -8.409  0.25 11.37 ? 109 GLU B CB  3 
ATOM   7740  C  CG  . GLU B 1 109 ? -3.372  95.680  -9.331  0.25 14.84 ? 109 GLU B CG  3 
ATOM   7741  C  CD  . GLU B 1 109 ? -3.524  94.169  -9.238  0.25 17.36 ? 109 GLU B CD  3 
ATOM   7742  O  OE1 . GLU B 1 109 ? -2.591  93.443  -9.646  0.25 17.89 ? 109 GLU B OE1 3 
ATOM   7743  O  OE2 . GLU B 1 109 ? -4.576  93.709  -8.749  0.25 17.41 ? 109 GLU B OE2 3 
ATOM   7744  N  N   . VAL B 1 110 ? -4.431  98.749  -8.746  0.25 10.06 ? 110 VAL B N   3 
ATOM   7745  C  CA  . VAL B 1 110 ? -5.744  99.253  -8.364  0.25 11.59 ? 110 VAL B CA  3 
ATOM   7746  C  C   . VAL B 1 110 ? -6.776  98.932  -9.434  0.25 12.80 ? 110 VAL B C   3 
ATOM   7747  O  O   . VAL B 1 110 ? -6.432  98.714  -10.595 0.25 14.11 ? 110 VAL B O   3 
ATOM   7748  C  CB  . VAL B 1 110 ? -5.745  100.791 -8.165  0.25 12.56 ? 110 VAL B CB  3 
ATOM   7749  C  CG1 . VAL B 1 110 ? -4.809  101.176 -7.043  0.25 10.33 ? 110 VAL B CG1 3 
ATOM   7750  C  CG2 . VAL B 1 110 ? -5.358  101.488 -9.463  0.25 12.19 ? 110 VAL B CG2 3 
ATOM   7751  N  N   . LYS B 1 111 ? -8.042  98.895  -9.032  0.25 13.43 ? 111 LYS B N   3 
ATOM   7752  C  CA  . LYS B 1 111 ? -9.128  98.633  -9.966  0.25 14.45 ? 111 LYS B CA  3 
ATOM   7753  C  C   . LYS B 1 111 ? -9.964  99.902  -10.015 0.25 13.83 ? 111 LYS B C   3 
ATOM   7754  O  O   . LYS B 1 111 ? -10.658 100.246 -9.057  0.25 12.12 ? 111 LYS B O   3 
ATOM   7755  C  CB  . LYS B 1 111 ? -9.964  97.437  -9.500  0.25 15.06 ? 111 LYS B CB  3 
ATOM   7756  C  CG  . LYS B 1 111 ? -9.190  96.121  -9.507  0.25 16.92 ? 111 LYS B CG  3 
ATOM   7757  C  CD  . LYS B 1 111 ? -10.076 94.942  -9.119  0.25 20.54 ? 111 LYS B CD  3 
ATOM   7758  C  CE  . LYS B 1 111 ? -9.253  93.689  -8.818  0.25 21.08 ? 111 LYS B CE  3 
ATOM   7759  N  NZ  . LYS B 1 111 ? -8.410  93.288  -9.973  0.25 23.62 ? 111 LYS B NZ  3 
ATOM   7760  N  N   . VAL B 1 112 ? -9.866  100.617 -11.127 0.25 11.48 ? 112 VAL B N   3 
ATOM   7761  C  CA  . VAL B 1 112 ? -10.591 101.862 -11.279 0.25 10.57 ? 112 VAL B CA  3 
ATOM   7762  C  C   . VAL B 1 112 ? -11.927 101.650 -11.976 0.25 11.54 ? 112 VAL B C   3 
ATOM   7763  O  O   . VAL B 1 112 ? -12.194 100.574 -12.509 0.25 12.53 ? 112 VAL B O   3 
ATOM   7764  C  CB  . VAL B 1 112 ? -9.740  102.904 -12.049 0.25 10.27 ? 112 VAL B CB  3 
ATOM   7765  C  CG1 . VAL B 1 112 ? -8.560  103.345 -11.181 0.25 10.17 ? 112 VAL B CG1 3 
ATOM   7766  C  CG2 . VAL B 1 112 ? -9.229  102.308 -13.355 0.25 8.21  ? 112 VAL B CG2 3 
ATOM   7767  N  N   . ALA B 1 113 ? -12.766 102.681 -11.959 0.25 10.83 ? 113 ALA B N   3 
ATOM   7768  C  CA  . ALA B 1 113 ? -14.082 102.595 -12.571 0.25 12.38 ? 113 ALA B CA  3 
ATOM   7769  C  C   . ALA B 1 113 ? -14.310 103.667 -13.632 0.25 11.93 ? 113 ALA B C   3 
ATOM   7770  O  O   . ALA B 1 113 ? -14.195 104.860 -13.354 0.25 11.97 ? 113 ALA B O   3 
ATOM   7771  C  CB  . ALA B 1 113 ? -15.152 102.692 -11.488 0.25 7.95  ? 113 ALA B CB  3 
ATOM   7772  N  N   . THR B 1 114 ? -14.626 103.232 -14.849 0.25 14.46 ? 114 THR B N   3 
ATOM   7773  C  CA  . THR B 1 114 ? -14.892 104.152 -15.947 0.25 16.90 ? 114 THR B CA  3 
ATOM   7774  C  C   . THR B 1 114 ? -16.318 104.661 -15.770 0.25 19.60 ? 114 THR B C   3 
ATOM   7775  O  O   . THR B 1 114 ? -17.099 104.077 -15.016 0.25 18.73 ? 114 THR B O   3 
ATOM   7776  C  CB  . THR B 1 114 ? -14.797 103.448 -17.316 0.25 17.81 ? 114 THR B CB  3 
ATOM   7777  O  OG1 . THR B 1 114 ? -15.913 102.562 -17.477 0.25 16.86 ? 114 THR B OG1 3 
ATOM   7778  C  CG2 . THR B 1 114 ? -13.511 102.649 -17.413 0.25 17.46 ? 114 THR B CG2 3 
ATOM   7779  N  N   . GLN B 1 115 ? -16.659 105.744 -16.457 0.25 22.70 ? 115 GLN B N   3 
ATOM   7780  C  CA  . GLN B 1 115 ? -18.004 106.301 -16.350 0.25 26.42 ? 115 GLN B CA  3 
ATOM   7781  C  C   . GLN B 1 115 ? -19.088 105.321 -16.796 0.25 26.15 ? 115 GLN B C   3 
ATOM   7782  O  O   . GLN B 1 115 ? -20.241 105.434 -16.383 0.25 25.46 ? 115 GLN B O   3 
ATOM   7783  C  CB  . GLN B 1 115 ? -18.103 107.601 -17.150 0.25 29.98 ? 115 GLN B CB  3 
ATOM   7784  C  CG  . GLN B 1 115 ? -17.523 108.800 -16.424 0.25 34.50 ? 115 GLN B CG  3 
ATOM   7785  C  CD  . GLN B 1 115 ? -18.360 109.213 -15.228 0.25 36.78 ? 115 GLN B CD  3 
ATOM   7786  O  OE1 . GLN B 1 115 ? -18.652 108.402 -14.348 0.25 38.02 ? 115 GLN B OE1 3 
ATOM   7787  N  NE2 . GLN B 1 115 ? -18.750 110.481 -15.190 0.25 38.80 ? 115 GLN B NE2 3 
ATOM   7788  N  N   . GLU B 1 116 ? -18.718 104.355 -17.631 0.25 26.96 ? 116 GLU B N   3 
ATOM   7789  C  CA  . GLU B 1 116 ? -19.677 103.358 -18.100 0.25 29.08 ? 116 GLU B CA  3 
ATOM   7790  C  C   . GLU B 1 116 ? -19.827 102.240 -17.073 0.25 27.04 ? 116 GLU B C   3 
ATOM   7791  O  O   . GLU B 1 116 ? -20.588 101.300 -17.276 0.25 26.21 ? 116 GLU B O   3 
ATOM   7792  C  CB  . GLU B 1 116 ? -19.228 102.759 -19.436 0.25 33.13 ? 116 GLU B CB  3 
ATOM   7793  C  CG  . GLU B 1 116 ? -19.266 103.726 -20.613 0.25 40.78 ? 116 GLU B CG  3 
ATOM   7794  C  CD  . GLU B 1 116 ? -18.324 104.904 -20.441 0.25 43.15 ? 116 GLU B CD  3 
ATOM   7795  O  OE1 . GLU B 1 116 ? -17.123 104.675 -20.178 0.25 44.62 ? 116 GLU B OE1 3 
ATOM   7796  O  OE2 . GLU B 1 116 ? -18.783 106.059 -20.574 0.25 45.84 ? 116 GLU B OE2 3 
ATOM   7797  N  N   . GLY B 1 117 ? -19.092 102.347 -15.972 0.25 26.14 ? 117 GLY B N   3 
ATOM   7798  C  CA  . GLY B 1 117 ? -19.172 101.336 -14.932 0.25 26.72 ? 117 GLY B CA  3 
ATOM   7799  C  C   . GLY B 1 117 ? -18.242 100.153 -15.125 0.25 26.08 ? 117 GLY B C   3 
ATOM   7800  O  O   . GLY B 1 117 ? -18.315 99.174  -14.384 0.25 25.87 ? 117 GLY B O   3 
ATOM   7801  N  N   . LYS B 1 118 ? -17.364 100.242 -16.115 0.25 26.52 ? 118 LYS B N   3 
ATOM   7802  C  CA  . LYS B 1 118 ? -16.417 99.166  -16.392 0.25 28.17 ? 118 LYS B CA  3 
ATOM   7803  C  C   . LYS B 1 118 ? -15.209 99.292  -15.469 0.25 25.46 ? 118 LYS B C   3 
ATOM   7804  O  O   . LYS B 1 118 ? -14.607 100.358 -15.375 0.25 25.15 ? 118 LYS B O   3 
ATOM   7805  C  CB  . LYS B 1 118 ? -15.952 99.237  -17.847 0.25 31.74 ? 118 LYS B CB  3 
ATOM   7806  C  CG  . LYS B 1 118 ? -17.074 99.503  -18.836 0.25 38.22 ? 118 LYS B CG  3 
ATOM   7807  C  CD  . LYS B 1 118 ? -16.557 99.554  -20.264 0.25 41.71 ? 118 LYS B CD  3 
ATOM   7808  C  CE  . LYS B 1 118 ? -17.628 100.067 -21.217 0.25 46.42 ? 118 LYS B CE  3 
ATOM   7809  N  NZ  . LYS B 1 118 ? -18.882 99.275  -21.130 0.25 47.78 ? 118 LYS B NZ  3 
ATOM   7810  N  N   . GLU B 1 119 ? -14.865 98.200  -14.794 0.25 24.36 ? 119 GLU B N   3 
ATOM   7811  C  CA  . GLU B 1 119 ? -13.726 98.177  -13.881 0.25 23.57 ? 119 GLU B CA  3 
ATOM   7812  C  C   . GLU B 1 119 ? -12.441 97.816  -14.630 0.25 22.33 ? 119 GLU B C   3 
ATOM   7813  O  O   . GLU B 1 119 ? -12.411 96.862  -15.411 0.25 20.19 ? 119 GLU B O   3 
ATOM   7814  C  CB  . GLU B 1 119 ? -13.985 97.172  -12.750 0.25 24.25 ? 119 GLU B CB  3 
ATOM   7815  C  CG  . GLU B 1 119 ? -12.787 96.901  -11.844 0.25 27.73 ? 119 GLU B CG  3 
ATOM   7816  C  CD  . GLU B 1 119 ? -13.146 96.059  -10.628 0.25 28.96 ? 119 GLU B CD  3 
ATOM   7817  O  OE1 . GLU B 1 119 ? -13.844 96.573  -9.729  0.25 29.58 ? 119 GLU B OE1 3 
ATOM   7818  O  OE2 . GLU B 1 119 ? -12.736 94.880  -10.572 0.25 30.83 ? 119 GLU B OE2 3 
ATOM   7819  N  N   . ILE B 1 120 ? -11.386 98.586  -14.385 0.25 19.73 ? 120 ILE B N   3 
ATOM   7820  C  CA  . ILE B 1 120 ? -10.097 98.369  -15.030 0.25 18.79 ? 120 ILE B CA  3 
ATOM   7821  C  C   . ILE B 1 120 ? -8.998  98.188  -13.983 0.25 17.69 ? 120 ILE B C   3 
ATOM   7822  O  O   . ILE B 1 120 ? -8.819  99.048  -13.119 0.25 16.64 ? 120 ILE B O   3 
ATOM   7823  C  CB  . ILE B 1 120 ? -9.702  99.578  -15.905 0.25 17.65 ? 120 ILE B CB  3 
ATOM   7824  C  CG1 . ILE B 1 120 ? -10.846 99.947  -16.851 0.25 20.43 ? 120 ILE B CG1 3 
ATOM   7825  C  CG2 . ILE B 1 120 ? -8.450  99.261  -16.690 0.25 17.87 ? 120 ILE B CG2 3 
ATOM   7826  C  CD1 . ILE B 1 120 ? -11.270 98.823  -17.775 0.25 22.32 ? 120 ILE B CD1 3 
ATOM   7827  N  N   . THR B 1 121 ? -8.260  97.083  -14.069 0.25 15.58 ? 121 THR B N   3 
ATOM   7828  C  CA  . THR B 1 121 ? -7.167  96.818  -13.134 0.25 15.67 ? 121 THR B CA  3 
ATOM   7829  C  C   . THR B 1 121 ? -5.898  97.461  -13.686 0.25 14.56 ? 121 THR B C   3 
ATOM   7830  O  O   . THR B 1 121 ? -5.497  97.174  -14.820 0.25 13.14 ? 121 THR B O   3 
ATOM   7831  C  CB  . THR B 1 121 ? -6.925  95.305  -12.963 0.25 15.67 ? 121 THR B CB  3 
ATOM   7832  O  OG1 . THR B 1 121 ? -8.116  94.684  -12.474 0.25 16.78 ? 121 THR B OG1 3 
ATOM   7833  C  CG2 . THR B 1 121 ? -5.791  95.050  -11.974 0.25 15.59 ? 121 THR B CG2 3 
ATOM   7834  N  N   . CYS B 1 122 ? -5.266  98.321  -12.888 0.25 11.90 ? 122 CYS B N   3 
ATOM   7835  C  CA  . CYS B 1 122 ? -4.059  99.019  -13.326 0.25 11.46 ? 122 CYS B CA  3 
ATOM   7836  C  C   . CYS B 1 122 ? -2.927  99.052  -12.311 0.25 10.64 ? 122 CYS B C   3 
ATOM   7837  O  O   . CYS B 1 122 ? -3.099  98.725  -11.138 0.25 11.71 ? 122 CYS B O   3 
ATOM   7838  C  CB  . CYS B 1 122 ? -4.382  100.474 -13.661 0.25 9.31  ? 122 CYS B CB  3 
ATOM   7839  S  SG  . CYS B 1 122 ? -5.816  100.737 -14.714 0.25 16.62 ? 122 CYS B SG  3 
ATOM   7840  N  N   . ARG B 1 123 ? -1.768  99.477  -12.794 0.25 9.48  ? 123 ARG B N   3 
ATOM   7841  C  CA  . ARG B 1 123 ? -0.588  99.651  -11.969 0.25 7.47  ? 123 ARG B CA  3 
ATOM   7842  C  C   . ARG B 1 123 ? -0.634  101.135 -11.634 0.25 8.67  ? 123 ARG B C   3 
ATOM   7843  O  O   . ARG B 1 123 ? -1.217  101.923 -12.380 0.25 8.89  ? 123 ARG B O   3 
ATOM   7844  C  CB  . ARG B 1 123 ? 0.674   99.357  -12.784 0.25 7.83  ? 123 ARG B CB  3 
ATOM   7845  C  CG  . ARG B 1 123 ? 1.998   99.495  -12.020 0.25 6.48  ? 123 ARG B CG  3 
ATOM   7846  C  CD  . ARG B 1 123 ? 3.157   99.504  -13.023 0.25 10.65 ? 123 ARG B CD  3 
ATOM   7847  N  NE  . ARG B 1 123 ? 4.472   99.207  -12.450 0.25 6.29  ? 123 ARG B NE  3 
ATOM   7848  C  CZ  . ARG B 1 123 ? 4.861   98.001  -12.047 0.25 9.26  ? 123 ARG B CZ  3 
ATOM   7849  N  NH1 . ARG B 1 123 ? 4.033   96.970  -12.139 0.25 9.01  ? 123 ARG B NH1 3 
ATOM   7850  N  NH2 . ARG B 1 123 ? 6.094   97.816  -11.592 0.25 9.19  ? 123 ARG B NH2 3 
ATOM   7851  N  N   . SER B 1 124 ? -0.040  101.518 -10.512 0.25 6.71  ? 124 SER B N   3 
ATOM   7852  C  CA  . SER B 1 124 ? 0.004   102.922 -10.131 0.25 6.68  ? 124 SER B CA  3 
ATOM   7853  C  C   . SER B 1 124 ? 1.037   103.038 -9.012  0.25 7.27  ? 124 SER B C   3 
ATOM   7854  O  O   . SER B 1 124 ? 1.814   102.105 -8.778  0.25 6.25  ? 124 SER B O   3 
ATOM   7855  C  CB  . SER B 1 124 ? -1.386  103.402 -9.672  0.25 6.95  ? 124 SER B CB  3 
ATOM   7856  O  OG  . SER B 1 124 ? -1.474  104.822 -9.652  0.25 4.39  ? 124 SER B OG  3 
ATOM   7857  N  N   . TYR B 1 125 ? 1.051   104.169 -8.321  0.25 6.62  ? 125 TYR B N   3 
ATOM   7858  C  CA  . TYR B 1 125 ? 2.021   104.382 -7.248  0.25 6.68  ? 125 TYR B CA  3 
ATOM   7859  C  C   . TYR B 1 125 ? 1.402   105.258 -6.171  0.25 5.96  ? 125 TYR B C   3 
ATOM   7860  O  O   . TYR B 1 125 ? 0.359   105.869 -6.390  0.25 5.21  ? 125 TYR B O   3 
ATOM   7861  C  CB  . TYR B 1 125 ? 3.272   105.087 -7.803  0.25 6.69  ? 125 TYR B CB  3 
ATOM   7862  C  CG  . TYR B 1 125 ? 3.904   104.382 -8.983  0.25 8.74  ? 125 TYR B CG  3 
ATOM   7863  C  CD1 . TYR B 1 125 ? 4.897   103.415 -8.799  0.25 9.87  ? 125 TYR B CD1 3 
ATOM   7864  C  CD2 . TYR B 1 125 ? 3.465   104.635 -10.279 0.25 7.49  ? 125 TYR B CD2 3 
ATOM   7865  C  CE1 . TYR B 1 125 ? 5.433   102.715 -9.885  0.25 11.81 ? 125 TYR B CE1 3 
ATOM   7866  C  CE2 . TYR B 1 125 ? 3.989   103.939 -11.370 0.25 12.73 ? 125 TYR B CE2 3 
ATOM   7867  C  CZ  . TYR B 1 125 ? 4.971   102.982 -11.166 0.25 8.85  ? 125 TYR B CZ  3 
ATOM   7868  O  OH  . TYR B 1 125 ? 5.484   102.297 -12.240 0.25 12.53 ? 125 TYR B OH  3 
ATOM   7869  N  N   . LEU B 1 126 ? 2.044   105.299 -5.006  0.25 5.49  ? 126 LEU B N   3 
ATOM   7870  C  CA  . LEU B 1 126 ? 1.605   106.144 -3.900  0.25 6.79  ? 126 LEU B CA  3 
ATOM   7871  C  C   . LEU B 1 126 ? 2.752   106.294 -2.914  0.25 7.46  ? 126 LEU B C   3 
ATOM   7872  O  O   . LEU B 1 126 ? 3.778   105.628 -3.045  0.25 8.28  ? 126 LEU B O   3 
ATOM   7873  C  CB  . LEU B 1 126 ? 0.352   105.578 -3.205  0.25 6.87  ? 126 LEU B CB  3 
ATOM   7874  C  CG  . LEU B 1 126 ? 0.318   104.239 -2.455  0.25 6.81  ? 126 LEU B CG  3 
ATOM   7875  C  CD1 . LEU B 1 126 ? 1.219   104.288 -1.225  0.25 5.83  ? 126 LEU B CD1 3 
ATOM   7876  C  CD2 . LEU B 1 126 ? -1.117  103.954 -2.028  0.25 4.92  ? 126 LEU B CD2 3 
HETATM 7877  N  N   . MSE B 1 127 ? 2.592   107.183 -1.940  0.25 8.76  ? 127 MSE B N   3 
HETATM 7878  C  CA  . MSE B 1 127 ? 3.636   107.397 -0.941  0.25 9.02  ? 127 MSE B CA  3 
HETATM 7879  C  C   . MSE B 1 127 ? 3.306   106.660 0.350   0.25 8.53  ? 127 MSE B C   3 
HETATM 7880  O  O   . MSE B 1 127 ? 2.190   106.755 0.851   0.25 7.64  ? 127 MSE B O   3 
HETATM 7881  C  CB  . MSE B 1 127 ? 3.801   108.893 -0.651  0.25 6.97  ? 127 MSE B CB  3 
HETATM 7882  C  CG  . MSE B 1 127 ? 4.006   109.744 -1.903  0.25 11.05 ? 127 MSE B CG  3 
HETATM 7883  SE SE  . MSE B 1 127 ? 4.434   111.591 -1.488  0.25 11.45 ? 127 MSE B SE  3 
HETATM 7884  C  CE  . MSE B 1 127 ? 5.744   111.890 -2.862  0.25 10.03 ? 127 MSE B CE  3 
ATOM   7885  N  N   . THR B 1 128 ? 4.286   105.937 0.886   0.25 10.08 ? 128 THR B N   3 
ATOM   7886  C  CA  . THR B 1 128 ? 4.096   105.178 2.118   0.25 10.51 ? 128 THR B CA  3 
ATOM   7887  C  C   . THR B 1 128 ? 4.758   105.832 3.327   0.25 12.44 ? 128 THR B C   3 
ATOM   7888  O  O   . THR B 1 128 ? 4.742   105.272 4.420   0.25 12.87 ? 128 THR B O   3 
ATOM   7889  C  CB  . THR B 1 128 ? 4.665   103.752 1.995   0.25 11.46 ? 128 THR B CB  3 
ATOM   7890  O  OG1 . THR B 1 128 ? 6.091   103.814 1.885   0.25 9.27  ? 128 THR B OG1 3 
ATOM   7891  C  CG2 . THR B 1 128 ? 4.085   103.053 0.773   0.25 9.99  ? 128 THR B CG2 3 
ATOM   7892  N  N   . ASN B 1 129 ? 5.351   107.005 3.133   0.25 11.50 ? 129 ASN B N   3 
ATOM   7893  C  CA  . ASN B 1 129 ? 5.999   107.716 4.234   0.25 14.68 ? 129 ASN B CA  3 
ATOM   7894  C  C   . ASN B 1 129 ? 6.360   109.114 3.781   0.25 13.89 ? 129 ASN B C   3 
ATOM   7895  O  O   . ASN B 1 129 ? 7.475   109.369 3.331   0.25 15.17 ? 129 ASN B O   3 
ATOM   7896  C  CB  . ASN B 1 129 ? 7.261   106.979 4.691   0.25 16.18 ? 129 ASN B CB  3 
ATOM   7897  C  CG  . ASN B 1 129 ? 7.974   107.699 5.819   0.25 18.90 ? 129 ASN B CG  3 
ATOM   7898  O  OD1 . ASN B 1 129 ? 7.339   108.185 6.755   0.25 15.72 ? 129 ASN B OD1 3 
ATOM   7899  N  ND2 . ASN B 1 129 ? 9.301   107.764 5.739   0.25 19.92 ? 129 ASN B ND2 3 
ATOM   7900  N  N   . TYR B 1 130 ? 5.406   110.025 3.906   0.25 13.82 ? 130 TYR B N   3 
ATOM   7901  C  CA  . TYR B 1 130 ? 5.629   111.386 3.461   0.25 13.74 ? 130 TYR B CA  3 
ATOM   7902  C  C   . TYR B 1 130 ? 5.109   112.426 4.436   0.25 15.08 ? 130 TYR B C   3 
ATOM   7903  O  O   . TYR B 1 130 ? 4.416   112.107 5.405   0.25 13.88 ? 130 TYR B O   3 
ATOM   7904  C  CB  . TYR B 1 130 ? 4.949   111.603 2.108   0.25 13.52 ? 130 TYR B CB  3 
ATOM   7905  C  CG  . TYR B 1 130 ? 3.436   111.627 2.179   0.25 12.57 ? 130 TYR B CG  3 
ATOM   7906  C  CD1 . TYR B 1 130 ? 2.693   110.447 2.210   0.25 13.11 ? 130 TYR B CD1 3 
ATOM   7907  C  CD2 . TYR B 1 130 ? 2.746   112.836 2.216   0.25 12.42 ? 130 TYR B CD2 3 
ATOM   7908  C  CE1 . TYR B 1 130 ? 1.298   110.471 2.273   0.25 11.72 ? 130 TYR B CE1 3 
ATOM   7909  C  CE2 . TYR B 1 130 ? 1.355   112.874 2.277   0.25 13.22 ? 130 TYR B CE2 3 
ATOM   7910  C  CZ  . TYR B 1 130 ? 0.638   111.691 2.306   0.25 12.62 ? 130 TYR B CZ  3 
ATOM   7911  O  OH  . TYR B 1 130 ? -0.738  111.730 2.370   0.25 11.78 ? 130 TYR B OH  3 
ATOM   7912  N  N   . GLU B 1 131 ? 5.466   113.675 4.163   0.25 15.19 ? 131 GLU B N   3 
ATOM   7913  C  CA  . GLU B 1 131 ? 5.027   114.806 4.965   0.25 18.76 ? 131 GLU B CA  3 
ATOM   7914  C  C   . GLU B 1 131 ? 4.105   115.603 4.057   0.25 17.23 ? 131 GLU B C   3 
ATOM   7915  O  O   . GLU B 1 131 ? 4.474   115.945 2.932   0.25 14.92 ? 131 GLU B O   3 
ATOM   7916  C  CB  . GLU B 1 131 ? 6.220   115.659 5.385   0.25 23.11 ? 131 GLU B CB  3 
ATOM   7917  C  CG  . GLU B 1 131 ? 7.181   114.949 6.322   0.25 29.58 ? 131 GLU B CG  3 
ATOM   7918  C  CD  . GLU B 1 131 ? 8.419   115.771 6.606   0.25 31.84 ? 131 GLU B CD  3 
ATOM   7919  O  OE1 . GLU B 1 131 ? 8.273   116.975 6.897   0.25 35.59 ? 131 GLU B OE1 3 
ATOM   7920  O  OE2 . GLU B 1 131 ? 9.535   115.215 6.544   0.25 35.89 ? 131 GLU B OE2 3 
ATOM   7921  N  N   . SER B 1 132 ? 2.898   115.874 4.539   0.25 16.01 ? 132 SER B N   3 
ATOM   7922  C  CA  . SER B 1 132 ? 1.926   116.614 3.754   0.25 16.96 ? 132 SER B CA  3 
ATOM   7923  C  C   . SER B 1 132 ? 2.409   118.039 3.522   0.25 16.93 ? 132 SER B C   3 
ATOM   7924  O  O   . SER B 1 132 ? 2.915   118.699 4.433   0.25 14.16 ? 132 SER B O   3 
ATOM   7925  C  CB  . SER B 1 132 ? 0.569   116.624 4.465   0.25 18.08 ? 132 SER B CB  3 
ATOM   7926  O  OG  . SER B 1 132 ? -0.440  117.126 3.608   0.25 18.80 ? 132 SER B OG  3 
ATOM   7927  N  N   . ALA B 1 133 ? 2.259   118.507 2.290   0.25 17.10 ? 133 ALA B N   3 
ATOM   7928  C  CA  . ALA B 1 133 ? 2.681   119.855 1.941   0.25 16.59 ? 133 ALA B CA  3 
ATOM   7929  C  C   . ALA B 1 133 ? 2.083   120.214 0.592   0.25 16.91 ? 133 ALA B C   3 
ATOM   7930  O  O   . ALA B 1 133 ? 2.097   119.402 -0.334  0.25 18.28 ? 133 ALA B O   3 
ATOM   7931  C  CB  . ALA B 1 133 ? 4.206   119.926 1.890   0.25 16.66 ? 133 ALA B CB  3 
ATOM   7932  N  N   . PRO B 1 134 ? 1.542   121.437 0.463   0.25 15.86 ? 134 PRO B N   3 
ATOM   7933  C  CA  . PRO B 1 134 ? 0.935   121.874 -0.796  0.25 15.81 ? 134 PRO B CA  3 
ATOM   7934  C  C   . PRO B 1 134 ? 1.863   121.892 -2.011  0.25 14.64 ? 134 PRO B C   3 
ATOM   7935  O  O   . PRO B 1 134 ? 3.076   122.077 -1.884  0.25 13.28 ? 134 PRO B O   3 
ATOM   7936  C  CB  . PRO B 1 134 ? 0.390   123.261 -0.453  0.25 16.17 ? 134 PRO B CB  3 
ATOM   7937  C  CG  . PRO B 1 134 ? 1.319   123.733 0.632   0.25 17.31 ? 134 PRO B CG  3 
ATOM   7938  C  CD  . PRO B 1 134 ? 1.471   122.501 1.478   0.25 15.70 ? 134 PRO B CD  3 
ATOM   7939  N  N   . PRO B 1 135 ? 1.293   121.693 -3.208  0.25 13.06 ? 135 PRO B N   3 
ATOM   7940  C  CA  . PRO B 1 135 ? 2.033   121.684 -4.477  0.25 14.17 ? 135 PRO B CA  3 
ATOM   7941  C  C   . PRO B 1 135 ? 2.382   123.095 -4.950  0.25 15.37 ? 135 PRO B C   3 
ATOM   7942  O  O   . PRO B 1 135 ? 1.854   124.081 -4.434  0.25 14.83 ? 135 PRO B O   3 
ATOM   7943  C  CB  . PRO B 1 135 ? 1.065   121.000 -5.429  0.25 12.93 ? 135 PRO B CB  3 
ATOM   7944  C  CG  . PRO B 1 135 ? -0.275  121.486 -4.927  0.25 13.00 ? 135 PRO B CG  3 
ATOM   7945  C  CD  . PRO B 1 135 ? -0.124  121.337 -3.424  0.25 13.22 ? 135 PRO B CD  3 
ATOM   7946  N  N   . SER B 1 136 ? 3.274   123.185 -5.930  0.25 14.83 ? 136 SER B N   3 
ATOM   7947  C  CA  . SER B 1 136 ? 3.658   124.476 -6.482  0.25 14.74 ? 136 SER B CA  3 
ATOM   7948  C  C   . SER B 1 136 ? 2.570   124.860 -7.474  0.25 15.86 ? 136 SER B C   3 
ATOM   7949  O  O   . SER B 1 136 ? 1.819   123.999 -7.940  0.25 15.95 ? 136 SER B O   3 
ATOM   7950  C  CB  . SER B 1 136 ? 4.990   124.368 -7.221  0.25 14.38 ? 136 SER B CB  3 
ATOM   7951  O  OG  . SER B 1 136 ? 4.850   123.579 -8.390  0.25 11.74 ? 136 SER B OG  3 
ATOM   7952  N  N   . PRO B 1 137 ? 2.458   126.156 -7.801  0.25 15.92 ? 137 PRO B N   3 
ATOM   7953  C  CA  . PRO B 1 137 ? 1.429   126.572 -8.755  0.25 15.72 ? 137 PRO B CA  3 
ATOM   7954  C  C   . PRO B 1 137 ? 1.636   125.898 -10.106 0.25 15.74 ? 137 PRO B C   3 
ATOM   7955  O  O   . PRO B 1 137 ? 0.671   125.518 -10.771 0.25 14.28 ? 137 PRO B O   3 
ATOM   7956  C  CB  . PRO B 1 137 ? 1.616   128.084 -8.827  0.25 16.72 ? 137 PRO B CB  3 
ATOM   7957  C  CG  . PRO B 1 137 ? 2.081   128.419 -7.429  0.25 16.53 ? 137 PRO B CG  3 
ATOM   7958  C  CD  . PRO B 1 137 ? 3.092   127.326 -7.167  0.25 16.22 ? 137 PRO B CD  3 
ATOM   7959  N  N   . GLN B 1 138 ? 2.895   125.735 -10.505 0.25 15.87 ? 138 GLN B N   3 
ATOM   7960  C  CA  . GLN B 1 138 ? 3.196   125.105 -11.788 0.25 16.28 ? 138 GLN B CA  3 
ATOM   7961  C  C   . GLN B 1 138 ? 2.702   123.664 -11.846 0.25 15.88 ? 138 GLN B C   3 
ATOM   7962  O  O   . GLN B 1 138 ? 2.197   123.220 -12.874 0.25 15.69 ? 138 GLN B O   3 
ATOM   7963  C  CB  . GLN B 1 138 ? 4.702   125.136 -12.079 0.25 18.69 ? 138 GLN B CB  3 
ATOM   7964  C  CG  . GLN B 1 138 ? 5.245   126.519 -12.391 0.25 18.90 ? 138 GLN B CG  3 
ATOM   7965  C  CD  . GLN B 1 138 ? 6.060   127.092 -11.254 0.25 20.36 ? 138 GLN B CD  3 
ATOM   7966  O  OE1 . GLN B 1 138 ? 5.639   127.063 -10.097 0.25 22.20 ? 138 GLN B OE1 3 
ATOM   7967  N  NE2 . GLN B 1 138 ? 7.235   127.623 -11.578 0.25 17.99 ? 138 GLN B NE2 3 
ATOM   7968  N  N   . TYR B 1 139 ? 2.854   122.937 -10.744 0.25 15.48 ? 139 TYR B N   3 
ATOM   7969  C  CA  . TYR B 1 139 ? 2.411   121.548 -10.681 0.25 14.25 ? 139 TYR B CA  3 
ATOM   7970  C  C   . TYR B 1 139 ? 0.887   121.503 -10.795 0.25 14.68 ? 139 TYR B C   3 
ATOM   7971  O  O   . TYR B 1 139 ? 0.318   120.669 -11.510 0.25 10.94 ? 139 TYR B O   3 
ATOM   7972  C  CB  . TYR B 1 139 ? 2.864   120.920 -9.359  0.25 14.68 ? 139 TYR B CB  3 
ATOM   7973  C  CG  . TYR B 1 139 ? 2.688   119.417 -9.279  0.25 13.44 ? 139 TYR B CG  3 
ATOM   7974  C  CD1 . TYR B 1 139 ? 3.257   118.576 -10.234 0.25 16.29 ? 139 TYR B CD1 3 
ATOM   7975  C  CD2 . TYR B 1 139 ? 1.979   118.833 -8.228  0.25 16.14 ? 139 TYR B CD2 3 
ATOM   7976  C  CE1 . TYR B 1 139 ? 3.130   117.188 -10.145 0.25 14.91 ? 139 TYR B CE1 3 
ATOM   7977  C  CE2 . TYR B 1 139 ? 1.842   117.450 -8.130  0.25 14.52 ? 139 TYR B CE2 3 
ATOM   7978  C  CZ  . TYR B 1 139 ? 2.421   116.635 -9.090  0.25 13.60 ? 139 TYR B CZ  3 
ATOM   7979  O  OH  . TYR B 1 139 ? 2.303   115.271 -8.987  0.25 13.79 ? 139 TYR B OH  3 
ATOM   7980  N  N   . LYS B 1 140 ? 0.226   122.417 -10.091 0.25 13.97 ? 140 LYS B N   3 
ATOM   7981  C  CA  . LYS B 1 140 ? -1.230  122.486 -10.120 0.25 13.63 ? 140 LYS B CA  3 
ATOM   7982  C  C   . LYS B 1 140 ? -1.746  122.706 -11.539 0.25 14.08 ? 140 LYS B C   3 
ATOM   7983  O  O   . LYS B 1 140 ? -2.625  121.985 -12.021 0.25 10.71 ? 140 LYS B O   3 
ATOM   7984  C  CB  . LYS B 1 140 ? -1.719  123.622 -9.217  0.25 14.49 ? 140 LYS B CB  3 
ATOM   7985  C  CG  . LYS B 1 140 ? -3.180  123.976 -9.428  0.25 14.31 ? 140 LYS B CG  3 
ATOM   7986  C  CD  . LYS B 1 140 ? -3.685  124.922 -8.352  0.25 14.75 ? 140 LYS B CD  3 
ATOM   7987  C  CE  . LYS B 1 140 ? -5.154  125.236 -8.563  0.25 14.92 ? 140 LYS B CE  3 
ATOM   7988  N  NZ  . LYS B 1 140 ? -5.716  126.038 -7.449  0.25 14.40 ? 140 LYS B NZ  3 
ATOM   7989  N  N   . LYS B 1 141 ? -1.198  123.716 -12.201 0.25 14.52 ? 141 LYS B N   3 
ATOM   7990  C  CA  . LYS B 1 141 ? -1.606  124.042 -13.558 0.25 16.50 ? 141 LYS B CA  3 
ATOM   7991  C  C   . LYS B 1 141 ? -1.504  122.820 -14.471 0.25 14.60 ? 141 LYS B C   3 
ATOM   7992  O  O   . LYS B 1 141 ? -2.436  122.519 -15.220 0.25 14.82 ? 141 LYS B O   3 
ATOM   7993  C  CB  . LYS B 1 141 ? -0.733  125.176 -14.103 0.25 18.71 ? 141 LYS B CB  3 
ATOM   7994  C  CG  . LYS B 1 141 ? -1.122  125.640 -15.492 0.25 23.83 ? 141 LYS B CG  3 
ATOM   7995  C  CD  . LYS B 1 141 ? -2.552  126.153 -15.517 0.25 27.81 ? 141 LYS B CD  3 
ATOM   7996  C  CE  . LYS B 1 141 ? -2.911  126.702 -16.889 0.25 30.64 ? 141 LYS B CE  3 
ATOM   7997  N  NZ  . LYS B 1 141 ? -4.291  127.255 -16.930 0.25 34.25 ? 141 LYS B NZ  3 
ATOM   7998  N  N   . ILE B 1 142 ? -0.374  122.119 -14.404 0.25 14.25 ? 142 ILE B N   3 
ATOM   7999  C  CA  . ILE B 1 142 ? -0.167  120.935 -15.235 0.25 13.61 ? 142 ILE B CA  3 
ATOM   8000  C  C   . ILE B 1 142 ? -1.262  119.902 -14.975 0.25 13.03 ? 142 ILE B C   3 
ATOM   8001  O  O   . ILE B 1 142 ? -1.908  119.425 -15.905 0.25 11.52 ? 142 ILE B O   3 
ATOM   8002  C  CB  . ILE B 1 142 ? 1.224   120.293 -14.980 0.25 13.52 ? 142 ILE B CB  3 
ATOM   8003  C  CG1 . ILE B 1 142 ? 2.334   121.240 -15.451 0.25 14.47 ? 142 ILE B CG1 3 
ATOM   8004  C  CG2 . ILE B 1 142 ? 1.329   118.952 -15.714 0.25 13.32 ? 142 ILE B CG2 3 
ATOM   8005  C  CD1 . ILE B 1 142 ? 2.356   121.494 -16.961 0.25 13.71 ? 142 ILE B CD1 3 
ATOM   8006  N  N   . ILE B 1 143 ? -1.475  119.560 -13.710 0.25 11.85 ? 143 ILE B N   3 
ATOM   8007  C  CA  . ILE B 1 143 ? -2.513  118.592 -13.373 0.25 12.74 ? 143 ILE B CA  3 
ATOM   8008  C  C   . ILE B 1 143 ? -3.872  119.062 -13.900 0.25 13.16 ? 143 ILE B C   3 
ATOM   8009  O  O   . ILE B 1 143 ? -4.601  118.293 -14.540 0.25 11.36 ? 143 ILE B O   3 
ATOM   8010  C  CB  . ILE B 1 143 ? -2.571  118.365 -11.838 0.25 11.61 ? 143 ILE B CB  3 
ATOM   8011  C  CG1 . ILE B 1 143 ? -1.364  117.513 -11.415 0.25 10.74 ? 143 ILE B CG1 3 
ATOM   8012  C  CG2 . ILE B 1 143 ? -3.882  117.682 -11.451 0.25 10.57 ? 143 ILE B CG2 3 
ATOM   8013  C  CD1 . ILE B 1 143 ? -1.148  117.419 -9.926  0.25 12.85 ? 143 ILE B CD1 3 
ATOM   8014  N  N   . CYS B 1 144 ? -4.202  120.327 -13.642 0.25 13.89 ? 144 CYS B N   3 
ATOM   8015  C  CA  . CYS B 1 144 ? -5.467  120.899 -14.101 0.25 13.03 ? 144 CYS B CA  3 
ATOM   8016  C  C   . CYS B 1 144 ? -5.570  120.849 -15.629 0.25 12.14 ? 144 CYS B C   3 
ATOM   8017  O  O   . CYS B 1 144 ? -6.650  120.634 -16.185 0.25 9.33  ? 144 CYS B O   3 
ATOM   8018  C  CB  . CYS B 1 144 ? -5.600  122.350 -13.620 0.25 15.39 ? 144 CYS B CB  3 
ATOM   8019  S  SG  . CYS B 1 144 ? -5.798  122.550 -11.828 0.25 10.74 ? 144 CYS B SG  3 
HETATM 8020  N  N   . MSE B 1 145 ? -4.444  121.056 -16.306 0.25 12.65 ? 145 MSE B N   3 
HETATM 8021  C  CA  . MSE B 1 145 ? -4.422  121.012 -17.767 0.25 13.75 ? 145 MSE B CA  3 
HETATM 8022  C  C   . MSE B 1 145 ? -4.808  119.613 -18.237 0.25 13.90 ? 145 MSE B C   3 
HETATM 8023  O  O   . MSE B 1 145 ? -5.696  119.450 -19.071 0.25 12.24 ? 145 MSE B O   3 
HETATM 8024  C  CB  . MSE B 1 145 ? -3.026  121.353 -18.304 0.25 15.26 ? 145 MSE B CB  3 
HETATM 8025  C  CG  . MSE B 1 145 ? -2.637  122.828 -18.239 0.25 16.76 ? 145 MSE B CG  3 
HETATM 8026  SE SE  . MSE B 1 145 ? -0.806  123.122 -18.826 0.25 18.97 ? 145 MSE B SE  3 
HETATM 8027  C  CE  . MSE B 1 145 ? -1.075  123.099 -20.740 0.25 16.87 ? 145 MSE B CE  3 
ATOM   8028  N  N   . GLY B 1 146 ? -4.135  118.603 -17.694 0.25 13.31 ? 146 GLY B N   3 
ATOM   8029  C  CA  . GLY B 1 146 ? -4.428  117.236 -18.083 0.25 9.75  ? 146 GLY B CA  3 
ATOM   8030  C  C   . GLY B 1 146 ? -5.857  116.845 -17.761 0.25 10.03 ? 146 GLY B C   3 
ATOM   8031  O  O   . GLY B 1 146 ? -6.536  116.204 -18.572 0.25 9.12  ? 146 GLY B O   3 
ATOM   8032  N  N   . ALA B 1 147 ? -6.313  117.228 -16.572 0.25 8.86  ? 147 ALA B N   3 
ATOM   8033  C  CA  . ALA B 1 147 ? -7.672  116.923 -16.125 0.25 10.11 ? 147 ALA B CA  3 
ATOM   8034  C  C   . ALA B 1 147 ? -8.694  117.407 -17.150 0.25 11.21 ? 147 ALA B C   3 
ATOM   8035  O  O   . ALA B 1 147 ? -9.615  116.679 -17.524 0.25 11.85 ? 147 ALA B O   3 
ATOM   8036  C  CB  . ALA B 1 147 ? -7.939  117.590 -14.775 0.25 8.72  ? 147 ALA B CB  3 
ATOM   8037  N  N   . LYS B 1 148 ? -8.522  118.647 -17.592 0.25 12.04 ? 148 LYS B N   3 
ATOM   8038  C  CA  . LYS B 1 148 ? -9.415  119.240 -18.579 0.25 14.03 ? 148 LYS B CA  3 
ATOM   8039  C  C   . LYS B 1 148 ? -9.175  118.603 -19.940 0.25 14.00 ? 148 LYS B C   3 
ATOM   8040  O  O   . LYS B 1 148 ? -10.114 118.305 -20.678 0.25 12.43 ? 148 LYS B O   3 
ATOM   8041  C  CB  . LYS B 1 148 ? -9.171  120.748 -18.671 0.25 17.50 ? 148 LYS B CB  3 
ATOM   8042  C  CG  . LYS B 1 148 ? -9.999  121.453 -19.744 0.25 19.86 ? 148 LYS B CG  3 
ATOM   8043  C  CD  . LYS B 1 148 ? -9.686  122.941 -19.793 0.25 26.92 ? 148 LYS B CD  3 
ATOM   8044  C  CE  . LYS B 1 148 ? -10.509 123.642 -20.870 0.25 28.21 ? 148 LYS B CE  3 
ATOM   8045  N  NZ  . LYS B 1 148 ? -10.145 125.081 -21.006 0.25 31.38 ? 148 LYS B NZ  3 
ATOM   8046  N  N   . GLU B 1 149 ? -7.903  118.394 -20.261 0.25 15.88 ? 149 GLU B N   3 
ATOM   8047  C  CA  . GLU B 1 149 ? -7.522  117.803 -21.535 0.25 17.60 ? 149 GLU B CA  3 
ATOM   8048  C  C   . GLU B 1 149 ? -8.181  116.454 -21.789 0.25 17.53 ? 149 GLU B C   3 
ATOM   8049  O  O   . GLU B 1 149 ? -8.557  116.148 -22.922 0.25 17.11 ? 149 GLU B O   3 
ATOM   8050  C  CB  . GLU B 1 149 ? -6.004  117.622 -21.608 0.25 18.40 ? 149 GLU B CB  3 
ATOM   8051  C  CG  . GLU B 1 149 ? -5.525  117.092 -22.958 0.25 21.29 ? 149 GLU B CG  3 
ATOM   8052  C  CD  . GLU B 1 149 ? -4.042  116.783 -22.979 0.25 21.56 ? 149 GLU B CD  3 
ATOM   8053  O  OE1 . GLU B 1 149 ? -3.623  115.816 -22.307 0.25 23.56 ? 149 GLU B OE1 3 
ATOM   8054  O  OE2 . GLU B 1 149 ? -3.293  117.513 -23.664 0.25 22.20 ? 149 GLU B OE2 3 
ATOM   8055  N  N   . ASN B 1 150 ? -8.331  115.651 -20.737 0.25 15.82 ? 150 ASN B N   3 
ATOM   8056  C  CA  . ASN B 1 150 ? -8.914  114.324 -20.897 0.25 15.23 ? 150 ASN B CA  3 
ATOM   8057  C  C   . ASN B 1 150 ? -10.336 114.098 -20.392 0.25 15.22 ? 150 ASN B C   3 
ATOM   8058  O  O   . ASN B 1 150 ? -10.711 112.978 -20.048 0.25 16.98 ? 150 ASN B O   3 
ATOM   8059  C  CB  . ASN B 1 150 ? -7.970  113.281 -20.300 0.25 16.69 ? 150 ASN B CB  3 
ATOM   8060  C  CG  . ASN B 1 150 ? -6.638  113.242 -21.020 0.25 17.47 ? 150 ASN B CG  3 
ATOM   8061  O  OD1 . ASN B 1 150 ? -5.666  113.885 -20.607 0.25 18.38 ? 150 ASN B OD1 3 
ATOM   8062  N  ND2 . ASN B 1 150 ? -6.592  112.503 -22.124 0.25 15.69 ? 150 ASN B ND2 3 
ATOM   8063  N  N   . GLY B 1 151 ? -11.131 115.159 -20.358 0.25 15.08 ? 151 GLY B N   3 
ATOM   8064  C  CA  . GLY B 1 151 ? -12.512 115.027 -19.937 0.25 13.90 ? 151 GLY B CA  3 
ATOM   8065  C  C   . GLY B 1 151 ? -12.823 114.621 -18.505 0.25 15.41 ? 151 GLY B C   3 
ATOM   8066  O  O   . GLY B 1 151 ? -13.926 114.140 -18.236 0.25 12.86 ? 151 GLY B O   3 
ATOM   8067  N  N   . LEU B 1 152 ? -11.880 114.783 -17.580 0.25 15.64 ? 152 LEU B N   3 
ATOM   8068  C  CA  . LEU B 1 152 ? -12.180 114.447 -16.192 0.25 17.05 ? 152 LEU B CA  3 
ATOM   8069  C  C   . LEU B 1 152 ? -13.430 115.261 -15.846 0.25 17.19 ? 152 LEU B C   3 
ATOM   8070  O  O   . LEU B 1 152 ? -13.594 116.386 -16.327 0.25 17.79 ? 152 LEU B O   3 
ATOM   8071  C  CB  . LEU B 1 152 ? -11.014 114.845 -15.280 0.25 15.55 ? 152 LEU B CB  3 
ATOM   8072  C  CG  . LEU B 1 152 ? -10.023 113.746 -14.878 0.25 16.89 ? 152 LEU B CG  3 
ATOM   8073  C  CD1 . LEU B 1 152 ? -9.569  112.954 -16.093 0.25 13.60 ? 152 LEU B CD1 3 
ATOM   8074  C  CD2 . LEU B 1 152 ? -8.836  114.381 -14.161 0.25 16.47 ? 152 LEU B CD2 3 
ATOM   8075  N  N   . PRO B 1 153 ? -14.341 114.701 -15.035 0.25 18.47 ? 153 PRO B N   3 
ATOM   8076  C  CA  . PRO B 1 153 ? -15.548 115.461 -14.690 0.25 18.36 ? 153 PRO B CA  3 
ATOM   8077  C  C   . PRO B 1 153 ? -15.210 116.892 -14.257 0.25 19.04 ? 153 PRO B C   3 
ATOM   8078  O  O   . PRO B 1 153 ? -14.175 117.134 -13.636 0.25 17.48 ? 153 PRO B O   3 
ATOM   8079  C  CB  . PRO B 1 153 ? -16.162 114.634 -13.565 0.25 18.35 ? 153 PRO B CB  3 
ATOM   8080  C  CG  . PRO B 1 153 ? -15.786 113.233 -13.955 0.25 18.85 ? 153 PRO B CG  3 
ATOM   8081  C  CD  . PRO B 1 153 ? -14.336 113.387 -14.368 0.25 17.18 ? 153 PRO B CD  3 
ATOM   8082  N  N   . LEU B 1 154 ? -16.089 117.831 -14.594 0.25 19.64 ? 154 LEU B N   3 
ATOM   8083  C  CA  . LEU B 1 154 ? -15.888 119.234 -14.254 0.25 20.90 ? 154 LEU B CA  3 
ATOM   8084  C  C   . LEU B 1 154 ? -15.810 119.390 -12.742 0.25 19.92 ? 154 LEU B C   3 
ATOM   8085  O  O   . LEU B 1 154 ? -15.020 120.185 -12.229 0.25 18.85 ? 154 LEU B O   3 
ATOM   8086  C  CB  . LEU B 1 154 ? -17.046 120.078 -14.802 0.25 25.65 ? 154 LEU B CB  3 
ATOM   8087  C  CG  . LEU B 1 154 ? -16.770 121.552 -15.122 0.25 26.85 ? 154 LEU B CG  3 
ATOM   8088  C  CD1 . LEU B 1 154 ? -16.171 122.260 -13.919 0.25 28.11 ? 154 LEU B CD1 3 
ATOM   8089  C  CD2 . LEU B 1 154 ? -15.821 121.631 -16.311 0.25 31.74 ? 154 LEU B CD2 3 
ATOM   8090  N  N   . GLU B 1 155 ? -16.639 118.624 -12.037 0.25 19.98 ? 155 GLU B N   3 
ATOM   8091  C  CA  . GLU B 1 155 ? -16.671 118.658 -10.579 0.25 22.03 ? 155 GLU B CA  3 
ATOM   8092  C  C   . GLU B 1 155 ? -15.300 118.336 -9.987  0.25 18.77 ? 155 GLU B C   3 
ATOM   8093  O  O   . GLU B 1 155 ? -14.944 118.845 -8.922  0.25 18.09 ? 155 GLU B O   3 
ATOM   8094  C  CB  . GLU B 1 155 ? -17.696 117.651 -10.037 0.25 26.71 ? 155 GLU B CB  3 
ATOM   8095  C  CG  . GLU B 1 155 ? -19.153 117.945 -10.391 0.25 34.96 ? 155 GLU B CG  3 
ATOM   8096  C  CD  . GLU B 1 155 ? -19.444 117.825 -11.877 0.25 38.23 ? 155 GLU B CD  3 
ATOM   8097  O  OE1 . GLU B 1 155 ? -19.040 116.810 -12.489 0.25 41.65 ? 155 GLU B OE1 3 
ATOM   8098  O  OE2 . GLU B 1 155 ? -20.085 118.742 -12.431 0.25 41.90 ? 155 GLU B OE2 3 
ATOM   8099  N  N   . TYR B 1 156 ? -14.535 117.487 -10.671 0.25 16.61 ? 156 TYR B N   3 
ATOM   8100  C  CA  . TYR B 1 156 ? -13.208 117.115 -10.183 0.25 15.15 ? 156 TYR B CA  3 
ATOM   8101  C  C   . TYR B 1 156 ? -12.197 118.185 -10.549 0.25 14.52 ? 156 TYR B C   3 
ATOM   8102  O  O   . TYR B 1 156 ? -11.261 118.447 -9.797  0.25 14.88 ? 156 TYR B O   3 
ATOM   8103  C  CB  . TYR B 1 156 ? -12.755 115.770 -10.760 0.25 13.71 ? 156 TYR B CB  3 
ATOM   8104  C  CG  . TYR B 1 156 ? -11.520 115.220 -10.073 0.25 14.64 ? 156 TYR B CG  3 
ATOM   8105  C  CD1 . TYR B 1 156 ? -11.579 114.770 -8.751  0.25 12.96 ? 156 TYR B CD1 3 
ATOM   8106  C  CD2 . TYR B 1 156 ? -10.290 115.168 -10.734 0.25 12.61 ? 156 TYR B CD2 3 
ATOM   8107  C  CE1 . TYR B 1 156 ? -10.446 114.281 -8.104  0.25 14.07 ? 156 TYR B CE1 3 
ATOM   8108  C  CE2 . TYR B 1 156 ? -9.147  114.680 -10.095 0.25 12.56 ? 156 TYR B CE2 3 
ATOM   8109  C  CZ  . TYR B 1 156 ? -9.232  114.238 -8.782  0.25 10.83 ? 156 TYR B CZ  3 
ATOM   8110  O  OH  . TYR B 1 156 ? -8.117  113.744 -8.147  0.25 13.21 ? 156 TYR B OH  3 
ATOM   8111  N  N   . GLN B 1 157 ? -12.382 118.797 -11.713 0.25 15.26 ? 157 GLN B N   3 
ATOM   8112  C  CA  . GLN B 1 157 ? -11.488 119.860 -12.138 0.25 15.28 ? 157 GLN B CA  3 
ATOM   8113  C  C   . GLN B 1 157 ? -11.642 121.037 -11.174 0.25 16.17 ? 157 GLN B C   3 
ATOM   8114  O  O   . GLN B 1 157 ? -10.668 121.698 -10.834 0.25 14.32 ? 157 GLN B O   3 
ATOM   8115  C  CB  . GLN B 1 157 ? -11.810 120.300 -13.569 0.25 12.95 ? 157 GLN B CB  3 
ATOM   8116  C  CG  . GLN B 1 157 ? -11.431 119.278 -14.642 0.25 13.53 ? 157 GLN B CG  3 
ATOM   8117  C  CD  . GLN B 1 157 ? -11.580 119.832 -16.054 0.25 13.83 ? 157 GLN B CD  3 
ATOM   8118  O  OE1 . GLN B 1 157 ? -10.956 120.836 -16.404 0.25 16.64 ? 157 GLN B OE1 3 
ATOM   8119  N  NE2 . GLN B 1 157 ? -12.407 119.180 -16.870 0.25 9.99  ? 157 GLN B NE2 3 
ATOM   8120  N  N   . GLU B 1 158 ? -12.868 121.286 -10.723 0.25 18.71 ? 158 GLU B N   3 
ATOM   8121  C  CA  . GLU B 1 158 ? -13.111 122.382 -9.792  0.25 19.79 ? 158 GLU B CA  3 
ATOM   8122  C  C   . GLU B 1 158 ? -12.396 122.145 -8.472  0.25 18.21 ? 158 GLU B C   3 
ATOM   8123  O  O   . GLU B 1 158 ? -11.823 123.067 -7.896  0.25 18.45 ? 158 GLU B O   3 
ATOM   8124  C  CB  . GLU B 1 158 ? -14.611 122.564 -9.551  0.25 24.12 ? 158 GLU B CB  3 
ATOM   8125  C  CG  . GLU B 1 158 ? -15.350 123.094 -10.762 0.25 31.87 ? 158 GLU B CG  3 
ATOM   8126  C  CD  . GLU B 1 158 ? -14.697 124.339 -11.338 0.25 34.72 ? 158 GLU B CD  3 
ATOM   8127  O  OE1 . GLU B 1 158 ? -14.563 125.341 -10.602 0.25 37.52 ? 158 GLU B OE1 3 
ATOM   8128  O  OE2 . GLU B 1 158 ? -14.315 124.316 -12.527 0.25 36.58 ? 158 GLU B OE2 3 
ATOM   8129  N  N   . LYS B 1 159 ? -12.424 120.905 -7.995  0.25 19.50 ? 159 LYS B N   3 
ATOM   8130  C  CA  . LYS B 1 159 ? -11.755 120.570 -6.746  0.25 19.63 ? 159 LYS B CA  3 
ATOM   8131  C  C   . LYS B 1 159 ? -10.239 120.656 -6.929  0.25 18.02 ? 159 LYS B C   3 
ATOM   8132  O  O   . LYS B 1 159 ? -9.516  121.045 -6.012  0.25 15.12 ? 159 LYS B O   3 
ATOM   8133  C  CB  . LYS B 1 159 ? -12.153 119.166 -6.283  0.25 23.77 ? 159 LYS B CB  3 
ATOM   8134  C  CG  . LYS B 1 159 ? -13.593 119.056 -5.810  0.25 28.38 ? 159 LYS B CG  3 
ATOM   8135  C  CD  . LYS B 1 159 ? -13.892 117.658 -5.296  0.25 33.16 ? 159 LYS B CD  3 
ATOM   8136  C  CE  . LYS B 1 159 ? -15.317 117.549 -4.783  0.25 35.50 ? 159 LYS B CE  3 
ATOM   8137  N  NZ  . LYS B 1 159 ? -15.622 116.176 -4.297  0.25 39.42 ? 159 LYS B NZ  3 
ATOM   8138  N  N   . LEU B 1 160 ? -9.756  120.291 -8.111  0.25 15.95 ? 160 LEU B N   3 
ATOM   8139  C  CA  . LEU B 1 160 ? -8.323  120.367 -8.380  0.25 16.18 ? 160 LEU B CA  3 
ATOM   8140  C  C   . LEU B 1 160 ? -7.924  121.840 -8.456  0.25 17.82 ? 160 LEU B C   3 
ATOM   8141  O  O   . LEU B 1 160 ? -6.914  122.254 -7.885  0.25 18.16 ? 160 LEU B O   3 
ATOM   8142  C  CB  . LEU B 1 160 ? -7.974  119.671 -9.703  0.25 15.43 ? 160 LEU B CB  3 
ATOM   8143  C  CG  . LEU B 1 160 ? -8.101  118.145 -9.799  0.25 15.68 ? 160 LEU B CG  3 
ATOM   8144  C  CD1 . LEU B 1 160 ? -7.859  117.704 -11.243 0.25 16.33 ? 160 LEU B CD1 3 
ATOM   8145  C  CD2 . LEU B 1 160 ? -7.096  117.479 -8.867  0.25 14.68 ? 160 LEU B CD2 3 
ATOM   8146  N  N   . LYS B 1 161 ? -8.733  122.628 -9.159  0.25 18.06 ? 161 LYS B N   3 
ATOM   8147  C  CA  . LYS B 1 161 ? -8.468  124.052 -9.317  0.25 22.37 ? 161 LYS B CA  3 
ATOM   8148  C  C   . LYS B 1 161 ? -8.657  124.785 -7.994  0.25 21.17 ? 161 LYS B C   3 
ATOM   8149  O  O   . LYS B 1 161 ? -8.250  125.933 -7.850  0.25 20.39 ? 161 LYS B O   3 
ATOM   8150  C  CB  . LYS B 1 161 ? -9.400  124.641 -10.384 0.25 25.50 ? 161 LYS B CB  3 
ATOM   8151  C  CG  . LYS B 1 161 ? -9.148  124.094 -11.789 0.25 31.40 ? 161 LYS B CG  3 
ATOM   8152  C  CD  . LYS B 1 161 ? -10.334 124.332 -12.721 0.25 35.01 ? 161 LYS B CD  3 
ATOM   8153  C  CE  . LYS B 1 161 ? -10.616 125.814 -12.935 0.25 37.67 ? 161 LYS B CE  3 
ATOM   8154  N  NZ  . LYS B 1 161 ? -11.847 126.026 -13.751 0.25 39.15 ? 161 LYS B NZ  3 
ATOM   8155  N  N   . ALA B 1 162 ? -9.269  124.108 -7.029  0.25 20.92 ? 162 ALA B N   3 
ATOM   8156  C  CA  . ALA B 1 162 ? -9.516  124.697 -5.720  0.25 21.05 ? 162 ALA B CA  3 
ATOM   8157  C  C   . ALA B 1 162 ? -8.373  124.448 -4.742  0.25 21.05 ? 162 ALA B C   3 
ATOM   8158  O  O   . ALA B 1 162 ? -8.391  124.953 -3.619  0.25 20.77 ? 162 ALA B O   3 
ATOM   8159  C  CB  . ALA B 1 162 ? -10.813 124.152 -5.146  0.25 21.14 ? 162 ALA B CB  3 
ATOM   8160  N  N   . ILE B 1 163 ? -7.382  123.667 -5.162  0.25 19.72 ? 163 ILE B N   3 
ATOM   8161  C  CA  . ILE B 1 163 ? -6.247  123.369 -4.296  0.25 18.38 ? 163 ILE B CA  3 
ATOM   8162  C  C   . ILE B 1 163 ? -5.307  124.563 -4.210  0.25 17.60 ? 163 ILE B C   3 
ATOM   8163  O  O   . ILE B 1 163 ? -4.783  125.031 -5.219  0.25 17.37 ? 163 ILE B O   3 
ATOM   8164  C  CB  . ILE B 1 163 ? -5.458  122.139 -4.803  0.25 17.86 ? 163 ILE B CB  3 
ATOM   8165  C  CG1 . ILE B 1 163 ? -6.365  120.906 -4.796  0.25 16.46 ? 163 ILE B CG1 3 
ATOM   8166  C  CG2 . ILE B 1 163 ? -4.234  121.898 -3.918  0.25 14.58 ? 163 ILE B CG2 3 
ATOM   8167  C  CD1 . ILE B 1 163 ? -5.774  119.714 -5.507  0.25 17.01 ? 163 ILE B CD1 3 
ATOM   8168  N  N   . GLU B 1 164 ? -5.099  125.055 -2.992  0.25 18.52 ? 164 GLU B N   3 
ATOM   8169  C  CA  . GLU B 1 164 ? -4.220  126.197 -2.770  0.25 17.44 ? 164 GLU B CA  3 
ATOM   8170  C  C   . GLU B 1 164 ? -2.768  125.763 -2.938  0.25 18.46 ? 164 GLU B C   3 
ATOM   8171  O  O   . GLU B 1 164 ? -2.341  124.759 -2.368  0.25 17.07 ? 164 GLU B O   3 
ATOM   8172  C  CB  . GLU B 1 164 ? -4.443  126.765 -1.366  0.25 18.67 ? 164 GLU B CB  3 
ATOM   8173  C  CG  . GLU B 1 164 ? -3.554  127.951 -1.011  0.25 20.09 ? 164 GLU B CG  3 
ATOM   8174  C  CD  . GLU B 1 164 ? -3.843  128.507 0.374   0.25 22.06 ? 164 GLU B CD  3 
ATOM   8175  O  OE1 . GLU B 1 164 ? -3.047  129.343 0.858   0.25 23.25 ? 164 GLU B OE1 3 
ATOM   8176  O  OE2 . GLU B 1 164 ? -4.867  128.114 0.977   0.25 22.07 ? 164 GLU B OE2 3 
ATOM   8177  N  N   . PRO B 1 165 ? -1.992  126.514 -3.733  0.25 18.77 ? 165 PRO B N   3 
ATOM   8178  C  CA  . PRO B 1 165 ? -0.579  126.201 -3.975  0.25 19.57 ? 165 PRO B CA  3 
ATOM   8179  C  C   . PRO B 1 165 ? 0.318   126.564 -2.792  0.25 20.66 ? 165 PRO B C   3 
ATOM   8180  O  O   . PRO B 1 165 ? -0.151  127.080 -1.776  0.25 18.37 ? 165 PRO B O   3 
ATOM   8181  C  CB  . PRO B 1 165 ? -0.259  127.034 -5.211  0.25 17.93 ? 165 PRO B CB  3 
ATOM   8182  C  CG  . PRO B 1 165 ? -1.079  128.265 -4.981  0.25 18.58 ? 165 PRO B CG  3 
ATOM   8183  C  CD  . PRO B 1 165 ? -2.408  127.693 -4.518  0.25 19.03 ? 165 PRO B CD  3 
ATOM   8184  N  N   . ASN B 1 166 ? 1.608   126.279 -2.928  0.25 21.24 ? 166 ASN B N   3 
ATOM   8185  C  CA  . ASN B 1 166 ? 2.569   126.609 -1.887  0.25 21.92 ? 166 ASN B CA  3 
ATOM   8186  C  C   . ASN B 1 166 ? 3.086   128.003 -2.236  0.25 22.91 ? 166 ASN B C   3 
ATOM   8187  O  O   . ASN B 1 166 ? 2.446   128.717 -3.006  0.25 22.91 ? 166 ASN B O   3 
ATOM   8188  C  CB  . ASN B 1 166 ? 3.710   125.587 -1.871  0.25 19.36 ? 166 ASN B CB  3 
ATOM   8189  C  CG  . ASN B 1 166 ? 4.692   125.789 -3.002  0.25 18.20 ? 166 ASN B CG  3 
ATOM   8190  O  OD1 . ASN B 1 166 ? 4.311   126.107 -4.126  0.25 14.27 ? 166 ASN B OD1 3 
ATOM   8191  N  ND2 . ASN B 1 166 ? 5.965   125.593 -2.710  0.25 16.24 ? 166 ASN B ND2 3 
ATOM   8192  N  N   . ASP B 1 167 ? 4.230   128.400 -1.691  0.25 25.99 ? 167 ASP B N   3 
ATOM   8193  C  CA  . ASP B 1 167 ? 4.750   129.730 -1.988  0.25 28.77 ? 167 ASP B CA  3 
ATOM   8194  C  C   . ASP B 1 167 ? 6.022   129.759 -2.821  0.25 28.71 ? 167 ASP B C   3 
ATOM   8195  O  O   . ASP B 1 167 ? 6.983   130.449 -2.473  0.25 29.08 ? 167 ASP B O   3 
ATOM   8196  C  CB  . ASP B 1 167 ? 4.970   130.521 -0.695  0.25 31.91 ? 167 ASP B CB  3 
ATOM   8197  C  CG  . ASP B 1 167 ? 3.670   130.856 0.009   0.25 34.71 ? 167 ASP B CG  3 
ATOM   8198  O  OD1 . ASP B 1 167 ? 3.133   129.987 0.726   0.25 37.61 ? 167 ASP B OD1 3 
ATOM   8199  O  OD2 . ASP B 1 167 ? 3.179   131.989 -0.166  0.25 35.32 ? 167 ASP B OD2 3 
ATOM   8200  N  N   . TYR B 1 168 ? 6.029   129.021 -3.926  0.25 26.58 ? 168 TYR B N   3 
ATOM   8201  C  CA  . TYR B 1 168 ? 7.196   129.002 -4.800  0.25 26.34 ? 168 TYR B CA  3 
ATOM   8202  C  C   . TYR B 1 168 ? 7.082   130.146 -5.798  0.25 27.33 ? 168 TYR B C   3 
ATOM   8203  O  O   . TYR B 1 168 ? 6.049   130.314 -6.449  0.25 27.01 ? 168 TYR B O   3 
ATOM   8204  C  CB  . TYR B 1 168 ? 7.297   127.665 -5.545  0.25 23.82 ? 168 TYR B CB  3 
ATOM   8205  C  CG  . TYR B 1 168 ? 8.548   127.531 -6.392  0.25 19.90 ? 168 TYR B CG  3 
ATOM   8206  C  CD1 . TYR B 1 168 ? 9.813   127.694 -5.830  0.25 20.60 ? 168 TYR B CD1 3 
ATOM   8207  C  CD2 . TYR B 1 168 ? 8.466   127.239 -7.753  0.25 19.91 ? 168 TYR B CD2 3 
ATOM   8208  C  CE1 . TYR B 1 168 ? 10.970  127.569 -6.605  0.25 18.74 ? 168 TYR B CE1 3 
ATOM   8209  C  CE2 . TYR B 1 168 ? 9.615   127.109 -8.537  0.25 17.95 ? 168 TYR B CE2 3 
ATOM   8210  C  CZ  . TYR B 1 168 ? 10.859  127.274 -7.955  0.25 18.68 ? 168 TYR B CZ  3 
ATOM   8211  O  OH  . TYR B 1 168 ? 11.994  127.129 -8.719  0.25 18.81 ? 168 TYR B OH  3 
ATOM   8212  N  N   . THR B 1 169 ? 8.142   130.940 -5.906  0.25 28.51 ? 169 THR B N   3 
ATOM   8213  C  CA  . THR B 1 169 ? 8.152   132.071 -6.823  0.25 30.27 ? 169 THR B CA  3 
ATOM   8214  C  C   . THR B 1 169 ? 9.127   131.817 -7.963  0.25 30.27 ? 169 THR B C   3 
ATOM   8215  O  O   . THR B 1 169 ? 9.064   132.471 -9.004  0.25 30.66 ? 169 THR B O   3 
ATOM   8216  C  CB  . THR B 1 169 ? 8.561   133.371 -6.099  0.25 32.16 ? 169 THR B CB  3 
ATOM   8217  O  OG1 . THR B 1 169 ? 9.926   133.274 -5.674  0.25 33.46 ? 169 THR B OG1 3 
ATOM   8218  C  CG2 . THR B 1 169 ? 7.677   133.598 -4.882  0.25 31.03 ? 169 THR B CG2 3 
ATOM   8219  N  N   . GLY B 1 170 ? 10.027  130.860 -7.759  0.25 29.56 ? 170 GLY B N   3 
ATOM   8220  C  CA  . GLY B 1 170 ? 11.003  130.533 -8.780  0.25 28.73 ? 170 GLY B CA  3 
ATOM   8221  C  C   . GLY B 1 170 ? 10.363  129.869 -9.981  0.25 29.16 ? 170 GLY B C   3 
ATOM   8222  O  O   . GLY B 1 170 ? 9.147   129.923 -10.159 0.25 28.26 ? 170 GLY B O   3 
ATOM   8223  N  N   . LYS B 1 171 ? 11.182  129.229 -10.806 0.25 30.00 ? 171 LYS B N   3 
ATOM   8224  C  CA  . LYS B 1 171 ? 10.680  128.559 -11.998 0.25 32.39 ? 171 LYS B CA  3 
ATOM   8225  C  C   . LYS B 1 171 ? 11.002  127.072 -11.975 0.25 30.12 ? 171 LYS B C   3 
ATOM   8226  O  O   . LYS B 1 171 ? 11.768  126.602 -11.134 0.25 28.61 ? 171 LYS B O   3 
ATOM   8227  C  CB  . LYS B 1 171 ? 11.294  129.191 -13.253 0.25 36.54 ? 171 LYS B CB  3 
ATOM   8228  C  CG  . LYS B 1 171 ? 11.028  130.678 -13.389 0.25 43.61 ? 171 LYS B CG  3 
ATOM   8229  C  CD  . LYS B 1 171 ? 11.669  131.249 -14.640 0.25 49.11 ? 171 LYS B CD  3 
ATOM   8230  C  CE  . LYS B 1 171 ? 11.382  132.739 -14.770 0.25 52.54 ? 171 LYS B CE  3 
ATOM   8231  N  NZ  . LYS B 1 171 ? 11.985  133.324 -15.999 0.25 56.87 ? 171 LYS B NZ  3 
ATOM   8232  N  N   . VAL B 1 172 ? 10.398  126.333 -12.897 0.25 29.43 ? 172 VAL B N   3 
ATOM   8233  C  CA  . VAL B 1 172 ? 10.645  124.904 -13.016 0.25 29.17 ? 172 VAL B CA  3 
ATOM   8234  C  C   . VAL B 1 172 ? 11.465  124.709 -14.290 0.25 28.99 ? 172 VAL B C   3 
ATOM   8235  O  O   . VAL B 1 172 ? 11.815  125.687 -14.952 0.25 27.80 ? 172 VAL B O   3 
ATOM   8236  C  CB  . VAL B 1 172 ? 9.322   124.108 -13.095 0.25 29.36 ? 172 VAL B CB  3 
ATOM   8237  C  CG1 . VAL B 1 172 ? 8.732   123.945 -11.703 0.25 29.70 ? 172 VAL B CG1 3 
ATOM   8238  C  CG2 . VAL B 1 172 ? 8.331   124.834 -13.985 0.25 30.02 ? 172 VAL B CG2 3 
ATOM   8239  N  N   . SER B 1 173 ? 11.774  123.464 -14.638 0.25 28.25 ? 173 SER B N   3 
ATOM   8240  C  CA  . SER B 1 173 ? 12.571  123.205 -15.835 0.25 28.74 ? 173 SER B CA  3 
ATOM   8241  C  C   . SER B 1 173 ? 12.010  123.925 -17.058 0.25 29.23 ? 173 SER B C   3 
ATOM   8242  O  O   . SER B 1 173 ? 10.852  124.354 -17.066 0.25 28.24 ? 173 SER B O   3 
ATOM   8243  C  CB  . SER B 1 173 ? 12.646  121.700 -16.119 0.25 28.00 ? 173 SER B CB  3 
ATOM   8244  O  OG  . SER B 1 173 ? 11.412  121.200 -16.600 0.25 27.55 ? 173 SER B OG  3 
ATOM   8245  N  N   . GLU B 1 174 ? 12.843  124.056 -18.087 0.25 30.46 ? 174 GLU B N   3 
ATOM   8246  C  CA  . GLU B 1 174 ? 12.447  124.715 -19.322 0.25 32.73 ? 174 GLU B CA  3 
ATOM   8247  C  C   . GLU B 1 174 ? 11.288  123.996 -20.009 0.25 32.69 ? 174 GLU B C   3 
ATOM   8248  O  O   . GLU B 1 174 ? 10.364  124.639 -20.506 0.25 31.71 ? 174 GLU B O   3 
ATOM   8249  C  CB  . GLU B 1 174 ? 13.639  124.798 -20.282 0.25 35.86 ? 174 GLU B CB  3 
ATOM   8250  C  CG  . GLU B 1 174 ? 14.693  125.826 -19.885 0.25 41.74 ? 174 GLU B CG  3 
ATOM   8251  C  CD  . GLU B 1 174 ? 15.856  125.888 -20.863 0.25 43.52 ? 174 GLU B CD  3 
ATOM   8252  O  OE1 . GLU B 1 174 ? 15.610  126.029 -22.079 0.25 46.30 ? 174 GLU B OE1 3 
ATOM   8253  O  OE2 . GLU B 1 174 ? 17.020  125.802 -20.416 0.25 46.16 ? 174 GLU B OE2 3 
ATOM   8254  N  N   . GLU B 1 175 ? 11.340  122.668 -20.041 0.25 33.24 ? 175 GLU B N   3 
ATOM   8255  C  CA  . GLU B 1 175 ? 10.285  121.884 -20.676 0.25 35.35 ? 175 GLU B CA  3 
ATOM   8256  C  C   . GLU B 1 175 ? 8.939   122.150 -20.019 0.25 33.06 ? 175 GLU B C   3 
ATOM   8257  O  O   . GLU B 1 175 ? 7.943   122.400 -20.697 0.25 31.43 ? 175 GLU B O   3 
ATOM   8258  C  CB  . GLU B 1 175 ? 10.594  120.390 -20.587 0.25 40.50 ? 175 GLU B CB  3 
ATOM   8259  C  CG  . GLU B 1 175 ? 11.924  119.994 -21.193 0.25 48.51 ? 175 GLU B CG  3 
ATOM   8260  C  CD  . GLU B 1 175 ? 12.106  118.492 -21.259 0.25 51.35 ? 175 GLU B CD  3 
ATOM   8261  O  OE1 . GLU B 1 175 ? 11.981  117.828 -20.207 0.25 53.27 ? 175 GLU B OE1 3 
ATOM   8262  O  OE2 . GLU B 1 175 ? 12.375  117.977 -22.365 0.25 53.64 ? 175 GLU B OE2 3 
ATOM   8263  N  N   . ILE B 1 176 ? 8.919   122.087 -18.694 0.25 31.38 ? 176 ILE B N   3 
ATOM   8264  C  CA  . ILE B 1 176 ? 7.696   122.321 -17.941 0.25 30.99 ? 176 ILE B CA  3 
ATOM   8265  C  C   . ILE B 1 176 ? 7.114   123.697 -18.253 0.25 30.64 ? 176 ILE B C   3 
ATOM   8266  O  O   . ILE B 1 176 ? 5.948   123.815 -18.623 0.25 29.60 ? 176 ILE B O   3 
ATOM   8267  C  CB  . ILE B 1 176 ? 7.955   122.220 -16.426 0.25 30.56 ? 176 ILE B CB  3 
ATOM   8268  C  CG1 . ILE B 1 176 ? 8.523   120.838 -16.090 0.25 32.03 ? 176 ILE B CG1 3 
ATOM   8269  C  CG2 . ILE B 1 176 ? 6.657   122.475 -15.656 0.25 30.43 ? 176 ILE B CG2 3 
ATOM   8270  C  CD1 . ILE B 1 176 ? 8.921   120.661 -14.627 0.25 30.63 ? 176 ILE B CD1 3 
ATOM   8271  N  N   . GLU B 1 177 ? 7.929   124.736 -18.103 0.25 31.15 ? 177 GLU B N   3 
ATOM   8272  C  CA  . GLU B 1 177 ? 7.477   126.096 -18.372 0.25 32.25 ? 177 GLU B CA  3 
ATOM   8273  C  C   . GLU B 1 177 ? 6.956   126.226 -19.800 0.25 32.03 ? 177 GLU B C   3 
ATOM   8274  O  O   . GLU B 1 177 ? 5.945   126.882 -20.037 0.25 30.89 ? 177 GLU B O   3 
ATOM   8275  C  CB  . GLU B 1 177 ? 8.617   127.091 -18.132 0.25 33.26 ? 177 GLU B CB  3 
ATOM   8276  C  CG  . GLU B 1 177 ? 9.078   127.155 -16.679 0.25 34.47 ? 177 GLU B CG  3 
ATOM   8277  C  CD  . GLU B 1 177 ? 8.023   127.735 -15.743 0.25 36.16 ? 177 GLU B CD  3 
ATOM   8278  O  OE1 . GLU B 1 177 ? 6.866   127.915 -16.179 0.25 35.45 ? 177 GLU B OE1 3 
ATOM   8279  O  OE2 . GLU B 1 177 ? 8.350   128.007 -14.566 0.25 35.38 ? 177 GLU B OE2 3 
ATOM   8280  N  N   . ASP B 1 178 ? 7.642   125.592 -20.746 0.25 33.04 ? 178 ASP B N   3 
ATOM   8281  C  CA  . ASP B 1 178 ? 7.228   125.640 -22.144 0.25 34.22 ? 178 ASP B CA  3 
ATOM   8282  C  C   . ASP B 1 178 ? 5.790   125.164 -22.301 0.25 33.98 ? 178 ASP B C   3 
ATOM   8283  O  O   . ASP B 1 178 ? 5.016   125.737 -23.068 0.25 32.62 ? 178 ASP B O   3 
ATOM   8284  C  CB  . ASP B 1 178 ? 8.146   124.771 -23.003 0.25 36.41 ? 178 ASP B CB  3 
ATOM   8285  C  CG  . ASP B 1 178 ? 7.626   124.597 -24.416 0.25 38.40 ? 178 ASP B CG  3 
ATOM   8286  O  OD1 . ASP B 1 178 ? 6.617   123.880 -24.598 0.25 39.93 ? 178 ASP B OD1 3 
ATOM   8287  O  OD2 . ASP B 1 178 ? 8.221   125.181 -25.345 0.25 39.89 ? 178 ASP B OD2 3 
ATOM   8288  N  N   . ILE B 1 179 ? 5.435   124.110 -21.575 0.25 33.42 ? 179 ILE B N   3 
ATOM   8289  C  CA  . ILE B 1 179 ? 4.081   123.573 -21.640 0.25 33.31 ? 179 ILE B CA  3 
ATOM   8290  C  C   . ILE B 1 179 ? 3.101   124.559 -21.013 0.25 33.45 ? 179 ILE B C   3 
ATOM   8291  O  O   . ILE B 1 179 ? 2.021   124.810 -21.551 0.25 34.65 ? 179 ILE B O   3 
ATOM   8292  C  CB  . ILE B 1 179 ? 3.978   122.225 -20.898 0.25 32.61 ? 179 ILE B CB  3 
ATOM   8293  C  CG1 . ILE B 1 179 ? 4.970   121.227 -21.501 0.25 31.57 ? 179 ILE B CG1 3 
ATOM   8294  C  CG2 . ILE B 1 179 ? 2.553   121.685 -20.996 0.25 30.84 ? 179 ILE B CG2 3 
ATOM   8295  C  CD1 . ILE B 1 179 ? 4.994   119.877 -20.807 0.25 30.03 ? 179 ILE B CD1 3 
ATOM   8296  N  N   . ILE B 1 180 ? 3.487   125.125 -19.876 0.25 32.84 ? 180 ILE B N   3 
ATOM   8297  C  CA  . ILE B 1 180 ? 2.641   126.080 -19.178 0.25 34.48 ? 180 ILE B CA  3 
ATOM   8298  C  C   . ILE B 1 180 ? 2.401   127.348 -19.996 0.25 38.15 ? 180 ILE B C   3 
ATOM   8299  O  O   . ILE B 1 180 ? 1.260   127.777 -20.159 0.25 38.36 ? 180 ILE B O   3 
ATOM   8300  C  CB  . ILE B 1 180 ? 3.259   126.467 -17.822 0.25 31.91 ? 180 ILE B CB  3 
ATOM   8301  C  CG1 . ILE B 1 180 ? 3.303   125.234 -16.913 0.25 28.37 ? 180 ILE B CG1 3 
ATOM   8302  C  CG2 . ILE B 1 180 ? 2.462   127.599 -17.184 0.25 30.89 ? 180 ILE B CG2 3 
ATOM   8303  C  CD1 . ILE B 1 180 ? 3.904   125.487 -15.545 0.25 24.63 ? 180 ILE B CD1 3 
ATOM   8304  N  N   . LYS B 1 181 ? 3.479   127.936 -20.509 0.25 42.05 ? 181 LYS B N   3 
ATOM   8305  C  CA  . LYS B 1 181 ? 3.394   129.160 -21.306 0.25 45.88 ? 181 LYS B CA  3 
ATOM   8306  C  C   . LYS B 1 181 ? 2.259   129.128 -22.319 0.25 47.41 ? 181 LYS B C   3 
ATOM   8307  O  O   . LYS B 1 181 ? 1.444   130.047 -22.379 0.25 47.90 ? 181 LYS B O   3 
ATOM   8308  C  CB  . LYS B 1 181 ? 4.717   129.407 -22.033 0.25 47.96 ? 181 LYS B CB  3 
ATOM   8309  C  CG  . LYS B 1 181 ? 5.892   129.642 -21.099 0.25 52.08 ? 181 LYS B CG  3 
ATOM   8310  C  CD  . LYS B 1 181 ? 7.209   129.687 -21.852 0.25 54.18 ? 181 LYS B CD  3 
ATOM   8311  C  CE  . LYS B 1 181 ? 8.380   129.816 -20.891 0.25 56.21 ? 181 LYS B CE  3 
ATOM   8312  N  NZ  . LYS B 1 181 ? 9.692   129.717 -21.589 0.25 58.00 ? 181 LYS B NZ  3 
ATOM   8313  N  N   . LYS B 1 182 ? 2.209   128.066 -23.115 0.25 49.62 ? 182 LYS B N   3 
ATOM   8314  C  CA  . LYS B 1 182 ? 1.172   127.920 -24.129 0.25 50.96 ? 182 LYS B CA  3 
ATOM   8315  C  C   . LYS B 1 182 ? -0.199  127.788 -23.478 0.25 49.84 ? 182 LYS B C   3 
ATOM   8316  O  O   . LYS B 1 182 ? -1.055  128.662 -23.625 0.25 50.90 ? 182 LYS B O   3 
ATOM   8317  C  CB  . LYS B 1 182 ? 1.460   126.692 -24.989 0.25 53.91 ? 182 LYS B CB  3 
ATOM   8318  C  CG  . LYS B 1 182 ? 2.856   126.689 -25.580 0.25 56.81 ? 182 LYS B CG  3 
ATOM   8319  C  CD  . LYS B 1 182 ? 3.148   125.397 -26.312 0.25 58.58 ? 182 LYS B CD  3 
ATOM   8320  C  CE  . LYS B 1 182 ? 4.583   125.370 -26.807 0.25 60.12 ? 182 LYS B CE  3 
ATOM   8321  N  NZ  . LYS B 1 182 ? 4.899   124.104 -27.521 0.25 62.28 ? 182 LYS B NZ  3 
ATOM   8322  N  N   . GLY B 1 183 ? -0.403  126.691 -22.758 0.25 46.78 ? 183 GLY B N   3 
ATOM   8323  C  CA  . GLY B 1 183 ? -1.672  126.473 -22.093 0.25 45.37 ? 183 GLY B CA  3 
ATOM   8324  C  C   . GLY B 1 183 ? -1.770  127.253 -20.798 0.25 45.39 ? 183 GLY B C   3 
ATOM   8325  O  O   . GLY B 1 183 ? -1.970  126.623 -19.739 0.25 43.02 ? 183 GLY B O   3 
HETATM 8326  O  O   . HOH C 2 .   ? -2.435  92.406  17.010  0.25 15.94 ? 189 HOH A O   3 
HETATM 8327  O  O   . HOH C 2 .   ? -5.695  96.548  14.420  0.25 14.89 ? 190 HOH A O   3 
HETATM 8328  O  O   . HOH C 2 .   ? 5.327   97.897  20.163  0.25 17.01 ? 191 HOH A O   3 
HETATM 8329  O  O   . HOH C 2 .   ? 14.972  80.212  0.916   0.25 18.23 ? 192 HOH A O   3 
HETATM 8330  O  O   . HOH C 2 .   ? -5.171  81.670  6.199   0.25 16.44 ? 193 HOH A O   3 
HETATM 8331  O  O   . HOH C 2 .   ? 2.213   101.132 5.903   0.25 15.93 ? 194 HOH A O   3 
HETATM 8332  O  O   . HOH C 2 .   ? -2.816  97.543  20.423  0.25 12.76 ? 195 HOH A O   3 
HETATM 8333  O  O   . HOH C 2 .   ? 8.016   97.398  20.033  0.25 22.47 ? 196 HOH A O   3 
HETATM 8334  O  O   . HOH C 2 .   ? 8.537   90.213  9.003   0.25 14.77 ? 197 HOH A O   3 
HETATM 8335  O  O   . HOH C 2 .   ? 15.028  89.753  21.068  0.25 17.13 ? 198 HOH A O   3 
HETATM 8336  O  O   . HOH C 2 .   ? -5.238  77.489  -1.491  0.25 24.68 ? 199 HOH A O   3 
HETATM 8337  O  O   . HOH C 2 .   ? -8.589  99.630  -1.570  0.25 17.05 ? 200 HOH A O   3 
HETATM 8338  O  O   . HOH C 2 .   ? 14.754  79.399  12.738  0.25 16.95 ? 201 HOH A O   3 
HETATM 8339  O  O   . HOH C 2 .   ? 1.570   92.953  -7.328  0.25 17.82 ? 202 HOH A O   3 
HETATM 8340  O  O   . HOH C 2 .   ? -5.055  91.960  29.960  0.25 19.60 ? 203 HOH A O   3 
HETATM 8341  O  O   . HOH C 2 .   ? 12.741  78.299  -4.609  0.25 28.69 ? 204 HOH A O   3 
HETATM 8342  O  O   . HOH C 2 .   ? 11.689  96.494  9.987   0.25 15.25 ? 205 HOH A O   3 
HETATM 8343  O  O   . HOH C 2 .   ? 12.172  102.114 -0.245  0.25 20.39 ? 206 HOH A O   3 
HETATM 8344  O  O   . HOH C 2 .   ? -11.025 90.097  -4.016  0.25 18.45 ? 207 HOH A O   3 
HETATM 8345  O  O   . HOH C 2 .   ? 14.356  94.785  -2.042  0.25 15.34 ? 208 HOH A O   3 
HETATM 8346  O  O   . HOH C 2 .   ? 6.479   89.156  24.176  0.25 17.79 ? 209 HOH A O   3 
HETATM 8347  O  O   . HOH C 2 .   ? -3.242  85.302  7.958   0.25 32.73 ? 210 HOH A O   3 
HETATM 8348  O  O   . HOH C 2 .   ? 7.852   76.190  -4.041  0.25 23.56 ? 211 HOH A O   3 
HETATM 8349  O  O   . HOH C 2 .   ? 7.197   86.942  -10.131 0.25 26.14 ? 212 HOH A O   3 
HETATM 8350  O  O   . HOH C 2 .   ? 4.460   98.171  17.480  0.25 21.22 ? 213 HOH A O   3 
HETATM 8351  O  O   . HOH C 2 .   ? -1.385  106.355 7.792   0.25 29.50 ? 214 HOH A O   3 
HETATM 8352  O  O   . HOH C 2 .   ? 4.898   74.723  1.412   0.25 23.40 ? 215 HOH A O   3 
HETATM 8353  O  O   . HOH C 2 .   ? 1.510   91.783  27.217  0.25 21.87 ? 216 HOH A O   3 
HETATM 8354  O  O   . HOH C 2 .   ? 10.578  87.313  -10.090 0.25 23.51 ? 217 HOH A O   3 
HETATM 8355  O  O   . HOH C 2 .   ? -7.081  99.241  -3.634  0.25 12.31 ? 218 HOH A O   3 
HETATM 8356  O  O   . HOH C 2 .   ? 7.711   74.025  -0.711  0.25 24.43 ? 219 HOH A O   3 
HETATM 8357  O  O   . HOH C 2 .   ? 18.278  82.284  -4.321  0.25 20.76 ? 220 HOH A O   3 
HETATM 8358  O  O   . HOH C 2 .   ? 20.582  83.707  10.759  0.25 22.29 ? 221 HOH A O   3 
HETATM 8359  O  O   . HOH C 2 .   ? 8.983   97.502  -6.925  0.25 18.30 ? 222 HOH A O   3 
HETATM 8360  O  O   . HOH C 2 .   ? -8.039  92.266  11.393  0.25 28.81 ? 223 HOH A O   3 
HETATM 8361  O  O   . HOH C 2 .   ? 19.188  89.294  0.879   0.25 29.46 ? 224 HOH A O   3 
HETATM 8362  O  O   . HOH C 2 .   ? -6.876  82.810  7.936   0.25 32.87 ? 225 HOH A O   3 
HETATM 8363  O  O   . HOH C 2 .   ? 11.278  83.788  15.842  0.25 18.99 ? 226 HOH A O   3 
HETATM 8364  O  O   . HOH C 2 .   ? 3.618   87.170  22.384  0.25 23.07 ? 227 HOH A O   3 
HETATM 8365  O  O   . HOH C 2 .   ? 16.827  83.123  1.154   0.25 26.05 ? 228 HOH A O   3 
HETATM 8366  O  O   . HOH C 2 .   ? 10.703  82.770  18.201  0.25 26.26 ? 229 HOH A O   3 
HETATM 8367  O  O   . HOH C 2 .   ? 10.933  87.733  23.482  0.25 36.02 ? 230 HOH A O   3 
HETATM 8368  O  O   . HOH C 2 .   ? 18.500  88.443  -9.308  0.25 27.97 ? 231 HOH A O   3 
HETATM 8369  O  O   . HOH C 2 .   ? -5.978  106.038 10.531  0.25 30.15 ? 232 HOH A O   3 
HETATM 8370  O  O   . HOH C 2 .   ? 13.191  98.116  -1.939  0.25 25.88 ? 233 HOH A O   3 
HETATM 8371  O  O   . HOH C 2 .   ? -9.060  101.541 17.864  0.25 30.65 ? 234 HOH A O   3 
HETATM 8372  O  O   . HOH C 2 .   ? 10.700  96.738  -4.153  0.25 27.58 ? 235 HOH A O   3 
HETATM 8373  O  O   . HOH C 2 .   ? 0.024   73.622  7.456   0.25 34.45 ? 236 HOH A O   3 
HETATM 8374  O  O   . HOH C 2 .   ? -8.442  95.468  11.375  0.25 43.41 ? 237 HOH A O   3 
HETATM 8375  O  O   . HOH C 2 .   ? 7.917   101.004 13.348  0.25 34.66 ? 238 HOH A O   3 
HETATM 8376  O  O   . HOH C 2 .   ? 7.917   94.758  -12.467 0.25 26.65 ? 239 HOH A O   3 
HETATM 8377  O  O   . HOH C 2 .   ? 6.334   88.397  -11.911 0.25 38.04 ? 240 HOH A O   3 
HETATM 8378  O  O   . HOH C 2 .   ? 4.137   72.969  8.228   0.25 33.04 ? 241 HOH A O   3 
HETATM 8379  O  O   . HOH C 2 .   ? 11.856  95.161  17.287  0.25 35.34 ? 242 HOH A O   3 
HETATM 8380  O  O   . HOH C 2 .   ? -5.945  103.531 16.907  0.25 27.96 ? 243 HOH A O   3 
HETATM 8381  O  O   . HOH C 2 .   ? 21.199  86.512  11.551  0.25 30.61 ? 244 HOH A O   3 
HETATM 8382  O  O   . HOH C 2 .   ? 10.262  98.056  13.207  0.25 26.36 ? 245 HOH A O   3 
HETATM 8383  O  O   . HOH C 2 .   ? -6.546  97.314  11.899  0.25 22.79 ? 246 HOH A O   3 
HETATM 8384  O  O   . HOH C 2 .   ? 4.370   86.400  -9.365  0.25 36.04 ? 247 HOH A O   3 
HETATM 8385  O  O   . HOH C 2 .   ? -4.972  97.860  18.660  0.25 29.31 ? 248 HOH A O   3 
HETATM 8386  O  O   . HOH C 2 .   ? -9.750  83.567  -5.584  0.25 31.79 ? 249 HOH A O   3 
HETATM 8387  O  O   . HOH C 2 .   ? 11.580  94.600  12.250  0.25 35.51 ? 250 HOH A O   3 
HETATM 8388  O  O   . HOH C 2 .   ? -11.765 79.305  15.223  0.25 38.02 ? 251 HOH A O   3 
HETATM 8389  O  O   . HOH C 2 .   ? 7.931   103.416 13.025  0.25 35.73 ? 252 HOH A O   3 
HETATM 8390  O  O   . HOH C 2 .   ? -2.929  99.264  22.028  0.25 28.03 ? 253 HOH A O   3 
HETATM 8391  O  O   . HOH C 2 .   ? -7.115  90.466  -7.764  0.25 25.83 ? 254 HOH A O   3 
HETATM 8392  O  O   . HOH C 2 .   ? 11.549  98.186  -10.429 0.25 32.71 ? 255 HOH A O   3 
HETATM 8393  O  O   . HOH C 2 .   ? -2.058  87.099  25.703  0.25 38.21 ? 256 HOH A O   3 
HETATM 8394  O  O   . HOH C 2 .   ? -4.165  84.958  26.549  0.25 36.11 ? 257 HOH A O   3 
HETATM 8395  O  O   . HOH C 2 .   ? 22.471  90.347  -6.311  0.25 37.94 ? 258 HOH A O   3 
HETATM 8396  O  O   . HOH C 2 .   ? 0.615   89.616  -8.739  0.25 39.80 ? 259 HOH A O   3 
HETATM 8397  O  O   . HOH C 2 .   ? 16.513  80.414  5.552   0.25 32.99 ? 260 HOH A O   3 
HETATM 8398  O  O   . HOH C 2 .   ? -4.085  83.741  5.275   0.25 30.05 ? 261 HOH A O   3 
HETATM 8399  O  O   . HOH D 2 .   ? -5.157  97.490  -4.109  0.25 13.40 ? 189 HOH B O   3 
HETATM 8400  O  O   . HOH D 2 .   ? 4.656   120.570 -6.346  0.25 13.18 ? 190 HOH B O   3 
HETATM 8401  O  O   . HOH D 2 .   ? -6.350  113.280 -9.873  0.25 13.46 ? 191 HOH B O   3 
HETATM 8402  O  O   . HOH D 2 .   ? -9.584  112.899 -3.457  0.25 11.68 ? 192 HOH B O   3 
HETATM 8403  O  O   . HOH D 2 .   ? 5.034   122.933 -0.601  0.25 16.06 ? 193 HOH B O   3 
HETATM 8404  O  O   . HOH D 2 .   ? 7.369   98.886  -5.427  0.25 8.87  ? 194 HOH B O   3 
HETATM 8405  O  O   . HOH D 2 .   ? -9.990  102.092 0.028   0.25 20.95 ? 195 HOH B O   3 
HETATM 8406  O  O   . HOH D 2 .   ? 0.099   108.128 0.130   0.25 16.65 ? 196 HOH B O   3 
HETATM 8407  O  O   . HOH D 2 .   ? 8.080   117.158 -2.714  0.25 18.58 ? 197 HOH B O   3 
HETATM 8408  O  O   . HOH D 2 .   ? 9.122   99.137  -3.440  0.25 14.11 ? 198 HOH B O   3 
HETATM 8409  O  O   . HOH D 2 .   ? 7.316   111.973 -18.891 0.25 17.36 ? 199 HOH B O   3 
HETATM 8410  O  O   . HOH D 2 .   ? -3.048  122.521 -0.435  0.25 20.13 ? 200 HOH B O   3 
HETATM 8411  O  O   . HOH D 2 .   ? 0.483   96.710  -10.264 0.25 18.87 ? 201 HOH B O   3 
HETATM 8412  O  O   . HOH D 2 .   ? 5.260   113.277 -14.851 0.25 34.23 ? 202 HOH B O   3 
HETATM 8413  O  O   . HOH D 2 .   ? 7.160   106.816 0.197   0.25 17.02 ? 203 HOH B O   3 
HETATM 8414  O  O   . HOH D 2 .   ? 13.385  100.361 -12.391 0.25 17.70 ? 204 HOH B O   3 
HETATM 8415  O  O   . HOH D 2 .   ? -9.556  121.024 -3.581  0.25 26.29 ? 205 HOH B O   3 
HETATM 8416  O  O   . HOH D 2 .   ? -8.573  99.424  -5.937  0.25 17.38 ? 206 HOH B O   3 
HETATM 8417  O  O   . HOH D 2 .   ? -5.021  101.240 4.725   0.25 19.44 ? 207 HOH B O   3 
HETATM 8418  O  O   . HOH D 2 .   ? 7.345   104.929 -24.191 0.25 27.94 ? 208 HOH B O   3 
HETATM 8419  O  O   . HOH D 2 .   ? 8.754   114.630 -2.529  0.25 21.90 ? 209 HOH B O   3 
HETATM 8420  O  O   . HOH D 2 .   ? 10.666  96.697  -17.939 0.25 30.03 ? 210 HOH B O   3 
HETATM 8421  O  O   . HOH D 2 .   ? -12.146 102.000 -7.437  0.25 22.32 ? 211 HOH B O   3 
HETATM 8422  O  O   . HOH D 2 .   ? -0.782  117.732 -23.917 0.25 19.00 ? 212 HOH B O   3 
HETATM 8423  O  O   . HOH D 2 .   ? 6.076   95.604  -24.220 0.25 39.37 ? 213 HOH B O   3 
HETATM 8424  O  O   . HOH D 2 .   ? -6.705  95.725  -5.985  0.25 23.33 ? 214 HOH B O   3 
HETATM 8425  O  O   . HOH D 2 .   ? -2.427  96.156  -16.894 0.25 25.26 ? 215 HOH B O   3 
HETATM 8426  O  O   . HOH D 2 .   ? -12.415 119.172 -19.939 0.25 20.34 ? 216 HOH B O   3 
HETATM 8427  O  O   . HOH D 2 .   ? 4.436   110.862 -28.127 0.25 29.30 ? 217 HOH B O   3 
HETATM 8428  O  O   . HOH D 2 .   ? -18.626 116.300 -15.835 0.25 29.85 ? 218 HOH B O   3 
HETATM 8429  O  O   . HOH D 2 .   ? 10.984  100.987 -2.746  0.25 21.19 ? 219 HOH B O   3 
HETATM 8430  O  O   . HOH D 2 .   ? 11.814  99.715  -19.021 0.25 23.70 ? 220 HOH B O   3 
HETATM 8431  O  O   . HOH D 2 .   ? 13.204  103.060 -9.080  0.25 40.90 ? 221 HOH B O   3 
HETATM 8432  O  O   . HOH D 2 .   ? -15.963 102.444 -20.462 0.25 35.70 ? 222 HOH B O   3 
HETATM 8433  O  O   . HOH D 2 .   ? 8.301   111.795 5.616   0.25 36.68 ? 223 HOH B O   3 
HETATM 8434  O  O   . HOH D 2 .   ? -8.984  121.265 -15.015 0.25 16.16 ? 224 HOH B O   3 
HETATM 8435  O  O   . HOH D 2 .   ? -8.416  95.208  -16.475 0.25 30.31 ? 225 HOH B O   3 
HETATM 8436  O  O   . HOH D 2 .   ? 5.198   124.313 1.823   0.25 20.77 ? 226 HOH B O   3 
HETATM 8437  O  O   . HOH D 2 .   ? -2.021  120.106 -0.579  0.25 33.38 ? 227 HOH B O   3 
HETATM 8438  O  O   . HOH D 2 .   ? 6.193   115.647 -24.773 0.25 25.35 ? 228 HOH B O   3 
HETATM 8439  O  O   . HOH D 2 .   ? 4.852   115.050 -26.903 0.25 26.54 ? 229 HOH B O   3 
HETATM 8440  O  O   . HOH D 2 .   ? -10.325 94.389  -13.770 0.25 29.00 ? 230 HOH B O   3 
HETATM 8441  O  O   . HOH D 2 .   ? -1.311  127.256 -10.587 0.25 25.79 ? 231 HOH B O   3 
HETATM 8442  O  O   . HOH D 2 .   ? 3.592   108.977 5.792   0.25 26.28 ? 232 HOH B O   3 
HETATM 8443  O  O   . HOH D 2 .   ? -15.722 116.841 -18.182 0.25 34.34 ? 233 HOH B O   3 
HETATM 8444  O  O   . HOH D 2 .   ? 8.319   118.297 4.467   0.25 25.02 ? 234 HOH B O   3 
HETATM 8445  O  O   . HOH D 2 .   ? 8.117   121.581 -23.516 0.25 37.58 ? 235 HOH B O   3 
HETATM 8446  O  O   . HOH D 2 .   ? -5.965  122.547 -0.803  0.25 34.85 ? 236 HOH B O   3 
HETATM 8447  O  O   . HOH D 2 .   ? -12.960 112.723 -2.586  0.25 24.81 ? 237 HOH B O   3 
HETATM 8448  O  O   . HOH D 2 .   ? 11.485  121.260 -13.044 0.25 33.71 ? 238 HOH B O   3 
HETATM 8449  O  O   . HOH D 2 .   ? 9.255   96.789  -12.968 0.25 27.57 ? 239 HOH B O   3 
HETATM 8450  O  O   . HOH D 2 .   ? 1.722   111.756 5.833   0.25 37.10 ? 240 HOH B O   3 
HETATM 8451  O  O   . HOH D 2 .   ? -16.474 120.000 -7.035  0.25 33.46 ? 241 HOH B O   3 
HETATM 8452  O  O   . HOH D 2 .   ? 5.590   129.336 -17.807 0.25 44.98 ? 242 HOH B O   3 
HETATM 8453  O  O   . HOH D 2 .   ? -4.795  112.789 -24.530 0.25 29.46 ? 243 HOH B O   3 
HETATM 8454  O  O   . HOH D 2 .   ? 0.594   123.816 -23.484 0.25 35.48 ? 244 HOH B O   3 
HETATM 8455  O  O   . HOH D 2 .   ? -5.808  124.273 -16.834 0.25 33.08 ? 245 HOH B O   3 
HETATM 8456  O  O   . HOH D 2 .   ? 5.467   129.710 -9.348  0.25 37.26 ? 246 HOH B O   3 
HETATM 8457  O  O   . HOH D 2 .   ? -5.112  118.736 -1.733  0.25 29.56 ? 247 HOH B O   3 
HETATM 8458  O  O   . HOH D 2 .   ? -11.503 127.211 -10.376 0.25 55.74 ? 248 HOH B O   3 
HETATM 8459  O  O   . HOH D 2 .   ? 15.520  123.738 -17.627 0.25 32.98 ? 249 HOH B O   3 
HETATM 8460  O  O   . HOH D 2 .   ? -14.414 106.627 -18.851 0.25 44.70 ? 250 HOH B O   3 
HETATM 8461  O  O   . HOH D 2 .   ? 7.286   121.193 -0.606  0.25 24.60 ? 251 HOH B O   3 
HETATM 8462  O  O   . HOH D 2 .   ? 1.008   101.731 -25.791 0.25 34.55 ? 252 HOH B O   3 
HETATM 8463  O  O   . HOH D 2 .   ? -5.574  121.537 -20.822 0.25 24.62 ? 253 HOH B O   3 
HETATM 8464  O  O   . HOH D 2 .   ? -3.033  108.693 -26.859 0.25 24.68 ? 254 HOH B O   3 
HETATM 8465  O  O   . HOH D 2 .   ? 1.869   114.709 6.826   0.25 33.90 ? 255 HOH B O   3 
HETATM 8466  O  O   . HOH D 2 .   ? 9.977   114.866 -7.648  0.25 34.41 ? 256 HOH B O   3 
ATOM   8467  N  N   . GLU A 1 14  ? 3.015   82.344  -15.465 0.25 43.64 ? 14  GLU A N   4 
ATOM   8468  C  CA  . GLU A 1 14  ? 1.944   81.555  -16.143 0.25 44.53 ? 14  GLU A CA  4 
ATOM   8469  C  C   . GLU A 1 14  ? 0.658   81.542  -15.320 0.25 41.39 ? 14  GLU A C   4 
ATOM   8470  O  O   . GLU A 1 14  ? -0.125  82.491  -15.360 0.25 39.00 ? 14  GLU A O   4 
ATOM   8471  C  CB  . GLU A 1 14  ? 2.425   80.122  -16.376 0.25 50.04 ? 14  GLU A CB  4 
ATOM   8472  C  CG  . GLU A 1 14  ? 3.649   80.026  -17.269 0.25 57.88 ? 14  GLU A CG  4 
ATOM   8473  C  CD  . GLU A 1 14  ? 4.124   78.601  -17.457 0.25 60.76 ? 14  GLU A CD  4 
ATOM   8474  O  OE1 . GLU A 1 14  ? 5.121   78.396  -18.182 0.25 63.43 ? 14  GLU A OE1 4 
ATOM   8475  O  OE2 . GLU A 1 14  ? 3.501   77.685  -16.880 0.25 63.08 ? 14  GLU A OE2 4 
ATOM   8476  N  N   . GLU A 1 15  ? 0.443   80.463  -14.575 0.25 38.40 ? 15  GLU A N   4 
ATOM   8477  C  CA  . GLU A 1 15  ? -0.747  80.344  -13.743 0.25 37.70 ? 15  GLU A CA  4 
ATOM   8478  C  C   . GLU A 1 15  ? -0.415  80.470  -12.261 0.25 32.92 ? 15  GLU A C   4 
ATOM   8479  O  O   . GLU A 1 15  ? -1.220  80.102  -11.408 0.25 30.87 ? 15  GLU A O   4 
ATOM   8480  C  CB  . GLU A 1 15  ? -1.447  79.005  -14.001 0.25 42.88 ? 15  GLU A CB  4 
ATOM   8481  C  CG  . GLU A 1 15  ? -2.284  78.980  -15.273 0.25 50.57 ? 15  GLU A CG  4 
ATOM   8482  C  CD  . GLU A 1 15  ? -1.508  79.435  -16.491 0.25 53.34 ? 15  GLU A CD  4 
ATOM   8483  O  OE1 . GLU A 1 15  ? -0.497  78.785  -16.834 0.25 57.52 ? 15  GLU A OE1 4 
ATOM   8484  O  OE2 . GLU A 1 15  ? -1.908  80.446  -17.106 0.25 56.38 ? 15  GLU A OE2 4 
ATOM   8485  N  N   . SER A 1 16  ? 0.768   80.999  -11.960 0.25 27.95 ? 16  SER A N   4 
ATOM   8486  C  CA  . SER A 1 16  ? 1.201   81.166  -10.574 0.25 24.95 ? 16  SER A CA  4 
ATOM   8487  C  C   . SER A 1 16  ? 1.888   82.505  -10.343 0.25 21.17 ? 16  SER A C   4 
ATOM   8488  O  O   . SER A 1 16  ? 2.359   83.136  -11.284 0.25 19.83 ? 16  SER A O   4 
ATOM   8489  C  CB  . SER A 1 16  ? 2.166   80.042  -10.187 0.25 24.77 ? 16  SER A CB  4 
ATOM   8490  O  OG  . SER A 1 16  ? 1.528   78.780  -10.240 0.25 26.44 ? 16  SER A OG  4 
ATOM   8491  N  N   . PHE A 1 17  ? 1.934   82.940  -9.086  0.25 18.04 ? 17  PHE A N   4 
ATOM   8492  C  CA  . PHE A 1 17  ? 2.602   84.193  -8.738  0.25 14.76 ? 17  PHE A CA  4 
ATOM   8493  C  C   . PHE A 1 17  ? 3.290   84.047  -7.382  0.25 13.53 ? 17  PHE A C   4 
ATOM   8494  O  O   . PHE A 1 17  ? 3.200   82.990  -6.751  0.25 12.21 ? 17  PHE A O   4 
ATOM   8495  C  CB  . PHE A 1 17  ? 1.610   85.370  -8.700  0.25 12.46 ? 17  PHE A CB  4 
ATOM   8496  C  CG  . PHE A 1 17  ? 0.613   85.302  -7.574  0.25 13.23 ? 17  PHE A CG  4 
ATOM   8497  C  CD1 . PHE A 1 17  ? -0.524  84.509  -7.676  0.25 13.24 ? 17  PHE A CD1 4 
ATOM   8498  C  CD2 . PHE A 1 17  ? 0.815   86.035  -6.404  0.25 12.26 ? 17  PHE A CD2 4 
ATOM   8499  C  CE1 . PHE A 1 17  ? -1.446  84.446  -6.633  0.25 9.17  ? 17  PHE A CE1 4 
ATOM   8500  C  CE2 . PHE A 1 17  ? -0.102  85.973  -5.360  0.25 11.25 ? 17  PHE A CE2 4 
ATOM   8501  C  CZ  . PHE A 1 17  ? -1.232  85.180  -5.475  0.25 10.71 ? 17  PHE A CZ  4 
ATOM   8502  N  N   . LEU A 1 18  ? 3.989   85.097  -6.948  0.25 9.12  ? 18  LEU A N   4 
ATOM   8503  C  CA  . LEU A 1 18  ? 4.682   85.074  -5.668  0.25 10.77 ? 18  LEU A CA  4 
ATOM   8504  C  C   . LEU A 1 18  ? 4.086   86.101  -4.704  0.25 10.00 ? 18  LEU A C   4 
ATOM   8505  O  O   . LEU A 1 18  ? 3.766   87.229  -5.087  0.25 10.48 ? 18  LEU A O   4 
ATOM   8506  C  CB  . LEU A 1 18  ? 6.180   85.330  -5.860  0.25 8.82  ? 18  LEU A CB  4 
ATOM   8507  C  CG  . LEU A 1 18  ? 6.918   84.348  -6.778  0.25 9.97  ? 18  LEU A CG  4 
ATOM   8508  C  CD1 . LEU A 1 18  ? 8.403   84.671  -6.764  0.25 11.03 ? 18  LEU A CD1 4 
ATOM   8509  C  CD2 . LEU A 1 18  ? 6.676   82.909  -6.319  0.25 14.22 ? 18  LEU A CD2 4 
ATOM   8510  N  N   . TYR A 1 19  ? 3.944   85.686  -3.451  0.25 8.45  ? 19  TYR A N   4 
ATOM   8511  C  CA  . TYR A 1 19  ? 3.360   86.503  -2.396  0.25 8.91  ? 19  TYR A CA  4 
ATOM   8512  C  C   . TYR A 1 19  ? 4.277   86.652  -1.180  0.25 8.42  ? 19  TYR A C   4 
ATOM   8513  O  O   . TYR A 1 19  ? 4.476   85.704  -0.416  0.25 6.74  ? 19  TYR A O   4 
ATOM   8514  C  CB  . TYR A 1 19  ? 2.028   85.877  -1.980  0.25 7.39  ? 19  TYR A CB  4 
ATOM   8515  C  CG  . TYR A 1 19  ? 1.506   86.324  -0.632  0.25 9.15  ? 19  TYR A CG  4 
ATOM   8516  C  CD1 . TYR A 1 19  ? 1.339   87.679  -0.334  0.25 7.04  ? 19  TYR A CD1 4 
ATOM   8517  C  CD2 . TYR A 1 19  ? 1.159   85.385  0.343   0.25 5.65  ? 19  TYR A CD2 4 
ATOM   8518  C  CE1 . TYR A 1 19  ? 0.837   88.086  0.912   0.25 8.67  ? 19  TYR A CE1 4 
ATOM   8519  C  CE2 . TYR A 1 19  ? 0.659   85.779  1.580   0.25 10.61 ? 19  TYR A CE2 4 
ATOM   8520  C  CZ  . TYR A 1 19  ? 0.500   87.125  1.860   0.25 7.01  ? 19  TYR A CZ  4 
ATOM   8521  O  OH  . TYR A 1 19  ? 0.002   87.506  3.088   0.25 12.55 ? 19  TYR A OH  4 
ATOM   8522  N  N   . PHE A 1 20  ? 4.814   87.855  -0.995  0.25 7.39  ? 20  PHE A N   4 
ATOM   8523  C  CA  . PHE A 1 20  ? 5.720   88.143  0.121   0.25 8.13  ? 20  PHE A CA  4 
ATOM   8524  C  C   . PHE A 1 20  ? 4.943   88.426  1.403   0.25 8.72  ? 20  PHE A C   4 
ATOM   8525  O  O   . PHE A 1 20  ? 4.244   89.439  1.508   0.25 8.89  ? 20  PHE A O   4 
ATOM   8526  C  CB  . PHE A 1 20  ? 6.599   89.352  -0.220  0.25 8.31  ? 20  PHE A CB  4 
ATOM   8527  C  CG  . PHE A 1 20  ? 7.590   89.711  0.856   0.25 7.39  ? 20  PHE A CG  4 
ATOM   8528  C  CD1 . PHE A 1 20  ? 8.660   88.869  1.145   0.25 6.95  ? 20  PHE A CD1 4 
ATOM   8529  C  CD2 . PHE A 1 20  ? 7.465   90.901  1.566   0.25 6.20  ? 20  PHE A CD2 4 
ATOM   8530  C  CE1 . PHE A 1 20  ? 9.597   89.209  2.123   0.25 9.68  ? 20  PHE A CE1 4 
ATOM   8531  C  CE2 . PHE A 1 20  ? 8.398   91.252  2.551   0.25 6.81  ? 20  PHE A CE2 4 
ATOM   8532  C  CZ  . PHE A 1 20  ? 9.465   90.404  2.827   0.25 10.14 ? 20  PHE A CZ  4 
ATOM   8533  N  N   . ALA A 1 21  ? 5.079   87.530  2.377   0.25 9.11  ? 21  ALA A N   4 
ATOM   8534  C  CA  . ALA A 1 21  ? 4.392   87.651  3.660   0.25 7.09  ? 21  ALA A CA  4 
ATOM   8535  C  C   . ALA A 1 21  ? 5.355   88.101  4.753   0.25 7.80  ? 21  ALA A C   4 
ATOM   8536  O  O   . ALA A 1 21  ? 6.413   87.507  4.950   0.25 5.08  ? 21  ALA A O   4 
ATOM   8537  C  CB  . ALA A 1 21  ? 3.768   86.310  4.043   0.25 8.17  ? 21  ALA A CB  4 
ATOM   8538  N  N   . TYR A 1 22  ? 4.982   89.148  5.475   0.25 7.47  ? 22  TYR A N   4 
ATOM   8539  C  CA  . TYR A 1 22  ? 5.837   89.655  6.534   0.25 9.70  ? 22  TYR A CA  4 
ATOM   8540  C  C   . TYR A 1 22  ? 5.117   89.641  7.874   0.25 10.74 ? 22  TYR A C   4 
ATOM   8541  O  O   . TYR A 1 22  ? 5.719   89.928  8.903   0.25 10.69 ? 22  TYR A O   4 
ATOM   8542  C  CB  . TYR A 1 22  ? 6.313   91.068  6.176   0.25 9.70  ? 22  TYR A CB  4 
ATOM   8543  C  CG  . TYR A 1 22  ? 5.186   92.027  5.872   0.25 7.79  ? 22  TYR A CG  4 
ATOM   8544  C  CD1 . TYR A 1 22  ? 4.452   92.612  6.900   0.25 10.14 ? 22  TYR A CD1 4 
ATOM   8545  C  CD2 . TYR A 1 22  ? 4.847   92.343  4.557   0.25 6.18  ? 22  TYR A CD2 4 
ATOM   8546  C  CE1 . TYR A 1 22  ? 3.407   93.494  6.630   0.25 8.10  ? 22  TYR A CE1 4 
ATOM   8547  C  CE2 . TYR A 1 22  ? 3.801   93.226  4.275   0.25 8.01  ? 22  TYR A CE2 4 
ATOM   8548  C  CZ  . TYR A 1 22  ? 3.091   93.798  5.318   0.25 8.92  ? 22  TYR A CZ  4 
ATOM   8549  O  OH  . TYR A 1 22  ? 2.078   94.690  5.061   0.25 8.00  ? 22  TYR A OH  4 
ATOM   8550  N  N   . GLY A 1 23  ? 3.831   89.288  7.850   0.25 11.41 ? 23  GLY A N   4 
ATOM   8551  C  CA  . GLY A 1 23  ? 3.036   89.235  9.068   0.25 11.04 ? 23  GLY A CA  4 
ATOM   8552  C  C   . GLY A 1 23  ? 2.737   87.825  9.561   0.25 10.48 ? 23  GLY A C   4 
ATOM   8553  O  O   . GLY A 1 23  ? 3.631   86.979  9.618   0.25 12.49 ? 23  GLY A O   4 
ATOM   8554  N  N   . SER A 1 24  ? 1.481   87.557  9.914   0.25 8.87  ? 24  SER A N   4 
ATOM   8555  C  CA  . SER A 1 24  ? 1.128   86.233  10.410  0.25 10.60 ? 24  SER A CA  4 
ATOM   8556  C  C   . SER A 1 24  ? 1.294   85.148  9.347   0.25 11.02 ? 24  SER A C   4 
ATOM   8557  O  O   . SER A 1 24  ? 1.486   83.981  9.686   0.25 7.84  ? 24  SER A O   4 
ATOM   8558  C  CB  . SER A 1 24  ? -0.305  86.215  10.984  0.25 9.90  ? 24  SER A CB  4 
ATOM   8559  O  OG  . SER A 1 24  ? -1.273  86.645  10.043  0.25 12.14 ? 24  SER A OG  4 
ATOM   8560  N  N   . ASN A 1 25  ? 1.245   85.515  8.066   0.25 11.22 ? 25  ASN A N   4 
ATOM   8561  C  CA  . ASN A 1 25  ? 1.410   84.498  7.029   0.25 9.78  ? 25  ASN A CA  4 
ATOM   8562  C  C   . ASN A 1 25  ? 2.855   84.037  6.848   0.25 10.67 ? 25  ASN A C   4 
ATOM   8563  O  O   . ASN A 1 25  ? 3.217   83.477  5.813   0.25 8.46  ? 25  ASN A O   4 
ATOM   8564  C  CB  . ASN A 1 25  ? 0.824   84.956  5.685   0.25 9.91  ? 25  ASN A CB  4 
ATOM   8565  C  CG  . ASN A 1 25  ? -0.698  84.871  5.656   0.25 10.56 ? 25  ASN A CG  4 
ATOM   8566  O  OD1 . ASN A 1 25  ? -1.301  84.047  6.355   0.25 13.41 ? 25  ASN A OD1 4 
ATOM   8567  N  ND2 . ASN A 1 25  ? -1.326  85.712  4.838   0.25 12.30 ? 25  ASN A ND2 4 
ATOM   8568  N  N   . LEU A 1 26  ? 3.678   84.281  7.861   0.25 10.98 ? 26  LEU A N   4 
ATOM   8569  C  CA  . LEU A 1 26  ? 5.062   83.820  7.847   0.25 12.37 ? 26  LEU A CA  4 
ATOM   8570  C  C   . LEU A 1 26  ? 5.018   82.348  8.252   0.25 12.13 ? 26  LEU A C   4 
ATOM   8571  O  O   . LEU A 1 26  ? 5.966   81.597  8.012   0.25 10.23 ? 26  LEU A O   4 
ATOM   8572  C  CB  . LEU A 1 26  ? 5.907   84.577  8.875   0.25 11.68 ? 26  LEU A CB  4 
ATOM   8573  C  CG  . LEU A 1 26  ? 6.445   85.969  8.543   0.25 10.39 ? 26  LEU A CG  4 
ATOM   8574  C  CD1 . LEU A 1 26  ? 7.127   86.553  9.774   0.25 10.12 ? 26  LEU A CD1 4 
ATOM   8575  C  CD2 . LEU A 1 26  ? 7.428   85.876  7.382   0.25 11.14 ? 26  LEU A CD2 4 
ATOM   8576  N  N   . LEU A 1 27  ? 3.904   81.956  8.870   0.25 11.38 ? 27  LEU A N   4 
ATOM   8577  C  CA  . LEU A 1 27  ? 3.701   80.589  9.353   0.25 14.49 ? 27  LEU A CA  4 
ATOM   8578  C  C   . LEU A 1 27  ? 2.957   79.732  8.339   0.25 14.07 ? 27  LEU A C   4 
ATOM   8579  O  O   . LEU A 1 27  ? 2.021   80.195  7.690   0.25 13.75 ? 27  LEU A O   4 
ATOM   8580  C  CB  . LEU A 1 27  ? 2.920   80.604  10.674  0.25 13.46 ? 27  LEU A CB  4 
ATOM   8581  C  CG  . LEU A 1 27  ? 2.737   79.238  11.343  0.25 14.46 ? 27  LEU A CG  4 
ATOM   8582  C  CD1 . LEU A 1 27  ? 4.095   78.729  11.825  0.25 13.40 ? 27  LEU A CD1 4 
ATOM   8583  C  CD2 . LEU A 1 27  ? 1.779   79.353  12.509  0.25 12.50 ? 27  LEU A CD2 4 
ATOM   8584  N  N   . THR A 1 28  ? 3.368   78.475  8.225   0.25 15.91 ? 28  THR A N   4 
ATOM   8585  C  CA  . THR A 1 28  ? 2.766   77.543  7.274   0.25 16.42 ? 28  THR A CA  4 
ATOM   8586  C  C   . THR A 1 28  ? 1.330   77.170  7.608   0.25 16.23 ? 28  THR A C   4 
ATOM   8587  O  O   . THR A 1 28  ? 0.438   77.300  6.769   0.25 14.05 ? 28  THR A O   4 
ATOM   8588  C  CB  . THR A 1 28  ? 3.593   76.261  7.179   0.25 17.45 ? 28  THR A CB  4 
ATOM   8589  O  OG1 . THR A 1 28  ? 4.962   76.607  6.952   0.25 18.60 ? 28  THR A OG1 4 
ATOM   8590  C  CG2 . THR A 1 28  ? 3.106   75.395  6.020   0.25 16.40 ? 28  THR A CG2 4 
ATOM   8591  N  N   . GLU A 1 29  ? 1.111   76.690  8.828   0.25 17.57 ? 29  GLU A N   4 
ATOM   8592  C  CA  . GLU A 1 29  ? -0.227  76.307  9.254   0.25 19.33 ? 29  GLU A CA  4 
ATOM   8593  C  C   . GLU A 1 29  ? -1.124  77.534  9.237   0.25 19.61 ? 29  GLU A C   4 
ATOM   8594  O  O   . GLU A 1 29  ? -2.336  77.430  9.036   0.25 19.07 ? 29  GLU A O   4 
ATOM   8595  C  CB  . GLU A 1 29  ? -0.201  75.719  10.669  0.25 21.76 ? 29  GLU A CB  4 
ATOM   8596  C  CG  . GLU A 1 29  ? 0.416   74.334  10.763  0.25 24.30 ? 29  GLU A CG  4 
ATOM   8597  C  CD  . GLU A 1 29  ? 1.826   74.282  10.212  0.25 27.90 ? 29  GLU A CD  4 
ATOM   8598  O  OE1 . GLU A 1 29  ? 2.711   74.989  10.750  0.25 30.40 ? 29  GLU A OE1 4 
ATOM   8599  O  OE2 . GLU A 1 29  ? 2.048   73.533  9.237   0.25 27.89 ? 29  GLU A OE2 4 
ATOM   8600  N  N   . ARG A 1 30  ? -0.519  78.696  9.457   0.25 17.86 ? 30  ARG A N   4 
ATOM   8601  C  CA  . ARG A 1 30  ? -1.266  79.940  9.472   0.25 18.15 ? 30  ARG A CA  4 
ATOM   8602  C  C   . ARG A 1 30  ? -1.843  80.289  8.106   0.25 16.34 ? 30  ARG A C   4 
ATOM   8603  O  O   . ARG A 1 30  ? -3.052  80.441  7.965   0.25 16.15 ? 30  ARG A O   4 
ATOM   8604  C  CB  . ARG A 1 30  ? -0.386  81.090  9.970   0.25 20.59 ? 30  ARG A CB  4 
ATOM   8605  C  CG  . ARG A 1 30  ? -0.993  82.469  9.718   0.25 23.97 ? 30  ARG A CG  4 
ATOM   8606  C  CD  . ARG A 1 30  ? -2.392  82.579  10.299  0.25 24.68 ? 30  ARG A CD  4 
ATOM   8607  N  NE  . ARG A 1 30  ? -3.133  83.712  9.751   0.25 26.25 ? 30  ARG A NE  4 
ATOM   8608  C  CZ  . ARG A 1 30  ? -4.351  84.069  10.151  0.25 29.09 ? 30  ARG A CZ  4 
ATOM   8609  N  NH1 . ARG A 1 30  ? -4.965  83.381  11.107  0.25 30.85 ? 30  ARG A NH1 4 
ATOM   8610  N  NH2 . ARG A 1 30  ? -4.961  85.109  9.594   0.25 30.83 ? 30  ARG A NH2 4 
ATOM   8611  N  N   . ILE A 1 31  ? -0.986  80.418  7.099   0.25 14.57 ? 31  ILE A N   4 
ATOM   8612  C  CA  . ILE A 1 31  ? -1.468  80.763  5.767   0.25 12.86 ? 31  ILE A CA  4 
ATOM   8613  C  C   . ILE A 1 31  ? -2.386  79.687  5.182   0.25 13.85 ? 31  ILE A C   4 
ATOM   8614  O  O   . ILE A 1 31  ? -3.340  80.002  4.470   0.25 13.36 ? 31  ILE A O   4 
ATOM   8615  C  CB  . ILE A 1 31  ? -0.293  81.026  4.783   0.25 13.31 ? 31  ILE A CB  4 
ATOM   8616  C  CG1 . ILE A 1 31  ? -0.803  81.791  3.558   0.25 11.39 ? 31  ILE A CG1 4 
ATOM   8617  C  CG2 . ILE A 1 31  ? 0.334   79.716  4.338   0.25 11.35 ? 31  ILE A CG2 4 
ATOM   8618  C  CD1 . ILE A 1 31  ? 0.294   82.172  2.571   0.25 8.87  ? 31  ILE A CD1 4 
ATOM   8619  N  N   . HIS A 1 32  ? -2.111  78.423  5.490   0.25 14.54 ? 32  HIS A N   4 
ATOM   8620  C  CA  . HIS A 1 32  ? -2.924  77.329  4.965   0.25 15.65 ? 32  HIS A CA  4 
ATOM   8621  C  C   . HIS A 1 32  ? -4.392  77.347  5.394   0.25 17.13 ? 32  HIS A C   4 
ATOM   8622  O  O   . HIS A 1 32  ? -5.212  76.616  4.834   0.25 16.47 ? 32  HIS A O   4 
ATOM   8623  C  CB  . HIS A 1 32  ? -2.287  75.980  5.321   0.25 16.16 ? 32  HIS A CB  4 
ATOM   8624  C  CG  . HIS A 1 32  ? -1.146  75.602  4.424   0.25 17.40 ? 32  HIS A CG  4 
ATOM   8625  N  ND1 . HIS A 1 32  ? -0.364  74.489  4.640   0.25 15.17 ? 32  HIS A ND1 4 
ATOM   8626  C  CD2 . HIS A 1 32  ? -0.668  76.185  3.298   0.25 14.83 ? 32  HIS A CD2 4 
ATOM   8627  C  CE1 . HIS A 1 32  ? 0.548   74.402  3.686   0.25 16.68 ? 32  HIS A CE1 4 
ATOM   8628  N  NE2 . HIS A 1 32  ? 0.385   75.419  2.860   0.25 18.41 ? 32  HIS A NE2 4 
ATOM   8629  N  N   . LEU A 1 33  ? -4.731  78.181  6.374   0.25 18.25 ? 33  LEU A N   4 
ATOM   8630  C  CA  . LEU A 1 33  ? -6.117  78.274  6.833   0.25 21.08 ? 33  LEU A CA  4 
ATOM   8631  C  C   . LEU A 1 33  ? -7.041  78.642  5.671   0.25 20.01 ? 33  LEU A C   4 
ATOM   8632  O  O   . LEU A 1 33  ? -8.026  77.949  5.404   0.25 20.43 ? 33  LEU A O   4 
ATOM   8633  C  CB  . LEU A 1 33  ? -6.250  79.326  7.940   0.25 22.09 ? 33  LEU A CB  4 
ATOM   8634  C  CG  . LEU A 1 33  ? -5.552  79.056  9.278   0.25 25.37 ? 33  LEU A CG  4 
ATOM   8635  C  CD1 . LEU A 1 33  ? -5.706  80.267  10.189  0.25 26.82 ? 33  LEU A CD1 4 
ATOM   8636  C  CD2 . LEU A 1 33  ? -6.154  77.819  9.933   0.25 27.40 ? 33  LEU A CD2 4 
ATOM   8637  N  N   . ARG A 1 34  ? -6.718  79.736  4.984   0.25 19.57 ? 34  ARG A N   4 
ATOM   8638  C  CA  . ARG A 1 34  ? -7.509  80.209  3.847   0.25 18.78 ? 34  ARG A CA  4 
ATOM   8639  C  C   . ARG A 1 34  ? -6.851  79.910  2.498   0.25 18.82 ? 34  ARG A C   4 
ATOM   8640  O  O   . ARG A 1 34  ? -7.499  79.989  1.455   0.25 15.60 ? 34  ARG A O   4 
ATOM   8641  C  CB  . ARG A 1 34  ? -7.742  81.723  3.949   0.25 20.90 ? 34  ARG A CB  4 
ATOM   8642  C  CG  . ARG A 1 34  ? -8.753  82.158  5.003   0.25 23.11 ? 34  ARG A CG  4 
ATOM   8643  C  CD  . ARG A 1 34  ? -10.148 81.646  4.672   0.25 26.03 ? 34  ARG A CD  4 
ATOM   8644  N  NE  . ARG A 1 34  ? -10.609 82.083  3.354   0.25 26.68 ? 34  ARG A NE  4 
ATOM   8645  C  CZ  . ARG A 1 34  ? -11.012 83.316  3.060   0.25 26.92 ? 34  ARG A CZ  4 
ATOM   8646  N  NH1 . ARG A 1 34  ? -11.020 84.260  3.991   0.25 27.47 ? 34  ARG A NH1 4 
ATOM   8647  N  NH2 . ARG A 1 34  ? -11.414 83.604  1.830   0.25 29.72 ? 34  ARG A NH2 4 
ATOM   8648  N  N   . ASN A 1 35  ? -5.562  79.577  2.517   0.25 15.78 ? 35  ASN A N   4 
ATOM   8649  C  CA  . ASN A 1 35  ? -4.835  79.291  1.280   0.25 15.18 ? 35  ASN A CA  4 
ATOM   8650  C  C   . ASN A 1 35  ? -4.170  77.928  1.403   0.25 16.07 ? 35  ASN A C   4 
ATOM   8651  O  O   . ASN A 1 35  ? -2.944  77.815  1.355   0.25 13.36 ? 35  ASN A O   4 
ATOM   8652  C  CB  . ASN A 1 35  ? -3.775  80.364  1.056   0.25 15.36 ? 35  ASN A CB  4 
ATOM   8653  C  CG  . ASN A 1 35  ? -4.316  81.758  1.280   0.25 15.03 ? 35  ASN A CG  4 
ATOM   8654  O  OD1 . ASN A 1 35  ? -5.093  82.272  0.477   0.25 14.71 ? 35  ASN A OD1 4 
ATOM   8655  N  ND2 . ASN A 1 35  ? -3.919  82.375  2.390   0.25 13.47 ? 35  ASN A ND2 4 
ATOM   8656  N  N   . PRO A 1 36  ? -4.979  76.870  1.553   0.25 16.16 ? 36  PRO A N   4 
ATOM   8657  C  CA  . PRO A 1 36  ? -4.468  75.506  1.692   0.25 15.93 ? 36  PRO A CA  4 
ATOM   8658  C  C   . PRO A 1 36  ? -3.403  75.094  0.683   0.25 15.32 ? 36  PRO A C   4 
ATOM   8659  O  O   . PRO A 1 36  ? -2.463  74.395  1.042   0.25 15.94 ? 36  PRO A O   4 
ATOM   8660  C  CB  . PRO A 1 36  ? -5.736  74.649  1.608   0.25 16.86 ? 36  PRO A CB  4 
ATOM   8661  C  CG  . PRO A 1 36  ? -6.661  75.480  0.781   0.25 17.04 ? 36  PRO A CG  4 
ATOM   8662  C  CD  . PRO A 1 36  ? -6.436  76.861  1.342   0.25 16.56 ? 36  PRO A CD  4 
ATOM   8663  N  N   . SER A 1 37  ? -3.531  75.539  -0.566  0.25 17.38 ? 37  SER A N   4 
ATOM   8664  C  CA  . SER A 1 37  ? -2.558  75.172  -1.597  0.25 17.78 ? 37  SER A CA  4 
ATOM   8665  C  C   . SER A 1 37  ? -1.366  76.122  -1.751  0.25 17.91 ? 37  SER A C   4 
ATOM   8666  O  O   . SER A 1 37  ? -0.745  76.178  -2.817  0.25 17.39 ? 37  SER A O   4 
ATOM   8667  C  CB  . SER A 1 37  ? -3.258  75.001  -2.956  0.25 19.22 ? 37  SER A CB  4 
ATOM   8668  O  OG  . SER A 1 37  ? -3.908  76.188  -3.366  0.25 21.13 ? 37  SER A OG  4 
ATOM   8669  N  N   . ALA A 1 38  ? -1.039  76.861  -0.694  0.25 16.95 ? 38  ALA A N   4 
ATOM   8670  C  CA  . ALA A 1 38  ? 0.097   77.780  -0.742  0.25 15.75 ? 38  ALA A CA  4 
ATOM   8671  C  C   . ALA A 1 38  ? 1.371   76.999  -0.434  0.25 15.86 ? 38  ALA A C   4 
ATOM   8672  O  O   . ALA A 1 38  ? 1.466   76.343  0.606   0.25 17.10 ? 38  ALA A O   4 
ATOM   8673  C  CB  . ALA A 1 38  ? -0.084  78.905  0.271   0.25 17.07 ? 38  ALA A CB  4 
ATOM   8674  N  N   . ALA A 1 39  ? 2.342   77.069  -1.341  0.25 14.20 ? 39  ALA A N   4 
ATOM   8675  C  CA  . ALA A 1 39  ? 3.604   76.364  -1.173  0.25 13.75 ? 39  ALA A CA  4 
ATOM   8676  C  C   . ALA A 1 39  ? 4.756   77.319  -0.909  0.25 14.48 ? 39  ALA A C   4 
ATOM   8677  O  O   . ALA A 1 39  ? 4.898   78.346  -1.583  0.25 15.28 ? 39  ALA A O   4 
ATOM   8678  C  CB  . ALA A 1 39  ? 3.905   75.521  -2.418  0.25 13.46 ? 39  ALA A CB  4 
ATOM   8679  N  N   . PHE A 1 40  ? 5.575   76.984  0.085   0.25 13.99 ? 40  PHE A N   4 
ATOM   8680  C  CA  . PHE A 1 40  ? 6.737   77.801  0.424   0.25 13.19 ? 40  PHE A CA  4 
ATOM   8681  C  C   . PHE A 1 40  ? 7.582   77.894  -0.835  0.25 14.50 ? 40  PHE A C   4 
ATOM   8682  O  O   . PHE A 1 40  ? 7.802   76.888  -1.515  0.25 13.72 ? 40  PHE A O   4 
ATOM   8683  C  CB  . PHE A 1 40  ? 7.559   77.137  1.539   0.25 13.86 ? 40  PHE A CB  4 
ATOM   8684  C  CG  . PHE A 1 40  ? 8.870   77.833  1.831   0.25 15.04 ? 40  PHE A CG  4 
ATOM   8685  C  CD1 . PHE A 1 40  ? 8.909   78.985  2.611   0.25 13.65 ? 40  PHE A CD1 4 
ATOM   8686  C  CD2 . PHE A 1 40  ? 10.064  77.342  1.310   0.25 13.11 ? 40  PHE A CD2 4 
ATOM   8687  C  CE1 . PHE A 1 40  ? 10.123  79.644  2.868   0.25 14.91 ? 40  PHE A CE1 4 
ATOM   8688  C  CE2 . PHE A 1 40  ? 11.279  77.990  1.558   0.25 15.90 ? 40  PHE A CE2 4 
ATOM   8689  C  CZ  . PHE A 1 40  ? 11.307  79.144  2.341   0.25 13.00 ? 40  PHE A CZ  4 
ATOM   8690  N  N   . PHE A 1 41  ? 8.047   79.096  -1.153  0.25 14.01 ? 41  PHE A N   4 
ATOM   8691  C  CA  . PHE A 1 41  ? 8.868   79.283  -2.335  0.25 15.38 ? 41  PHE A CA  4 
ATOM   8692  C  C   . PHE A 1 41  ? 10.287  79.608  -1.898  0.25 14.72 ? 41  PHE A C   4 
ATOM   8693  O  O   . PHE A 1 41  ? 11.228  78.901  -2.256  0.25 14.03 ? 41  PHE A O   4 
ATOM   8694  C  CB  . PHE A 1 41  ? 8.318   80.411  -3.205  0.25 15.61 ? 41  PHE A CB  4 
ATOM   8695  C  CG  . PHE A 1 41  ? 8.955   80.483  -4.559  0.25 15.00 ? 41  PHE A CG  4 
ATOM   8696  C  CD1 . PHE A 1 41  ? 8.726   79.486  -5.500  0.25 18.19 ? 41  PHE A CD1 4 
ATOM   8697  C  CD2 . PHE A 1 41  ? 9.796   81.534  -4.890  0.25 14.82 ? 41  PHE A CD2 4 
ATOM   8698  C  CE1 . PHE A 1 41  ? 9.329   79.533  -6.758  0.25 18.57 ? 41  PHE A CE1 4 
ATOM   8699  C  CE2 . PHE A 1 41  ? 10.405  81.593  -6.143  0.25 18.12 ? 41  PHE A CE2 4 
ATOM   8700  C  CZ  . PHE A 1 41  ? 10.171  80.590  -7.079  0.25 18.20 ? 41  PHE A CZ  4 
ATOM   8701  N  N   . CYS A 1 42  ? 10.441  80.677  -1.122  0.25 13.27 ? 42  CYS A N   4 
ATOM   8702  C  CA  . CYS A 1 42  ? 11.762  81.051  -0.627  0.25 13.35 ? 42  CYS A CA  4 
ATOM   8703  C  C   . CYS A 1 42  ? 11.690  82.186  0.379   0.25 14.49 ? 42  CYS A C   4 
ATOM   8704  O  O   . CYS A 1 42  ? 10.730  82.960  0.396   0.25 13.03 ? 42  CYS A O   4 
ATOM   8705  C  CB  . CYS A 1 42  ? 12.682  81.459  -1.787  0.25 14.08 ? 42  CYS A CB  4 
ATOM   8706  S  SG  . CYS A 1 42  ? 12.352  83.087  -2.498  0.25 18.80 ? 42  CYS A SG  4 
ATOM   8707  N  N   . VAL A 1 43  ? 12.700  82.264  1.240   0.25 13.61 ? 43  VAL A N   4 
ATOM   8708  C  CA  . VAL A 1 43  ? 12.773  83.333  2.225   0.25 12.83 ? 43  VAL A CA  4 
ATOM   8709  C  C   . VAL A 1 43  ? 13.496  84.473  1.513   0.25 12.54 ? 43  VAL A C   4 
ATOM   8710  O  O   . VAL A 1 43  ? 14.471  84.233  0.804   0.25 12.51 ? 43  VAL A O   4 
ATOM   8711  C  CB  . VAL A 1 43  ? 13.590  82.904  3.461   0.25 14.58 ? 43  VAL A CB  4 
ATOM   8712  C  CG1 . VAL A 1 43  ? 13.965  84.121  4.278   0.25 11.75 ? 43  VAL A CG1 4 
ATOM   8713  C  CG2 . VAL A 1 43  ? 12.787  81.915  4.300   0.25 11.47 ? 43  VAL A CG2 4 
ATOM   8714  N  N   . ALA A 1 44  ? 13.030  85.704  1.702   0.25 10.87 ? 44  ALA A N   4 
ATOM   8715  C  CA  . ALA A 1 44  ? 13.647  86.853  1.041   0.25 13.41 ? 44  ALA A CA  4 
ATOM   8716  C  C   . ALA A 1 44  ? 13.632  88.119  1.888   0.25 12.75 ? 44  ALA A C   4 
ATOM   8717  O  O   . ALA A 1 44  ? 12.913  88.209  2.883   0.25 11.74 ? 44  ALA A O   4 
ATOM   8718  C  CB  . ALA A 1 44  ? 12.952  87.119  -0.286  0.25 11.43 ? 44  ALA A CB  4 
ATOM   8719  N  N   . ARG A 1 45  ? 14.418  89.104  1.462   0.25 13.96 ? 45  ARG A N   4 
ATOM   8720  C  CA  . ARG A 1 45  ? 14.529  90.371  2.174   0.25 15.64 ? 45  ARG A CA  4 
ATOM   8721  C  C   . ARG A 1 45  ? 14.078  91.571  1.342   0.25 13.21 ? 45  ARG A C   4 
ATOM   8722  O  O   . ARG A 1 45  ? 14.459  91.707  0.180   0.25 12.42 ? 45  ARG A O   4 
ATOM   8723  C  CB  . ARG A 1 45  ? 15.985  90.576  2.619   0.25 17.96 ? 45  ARG A CB  4 
ATOM   8724  C  CG  . ARG A 1 45  ? 16.267  91.917  3.281   0.25 24.61 ? 45  ARG A CG  4 
ATOM   8725  C  CD  . ARG A 1 45  ? 17.723  92.004  3.725   0.25 32.96 ? 45  ARG A CD  4 
ATOM   8726  N  NE  . ARG A 1 45  ? 18.643  91.825  2.607   0.25 39.69 ? 45  ARG A NE  4 
ATOM   8727  C  CZ  . ARG A 1 45  ? 19.951  91.624  2.735   0.25 43.51 ? 45  ARG A CZ  4 
ATOM   8728  N  NH1 . ARG A 1 45  ? 20.507  91.572  3.939   0.25 46.70 ? 45  ARG A NH1 4 
ATOM   8729  N  NH2 . ARG A 1 45  ? 20.707  91.477  1.655   0.25 49.66 ? 45  ARG A NH2 4 
ATOM   8730  N  N   . LEU A 1 46  ? 13.257  92.428  1.943   0.25 12.34 ? 46  LEU A N   4 
ATOM   8731  C  CA  . LEU A 1 46  ? 12.774  93.641  1.288   0.25 13.03 ? 46  LEU A CA  4 
ATOM   8732  C  C   . LEU A 1 46  ? 13.560  94.781  1.924   0.25 14.01 ? 46  LEU A C   4 
ATOM   8733  O  O   . LEU A 1 46  ? 13.298  95.164  3.067   0.25 14.59 ? 46  LEU A O   4 
ATOM   8734  C  CB  . LEU A 1 46  ? 11.273  93.840  1.542   0.25 12.25 ? 46  LEU A CB  4 
ATOM   8735  C  CG  . LEU A 1 46  ? 10.611  95.087  0.941   0.25 11.76 ? 46  LEU A CG  4 
ATOM   8736  C  CD1 . LEU A 1 46  ? 10.841  95.143  -0.566  0.25 13.80 ? 46  LEU A CD1 4 
ATOM   8737  C  CD2 . LEU A 1 46  ? 9.113   95.056  1.242   0.25 12.01 ? 46  LEU A CD2 4 
ATOM   8738  N  N   . GLN A 1 47  ? 14.525  95.323  1.189   0.25 15.27 ? 47  GLN A N   4 
ATOM   8739  C  CA  . GLN A 1 47  ? 15.362  96.395  1.719   0.25 15.30 ? 47  GLN A CA  4 
ATOM   8740  C  C   . GLN A 1 47  ? 14.688  97.759  1.743   0.25 13.75 ? 47  GLN A C   4 
ATOM   8741  O  O   . GLN A 1 47  ? 13.846  98.074  0.902   0.25 12.22 ? 47  GLN A O   4 
ATOM   8742  C  CB  . GLN A 1 47  ? 16.658  96.497  0.914   0.25 16.85 ? 47  GLN A CB  4 
ATOM   8743  C  CG  . GLN A 1 47  ? 17.891  96.791  1.764   0.25 17.37 ? 47  GLN A CG  4 
ATOM   8744  C  CD  . GLN A 1 47  ? 18.370  95.573  2.542   0.25 17.04 ? 47  GLN A CD  4 
ATOM   8745  O  OE1 . GLN A 1 47  ? 18.628  94.521  1.962   0.25 15.63 ? 47  GLN A OE1 4 
ATOM   8746  N  NE2 . GLN A 1 47  ? 18.496  95.714  3.858   0.25 16.07 ? 47  GLN A NE2 4 
ATOM   8747  N  N   . ASP A 1 48  ? 15.078  98.565  2.723   0.25 13.42 ? 48  ASP A N   4 
ATOM   8748  C  CA  . ASP A 1 48  ? 14.558  99.914  2.882   0.25 13.01 ? 48  ASP A CA  4 
ATOM   8749  C  C   . ASP A 1 48  ? 13.062  100.011 3.167   0.25 12.47 ? 48  ASP A C   4 
ATOM   8750  O  O   . ASP A 1 48  ? 12.390  100.919 2.685   0.25 12.01 ? 48  ASP A O   4 
ATOM   8751  C  CB  . ASP A 1 48  ? 14.923  100.776 1.663   0.25 15.27 ? 48  ASP A CB  4 
ATOM   8752  C  CG  . ASP A 1 48  ? 16.426  101.018 1.544   0.25 19.82 ? 48  ASP A CG  4 
ATOM   8753  O  OD1 . ASP A 1 48  ? 17.077  101.270 2.583   0.25 18.58 ? 48  ASP A OD1 4 
ATOM   8754  O  OD2 . ASP A 1 48  ? 16.956  100.963 0.410   0.25 20.68 ? 48  ASP A OD2 4 
ATOM   8755  N  N   . PHE A 1 49  ? 12.554  99.062  3.950   0.25 11.40 ? 49  PHE A N   4 
ATOM   8756  C  CA  . PHE A 1 49  ? 11.158  99.050  4.376   0.25 11.22 ? 49  PHE A CA  4 
ATOM   8757  C  C   . PHE A 1 49  ? 11.189  98.866  5.887   0.25 11.82 ? 49  PHE A C   4 
ATOM   8758  O  O   . PHE A 1 49  ? 12.145  98.295  6.422   0.25 12.15 ? 49  PHE A O   4 
ATOM   8759  C  CB  . PHE A 1 49  ? 10.376  97.910  3.726   0.25 11.82 ? 49  PHE A CB  4 
ATOM   8760  C  CG  . PHE A 1 49  ? 9.890   98.222  2.338   0.25 12.71 ? 49  PHE A CG  4 
ATOM   8761  C  CD1 . PHE A 1 49  ? 10.789  98.403  1.289   0.25 12.42 ? 49  PHE A CD1 4 
ATOM   8762  C  CD2 . PHE A 1 49  ? 8.530   98.317  2.077   0.25 12.51 ? 49  PHE A CD2 4 
ATOM   8763  C  CE1 . PHE A 1 49  ? 10.332  98.672  -0.007  0.25 13.03 ? 49  PHE A CE1 4 
ATOM   8764  C  CE2 . PHE A 1 49  ? 8.064   98.586  0.790   0.25 13.75 ? 49  PHE A CE2 4 
ATOM   8765  C  CZ  . PHE A 1 49  ? 8.967   98.762  -0.252  0.25 12.44 ? 49  PHE A CZ  4 
ATOM   8766  N  N   . LYS A 1 50  ? 10.159  99.354  6.573   0.25 11.90 ? 50  LYS A N   4 
ATOM   8767  C  CA  . LYS A 1 50  ? 10.105  99.258  8.028   0.25 12.38 ? 50  LYS A CA  4 
ATOM   8768  C  C   . LYS A 1 50  ? 8.791   98.660  8.522   0.25 12.82 ? 50  LYS A C   4 
ATOM   8769  O  O   . LYS A 1 50  ? 7.710   99.121  8.161   0.25 11.97 ? 50  LYS A O   4 
ATOM   8770  C  CB  . LYS A 1 50  ? 10.309  100.652 8.632   0.25 13.50 ? 50  LYS A CB  4 
ATOM   8771  C  CG  . LYS A 1 50  ? 10.483  100.697 10.140  0.25 20.44 ? 50  LYS A CG  4 
ATOM   8772  C  CD  . LYS A 1 50  ? 10.916  102.102 10.559  0.25 24.79 ? 50  LYS A CD  4 
ATOM   8773  C  CE  . LYS A 1 50  ? 11.366  102.159 12.006  0.25 28.16 ? 50  LYS A CE  4 
ATOM   8774  N  NZ  . LYS A 1 50  ? 11.838  103.524 12.364  0.25 30.66 ? 50  LYS A NZ  4 
ATOM   8775  N  N   . LEU A 1 51  ? 8.897   97.626  9.350   0.25 10.74 ? 51  LEU A N   4 
ATOM   8776  C  CA  . LEU A 1 51  ? 7.723   96.968  9.911   0.25 10.24 ? 51  LEU A CA  4 
ATOM   8777  C  C   . LEU A 1 51  ? 7.053   97.862  10.953  0.25 10.68 ? 51  LEU A C   4 
ATOM   8778  O  O   . LEU A 1 51  ? 7.723   98.579  11.692  0.25 10.67 ? 51  LEU A O   4 
ATOM   8779  C  CB  . LEU A 1 51  ? 8.130   95.650  10.569  0.25 9.81  ? 51  LEU A CB  4 
ATOM   8780  C  CG  . LEU A 1 51  ? 7.031   94.856  11.274  0.25 9.60  ? 51  LEU A CG  4 
ATOM   8781  C  CD1 . LEU A 1 51  ? 6.056   94.291  10.247  0.25 8.76  ? 51  LEU A CD1 4 
ATOM   8782  C  CD2 . LEU A 1 51  ? 7.676   93.724  12.071  0.25 8.93  ? 51  LEU A CD2 4 
ATOM   8783  N  N   . ASP A 1 52  ? 5.727   97.810  11.005  0.25 10.33 ? 52  ASP A N   4 
ATOM   8784  C  CA  . ASP A 1 52  ? 4.966   98.597  11.967  0.25 10.88 ? 52  ASP A CA  4 
ATOM   8785  C  C   . ASP A 1 52  ? 3.709   97.801  12.307  0.25 11.74 ? 52  ASP A C   4 
ATOM   8786  O  O   . ASP A 1 52  ? 3.500   96.707  11.782  0.25 9.99  ? 52  ASP A O   4 
ATOM   8787  C  CB  . ASP A 1 52  ? 4.568   99.949  11.359  0.25 11.13 ? 52  ASP A CB  4 
ATOM   8788  C  CG  . ASP A 1 52  ? 4.176   100.980 12.416  0.25 13.00 ? 52  ASP A CG  4 
ATOM   8789  O  OD1 . ASP A 1 52  ? 3.909   100.593 13.578  0.25 8.12  ? 52  ASP A OD1 4 
ATOM   8790  O  OD2 . ASP A 1 52  ? 4.128   102.183 12.077  0.25 12.66 ? 52  ASP A OD2 4 
ATOM   8791  N  N   . PHE A 1 53  ? 2.885   98.342  13.197  0.25 10.87 ? 53  PHE A N   4 
ATOM   8792  C  CA  . PHE A 1 53  ? 1.636   97.696  13.577  0.25 10.83 ? 53  PHE A CA  4 
ATOM   8793  C  C   . PHE A 1 53  ? 0.584   98.759  13.839  0.25 10.83 ? 53  PHE A C   4 
ATOM   8794  O  O   . PHE A 1 53  ? 0.830   99.738  14.547  0.25 6.83  ? 53  PHE A O   4 
ATOM   8795  C  CB  . PHE A 1 53  ? 1.832   96.821  14.816  0.25 11.32 ? 53  PHE A CB  4 
ATOM   8796  C  CG  . PHE A 1 53  ? 2.783   95.680  14.596  0.25 11.80 ? 53  PHE A CG  4 
ATOM   8797  C  CD1 . PHE A 1 53  ? 4.157   95.864  14.738  0.25 10.68 ? 53  PHE A CD1 4 
ATOM   8798  C  CD2 . PHE A 1 53  ? 2.310   94.433  14.202  0.25 9.83  ? 53  PHE A CD2 4 
ATOM   8799  C  CE1 . PHE A 1 53  ? 5.044   94.820  14.490  0.25 12.43 ? 53  PHE A CE1 4 
ATOM   8800  C  CE2 . PHE A 1 53  ? 3.192   93.377  13.950  0.25 11.34 ? 53  PHE A CE2 4 
ATOM   8801  C  CZ  . PHE A 1 53  ? 4.561   93.573  14.095  0.25 13.20 ? 53  PHE A CZ  4 
ATOM   8802  N  N   . GLY A 1 54  ? -0.596  98.576  13.262  0.25 11.52 ? 54  GLY A N   4 
ATOM   8803  C  CA  . GLY A 1 54  ? -1.621  99.577  13.458  0.25 12.08 ? 54  GLY A CA  4 
ATOM   8804  C  C   . GLY A 1 54  ? -3.047  99.122  13.269  0.25 13.05 ? 54  GLY A C   4 
ATOM   8805  O  O   . GLY A 1 54  ? -3.329  97.963  12.944  0.25 12.92 ? 54  GLY A O   4 
ATOM   8806  N  N   . ASN A 1 55  ? -3.951  100.067 13.486  0.25 13.47 ? 55  ASN A N   4 
ATOM   8807  C  CA  . ASN A 1 55  ? -5.373  99.827  13.356  0.25 16.34 ? 55  ASN A CA  4 
ATOM   8808  C  C   . ASN A 1 55  ? -5.872  100.554 12.115  0.25 17.44 ? 55  ASN A C   4 
ATOM   8809  O  O   . ASN A 1 55  ? -5.858  101.788 12.060  0.25 15.45 ? 55  ASN A O   4 
ATOM   8810  C  CB  . ASN A 1 55  ? -6.109  100.354 14.595  0.25 15.18 ? 55  ASN A CB  4 
ATOM   8811  C  CG  . ASN A 1 55  ? -5.513  99.833  15.896  0.25 16.34 ? 55  ASN A CG  4 
ATOM   8812  O  OD1 . ASN A 1 55  ? -5.186  98.654  16.011  0.25 13.92 ? 55  ASN A OD1 4 
ATOM   8813  N  ND2 . ASN A 1 55  ? -5.383  100.711 16.883  0.25 14.58 ? 55  ASN A ND2 4 
ATOM   8814  N  N   . SER A 1 56  ? -6.297  99.790  11.116  0.25 19.70 ? 56  SER A N   4 
ATOM   8815  C  CA  . SER A 1 56  ? -6.813  100.375 9.888   0.25 23.40 ? 56  SER A CA  4 
ATOM   8816  C  C   . SER A 1 56  ? -7.904  101.387 10.209  0.25 24.96 ? 56  SER A C   4 
ATOM   8817  O  O   . SER A 1 56  ? -8.807  101.105 10.991  0.25 25.17 ? 56  SER A O   4 
ATOM   8818  C  CB  . SER A 1 56  ? -7.390  99.291  8.982   0.25 22.99 ? 56  SER A CB  4 
ATOM   8819  O  OG  . SER A 1 56  ? -8.070  99.872  7.883   0.25 22.68 ? 56  SER A OG  4 
ATOM   8820  N  N   . GLN A 1 57  ? -7.808  102.564 9.602   0.25 27.21 ? 57  GLN A N   4 
ATOM   8821  C  CA  . GLN A 1 57  ? -8.787  103.626 9.812   0.25 29.93 ? 57  GLN A CA  4 
ATOM   8822  C  C   . GLN A 1 57  ? -8.942  103.957 11.297  0.25 30.14 ? 57  GLN A C   4 
ATOM   8823  O  O   . GLN A 1 57  ? -9.956  104.514 11.713  0.25 29.18 ? 57  GLN A O   4 
ATOM   8824  C  CB  . GLN A 1 57  ? -10.150 103.219 9.236   0.25 32.59 ? 57  GLN A CB  4 
ATOM   8825  C  CG  . GLN A 1 57  ? -10.091 102.426 7.930   0.25 35.08 ? 57  GLN A CG  4 
ATOM   8826  C  CD  . GLN A 1 57  ? -9.200  103.063 6.881   0.25 37.91 ? 57  GLN A CD  4 
ATOM   8827  O  OE1 . GLN A 1 57  ? -9.426  104.198 6.457   0.25 37.67 ? 57  GLN A OE1 4 
ATOM   8828  N  NE2 . GLN A 1 57  ? -8.177  102.329 6.454   0.25 39.38 ? 57  GLN A NE2 4 
ATOM   8829  N  N   . GLY A 1 58  ? -7.935  103.607 12.092  0.25 29.35 ? 58  GLY A N   4 
ATOM   8830  C  CA  . GLY A 1 58  ? -7.987  103.885 13.515  0.25 27.91 ? 58  GLY A CA  4 
ATOM   8831  C  C   . GLY A 1 58  ? -8.860  102.937 14.312  0.25 28.06 ? 58  GLY A C   4 
ATOM   8832  O  O   . GLY A 1 58  ? -9.056  103.134 15.511  0.25 27.69 ? 58  GLY A O   4 
ATOM   8833  N  N   . LYS A 1 59  ? -9.387  101.910 13.653  0.25 26.67 ? 59  LYS A N   4 
ATOM   8834  C  CA  . LYS A 1 59  ? -10.243 100.928 14.313  0.25 27.41 ? 59  LYS A CA  4 
ATOM   8835  C  C   . LYS A 1 59  ? -9.426  99.693  14.680  0.25 25.31 ? 59  LYS A C   4 
ATOM   8836  O  O   . LYS A 1 59  ? -8.860  99.035  13.806  0.25 22.65 ? 59  LYS A O   4 
ATOM   8837  C  CB  . LYS A 1 59  ? -11.392 100.513 13.390  0.25 31.44 ? 59  LYS A CB  4 
ATOM   8838  C  CG  . LYS A 1 59  ? -12.260 101.658 12.892  0.25 34.93 ? 59  LYS A CG  4 
ATOM   8839  C  CD  . LYS A 1 59  ? -13.397 101.130 12.028  0.25 40.45 ? 59  LYS A CD  4 
ATOM   8840  C  CE  . LYS A 1 59  ? -14.288 102.250 11.516  0.25 42.10 ? 59  LYS A CE  4 
ATOM   8841  N  NZ  . LYS A 1 59  ? -15.425 101.726 10.703  0.25 46.01 ? 59  LYS A NZ  4 
ATOM   8842  N  N   . THR A 1 60  ? -9.366  99.379  15.970  0.25 23.15 ? 60  THR A N   4 
ATOM   8843  C  CA  . THR A 1 60  ? -8.609  98.222  16.435  0.25 23.11 ? 60  THR A CA  4 
ATOM   8844  C  C   . THR A 1 60  ? -9.187  96.919  15.901  0.25 22.70 ? 60  THR A C   4 
ATOM   8845  O  O   . THR A 1 60  ? -10.390 96.671  16.002  0.25 22.47 ? 60  THR A O   4 
ATOM   8846  C  CB  . THR A 1 60  ? -8.577  98.154  17.973  0.25 23.99 ? 60  THR A CB  4 
ATOM   8847  O  OG1 . THR A 1 60  ? -7.949  99.333  18.488  0.25 23.37 ? 60  THR A OG1 4 
ATOM   8848  C  CG2 . THR A 1 60  ? -7.799  96.929  18.437  0.25 24.66 ? 60  THR A CG2 4 
ATOM   8849  N  N   . SER A 1 61  ? -8.318  96.088  15.333  0.25 21.18 ? 61  SER A N   4 
ATOM   8850  C  CA  . SER A 1 61  ? -8.731  94.804  14.777  0.25 20.63 ? 61  SER A CA  4 
ATOM   8851  C  C   . SER A 1 61  ? -9.524  93.987  15.784  0.25 21.58 ? 61  SER A C   4 
ATOM   8852  O  O   . SER A 1 61  ? -9.122  93.849  16.943  0.25 18.02 ? 61  SER A O   4 
ATOM   8853  C  CB  . SER A 1 61  ? -7.512  93.993  14.338  0.25 20.10 ? 61  SER A CB  4 
ATOM   8854  O  OG  . SER A 1 61  ? -7.889  92.671  13.997  0.25 18.71 ? 61  SER A OG  4 
ATOM   8855  N  N   . GLN A 1 62  ? -10.650 93.440  15.335  0.25 21.48 ? 62  GLN A N   4 
ATOM   8856  C  CA  . GLN A 1 62  ? -11.488 92.622  16.200  0.25 24.84 ? 62  GLN A CA  4 
ATOM   8857  C  C   . GLN A 1 62  ? -11.175 91.150  15.995  0.25 23.17 ? 62  GLN A C   4 
ATOM   8858  O  O   . GLN A 1 62  ? -11.879 90.271  16.489  0.25 21.63 ? 62  GLN A O   4 
ATOM   8859  C  CB  . GLN A 1 62  ? -12.967 92.897  15.930  0.25 28.45 ? 62  GLN A CB  4 
ATOM   8860  C  CG  . GLN A 1 62  ? -13.409 94.263  16.421  0.25 32.49 ? 62  GLN A CG  4 
ATOM   8861  C  CD  . GLN A 1 62  ? -13.042 94.500  17.878  0.25 34.09 ? 62  GLN A CD  4 
ATOM   8862  O  OE1 . GLN A 1 62  ? -13.522 93.804  18.775  0.25 35.34 ? 62  GLN A OE1 4 
ATOM   8863  N  NE2 . GLN A 1 62  ? -12.183 95.483  18.118  0.25 35.36 ? 62  GLN A NE2 4 
ATOM   8864  N  N   . THR A 1 63  ? -10.108 90.894  15.248  0.25 21.28 ? 63  THR A N   4 
ATOM   8865  C  CA  . THR A 1 63  ? -9.658  89.536  14.991  0.25 20.58 ? 63  THR A CA  4 
ATOM   8866  C  C   . THR A 1 63  ? -8.401  89.287  15.822  0.25 20.27 ? 63  THR A C   4 
ATOM   8867  O  O   . THR A 1 63  ? -8.251  88.231  16.440  0.25 20.92 ? 63  THR A O   4 
ATOM   8868  C  CB  . THR A 1 63  ? -9.308  89.332  13.508  0.25 21.09 ? 63  THR A CB  4 
ATOM   8869  O  OG1 . THR A 1 63  ? -10.493 89.466  12.714  0.25 22.89 ? 63  THR A OG1 4 
ATOM   8870  C  CG2 . THR A 1 63  ? -8.694  87.954  13.289  0.25 23.51 ? 63  THR A CG2 4 
ATOM   8871  N  N   . TRP A 1 64  ? -7.511  90.278  15.843  0.25 17.38 ? 64  TRP A N   4 
ATOM   8872  C  CA  . TRP A 1 64  ? -6.252  90.175  16.579  0.25 17.79 ? 64  TRP A CA  4 
ATOM   8873  C  C   . TRP A 1 64  ? -6.154  91.031  17.835  0.25 18.54 ? 64  TRP A C   4 
ATOM   8874  O  O   . TRP A 1 64  ? -5.157  90.966  18.556  0.25 20.13 ? 64  TRP A O   4 
ATOM   8875  C  CB  . TRP A 1 64  ? -5.085  90.519  15.659  0.25 14.60 ? 64  TRP A CB  4 
ATOM   8876  C  CG  . TRP A 1 64  ? -4.920  89.542  14.553  0.25 15.80 ? 64  TRP A CG  4 
ATOM   8877  C  CD1 . TRP A 1 64  ? -5.313  89.692  13.252  0.25 14.85 ? 64  TRP A CD1 4 
ATOM   8878  C  CD2 . TRP A 1 64  ? -4.333  88.244  14.650  0.25 14.85 ? 64  TRP A CD2 4 
ATOM   8879  N  NE1 . TRP A 1 64  ? -5.000  88.562  12.532  0.25 15.94 ? 64  TRP A NE1 4 
ATOM   8880  C  CE2 . TRP A 1 64  ? -4.397  87.657  13.367  0.25 15.44 ? 64  TRP A CE2 4 
ATOM   8881  C  CE3 . TRP A 1 64  ? -3.755  87.516  15.701  0.25 15.35 ? 64  TRP A CE3 4 
ATOM   8882  C  CZ2 . TRP A 1 64  ? -3.903  86.377  13.104  0.25 16.25 ? 64  TRP A CZ2 4 
ATOM   8883  C  CZ3 . TRP A 1 64  ? -3.264  86.241  15.439  0.25 16.03 ? 64  TRP A CZ3 4 
ATOM   8884  C  CH2 . TRP A 1 64  ? -3.341  85.686  14.149  0.25 15.68 ? 64  TRP A CH2 4 
ATOM   8885  N  N   . HIS A 1 65  ? -7.184  91.829  18.093  0.25 18.24 ? 65  HIS A N   4 
ATOM   8886  C  CA  . HIS A 1 65  ? -7.220  92.700  19.263  0.25 18.81 ? 65  HIS A CA  4 
ATOM   8887  C  C   . HIS A 1 65  ? -5.914  93.465  19.464  0.25 16.94 ? 65  HIS A C   4 
ATOM   8888  O  O   . HIS A 1 65  ? -5.411  93.590  20.580  0.25 15.05 ? 65  HIS A O   4 
ATOM   8889  C  CB  . HIS A 1 65  ? -7.555  91.880  20.515  0.25 20.61 ? 65  HIS A CB  4 
ATOM   8890  C  CG  . HIS A 1 65  ? -8.782  91.036  20.366  0.25 18.75 ? 65  HIS A CG  4 
ATOM   8891  N  ND1 . HIS A 1 65  ? -8.732  89.711  19.991  0.25 21.18 ? 65  HIS A ND1 4 
ATOM   8892  C  CD2 . HIS A 1 65  ? -10.095 91.344  20.488  0.25 19.49 ? 65  HIS A CD2 4 
ATOM   8893  C  CE1 . HIS A 1 65  ? -9.962  89.238  19.887  0.25 20.12 ? 65  HIS A CE1 4 
ATOM   8894  N  NE2 . HIS A 1 65  ? -10.807 90.209  20.183  0.25 20.00 ? 65  HIS A NE2 4 
ATOM   8895  N  N   . GLY A 1 66  ? -5.378  93.983  18.367  0.25 16.06 ? 66  GLY A N   4 
ATOM   8896  C  CA  . GLY A 1 66  ? -4.141  94.736  18.422  0.25 13.23 ? 66  GLY A CA  4 
ATOM   8897  C  C   . GLY A 1 66  ? -3.729  95.121  17.015  0.25 13.06 ? 66  GLY A C   4 
ATOM   8898  O  O   . GLY A 1 66  ? -4.297  94.625  16.042  0.25 11.35 ? 66  GLY A O   4 
ATOM   8899  N  N   . GLY A 1 67  ? -2.748  96.007  16.903  0.25 12.58 ? 67  GLY A N   4 
ATOM   8900  C  CA  . GLY A 1 67  ? -2.292  96.421  15.592  0.25 12.01 ? 67  GLY A CA  4 
ATOM   8901  C  C   . GLY A 1 67  ? -1.710  95.259  14.809  0.25 12.53 ? 67  GLY A C   4 
ATOM   8902  O  O   . GLY A 1 67  ? -0.871  94.515  15.319  0.25 12.89 ? 67  GLY A O   4 
ATOM   8903  N  N   . ILE A 1 68  ? -2.160  95.088  13.571  0.25 13.33 ? 68  ILE A N   4 
ATOM   8904  C  CA  . ILE A 1 68  ? -1.651  94.014  12.732  0.25 11.55 ? 68  ILE A CA  4 
ATOM   8905  C  C   . ILE A 1 68  ? -0.480  94.520  11.883  0.25 11.16 ? 68  ILE A C   4 
ATOM   8906  O  O   . ILE A 1 68  ? -0.066  95.673  12.013  0.25 9.42  ? 68  ILE A O   4 
ATOM   8907  C  CB  . ILE A 1 68  ? -2.775  93.414  11.857  0.25 13.62 ? 68  ILE A CB  4 
ATOM   8908  C  CG1 . ILE A 1 68  ? -3.419  94.493  10.985  0.25 14.06 ? 68  ILE A CG1 4 
ATOM   8909  C  CG2 . ILE A 1 68  ? -3.828  92.775  12.761  0.25 13.40 ? 68  ILE A CG2 4 
ATOM   8910  C  CD1 . ILE A 1 68  ? -4.559  93.987  10.118  0.25 14.51 ? 68  ILE A CD1 4 
ATOM   8911  N  N   . ALA A 1 69  ? 0.050   93.668  11.010  0.25 8.66  ? 69  ALA A N   4 
ATOM   8912  C  CA  . ALA A 1 69  ? 1.219   94.036  10.216  0.25 8.64  ? 69  ALA A CA  4 
ATOM   8913  C  C   . ALA A 1 69  ? 1.047   94.991  9.034   0.25 8.90  ? 69  ALA A C   4 
ATOM   8914  O  O   . ALA A 1 69  ? -0.045  95.191  8.512   0.25 8.23  ? 69  ALA A O   4 
ATOM   8915  C  CB  . ALA A 1 69  ? 1.930   92.770  9.745   0.25 8.57  ? 69  ALA A CB  4 
ATOM   8916  N  N   . THR A 1 70  ? 2.174   95.570  8.631   0.25 9.81  ? 70  THR A N   4 
ATOM   8917  C  CA  . THR A 1 70  ? 2.260   96.492  7.507   0.25 8.83  ? 70  THR A CA  4 
ATOM   8918  C  C   . THR A 1 70  ? 3.716   96.913  7.369   0.25 9.15  ? 70  THR A C   4 
ATOM   8919  O  O   . THR A 1 70  ? 4.556   96.572  8.206   0.25 7.41  ? 70  THR A O   4 
ATOM   8920  C  CB  . THR A 1 70  ? 1.409   97.754  7.719   0.25 9.80  ? 70  THR A CB  4 
ATOM   8921  O  OG1 . THR A 1 70  ? 1.347   98.497  6.492   0.25 10.22 ? 70  THR A OG1 4 
ATOM   8922  C  CG2 . THR A 1 70  ? 2.020   98.631  8.805   0.25 9.56  ? 70  THR A CG2 4 
ATOM   8923  N  N   . ILE A 1 71  ? 4.011   97.657  6.312   0.25 9.10  ? 71  ILE A N   4 
ATOM   8924  C  CA  . ILE A 1 71  ? 5.364   98.130  6.076   0.25 8.78  ? 71  ILE A CA  4 
ATOM   8925  C  C   . ILE A 1 71  ? 5.332   99.491  5.401   0.25 9.38  ? 71  ILE A C   4 
ATOM   8926  O  O   . ILE A 1 71  ? 4.347   99.853  4.758   0.25 8.86  ? 71  ILE A O   4 
ATOM   8927  C  CB  . ILE A 1 71  ? 6.156   97.142  5.169   0.25 8.19  ? 71  ILE A CB  4 
ATOM   8928  C  CG1 . ILE A 1 71  ? 5.362   96.838  3.891   0.25 7.87  ? 71  ILE A CG1 4 
ATOM   8929  C  CG2 . ILE A 1 71  ? 6.441   95.844  5.923   0.25 11.18 ? 71  ILE A CG2 4 
ATOM   8930  C  CD1 . ILE A 1 71  ? 6.080   95.883  2.931   0.25 7.67  ? 71  ILE A CD1 4 
ATOM   8931  N  N   . PHE A 1 72  ? 6.406   100.254 5.564   0.25 10.85 ? 72  PHE A N   4 
ATOM   8932  C  CA  . PHE A 1 72  ? 6.511   101.552 4.914   0.25 10.52 ? 72  PHE A CA  4 
ATOM   8933  C  C   . PHE A 1 72  ? 7.971   101.788 4.543   0.25 12.52 ? 72  PHE A C   4 
ATOM   8934  O  O   . PHE A 1 72  ? 8.883   101.316 5.225   0.25 11.30 ? 72  PHE A O   4 
ATOM   8935  C  CB  . PHE A 1 72  ? 5.947   102.677 5.805   0.25 9.56  ? 72  PHE A CB  4 
ATOM   8936  C  CG  . PHE A 1 72  ? 6.716   102.920 7.081   0.25 12.67 ? 72  PHE A CG  4 
ATOM   8937  C  CD1 . PHE A 1 72  ? 7.943   103.576 7.063   0.25 11.63 ? 72  PHE A CD1 4 
ATOM   8938  C  CD2 . PHE A 1 72  ? 6.186   102.533 8.305   0.25 10.82 ? 72  PHE A CD2 4 
ATOM   8939  C  CE1 . PHE A 1 72  ? 8.631   103.845 8.251   0.25 14.15 ? 72  PHE A CE1 4 
ATOM   8940  C  CE2 . PHE A 1 72  ? 6.864   102.797 9.498   0.25 14.05 ? 72  PHE A CE2 4 
ATOM   8941  C  CZ  . PHE A 1 72  ? 8.088   103.456 9.469   0.25 13.91 ? 72  PHE A CZ  4 
ATOM   8942  N  N   . GLN A 1 73  ? 8.187   102.497 3.440   0.25 13.28 ? 73  GLN A N   4 
ATOM   8943  C  CA  . GLN A 1 73  ? 9.530   102.774 2.954   0.25 14.15 ? 73  GLN A CA  4 
ATOM   8944  C  C   . GLN A 1 73  ? 10.356  103.589 3.931   0.25 15.10 ? 73  GLN A C   4 
ATOM   8945  O  O   . GLN A 1 73  ? 9.934   104.644 4.393   0.25 13.84 ? 73  GLN A O   4 
ATOM   8946  C  CB  . GLN A 1 73  ? 9.436   103.470 1.598   0.25 12.94 ? 73  GLN A CB  4 
ATOM   8947  C  CG  . GLN A 1 73  ? 8.773   102.572 0.561   0.25 16.97 ? 73  GLN A CG  4 
ATOM   8948  C  CD  . GLN A 1 73  ? 8.286   103.329 -0.654  0.25 17.30 ? 73  GLN A CD  4 
ATOM   8949  O  OE1 . GLN A 1 73  ? 7.429   104.206 -0.550  0.25 18.28 ? 73  GLN A OE1 4 
ATOM   8950  N  NE2 . GLN A 1 73  ? 8.827   102.990 -1.815  0.25 15.94 ? 73  GLN A NE2 4 
ATOM   8951  N  N   . SER A 1 74  ? 11.548  103.083 4.230   0.25 16.49 ? 74  SER A N   4 
ATOM   8952  C  CA  . SER A 1 74  ? 12.451  103.717 5.177   0.25 17.00 ? 74  SER A CA  4 
ATOM   8953  C  C   . SER A 1 74  ? 13.883  103.267 4.872   0.25 18.29 ? 74  SER A C   4 
ATOM   8954  O  O   . SER A 1 74  ? 14.274  102.148 5.202   0.25 17.57 ? 74  SER A O   4 
ATOM   8955  C  CB  . SER A 1 74  ? 12.050  103.299 6.598   0.25 18.29 ? 74  SER A CB  4 
ATOM   8956  O  OG  . SER A 1 74  ? 12.835  103.933 7.590   0.25 18.38 ? 74  SER A OG  4 
ATOM   8957  N  N   . PRO A 1 75  ? 14.679  104.130 4.219   0.25 19.48 ? 75  PRO A N   4 
ATOM   8958  C  CA  . PRO A 1 75  ? 16.060  103.771 3.891   0.25 18.90 ? 75  PRO A CA  4 
ATOM   8959  C  C   . PRO A 1 75  ? 16.824  103.314 5.128   0.25 19.11 ? 75  PRO A C   4 
ATOM   8960  O  O   . PRO A 1 75  ? 16.739  103.941 6.181   0.25 15.93 ? 75  PRO A O   4 
ATOM   8961  C  CB  . PRO A 1 75  ? 16.619  105.064 3.308   0.25 19.53 ? 75  PRO A CB  4 
ATOM   8962  C  CG  . PRO A 1 75  ? 15.424  105.658 2.628   0.25 19.41 ? 75  PRO A CG  4 
ATOM   8963  C  CD  . PRO A 1 75  ? 14.338  105.454 3.667   0.25 20.40 ? 75  PRO A CD  4 
ATOM   8964  N  N   . GLY A 1 76  ? 17.554  102.210 5.001   0.25 19.43 ? 76  GLY A N   4 
ATOM   8965  C  CA  . GLY A 1 76  ? 18.321  101.705 6.126   0.25 19.11 ? 76  GLY A CA  4 
ATOM   8966  C  C   . GLY A 1 76  ? 17.696  100.518 6.834   0.25 20.29 ? 76  GLY A C   4 
ATOM   8967  O  O   . GLY A 1 76  ? 18.406  99.606  7.255   0.25 20.57 ? 76  GLY A O   4 
ATOM   8968  N  N   . ASP A 1 77  ? 16.371  100.523 6.972   0.25 17.91 ? 77  ASP A N   4 
ATOM   8969  C  CA  . ASP A 1 77  ? 15.664  99.425  7.635   0.25 16.24 ? 77  ASP A CA  4 
ATOM   8970  C  C   . ASP A 1 77  ? 15.524  98.194  6.742   0.25 13.49 ? 77  ASP A C   4 
ATOM   8971  O  O   . ASP A 1 77  ? 15.825  98.241  5.545   0.25 11.74 ? 77  ASP A O   4 
ATOM   8972  C  CB  . ASP A 1 77  ? 14.267  99.878  8.071   0.25 17.13 ? 77  ASP A CB  4 
ATOM   8973  C  CG  . ASP A 1 77  ? 14.301  100.805 9.274   0.25 20.68 ? 77  ASP A CG  4 
ATOM   8974  O  OD1 . ASP A 1 77  ? 14.899  100.416 10.299  0.25 17.16 ? 77  ASP A OD1 4 
ATOM   8975  O  OD2 . ASP A 1 77  ? 13.726  101.915 9.194   0.25 19.58 ? 77  ASP A OD2 4 
ATOM   8976  N  N   . GLU A 1 78  ? 15.061  97.092  7.330   0.25 12.29 ? 78  GLU A N   4 
ATOM   8977  C  CA  . GLU A 1 78  ? 14.858  95.850  6.588   0.25 13.54 ? 78  GLU A CA  4 
ATOM   8978  C  C   . GLU A 1 78  ? 13.575  95.141  6.996   0.25 14.15 ? 78  GLU A C   4 
ATOM   8979  O  O   . GLU A 1 78  ? 13.092  95.294  8.119   0.25 13.17 ? 78  GLU A O   4 
ATOM   8980  C  CB  . GLU A 1 78  ? 16.037  94.886  6.783   0.25 17.65 ? 78  GLU A CB  4 
ATOM   8981  C  CG  . GLU A 1 78  ? 16.418  94.640  8.239   0.25 21.24 ? 78  GLU A CG  4 
ATOM   8982  C  CD  . GLU A 1 78  ? 17.367  93.457  8.416   0.25 24.92 ? 78  GLU A CD  4 
ATOM   8983  O  OE1 . GLU A 1 78  ? 18.242  93.258  7.546   0.25 23.60 ? 78  GLU A OE1 4 
ATOM   8984  O  OE2 . GLU A 1 78  ? 17.244  92.736  9.432   0.25 19.45 ? 78  GLU A OE2 4 
ATOM   8985  N  N   . VAL A 1 79  ? 13.027  94.370  6.061   0.25 13.06 ? 79  VAL A N   4 
ATOM   8986  C  CA  . VAL A 1 79  ? 11.816  93.599  6.291   0.25 13.23 ? 79  VAL A CA  4 
ATOM   8987  C  C   . VAL A 1 79  ? 11.981  92.223  5.664   0.25 13.91 ? 79  VAL A C   4 
ATOM   8988  O  O   . VAL A 1 79  ? 11.730  92.043  4.464   0.25 13.96 ? 79  VAL A O   4 
ATOM   8989  C  CB  . VAL A 1 79  ? 10.571  94.256  5.653   0.25 13.25 ? 79  VAL A CB  4 
ATOM   8990  C  CG1 . VAL A 1 79  ? 9.373   93.303  5.767   0.25 11.70 ? 79  VAL A CG1 4 
ATOM   8991  C  CG2 . VAL A 1 79  ? 10.263  95.576  6.343   0.25 10.48 ? 79  VAL A CG2 4 
ATOM   8992  N  N   . TRP A 1 80  ? 12.417  91.254  6.463   0.25 12.30 ? 80  TRP A N   4 
ATOM   8993  C  CA  . TRP A 1 80  ? 12.571  89.899  5.951   0.25 11.40 ? 80  TRP A CA  4 
ATOM   8994  C  C   . TRP A 1 80  ? 11.199  89.241  5.936   0.25 11.30 ? 80  TRP A C   4 
ATOM   8995  O  O   . TRP A 1 80  ? 10.308  89.637  6.691   0.25 12.59 ? 80  TRP A O   4 
ATOM   8996  C  CB  . TRP A 1 80  ? 13.528  89.084  6.829   0.25 12.77 ? 80  TRP A CB  4 
ATOM   8997  C  CG  . TRP A 1 80  ? 14.977  89.332  6.534   0.25 11.86 ? 80  TRP A CG  4 
ATOM   8998  C  CD1 . TRP A 1 80  ? 15.797  90.244  7.134   0.25 12.84 ? 80  TRP A CD1 4 
ATOM   8999  C  CD2 . TRP A 1 80  ? 15.772  88.662  5.550   0.25 11.55 ? 80  TRP A CD2 4 
ATOM   9000  N  NE1 . TRP A 1 80  ? 17.057  90.183  6.586   0.25 14.54 ? 80  TRP A NE1 4 
ATOM   9001  C  CE2 . TRP A 1 80  ? 17.070  89.221  5.609   0.25 13.67 ? 80  TRP A CE2 4 
ATOM   9002  C  CE3 . TRP A 1 80  ? 15.513  87.645  4.618   0.25 12.76 ? 80  TRP A CE3 4 
ATOM   9003  C  CZ2 . TRP A 1 80  ? 18.111  88.793  4.775   0.25 12.23 ? 80  TRP A CZ2 4 
ATOM   9004  C  CZ3 . TRP A 1 80  ? 16.549  87.220  3.786   0.25 12.31 ? 80  TRP A CZ3 4 
ATOM   9005  C  CH2 . TRP A 1 80  ? 17.833  87.796  3.872   0.25 10.49 ? 80  TRP A CH2 4 
ATOM   9006  N  N   . GLY A 1 81  ? 11.023  88.243  5.076   0.25 10.71 ? 81  GLY A N   4 
ATOM   9007  C  CA  . GLY A 1 81  ? 9.744   87.568  5.021   0.25 10.77 ? 81  GLY A CA  4 
ATOM   9008  C  C   . GLY A 1 81  ? 9.758   86.276  4.238   0.25 10.94 ? 81  GLY A C   4 
ATOM   9009  O  O   . GLY A 1 81  ? 10.796  85.833  3.739   0.25 10.02 ? 81  GLY A O   4 
ATOM   9010  N  N   . VAL A 1 82  ? 8.587   85.666  4.136   0.25 10.54 ? 82  VAL A N   4 
ATOM   9011  C  CA  . VAL A 1 82  ? 8.439   84.420  3.407   0.25 10.69 ? 82  VAL A CA  4 
ATOM   9012  C  C   . VAL A 1 82  ? 7.684   84.670  2.119   0.25 10.33 ? 82  VAL A C   4 
ATOM   9013  O  O   . VAL A 1 82  ? 6.643   85.335  2.123   0.25 9.96  ? 82  VAL A O   4 
ATOM   9014  C  CB  . VAL A 1 82  ? 7.654   83.369  4.232   0.25 9.48  ? 82  VAL A CB  4 
ATOM   9015  C  CG1 . VAL A 1 82  ? 7.308   82.172  3.354   0.25 7.05  ? 82  VAL A CG1 4 
ATOM   9016  C  CG2 . VAL A 1 82  ? 8.488   82.922  5.439   0.25 7.19  ? 82  VAL A CG2 4 
ATOM   9017  N  N   . VAL A 1 83  ? 8.226   84.152  1.021   0.25 11.94 ? 83  VAL A N   4 
ATOM   9018  C  CA  . VAL A 1 83  ? 7.589   84.264  -0.285  0.25 11.10 ? 83  VAL A CA  4 
ATOM   9019  C  C   . VAL A 1 83  ? 6.850   82.944  -0.510  0.25 11.32 ? 83  VAL A C   4 
ATOM   9020  O  O   . VAL A 1 83  ? 7.410   81.867  -0.288  0.25 11.26 ? 83  VAL A O   4 
ATOM   9021  C  CB  . VAL A 1 83  ? 8.638   84.459  -1.413  0.25 12.71 ? 83  VAL A CB  4 
ATOM   9022  C  CG1 . VAL A 1 83  ? 7.952   84.439  -2.780  0.25 11.00 ? 83  VAL A CG1 4 
ATOM   9023  C  CG2 . VAL A 1 83  ? 9.369   85.785  -1.226  0.25 13.30 ? 83  VAL A CG2 4 
ATOM   9024  N  N   . TRP A 1 84  ? 5.586   83.032  -0.918  0.25 10.94 ? 84  TRP A N   4 
ATOM   9025  C  CA  . TRP A 1 84  ? 4.773   81.849  -1.173  0.25 9.14  ? 84  TRP A CA  4 
ATOM   9026  C  C   . TRP A 1 84  ? 4.388   81.784  -2.641  0.25 12.04 ? 84  TRP A C   4 
ATOM   9027  O  O   . TRP A 1 84  ? 4.248   82.817  -3.301  0.25 10.27 ? 84  TRP A O   4 
ATOM   9028  C  CB  . TRP A 1 84  ? 3.475   81.879  -0.359  0.25 9.29  ? 84  TRP A CB  4 
ATOM   9029  C  CG  . TRP A 1 84  ? 3.663   82.000  1.120   0.25 9.04  ? 84  TRP A CG  4 
ATOM   9030  C  CD1 . TRP A 1 84  ? 3.678   83.147  1.857   0.25 9.82  ? 84  TRP A CD1 4 
ATOM   9031  C  CD2 . TRP A 1 84  ? 3.894   80.926  2.037   0.25 11.19 ? 84  TRP A CD2 4 
ATOM   9032  N  NE1 . TRP A 1 84  ? 3.908   82.854  3.184   0.25 10.30 ? 84  TRP A NE1 4 
ATOM   9033  C  CE2 . TRP A 1 84  ? 4.045   81.499  3.319   0.25 9.56  ? 84  TRP A CE2 4 
ATOM   9034  C  CE3 . TRP A 1 84  ? 3.989   79.536  1.898   0.25 9.79  ? 84  TRP A CE3 4 
ATOM   9035  C  CZ2 . TRP A 1 84  ? 4.289   80.725  4.458   0.25 12.53 ? 84  TRP A CZ2 4 
ATOM   9036  C  CZ3 . TRP A 1 84  ? 4.232   78.769  3.030   0.25 12.34 ? 84  TRP A CZ3 4 
ATOM   9037  C  CH2 . TRP A 1 84  ? 4.380   79.370  4.296   0.25 7.84  ? 84  TRP A CH2 4 
ATOM   9038  N  N   . LYS A 1 85  ? 4.216   80.570  -3.153  0.25 13.01 ? 85  LYS A N   4 
ATOM   9039  C  CA  . LYS A 1 85  ? 3.796   80.405  -4.535  0.25 15.07 ? 85  LYS A CA  4 
ATOM   9040  C  C   . LYS A 1 85  ? 2.382   79.826  -4.513  0.25 14.58 ? 85  LYS A C   4 
ATOM   9041  O  O   . LYS A 1 85  ? 2.142   78.789  -3.900  0.25 13.45 ? 85  LYS A O   4 
ATOM   9042  C  CB  . LYS A 1 85  ? 4.744   79.464  -5.281  0.25 16.79 ? 85  LYS A CB  4 
ATOM   9043  C  CG  . LYS A 1 85  ? 4.425   79.325  -6.760  0.25 18.05 ? 85  LYS A CG  4 
ATOM   9044  C  CD  . LYS A 1 85  ? 5.521   78.559  -7.484  0.25 22.12 ? 85  LYS A CD  4 
ATOM   9045  C  CE  . LYS A 1 85  ? 5.238   78.464  -8.973  0.25 26.56 ? 85  LYS A CE  4 
ATOM   9046  N  NZ  . LYS A 1 85  ? 6.376   77.850  -9.713  0.25 27.16 ? 85  LYS A NZ  4 
HETATM 9047  N  N   . MSE A 1 86  ? 1.449   80.505  -5.173  0.25 14.98 ? 86  MSE A N   4 
HETATM 9048  C  CA  . MSE A 1 86  ? 0.061   80.058  -5.216  0.25 16.79 ? 86  MSE A CA  4 
HETATM 9049  C  C   . MSE A 1 86  ? -0.499  80.216  -6.624  0.25 18.36 ? 86  MSE A C   4 
HETATM 9050  O  O   . MSE A 1 86  ? 0.132   80.839  -7.480  0.25 15.15 ? 86  MSE A O   4 
HETATM 9051  C  CB  . MSE A 1 86  ? -0.781  80.877  -4.239  0.25 19.47 ? 86  MSE A CB  4 
HETATM 9052  C  CG  . MSE A 1 86  ? -0.241  80.883  -2.816  0.25 21.01 ? 86  MSE A CG  4 
HETATM 9053  SE SE  . MSE A 1 86  ? -1.242  82.048  -1.652  0.25 28.57 ? 86  MSE A SE  4 
HETATM 9054  C  CE  . MSE A 1 86  ? -0.607  83.739  -2.322  0.25 26.92 ? 86  MSE A CE  4 
ATOM   9055  N  N   . ASN A 1 87  ? -1.682  79.652  -6.864  0.25 19.91 ? 87  ASN A N   4 
ATOM   9056  C  CA  . ASN A 1 87  ? -2.307  79.749  -8.180  0.25 22.06 ? 87  ASN A CA  4 
ATOM   9057  C  C   . ASN A 1 87  ? -2.857  81.155  -8.392  0.25 21.08 ? 87  ASN A C   4 
ATOM   9058  O  O   . ASN A 1 87  ? -3.411  81.751  -7.468  0.25 17.96 ? 87  ASN A O   4 
ATOM   9059  C  CB  . ASN A 1 87  ? -3.439  78.729  -8.309  0.25 26.50 ? 87  ASN A CB  4 
ATOM   9060  C  CG  . ASN A 1 87  ? -4.049  78.713  -9.700  0.25 29.93 ? 87  ASN A CG  4 
ATOM   9061  O  OD1 . ASN A 1 87  ? -4.612  79.707  -10.155 0.25 32.55 ? 87  ASN A OD1 4 
ATOM   9062  N  ND2 . ASN A 1 87  ? -3.931  77.582  -10.384 0.25 33.08 ? 87  ASN A ND2 4 
ATOM   9063  N  N   . LYS A 1 88  ? -2.706  81.681  -9.605  0.25 20.63 ? 88  LYS A N   4 
ATOM   9064  C  CA  . LYS A 1 88  ? -3.189  83.025  -9.921  0.25 23.17 ? 88  LYS A CA  4 
ATOM   9065  C  C   . LYS A 1 88  ? -4.687  83.181  -9.686  0.25 23.38 ? 88  LYS A C   4 
ATOM   9066  O  O   . LYS A 1 88  ? -5.170  84.285  -9.430  0.25 21.79 ? 88  LYS A O   4 
ATOM   9067  C  CB  . LYS A 1 88  ? -2.857  83.393  -11.370 0.25 24.93 ? 88  LYS A CB  4 
ATOM   9068  C  CG  . LYS A 1 88  ? -1.395  83.747  -11.605 0.25 27.20 ? 88  LYS A CG  4 
ATOM   9069  C  CD  . LYS A 1 88  ? -1.174  84.218  -13.035 0.25 29.06 ? 88  LYS A CD  4 
ATOM   9070  C  CE  . LYS A 1 88  ? 0.265   84.640  -13.267 0.25 30.23 ? 88  LYS A CE  4 
ATOM   9071  N  NZ  . LYS A 1 88  ? 0.495   85.074  -14.670 0.25 32.12 ? 88  LYS A NZ  4 
ATOM   9072  N  N   . SER A 1 89  ? -5.416  82.075  -9.778  0.25 23.73 ? 89  SER A N   4 
ATOM   9073  C  CA  . SER A 1 89  ? -6.858  82.086  -9.558  0.25 24.30 ? 89  SER A CA  4 
ATOM   9074  C  C   . SER A 1 89  ? -7.154  82.336  -8.081  0.25 24.86 ? 89  SER A C   4 
ATOM   9075  O  O   . SER A 1 89  ? -8.303  82.564  -7.695  0.25 23.78 ? 89  SER A O   4 
ATOM   9076  C  CB  . SER A 1 89  ? -7.460  80.743  -9.963  0.25 24.48 ? 89  SER A CB  4 
ATOM   9077  O  OG  . SER A 1 89  ? -6.971  79.712  -9.124  0.25 26.45 ? 89  SER A OG  4 
ATOM   9078  N  N   . ASN A 1 90  ? -6.113  82.288  -7.259  0.25 23.94 ? 90  ASN A N   4 
ATOM   9079  C  CA  . ASN A 1 90  ? -6.262  82.493  -5.824  0.25 23.90 ? 90  ASN A CA  4 
ATOM   9080  C  C   . ASN A 1 90  ? -6.162  83.972  -5.476  0.25 22.72 ? 90  ASN A C   4 
ATOM   9081  O  O   . ASN A 1 90  ? -6.405  84.374  -4.337  0.25 22.03 ? 90  ASN A O   4 
ATOM   9082  C  CB  . ASN A 1 90  ? -5.175  81.723  -5.071  0.25 25.94 ? 90  ASN A CB  4 
ATOM   9083  C  CG  . ASN A 1 90  ? -5.530  81.489  -3.622  0.25 25.86 ? 90  ASN A CG  4 
ATOM   9084  O  OD1 . ASN A 1 90  ? -4.658  81.325  -2.772  0.25 28.94 ? 90  ASN A OD1 4 
ATOM   9085  N  ND2 . ASN A 1 90  ? -6.822  81.456  -3.333  0.25 30.30 ? 90  ASN A ND2 4 
ATOM   9086  N  N   . LEU A 1 91  ? -5.807  84.776  -6.472  0.25 21.73 ? 91  LEU A N   4 
ATOM   9087  C  CA  . LEU A 1 91  ? -5.649  86.214  -6.301  0.25 20.60 ? 91  LEU A CA  4 
ATOM   9088  C  C   . LEU A 1 91  ? -6.834  86.850  -5.571  0.25 20.86 ? 91  LEU A C   4 
ATOM   9089  O  O   . LEU A 1 91  ? -6.654  87.572  -4.586  0.25 18.99 ? 91  LEU A O   4 
ATOM   9090  C  CB  . LEU A 1 91  ? -5.463  86.872  -7.670  0.25 21.78 ? 91  LEU A CB  4 
ATOM   9091  C  CG  . LEU A 1 91  ? -4.464  88.027  -7.773  0.25 24.27 ? 91  LEU A CG  4 
ATOM   9092  C  CD1 . LEU A 1 91  ? -3.100  87.600  -7.247  0.25 23.12 ? 91  LEU A CD1 4 
ATOM   9093  C  CD2 . LEU A 1 91  ? -4.351  88.461  -9.229  0.25 26.35 ? 91  LEU A CD2 4 
ATOM   9094  N  N   . ASN A 1 92  ? -8.043  86.576  -6.053  0.25 18.60 ? 92  ASN A N   4 
ATOM   9095  C  CA  . ASN A 1 92  ? -9.255  87.123  -5.447  0.25 19.48 ? 92  ASN A CA  4 
ATOM   9096  C  C   . ASN A 1 92  ? -9.338  86.907  -3.941  0.25 18.07 ? 92  ASN A C   4 
ATOM   9097  O  O   . ASN A 1 92  ? -9.413  87.867  -3.177  0.25 17.64 ? 92  ASN A O   4 
ATOM   9098  C  CB  . ASN A 1 92  ? -10.501 86.533  -6.114  0.25 20.83 ? 92  ASN A CB  4 
ATOM   9099  C  CG  . ASN A 1 92  ? -10.833 87.205  -7.431  0.25 23.53 ? 92  ASN A CG  4 
ATOM   9100  O  OD1 . ASN A 1 92  ? -11.163 88.392  -7.470  0.25 29.16 ? 92  ASN A OD1 4 
ATOM   9101  N  ND2 . ASN A 1 92  ? -10.747 86.451  -8.518  0.25 24.74 ? 92  ASN A ND2 4 
ATOM   9102  N  N   . SER A 1 93  ? -9.331  85.650  -3.508  0.25 16.80 ? 93  SER A N   4 
ATOM   9103  C  CA  . SER A 1 93  ? -9.418  85.366  -2.082  0.25 15.46 ? 93  SER A CA  4 
ATOM   9104  C  C   . SER A 1 93  ? -8.345  86.092  -1.272  0.25 15.08 ? 93  SER A C   4 
ATOM   9105  O  O   . SER A 1 93  ? -8.644  86.686  -0.238  0.25 14.84 ? 93  SER A O   4 
ATOM   9106  C  CB  . SER A 1 93  ? -9.311  83.866  -1.823  0.25 16.85 ? 93  SER A CB  4 
ATOM   9107  O  OG  . SER A 1 93  ? -9.486  83.598  -0.444  0.25 15.38 ? 93  SER A OG  4 
ATOM   9108  N  N   . LEU A 1 94  ? -7.098  86.039  -1.733  0.25 15.15 ? 94  LEU A N   4 
ATOM   9109  C  CA  . LEU A 1 94  ? -6.018  86.702  -1.020  0.25 12.21 ? 94  LEU A CA  4 
ATOM   9110  C  C   . LEU A 1 94  ? -6.373  88.181  -0.927  0.25 12.56 ? 94  LEU A C   4 
ATOM   9111  O  O   . LEU A 1 94  ? -6.215  88.807  0.124   0.25 11.71 ? 94  LEU A O   4 
ATOM   9112  C  CB  . LEU A 1 94  ? -4.689  86.502  -1.755  0.25 14.26 ? 94  LEU A CB  4 
ATOM   9113  C  CG  . LEU A 1 94  ? -3.406  86.942  -1.038  0.25 12.80 ? 94  LEU A CG  4 
ATOM   9114  C  CD1 . LEU A 1 94  ? -3.242  86.163  0.258   0.25 14.83 ? 94  LEU A CD1 4 
ATOM   9115  C  CD2 . LEU A 1 94  ? -2.207  86.698  -1.945  0.25 14.69 ? 94  LEU A CD2 4 
ATOM   9116  N  N   . ASP A 1 95  ? -6.878  88.732  -2.027  0.25 13.77 ? 95  ASP A N   4 
ATOM   9117  C  CA  . ASP A 1 95  ? -7.287  90.133  -2.071  0.25 14.07 ? 95  ASP A CA  4 
ATOM   9118  C  C   . ASP A 1 95  ? -8.375  90.418  -1.029  0.25 14.49 ? 95  ASP A C   4 
ATOM   9119  O  O   . ASP A 1 95  ? -8.340  91.441  -0.344  0.25 11.31 ? 95  ASP A O   4 
ATOM   9120  C  CB  . ASP A 1 95  ? -7.803  90.483  -3.474  0.25 13.67 ? 95  ASP A CB  4 
ATOM   9121  C  CG  . ASP A 1 95  ? -6.746  91.160  -4.339  0.25 18.40 ? 95  ASP A CG  4 
ATOM   9122  O  OD1 . ASP A 1 95  ? -5.545  90.820  -4.203  0.25 21.87 ? 95  ASP A OD1 4 
ATOM   9123  O  OD2 . ASP A 1 95  ? -7.122  92.025  -5.163  0.25 15.66 ? 95  ASP A OD2 4 
ATOM   9124  N  N   . GLU A 1 96  ? -9.343  89.516  -0.904  0.25 14.73 ? 96  GLU A N   4 
ATOM   9125  C  CA  . GLU A 1 96  ? -10.416 89.719  0.070   0.25 16.15 ? 96  GLU A CA  4 
ATOM   9126  C  C   . GLU A 1 96  ? -9.901  89.506  1.497   0.25 14.58 ? 96  GLU A C   4 
ATOM   9127  O  O   . GLU A 1 96  ? -10.217 90.277  2.401   0.25 13.82 ? 96  GLU A O   4 
ATOM   9128  C  CB  . GLU A 1 96  ? -11.596 88.780  -0.227  0.25 19.36 ? 96  GLU A CB  4 
ATOM   9129  C  CG  . GLU A 1 96  ? -12.816 89.000  0.672   0.25 21.29 ? 96  GLU A CG  4 
ATOM   9130  C  CD  . GLU A 1 96  ? -12.798 88.152  1.945   0.25 26.09 ? 96  GLU A CD  4 
ATOM   9131  O  OE1 . GLU A 1 96  ? -11.723 87.616  2.304   0.25 25.17 ? 96  GLU A OE1 4 
ATOM   9132  O  OE2 . GLU A 1 96  ? -13.865 88.027  2.595   0.25 23.25 ? 96  GLU A OE2 4 
ATOM   9133  N  N   . GLN A 1 97  ? -9.100  88.465  1.696   0.25 13.97 ? 97  GLN A N   4 
ATOM   9134  C  CA  . GLN A 1 97  ? -8.540  88.179  3.017   0.25 15.50 ? 97  GLN A CA  4 
ATOM   9135  C  C   . GLN A 1 97  ? -7.855  89.414  3.604   0.25 16.38 ? 97  GLN A C   4 
ATOM   9136  O  O   . GLN A 1 97  ? -7.904  89.657  4.819   0.25 13.49 ? 97  GLN A O   4 
ATOM   9137  C  CB  . GLN A 1 97  ? -7.533  87.037  2.915   0.25 16.52 ? 97  GLN A CB  4 
ATOM   9138  C  CG  . GLN A 1 97  ? -8.143  85.712  2.490   0.25 17.01 ? 97  GLN A CG  4 
ATOM   9139  C  CD  . GLN A 1 97  ? -7.087  84.671  2.188   0.25 16.67 ? 97  GLN A CD  4 
ATOM   9140  O  OE1 . GLN A 1 97  ? -6.120  84.521  2.935   0.25 17.92 ? 97  GLN A OE1 4 
ATOM   9141  N  NE2 . GLN A 1 97  ? -7.271  83.939  1.094   0.25 13.04 ? 97  GLN A NE2 4 
ATOM   9142  N  N   . GLU A 1 98  ? -7.217  90.191  2.733   0.25 16.22 ? 98  GLU A N   4 
ATOM   9143  C  CA  . GLU A 1 98  ? -6.511  91.405  3.143   0.25 18.76 ? 98  GLU A CA  4 
ATOM   9144  C  C   . GLU A 1 98  ? -7.459  92.610  3.126   0.25 18.87 ? 98  GLU A C   4 
ATOM   9145  O  O   . GLU A 1 98  ? -7.036  93.750  3.313   0.25 20.14 ? 98  GLU A O   4 
ATOM   9146  C  CB  . GLU A 1 98  ? -5.325  91.657  2.204   0.25 20.92 ? 98  GLU A CB  4 
ATOM   9147  C  CG  . GLU A 1 98  ? -4.486  90.405  1.919   0.25 23.15 ? 98  GLU A CG  4 
ATOM   9148  C  CD  . GLU A 1 98  ? -3.761  89.880  3.147   0.25 27.20 ? 98  GLU A CD  4 
ATOM   9149  O  OE1 . GLU A 1 98  ? -4.415  89.708  4.201   0.25 28.33 ? 98  GLU A OE1 4 
ATOM   9150  O  OE2 . GLU A 1 98  ? -2.537  89.631  3.055   0.25 25.29 ? 98  GLU A OE2 4 
ATOM   9151  N  N   . GLY A 1 99  ? -8.741  92.343  2.892   0.25 18.82 ? 99  GLY A N   4 
ATOM   9152  C  CA  . GLY A 1 99  ? -9.744  93.398  2.865   0.25 16.78 ? 99  GLY A CA  4 
ATOM   9153  C  C   . GLY A 1 99  ? -9.350  94.633  2.080   0.25 16.68 ? 99  GLY A C   4 
ATOM   9154  O  O   . GLY A 1 99  ? -9.657  95.760  2.475   0.25 15.51 ? 99  GLY A O   4 
ATOM   9155  N  N   . VAL A 1 100 ? -8.669  94.429  0.961   0.25 17.41 ? 100 VAL A N   4 
ATOM   9156  C  CA  . VAL A 1 100 ? -8.248  95.545  0.130   0.25 18.02 ? 100 VAL A CA  4 
ATOM   9157  C  C   . VAL A 1 100 ? -9.427  96.458  -0.197  0.25 21.33 ? 100 VAL A C   4 
ATOM   9158  O  O   . VAL A 1 100 ? -9.272  97.674  -0.254  0.25 21.61 ? 100 VAL A O   4 
ATOM   9159  C  CB  . VAL A 1 100 ? -7.607  95.043  -1.178  0.25 16.99 ? 100 VAL A CB  4 
ATOM   9160  C  CG1 . VAL A 1 100 ? -7.273  96.219  -2.093  0.25 17.03 ? 100 VAL A CG1 4 
ATOM   9161  C  CG2 . VAL A 1 100 ? -6.343  94.251  -0.853  0.25 16.47 ? 100 VAL A CG2 4 
ATOM   9162  N  N   . LYS A 1 101 ? -10.607 95.873  -0.389  0.25 23.30 ? 101 LYS A N   4 
ATOM   9163  C  CA  . LYS A 1 101 ? -11.798 96.654  -0.716  0.25 26.04 ? 101 LYS A CA  4 
ATOM   9164  C  C   . LYS A 1 101 ? -12.390 97.380  0.487   0.25 26.34 ? 101 LYS A C   4 
ATOM   9165  O  O   . LYS A 1 101 ? -13.348 98.143  0.355   0.25 26.32 ? 101 LYS A O   4 
ATOM   9166  C  CB  . LYS A 1 101 ? -12.864 95.758  -1.356  0.25 28.04 ? 101 LYS A CB  4 
ATOM   9167  C  CG  . LYS A 1 101 ? -12.431 95.158  -2.682  0.25 29.20 ? 101 LYS A CG  4 
ATOM   9168  C  CD  . LYS A 1 101 ? -13.560 94.414  -3.377  0.25 31.45 ? 101 LYS A CD  4 
ATOM   9169  C  CE  . LYS A 1 101 ? -13.091 93.838  -4.710  0.25 31.20 ? 101 LYS A CE  4 
ATOM   9170  N  NZ  . LYS A 1 101 ? -14.181 93.137  -5.444  0.25 36.00 ? 101 LYS A NZ  4 
ATOM   9171  N  N   . SER A 1 102 ? -11.814 97.150  1.660   0.25 25.06 ? 102 SER A N   4 
ATOM   9172  C  CA  . SER A 1 102 ? -12.290 97.800  2.874   0.25 23.81 ? 102 SER A CA  4 
ATOM   9173  C  C   . SER A 1 102 ? -11.340 98.938  3.256   0.25 22.47 ? 102 SER A C   4 
ATOM   9174  O  O   . SER A 1 102 ? -11.539 99.627  4.259   0.25 22.49 ? 102 SER A O   4 
ATOM   9175  C  CB  . SER A 1 102 ? -12.379 96.780  4.010   0.25 25.00 ? 102 SER A CB  4 
ATOM   9176  O  OG  . SER A 1 102 ? -12.935 97.360  5.174   0.25 27.21 ? 102 SER A OG  4 
ATOM   9177  N  N   . GLY A 1 103 ? -10.302 99.123  2.447   0.25 18.66 ? 103 GLY A N   4 
ATOM   9178  C  CA  . GLY A 1 103 ? -9.338  100.175 2.706   0.25 17.44 ? 103 GLY A CA  4 
ATOM   9179  C  C   . GLY A 1 103 ? -8.296  99.832  3.757   0.25 16.01 ? 103 GLY A C   4 
ATOM   9180  O  O   . GLY A 1 103 ? -7.511  100.696 4.152   0.25 15.45 ? 103 GLY A O   4 
HETATM 9181  N  N   . MSE A 1 104 ? -8.274  98.579  4.207   0.25 13.93 ? 104 MSE A N   4 
HETATM 9182  C  CA  . MSE A 1 104 ? -7.315  98.151  5.227   0.25 12.30 ? 104 MSE A CA  4 
HETATM 9183  C  C   . MSE A 1 104 ? -5.924  97.984  4.639   0.25 11.49 ? 104 MSE A C   4 
HETATM 9184  O  O   . MSE A 1 104 ? -4.922  98.364  5.255   0.25 8.20  ? 104 MSE A O   4 
HETATM 9185  C  CB  . MSE A 1 104 ? -7.760  96.831  5.858   0.25 13.76 ? 104 MSE A CB  4 
HETATM 9186  C  CG  . MSE A 1 104 ? -9.050  96.924  6.657   0.25 15.35 ? 104 MSE A CG  4 
HETATM 9187  SE SE  . MSE A 1 104 ? -9.495  95.250  7.514   0.25 18.03 ? 104 MSE A SE  4 
HETATM 9188  C  CE  . MSE A 1 104 ? -7.838  94.948  8.457   0.25 13.67 ? 104 MSE A CE  4 
ATOM   9189  N  N   . TYR A 1 105 ? -5.873  97.383  3.457   0.25 10.03 ? 105 TYR A N   4 
ATOM   9190  C  CA  . TYR A 1 105 ? -4.618  97.169  2.745   0.25 10.20 ? 105 TYR A CA  4 
ATOM   9191  C  C   . TYR A 1 105 ? -4.859  97.463  1.283   0.25 9.50  ? 105 TYR A C   4 
ATOM   9192  O  O   . TYR A 1 105 ? -5.998  97.459  0.820   0.25 8.43  ? 105 TYR A O   4 
ATOM   9193  C  CB  . TYR A 1 105 ? -4.136  95.717  2.849   0.25 9.28  ? 105 TYR A CB  4 
ATOM   9194  C  CG  . TYR A 1 105 ? -3.616  95.302  4.203   0.25 8.88  ? 105 TYR A CG  4 
ATOM   9195  C  CD1 . TYR A 1 105 ? -4.462  94.726  5.148   0.25 11.11 ? 105 TYR A CD1 4 
ATOM   9196  C  CD2 . TYR A 1 105 ? -2.271  95.470  4.535   0.25 9.94  ? 105 TYR A CD2 4 
ATOM   9197  C  CE1 . TYR A 1 105 ? -3.987  94.324  6.388   0.25 10.24 ? 105 TYR A CE1 4 
ATOM   9198  C  CE2 . TYR A 1 105 ? -1.784  95.070  5.778   0.25 10.58 ? 105 TYR A CE2 4 
ATOM   9199  C  CZ  . TYR A 1 105 ? -2.651  94.497  6.697   0.25 9.12  ? 105 TYR A CZ  4 
ATOM   9200  O  OH  . TYR A 1 105 ? -2.187  94.099  7.931   0.25 12.21 ? 105 TYR A OH  4 
ATOM   9201  N  N   . VAL A 1 106 ? -3.773  97.721  0.569   0.25 8.27  ? 106 VAL A N   4 
ATOM   9202  C  CA  . VAL A 1 106 ? -3.818  97.970  -0.858  0.25 8.06  ? 106 VAL A CA  4 
ATOM   9203  C  C   . VAL A 1 106 ? -2.845  96.946  -1.430  0.25 7.64  ? 106 VAL A C   4 
ATOM   9204  O  O   . VAL A 1 106 ? -1.924  96.513  -0.729  0.25 7.83  ? 106 VAL A O   4 
ATOM   9205  C  CB  . VAL A 1 106 ? -3.334  99.404  -1.207  0.25 10.40 ? 106 VAL A CB  4 
ATOM   9206  C  CG1 . VAL A 1 106 ? -1.889  99.592  -0.780  0.25 10.19 ? 106 VAL A CG1 4 
ATOM   9207  C  CG2 . VAL A 1 106 ? -3.483  99.657  -2.718  0.25 8.69  ? 106 VAL A CG2 4 
ATOM   9208  N  N   . VAL A 1 107 ? -3.069  96.527  -2.670  0.25 3.69  ? 107 VAL A N   4 
ATOM   9209  C  CA  . VAL A 1 107 ? -2.171  95.580  -3.320  0.25 6.80  ? 107 VAL A CA  4 
ATOM   9210  C  C   . VAL A 1 107 ? -0.876  96.323  -3.649  0.25 7.95  ? 107 VAL A C   4 
ATOM   9211  O  O   . VAL A 1 107 ? -0.899  97.520  -3.919  0.25 7.09  ? 107 VAL A O   4 
ATOM   9212  C  CB  . VAL A 1 107 ? -2.754  95.056  -4.655  0.25 6.25  ? 107 VAL A CB  4 
ATOM   9213  C  CG1 . VAL A 1 107 ? -1.750  94.120  -5.322  0.25 8.95  ? 107 VAL A CG1 4 
ATOM   9214  C  CG2 . VAL A 1 107 ? -4.078  94.318  -4.418  0.25 5.61  ? 107 VAL A CG2 4 
ATOM   9215  N  N   . ILE A 1 108 ? 0.252   95.626  -3.615  0.25 7.38  ? 108 ILE A N   4 
ATOM   9216  C  CA  . ILE A 1 108 ? 1.516   96.262  -3.961  0.25 7.45  ? 108 ILE A CA  4 
ATOM   9217  C  C   . ILE A 1 108 ? 2.429   95.264  -4.644  0.25 7.76  ? 108 ILE A C   4 
ATOM   9218  O  O   . ILE A 1 108 ? 2.192   94.060  -4.605  0.25 8.02  ? 108 ILE A O   4 
ATOM   9219  C  CB  . ILE A 1 108 ? 2.284   96.806  -2.723  0.25 8.54  ? 108 ILE A CB  4 
ATOM   9220  C  CG1 . ILE A 1 108 ? 2.919   95.652  -1.938  0.25 4.34  ? 108 ILE A CG1 4 
ATOM   9221  C  CG2 . ILE A 1 108 ? 1.344   97.595  -1.819  0.25 6.79  ? 108 ILE A CG2 4 
ATOM   9222  C  CD1 . ILE A 1 108 ? 3.830   96.121  -0.794  0.25 8.97  ? 108 ILE A CD1 4 
ATOM   9223  N  N   . GLU A 1 109 ? 3.463   95.788  -5.288  0.25 9.57  ? 109 GLU A N   4 
ATOM   9224  C  CA  . GLU A 1 109 ? 4.467   94.966  -5.938  0.25 10.19 ? 109 GLU A CA  4 
ATOM   9225  C  C   . GLU A 1 109 ? 5.782   95.401  -5.317  0.25 9.99  ? 109 GLU A C   4 
ATOM   9226  O  O   . GLU A 1 109 ? 6.017   96.591  -5.112  0.25 8.52  ? 109 GLU A O   4 
ATOM   9227  C  CB  . GLU A 1 109 ? 4.512   95.221  -7.442  0.25 11.75 ? 109 GLU A CB  4 
ATOM   9228  C  CG  . GLU A 1 109 ? 5.690   94.556  -8.132  0.25 12.93 ? 109 GLU A CG  4 
ATOM   9229  C  CD  . GLU A 1 109 ? 5.716   94.818  -9.627  0.25 16.20 ? 109 GLU A CD  4 
ATOM   9230  O  OE1 . GLU A 1 109 ? 4.820   94.320  -10.338 0.25 15.24 ? 109 GLU A OE1 4 
ATOM   9231  O  OE2 . GLU A 1 109 ? 6.628   95.531  -10.091 0.25 17.88 ? 109 GLU A OE2 4 
ATOM   9232  N  N   . VAL A 1 110 ? 6.628   94.430  -5.000  0.25 10.23 ? 110 VAL A N   4 
ATOM   9233  C  CA  . VAL A 1 110 ? 7.926   94.716  -4.414  0.25 10.55 ? 110 VAL A CA  4 
ATOM   9234  C  C   . VAL A 1 110 ? 8.939   93.728  -4.961  0.25 11.10 ? 110 VAL A C   4 
ATOM   9235  O  O   . VAL A 1 110 ? 8.587   92.641  -5.410  0.25 11.75 ? 110 VAL A O   4 
ATOM   9236  C  CB  . VAL A 1 110 ? 7.921   94.572  -2.874  0.25 11.84 ? 110 VAL A CB  4 
ATOM   9237  C  CG1 . VAL A 1 110 ? 6.987   95.581  -2.249  0.25 8.27  ? 110 VAL A CG1 4 
ATOM   9238  C  CG2 . VAL A 1 110 ? 7.525   93.159  -2.487  0.25 8.54  ? 110 VAL A CG2 4 
ATOM   9239  N  N   . LYS A 1 111 ? 10.202  94.124  -4.934  0.25 12.91 ? 111 LYS A N   4 
ATOM   9240  C  CA  . LYS A 1 111 ? 11.266  93.258  -5.395  0.25 13.64 ? 111 LYS A CA  4 
ATOM   9241  C  C   . LYS A 1 111 ? 12.022  92.871  -4.143  0.25 14.07 ? 111 LYS A C   4 
ATOM   9242  O  O   . LYS A 1 111 ? 12.490  93.738  -3.404  0.25 13.79 ? 111 LYS A O   4 
ATOM   9243  C  CB  . LYS A 1 111 ? 12.165  94.001  -6.387  0.25 15.03 ? 111 LYS A CB  4 
ATOM   9244  C  CG  . LYS A 1 111 ? 11.422  94.392  -7.663  0.25 17.70 ? 111 LYS A CG  4 
ATOM   9245  C  CD  . LYS A 1 111 ? 12.341  94.970  -8.723  0.25 20.92 ? 111 LYS A CD  4 
ATOM   9246  C  CE  . LYS A 1 111 ? 11.565  95.227  -10.015 0.25 22.96 ? 111 LYS A CE  4 
ATOM   9247  N  NZ  . LYS A 1 111 ? 12.409  95.824  -11.084 0.25 26.22 ? 111 LYS A NZ  4 
ATOM   9248  N  N   . VAL A 1 112 ? 12.094  91.568  -3.885  0.25 14.39 ? 112 VAL A N   4 
ATOM   9249  C  CA  . VAL A 1 112 ? 12.792  91.050  -2.716  0.25 13.63 ? 112 VAL A CA  4 
ATOM   9250  C  C   . VAL A 1 112 ? 13.914  90.119  -3.160  0.25 15.88 ? 112 VAL A C   4 
ATOM   9251  O  O   . VAL A 1 112 ? 13.771  89.380  -4.136  0.25 14.29 ? 112 VAL A O   4 
ATOM   9252  C  CB  . VAL A 1 112 ? 11.834  90.290  -1.784  0.25 12.90 ? 112 VAL A CB  4 
ATOM   9253  C  CG1 . VAL A 1 112 ? 10.770  91.247  -1.247  0.25 12.17 ? 112 VAL A CG1 4 
ATOM   9254  C  CG2 . VAL A 1 112 ? 11.175  89.145  -2.537  0.25 11.20 ? 112 VAL A CG2 4 
ATOM   9255  N  N   . ALA A 1 113 ? 15.029  90.162  -2.437  0.25 16.31 ? 113 ALA A N   4 
ATOM   9256  C  CA  . ALA A 1 113 ? 16.190  89.344  -2.767  0.25 15.98 ? 113 ALA A CA  4 
ATOM   9257  C  C   . ALA A 1 113 ? 16.391  88.190  -1.802  0.25 15.66 ? 113 ALA A C   4 
ATOM   9258  O  O   . ALA A 1 113 ? 16.315  88.362  -0.586  0.25 16.49 ? 113 ALA A O   4 
ATOM   9259  C  CB  . ALA A 1 113 ? 17.441  90.213  -2.791  0.25 14.08 ? 113 ALA A CB  4 
ATOM   9260  N  N   . THR A 1 114 ? 16.654  87.012  -2.358  0.25 16.34 ? 114 THR A N   4 
ATOM   9261  C  CA  . THR A 1 114 ? 16.894  85.819  -1.563  0.25 16.92 ? 114 THR A CA  4 
ATOM   9262  C  C   . THR A 1 114 ? 18.223  86.021  -0.845  0.25 19.01 ? 114 THR A C   4 
ATOM   9263  O  O   . THR A 1 114 ? 18.953  86.968  -1.138  0.25 16.52 ? 114 THR A O   4 
ATOM   9264  C  CB  . THR A 1 114 ? 17.007  84.575  -2.456  0.25 15.94 ? 114 THR A CB  4 
ATOM   9265  O  OG1 . THR A 1 114 ? 18.250  84.611  -3.171  0.25 15.33 ? 114 THR A OG1 4 
ATOM   9266  C  CG2 . THR A 1 114 ? 15.862  84.540  -3.456  0.25 14.01 ? 114 THR A CG2 4 
ATOM   9267  N  N   . GLN A 1 115 ? 18.537  85.132  0.090   0.25 19.94 ? 115 GLN A N   4 
ATOM   9268  C  CA  . GLN A 1 115 ? 19.782  85.234  0.835   0.25 22.69 ? 115 GLN A CA  4 
ATOM   9269  C  C   . GLN A 1 115 ? 20.994  85.001  -0.065  0.25 21.88 ? 115 GLN A C   4 
ATOM   9270  O  O   . GLN A 1 115 ? 22.120  85.346  0.300   0.25 20.99 ? 115 GLN A O   4 
ATOM   9271  C  CB  . GLN A 1 115 ? 19.774  84.243  2.001   0.25 26.52 ? 115 GLN A CB  4 
ATOM   9272  C  CG  . GLN A 1 115 ? 18.614  84.479  2.963   0.25 31.50 ? 115 GLN A CG  4 
ATOM   9273  C  CD  . GLN A 1 115 ? 18.554  83.464  4.086   0.25 33.55 ? 115 GLN A CD  4 
ATOM   9274  O  OE1 . GLN A 1 115 ? 19.416  83.439  4.965   0.25 34.77 ? 115 GLN A OE1 4 
ATOM   9275  N  NE2 . GLN A 1 115 ? 17.533  82.614  4.058   0.25 33.82 ? 115 GLN A NE2 4 
ATOM   9276  N  N   . GLU A 1 116 ? 20.761  84.420  -1.239  0.25 21.33 ? 116 GLU A N   4 
ATOM   9277  C  CA  . GLU A 1 116 ? 21.841  84.178  -2.195  0.25 23.00 ? 116 GLU A CA  4 
ATOM   9278  C  C   . GLU A 1 116 ? 22.028  85.419  -3.063  0.25 21.29 ? 116 GLU A C   4 
ATOM   9279  O  O   . GLU A 1 116 ? 22.982  85.514  -3.832  0.25 21.66 ? 116 GLU A O   4 
ATOM   9280  C  CB  . GLU A 1 116 ? 21.516  82.990  -3.102  0.25 26.62 ? 116 GLU A CB  4 
ATOM   9281  C  CG  . GLU A 1 116 ? 21.479  81.640  -2.403  0.25 31.31 ? 116 GLU A CG  4 
ATOM   9282  C  CD  . GLU A 1 116 ? 20.338  81.523  -1.420  0.25 34.85 ? 116 GLU A CD  4 
ATOM   9283  O  OE1 . GLU A 1 116 ? 19.176  81.748  -1.822  0.25 35.75 ? 116 GLU A OE1 4 
ATOM   9284  O  OE2 . GLU A 1 116 ? 20.603  81.200  -0.244  0.25 37.13 ? 116 GLU A OE2 4 
ATOM   9285  N  N   . GLY A 1 117 ? 21.101  86.363  -2.946  0.25 20.84 ? 117 GLY A N   4 
ATOM   9286  C  CA  . GLY A 1 117 ? 21.192  87.583  -3.728  0.25 21.27 ? 117 GLY A CA  4 
ATOM   9287  C  C   . GLY A 1 117 ? 20.327  87.589  -4.975  0.25 21.38 ? 117 GLY A C   4 
ATOM   9288  O  O   . GLY A 1 117 ? 20.446  88.491  -5.805  0.25 22.50 ? 117 GLY A O   4 
ATOM   9289  N  N   . LYS A 1 118 ? 19.456  86.594  -5.119  0.25 21.53 ? 118 LYS A N   4 
ATOM   9290  C  CA  . LYS A 1 118 ? 18.583  86.539  -6.286  0.25 23.89 ? 118 LYS A CA  4 
ATOM   9291  C  C   . LYS A 1 118 ? 17.308  87.339  -6.020  0.25 23.99 ? 118 LYS A C   4 
ATOM   9292  O  O   . LYS A 1 118 ? 16.627  87.139  -5.008  0.25 21.91 ? 118 LYS A O   4 
ATOM   9293  C  CB  . LYS A 1 118 ? 18.235  85.089  -6.637  0.25 27.69 ? 118 LYS A CB  4 
ATOM   9294  C  CG  . LYS A 1 118 ? 17.514  84.948  -7.974  0.25 32.62 ? 118 LYS A CG  4 
ATOM   9295  C  CD  . LYS A 1 118 ? 17.267  83.490  -8.343  0.25 37.06 ? 118 LYS A CD  4 
ATOM   9296  C  CE  . LYS A 1 118 ? 16.521  83.379  -9.670  0.25 40.64 ? 118 LYS A CE  4 
ATOM   9297  N  NZ  . LYS A 1 118 ? 16.313  81.966  -10.106 0.25 42.24 ? 118 LYS A NZ  4 
ATOM   9298  N  N   . GLU A 1 119 ? 16.997  88.246  -6.938  0.25 23.00 ? 119 GLU A N   4 
ATOM   9299  C  CA  . GLU A 1 119 ? 15.831  89.108  -6.818  0.25 24.90 ? 119 GLU A CA  4 
ATOM   9300  C  C   . GLU A 1 119 ? 14.626  88.575  -7.583  0.25 22.43 ? 119 GLU A C   4 
ATOM   9301  O  O   . GLU A 1 119 ? 14.732  88.214  -8.749  0.25 20.75 ? 119 GLU A O   4 
ATOM   9302  C  CB  . GLU A 1 119 ? 16.194  90.513  -7.313  0.25 27.80 ? 119 GLU A CB  4 
ATOM   9303  C  CG  . GLU A 1 119 ? 15.064  91.521  -7.280  0.25 32.59 ? 119 GLU A CG  4 
ATOM   9304  C  CD  . GLU A 1 119 ? 15.539  92.923  -7.627  0.25 34.91 ? 119 GLU A CD  4 
ATOM   9305  O  OE1 . GLU A 1 119 ? 16.345  93.485  -6.856  0.25 36.48 ? 119 GLU A OE1 4 
ATOM   9306  O  OE2 . GLU A 1 119 ? 15.111  93.460  -8.671  0.25 35.77 ? 119 GLU A OE2 4 
ATOM   9307  N  N   . ILE A 1 120 ? 13.479  88.530  -6.916  0.25 21.35 ? 120 ILE A N   4 
ATOM   9308  C  CA  . ILE A 1 120 ? 12.249  88.051  -7.540  0.25 19.23 ? 120 ILE A CA  4 
ATOM   9309  C  C   . ILE A 1 120 ? 11.135  89.066  -7.273  0.25 18.74 ? 120 ILE A C   4 
ATOM   9310  O  O   . ILE A 1 120 ? 11.048  89.626  -6.176  0.25 18.81 ? 120 ILE A O   4 
ATOM   9311  C  CB  . ILE A 1 120 ? 11.831  86.674  -6.963  0.25 21.13 ? 120 ILE A CB  4 
ATOM   9312  C  CG1 . ILE A 1 120 ? 11.526  86.802  -5.468  0.25 20.77 ? 120 ILE A CG1 4 
ATOM   9313  C  CG2 . ILE A 1 120 ? 12.951  85.659  -7.173  0.25 20.58 ? 120 ILE A CG2 4 
ATOM   9314  C  CD1 . ILE A 1 120 ? 10.990  85.540  -4.833  0.25 24.33 ? 120 ILE A CD1 4 
ATOM   9315  N  N   . THR A 1 121 ? 10.295  89.308  -8.275  0.25 14.57 ? 121 THR A N   4 
ATOM   9316  C  CA  . THR A 1 121 ? 9.194   90.256  -8.137  0.25 14.49 ? 121 THR A CA  4 
ATOM   9317  C  C   . THR A 1 121 ? 8.078   89.605  -7.327  0.25 14.47 ? 121 THR A C   4 
ATOM   9318  O  O   . THR A 1 121 ? 7.714   88.454  -7.574  0.25 14.18 ? 121 THR A O   4 
ATOM   9319  C  CB  . THR A 1 121 ? 8.645   90.680  -9.518  0.25 13.74 ? 121 THR A CB  4 
ATOM   9320  O  OG1 . THR A 1 121 ? 9.719   91.182  -10.320 0.25 11.00 ? 121 THR A OG1 4 
ATOM   9321  C  CG2 . THR A 1 121 ? 7.595   91.773  -9.373  0.25 11.63 ? 121 THR A CG2 4 
ATOM   9322  N  N   . CYS A 1 122 ? 7.535   90.340  -6.361  0.25 12.91 ? 122 CYS A N   4 
ATOM   9323  C  CA  . CYS A 1 122 ? 6.479   89.794  -5.514  0.25 12.31 ? 122 CYS A CA  4 
ATOM   9324  C  C   . CYS A 1 122 ? 5.269   90.679  -5.304  0.25 12.05 ? 122 CYS A C   4 
ATOM   9325  O  O   . CYS A 1 122 ? 5.351   91.910  -5.336  0.25 11.52 ? 122 CYS A O   4 
ATOM   9326  C  CB  . CYS A 1 122 ? 7.028   89.450  -4.129  0.25 12.31 ? 122 CYS A CB  4 
ATOM   9327  S  SG  . CYS A 1 122 ? 8.172   88.067  -4.080  0.25 16.23 ? 122 CYS A SG  4 
ATOM   9328  N  N   . ARG A 1 123 ? 4.140   90.023  -5.075  0.25 11.37 ? 123 ARG A N   4 
ATOM   9329  C  CA  . ARG A 1 123 ? 2.905   90.714  -4.774  0.25 9.33  ? 123 ARG A CA  4 
ATOM   9330  C  C   . ARG A 1 123 ? 2.891   90.750  -3.248  0.25 9.16  ? 123 ARG A C   4 
ATOM   9331  O  O   . ARG A 1 123 ? 3.359   89.814  -2.590  0.25 4.94  ? 123 ARG A O   4 
ATOM   9332  C  CB  . ARG A 1 123 ? 1.706   89.910  -5.268  0.25 11.82 ? 123 ARG A CB  4 
ATOM   9333  C  CG  . ARG A 1 123 ? 0.357   90.515  -4.896  0.25 12.51 ? 123 ARG A CG  4 
ATOM   9334  C  CD  . ARG A 1 123 ? -0.740  89.472  -5.003  0.25 10.44 ? 123 ARG A CD  4 
ATOM   9335  N  NE  . ARG A 1 123 ? -2.072  90.068  -5.057  0.25 12.51 ? 123 ARG A NE  4 
ATOM   9336  C  CZ  . ARG A 1 123 ? -2.513  90.796  -6.074  0.25 10.68 ? 123 ARG A CZ  4 
ATOM   9337  N  NH1 . ARG A 1 123 ? -1.723  91.020  -7.116  0.25 11.74 ? 123 ARG A NH1 4 
ATOM   9338  N  NH2 . ARG A 1 123 ? -3.747  91.280  -6.061  0.25 12.11 ? 123 ARG A NH2 4 
ATOM   9339  N  N   . SER A 1 124 ? 2.383   91.836  -2.686  0.25 7.29  ? 124 SER A N   4 
ATOM   9340  C  CA  . SER A 1 124 ? 2.279   91.960  -1.244  0.25 5.89  ? 124 SER A CA  4 
ATOM   9341  C  C   . SER A 1 124 ? 1.254   93.053  -0.980  0.25 5.97  ? 124 SER A C   4 
ATOM   9342  O  O   . SER A 1 124 ? 0.626   93.561  -1.917  0.25 5.59  ? 124 SER A O   4 
ATOM   9343  C  CB  . SER A 1 124 ? 3.631   92.320  -0.621  0.25 2.98  ? 124 SER A CB  4 
ATOM   9344  O  OG  . SER A 1 124 ? 3.629   92.043  0.775   0.25 4.54  ? 124 SER A OG  4 
ATOM   9345  N  N   . TYR A 1 125 ? 1.094   93.418  0.284   0.25 4.22  ? 125 TYR A N   4 
ATOM   9346  C  CA  . TYR A 1 125 ? 0.120   94.430  0.677   0.25 7.38  ? 125 TYR A CA  4 
ATOM   9347  C  C   . TYR A 1 125 ? 0.699   95.275  1.805   0.25 6.22  ? 125 TYR A C   4 
ATOM   9348  O  O   . TYR A 1 125 ? 1.573   94.813  2.539   0.25 7.74  ? 125 TYR A O   4 
ATOM   9349  C  CB  . TYR A 1 125 ? -1.153  93.748  1.200   0.25 7.03  ? 125 TYR A CB  4 
ATOM   9350  C  CG  . TYR A 1 125 ? -1.795  92.760  0.246   0.25 8.10  ? 125 TYR A CG  4 
ATOM   9351  C  CD1 . TYR A 1 125 ? -2.887  93.130  -0.542  0.25 5.34  ? 125 TYR A CD1 4 
ATOM   9352  C  CD2 . TYR A 1 125 ? -1.312  91.452  0.133   0.25 9.70  ? 125 TYR A CD2 4 
ATOM   9353  C  CE1 . TYR A 1 125 ? -3.487  92.217  -1.422  0.25 5.04  ? 125 TYR A CE1 4 
ATOM   9354  C  CE2 . TYR A 1 125 ? -1.901  90.536  -0.740  0.25 8.79  ? 125 TYR A CE2 4 
ATOM   9355  C  CZ  . TYR A 1 125 ? -2.983  90.924  -1.512  0.25 8.21  ? 125 TYR A CZ  4 
ATOM   9356  O  OH  . TYR A 1 125 ? -3.551  90.025  -2.379  0.25 9.86  ? 125 TYR A OH  4 
ATOM   9357  N  N   . LEU A 1 126 ? 0.220   96.509  1.934   0.25 6.72  ? 126 LEU A N   4 
ATOM   9358  C  CA  . LEU A 1 126 ? 0.645   97.383  3.031   0.25 7.98  ? 126 LEU A CA  4 
ATOM   9359  C  C   . LEU A 1 126 ? -0.465  98.369  3.355   0.25 8.93  ? 126 LEU A C   4 
ATOM   9360  O  O   . LEU A 1 126 ? -1.350  98.615  2.528   0.25 8.47  ? 126 LEU A O   4 
ATOM   9361  C  CB  . LEU A 1 126 ? 1.954   98.125  2.701   0.25 7.15  ? 126 LEU A CB  4 
ATOM   9362  C  CG  . LEU A 1 126 ? 2.152   98.884  1.385   0.25 7.99  ? 126 LEU A CG  4 
ATOM   9363  C  CD1 . LEU A 1 126 ? 1.282   100.136 1.335   0.25 6.94  ? 126 LEU A CD1 4 
ATOM   9364  C  CD2 . LEU A 1 126 ? 3.620   99.257  1.264   0.25 8.12  ? 126 LEU A CD2 4 
HETATM 9365  N  N   . MSE A 1 127 ? -0.438  98.913  4.567   0.25 7.89  ? 127 MSE A N   4 
HETATM 9366  C  CA  . MSE A 1 127 ? -1.448  99.876  4.982   0.25 9.31  ? 127 MSE A CA  4 
HETATM 9367  C  C   . MSE A 1 127 ? -1.148  101.256 4.405   0.25 9.16  ? 127 MSE A C   4 
HETATM 9368  O  O   . MSE A 1 127 ? 0.013   101.610 4.215   0.25 9.89  ? 127 MSE A O   4 
HETATM 9369  C  CB  . MSE A 1 127 ? -1.509  99.945  6.507   0.25 7.82  ? 127 MSE A CB  4 
HETATM 9370  C  CG  . MSE A 1 127 ? -2.041  98.683  7.142   0.25 6.62  ? 127 MSE A CG  4 
HETATM 9371  SE SE  . MSE A 1 127 ? -2.335  98.936  9.016   0.25 8.98  ? 127 MSE A SE  4 
HETATM 9372  C  CE  . MSE A 1 127 ? -1.846  97.186  9.673   0.25 9.30  ? 127 MSE A CE  4 
ATOM   9373  N  N   . THR A 1 128 ? -2.197  102.027 4.125   0.25 8.68  ? 128 THR A N   4 
ATOM   9374  C  CA  . THR A 1 128 ? -2.033  103.362 3.557   0.25 9.09  ? 128 THR A CA  4 
ATOM   9375  C  C   . THR A 1 128 ? -2.692  104.445 4.404   0.25 11.59 ? 128 THR A C   4 
ATOM   9376  O  O   . THR A 1 128 ? -2.630  105.627 4.072   0.25 15.14 ? 128 THR A O   4 
ATOM   9377  C  CB  . THR A 1 128 ? -2.629  103.441 2.139   0.25 8.41  ? 128 THR A CB  4 
ATOM   9378  O  OG1 . THR A 1 128 ? -4.033  103.167 2.200   0.25 9.50  ? 128 THR A OG1 4 
ATOM   9379  C  CG2 . THR A 1 128 ? -1.948  102.435 1.201   0.25 7.35  ? 128 THR A CG2 4 
ATOM   9380  N  N   . ASN A 1 129 ? -3.321  104.039 5.500   0.25 11.60 ? 129 ASN A N   4 
ATOM   9381  C  CA  . ASN A 1 129 ? -3.992  104.978 6.392   0.25 13.57 ? 129 ASN A CA  4 
ATOM   9382  C  C   . ASN A 1 129 ? -4.302  104.248 7.686   0.25 14.45 ? 129 ASN A C   4 
ATOM   9383  O  O   . ASN A 1 129 ? -5.340  103.594 7.807   0.25 15.38 ? 129 ASN A O   4 
ATOM   9384  C  CB  . ASN A 1 129 ? -5.288  105.491 5.754   0.25 13.34 ? 129 ASN A CB  4 
ATOM   9385  C  CG  . ASN A 1 129 ? -6.013  106.498 6.633   0.25 18.07 ? 129 ASN A CG  4 
ATOM   9386  O  OD1 . ASN A 1 129 ? -5.429  107.070 7.553   0.25 13.86 ? 129 ASN A OD1 4 
ATOM   9387  N  ND2 . ASN A 1 129 ? -7.291  106.729 6.342   0.25 16.58 ? 129 ASN A ND2 4 
ATOM   9388  N  N   . TYR A 1 130 ? -3.398  104.354 8.654   0.25 12.83 ? 130 TYR A N   4 
ATOM   9389  C  CA  . TYR A 1 130 ? -3.591  103.665 9.921   0.25 14.76 ? 130 TYR A CA  4 
ATOM   9390  C  C   . TYR A 1 130 ? -2.990  104.411 11.099  0.25 15.16 ? 130 TYR A C   4 
ATOM   9391  O  O   . TYR A 1 130 ? -2.212  105.349 10.933  0.25 13.31 ? 130 TYR A O   4 
ATOM   9392  C  CB  . TYR A 1 130 ? -2.959  102.273 9.866   0.25 11.73 ? 130 TYR A CB  4 
ATOM   9393  C  CG  . TYR A 1 130 ? -1.445  102.307 9.855   0.25 14.34 ? 130 TYR A CG  4 
ATOM   9394  C  CD1 . TYR A 1 130 ? -0.742  102.582 8.682   0.25 14.36 ? 130 TYR A CD1 4 
ATOM   9395  C  CD2 . TYR A 1 130 ? -0.715  102.100 11.031  0.25 11.54 ? 130 TYR A CD2 4 
ATOM   9396  C  CE1 . TYR A 1 130 ? 0.653   102.652 8.678   0.25 13.97 ? 130 TYR A CE1 4 
ATOM   9397  C  CE2 . TYR A 1 130 ? 0.674   102.168 11.040  0.25 11.22 ? 130 TYR A CE2 4 
ATOM   9398  C  CZ  . TYR A 1 130 ? 1.352   102.443 9.862   0.25 14.47 ? 130 TYR A CZ  4 
ATOM   9399  O  OH  . TYR A 1 130 ? 2.725   102.507 9.867   0.25 15.96 ? 130 TYR A OH  4 
ATOM   9400  N  N   . GLU A 1 131 ? -3.353  103.959 12.293  0.25 15.54 ? 131 GLU A N   4 
ATOM   9401  C  CA  . GLU A 1 131 ? -2.852  104.536 13.530  0.25 19.24 ? 131 GLU A CA  4 
ATOM   9402  C  C   . GLU A 1 131 ? -1.878  103.544 14.156  0.25 17.56 ? 131 GLU A C   4 
ATOM   9403  O  O   . GLU A 1 131 ? -2.227  102.386 14.382  0.25 17.29 ? 131 GLU A O   4 
ATOM   9404  C  CB  . GLU A 1 131 ? -4.013  104.812 14.497  0.25 19.88 ? 131 GLU A CB  4 
ATOM   9405  C  CG  . GLU A 1 131 ? -4.814  106.070 14.160  0.25 27.00 ? 131 GLU A CG  4 
ATOM   9406  C  CD  . GLU A 1 131 ? -6.088  106.206 14.984  0.25 28.83 ? 131 GLU A CD  4 
ATOM   9407  O  OE1 . GLU A 1 131 ? -6.055  105.896 16.192  0.25 32.68 ? 131 GLU A OE1 4 
ATOM   9408  O  OE2 . GLU A 1 131 ? -7.122  106.634 14.425  0.25 30.26 ? 131 GLU A OE2 4 
ATOM   9409  N  N   . SER A 1 132 ? -0.656  104.001 14.415  0.25 17.65 ? 132 SER A N   4 
ATOM   9410  C  CA  . SER A 1 132 ? 0.369   103.167 15.022  0.25 17.21 ? 132 SER A CA  4 
ATOM   9411  C  C   . SER A 1 132 ? -0.103  102.649 16.371  0.25 17.10 ? 132 SER A C   4 
ATOM   9412  O  O   . SER A 1 132 ? -0.459  103.420 17.262  0.25 15.86 ? 132 SER A O   4 
ATOM   9413  C  CB  . SER A 1 132 ? 1.667   103.958 15.209  0.25 19.34 ? 132 SER A CB  4 
ATOM   9414  O  OG  . SER A 1 132 ? 2.310   104.194 13.966  0.25 20.00 ? 132 SER A OG  4 
ATOM   9415  N  N   . ALA A 1 133 ? -0.104  101.331 16.508  0.25 16.64 ? 133 ALA A N   4 
ATOM   9416  C  CA  . ALA A 1 133 ? -0.526  100.685 17.741  0.25 16.21 ? 133 ALA A CA  4 
ATOM   9417  C  C   . ALA A 1 133 ? 0.220   99.367  17.828  0.25 16.02 ? 133 ALA A C   4 
ATOM   9418  O  O   . ALA A 1 133 ? 0.322   98.636  16.839  0.25 15.96 ? 133 ALA A O   4 
ATOM   9419  C  CB  . ALA A 1 133 ? -2.032  100.440 17.720  0.25 18.20 ? 133 ALA A CB  4 
ATOM   9420  N  N   . PRO A 1 134 ? 0.769   99.050  19.009  0.25 14.85 ? 134 PRO A N   4 
ATOM   9421  C  CA  . PRO A 1 134 ? 1.498   97.790  19.145  0.25 14.40 ? 134 PRO A CA  4 
ATOM   9422  C  C   . PRO A 1 134 ? 0.597   96.577  18.959  0.25 13.48 ? 134 PRO A C   4 
ATOM   9423  O  O   . PRO A 1 134 ? -0.608  96.632  19.228  0.25 14.79 ? 134 PRO A O   4 
ATOM   9424  C  CB  . PRO A 1 134 ? 2.089   97.881  20.553  0.25 13.83 ? 134 PRO A CB  4 
ATOM   9425  C  CG  . PRO A 1 134 ? 1.095   98.734  21.282  0.25 14.96 ? 134 PRO A CG  4 
ATOM   9426  C  CD  . PRO A 1 134 ? 0.780   99.805  20.274  0.25 13.30 ? 134 PRO A CD  4 
ATOM   9427  N  N   . PRO A 1 135 ? 1.170   95.469  18.470  0.25 12.82 ? 135 PRO A N   4 
ATOM   9428  C  CA  . PRO A 1 135 ? 0.444   94.220  18.237  0.25 12.03 ? 135 PRO A CA  4 
ATOM   9429  C  C   . PRO A 1 135 ? 0.177   93.499  19.546  0.25 14.42 ? 135 PRO A C   4 
ATOM   9430  O  O   . PRO A 1 135 ? 0.947   93.620  20.505  0.25 12.81 ? 135 PRO A O   4 
ATOM   9431  C  CB  . PRO A 1 135 ? 1.396   93.436  17.346  0.25 12.52 ? 135 PRO A CB  4 
ATOM   9432  C  CG  . PRO A 1 135 ? 2.741   93.857  17.873  0.25 12.52 ? 135 PRO A CG  4 
ATOM   9433  C  CD  . PRO A 1 135 ? 2.570   95.352  18.021  0.25 11.37 ? 135 PRO A CD  4 
ATOM   9434  N  N   . SER A 1 136 ? -0.921  92.756  19.587  0.25 13.56 ? 136 SER A N   4 
ATOM   9435  C  CA  . SER A 1 136 ? -1.275  91.999  20.776  0.25 13.62 ? 136 SER A CA  4 
ATOM   9436  C  C   . SER A 1 136 ? -0.252  90.882  20.962  0.25 14.40 ? 136 SER A C   4 
ATOM   9437  O  O   . SER A 1 136 ? 0.537   90.596  20.054  0.25 10.52 ? 136 SER A O   4 
ATOM   9438  C  CB  . SER A 1 136 ? -2.667  91.394  20.600  0.25 14.98 ? 136 SER A CB  4 
ATOM   9439  O  OG  . SER A 1 136 ? -2.726  90.625  19.407  0.25 12.64 ? 136 SER A OG  4 
ATOM   9440  N  N   . PRO A 1 137 ? -0.224  90.255  22.152  0.25 13.89 ? 137 PRO A N   4 
ATOM   9441  C  CA  . PRO A 1 137 ? 0.745   89.172  22.329  0.25 13.45 ? 137 PRO A CA  4 
ATOM   9442  C  C   . PRO A 1 137 ? 0.417   88.038  21.356  0.25 13.02 ? 137 PRO A C   4 
ATOM   9443  O  O   . PRO A 1 137 ? 1.317   87.385  20.835  0.25 11.69 ? 137 PRO A O   4 
ATOM   9444  C  CB  . PRO A 1 137 ? 0.548   88.763  23.789  0.25 14.96 ? 137 PRO A CB  4 
ATOM   9445  C  CG  . PRO A 1 137 ? 0.183   90.056  24.446  0.25 14.52 ? 137 PRO A CG  4 
ATOM   9446  C  CD  . PRO A 1 137 ? -0.817  90.641  23.446  0.25 14.53 ? 137 PRO A CD  4 
ATOM   9447  N  N   . GLN A 1 138 ? -0.874  87.817  21.102  0.25 11.99 ? 138 GLN A N   4 
ATOM   9448  C  CA  . GLN A 1 138 ? -1.305  86.758  20.187  0.25 12.37 ? 138 GLN A CA  4 
ATOM   9449  C  C   . GLN A 1 138 ? -0.674  86.905  18.801  0.25 12.80 ? 138 GLN A C   4 
ATOM   9450  O  O   . GLN A 1 138 ? 0.116   86.061  18.371  0.25 14.64 ? 138 GLN A O   4 
ATOM   9451  C  CB  . GLN A 1 138 ? -2.830  86.759  20.032  0.25 16.77 ? 138 GLN A CB  4 
ATOM   9452  C  CG  . GLN A 1 138 ? -3.619  86.472  21.307  0.25 19.30 ? 138 GLN A CG  4 
ATOM   9453  C  CD  . GLN A 1 138 ? -3.443  87.547  22.354  0.25 19.68 ? 138 GLN A CD  4 
ATOM   9454  O  OE1 . GLN A 1 138 ? -3.396  88.732  22.032  0.25 18.83 ? 138 GLN A OE1 4 
ATOM   9455  N  NE2 . GLN A 1 138 ? -3.362  87.141  23.619  0.25 22.38 ? 138 GLN A NE2 4 
ATOM   9456  N  N   . TYR A 1 139 ? -1.039  87.974  18.100  0.25 13.05 ? 139 TYR A N   4 
ATOM   9457  C  CA  . TYR A 1 139 ? -0.509  88.225  16.762  0.25 12.45 ? 139 TYR A CA  4 
ATOM   9458  C  C   . TYR A 1 139 ? 1.007   88.111  16.794  0.25 13.34 ? 139 TYR A C   4 
ATOM   9459  O  O   . TYR A 1 139 ? 1.605   87.464  15.933  0.25 11.81 ? 139 TYR A O   4 
ATOM   9460  C  CB  . TYR A 1 139 ? -0.914  89.621  16.283  0.25 11.96 ? 139 TYR A CB  4 
ATOM   9461  C  CG  . TYR A 1 139 ? -0.657  89.873  14.810  0.25 13.44 ? 139 TYR A CG  4 
ATOM   9462  C  CD1 . TYR A 1 139 ? -1.179  89.021  13.832  0.25 11.93 ? 139 TYR A CD1 4 
ATOM   9463  C  CD2 . TYR A 1 139 ? 0.081   90.979  14.391  0.25 13.64 ? 139 TYR A CD2 4 
ATOM   9464  C  CE1 . TYR A 1 139 ? -0.972  89.268  12.463  0.25 12.32 ? 139 TYR A CE1 4 
ATOM   9465  C  CE2 . TYR A 1 139 ? 0.295   91.238  13.030  0.25 14.20 ? 139 TYR A CE2 4 
ATOM   9466  C  CZ  . TYR A 1 139 ? -0.233  90.376  12.077  0.25 13.82 ? 139 TYR A CZ  4 
ATOM   9467  O  OH  . TYR A 1 139 ? 0.000   90.612  10.746  0.25 13.41 ? 139 TYR A OH  4 
ATOM   9468  N  N   . LYS A 1 140 ? 1.631   88.727  17.795  0.25 11.61 ? 140 LYS A N   4 
ATOM   9469  C  CA  . LYS A 1 140 ? 3.082   88.657  17.903  0.25 13.35 ? 140 LYS A CA  4 
ATOM   9470  C  C   . LYS A 1 140 ? 3.546   87.210  18.028  0.25 13.27 ? 140 LYS A C   4 
ATOM   9471  O  O   . LYS A 1 140 ? 4.568   86.834  17.455  0.25 15.04 ? 140 LYS A O   4 
ATOM   9472  C  CB  . LYS A 1 140 ? 3.593   89.451  19.109  0.25 12.42 ? 140 LYS A CB  4 
ATOM   9473  C  CG  . LYS A 1 140 ? 5.100   89.305  19.295  0.25 14.74 ? 140 LYS A CG  4 
ATOM   9474  C  CD  . LYS A 1 140 ? 5.625   90.087  20.488  0.25 14.17 ? 140 LYS A CD  4 
ATOM   9475  C  CE  . LYS A 1 140 ? 7.086   89.749  20.748  0.25 14.39 ? 140 LYS A CE  4 
ATOM   9476  N  NZ  . LYS A 1 140 ? 7.595   90.377  21.998  0.25 16.42 ? 140 LYS A NZ  4 
ATOM   9477  N  N   . LYS A 1 141 ? 2.800   86.405  18.782  0.25 15.29 ? 141 LYS A N   4 
ATOM   9478  C  CA  . LYS A 1 141 ? 3.148   85.000  18.977  0.25 16.51 ? 141 LYS A CA  4 
ATOM   9479  C  C   . LYS A 1 141 ? 3.200   84.255  17.652  0.25 15.71 ? 141 LYS A C   4 
ATOM   9480  O  O   . LYS A 1 141 ? 4.221   83.659  17.308  0.25 15.09 ? 141 LYS A O   4 
ATOM   9481  C  CB  . LYS A 1 141 ? 2.140   84.309  19.903  0.25 19.50 ? 141 LYS A CB  4 
ATOM   9482  C  CG  . LYS A 1 141 ? 2.273   84.668  21.375  0.25 24.21 ? 141 LYS A CG  4 
ATOM   9483  C  CD  . LYS A 1 141 ? 1.249   83.914  22.217  0.25 28.89 ? 141 LYS A CD  4 
ATOM   9484  C  CE  . LYS A 1 141 ? 1.506   84.093  23.705  0.25 31.45 ? 141 LYS A CE  4 
ATOM   9485  N  NZ  . LYS A 1 141 ? 1.440   85.516  24.128  0.25 32.75 ? 141 LYS A NZ  4 
ATOM   9486  N  N   . ILE A 1 142 ? 2.097   84.283  16.911  0.25 13.55 ? 142 ILE A N   4 
ATOM   9487  C  CA  . ILE A 1 142 ? 2.048   83.598  15.620  0.25 13.49 ? 142 ILE A CA  4 
ATOM   9488  C  C   . ILE A 1 142 ? 3.166   84.091  14.710  0.25 13.15 ? 142 ILE A C   4 
ATOM   9489  O  O   . ILE A 1 142 ? 3.807   83.303  14.012  0.25 12.48 ? 142 ILE A O   4 
ATOM   9490  C  CB  . ILE A 1 142 ? 0.689   83.811  14.921  0.25 14.35 ? 142 ILE A CB  4 
ATOM   9491  C  CG1 . ILE A 1 142 ? -0.388  82.974  15.618  0.25 15.04 ? 142 ILE A CG1 4 
ATOM   9492  C  CG2 . ILE A 1 142 ? 0.791   83.447  13.438  0.25 13.58 ? 142 ILE A CG2 4 
ATOM   9493  C  CD1 . ILE A 1 142 ? -0.124  81.480  15.592  0.25 12.15 ? 142 ILE A CD1 4 
ATOM   9494  N  N   . ILE A 1 143 ? 3.396   85.399  14.720  0.25 12.58 ? 143 ILE A N   4 
ATOM   9495  C  CA  . ILE A 1 143 ? 4.439   85.996  13.896  0.25 12.16 ? 143 ILE A CA  4 
ATOM   9496  C  C   . ILE A 1 143 ? 5.813   85.391  14.209  0.25 13.17 ? 143 ILE A C   4 
ATOM   9497  O  O   . ILE A 1 143 ? 6.497   84.878  13.319  0.25 12.63 ? 143 ILE A O   4 
ATOM   9498  C  CB  . ILE A 1 143 ? 4.474   87.533  14.096  0.25 8.93  ? 143 ILE A CB  4 
ATOM   9499  C  CG1 . ILE A 1 143 ? 3.260   88.159  13.401  0.25 10.65 ? 143 ILE A CG1 4 
ATOM   9500  C  CG2 . ILE A 1 143 ? 5.773   88.113  13.553  0.25 11.21 ? 143 ILE A CG2 4 
ATOM   9501  C  CD1 . ILE A 1 143 ? 3.130   89.658  13.592  0.25 5.68  ? 143 ILE A CD1 4 
ATOM   9502  N  N   . CYS A 1 144 ? 6.213   85.442  15.475  0.25 14.24 ? 144 CYS A N   4 
ATOM   9503  C  CA  . CYS A 1 144 ? 7.505   84.891  15.868  0.25 14.38 ? 144 CYS A CA  4 
ATOM   9504  C  C   . CYS A 1 144 ? 7.567   83.391  15.593  0.25 14.28 ? 144 CYS A C   4 
ATOM   9505  O  O   . CYS A 1 144 ? 8.636   82.849  15.312  0.25 14.80 ? 144 CYS A O   4 
ATOM   9506  C  CB  . CYS A 1 144 ? 7.776   85.185  17.347  0.25 15.18 ? 144 CYS A CB  4 
ATOM   9507  S  SG  . CYS A 1 144 ? 8.160   86.935  17.667  0.25 17.24 ? 144 CYS A SG  4 
HETATM 9508  N  N   . MSE A 1 145 ? 6.417   82.729  15.658  0.25 13.61 ? 145 MSE A N   4 
HETATM 9509  C  CA  . MSE A 1 145 ? 6.336   81.295  15.391  0.25 14.33 ? 145 MSE A CA  4 
HETATM 9510  C  C   . MSE A 1 145 ? 6.645   81.013  13.920  0.25 14.43 ? 145 MSE A C   4 
HETATM 9511  O  O   . MSE A 1 145 ? 7.531   80.219  13.598  0.25 14.01 ? 145 MSE A O   4 
HETATM 9512  C  CB  . MSE A 1 145 ? 4.936   80.771  15.727  0.25 14.92 ? 145 MSE A CB  4 
HETATM 9513  C  CG  . MSE A 1 145 ? 4.671   80.569  17.212  0.25 17.53 ? 145 MSE A CG  4 
HETATM 9514  SE SE  . MSE A 1 145 ? 2.864   79.955  17.580  0.25 19.48 ? 145 MSE A SE  4 
HETATM 9515  C  CE  . MSE A 1 145 ? 2.900   78.313  16.552  0.25 17.75 ? 145 MSE A CE  4 
ATOM   9516  N  N   . GLY A 1 146 ? 5.909   81.671  13.029  0.25 12.10 ? 146 GLY A N   4 
ATOM   9517  C  CA  . GLY A 1 146 ? 6.124   81.476  11.608  0.25 11.73 ? 146 GLY A CA  4 
ATOM   9518  C  C   . GLY A 1 146 ? 7.554   81.781  11.224  0.25 11.95 ? 146 GLY A C   4 
ATOM   9519  O  O   . GLY A 1 146 ? 8.162   81.072  10.417  0.25 13.41 ? 146 GLY A O   4 
ATOM   9520  N  N   . ALA A 1 147 ? 8.095   82.842  11.813  0.25 12.02 ? 147 ALA A N   4 
ATOM   9521  C  CA  . ALA A 1 147 ? 9.467   83.259  11.545  0.25 12.39 ? 147 ALA A CA  4 
ATOM   9522  C  C   . ALA A 1 147 ? 10.452  82.120  11.813  0.25 13.10 ? 147 ALA A C   4 
ATOM   9523  O  O   . ALA A 1 147 ? 11.170  81.681  10.913  0.25 13.45 ? 147 ALA A O   4 
ATOM   9524  C  CB  . ALA A 1 147 ? 9.809   84.469  12.406  0.25 9.13  ? 147 ALA A CB  4 
ATOM   9525  N  N   . LYS A 1 148 ? 10.481  81.647  13.055  0.25 15.17 ? 148 LYS A N   4 
ATOM   9526  C  CA  . LYS A 1 148 ? 11.379  80.561  13.443  0.25 18.57 ? 148 LYS A CA  4 
ATOM   9527  C  C   . LYS A 1 148 ? 11.176  79.349  12.545  0.25 19.26 ? 148 LYS A C   4 
ATOM   9528  O  O   . LYS A 1 148 ? 12.133  78.772  12.026  0.25 19.13 ? 148 LYS A O   4 
ATOM   9529  C  CB  . LYS A 1 148 ? 11.122  80.158  14.898  0.25 20.73 ? 148 LYS A CB  4 
ATOM   9530  C  CG  . LYS A 1 148 ? 12.185  79.231  15.485  0.25 24.81 ? 148 LYS A CG  4 
ATOM   9531  C  CD  . LYS A 1 148 ? 11.956  79.013  16.971  0.25 29.22 ? 148 LYS A CD  4 
ATOM   9532  C  CE  . LYS A 1 148 ? 13.116  78.267  17.615  0.25 31.33 ? 148 LYS A CE  4 
ATOM   9533  N  NZ  . LYS A 1 148 ? 13.326  76.921  17.018  0.25 34.87 ? 148 LYS A NZ  4 
ATOM   9534  N  N   . GLU A 1 149 ? 9.914   78.977  12.366  0.25 19.35 ? 149 GLU A N   4 
ATOM   9535  C  CA  . GLU A 1 149 ? 9.544   77.837  11.545  0.25 20.04 ? 149 GLU A CA  4 
ATOM   9536  C  C   . GLU A 1 149 ? 10.191  77.832  10.166  0.25 19.38 ? 149 GLU A C   4 
ATOM   9537  O  O   . GLU A 1 149 ? 10.850  76.862  9.779   0.25 19.75 ? 149 GLU A O   4 
ATOM   9538  C  CB  . GLU A 1 149 ? 8.026   77.789  11.371  0.25 21.62 ? 149 GLU A CB  4 
ATOM   9539  C  CG  . GLU A 1 149 ? 7.546   76.590  10.571  0.25 24.69 ? 149 GLU A CG  4 
ATOM   9540  C  CD  . GLU A 1 149 ? 6.070   76.661  10.251  0.25 25.72 ? 149 GLU A CD  4 
ATOM   9541  O  OE1 . GLU A 1 149 ? 5.678   77.531  9.444   0.25 25.64 ? 149 GLU A OE1 4 
ATOM   9542  O  OE2 . GLU A 1 149 ? 5.301   75.850  10.812  0.25 26.19 ? 149 GLU A OE2 4 
ATOM   9543  N  N   . ASN A 1 150 ? 9.999   78.909  9.417   0.25 17.41 ? 150 ASN A N   4 
ATOM   9544  C  CA  . ASN A 1 150 ? 10.555  78.967  8.074   0.25 16.47 ? 150 ASN A CA  4 
ATOM   9545  C  C   . ASN A 1 150 ? 11.939  79.586  7.990   0.25 14.75 ? 150 ASN A C   4 
ATOM   9546  O  O   . ASN A 1 150 ? 12.411  79.950  6.913   0.25 16.87 ? 150 ASN A O   4 
ATOM   9547  C  CB  . ASN A 1 150 ? 9.559   79.655  7.139   0.25 16.26 ? 150 ASN A CB  4 
ATOM   9548  C  CG  . ASN A 1 150 ? 8.320   78.808  6.917   0.25 17.57 ? 150 ASN A CG  4 
ATOM   9549  O  OD1 . ASN A 1 150 ? 8.428   77.611  6.656   0.25 16.88 ? 150 ASN A OD1 4 
ATOM   9550  N  ND2 . ASN A 1 150 ? 7.141   79.414  7.025   0.25 17.23 ? 150 ASN A ND2 4 
ATOM   9551  N  N   . GLY A 1 151 ? 12.584  79.686  9.146   0.25 14.47 ? 151 GLY A N   4 
ATOM   9552  C  CA  . GLY A 1 151 ? 13.940  80.196  9.232   0.25 15.14 ? 151 GLY A CA  4 
ATOM   9553  C  C   . GLY A 1 151 ? 14.338  81.542  8.650   0.25 15.16 ? 151 GLY A C   4 
ATOM   9554  O  O   . GLY A 1 151 ? 14.997  81.610  7.615   0.25 13.34 ? 151 GLY A O   4 
ATOM   9555  N  N   . LEU A 1 152 ? 13.946  82.618  9.319   0.25 14.89 ? 152 LEU A N   4 
ATOM   9556  C  CA  . LEU A 1 152 ? 14.332  83.947  8.885   0.25 15.66 ? 152 LEU A CA  4 
ATOM   9557  C  C   . LEU A 1 152 ? 15.674  84.192  9.579   0.25 15.68 ? 152 LEU A C   4 
ATOM   9558  O  O   . LEU A 1 152 ? 16.006  83.510  10.546  0.25 16.40 ? 152 LEU A O   4 
ATOM   9559  C  CB  . LEU A 1 152 ? 13.293  84.986  9.326   0.25 13.94 ? 152 LEU A CB  4 
ATOM   9560  C  CG  . LEU A 1 152 ? 12.000  85.042  8.503   0.25 15.80 ? 152 LEU A CG  4 
ATOM   9561  C  CD1 . LEU A 1 152 ? 11.218  83.736  8.642   0.25 15.10 ? 152 LEU A CD1 4 
ATOM   9562  C  CD2 . LEU A 1 152 ? 11.159  86.219  8.967   0.25 12.18 ? 152 LEU A CD2 4 
ATOM   9563  N  N   . PRO A 1 153 ? 16.467  85.156  9.097   0.25 15.23 ? 153 PRO A N   4 
ATOM   9564  C  CA  . PRO A 1 153 ? 17.763  85.415  9.737   0.25 15.11 ? 153 PRO A CA  4 
ATOM   9565  C  C   . PRO A 1 153 ? 17.643  85.623  11.245  0.25 15.18 ? 153 PRO A C   4 
ATOM   9566  O  O   . PRO A 1 153 ? 16.690  86.243  11.723  0.25 13.18 ? 153 PRO A O   4 
ATOM   9567  C  CB  . PRO A 1 153 ? 18.259  86.664  9.015   0.25 15.22 ? 153 PRO A CB  4 
ATOM   9568  C  CG  . PRO A 1 153 ? 17.660  86.507  7.637   0.25 14.10 ? 153 PRO A CG  4 
ATOM   9569  C  CD  . PRO A 1 153 ? 16.251  86.060  7.955   0.25 14.32 ? 153 PRO A CD  4 
ATOM   9570  N  N   . LEU A 1 154 ? 18.621  85.109  11.986  0.25 14.65 ? 154 LEU A N   4 
ATOM   9571  C  CA  . LEU A 1 154 ? 18.622  85.222  13.440  0.25 17.99 ? 154 LEU A CA  4 
ATOM   9572  C  C   . LEU A 1 154 ? 18.531  86.656  13.947  0.25 17.69 ? 154 LEU A C   4 
ATOM   9573  O  O   . LEU A 1 154 ? 17.818  86.927  14.915  0.25 19.18 ? 154 LEU A O   4 
ATOM   9574  C  CB  . LEU A 1 154 ? 19.865  84.538  14.024  0.25 20.02 ? 154 LEU A CB  4 
ATOM   9575  C  CG  . LEU A 1 154 ? 19.906  83.017  13.831  0.25 24.16 ? 154 LEU A CG  4 
ATOM   9576  C  CD1 . LEU A 1 154 ? 21.220  82.463  14.360  0.25 26.49 ? 154 LEU A CD1 4 
ATOM   9577  C  CD2 . LEU A 1 154 ? 18.728  82.373  14.548  0.25 24.24 ? 154 LEU A CD2 4 
ATOM   9578  N  N   . GLU A 1 155 ? 19.246  87.575  13.305  0.25 18.95 ? 155 GLU A N   4 
ATOM   9579  C  CA  . GLU A 1 155 ? 19.207  88.972  13.728  0.25 19.68 ? 155 GLU A CA  4 
ATOM   9580  C  C   . GLU A 1 155 ? 17.828  89.579  13.487  0.25 15.85 ? 155 GLU A C   4 
ATOM   9581  O  O   . GLU A 1 155 ? 17.373  90.423  14.256  0.25 13.49 ? 155 GLU A O   4 
ATOM   9582  C  CB  . GLU A 1 155 ? 20.260  89.799  12.989  0.25 26.42 ? 155 GLU A CB  4 
ATOM   9583  C  CG  . GLU A 1 155 ? 20.292  91.261  13.420  0.25 38.41 ? 155 GLU A CG  4 
ATOM   9584  C  CD  . GLU A 1 155 ? 21.349  92.078  12.696  0.25 42.60 ? 155 GLU A CD  4 
ATOM   9585  O  OE1 . GLU A 1 155 ? 22.549  91.745  12.807  0.25 45.97 ? 155 GLU A OE1 4 
ATOM   9586  O  OE2 . GLU A 1 155 ? 20.976  93.060  12.018  0.25 46.75 ? 155 GLU A OE2 4 
ATOM   9587  N  N   . TYR A 1 156 ? 17.162  89.157  12.417  0.25 13.17 ? 156 TYR A N   4 
ATOM   9588  C  CA  . TYR A 1 156 ? 15.837  89.688  12.132  0.25 11.97 ? 156 TYR A CA  4 
ATOM   9589  C  C   . TYR A 1 156 ? 14.847  89.103  13.130  0.25 11.36 ? 156 TYR A C   4 
ATOM   9590  O  O   . TYR A 1 156 ? 13.993  89.814  13.658  0.25 12.87 ? 156 TYR A O   4 
ATOM   9591  C  CB  . TYR A 1 156 ? 15.393  89.348  10.709  0.25 11.32 ? 156 TYR A CB  4 
ATOM   9592  C  CG  . TYR A 1 156 ? 14.147  90.105  10.298  0.25 10.49 ? 156 TYR A CG  4 
ATOM   9593  C  CD1 . TYR A 1 156 ? 14.200  91.473  10.012  0.25 11.55 ? 156 TYR A CD1 4 
ATOM   9594  C  CD2 . TYR A 1 156 ? 12.910  89.469  10.236  0.25 11.48 ? 156 TYR A CD2 4 
ATOM   9595  C  CE1 . TYR A 1 156 ? 13.046  92.190  9.677   0.25 8.92  ? 156 TYR A CE1 4 
ATOM   9596  C  CE2 . TYR A 1 156 ? 11.753  90.167  9.900   0.25 9.33  ? 156 TYR A CE2 4 
ATOM   9597  C  CZ  . TYR A 1 156 ? 11.824  91.527  9.624   0.25 10.22 ? 156 TYR A CZ  4 
ATOM   9598  O  OH  . TYR A 1 156 ? 10.679  92.218  9.294   0.25 11.67 ? 156 TYR A OH  4 
ATOM   9599  N  N   . GLN A 1 157 ? 14.957  87.803  13.384  0.25 11.15 ? 157 GLN A N   4 
ATOM   9600  C  CA  . GLN A 1 157 ? 14.071  87.159  14.343  0.25 12.66 ? 157 GLN A CA  4 
ATOM   9601  C  C   . GLN A 1 157 ? 14.268  87.806  15.706  0.25 13.84 ? 157 GLN A C   4 
ATOM   9602  O  O   . GLN A 1 157 ? 13.342  87.863  16.513  0.25 13.63 ? 157 GLN A O   4 
ATOM   9603  C  CB  . GLN A 1 157 ? 14.362  85.661  14.441  0.25 13.61 ? 157 GLN A CB  4 
ATOM   9604  C  CG  . GLN A 1 157 ? 13.868  84.844  13.258  0.25 14.29 ? 157 GLN A CG  4 
ATOM   9605  C  CD  . GLN A 1 157 ? 13.996  83.350  13.498  0.25 16.16 ? 157 GLN A CD  4 
ATOM   9606  O  OE1 . GLN A 1 157 ? 13.612  82.851  14.552  0.25 13.32 ? 157 GLN A OE1 4 
ATOM   9607  N  NE2 . GLN A 1 157 ? 14.523  82.628  12.514  0.25 17.40 ? 157 GLN A NE2 4 
ATOM   9608  N  N   . GLU A 1 158 ? 15.481  88.287  15.966  0.25 14.91 ? 158 GLU A N   4 
ATOM   9609  C  CA  . GLU A 1 158 ? 15.758  88.942  17.240  0.25 17.90 ? 158 GLU A CA  4 
ATOM   9610  C  C   . GLU A 1 158 ? 14.874  90.168  17.369  0.25 16.40 ? 158 GLU A C   4 
ATOM   9611  O  O   . GLU A 1 158 ? 14.249  90.377  18.405  0.25 16.91 ? 158 GLU A O   4 
ATOM   9612  C  CB  . GLU A 1 158 ? 17.228  89.362  17.345  0.25 22.57 ? 158 GLU A CB  4 
ATOM   9613  C  CG  . GLU A 1 158 ? 18.176  88.222  17.670  0.25 30.48 ? 158 GLU A CG  4 
ATOM   9614  C  CD  . GLU A 1 158 ? 17.791  87.510  18.949  0.25 33.90 ? 158 GLU A CD  4 
ATOM   9615  O  OE1 . GLU A 1 158 ? 17.626  88.196  19.981  0.25 35.38 ? 158 GLU A OE1 4 
ATOM   9616  O  OE2 . GLU A 1 158 ? 17.653  86.268  18.924  0.25 36.66 ? 158 GLU A OE2 4 
ATOM   9617  N  N   . LYS A 1 159 ? 14.821  90.973  16.310  0.25 15.92 ? 159 LYS A N   4 
ATOM   9618  C  CA  . LYS A 1 159 ? 14.003  92.179  16.318  0.25 18.12 ? 159 LYS A CA  4 
ATOM   9619  C  C   . LYS A 1 159 ? 12.532  91.824  16.507  0.25 16.73 ? 159 LYS A C   4 
ATOM   9620  O  O   . LYS A 1 159 ? 11.833  92.461  17.293  0.25 15.38 ? 159 LYS A O   4 
ATOM   9621  C  CB  . LYS A 1 159 ? 14.198  92.961  15.018  0.25 21.23 ? 159 LYS A CB  4 
ATOM   9622  C  CG  . LYS A 1 159 ? 15.638  93.392  14.784  0.25 27.67 ? 159 LYS A CG  4 
ATOM   9623  C  CD  . LYS A 1 159 ? 15.772  94.335  13.600  0.25 32.09 ? 159 LYS A CD  4 
ATOM   9624  C  CE  . LYS A 1 159 ? 15.061  95.655  13.859  0.25 34.70 ? 159 LYS A CE  4 
ATOM   9625  N  NZ  . LYS A 1 159 ? 15.335  96.648  12.786  0.25 37.73 ? 159 LYS A NZ  4 
ATOM   9626  N  N   . LEU A 1 160 ? 12.067  90.803  15.791  0.25 15.62 ? 160 LEU A N   4 
ATOM   9627  C  CA  . LEU A 1 160 ? 10.679  90.367  15.904  0.25 15.03 ? 160 LEU A CA  4 
ATOM   9628  C  C   . LEU A 1 160 ? 10.334  90.046  17.359  0.25 15.37 ? 160 LEU A C   4 
ATOM   9629  O  O   . LEU A 1 160 ? 9.237   90.336  17.831  0.25 15.21 ? 160 LEU A O   4 
ATOM   9630  C  CB  . LEU A 1 160 ? 10.447  89.120  15.048  0.25 12.61 ? 160 LEU A CB  4 
ATOM   9631  C  CG  . LEU A 1 160 ? 10.510  89.300  13.532  0.25 12.08 ? 160 LEU A CG  4 
ATOM   9632  C  CD1 . LEU A 1 160 ? 10.608  87.943  12.856  0.25 11.65 ? 160 LEU A CD1 4 
ATOM   9633  C  CD2 . LEU A 1 160 ? 9.279   90.058  13.059  0.25 11.72 ? 160 LEU A CD2 4 
ATOM   9634  N  N   . LYS A 1 161 ? 11.280  89.437  18.066  0.25 15.75 ? 161 LYS A N   4 
ATOM   9635  C  CA  . LYS A 1 161 ? 11.068  89.066  19.462  0.25 17.75 ? 161 LYS A CA  4 
ATOM   9636  C  C   . LYS A 1 161 ? 11.113  90.280  20.384  0.25 16.90 ? 161 LYS A C   4 
ATOM   9637  O  O   . LYS A 1 161 ? 10.485  90.282  21.447  0.25 18.03 ? 161 LYS A O   4 
ATOM   9638  C  CB  . LYS A 1 161 ? 12.124  88.038  19.888  0.25 18.09 ? 161 LYS A CB  4 
ATOM   9639  C  CG  . LYS A 1 161 ? 12.124  86.795  19.015  0.25 20.99 ? 161 LYS A CG  4 
ATOM   9640  C  CD  . LYS A 1 161 ? 13.365  85.931  19.217  0.25 23.18 ? 161 LYS A CD  4 
ATOM   9641  C  CE  . LYS A 1 161 ? 13.313  85.132  20.503  0.25 25.71 ? 161 LYS A CE  4 
ATOM   9642  N  NZ  . LYS A 1 161 ? 14.492  84.223  20.595  0.25 26.19 ? 161 LYS A NZ  4 
ATOM   9643  N  N   . ALA A 1 162 ? 11.840  91.313  19.966  0.25 15.38 ? 162 ALA A N   4 
ATOM   9644  C  CA  . ALA A 1 162 ? 11.980  92.535  20.756  0.25 15.43 ? 162 ALA A CA  4 
ATOM   9645  C  C   . ALA A 1 162 ? 10.731  93.414  20.728  0.25 15.56 ? 162 ALA A C   4 
ATOM   9646  O  O   . ALA A 1 162 ? 10.571  94.311  21.561  0.25 13.97 ? 162 ALA A O   4 
ATOM   9647  C  CB  . ALA A 1 162 ? 13.187  93.332  20.265  0.25 13.46 ? 162 ALA A CB  4 
ATOM   9648  N  N   . ILE A 1 163 ? 9.848   93.158  19.771  0.25 14.97 ? 163 ILE A N   4 
ATOM   9649  C  CA  . ILE A 1 163 ? 8.623   93.933  19.649  0.25 15.09 ? 163 ILE A CA  4 
ATOM   9650  C  C   . ILE A 1 163 ? 7.865   93.965  20.973  0.25 16.09 ? 163 ILE A C   4 
ATOM   9651  O  O   . ILE A 1 163 ? 7.775   92.954  21.671  0.25 16.69 ? 163 ILE A O   4 
ATOM   9652  C  CB  . ILE A 1 163 ? 7.692   93.337  18.571  0.25 14.41 ? 163 ILE A CB  4 
ATOM   9653  C  CG1 . ILE A 1 163 ? 8.413   93.297  17.225  0.25 12.48 ? 163 ILE A CG1 4 
ATOM   9654  C  CG2 . ILE A 1 163 ? 6.412   94.177  18.465  0.25 14.13 ? 163 ILE A CG2 4 
ATOM   9655  C  CD1 . ILE A 1 163 ? 7.650   92.555  16.140  0.25 14.86 ? 163 ILE A CD1 4 
ATOM   9656  N  N   . GLU A 1 164 ? 7.327   95.128  21.320  0.25 16.02 ? 164 GLU A N   4 
ATOM   9657  C  CA  . GLU A 1 164 ? 6.567   95.256  22.555  0.25 18.14 ? 164 GLU A CA  4 
ATOM   9658  C  C   . GLU A 1 164 ? 5.085   95.148  22.219  0.25 16.93 ? 164 GLU A C   4 
ATOM   9659  O  O   . GLU A 1 164 ? 4.540   95.980  21.497  0.25 17.25 ? 164 GLU A O   4 
ATOM   9660  C  CB  . GLU A 1 164 ? 6.862   96.600  23.233  0.25 22.39 ? 164 GLU A CB  4 
ATOM   9661  C  CG  . GLU A 1 164 ? 8.346   96.853  23.500  0.25 26.46 ? 164 GLU A CG  4 
ATOM   9662  C  CD  . GLU A 1 164 ? 8.587   98.017  24.453  0.25 30.92 ? 164 GLU A CD  4 
ATOM   9663  O  OE1 . GLU A 1 164 ? 8.022   99.109  24.226  0.25 30.20 ? 164 GLU A OE1 4 
ATOM   9664  O  OE2 . GLU A 1 164 ? 9.350   97.841  25.428  0.25 31.00 ? 164 GLU A OE2 4 
ATOM   9665  N  N   . PRO A 1 165 ? 4.415   94.106  22.734  0.25 16.65 ? 165 PRO A N   4 
ATOM   9666  C  CA  . PRO A 1 165 ? 2.988   93.869  22.498  0.25 15.68 ? 165 PRO A CA  4 
ATOM   9667  C  C   . PRO A 1 165 ? 2.129   94.719  23.425  0.25 17.06 ? 165 PRO A C   4 
ATOM   9668  O  O   . PRO A 1 165 ? 2.639   95.284  24.392  0.25 14.82 ? 165 PRO A O   4 
ATOM   9669  C  CB  . PRO A 1 165 ? 2.846   92.383  22.797  0.25 15.49 ? 165 PRO A CB  4 
ATOM   9670  C  CG  . PRO A 1 165 ? 3.769   92.221  23.969  0.25 17.48 ? 165 PRO A CG  4 
ATOM   9671  C  CD  . PRO A 1 165 ? 4.995   93.025  23.555  0.25 16.78 ? 165 PRO A CD  4 
ATOM   9672  N  N   . ASN A 1 166 ? 0.833   94.825  23.136  0.25 18.08 ? 166 ASN A N   4 
ATOM   9673  C  CA  . ASN A 1 166 ? -0.042  95.591  24.016  0.25 18.28 ? 166 ASN A CA  4 
ATOM   9674  C  C   . ASN A 1 166 ? -0.319  94.706  25.232  0.25 19.58 ? 166 ASN A C   4 
ATOM   9675  O  O   . ASN A 1 166 ? 0.465   93.800  25.517  0.25 19.39 ? 166 ASN A O   4 
ATOM   9676  C  CB  . ASN A 1 166 ? -1.351  95.987  23.314  0.25 16.72 ? 166 ASN A CB  4 
ATOM   9677  C  CG  . ASN A 1 166 ? -2.160  94.794  22.842  0.25 13.43 ? 166 ASN A CG  4 
ATOM   9678  O  OD1 . ASN A 1 166 ? -2.115  93.717  23.437  0.25 13.40 ? 166 ASN A OD1 4 
ATOM   9679  N  ND2 . ASN A 1 166 ? -2.929  94.991  21.770  0.25 14.71 ? 166 ASN A ND2 4 
ATOM   9680  N  N   . ASP A 1 167 ? -1.423  94.939  25.939  0.25 21.13 ? 167 ASP A N   4 
ATOM   9681  C  CA  . ASP A 1 167 ? -1.718  94.139  27.129  0.25 24.23 ? 167 ASP A CA  4 
ATOM   9682  C  C   . ASP A 1 167 ? -2.971  93.270  27.035  0.25 23.84 ? 167 ASP A C   4 
ATOM   9683  O  O   . ASP A 1 167 ? -3.601  92.970  28.049  0.25 23.19 ? 167 ASP A O   4 
ATOM   9684  C  CB  . ASP A 1 167 ? -1.824  95.053  28.356  0.25 26.66 ? 167 ASP A CB  4 
ATOM   9685  C  CG  . ASP A 1 167 ? -3.121  95.840  28.387  0.25 29.81 ? 167 ASP A CG  4 
ATOM   9686  O  OD1 . ASP A 1 167 ? -3.595  96.249  27.305  0.25 27.48 ? 167 ASP A OD1 4 
ATOM   9687  O  OD2 . ASP A 1 167 ? -3.660  96.056  29.494  0.25 30.81 ? 167 ASP A OD2 4 
ATOM   9688  N  N   . TYR A 1 168 ? -3.338  92.864  25.826  0.25 21.21 ? 168 TYR A N   4 
ATOM   9689  C  CA  . TYR A 1 168 ? -4.509  92.012  25.666  0.25 21.32 ? 168 TYR A CA  4 
ATOM   9690  C  C   . TYR A 1 168 ? -4.165  90.644  26.249  0.25 22.28 ? 168 TYR A C   4 
ATOM   9691  O  O   . TYR A 1 168 ? -3.100  90.093  25.962  0.25 20.36 ? 168 TYR A O   4 
ATOM   9692  C  CB  . TYR A 1 168 ? -4.874  91.861  24.185  0.25 20.96 ? 168 TYR A CB  4 
ATOM   9693  C  CG  . TYR A 1 168 ? -6.068  90.965  23.952  0.25 20.51 ? 168 TYR A CG  4 
ATOM   9694  C  CD1 . TYR A 1 168 ? -7.361  91.416  24.208  0.25 20.03 ? 168 TYR A CD1 4 
ATOM   9695  C  CD2 . TYR A 1 168 ? -5.903  89.646  23.522  0.25 19.42 ? 168 TYR A CD2 4 
ATOM   9696  C  CE1 . TYR A 1 168 ? -8.462  90.576  24.048  0.25 19.14 ? 168 TYR A CE1 4 
ATOM   9697  C  CE2 . TYR A 1 168 ? -7.000  88.798  23.360  0.25 19.38 ? 168 TYR A CE2 4 
ATOM   9698  C  CZ  . TYR A 1 168 ? -8.276  89.271  23.627  0.25 18.76 ? 168 TYR A CZ  4 
ATOM   9699  O  OH  . TYR A 1 168 ? -9.363  88.436  23.497  0.25 18.13 ? 168 TYR A OH  4 
ATOM   9700  N  N   . THR A 1 169 ? -5.057  90.100  27.072  0.25 21.36 ? 169 THR A N   4 
ATOM   9701  C  CA  . THR A 1 169 ? -4.818  88.792  27.676  0.25 23.11 ? 169 THR A CA  4 
ATOM   9702  C  C   . THR A 1 169 ? -5.989  87.849  27.450  0.25 24.65 ? 169 THR A C   4 
ATOM   9703  O  O   . THR A 1 169 ? -6.057  86.764  28.031  0.25 23.40 ? 169 THR A O   4 
ATOM   9704  C  CB  . THR A 1 169 ? -4.543  88.908  29.191  0.25 21.70 ? 169 THR A CB  4 
ATOM   9705  O  OG1 . THR A 1 169 ? -5.628  89.587  29.830  0.25 20.60 ? 169 THR A OG1 4 
ATOM   9706  C  CG2 . THR A 1 169 ? -3.252  89.677  29.432  0.25 21.44 ? 169 THR A CG2 4 
ATOM   9707  N  N   . GLY A 1 170 ? -6.916  88.272  26.599  0.25 26.27 ? 170 GLY A N   4 
ATOM   9708  C  CA  . GLY A 1 170 ? -8.056  87.434  26.302  0.25 27.59 ? 170 GLY A CA  4 
ATOM   9709  C  C   . GLY A 1 170 ? -7.599  86.315  25.388  0.25 29.60 ? 170 GLY A C   4 
ATOM   9710  O  O   . GLY A 1 170 ? -6.436  85.901  25.418  0.25 28.09 ? 170 GLY A O   4 
ATOM   9711  N  N   . LYS A 1 171 ? -8.511  85.831  24.560  0.25 32.20 ? 171 LYS A N   4 
ATOM   9712  C  CA  . LYS A 1 171 ? -8.192  84.752  23.641  0.25 35.50 ? 171 LYS A CA  4 
ATOM   9713  C  C   . LYS A 1 171 ? -8.610  85.161  22.233  0.25 34.49 ? 171 LYS A C   4 
ATOM   9714  O  O   . LYS A 1 171 ? -9.497  85.997  22.063  0.25 34.74 ? 171 LYS A O   4 
ATOM   9715  C  CB  . LYS A 1 171 ? -8.937  83.488  24.079  0.25 39.76 ? 171 LYS A CB  4 
ATOM   9716  C  CG  . LYS A 1 171 ? -8.546  82.207  23.366  0.25 46.08 ? 171 LYS A CG  4 
ATOM   9717  C  CD  . LYS A 1 171 ? -9.267  81.019  23.997  0.25 50.93 ? 171 LYS A CD  4 
ATOM   9718  C  CE  . LYS A 1 171 ? -8.928  79.708  23.304  0.25 54.65 ? 171 LYS A CE  4 
ATOM   9719  N  NZ  . LYS A 1 171 ? -9.600  78.537  23.934  0.25 58.53 ? 171 LYS A NZ  4 
ATOM   9720  N  N   . VAL A 1 172 ? -7.952  84.597  21.228  0.25 33.54 ? 172 VAL A N   4 
ATOM   9721  C  CA  . VAL A 1 172 ? -8.297  84.888  19.843  0.25 32.55 ? 172 VAL A CA  4 
ATOM   9722  C  C   . VAL A 1 172 ? -9.079  83.683  19.328  0.25 32.02 ? 172 VAL A C   4 
ATOM   9723  O  O   . VAL A 1 172 ? -9.500  82.841  20.123  0.25 31.35 ? 172 VAL A O   4 
ATOM   9724  C  CB  . VAL A 1 172 ? -7.040  85.123  18.977  0.25 32.43 ? 172 VAL A CB  4 
ATOM   9725  C  CG1 . VAL A 1 172 ? -6.408  86.456  19.340  0.25 32.93 ? 172 VAL A CG1 4 
ATOM   9726  C  CG2 . VAL A 1 172 ? -6.044  84.000  19.185  0.25 33.14 ? 172 VAL A CG2 4 
ATOM   9727  N  N   . SER A 1 173 ? -9.276  83.588  18.016  0.25 30.01 ? 173 SER A N   4 
ATOM   9728  C  CA  . SER A 1 173 ? -10.030 82.467  17.458  0.25 28.92 ? 173 SER A CA  4 
ATOM   9729  C  C   . SER A 1 173 ? -9.555  81.116  17.996  0.25 29.56 ? 173 SER A C   4 
ATOM   9730  O  O   . SER A 1 173 ? -8.391  80.952  18.373  0.25 28.05 ? 173 SER A O   4 
ATOM   9731  C  CB  . SER A 1 173 ? -9.932  82.463  15.933  0.25 27.83 ? 173 SER A CB  4 
ATOM   9732  O  OG  . SER A 1 173 ? -8.646  82.051  15.507  0.25 24.80 ? 173 SER A OG  4 
ATOM   9733  N  N   . GLU A 1 174 ? -10.466 80.150  18.026  0.25 31.96 ? 174 GLU A N   4 
ATOM   9734  C  CA  . GLU A 1 174 ? -10.150 78.812  18.511  0.25 34.71 ? 174 GLU A CA  4 
ATOM   9735  C  C   . GLU A 1 174 ? -9.009  78.190  17.713  0.25 34.13 ? 174 GLU A C   4 
ATOM   9736  O  O   . GLU A 1 174 ? -8.070  77.639  18.287  0.25 34.03 ? 174 GLU A O   4 
ATOM   9737  C  CB  . GLU A 1 174 ? -11.381 77.905  18.414  0.25 38.42 ? 174 GLU A CB  4 
ATOM   9738  C  CG  . GLU A 1 174 ? -11.121 76.467  18.852  0.25 44.51 ? 174 GLU A CG  4 
ATOM   9739  C  CD  . GLU A 1 174 ? -12.254 75.526  18.485  0.25 47.51 ? 174 GLU A CD  4 
ATOM   9740  O  OE1 . GLU A 1 174 ? -13.393 75.753  18.947  0.25 50.79 ? 174 GLU A OE1 4 
ATOM   9741  O  OE2 . GLU A 1 174 ? -12.004 74.559  17.733  0.25 49.79 ? 174 GLU A OE2 4 
ATOM   9742  N  N   . GLU A 1 175 ? -9.095  78.283  16.390  0.25 33.41 ? 175 GLU A N   4 
ATOM   9743  C  CA  . GLU A 1 175 ? -8.073  77.711  15.517  0.25 34.46 ? 175 GLU A CA  4 
ATOM   9744  C  C   . GLU A 1 175 ? -6.693  78.321  15.720  0.25 33.56 ? 175 GLU A C   4 
ATOM   9745  O  O   . GLU A 1 175 ? -5.688  77.610  15.689  0.25 33.11 ? 175 GLU A O   4 
ATOM   9746  C  CB  . GLU A 1 175 ? -8.501  77.835  14.052  0.25 36.23 ? 175 GLU A CB  4 
ATOM   9747  C  CG  . GLU A 1 175 ? -8.833  79.240  13.598  0.25 38.57 ? 175 GLU A CG  4 
ATOM   9748  C  CD  . GLU A 1 175 ? -9.777  79.242  12.410  0.25 40.01 ? 175 GLU A CD  4 
ATOM   9749  O  OE1 . GLU A 1 175 ? -9.497  78.523  11.426  0.25 40.36 ? 175 GLU A OE1 4 
ATOM   9750  O  OE2 . GLU A 1 175 ? -10.799 79.962  12.461  0.25 41.43 ? 175 GLU A OE2 4 
ATOM   9751  N  N   . ILE A 1 176 ? -6.632  79.632  15.927  0.25 32.29 ? 176 ILE A N   4 
ATOM   9752  C  CA  . ILE A 1 176 ? -5.342  80.270  16.154  0.25 31.56 ? 176 ILE A CA  4 
ATOM   9753  C  C   . ILE A 1 176 ? -4.739  79.661  17.415  0.25 31.74 ? 176 ILE A C   4 
ATOM   9754  O  O   . ILE A 1 176 ? -3.539  79.390  17.478  0.25 31.36 ? 176 ILE A O   4 
ATOM   9755  C  CB  . ILE A 1 176 ? -5.481  81.799  16.337  0.25 30.98 ? 176 ILE A CB  4 
ATOM   9756  C  CG1 . ILE A 1 176 ? -5.906  82.443  15.013  0.25 31.89 ? 176 ILE A CG1 4 
ATOM   9757  C  CG2 . ILE A 1 176 ? -4.152  82.388  16.805  0.25 29.30 ? 176 ILE A CG2 4 
ATOM   9758  C  CD1 . ILE A 1 176 ? -6.158  83.942  15.098  0.25 32.43 ? 176 ILE A CD1 4 
ATOM   9759  N  N   . GLU A 1 177 ? -5.586  79.435  18.414  0.25 33.52 ? 177 GLU A N   4 
ATOM   9760  C  CA  . GLU A 1 177 ? -5.143  78.843  19.666  0.25 35.43 ? 177 GLU A CA  4 
ATOM   9761  C  C   . GLU A 1 177 ? -4.636  77.426  19.436  0.25 34.40 ? 177 GLU A C   4 
ATOM   9762  O  O   . GLU A 1 177 ? -3.626  77.023  20.014  0.25 33.82 ? 177 GLU A O   4 
ATOM   9763  C  CB  . GLU A 1 177 ? -6.285  78.835  20.679  0.25 39.73 ? 177 GLU A CB  4 
ATOM   9764  C  CG  . GLU A 1 177 ? -6.664  80.219  21.160  0.25 46.00 ? 177 GLU A CG  4 
ATOM   9765  C  CD  . GLU A 1 177 ? -5.477  80.980  21.720  0.25 49.09 ? 177 GLU A CD  4 
ATOM   9766  O  OE1 . GLU A 1 177 ? -4.744  80.411  22.558  0.25 51.93 ? 177 GLU A OE1 4 
ATOM   9767  O  OE2 . GLU A 1 177 ? -5.279  82.147  21.325  0.25 51.45 ? 177 GLU A OE2 4 
ATOM   9768  N  N   . ASP A 1 178 ? -5.333  76.673  18.591  0.25 33.41 ? 178 ASP A N   4 
ATOM   9769  C  CA  . ASP A 1 178 ? -4.923  75.307  18.289  0.25 34.85 ? 178 ASP A CA  4 
ATOM   9770  C  C   . ASP A 1 178 ? -3.478  75.337  17.801  0.25 33.90 ? 178 ASP A C   4 
ATOM   9771  O  O   . ASP A 1 178 ? -2.619  74.621  18.317  0.25 32.88 ? 178 ASP A O   4 
ATOM   9772  C  CB  . ASP A 1 178 ? -5.814  74.693  17.200  0.25 38.00 ? 178 ASP A CB  4 
ATOM   9773  C  CG  . ASP A 1 178 ? -7.279  74.635  17.599  0.25 41.24 ? 178 ASP A CG  4 
ATOM   9774  O  OD1 . ASP A 1 178 ? -7.575  74.194  18.730  0.25 43.26 ? 178 ASP A OD1 4 
ATOM   9775  O  OD2 . ASP A 1 178 ? -8.137  75.018  16.775  0.25 42.16 ? 178 ASP A OD2 4 
ATOM   9776  N  N   . ILE A 1 179 ? -3.220  76.181  16.805  0.25 32.47 ? 179 ILE A N   4 
ATOM   9777  C  CA  . ILE A 1 179 ? -1.883  76.326  16.235  0.25 31.18 ? 179 ILE A CA  4 
ATOM   9778  C  C   . ILE A 1 179 ? -0.844  76.620  17.309  0.25 31.07 ? 179 ILE A C   4 
ATOM   9779  O  O   . ILE A 1 179 ? 0.212   75.989  17.346  0.25 31.89 ? 179 ILE A O   4 
ATOM   9780  C  CB  . ILE A 1 179 ? -1.842  77.463  15.185  0.25 29.44 ? 179 ILE A CB  4 
ATOM   9781  C  CG1 . ILE A 1 179 ? -2.692  77.078  13.970  0.25 28.23 ? 179 ILE A CG1 4 
ATOM   9782  C  CG2 . ILE A 1 179 ? -0.406  77.739  14.770  0.25 29.10 ? 179 ILE A CG2 4 
ATOM   9783  C  CD1 . ILE A 1 179 ? -2.768  78.150  12.903  0.25 26.22 ? 179 ILE A CD1 4 
ATOM   9784  N  N   . ILE A 1 180 ? -1.142  77.581  18.178  0.25 32.29 ? 180 ILE A N   4 
ATOM   9785  C  CA  . ILE A 1 180 ? -0.221  77.940  19.248  0.25 34.56 ? 180 ILE A CA  4 
ATOM   9786  C  C   . ILE A 1 180 ? -0.080  76.804  20.258  0.25 37.82 ? 180 ILE A C   4 
ATOM   9787  O  O   . ILE A 1 180 ? 1.035   76.375  20.560  0.25 36.21 ? 180 ILE A O   4 
ATOM   9788  C  CB  . ILE A 1 180 ? -0.678  79.225  19.973  0.25 33.59 ? 180 ILE A CB  4 
ATOM   9789  C  CG1 . ILE A 1 180 ? -0.556  80.421  19.025  0.25 32.23 ? 180 ILE A CG1 4 
ATOM   9790  C  CG2 . ILE A 1 180 ? 0.164   79.456  21.217  0.25 33.77 ? 180 ILE A CG2 4 
ATOM   9791  C  CD1 . ILE A 1 180 ? -0.976  81.741  19.632  0.25 27.70 ? 180 ILE A CD1 4 
ATOM   9792  N  N   . LYS A 1 181 ? -1.210  76.319  20.771  0.25 41.67 ? 181 LYS A N   4 
ATOM   9793  C  CA  . LYS A 1 181 ? -1.210  75.227  21.741  0.25 44.85 ? 181 LYS A CA  4 
ATOM   9794  C  C   . LYS A 1 181 ? -0.116  74.213  21.428  0.25 45.21 ? 181 LYS A C   4 
ATOM   9795  O  O   . LYS A 1 181 ? 0.841   74.071  22.186  0.25 45.84 ? 181 LYS A O   4 
ATOM   9796  C  CB  . LYS A 1 181 ? -2.566  74.511  21.753  0.25 48.46 ? 181 LYS A CB  4 
ATOM   9797  C  CG  . LYS A 1 181 ? -3.698  75.268  22.436  0.25 52.01 ? 181 LYS A CG  4 
ATOM   9798  C  CD  . LYS A 1 181 ? -4.917  74.364  22.602  0.25 54.23 ? 181 LYS A CD  4 
ATOM   9799  C  CE  . LYS A 1 181 ? -6.045  75.046  23.363  0.25 55.96 ? 181 LYS A CE  4 
ATOM   9800  N  NZ  . LYS A 1 181 ? -6.613  76.199  22.617  0.25 58.93 ? 181 LYS A NZ  4 
ATOM   9801  N  N   . LYS A 1 182 ? -0.258  73.515  20.305  0.25 44.84 ? 182 LYS A N   4 
ATOM   9802  C  CA  . LYS A 1 182 ? 0.727   72.518  19.906  0.25 46.34 ? 182 LYS A CA  4 
ATOM   9803  C  C   . LYS A 1 182 ? 2.010   73.179  19.409  0.25 45.58 ? 182 LYS A C   4 
ATOM   9804  O  O   . LYS A 1 182 ? 2.013   74.417  19.250  0.25 41.86 ? 182 LYS A O   4 
ATOM   9805  C  CB  . LYS A 1 182 ? 0.156   71.615  18.808  0.25 48.06 ? 182 LYS A CB  4 
ATOM   9806  C  CG  . LYS A 1 182 ? -0.261  72.349  17.544  0.25 52.23 ? 182 LYS A CG  4 
ATOM   9807  C  CD  . LYS A 1 182 ? -0.699  71.378  16.454  0.25 55.09 ? 182 LYS A CD  4 
ATOM   9808  C  CE  . LYS A 1 182 ? -1.940  70.592  16.856  0.25 55.77 ? 182 LYS A CE  4 
ATOM   9809  N  NZ  . LYS A 1 182 ? -3.131  71.469  17.016  0.25 56.67 ? 182 LYS A NZ  4 
ATOM   9810  N  N   . GLU B 1 15  ? 1.544   91.709  -23.975 0.25 31.09 ? 15  GLU B N   4 
ATOM   9811  C  CA  . GLU B 1 15  ? 2.795   92.481  -23.724 0.25 32.80 ? 15  GLU B CA  4 
ATOM   9812  C  C   . GLU B 1 15  ? 2.485   93.937  -23.374 0.25 29.18 ? 15  GLU B C   4 
ATOM   9813  O  O   . GLU B 1 15  ? 3.282   94.837  -23.650 0.25 27.45 ? 15  GLU B O   4 
ATOM   9814  C  CB  . GLU B 1 15  ? 3.699   92.436  -24.960 0.25 37.23 ? 15  GLU B CB  4 
ATOM   9815  C  CG  . GLU B 1 15  ? 3.150   93.185  -26.164 0.25 45.24 ? 15  GLU B CG  4 
ATOM   9816  C  CD  . GLU B 1 15  ? 4.087   93.133  -27.357 0.25 48.21 ? 15  GLU B CD  4 
ATOM   9817  O  OE1 . GLU B 1 15  ? 5.272   93.493  -27.199 0.25 51.38 ? 15  GLU B OE1 4 
ATOM   9818  O  OE2 . GLU B 1 15  ? 3.638   92.735  -28.454 0.25 51.34 ? 15  GLU B OE2 4 
ATOM   9819  N  N   . SER B 1 16  ? 1.323   94.169  -22.773 0.25 25.30 ? 16  SER B N   4 
ATOM   9820  C  CA  . SER B 1 16  ? 0.929   95.523  -22.399 0.25 22.83 ? 16  SER B CA  4 
ATOM   9821  C  C   . SER B 1 16  ? 0.273   95.576  -21.024 0.25 20.00 ? 16  SER B C   4 
ATOM   9822  O  O   . SER B 1 16  ? -0.148  94.549  -20.481 0.25 17.35 ? 16  SER B O   4 
ATOM   9823  C  CB  . SER B 1 16  ? -0.039  96.094  -23.438 0.25 24.10 ? 16  SER B CB  4 
ATOM   9824  O  OG  . SER B 1 16  ? 0.556   96.138  -24.723 0.25 27.33 ? 16  SER B OG  4 
ATOM   9825  N  N   . PHE B 1 17  ? 0.198   96.781  -20.465 0.25 16.85 ? 17  PHE B N   4 
ATOM   9826  C  CA  . PHE B 1 17  ? -0.429  96.988  -19.167 0.25 14.10 ? 17  PHE B CA  4 
ATOM   9827  C  C   . PHE B 1 17  ? -0.988  98.399  -19.115 0.25 13.47 ? 17  PHE B C   4 
ATOM   9828  O  O   . PHE B 1 17  ? -0.650  99.245  -19.947 0.25 11.31 ? 17  PHE B O   4 
ATOM   9829  C  CB  . PHE B 1 17  ? 0.571   96.778  -18.014 0.25 13.39 ? 17  PHE B CB  4 
ATOM   9830  C  CG  . PHE B 1 17  ? 1.568   97.896  -17.850 0.25 11.62 ? 17  PHE B CG  4 
ATOM   9831  C  CD1 . PHE B 1 17  ? 2.622   98.051  -18.744 0.25 12.63 ? 17  PHE B CD1 4 
ATOM   9832  C  CD2 . PHE B 1 17  ? 1.441   98.806  -16.804 0.25 13.06 ? 17  PHE B CD2 4 
ATOM   9833  C  CE1 . PHE B 1 17  ? 3.537   99.098  -18.598 0.25 12.53 ? 17  PHE B CE1 4 
ATOM   9834  C  CE2 . PHE B 1 17  ? 2.348   99.857  -16.650 0.25 10.45 ? 17  PHE B CE2 4 
ATOM   9835  C  CZ  . PHE B 1 17  ? 3.399   100.004 -17.549 0.25 12.18 ? 17  PHE B CZ  4 
ATOM   9836  N  N   . LEU B 1 18  ? -1.846  98.648  -18.135 0.25 11.17 ? 18  LEU B N   4 
ATOM   9837  C  CA  . LEU B 1 18  ? -2.455  99.955  -17.982 0.25 12.43 ? 18  LEU B CA  4 
ATOM   9838  C  C   . LEU B 1 18  ? -1.835  100.643 -16.776 0.25 13.66 ? 18  LEU B C   4 
ATOM   9839  O  O   . LEU B 1 18  ? -1.480  99.985  -15.790 0.25 12.23 ? 18  LEU B O   4 
ATOM   9840  C  CB  . LEU B 1 18  ? -3.969  99.812  -17.801 0.25 9.14  ? 18  LEU B CB  4 
ATOM   9841  C  CG  . LEU B 1 18  ? -4.692  99.146  -18.970 0.25 13.09 ? 18  LEU B CG  4 
ATOM   9842  C  CD1 . LEU B 1 18  ? -6.154  98.947  -18.613 0.25 10.96 ? 18  LEU B CD1 4 
ATOM   9843  C  CD2 . LEU B 1 18  ? -4.563  100.005 -20.225 0.25 9.61  ? 18  LEU B CD2 4 
ATOM   9844  N  N   . TYR B 1 19  ? -1.703  101.966 -16.873 0.25 11.05 ? 19  TYR B N   4 
ATOM   9845  C  CA  . TYR B 1 19  ? -1.110  102.785 -15.817 0.25 11.60 ? 19  TYR B CA  4 
ATOM   9846  C  C   . TYR B 1 19  ? -2.039  103.937 -15.426 0.25 10.95 ? 19  TYR B C   4 
ATOM   9847  O  O   . TYR B 1 19  ? -2.290  104.841 -16.229 0.25 11.98 ? 19  TYR B O   4 
ATOM   9848  C  CB  . TYR B 1 19  ? 0.243   103.333 -16.301 0.25 10.43 ? 19  TYR B CB  4 
ATOM   9849  C  CG  . TYR B 1 19  ? 0.720   104.571 -15.576 0.25 10.93 ? 19  TYR B CG  4 
ATOM   9850  C  CD1 . TYR B 1 19  ? 0.857   104.587 -14.189 0.25 12.45 ? 19  TYR B CD1 4 
ATOM   9851  C  CD2 . TYR B 1 19  ? 1.014   105.740 -16.281 0.25 11.46 ? 19  TYR B CD2 4 
ATOM   9852  C  CE1 . TYR B 1 19  ? 1.269   105.745 -13.517 0.25 12.06 ? 19  TYR B CE1 4 
ATOM   9853  C  CE2 . TYR B 1 19  ? 1.429   106.899 -15.621 0.25 10.61 ? 19  TYR B CE2 4 
ATOM   9854  C  CZ  . TYR B 1 19  ? 1.551   106.896 -14.242 0.25 12.71 ? 19  TYR B CZ  4 
ATOM   9855  O  OH  . TYR B 1 19  ? 1.934   108.053 -13.594 0.25 13.05 ? 19  TYR B OH  4 
ATOM   9856  N  N   . PHE B 1 20  ? -2.542  103.898 -14.192 0.25 10.49 ? 20  PHE B N   4 
ATOM   9857  C  CA  . PHE B 1 20  ? -3.458  104.929 -13.693 0.25 8.30  ? 20  PHE B CA  4 
ATOM   9858  C  C   . PHE B 1 20  ? -2.675  106.161 -13.269 0.25 9.10  ? 20  PHE B C   4 
ATOM   9859  O  O   . PHE B 1 20  ? -1.847  106.107 -12.354 0.25 7.99  ? 20  PHE B O   4 
ATOM   9860  C  CB  . PHE B 1 20  ? -4.271  104.397 -12.502 0.25 9.06  ? 20  PHE B CB  4 
ATOM   9861  C  CG  . PHE B 1 20  ? -5.317  105.358 -11.989 0.25 8.51  ? 20  PHE B CG  4 
ATOM   9862  C  CD1 . PHE B 1 20  ? -6.412  105.710 -12.778 0.25 10.15 ? 20  PHE B CD1 4 
ATOM   9863  C  CD2 . PHE B 1 20  ? -5.216  105.896 -10.709 0.25 10.60 ? 20  PHE B CD2 4 
ATOM   9864  C  CE1 . PHE B 1 20  ? -7.397  106.587 -12.298 0.25 9.84  ? 20  PHE B CE1 4 
ATOM   9865  C  CE2 . PHE B 1 20  ? -6.196  106.780 -10.213 0.25 9.97  ? 20  PHE B CE2 4 
ATOM   9866  C  CZ  . PHE B 1 20  ? -7.286  107.123 -11.009 0.25 9.85  ? 20  PHE B CZ  4 
ATOM   9867  N  N   . ALA B 1 21  ? -2.945  107.274 -13.939 0.25 7.31  ? 21  ALA B N   4 
ATOM   9868  C  CA  . ALA B 1 21  ? -2.264  108.530 -13.649 0.25 8.99  ? 21  ALA B CA  4 
ATOM   9869  C  C   . ALA B 1 21  ? -3.216  109.499 -12.966 0.25 9.21  ? 21  ALA B C   4 
ATOM   9870  O  O   . ALA B 1 21  ? -4.327  109.724 -13.445 0.25 9.41  ? 21  ALA B O   4 
ATOM   9871  C  CB  . ALA B 1 21  ? -1.734  109.150 -14.949 0.25 4.84  ? 21  ALA B CB  4 
ATOM   9872  N  N   . TYR B 1 22  ? -2.774  110.079 -11.852 0.25 8.95  ? 22  TYR B N   4 
ATOM   9873  C  CA  . TYR B 1 22  ? -3.605  111.027 -11.120 0.25 8.52  ? 22  TYR B CA  4 
ATOM   9874  C  C   . TYR B 1 22  ? -2.901  112.355 -10.862 0.25 8.58  ? 22  TYR B C   4 
ATOM   9875  O  O   . TYR B 1 22  ? -3.516  113.301 -10.375 0.25 10.40 ? 22  TYR B O   4 
ATOM   9876  C  CB  . TYR B 1 22  ? -4.087  110.402 -9.799  0.25 10.29 ? 22  TYR B CB  4 
ATOM   9877  C  CG  . TYR B 1 22  ? -2.983  109.918 -8.882  0.25 6.80  ? 22  TYR B CG  4 
ATOM   9878  C  CD1 . TYR B 1 22  ? -2.347  110.787 -8.003  0.25 8.66  ? 22  TYR B CD1 4 
ATOM   9879  C  CD2 . TYR B 1 22  ? -2.576  108.585 -8.900  0.25 8.67  ? 22  TYR B CD2 4 
ATOM   9880  C  CE1 . TYR B 1 22  ? -1.323  110.336 -7.150  0.25 8.66  ? 22  TYR B CE1 4 
ATOM   9881  C  CE2 . TYR B 1 22  ? -1.560  108.124 -8.060  0.25 8.12  ? 22  TYR B CE2 4 
ATOM   9882  C  CZ  . TYR B 1 22  ? -0.940  109.004 -7.186  0.25 8.70  ? 22  TYR B CZ  4 
ATOM   9883  O  OH  . TYR B 1 22  ? 0.046   108.541 -6.344  0.25 7.08  ? 22  TYR B OH  4 
ATOM   9884  N  N   . GLY B 1 23  ? -1.622  112.430 -11.230 0.25 8.05  ? 23  GLY B N   4 
ATOM   9885  C  CA  . GLY B 1 23  ? -0.844  113.643 -11.033 0.25 8.72  ? 23  GLY B CA  4 
ATOM   9886  C  C   . GLY B 1 23  ? -0.451  114.345 -12.323 0.25 7.84  ? 23  GLY B C   4 
ATOM   9887  O  O   . GLY B 1 23  ? -1.283  114.529 -13.212 0.25 9.89  ? 23  GLY B O   4 
ATOM   9888  N  N   . SER B 1 24  ? 0.817   114.733 -12.436 0.25 10.21 ? 24  SER B N   4 
ATOM   9889  C  CA  . SER B 1 24  ? 1.285   115.430 -13.631 0.25 10.74 ? 24  SER B CA  4 
ATOM   9890  C  C   . SER B 1 24  ? 1.196   114.602 -14.911 0.25 11.80 ? 24  SER B C   4 
ATOM   9891  O  O   . SER B 1 24  ? 1.340   115.145 -16.011 0.25 10.43 ? 24  SER B O   4 
ATOM   9892  C  CB  . SER B 1 24  ? 2.720   115.948 -13.438 0.25 10.15 ? 24  SER B CB  4 
ATOM   9893  O  OG  . SER B 1 24  ? 3.607   114.942 -12.984 0.25 9.14  ? 24  SER B OG  4 
ATOM   9894  N  N   . ASN B 1 25  ? 0.969   113.295 -14.785 0.25 11.17 ? 25  ASN B N   4 
ATOM   9895  C  CA  . ASN B 1 25  ? 0.838   112.471 -15.981 0.25 10.96 ? 25  ASN B CA  4 
ATOM   9896  C  C   . ASN B 1 25  ? -0.593  112.456 -16.527 0.25 11.85 ? 25  ASN B C   4 
ATOM   9897  O  O   . ASN B 1 25  ? -0.944  111.625 -17.369 0.25 10.27 ? 25  ASN B O   4 
ATOM   9898  C  CB  . ASN B 1 25  ? 1.351   111.044 -15.744 0.25 11.60 ? 25  ASN B CB  4 
ATOM   9899  C  CG  . ASN B 1 25  ? 2.868   110.951 -15.853 0.25 14.08 ? 25  ASN B CG  4 
ATOM   9900  O  OD1 . ASN B 1 25  ? 3.491   111.705 -16.607 0.25 13.92 ? 25  ASN B OD1 4 
ATOM   9901  N  ND2 . ASN B 1 25  ? 3.467   110.020 -15.113 0.25 13.20 ? 25  ASN B ND2 4 
ATOM   9902  N  N   . LEU B 1 26  ? -1.424  113.375 -16.038 0.25 10.92 ? 26  LEU B N   4 
ATOM   9903  C  CA  . LEU B 1 26  ? -2.782  113.503 -16.560 0.25 9.78  ? 26  LEU B CA  4 
ATOM   9904  C  C   . LEU B 1 26  ? -2.608  114.241 -17.893 0.25 10.43 ? 26  LEU B C   4 
ATOM   9905  O  O   . LEU B 1 26  ? -3.456  114.159 -18.780 0.25 10.74 ? 26  LEU B O   4 
ATOM   9906  C  CB  . LEU B 1 26  ? -3.661  114.354 -15.636 0.25 9.97  ? 26  LEU B CB  4 
ATOM   9907  C  CG  . LEU B 1 26  ? -4.185  113.780 -14.318 0.25 9.76  ? 26  LEU B CG  4 
ATOM   9908  C  CD1 . LEU B 1 26  ? -4.930  114.879 -13.560 0.25 8.96  ? 26  LEU B CD1 4 
ATOM   9909  C  CD2 . LEU B 1 26  ? -5.115  112.602 -14.601 0.25 11.86 ? 26  LEU B CD2 4 
ATOM   9910  N  N   . LEU B 1 27  ? -1.489  114.951 -18.025 0.25 8.69  ? 27  LEU B N   4 
ATOM   9911  C  CA  . LEU B 1 27  ? -1.195  115.717 -19.237 0.25 10.53 ? 27  LEU B CA  4 
ATOM   9912  C  C   . LEU B 1 27  ? -0.365  114.919 -20.241 0.25 11.12 ? 27  LEU B C   4 
ATOM   9913  O  O   . LEU B 1 27  ? 0.788   114.578 -19.984 0.25 10.00 ? 27  LEU B O   4 
ATOM   9914  C  CB  . LEU B 1 27  ? -0.455  117.011 -18.880 0.25 10.82 ? 27  LEU B CB  4 
ATOM   9915  C  CG  . LEU B 1 27  ? -0.172  117.910 -20.087 0.25 13.24 ? 27  LEU B CG  4 
ATOM   9916  C  CD1 . LEU B 1 27  ? -1.494  118.344 -20.704 0.25 11.42 ? 27  LEU B CD1 4 
ATOM   9917  C  CD2 . LEU B 1 27  ? 0.644   119.121 -19.671 0.25 11.03 ? 27  LEU B CD2 4 
ATOM   9918  N  N   . THR B 1 28  ? -0.962  114.642 -21.395 0.25 12.83 ? 28  THR B N   4 
ATOM   9919  C  CA  . THR B 1 28  ? -0.316  113.874 -22.453 0.25 12.89 ? 28  THR B CA  4 
ATOM   9920  C  C   . THR B 1 28  ? 1.125   114.289 -22.744 0.25 14.00 ? 28  THR B C   4 
ATOM   9921  O  O   . THR B 1 28  ? 2.022   113.448 -22.783 0.25 14.73 ? 28  THR B O   4 
ATOM   9922  C  CB  . THR B 1 28  ? -1.121  113.971 -23.755 0.25 13.98 ? 28  THR B CB  4 
ATOM   9923  O  OG1 . THR B 1 28  ? -2.470  113.546 -23.516 0.25 12.03 ? 28  THR B OG1 4 
ATOM   9924  C  CG2 . THR B 1 28  ? -0.499  113.095 -24.829 0.25 12.75 ? 28  THR B CG2 4 
ATOM   9925  N  N   . GLU B 1 29  ? 1.345   115.581 -22.954 0.25 15.69 ? 29  GLU B N   4 
ATOM   9926  C  CA  . GLU B 1 29  ? 2.682   116.076 -23.253 0.25 16.65 ? 29  GLU B CA  4 
ATOM   9927  C  C   . GLU B 1 29  ? 3.691   115.802 -22.139 0.25 15.68 ? 29  GLU B C   4 
ATOM   9928  O  O   . GLU B 1 29  ? 4.868   115.563 -22.409 0.25 13.86 ? 29  GLU B O   4 
ATOM   9929  C  CB  . GLU B 1 29  ? 2.633   117.576 -23.573 0.25 19.57 ? 29  GLU B CB  4 
ATOM   9930  C  CG  . GLU B 1 29  ? 4.001   118.239 -23.653 0.25 24.90 ? 29  GLU B CG  4 
ATOM   9931  C  CD  . GLU B 1 29  ? 3.997   119.499 -24.506 0.25 28.08 ? 29  GLU B CD  4 
ATOM   9932  O  OE1 . GLU B 1 29  ? 2.985   120.233 -24.488 0.25 28.19 ? 29  GLU B OE1 4 
ATOM   9933  O  OE2 . GLU B 1 29  ? 5.015   119.759 -25.184 0.25 27.83 ? 29  GLU B OE2 4 
ATOM   9934  N  N   . ARG B 1 30  ? 3.240   115.835 -20.889 0.25 14.03 ? 30  ARG B N   4 
ATOM   9935  C  CA  . ARG B 1 30  ? 4.140   115.574 -19.768 0.25 13.92 ? 30  ARG B CA  4 
ATOM   9936  C  C   . ARG B 1 30  ? 4.536   114.095 -19.711 0.25 12.48 ? 30  ARG B C   4 
ATOM   9937  O  O   . ARG B 1 30  ? 5.723   113.766 -19.632 0.25 13.49 ? 30  ARG B O   4 
ATOM   9938  C  CB  . ARG B 1 30  ? 3.484   116.000 -18.445 0.25 15.40 ? 30  ARG B CB  4 
ATOM   9939  C  CG  . ARG B 1 30  ? 4.159   115.439 -17.194 0.25 17.81 ? 30  ARG B CG  4 
ATOM   9940  C  CD  . ARG B 1 30  ? 5.597   115.920 -17.053 0.25 21.03 ? 30  ARG B CD  4 
ATOM   9941  N  NE  . ARG B 1 30  ? 6.261   115.302 -15.907 0.25 23.07 ? 30  ARG B NE  4 
ATOM   9942  C  CZ  . ARG B 1 30  ? 7.474   115.634 -15.474 0.25 25.38 ? 30  ARG B CZ  4 
ATOM   9943  N  NH1 . ARG B 1 30  ? 8.168   116.585 -16.087 0.25 24.02 ? 30  ARG B NH1 4 
ATOM   9944  N  NH2 . ARG B 1 30  ? 7.994   115.012 -14.426 0.25 26.50 ? 30  ARG B NH2 4 
ATOM   9945  N  N   . ILE B 1 31  ? 3.554   113.202 -19.764 0.25 11.70 ? 31  ILE B N   4 
ATOM   9946  C  CA  . ILE B 1 31  ? 3.856   111.774 -19.704 0.25 11.46 ? 31  ILE B CA  4 
ATOM   9947  C  C   . ILE B 1 31  ? 4.687   111.337 -20.912 0.25 12.65 ? 31  ILE B C   4 
ATOM   9948  O  O   . ILE B 1 31  ? 5.567   110.485 -20.787 0.25 13.01 ? 31  ILE B O   4 
ATOM   9949  C  CB  . ILE B 1 31  ? 2.572   110.908 -19.635 0.25 10.46 ? 31  ILE B CB  4 
ATOM   9950  C  CG1 . ILE B 1 31  ? 2.951   109.456 -19.322 0.25 7.33  ? 31  ILE B CG1 4 
ATOM   9951  C  CG2 . ILE B 1 31  ? 1.816   110.967 -20.955 0.25 8.36  ? 31  ILE B CG2 4 
ATOM   9952  C  CD1 . ILE B 1 31  ? 1.756   108.530 -19.131 0.25 11.76 ? 31  ILE B CD1 4 
ATOM   9953  N  N   . HIS B 1 32  ? 4.413   111.937 -22.069 0.25 13.13 ? 32  HIS B N   4 
ATOM   9954  C  CA  . HIS B 1 32  ? 5.130   111.619 -23.300 0.25 14.11 ? 32  HIS B CA  4 
ATOM   9955  C  C   . HIS B 1 32  ? 6.561   112.147 -23.310 0.25 15.83 ? 32  HIS B C   4 
ATOM   9956  O  O   . HIS B 1 32  ? 7.353   111.771 -24.176 0.25 16.89 ? 32  HIS B O   4 
ATOM   9957  C  CB  . HIS B 1 32  ? 4.386   112.182 -24.517 0.25 13.61 ? 32  HIS B CB  4 
ATOM   9958  C  CG  . HIS B 1 32  ? 3.291   111.294 -25.027 0.25 10.76 ? 32  HIS B CG  4 
ATOM   9959  N  ND1 . HIS B 1 32  ? 2.343   111.727 -25.926 0.25 10.24 ? 32  HIS B ND1 4 
ATOM   9960  C  CD2 . HIS B 1 32  ? 2.995   110.000 -24.759 0.25 7.48  ? 32  HIS B CD2 4 
ATOM   9961  C  CE1 . HIS B 1 32  ? 1.505   110.739 -26.190 0.25 10.37 ? 32  HIS B CE1 4 
ATOM   9962  N  NE2 . HIS B 1 32  ? 1.877   109.680 -25.494 0.25 10.09 ? 32  HIS B NE2 4 
ATOM   9963  N  N   . LEU B 1 33  ? 6.893   113.023 -22.366 0.25 15.72 ? 33  LEU B N   4 
ATOM   9964  C  CA  . LEU B 1 33  ? 8.245   113.567 -22.311 0.25 16.75 ? 33  LEU B CA  4 
ATOM   9965  C  C   . LEU B 1 33  ? 9.241   112.447 -22.052 0.25 17.18 ? 33  LEU B C   4 
ATOM   9966  O  O   . LEU B 1 33  ? 10.314  112.406 -22.655 0.25 16.12 ? 33  LEU B O   4 
ATOM   9967  C  CB  . LEU B 1 33  ? 8.370   114.628 -21.210 0.25 17.35 ? 33  LEU B CB  4 
ATOM   9968  C  CG  . LEU B 1 33  ? 7.745   116.005 -21.472 0.25 21.04 ? 33  LEU B CG  4 
ATOM   9969  C  CD1 . LEU B 1 33  ? 7.952   116.897 -20.262 0.25 21.25 ? 33  LEU B CD1 4 
ATOM   9970  C  CD2 . LEU B 1 33  ? 8.373   116.640 -22.705 0.25 22.20 ? 33  LEU B CD2 4 
ATOM   9971  N  N   . ARG B 1 34  ? 8.878   111.539 -21.152 0.25 15.71 ? 34  ARG B N   4 
ATOM   9972  C  CA  . ARG B 1 34  ? 9.731   110.411 -20.805 0.25 15.36 ? 34  ARG B CA  4 
ATOM   9973  C  C   . ARG B 1 34  ? 9.215   109.116 -21.426 0.25 14.39 ? 34  ARG B C   4 
ATOM   9974  O  O   . ARG B 1 34  ? 9.990   108.202 -21.693 0.25 13.92 ? 34  ARG B O   4 
ATOM   9975  C  CB  . ARG B 1 34  ? 9.797   110.249 -19.278 0.25 19.82 ? 34  ARG B CB  4 
ATOM   9976  C  CG  . ARG B 1 34  ? 10.441  111.419 -18.533 0.25 21.01 ? 34  ARG B CG  4 
ATOM   9977  C  CD  . ARG B 1 34  ? 11.945  111.485 -18.780 0.25 24.03 ? 34  ARG B CD  4 
ATOM   9978  N  NE  . ARG B 1 34  ? 12.686  110.450 -18.058 0.25 25.58 ? 34  ARG B NE  4 
ATOM   9979  C  CZ  . ARG B 1 34  ? 12.822  110.406 -16.734 0.25 28.45 ? 34  ARG B CZ  4 
ATOM   9980  N  NH1 . ARG B 1 34  ? 12.265  111.341 -15.973 0.25 31.81 ? 34  ARG B NH1 4 
ATOM   9981  N  NH2 . ARG B 1 34  ? 13.521  109.430 -16.165 0.25 27.51 ? 34  ARG B NH2 4 
ATOM   9982  N  N   . ASN B 1 35  ? 7.907   109.040 -21.659 0.25 11.88 ? 35  ASN B N   4 
ATOM   9983  C  CA  . ASN B 1 35  ? 7.299   107.832 -22.225 0.25 11.37 ? 35  ASN B CA  4 
ATOM   9984  C  C   . ASN B 1 35  ? 6.456   108.163 -23.461 0.25 11.24 ? 35  ASN B C   4 
ATOM   9985  O  O   . ASN B 1 35  ? 5.243   107.934 -23.475 0.25 10.99 ? 35  ASN B O   4 
ATOM   9986  C  CB  . ASN B 1 35  ? 6.410   107.164 -21.172 0.25 11.81 ? 35  ASN B CB  4 
ATOM   9987  C  CG  . ASN B 1 35  ? 7.088   107.052 -19.823 0.25 11.95 ? 35  ASN B CG  4 
ATOM   9988  O  OD1 . ASN B 1 35  ? 8.003   106.251 -19.640 0.25 13.52 ? 35  ASN B OD1 4 
ATOM   9989  N  ND2 . ASN B 1 35  ? 6.648   107.868 -18.871 0.25 12.38 ? 35  ASN B ND2 4 
ATOM   9990  N  N   . PRO B 1 36  ? 7.091   108.691 -24.519 0.25 10.81 ? 36  PRO B N   4 
ATOM   9991  C  CA  . PRO B 1 36  ? 6.390   109.057 -25.755 0.25 10.99 ? 36  PRO B CA  4 
ATOM   9992  C  C   . PRO B 1 36  ? 5.489   108.009 -26.399 0.25 11.75 ? 36  PRO B C   4 
ATOM   9993  O  O   . PRO B 1 36  ? 4.643   108.357 -27.226 0.25 12.02 ? 36  PRO B O   4 
ATOM   9994  C  CB  . PRO B 1 36  ? 7.527   109.514 -26.684 0.25 11.22 ? 36  PRO B CB  4 
ATOM   9995  C  CG  . PRO B 1 36  ? 8.736   108.811 -26.141 0.25 10.29 ? 36  PRO B CG  4 
ATOM   9996  C  CD  . PRO B 1 36  ? 8.541   108.915 -24.654 0.25 8.57  ? 36  PRO B CD  4 
ATOM   9997  N  N   . SER B 1 37  ? 5.638   106.738 -26.034 0.25 12.05 ? 37  SER B N   4 
ATOM   9998  C  CA  . SER B 1 37  ? 4.784   105.712 -26.641 0.25 14.21 ? 37  SER B CA  4 
ATOM   9999  C  C   . SER B 1 37  ? 3.526   105.390 -25.827 0.25 13.76 ? 37  SER B C   4 
ATOM   10000 O  O   . SER B 1 37  ? 2.797   104.447 -26.143 0.25 13.56 ? 37  SER B O   4 
ATOM   10001 C  CB  . SER B 1 37  ? 5.573   104.419 -26.898 0.25 15.53 ? 37  SER B CB  4 
ATOM   10002 O  OG  . SER B 1 37  ? 5.844   103.720 -25.698 0.25 19.69 ? 37  SER B OG  4 
ATOM   10003 N  N   . ALA B 1 38  ? 3.266   106.172 -24.784 0.25 13.02 ? 38  ALA B N   4 
ATOM   10004 C  CA  . ALA B 1 38  ? 2.084   105.943 -23.957 0.25 13.59 ? 38  ALA B CA  4 
ATOM   10005 C  C   . ALA B 1 38  ? 0.849   106.300 -24.776 0.25 13.23 ? 38  ALA B C   4 
ATOM   10006 O  O   . ALA B 1 38  ? 0.855   107.275 -25.529 0.25 14.01 ? 38  ALA B O   4 
ATOM   10007 C  CB  . ALA B 1 38  ? 2.144   106.803 -22.690 0.25 12.02 ? 38  ALA B CB  4 
ATOM   10008 N  N   . ALA B 1 39  ? -0.207  105.509 -24.631 0.25 11.62 ? 39  ALA B N   4 
ATOM   10009 C  CA  . ALA B 1 39  ? -1.436  105.757 -25.371 0.25 12.68 ? 39  ALA B CA  4 
ATOM   10010 C  C   . ALA B 1 39  ? -2.618  105.920 -24.432 0.25 12.60 ? 39  ALA B C   4 
ATOM   10011 O  O   . ALA B 1 39  ? -2.874  105.059 -23.585 0.25 10.74 ? 39  ALA B O   4 
ATOM   10012 C  CB  . ALA B 1 39  ? -1.700  104.603 -26.363 0.25 14.78 ? 39  ALA B CB  4 
ATOM   10013 N  N   . PHE B 1 40  ? -3.324  107.039 -24.575 0.25 11.77 ? 40  PHE B N   4 
ATOM   10014 C  CA  . PHE B 1 40  ? -4.497  107.318 -23.757 0.25 12.12 ? 40  PHE B CA  4 
ATOM   10015 C  C   . PHE B 1 40  ? -5.394  106.104 -23.869 0.25 11.46 ? 40  PHE B C   4 
ATOM   10016 O  O   . PHE B 1 40  ? -5.521  105.528 -24.949 0.25 10.68 ? 40  PHE B O   4 
ATOM   10017 C  CB  . PHE B 1 40  ? -5.255  108.536 -24.296 0.25 12.67 ? 40  PHE B CB  4 
ATOM   10018 C  CG  . PHE B 1 40  ? -6.551  108.818 -23.571 0.25 12.30 ? 40  PHE B CG  4 
ATOM   10019 C  CD1 . PHE B 1 40  ? -6.573  109.644 -22.452 0.25 10.67 ? 40  PHE B CD1 4 
ATOM   10020 C  CD2 . PHE B 1 40  ? -7.746  108.254 -24.011 0.25 12.07 ? 40  PHE B CD2 4 
ATOM   10021 C  CE1 . PHE B 1 40  ? -7.771  109.909 -21.780 0.25 14.83 ? 40  PHE B CE1 4 
ATOM   10022 C  CE2 . PHE B 1 40  ? -8.947  108.508 -23.350 0.25 13.39 ? 40  PHE B CE2 4 
ATOM   10023 C  CZ  . PHE B 1 40  ? -8.962  109.340 -22.231 0.25 12.22 ? 40  PHE B CZ  4 
ATOM   10024 N  N   . PHE B 1 41  ? -6.016  105.710 -22.767 0.25 10.58 ? 41  PHE B N   4 
ATOM   10025 C  CA  . PHE B 1 41  ? -6.901  104.557 -22.807 0.25 11.32 ? 41  PHE B CA  4 
ATOM   10026 C  C   . PHE B 1 41  ? -8.303  104.948 -22.361 0.25 13.11 ? 41  PHE B C   4 
ATOM   10027 O  O   . PHE B 1 41  ? -9.286  104.587 -23.005 0.25 12.16 ? 41  PHE B O   4 
ATOM   10028 C  CB  . PHE B 1 41  ? -6.359  103.428 -21.928 0.25 12.53 ? 41  PHE B CB  4 
ATOM   10029 C  CG  . PHE B 1 41  ? -7.112  102.135 -22.076 0.25 15.58 ? 41  PHE B CG  4 
ATOM   10030 C  CD1 . PHE B 1 41  ? -7.131  101.462 -23.296 0.25 14.89 ? 41  PHE B CD1 4 
ATOM   10031 C  CD2 . PHE B 1 41  ? -7.804  101.591 -21.000 0.25 14.15 ? 41  PHE B CD2 4 
ATOM   10032 C  CE1 . PHE B 1 41  ? -7.829  100.265 -23.440 0.25 16.54 ? 41  PHE B CE1 4 
ATOM   10033 C  CE2 . PHE B 1 41  ? -8.506  100.394 -21.132 0.25 18.11 ? 41  PHE B CE2 4 
ATOM   10034 C  CZ  . PHE B 1 41  ? -8.519  99.729  -22.351 0.25 17.74 ? 41  PHE B CZ  4 
ATOM   10035 N  N   . CYS B 1 42  ? -8.393  105.699 -21.265 0.25 13.76 ? 42  CYS B N   4 
ATOM   10036 C  CA  . CYS B 1 42  ? -9.690  106.134 -20.754 0.25 14.03 ? 42  CYS B CA  4 
ATOM   10037 C  C   . CYS B 1 42  ? -9.554  106.887 -19.441 0.25 13.41 ? 42  CYS B C   4 
ATOM   10038 O  O   . CYS B 1 42  ? -8.488  106.907 -18.829 0.25 12.44 ? 42  CYS B O   4 
ATOM   10039 C  CB  . CYS B 1 42  ? -10.602 104.931 -20.515 0.25 16.49 ? 42  CYS B CB  4 
ATOM   10040 S  SG  . CYS B 1 42  ? -10.179 103.974 -19.035 0.25 20.19 ? 42  CYS B SG  4 
ATOM   10041 N  N   . VAL B 1 43  ? -10.652 107.505 -19.017 0.25 13.40 ? 43  VAL B N   4 
ATOM   10042 C  CA  . VAL B 1 43  ? -10.700 108.229 -17.754 0.25 13.15 ? 43  VAL B CA  4 
ATOM   10043 C  C   . VAL B 1 43  ? -11.386 107.277 -16.780 0.25 13.82 ? 43  VAL B C   4 
ATOM   10044 O  O   . VAL B 1 43  ? -12.379 106.631 -17.130 0.25 12.59 ? 43  VAL B O   4 
ATOM   10045 C  CB  . VAL B 1 43  ? -11.513 109.536 -17.892 0.25 15.17 ? 43  VAL B CB  4 
ATOM   10046 C  CG1 . VAL B 1 43  ? -11.952 110.040 -16.524 0.25 13.86 ? 43  VAL B CG1 4 
ATOM   10047 C  CG2 . VAL B 1 43  ? -10.658 110.593 -18.584 0.25 15.40 ? 43  VAL B CG2 4 
ATOM   10048 N  N   . ALA B 1 44  ? -10.855 107.175 -15.565 0.25 11.63 ? 44  ALA B N   4 
ATOM   10049 C  CA  . ALA B 1 44  ? -11.431 106.265 -14.588 0.25 10.52 ? 44  ALA B CA  4 
ATOM   10050 C  C   . ALA B 1 44  ? -11.467 106.819 -13.173 0.25 10.81 ? 44  ALA B C   4 
ATOM   10051 O  O   . ALA B 1 44  ? -10.731 107.739 -12.824 0.25 10.80 ? 44  ALA B O   4 
ATOM   10052 C  CB  . ALA B 1 44  ? -10.673 104.944 -14.608 0.25 9.85  ? 44  ALA B CB  4 
ATOM   10053 N  N   . ARG B 1 45  ? -12.333 106.231 -12.359 0.25 11.97 ? 45  ARG B N   4 
ATOM   10054 C  CA  . ARG B 1 45  ? -12.509 106.654 -10.979 0.25 11.71 ? 45  ARG B CA  4 
ATOM   10055 C  C   . ARG B 1 45  ? -12.002 105.614 -9.988  0.25 11.26 ? 45  ARG B C   4 
ATOM   10056 O  O   . ARG B 1 45  ? -12.307 104.436 -10.108 0.25 8.71  ? 45  ARG B O   4 
ATOM   10057 C  CB  . ARG B 1 45  ? -13.993 106.925 -10.711 0.25 12.60 ? 45  ARG B CB  4 
ATOM   10058 C  CG  . ARG B 1 45  ? -14.376 106.971 -9.238  0.25 19.48 ? 45  ARG B CG  4 
ATOM   10059 C  CD  . ARG B 1 45  ? -15.865 107.282 -9.061  0.25 22.03 ? 45  ARG B CD  4 
ATOM   10060 N  NE  . ARG B 1 45  ? -16.722 106.334 -9.768  0.25 27.59 ? 45  ARG B NE  4 
ATOM   10061 C  CZ  . ARG B 1 45  ? -16.840 105.046 -9.459  0.25 31.06 ? 45  ARG B CZ  4 
ATOM   10062 N  NH1 . ARG B 1 45  ? -16.155 104.535 -8.444  0.25 36.26 ? 45  ARG B NH1 4 
ATOM   10063 N  NH2 . ARG B 1 45  ? -17.645 104.266 -10.169 0.25 32.96 ? 45  ARG B NH2 4 
ATOM   10064 N  N   . LEU B 1 46  ? -11.224 106.070 -9.014  0.25 11.85 ? 46  LEU B N   4 
ATOM   10065 C  CA  . LEU B 1 46  ? -10.706 105.209 -7.968  0.25 11.42 ? 46  LEU B CA  4 
ATOM   10066 C  C   . LEU B 1 46  ? -11.471 105.587 -6.703  0.25 12.02 ? 46  LEU B C   4 
ATOM   10067 O  O   . LEU B 1 46  ? -11.235 106.643 -6.112  0.25 11.64 ? 46  LEU B O   4 
ATOM   10068 C  CB  . LEU B 1 46  ? -9.203  105.442 -7.771  0.25 10.53 ? 46  LEU B CB  4 
ATOM   10069 C  CG  . LEU B 1 46  ? -8.597  104.750 -6.543  0.25 11.68 ? 46  LEU B CG  4 
ATOM   10070 C  CD1 . LEU B 1 46  ? -8.831  103.249 -6.612  0.25 10.47 ? 46  LEU B CD1 4 
ATOM   10071 C  CD2 . LEU B 1 46  ? -7.116  105.062 -6.466  0.25 11.58 ? 46  LEU B CD2 4 
ATOM   10072 N  N   . GLN B 1 47  ? -12.399 104.723 -6.306  0.25 12.09 ? 47  GLN B N   4 
ATOM   10073 C  CA  . GLN B 1 47  ? -13.232 104.950 -5.135  0.25 14.20 ? 47  GLN B CA  4 
ATOM   10074 C  C   . GLN B 1 47  ? -12.512 104.652 -3.818  0.25 13.75 ? 47  GLN B C   4 
ATOM   10075 O  O   . GLN B 1 47  ? -11.628 103.800 -3.762  0.25 13.09 ? 47  GLN B O   4 
ATOM   10076 C  CB  . GLN B 1 47  ? -14.489 104.082 -5.234  0.25 16.94 ? 47  GLN B CB  4 
ATOM   10077 C  CG  . GLN B 1 47  ? -15.534 104.367 -4.170  0.25 17.99 ? 47  GLN B CG  4 
ATOM   10078 C  CD  . GLN B 1 47  ? -16.051 105.792 -4.237  0.25 19.82 ? 47  GLN B CD  4 
ATOM   10079 O  OE1 . GLN B 1 47  ? -16.508 106.248 -5.289  0.25 19.25 ? 47  GLN B OE1 4 
ATOM   10080 N  NE2 . GLN B 1 47  ? -15.984 106.505 -3.112  0.25 17.89 ? 47  GLN B NE2 4 
ATOM   10081 N  N   . ASP B 1 48  ? -12.908 105.365 -2.767  0.25 13.17 ? 48  ASP B N   4 
ATOM   10082 C  CA  . ASP B 1 48  ? -12.351 105.193 -1.428  0.25 12.70 ? 48  ASP B CA  4 
ATOM   10083 C  C   . ASP B 1 48  ? -10.869 105.503 -1.250  0.25 12.45 ? 48  ASP B C   4 
ATOM   10084 O  O   . ASP B 1 48  ? -10.212 104.996 -0.335  0.25 10.84 ? 48  ASP B O   4 
ATOM   10085 C  CB  . ASP B 1 48  ? -12.684 103.791 -0.919  0.25 13.40 ? 48  ASP B CB  4 
ATOM   10086 C  CG  . ASP B 1 48  ? -14.175 103.621 -0.647  0.25 17.60 ? 48  ASP B CG  4 
ATOM   10087 O  OD1 . ASP B 1 48  ? -14.961 104.464 -1.140  0.25 12.14 ? 48  ASP B OD1 4 
ATOM   10088 O  OD2 . ASP B 1 48  ? -14.561 102.656 0.048   0.25 16.27 ? 48  ASP B OD2 4 
ATOM   10089 N  N   . PHE B 1 49  ? -10.346 106.343 -2.135  0.25 11.40 ? 49  PHE B N   4 
ATOM   10090 C  CA  . PHE B 1 49  ? -8.968  106.797 -2.046  0.25 12.94 ? 49  PHE B CA  4 
ATOM   10091 C  C   . PHE B 1 49  ? -9.054  108.314 -2.052  0.25 12.45 ? 49  PHE B C   4 
ATOM   10092 O  O   . PHE B 1 49  ? -9.949  108.887 -2.673  0.25 14.47 ? 49  PHE B O   4 
ATOM   10093 C  CB  . PHE B 1 49  ? -8.126  106.345 -3.243  0.25 12.11 ? 49  PHE B CB  4 
ATOM   10094 C  CG  . PHE B 1 49  ? -7.484  104.999 -3.071  0.25 11.89 ? 49  PHE B CG  4 
ATOM   10095 C  CD1 . PHE B 1 49  ? -8.211  103.830 -3.272  0.25 11.80 ? 49  PHE B CD1 4 
ATOM   10096 C  CD2 . PHE B 1 49  ? -6.136  104.900 -2.731  0.25 12.39 ? 49  PHE B CD2 4 
ATOM   10097 C  CE1 . PHE B 1 49  ? -7.603  102.579 -3.141  0.25 11.44 ? 49  PHE B CE1 4 
ATOM   10098 C  CE2 . PHE B 1 49  ? -5.518  103.655 -2.596  0.25 12.13 ? 49  PHE B CE2 4 
ATOM   10099 C  CZ  . PHE B 1 49  ? -6.253  102.494 -2.802  0.25 7.63  ? 49  PHE B CZ  4 
ATOM   10100 N  N   . LYS B 1 50  ? -8.124  108.961 -1.363  0.25 13.58 ? 50  LYS B N   4 
ATOM   10101 C  CA  . LYS B 1 50  ? -8.103  110.414 -1.299  0.25 12.49 ? 50  LYS B CA  4 
ATOM   10102 C  C   . LYS B 1 50  ? -6.771  110.962 -1.797  0.25 12.40 ? 50  LYS B C   4 
ATOM   10103 O  O   . LYS B 1 50  ? -5.702  110.511 -1.376  0.25 11.09 ? 50  LYS B O   4 
ATOM   10104 C  CB  . LYS B 1 50  ? -8.334  110.877 0.137   0.25 12.87 ? 50  LYS B CB  4 
ATOM   10105 C  CG  . LYS B 1 50  ? -8.345  112.394 0.312   0.25 14.99 ? 50  LYS B CG  4 
ATOM   10106 C  CD  . LYS B 1 50  ? -8.709  112.751 1.747   0.25 18.25 ? 50  LYS B CD  4 
ATOM   10107 C  CE  . LYS B 1 50  ? -8.753  114.253 1.967   0.25 20.77 ? 50  LYS B CE  4 
ATOM   10108 N  NZ  . LYS B 1 50  ? -9.091  114.573 3.385   0.25 18.44 ? 50  LYS B NZ  4 
ATOM   10109 N  N   . LEU B 1 51  ? -6.845  111.943 -2.688  0.25 10.27 ? 51  LEU B N   4 
ATOM   10110 C  CA  . LEU B 1 51  ? -5.648  112.565 -3.238  0.25 11.46 ? 51  LEU B CA  4 
ATOM   10111 C  C   . LEU B 1 51  ? -5.086  113.550 -2.230  0.25 11.64 ? 51  LEU B C   4 
ATOM   10112 O  O   . LEU B 1 51  ? -5.810  114.062 -1.373  0.25 9.26  ? 51  LEU B O   4 
ATOM   10113 C  CB  . LEU B 1 51  ? -5.976  113.302 -4.539  0.25 11.06 ? 51  LEU B CB  4 
ATOM   10114 C  CG  . LEU B 1 51  ? -4.919  114.256 -5.104  0.25 10.26 ? 51  LEU B CG  4 
ATOM   10115 C  CD1 . LEU B 1 51  ? -3.696  113.480 -5.556  0.25 8.79  ? 51  LEU B CD1 4 
ATOM   10116 C  CD2 . LEU B 1 51  ? -5.515  115.040 -6.269  0.25 11.16 ? 51  LEU B CD2 4 
ATOM   10117 N  N   . ASP B 1 52  ? -3.786  113.803 -2.329  0.25 11.47 ? 52  ASP B N   4 
ATOM   10118 C  CA  . ASP B 1 52  ? -3.122  114.746 -1.439  0.25 11.90 ? 52  ASP B CA  4 
ATOM   10119 C  C   . ASP B 1 52  ? -1.715  114.979 -1.970  0.25 11.83 ? 52  ASP B C   4 
ATOM   10120 O  O   . ASP B 1 52  ? -1.280  114.294 -2.898  0.25 10.21 ? 52  ASP B O   4 
ATOM   10121 C  CB  . ASP B 1 52  ? -3.087  114.181 -0.010  0.25 11.19 ? 52  ASP B CB  4 
ATOM   10122 C  CG  . ASP B 1 52  ? -2.372  115.103 0.977   0.25 14.75 ? 52  ASP B CG  4 
ATOM   10123 O  OD1 . ASP B 1 52  ? -2.414  116.337 0.793   0.25 12.97 ? 52  ASP B OD1 4 
ATOM   10124 O  OD2 . ASP B 1 52  ? -1.775  114.591 1.949   0.25 13.00 ? 52  ASP B OD2 4 
ATOM   10125 N  N   . PHE B 1 53  ? -1.011  115.954 -1.405  0.25 11.79 ? 53  PHE B N   4 
ATOM   10126 C  CA  . PHE B 1 53  ? 0.350   116.237 -1.833  0.25 11.37 ? 53  PHE B CA  4 
ATOM   10127 C  C   . PHE B 1 53  ? 1.266   116.189 -0.622  0.25 11.73 ? 53  PHE B C   4 
ATOM   10128 O  O   . PHE B 1 53  ? 0.875   116.595 0.472   0.25 10.31 ? 53  PHE B O   4 
ATOM   10129 C  CB  . PHE B 1 53  ? 0.422   117.608 -2.517  0.25 11.86 ? 53  PHE B CB  4 
ATOM   10130 C  CG  . PHE B 1 53  ? -0.385  117.687 -3.782  0.25 11.32 ? 53  PHE B CG  4 
ATOM   10131 C  CD1 . PHE B 1 53  ? -1.769  117.809 -3.734  0.25 10.45 ? 53  PHE B CD1 4 
ATOM   10132 C  CD2 . PHE B 1 53  ? 0.231   117.570 -5.023  0.25 8.24  ? 53  PHE B CD2 4 
ATOM   10133 C  CE1 . PHE B 1 53  ? -2.526  117.808 -4.899  0.25 12.21 ? 53  PHE B CE1 4 
ATOM   10134 C  CE2 . PHE B 1 53  ? -0.518  117.569 -6.193  0.25 11.36 ? 53  PHE B CE2 4 
ATOM   10135 C  CZ  . PHE B 1 53  ? -1.898  117.687 -6.132  0.25 10.71 ? 53  PHE B CZ  4 
ATOM   10136 N  N   . GLY B 1 54  ? 2.483   115.683 -0.810  0.25 13.96 ? 54  GLY B N   4 
ATOM   10137 C  CA  . GLY B 1 54  ? 3.406   115.592 0.306   0.25 14.51 ? 54  GLY B CA  4 
ATOM   10138 C  C   . GLY B 1 54  ? 4.869   115.484 -0.071  0.25 14.89 ? 54  GLY B C   4 
ATOM   10139 O  O   . GLY B 1 54  ? 5.215   115.344 -1.245  0.25 14.28 ? 54  GLY B O   4 
ATOM   10140 N  N   . ASN B 1 55  ? 5.734   115.540 0.937   0.25 14.81 ? 55  ASN B N   4 
ATOM   10141 C  CA  . ASN B 1 55  ? 7.170   115.460 0.716   0.25 16.50 ? 55  ASN B CA  4 
ATOM   10142 C  C   . ASN B 1 55  ? 7.739   114.100 1.093   0.25 17.75 ? 55  ASN B C   4 
ATOM   10143 O  O   . ASN B 1 55  ? 7.665   113.682 2.252   0.25 17.58 ? 55  ASN B O   4 
ATOM   10144 C  CB  . ASN B 1 55  ? 7.892   116.551 1.513   0.25 15.02 ? 55  ASN B CB  4 
ATOM   10145 C  CG  . ASN B 1 55  ? 7.421   117.947 1.148   0.25 15.17 ? 55  ASN B CG  4 
ATOM   10146 O  OD1 . ASN B 1 55  ? 7.283   118.279 -0.026  0.25 11.10 ? 55  ASN B OD1 4 
ATOM   10147 N  ND2 . ASN B 1 55  ? 7.183   118.775 2.161   0.25 12.96 ? 55  ASN B ND2 4 
ATOM   10148 N  N   . SER B 1 56  ? 8.309   113.414 0.107   0.25 19.83 ? 56  SER B N   4 
ATOM   10149 C  CA  . SER B 1 56  ? 8.899   112.104 0.331   0.25 22.54 ? 56  SER B CA  4 
ATOM   10150 C  C   . SER B 1 56  ? 10.065  112.203 1.305   0.25 24.06 ? 56  SER B C   4 
ATOM   10151 O  O   . SER B 1 56  ? 10.982  113.001 1.114   0.25 23.65 ? 56  SER B O   4 
ATOM   10152 C  CB  . SER B 1 56  ? 9.387   111.512 -0.990  0.25 22.89 ? 56  SER B CB  4 
ATOM   10153 O  OG  . SER B 1 56  ? 10.038  110.274 -0.771  0.25 25.77 ? 56  SER B OG  4 
ATOM   10154 N  N   . GLN B 1 57  ? 10.025  111.385 2.351   0.25 26.49 ? 57  GLN B N   4 
ATOM   10155 C  CA  . GLN B 1 57  ? 11.079  111.383 3.355   0.25 28.06 ? 57  GLN B CA  4 
ATOM   10156 C  C   . GLN B 1 57  ? 11.264  112.794 3.916   0.25 28.66 ? 57  GLN B C   4 
ATOM   10157 O  O   . GLN B 1 57  ? 12.339  113.142 4.404   0.25 27.49 ? 57  GLN B O   4 
ATOM   10158 C  CB  . GLN B 1 57  ? 12.398  110.901 2.743   0.25 30.27 ? 57  GLN B CB  4 
ATOM   10159 C  CG  . GLN B 1 57  ? 12.294  109.667 1.848   0.25 33.61 ? 57  GLN B CG  4 
ATOM   10160 C  CD  . GLN B 1 57  ? 11.692  108.461 2.546   0.25 34.35 ? 57  GLN B CD  4 
ATOM   10161 O  OE1 . GLN B 1 57  ? 12.065  108.128 3.669   0.25 34.60 ? 57  GLN B OE1 4 
ATOM   10162 N  NE2 . GLN B 1 57  ? 10.764  107.790 1.872   0.25 35.88 ? 57  GLN B NE2 4 
ATOM   10163 N  N   . GLY B 1 58  ? 10.213  113.605 3.831   0.25 28.10 ? 58  GLY B N   4 
ATOM   10164 C  CA  . GLY B 1 58  ? 10.283  114.966 4.333   0.25 28.53 ? 58  GLY B CA  4 
ATOM   10165 C  C   . GLY B 1 58  ? 11.095  115.908 3.457   0.25 28.35 ? 58  GLY B C   4 
ATOM   10166 O  O   . GLY B 1 58  ? 11.312  117.066 3.812   0.25 28.56 ? 58  GLY B O   4 
ATOM   10167 N  N   . LYS B 1 59  ? 11.542  115.414 2.308   0.25 27.96 ? 59  LYS B N   4 
ATOM   10168 C  CA  . LYS B 1 59  ? 12.334  116.218 1.383   0.25 28.17 ? 59  LYS B CA  4 
ATOM   10169 C  C   . LYS B 1 59  ? 11.452  116.819 0.289   0.25 26.38 ? 59  LYS B C   4 
ATOM   10170 O  O   . LYS B 1 59  ? 10.561  116.151 -0.238  0.25 25.04 ? 59  LYS B O   4 
ATOM   10171 C  CB  . LYS B 1 59  ? 13.423  115.354 0.744   0.25 30.60 ? 59  LYS B CB  4 
ATOM   10172 C  CG  . LYS B 1 59  ? 14.300  114.617 1.743   0.25 35.14 ? 59  LYS B CG  4 
ATOM   10173 C  CD  . LYS B 1 59  ? 15.242  113.653 1.037   0.25 38.94 ? 59  LYS B CD  4 
ATOM   10174 C  CE  . LYS B 1 59  ? 16.082  112.865 2.033   0.25 39.83 ? 59  LYS B CE  4 
ATOM   10175 N  NZ  . LYS B 1 59  ? 17.021  111.936 1.345   0.25 43.04 ? 59  LYS B NZ  4 
ATOM   10176 N  N   . THR B 1 60  ? 11.700  118.083 -0.041  0.25 23.28 ? 60  THR B N   4 
ATOM   10177 C  CA  . THR B 1 60  ? 10.939  118.771 -1.078  0.25 23.47 ? 60  THR B CA  4 
ATOM   10178 C  C   . THR B 1 60  ? 11.464  118.421 -2.467  0.25 23.12 ? 60  THR B C   4 
ATOM   10179 O  O   . THR B 1 60  ? 12.648  118.599 -2.759  0.25 23.56 ? 60  THR B O   4 
ATOM   10180 C  CB  . THR B 1 60  ? 11.019  120.309 -0.924  0.25 22.64 ? 60  THR B CB  4 
ATOM   10181 O  OG1 . THR B 1 60  ? 10.405  120.707 0.308   0.25 20.89 ? 60  THR B OG1 4 
ATOM   10182 C  CG2 . THR B 1 60  ? 10.308  120.997 -2.088  0.25 22.33 ? 60  THR B CG2 4 
ATOM   10183 N  N   . SER B 1 61  ? 10.576  117.925 -3.320  0.25 21.27 ? 61  SER B N   4 
ATOM   10184 C  CA  . SER B 1 61  ? 10.939  117.572 -4.686  0.25 21.72 ? 61  SER B CA  4 
ATOM   10185 C  C   . SER B 1 61  ? 11.628  118.759 -5.351  0.25 21.24 ? 61  SER B C   4 
ATOM   10186 O  O   . SER B 1 61  ? 11.029  119.824 -5.489  0.25 20.33 ? 61  SER B O   4 
ATOM   10187 C  CB  . SER B 1 61  ? 9.685   117.204 -5.484  0.25 20.63 ? 61  SER B CB  4 
ATOM   10188 O  OG  . SER B 1 61  ? 9.949   117.211 -6.877  0.25 20.14 ? 61  SER B OG  4 
ATOM   10189 N  N   . GLN B 1 62  ? 12.884  118.578 -5.750  0.25 22.89 ? 62  GLN B N   4 
ATOM   10190 C  CA  . GLN B 1 62  ? 13.626  119.649 -6.407  0.25 23.47 ? 62  GLN B CA  4 
ATOM   10191 C  C   . GLN B 1 62  ? 13.310  119.675 -7.892  0.25 22.09 ? 62  GLN B C   4 
ATOM   10192 O  O   . GLN B 1 62  ? 13.894  120.445 -8.652  0.25 23.02 ? 62  GLN B O   4 
ATOM   10193 C  CB  . GLN B 1 62  ? 15.131  119.480 -6.196  0.25 26.61 ? 62  GLN B CB  4 
ATOM   10194 C  CG  . GLN B 1 62  ? 15.572  119.805 -4.777  0.25 30.83 ? 62  GLN B CG  4 
ATOM   10195 C  CD  . GLN B 1 62  ? 15.033  121.144 -4.297  0.25 31.79 ? 62  GLN B CD  4 
ATOM   10196 O  OE1 . GLN B 1 62  ? 15.357  122.195 -4.854  0.25 31.94 ? 62  GLN B OE1 4 
ATOM   10197 N  NE2 . GLN B 1 62  ? 14.198  121.110 -3.265  0.25 32.23 ? 62  GLN B NE2 4 
ATOM   10198 N  N   . THR B 1 63  ? 12.384  118.817 -8.294  0.25 20.69 ? 63  THR B N   4 
ATOM   10199 C  CA  . THR B 1 63  ? 11.956  118.752 -9.678  0.25 20.89 ? 63  THR B CA  4 
ATOM   10200 C  C   . THR B 1 63  ? 10.777  119.711 -9.824  0.25 19.26 ? 63  THR B C   4 
ATOM   10201 O  O   . THR B 1 63  ? 10.692  120.455 -10.798 0.25 20.01 ? 63  THR B O   4 
ATOM   10202 C  CB  . THR B 1 63  ? 11.498  117.330 -10.059 0.25 20.98 ? 63  THR B CB  4 
ATOM   10203 O  OG1 . THR B 1 63  ? 12.504  116.383 -9.680  0.25 23.62 ? 63  THR B OG1 4 
ATOM   10204 C  CG2 . THR B 1 63  ? 11.268  117.233 -11.557 0.25 22.13 ? 63  THR B CG2 4 
ATOM   10205 N  N   . TRP B 1 64  ? 9.882   119.707 -8.837  0.25 16.67 ? 64  TRP B N   4 
ATOM   10206 C  CA  . TRP B 1 64  ? 8.704   120.575 -8.869  0.25 15.64 ? 64  TRP B CA  4 
ATOM   10207 C  C   . TRP B 1 64  ? 8.657   121.710 -7.839  0.25 16.56 ? 64  TRP B C   4 
ATOM   10208 O  O   . TRP B 1 64  ? 7.850   122.634 -7.970  0.25 16.95 ? 64  TRP B O   4 
ATOM   10209 C  CB  . TRP B 1 64  ? 7.436   119.730 -8.741  0.25 15.46 ? 64  TRP B CB  4 
ATOM   10210 C  CG  . TRP B 1 64  ? 7.168   118.897 -9.948  0.25 15.11 ? 64  TRP B CG  4 
ATOM   10211 C  CD1 . TRP B 1 64  ? 7.465   117.574 -10.118 0.25 15.06 ? 64  TRP B CD1 4 
ATOM   10212 C  CD2 . TRP B 1 64  ? 6.562   119.335 -11.171 0.25 15.16 ? 64  TRP B CD2 4 
ATOM   10213 N  NE1 . TRP B 1 64  ? 7.078   117.161 -11.372 0.25 14.61 ? 64  TRP B NE1 4 
ATOM   10214 C  CE2 . TRP B 1 64  ? 6.520   118.223 -12.039 0.25 15.87 ? 64  TRP B CE2 4 
ATOM   10215 C  CE3 . TRP B 1 64  ? 6.045   120.563 -11.617 0.25 16.16 ? 64  TRP B CE3 4 
ATOM   10216 C  CZ2 . TRP B 1 64  ? 5.985   118.297 -13.330 0.25 15.20 ? 64  TRP B CZ2 4 
ATOM   10217 C  CZ3 . TRP B 1 64  ? 5.511   120.638 -12.902 0.25 13.54 ? 64  TRP B CZ3 4 
ATOM   10218 C  CH2 . TRP B 1 64  ? 5.485   119.510 -13.742 0.25 14.28 ? 64  TRP B CH2 4 
ATOM   10219 N  N   . HIS B 1 65  ? 9.501   121.636 -6.816  0.25 16.98 ? 65  HIS B N   4 
ATOM   10220 C  CA  . HIS B 1 65  ? 9.556   122.668 -5.780  0.25 17.67 ? 65  HIS B CA  4 
ATOM   10221 C  C   . HIS B 1 65  ? 8.248   122.798 -5.000  0.25 16.79 ? 65  HIS B C   4 
ATOM   10222 O  O   . HIS B 1 65  ? 7.894   123.876 -4.515  0.25 15.11 ? 65  HIS B O   4 
ATOM   10223 C  CB  . HIS B 1 65  ? 9.926   124.020 -6.401  0.25 20.85 ? 65  HIS B CB  4 
ATOM   10224 C  CG  . HIS B 1 65  ? 11.168  123.977 -7.235  0.25 21.97 ? 65  HIS B CG  4 
ATOM   10225 N  ND1 . HIS B 1 65  ? 11.167  123.574 -8.554  0.25 24.62 ? 65  HIS B ND1 4 
ATOM   10226 C  CD2 . HIS B 1 65  ? 12.459  124.243 -6.925  0.25 23.61 ? 65  HIS B CD2 4 
ATOM   10227 C  CE1 . HIS B 1 65  ? 12.402  123.593 -9.019  0.25 23.08 ? 65  HIS B CE1 4 
ATOM   10228 N  NE2 . HIS B 1 65  ? 13.206  123.995 -8.051  0.25 25.13 ? 65  HIS B NE2 4 
ATOM   10229 N  N   . GLY B 1 66  ? 7.535   121.687 -4.887  0.25 14.91 ? 66  GLY B N   4 
ATOM   10230 C  CA  . GLY B 1 66  ? 6.284   121.671 -4.159  0.25 13.32 ? 66  GLY B CA  4 
ATOM   10231 C  C   . GLY B 1 66  ? 6.038   120.243 -3.720  0.25 13.09 ? 66  GLY B C   4 
ATOM   10232 O  O   . GLY B 1 66  ? 6.856   119.363 -3.994  0.25 13.09 ? 66  GLY B O   4 
ATOM   10233 N  N   . GLY B 1 67  ? 4.926   120.004 -3.036  0.25 10.15 ? 67  GLY B N   4 
ATOM   10234 C  CA  . GLY B 1 67  ? 4.631   118.655 -2.602  0.25 9.34  ? 67  GLY B CA  4 
ATOM   10235 C  C   . GLY B 1 67  ? 4.261   117.818 -3.809  0.25 8.97  ? 67  GLY B C   4 
ATOM   10236 O  O   . GLY B 1 67  ? 3.655   118.319 -4.763  0.25 7.68  ? 67  GLY B O   4 
ATOM   10237 N  N   . ILE B 1 68  ? 4.636   116.547 -3.798  0.25 9.49  ? 68  ILE B N   4 
ATOM   10238 C  CA  . ILE B 1 68  ? 4.280   115.697 -4.918  0.25 10.03 ? 68  ILE B CA  4 
ATOM   10239 C  C   . ILE B 1 68  ? 2.997   114.954 -4.568  0.25 8.27  ? 68  ILE B C   4 
ATOM   10240 O  O   . ILE B 1 68  ? 2.683   114.745 -3.389  0.25 9.68  ? 68  ILE B O   4 
ATOM   10241 C  CB  . ILE B 1 68  ? 5.433   114.733 -5.293  0.25 11.79 ? 68  ILE B CB  4 
ATOM   10242 C  CG1 . ILE B 1 68  ? 6.033   114.098 -4.043  0.25 14.34 ? 68  ILE B CG1 4 
ATOM   10243 C  CG2 . ILE B 1 68  ? 6.502   115.495 -6.065  0.25 12.63 ? 68  ILE B CG2 4 
ATOM   10244 C  CD1 . ILE B 1 68  ? 7.153   113.105 -4.354  0.25 16.55 ? 68  ILE B CD1 4 
ATOM   10245 N  N   . ALA B 1 69  ? 2.246   114.574 -5.593  0.25 6.82  ? 69  ALA B N   4 
ATOM   10246 C  CA  . ALA B 1 69  ? 0.957   113.920 -5.403  0.25 4.59  ? 69  ALA B CA  4 
ATOM   10247 C  C   . ALA B 1 69  ? 0.955   112.446 -5.015  0.25 4.99  ? 69  ALA B C   4 
ATOM   10248 O  O   . ALA B 1 69  ? 1.679   111.632 -5.580  0.25 5.29  ? 69  ALA B O   4 
ATOM   10249 C  CB  . ALA B 1 69  ? 0.106   114.120 -6.651  0.25 4.51  ? 69  ALA B CB  4 
ATOM   10250 N  N   . THR B 1 70  ? 0.112   112.110 -4.048  0.25 3.83  ? 70  THR B N   4 
ATOM   10251 C  CA  . THR B 1 70  ? -0.020  110.735 -3.598  0.25 6.29  ? 70  THR B CA  4 
ATOM   10252 C  C   . THR B 1 70  ? -1.444  110.510 -3.088  0.25 7.06  ? 70  THR B C   4 
ATOM   10253 O  O   . THR B 1 70  ? -2.097  111.435 -2.587  0.25 8.89  ? 70  THR B O   4 
ATOM   10254 C  CB  . THR B 1 70  ? 1.009   110.417 -2.482  0.25 7.03  ? 70  THR B CB  4 
ATOM   10255 O  OG1 . THR B 1 70  ? 0.903   109.038 -2.107  0.25 8.02  ? 70  THR B OG1 4 
ATOM   10256 C  CG2 . THR B 1 70  ? 0.771   111.308 -1.262  0.25 8.90  ? 70  THR B CG2 4 
ATOM   10257 N  N   . ILE B 1 71  ? -1.938  109.291 -3.254  0.25 6.57  ? 71  ILE B N   4 
ATOM   10258 C  CA  . ILE B 1 71  ? -3.278  108.948 -2.797  0.25 6.47  ? 71  ILE B CA  4 
ATOM   10259 C  C   . ILE B 1 71  ? -3.165  108.048 -1.577  0.25 8.03  ? 71  ILE B C   4 
ATOM   10260 O  O   . ILE B 1 71  ? -2.109  107.464 -1.323  0.25 7.66  ? 71  ILE B O   4 
ATOM   10261 C  CB  . ILE B 1 71  ? -4.065  108.179 -3.881  0.25 7.01  ? 71  ILE B CB  4 
ATOM   10262 C  CG1 . ILE B 1 71  ? -3.284  106.925 -4.297  0.25 5.83  ? 71  ILE B CG1 4 
ATOM   10263 C  CG2 . ILE B 1 71  ? -4.312  109.083 -5.090  0.25 7.46  ? 71  ILE B CG2 4 
ATOM   10264 C  CD1 . ILE B 1 71  ? -4.016  106.021 -5.281  0.25 6.65  ? 71  ILE B CD1 4 
ATOM   10265 N  N   . PHE B 1 72  ? -4.255  107.952 -0.821  0.25 8.44  ? 72  PHE B N   4 
ATOM   10266 C  CA  . PHE B 1 72  ? -4.317  107.093 0.347   0.25 9.92  ? 72  PHE B CA  4 
ATOM   10267 C  C   . PHE B 1 72  ? -5.776  106.687 0.542   0.25 11.05 ? 72  PHE B C   4 
ATOM   10268 O  O   . PHE B 1 72  ? -6.687  107.424 0.155   0.25 9.89  ? 72  PHE B O   4 
ATOM   10269 C  CB  . PHE B 1 72  ? -3.737  107.801 1.586   0.25 10.88 ? 72  PHE B CB  4 
ATOM   10270 C  CG  . PHE B 1 72  ? -4.558  108.967 2.086   0.25 13.33 ? 72  PHE B CG  4 
ATOM   10271 C  CD1 . PHE B 1 72  ? -5.761  108.760 2.759   0.25 14.01 ? 72  PHE B CD1 4 
ATOM   10272 C  CD2 . PHE B 1 72  ? -4.096  110.268 1.932   0.25 14.34 ? 72  PHE B CD2 4 
ATOM   10273 C  CE1 . PHE B 1 72  ? -6.490  109.834 3.275   0.25 13.51 ? 72  PHE B CE1 4 
ATOM   10274 C  CE2 . PHE B 1 72  ? -4.815  111.352 2.444   0.25 12.88 ? 72  PHE B CE2 4 
ATOM   10275 C  CZ  . PHE B 1 72  ? -6.012  111.135 3.117   0.25 12.30 ? 72  PHE B CZ  4 
ATOM   10276 N  N   . GLN B 1 73  ? -5.993  105.501 1.107   0.25 10.94 ? 73  GLN B N   4 
ATOM   10277 C  CA  . GLN B 1 73  ? -7.341  104.981 1.322   0.25 10.82 ? 73  GLN B CA  4 
ATOM   10278 C  C   . GLN B 1 73  ? -8.120  105.779 2.362   0.25 11.97 ? 73  GLN B C   4 
ATOM   10279 O  O   . GLN B 1 73  ? -7.757  105.824 3.540   0.25 8.72  ? 73  GLN B O   4 
ATOM   10280 C  CB  . GLN B 1 73  ? -7.269  103.495 1.713   0.25 10.31 ? 73  GLN B CB  4 
ATOM   10281 C  CG  . GLN B 1 73  ? -6.591  102.619 0.642   0.25 10.85 ? 73  GLN B CG  4 
ATOM   10282 C  CD  . GLN B 1 73  ? -6.294  101.197 1.116   0.25 14.67 ? 73  GLN B CD  4 
ATOM   10283 O  OE1 . GLN B 1 73  ? -5.628  100.994 2.135   0.25 15.41 ? 73  GLN B OE1 4 
ATOM   10284 N  NE2 . GLN B 1 73  ? -6.779  100.208 0.367   0.25 11.45 ? 73  GLN B NE2 4 
ATOM   10285 N  N   . SER B 1 74  ? -9.204  106.395 1.899   0.25 12.66 ? 74  SER B N   4 
ATOM   10286 C  CA  . SER B 1 74  ? -10.077 107.229 2.721   0.25 13.70 ? 74  SER B CA  4 
ATOM   10287 C  C   . SER B 1 74  ? -11.538 106.952 2.357   0.25 14.41 ? 74  SER B C   4 
ATOM   10288 O  O   . SER B 1 74  ? -11.977 107.255 1.248   0.25 13.32 ? 74  SER B O   4 
ATOM   10289 C  CB  . SER B 1 74  ? -9.739  108.703 2.464   0.25 14.80 ? 74  SER B CB  4 
ATOM   10290 O  OG  . SER B 1 74  ? -10.656 109.590 3.076   0.25 11.20 ? 74  SER B OG  4 
ATOM   10291 N  N   . PRO B 1 75  ? -12.307 106.356 3.283   0.25 14.48 ? 75  PRO B N   4 
ATOM   10292 C  CA  . PRO B 1 75  ? -13.716 106.054 3.015   0.25 15.02 ? 75  PRO B CA  4 
ATOM   10293 C  C   . PRO B 1 75  ? -14.551 107.260 2.586   0.25 14.25 ? 75  PRO B C   4 
ATOM   10294 O  O   . PRO B 1 75  ? -14.419 108.350 3.138   0.25 15.37 ? 75  PRO B O   4 
ATOM   10295 C  CB  . PRO B 1 75  ? -14.196 105.462 4.337   0.25 14.08 ? 75  PRO B CB  4 
ATOM   10296 C  CG  . PRO B 1 75  ? -12.981 104.747 4.832   0.25 15.03 ? 75  PRO B CG  4 
ATOM   10297 C  CD  . PRO B 1 75  ? -11.876 105.747 4.556   0.25 13.86 ? 75  PRO B CD  4 
ATOM   10298 N  N   . GLY B 1 76  ? -15.405 107.057 1.590   0.25 15.43 ? 76  GLY B N   4 
ATOM   10299 C  CA  . GLY B 1 76  ? -16.261 108.132 1.124   0.25 15.06 ? 76  GLY B CA  4 
ATOM   10300 C  C   . GLY B 1 76  ? -15.603 109.090 0.153   0.25 16.79 ? 76  GLY B C   4 
ATOM   10301 O  O   . GLY B 1 76  ? -16.266 109.967 -0.394  0.25 15.37 ? 76  GLY B O   4 
ATOM   10302 N  N   . ASP B 1 77  ? -14.299 108.941 -0.060  0.25 14.61 ? 77  ASP B N   4 
ATOM   10303 C  CA  . ASP B 1 77  ? -13.598 109.814 -0.998  0.25 15.24 ? 77  ASP B CA  4 
ATOM   10304 C  C   . ASP B 1 77  ? -13.311 109.099 -2.312  0.25 13.89 ? 77  ASP B C   4 
ATOM   10305 O  O   . ASP B 1 77  ? -13.516 107.888 -2.435  0.25 15.69 ? 77  ASP B O   4 
ATOM   10306 C  CB  . ASP B 1 77  ? -12.287 110.313 -0.392  0.25 15.42 ? 77  ASP B CB  4 
ATOM   10307 C  CG  . ASP B 1 77  ? -12.488 111.487 0.543   0.25 18.43 ? 77  ASP B CG  4 
ATOM   10308 O  OD1 . ASP B 1 77  ? -12.866 112.575 0.058   0.25 16.36 ? 77  ASP B OD1 4 
ATOM   10309 O  OD2 . ASP B 1 77  ? -12.273 111.320 1.761   0.25 14.62 ? 77  ASP B OD2 4 
ATOM   10310 N  N   . GLU B 1 78  ? -12.853 109.857 -3.300  0.25 13.41 ? 78  GLU B N   4 
ATOM   10311 C  CA  . GLU B 1 78  ? -12.517 109.288 -4.593  0.25 12.45 ? 78  GLU B CA  4 
ATOM   10312 C  C   . GLU B 1 78  ? -11.499 110.139 -5.326  0.25 10.94 ? 78  GLU B C   4 
ATOM   10313 O  O   . GLU B 1 78  ? -11.306 111.316 -5.020  0.25 11.02 ? 78  GLU B O   4 
ATOM   10314 C  CB  . GLU B 1 78  ? -13.768 109.110 -5.458  0.25 15.35 ? 78  GLU B CB  4 
ATOM   10315 C  CG  . GLU B 1 78  ? -14.535 110.381 -5.747  0.25 20.66 ? 78  GLU B CG  4 
ATOM   10316 C  CD  . GLU B 1 78  ? -15.814 110.110 -6.517  0.25 22.46 ? 78  GLU B CD  4 
ATOM   10317 O  OE1 . GLU B 1 78  ? -16.590 109.228 -6.088  0.25 23.94 ? 78  GLU B OE1 4 
ATOM   10318 O  OE2 . GLU B 1 78  ? -16.046 110.780 -7.543  0.25 19.39 ? 78  GLU B OE2 4 
ATOM   10319 N  N   . VAL B 1 79  ? -10.839 109.519 -6.293  0.25 8.41  ? 79  VAL B N   4 
ATOM   10320 C  CA  . VAL B 1 79  ? -9.828  110.179 -7.099  0.25 6.78  ? 79  VAL B CA  4 
ATOM   10321 C  C   . VAL B 1 79  ? -10.060 109.750 -8.537  0.25 8.18  ? 79  VAL B C   4 
ATOM   10322 O  O   . VAL B 1 79  ? -10.286 108.566 -8.809  0.25 8.78  ? 79  VAL B O   4 
ATOM   10323 C  CB  . VAL B 1 79  ? -8.403  109.743 -6.668  0.25 7.00  ? 79  VAL B CB  4 
ATOM   10324 C  CG1 . VAL B 1 79  ? -7.365  110.291 -7.639  0.25 7.54  ? 79  VAL B CG1 4 
ATOM   10325 C  CG2 . VAL B 1 79  ? -8.125  110.216 -5.248  0.25 6.32  ? 79  VAL B CG2 4 
ATOM   10326 N  N   . TRP B 1 80  ? -10.027 110.713 -9.452  0.25 7.23  ? 80  TRP B N   4 
ATOM   10327 C  CA  . TRP B 1 80  ? -10.202 110.412 -10.864 0.25 9.36  ? 80  TRP B CA  4 
ATOM   10328 C  C   . TRP B 1 80  ? -8.833  110.481 -11.512 0.25 11.48 ? 80  TRP B C   4 
ATOM   10329 O  O   . TRP B 1 80  ? -7.933  111.151 -11.004 0.25 11.57 ? 80  TRP B O   4 
ATOM   10330 C  CB  . TRP B 1 80  ? -11.139 111.422 -11.534 0.25 11.14 ? 80  TRP B CB  4 
ATOM   10331 C  CG  . TRP B 1 80  ? -12.589 111.214 -11.206 0.25 11.28 ? 80  TRP B CG  4 
ATOM   10332 C  CD1 . TRP B 1 80  ? -13.257 111.651 -10.089 0.25 13.08 ? 80  TRP B CD1 4 
ATOM   10333 C  CD2 . TRP B 1 80  ? -13.546 110.494 -11.989 0.25 14.14 ? 80  TRP B CD2 4 
ATOM   10334 N  NE1 . TRP B 1 80  ? -14.574 111.246 -10.135 0.25 13.98 ? 80  TRP B NE1 4 
ATOM   10335 C  CE2 . TRP B 1 80  ? -14.777 110.533 -11.292 0.25 15.57 ? 80  TRP B CE2 4 
ATOM   10336 C  CE3 . TRP B 1 80  ? -13.485 109.815 -13.216 0.25 15.64 ? 80  TRP B CE3 4 
ATOM   10337 C  CZ2 . TRP B 1 80  ? -15.939 109.921 -11.784 0.25 15.67 ? 80  TRP B CZ2 4 
ATOM   10338 C  CZ3 . TRP B 1 80  ? -14.641 109.205 -13.705 0.25 14.89 ? 80  TRP B CZ3 4 
ATOM   10339 C  CH2 . TRP B 1 80  ? -15.851 109.264 -12.987 0.25 16.10 ? 80  TRP B CH2 4 
ATOM   10340 N  N   . GLY B 1 81  ? -8.674  109.787 -12.630 0.25 10.91 ? 81  GLY B N   4 
ATOM   10341 C  CA  . GLY B 1 81  ? -7.400  109.806 -13.311 0.25 9.96  ? 81  GLY B CA  4 
ATOM   10342 C  C   . GLY B 1 81  ? -7.511  109.305 -14.731 0.25 10.24 ? 81  GLY B C   4 
ATOM   10343 O  O   . GLY B 1 81  ? -8.599  108.974 -15.204 0.25 10.43 ? 81  GLY B O   4 
ATOM   10344 N  N   . VAL B 1 82  ? -6.371  109.262 -15.407 0.25 9.50  ? 82  VAL B N   4 
ATOM   10345 C  CA  . VAL B 1 82  ? -6.296  108.796 -16.781 0.25 9.07  ? 82  VAL B CA  4 
ATOM   10346 C  C   . VAL B 1 82  ? -5.576  107.458 -16.815 0.25 9.37  ? 82  VAL B C   4 
ATOM   10347 O  O   . VAL B 1 82  ? -4.531  107.283 -16.183 0.25 9.49  ? 82  VAL B O   4 
ATOM   10348 C  CB  . VAL B 1 82  ? -5.515  109.784 -17.672 0.25 10.67 ? 82  VAL B CB  4 
ATOM   10349 C  CG1 . VAL B 1 82  ? -5.284  109.176 -19.052 0.25 9.06  ? 82  VAL B CG1 4 
ATOM   10350 C  CG2 . VAL B 1 82  ? -6.280  111.100 -17.793 0.25 8.36  ? 82  VAL B CG2 4 
ATOM   10351 N  N   . VAL B 1 83  ? -6.153  106.506 -17.534 0.25 8.74  ? 83  VAL B N   4 
ATOM   10352 C  CA  . VAL B 1 83  ? -5.534  105.205 -17.676 0.25 9.58  ? 83  VAL B CA  4 
ATOM   10353 C  C   . VAL B 1 83  ? -4.771  105.245 -18.995 0.25 10.39 ? 83  VAL B C   4 
ATOM   10354 O  O   . VAL B 1 83  ? -5.338  105.593 -20.034 0.25 12.49 ? 83  VAL B O   4 
ATOM   10355 C  CB  . VAL B 1 83  ? -6.582  104.090 -17.721 0.25 9.90  ? 83  VAL B CB  4 
ATOM   10356 C  CG1 . VAL B 1 83  ? -5.903  102.745 -17.920 0.25 12.28 ? 83  VAL B CG1 4 
ATOM   10357 C  CG2 . VAL B 1 83  ? -7.386  104.089 -16.435 0.25 9.83  ? 83  VAL B CG2 4 
ATOM   10358 N  N   . TRP B 1 84  ? -3.482  104.920 -18.941 0.25 10.17 ? 84  TRP B N   4 
ATOM   10359 C  CA  . TRP B 1 84  ? -2.634  104.910 -20.130 0.25 11.09 ? 84  TRP B CA  4 
ATOM   10360 C  C   . TRP B 1 84  ? -2.217  103.480 -20.461 0.25 12.05 ? 84  TRP B C   4 
ATOM   10361 O  O   . TRP B 1 84  ? -1.991  102.673 -19.557 0.25 10.23 ? 84  TRP B O   4 
ATOM   10362 C  CB  . TRP B 1 84  ? -1.364  105.744 -19.905 0.25 8.98  ? 84  TRP B CB  4 
ATOM   10363 C  CG  . TRP B 1 84  ? -1.599  107.195 -19.652 0.25 11.68 ? 84  TRP B CG  4 
ATOM   10364 C  CD1 . TRP B 1 84  ? -1.708  107.812 -18.437 0.25 8.34  ? 84  TRP B CD1 4 
ATOM   10365 C  CD2 . TRP B 1 84  ? -1.749  108.223 -20.639 0.25 9.80  ? 84  TRP B CD2 4 
ATOM   10366 N  NE1 . TRP B 1 84  ? -1.913  109.159 -18.608 0.25 10.24 ? 84  TRP B NE1 4 
ATOM   10367 C  CE2 . TRP B 1 84  ? -1.943  109.439 -19.948 0.25 10.30 ? 84  TRP B CE2 4 
ATOM   10368 C  CE3 . TRP B 1 84  ? -1.739  108.234 -22.040 0.25 10.93 ? 84  TRP B CE3 4 
ATOM   10369 C  CZ2 . TRP B 1 84  ? -2.125  110.660 -20.614 0.25 11.71 ? 84  TRP B CZ2 4 
ATOM   10370 C  CZ3 . TRP B 1 84  ? -1.921  109.448 -22.700 0.25 12.33 ? 84  TRP B CZ3 4 
ATOM   10371 C  CH2 . TRP B 1 84  ? -2.112  110.643 -21.985 0.25 11.75 ? 84  TRP B CH2 4 
ATOM   10372 N  N   . LYS B 1 85  ? -2.116  103.169 -21.753 0.25 13.50 ? 85  LYS B N   4 
ATOM   10373 C  CA  . LYS B 1 85  ? -1.702  101.835 -22.177 0.25 13.85 ? 85  LYS B CA  4 
ATOM   10374 C  C   . LYS B 1 85  ? -0.212  101.874 -22.475 0.25 13.98 ? 85  LYS B C   4 
ATOM   10375 O  O   . LYS B 1 85  ? 0.256   102.747 -23.207 0.25 14.33 ? 85  LYS B O   4 
ATOM   10376 C  CB  . LYS B 1 85  ? -2.464  101.391 -23.429 0.25 15.54 ? 85  LYS B CB  4 
ATOM   10377 C  CG  . LYS B 1 85  ? -2.085  99.980  -23.888 0.25 20.29 ? 85  LYS B CG  4 
ATOM   10378 C  CD  . LYS B 1 85  ? -2.857  99.545  -25.123 0.25 25.24 ? 85  LYS B CD  4 
ATOM   10379 C  CE  . LYS B 1 85  ? -4.339  99.408  -24.832 0.25 27.44 ? 85  LYS B CE  4 
ATOM   10380 N  NZ  . LYS B 1 85  ? -5.074  98.870  -26.006 0.25 32.53 ? 85  LYS B NZ  4 
HETATM 10381 N  N   . MSE B 1 86  ? 0.536   100.933 -21.910 0.25 13.32 ? 86  MSE B N   4 
HETATM 10382 C  CA  . MSE B 1 86  ? 1.982   100.907 -22.118 0.25 16.11 ? 86  MSE B CA  4 
HETATM 10383 C  C   . MSE B 1 86  ? 2.530   99.496  -22.287 0.25 16.63 ? 86  MSE B C   4 
HETATM 10384 O  O   . MSE B 1 86  ? 1.945   98.525  -21.802 0.25 14.67 ? 86  MSE B O   4 
HETATM 10385 C  CB  . MSE B 1 86  ? 2.683   101.599 -20.942 0.25 16.75 ? 86  MSE B CB  4 
HETATM 10386 C  CG  . MSE B 1 86  ? 2.186   103.022 -20.700 0.25 23.89 ? 86  MSE B CG  4 
HETATM 10387 SE SE  . MSE B 1 86  ? 3.108   103.962 -19.290 0.25 30.26 ? 86  MSE B SE  4 
HETATM 10388 C  CE  . MSE B 1 86  ? 4.794   104.238 -20.191 0.25 28.75 ? 86  MSE B CE  4 
ATOM   10389 N  N   . ASN B 1 87  ? 3.665   99.402  -22.975 0.25 18.71 ? 87  ASN B N   4 
ATOM   10390 C  CA  . ASN B 1 87  ? 4.334   98.133  -23.230 0.25 20.97 ? 87  ASN B CA  4 
ATOM   10391 C  C   . ASN B 1 87  ? 5.027   97.626  -21.971 0.25 19.66 ? 87  ASN B C   4 
ATOM   10392 O  O   . ASN B 1 87  ? 5.714   98.390  -21.288 0.25 17.36 ? 87  ASN B O   4 
ATOM   10393 C  CB  . ASN B 1 87  ? 5.371   98.319  -24.341 0.25 25.34 ? 87  ASN B CB  4 
ATOM   10394 C  CG  . ASN B 1 87  ? 4.738   98.647  -25.675 0.25 29.82 ? 87  ASN B CG  4 
ATOM   10395 O  OD1 . ASN B 1 87  ? 5.389   99.188  -26.570 0.25 32.88 ? 87  ASN B OD1 4 
ATOM   10396 N  ND2 . ASN B 1 87  ? 3.462   98.312  -25.820 0.25 30.23 ? 87  ASN B ND2 4 
ATOM   10397 N  N   . LYS B 1 88  ? 4.851   96.344  -21.662 0.25 19.27 ? 88  LYS B N   4 
ATOM   10398 C  CA  . LYS B 1 88  ? 5.489   95.767  -20.483 0.25 20.14 ? 88  LYS B CA  4 
ATOM   10399 C  C   . LYS B 1 88  ? 6.985   96.046  -20.534 0.25 18.86 ? 88  LYS B C   4 
ATOM   10400 O  O   . LYS B 1 88  ? 7.653   96.087  -19.508 0.25 18.37 ? 88  LYS B O   4 
ATOM   10401 C  CB  . LYS B 1 88  ? 5.247   94.258  -20.418 0.25 22.44 ? 88  LYS B CB  4 
ATOM   10402 C  CG  . LYS B 1 88  ? 3.796   93.871  -20.182 0.25 26.77 ? 88  LYS B CG  4 
ATOM   10403 C  CD  . LYS B 1 88  ? 3.624   92.366  -20.225 0.25 28.81 ? 88  LYS B CD  4 
ATOM   10404 C  CE  . LYS B 1 88  ? 2.170   91.966  -20.044 0.25 31.08 ? 88  LYS B CE  4 
ATOM   10405 N  NZ  . LYS B 1 88  ? 1.984   90.500  -20.205 0.25 31.99 ? 88  LYS B NZ  4 
ATOM   10406 N  N   . SER B 1 89  ? 7.504   96.246  -21.739 0.25 18.53 ? 89  SER B N   4 
ATOM   10407 C  CA  . SER B 1 89  ? 8.918   96.535  -21.911 0.25 19.11 ? 89  SER B CA  4 
ATOM   10408 C  C   . SER B 1 89  ? 9.308   97.828  -21.193 0.25 19.88 ? 89  SER B C   4 
ATOM   10409 O  O   . SER B 1 89  ? 10.453  97.989  -20.772 0.25 19.02 ? 89  SER B O   4 
ATOM   10410 C  CB  . SER B 1 89  ? 9.247   96.655  -23.399 0.25 20.31 ? 89  SER B CB  4 
ATOM   10411 O  OG  . SER B 1 89  ? 8.440   97.645  -24.008 0.25 21.35 ? 89  SER B OG  4 
ATOM   10412 N  N   . ASN B 1 90  ? 8.351   98.744  -21.050 0.25 19.64 ? 90  ASN B N   4 
ATOM   10413 C  CA  . ASN B 1 90  ? 8.606   100.030 -20.395 0.25 21.21 ? 90  ASN B CA  4 
ATOM   10414 C  C   . ASN B 1 90  ? 8.287   100.042 -18.901 0.25 19.29 ? 90  ASN B C   4 
ATOM   10415 O  O   . ASN B 1 90  ? 8.296   101.099 -18.264 0.25 18.85 ? 90  ASN B O   4 
ATOM   10416 C  CB  . ASN B 1 90  ? 7.805   101.134 -21.090 0.25 22.29 ? 90  ASN B CB  4 
ATOM   10417 C  CG  . ASN B 1 90  ? 8.251   101.362 -22.520 0.25 24.73 ? 90  ASN B CG  4 
ATOM   10418 O  OD1 . ASN B 1 90  ? 7.431   101.410 -23.438 0.25 22.26 ? 90  ASN B OD1 4 
ATOM   10419 N  ND2 . ASN B 1 90  ? 9.559   101.511 -22.715 0.25 24.40 ? 90  ASN B ND2 4 
ATOM   10420 N  N   . LEU B 1 91  ? 8.007   98.871  -18.343 0.25 17.29 ? 91  LEU B N   4 
ATOM   10421 C  CA  . LEU B 1 91  ? 7.687   98.769  -16.925 0.25 17.19 ? 91  LEU B CA  4 
ATOM   10422 C  C   . LEU B 1 91  ? 8.813   99.300  -16.052 0.25 14.66 ? 91  LEU B C   4 
ATOM   10423 O  O   . LEU B 1 91  ? 8.616   100.237 -15.286 0.25 12.68 ? 91  LEU B O   4 
ATOM   10424 C  CB  . LEU B 1 91  ? 7.389   97.316  -16.544 0.25 16.10 ? 91  LEU B CB  4 
ATOM   10425 C  CG  . LEU B 1 91  ? 6.003   96.774  -16.905 0.25 17.78 ? 91  LEU B CG  4 
ATOM   10426 C  CD1 . LEU B 1 91  ? 6.008   95.247  -16.825 0.25 16.13 ? 91  LEU B CD1 4 
ATOM   10427 C  CD2 . LEU B 1 91  ? 4.961   97.358  -15.952 0.25 17.63 ? 91  LEU B CD2 4 
ATOM   10428 N  N   . ASN B 1 92  ? 9.998   98.711  -16.173 0.25 14.56 ? 92  ASN B N   4 
ATOM   10429 C  CA  . ASN B 1 92  ? 11.123  99.151  -15.361 0.25 15.50 ? 92  ASN B CA  4 
ATOM   10430 C  C   . ASN B 1 92  ? 11.442  100.623 -15.539 0.25 14.94 ? 92  ASN B C   4 
ATOM   10431 O  O   . ASN B 1 92  ? 11.900  101.277 -14.602 0.25 15.63 ? 92  ASN B O   4 
ATOM   10432 C  CB  . ASN B 1 92  ? 12.360  98.302  -15.653 0.25 15.94 ? 92  ASN B CB  4 
ATOM   10433 C  CG  . ASN B 1 92  ? 12.221  96.894  -15.123 0.25 18.48 ? 92  ASN B CG  4 
ATOM   10434 O  OD1 . ASN B 1 92  ? 11.745  96.689  -14.009 0.25 16.01 ? 92  ASN B OD1 4 
ATOM   10435 N  ND2 . ASN B 1 92  ? 12.642  95.915  -15.914 0.25 19.95 ? 92  ASN B ND2 4 
ATOM   10436 N  N   . SER B 1 93  ? 11.200  101.147 -16.736 0.25 13.00 ? 93  SER B N   4 
ATOM   10437 C  CA  . SER B 1 93  ? 11.450  102.556 -16.998 0.25 14.26 ? 93  SER B CA  4 
ATOM   10438 C  C   . SER B 1 93  ? 10.486  103.422 -16.189 0.25 14.51 ? 93  SER B C   4 
ATOM   10439 O  O   . SER B 1 93  ? 10.836  104.523 -15.762 0.25 12.98 ? 93  SER B O   4 
ATOM   10440 C  CB  . SER B 1 93  ? 11.273  102.863 -18.483 0.25 14.60 ? 93  SER B CB  4 
ATOM   10441 O  OG  . SER B 1 93  ? 11.402  104.258 -18.714 0.25 17.99 ? 93  SER B OG  4 
ATOM   10442 N  N   . LEU B 1 94  ? 9.269   102.923 -15.985 0.25 13.15 ? 94  LEU B N   4 
ATOM   10443 C  CA  . LEU B 1 94  ? 8.277   103.670 -15.226 0.25 11.27 ? 94  LEU B CA  4 
ATOM   10444 C  C   . LEU B 1 94  ? 8.648   103.702 -13.745 0.25 10.65 ? 94  LEU B C   4 
ATOM   10445 O  O   . LEU B 1 94  ? 8.579   104.749 -13.104 0.25 8.11  ? 94  LEU B O   4 
ATOM   10446 C  CB  . LEU B 1 94  ? 6.886   103.059 -15.416 0.25 12.96 ? 94  LEU B CB  4 
ATOM   10447 C  CG  . LEU B 1 94  ? 5.738   103.838 -14.769 0.25 12.02 ? 94  LEU B CG  4 
ATOM   10448 C  CD1 . LEU B 1 94  ? 5.822   105.303 -15.189 0.25 13.29 ? 94  LEU B CD1 4 
ATOM   10449 C  CD2 . LEU B 1 94  ? 4.392   103.231 -15.180 0.25 13.66 ? 94  LEU B CD2 4 
ATOM   10450 N  N   . ASP B 1 95  ? 9.057   102.560 -13.202 0.25 11.35 ? 95  ASP B N   4 
ATOM   10451 C  CA  . ASP B 1 95  ? 9.452   102.500 -11.799 0.25 13.55 ? 95  ASP B CA  4 
ATOM   10452 C  C   . ASP B 1 95  ? 10.595  103.475 -11.503 0.25 13.06 ? 95  ASP B C   4 
ATOM   10453 O  O   . ASP B 1 95  ? 10.674  104.035 -10.415 0.25 12.33 ? 95  ASP B O   4 
ATOM   10454 C  CB  . ASP B 1 95  ? 9.884   101.079 -11.426 0.25 11.79 ? 95  ASP B CB  4 
ATOM   10455 C  CG  . ASP B 1 95  ? 8.717   100.110 -11.356 0.25 15.37 ? 95  ASP B CG  4 
ATOM   10456 O  OD1 . ASP B 1 95  ? 7.559   100.547 -11.547 0.25 14.00 ? 95  ASP B OD1 4 
ATOM   10457 O  OD2 . ASP B 1 95  ? 8.960   98.909  -11.101 0.25 13.17 ? 95  ASP B OD2 4 
ATOM   10458 N  N   . GLU B 1 96  ? 11.487  103.667 -12.473 0.25 16.30 ? 96  GLU B N   4 
ATOM   10459 C  CA  . GLU B 1 96  ? 12.622  104.577 -12.300 0.25 16.15 ? 96  GLU B CA  4 
ATOM   10460 C  C   . GLU B 1 96  ? 12.146  106.022 -12.214 0.25 14.44 ? 96  GLU B C   4 
ATOM   10461 O  O   . GLU B 1 96  ? 12.700  106.818 -11.460 0.25 13.24 ? 96  GLU B O   4 
ATOM   10462 C  CB  . GLU B 1 96  ? 13.600  104.431 -13.474 0.25 18.15 ? 96  GLU B CB  4 
ATOM   10463 C  CG  . GLU B 1 96  ? 14.933  105.183 -13.340 0.25 23.08 ? 96  GLU B CG  4 
ATOM   10464 C  CD  . GLU B 1 96  ? 14.808  106.708 -13.427 0.25 27.28 ? 96  GLU B CD  4 
ATOM   10465 O  OE1 . GLU B 1 96  ? 13.880  107.213 -14.101 0.25 25.41 ? 96  GLU B OE1 4 
ATOM   10466 O  OE2 . GLU B 1 96  ? 15.660  107.405 -12.832 0.25 27.32 ? 96  GLU B OE2 4 
ATOM   10467 N  N   . GLN B 1 97  ? 11.132  106.359 -13.005 0.25 13.68 ? 97  GLN B N   4 
ATOM   10468 C  CA  . GLN B 1 97  ? 10.582  107.718 -13.025 0.25 13.56 ? 97  GLN B CA  4 
ATOM   10469 C  C   . GLN B 1 97  ? 9.771   107.993 -11.770 0.25 14.56 ? 97  GLN B C   4 
ATOM   10470 O  O   . GLN B 1 97  ? 9.678   109.134 -11.318 0.25 15.13 ? 97  GLN B O   4 
ATOM   10471 C  CB  . GLN B 1 97  ? 9.676   107.908 -14.242 0.25 12.37 ? 97  GLN B CB  4 
ATOM   10472 C  CG  . GLN B 1 97  ? 10.390  107.796 -15.585 0.25 15.29 ? 97  GLN B CG  4 
ATOM   10473 C  CD  . GLN B 1 97  ? 9.419   107.640 -16.736 0.25 13.79 ? 97  GLN B CD  4 
ATOM   10474 O  OE1 . GLN B 1 97  ? 8.425   108.363 -16.827 0.25 17.00 ? 97  GLN B OE1 4 
ATOM   10475 N  NE2 . GLN B 1 97  ? 9.701   106.695 -17.623 0.25 13.21 ? 97  GLN B NE2 4 
ATOM   10476 N  N   . GLU B 1 98  ? 9.179   106.941 -11.216 0.25 14.40 ? 98  GLU B N   4 
ATOM   10477 C  CA  . GLU B 1 98  ? 8.356   107.072 -10.024 0.25 16.88 ? 98  GLU B CA  4 
ATOM   10478 C  C   . GLU B 1 98  ? 9.198   107.058 -8.748  0.25 16.86 ? 98  GLU B C   4 
ATOM   10479 O  O   . GLU B 1 98  ? 8.677   107.265 -7.651  0.25 16.94 ? 98  GLU B O   4 
ATOM   10480 C  CB  . GLU B 1 98  ? 7.322   105.942 -9.987  0.25 17.45 ? 98  GLU B CB  4 
ATOM   10481 C  CG  . GLU B 1 98  ? 6.537   105.773 -11.288 0.25 24.49 ? 98  GLU B CG  4 
ATOM   10482 C  CD  . GLU B 1 98  ? 5.639   106.951 -11.611 0.25 26.71 ? 98  GLU B CD  4 
ATOM   10483 O  OE1 . GLU B 1 98  ? 4.632   107.145 -10.900 0.25 23.84 ? 98  GLU B OE1 4 
ATOM   10484 O  OE2 . GLU B 1 98  ? 5.940   107.684 -12.578 0.25 30.53 ? 98  GLU B OE2 4 
ATOM   10485 N  N   . GLY B 1 99  ? 10.499  106.809 -8.899  0.25 15.28 ? 99  GLY B N   4 
ATOM   10486 C  CA  . GLY B 1 99  ? 11.396  106.780 -7.751  0.25 15.37 ? 99  GLY B CA  4 
ATOM   10487 C  C   . GLY B 1 99  ? 11.203  105.600 -6.813  0.25 15.09 ? 99  GLY B C   4 
ATOM   10488 O  O   . GLY B 1 99  ? 11.431  105.716 -5.607  0.25 14.61 ? 99  GLY B O   4 
ATOM   10489 N  N   . VAL B 1 100 ? 10.809  104.453 -7.356  0.25 13.91 ? 100 VAL B N   4 
ATOM   10490 C  CA  . VAL B 1 100 ? 10.588  103.277 -6.522  0.25 14.04 ? 100 VAL B CA  4 
ATOM   10491 C  C   . VAL B 1 100 ? 11.843  102.839 -5.758  0.25 16.71 ? 100 VAL B C   4 
ATOM   10492 O  O   . VAL B 1 100 ? 11.807  102.693 -4.533  0.25 14.29 ? 100 VAL B O   4 
ATOM   10493 C  CB  . VAL B 1 100 ? 10.054  102.090 -7.362  0.25 14.18 ? 100 VAL B CB  4 
ATOM   10494 C  CG1 . VAL B 1 100 ? 9.843   100.873 -6.469  0.25 12.53 ? 100 VAL B CG1 4 
ATOM   10495 C  CG2 . VAL B 1 100 ? 8.742   102.480 -8.033  0.25 12.76 ? 100 VAL B CG2 4 
ATOM   10496 N  N   . LYS B 1 101 ? 12.949  102.641 -6.470  0.25 18.71 ? 101 LYS B N   4 
ATOM   10497 C  CA  . LYS B 1 101 ? 14.200  102.211 -5.841  0.25 21.19 ? 101 LYS B CA  4 
ATOM   10498 C  C   . LYS B 1 101 ? 14.639  103.120 -4.693  0.25 21.16 ? 101 LYS B C   4 
ATOM   10499 O  O   . LYS B 1 101 ? 15.076  102.641 -3.646  0.25 21.50 ? 101 LYS B O   4 
ATOM   10500 C  CB  . LYS B 1 101 ? 15.324  102.150 -6.878  0.25 26.30 ? 101 LYS B CB  4 
ATOM   10501 C  CG  . LYS B 1 101 ? 15.092  101.177 -8.027  0.25 32.94 ? 101 LYS B CG  4 
ATOM   10502 C  CD  . LYS B 1 101 ? 15.214  99.725  -7.600  0.25 36.65 ? 101 LYS B CD  4 
ATOM   10503 C  CE  . LYS B 1 101 ? 15.064  98.799  -8.804  0.25 40.39 ? 101 LYS B CE  4 
ATOM   10504 N  NZ  . LYS B 1 101 ? 15.267  97.362  -8.461  0.25 44.37 ? 101 LYS B NZ  4 
ATOM   10505 N  N   . SER B 1 102 ? 14.528  104.430 -4.894  0.25 21.35 ? 102 SER B N   4 
ATOM   10506 C  CA  . SER B 1 102 ? 14.923  105.400 -3.878  0.25 19.99 ? 102 SER B CA  4 
ATOM   10507 C  C   . SER B 1 102 ? 13.876  105.579 -2.778  0.25 19.33 ? 102 SER B C   4 
ATOM   10508 O  O   . SER B 1 102 ? 14.037  106.419 -1.891  0.25 19.36 ? 102 SER B O   4 
ATOM   10509 C  CB  . SER B 1 102 ? 15.220  106.752 -4.531  0.25 21.05 ? 102 SER B CB  4 
ATOM   10510 O  OG  . SER B 1 102 ? 14.076  107.264 -5.188  0.25 21.64 ? 102 SER B OG  4 
ATOM   10511 N  N   . GLY B 1 103 ? 12.802  104.799 -2.850  0.25 17.72 ? 103 GLY B N   4 
ATOM   10512 C  CA  . GLY B 1 103 ? 11.751  104.868 -1.846  0.25 16.08 ? 103 GLY B CA  4 
ATOM   10513 C  C   . GLY B 1 103 ? 10.820  106.068 -1.914  0.25 15.32 ? 103 GLY B C   4 
ATOM   10514 O  O   . GLY B 1 103 ? 10.253  106.474 -0.895  0.25 16.07 ? 103 GLY B O   4 
HETATM 10515 N  N   . MSE B 1 104 ? 10.644  106.635 -3.104  0.25 13.37 ? 104 MSE B N   4 
HETATM 10516 C  CA  . MSE B 1 104 ? 9.774   107.798 -3.264  0.25 12.33 ? 104 MSE B CA  4 
HETATM 10517 C  C   . MSE B 1 104 ? 8.312   107.362 -3.283  0.25 12.20 ? 104 MSE B C   4 
HETATM 10518 O  O   . MSE B 1 104 ? 7.453   108.011 -2.691  0.25 11.85 ? 104 MSE B O   4 
HETATM 10519 C  CB  . MSE B 1 104 ? 10.116  108.538 -4.563  0.25 11.44 ? 104 MSE B CB  4 
HETATM 10520 C  CG  . MSE B 1 104 ? 9.533   109.942 -4.664  0.25 8.01  ? 104 MSE B CG  4 
HETATM 10521 SE SE  . MSE B 1 104 ? 9.948   110.801 -6.360  0.25 14.34 ? 104 MSE B SE  4 
HETATM 10522 C  CE  . MSE B 1 104 ? 11.782  111.280 -6.010  0.25 9.95  ? 104 MSE B CE  4 
ATOM   10523 N  N   . TYR B 1 105 ? 8.044   106.261 -3.978  0.25 10.52 ? 105 TYR B N   4 
ATOM   10524 C  CA  . TYR B 1 105 ? 6.697   105.700 -4.083  0.25 11.21 ? 105 TYR B CA  4 
ATOM   10525 C  C   . TYR B 1 105 ? 6.803   104.182 -4.069  0.25 10.38 ? 105 TYR B C   4 
ATOM   10526 O  O   . TYR B 1 105 ? 7.892   103.627 -4.178  0.25 10.53 ? 105 TYR B O   4 
ATOM   10527 C  CB  . TYR B 1 105 ? 6.034   106.076 -5.412  0.25 9.93  ? 105 TYR B CB  4 
ATOM   10528 C  CG  . TYR B 1 105 ? 5.614   107.512 -5.573  0.25 12.58 ? 105 TYR B CG  4 
ATOM   10529 C  CD1 . TYR B 1 105 ? 6.558   108.530 -5.691  0.25 12.60 ? 105 TYR B CD1 4 
ATOM   10530 C  CD2 . TYR B 1 105 ? 4.263   107.849 -5.668  0.25 11.09 ? 105 TYR B CD2 4 
ATOM   10531 C  CE1 . TYR B 1 105 ? 6.167   109.851 -5.910  0.25 14.18 ? 105 TYR B CE1 4 
ATOM   10532 C  CE2 . TYR B 1 105 ? 3.861   109.161 -5.887  0.25 11.63 ? 105 TYR B CE2 4 
ATOM   10533 C  CZ  . TYR B 1 105 ? 4.818   110.155 -6.009  0.25 13.96 ? 105 TYR B CZ  4 
ATOM   10534 O  OH  . TYR B 1 105 ? 4.427   111.446 -6.249  0.25 12.20 ? 105 TYR B OH  4 
ATOM   10535 N  N   . VAL B 1 106 ? 5.659   103.522 -3.934  0.25 9.75  ? 106 VAL B N   4 
ATOM   10536 C  CA  . VAL B 1 106 ? 5.601   102.071 -3.985  0.25 8.99  ? 106 VAL B CA  4 
ATOM   10537 C  C   . VAL B 1 106 ? 4.618   101.740 -5.113  0.25 7.92  ? 106 VAL B C   4 
ATOM   10538 O  O   . VAL B 1 106 ? 3.690   102.514 -5.384  0.25 5.41  ? 106 VAL B O   4 
ATOM   10539 C  CB  . VAL B 1 106 ? 5.089   101.453 -2.659  0.25 9.99  ? 106 VAL B CB  4 
ATOM   10540 C  CG1 . VAL B 1 106 ? 3.638   101.844 -2.411  0.25 11.21 ? 106 VAL B CG1 4 
ATOM   10541 C  CG2 . VAL B 1 106 ? 5.224   99.941  -2.719  0.25 9.60  ? 106 VAL B CG2 4 
ATOM   10542 N  N   . VAL B 1 107 ? 4.832   100.618 -5.791  0.25 6.87  ? 107 VAL B N   4 
ATOM   10543 C  CA  . VAL B 1 107 ? 3.932   100.208 -6.865  0.25 6.84  ? 107 VAL B CA  4 
ATOM   10544 C  C   . VAL B 1 107 ? 2.679   99.604  -6.240  0.25 7.15  ? 107 VAL B C   4 
ATOM   10545 O  O   . VAL B 1 107 ? 2.770   98.827  -5.292  0.25 7.06  ? 107 VAL B O   4 
ATOM   10546 C  CB  . VAL B 1 107 ? 4.558   99.114  -7.768  0.25 8.16  ? 107 VAL B CB  4 
ATOM   10547 C  CG1 . VAL B 1 107 ? 3.521   98.630  -8.774  0.25 3.68  ? 107 VAL B CG1 4 
ATOM   10548 C  CG2 . VAL B 1 107 ? 5.789   99.655  -8.503  0.25 10.20 ? 107 VAL B CG2 4 
ATOM   10549 N  N   . ILE B 1 108 ? 1.509   99.953  -6.764  0.25 4.99  ? 108 ILE B N   4 
ATOM   10550 C  CA  . ILE B 1 108 ? 0.275   99.386  -6.241  0.25 5.05  ? 108 ILE B CA  4 
ATOM   10551 C  C   . ILE B 1 108 ? -0.565  98.793  -7.363  0.25 7.42  ? 108 ILE B C   4 
ATOM   10552 O  O   . ILE B 1 108 ? -0.359  99.088  -8.546  0.25 6.09  ? 108 ILE B O   4 
ATOM   10553 C  CB  . ILE B 1 108 ? -0.594  100.444 -5.519  0.25 6.73  ? 108 ILE B CB  4 
ATOM   10554 C  CG1 . ILE B 1 108 ? -0.998  101.551 -6.502  0.25 8.88  ? 108 ILE B CG1 4 
ATOM   10555 C  CG2 . ILE B 1 108 ? 0.169   101.036 -4.331  0.25 2.45  ? 108 ILE B CG2 4 
ATOM   10556 C  CD1 . ILE B 1 108 ? -1.940  102.599 -5.902  0.25 6.83  ? 108 ILE B CD1 4 
ATOM   10557 N  N   . GLU B 1 109 ? -1.492  97.920  -6.988  0.25 8.14  ? 109 GLU B N   4 
ATOM   10558 C  CA  . GLU B 1 109 ? -2.413  97.355  -7.960  0.25 11.14 ? 109 GLU B CA  4 
ATOM   10559 C  C   . GLU B 1 109 ? -3.802  97.719  -7.468  0.25 11.27 ? 109 GLU B C   4 
ATOM   10560 O  O   . GLU B 1 109 ? -4.291  97.153  -6.481  0.25 8.74  ? 109 GLU B O   4 
ATOM   10561 C  CB  . GLU B 1 109 ? -2.292  95.833  -8.059  0.25 10.58 ? 109 GLU B CB  4 
ATOM   10562 C  CG  . GLU B 1 109 ? -3.204  95.260  -9.133  0.25 16.35 ? 109 GLU B CG  4 
ATOM   10563 C  CD  . GLU B 1 109 ? -3.270  93.747  -9.106  0.25 17.93 ? 109 GLU B CD  4 
ATOM   10564 O  OE1 . GLU B 1 109 ? -2.223  93.095  -9.308  0.25 15.88 ? 109 GLU B OE1 4 
ATOM   10565 O  OE2 . GLU B 1 109 ? -4.374  93.213  -8.879  0.25 17.45 ? 109 GLU B OE2 4 
ATOM   10566 N  N   . VAL B 1 110 ? -4.428  98.683  -8.137  0.25 11.06 ? 110 VAL B N   4 
ATOM   10567 C  CA  . VAL B 1 110 ? -5.768  99.107  -7.756  0.25 11.88 ? 110 VAL B CA  4 
ATOM   10568 C  C   . VAL B 1 110 ? -6.765  98.813  -8.864  0.25 12.38 ? 110 VAL B C   4 
ATOM   10569 O  O   . VAL B 1 110 ? -6.391  98.618  -10.023 0.25 12.49 ? 110 VAL B O   4 
ATOM   10570 C  CB  . VAL B 1 110 ? -5.837  100.626 -7.449  0.25 13.03 ? 110 VAL B CB  4 
ATOM   10571 C  CG1 . VAL B 1 110 ? -4.997  100.957 -6.241  0.25 12.49 ? 110 VAL B CG1 4 
ATOM   10572 C  CG2 . VAL B 1 110 ? -5.388  101.426 -8.661  0.25 13.82 ? 110 VAL B CG2 4 
ATOM   10573 N  N   . LYS B 1 111 ? -8.037  98.780  -8.486  0.25 13.23 ? 111 LYS B N   4 
ATOM   10574 C  CA  . LYS B 1 111 ? -9.120  98.535  -9.420  0.25 13.48 ? 111 LYS B CA  4 
ATOM   10575 C  C   . LYS B 1 111 ? -9.815  99.875  -9.618  0.25 12.13 ? 111 LYS B C   4 
ATOM   10576 O  O   . LYS B 1 111 ? -10.017 100.632 -8.663  0.25 8.41  ? 111 LYS B O   4 
ATOM   10577 C  CB  . LYS B 1 111 ? -10.095 97.505  -8.843  0.25 15.49 ? 111 LYS B CB  4 
ATOM   10578 C  CG  . LYS B 1 111 ? -9.429  96.213  -8.364  0.25 21.60 ? 111 LYS B CG  4 
ATOM   10579 C  CD  . LYS B 1 111 ? -8.740  95.464  -9.502  0.25 20.11 ? 111 LYS B CD  4 
ATOM   10580 C  CE  . LYS B 1 111 ? -8.193  94.116  -9.034  0.25 23.97 ? 111 LYS B CE  4 
ATOM   10581 N  NZ  . LYS B 1 111 ? -7.176  94.241  -7.939  0.25 25.69 ? 111 LYS B NZ  4 
ATOM   10582 N  N   . VAL B 1 112 ? -10.157 100.185 -10.862 0.25 9.92  ? 112 VAL B N   4 
ATOM   10583 C  CA  . VAL B 1 112 ? -10.819 101.445 -11.148 0.25 9.68  ? 112 VAL B CA  4 
ATOM   10584 C  C   . VAL B 1 112 ? -12.039 101.217 -12.031 0.25 11.24 ? 112 VAL B C   4 
ATOM   10585 O  O   . VAL B 1 112 ? -12.247 100.115 -12.534 0.25 13.44 ? 112 VAL B O   4 
ATOM   10586 C  CB  . VAL B 1 112 ? -9.848  102.445 -11.823 0.25 10.16 ? 112 VAL B CB  4 
ATOM   10587 C  CG1 . VAL B 1 112 ? -8.735  102.827 -10.846 0.25 10.24 ? 112 VAL B CG1 4 
ATOM   10588 C  CG2 . VAL B 1 112 ? -9.254  101.833 -13.083 0.25 8.09  ? 112 VAL B CG2 4 
ATOM   10589 N  N   . ALA B 1 113 ? -12.851 102.255 -12.211 0.25 12.13 ? 113 ALA B N   4 
ATOM   10590 C  CA  . ALA B 1 113 ? -14.054 102.126 -13.024 0.25 13.33 ? 113 ALA B CA  4 
ATOM   10591 C  C   . ALA B 1 113 ? -14.310 103.336 -13.915 0.25 12.42 ? 113 ALA B C   4 
ATOM   10592 O  O   . ALA B 1 113 ? -14.262 104.479 -13.464 0.25 11.91 ? 113 ALA B O   4 
ATOM   10593 C  CB  . ALA B 1 113 ? -15.261 101.876 -12.120 0.25 13.97 ? 113 ALA B CB  4 
ATOM   10594 N  N   . THR B 1 114 ? -14.582 103.068 -15.186 0.25 14.15 ? 114 THR B N   4 
ATOM   10595 C  CA  . THR B 1 114 ? -14.861 104.120 -16.151 0.25 16.80 ? 114 THR B CA  4 
ATOM   10596 C  C   . THR B 1 114 ? -16.229 104.702 -15.825 0.25 19.52 ? 114 THR B C   4 
ATOM   10597 O  O   . THR B 1 114 ? -16.980 104.130 -15.031 0.25 18.97 ? 114 THR B O   4 
ATOM   10598 C  CB  . THR B 1 114 ? -14.908 103.560 -17.578 0.25 17.32 ? 114 THR B CB  4 
ATOM   10599 O  OG1 . THR B 1 114 ? -16.043 102.695 -17.708 0.25 16.08 ? 114 THR B OG1 4 
ATOM   10600 C  CG2 . THR B 1 114 ? -13.647 102.771 -17.879 0.25 17.58 ? 114 THR B CG2 4 
ATOM   10601 N  N   . GLN B 1 115 ? -16.557 105.834 -16.434 0.25 22.44 ? 115 GLN B N   4 
ATOM   10602 C  CA  . GLN B 1 115 ? -17.850 106.460 -16.188 0.25 26.44 ? 115 GLN B CA  4 
ATOM   10603 C  C   . GLN B 1 115 ? -18.990 105.557 -16.657 0.25 26.34 ? 115 GLN B C   4 
ATOM   10604 O  O   . GLN B 1 115 ? -20.152 105.790 -16.330 0.25 26.30 ? 115 GLN B O   4 
ATOM   10605 C  CB  . GLN B 1 115 ? -17.922 107.819 -16.884 0.25 29.44 ? 115 GLN B CB  4 
ATOM   10606 C  CG  . GLN B 1 115 ? -16.854 108.788 -16.415 0.25 34.81 ? 115 GLN B CG  4 
ATOM   10607 C  CD  . GLN B 1 115 ? -17.014 110.169 -17.014 0.25 37.06 ? 115 GLN B CD  4 
ATOM   10608 O  OE1 . GLN B 1 115 ? -18.001 110.857 -16.759 0.25 38.31 ? 115 GLN B OE1 4 
ATOM   10609 N  NE2 . GLN B 1 115 ? -16.041 110.583 -17.817 0.25 39.34 ? 115 GLN B NE2 4 
ATOM   10610 N  N   . GLU B 1 116 ? -18.650 104.521 -17.421 0.25 26.90 ? 116 GLU B N   4 
ATOM   10611 C  CA  . GLU B 1 116 ? -19.647 103.570 -17.905 0.25 28.81 ? 116 GLU B CA  4 
ATOM   10612 C  C   . GLU B 1 116 ? -19.787 102.426 -16.904 0.25 26.47 ? 116 GLU B C   4 
ATOM   10613 O  O   . GLU B 1 116 ? -20.483 101.448 -17.160 0.25 24.31 ? 116 GLU B O   4 
ATOM   10614 C  CB  . GLU B 1 116 ? -19.245 102.998 -19.267 0.25 32.98 ? 116 GLU B CB  4 
ATOM   10615 C  CG  . GLU B 1 116 ? -19.219 104.008 -20.407 0.25 40.79 ? 116 GLU B CG  4 
ATOM   10616 C  CD  . GLU B 1 116 ? -18.136 105.059 -20.242 0.25 42.84 ? 116 GLU B CD  4 
ATOM   10617 O  OE1 . GLU B 1 116 ? -16.970 104.680 -20.002 0.25 44.46 ? 116 GLU B OE1 4 
ATOM   10618 O  OE2 . GLU B 1 116 ? -18.449 106.262 -20.363 0.25 45.84 ? 116 GLU B OE2 4 
ATOM   10619 N  N   . GLY B 1 117 ? -19.107 102.551 -15.768 0.25 25.13 ? 117 GLY B N   4 
ATOM   10620 C  CA  . GLY B 1 117 ? -19.180 101.525 -14.741 0.25 26.00 ? 117 GLY B CA  4 
ATOM   10621 C  C   . GLY B 1 117 ? -18.348 100.280 -15.004 0.25 25.89 ? 117 GLY B C   4 
ATOM   10622 O  O   . GLY B 1 117 ? -18.522 99.263  -14.333 0.25 25.55 ? 117 GLY B O   4 
ATOM   10623 N  N   . LYS B 1 118 ? -17.445 100.356 -15.975 0.25 26.33 ? 118 LYS B N   4 
ATOM   10624 C  CA  . LYS B 1 118 ? -16.587 99.224  -16.308 0.25 28.14 ? 118 LYS B CA  4 
ATOM   10625 C  C   . LYS B 1 118 ? -15.337 99.251  -15.433 0.25 25.58 ? 118 LYS B C   4 
ATOM   10626 O  O   . LYS B 1 118 ? -14.635 100.257 -15.386 0.25 24.88 ? 118 LYS B O   4 
ATOM   10627 C  CB  . LYS B 1 118 ? -16.174 99.293  -17.780 0.25 31.89 ? 118 LYS B CB  4 
ATOM   10628 C  CG  . LYS B 1 118 ? -17.324 99.586  -18.729 0.25 38.12 ? 118 LYS B CG  4 
ATOM   10629 C  CD  . LYS B 1 118 ? -16.846 99.668  -20.171 0.25 42.18 ? 118 LYS B CD  4 
ATOM   10630 C  CE  . LYS B 1 118 ? -17.937 100.213 -21.082 0.25 46.04 ? 118 LYS B CE  4 
ATOM   10631 N  NZ  . LYS B 1 118 ? -19.188 99.416  -20.994 0.25 48.04 ? 118 LYS B NZ  4 
ATOM   10632 N  N   . GLU B 1 119 ? -15.066 98.145  -14.747 0.25 24.58 ? 119 GLU B N   4 
ATOM   10633 C  CA  . GLU B 1 119 ? -13.895 98.047  -13.881 0.25 23.57 ? 119 GLU B CA  4 
ATOM   10634 C  C   . GLU B 1 119 ? -12.699 97.456  -14.627 0.25 22.25 ? 119 GLU B C   4 
ATOM   10635 O  O   . GLU B 1 119 ? -12.842 96.522  -15.415 0.25 19.80 ? 119 GLU B O   4 
ATOM   10636 C  CB  . GLU B 1 119 ? -14.218 97.192  -12.648 0.25 24.06 ? 119 GLU B CB  4 
ATOM   10637 C  CG  . GLU B 1 119 ? -13.021 96.915  -11.744 0.25 27.71 ? 119 GLU B CG  4 
ATOM   10638 C  CD  . GLU B 1 119 ? -13.411 96.246  -10.433 0.25 28.68 ? 119 GLU B CD  4 
ATOM   10639 O  OE1 . GLU B 1 119 ? -14.125 96.881  -9.629  0.25 29.86 ? 119 GLU B OE1 4 
ATOM   10640 O  OE2 . GLU B 1 119 ? -13.005 95.087  -10.205 0.25 30.68 ? 119 GLU B OE2 4 
ATOM   10641 N  N   . ILE B 1 120 ? -11.521 98.016  -14.372 0.25 19.31 ? 120 ILE B N   4 
ATOM   10642 C  CA  . ILE B 1 120 ? -10.287 97.570  -15.004 0.25 17.55 ? 120 ILE B CA  4 
ATOM   10643 C  C   . ILE B 1 120 ? -9.184  97.511  -13.950 0.25 15.71 ? 120 ILE B C   4 
ATOM   10644 O  O   . ILE B 1 120 ? -9.263  98.195  -12.930 0.25 15.36 ? 120 ILE B O   4 
ATOM   10645 C  CB  . ILE B 1 120 ? -9.872  98.549  -16.122 0.25 17.89 ? 120 ILE B CB  4 
ATOM   10646 C  CG1 . ILE B 1 120 ? -10.954 98.586  -17.203 0.25 21.59 ? 120 ILE B CG1 4 
ATOM   10647 C  CG2 . ILE B 1 120 ? -8.551  98.138  -16.712 0.25 20.32 ? 120 ILE B CG2 4 
ATOM   10648 C  CD1 . ILE B 1 120 ? -11.274 97.232  -17.806 0.25 20.33 ? 120 ILE B CD1 4 
ATOM   10649 N  N   . THR B 1 121 ? -8.163  96.693  -14.192 0.25 14.22 ? 121 THR B N   4 
ATOM   10650 C  CA  . THR B 1 121 ? -7.048  96.563  -13.258 0.25 15.28 ? 121 THR B CA  4 
ATOM   10651 C  C   . THR B 1 121 ? -5.865  97.385  -13.759 0.25 14.48 ? 121 THR B C   4 
ATOM   10652 O  O   . THR B 1 121 ? -5.389  97.179  -14.881 0.25 13.00 ? 121 THR B O   4 
ATOM   10653 C  CB  . THR B 1 121 ? -6.620  95.088  -13.107 0.25 16.76 ? 121 THR B CB  4 
ATOM   10654 O  OG1 . THR B 1 121 ? -7.722  94.325  -12.602 0.25 18.29 ? 121 THR B OG1 4 
ATOM   10655 C  CG2 . THR B 1 121 ? -5.443  94.960  -12.140 0.25 15.69 ? 121 THR B CG2 4 
ATOM   10656 N  N   . CYS B 1 122 ? -5.396  98.316  -12.928 0.25 11.90 ? 122 CYS B N   4 
ATOM   10657 C  CA  . CYS B 1 122 ? -4.281  99.187  -13.295 0.25 11.50 ? 122 CYS B CA  4 
ATOM   10658 C  C   . CYS B 1 122 ? -3.077  99.126  -12.370 0.25 11.60 ? 122 CYS B C   4 
ATOM   10659 O  O   . CYS B 1 122 ? -3.174  98.747  -11.203 0.25 12.59 ? 122 CYS B O   4 
ATOM   10660 C  CB  . CYS B 1 122 ? -4.724  100.652 -13.327 0.25 8.51  ? 122 CYS B CB  4 
ATOM   10661 S  SG  . CYS B 1 122 ? -5.896  101.122 -14.615 0.25 11.92 ? 122 CYS B SG  4 
ATOM   10662 N  N   . ARG B 1 123 ? -1.939  99.527  -12.919 0.25 10.64 ? 123 ARG B N   4 
ATOM   10663 C  CA  . ARG B 1 123 ? -0.700  99.617  -12.171 0.25 8.51  ? 123 ARG B CA  4 
ATOM   10664 C  C   . ARG B 1 123 ? -0.653  101.099 -11.821 0.25 9.35  ? 123 ARG B C   4 
ATOM   10665 O  O   . ARG B 1 123 ? -1.033  101.936 -12.641 0.25 10.65 ? 123 ARG B O   4 
ATOM   10666 C  CB  . ARG B 1 123 ? 0.487   99.264  -13.073 0.25 7.34  ? 123 ARG B CB  4 
ATOM   10667 C  CG  . ARG B 1 123 ? 1.846   99.231  -12.366 0.25 9.48  ? 123 ARG B CG  4 
ATOM   10668 C  CD  . ARG B 1 123 ? 2.947   99.034  -13.403 0.25 9.03  ? 123 ARG B CD  4 
ATOM   10669 N  NE  . ARG B 1 123 ? 4.269   98.760  -12.843 0.25 9.37  ? 123 ARG B NE  4 
ATOM   10670 C  CZ  . ARG B 1 123 ? 4.594   97.651  -12.186 0.25 9.95  ? 123 ARG B CZ  4 
ATOM   10671 N  NH1 . ARG B 1 123 ? 3.687   96.706  -11.987 0.25 8.39  ? 123 ARG B NH1 4 
ATOM   10672 N  NH2 . ARG B 1 123 ? 5.841   97.467  -11.773 0.25 7.47  ? 123 ARG B NH2 4 
ATOM   10673 N  N   . SER B 1 124 ? -0.226  101.433 -10.609 0.25 7.28  ? 124 SER B N   4 
ATOM   10674 C  CA  . SER B 1 124 ? -0.124  102.837 -10.231 0.25 6.82  ? 124 SER B CA  4 
ATOM   10675 C  C   . SER B 1 124 ? 0.960   102.968 -9.161  0.25 7.51  ? 124 SER B C   4 
ATOM   10676 O  O   . SER B 1 124 ? 1.740   102.032 -8.939  0.25 6.54  ? 124 SER B O   4 
ATOM   10677 C  CB  . SER B 1 124 ? -1.479  103.359 -9.721  0.25 6.46  ? 124 SER B CB  4 
ATOM   10678 O  OG  . SER B 1 124 ? -1.523  104.781 -9.701  0.25 4.40  ? 124 SER B OG  4 
ATOM   10679 N  N   . TYR B 1 125 ? 1.015   104.120 -8.505  0.25 6.62  ? 125 TYR B N   4 
ATOM   10680 C  CA  . TYR B 1 125 ? 2.030   104.366 -7.481  0.25 6.65  ? 125 TYR B CA  4 
ATOM   10681 C  C   . TYR B 1 125 ? 1.471   105.275 -6.398  0.25 5.55  ? 125 TYR B C   4 
ATOM   10682 O  O   . TYR B 1 125 ? 0.507   105.997 -6.633  0.25 3.71  ? 125 TYR B O   4 
ATOM   10683 C  CB  . TYR B 1 125 ? 3.253   105.055 -8.108  0.25 7.46  ? 125 TYR B CB  4 
ATOM   10684 C  CG  . TYR B 1 125 ? 3.874   104.285 -9.250  0.25 8.77  ? 125 TYR B CG  4 
ATOM   10685 C  CD1 . TYR B 1 125 ? 4.917   103.383 -9.027  0.25 11.01 ? 125 TYR B CD1 4 
ATOM   10686 C  CD2 . TYR B 1 125 ? 3.377   104.409 -10.542 0.25 9.61  ? 125 TYR B CD2 4 
ATOM   10687 C  CE1 . TYR B 1 125 ? 5.446   102.621 -10.070 0.25 10.75 ? 125 TYR B CE1 4 
ATOM   10688 C  CE2 . TYR B 1 125 ? 3.895   103.653 -11.592 0.25 11.34 ? 125 TYR B CE2 4 
ATOM   10689 C  CZ  . TYR B 1 125 ? 4.926   102.762 -11.348 0.25 8.19  ? 125 TYR B CZ  4 
ATOM   10690 O  OH  . TYR B 1 125 ? 5.434   102.010 -12.376 0.25 12.87 ? 125 TYR B OH  4 
ATOM   10691 N  N   . LEU B 1 126 ? 2.081   105.225 -5.216  0.25 5.42  ? 126 LEU B N   4 
ATOM   10692 C  CA  . LEU B 1 126 ? 1.694   106.082 -4.099  0.25 6.38  ? 126 LEU B CA  4 
ATOM   10693 C  C   . LEU B 1 126 ? 2.829   106.146 -3.088  0.25 6.90  ? 126 LEU B C   4 
ATOM   10694 O  O   . LEU B 1 126 ? 3.704   105.283 -3.076  0.25 7.60  ? 126 LEU B O   4 
ATOM   10695 C  CB  . LEU B 1 126 ? 0.391   105.597 -3.439  0.25 6.87  ? 126 LEU B CB  4 
ATOM   10696 C  CG  . LEU B 1 126 ? 0.231   104.216 -2.792  0.25 6.14  ? 126 LEU B CG  4 
ATOM   10697 C  CD1 . LEU B 1 126 ? 0.976   104.140 -1.455  0.25 5.95  ? 126 LEU B CD1 4 
ATOM   10698 C  CD2 . LEU B 1 126 ? -1.253  103.974 -2.565  0.25 5.79  ? 126 LEU B CD2 4 
HETATM 10699 N  N   . MSE B 1 127 ? 2.835   107.187 -2.260  0.25 8.46  ? 127 MSE B N   4 
HETATM 10700 C  CA  . MSE B 1 127 ? 3.879   107.339 -1.251  0.25 9.75  ? 127 MSE B CA  4 
HETATM 10701 C  C   . MSE B 1 127 ? 3.483   106.656 0.056   0.25 9.13  ? 127 MSE B C   4 
HETATM 10702 O  O   . MSE B 1 127 ? 2.316   106.675 0.440   0.25 8.22  ? 127 MSE B O   4 
HETATM 10703 C  CB  . MSE B 1 127 ? 4.160   108.825 -0.983  0.25 10.86 ? 127 MSE B CB  4 
HETATM 10704 C  CG  . MSE B 1 127 ? 4.625   109.613 -2.210  0.25 13.45 ? 127 MSE B CG  4 
HETATM 10705 SE SE  . MSE B 1 127 ? 5.414   111.323 -1.705  0.25 24.46 ? 127 MSE B SE  4 
HETATM 10706 C  CE  . MSE B 1 127 ? 3.922   112.489 -2.004  0.25 10.51 ? 127 MSE B CE  4 
ATOM   10707 N  N   . THR B 1 128 ? 4.461   106.060 0.735   0.25 10.52 ? 128 THR B N   4 
ATOM   10708 C  CA  . THR B 1 128 ? 4.205   105.371 1.998   0.25 11.41 ? 128 THR B CA  4 
ATOM   10709 C  C   . THR B 1 128 ? 4.894   106.062 3.173   0.25 13.32 ? 128 THR B C   4 
ATOM   10710 O  O   . THR B 1 128 ? 4.621   105.746 4.328   0.25 15.68 ? 128 THR B O   4 
ATOM   10711 C  CB  . THR B 1 128 ? 4.698   103.910 1.960   0.25 11.93 ? 128 THR B CB  4 
ATOM   10712 O  OG1 . THR B 1 128 ? 6.128   103.887 1.875   0.25 9.64  ? 128 THR B OG1 4 
ATOM   10713 C  CG2 . THR B 1 128 ? 4.102   103.180 0.764   0.25 10.72 ? 128 THR B CG2 4 
ATOM   10714 N  N   . ASN B 1 129 ? 5.794   106.995 2.881   0.25 11.77 ? 129 ASN B N   4 
ATOM   10715 C  CA  . ASN B 1 129 ? 6.496   107.712 3.945   0.25 15.27 ? 129 ASN B CA  4 
ATOM   10716 C  C   . ASN B 1 129 ? 6.643   109.167 3.546   0.25 14.41 ? 129 ASN B C   4 
ATOM   10717 O  O   . ASN B 1 129 ? 7.596   109.541 2.859   0.25 15.40 ? 129 ASN B O   4 
ATOM   10718 C  CB  . ASN B 1 129 ? 7.883   107.109 4.183   0.25 15.70 ? 129 ASN B CB  4 
ATOM   10719 C  CG  . ASN B 1 129 ? 8.547   107.661 5.433   0.25 20.13 ? 129 ASN B CG  4 
ATOM   10720 O  OD1 . ASN B 1 129 ? 8.109   108.673 5.989   0.25 17.39 ? 129 ASN B OD1 4 
ATOM   10721 N  ND2 . ASN B 1 129 ? 9.612   107.002 5.878   0.25 17.64 ? 129 ASN B ND2 4 
ATOM   10722 N  N   . TYR B 1 130 ? 5.703   109.994 3.980   0.25 13.88 ? 130 TYR B N   4 
ATOM   10723 C  CA  . TYR B 1 130 ? 5.758   111.394 3.609   0.25 13.91 ? 130 TYR B CA  4 
ATOM   10724 C  C   . TYR B 1 130 ? 5.087   112.329 4.599   0.25 15.05 ? 130 TYR B C   4 
ATOM   10725 O  O   . TYR B 1 130 ? 4.395   111.899 5.524   0.25 12.78 ? 130 TYR B O   4 
ATOM   10726 C  CB  . TYR B 1 130 ? 5.111   111.594 2.237   0.25 13.67 ? 130 TYR B CB  4 
ATOM   10727 C  CG  . TYR B 1 130 ? 3.595   111.634 2.265   0.25 12.83 ? 130 TYR B CG  4 
ATOM   10728 C  CD1 . TYR B 1 130 ? 2.838   110.465 2.191   0.25 13.08 ? 130 TYR B CD1 4 
ATOM   10729 C  CD2 . TYR B 1 130 ? 2.920   112.847 2.362   0.25 11.29 ? 130 TYR B CD2 4 
ATOM   10730 C  CE1 . TYR B 1 130 ? 1.440   110.507 2.208   0.25 12.33 ? 130 TYR B CE1 4 
ATOM   10731 C  CE2 . TYR B 1 130 ? 1.528   112.903 2.379   0.25 13.73 ? 130 TYR B CE2 4 
ATOM   10732 C  CZ  . TYR B 1 130 ? 0.795   111.732 2.302   0.25 12.75 ? 130 TYR B CZ  4 
ATOM   10733 O  OH  . TYR B 1 130 ? -0.581  111.794 2.321   0.25 12.12 ? 130 TYR B OH  4 
ATOM   10734 N  N   . GLU B 1 131 ? 5.314   113.618 4.378   0.25 15.43 ? 131 GLU B N   4 
ATOM   10735 C  CA  . GLU B 1 131 ? 4.734   114.684 5.184   0.25 18.85 ? 131 GLU B CA  4 
ATOM   10736 C  C   . GLU B 1 131 ? 4.018   115.575 4.175   0.25 17.77 ? 131 GLU B C   4 
ATOM   10737 O  O   . GLU B 1 131 ? 4.627   116.054 3.218   0.25 17.00 ? 131 GLU B O   4 
ATOM   10738 C  CB  . GLU B 1 131 ? 5.833   115.459 5.907   0.25 22.06 ? 131 GLU B CB  4 
ATOM   10739 C  CG  . GLU B 1 131 ? 6.511   114.667 7.017   0.25 28.86 ? 131 GLU B CG  4 
ATOM   10740 C  CD  . GLU B 1 131 ? 7.815   115.295 7.466   0.25 32.65 ? 131 GLU B CD  4 
ATOM   10741 O  OE1 . GLU B 1 131 ? 7.875   116.538 7.544   0.25 35.57 ? 131 GLU B OE1 4 
ATOM   10742 O  OE2 . GLU B 1 131 ? 8.776   114.546 7.747   0.25 34.77 ? 131 GLU B OE2 4 
ATOM   10743 N  N   . SER B 1 132 ? 2.720   115.770 4.377   0.25 16.48 ? 132 SER B N   4 
ATOM   10744 C  CA  . SER B 1 132 ? 1.920   116.574 3.464   0.25 16.86 ? 132 SER B CA  4 
ATOM   10745 C  C   . SER B 1 132 ? 2.492   117.972 3.258   0.25 16.73 ? 132 SER B C   4 
ATOM   10746 O  O   . SER B 1 132 ? 3.148   118.531 4.142   0.25 14.94 ? 132 SER B O   4 
ATOM   10747 C  CB  . SER B 1 132 ? 0.477   116.669 3.973   0.25 17.34 ? 132 SER B CB  4 
ATOM   10748 O  OG  . SER B 1 132 ? -0.371  117.233 2.988   0.25 17.68 ? 132 SER B OG  4 
ATOM   10749 N  N   . ALA B 1 133 ? 2.240   118.528 2.078   0.25 16.74 ? 133 ALA B N   4 
ATOM   10750 C  CA  . ALA B 1 133 ? 2.720   119.863 1.743   0.25 16.34 ? 133 ALA B CA  4 
ATOM   10751 C  C   . ALA B 1 133 ? 2.104   120.295 0.421   0.25 16.88 ? 133 ALA B C   4 
ATOM   10752 O  O   . ALA B 1 133 ? 1.970   119.488 -0.500  0.25 18.09 ? 133 ALA B O   4 
ATOM   10753 C  CB  . ALA B 1 133 ? 4.242   119.862 1.644   0.25 17.06 ? 133 ALA B CB  4 
ATOM   10754 N  N   . PRO B 1 134 ? 1.717   121.577 0.308   0.25 15.49 ? 134 PRO B N   4 
ATOM   10755 C  CA  . PRO B 1 134 ? 1.110   122.073 -0.929  0.25 15.64 ? 134 PRO B CA  4 
ATOM   10756 C  C   . PRO B 1 134 ? 2.003   122.025 -2.168  0.25 14.53 ? 134 PRO B C   4 
ATOM   10757 O  O   . PRO B 1 134 ? 3.225   122.160 -2.081  0.25 12.33 ? 134 PRO B O   4 
ATOM   10758 C  CB  . PRO B 1 134 ? 0.700   123.498 -0.566  0.25 15.96 ? 134 PRO B CB  4 
ATOM   10759 C  CG  . PRO B 1 134 ? 1.722   123.888 0.467   0.25 17.03 ? 134 PRO B CG  4 
ATOM   10760 C  CD  . PRO B 1 134 ? 1.802   122.647 1.317   0.25 15.78 ? 134 PRO B CD  4 
ATOM   10761 N  N   . PRO B 1 135 ? 1.392   121.831 -3.345  0.25 13.30 ? 135 PRO B N   4 
ATOM   10762 C  CA  . PRO B 1 135 ? 2.122   121.767 -4.618  0.25 14.14 ? 135 PRO B CA  4 
ATOM   10763 C  C   . PRO B 1 135 ? 2.576   123.148 -5.094  0.25 15.05 ? 135 PRO B C   4 
ATOM   10764 O  O   . PRO B 1 135 ? 2.071   124.171 -4.633  0.25 14.08 ? 135 PRO B O   4 
ATOM   10765 C  CB  . PRO B 1 135 ? 1.100   121.156 -5.565  0.25 12.72 ? 135 PRO B CB  4 
ATOM   10766 C  CG  . PRO B 1 135 ? -0.201  121.725 -5.044  0.25 13.54 ? 135 PRO B CG  4 
ATOM   10767 C  CD  . PRO B 1 135 ? -0.043  121.550 -3.546  0.25 14.53 ? 135 PRO B CD  4 
ATOM   10768 N  N   . SER B 1 136 ? 3.533   123.177 -6.014  0.25 14.73 ? 136 SER B N   4 
ATOM   10769 C  CA  . SER B 1 136 ? 4.002   124.446 -6.551  0.25 15.29 ? 136 SER B CA  4 
ATOM   10770 C  C   . SER B 1 136 ? 2.957   124.882 -7.572  0.25 16.69 ? 136 SER B C   4 
ATOM   10771 O  O   . SER B 1 136 ? 2.111   124.081 -7.977  0.25 17.62 ? 136 SER B O   4 
ATOM   10772 C  CB  . SER B 1 136 ? 5.368   124.274 -7.224  0.25 14.86 ? 136 SER B CB  4 
ATOM   10773 O  OG  . SER B 1 136 ? 5.294   123.402 -8.338  0.25 12.42 ? 136 SER B OG  4 
ATOM   10774 N  N   . PRO B 1 137 ? 2.982   126.158 -7.986  0.25 16.60 ? 137 PRO B N   4 
ATOM   10775 C  CA  . PRO B 1 137 ? 1.999   126.621 -8.969  0.25 16.11 ? 137 PRO B CA  4 
ATOM   10776 C  C   . PRO B 1 137 ? 2.111   125.829 -10.261 0.25 16.11 ? 137 PRO B C   4 
ATOM   10777 O  O   . PRO B 1 137 ? 1.099   125.449 -10.854 0.25 15.05 ? 137 PRO B O   4 
ATOM   10778 C  CB  . PRO B 1 137 ? 2.364   128.091 -9.156  0.25 17.01 ? 137 PRO B CB  4 
ATOM   10779 C  CG  . PRO B 1 137 ? 2.897   128.471 -7.797  0.25 15.90 ? 137 PRO B CG  4 
ATOM   10780 C  CD  . PRO B 1 137 ? 3.768   127.287 -7.458  0.25 17.40 ? 137 PRO B CD  4 
ATOM   10781 N  N   . GLN B 1 138 ? 3.345   125.577 -10.691 0.25 16.19 ? 138 GLN B N   4 
ATOM   10782 C  CA  . GLN B 1 138 ? 3.581   124.824 -11.919 0.25 16.75 ? 138 GLN B CA  4 
ATOM   10783 C  C   . GLN B 1 138 ? 2.893   123.468 -11.865 0.25 16.00 ? 138 GLN B C   4 
ATOM   10784 O  O   . GLN B 1 138 ? 2.119   123.124 -12.754 0.25 16.00 ? 138 GLN B O   4 
ATOM   10785 C  CB  . GLN B 1 138 ? 5.081   124.603 -12.156 0.25 17.71 ? 138 GLN B CB  4 
ATOM   10786 C  CG  . GLN B 1 138 ? 5.889   125.850 -12.488 0.25 19.80 ? 138 GLN B CG  4 
ATOM   10787 C  CD  . GLN B 1 138 ? 5.957   126.832 -11.340 0.25 20.19 ? 138 GLN B CD  4 
ATOM   10788 O  OE1 . GLN B 1 138 ? 5.799   126.459 -10.175 0.25 22.21 ? 138 GLN B OE1 4 
ATOM   10789 N  NE2 . GLN B 1 138 ? 6.214   128.094 -11.660 0.25 17.96 ? 138 GLN B NE2 4 
ATOM   10790 N  N   . TYR B 1 139 ? 3.183   122.704 -10.816 0.25 15.44 ? 139 TYR B N   4 
ATOM   10791 C  CA  . TYR B 1 139 ? 2.607   121.375 -10.639 0.25 14.31 ? 139 TYR B CA  4 
ATOM   10792 C  C   . TYR B 1 139 ? 1.078   121.417 -10.680 0.25 14.46 ? 139 TYR B C   4 
ATOM   10793 O  O   . TYR B 1 139 ? 0.444   120.663 -11.431 0.25 11.82 ? 139 TYR B O   4 
ATOM   10794 C  CB  . TYR B 1 139 ? 3.092   120.785 -9.311  0.25 14.55 ? 139 TYR B CB  4 
ATOM   10795 C  CG  . TYR B 1 139 ? 2.983   119.275 -9.203  0.25 13.35 ? 139 TYR B CG  4 
ATOM   10796 C  CD1 . TYR B 1 139 ? 3.569   118.439 -10.156 0.25 16.94 ? 139 TYR B CD1 4 
ATOM   10797 C  CD2 . TYR B 1 139 ? 2.337   118.683 -8.120  0.25 15.88 ? 139 TYR B CD2 4 
ATOM   10798 C  CE1 . TYR B 1 139 ? 3.517   117.044 -10.028 0.25 14.11 ? 139 TYR B CE1 4 
ATOM   10799 C  CE2 . TYR B 1 139 ? 2.277   117.302 -7.981  0.25 14.19 ? 139 TYR B CE2 4 
ATOM   10800 C  CZ  . TYR B 1 139 ? 2.868   116.488 -8.934  0.25 14.36 ? 139 TYR B CZ  4 
ATOM   10801 O  OH  . TYR B 1 139 ? 2.820   115.124 -8.771  0.25 13.65 ? 139 TYR B OH  4 
ATOM   10802 N  N   . LYS B 1 140 ? 0.477   122.299 -9.885  0.25 13.51 ? 140 LYS B N   4 
ATOM   10803 C  CA  . LYS B 1 140 ? -0.980  122.403 -9.878  0.25 13.72 ? 140 LYS B CA  4 
ATOM   10804 C  C   . LYS B 1 140 ? -1.503  122.719 -11.276 0.25 14.38 ? 140 LYS B C   4 
ATOM   10805 O  O   . LYS B 1 140 ? -2.533  122.188 -11.707 0.25 12.98 ? 140 LYS B O   4 
ATOM   10806 C  CB  . LYS B 1 140 ? -1.450  123.497 -8.911  0.25 14.42 ? 140 LYS B CB  4 
ATOM   10807 C  CG  . LYS B 1 140 ? -2.956  123.728 -8.980  0.25 14.89 ? 140 LYS B CG  4 
ATOM   10808 C  CD  . LYS B 1 140 ? -3.433  124.833 -8.052  0.25 15.07 ? 140 LYS B CD  4 
ATOM   10809 C  CE  . LYS B 1 140 ? -4.936  125.018 -8.190  0.25 16.41 ? 140 LYS B CE  4 
ATOM   10810 N  NZ  . LYS B 1 140 ? -5.466  126.111 -7.340  0.25 15.34 ? 140 LYS B NZ  4 
ATOM   10811 N  N   . LYS B 1 141 ? -0.791  123.588 -11.983 0.25 14.45 ? 141 LYS B N   4 
ATOM   10812 C  CA  . LYS B 1 141 ? -1.196  123.981 -13.326 0.25 16.62 ? 141 LYS B CA  4 
ATOM   10813 C  C   . LYS B 1 141 ? -1.171  122.798 -14.290 0.25 14.52 ? 141 LYS B C   4 
ATOM   10814 O  O   . LYS B 1 141 ? -2.132  122.569 -15.028 0.25 14.10 ? 141 LYS B O   4 
ATOM   10815 C  CB  . LYS B 1 141 ? -0.280  125.092 -13.850 0.25 18.38 ? 141 LYS B CB  4 
ATOM   10816 C  CG  . LYS B 1 141 ? -0.611  125.560 -15.258 0.25 23.75 ? 141 LYS B CG  4 
ATOM   10817 C  CD  . LYS B 1 141 ? -1.987  126.207 -15.326 0.25 27.19 ? 141 LYS B CD  4 
ATOM   10818 C  CE  . LYS B 1 141 ? -2.275  126.726 -16.729 0.25 31.01 ? 141 LYS B CE  4 
ATOM   10819 N  NZ  . LYS B 1 141 ? -3.592  127.417 -16.830 0.25 32.81 ? 141 LYS B NZ  4 
ATOM   10820 N  N   . ILE B 1 142 ? -0.070  122.051 -14.288 0.25 14.00 ? 142 ILE B N   4 
ATOM   10821 C  CA  . ILE B 1 142 ? 0.055   120.899 -15.176 0.25 13.43 ? 142 ILE B CA  4 
ATOM   10822 C  C   . ILE B 1 142 ? -1.045  119.878 -14.888 0.25 12.99 ? 142 ILE B C   4 
ATOM   10823 O  O   . ILE B 1 142 ? -1.630  119.308 -15.805 0.25 11.94 ? 142 ILE B O   4 
ATOM   10824 C  CB  . ILE B 1 142 ? 1.441   120.217 -15.034 0.25 13.13 ? 142 ILE B CB  4 
ATOM   10825 C  CG1 . ILE B 1 142 ? 2.542   121.151 -15.549 0.25 14.42 ? 142 ILE B CG1 4 
ATOM   10826 C  CG2 . ILE B 1 142 ? 1.458   118.900 -15.811 0.25 12.73 ? 142 ILE B CG2 4 
ATOM   10827 C  CD1 . ILE B 1 142 ? 2.447   121.480 -17.039 0.25 12.59 ? 142 ILE B CD1 4 
ATOM   10828 N  N   . ILE B 1 143 ? -1.330  119.651 -13.613 0.25 11.50 ? 143 ILE B N   4 
ATOM   10829 C  CA  . ILE B 1 143 ? -2.368  118.699 -13.245 0.25 13.16 ? 143 ILE B CA  4 
ATOM   10830 C  C   . ILE B 1 143 ? -3.738  119.134 -13.772 0.25 13.42 ? 143 ILE B C   4 
ATOM   10831 O  O   . ILE B 1 143 ? -4.465  118.335 -14.377 0.25 12.84 ? 143 ILE B O   4 
ATOM   10832 C  CB  . ILE B 1 143 ? -2.400  118.505 -11.708 0.25 11.24 ? 143 ILE B CB  4 
ATOM   10833 C  CG1 . ILE B 1 143 ? -1.160  117.699 -11.289 0.25 12.02 ? 143 ILE B CG1 4 
ATOM   10834 C  CG2 . ILE B 1 143 ? -3.679  117.787 -11.288 0.25 12.02 ? 143 ILE B CG2 4 
ATOM   10835 C  CD1 . ILE B 1 143 ? -0.829  117.759 -9.815  0.25 12.76 ? 143 ILE B CD1 4 
ATOM   10836 N  N   . CYS B 1 144 ? -4.084  120.403 -13.560 0.25 13.88 ? 144 CYS B N   4 
ATOM   10837 C  CA  . CYS B 1 144 ? -5.366  120.935 -14.024 0.25 13.21 ? 144 CYS B CA  4 
ATOM   10838 C  C   . CYS B 1 144 ? -5.486  120.885 -15.550 0.25 12.42 ? 144 CYS B C   4 
ATOM   10839 O  O   . CYS B 1 144 ? -6.565  120.634 -16.093 0.25 10.06 ? 144 CYS B O   4 
ATOM   10840 C  CB  . CYS B 1 144 ? -5.545  122.379 -13.541 0.25 15.29 ? 144 CYS B CB  4 
ATOM   10841 S  SG  . CYS B 1 144 ? -5.795  122.557 -11.759 0.25 10.27 ? 144 CYS B SG  4 
HETATM 10842 N  N   . MSE B 1 145 ? -4.379  121.135 -16.242 0.25 12.83 ? 145 MSE B N   4 
HETATM 10843 C  CA  . MSE B 1 145 ? -4.383  121.101 -17.702 0.25 13.98 ? 145 MSE B CA  4 
HETATM 10844 C  C   . MSE B 1 145 ? -4.609  119.674 -18.189 0.25 14.15 ? 145 MSE B C   4 
HETATM 10845 O  O   . MSE B 1 145 ? -5.290  119.448 -19.190 0.25 12.69 ? 145 MSE B O   4 
HETATM 10846 C  CB  . MSE B 1 145 ? -3.056  121.628 -18.255 0.25 15.69 ? 145 MSE B CB  4 
HETATM 10847 C  CG  . MSE B 1 145 ? -2.865  123.133 -18.113 0.25 16.86 ? 145 MSE B CG  4 
HETATM 10848 SE SE  . MSE B 1 145 ? -1.105  123.714 -18.669 0.25 19.17 ? 145 MSE B SE  4 
HETATM 10849 C  CE  . MSE B 1 145 ? -1.311  123.540 -20.589 0.25 18.54 ? 145 MSE B CE  4 
ATOM   10850 N  N   . GLY B 1 146 ? -4.032  118.711 -17.478 0.25 13.25 ? 146 GLY B N   4 
ATOM   10851 C  CA  . GLY B 1 146 ? -4.193  117.323 -17.868 0.25 10.50 ? 146 GLY B CA  4 
ATOM   10852 C  C   . GLY B 1 146 ? -5.627  116.858 -17.706 0.25 10.31 ? 146 GLY B C   4 
ATOM   10853 O  O   . GLY B 1 146 ? -6.168  116.153 -18.567 0.25 10.61 ? 146 GLY B O   4 
ATOM   10854 N  N   . ALA B 1 147 ? -6.245  117.244 -16.594 0.25 9.01  ? 147 ALA B N   4 
ATOM   10855 C  CA  . ALA B 1 147 ? -7.631  116.872 -16.318 0.25 9.82  ? 147 ALA B CA  4 
ATOM   10856 C  C   . ALA B 1 147 ? -8.522  117.441 -17.418 0.25 11.06 ? 147 ALA B C   4 
ATOM   10857 O  O   . ALA B 1 147 ? -9.383  116.749 -17.964 0.25 10.42 ? 147 ALA B O   4 
ATOM   10858 C  CB  . ALA B 1 147 ? -8.061  117.425 -14.956 0.25 9.60  ? 147 ALA B CB  4 
ATOM   10859 N  N   . LYS B 1 148 ? -8.300  118.711 -17.736 0.25 12.31 ? 148 LYS B N   4 
ATOM   10860 C  CA  . LYS B 1 148 ? -9.067  119.392 -18.775 0.25 14.62 ? 148 LYS B CA  4 
ATOM   10861 C  C   . LYS B 1 148 ? -8.955  118.651 -20.102 0.25 14.25 ? 148 LYS B C   4 
ATOM   10862 O  O   . LYS B 1 148 ? -9.959  118.288 -20.716 0.25 12.55 ? 148 LYS B O   4 
ATOM   10863 C  CB  . LYS B 1 148 ? -8.549  120.820 -18.955 0.25 17.76 ? 148 LYS B CB  4 
ATOM   10864 C  CG  . LYS B 1 148 ? -9.197  121.574 -20.117 0.25 21.41 ? 148 LYS B CG  4 
ATOM   10865 C  CD  . LYS B 1 148 ? -8.495  122.902 -20.366 0.25 25.91 ? 148 LYS B CD  4 
ATOM   10866 C  CE  . LYS B 1 148 ? -9.060  123.612 -21.589 0.25 26.37 ? 148 LYS B CE  4 
ATOM   10867 N  NZ  . LYS B 1 148 ? -8.371  124.909 -21.856 0.25 29.33 ? 148 LYS B NZ  4 
ATOM   10868 N  N   . GLU B 1 149 ? -7.719  118.435 -20.536 0.25 16.28 ? 149 GLU B N   4 
ATOM   10869 C  CA  . GLU B 1 149 ? -7.440  117.753 -21.793 0.25 17.48 ? 149 GLU B CA  4 
ATOM   10870 C  C   . GLU B 1 149 ? -8.176  116.426 -21.939 0.25 17.40 ? 149 GLU B C   4 
ATOM   10871 O  O   . GLU B 1 149 ? -8.831  116.178 -22.951 0.25 16.38 ? 149 GLU B O   4 
ATOM   10872 C  CB  . GLU B 1 149 ? -5.937  117.503 -21.927 0.25 19.15 ? 149 GLU B CB  4 
ATOM   10873 C  CG  . GLU B 1 149 ? -5.542  116.823 -23.230 0.25 20.10 ? 149 GLU B CG  4 
ATOM   10874 C  CD  . GLU B 1 149 ? -4.068  116.485 -23.283 0.25 21.12 ? 149 GLU B CD  4 
ATOM   10875 O  OE1 . GLU B 1 149 ? -3.626  115.618 -22.498 0.25 23.06 ? 149 GLU B OE1 4 
ATOM   10876 O  OE2 . GLU B 1 149 ? -3.348  117.091 -24.105 0.25 22.61 ? 149 GLU B OE2 4 
ATOM   10877 N  N   . ASN B 1 150 ? -8.070  115.578 -20.919 0.25 15.54 ? 150 ASN B N   4 
ATOM   10878 C  CA  . ASN B 1 150 ? -8.702  114.264 -20.954 0.25 15.17 ? 150 ASN B CA  4 
ATOM   10879 C  C   . ASN B 1 150 ? -10.129 114.212 -20.421 0.25 14.90 ? 150 ASN B C   4 
ATOM   10880 O  O   . ASN B 1 150 ? -10.690 113.137 -20.208 0.25 16.27 ? 150 ASN B O   4 
ATOM   10881 C  CB  . ASN B 1 150 ? -7.799  113.264 -20.236 0.25 16.52 ? 150 ASN B CB  4 
ATOM   10882 C  CG  . ASN B 1 150 ? -6.519  113.004 -21.006 0.25 18.16 ? 150 ASN B CG  4 
ATOM   10883 O  OD1 . ASN B 1 150 ? -5.482  112.662 -20.432 0.25 19.58 ? 150 ASN B OD1 4 
ATOM   10884 N  ND2 . ASN B 1 150 ? -6.589  113.163 -22.326 0.25 13.72 ? 150 ASN B ND2 4 
ATOM   10885 N  N   . GLY B 1 151 ? -10.717 115.385 -20.220 0.25 15.06 ? 151 GLY B N   4 
ATOM   10886 C  CA  . GLY B 1 151 ? -12.090 115.466 -19.760 0.25 14.42 ? 151 GLY B CA  4 
ATOM   10887 C  C   . GLY B 1 151 ? -12.504 114.780 -18.468 0.25 15.99 ? 151 GLY B C   4 
ATOM   10888 O  O   . GLY B 1 151 ? -13.513 114.072 -18.445 0.25 14.21 ? 151 GLY B O   4 
ATOM   10889 N  N   . LEU B 1 152 ? -11.745 114.966 -17.392 0.25 15.58 ? 152 LEU B N   4 
ATOM   10890 C  CA  . LEU B 1 152 ? -12.148 114.372 -16.122 0.25 16.98 ? 152 LEU B CA  4 
ATOM   10891 C  C   . LEU B 1 152 ? -13.400 115.148 -15.697 0.25 17.31 ? 152 LEU B C   4 
ATOM   10892 O  O   . LEU B 1 152 ? -13.699 116.205 -16.259 0.25 17.54 ? 152 LEU B O   4 
ATOM   10893 C  CB  . LEU B 1 152 ? -11.033 114.516 -15.079 0.25 15.74 ? 152 LEU B CB  4 
ATOM   10894 C  CG  . LEU B 1 152 ? -9.948  113.428 -15.094 0.25 16.48 ? 152 LEU B CG  4 
ATOM   10895 C  CD1 . LEU B 1 152 ? -9.234  113.412 -16.433 0.25 15.70 ? 152 LEU B CD1 4 
ATOM   10896 C  CD2 . LEU B 1 152 ? -8.954  113.676 -13.960 0.25 15.83 ? 152 LEU B CD2 4 
ATOM   10897 N  N   . PRO B 1 153 ? -14.161 114.633 -14.718 0.25 18.90 ? 153 PRO B N   4 
ATOM   10898 C  CA  . PRO B 1 153 ? -15.369 115.347 -14.285 0.25 19.08 ? 153 PRO B CA  4 
ATOM   10899 C  C   . PRO B 1 153 ? -15.133 116.834 -14.003 0.25 19.49 ? 153 PRO B C   4 
ATOM   10900 O  O   . PRO B 1 153 ? -14.074 117.223 -13.511 0.25 17.70 ? 153 PRO B O   4 
ATOM   10901 C  CB  . PRO B 1 153 ? -15.790 114.574 -13.041 0.25 19.59 ? 153 PRO B CB  4 
ATOM   10902 C  CG  . PRO B 1 153 ? -15.391 113.165 -13.399 0.25 19.55 ? 153 PRO B CG  4 
ATOM   10903 C  CD  . PRO B 1 153 ? -14.012 113.361 -13.988 0.25 17.46 ? 153 PRO B CD  4 
ATOM   10904 N  N   . LEU B 1 154 ? -16.131 117.654 -14.323 0.25 19.67 ? 154 LEU B N   4 
ATOM   10905 C  CA  . LEU B 1 154 ? -16.058 119.096 -14.117 0.25 20.71 ? 154 LEU B CA  4 
ATOM   10906 C  C   . LEU B 1 154 ? -15.880 119.471 -12.652 0.25 19.39 ? 154 LEU B C   4 
ATOM   10907 O  O   . LEU B 1 154 ? -15.021 120.289 -12.313 0.25 18.05 ? 154 LEU B O   4 
ATOM   10908 C  CB  . LEU B 1 154 ? -17.325 119.769 -14.662 0.25 25.43 ? 154 LEU B CB  4 
ATOM   10909 C  CG  . LEU B 1 154 ? -17.294 120.262 -16.112 0.25 28.24 ? 154 LEU B CG  4 
ATOM   10910 C  CD1 . LEU B 1 154 ? -16.418 121.499 -16.206 0.25 30.35 ? 154 LEU B CD1 4 
ATOM   10911 C  CD2 . LEU B 1 154 ? -16.782 119.170 -17.028 0.25 29.60 ? 154 LEU B CD2 4 
ATOM   10912 N  N   . GLU B 1 155 ? -16.699 118.876 -11.790 0.25 19.44 ? 155 GLU B N   4 
ATOM   10913 C  CA  . GLU B 1 155 ? -16.632 119.144 -10.359 0.25 21.33 ? 155 GLU B CA  4 
ATOM   10914 C  C   . GLU B 1 155 ? -15.293 118.688 -9.793  0.25 18.79 ? 155 GLU B C   4 
ATOM   10915 O  O   . GLU B 1 155 ? -14.728 119.343 -8.915  0.25 18.45 ? 155 GLU B O   4 
ATOM   10916 C  CB  . GLU B 1 155 ? -17.768 118.428 -9.618  0.25 26.16 ? 155 GLU B CB  4 
ATOM   10917 C  CG  . GLU B 1 155 ? -18.791 117.745 -10.519 0.25 34.54 ? 155 GLU B CG  4 
ATOM   10918 C  CD  . GLU B 1 155 ? -18.225 116.531 -11.239 0.25 36.93 ? 155 GLU B CD  4 
ATOM   10919 O  OE1 . GLU B 1 155 ? -17.755 115.600 -10.552 0.25 39.76 ? 155 GLU B OE1 4 
ATOM   10920 O  OE2 . GLU B 1 155 ? -18.255 116.506 -12.489 0.25 39.46 ? 155 GLU B OE2 4 
ATOM   10921 N  N   . TYR B 1 156 ? -14.789 117.560 -10.289 0.25 17.11 ? 156 TYR B N   4 
ATOM   10922 C  CA  . TYR B 1 156 ? -13.504 117.050 -9.819  0.25 16.29 ? 156 TYR B CA  4 
ATOM   10923 C  C   . TYR B 1 156 ? -12.436 118.045 -10.233 0.25 15.34 ? 156 TYR B C   4 
ATOM   10924 O  O   . TYR B 1 156 ? -11.474 118.283 -9.506  0.25 15.93 ? 156 TYR B O   4 
ATOM   10925 C  CB  . TYR B 1 156 ? -13.191 115.677 -10.426 0.25 14.63 ? 156 TYR B CB  4 
ATOM   10926 C  CG  . TYR B 1 156 ? -11.928 115.062 -9.863  0.25 15.71 ? 156 TYR B CG  4 
ATOM   10927 C  CD1 . TYR B 1 156 ? -11.888 114.585 -8.553  0.25 12.36 ? 156 TYR B CD1 4 
ATOM   10928 C  CD2 . TYR B 1 156 ? -10.759 114.993 -10.628 0.25 14.53 ? 156 TYR B CD2 4 
ATOM   10929 C  CE1 . TYR B 1 156 ? -10.718 114.056 -8.014  0.25 14.42 ? 156 TYR B CE1 4 
ATOM   10930 C  CE2 . TYR B 1 156 ? -9.580  114.467 -10.100 0.25 14.09 ? 156 TYR B CE2 4 
ATOM   10931 C  CZ  . TYR B 1 156 ? -9.566  114.001 -8.793  0.25 13.60 ? 156 TYR B CZ  4 
ATOM   10932 O  OH  . TYR B 1 156 ? -8.407  113.487 -8.259  0.25 13.49 ? 156 TYR B OH  4 
ATOM   10933 N  N   . GLN B 1 157 ? -12.615 118.629 -11.412 0.25 16.09 ? 157 GLN B N   4 
ATOM   10934 C  CA  . GLN B 1 157 ? -11.674 119.621 -11.904 0.25 15.30 ? 157 GLN B CA  4 
ATOM   10935 C  C   . GLN B 1 157 ? -11.714 120.858 -11.004 0.25 16.13 ? 157 GLN B C   4 
ATOM   10936 O  O   . GLN B 1 157 ? -10.721 121.565 -10.872 0.25 13.42 ? 157 GLN B O   4 
ATOM   10937 C  CB  . GLN B 1 157 ? -12.007 120.011 -13.348 0.25 12.58 ? 157 GLN B CB  4 
ATOM   10938 C  CG  . GLN B 1 157 ? -11.692 118.929 -14.384 0.25 13.67 ? 157 GLN B CG  4 
ATOM   10939 C  CD  . GLN B 1 157 ? -11.742 119.460 -15.810 0.25 15.52 ? 157 GLN B CD  4 
ATOM   10940 O  OE1 . GLN B 1 157 ? -11.033 120.407 -16.154 0.25 16.16 ? 157 GLN B OE1 4 
ATOM   10941 N  NE2 . GLN B 1 157 ? -12.582 118.850 -16.649 0.25 13.38 ? 157 GLN B NE2 4 
ATOM   10942 N  N   . GLU B 1 158 ? -12.859 121.115 -10.377 0.25 18.66 ? 158 GLU B N   4 
ATOM   10943 C  CA  . GLU B 1 158 ? -12.975 122.270 -9.492  0.25 19.59 ? 158 GLU B CA  4 
ATOM   10944 C  C   . GLU B 1 158 ? -12.111 122.072 -8.256  0.25 19.08 ? 158 GLU B C   4 
ATOM   10945 O  O   . GLU B 1 158 ? -11.456 123.005 -7.793  0.25 18.77 ? 158 GLU B O   4 
ATOM   10946 C  CB  . GLU B 1 158 ? -14.429 122.501 -9.077  0.25 23.91 ? 158 GLU B CB  4 
ATOM   10947 C  CG  . GLU B 1 158 ? -15.020 123.787 -9.626  0.25 31.12 ? 158 GLU B CG  4 
ATOM   10948 C  CD  . GLU B 1 158 ? -14.104 124.983 -9.429  0.25 34.20 ? 158 GLU B CD  4 
ATOM   10949 O  OE1 . GLU B 1 158 ? -13.661 125.217 -8.283  0.25 37.85 ? 158 GLU B OE1 4 
ATOM   10950 O  OE2 . GLU B 1 158 ? -13.830 125.694 -10.419 0.25 35.96 ? 158 GLU B OE2 4 
ATOM   10951 N  N   . LYS B 1 159 ? -12.108 120.854 -7.723  0.25 20.45 ? 159 LYS B N   4 
ATOM   10952 C  CA  . LYS B 1 159 ? -11.296 120.552 -6.550  0.25 20.59 ? 159 LYS B CA  4 
ATOM   10953 C  C   . LYS B 1 159 ? -9.818  120.758 -6.879  0.25 18.53 ? 159 LYS B C   4 
ATOM   10954 O  O   . LYS B 1 159 ? -9.045  121.220 -6.040  0.25 15.33 ? 159 LYS B O   4 
ATOM   10955 C  CB  . LYS B 1 159 ? -11.528 119.111 -6.081  0.25 24.97 ? 159 LYS B CB  4 
ATOM   10956 C  CG  . LYS B 1 159 ? -12.844 118.887 -5.356  0.25 29.85 ? 159 LYS B CG  4 
ATOM   10957 C  CD  . LYS B 1 159 ? -12.916 117.467 -4.811  0.25 33.11 ? 159 LYS B CD  4 
ATOM   10958 C  CE  . LYS B 1 159 ? -14.150 117.249 -3.950  0.25 35.22 ? 159 LYS B CE  4 
ATOM   10959 N  NZ  . LYS B 1 159 ? -14.196 115.859 -3.411  0.25 37.76 ? 159 LYS B NZ  4 
ATOM   10960 N  N   . LEU B 1 160 ? -9.422  120.410 -8.098  0.25 16.34 ? 160 LEU B N   4 
ATOM   10961 C  CA  . LEU B 1 160 ? -8.032  120.595 -8.501  0.25 15.81 ? 160 LEU B CA  4 
ATOM   10962 C  C   . LEU B 1 160 ? -7.766  122.086 -8.690  0.25 17.00 ? 160 LEU B C   4 
ATOM   10963 O  O   . LEU B 1 160 ? -6.706  122.591 -8.321  0.25 16.30 ? 160 LEU B O   4 
ATOM   10964 C  CB  . LEU B 1 160 ? -7.737  119.851 -9.811  0.25 14.91 ? 160 LEU B CB  4 
ATOM   10965 C  CG  . LEU B 1 160 ? -7.741  118.317 -9.796  0.25 15.71 ? 160 LEU B CG  4 
ATOM   10966 C  CD1 . LEU B 1 160 ? -7.624  117.795 -11.228 0.25 15.72 ? 160 LEU B CD1 4 
ATOM   10967 C  CD2 . LEU B 1 160 ? -6.591  117.800 -8.939  0.25 12.90 ? 160 LEU B CD2 4 
ATOM   10968 N  N   . LYS B 1 161 ? -8.739  122.790 -9.259  0.25 17.31 ? 161 LYS B N   4 
ATOM   10969 C  CA  . LYS B 1 161 ? -8.591  124.220 -9.496  0.25 22.11 ? 161 LYS B CA  4 
ATOM   10970 C  C   . LYS B 1 161 ? -8.617  124.999 -8.187  0.25 20.79 ? 161 LYS B C   4 
ATOM   10971 O  O   . LYS B 1 161 ? -8.172  126.141 -8.129  0.25 20.39 ? 161 LYS B O   4 
ATOM   10972 C  CB  . LYS B 1 161 ? -9.700  124.716 -10.432 0.25 24.77 ? 161 LYS B CB  4 
ATOM   10973 C  CG  . LYS B 1 161 ? -9.632  124.102 -11.832 0.25 31.67 ? 161 LYS B CG  4 
ATOM   10974 C  CD  . LYS B 1 161 ? -10.882 124.394 -12.656 0.25 35.24 ? 161 LYS B CD  4 
ATOM   10975 C  CE  . LYS B 1 161 ? -11.033 125.876 -12.966 0.25 37.69 ? 161 LYS B CE  4 
ATOM   10976 N  NZ  . LYS B 1 161 ? -12.282 126.152 -13.732 0.25 38.06 ? 161 LYS B NZ  4 
ATOM   10977 N  N   . ALA B 1 162 ? -9.129  124.369 -7.134  0.25 20.45 ? 162 ALA B N   4 
ATOM   10978 C  CA  . ALA B 1 162 ? -9.212  125.008 -5.827  0.25 20.37 ? 162 ALA B CA  4 
ATOM   10979 C  C   . ALA B 1 162 ? -8.076  124.591 -4.899  0.25 20.30 ? 162 ALA B C   4 
ATOM   10980 O  O   . ALA B 1 162 ? -8.003  125.046 -3.757  0.25 20.14 ? 162 ALA B O   4 
ATOM   10981 C  CB  . ALA B 1 162 ? -10.550 124.688 -5.178  0.25 20.88 ? 162 ALA B CB  4 
ATOM   10982 N  N   . ILE B 1 163 ? -7.193  123.723 -5.382  0.25 19.23 ? 163 ILE B N   4 
ATOM   10983 C  CA  . ILE B 1 163 ? -6.076  123.263 -4.567  0.25 18.76 ? 163 ILE B CA  4 
ATOM   10984 C  C   . ILE B 1 163 ? -5.161  124.421 -4.193  0.25 17.99 ? 163 ILE B C   4 
ATOM   10985 O  O   . ILE B 1 163 ? -4.767  125.214 -5.046  0.25 17.54 ? 163 ILE B O   4 
ATOM   10986 C  CB  . ILE B 1 163 ? -5.239  122.191 -5.299  0.25 17.54 ? 163 ILE B CB  4 
ATOM   10987 C  CG1 . ILE B 1 163 ? -6.097  120.954 -5.571  0.25 19.19 ? 163 ILE B CG1 4 
ATOM   10988 C  CG2 . ILE B 1 163 ? -4.025  121.815 -4.451  0.25 16.46 ? 163 ILE B CG2 4 
ATOM   10989 C  CD1 . ILE B 1 163 ? -5.398  119.889 -6.389  0.25 16.30 ? 163 ILE B CD1 4 
ATOM   10990 N  N   . GLU B 1 164 ? -4.819  124.505 -2.910  0.25 19.06 ? 164 GLU B N   4 
ATOM   10991 C  CA  . GLU B 1 164 ? -3.947  125.566 -2.416  0.25 19.78 ? 164 GLU B CA  4 
ATOM   10992 C  C   . GLU B 1 164 ? -2.476  125.261 -2.688  0.25 19.99 ? 164 GLU B C   4 
ATOM   10993 O  O   . GLU B 1 164 ? -1.915  124.323 -2.130  0.25 19.37 ? 164 GLU B O   4 
ATOM   10994 C  CB  . GLU B 1 164 ? -4.138  125.752 -0.908  0.25 20.28 ? 164 GLU B CB  4 
ATOM   10995 C  CG  . GLU B 1 164 ? -3.241  126.822 -0.302  0.25 21.76 ? 164 GLU B CG  4 
ATOM   10996 C  CD  . GLU B 1 164 ? -2.524  126.355 0.953   0.25 22.27 ? 164 GLU B CD  4 
ATOM   10997 O  OE1 . GLU B 1 164 ? -1.612  125.511 0.840   0.25 19.68 ? 164 GLU B OE1 4 
ATOM   10998 O  OE2 . GLU B 1 164 ? -2.875  126.829 2.055   0.25 23.81 ? 164 GLU B OE2 4 
ATOM   10999 N  N   . PRO B 1 165 ? -1.830  126.055 -3.553  0.25 20.09 ? 165 PRO B N   4 
ATOM   11000 C  CA  . PRO B 1 165 ? -0.415  125.827 -3.859  0.25 20.59 ? 165 PRO B CA  4 
ATOM   11001 C  C   . PRO B 1 165 ? 0.460   126.472 -2.787  0.25 21.04 ? 165 PRO B C   4 
ATOM   11002 O  O   . PRO B 1 165 ? -0.044  127.202 -1.932  0.25 18.79 ? 165 PRO B O   4 
ATOM   11003 C  CB  . PRO B 1 165 ? -0.251  126.517 -5.207  0.25 19.89 ? 165 PRO B CB  4 
ATOM   11004 C  CG  . PRO B 1 165 ? -1.136  127.716 -5.052  0.25 20.92 ? 165 PRO B CG  4 
ATOM   11005 C  CD  . PRO B 1 165 ? -2.385  127.127 -4.404  0.25 21.24 ? 165 PRO B CD  4 
ATOM   11006 N  N   . ASN B 1 166 ? 1.760   126.192 -2.806  0.25 21.43 ? 166 ASN B N   4 
ATOM   11007 C  CA  . ASN B 1 166 ? 2.637   126.839 -1.843  0.25 22.51 ? 166 ASN B CA  4 
ATOM   11008 C  C   . ASN B 1 166 ? 2.916   128.213 -2.444  0.25 23.59 ? 166 ASN B C   4 
ATOM   11009 O  O   . ASN B 1 166 ? 2.287   128.592 -3.433  0.25 24.22 ? 166 ASN B O   4 
ATOM   11010 C  CB  . ASN B 1 166 ? 3.944   126.053 -1.621  0.25 19.93 ? 166 ASN B CB  4 
ATOM   11011 C  CG  . ASN B 1 166 ? 4.684   125.744 -2.907  0.25 18.66 ? 166 ASN B CG  4 
ATOM   11012 O  OD1 . ASN B 1 166 ? 4.673   126.526 -3.855  0.25 14.39 ? 166 ASN B OD1 4 
ATOM   11013 N  ND2 . ASN B 1 166 ? 5.357   124.601 -2.933  0.25 16.91 ? 166 ASN B ND2 4 
ATOM   11014 N  N   . ASP B 1 167 ? 3.839   128.968 -1.864  0.25 27.31 ? 167 ASP B N   4 
ATOM   11015 C  CA  . ASP B 1 167 ? 4.124   130.297 -2.391  0.25 29.36 ? 167 ASP B CA  4 
ATOM   11016 C  C   . ASP B 1 167 ? 5.366   130.368 -3.272  0.25 28.63 ? 167 ASP B C   4 
ATOM   11017 O  O   . ASP B 1 167 ? 5.983   131.428 -3.400  0.25 28.31 ? 167 ASP B O   4 
ATOM   11018 C  CB  . ASP B 1 167 ? 4.231   131.307 -1.243  0.25 33.22 ? 167 ASP B CB  4 
ATOM   11019 C  CG  . ASP B 1 167 ? 5.250   130.901 -0.202  0.25 36.67 ? 167 ASP B CG  4 
ATOM   11020 O  OD1 . ASP B 1 167 ? 6.435   130.741 -0.562  0.25 39.55 ? 167 ASP B OD1 4 
ATOM   11021 O  OD2 . ASP B 1 167 ? 4.865   130.745 0.977   0.25 38.14 ? 167 ASP B OD2 4 
ATOM   11022 N  N   . TYR B 1 168 ? 5.732   129.245 -3.886  0.25 26.22 ? 168 TYR B N   4 
ATOM   11023 C  CA  . TYR B 1 168 ? 6.899   129.225 -4.763  0.25 25.98 ? 168 TYR B CA  4 
ATOM   11024 C  C   . TYR B 1 168 ? 6.653   130.248 -5.865  0.25 26.95 ? 168 TYR B C   4 
ATOM   11025 O  O   . TYR B 1 168 ? 5.657   130.172 -6.586  0.25 26.34 ? 168 TYR B O   4 
ATOM   11026 C  CB  . TYR B 1 168 ? 7.101   127.829 -5.372  0.25 24.15 ? 168 TYR B CB  4 
ATOM   11027 C  CG  . TYR B 1 168 ? 8.356   127.689 -6.218  0.25 20.76 ? 168 TYR B CG  4 
ATOM   11028 C  CD1 . TYR B 1 168 ? 9.620   127.920 -5.675  0.25 20.49 ? 168 TYR B CD1 4 
ATOM   11029 C  CD2 . TYR B 1 168 ? 8.275   127.319 -7.559  0.25 20.10 ? 168 TYR B CD2 4 
ATOM   11030 C  CE1 . TYR B 1 168 ? 10.776  127.786 -6.453  0.25 19.79 ? 168 TYR B CE1 4 
ATOM   11031 C  CE2 . TYR B 1 168 ? 9.422   127.180 -8.344  0.25 18.95 ? 168 TYR B CE2 4 
ATOM   11032 C  CZ  . TYR B 1 168 ? 10.665  127.413 -7.785  0.25 18.62 ? 168 TYR B CZ  4 
ATOM   11033 O  OH  . TYR B 1 168 ? 11.794  127.258 -8.558  0.25 20.22 ? 168 TYR B OH  4 
ATOM   11034 N  N   . THR B 1 169 ? 7.552   131.218 -5.978  0.25 27.97 ? 169 THR B N   4 
ATOM   11035 C  CA  . THR B 1 169 ? 7.419   132.259 -6.989  0.25 29.39 ? 169 THR B CA  4 
ATOM   11036 C  C   . THR B 1 169 ? 8.479   132.102 -8.067  0.25 29.52 ? 169 THR B C   4 
ATOM   11037 O  O   . THR B 1 169 ? 8.574   132.919 -8.981  0.25 29.39 ? 169 THR B O   4 
ATOM   11038 C  CB  . THR B 1 169 ? 7.526   133.663 -6.358  0.25 30.15 ? 169 THR B CB  4 
ATOM   11039 O  OG1 . THR B 1 169 ? 8.662   133.714 -5.485  0.25 31.01 ? 169 THR B OG1 4 
ATOM   11040 C  CG2 . THR B 1 169 ? 6.265   133.983 -5.566  0.25 31.38 ? 169 THR B CG2 4 
ATOM   11041 N  N   . GLY B 1 170 ? 9.274   131.044 -7.947  0.25 29.54 ? 170 GLY B N   4 
ATOM   11042 C  CA  . GLY B 1 170 ? 10.307  130.775 -8.926  0.25 28.79 ? 170 GLY B CA  4 
ATOM   11043 C  C   . GLY B 1 170 ? 9.741   129.895 -10.022 0.25 29.30 ? 170 GLY B C   4 
ATOM   11044 O  O   . GLY B 1 170 ? 8.555   129.567 -10.011 0.25 28.33 ? 170 GLY B O   4 
ATOM   11045 N  N   . LYS B 1 171 ? 10.581  129.503 -10.971 0.25 29.91 ? 171 LYS B N   4 
ATOM   11046 C  CA  . LYS B 1 171 ? 10.125  128.655 -12.063 0.25 32.38 ? 171 LYS B CA  4 
ATOM   11047 C  C   . LYS B 1 171 ? 10.800  127.291 -12.017 0.25 30.14 ? 171 LYS B C   4 
ATOM   11048 O  O   . LYS B 1 171 ? 11.670  127.046 -11.184 0.25 28.69 ? 171 LYS B O   4 
ATOM   11049 C  CB  . LYS B 1 171 ? 10.413  129.330 -13.408 0.25 36.36 ? 171 LYS B CB  4 
ATOM   11050 C  CG  . LYS B 1 171 ? 9.721   130.671 -13.582 0.25 43.38 ? 171 LYS B CG  4 
ATOM   11051 C  CD  . LYS B 1 171 ? 9.997   131.278 -14.946 0.25 47.87 ? 171 LYS B CD  4 
ATOM   11052 C  CE  . LYS B 1 171 ? 9.297   132.620 -15.094 0.25 52.38 ? 171 LYS B CE  4 
ATOM   11053 N  NZ  . LYS B 1 171 ? 9.528   133.234 -16.430 0.25 56.68 ? 171 LYS B NZ  4 
ATOM   11054 N  N   . VAL B 1 172 ? 10.373  126.401 -12.905 0.25 29.38 ? 172 VAL B N   4 
ATOM   11055 C  CA  . VAL B 1 172 ? 10.951  125.068 -12.997 0.25 29.09 ? 172 VAL B CA  4 
ATOM   11056 C  C   . VAL B 1 172 ? 11.642  124.980 -14.354 0.25 28.87 ? 172 VAL B C   4 
ATOM   11057 O  O   . VAL B 1 172 ? 11.869  126.006 -14.997 0.25 27.78 ? 172 VAL B O   4 
ATOM   11058 C  CB  . VAL B 1 172 ? 9.866   123.970 -12.877 0.25 29.19 ? 172 VAL B CB  4 
ATOM   11059 C  CG1 . VAL B 1 172 ? 9.389   123.869 -11.438 0.25 29.38 ? 172 VAL B CG1 4 
ATOM   11060 C  CG2 . VAL B 1 172 ? 8.693   124.288 -13.789 0.25 29.72 ? 172 VAL B CG2 4 
ATOM   11061 N  N   . SER B 1 173 ? 11.983  123.774 -14.796 0.25 28.63 ? 173 SER B N   4 
ATOM   11062 C  CA  . SER B 1 173 ? 12.644  123.627 -16.086 0.25 28.50 ? 173 SER B CA  4 
ATOM   11063 C  C   . SER B 1 173 ? 11.831  124.354 -17.152 0.25 29.30 ? 173 SER B C   4 
ATOM   11064 O  O   . SER B 1 173 ? 10.597  124.340 -17.122 0.25 27.72 ? 173 SER B O   4 
ATOM   11065 C  CB  . SER B 1 173 ? 12.788  122.146 -16.457 0.25 28.30 ? 173 SER B CB  4 
ATOM   11066 O  OG  . SER B 1 173 ? 11.526  121.536 -16.662 0.25 27.13 ? 173 SER B OG  4 
ATOM   11067 N  N   . GLU B 1 174 ? 12.523  125.000 -18.087 0.25 30.47 ? 174 GLU B N   4 
ATOM   11068 C  CA  . GLU B 1 174 ? 11.852  125.729 -19.151 0.25 32.80 ? 174 GLU B CA  4 
ATOM   11069 C  C   . GLU B 1 174 ? 11.015  124.769 -19.988 0.25 33.24 ? 174 GLU B C   4 
ATOM   11070 O  O   . GLU B 1 174 ? 10.064  125.177 -20.649 0.25 33.12 ? 174 GLU B O   4 
ATOM   11071 C  CB  . GLU B 1 174 ? 12.879  126.437 -20.039 0.25 35.46 ? 174 GLU B CB  4 
ATOM   11072 C  CG  . GLU B 1 174 ? 13.760  127.428 -19.295 0.25 40.45 ? 174 GLU B CG  4 
ATOM   11073 C  CD  . GLU B 1 174 ? 14.815  128.057 -20.186 0.25 43.24 ? 174 GLU B CD  4 
ATOM   11074 O  OE1 . GLU B 1 174 ? 14.441  128.757 -21.151 0.25 46.78 ? 174 GLU B OE1 4 
ATOM   11075 O  OE2 . GLU B 1 174 ? 16.018  127.851 -19.921 0.25 45.61 ? 174 GLU B OE2 4 
ATOM   11076 N  N   . GLU B 1 175 ? 11.378  123.491 -19.952 0.25 33.78 ? 175 GLU B N   4 
ATOM   11077 C  CA  . GLU B 1 175 ? 10.659  122.467 -20.701 0.25 35.70 ? 175 GLU B CA  4 
ATOM   11078 C  C   . GLU B 1 175 ? 9.239   122.334 -20.161 0.25 33.60 ? 175 GLU B C   4 
ATOM   11079 O  O   . GLU B 1 175 ? 8.327   121.898 -20.863 0.25 32.39 ? 175 GLU B O   4 
ATOM   11080 C  CB  . GLU B 1 175 ? 11.387  121.127 -20.584 0.25 40.63 ? 175 GLU B CB  4 
ATOM   11081 C  CG  . GLU B 1 175 ? 12.813  121.148 -21.118 0.25 48.20 ? 175 GLU B CG  4 
ATOM   11082 C  CD  . GLU B 1 175 ? 12.873  121.295 -22.629 0.25 51.80 ? 175 GLU B CD  4 
ATOM   11083 O  OE1 . GLU B 1 175 ? 12.437  120.360 -23.335 0.25 55.06 ? 175 GLU B OE1 4 
ATOM   11084 O  OE2 . GLU B 1 175 ? 13.353  122.344 -23.112 0.25 53.76 ? 175 GLU B OE2 4 
ATOM   11085 N  N   . ILE B 1 176 ? 9.063   122.718 -18.903 0.25 31.71 ? 176 ILE B N   4 
ATOM   11086 C  CA  . ILE B 1 176 ? 7.761   122.652 -18.259 0.25 31.02 ? 176 ILE B CA  4 
ATOM   11087 C  C   . ILE B 1 176 ? 7.059   124.007 -18.314 0.25 30.52 ? 176 ILE B C   4 
ATOM   11088 O  O   . ILE B 1 176 ? 5.851   124.079 -18.527 0.25 29.43 ? 176 ILE B O   4 
ATOM   11089 C  CB  . ILE B 1 176 ? 7.900   122.220 -16.786 0.25 30.16 ? 176 ILE B CB  4 
ATOM   11090 C  CG1 . ILE B 1 176 ? 8.533   120.828 -16.712 0.25 30.34 ? 176 ILE B CG1 4 
ATOM   11091 C  CG2 . ILE B 1 176 ? 6.534   122.242 -16.107 0.25 30.68 ? 176 ILE B CG2 4 
ATOM   11092 C  CD1 . ILE B 1 176 ? 8.804   120.336 -15.291 0.25 32.90 ? 176 ILE B CD1 4 
ATOM   11093 N  N   . GLU B 1 177 ? 7.822   125.078 -18.118 0.25 31.28 ? 177 GLU B N   4 
ATOM   11094 C  CA  . GLU B 1 177 ? 7.266   126.427 -18.147 0.25 32.58 ? 177 GLU B CA  4 
ATOM   11095 C  C   . GLU B 1 177 ? 6.588   126.742 -19.477 0.25 32.69 ? 177 GLU B C   4 
ATOM   11096 O  O   . GLU B 1 177 ? 5.517   127.346 -19.505 0.25 33.09 ? 177 GLU B O   4 
ATOM   11097 C  CB  . GLU B 1 177 ? 8.361   127.460 -17.876 0.25 33.24 ? 177 GLU B CB  4 
ATOM   11098 C  CG  . GLU B 1 177 ? 8.851   127.510 -16.433 0.25 35.64 ? 177 GLU B CG  4 
ATOM   11099 C  CD  . GLU B 1 177 ? 7.756   127.898 -15.445 0.25 35.85 ? 177 GLU B CD  4 
ATOM   11100 O  OE1 . GLU B 1 177 ? 6.889   128.721 -15.802 0.25 35.80 ? 177 GLU B OE1 4 
ATOM   11101 O  OE2 . GLU B 1 177 ? 7.772   127.392 -14.304 0.25 36.21 ? 177 GLU B OE2 4 
ATOM   11102 N  N   . ASP B 1 178 ? 7.211   126.335 -20.578 0.25 34.05 ? 178 ASP B N   4 
ATOM   11103 C  CA  . ASP B 1 178 ? 6.646   126.591 -21.898 0.25 35.30 ? 178 ASP B CA  4 
ATOM   11104 C  C   . ASP B 1 178 ? 5.269   125.955 -22.045 0.25 34.80 ? 178 ASP B C   4 
ATOM   11105 O  O   . ASP B 1 178 ? 4.348   126.567 -22.589 0.25 33.56 ? 178 ASP B O   4 
ATOM   11106 C  CB  . ASP B 1 178 ? 7.583   126.071 -22.986 0.25 38.01 ? 178 ASP B CB  4 
ATOM   11107 C  CG  . ASP B 1 178 ? 8.909   126.803 -23.003 0.25 40.35 ? 178 ASP B CG  4 
ATOM   11108 O  OD1 . ASP B 1 178 ? 8.896   128.050 -22.950 0.25 41.00 ? 178 ASP B OD1 4 
ATOM   11109 O  OD2 . ASP B 1 178 ? 9.962   126.134 -23.075 0.25 41.63 ? 178 ASP B OD2 4 
ATOM   11110 N  N   . ILE B 1 179 ? 5.129   124.727 -21.557 0.25 34.09 ? 179 ILE B N   4 
ATOM   11111 C  CA  . ILE B 1 179 ? 3.849   124.034 -21.628 0.25 33.37 ? 179 ILE B CA  4 
ATOM   11112 C  C   . ILE B 1 179 ? 2.819   124.877 -20.887 0.25 33.39 ? 179 ILE B C   4 
ATOM   11113 O  O   . ILE B 1 179 ? 1.740   125.168 -21.405 0.25 33.56 ? 179 ILE B O   4 
ATOM   11114 C  CB  . ILE B 1 179 ? 3.924   122.642 -20.968 0.25 32.61 ? 179 ILE B CB  4 
ATOM   11115 C  CG1 . ILE B 1 179 ? 4.981   121.792 -21.675 0.25 31.51 ? 179 ILE B CG1 4 
ATOM   11116 C  CG2 . ILE B 1 179 ? 2.559   121.960 -21.028 0.25 31.08 ? 179 ILE B CG2 4 
ATOM   11117 C  CD1 . ILE B 1 179 ? 5.158   120.405 -21.087 0.25 30.60 ? 179 ILE B CD1 4 
ATOM   11118 N  N   . ILE B 1 180 ? 3.172   125.277 -19.672 0.25 33.01 ? 180 ILE B N   4 
ATOM   11119 C  CA  . ILE B 1 180 ? 2.292   126.088 -18.848 0.25 34.60 ? 180 ILE B CA  4 
ATOM   11120 C  C   . ILE B 1 180 ? 1.828   127.339 -19.585 0.25 38.32 ? 180 ILE B C   4 
ATOM   11121 O  O   . ILE B 1 180 ? 0.629   127.611 -19.659 0.25 38.16 ? 180 ILE B O   4 
ATOM   11122 C  CB  . ILE B 1 180 ? 2.998   126.502 -17.545 0.25 32.65 ? 180 ILE B CB  4 
ATOM   11123 C  CG1 . ILE B 1 180 ? 3.297   125.252 -16.711 0.25 28.55 ? 180 ILE B CG1 4 
ATOM   11124 C  CG2 . ILE B 1 180 ? 2.136   127.494 -16.773 0.25 31.17 ? 180 ILE B CG2 4 
ATOM   11125 C  CD1 . ILE B 1 180 ? 3.991   125.535 -15.394 0.25 24.92 ? 180 ILE B CD1 4 
ATOM   11126 N  N   . LYS B 1 181 ? 2.777   128.093 -20.134 0.25 42.70 ? 181 LYS B N   4 
ATOM   11127 C  CA  . LYS B 1 181 ? 2.460   129.321 -20.861 0.25 46.81 ? 181 LYS B CA  4 
ATOM   11128 C  C   . LYS B 1 181 ? 1.461   129.109 -21.990 0.25 48.34 ? 181 LYS B C   4 
ATOM   11129 O  O   . LYS B 1 181 ? 0.450   129.807 -22.072 0.25 48.94 ? 181 LYS B O   4 
ATOM   11130 C  CB  . LYS B 1 181 ? 3.735   129.954 -21.429 0.25 48.45 ? 181 LYS B CB  4 
ATOM   11131 C  CG  . LYS B 1 181 ? 4.612   130.626 -20.387 0.25 52.09 ? 181 LYS B CG  4 
ATOM   11132 C  CD  . LYS B 1 181 ? 5.738   131.421 -21.037 0.25 54.73 ? 181 LYS B CD  4 
ATOM   11133 C  CE  . LYS B 1 181 ? 6.555   132.175 -19.999 0.25 56.35 ? 181 LYS B CE  4 
ATOM   11134 N  NZ  . LYS B 1 181 ? 7.610   133.021 -20.624 0.25 58.21 ? 181 LYS B NZ  4 
ATOM   11135 N  N   . LYS B 1 182 ? 1.746   128.149 -22.861 0.25 50.47 ? 182 LYS B N   4 
ATOM   11136 C  CA  . LYS B 1 182 ? 0.871   127.859 -23.990 0.25 51.61 ? 182 LYS B CA  4 
ATOM   11137 C  C   . LYS B 1 182 ? -0.563  127.589 -23.543 0.25 50.43 ? 182 LYS B C   4 
ATOM   11138 O  O   . LYS B 1 182 ? -1.508  127.801 -24.304 0.25 51.91 ? 182 LYS B O   4 
ATOM   11139 C  CB  . LYS B 1 182 ? 1.411   126.659 -24.767 0.25 54.25 ? 182 LYS B CB  4 
ATOM   11140 C  CG  . LYS B 1 182 ? 2.838   126.850 -25.243 0.25 56.85 ? 182 LYS B CG  4 
ATOM   11141 C  CD  . LYS B 1 182 ? 3.383   125.599 -25.902 0.25 58.61 ? 182 LYS B CD  4 
ATOM   11142 C  CE  . LYS B 1 182 ? 4.845   125.781 -26.275 0.25 59.73 ? 182 LYS B CE  4 
ATOM   11143 N  NZ  . LYS B 1 182 ? 5.411   124.557 -26.900 0.25 62.21 ? 182 LYS B NZ  4 
ATOM   11144 N  N   . GLY B 1 183 ? -0.719  127.129 -22.306 0.25 47.31 ? 183 GLY B N   4 
ATOM   11145 C  CA  . GLY B 1 183 ? -2.043  126.840 -21.787 0.25 45.67 ? 183 GLY B CA  4 
ATOM   11146 C  C   . GLY B 1 183 ? -2.497  127.815 -20.715 0.25 45.42 ? 183 GLY B C   4 
ATOM   11147 O  O   . GLY B 1 183 ? -2.726  127.372 -19.571 0.25 43.28 ? 183 GLY B O   4 
HETATM 11148 O  O   . HOH C 2 .   ? -2.435  92.406  17.010  0.25 15.94 ? 189 HOH A O   4 
HETATM 11149 O  O   . HOH C 2 .   ? 7.369   98.886  -5.427  0.25 8.87  ? 190 HOH A O   4 
HETATM 11150 O  O   . HOH C 2 .   ? -5.695  96.548  14.420  0.25 14.89 ? 191 HOH A O   4 
HETATM 11151 O  O   . HOH C 2 .   ? 5.327   97.897  20.163  0.25 17.01 ? 192 HOH A O   4 
HETATM 11152 O  O   . HOH C 2 .   ? 14.972  80.212  0.916   0.25 18.23 ? 193 HOH A O   4 
HETATM 11153 O  O   . HOH C 2 .   ? -5.171  81.670  6.199   0.25 16.44 ? 194 HOH A O   4 
HETATM 11154 O  O   . HOH C 2 .   ? 2.213   101.132 5.903   0.25 15.93 ? 195 HOH A O   4 
HETATM 11155 O  O   . HOH C 2 .   ? -2.816  97.543  20.423  0.25 12.76 ? 196 HOH A O   4 
HETATM 11156 O  O   . HOH C 2 .   ? 8.016   97.398  20.033  0.25 22.47 ? 197 HOH A O   4 
HETATM 11157 O  O   . HOH C 2 .   ? 9.122   99.137  -3.440  0.25 14.11 ? 198 HOH A O   4 
HETATM 11158 O  O   . HOH C 2 .   ? 8.537   90.213  9.003   0.25 14.77 ? 199 HOH A O   4 
HETATM 11159 O  O   . HOH C 2 .   ? 15.028  89.753  21.068  0.25 17.13 ? 200 HOH A O   4 
HETATM 11160 O  O   . HOH C 2 .   ? -5.238  77.489  -1.491  0.25 24.68 ? 201 HOH A O   4 
HETATM 11161 O  O   . HOH C 2 .   ? -8.589  99.630  -1.570  0.25 17.05 ? 202 HOH A O   4 
HETATM 11162 O  O   . HOH C 2 .   ? 14.754  79.399  12.738  0.25 16.95 ? 203 HOH A O   4 
HETATM 11163 O  O   . HOH C 2 .   ? 1.570   92.953  -7.328  0.25 17.82 ? 204 HOH A O   4 
HETATM 11164 O  O   . HOH C 2 .   ? -5.055  91.960  29.960  0.25 19.60 ? 205 HOH A O   4 
HETATM 11165 O  O   . HOH C 2 .   ? 12.741  78.299  -4.609  0.25 28.69 ? 206 HOH A O   4 
HETATM 11166 O  O   . HOH C 2 .   ? 11.689  96.494  9.987   0.25 15.25 ? 207 HOH A O   4 
HETATM 11167 O  O   . HOH C 2 .   ? 7.160   106.816 0.197   0.25 17.02 ? 208 HOH A O   4 
HETATM 11168 O  O   . HOH C 2 .   ? 12.172  102.114 -0.245  0.25 20.39 ? 209 HOH A O   4 
HETATM 11169 O  O   . HOH C 2 .   ? -11.025 90.097  -4.016  0.25 18.45 ? 210 HOH A O   4 
HETATM 11170 O  O   . HOH C 2 .   ? -5.021  101.240 4.725   0.25 19.44 ? 211 HOH A O   4 
HETATM 11171 O  O   . HOH C 2 .   ? 14.356  94.785  -2.042  0.25 15.34 ? 212 HOH A O   4 
HETATM 11172 O  O   . HOH C 2 .   ? 6.479   89.156  24.176  0.25 17.79 ? 213 HOH A O   4 
HETATM 11173 O  O   . HOH C 2 .   ? -3.242  85.302  7.958   0.25 32.73 ? 214 HOH A O   4 
HETATM 11174 O  O   . HOH C 2 .   ? 7.852   76.190  -4.041  0.25 23.56 ? 215 HOH A O   4 
HETATM 11175 O  O   . HOH C 2 .   ? 7.197   86.942  -10.131 0.25 26.14 ? 216 HOH A O   4 
HETATM 11176 O  O   . HOH C 2 .   ? 4.460   98.171  17.480  0.25 21.22 ? 217 HOH A O   4 
HETATM 11177 O  O   . HOH C 2 .   ? -1.385  106.355 7.792   0.25 29.50 ? 218 HOH A O   4 
HETATM 11178 O  O   . HOH C 2 .   ? 4.898   74.723  1.412   0.25 23.40 ? 219 HOH A O   4 
HETATM 11179 O  O   . HOH C 2 .   ? 1.510   91.783  27.217  0.25 21.87 ? 220 HOH A O   4 
HETATM 11180 O  O   . HOH C 2 .   ? 10.578  87.313  -10.090 0.25 23.51 ? 221 HOH A O   4 
HETATM 11181 O  O   . HOH C 2 .   ? -7.081  99.241  -3.634  0.25 12.31 ? 222 HOH A O   4 
HETATM 11182 O  O   . HOH C 2 .   ? 7.711   74.025  -0.711  0.25 24.43 ? 223 HOH A O   4 
HETATM 11183 O  O   . HOH C 2 .   ? 18.278  82.284  -4.321  0.25 20.76 ? 224 HOH A O   4 
HETATM 11184 O  O   . HOH C 2 .   ? 20.582  83.707  10.759  0.25 22.29 ? 225 HOH A O   4 
HETATM 11185 O  O   . HOH C 2 .   ? 8.983   97.502  -6.925  0.25 18.30 ? 226 HOH A O   4 
HETATM 11186 O  O   . HOH C 2 .   ? -8.039  92.266  11.393  0.25 28.81 ? 227 HOH A O   4 
HETATM 11187 O  O   . HOH C 2 .   ? 19.188  89.294  0.879   0.25 29.46 ? 228 HOH A O   4 
HETATM 11188 O  O   . HOH C 2 .   ? -6.876  82.810  7.936   0.25 32.87 ? 229 HOH A O   4 
HETATM 11189 O  O   . HOH C 2 .   ? 11.278  83.788  15.842  0.25 18.99 ? 230 HOH A O   4 
HETATM 11190 O  O   . HOH C 2 .   ? 3.618   87.170  22.384  0.25 23.07 ? 231 HOH A O   4 
HETATM 11191 O  O   . HOH C 2 .   ? 16.827  83.123  1.154   0.25 26.05 ? 232 HOH A O   4 
HETATM 11192 O  O   . HOH C 2 .   ? 10.703  82.770  18.201  0.25 26.26 ? 233 HOH A O   4 
HETATM 11193 O  O   . HOH C 2 .   ? 10.933  87.733  23.482  0.25 36.02 ? 234 HOH A O   4 
HETATM 11194 O  O   . HOH C 2 .   ? 18.500  88.443  -9.308  0.25 27.97 ? 235 HOH A O   4 
HETATM 11195 O  O   . HOH C 2 .   ? -5.978  106.038 10.531  0.25 30.15 ? 236 HOH A O   4 
HETATM 11196 O  O   . HOH C 2 .   ? 13.191  98.116  -1.939  0.25 25.88 ? 237 HOH A O   4 
HETATM 11197 O  O   . HOH C 2 .   ? -9.060  101.541 17.864  0.25 30.65 ? 238 HOH A O   4 
HETATM 11198 O  O   . HOH C 2 .   ? 10.700  96.738  -4.153  0.25 27.58 ? 239 HOH A O   4 
HETATM 11199 O  O   . HOH C 2 .   ? 0.024   73.622  7.456   0.25 34.45 ? 240 HOH A O   4 
HETATM 11200 O  O   . HOH C 2 .   ? -8.442  95.468  11.375  0.25 43.41 ? 241 HOH A O   4 
HETATM 11201 O  O   . HOH C 2 .   ? 7.917   101.004 13.348  0.25 34.66 ? 242 HOH A O   4 
HETATM 11202 O  O   . HOH C 2 .   ? 7.917   94.758  -12.467 0.25 26.65 ? 243 HOH A O   4 
HETATM 11203 O  O   . HOH C 2 .   ? 6.334   88.397  -11.911 0.25 38.04 ? 244 HOH A O   4 
HETATM 11204 O  O   . HOH C 2 .   ? 4.137   72.969  8.228   0.25 33.04 ? 245 HOH A O   4 
HETATM 11205 O  O   . HOH C 2 .   ? 11.856  95.161  17.287  0.25 35.34 ? 246 HOH A O   4 
HETATM 11206 O  O   . HOH C 2 .   ? -5.945  103.531 16.907  0.25 27.96 ? 247 HOH A O   4 
HETATM 11207 O  O   . HOH C 2 .   ? 21.199  86.512  11.551  0.25 30.61 ? 248 HOH A O   4 
HETATM 11208 O  O   . HOH C 2 .   ? 10.262  98.056  13.207  0.25 26.36 ? 249 HOH A O   4 
HETATM 11209 O  O   . HOH C 2 .   ? -6.546  97.314  11.899  0.25 22.79 ? 250 HOH A O   4 
HETATM 11210 O  O   . HOH C 2 .   ? 4.370   86.400  -9.365  0.25 36.04 ? 251 HOH A O   4 
HETATM 11211 O  O   . HOH C 2 .   ? -4.972  97.860  18.660  0.25 29.31 ? 252 HOH A O   4 
HETATM 11212 O  O   . HOH C 2 .   ? -9.750  83.567  -5.584  0.25 31.79 ? 253 HOH A O   4 
HETATM 11213 O  O   . HOH C 2 .   ? 11.580  94.600  12.250  0.25 35.51 ? 254 HOH A O   4 
HETATM 11214 O  O   . HOH C 2 .   ? -11.765 79.305  15.223  0.25 38.02 ? 255 HOH A O   4 
HETATM 11215 O  O   . HOH C 2 .   ? 7.931   103.416 13.025  0.25 35.73 ? 256 HOH A O   4 
HETATM 11216 O  O   . HOH C 2 .   ? -2.929  99.264  22.028  0.25 28.03 ? 257 HOH A O   4 
HETATM 11217 O  O   . HOH C 2 .   ? -7.115  90.466  -7.764  0.25 25.83 ? 258 HOH A O   4 
HETATM 11218 O  O   . HOH C 2 .   ? 11.549  98.186  -10.429 0.25 32.71 ? 259 HOH A O   4 
HETATM 11219 O  O   . HOH C 2 .   ? -2.058  87.099  25.703  0.25 38.21 ? 260 HOH A O   4 
HETATM 11220 O  O   . HOH C 2 .   ? -4.165  84.958  26.549  0.25 36.11 ? 261 HOH A O   4 
HETATM 11221 O  O   . HOH C 2 .   ? 22.471  90.347  -6.311  0.25 37.94 ? 262 HOH A O   4 
HETATM 11222 O  O   . HOH C 2 .   ? 0.615   89.616  -8.739  0.25 39.80 ? 263 HOH A O   4 
HETATM 11223 O  O   . HOH C 2 .   ? 16.513  80.414  5.552   0.25 32.99 ? 264 HOH A O   4 
HETATM 11224 O  O   . HOH C 2 .   ? -4.085  83.741  5.275   0.25 30.05 ? 265 HOH A O   4 
HETATM 11225 O  O   . HOH D 2 .   ? -5.157  97.490  -4.109  0.25 13.40 ? 189 HOH B O   4 
HETATM 11226 O  O   . HOH D 2 .   ? 4.656   120.570 -6.346  0.25 13.18 ? 190 HOH B O   4 
HETATM 11227 O  O   . HOH D 2 .   ? -6.350  113.280 -9.873  0.25 13.46 ? 191 HOH B O   4 
HETATM 11228 O  O   . HOH D 2 .   ? -9.584  112.899 -3.457  0.25 11.68 ? 192 HOH B O   4 
HETATM 11229 O  O   . HOH D 2 .   ? 5.034   122.933 -0.601  0.25 16.06 ? 193 HOH B O   4 
HETATM 11230 O  O   . HOH D 2 .   ? -9.990  102.092 0.028   0.25 20.95 ? 194 HOH B O   4 
HETATM 11231 O  O   . HOH D 2 .   ? 0.099   108.128 0.130   0.25 16.65 ? 195 HOH B O   4 
HETATM 11232 O  O   . HOH D 2 .   ? 8.080   117.158 -2.714  0.25 18.58 ? 196 HOH B O   4 
HETATM 11233 O  O   . HOH D 2 .   ? 7.316   111.973 -18.891 0.25 17.36 ? 197 HOH B O   4 
HETATM 11234 O  O   . HOH D 2 .   ? -3.048  122.521 -0.435  0.25 20.13 ? 198 HOH B O   4 
HETATM 11235 O  O   . HOH D 2 .   ? 0.483   96.710  -10.264 0.25 18.87 ? 199 HOH B O   4 
HETATM 11236 O  O   . HOH D 2 .   ? 5.260   113.277 -14.851 0.25 34.23 ? 200 HOH B O   4 
HETATM 11237 O  O   . HOH D 2 .   ? 13.385  100.361 -12.391 0.25 17.70 ? 201 HOH B O   4 
HETATM 11238 O  O   . HOH D 2 .   ? -9.556  121.024 -3.581  0.25 26.29 ? 202 HOH B O   4 
HETATM 11239 O  O   . HOH D 2 .   ? -8.573  99.424  -5.937  0.25 17.38 ? 203 HOH B O   4 
HETATM 11240 O  O   . HOH D 2 .   ? 7.345   104.929 -24.191 0.25 27.94 ? 204 HOH B O   4 
HETATM 11241 O  O   . HOH D 2 .   ? 8.754   114.630 -2.529  0.25 21.90 ? 205 HOH B O   4 
HETATM 11242 O  O   . HOH D 2 .   ? 10.666  96.697  -17.939 0.25 30.03 ? 206 HOH B O   4 
HETATM 11243 O  O   . HOH D 2 .   ? -12.146 102.000 -7.437  0.25 22.32 ? 207 HOH B O   4 
HETATM 11244 O  O   . HOH D 2 .   ? -0.782  117.732 -23.917 0.25 19.00 ? 208 HOH B O   4 
HETATM 11245 O  O   . HOH D 2 .   ? 6.076   95.604  -24.220 0.25 39.37 ? 209 HOH B O   4 
HETATM 11246 O  O   . HOH D 2 .   ? -6.705  95.725  -5.985  0.25 23.33 ? 210 HOH B O   4 
HETATM 11247 O  O   . HOH D 2 .   ? -2.427  96.156  -16.894 0.25 25.26 ? 211 HOH B O   4 
HETATM 11248 O  O   . HOH D 2 .   ? -12.415 119.172 -19.939 0.25 20.34 ? 212 HOH B O   4 
HETATM 11249 O  O   . HOH D 2 .   ? 4.436   110.862 -28.127 0.25 29.30 ? 213 HOH B O   4 
HETATM 11250 O  O   . HOH D 2 .   ? -18.626 116.300 -15.835 0.25 29.85 ? 214 HOH B O   4 
HETATM 11251 O  O   . HOH D 2 .   ? 10.984  100.987 -2.746  0.25 21.19 ? 215 HOH B O   4 
HETATM 11252 O  O   . HOH D 2 .   ? 11.814  99.715  -19.021 0.25 23.70 ? 216 HOH B O   4 
HETATM 11253 O  O   . HOH D 2 .   ? 13.204  103.060 -9.080  0.25 40.90 ? 217 HOH B O   4 
HETATM 11254 O  O   . HOH D 2 .   ? -15.963 102.444 -20.462 0.25 35.70 ? 218 HOH B O   4 
HETATM 11255 O  O   . HOH D 2 .   ? 8.301   111.795 5.616   0.25 36.68 ? 219 HOH B O   4 
HETATM 11256 O  O   . HOH D 2 .   ? -8.984  121.265 -15.015 0.25 16.16 ? 220 HOH B O   4 
HETATM 11257 O  O   . HOH D 2 .   ? -8.416  95.208  -16.475 0.25 30.31 ? 221 HOH B O   4 
HETATM 11258 O  O   . HOH D 2 .   ? 5.198   124.313 1.823   0.25 20.77 ? 222 HOH B O   4 
HETATM 11259 O  O   . HOH D 2 .   ? -2.021  120.106 -0.579  0.25 33.38 ? 223 HOH B O   4 
HETATM 11260 O  O   . HOH D 2 .   ? 6.193   115.647 -24.773 0.25 25.35 ? 224 HOH B O   4 
HETATM 11261 O  O   . HOH D 2 .   ? 4.852   115.050 -26.903 0.25 26.54 ? 225 HOH B O   4 
HETATM 11262 O  O   . HOH D 2 .   ? -10.325 94.389  -13.770 0.25 29.00 ? 226 HOH B O   4 
HETATM 11263 O  O   . HOH D 2 .   ? -1.311  127.256 -10.587 0.25 25.79 ? 227 HOH B O   4 
HETATM 11264 O  O   . HOH D 2 .   ? 3.592   108.977 5.792   0.25 26.28 ? 228 HOH B O   4 
HETATM 11265 O  O   . HOH D 2 .   ? -15.722 116.841 -18.182 0.25 34.34 ? 229 HOH B O   4 
HETATM 11266 O  O   . HOH D 2 .   ? 8.319   118.297 4.467   0.25 25.02 ? 230 HOH B O   4 
HETATM 11267 O  O   . HOH D 2 .   ? 8.117   121.581 -23.516 0.25 37.58 ? 231 HOH B O   4 
HETATM 11268 O  O   . HOH D 2 .   ? -5.965  122.547 -0.803  0.25 34.85 ? 232 HOH B O   4 
HETATM 11269 O  O   . HOH D 2 .   ? -12.960 112.723 -2.586  0.25 24.81 ? 233 HOH B O   4 
HETATM 11270 O  O   . HOH D 2 .   ? 11.485  121.260 -13.044 0.25 33.71 ? 234 HOH B O   4 
HETATM 11271 O  O   . HOH D 2 .   ? 9.255   96.789  -12.968 0.25 27.57 ? 235 HOH B O   4 
HETATM 11272 O  O   . HOH D 2 .   ? 1.722   111.756 5.833   0.25 37.10 ? 236 HOH B O   4 
HETATM 11273 O  O   . HOH D 2 .   ? -16.474 120.000 -7.035  0.25 33.46 ? 237 HOH B O   4 
HETATM 11274 O  O   . HOH D 2 .   ? 5.590   129.336 -17.807 0.25 44.98 ? 238 HOH B O   4 
HETATM 11275 O  O   . HOH D 2 .   ? -4.795  112.789 -24.530 0.25 29.46 ? 239 HOH B O   4 
HETATM 11276 O  O   . HOH D 2 .   ? 0.594   123.816 -23.484 0.25 35.48 ? 240 HOH B O   4 
HETATM 11277 O  O   . HOH D 2 .   ? -5.808  124.273 -16.834 0.25 33.08 ? 241 HOH B O   4 
HETATM 11278 O  O   . HOH D 2 .   ? 5.467   129.710 -9.348  0.25 37.26 ? 242 HOH B O   4 
HETATM 11279 O  O   . HOH D 2 .   ? -5.112  118.736 -1.733  0.25 29.56 ? 243 HOH B O   4 
HETATM 11280 O  O   . HOH D 2 .   ? -11.503 127.211 -10.376 0.25 55.74 ? 244 HOH B O   4 
HETATM 11281 O  O   . HOH D 2 .   ? 15.520  123.738 -17.627 0.25 32.98 ? 245 HOH B O   4 
HETATM 11282 O  O   . HOH D 2 .   ? -14.414 106.627 -18.851 0.25 44.70 ? 246 HOH B O   4 
HETATM 11283 O  O   . HOH D 2 .   ?