data_2Q5H
# 
_entry.id   2Q5H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Q5H         
RCSB  RCSB043173   
WWPDB D_1000043173 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2Q5I 
_pdbx_database_related.details        'Crystal structure of apo S581L Glycyl-tRNA synthetase mutant' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Q5H 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cader, M.Z.'                               1 
'Ren, J.'                                   2 
'James, P.A.'                               3 
'Bird, L.E.'                                4 
'Talbot, K.'                                5 
'Stammers, D.K.'                            6 
'Oxford Protein Production Facility (OPPF)' 7 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of human wildtype and S581L-mutant glycyl-tRNA synthetase, an enzyme underlying distal spinal muscular atrophy.' 
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            581 
_citation.page_first                2959 
_citation.page_last                 2964 
_citation.year                      2007 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17544401 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2007.05.046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cader, M.Z.'    1 
primary 'Ren, J.'        2 
primary 'James, P.A.'    3 
primary 'Bird, L.E.'     4 
primary 'Talbot, K.'     5 
primary 'Stammers, D.K.' 6 
# 
_cell.entry_id           2Q5H 
_cell.length_a           92.530 
_cell.length_b           92.530 
_cell.length_c           246.860 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2Q5H 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Glycyl-tRNA synthetase' 78462.555 1  6.1.1.14 ? 'Residues 55-739' ? 
2 water   nat water                    18.015    10 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glycine-tRNA ligase, GlyRS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   ALA n 
1 5   GLY n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  PRO n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  ALA n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  GLN n 
1 21  GLY n 
1 22  ASP n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  GLU n 
1 30  ASP n 
1 31  LYS n 
1 32  ALA n 
1 33  PRO n 
1 34  GLN n 
1 35  VAL n 
1 36  ASP n 
1 37  VAL n 
1 38  ASP n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  ALA n 
1 47  ARG n 
1 48  LYS n 
1 49  ARG n 
1 50  VAL n 
1 51  LEU n 
1 52  GLU n 
1 53  ALA n 
1 54  LYS n 
1 55  GLU n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  PRO n 
1 61  LYS n 
1 62  ASP n 
1 63  ASP n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  MET n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LYS n 
1 76  ARG n 
1 77  ARG n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  GLN n 
1 83  ALA n 
1 84  PHE n 
1 85  ALA n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLY n 
1 90  VAL n 
1 91  SER n 
1 92  GLY n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  PHE n 
1 97  GLY n 
1 98  PRO n 
1 99  VAL n 
1 100 GLY n 
1 101 CYS n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 ASN n 
1 106 ASN n 
1 107 ILE n 
1 108 ILE n 
1 109 GLN n 
1 110 THR n 
1 111 TRP n 
1 112 ARG n 
1 113 GLN n 
1 114 HIS n 
1 115 PHE n 
1 116 ILE n 
1 117 GLN n 
1 118 GLU n 
1 119 GLU n 
1 120 GLN n 
1 121 ILE n 
1 122 LEU n 
1 123 GLU n 
1 124 ILE n 
1 125 ASP n 
1 126 CYS n 
1 127 THR n 
1 128 MET n 
1 129 LEU n 
1 130 THR n 
1 131 PRO n 
1 132 GLU n 
1 133 PRO n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 THR n 
1 138 SER n 
1 139 GLY n 
1 140 HIS n 
1 141 VAL n 
1 142 ASP n 
1 143 LYS n 
1 144 PHE n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 MET n 
1 149 VAL n 
1 150 LYS n 
1 151 ASP n 
1 152 VAL n 
1 153 LYS n 
1 154 ASN n 
1 155 GLY n 
1 156 GLU n 
1 157 CYS n 
1 158 PHE n 
1 159 ARG n 
1 160 ALA n 
1 161 ASP n 
1 162 HIS n 
1 163 LEU n 
1 164 LEU n 
1 165 LYS n 
1 166 ALA n 
1 167 HIS n 
1 168 LEU n 
1 169 GLN n 
1 170 LYS n 
1 171 LEU n 
1 172 MET n 
1 173 SER n 
1 174 ASP n 
1 175 LYS n 
1 176 LYS n 
1 177 CYS n 
1 178 SER n 
1 179 VAL n 
1 180 GLU n 
1 181 LYS n 
1 182 LYS n 
1 183 SER n 
1 184 GLU n 
1 185 MET n 
1 186 GLU n 
1 187 SER n 
1 188 VAL n 
1 189 LEU n 
1 190 ALA n 
1 191 GLN n 
1 192 LEU n 
1 193 ASP n 
1 194 ASN n 
1 195 TYR n 
1 196 GLY n 
1 197 GLN n 
1 198 GLN n 
1 199 GLU n 
1 200 LEU n 
1 201 ALA n 
1 202 ASP n 
1 203 LEU n 
1 204 PHE n 
1 205 VAL n 
1 206 ASN n 
1 207 TYR n 
1 208 ASN n 
1 209 VAL n 
1 210 LYS n 
1 211 SER n 
1 212 PRO n 
1 213 ILE n 
1 214 THR n 
1 215 GLY n 
1 216 ASN n 
1 217 ASP n 
1 218 LEU n 
1 219 SER n 
1 220 PRO n 
1 221 PRO n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 LEU n 
1 227 MET n 
1 228 PHE n 
1 229 LYS n 
1 230 THR n 
1 231 PHE n 
1 232 ILE n 
1 233 GLY n 
1 234 PRO n 
1 235 GLY n 
1 236 GLY n 
1 237 ASN n 
1 238 MET n 
1 239 PRO n 
1 240 GLY n 
1 241 TYR n 
1 242 LEU n 
1 243 ARG n 
1 244 PRO n 
1 245 GLU n 
1 246 THR n 
1 247 ALA n 
1 248 GLN n 
1 249 GLY n 
1 250 ILE n 
1 251 PHE n 
1 252 LEU n 
1 253 ASN n 
1 254 PHE n 
1 255 LYS n 
1 256 ARG n 
1 257 LEU n 
1 258 LEU n 
1 259 GLU n 
1 260 PHE n 
1 261 ASN n 
1 262 GLN n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 PRO n 
1 267 PHE n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 GLN n 
1 272 ILE n 
1 273 GLY n 
1 274 ASN n 
1 275 SER n 
1 276 PHE n 
1 277 ARG n 
1 278 ASN n 
1 279 GLU n 
1 280 ILE n 
1 281 SER n 
1 282 PRO n 
1 283 ARG n 
1 284 SER n 
1 285 GLY n 
1 286 LEU n 
1 287 ILE n 
1 288 ARG n 
1 289 VAL n 
1 290 ARG n 
1 291 GLU n 
1 292 PHE n 
1 293 THR n 
1 294 MET n 
1 295 ALA n 
1 296 GLU n 
1 297 ILE n 
1 298 GLU n 
1 299 HIS n 
1 300 PHE n 
1 301 VAL n 
1 302 ASP n 
1 303 PRO n 
1 304 SER n 
1 305 GLU n 
1 306 LYS n 
1 307 ASP n 
1 308 HIS n 
1 309 PRO n 
1 310 LYS n 
1 311 PHE n 
1 312 GLN n 
1 313 ASN n 
1 314 VAL n 
1 315 ALA n 
1 316 ASP n 
1 317 LEU n 
1 318 HIS n 
1 319 LEU n 
1 320 TYR n 
1 321 LEU n 
1 322 TYR n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ALA n 
1 327 GLN n 
1 328 VAL n 
1 329 SER n 
1 330 GLY n 
1 331 GLN n 
1 332 SER n 
1 333 ALA n 
1 334 ARG n 
1 335 LYS n 
1 336 MET n 
1 337 ARG n 
1 338 LEU n 
1 339 GLY n 
1 340 ASP n 
1 341 ALA n 
1 342 VAL n 
1 343 GLU n 
1 344 GLN n 
1 345 GLY n 
1 346 VAL n 
1 347 ILE n 
1 348 ASN n 
1 349 ASN n 
1 350 THR n 
1 351 VAL n 
1 352 LEU n 
1 353 GLY n 
1 354 TYR n 
1 355 PHE n 
1 356 ILE n 
1 357 GLY n 
1 358 ARG n 
1 359 ILE n 
1 360 TYR n 
1 361 LEU n 
1 362 TYR n 
1 363 LEU n 
1 364 THR n 
1 365 LYS n 
1 366 VAL n 
1 367 GLY n 
1 368 ILE n 
1 369 SER n 
1 370 PRO n 
1 371 ASP n 
1 372 LYS n 
1 373 LEU n 
1 374 ARG n 
1 375 PHE n 
1 376 ARG n 
1 377 GLN n 
1 378 HIS n 
1 379 MET n 
1 380 GLU n 
1 381 ASN n 
1 382 GLU n 
1 383 MET n 
1 384 ALA n 
1 385 HIS n 
1 386 TYR n 
1 387 ALA n 
1 388 CYS n 
1 389 ASP n 
1 390 CYS n 
1 391 TRP n 
1 392 ASP n 
1 393 ALA n 
1 394 GLU n 
1 395 SER n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 TYR n 
1 400 GLY n 
1 401 TRP n 
1 402 ILE n 
1 403 GLU n 
1 404 ILE n 
1 405 VAL n 
1 406 GLY n 
1 407 CYS n 
1 408 ALA n 
1 409 ASP n 
1 410 ARG n 
1 411 SER n 
1 412 CYS n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 SER n 
1 417 CYS n 
1 418 HIS n 
1 419 ALA n 
1 420 ARG n 
1 421 ALA n 
1 422 THR n 
1 423 LYS n 
1 424 VAL n 
1 425 PRO n 
1 426 LEU n 
1 427 VAL n 
1 428 ALA n 
1 429 GLU n 
1 430 LYS n 
1 431 PRO n 
1 432 LEU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 LYS n 
1 437 THR n 
1 438 VAL n 
1 439 ASN n 
1 440 VAL n 
1 441 VAL n 
1 442 GLN n 
1 443 PHE n 
1 444 GLU n 
1 445 PRO n 
1 446 SER n 
1 447 LYS n 
1 448 GLY n 
1 449 ALA n 
1 450 ILE n 
1 451 GLY n 
1 452 LYS n 
1 453 ALA n 
1 454 TYR n 
1 455 LYS n 
1 456 LYS n 
1 457 ASP n 
1 458 ALA n 
1 459 LYS n 
1 460 LEU n 
1 461 VAL n 
1 462 MET n 
1 463 GLU n 
1 464 TYR n 
1 465 LEU n 
1 466 ALA n 
1 467 ILE n 
1 468 CYS n 
1 469 ASP n 
1 470 GLU n 
1 471 CYS n 
1 472 TYR n 
1 473 ILE n 
1 474 THR n 
1 475 GLU n 
1 476 MET n 
1 477 GLU n 
1 478 MET n 
1 479 LEU n 
1 480 LEU n 
1 481 ASN n 
1 482 GLU n 
1 483 LYS n 
1 484 GLY n 
1 485 GLU n 
1 486 PHE n 
1 487 THR n 
1 488 ILE n 
1 489 GLU n 
1 490 THR n 
1 491 GLU n 
1 492 GLY n 
1 493 LYS n 
1 494 THR n 
1 495 PHE n 
1 496 GLN n 
1 497 LEU n 
1 498 THR n 
1 499 LYS n 
1 500 ASP n 
1 501 MET n 
1 502 ILE n 
1 503 ASN n 
1 504 VAL n 
1 505 LYS n 
1 506 ARG n 
1 507 PHE n 
1 508 GLN n 
1 509 LYS n 
1 510 THR n 
1 511 LEU n 
1 512 TYR n 
1 513 VAL n 
1 514 GLU n 
1 515 GLU n 
1 516 VAL n 
1 517 VAL n 
1 518 PRO n 
1 519 ASN n 
1 520 VAL n 
1 521 ILE n 
1 522 GLU n 
1 523 PRO n 
1 524 SER n 
1 525 PHE n 
1 526 GLY n 
1 527 LEU n 
1 528 GLY n 
1 529 ARG n 
1 530 ILE n 
1 531 MET n 
1 532 TYR n 
1 533 THR n 
1 534 VAL n 
1 535 PHE n 
1 536 GLU n 
1 537 HIS n 
1 538 THR n 
1 539 PHE n 
1 540 HIS n 
1 541 VAL n 
1 542 ARG n 
1 543 GLU n 
1 544 GLY n 
1 545 ASP n 
1 546 GLU n 
1 547 GLN n 
1 548 ARG n 
1 549 THR n 
1 550 PHE n 
1 551 PHE n 
1 552 SER n 
1 553 PHE n 
1 554 PRO n 
1 555 ALA n 
1 556 VAL n 
1 557 VAL n 
1 558 ALA n 
1 559 PRO n 
1 560 PHE n 
1 561 LYS n 
1 562 CYS n 
1 563 SER n 
1 564 VAL n 
1 565 LEU n 
1 566 PRO n 
1 567 LEU n 
1 568 SER n 
1 569 GLN n 
1 570 ASN n 
1 571 GLN n 
1 572 GLU n 
1 573 PHE n 
1 574 MET n 
1 575 PRO n 
1 576 PHE n 
1 577 VAL n 
1 578 LYS n 
1 579 GLU n 
1 580 LEU n 
1 581 SER n 
1 582 GLU n 
1 583 ALA n 
1 584 LEU n 
1 585 THR n 
1 586 ARG n 
1 587 HIS n 
1 588 GLY n 
1 589 VAL n 
1 590 SER n 
1 591 HIS n 
1 592 LYS n 
1 593 VAL n 
1 594 ASP n 
1 595 ASP n 
1 596 SER n 
1 597 SER n 
1 598 GLY n 
1 599 SER n 
1 600 ILE n 
1 601 GLY n 
1 602 ARG n 
1 603 ARG n 
1 604 TYR n 
1 605 ALA n 
1 606 ARG n 
1 607 THR n 
1 608 ASP n 
1 609 GLU n 
1 610 ILE n 
1 611 GLY n 
1 612 VAL n 
1 613 ALA n 
1 614 PHE n 
1 615 GLY n 
1 616 VAL n 
1 617 THR n 
1 618 ILE n 
1 619 ASP n 
1 620 PHE n 
1 621 ASP n 
1 622 THR n 
1 623 VAL n 
1 624 ASN n 
1 625 LYS n 
1 626 THR n 
1 627 PRO n 
1 628 HIS n 
1 629 THR n 
1 630 ALA n 
1 631 THR n 
1 632 LEU n 
1 633 ARG n 
1 634 ASP n 
1 635 ARG n 
1 636 ASP n 
1 637 SER n 
1 638 MET n 
1 639 ARG n 
1 640 GLN n 
1 641 ILE n 
1 642 ARG n 
1 643 ALA n 
1 644 GLU n 
1 645 ILE n 
1 646 SER n 
1 647 GLU n 
1 648 LEU n 
1 649 PRO n 
1 650 SER n 
1 651 ILE n 
1 652 VAL n 
1 653 GLN n 
1 654 ASP n 
1 655 LEU n 
1 656 ALA n 
1 657 ASN n 
1 658 GLY n 
1 659 ASN n 
1 660 ILE n 
1 661 THR n 
1 662 TRP n 
1 663 ALA n 
1 664 ASP n 
1 665 VAL n 
1 666 GLU n 
1 667 ALA n 
1 668 ARG n 
1 669 TYR n 
1 670 PRO n 
1 671 LEU n 
1 672 PHE n 
1 673 GLU n 
1 674 GLY n 
1 675 GLN n 
1 676 GLU n 
1 677 THR n 
1 678 GLY n 
1 679 LYS n 
1 680 LYS n 
1 681 GLU n 
1 682 THR n 
1 683 ILE n 
1 684 GLU n 
1 685 GLU n 
1 686 HIS n 
1 687 HIS n 
1 688 HIS n 
1 689 HIS n 
1 690 HIS n 
1 691 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GARS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYG_HUMAN 
_struct_ref.pdbx_db_accession          P41250 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
;
_struct_ref.pdbx_align_begin           55 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2Q5H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 685 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41250 
_struct_ref_seq.db_align_beg                  55 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  739 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       685 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Q5H HIS A 686 ? UNP P41250 ? ? 'EXPRESSION TAG' 686 1 
1 2Q5H HIS A 687 ? UNP P41250 ? ? 'EXPRESSION TAG' 687 2 
1 2Q5H HIS A 688 ? UNP P41250 ? ? 'EXPRESSION TAG' 688 3 
1 2Q5H HIS A 689 ? UNP P41250 ? ? 'EXPRESSION TAG' 689 4 
1 2Q5H HIS A 690 ? UNP P41250 ? ? 'EXPRESSION TAG' 690 5 
1 2Q5H HIS A 691 ? UNP P41250 ? ? 'EXPRESSION TAG' 691 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Q5H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.37 
_exptl_crystal.density_percent_sol   63.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG 3350, 0.2M Sodium bromide, 0.1M Bis-Tris propane, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-07-23 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.93300 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.93300 
# 
_reflns.entry_id                     2Q5H 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            3.0 
_reflns.d_resolution_low             30.0 
_reflns.number_all                   ? 
_reflns.number_obs                   21172 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.186 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   90.0 
_reflns_shell.Rmerge_I_obs           0.986 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        8.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1941 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2Q5H 
_refine.ls_number_reflns_obs                     20082 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.27 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    94.60 
_refine.ls_R_factor_obs                          0.20749 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20526 
_refine.ls_R_factor_R_free                       0.25013 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1021 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.922 
_refine.correlation_coeff_Fo_to_Fc_free          0.904 
_refine.B_iso_mean                               31.316 
_refine.aniso_B[1][1]                            0.30 
_refine.aniso_B[2][2]                            0.30 
_refine.aniso_B[3][3]                            -0.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. O program has also been used in structure solution. CNS program has also been used in the refinement.
;
_refine.pdbx_starting_model                      'PDB entry 1ATI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.734 
_refine.pdbx_overall_ESU_R_Free                  0.356 
_refine.overall_SU_ML                            0.263 
_refine.overall_SU_B                             32.662 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4213 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               4223 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        29.27 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 4310 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2978 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.004  1.952  ? 5823 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.773  3.000  ? 7224 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.722  5.000  ? 525  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.579 23.897 ? 213  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.347 15.000 ? 741  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.713 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.058  0.200  ? 628  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 4808 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 910  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.216  0.200  ? 942  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.181  0.200  ? 2986 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.181  0.200  ? 2127 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.082  0.200  ? 2372 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.099  0.200  ? 88   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.223  0.200  ? 15   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.185  0.200  ? 49   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.084  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.877  4.000  ? 3413 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.555  4.000  ? 1064 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.966  6.000  ? 4247 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.095  6.000  ? 1958 'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.564  12.000 ? 1576 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.000 
_refine_ls_shell.d_res_low                        3.077 
_refine_ls_shell.number_reflns_R_work             1182 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               76.87 
_refine_ls_shell.R_factor_R_free                  0.446 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             44 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2Q5H 
_struct.title                     'Crystal structure of apo-wildtype Glycyl-tRNA synthetase' 
_struct.pdbx_descriptor           'Glycyl-tRNA synthetase (E.C.6.1.1.14)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Q5H 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
;Aminoacyl-tRNA synthetase, ATP-binding, Structural Genomics, Glycyl-tRNA Synthetase, Oxford Protein Production Facility, OPPF, LIGASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'The biological assembly is a homodimer generated from the monomer in the asymmetric unit by the symmetry operation Y,X,-Z' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? ARG A 77  ? ASP A 66  ARG A 77  1 ? 12 
HELX_P HELX_P2  2  PHE A 84  ? GLY A 88  ? PHE A 84  GLY A 88  5 ? 5  
HELX_P HELX_P3  3  GLY A 97  ? PHE A 115 ? GLY A 97  PHE A 115 1 ? 19 
HELX_P HELX_P4  4  PHE A 115 ? GLN A 120 ? PHE A 115 GLN A 120 1 ? 6  
HELX_P HELX_P5  5  GLU A 132 ? SER A 138 ? GLU A 132 SER A 138 1 ? 7  
HELX_P HELX_P6  6  GLY A 139 ? PHE A 144 ? GLY A 139 PHE A 144 1 ? 6  
HELX_P HELX_P7  7  ALA A 160 ? LEU A 171 ? ALA A 160 LEU A 171 1 ? 12 
HELX_P HELX_P8  8  SER A 178 ? GLN A 191 ? SER A 178 GLN A 191 1 ? 14 
HELX_P HELX_P9  9  GLY A 196 ? TYR A 207 ? GLY A 196 TYR A 207 1 ? 12 
HELX_P HELX_P10 10 THR A 246 ? ASN A 253 ? THR A 246 ASN A 253 1 ? 8  
HELX_P HELX_P11 11 ASN A 253 ? ASN A 261 ? ASN A 253 ASN A 261 1 ? 9  
HELX_P HELX_P12 12 SER A 284 ? ARG A 288 ? SER A 284 ARG A 288 5 ? 5  
HELX_P HELX_P13 13 LYS A 310 ? VAL A 314 ? LYS A 310 VAL A 314 5 ? 5  
HELX_P HELX_P14 14 SER A 323 ? GLY A 330 ? SER A 323 GLY A 330 1 ? 8  
HELX_P HELX_P15 15 LEU A 338 ? GLN A 344 ? LEU A 338 GLN A 344 1 ? 7  
HELX_P HELX_P16 16 ASN A 349 ? VAL A 366 ? ASN A 349 VAL A 366 1 ? 18 
HELX_P HELX_P17 17 SER A 369 ? ASP A 371 ? SER A 369 ASP A 371 5 ? 3  
HELX_P HELX_P18 18 MET A 379 ? MET A 383 ? MET A 379 MET A 383 5 ? 5  
HELX_P HELX_P19 19 TYR A 413 ? LYS A 423 ? TYR A 413 LYS A 423 1 ? 11 
HELX_P HELX_P20 20 LEU A 527 ? THR A 538 ? LEU A 527 THR A 538 1 ? 12 
HELX_P HELX_P21 21 PHE A 573 ? HIS A 587 ? PHE A 573 HIS A 587 1 ? 15 
HELX_P HELX_P22 22 SER A 599 ? ILE A 610 ? SER A 599 ILE A 610 1 ? 12 
HELX_P HELX_P23 23 ASP A 619 ? LYS A 625 ? ASP A 619 LYS A 625 1 ? 7  
HELX_P HELX_P24 24 GLU A 647 ? ASN A 657 ? GLU A 647 ASN A 657 1 ? 11 
HELX_P HELX_P25 25 THR A 661 ? TYR A 669 ? THR A 661 TYR A 669 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 265 A . ? LEU 265 A PRO 266 A ? PRO 266 A 1 8.34 
2 THR 626 A . ? THR 626 A PRO 627 A ? PRO 627 A 1 9.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 80  ? GLN A 82  ? TYR A 80  GLN A 82  
A 2 TYR A 94  ? PHE A 96  ? TYR A 94  PHE A 96  
B 1 LEU A 122 ? GLU A 123 ? LEU A 122 GLU A 123 
B 2 PHE A 267 ? PHE A 276 ? PHE A 267 PHE A 276 
B 3 GLU A 291 ? VAL A 301 ? GLU A 291 VAL A 301 
B 4 ASN A 519 ? GLY A 526 ? ASN A 519 GLY A 526 
B 5 GLY A 400 ? ARG A 410 ? GLY A 400 ARG A 410 
B 6 ASP A 389 ? THR A 397 ? ASP A 389 THR A 397 
B 7 LEU A 373 ? GLN A 377 ? LEU A 373 GLN A 377 
B 8 HIS A 318 ? TYR A 322 ? HIS A 318 TYR A 322 
B 9 ARG A 334 ? ARG A 337 ? ARG A 334 ARG A 337 
C 1 LEU A 129 ? PRO A 131 ? LEU A 129 PRO A 131 
C 2 MET A 238 ? LEU A 242 ? MET A 238 LEU A 242 
C 3 LYS A 229 ? ILE A 232 ? LYS A 229 ILE A 232 
D 1 CYS A 157 ? ARG A 159 ? CYS A 157 ARG A 159 
D 2 ALA A 145 ? LYS A 150 ? ALA A 145 LYS A 150 
D 3 VAL A 222 ? ASN A 225 ? VAL A 222 ASN A 225 
E 1 PHE A 539 ? VAL A 541 ? PHE A 539 VAL A 541 
E 2 THR A 549 ? PHE A 551 ? THR A 549 PHE A 551 
F 1 HIS A 591 ? VAL A 593 ? HIS A 591 VAL A 593 
F 2 CYS A 562 ? PRO A 566 ? CYS A 562 PRO A 566 
F 3 PHE A 614 ? ILE A 618 ? PHE A 614 ILE A 618 
F 4 THR A 629 ? ASP A 634 ? THR A 629 ASP A 634 
F 5 GLN A 640 ? GLU A 644 ? GLN A 640 GLU A 644 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 81  ? N ASP A 81  O ASP A 95  ? O ASP A 95  
B 1 2 N LEU A 122 ? N LEU A 122 O ALA A 268 ? O ALA A 268 
B 2 3 N GLY A 273 ? N GLY A 273 O MET A 294 ? O MET A 294 
B 3 4 N ALA A 295 ? N ALA A 295 O PHE A 525 ? O PHE A 525 
B 4 5 O SER A 524 ? O SER A 524 N GLY A 406 ? N GLY A 406 
B 5 6 O VAL A 405 ? O VAL A 405 N ALA A 393 ? N ALA A 393 
B 6 7 O GLU A 394 ? O GLU A 394 N ARG A 374 ? N ARG A 374 
B 7 8 O PHE A 375 ? O PHE A 375 N TYR A 322 ? N TYR A 322 
B 8 9 N LEU A 321 ? N LEU A 321 O ARG A 334 ? O ARG A 334 
C 1 2 N THR A 130 ? N THR A 130 O TYR A 241 ? O TYR A 241 
C 2 3 O MET A 238 ? O MET A 238 N ILE A 232 ? N ILE A 232 
D 1 2 O PHE A 158 ? O PHE A 158 N VAL A 149 ? N VAL A 149 
D 2 3 N MET A 148 ? N MET A 148 O VAL A 222 ? O VAL A 222 
E 1 2 N HIS A 540 ? N HIS A 540 O PHE A 550 ? O PHE A 550 
F 1 2 O LYS A 592 ? O LYS A 592 N CYS A 562 ? N CYS A 562 
F 2 3 N LEU A 565 ? N LEU A 565 O ILE A 618 ? O ILE A 618 
F 3 4 N GLY A 615 ? N GLY A 615 O ARG A 633 ? O ARG A 633 
F 4 5 N ALA A 630 ? N ALA A 630 O ALA A 643 ? O ALA A 643 
# 
_database_PDB_matrix.entry_id          2Q5H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Q5H 
_atom_sites.fract_transf_matrix[1][1]   0.010807 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010807 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004051 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 64  ? 65.003  18.697  -120.343 1.00 31.28  ? 64  ILE A N   1 
ATOM   2    C CA  . ILE A 1 64  ? 65.008  19.603  -119.154 1.00 37.01  ? 64  ILE A CA  1 
ATOM   3    C C   . ILE A 1 64  ? 65.463  18.853  -117.887 1.00 40.89  ? 64  ILE A C   1 
ATOM   4    O O   . ILE A 1 64  ? 65.040  19.207  -116.779 1.00 47.49  ? 64  ILE A O   1 
ATOM   5    C CB  . ILE A 1 64  ? 63.586  20.228  -118.887 1.00 38.10  ? 64  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 64  ? 62.975  20.819  -120.175 1.00 46.81  ? 64  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 64  ? 63.649  21.292  -117.770 1.00 31.76  ? 64  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 64  ? 61.703  21.706  -119.960 1.00 35.91  ? 64  ILE A CD1 1 
ATOM   9    N N   . VAL A 1 65  ? 66.316  17.835  -118.035 1.00 37.06  ? 65  VAL A N   1 
ATOM   10   C CA  . VAL A 1 65  ? 66.710  16.988  -116.890 1.00 35.66  ? 65  VAL A CA  1 
ATOM   11   C C   . VAL A 1 65  ? 67.468  17.772  -115.814 1.00 36.63  ? 65  VAL A C   1 
ATOM   12   O O   . VAL A 1 65  ? 68.193  18.716  -116.129 1.00 38.99  ? 65  VAL A O   1 
ATOM   13   C CB  . VAL A 1 65  ? 67.587  15.787  -117.322 1.00 35.67  ? 65  VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 65  ? 69.002  16.239  -117.657 1.00 34.82  ? 65  VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 65  ? 67.627  14.740  -116.225 1.00 34.74  ? 65  VAL A CG2 1 
ATOM   16   N N   . ASP A 1 66  ? 67.292  17.379  -114.551 1.00 35.09  ? 66  ASP A N   1 
ATOM   17   C CA  . ASP A 1 66  ? 67.988  18.020  -113.435 1.00 33.08  ? 66  ASP A CA  1 
ATOM   18   C C   . ASP A 1 66  ? 69.403  17.455  -113.299 1.00 35.10  ? 66  ASP A C   1 
ATOM   19   O O   . ASP A 1 66  ? 69.623  16.447  -112.621 1.00 40.44  ? 66  ASP A O   1 
ATOM   20   C CB  . ASP A 1 66  ? 67.212  17.831  -112.135 1.00 31.79  ? 66  ASP A CB  1 
ATOM   21   C CG  . ASP A 1 66  ? 67.852  18.558  -110.964 1.00 36.73  ? 66  ASP A CG  1 
ATOM   22   O OD1 . ASP A 1 66  ? 69.033  18.968  -111.083 1.00 38.82  ? 66  ASP A OD1 1 
ATOM   23   O OD2 . ASP A 1 66  ? 67.173  18.719  -109.923 1.00 31.87  ? 66  ASP A OD2 1 
ATOM   24   N N   . ARG A 1 67  ? 70.359  18.129  -113.931 1.00 32.93  ? 67  ARG A N   1 
ATOM   25   C CA  . ARG A 1 67  ? 71.723  17.616  -114.058 1.00 31.16  ? 67  ARG A CA  1 
ATOM   26   C C   . ARG A 1 67  ? 72.413  17.451  -112.714 1.00 31.68  ? 67  ARG A C   1 
ATOM   27   O O   . ARG A 1 67  ? 73.200  16.529  -112.532 1.00 27.27  ? 67  ARG A O   1 
ATOM   28   C CB  . ARG A 1 67  ? 72.553  18.550  -114.933 1.00 29.79  ? 67  ARG A CB  1 
ATOM   29   C CG  . ARG A 1 67  ? 73.898  17.983  -115.368 1.00 32.86  ? 67  ARG A CG  1 
ATOM   30   C CD  . ARG A 1 67  ? 74.872  19.091  -115.737 1.00 36.09  ? 67  ARG A CD  1 
ATOM   31   N NE  . ARG A 1 67  ? 74.462  19.815  -116.936 1.00 37.53  ? 67  ARG A NE  1 
ATOM   32   C CZ  . ARG A 1 67  ? 75.102  20.871  -117.429 1.00 39.50  ? 67  ARG A CZ  1 
ATOM   33   N NH1 . ARG A 1 67  ? 76.178  21.356  -116.821 1.00 44.10  ? 67  ARG A NH1 1 
ATOM   34   N NH2 . ARG A 1 67  ? 74.650  21.452  -118.534 1.00 43.84  ? 67  ARG A NH2 1 
ATOM   35   N N   . ALA A 1 68  ? 72.127  18.354  -111.779 1.00 36.05  ? 68  ALA A N   1 
ATOM   36   C CA  . ALA A 1 68  ? 72.722  18.289  -110.449 1.00 33.33  ? 68  ALA A CA  1 
ATOM   37   C C   . ALA A 1 68  ? 72.292  17.011  -109.747 1.00 34.93  ? 68  ALA A C   1 
ATOM   38   O O   . ALA A 1 68  ? 73.133  16.244  -109.266 1.00 34.65  ? 68  ALA A O   1 
ATOM   39   C CB  . ALA A 1 68  ? 72.311  19.479  -109.641 1.00 34.98  ? 68  ALA A CB  1 
ATOM   40   N N   . LYS A 1 69  ? 70.979  16.782  -109.716 1.00 35.79  ? 69  LYS A N   1 
ATOM   41   C CA  . LYS A 1 69  ? 70.401  15.606  -109.053 1.00 36.93  ? 69  LYS A CA  1 
ATOM   42   C C   . LYS A 1 69  ? 70.965  14.318  -109.632 1.00 36.34  ? 69  LYS A C   1 
ATOM   43   O O   . LYS A 1 69  ? 71.302  13.395  -108.890 1.00 36.75  ? 69  LYS A O   1 
ATOM   44   C CB  . LYS A 1 69  ? 68.872  15.600  -109.172 1.00 38.20  ? 69  LYS A CB  1 
ATOM   45   C CG  . LYS A 1 69  ? 68.153  14.840  -108.051 1.00 38.14  ? 69  LYS A CG  1 
ATOM   46   C CD  . LYS A 1 69  ? 66.635  15.097  -108.076 1.00 40.45  ? 69  LYS A CD  1 
ATOM   47   C CE  . LYS A 1 69  ? 65.983  14.991  -106.693 1.00 39.86  ? 69  LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 69  ? 65.904  13.593  -106.190 1.00 37.47  ? 69  LYS A NZ  1 
ATOM   49   N N   . MET A 1 70  ? 71.070  14.270  -110.958 1.00 34.50  ? 70  MET A N   1 
ATOM   50   C CA  . MET A 1 70  ? 71.665  13.128  -111.641 1.00 35.18  ? 70  MET A CA  1 
ATOM   51   C C   . MET A 1 70  ? 73.140  12.981  -111.264 1.00 33.92  ? 70  MET A C   1 
ATOM   52   O O   . MET A 1 70  ? 73.571  11.922  -110.795 1.00 32.50  ? 70  MET A O   1 
ATOM   53   C CB  . MET A 1 70  ? 71.525  13.285  -113.157 1.00 35.09  ? 70  MET A CB  1 
ATOM   54   C CG  . MET A 1 70  ? 71.962  12.061  -113.950 1.00 34.72  ? 70  MET A CG  1 
ATOM   55   S SD  . MET A 1 70  ? 72.135  12.369  -115.719 1.00 35.40  ? 70  MET A SD  1 
ATOM   56   C CE  . MET A 1 70  ? 73.462  13.570  -115.711 1.00 34.35  ? 70  MET A CE  1 
ATOM   57   N N   . GLU A 1 71  ? 73.905  14.051  -111.466 1.00 32.80  ? 71  GLU A N   1 
ATOM   58   C CA  . GLU A 1 71  ? 75.338  14.028  -111.192 1.00 34.03  ? 71  GLU A CA  1 
ATOM   59   C C   . GLU A 1 71  ? 75.577  13.556  -109.775 1.00 33.30  ? 71  GLU A C   1 
ATOM   60   O O   . GLU A 1 71  ? 76.501  12.788  -109.523 1.00 32.44  ? 71  GLU A O   1 
ATOM   61   C CB  . GLU A 1 71  ? 75.978  15.405  -111.408 1.00 33.94  ? 71  GLU A CB  1 
ATOM   62   C CG  . GLU A 1 71  ? 76.263  15.732  -112.876 1.00 37.28  ? 71  GLU A CG  1 
ATOM   63   C CD  . GLU A 1 71  ? 76.639  17.193  -113.122 1.00 37.93  ? 71  GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 71  ? 77.193  17.483  -114.205 1.00 38.86  ? 71  GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 71  ? 76.383  18.052  -112.250 1.00 44.56  ? 71  GLU A OE2 1 
ATOM   66   N N   . ASP A 1 72  ? 74.731  13.995  -108.850 1.00 37.29  ? 72  ASP A N   1 
ATOM   67   C CA  . ASP A 1 72  ? 74.851  13.537  -107.474 1.00 37.30  ? 72  ASP A CA  1 
ATOM   68   C C   . ASP A 1 72  ? 74.712  12.014  -107.417 1.00 35.01  ? 72  ASP A C   1 
ATOM   69   O O   . ASP A 1 72  ? 75.624  11.334  -106.939 1.00 31.66  ? 72  ASP A O   1 
ATOM   70   C CB  . ASP A 1 72  ? 73.826  14.215  -106.560 1.00 38.13  ? 72  ASP A CB  1 
ATOM   71   C CG  . ASP A 1 72  ? 74.056  13.894  -105.088 1.00 41.16  ? 72  ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 72  ? 75.155  13.417  -104.728 1.00 44.75  ? 72  ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 72  ? 73.132  14.117  -104.283 1.00 55.21  ? 72  ASP A OD2 1 
ATOM   74   N N   . THR A 1 73  ? 73.595  11.489  -107.927 1.00 31.10  ? 73  THR A N   1 
ATOM   75   C CA  . THR A 1 73  ? 73.352  10.042  -107.927 1.00 32.97  ? 73  THR A CA  1 
ATOM   76   C C   . THR A 1 73  ? 74.517  9.300   -108.590 1.00 36.00  ? 73  THR A C   1 
ATOM   77   O O   . THR A 1 73  ? 75.022  8.301   -108.055 1.00 33.04  ? 73  THR A O   1 
ATOM   78   C CB  . THR A 1 73  ? 72.024  9.674   -108.635 1.00 27.78  ? 73  THR A CB  1 
ATOM   79   O OG1 . THR A 1 73  ? 70.924  10.185  -107.882 1.00 36.01  ? 73  THR A OG1 1 
ATOM   80   C CG2 . THR A 1 73  ? 71.853  8.169   -108.745 1.00 26.70  ? 73  THR A CG2 1 
ATOM   81   N N   . LEU A 1 74  ? 74.951  9.804   -109.743 1.00 35.34  ? 74  LEU A N   1 
ATOM   82   C CA  . LEU A 1 74  ? 76.046  9.182   -110.481 1.00 36.46  ? 74  LEU A CA  1 
ATOM   83   C C   . LEU A 1 74  ? 77.329  9.062   -109.646 1.00 37.84  ? 74  LEU A C   1 
ATOM   84   O O   . LEU A 1 74  ? 77.983  8.013   -109.652 1.00 32.90  ? 74  LEU A O   1 
ATOM   85   C CB  . LEU A 1 74  ? 76.314  9.948   -111.781 1.00 38.48  ? 74  LEU A CB  1 
ATOM   86   C CG  . LEU A 1 74  ? 75.409  9.581   -112.960 1.00 34.94  ? 74  LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 74  ? 75.610  10.537  -114.110 1.00 24.95  ? 74  LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 74  ? 75.694  8.158   -113.405 1.00 34.61  ? 74  LEU A CD2 1 
ATOM   89   N N   . LYS A 1 75  ? 77.670  10.130  -108.924 1.00 40.13  ? 75  LYS A N   1 
ATOM   90   C CA  . LYS A 1 75  ? 78.865  10.147  -108.073 1.00 38.26  ? 75  LYS A CA  1 
ATOM   91   C C   . LYS A 1 75  ? 78.656  9.320   -106.805 1.00 35.06  ? 75  LYS A C   1 
ATOM   92   O O   . LYS A 1 75  ? 79.563  8.599   -106.377 1.00 33.81  ? 75  LYS A O   1 
ATOM   93   C CB  . LYS A 1 75  ? 79.255  11.585  -107.700 1.00 40.33  ? 75  LYS A CB  1 
ATOM   94   C CG  . LYS A 1 75  ? 80.688  11.726  -107.168 1.00 42.02  ? 75  LYS A CG  1 
ATOM   95   C CD  . LYS A 1 75  ? 80.853  12.925  -106.221 1.00 45.03  ? 75  LYS A CD  1 
ATOM   96   C CE  . LYS A 1 75  ? 82.257  12.989  -105.579 1.00 51.63  ? 75  LYS A CE  1 
ATOM   97   N NZ  . LYS A 1 75  ? 82.509  11.953  -104.511 1.00 53.27  ? 75  LYS A NZ  1 
ATOM   98   N N   . ARG A 1 76  ? 77.465  9.422   -106.215 1.00 31.65  ? 76  ARG A N   1 
ATOM   99   C CA  . ARG A 1 76  ? 77.160  8.720   -104.968 1.00 32.25  ? 76  ARG A CA  1 
ATOM   100  C C   . ARG A 1 76  ? 77.288  7.217   -105.140 1.00 29.95  ? 76  ARG A C   1 
ATOM   101  O O   . ARG A 1 76  ? 77.847  6.559   -104.286 1.00 33.20  ? 76  ARG A O   1 
ATOM   102  C CB  . ARG A 1 76  ? 75.745  9.042   -104.474 1.00 33.46  ? 76  ARG A CB  1 
ATOM   103  C CG  . ARG A 1 76  ? 75.577  8.991   -102.945 1.00 35.30  ? 76  ARG A CG  1 
ATOM   104  C CD  . ARG A 1 76  ? 74.248  8.360   -102.468 1.00 36.77  ? 76  ARG A CD  1 
ATOM   105  N NE  . ARG A 1 76  ? 73.211  8.341   -103.501 1.00 39.05  ? 76  ARG A NE  1 
ATOM   106  C CZ  . ARG A 1 76  ? 72.524  9.401   -103.927 1.00 41.85  ? 76  ARG A CZ  1 
ATOM   107  N NH1 . ARG A 1 76  ? 72.735  10.612  -103.419 1.00 44.87  ? 76  ARG A NH1 1 
ATOM   108  N NH2 . ARG A 1 76  ? 71.617  9.247   -104.881 1.00 43.29  ? 76  ARG A NH2 1 
ATOM   109  N N   . ARG A 1 77  ? 76.773  6.679   -106.245 1.00 33.39  ? 77  ARG A N   1 
ATOM   110  C CA  . ARG A 1 77  ? 76.825  5.234   -106.509 1.00 33.35  ? 77  ARG A CA  1 
ATOM   111  C C   . ARG A 1 77  ? 78.066  4.787   -107.276 1.00 37.09  ? 77  ARG A C   1 
ATOM   112  O O   . ARG A 1 77  ? 78.231  3.598   -107.556 1.00 44.00  ? 77  ARG A O   1 
ATOM   113  C CB  . ARG A 1 77  ? 75.570  4.788   -107.258 1.00 28.80  ? 77  ARG A CB  1 
ATOM   114  C CG  . ARG A 1 77  ? 74.286  5.069   -106.503 1.00 29.46  ? 77  ARG A CG  1 
ATOM   115  C CD  . ARG A 1 77  ? 74.247  4.372   -105.152 1.00 28.63  ? 77  ARG A CD  1 
ATOM   116  N NE  . ARG A 1 77  ? 74.101  2.920   -105.278 1.00 31.25  ? 77  ARG A NE  1 
ATOM   117  C CZ  . ARG A 1 77  ? 72.941  2.259   -105.236 1.00 35.02  ? 77  ARG A CZ  1 
ATOM   118  N NH1 . ARG A 1 77  ? 71.792  2.903   -105.074 1.00 32.55  ? 77  ARG A NH1 1 
ATOM   119  N NH2 . ARG A 1 77  ? 72.924  0.935   -105.355 1.00 37.68  ? 77  ARG A NH2 1 
ATOM   120  N N   . PHE A 1 78  ? 78.933  5.739   -107.607 1.00 37.00  ? 78  PHE A N   1 
ATOM   121  C CA  . PHE A 1 78  ? 80.205  5.463   -108.276 1.00 36.58  ? 78  PHE A CA  1 
ATOM   122  C C   . PHE A 1 78  ? 80.025  4.796   -109.636 1.00 37.77  ? 78  PHE A C   1 
ATOM   123  O O   . PHE A 1 78  ? 80.644  3.773   -109.931 1.00 39.83  ? 78  PHE A O   1 
ATOM   124  C CB  . PHE A 1 78  ? 81.127  4.640   -107.368 1.00 34.10  ? 78  PHE A CB  1 
ATOM   125  C CG  . PHE A 1 78  ? 82.589  4.676   -107.759 1.00 34.45  ? 78  PHE A CG  1 
ATOM   126  C CD1 . PHE A 1 78  ? 83.469  3.744   -107.223 1.00 38.21  ? 78  PHE A CD1 1 
ATOM   127  C CD2 . PHE A 1 78  ? 83.090  5.619   -108.653 1.00 31.85  ? 78  PHE A CD2 1 
ATOM   128  C CE1 . PHE A 1 78  ? 84.821  3.751   -107.562 1.00 36.57  ? 78  PHE A CE1 1 
ATOM   129  C CE2 . PHE A 1 78  ? 84.440  5.623   -108.997 1.00 33.51  ? 78  PHE A CE2 1 
ATOM   130  C CZ  . PHE A 1 78  ? 85.304  4.690   -108.451 1.00 29.39  ? 78  PHE A CZ  1 
ATOM   131  N N   . PHE A 1 79  ? 79.141  5.371   -110.445 1.00 36.82  ? 79  PHE A N   1 
ATOM   132  C CA  . PHE A 1 79  ? 79.133  5.100   -111.867 1.00 36.71  ? 79  PHE A CA  1 
ATOM   133  C C   . PHE A 1 79  ? 80.463  5.612   -112.380 1.00 37.72  ? 79  PHE A C   1 
ATOM   134  O O   . PHE A 1 79  ? 81.213  4.875   -113.009 1.00 39.78  ? 79  PHE A O   1 
ATOM   135  C CB  . PHE A 1 79  ? 77.982  5.827   -112.567 1.00 38.34  ? 79  PHE A CB  1 
ATOM   136  C CG  . PHE A 1 79  ? 76.686  5.065   -112.552 1.00 40.46  ? 79  PHE A CG  1 
ATOM   137  C CD1 . PHE A 1 79  ? 76.338  4.243   -113.615 1.00 37.10  ? 79  PHE A CD1 1 
ATOM   138  C CD2 . PHE A 1 79  ? 75.818  5.163   -111.476 1.00 41.80  ? 79  PHE A CD2 1 
ATOM   139  C CE1 . PHE A 1 79  ? 75.148  3.534   -113.604 1.00 38.49  ? 79  PHE A CE1 1 
ATOM   140  C CE2 . PHE A 1 79  ? 74.623  4.454   -111.458 1.00 38.01  ? 79  PHE A CE2 1 
ATOM   141  C CZ  . PHE A 1 79  ? 74.288  3.639   -112.521 1.00 36.65  ? 79  PHE A CZ  1 
ATOM   142  N N   . TYR A 1 80  ? 80.760  6.873   -112.077 1.00 41.23  ? 80  TYR A N   1 
ATOM   143  C CA  . TYR A 1 80  ? 82.042  7.473   -112.438 1.00 41.81  ? 80  TYR A CA  1 
ATOM   144  C C   . TYR A 1 80  ? 82.359  8.710   -111.592 1.00 43.27  ? 80  TYR A C   1 
ATOM   145  O O   . TYR A 1 80  ? 81.457  9.339   -111.038 1.00 44.05  ? 80  TYR A O   1 
ATOM   146  C CB  . TYR A 1 80  ? 82.061  7.820   -113.928 1.00 40.85  ? 80  TYR A CB  1 
ATOM   147  C CG  . TYR A 1 80  ? 81.150  8.959   -114.339 1.00 39.09  ? 80  TYR A CG  1 
ATOM   148  C CD1 . TYR A 1 80  ? 79.869  8.714   -114.836 1.00 38.54  ? 80  TYR A CD1 1 
ATOM   149  C CD2 . TYR A 1 80  ? 81.586  10.284  -114.264 1.00 38.30  ? 80  TYR A CD2 1 
ATOM   150  C CE1 . TYR A 1 80  ? 79.037  9.766   -115.238 1.00 40.34  ? 80  TYR A CE1 1 
ATOM   151  C CE2 . TYR A 1 80  ? 80.770  11.337  -114.662 1.00 40.11  ? 80  TYR A CE2 1 
ATOM   152  C CZ  . TYR A 1 80  ? 79.498  11.073  -115.147 1.00 42.76  ? 80  TYR A CZ  1 
ATOM   153  O OH  . TYR A 1 80  ? 78.698  12.122  -115.532 1.00 40.74  ? 80  TYR A OH  1 
ATOM   154  N N   . ASP A 1 81  ? 83.641  9.061   -111.508 1.00 42.73  ? 81  ASP A N   1 
ATOM   155  C CA  . ASP A 1 81  ? 84.085  10.120  -110.604 1.00 43.28  ? 81  ASP A CA  1 
ATOM   156  C C   . ASP A 1 81  ? 85.442  10.701  -111.014 1.00 42.02  ? 81  ASP A C   1 
ATOM   157  O O   . ASP A 1 81  ? 86.146  10.139  -111.852 1.00 39.17  ? 81  ASP A O   1 
ATOM   158  C CB  . ASP A 1 81  ? 84.167  9.559   -109.179 1.00 47.91  ? 81  ASP A CB  1 
ATOM   159  C CG  . ASP A 1 81  ? 83.889  10.600  -108.102 1.00 48.86  ? 81  ASP A CG  1 
ATOM   160  O OD1 . ASP A 1 81  ? 84.179  11.796  -108.308 1.00 50.18  ? 81  ASP A OD1 1 
ATOM   161  O OD2 . ASP A 1 81  ? 83.402  10.196  -107.024 1.00 50.69  ? 81  ASP A OD2 1 
ATOM   162  N N   . GLN A 1 82  ? 85.779  11.835  -110.402 1.00 44.17  ? 82  GLN A N   1 
ATOM   163  C CA  . GLN A 1 82  ? 87.016  12.574  -110.655 1.00 44.08  ? 82  GLN A CA  1 
ATOM   164  C C   . GLN A 1 82  ? 88.249  11.711  -110.420 1.00 43.72  ? 82  GLN A C   1 
ATOM   165  O O   . GLN A 1 82  ? 88.478  11.243  -109.305 1.00 44.24  ? 82  GLN A O   1 
ATOM   166  C CB  . GLN A 1 82  ? 87.068  13.799  -109.722 1.00 48.73  ? 82  GLN A CB  1 
ATOM   167  C CG  . GLN A 1 82  ? 88.254  14.753  -109.910 1.00 51.26  ? 82  GLN A CG  1 
ATOM   168  C CD  . GLN A 1 82  ? 88.015  15.804  -110.986 1.00 63.26  ? 82  GLN A CD  1 
ATOM   169  O OE1 . GLN A 1 82  ? 88.187  17.001  -110.743 1.00 59.79  ? 82  GLN A OE1 1 
ATOM   170  N NE2 . GLN A 1 82  ? 87.616  15.363  -112.179 1.00 70.24  ? 82  GLN A NE2 1 
ATOM   171  N N   . ALA A 1 83  ? 89.039  11.509  -111.471 1.00 40.78  ? 83  ALA A N   1 
ATOM   172  C CA  . ALA A 1 83  ? 90.290  10.770  -111.358 1.00 37.04  ? 83  ALA A CA  1 
ATOM   173  C C   . ALA A 1 83  ? 91.256  11.544  -110.476 1.00 34.06  ? 83  ALA A C   1 
ATOM   174  O O   . ALA A 1 83  ? 91.286  12.764  -110.513 1.00 32.13  ? 83  ALA A O   1 
ATOM   175  C CB  . ALA A 1 83  ? 90.896  10.539  -112.727 1.00 32.85  ? 83  ALA A CB  1 
ATOM   176  N N   . PHE A 1 84  ? 92.031  10.826  -109.670 1.00 35.73  ? 84  PHE A N   1 
ATOM   177  C CA  . PHE A 1 84  ? 93.034  11.440  -108.795 1.00 35.83  ? 84  PHE A CA  1 
ATOM   178  C C   . PHE A 1 84  ? 92.442  12.436  -107.809 1.00 33.76  ? 84  PHE A C   1 
ATOM   179  O O   . PHE A 1 84  ? 93.102  13.395  -107.413 1.00 35.60  ? 84  PHE A O   1 
ATOM   180  C CB  . PHE A 1 84  ? 94.126  12.098  -109.638 1.00 35.20  ? 84  PHE A CB  1 
ATOM   181  C CG  . PHE A 1 84  ? 94.687  11.189  -110.674 1.00 35.11  ? 84  PHE A CG  1 
ATOM   182  C CD1 . PHE A 1 84  ? 94.251  11.260  -111.990 1.00 46.33  ? 84  PHE A CD1 1 
ATOM   183  C CD2 . PHE A 1 84  ? 95.621  10.223  -110.325 1.00 30.76  ? 84  PHE A CD2 1 
ATOM   184  C CE1 . PHE A 1 84  ? 94.757  10.398  -112.951 1.00 42.89  ? 84  PHE A CE1 1 
ATOM   185  C CE2 . PHE A 1 84  ? 96.134  9.358   -111.277 1.00 36.08  ? 84  PHE A CE2 1 
ATOM   186  C CZ  . PHE A 1 84  ? 95.703  9.444   -112.593 1.00 42.98  ? 84  PHE A CZ  1 
ATOM   187  N N   . ALA A 1 85  ? 91.205  12.179  -107.394 1.00 34.27  ? 85  ALA A N   1 
ATOM   188  C CA  . ALA A 1 85  ? 90.467  13.084  -106.517 1.00 36.75  ? 85  ALA A CA  1 
ATOM   189  C C   . ALA A 1 85  ? 91.279  13.508  -105.289 1.00 37.79  ? 85  ALA A C   1 
ATOM   190  O O   . ALA A 1 85  ? 91.341  14.694  -104.960 1.00 39.21  ? 85  ALA A O   1 
ATOM   191  C CB  . ALA A 1 85  ? 89.156  12.436  -106.084 1.00 38.09  ? 85  ALA A CB  1 
ATOM   192  N N   . ILE A 1 86  ? 91.917  12.541  -104.635 1.00 35.58  ? 86  ILE A N   1 
ATOM   193  C CA  . ILE A 1 86  ? 92.646  12.810  -103.397 1.00 34.06  ? 86  ILE A CA  1 
ATOM   194  C C   . ILE A 1 86  ? 93.923  13.616  -103.636 1.00 32.08  ? 86  ILE A C   1 
ATOM   195  O O   . ILE A 1 86  ? 94.414  14.285  -102.730 1.00 34.92  ? 86  ILE A O   1 
ATOM   196  C CB  . ILE A 1 86  ? 92.973  11.507  -102.616 1.00 36.31  ? 86  ILE A CB  1 
ATOM   197  C CG1 . ILE A 1 86  ? 94.123  10.732  -103.265 1.00 34.90  ? 86  ILE A CG1 1 
ATOM   198  C CG2 . ILE A 1 86  ? 91.731  10.621  -102.513 1.00 38.62  ? 86  ILE A CG2 1 
ATOM   199  C CD1 . ILE A 1 86  ? 94.493  9.474   -102.512 1.00 32.98  ? 86  ILE A CD1 1 
ATOM   200  N N   . TYR A 1 87  ? 94.460  13.555  -104.851 1.00 32.86  ? 87  TYR A N   1 
ATOM   201  C CA  . TYR A 1 87  ? 95.614  14.383  -105.212 1.00 32.36  ? 87  TYR A CA  1 
ATOM   202  C C   . TYR A 1 87  ? 95.172  15.755  -105.702 1.00 28.88  ? 87  TYR A C   1 
ATOM   203  O O   . TYR A 1 87  ? 96.001  16.583  -106.058 1.00 31.09  ? 87  TYR A O   1 
ATOM   204  C CB  . TYR A 1 87  ? 96.505  13.679  -106.250 1.00 32.92  ? 87  TYR A CB  1 
ATOM   205  C CG  . TYR A 1 87  ? 97.525  12.754  -105.616 1.00 31.72  ? 87  TYR A CG  1 
ATOM   206  C CD1 . TYR A 1 87  ? 97.199  11.437  -105.292 1.00 35.58  ? 87  TYR A CD1 1 
ATOM   207  C CD2 . TYR A 1 87  ? 98.807  13.204  -105.316 1.00 29.10  ? 87  TYR A CD2 1 
ATOM   208  C CE1 . TYR A 1 87  ? 98.129  10.586  -104.693 1.00 35.20  ? 87  TYR A CE1 1 
ATOM   209  C CE2 . TYR A 1 87  ? 99.744  12.365  -104.717 1.00 33.52  ? 87  TYR A CE2 1 
ATOM   210  C CZ  . TYR A 1 87  ? 99.399  11.059  -104.408 1.00 37.65  ? 87  TYR A CZ  1 
ATOM   211  O OH  . TYR A 1 87  ? 100.328 10.229  -103.824 1.00 35.36  ? 87  TYR A OH  1 
ATOM   212  N N   . GLY A 1 88  ? 93.866  15.994  -105.693 1.00 27.03  ? 88  GLY A N   1 
ATOM   213  C CA  . GLY A 1 88  ? 93.304  17.270  -106.102 1.00 30.34  ? 88  GLY A CA  1 
ATOM   214  C C   . GLY A 1 88  ? 92.369  17.103  -107.276 1.00 30.44  ? 88  GLY A C   1 
ATOM   215  O O   . GLY A 1 88  ? 91.513  17.950  -107.520 1.00 30.95  ? 88  GLY A O   1 
ATOM   216  N N   . GLY A 1 89  ? 92.531  16.000  -107.998 1.00 32.95  ? 89  GLY A N   1 
ATOM   217  C CA  . GLY A 1 89  ? 91.793  15.766  -109.228 1.00 33.81  ? 89  GLY A CA  1 
ATOM   218  C C   . GLY A 1 89  ? 92.555  16.294  -110.429 1.00 35.10  ? 89  GLY A C   1 
ATOM   219  O O   . GLY A 1 89  ? 93.455  17.123  -110.292 1.00 40.12  ? 89  GLY A O   1 
ATOM   220  N N   . VAL A 1 90  ? 92.209  15.789  -111.607 1.00 35.74  ? 90  VAL A N   1 
ATOM   221  C CA  . VAL A 1 90  ? 92.686  16.352  -112.868 1.00 33.82  ? 90  VAL A CA  1 
ATOM   222  C C   . VAL A 1 90  ? 91.472  16.519  -113.765 1.00 31.27  ? 90  VAL A C   1 
ATOM   223  O O   . VAL A 1 90  ? 90.607  15.641  -113.820 1.00 28.05  ? 90  VAL A O   1 
ATOM   224  C CB  . VAL A 1 90  ? 93.749  15.452  -113.542 1.00 34.60  ? 90  VAL A CB  1 
ATOM   225  C CG1 . VAL A 1 90  ? 94.103  15.969  -114.938 1.00 16.52  ? 90  VAL A CG1 1 
ATOM   226  C CG2 . VAL A 1 90  ? 94.997  15.368  -112.662 1.00 33.22  ? 90  VAL A CG2 1 
ATOM   227  N N   . SER A 1 91  ? 91.403  17.658  -114.445 1.00 28.94  ? 91  SER A N   1 
ATOM   228  C CA  . SER A 1 91  ? 90.258  17.977  -115.290 1.00 32.74  ? 91  SER A CA  1 
ATOM   229  C C   . SER A 1 91  ? 90.257  17.127  -116.557 1.00 31.59  ? 91  SER A C   1 
ATOM   230  O O   . SER A 1 91  ? 91.311  16.816  -117.110 1.00 34.42  ? 91  SER A O   1 
ATOM   231  C CB  . SER A 1 91  ? 90.268  19.463  -115.636 1.00 33.47  ? 91  SER A CB  1 
ATOM   232  O OG  . SER A 1 91  ? 91.576  19.871  -115.990 1.00 41.23  ? 91  SER A OG  1 
ATOM   233  N N   . GLY A 1 92  ? 89.069  16.732  -116.999 1.00 29.91  ? 92  GLY A N   1 
ATOM   234  C CA  . GLY A 1 92  ? 88.931  15.878  -118.178 1.00 30.36  ? 92  GLY A CA  1 
ATOM   235  C C   . GLY A 1 92  ? 89.341  14.418  -118.016 1.00 27.80  ? 92  GLY A C   1 
ATOM   236  O O   . GLY A 1 92  ? 89.403  13.691  -119.006 1.00 26.17  ? 92  GLY A O   1 
ATOM   237  N N   . LEU A 1 93  ? 89.609  13.979  -116.787 1.00 26.21  ? 93  LEU A N   1 
ATOM   238  C CA  . LEU A 1 93  ? 89.936  12.577  -116.519 1.00 30.84  ? 93  LEU A CA  1 
ATOM   239  C C   . LEU A 1 93  ? 89.035  11.955  -115.447 1.00 32.55  ? 93  LEU A C   1 
ATOM   240  O O   . LEU A 1 93  ? 88.877  12.512  -114.358 1.00 30.32  ? 93  LEU A O   1 
ATOM   241  C CB  . LEU A 1 93  ? 91.393  12.457  -116.091 1.00 31.41  ? 93  LEU A CB  1 
ATOM   242  C CG  . LEU A 1 93  ? 92.413  12.721  -117.189 1.00 30.40  ? 93  LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 93  ? 93.833  12.522  -116.661 1.00 28.74  ? 93  LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 93  ? 92.148  11.811  -118.361 1.00 26.09  ? 93  LEU A CD2 1 
ATOM   245  N N   . TYR A 1 94  ? 88.465  10.788  -115.757 1.00 34.75  ? 94  TYR A N   1 
ATOM   246  C CA  . TYR A 1 94  ? 87.500  10.134  -114.866 1.00 34.66  ? 94  TYR A CA  1 
ATOM   247  C C   . TYR A 1 94  ? 87.776  8.650   -114.686 1.00 34.78  ? 94  TYR A C   1 
ATOM   248  O O   . TYR A 1 94  ? 88.167  7.954   -115.628 1.00 34.01  ? 94  TYR A O   1 
ATOM   249  C CB  . TYR A 1 94  ? 86.068  10.334  -115.381 1.00 34.71  ? 94  TYR A CB  1 
ATOM   250  C CG  . TYR A 1 94  ? 85.642  11.781  -115.350 1.00 36.41  ? 94  TYR A CG  1 
ATOM   251  C CD1 . TYR A 1 94  ? 85.828  12.603  -116.447 1.00 38.53  ? 94  TYR A CD1 1 
ATOM   252  C CD2 . TYR A 1 94  ? 85.092  12.337  -114.208 1.00 38.12  ? 94  TYR A CD2 1 
ATOM   253  C CE1 . TYR A 1 94  ? 85.458  13.934  -116.414 1.00 35.31  ? 94  TYR A CE1 1 
ATOM   254  C CE2 . TYR A 1 94  ? 84.723  13.666  -114.165 1.00 35.35  ? 94  TYR A CE2 1 
ATOM   255  C CZ  . TYR A 1 94  ? 84.907  14.458  -115.271 1.00 34.05  ? 94  TYR A CZ  1 
ATOM   256  O OH  . TYR A 1 94  ? 84.539  15.781  -115.231 1.00 39.44  ? 94  TYR A OH  1 
ATOM   257  N N   . ASP A 1 95  ? 87.576  8.185   -113.456 1.00 35.59  ? 95  ASP A N   1 
ATOM   258  C CA  . ASP A 1 95  ? 87.600  6.766   -113.140 1.00 33.95  ? 95  ASP A CA  1 
ATOM   259  C C   . ASP A 1 95  ? 86.166  6.281   -113.142 1.00 33.45  ? 95  ASP A C   1 
ATOM   260  O O   . ASP A 1 95  ? 85.269  7.006   -112.702 1.00 29.75  ? 95  ASP A O   1 
ATOM   261  C CB  . ASP A 1 95  ? 88.204  6.527   -111.760 1.00 32.64  ? 95  ASP A CB  1 
ATOM   262  C CG  . ASP A 1 95  ? 89.643  6.999   -111.649 1.00 39.21  ? 95  ASP A CG  1 
ATOM   263  O OD1 . ASP A 1 95  ? 90.302  7.223   -112.694 1.00 33.98  ? 95  ASP A OD1 1 
ATOM   264  O OD2 . ASP A 1 95  ? 90.115  7.143   -110.497 1.00 48.08  ? 95  ASP A OD2 1 
ATOM   265  N N   . PHE A 1 96  ? 85.951  5.064   -113.641 1.00 35.90  ? 96  PHE A N   1 
ATOM   266  C CA  . PHE A 1 96  ? 84.628  4.436   -113.611 1.00 39.00  ? 96  PHE A CA  1 
ATOM   267  C C   . PHE A 1 96  ? 84.555  3.345   -112.543 1.00 36.82  ? 96  PHE A C   1 
ATOM   268  O O   . PHE A 1 96  ? 85.350  2.406   -112.540 1.00 34.48  ? 96  PHE A O   1 
ATOM   269  C CB  . PHE A 1 96  ? 84.281  3.846   -114.970 1.00 42.37  ? 96  PHE A CB  1 
ATOM   270  C CG  . PHE A 1 96  ? 84.125  4.872   -116.047 1.00 46.76  ? 96  PHE A CG  1 
ATOM   271  C CD1 . PHE A 1 96  ? 85.227  5.302   -116.774 1.00 51.03  ? 96  PHE A CD1 1 
ATOM   272  C CD2 . PHE A 1 96  ? 82.877  5.402   -116.343 1.00 41.08  ? 96  PHE A CD2 1 
ATOM   273  C CE1 . PHE A 1 96  ? 85.087  6.244   -117.773 1.00 48.49  ? 96  PHE A CE1 1 
ATOM   274  C CE2 . PHE A 1 96  ? 82.729  6.343   -117.336 1.00 36.50  ? 96  PHE A CE2 1 
ATOM   275  C CZ  . PHE A 1 96  ? 83.833  6.766   -118.054 1.00 46.51  ? 96  PHE A CZ  1 
ATOM   276  N N   . GLY A 1 97  ? 83.594  3.479   -111.638 1.00 36.77  ? 97  GLY A N   1 
ATOM   277  C CA  . GLY A 1 97  ? 83.410  2.511   -110.574 1.00 37.22  ? 97  GLY A CA  1 
ATOM   278  C C   . GLY A 1 97  ? 82.673  1.295   -111.083 1.00 36.49  ? 97  GLY A C   1 
ATOM   279  O O   . GLY A 1 97  ? 82.188  1.289   -112.213 1.00 38.49  ? 97  GLY A O   1 
ATOM   280  N N   . PRO A 1 98  ? 82.578  0.259   -110.246 1.00 36.01  ? 98  PRO A N   1 
ATOM   281  C CA  . PRO A 1 98  ? 82.048  -1.036  -110.656 1.00 35.46  ? 98  PRO A CA  1 
ATOM   282  C C   . PRO A 1 98  ? 80.750  -0.947  -111.446 1.00 36.89  ? 98  PRO A C   1 
ATOM   283  O O   . PRO A 1 98  ? 80.629  -1.598  -112.483 1.00 39.89  ? 98  PRO A O   1 
ATOM   284  C CB  . PRO A 1 98  ? 81.846  -1.785  -109.329 1.00 37.84  ? 98  PRO A CB  1 
ATOM   285  C CG  . PRO A 1 98  ? 82.198  -0.826  -108.238 1.00 35.83  ? 98  PRO A CG  1 
ATOM   286  C CD  . PRO A 1 98  ? 82.984  0.274   -108.831 1.00 36.17  ? 98  PRO A CD  1 
ATOM   287  N N   . VAL A 1 99  ? 79.799  -0.143  -110.973 1.00 38.13  ? 99  VAL A N   1 
ATOM   288  C CA  . VAL A 1 99  ? 78.518  0.020   -111.677 1.00 33.41  ? 99  VAL A CA  1 
ATOM   289  C C   . VAL A 1 99  ? 78.772  0.553   -113.080 1.00 28.31  ? 99  VAL A C   1 
ATOM   290  O O   . VAL A 1 99  ? 78.303  -0.016  -114.051 1.00 32.57  ? 99  VAL A O   1 
ATOM   291  C CB  . VAL A 1 99  ? 77.549  0.976   -110.942 1.00 31.71  ? 99  VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 99  ? 76.157  0.876   -111.539 1.00 19.02  ? 99  VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 99  ? 77.504  0.660   -109.460 1.00 28.87  ? 99  VAL A CG2 1 
ATOM   294  N N   . GLY A 1 100 ? 79.545  1.629   -113.172 1.00 30.50  ? 100 GLY A N   1 
ATOM   295  C CA  . GLY A 1 100 ? 79.885  2.244   -114.456 1.00 34.55  ? 100 GLY A CA  1 
ATOM   296  C C   . GLY A 1 100 ? 80.571  1.304   -115.426 1.00 35.86  ? 100 GLY A C   1 
ATOM   297  O O   . GLY A 1 100 ? 80.232  1.280   -116.613 1.00 37.55  ? 100 GLY A O   1 
ATOM   298  N N   . CYS A 1 101 ? 81.532  0.533   -114.916 1.00 33.53  ? 101 CYS A N   1 
ATOM   299  C CA  . CYS A 1 101 ? 82.199  -0.505  -115.704 1.00 32.50  ? 101 CYS A CA  1 
ATOM   300  C C   . CYS A 1 101 ? 81.225  -1.545  -116.230 1.00 28.30  ? 101 CYS A C   1 
ATOM   301  O O   . CYS A 1 101 ? 81.321  -1.951  -117.379 1.00 31.02  ? 101 CYS A O   1 
ATOM   302  C CB  . CYS A 1 101 ? 83.258  -1.218  -114.876 1.00 33.41  ? 101 CYS A CB  1 
ATOM   303  S SG  . CYS A 1 101 ? 84.691  -0.223  -114.570 1.00 39.04  ? 101 CYS A SG  1 
ATOM   304  N N   . ALA A 1 102 ? 80.302  -1.983  -115.381 1.00 26.60  ? 102 ALA A N   1 
ATOM   305  C CA  . ALA A 1 102 ? 79.275  -2.933  -115.794 1.00 30.66  ? 102 ALA A CA  1 
ATOM   306  C C   . ALA A 1 102 ? 78.553  -2.382  -117.015 1.00 33.42  ? 102 ALA A C   1 
ATOM   307  O O   . ALA A 1 102 ? 78.425  -3.059  -118.041 1.00 32.01  ? 102 ALA A O   1 
ATOM   308  C CB  . ALA A 1 102 ? 78.282  -3.184  -114.657 1.00 23.96  ? 102 ALA A CB  1 
ATOM   309  N N   . LEU A 1 103 ? 78.111  -1.133  -116.896 1.00 32.60  ? 103 LEU A N   1 
ATOM   310  C CA  . LEU A 1 103 ? 77.347  -0.483  -117.941 1.00 35.77  ? 103 LEU A CA  1 
ATOM   311  C C   . LEU A 1 103 ? 78.194  -0.344  -119.208 1.00 41.20  ? 103 LEU A C   1 
ATOM   312  O O   . LEU A 1 103 ? 77.762  -0.715  -120.311 1.00 37.98  ? 103 LEU A O   1 
ATOM   313  C CB  . LEU A 1 103 ? 76.882  0.893   -117.462 1.00 34.90  ? 103 LEU A CB  1 
ATOM   314  C CG  . LEU A 1 103 ? 75.831  1.562   -118.351 1.00 34.14  ? 103 LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 103 ? 74.477  0.980   -118.025 1.00 37.11  ? 103 LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 103 ? 75.818  3.074   -118.169 1.00 33.28  ? 103 LEU A CD2 1 
ATOM   317  N N   . LYS A 1 104 ? 79.401  0.189   -119.023 1.00 40.97  ? 104 LYS A N   1 
ATOM   318  C CA  . LYS A 1 104 ? 80.342  0.421   -120.113 1.00 37.69  ? 104 LYS A CA  1 
ATOM   319  C C   . LYS A 1 104 ? 80.587  -0.882  -120.867 1.00 35.54  ? 104 LYS A C   1 
ATOM   320  O O   . LYS A 1 104 ? 80.487  -0.930  -122.092 1.00 35.22  ? 104 LYS A O   1 
ATOM   321  C CB  . LYS A 1 104 ? 81.655  0.970   -119.547 1.00 39.58  ? 104 LYS A CB  1 
ATOM   322  C CG  . LYS A 1 104 ? 82.634  1.490   -120.583 1.00 44.47  ? 104 LYS A CG  1 
ATOM   323  C CD  . LYS A 1 104 ? 83.892  2.034   -119.923 1.00 43.48  ? 104 LYS A CD  1 
ATOM   324  C CE  . LYS A 1 104 ? 84.880  2.575   -120.948 1.00 46.49  ? 104 LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 104 ? 85.862  3.505   -120.311 1.00 55.08  ? 104 LYS A NZ  1 
ATOM   326  N N   . ASN A 1 105 ? 80.880  -1.938  -120.117 1.00 31.80  ? 105 ASN A N   1 
ATOM   327  C CA  . ASN A 1 105 ? 81.068  -3.270  -120.686 1.00 32.12  ? 105 ASN A CA  1 
ATOM   328  C C   . ASN A 1 105 ? 79.841  -3.782  -121.445 1.00 31.00  ? 105 ASN A C   1 
ATOM   329  O O   . ASN A 1 105 ? 79.968  -4.430  -122.480 1.00 30.14  ? 105 ASN A O   1 
ATOM   330  C CB  . ASN A 1 105 ? 81.472  -4.256  -119.586 1.00 32.30  ? 105 ASN A CB  1 
ATOM   331  C CG  . ASN A 1 105 ? 82.853  -3.949  -118.998 1.00 39.00  ? 105 ASN A CG  1 
ATOM   332  O OD1 . ASN A 1 105 ? 83.632  -3.203  -119.584 1.00 50.98  ? 105 ASN A OD1 1 
ATOM   333  N ND2 . ASN A 1 105 ? 83.149  -4.515  -117.834 1.00 39.35  ? 105 ASN A ND2 1 
ATOM   334  N N   . ASN A 1 106 ? 78.652  -3.482  -120.945 1.00 34.88  ? 106 ASN A N   1 
ATOM   335  C CA  . ASN A 1 106 ? 77.435  -3.861  -121.655 1.00 34.59  ? 106 ASN A CA  1 
ATOM   336  C C   . ASN A 1 106 ? 77.309  -3.100  -122.956 1.00 30.08  ? 106 ASN A C   1 
ATOM   337  O O   . ASN A 1 106 ? 77.083  -3.693  -124.000 1.00 27.57  ? 106 ASN A O   1 
ATOM   338  C CB  . ASN A 1 106 ? 76.190  -3.608  -120.806 1.00 36.85  ? 106 ASN A CB  1 
ATOM   339  C CG  . ASN A 1 106 ? 76.081  -4.548  -119.617 1.00 40.61  ? 106 ASN A CG  1 
ATOM   340  O OD1 . ASN A 1 106 ? 75.341  -4.269  -118.670 1.00 43.31  ? 106 ASN A OD1 1 
ATOM   341  N ND2 . ASN A 1 106 ? 76.811  -5.669  -119.660 1.00 30.74  ? 106 ASN A ND2 1 
ATOM   342  N N   . ILE A 1 107 ? 77.451  -1.782  -122.884 1.00 32.36  ? 107 ILE A N   1 
ATOM   343  C CA  . ILE A 1 107 ? 77.396  -0.939  -124.076 1.00 34.50  ? 107 ILE A CA  1 
ATOM   344  C C   . ILE A 1 107 ? 78.329  -1.467  -125.167 1.00 35.41  ? 107 ILE A C   1 
ATOM   345  O O   . ILE A 1 107 ? 77.955  -1.517  -126.346 1.00 37.78  ? 107 ILE A O   1 
ATOM   346  C CB  . ILE A 1 107 ? 77.759  0.524   -123.743 1.00 36.03  ? 107 ILE A CB  1 
ATOM   347  C CG1 . ILE A 1 107 ? 76.591  1.213   -123.043 1.00 38.37  ? 107 ILE A CG1 1 
ATOM   348  C CG2 . ILE A 1 107 ? 78.117  1.302   -124.997 1.00 35.87  ? 107 ILE A CG2 1 
ATOM   349  C CD1 . ILE A 1 107 ? 76.767  2.706   -122.918 1.00 39.08  ? 107 ILE A CD1 1 
ATOM   350  N N   . ILE A 1 108 ? 79.526  -1.889  -124.759 1.00 30.41  ? 108 ILE A N   1 
ATOM   351  C CA  . ILE A 1 108 ? 80.518  -2.432  -125.689 1.00 31.13  ? 108 ILE A CA  1 
ATOM   352  C C   . ILE A 1 108 ? 80.126  -3.797  -126.255 1.00 29.22  ? 108 ILE A C   1 
ATOM   353  O O   . ILE A 1 108 ? 80.235  -4.032  -127.453 1.00 26.45  ? 108 ILE A O   1 
ATOM   354  C CB  . ILE A 1 108 ? 81.895  -2.525  -125.030 1.00 28.13  ? 108 ILE A CB  1 
ATOM   355  C CG1 . ILE A 1 108 ? 82.408  -1.109  -124.729 1.00 38.80  ? 108 ILE A CG1 1 
ATOM   356  C CG2 . ILE A 1 108 ? 82.859  -3.232  -125.940 1.00 20.83  ? 108 ILE A CG2 1 
ATOM   357  C CD1 . ILE A 1 108 ? 83.774  -1.055  -124.082 1.00 36.73  ? 108 ILE A CD1 1 
ATOM   358  N N   . GLN A 1 109 ? 79.669  -4.697  -125.396 1.00 29.41  ? 109 GLN A N   1 
ATOM   359  C CA  . GLN A 1 109 ? 79.193  -5.984  -125.871 1.00 28.82  ? 109 GLN A CA  1 
ATOM   360  C C   . GLN A 1 109 ? 78.020  -5.816  -126.813 1.00 28.52  ? 109 GLN A C   1 
ATOM   361  O O   . GLN A 1 109 ? 77.961  -6.475  -127.850 1.00 32.94  ? 109 GLN A O   1 
ATOM   362  C CB  . GLN A 1 109 ? 78.808  -6.906  -124.715 1.00 28.57  ? 109 GLN A CB  1 
ATOM   363  C CG  . GLN A 1 109 ? 79.888  -7.912  -124.391 1.00 46.37  ? 109 GLN A CG  1 
ATOM   364  C CD  . GLN A 1 109 ? 80.197  -8.854  -125.556 1.00 56.74  ? 109 GLN A CD  1 
ATOM   365  O OE1 . GLN A 1 109 ? 79.307  -9.228  -126.331 1.00 51.32  ? 109 GLN A OE1 1 
ATOM   366  N NE2 . GLN A 1 109 ? 81.467  -9.242  -125.679 1.00 57.74  ? 109 GLN A NE2 1 
ATOM   367  N N   . THR A 1 110 ? 77.091  -4.938  -126.455 1.00 27.27  ? 110 THR A N   1 
ATOM   368  C CA  . THR A 1 110 ? 75.942  -4.676  -127.302 1.00 29.44  ? 110 THR A CA  1 
ATOM   369  C C   . THR A 1 110 ? 76.418  -4.220  -128.662 1.00 33.54  ? 110 THR A C   1 
ATOM   370  O O   . THR A 1 110 ? 75.932  -4.698  -129.688 1.00 42.92  ? 110 THR A O   1 
ATOM   371  C CB  . THR A 1 110 ? 75.034  -3.598  -126.725 1.00 28.36  ? 110 THR A CB  1 
ATOM   372  O OG1 . THR A 1 110 ? 74.589  -4.005  -125.426 1.00 29.00  ? 110 THR A OG1 1 
ATOM   373  C CG2 . THR A 1 110 ? 73.823  -3.399  -127.630 1.00 24.95  ? 110 THR A CG2 1 
ATOM   374  N N   . TRP A 1 111 ? 77.384  -3.309  -128.659 1.00 31.26  ? 111 TRP A N   1 
ATOM   375  C CA  . TRP A 1 111 ? 77.995  -2.818  -129.891 1.00 29.76  ? 111 TRP A CA  1 
ATOM   376  C C   . TRP A 1 111 ? 78.648  -3.928  -130.705 1.00 28.16  ? 111 TRP A C   1 
ATOM   377  O O   . TRP A 1 111 ? 78.601  -3.918  -131.928 1.00 34.20  ? 111 TRP A O   1 
ATOM   378  C CB  . TRP A 1 111 ? 79.050  -1.778  -129.555 1.00 29.68  ? 111 TRP A CB  1 
ATOM   379  C CG  . TRP A 1 111 ? 79.518  -0.999  -130.719 1.00 29.88  ? 111 TRP A CG  1 
ATOM   380  C CD1 . TRP A 1 111 ? 78.979  0.152   -131.187 1.00 33.19  ? 111 TRP A CD1 1 
ATOM   381  C CD2 . TRP A 1 111 ? 80.647  -1.286  -131.554 1.00 26.15  ? 111 TRP A CD2 1 
ATOM   382  N NE1 . TRP A 1 111 ? 79.695  0.604   -132.266 1.00 36.08  ? 111 TRP A NE1 1 
ATOM   383  C CE2 . TRP A 1 111 ? 80.728  -0.259  -132.510 1.00 32.12  ? 111 TRP A CE2 1 
ATOM   384  C CE3 . TRP A 1 111 ? 81.601  -2.304  -131.580 1.00 32.01  ? 111 TRP A CE3 1 
ATOM   385  C CZ2 . TRP A 1 111 ? 81.715  -0.225  -133.490 1.00 33.56  ? 111 TRP A CZ2 1 
ATOM   386  C CZ3 . TRP A 1 111 ? 82.587  -2.269  -132.551 1.00 32.24  ? 111 TRP A CZ3 1 
ATOM   387  C CH2 . TRP A 1 111 ? 82.632  -1.240  -133.496 1.00 34.53  ? 111 TRP A CH2 1 
ATOM   388  N N   . ARG A 1 112 ? 79.277  -4.870  -130.021 1.00 28.49  ? 112 ARG A N   1 
ATOM   389  C CA  . ARG A 1 112 ? 79.981  -5.942  -130.692 1.00 29.02  ? 112 ARG A CA  1 
ATOM   390  C C   . ARG A 1 112 ? 79.038  -6.820  -131.474 1.00 29.69  ? 112 ARG A C   1 
ATOM   391  O O   . ARG A 1 112 ? 79.330  -7.173  -132.606 1.00 33.14  ? 112 ARG A O   1 
ATOM   392  C CB  . ARG A 1 112 ? 80.769  -6.768  -129.688 1.00 27.39  ? 112 ARG A CB  1 
ATOM   393  C CG  . ARG A 1 112 ? 82.061  -6.100  -129.330 1.00 31.87  ? 112 ARG A CG  1 
ATOM   394  C CD  . ARG A 1 112 ? 82.742  -6.763  -128.160 1.00 40.99  ? 112 ARG A CD  1 
ATOM   395  N NE  . ARG A 1 112 ? 84.155  -6.400  -128.116 1.00 42.42  ? 112 ARG A NE  1 
ATOM   396  C CZ  . ARG A 1 112 ? 85.096  -6.948  -128.875 1.00 38.03  ? 112 ARG A CZ  1 
ATOM   397  N NH1 . ARG A 1 112 ? 84.789  -7.911  -129.739 1.00 33.66  ? 112 ARG A NH1 1 
ATOM   398  N NH2 . ARG A 1 112 ? 86.348  -6.533  -128.760 1.00 39.48  ? 112 ARG A NH2 1 
ATOM   399  N N   . GLN A 1 113 ? 77.906  -7.170  -130.874 1.00 33.60  ? 113 GLN A N   1 
ATOM   400  C CA  . GLN A 1 113 ? 76.946  -8.033  -131.545 1.00 32.35  ? 113 GLN A CA  1 
ATOM   401  C C   . GLN A 1 113 ? 76.316  -7.259  -132.671 1.00 28.85  ? 113 GLN A C   1 
ATOM   402  O O   . GLN A 1 113 ? 76.042  -7.826  -133.726 1.00 30.60  ? 113 GLN A O   1 
ATOM   403  C CB  . GLN A 1 113 ? 75.848  -8.535  -130.594 1.00 35.94  ? 113 GLN A CB  1 
ATOM   404  C CG  . GLN A 1 113 ? 76.333  -9.244  -129.341 1.00 47.44  ? 113 GLN A CG  1 
ATOM   405  C CD  . GLN A 1 113 ? 77.383  -10.309 -129.617 1.00 71.91  ? 113 GLN A CD  1 
ATOM   406  O OE1 . GLN A 1 113 ? 77.300  -11.044 -130.605 1.00 82.27  ? 113 GLN A OE1 1 
ATOM   407  N NE2 . GLN A 1 113 ? 78.379  -10.398 -128.737 1.00 83.36  ? 113 GLN A NE2 1 
ATOM   408  N N   . HIS A 1 114 ? 76.105  -5.963  -132.439 1.00 28.69  ? 114 HIS A N   1 
ATOM   409  C CA  . HIS A 1 114 ? 75.327  -5.116  -133.346 1.00 31.72  ? 114 HIS A CA  1 
ATOM   410  C C   . HIS A 1 114 ? 76.095  -4.766  -134.604 1.00 33.19  ? 114 HIS A C   1 
ATOM   411  O O   . HIS A 1 114 ? 75.494  -4.600  -135.679 1.00 34.90  ? 114 HIS A O   1 
ATOM   412  C CB  . HIS A 1 114 ? 74.901  -3.830  -132.643 1.00 32.34  ? 114 HIS A CB  1 
ATOM   413  C CG  . HIS A 1 114 ? 73.850  -3.058  -133.376 1.00 33.67  ? 114 HIS A CG  1 
ATOM   414  N ND1 . HIS A 1 114 ? 72.506  -3.321  -133.243 1.00 26.83  ? 114 HIS A ND1 1 
ATOM   415  C CD2 . HIS A 1 114 ? 73.946  -2.023  -134.245 1.00 39.19  ? 114 HIS A CD2 1 
ATOM   416  C CE1 . HIS A 1 114 ? 71.818  -2.478  -133.994 1.00 28.54  ? 114 HIS A CE1 1 
ATOM   417  N NE2 . HIS A 1 114 ? 72.668  -1.679  -134.611 1.00 30.78  ? 114 HIS A NE2 1 
ATOM   418  N N   . PHE A 1 115 ? 77.418  -4.662  -134.474 1.00 31.63  ? 115 PHE A N   1 
ATOM   419  C CA  . PHE A 1 115 ? 78.270  -4.304  -135.601 1.00 31.72  ? 115 PHE A CA  1 
ATOM   420  C C   . PHE A 1 115 ? 79.249  -5.407  -135.998 1.00 31.35  ? 115 PHE A C   1 
ATOM   421  O O   . PHE A 1 115 ? 79.098  -6.011  -137.063 1.00 37.06  ? 115 PHE A O   1 
ATOM   422  C CB  . PHE A 1 115 ? 78.979  -2.980  -135.321 1.00 33.98  ? 115 PHE A CB  1 
ATOM   423  C CG  . PHE A 1 115 ? 78.040  -1.808  -135.272 1.00 33.96  ? 115 PHE A CG  1 
ATOM   424  C CD1 . PHE A 1 115 ? 77.776  -1.154  -134.081 1.00 43.69  ? 115 PHE A CD1 1 
ATOM   425  C CD2 . PHE A 1 115 ? 77.381  -1.386  -136.417 1.00 37.29  ? 115 PHE A CD2 1 
ATOM   426  C CE1 . PHE A 1 115 ? 76.890  -0.073  -134.033 1.00 42.41  ? 115 PHE A CE1 1 
ATOM   427  C CE2 . PHE A 1 115 ? 76.492  -0.317  -136.378 1.00 42.12  ? 115 PHE A CE2 1 
ATOM   428  C CZ  . PHE A 1 115 ? 76.247  0.345   -135.183 1.00 41.22  ? 115 PHE A CZ  1 
ATOM   429  N N   . ILE A 1 116 ? 80.243  -5.680  -135.164 1.00 26.90  ? 116 ILE A N   1 
ATOM   430  C CA  . ILE A 1 116 ? 81.256  -6.665  -135.533 1.00 28.46  ? 116 ILE A CA  1 
ATOM   431  C C   . ILE A 1 116 ? 80.608  -7.985  -135.940 1.00 27.38  ? 116 ILE A C   1 
ATOM   432  O O   . ILE A 1 116 ? 80.743  -8.427  -137.072 1.00 29.89  ? 116 ILE A O   1 
ATOM   433  C CB  . ILE A 1 116 ? 82.261  -6.911  -134.403 1.00 28.90  ? 116 ILE A CB  1 
ATOM   434  C CG1 . ILE A 1 116 ? 83.193  -5.700  -134.266 1.00 26.33  ? 116 ILE A CG1 1 
ATOM   435  C CG2 . ILE A 1 116 ? 83.053  -8.193  -134.672 1.00 23.66  ? 116 ILE A CG2 1 
ATOM   436  C CD1 . ILE A 1 116 ? 84.070  -5.731  -133.024 1.00 23.61  ? 116 ILE A CD1 1 
ATOM   437  N N   . GLN A 1 117 ? 79.872  -8.583  -135.018 1.00 30.81  ? 117 GLN A N   1 
ATOM   438  C CA  . GLN A 1 117 ? 79.284  -9.899  -135.236 1.00 33.39  ? 117 GLN A CA  1 
ATOM   439  C C   . GLN A 1 117 ? 78.308  -9.904  -136.398 1.00 31.80  ? 117 GLN A C   1 
ATOM   440  O O   . GLN A 1 117 ? 78.320  -10.832 -137.206 1.00 30.15  ? 117 GLN A O   1 
ATOM   441  C CB  . GLN A 1 117 ? 78.566  -10.390 -133.970 1.00 39.32  ? 117 GLN A CB  1 
ATOM   442  C CG  . GLN A 1 117 ? 78.694  -11.885 -133.736 1.00 44.85  ? 117 GLN A CG  1 
ATOM   443  C CD  . GLN A 1 117 ? 80.128  -12.295 -133.444 1.00 59.29  ? 117 GLN A CD  1 
ATOM   444  O OE1 . GLN A 1 117 ? 80.898  -11.538 -132.838 1.00 60.93  ? 117 GLN A OE1 1 
ATOM   445  N NE2 . GLN A 1 117 ? 80.500  -13.492 -133.886 1.00 68.73  ? 117 GLN A NE2 1 
ATOM   446  N N   . GLU A 1 118 ? 77.471  -8.870  -136.474 1.00 31.21  ? 118 GLU A N   1 
ATOM   447  C CA  . GLU A 1 118 ? 76.412  -8.794  -137.487 1.00 29.78  ? 118 GLU A CA  1 
ATOM   448  C C   . GLU A 1 118 ? 76.965  -8.624  -138.902 1.00 27.21  ? 118 GLU A C   1 
ATOM   449  O O   . GLU A 1 118 ? 76.476  -9.248  -139.833 1.00 31.74  ? 118 GLU A O   1 
ATOM   450  C CB  . GLU A 1 118 ? 75.445  -7.653  -137.163 1.00 28.11  ? 118 GLU A CB  1 
ATOM   451  C CG  . GLU A 1 118 ? 74.360  -7.410  -138.215 1.00 38.02  ? 118 GLU A CG  1 
ATOM   452  C CD  . GLU A 1 118 ? 73.260  -8.458  -138.224 1.00 49.28  ? 118 GLU A CD  1 
ATOM   453  O OE1 . GLU A 1 118 ? 72.958  -9.023  -137.149 1.00 44.65  ? 118 GLU A OE1 1 
ATOM   454  O OE2 . GLU A 1 118 ? 72.680  -8.695  -139.312 1.00 53.24  ? 118 GLU A OE2 1 
ATOM   455  N N   . GLU A 1 119 ? 77.979  -7.779  -139.061 1.00 28.88  ? 119 GLU A N   1 
ATOM   456  C CA  . GLU A 1 119 ? 78.578  -7.532  -140.376 1.00 27.56  ? 119 GLU A CA  1 
ATOM   457  C C   . GLU A 1 119 ? 79.877  -8.300  -140.571 1.00 27.39  ? 119 GLU A C   1 
ATOM   458  O O   . GLU A 1 119 ? 80.616  -8.030  -141.514 1.00 24.98  ? 119 GLU A O   1 
ATOM   459  C CB  . GLU A 1 119 ? 78.864  -6.041  -140.574 1.00 27.14  ? 119 GLU A CB  1 
ATOM   460  C CG  . GLU A 1 119 ? 77.765  -5.097  -140.108 1.00 27.09  ? 119 GLU A CG  1 
ATOM   461  C CD  . GLU A 1 119 ? 76.446  -5.325  -140.793 1.00 23.23  ? 119 GLU A CD  1 
ATOM   462  O OE1 . GLU A 1 119 ? 76.438  -5.868  -141.914 1.00 19.45  ? 119 GLU A OE1 1 
ATOM   463  O OE2 . GLU A 1 119 ? 75.410  -4.942  -140.206 1.00 37.01  ? 119 GLU A OE2 1 
ATOM   464  N N   . GLN A 1 120 ? 80.161  -9.241  -139.674 1.00 27.97  ? 120 GLN A N   1 
ATOM   465  C CA  . GLN A 1 120 ? 81.388  -10.015 -139.728 1.00 26.24  ? 120 GLN A CA  1 
ATOM   466  C C   . GLN A 1 120 ? 82.616  -9.117  -139.975 1.00 25.24  ? 120 GLN A C   1 
ATOM   467  O O   . GLN A 1 120 ? 83.385  -9.331  -140.909 1.00 24.65  ? 120 GLN A O   1 
ATOM   468  C CB  . GLN A 1 120 ? 81.240  -11.106 -140.789 1.00 27.28  ? 120 GLN A CB  1 
ATOM   469  C CG  . GLN A 1 120 ? 80.295  -12.231 -140.361 1.00 40.63  ? 120 GLN A CG  1 
ATOM   470  C CD  . GLN A 1 120 ? 80.941  -13.211 -139.367 1.00 55.83  ? 120 GLN A CD  1 
ATOM   471  O OE1 . GLN A 1 120 ? 81.915  -13.894 -139.695 1.00 59.08  ? 120 GLN A OE1 1 
ATOM   472  N NE2 . GLN A 1 120 ? 80.389  -13.286 -138.153 1.00 60.67  ? 120 GLN A NE2 1 
ATOM   473  N N   . ILE A 1 121 ? 82.783  -8.111  -139.118 1.00 26.40  ? 121 ILE A N   1 
ATOM   474  C CA  . ILE A 1 121 ? 83.841  -7.104  -139.277 1.00 27.16  ? 121 ILE A CA  1 
ATOM   475  C C   . ILE A 1 121 ? 85.165  -7.687  -138.842 1.00 26.37  ? 121 ILE A C   1 
ATOM   476  O O   . ILE A 1 121 ? 85.208  -8.531  -137.956 1.00 39.68  ? 121 ILE A O   1 
ATOM   477  C CB  . ILE A 1 121 ? 83.571  -5.822  -138.438 1.00 27.51  ? 121 ILE A CB  1 
ATOM   478  C CG1 . ILE A 1 121 ? 82.189  -5.237  -138.754 1.00 33.52  ? 121 ILE A CG1 1 
ATOM   479  C CG2 . ILE A 1 121 ? 84.617  -4.764  -138.715 1.00 23.46  ? 121 ILE A CG2 1 
ATOM   480  C CD1 . ILE A 1 121 ? 81.858  -3.989  -137.968 1.00 28.27  ? 121 ILE A CD1 1 
ATOM   481  N N   . LEU A 1 122 ? 86.243  -7.239  -139.468 1.00 27.08  ? 122 LEU A N   1 
ATOM   482  C CA  . LEU A 1 122 ? 87.580  -7.671  -139.097 1.00 29.69  ? 122 LEU A CA  1 
ATOM   483  C C   . LEU A 1 122 ? 88.099  -6.793  -137.968 1.00 31.96  ? 122 LEU A C   1 
ATOM   484  O O   . LEU A 1 122 ? 88.398  -5.619  -138.172 1.00 31.66  ? 122 LEU A O   1 
ATOM   485  C CB  . LEU A 1 122 ? 88.522  -7.581  -140.300 1.00 31.61  ? 122 LEU A CB  1 
ATOM   486  C CG  . LEU A 1 122 ? 88.118  -8.390  -141.532 1.00 22.30  ? 122 LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 122 ? 89.275  -8.451  -142.519 1.00 16.81  ? 122 LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 122 ? 87.676  -9.789  -141.130 1.00 20.73  ? 122 LEU A CD2 1 
ATOM   489  N N   . GLU A 1 123 ? 88.203  -7.366  -136.776 1.00 32.05  ? 123 GLU A N   1 
ATOM   490  C CA  . GLU A 1 123 ? 88.664  -6.620  -135.615 1.00 31.07  ? 123 GLU A CA  1 
ATOM   491  C C   . GLU A 1 123 ? 90.172  -6.649  -135.538 1.00 32.59  ? 123 GLU A C   1 
ATOM   492  O O   . GLU A 1 123 ? 90.777  -7.705  -135.685 1.00 35.35  ? 123 GLU A O   1 
ATOM   493  C CB  . GLU A 1 123 ? 88.097  -7.230  -134.346 1.00 31.29  ? 123 GLU A CB  1 
ATOM   494  C CG  . GLU A 1 123 ? 88.684  -6.658  -133.076 1.00 36.87  ? 123 GLU A CG  1 
ATOM   495  C CD  . GLU A 1 123 ? 87.895  -7.046  -131.838 1.00 41.51  ? 123 GLU A CD  1 
ATOM   496  O OE1 . GLU A 1 123 ? 88.095  -6.393  -130.790 1.00 37.56  ? 123 GLU A OE1 1 
ATOM   497  O OE2 . GLU A 1 123 ? 87.086  -8.000  -131.913 1.00 49.07  ? 123 GLU A OE2 1 
ATOM   498  N N   . ILE A 1 124 ? 90.784  -5.492  -135.310 1.00 32.45  ? 124 ILE A N   1 
ATOM   499  C CA  . ILE A 1 124 ? 92.209  -5.447  -135.007 1.00 31.30  ? 124 ILE A CA  1 
ATOM   500  C C   . ILE A 1 124 ? 92.407  -4.671  -133.734 1.00 26.55  ? 124 ILE A C   1 
ATOM   501  O O   . ILE A 1 124 ? 91.466  -4.098  -133.208 1.00 25.70  ? 124 ILE A O   1 
ATOM   502  C CB  . ILE A 1 124 ? 93.050  -4.806  -136.133 1.00 32.90  ? 124 ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 124 ? 92.739  -3.318  -136.279 1.00 34.67  ? 124 ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 124 ? 92.825  -5.521  -137.445 1.00 33.81  ? 124 ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 124 ? 93.687  -2.623  -137.215 1.00 35.34  ? 124 ILE A CD1 1 
ATOM   506  N N   . ASP A 1 125 ? 93.642  -4.651  -133.252 1.00 31.87  ? 125 ASP A N   1 
ATOM   507  C CA  . ASP A 1 125 ? 93.980  -3.973  -132.011 1.00 32.90  ? 125 ASP A CA  1 
ATOM   508  C C   . ASP A 1 125 ? 95.415  -3.471  -132.060 1.00 33.22  ? 125 ASP A C   1 
ATOM   509  O O   . ASP A 1 125 ? 96.352  -4.205  -131.749 1.00 35.79  ? 125 ASP A O   1 
ATOM   510  C CB  . ASP A 1 125 ? 93.799  -4.927  -130.839 1.00 32.40  ? 125 ASP A CB  1 
ATOM   511  C CG  . ASP A 1 125 ? 94.091  -4.279  -129.522 1.00 37.44  ? 125 ASP A CG  1 
ATOM   512  O OD1 . ASP A 1 125 ? 93.592  -3.147  -129.302 1.00 47.70  ? 125 ASP A OD1 1 
ATOM   513  O OD2 . ASP A 1 125 ? 94.817  -4.903  -128.714 1.00 48.62  ? 125 ASP A OD2 1 
ATOM   514  N N   . CYS A 1 126 ? 95.573  -2.217  -132.462 1.00 32.27  ? 126 CYS A N   1 
ATOM   515  C CA  . CYS A 1 126 ? 96.884  -1.623  -132.667 1.00 32.49  ? 126 CYS A CA  1 
ATOM   516  C C   . CYS A 1 126 ? 97.272  -0.814  -131.446 1.00 32.52  ? 126 CYS A C   1 
ATOM   517  O O   . CYS A 1 126 ? 96.476  -0.682  -130.513 1.00 39.52  ? 126 CYS A O   1 
ATOM   518  C CB  . CYS A 1 126 ? 96.859  -0.733  -133.909 1.00 37.05  ? 126 CYS A CB  1 
ATOM   519  S SG  . CYS A 1 126 ? 96.056  -1.512  -135.337 1.00 36.66  ? 126 CYS A SG  1 
ATOM   520  N N   . THR A 1 127 ? 98.486  -0.264  -131.460 1.00 29.39  ? 127 THR A N   1 
ATOM   521  C CA  . THR A 1 127 ? 99.045  0.411   -130.292 1.00 26.58  ? 127 THR A CA  1 
ATOM   522  C C   . THR A 1 127 ? 98.503  1.820   -130.160 1.00 30.11  ? 127 THR A C   1 
ATOM   523  O O   . THR A 1 127 ? 98.025  2.396   -131.134 1.00 34.58  ? 127 THR A O   1 
ATOM   524  C CB  . THR A 1 127 ? 100.581 0.494   -130.367 1.00 23.10  ? 127 THR A CB  1 
ATOM   525  O OG1 . THR A 1 127 ? 100.966 1.182   -131.561 1.00 19.99  ? 127 THR A OG1 1 
ATOM   526  C CG2 . THR A 1 127 ? 101.198 -0.901  -130.367 1.00 20.65  ? 127 THR A CG2 1 
ATOM   527  N N   . MET A 1 128 ? 98.572  2.355   -128.943 1.00 32.54  ? 128 MET A N   1 
ATOM   528  C CA  . MET A 1 128 ? 98.263  3.754   -128.666 1.00 28.50  ? 128 MET A CA  1 
ATOM   529  C C   . MET A 1 128 ? 99.488  4.623   -128.935 1.00 29.29  ? 128 MET A C   1 
ATOM   530  O O   . MET A 1 128 ? 99.365  5.723   -129.465 1.00 34.36  ? 128 MET A O   1 
ATOM   531  C CB  . MET A 1 128 ? 97.791  3.927   -127.220 1.00 25.60  ? 128 MET A CB  1 
ATOM   532  C CG  . MET A 1 128 ? 96.383  3.403   -126.972 1.00 32.48  ? 128 MET A CG  1 
ATOM   533  S SD  . MET A 1 128 ? 95.948  3.238   -125.228 1.00 33.21  ? 128 MET A SD  1 
ATOM   534  C CE  . MET A 1 128 ? 96.861  1.756   -124.812 1.00 41.87  ? 128 MET A CE  1 
ATOM   535  N N   . LEU A 1 129 ? 100.670 4.133   -128.572 1.00 29.90  ? 129 LEU A N   1 
ATOM   536  C CA  . LEU A 1 129 ? 101.904 4.871   -128.843 1.00 29.03  ? 129 LEU A CA  1 
ATOM   537  C C   . LEU A 1 129 ? 102.129 4.938   -130.345 1.00 27.14  ? 129 LEU A C   1 
ATOM   538  O O   . LEU A 1 129 ? 102.053 3.924   -131.028 1.00 28.92  ? 129 LEU A O   1 
ATOM   539  C CB  . LEU A 1 129 ? 103.104 4.213   -128.158 1.00 30.64  ? 129 LEU A CB  1 
ATOM   540  C CG  . LEU A 1 129 ? 103.159 4.355   -126.633 1.00 31.56  ? 129 LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 129 ? 104.215 3.432   -126.034 1.00 33.73  ? 129 LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 129 ? 103.430 5.799   -126.239 1.00 24.43  ? 129 LEU A CD2 1 
ATOM   543  N N   . THR A 1 130 ? 102.385 6.139   -130.852 1.00 26.53  ? 130 THR A N   1 
ATOM   544  C CA  . THR A 1 130 ? 102.525 6.359   -132.286 1.00 25.64  ? 130 THR A CA  1 
ATOM   545  C C   . THR A 1 130 ? 103.709 7.263   -132.591 1.00 24.63  ? 130 THR A C   1 
ATOM   546  O O   . THR A 1 130 ? 103.778 8.373   -132.080 1.00 24.76  ? 130 THR A O   1 
ATOM   547  C CB  . THR A 1 130 ? 101.281 7.028   -132.863 1.00 25.00  ? 130 THR A CB  1 
ATOM   548  O OG1 . THR A 1 130 ? 100.110 6.298   -132.466 1.00 21.56  ? 130 THR A OG1 1 
ATOM   549  C CG2 . THR A 1 130 ? 101.377 7.075   -134.378 1.00 23.80  ? 130 THR A CG2 1 
ATOM   550  N N   . PRO A 1 131 ? 104.642 6.793   -133.436 1.00 27.02  ? 131 PRO A N   1 
ATOM   551  C CA  . PRO A 1 131 ? 105.775 7.627   -133.810 1.00 26.05  ? 131 PRO A CA  1 
ATOM   552  C C   . PRO A 1 131 ? 105.349 8.815   -134.669 1.00 26.62  ? 131 PRO A C   1 
ATOM   553  O O   . PRO A 1 131 ? 104.357 8.739   -135.388 1.00 30.00  ? 131 PRO A O   1 
ATOM   554  C CB  . PRO A 1 131 ? 106.673 6.670   -134.600 1.00 25.52  ? 131 PRO A CB  1 
ATOM   555  C CG  . PRO A 1 131 ? 105.787 5.612   -135.092 1.00 20.95  ? 131 PRO A CG  1 
ATOM   556  C CD  . PRO A 1 131 ? 104.692 5.471   -134.090 1.00 28.80  ? 131 PRO A CD  1 
ATOM   557  N N   . GLU A 1 132 ? 106.112 9.897   -134.585 1.00 28.02  ? 132 GLU A N   1 
ATOM   558  C CA  . GLU A 1 132 ? 105.748 11.174  -135.195 1.00 27.56  ? 132 GLU A CA  1 
ATOM   559  C C   . GLU A 1 132 ? 105.388 11.080  -136.692 1.00 27.98  ? 132 GLU A C   1 
ATOM   560  O O   . GLU A 1 132 ? 104.317 11.538  -137.087 1.00 29.89  ? 132 GLU A O   1 
ATOM   561  C CB  . GLU A 1 132 ? 106.872 12.198  -134.945 1.00 26.94  ? 132 GLU A CB  1 
ATOM   562  C CG  . GLU A 1 132 ? 106.588 13.630  -135.387 1.00 30.82  ? 132 GLU A CG  1 
ATOM   563  C CD  . GLU A 1 132 ? 107.315 14.662  -134.525 1.00 34.51  ? 132 GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 132 ? 106.860 14.917  -133.388 1.00 38.12  ? 132 GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 132 ? 108.341 15.217  -134.979 1.00 42.62  ? 132 GLU A OE2 1 
ATOM   566  N N   . PRO A 1 133 ? 106.251 10.457  -137.523 1.00 27.62  ? 133 PRO A N   1 
ATOM   567  C CA  . PRO A 1 133 ? 106.057 10.524  -138.976 1.00 26.29  ? 133 PRO A CA  1 
ATOM   568  C C   . PRO A 1 133 ? 104.663 10.134  -139.459 1.00 27.76  ? 133 PRO A C   1 
ATOM   569  O O   . PRO A 1 133 ? 104.153 10.737  -140.404 1.00 30.84  ? 133 PRO A O   1 
ATOM   570  C CB  . PRO A 1 133 ? 107.093 9.536   -139.509 1.00 22.10  ? 133 PRO A CB  1 
ATOM   571  C CG  . PRO A 1 133 ? 108.148 9.536   -138.497 1.00 23.40  ? 133 PRO A CG  1 
ATOM   572  C CD  . PRO A 1 133 ? 107.431 9.642   -137.189 1.00 26.93  ? 133 PRO A CD  1 
ATOM   573  N N   . VAL A 1 134 ? 104.053 9.140   -138.816 1.00 29.31  ? 134 VAL A N   1 
ATOM   574  C CA  . VAL A 1 134 ? 102.724 8.674   -139.231 1.00 29.33  ? 134 VAL A CA  1 
ATOM   575  C C   . VAL A 1 134 ? 101.700 9.794   -139.046 1.00 28.75  ? 134 VAL A C   1 
ATOM   576  O O   . VAL A 1 134 ? 100.880 10.041  -139.925 1.00 31.69  ? 134 VAL A O   1 
ATOM   577  C CB  . VAL A 1 134 ? 102.247 7.357   -138.496 1.00 28.68  ? 134 VAL A CB  1 
ATOM   578  C CG1 . VAL A 1 134 ? 103.427 6.565   -137.922 1.00 17.91  ? 134 VAL A CG1 1 
ATOM   579  C CG2 . VAL A 1 134 ? 101.226 7.655   -137.409 1.00 23.43  ? 134 VAL A CG2 1 
ATOM   580  N N   . LEU A 1 135 ? 101.768 10.484  -137.912 1.00 27.56  ? 135 LEU A N   1 
ATOM   581  C CA  . LEU A 1 135 ? 100.824 11.560  -137.625 1.00 28.42  ? 135 LEU A CA  1 
ATOM   582  C C   . LEU A 1 135 ? 101.182 12.877  -138.343 1.00 29.82  ? 135 LEU A C   1 
ATOM   583  O O   . LEU A 1 135 ? 100.323 13.752  -138.513 1.00 30.72  ? 135 LEU A O   1 
ATOM   584  C CB  . LEU A 1 135 ? 100.678 11.759  -136.116 1.00 25.93  ? 135 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 135 ? 99.940  10.621  -135.404 1.00 22.24  ? 135 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 135 ? 100.168 10.704  -133.912 1.00 22.64  ? 135 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 135 ? 98.445  10.632  -135.719 1.00 21.89  ? 135 LEU A CD2 1 
ATOM   588  N N   . LYS A 1 136 ? 102.434 13.019  -138.770 1.00 28.34  ? 136 LYS A N   1 
ATOM   589  C CA  . LYS A 1 136 ? 102.774 14.087  -139.704 1.00 29.44  ? 136 LYS A CA  1 
ATOM   590  C C   . LYS A 1 136 ? 101.987 13.838  -140.985 1.00 27.75  ? 136 LYS A C   1 
ATOM   591  O O   . LYS A 1 136 ? 101.231 14.703  -141.422 1.00 28.42  ? 136 LYS A O   1 
ATOM   592  C CB  . LYS A 1 136 ? 104.281 14.140  -139.993 1.00 28.77  ? 136 LYS A CB  1 
ATOM   593  C CG  . LYS A 1 136 ? 104.741 15.406  -140.731 1.00 28.30  ? 136 LYS A CG  1 
ATOM   594  C CD  . LYS A 1 136 ? 104.473 16.687  -139.921 1.00 28.11  ? 136 LYS A CD  1 
ATOM   595  C CE  . LYS A 1 136 ? 105.409 17.855  -140.307 1.00 26.91  ? 136 LYS A CE  1 
ATOM   596  N NZ  . LYS A 1 136 ? 105.072 18.486  -141.614 1.00 15.02  ? 136 LYS A NZ  1 
ATOM   597  N N   . THR A 1 137 ? 102.138 12.636  -141.542 1.00 27.75  ? 137 THR A N   1 
ATOM   598  C CA  . THR A 1 137 ? 101.439 12.218  -142.766 1.00 30.43  ? 137 THR A CA  1 
ATOM   599  C C   . THR A 1 137 ? 99.911  12.376  -142.705 1.00 31.02  ? 137 THR A C   1 
ATOM   600  O O   . THR A 1 137 ? 99.286  12.748  -143.693 1.00 30.68  ? 137 THR A O   1 
ATOM   601  C CB  . THR A 1 137 ? 101.777 10.748  -143.124 1.00 31.94  ? 137 THR A CB  1 
ATOM   602  O OG1 . THR A 1 137 ? 103.159 10.654  -143.488 1.00 32.72  ? 137 THR A OG1 1 
ATOM   603  C CG2 . THR A 1 137 ? 100.915 10.241  -144.282 1.00 29.02  ? 137 THR A CG2 1 
ATOM   604  N N   . SER A 1 138 ? 99.309  12.103  -141.553 1.00 32.60  ? 138 SER A N   1 
ATOM   605  C CA  . SER A 1 138 ? 97.860  12.256  -141.406 1.00 32.56  ? 138 SER A CA  1 
ATOM   606  C C   . SER A 1 138 ? 97.450  13.711  -141.175 1.00 29.29  ? 138 SER A C   1 
ATOM   607  O O   . SER A 1 138 ? 96.266  14.014  -141.065 1.00 26.80  ? 138 SER A O   1 
ATOM   608  C CB  . SER A 1 138 ? 97.340  11.371  -140.268 1.00 34.47  ? 138 SER A CB  1 
ATOM   609  O OG  . SER A 1 138 ? 98.056  11.598  -139.070 1.00 32.45  ? 138 SER A OG  1 
ATOM   610  N N   . GLY A 1 139 ? 98.427  14.606  -141.084 1.00 31.76  ? 139 GLY A N   1 
ATOM   611  C CA  . GLY A 1 139 ? 98.159  16.025  -140.903 1.00 35.23  ? 139 GLY A CA  1 
ATOM   612  C C   . GLY A 1 139 ? 98.095  16.453  -139.450 1.00 36.49  ? 139 GLY A C   1 
ATOM   613  O O   . GLY A 1 139 ? 98.314  17.619  -139.138 1.00 39.33  ? 139 GLY A O   1 
ATOM   614  N N   . HIS A 1 140 ? 97.817  15.508  -138.558 1.00 36.89  ? 140 HIS A N   1 
ATOM   615  C CA  . HIS A 1 140 ? 97.558  15.823  -137.156 1.00 37.74  ? 140 HIS A CA  1 
ATOM   616  C C   . HIS A 1 140 ? 98.645  16.687  -136.516 1.00 37.44  ? 140 HIS A C   1 
ATOM   617  O O   . HIS A 1 140 ? 98.348  17.621  -135.767 1.00 36.79  ? 140 HIS A O   1 
ATOM   618  C CB  . HIS A 1 140 ? 97.371  14.538  -136.352 1.00 39.26  ? 140 HIS A CB  1 
ATOM   619  C CG  . HIS A 1 140 ? 96.105  13.808  -136.670 1.00 41.41  ? 140 HIS A CG  1 
ATOM   620  N ND1 . HIS A 1 140 ? 96.043  12.797  -137.603 1.00 42.05  ? 140 HIS A ND1 1 
ATOM   621  C CD2 . HIS A 1 140 ? 94.851  13.942  -136.176 1.00 44.15  ? 140 HIS A CD2 1 
ATOM   622  C CE1 . HIS A 1 140 ? 94.806  12.338  -137.671 1.00 43.10  ? 140 HIS A CE1 1 
ATOM   623  N NE2 . HIS A 1 140 ? 94.063  13.014  -136.813 1.00 46.77  ? 140 HIS A NE2 1 
ATOM   624  N N   . VAL A 1 141 ? 99.902  16.395  -136.818 1.00 37.17  ? 141 VAL A N   1 
ATOM   625  C CA  . VAL A 1 141 ? 100.988 17.197  -136.270 1.00 38.08  ? 141 VAL A CA  1 
ATOM   626  C C   . VAL A 1 141 ? 100.751 18.671  -136.623 1.00 38.04  ? 141 VAL A C   1 
ATOM   627  O O   . VAL A 1 141 ? 100.850 19.548  -135.760 1.00 37.66  ? 141 VAL A O   1 
ATOM   628  C CB  . VAL A 1 141 ? 102.378 16.726  -136.768 1.00 36.87  ? 141 VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 141 ? 103.483 17.580  -136.155 1.00 31.84  ? 141 VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 141 ? 102.598 15.247  -136.431 1.00 27.17  ? 141 VAL A CG2 1 
ATOM   631  N N   . ASP A 1 142 ? 100.394 18.925  -137.879 1.00 38.08  ? 142 ASP A N   1 
ATOM   632  C CA  . ASP A 1 142 ? 100.190 20.291  -138.365 1.00 39.19  ? 142 ASP A CA  1 
ATOM   633  C C   . ASP A 1 142 ? 98.848  20.891  -137.938 1.00 37.80  ? 142 ASP A C   1 
ATOM   634  O O   . ASP A 1 142 ? 98.802  22.022  -137.461 1.00 35.28  ? 142 ASP A O   1 
ATOM   635  C CB  . ASP A 1 142 ? 100.293 20.338  -139.896 1.00 40.84  ? 142 ASP A CB  1 
ATOM   636  C CG  . ASP A 1 142 ? 101.685 19.984  -140.406 1.00 47.56  ? 142 ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 142 ? 102.646 20.732  -140.114 1.00 45.75  ? 142 ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 142 ? 101.812 18.963  -141.116 1.00 55.14  ? 142 ASP A OD2 1 
ATOM   639  N N   . LYS A 1 143 ? 97.765  20.130  -138.097 1.00 39.60  ? 143 LYS A N   1 
ATOM   640  C CA  . LYS A 1 143 ? 96.410  20.702  -138.098 1.00 39.35  ? 143 LYS A CA  1 
ATOM   641  C C   . LYS A 1 143 ? 95.473  20.262  -136.969 1.00 37.25  ? 143 LYS A C   1 
ATOM   642  O O   . LYS A 1 143 ? 94.353  20.760  -136.894 1.00 41.52  ? 143 LYS A O   1 
ATOM   643  C CB  . LYS A 1 143 ? 95.721  20.396  -139.435 1.00 40.55  ? 143 LYS A CB  1 
ATOM   644  C CG  . LYS A 1 143 ? 96.455  20.909  -140.669 1.00 42.68  ? 143 LYS A CG  1 
ATOM   645  C CD  . LYS A 1 143 ? 95.655  20.656  -141.944 1.00 44.25  ? 143 LYS A CD  1 
ATOM   646  C CE  . LYS A 1 143 ? 95.503  19.159  -142.243 1.00 48.37  ? 143 LYS A CE  1 
ATOM   647  N NZ  . LYS A 1 143 ? 94.658  18.890  -143.444 1.00 46.91  ? 143 LYS A NZ  1 
ATOM   648  N N   . PHE A 1 144 ? 95.894  19.339  -136.109 1.00 33.47  ? 144 PHE A N   1 
ATOM   649  C CA  . PHE A 1 144 ? 95.050  18.908  -134.989 1.00 32.16  ? 144 PHE A CA  1 
ATOM   650  C C   . PHE A 1 144 ? 95.342  19.768  -133.761 1.00 31.37  ? 144 PHE A C   1 
ATOM   651  O O   . PHE A 1 144 ? 95.988  19.331  -132.809 1.00 32.30  ? 144 PHE A O   1 
ATOM   652  C CB  . PHE A 1 144 ? 95.276  17.431  -134.688 1.00 32.78  ? 144 PHE A CB  1 
ATOM   653  C CG  . PHE A 1 144 ? 94.269  16.846  -133.751 1.00 33.50  ? 144 PHE A CG  1 
ATOM   654  C CD1 . PHE A 1 144 ? 92.996  16.536  -134.196 1.00 36.81  ? 144 PHE A CD1 1 
ATOM   655  C CD2 . PHE A 1 144 ? 94.591  16.593  -132.431 1.00 34.84  ? 144 PHE A CD2 1 
ATOM   656  C CE1 . PHE A 1 144 ? 92.060  15.984  -133.340 1.00 32.05  ? 144 PHE A CE1 1 
ATOM   657  C CE2 . PHE A 1 144 ? 93.658  16.045  -131.570 1.00 33.92  ? 144 PHE A CE2 1 
ATOM   658  C CZ  . PHE A 1 144 ? 92.389  15.740  -132.028 1.00 32.36  ? 144 PHE A CZ  1 
ATOM   659  N N   . ALA A 1 145 ? 94.860  21.005  -133.800 1.00 31.70  ? 145 ALA A N   1 
ATOM   660  C CA  . ALA A 1 145 ? 95.159  21.992  -132.768 1.00 31.02  ? 145 ALA A CA  1 
ATOM   661  C C   . ALA A 1 145 ? 94.009  22.982  -132.581 1.00 31.05  ? 145 ALA A C   1 
ATOM   662  O O   . ALA A 1 145 ? 93.124  23.095  -133.431 1.00 32.73  ? 145 ALA A O   1 
ATOM   663  C CB  . ALA A 1 145 ? 96.435  22.731  -133.122 1.00 30.71  ? 145 ALA A CB  1 
ATOM   664  N N   . ASP A 1 146 ? 94.029  23.683  -131.451 1.00 32.13  ? 146 ASP A N   1 
ATOM   665  C CA  . ASP A 1 146 ? 93.030  24.699  -131.129 1.00 31.64  ? 146 ASP A CA  1 
ATOM   666  C C   . ASP A 1 146 ? 93.734  26.020  -130.884 1.00 31.83  ? 146 ASP A C   1 
ATOM   667  O O   . ASP A 1 146 ? 94.834  26.052  -130.326 1.00 32.44  ? 146 ASP A O   1 
ATOM   668  C CB  . ASP A 1 146 ? 92.246  24.314  -129.866 1.00 31.96  ? 146 ASP A CB  1 
ATOM   669  C CG  . ASP A 1 146 ? 91.222  23.220  -130.107 1.00 34.52  ? 146 ASP A CG  1 
ATOM   670  O OD1 . ASP A 1 146 ? 90.721  23.089  -131.245 1.00 45.65  ? 146 ASP A OD1 1 
ATOM   671  O OD2 . ASP A 1 146 ? 90.905  22.495  -129.139 1.00 35.70  ? 146 ASP A OD2 1 
ATOM   672  N N   . PHE A 1 147 ? 93.095  27.113  -131.286 1.00 32.55  ? 147 PHE A N   1 
ATOM   673  C CA  . PHE A 1 147 ? 93.623  28.432  -130.991 1.00 32.74  ? 147 PHE A CA  1 
ATOM   674  C C   . PHE A 1 147 ? 93.474  28.736  -129.505 1.00 34.13  ? 147 PHE A C   1 
ATOM   675  O O   . PHE A 1 147 ? 92.420  28.492  -128.906 1.00 34.62  ? 147 PHE A O   1 
ATOM   676  C CB  . PHE A 1 147 ? 92.940  29.503  -131.833 1.00 33.69  ? 147 PHE A CB  1 
ATOM   677  C CG  . PHE A 1 147 ? 93.368  29.496  -133.267 1.00 34.17  ? 147 PHE A CG  1 
ATOM   678  C CD1 . PHE A 1 147 ? 92.443  29.305  -134.284 1.00 34.89  ? 147 PHE A CD1 1 
ATOM   679  C CD2 . PHE A 1 147 ? 94.704  29.670  -133.602 1.00 37.52  ? 147 PHE A CD2 1 
ATOM   680  C CE1 . PHE A 1 147 ? 92.840  29.299  -135.614 1.00 34.45  ? 147 PHE A CE1 1 
ATOM   681  C CE2 . PHE A 1 147 ? 95.111  29.661  -134.931 1.00 38.00  ? 147 PHE A CE2 1 
ATOM   682  C CZ  . PHE A 1 147 ? 94.176  29.475  -135.938 1.00 34.99  ? 147 PHE A CZ  1 
ATOM   683  N N   . MET A 1 148 ? 94.546  29.271  -128.930 1.00 34.25  ? 148 MET A N   1 
ATOM   684  C CA  . MET A 1 148 ? 94.650  29.494  -127.500 1.00 33.99  ? 148 MET A CA  1 
ATOM   685  C C   . MET A 1 148 ? 95.294  30.855  -127.227 1.00 36.49  ? 148 MET A C   1 
ATOM   686  O O   . MET A 1 148 ? 96.447  31.096  -127.594 1.00 36.87  ? 148 MET A O   1 
ATOM   687  C CB  . MET A 1 148 ? 95.495  28.378  -126.883 1.00 32.34  ? 148 MET A CB  1 
ATOM   688  C CG  . MET A 1 148 ? 95.694  28.462  -125.371 1.00 32.54  ? 148 MET A CG  1 
ATOM   689  S SD  . MET A 1 148 ? 96.824  27.194  -124.737 1.00 26.98  ? 148 MET A SD  1 
ATOM   690  C CE  . MET A 1 148 ? 98.350  27.598  -125.592 1.00 20.68  ? 148 MET A CE  1 
ATOM   691  N N   . VAL A 1 149 ? 94.538  31.748  -126.603 1.00 39.57  ? 149 VAL A N   1 
ATOM   692  C CA  . VAL A 1 149 ? 95.109  32.965  -126.034 1.00 41.79  ? 149 VAL A CA  1 
ATOM   693  C C   . VAL A 1 149 ? 95.396  32.695  -124.564 1.00 43.51  ? 149 VAL A C   1 
ATOM   694  O O   . VAL A 1 149 ? 94.787  31.806  -123.961 1.00 44.99  ? 149 VAL A O   1 
ATOM   695  C CB  . VAL A 1 149 ? 94.154  34.170  -126.152 1.00 43.74  ? 149 VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 149 ? 93.976  34.569  -127.611 1.00 43.97  ? 149 VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 149 ? 92.804  33.866  -125.486 1.00 44.23  ? 149 VAL A CG2 1 
ATOM   698  N N   . LYS A 1 150 ? 96.325  33.452  -123.990 1.00 43.19  ? 150 LYS A N   1 
ATOM   699  C CA  . LYS A 1 150 ? 96.594  33.355  -122.558 1.00 44.86  ? 150 LYS A CA  1 
ATOM   700  C C   . LYS A 1 150 ? 96.781  34.721  -121.930 1.00 44.95  ? 150 LYS A C   1 
ATOM   701  O O   . LYS A 1 150 ? 97.201  35.669  -122.594 1.00 48.31  ? 150 LYS A O   1 
ATOM   702  C CB  . LYS A 1 150 ? 97.790  32.433  -122.254 1.00 46.49  ? 150 LYS A CB  1 
ATOM   703  C CG  . LYS A 1 150 ? 98.944  32.476  -123.248 1.00 46.40  ? 150 LYS A CG  1 
ATOM   704  C CD  . LYS A 1 150 ? 99.934  31.347  -122.973 1.00 43.45  ? 150 LYS A CD  1 
ATOM   705  C CE  . LYS A 1 150 ? 101.000 31.244  -124.057 1.00 45.12  ? 150 LYS A CE  1 
ATOM   706  N NZ  . LYS A 1 150 ? 101.984 32.366  -124.012 1.00 41.71  ? 150 LYS A NZ  1 
ATOM   707  N N   . ASP A 1 151 ? 96.448  34.804  -120.644 1.00 45.52  ? 151 ASP A N   1 
ATOM   708  C CA  . ASP A 1 151 ? 96.475  36.056  -119.884 1.00 46.44  ? 151 ASP A CA  1 
ATOM   709  C C   . ASP A 1 151 ? 97.920  36.501  -119.622 1.00 47.23  ? 151 ASP A C   1 
ATOM   710  O O   . ASP A 1 151 ? 98.710  35.760  -119.031 1.00 48.68  ? 151 ASP A O   1 
ATOM   711  C CB  . ASP A 1 151 ? 95.705  35.861  -118.570 1.00 45.76  ? 151 ASP A CB  1 
ATOM   712  C CG  . ASP A 1 151 ? 95.522  37.147  -117.790 1.00 42.38  ? 151 ASP A CG  1 
ATOM   713  O OD1 . ASP A 1 151 ? 94.360  37.484  -117.488 1.00 42.11  ? 151 ASP A OD1 1 
ATOM   714  O OD2 . ASP A 1 151 ? 96.528  37.811  -117.461 1.00 32.12  ? 151 ASP A OD2 1 
ATOM   715  N N   . VAL A 1 152 ? 98.254  37.716  -120.057 1.00 45.69  ? 152 VAL A N   1 
ATOM   716  C CA  . VAL A 1 152 ? 99.639  38.197  -120.031 1.00 44.42  ? 152 VAL A CA  1 
ATOM   717  C C   . VAL A 1 152 ? 100.135 38.477  -118.607 1.00 44.47  ? 152 VAL A C   1 
ATOM   718  O O   . VAL A 1 152 ? 101.242 38.072  -118.243 1.00 44.13  ? 152 VAL A O   1 
ATOM   719  C CB  . VAL A 1 152 ? 99.818  39.465  -120.905 1.00 43.67  ? 152 VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 152 ? 101.263 39.954  -120.851 1.00 42.06  ? 152 VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 152 ? 99.401  39.185  -122.346 1.00 40.18  ? 152 VAL A CG2 1 
ATOM   722  N N   . LYS A 1 153 ? 99.317  39.162  -117.809 1.00 43.54  ? 153 LYS A N   1 
ATOM   723  C CA  . LYS A 1 153 ? 99.686  39.508  -116.433 1.00 42.14  ? 153 LYS A CA  1 
ATOM   724  C C   . LYS A 1 153 ? 99.568  38.286  -115.514 1.00 41.81  ? 153 LYS A C   1 
ATOM   725  O O   . LYS A 1 153 ? 100.427 38.060  -114.662 1.00 43.07  ? 153 LYS A O   1 
ATOM   726  C CB  . LYS A 1 153 ? 98.835  40.680  -115.918 1.00 41.96  ? 153 LYS A CB  1 
ATOM   727  C CG  . LYS A 1 153 ? 99.002  41.970  -116.740 1.00 40.36  ? 153 LYS A CG  1 
ATOM   728  C CD  . LYS A 1 153 ? 97.943  43.027  -116.420 1.00 40.86  ? 153 LYS A CD  1 
ATOM   729  C CE  . LYS A 1 153 ? 98.451  44.075  -115.438 1.00 42.62  ? 153 LYS A CE  1 
ATOM   730  N NZ  . LYS A 1 153 ? 99.005  43.467  -114.198 1.00 44.83  ? 153 LYS A NZ  1 
ATOM   731  N N   . ASN A 1 154 ? 98.509  37.499  -115.698 1.00 40.63  ? 154 ASN A N   1 
ATOM   732  C CA  . ASN A 1 154 ? 98.347  36.234  -114.979 1.00 39.18  ? 154 ASN A CA  1 
ATOM   733  C C   . ASN A 1 154 ? 99.230  35.147  -115.611 1.00 38.35  ? 154 ASN A C   1 
ATOM   734  O O   . ASN A 1 154 ? 100.352 34.928  -115.157 1.00 38.20  ? 154 ASN A O   1 
ATOM   735  C CB  . ASN A 1 154 ? 96.858  35.828  -114.936 1.00 40.28  ? 154 ASN A CB  1 
ATOM   736  C CG  . ASN A 1 154 ? 96.620  34.459  -114.305 1.00 39.84  ? 154 ASN A CG  1 
ATOM   737  O OD1 . ASN A 1 154 ? 97.471  33.920  -113.597 1.00 40.11  ? 154 ASN A OD1 1 
ATOM   738  N ND2 . ASN A 1 154 ? 95.446  33.894  -114.563 1.00 34.61  ? 154 ASN A ND2 1 
ATOM   739  N N   . GLY A 1 155 ? 98.740  34.505  -116.673 1.00 36.67  ? 155 GLY A N   1 
ATOM   740  C CA  . GLY A 1 155 ? 99.399  33.334  -117.263 1.00 34.40  ? 155 GLY A CA  1 
ATOM   741  C C   . GLY A 1 155 ? 98.469  32.196  -117.670 1.00 32.50  ? 155 GLY A C   1 
ATOM   742  O O   . GLY A 1 155 ? 98.905  31.263  -118.347 1.00 29.00  ? 155 GLY A O   1 
ATOM   743  N N   . GLU A 1 156 ? 97.197  32.264  -117.265 1.00 32.10  ? 156 GLU A N   1 
ATOM   744  C CA  . GLU A 1 156 ? 96.227  31.188  -117.521 1.00 32.94  ? 156 GLU A CA  1 
ATOM   745  C C   . GLU A 1 156 ? 95.870  31.053  -119.004 1.00 31.36  ? 156 GLU A C   1 
ATOM   746  O O   . GLU A 1 156 ? 95.975  32.019  -119.758 1.00 26.29  ? 156 GLU A O   1 
ATOM   747  C CB  . GLU A 1 156 ? 94.952  31.407  -116.692 1.00 33.45  ? 156 GLU A CB  1 
ATOM   748  C CG  . GLU A 1 156 ? 93.950  30.241  -116.740 1.00 33.39  ? 156 GLU A CG  1 
ATOM   749  C CD  . GLU A 1 156 ? 92.919  30.283  -115.618 1.00 34.70  ? 156 GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 156 ? 91.722  30.068  -115.900 1.00 27.63  ? 156 GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 156 ? 93.303  30.527  -114.453 1.00 42.64  ? 156 GLU A OE2 1 
ATOM   752  N N   . CYS A 1 157 ? 95.450  29.847  -119.399 1.00 32.56  ? 157 CYS A N   1 
ATOM   753  C CA  . CYS A 1 157 ? 95.121  29.529  -120.793 1.00 32.62  ? 157 CYS A CA  1 
ATOM   754  C C   . CYS A 1 157 ? 93.631  29.371  -121.040 1.00 31.83  ? 157 CYS A C   1 
ATOM   755  O O   . CYS A 1 157 ? 92.900  28.830  -120.207 1.00 28.55  ? 157 CYS A O   1 
ATOM   756  C CB  . CYS A 1 157 ? 95.802  28.236  -121.213 1.00 32.70  ? 157 CYS A CB  1 
ATOM   757  S SG  . CYS A 1 157 ? 97.565  28.397  -121.375 1.00 42.75  ? 157 CYS A SG  1 
ATOM   758  N N   . PHE A 1 158 ? 93.200  29.823  -122.214 1.00 33.69  ? 158 PHE A N   1 
ATOM   759  C CA  . PHE A 1 158 ? 91.800  29.766  -122.611 1.00 33.81  ? 158 PHE A CA  1 
ATOM   760  C C   . PHE A 1 158 ? 91.673  29.350  -124.072 1.00 31.69  ? 158 PHE A C   1 
ATOM   761  O O   . PHE A 1 158 ? 92.517  29.693  -124.907 1.00 24.29  ? 158 PHE A O   1 
ATOM   762  C CB  . PHE A 1 158 ? 91.142  31.133  -122.405 1.00 37.25  ? 158 PHE A CB  1 
ATOM   763  C CG  . PHE A 1 158 ? 91.339  31.695  -121.029 1.00 34.88  ? 158 PHE A CG  1 
ATOM   764  C CD1 . PHE A 1 158 ? 92.416  32.528  -120.755 1.00 35.83  ? 158 PHE A CD1 1 
ATOM   765  C CD2 . PHE A 1 158 ? 90.456  31.380  -120.004 1.00 36.64  ? 158 PHE A CD2 1 
ATOM   766  C CE1 . PHE A 1 158 ? 92.608  33.045  -119.479 1.00 40.28  ? 158 PHE A CE1 1 
ATOM   767  C CE2 . PHE A 1 158 ? 90.638  31.891  -118.723 1.00 38.84  ? 158 PHE A CE2 1 
ATOM   768  C CZ  . PHE A 1 158 ? 91.716  32.726  -118.460 1.00 40.56  ? 158 PHE A CZ  1 
ATOM   769  N N   . ARG A 1 159 ? 90.615  28.603  -124.370 1.00 32.77  ? 159 ARG A N   1 
ATOM   770  C CA  . ARG A 1 159 ? 90.318  28.213  -125.738 1.00 33.46  ? 159 ARG A CA  1 
ATOM   771  C C   . ARG A 1 159 ? 89.730  29.431  -126.424 1.00 30.45  ? 159 ARG A C   1 
ATOM   772  O O   . ARG A 1 159 ? 88.720  29.978  -125.976 1.00 26.89  ? 159 ARG A O   1 
ATOM   773  C CB  . ARG A 1 159 ? 89.345  27.034  -125.774 1.00 34.03  ? 159 ARG A CB  1 
ATOM   774  C CG  . ARG A 1 159 ? 89.264  26.333  -127.122 1.00 35.25  ? 159 ARG A CG  1 
ATOM   775  C CD  . ARG A 1 159 ? 88.545  25.004  -126.992 1.00 41.16  ? 159 ARG A CD  1 
ATOM   776  N NE  . ARG A 1 159 ? 88.235  24.404  -128.288 1.00 44.77  ? 159 ARG A NE  1 
ATOM   777  C CZ  . ARG A 1 159 ? 87.120  24.620  -128.987 1.00 52.18  ? 159 ARG A CZ  1 
ATOM   778  N NH1 . ARG A 1 159 ? 86.166  25.436  -128.538 1.00 52.45  ? 159 ARG A NH1 1 
ATOM   779  N NH2 . ARG A 1 159 ? 86.957  24.007  -130.156 1.00 52.67  ? 159 ARG A NH2 1 
ATOM   780  N N   . ALA A 1 160 ? 90.375  29.856  -127.504 1.00 28.47  ? 160 ALA A N   1 
ATOM   781  C CA  . ALA A 1 160 ? 90.070  31.137  -128.112 1.00 30.08  ? 160 ALA A CA  1 
ATOM   782  C C   . ALA A 1 160 ? 88.624  31.217  -128.549 1.00 28.22  ? 160 ALA A C   1 
ATOM   783  O O   . ALA A 1 160 ? 87.875  32.063  -128.068 1.00 27.84  ? 160 ALA A O   1 
ATOM   784  C CB  . ALA A 1 160 ? 90.987  31.394  -129.289 1.00 31.47  ? 160 ALA A CB  1 
ATOM   785  N N   . ASP A 1 161 ? 88.229  30.325  -129.447 1.00 29.73  ? 161 ASP A N   1 
ATOM   786  C CA  . ASP A 1 161 ? 86.946  30.482  -130.128 1.00 34.06  ? 161 ASP A CA  1 
ATOM   787  C C   . ASP A 1 161 ? 85.776  30.645  -129.165 1.00 36.55  ? 161 ASP A C   1 
ATOM   788  O O   . ASP A 1 161 ? 84.972  31.553  -129.342 1.00 39.26  ? 161 ASP A O   1 
ATOM   789  C CB  . ASP A 1 161 ? 86.680  29.364  -131.149 1.00 32.06  ? 161 ASP A CB  1 
ATOM   790  C CG  . ASP A 1 161 ? 86.900  27.977  -130.587 1.00 33.32  ? 161 ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 161 ? 86.903  27.026  -131.394 1.00 32.51  ? 161 ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 161 ? 87.073  27.834  -129.359 1.00 31.96  ? 161 ASP A OD2 1 
ATOM   793  N N   . HIS A 1 162 ? 85.676  29.801  -128.141 1.00 41.74  ? 162 HIS A N   1 
ATOM   794  C CA  . HIS A 1 162 ? 84.523  29.907  -127.236 1.00 45.21  ? 162 HIS A CA  1 
ATOM   795  C C   . HIS A 1 162 ? 84.695  30.979  -126.143 1.00 42.88  ? 162 HIS A C   1 
ATOM   796  O O   . HIS A 1 162 ? 83.711  31.402  -125.532 1.00 42.90  ? 162 HIS A O   1 
ATOM   797  C CB  . HIS A 1 162 ? 84.053  28.532  -126.689 1.00 53.04  ? 162 HIS A CB  1 
ATOM   798  C CG  . HIS A 1 162 ? 84.974  27.890  -125.693 1.00 65.03  ? 162 HIS A CG  1 
ATOM   799  N ND1 . HIS A 1 162 ? 85.671  28.604  -124.741 1.00 74.18  ? 162 HIS A ND1 1 
ATOM   800  C CD2 . HIS A 1 162 ? 85.259  26.585  -125.466 1.00 69.66  ? 162 HIS A CD2 1 
ATOM   801  C CE1 . HIS A 1 162 ? 86.372  27.769  -123.993 1.00 74.78  ? 162 HIS A CE1 1 
ATOM   802  N NE2 . HIS A 1 162 ? 86.140  26.537  -124.413 1.00 74.45  ? 162 HIS A NE2 1 
ATOM   803  N N   . LEU A 1 163 ? 85.925  31.439  -125.922 1.00 38.25  ? 163 LEU A N   1 
ATOM   804  C CA  . LEU A 1 163 ? 86.161  32.603  -125.057 1.00 38.26  ? 163 LEU A CA  1 
ATOM   805  C C   . LEU A 1 163 ? 85.699  33.879  -125.765 1.00 36.61  ? 163 LEU A C   1 
ATOM   806  O O   . LEU A 1 163 ? 85.042  34.730  -125.165 1.00 36.98  ? 163 LEU A O   1 
ATOM   807  C CB  . LEU A 1 163 ? 87.642  32.705  -124.666 1.00 38.90  ? 163 LEU A CB  1 
ATOM   808  C CG  . LEU A 1 163 ? 88.110  33.834  -123.728 1.00 35.50  ? 163 LEU A CG  1 
ATOM   809  C CD1 . LEU A 1 163 ? 88.629  35.012  -124.513 1.00 32.99  ? 163 LEU A CD1 1 
ATOM   810  C CD2 . LEU A 1 163 ? 87.024  34.281  -122.752 1.00 35.96  ? 163 LEU A CD2 1 
ATOM   811  N N   . LEU A 1 164 ? 86.052  33.993  -127.043 1.00 32.59  ? 164 LEU A N   1 
ATOM   812  C CA  . LEU A 1 164 ? 85.564  35.060  -127.911 1.00 30.25  ? 164 LEU A CA  1 
ATOM   813  C C   . LEU A 1 164 ? 84.033  35.024  -127.998 1.00 26.53  ? 164 LEU A C   1 
ATOM   814  O O   . LEU A 1 164 ? 83.367  36.011  -127.713 1.00 22.72  ? 164 LEU A O   1 
ATOM   815  C CB  . LEU A 1 164 ? 86.203  34.903  -129.300 1.00 33.16  ? 164 LEU A CB  1 
ATOM   816  C CG  . LEU A 1 164 ? 85.852  35.824  -130.479 1.00 35.96  ? 164 LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 164 ? 84.536  35.402  -131.136 1.00 37.92  ? 164 LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 164 ? 85.823  37.292  -130.063 1.00 36.05  ? 164 LEU A CD2 1 
ATOM   819  N N   . LYS A 1 165 ? 83.490  33.869  -128.373 1.00 29.26  ? 165 LYS A N   1 
ATOM   820  C CA  . LYS A 1 165 ? 82.039  33.639  -128.440 1.00 29.28  ? 165 LYS A CA  1 
ATOM   821  C C   . LYS A 1 165 ? 81.313  34.138  -127.184 1.00 30.57  ? 165 LYS A C   1 
ATOM   822  O O   . LYS A 1 165 ? 80.213  34.692  -127.274 1.00 28.83  ? 165 LYS A O   1 
ATOM   823  C CB  . LYS A 1 165 ? 81.783  32.140  -128.633 1.00 29.03  ? 165 LYS A CB  1 
ATOM   824  C CG  . LYS A 1 165 ? 80.344  31.724  -128.909 1.00 32.58  ? 165 LYS A CG  1 
ATOM   825  C CD  . LYS A 1 165 ? 80.276  30.204  -129.168 1.00 31.98  ? 165 LYS A CD  1 
ATOM   826  C CE  . LYS A 1 165 ? 78.848  29.671  -129.214 1.00 27.38  ? 165 LYS A CE  1 
ATOM   827  N NZ  . LYS A 1 165 ? 78.135  29.810  -127.912 1.00 26.18  ? 165 LYS A NZ  1 
ATOM   828  N N   . ALA A 1 166 ? 81.943  33.932  -126.024 1.00 30.48  ? 166 ALA A N   1 
ATOM   829  C CA  . ALA A 1 166 ? 81.442  34.414  -124.730 1.00 28.54  ? 166 ALA A CA  1 
ATOM   830  C C   . ALA A 1 166 ? 81.309  35.940  -124.681 1.00 29.58  ? 166 ALA A C   1 
ATOM   831  O O   . ALA A 1 166 ? 80.319  36.474  -124.171 1.00 28.31  ? 166 ALA A O   1 
ATOM   832  C CB  . ALA A 1 166 ? 82.364  33.940  -123.611 1.00 23.36  ? 166 ALA A CB  1 
ATOM   833  N N   . HIS A 1 167 ? 82.320  36.628  -125.206 1.00 30.79  ? 167 HIS A N   1 
ATOM   834  C CA  . HIS A 1 167 ? 82.341  38.093  -125.263 1.00 30.39  ? 167 HIS A CA  1 
ATOM   835  C C   . HIS A 1 167 ? 81.215  38.607  -126.159 1.00 28.94  ? 167 HIS A C   1 
ATOM   836  O O   . HIS A 1 167 ? 80.477  39.514  -125.781 1.00 24.77  ? 167 HIS A O   1 
ATOM   837  C CB  . HIS A 1 167 ? 83.697  38.570  -125.800 1.00 32.25  ? 167 HIS A CB  1 
ATOM   838  C CG  . HIS A 1 167 ? 84.073  39.953  -125.373 1.00 34.25  ? 167 HIS A CG  1 
ATOM   839  N ND1 . HIS A 1 167 ? 83.872  41.059  -126.170 1.00 43.27  ? 167 HIS A ND1 1 
ATOM   840  C CD2 . HIS A 1 167 ? 84.654  40.406  -124.238 1.00 37.42  ? 167 HIS A CD2 1 
ATOM   841  C CE1 . HIS A 1 167 ? 84.304  42.137  -125.539 1.00 42.21  ? 167 HIS A CE1 1 
ATOM   842  N NE2 . HIS A 1 167 ? 84.785  41.768  -124.365 1.00 38.28  ? 167 HIS A NE2 1 
ATOM   843  N N   . LEU A 1 168 ? 81.077  37.994  -127.336 1.00 30.96  ? 168 LEU A N   1 
ATOM   844  C CA  . LEU A 1 168 ? 80.054  38.374  -128.313 1.00 33.41  ? 168 LEU A CA  1 
ATOM   845  C C   . LEU A 1 168 ? 78.675  37.795  -127.987 1.00 37.49  ? 168 LEU A C   1 
ATOM   846  O O   . LEU A 1 168 ? 77.840  37.637  -128.877 1.00 40.71  ? 168 LEU A O   1 
ATOM   847  C CB  . LEU A 1 168 ? 80.453  37.914  -129.723 1.00 31.36  ? 168 LEU A CB  1 
ATOM   848  C CG  . LEU A 1 168 ? 81.810  38.324  -130.292 1.00 25.56  ? 168 LEU A CG  1 
ATOM   849  C CD1 . LEU A 1 168 ? 81.935  37.819  -131.715 1.00 12.56  ? 168 LEU A CD1 1 
ATOM   850  C CD2 . LEU A 1 168 ? 81.989  39.830  -130.246 1.00 36.23  ? 168 LEU A CD2 1 
ATOM   851  N N   . GLN A 1 169 ? 78.446  37.436  -126.732 1.00 38.46  ? 169 GLN A N   1 
ATOM   852  C CA  . GLN A 1 169 ? 77.106  37.113  -126.271 1.00 40.68  ? 169 GLN A CA  1 
ATOM   853  C C   . GLN A 1 169 ? 76.686  38.066  -125.152 1.00 42.04  ? 169 GLN A C   1 
ATOM   854  O O   . GLN A 1 169 ? 75.493  38.237  -124.901 1.00 41.61  ? 169 GLN A O   1 
ATOM   855  C CB  . GLN A 1 169 ? 77.029  35.634  -125.876 1.00 42.32  ? 169 GLN A CB  1 
ATOM   856  C CG  . GLN A 1 169 ? 76.992  34.715  -127.122 1.00 45.00  ? 169 GLN A CG  1 
ATOM   857  C CD  . GLN A 1 169 ? 77.399  33.261  -126.866 1.00 42.17  ? 169 GLN A CD  1 
ATOM   858  O OE1 . GLN A 1 169 ? 76.821  32.334  -127.445 1.00 29.18  ? 169 GLN A OE1 1 
ATOM   859  N NE2 . GLN A 1 169 ? 78.408  33.060  -126.021 1.00 40.01  ? 169 GLN A NE2 1 
ATOM   860  N N   . LYS A 1 170 ? 77.668  38.700  -124.505 1.00 43.72  ? 170 LYS A N   1 
ATOM   861  C CA  . LYS A 1 170 ? 77.417  39.821  -123.597 1.00 44.15  ? 170 LYS A CA  1 
ATOM   862  C C   . LYS A 1 170 ? 77.056  41.052  -124.417 1.00 43.96  ? 170 LYS A C   1 
ATOM   863  O O   . LYS A 1 170 ? 76.037  41.702  -124.176 1.00 43.45  ? 170 LYS A O   1 
ATOM   864  C CB  . LYS A 1 170 ? 78.656  40.137  -122.746 1.00 43.97  ? 170 LYS A CB  1 
ATOM   865  C CG  . LYS A 1 170 ? 79.133  39.009  -121.830 1.00 47.89  ? 170 LYS A CG  1 
ATOM   866  C CD  . LYS A 1 170 ? 78.118  38.636  -120.740 1.00 50.84  ? 170 LYS A CD  1 
ATOM   867  C CE  . LYS A 1 170 ? 77.988  39.706  -119.657 1.00 49.50  ? 170 LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 170 ? 79.221  39.839  -118.837 1.00 47.52  ? 170 LYS A NZ  1 
ATOM   869  N N   . LEU A 1 171 ? 77.910  41.361  -125.389 1.00 43.43  ? 171 LEU A N   1 
ATOM   870  C CA  . LEU A 1 171 ? 77.699  42.495  -126.279 1.00 43.56  ? 171 LEU A CA  1 
ATOM   871  C C   . LEU A 1 171 ? 76.449  42.275  -127.133 1.00 46.06  ? 171 LEU A C   1 
ATOM   872  O O   . LEU A 1 171 ? 75.656  43.200  -127.332 1.00 47.42  ? 171 LEU A O   1 
ATOM   873  C CB  . LEU A 1 171 ? 78.928  42.712  -127.174 1.00 42.11  ? 171 LEU A CB  1 
ATOM   874  C CG  . LEU A 1 171 ? 80.271  42.987  -126.478 1.00 35.29  ? 171 LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 171 ? 81.406  43.107  -127.494 1.00 26.87  ? 171 LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 171 ? 80.198  44.237  -125.622 1.00 29.34  ? 171 LEU A CD2 1 
ATOM   877  N N   . MET A 1 172 ? 76.280  41.046  -127.623 1.00 47.31  ? 172 MET A N   1 
ATOM   878  C CA  . MET A 1 172 ? 75.089  40.657  -128.384 1.00 45.40  ? 172 MET A CA  1 
ATOM   879  C C   . MET A 1 172 ? 73.818  40.906  -127.574 1.00 44.81  ? 172 MET A C   1 
ATOM   880  O O   . MET A 1 172 ? 72.862  41.505  -128.070 1.00 44.29  ? 172 MET A O   1 
ATOM   881  C CB  . MET A 1 172 ? 75.165  39.176  -128.762 1.00 47.64  ? 172 MET A CB  1 
ATOM   882  C CG  . MET A 1 172 ? 74.284  38.774  -129.932 1.00 50.46  ? 172 MET A CG  1 
ATOM   883  S SD  . MET A 1 172 ? 75.186  38.713  -131.492 1.00 56.41  ? 172 MET A SD  1 
ATOM   884  C CE  . MET A 1 172 ? 75.990  37.120  -131.355 1.00 52.72  ? 172 MET A CE  1 
ATOM   885  N N   . SER A 1 173 ? 73.822  40.449  -126.325 1.00 42.56  ? 173 SER A N   1 
ATOM   886  C CA  . SER A 1 173 ? 72.689  40.644  -125.431 1.00 40.88  ? 173 SER A CA  1 
ATOM   887  C C   . SER A 1 173 ? 72.901  41.879  -124.565 1.00 38.31  ? 173 SER A C   1 
ATOM   888  O O   . SER A 1 173 ? 73.334  41.784  -123.416 1.00 36.20  ? 173 SER A O   1 
ATOM   889  C CB  . SER A 1 173 ? 72.478  39.403  -124.567 1.00 40.81  ? 173 SER A CB  1 
ATOM   890  O OG  . SER A 1 173 ? 72.265  38.267  -125.384 1.00 43.33  ? 173 SER A OG  1 
ATOM   891  N N   . ASP A 1 174 ? 72.604  43.040  -125.143 1.00 36.81  ? 174 ASP A N   1 
ATOM   892  C CA  . ASP A 1 174 ? 72.655  44.315  -124.429 1.00 37.50  ? 174 ASP A CA  1 
ATOM   893  C C   . ASP A 1 174 ? 71.679  45.300  -125.079 1.00 36.86  ? 174 ASP A C   1 
ATOM   894  O O   . ASP A 1 174 ? 71.681  45.474  -126.300 1.00 35.23  ? 174 ASP A O   1 
ATOM   895  C CB  . ASP A 1 174 ? 74.084  44.887  -124.440 1.00 36.43  ? 174 ASP A CB  1 
ATOM   896  C CG  . ASP A 1 174 ? 74.254  46.106  -123.521 1.00 34.47  ? 174 ASP A CG  1 
ATOM   897  O OD1 . ASP A 1 174 ? 73.338  46.411  -122.725 1.00 35.46  ? 174 ASP A OD1 1 
ATOM   898  O OD2 . ASP A 1 174 ? 75.316  46.761  -123.593 1.00 21.64  ? 174 ASP A OD2 1 
ATOM   899  N N   . LYS A 1 175 ? 70.837  45.930  -124.261 1.00 36.26  ? 175 LYS A N   1 
ATOM   900  C CA  . LYS A 1 175 ? 69.915  46.955  -124.754 1.00 35.45  ? 175 LYS A CA  1 
ATOM   901  C C   . LYS A 1 175 ? 70.677  48.163  -125.308 1.00 35.30  ? 175 LYS A C   1 
ATOM   902  O O   . LYS A 1 175 ? 70.246  48.777  -126.284 1.00 34.71  ? 175 LYS A O   1 
ATOM   903  C CB  . LYS A 1 175 ? 68.936  47.405  -123.656 1.00 34.79  ? 175 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 175 ? 67.643  46.581  -123.559 1.00 33.43  ? 175 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 175 ? 66.503  47.410  -122.954 1.00 31.30  ? 175 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 175 ? 65.151  46.723  -123.074 1.00 25.64  ? 175 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 175 ? 64.950  45.691  -122.026 1.00 20.94  ? 175 LYS A NZ  1 
ATOM   908  N N   . LYS A 1 176 ? 71.821  48.480  -124.699 1.00 36.21  ? 176 LYS A N   1 
ATOM   909  C CA  . LYS A 1 176 ? 72.644  49.625  -125.113 1.00 36.70  ? 176 LYS A CA  1 
ATOM   910  C C   . LYS A 1 176 ? 73.359  49.397  -126.455 1.00 36.28  ? 176 LYS A C   1 
ATOM   911  O O   . LYS A 1 176 ? 74.028  50.300  -126.959 1.00 35.47  ? 176 LYS A O   1 
ATOM   912  C CB  . LYS A 1 176 ? 73.692  49.958  -124.041 1.00 37.66  ? 176 LYS A CB  1 
ATOM   913  C CG  . LYS A 1 176 ? 73.138  50.223  -122.632 1.00 38.31  ? 176 LYS A CG  1 
ATOM   914  C CD  . LYS A 1 176 ? 74.249  50.376  -121.590 1.00 37.84  ? 176 LYS A CD  1 
ATOM   915  C CE  . LYS A 1 176 ? 75.147  49.136  -121.515 1.00 40.28  ? 176 LYS A CE  1 
ATOM   916  N NZ  . LYS A 1 176 ? 76.073  49.156  -120.353 1.00 41.06  ? 176 LYS A NZ  1 
ATOM   917  N N   . CYS A 1 177 ? 73.229  48.195  -127.016 1.00 36.14  ? 177 CYS A N   1 
ATOM   918  C CA  . CYS A 1 177 ? 73.823  47.865  -128.310 1.00 34.34  ? 177 CYS A CA  1 
ATOM   919  C C   . CYS A 1 177 ? 72.819  48.048  -129.450 1.00 32.32  ? 177 CYS A C   1 
ATOM   920  O O   . CYS A 1 177 ? 71.627  47.773  -129.293 1.00 30.17  ? 177 CYS A O   1 
ATOM   921  C CB  . CYS A 1 177 ? 74.333  46.422  -128.295 1.00 35.69  ? 177 CYS A CB  1 
ATOM   922  S SG  . CYS A 1 177 ? 74.792  45.785  -129.915 1.00 40.70  ? 177 CYS A SG  1 
ATOM   923  N N   . SER A 1 178 ? 73.318  48.500  -130.600 1.00 31.97  ? 178 SER A N   1 
ATOM   924  C CA  . SER A 1 178 ? 72.475  48.778  -131.765 1.00 31.45  ? 178 SER A CA  1 
ATOM   925  C C   . SER A 1 178 ? 72.104  47.498  -132.506 1.00 30.76  ? 178 SER A C   1 
ATOM   926  O O   . SER A 1 178 ? 72.823  46.499  -132.450 1.00 28.60  ? 178 SER A O   1 
ATOM   927  C CB  . SER A 1 178 ? 73.171  49.756  -132.722 1.00 30.39  ? 178 SER A CB  1 
ATOM   928  O OG  . SER A 1 178 ? 74.406  49.243  -133.191 1.00 26.14  ? 178 SER A OG  1 
ATOM   929  N N   . VAL A 1 179 ? 70.980  47.551  -133.214 1.00 31.38  ? 179 VAL A N   1 
ATOM   930  C CA  . VAL A 1 179 ? 70.448  46.383  -133.915 1.00 32.31  ? 179 VAL A CA  1 
ATOM   931  C C   . VAL A 1 179 ? 71.431  45.886  -134.976 1.00 33.54  ? 179 VAL A C   1 
ATOM   932  O O   . VAL A 1 179 ? 71.701  44.686  -135.076 1.00 29.49  ? 179 VAL A O   1 
ATOM   933  C CB  . VAL A 1 179 ? 69.095  46.692  -134.597 1.00 30.12  ? 179 VAL A CB  1 
ATOM   934  C CG1 . VAL A 1 179 ? 68.432  45.400  -135.057 1.00 28.63  ? 179 VAL A CG1 1 
ATOM   935  C CG2 . VAL A 1 179 ? 68.173  47.458  -133.655 1.00 27.03  ? 179 VAL A CG2 1 
ATOM   936  N N   . GLU A 1 180 ? 71.976  46.825  -135.746 1.00 35.65  ? 180 GLU A N   1 
ATOM   937  C CA  . GLU A 1 180 ? 72.889  46.508  -136.850 1.00 36.65  ? 180 GLU A CA  1 
ATOM   938  C C   . GLU A 1 180 ? 74.194  45.897  -136.337 1.00 37.51  ? 180 GLU A C   1 
ATOM   939  O O   . GLU A 1 180 ? 74.864  45.148  -137.055 1.00 35.87  ? 180 GLU A O   1 
ATOM   940  C CB  . GLU A 1 180 ? 73.191  47.770  -137.657 1.00 34.94  ? 180 GLU A CB  1 
ATOM   941  C CG  . GLU A 1 180 ? 71.943  48.475  -138.203 1.00 37.00  ? 180 GLU A CG  1 
ATOM   942  C CD  . GLU A 1 180 ? 71.932  49.986  -137.955 1.00 41.43  ? 180 GLU A CD  1 
ATOM   943  O OE1 . GLU A 1 180 ? 70.897  50.627  -138.245 1.00 38.88  ? 180 GLU A OE1 1 
ATOM   944  O OE2 . GLU A 1 180 ? 72.946  50.539  -137.472 1.00 51.61  ? 180 GLU A OE2 1 
ATOM   945  N N   . LYS A 1 181 ? 74.548  46.228  -135.097 1.00 36.66  ? 181 LYS A N   1 
ATOM   946  C CA  . LYS A 1 181 ? 75.736  45.677  -134.454 1.00 35.89  ? 181 LYS A CA  1 
ATOM   947  C C   . LYS A 1 181 ? 75.511  44.221  -134.036 1.00 36.61  ? 181 LYS A C   1 
ATOM   948  O O   . LYS A 1 181 ? 76.410  43.391  -134.190 1.00 37.83  ? 181 LYS A O   1 
ATOM   949  C CB  . LYS A 1 181 ? 76.132  46.543  -133.251 1.00 34.55  ? 181 LYS A CB  1 
ATOM   950  C CG  . LYS A 1 181 ? 77.389  46.099  -132.507 1.00 33.03  ? 181 LYS A CG  1 
ATOM   951  C CD  . LYS A 1 181 ? 78.614  46.101  -133.400 1.00 29.70  ? 181 LYS A CD  1 
ATOM   952  C CE  . LYS A 1 181 ? 79.885  45.926  -132.598 1.00 24.46  ? 181 LYS A CE  1 
ATOM   953  N NZ  . LYS A 1 181 ? 81.099  46.163  -133.416 1.00 19.06  ? 181 LYS A NZ  1 
ATOM   954  N N   . LYS A 1 182 ? 74.325  43.910  -133.508 1.00 34.67  ? 182 LYS A N   1 
ATOM   955  C CA  . LYS A 1 182 ? 73.969  42.519  -133.194 1.00 34.42  ? 182 LYS A CA  1 
ATOM   956  C C   . LYS A 1 182 ? 74.062  41.686  -134.457 1.00 31.70  ? 182 LYS A C   1 
ATOM   957  O O   . LYS A 1 182 ? 74.710  40.647  -134.478 1.00 32.24  ? 182 LYS A O   1 
ATOM   958  C CB  . LYS A 1 182 ? 72.555  42.413  -132.613 1.00 35.84  ? 182 LYS A CB  1 
ATOM   959  C CG  . LYS A 1 182 ? 72.460  42.791  -131.137 1.00 39.07  ? 182 LYS A CG  1 
ATOM   960  C CD  . LYS A 1 182 ? 71.074  43.341  -130.767 1.00 40.68  ? 182 LYS A CD  1 
ATOM   961  C CE  . LYS A 1 182 ? 71.032  43.896  -129.337 1.00 38.88  ? 182 LYS A CE  1 
ATOM   962  N NZ  . LYS A 1 182 ? 70.028  44.997  -129.175 1.00 30.87  ? 182 LYS A NZ  1 
ATOM   963  N N   . SER A 1 183 ? 73.416  42.169  -135.510 1.00 29.91  ? 183 SER A N   1 
ATOM   964  C CA  . SER A 1 183 ? 73.522  41.571  -136.830 1.00 29.32  ? 183 SER A CA  1 
ATOM   965  C C   . SER A 1 183 ? 74.980  41.282  -137.218 1.00 28.47  ? 183 SER A C   1 
ATOM   966  O O   . SER A 1 183 ? 75.288  40.182  -137.677 1.00 26.88  ? 183 SER A O   1 
ATOM   967  C CB  . SER A 1 183 ? 72.865  42.493  -137.857 1.00 27.82  ? 183 SER A CB  1 
ATOM   968  O OG  . SER A 1 183 ? 73.099  42.038  -139.172 1.00 31.70  ? 183 SER A OG  1 
ATOM   969  N N   . GLU A 1 184 ? 75.867  42.260  -137.016 1.00 29.93  ? 184 GLU A N   1 
ATOM   970  C CA  . GLU A 1 184 ? 77.296  42.117  -137.350 1.00 30.13  ? 184 GLU A CA  1 
ATOM   971  C C   . GLU A 1 184 ? 77.977  40.977  -136.579 1.00 28.65  ? 184 GLU A C   1 
ATOM   972  O O   . GLU A 1 184 ? 78.736  40.196  -137.154 1.00 26.67  ? 184 GLU A O   1 
ATOM   973  C CB  . GLU A 1 184 ? 78.055  43.436  -137.102 1.00 30.39  ? 184 GLU A CB  1 
ATOM   974  C CG  . GLU A 1 184 ? 79.583  43.369  -137.360 1.00 33.23  ? 184 GLU A CG  1 
ATOM   975  C CD  . GLU A 1 184 ? 80.320  44.663  -137.002 1.00 33.83  ? 184 GLU A CD  1 
ATOM   976  O OE1 . GLU A 1 184 ? 80.426  45.565  -137.868 1.00 28.08  ? 184 GLU A OE1 1 
ATOM   977  O OE2 . GLU A 1 184 ? 80.812  44.767  -135.855 1.00 30.98  ? 184 GLU A OE2 1 
ATOM   978  N N   . MET A 1 185 ? 77.716  40.896  -135.279 1.00 27.94  ? 185 MET A N   1 
ATOM   979  C CA  . MET A 1 185 ? 78.352  39.888  -134.428 1.00 29.66  ? 185 MET A CA  1 
ATOM   980  C C   . MET A 1 185 ? 77.702  38.518  -134.618 1.00 29.12  ? 185 MET A C   1 
ATOM   981  O O   . MET A 1 185 ? 78.353  37.476  -134.488 1.00 24.32  ? 185 MET A O   1 
ATOM   982  C CB  . MET A 1 185 ? 78.262  40.308  -132.965 1.00 29.63  ? 185 MET A CB  1 
ATOM   983  C CG  . MET A 1 185 ? 78.963  41.622  -132.659 1.00 30.48  ? 185 MET A CG  1 
ATOM   984  S SD  . MET A 1 185 ? 78.818  42.098  -130.927 1.00 36.32  ? 185 MET A SD  1 
ATOM   985  C CE  . MET A 1 185 ? 77.039  42.089  -130.711 1.00 31.11  ? 185 MET A CE  1 
ATOM   986  N N   . GLU A 1 186 ? 76.408  38.533  -134.922 1.00 30.93  ? 186 GLU A N   1 
ATOM   987  C CA  . GLU A 1 186 ? 75.674  37.321  -135.249 1.00 30.28  ? 186 GLU A CA  1 
ATOM   988  C C   . GLU A 1 186 ? 76.379  36.627  -136.401 1.00 28.36  ? 186 GLU A C   1 
ATOM   989  O O   . GLU A 1 186 ? 76.597  35.420  -136.364 1.00 31.21  ? 186 GLU A O   1 
ATOM   990  C CB  . GLU A 1 186 ? 74.236  37.662  -135.648 1.00 31.52  ? 186 GLU A CB  1 
ATOM   991  C CG  . GLU A 1 186 ? 73.166  36.948  -134.836 1.00 32.62  ? 186 GLU A CG  1 
ATOM   992  C CD  . GLU A 1 186 ? 71.831  37.685  -134.846 1.00 35.58  ? 186 GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 186 ? 71.684  38.676  -135.599 1.00 42.08  ? 186 GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 186 ? 70.927  37.275  -134.090 1.00 37.87  ? 186 GLU A OE2 1 
ATOM   995  N N   . SER A 1 187 ? 76.747  37.405  -137.415 1.00 25.87  ? 187 SER A N   1 
ATOM   996  C CA  . SER A 1 187 ? 77.462  36.874  -138.570 1.00 27.33  ? 187 SER A CA  1 
ATOM   997  C C   . SER A 1 187 ? 78.884  36.446  -138.218 1.00 28.49  ? 187 SER A C   1 
ATOM   998  O O   . SER A 1 187 ? 79.432  35.546  -138.855 1.00 32.35  ? 187 SER A O   1 
ATOM   999  C CB  . SER A 1 187 ? 77.514  37.905  -139.693 1.00 26.41  ? 187 SER A CB  1 
ATOM   1000 O OG  . SER A 1 187 ? 78.471  38.905  -139.410 1.00 28.82  ? 187 SER A OG  1 
ATOM   1001 N N   . VAL A 1 188 ? 79.487  37.096  -137.222 1.00 28.18  ? 188 VAL A N   1 
ATOM   1002 C CA  . VAL A 1 188 ? 80.837  36.731  -136.795 1.00 26.63  ? 188 VAL A CA  1 
ATOM   1003 C C   . VAL A 1 188 ? 80.816  35.335  -136.207 1.00 26.93  ? 188 VAL A C   1 
ATOM   1004 O O   . VAL A 1 188 ? 81.591  34.473  -136.623 1.00 27.58  ? 188 VAL A O   1 
ATOM   1005 C CB  . VAL A 1 188 ? 81.438  37.698  -135.755 1.00 23.58  ? 188 VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 188 ? 82.864  37.277  -135.419 1.00 15.93  ? 188 VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 188 ? 81.416  39.133  -136.271 1.00 21.74  ? 188 VAL A CG2 1 
ATOM   1008 N N   . LEU A 1 189 ? 79.919  35.116  -135.247 1.00 28.66  ? 189 LEU A N   1 
ATOM   1009 C CA  . LEU A 1 189 ? 79.703  33.780  -134.694 1.00 32.30  ? 189 LEU A CA  1 
ATOM   1010 C C   . LEU A 1 189 ? 79.382  32.775  -135.801 1.00 35.18  ? 189 LEU A C   1 
ATOM   1011 O O   . LEU A 1 189 ? 79.835  31.630  -135.748 1.00 34.16  ? 189 LEU A O   1 
ATOM   1012 C CB  . LEU A 1 189 ? 78.561  33.781  -133.675 1.00 33.86  ? 189 LEU A CB  1 
ATOM   1013 C CG  . LEU A 1 189 ? 78.715  34.626  -132.411 1.00 35.35  ? 189 LEU A CG  1 
ATOM   1014 C CD1 . LEU A 1 189 ? 77.677  34.194  -131.381 1.00 34.81  ? 189 LEU A CD1 1 
ATOM   1015 C CD2 . LEU A 1 189 ? 80.120  34.515  -131.838 1.00 40.32  ? 189 LEU A CD2 1 
ATOM   1016 N N   . ALA A 1 190 ? 78.601  33.220  -136.792 1.00 34.49  ? 190 ALA A N   1 
ATOM   1017 C CA  . ALA A 1 190 ? 78.211  32.398  -137.941 1.00 32.05  ? 190 ALA A CA  1 
ATOM   1018 C C   . ALA A 1 190 ? 79.398  31.668  -138.575 1.00 33.67  ? 190 ALA A C   1 
ATOM   1019 O O   . ALA A 1 190 ? 79.341  30.457  -138.777 1.00 38.53  ? 190 ALA A O   1 
ATOM   1020 C CB  . ALA A 1 190 ? 77.499  33.247  -138.980 1.00 26.13  ? 190 ALA A CB  1 
ATOM   1021 N N   . GLN A 1 191 ? 80.471  32.395  -138.873 1.00 33.34  ? 191 GLN A N   1 
ATOM   1022 C CA  . GLN A 1 191 ? 81.673  31.779  -139.442 1.00 35.45  ? 191 GLN A CA  1 
ATOM   1023 C C   . GLN A 1 191 ? 82.850  31.844  -138.467 1.00 34.84  ? 191 GLN A C   1 
ATOM   1024 O O   . GLN A 1 191 ? 83.974  32.183  -138.845 1.00 35.85  ? 191 GLN A O   1 
ATOM   1025 C CB  . GLN A 1 191 ? 82.028  32.417  -140.792 1.00 36.53  ? 191 GLN A CB  1 
ATOM   1026 C CG  . GLN A 1 191 ? 82.186  33.934  -140.772 1.00 41.05  ? 191 GLN A CG  1 
ATOM   1027 C CD  . GLN A 1 191 ? 82.876  34.471  -142.016 1.00 42.13  ? 191 GLN A CD  1 
ATOM   1028 O OE1 . GLN A 1 191 ? 83.680  33.775  -142.645 1.00 49.93  ? 191 GLN A OE1 1 
ATOM   1029 N NE2 . GLN A 1 191 ? 82.572  35.718  -142.372 1.00 38.57  ? 191 GLN A NE2 1 
ATOM   1030 N N   . LEU A 1 192 ? 82.579  31.489  -137.214 1.00 35.44  ? 192 LEU A N   1 
ATOM   1031 C CA  . LEU A 1 192 ? 83.585  31.520  -136.149 1.00 36.05  ? 192 LEU A CA  1 
ATOM   1032 C C   . LEU A 1 192 ? 84.673  30.458  -136.334 1.00 36.49  ? 192 LEU A C   1 
ATOM   1033 O O   . LEU A 1 192 ? 85.855  30.746  -136.153 1.00 36.54  ? 192 LEU A O   1 
ATOM   1034 C CB  . LEU A 1 192 ? 82.904  31.344  -134.789 1.00 35.81  ? 192 LEU A CB  1 
ATOM   1035 C CG  . LEU A 1 192 ? 83.768  31.331  -133.529 1.00 34.68  ? 192 LEU A CG  1 
ATOM   1036 C CD1 . LEU A 1 192 ? 84.745  32.496  -133.508 1.00 27.35  ? 192 LEU A CD1 1 
ATOM   1037 C CD2 . LEU A 1 192 ? 82.865  31.356  -132.298 1.00 33.52  ? 192 LEU A CD2 1 
ATOM   1038 N N   . ASP A 1 193 ? 84.270  29.243  -136.705 1.00 37.86  ? 193 ASP A N   1 
ATOM   1039 C CA  . ASP A 1 193 ? 85.214  28.137  -136.942 1.00 39.09  ? 193 ASP A CA  1 
ATOM   1040 C C   . ASP A 1 193 ? 86.101  28.318  -138.181 1.00 40.98  ? 193 ASP A C   1 
ATOM   1041 O O   . ASP A 1 193 ? 87.107  27.613  -138.329 1.00 42.18  ? 193 ASP A O   1 
ATOM   1042 C CB  . ASP A 1 193 ? 84.466  26.805  -137.066 1.00 38.73  ? 193 ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 193 ? 83.829  26.368  -135.765 1.00 39.56  ? 193 ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 193 ? 84.473  26.525  -134.704 1.00 36.43  ? 193 ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 193 ? 82.687  25.858  -135.808 1.00 35.47  ? 193 ASP A OD2 1 
ATOM   1046 N N   . ASN A 1 194 ? 85.725  29.238  -139.069 1.00 38.76  ? 194 ASN A N   1 
ATOM   1047 C CA  . ASN A 1 194 ? 86.503  29.502  -140.278 1.00 37.95  ? 194 ASN A CA  1 
ATOM   1048 C C   . ASN A 1 194 ? 87.757  30.317  -140.002 1.00 37.11  ? 194 ASN A C   1 
ATOM   1049 O O   . ASN A 1 194 ? 88.857  29.897  -140.354 1.00 38.36  ? 194 ASN A O   1 
ATOM   1050 C CB  . ASN A 1 194 ? 85.649  30.225  -141.333 1.00 38.23  ? 194 ASN A CB  1 
ATOM   1051 C CG  . ASN A 1 194 ? 84.665  29.297  -142.036 1.00 36.65  ? 194 ASN A CG  1 
ATOM   1052 O OD1 . ASN A 1 194 ? 83.718  29.754  -142.683 1.00 36.31  ? 194 ASN A OD1 1 
ATOM   1053 N ND2 . ASN A 1 194 ? 84.888  27.992  -141.921 1.00 21.56  ? 194 ASN A ND2 1 
ATOM   1054 N N   . TYR A 1 195 ? 87.587  31.472  -139.368 1.00 36.23  ? 195 TYR A N   1 
ATOM   1055 C CA  . TYR A 1 195 ? 88.667  32.455  -139.239 1.00 36.58  ? 195 TYR A CA  1 
ATOM   1056 C C   . TYR A 1 195 ? 90.022  31.818  -138.986 1.00 34.70  ? 195 TYR A C   1 
ATOM   1057 O O   . TYR A 1 195 ? 90.174  31.014  -138.072 1.00 34.37  ? 195 TYR A O   1 
ATOM   1058 C CB  . TYR A 1 195 ? 88.382  33.439  -138.108 1.00 40.01  ? 195 TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 195 ? 87.085  34.187  -138.262 1.00 43.95  ? 195 TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 195 ? 86.096  34.107  -137.287 1.00 48.88  ? 195 TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 195 ? 86.834  34.961  -139.389 1.00 43.46  ? 195 TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 195 ? 84.900  34.791  -137.419 1.00 45.39  ? 195 TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 195 ? 85.634  35.644  -139.532 1.00 42.79  ? 195 TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 195 ? 84.674  35.552  -138.540 1.00 42.22  ? 195 TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 195 ? 83.482  36.217  -138.661 1.00 42.62  ? 195 TYR A OH  1 
ATOM   1066 N N   . GLY A 1 196 ? 91.003  32.185  -139.801 1.00 35.20  ? 196 GLY A N   1 
ATOM   1067 C CA  . GLY A 1 196 ? 92.375  31.747  -139.596 1.00 34.57  ? 196 GLY A CA  1 
ATOM   1068 C C   . GLY A 1 196 ? 93.049  32.489  -138.454 1.00 35.20  ? 196 GLY A C   1 
ATOM   1069 O O   . GLY A 1 196 ? 92.491  33.432  -137.882 1.00 36.34  ? 196 GLY A O   1 
ATOM   1070 N N   . GLN A 1 197 ? 94.263  32.048  -138.140 1.00 33.84  ? 197 GLN A N   1 
ATOM   1071 C CA  . GLN A 1 197 ? 95.107  32.630  -137.088 1.00 34.23  ? 197 GLN A CA  1 
ATOM   1072 C C   . GLN A 1 197 ? 95.055  34.170  -137.024 1.00 34.72  ? 197 GLN A C   1 
ATOM   1073 O O   . GLN A 1 197 ? 94.685  34.749  -135.996 1.00 30.52  ? 197 GLN A O   1 
ATOM   1074 C CB  . GLN A 1 197 ? 96.555  32.144  -137.295 1.00 34.48  ? 197 GLN A CB  1 
ATOM   1075 C CG  . GLN A 1 197 ? 97.508  32.421  -136.152 1.00 31.88  ? 197 GLN A CG  1 
ATOM   1076 C CD  . GLN A 1 197 ? 97.920  33.867  -136.088 1.00 32.52  ? 197 GLN A CD  1 
ATOM   1077 O OE1 . GLN A 1 197 ? 98.395  34.436  -137.074 1.00 35.41  ? 197 GLN A OE1 1 
ATOM   1078 N NE2 . GLN A 1 197 ? 97.726  34.482  -134.930 1.00 37.36  ? 197 GLN A NE2 1 
ATOM   1079 N N   . GLN A 1 198 ? 95.420  34.820  -138.127 1.00 36.42  ? 198 GLN A N   1 
ATOM   1080 C CA  . GLN A 1 198 ? 95.502  36.286  -138.180 1.00 36.17  ? 198 GLN A CA  1 
ATOM   1081 C C   . GLN A 1 198 ? 94.144  36.965  -138.034 1.00 32.85  ? 198 GLN A C   1 
ATOM   1082 O O   . GLN A 1 198 ? 94.006  37.943  -137.294 1.00 26.21  ? 198 GLN A O   1 
ATOM   1083 C CB  . GLN A 1 198 ? 96.170  36.747  -139.486 1.00 39.02  ? 198 GLN A CB  1 
ATOM   1084 C CG  . GLN A 1 198 ? 97.589  37.280  -139.311 1.00 41.03  ? 198 GLN A CG  1 
ATOM   1085 C CD  . GLN A 1 198 ? 97.626  38.729  -138.838 1.00 41.54  ? 198 GLN A CD  1 
ATOM   1086 O OE1 . GLN A 1 198 ? 98.572  39.459  -139.131 1.00 40.04  ? 198 GLN A OE1 1 
ATOM   1087 N NE2 . GLN A 1 198 ? 96.594  39.151  -138.109 1.00 41.44  ? 198 GLN A NE2 1 
ATOM   1088 N N   . GLU A 1 199 ? 93.153  36.446  -138.750 1.00 31.94  ? 199 GLU A N   1 
ATOM   1089 C CA  . GLU A 1 199 ? 91.810  37.007  -138.707 1.00 36.07  ? 199 GLU A CA  1 
ATOM   1090 C C   . GLU A 1 199 ? 91.296  36.988  -137.278 1.00 36.31  ? 199 GLU A C   1 
ATOM   1091 O O   . GLU A 1 199 ? 90.752  37.978  -136.788 1.00 33.63  ? 199 GLU A O   1 
ATOM   1092 C CB  . GLU A 1 199 ? 90.865  36.210  -139.601 1.00 36.86  ? 199 GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 199 ? 91.202  36.279  -141.076 1.00 37.90  ? 199 GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 199 ? 90.423  35.269  -141.880 1.00 40.51  ? 199 GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 199 ? 89.274  35.573  -142.270 1.00 39.45  ? 199 GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 199 ? 90.964  34.168  -142.118 1.00 48.27  ? 199 GLU A OE2 1 
ATOM   1097 N N   . LEU A 1 200 ? 91.493  35.851  -136.617 1.00 37.80  ? 200 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 200 ? 91.083  35.674  -135.227 1.00 36.92  ? 200 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 200 ? 91.820  36.659  -134.312 1.00 33.70  ? 200 LEU A C   1 
ATOM   1100 O O   . LEU A 1 200 ? 91.230  37.210  -133.385 1.00 32.87  ? 200 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 200 ? 91.327  34.220  -134.787 1.00 38.61  ? 200 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 200 ? 90.558  33.650  -133.587 1.00 38.62  ? 200 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 200 ? 91.079  34.225  -132.275 1.00 44.36  ? 200 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 200 ? 89.050  33.876  -133.727 1.00 35.46  ? 200 LEU A CD2 1 
ATOM   1105 N N   . ALA A 1 201 ? 93.102  36.886  -134.586 1.00 30.56  ? 201 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 201 ? 93.888  37.851  -133.822 1.00 31.84  ? 201 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 201 ? 93.352  39.285  -133.982 1.00 30.98  ? 201 ALA A C   1 
ATOM   1108 O O   . ALA A 1 201 ? 93.384  40.077  -133.032 1.00 26.18  ? 201 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 201 ? 95.345  37.773  -134.235 1.00 31.99  ? 201 ALA A CB  1 
ATOM   1110 N N   . ASP A 1 202 ? 92.861  39.606  -135.181 1.00 31.50  ? 202 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 202 ? 92.232  40.907  -135.446 1.00 31.05  ? 202 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 202 ? 90.896  41.009  -134.732 1.00 30.51  ? 202 ASP A C   1 
ATOM   1113 O O   . ASP A 1 202 ? 90.571  42.044  -134.154 1.00 31.40  ? 202 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 202 ? 91.997  41.120  -136.947 1.00 31.76  ? 202 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 202 ? 93.283  41.212  -137.741 1.00 29.42  ? 202 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 202 ? 94.363  41.376  -137.130 1.00 26.91  ? 202 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 202 ? 93.203  41.124  -138.985 1.00 20.76  ? 202 ASP A OD2 1 
ATOM   1118 N N   . LEU A 1 203 ? 90.119  39.929  -134.791 1.00 29.77  ? 203 LEU A N   1 
ATOM   1119 C CA  . LEU A 1 203 ? 88.843  39.845  -134.084 1.00 27.64  ? 203 LEU A CA  1 
ATOM   1120 C C   . LEU A 1 203 ? 89.016  40.097  -132.593 1.00 26.20  ? 203 LEU A C   1 
ATOM   1121 O O   . LEU A 1 203 ? 88.118  40.637  -131.942 1.00 28.32  ? 203 LEU A O   1 
ATOM   1122 C CB  . LEU A 1 203 ? 88.200  38.473  -134.295 1.00 28.70  ? 203 LEU A CB  1 
ATOM   1123 C CG  . LEU A 1 203 ? 87.482  38.274  -135.631 1.00 31.70  ? 203 LEU A CG  1 
ATOM   1124 C CD1 . LEU A 1 203 ? 87.425  36.796  -136.021 1.00 27.62  ? 203 LEU A CD1 1 
ATOM   1125 C CD2 . LEU A 1 203 ? 86.083  38.880  -135.566 1.00 30.40  ? 203 LEU A CD2 1 
ATOM   1126 N N   . PHE A 1 204 ? 90.167  39.703  -132.055 1.00 22.91  ? 204 PHE A N   1 
ATOM   1127 C CA  . PHE A 1 204 ? 90.449  39.930  -130.644 1.00 25.67  ? 204 PHE A CA  1 
ATOM   1128 C C   . PHE A 1 204 ? 90.708  41.393  -130.333 1.00 24.87  ? 204 PHE A C   1 
ATOM   1129 O O   . PHE A 1 204 ? 90.232  41.904  -129.319 1.00 23.93  ? 204 PHE A O   1 
ATOM   1130 C CB  . PHE A 1 204 ? 91.594  39.039  -130.160 1.00 28.48  ? 204 PHE A CB  1 
ATOM   1131 C CG  . PHE A 1 204 ? 91.114  37.798  -129.473 1.00 33.12  ? 204 PHE A CG  1 
ATOM   1132 C CD1 . PHE A 1 204 ? 90.392  36.840  -130.174 1.00 32.95  ? 204 PHE A CD1 1 
ATOM   1133 C CD2 . PHE A 1 204 ? 91.338  37.604  -128.117 1.00 35.33  ? 204 PHE A CD2 1 
ATOM   1134 C CE1 . PHE A 1 204 ? 89.923  35.702  -129.544 1.00 31.46  ? 204 PHE A CE1 1 
ATOM   1135 C CE2 . PHE A 1 204 ? 90.870  36.466  -127.481 1.00 32.08  ? 204 PHE A CE2 1 
ATOM   1136 C CZ  . PHE A 1 204 ? 90.162  35.514  -128.196 1.00 31.76  ? 204 PHE A CZ  1 
ATOM   1137 N N   . VAL A 1 205 ? 91.432  42.071  -131.216 1.00 24.75  ? 205 VAL A N   1 
ATOM   1138 C CA  . VAL A 1 205 ? 91.668  43.503  -131.060 1.00 25.70  ? 205 VAL A CA  1 
ATOM   1139 C C   . VAL A 1 205 ? 90.375  44.286  -131.284 1.00 26.13  ? 205 VAL A C   1 
ATOM   1140 O O   . VAL A 1 205 ? 89.987  45.095  -130.446 1.00 24.33  ? 205 VAL A O   1 
ATOM   1141 C CB  . VAL A 1 205 ? 92.737  44.022  -132.038 1.00 25.33  ? 205 VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 205 ? 93.141  45.446  -131.665 1.00 17.36  ? 205 VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 205 ? 93.955  43.093  -132.054 1.00 24.89  ? 205 VAL A CG2 1 
ATOM   1144 N N   . ASN A 1 206 ? 89.708  44.015  -132.406 1.00 29.07  ? 206 ASN A N   1 
ATOM   1145 C CA  . ASN A 1 206 ? 88.498  44.746  -132.818 1.00 31.40  ? 206 ASN A CA  1 
ATOM   1146 C C   . ASN A 1 206 ? 87.373  44.789  -131.786 1.00 32.97  ? 206 ASN A C   1 
ATOM   1147 O O   . ASN A 1 206 ? 86.670  45.792  -131.684 1.00 35.90  ? 206 ASN A O   1 
ATOM   1148 C CB  . ASN A 1 206 ? 87.934  44.170  -134.125 1.00 32.04  ? 206 ASN A CB  1 
ATOM   1149 C CG  . ASN A 1 206 ? 88.779  44.520  -135.339 1.00 33.31  ? 206 ASN A CG  1 
ATOM   1150 O OD1 . ASN A 1 206 ? 89.447  45.560  -135.377 1.00 18.02  ? 206 ASN A OD1 1 
ATOM   1151 N ND2 . ASN A 1 206 ? 88.744  43.648  -136.349 1.00 32.73  ? 206 ASN A ND2 1 
ATOM   1152 N N   . TYR A 1 207 ? 87.185  43.703  -131.043 1.00 34.46  ? 207 TYR A N   1 
ATOM   1153 C CA  . TYR A 1 207 ? 86.156  43.663  -130.002 1.00 34.66  ? 207 TYR A CA  1 
ATOM   1154 C C   . TYR A 1 207 ? 86.767  43.809  -128.611 1.00 32.66  ? 207 TYR A C   1 
ATOM   1155 O O   . TYR A 1 207 ? 86.098  43.558  -127.612 1.00 28.80  ? 207 TYR A O   1 
ATOM   1156 C CB  . TYR A 1 207 ? 85.337  42.372  -130.111 1.00 36.16  ? 207 TYR A CB  1 
ATOM   1157 C CG  . TYR A 1 207 ? 84.445  42.333  -131.336 1.00 36.43  ? 207 TYR A CG  1 
ATOM   1158 C CD1 . TYR A 1 207 ? 84.882  41.754  -132.522 1.00 35.21  ? 207 TYR A CD1 1 
ATOM   1159 C CD2 . TYR A 1 207 ? 83.168  42.886  -131.309 1.00 36.93  ? 207 TYR A CD2 1 
ATOM   1160 C CE1 . TYR A 1 207 ? 84.069  41.719  -133.650 1.00 36.04  ? 207 TYR A CE1 1 
ATOM   1161 C CE2 . TYR A 1 207 ? 82.348  42.856  -132.432 1.00 37.50  ? 207 TYR A CE2 1 
ATOM   1162 C CZ  . TYR A 1 207 ? 82.804  42.272  -133.600 1.00 37.19  ? 207 TYR A CZ  1 
ATOM   1163 O OH  . TYR A 1 207 ? 81.998  42.240  -134.717 1.00 36.90  ? 207 TYR A OH  1 
ATOM   1164 N N   . ASN A 1 208 ? 88.028  44.241  -128.563 1.00 35.21  ? 208 ASN A N   1 
ATOM   1165 C CA  . ASN A 1 208 ? 88.785  44.402  -127.319 1.00 38.24  ? 208 ASN A CA  1 
ATOM   1166 C C   . ASN A 1 208 ? 88.470  43.317  -126.285 1.00 40.68  ? 208 ASN A C   1 
ATOM   1167 O O   . ASN A 1 208 ? 87.887  43.589  -125.233 1.00 42.34  ? 208 ASN A O   1 
ATOM   1168 C CB  . ASN A 1 208 ? 88.563  45.807  -126.736 1.00 38.07  ? 208 ASN A CB  1 
ATOM   1169 C CG  . ASN A 1 208 ? 89.731  46.281  -125.877 1.00 38.18  ? 208 ASN A CG  1 
ATOM   1170 O OD1 . ASN A 1 208 ? 90.409  45.482  -125.226 1.00 43.88  ? 208 ASN A OD1 1 
ATOM   1171 N ND2 . ASN A 1 208 ? 89.971  47.589  -125.876 1.00 31.47  ? 208 ASN A ND2 1 
ATOM   1172 N N   . VAL A 1 209 ? 88.862  42.087  -126.605 1.00 42.86  ? 209 VAL A N   1 
ATOM   1173 C CA  . VAL A 1 209 ? 88.600  40.931  -125.746 1.00 42.63  ? 209 VAL A CA  1 
ATOM   1174 C C   . VAL A 1 209 ? 89.562  40.909  -124.557 1.00 42.87  ? 209 VAL A C   1 
ATOM   1175 O O   . VAL A 1 209 ? 90.756  41.168  -124.714 1.00 44.95  ? 209 VAL A O   1 
ATOM   1176 C CB  . VAL A 1 209 ? 88.729  39.602  -126.533 1.00 43.53  ? 209 VAL A CB  1 
ATOM   1177 C CG1 . VAL A 1 209 ? 88.573  38.408  -125.605 1.00 40.06  ? 209 VAL A CG1 1 
ATOM   1178 C CG2 . VAL A 1 209 ? 87.702  39.543  -127.655 1.00 40.88  ? 209 VAL A CG2 1 
ATOM   1179 N N   . LYS A 1 210 ? 89.028  40.596  -123.377 1.00 39.79  ? 210 LYS A N   1 
ATOM   1180 C CA  . LYS A 1 210 ? 89.816  40.503  -122.147 1.00 38.97  ? 210 LYS A CA  1 
ATOM   1181 C C   . LYS A 1 210 ? 89.607  39.154  -121.464 1.00 36.86  ? 210 LYS A C   1 
ATOM   1182 O O   . LYS A 1 210 ? 88.694  38.405  -121.816 1.00 33.88  ? 210 LYS A O   1 
ATOM   1183 C CB  . LYS A 1 210 ? 89.432  41.633  -121.186 1.00 38.04  ? 210 LYS A CB  1 
ATOM   1184 C CG  . LYS A 1 210 ? 90.460  42.741  -121.069 1.00 38.48  ? 210 LYS A CG  1 
ATOM   1185 C CD  . LYS A 1 210 ? 90.686  43.462  -122.382 1.00 38.40  ? 210 LYS A CD  1 
ATOM   1186 C CE  . LYS A 1 210 ? 91.662  44.603  -122.203 1.00 37.15  ? 210 LYS A CE  1 
ATOM   1187 N NZ  . LYS A 1 210 ? 92.278  45.007  -123.493 1.00 37.02  ? 210 LYS A NZ  1 
ATOM   1188 N N   . SER A 1 211 ? 90.458  38.857  -120.485 1.00 34.55  ? 211 SER A N   1 
ATOM   1189 C CA  . SER A 1 211 ? 90.323  37.636  -119.697 1.00 35.83  ? 211 SER A CA  1 
ATOM   1190 C C   . SER A 1 211 ? 89.029  37.672  -118.885 1.00 35.12  ? 211 SER A C   1 
ATOM   1191 O O   . SER A 1 211 ? 88.744  38.661  -118.222 1.00 32.04  ? 211 SER A O   1 
ATOM   1192 C CB  . SER A 1 211 ? 91.524  37.449  -118.764 1.00 35.23  ? 211 SER A CB  1 
ATOM   1193 O OG  . SER A 1 211 ? 91.251  36.492  -117.750 1.00 31.32  ? 211 SER A OG  1 
ATOM   1194 N N   . PRO A 1 212 ? 88.243  36.585  -118.929 1.00 38.44  ? 212 PRO A N   1 
ATOM   1195 C CA  . PRO A 1 212 ? 86.975  36.572  -118.206 1.00 38.41  ? 212 PRO A CA  1 
ATOM   1196 C C   . PRO A 1 212 ? 87.158  36.471  -116.695 1.00 37.77  ? 212 PRO A C   1 
ATOM   1197 O O   . PRO A 1 212 ? 86.339  37.005  -115.953 1.00 37.94  ? 212 PRO A O   1 
ATOM   1198 C CB  . PRO A 1 212 ? 86.273  35.325  -118.751 1.00 39.69  ? 212 PRO A CB  1 
ATOM   1199 C CG  . PRO A 1 212 ? 87.371  34.425  -119.165 1.00 39.72  ? 212 PRO A CG  1 
ATOM   1200 C CD  . PRO A 1 212 ? 88.491  35.311  -119.629 1.00 39.66  ? 212 PRO A CD  1 
ATOM   1201 N N   . ILE A 1 213 ? 88.213  35.793  -116.245 1.00 38.44  ? 213 ILE A N   1 
ATOM   1202 C CA  . ILE A 1 213 ? 88.491  35.685  -114.814 1.00 39.70  ? 213 ILE A CA  1 
ATOM   1203 C C   . ILE A 1 213 ? 88.989  37.024  -114.278 1.00 40.65  ? 213 ILE A C   1 
ATOM   1204 O O   . ILE A 1 213 ? 88.294  37.683  -113.505 1.00 40.68  ? 213 ILE A O   1 
ATOM   1205 C CB  . ILE A 1 213 ? 89.537  34.585  -114.492 1.00 40.51  ? 213 ILE A CB  1 
ATOM   1206 C CG1 . ILE A 1 213 ? 88.980  33.197  -114.820 1.00 42.01  ? 213 ILE A CG1 1 
ATOM   1207 C CG2 . ILE A 1 213 ? 89.951  34.648  -113.021 1.00 38.70  ? 213 ILE A CG2 1 
ATOM   1208 C CD1 . ILE A 1 213 ? 89.847  32.052  -114.306 1.00 41.05  ? 213 ILE A CD1 1 
ATOM   1209 N N   . THR A 1 214 ? 90.181  37.427  -114.712 1.00 40.82  ? 214 THR A N   1 
ATOM   1210 C CA  . THR A 1 214 ? 90.851  38.606  -114.161 1.00 39.14  ? 214 THR A CA  1 
ATOM   1211 C C   . THR A 1 214 ? 90.451  39.894  -114.879 1.00 35.76  ? 214 THR A C   1 
ATOM   1212 O O   . THR A 1 214 ? 90.177  40.906  -114.238 1.00 31.70  ? 214 THR A O   1 
ATOM   1213 C CB  . THR A 1 214 ? 92.388  38.445  -114.210 1.00 39.29  ? 214 THR A CB  1 
ATOM   1214 O OG1 . THR A 1 214 ? 92.798  38.140  -115.547 1.00 42.66  ? 214 THR A OG1 1 
ATOM   1215 C CG2 . THR A 1 214 ? 92.844  37.327  -113.276 1.00 35.59  ? 214 THR A CG2 1 
ATOM   1216 N N   . GLY A 1 215 ? 90.404  39.849  -116.205 1.00 36.93  ? 215 GLY A N   1 
ATOM   1217 C CA  . GLY A 1 215 ? 90.146  41.041  -117.011 1.00 39.47  ? 215 GLY A CA  1 
ATOM   1218 C C   . GLY A 1 215 ? 91.412  41.714  -117.512 1.00 41.37  ? 215 GLY A C   1 
ATOM   1219 O O   . GLY A 1 215 ? 91.403  42.908  -117.821 1.00 41.75  ? 215 GLY A O   1 
ATOM   1220 N N   . ASN A 1 216 ? 92.501  40.953  -117.605 1.00 42.49  ? 216 ASN A N   1 
ATOM   1221 C CA  . ASN A 1 216 ? 93.773  41.486  -118.091 1.00 41.11  ? 216 ASN A CA  1 
ATOM   1222 C C   . ASN A 1 216 ? 93.860  41.349  -119.602 1.00 42.87  ? 216 ASN A C   1 
ATOM   1223 O O   . ASN A 1 216 ? 93.062  40.637  -120.223 1.00 42.66  ? 216 ASN A O   1 
ATOM   1224 C CB  . ASN A 1 216 ? 94.960  40.759  -117.453 1.00 39.65  ? 216 ASN A CB  1 
ATOM   1225 C CG  . ASN A 1 216 ? 94.773  40.515  -115.969 1.00 35.29  ? 216 ASN A CG  1 
ATOM   1226 O OD1 . ASN A 1 216 ? 95.311  39.555  -115.415 1.00 32.71  ? 216 ASN A OD1 1 
ATOM   1227 N ND2 . ASN A 1 216 ? 93.998  41.374  -115.320 1.00 30.26  ? 216 ASN A ND2 1 
ATOM   1228 N N   . ASP A 1 217 ? 94.840  42.032  -120.188 1.00 44.37  ? 217 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 217 ? 95.070  41.961  -121.628 1.00 42.52  ? 217 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 217 ? 95.461  40.549  -122.032 1.00 42.54  ? 217 ASP A C   1 
ATOM   1231 O O   . ASP A 1 217 ? 96.174  39.848  -121.305 1.00 41.20  ? 217 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 217 ? 96.142  42.960  -122.075 1.00 42.45  ? 217 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 217 ? 95.615  44.378  -122.164 1.00 38.92  ? 217 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 217 ? 94.663  44.710  -121.430 1.00 31.88  ? 217 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 217 ? 96.157  45.163  -122.969 1.00 41.57  ? 217 ASP A OD2 1 
ATOM   1236 N N   . LEU A 1 218 ? 94.988  40.154  -123.208 1.00 41.83  ? 218 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 218 ? 95.050  38.775  -123.661 1.00 39.83  ? 218 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 218 ? 96.089  38.663  -124.762 1.00 36.65  ? 218 LEU A C   1 
ATOM   1239 O O   . LEU A 1 218 ? 96.087  39.457  -125.701 1.00 35.02  ? 218 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 218 ? 93.672  38.363  -124.187 1.00 40.72  ? 218 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 218 ? 93.003  37.127  -123.589 1.00 42.29  ? 218 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 218 ? 93.236  37.012  -122.087 1.00 46.71  ? 218 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 218 ? 91.514  37.191  -123.885 1.00 42.67  ? 218 LEU A CD2 1 
ATOM   1244 N N   . SER A 1 219 ? 96.974  37.679  -124.648 1.00 34.31  ? 219 SER A N   1 
ATOM   1245 C CA  . SER A 1 219 ? 98.009  37.458  -125.653 1.00 34.79  ? 219 SER A CA  1 
ATOM   1246 C C   . SER A 1 219 ? 97.388  37.131  -127.018 1.00 34.99  ? 219 SER A C   1 
ATOM   1247 O O   . SER A 1 219 ? 96.197  36.818  -127.102 1.00 33.26  ? 219 SER A O   1 
ATOM   1248 C CB  . SER A 1 219 ? 98.940  36.326  -125.208 1.00 33.72  ? 219 SER A CB  1 
ATOM   1249 O OG  . SER A 1 219 ? 98.231  35.109  -125.052 1.00 28.68  ? 219 SER A OG  1 
ATOM   1250 N N   . PRO A 1 220 ? 98.188  37.212  -128.097 1.00 37.18  ? 220 PRO A N   1 
ATOM   1251 C CA  . PRO A 1 220 ? 97.638  36.870  -129.402 1.00 37.11  ? 220 PRO A CA  1 
ATOM   1252 C C   . PRO A 1 220 ? 97.427  35.367  -129.521 1.00 38.70  ? 220 PRO A C   1 
ATOM   1253 O O   . PRO A 1 220 ? 98.229  34.590  -128.998 1.00 41.77  ? 220 PRO A O   1 
ATOM   1254 C CB  . PRO A 1 220 ? 98.715  37.339  -130.392 1.00 37.28  ? 220 PRO A CB  1 
ATOM   1255 C CG  . PRO A 1 220 ? 99.724  38.087  -129.590 1.00 41.39  ? 220 PRO A CG  1 
ATOM   1256 C CD  . PRO A 1 220 ? 99.605  37.598  -128.190 1.00 40.29  ? 220 PRO A CD  1 
ATOM   1257 N N   . PRO A 1 221 ? 96.353  34.956  -130.205 1.00 38.63  ? 221 PRO A N   1 
ATOM   1258 C CA  . PRO A 1 221 ? 96.002  33.544  -130.288 1.00 38.59  ? 221 PRO A CA  1 
ATOM   1259 C C   . PRO A 1 221 ? 97.026  32.707  -131.056 1.00 39.75  ? 221 PRO A C   1 
ATOM   1260 O O   . PRO A 1 221 ? 97.195  32.880  -132.265 1.00 41.31  ? 221 PRO A O   1 
ATOM   1261 C CB  . PRO A 1 221 ? 94.655  33.561  -131.019 1.00 40.02  ? 221 PRO A CB  1 
ATOM   1262 C CG  . PRO A 1 221 ? 94.634  34.846  -131.764 1.00 40.88  ? 221 PRO A CG  1 
ATOM   1263 C CD  . PRO A 1 221 ? 95.408  35.812  -130.945 1.00 39.97  ? 221 PRO A CD  1 
ATOM   1264 N N   . VAL A 1 222 ? 97.705  31.813  -130.342 1.00 39.37  ? 222 VAL A N   1 
ATOM   1265 C CA  . VAL A 1 222 ? 98.614  30.850  -130.963 1.00 37.51  ? 222 VAL A CA  1 
ATOM   1266 C C   . VAL A 1 222 ? 97.874  29.532  -131.211 1.00 36.09  ? 222 VAL A C   1 
ATOM   1267 O O   . VAL A 1 222 ? 96.829  29.277  -130.613 1.00 33.60  ? 222 VAL A O   1 
ATOM   1268 C CB  . VAL A 1 222 ? 99.865  30.599  -130.080 1.00 36.40  ? 222 VAL A CB  1 
ATOM   1269 C CG1 . VAL A 1 222 ? 100.530 31.920  -129.714 1.00 29.90  ? 222 VAL A CG1 1 
ATOM   1270 C CG2 . VAL A 1 222 ? 99.504  29.812  -128.818 1.00 36.06  ? 222 VAL A CG2 1 
ATOM   1271 N N   . SER A 1 223 ? 98.408  28.707  -132.104 1.00 35.65  ? 223 SER A N   1 
ATOM   1272 C CA  . SER A 1 223 ? 97.880  27.363  -132.302 1.00 34.60  ? 223 SER A CA  1 
ATOM   1273 C C   . SER A 1 223 ? 98.497  26.442  -131.253 1.00 36.52  ? 223 SER A C   1 
ATOM   1274 O O   . SER A 1 223 ? 99.676  26.573  -130.931 1.00 38.21  ? 223 SER A O   1 
ATOM   1275 C CB  . SER A 1 223 ? 98.201  26.858  -133.700 1.00 32.33  ? 223 SER A CB  1 
ATOM   1276 O OG  . SER A 1 223 ? 97.630  25.584  -133.904 1.00 30.30  ? 223 SER A OG  1 
ATOM   1277 N N   . PHE A 1 224 ? 97.692  25.530  -130.712 1.00 36.40  ? 224 PHE A N   1 
ATOM   1278 C CA  . PHE A 1 224 ? 98.144  24.605  -129.673 1.00 35.30  ? 224 PHE A CA  1 
ATOM   1279 C C   . PHE A 1 224 ? 97.696  23.186  -130.021 1.00 36.77  ? 224 PHE A C   1 
ATOM   1280 O O   . PHE A 1 224 ? 96.511  22.859  -129.913 1.00 35.12  ? 224 PHE A O   1 
ATOM   1281 C CB  . PHE A 1 224 ? 97.595  25.035  -128.309 1.00 35.70  ? 224 PHE A CB  1 
ATOM   1282 C CG  . PHE A 1 224 ? 97.859  24.047  -127.200 1.00 35.91  ? 224 PHE A CG  1 
ATOM   1283 C CD1 . PHE A 1 224 ? 99.103  23.978  -126.592 1.00 35.55  ? 224 PHE A CD1 1 
ATOM   1284 C CD2 . PHE A 1 224 ? 96.854  23.195  -126.753 1.00 41.28  ? 224 PHE A CD2 1 
ATOM   1285 C CE1 . PHE A 1 224 ? 99.344  23.071  -125.562 1.00 34.66  ? 224 PHE A CE1 1 
ATOM   1286 C CE2 . PHE A 1 224 ? 97.089  22.285  -125.721 1.00 39.46  ? 224 PHE A CE2 1 
ATOM   1287 C CZ  . PHE A 1 224 ? 98.334  22.224  -125.128 1.00 33.04  ? 224 PHE A CZ  1 
ATOM   1288 N N   . ASN A 1 225 ? 98.648  22.352  -130.441 1.00 35.08  ? 225 ASN A N   1 
ATOM   1289 C CA  . ASN A 1 225 ? 98.338  20.999  -130.896 1.00 30.76  ? 225 ASN A CA  1 
ATOM   1290 C C   . ASN A 1 225 ? 97.831  20.148  -129.753 1.00 26.50  ? 225 ASN A C   1 
ATOM   1291 O O   . ASN A 1 225 ? 98.411  20.137  -128.671 1.00 23.49  ? 225 ASN A O   1 
ATOM   1292 C CB  . ASN A 1 225 ? 99.559  20.336  -131.535 1.00 31.28  ? 225 ASN A CB  1 
ATOM   1293 C CG  . ASN A 1 225 ? 99.192  19.117  -132.360 1.00 27.68  ? 225 ASN A CG  1 
ATOM   1294 O OD1 . ASN A 1 225 ? 99.393  17.983  -131.931 1.00 15.92  ? 225 ASN A OD1 1 
ATOM   1295 N ND2 . ASN A 1 225 ? 98.640  19.346  -133.546 1.00 17.94  ? 225 ASN A ND2 1 
ATOM   1296 N N   . LEU A 1 226 ? 96.753  19.423  -130.013 1.00 27.51  ? 226 LEU A N   1 
ATOM   1297 C CA  . LEU A 1 226 ? 96.046  18.681  -128.974 1.00 28.38  ? 226 LEU A CA  1 
ATOM   1298 C C   . LEU A 1 226 ? 96.570  17.270  -128.709 1.00 26.02  ? 226 LEU A C   1 
ATOM   1299 O O   . LEU A 1 226 ? 96.028  16.575  -127.854 1.00 30.76  ? 226 LEU A O   1 
ATOM   1300 C CB  . LEU A 1 226 ? 94.558  18.603  -129.326 1.00 28.73  ? 226 LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 226 ? 93.825  19.939  -129.314 1.00 27.41  ? 226 LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 226 ? 92.426  19.771  -129.875 1.00 29.73  ? 226 LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 226 ? 93.787  20.499  -127.898 1.00 23.37  ? 226 LEU A CD2 1 
ATOM   1304 N N   . MET A 1 227 ? 97.598  16.832  -129.430 1.00 23.97  ? 227 MET A N   1 
ATOM   1305 C CA  . MET A 1 227 ? 98.168  15.503  -129.188 1.00 26.30  ? 227 MET A CA  1 
ATOM   1306 C C   . MET A 1 227 ? 99.156  15.546  -128.018 1.00 28.03  ? 227 MET A C   1 
ATOM   1307 O O   . MET A 1 227 ? 99.943  16.487  -127.900 1.00 25.76  ? 227 MET A O   1 
ATOM   1308 C CB  . MET A 1 227 ? 98.865  14.966  -130.441 1.00 22.56  ? 227 MET A CB  1 
ATOM   1309 C CG  . MET A 1 227 ? 97.924  14.657  -131.589 1.00 21.19  ? 227 MET A CG  1 
ATOM   1310 S SD  . MET A 1 227 ? 98.748  13.814  -132.959 1.00 29.35  ? 227 MET A SD  1 
ATOM   1311 C CE  . MET A 1 227 ? 99.914  15.074  -133.502 1.00 16.71  ? 227 MET A CE  1 
ATOM   1312 N N   . PHE A 1 228 ? 99.096  14.530  -127.154 1.00 28.92  ? 228 PHE A N   1 
ATOM   1313 C CA  . PHE A 1 228 ? 100.066 14.360  -126.071 1.00 29.84  ? 228 PHE A CA  1 
ATOM   1314 C C   . PHE A 1 228 ? 101.394 13.881  -126.645 1.00 32.21  ? 228 PHE A C   1 
ATOM   1315 O O   . PHE A 1 228 ? 101.428 12.874  -127.354 1.00 35.64  ? 228 PHE A O   1 
ATOM   1316 C CB  . PHE A 1 228 ? 99.570  13.321  -125.070 1.00 33.92  ? 228 PHE A CB  1 
ATOM   1317 C CG  . PHE A 1 228 ? 98.398  13.771  -124.247 1.00 39.79  ? 228 PHE A CG  1 
ATOM   1318 C CD1 . PHE A 1 228 ? 98.595  14.395  -123.018 1.00 41.95  ? 228 PHE A CD1 1 
ATOM   1319 C CD2 . PHE A 1 228 ? 97.096  13.553  -124.688 1.00 40.19  ? 228 PHE A CD2 1 
ATOM   1320 C CE1 . PHE A 1 228 ? 97.516  14.800  -122.252 1.00 40.37  ? 228 PHE A CE1 1 
ATOM   1321 C CE2 . PHE A 1 228 ? 96.010  13.953  -123.925 1.00 35.27  ? 228 PHE A CE2 1 
ATOM   1322 C CZ  . PHE A 1 228 ? 96.218  14.574  -122.706 1.00 39.15  ? 228 PHE A CZ  1 
ATOM   1323 N N   . LYS A 1 229 ? 102.486 14.571  -126.331 1.00 31.66  ? 229 LYS A N   1 
ATOM   1324 C CA  . LYS A 1 229 ? 103.783 14.241  -126.919 1.00 30.98  ? 229 LYS A CA  1 
ATOM   1325 C C   . LYS A 1 229 ? 104.650 13.455  -125.937 1.00 28.50  ? 229 LYS A C   1 
ATOM   1326 O O   . LYS A 1 229 ? 104.706 13.810  -124.765 1.00 26.15  ? 229 LYS A O   1 
ATOM   1327 C CB  . LYS A 1 229 ? 104.496 15.525  -127.353 1.00 32.77  ? 229 LYS A CB  1 
ATOM   1328 C CG  . LYS A 1 229 ? 105.679 15.282  -128.276 1.00 39.12  ? 229 LYS A CG  1 
ATOM   1329 C CD  . LYS A 1 229 ? 106.217 16.570  -128.896 1.00 41.23  ? 229 LYS A CD  1 
ATOM   1330 C CE  . LYS A 1 229 ? 107.488 16.289  -129.715 1.00 45.12  ? 229 LYS A CE  1 
ATOM   1331 N NZ  . LYS A 1 229 ? 108.140 17.518  -130.272 1.00 41.61  ? 229 LYS A NZ  1 
ATOM   1332 N N   . THR A 1 230 ? 105.282 12.373  -126.411 1.00 27.79  ? 230 THR A N   1 
ATOM   1333 C CA  . THR A 1 230 ? 106.377 11.686  -125.684 1.00 28.51  ? 230 THR A CA  1 
ATOM   1334 C C   . THR A 1 230 ? 107.531 11.367  -126.615 1.00 28.90  ? 230 THR A C   1 
ATOM   1335 O O   . THR A 1 230 ? 107.540 11.773  -127.778 1.00 31.64  ? 230 THR A O   1 
ATOM   1336 C CB  . THR A 1 230 ? 105.968 10.324  -125.057 1.00 26.06  ? 230 THR A CB  1 
ATOM   1337 O OG1 . THR A 1 230 ? 105.160 9.590   -125.980 1.00 28.23  ? 230 THR A OG1 1 
ATOM   1338 C CG2 . THR A 1 230 ? 105.246 10.512  -123.760 1.00 22.52  ? 230 THR A CG2 1 
ATOM   1339 N N   . PHE A 1 231 ? 108.509 10.646  -126.073 1.00 28.02  ? 231 PHE A N   1 
ATOM   1340 C CA  . PHE A 1 231 ? 109.549 10.021  -126.860 1.00 29.62  ? 231 PHE A CA  1 
ATOM   1341 C C   . PHE A 1 231 ? 109.528 8.516   -126.636 1.00 29.46  ? 231 PHE A C   1 
ATOM   1342 O O   . PHE A 1 231 ? 109.465 8.052   -125.500 1.00 33.69  ? 231 PHE A O   1 
ATOM   1343 C CB  . PHE A 1 231 ? 110.902 10.601  -126.476 1.00 32.40  ? 231 PHE A CB  1 
ATOM   1344 C CG  . PHE A 1 231 ? 110.994 12.076  -126.690 1.00 30.01  ? 231 PHE A CG  1 
ATOM   1345 C CD1 . PHE A 1 231 ? 110.403 12.957  -125.792 1.00 34.66  ? 231 PHE A CD1 1 
ATOM   1346 C CD2 . PHE A 1 231 ? 111.654 12.589  -127.796 1.00 32.87  ? 231 PHE A CD2 1 
ATOM   1347 C CE1 . PHE A 1 231 ? 110.478 14.328  -125.988 1.00 38.70  ? 231 PHE A CE1 1 
ATOM   1348 C CE2 . PHE A 1 231 ? 111.740 13.960  -128.001 1.00 33.69  ? 231 PHE A CE2 1 
ATOM   1349 C CZ  . PHE A 1 231 ? 111.151 14.832  -127.096 1.00 36.64  ? 231 PHE A CZ  1 
ATOM   1350 N N   . ILE A 1 232 ? 109.552 7.761   -127.731 1.00 28.07  ? 232 ILE A N   1 
ATOM   1351 C CA  . ILE A 1 232 ? 109.643 6.309   -127.670 1.00 28.60  ? 232 ILE A CA  1 
ATOM   1352 C C   . ILE A 1 232 ? 111.110 5.940   -127.608 1.00 29.57  ? 232 ILE A C   1 
ATOM   1353 O O   . ILE A 1 232 ? 111.898 6.408   -128.426 1.00 30.01  ? 232 ILE A O   1 
ATOM   1354 C CB  . ILE A 1 232 ? 109.034 5.652   -128.914 1.00 27.06  ? 232 ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 232 ? 107.527 5.917   -128.979 1.00 25.74  ? 232 ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 232 ? 109.303 4.169   -128.901 1.00 23.60  ? 232 ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 232 ? 106.963 5.845   -130.382 1.00 26.66  ? 232 ILE A CD1 1 
ATOM   1358 N N   . GLY A 1 233 ? 111.474 5.101   -126.645 1.00 32.97  ? 233 GLY A N   1 
ATOM   1359 C CA  . GLY A 1 233 ? 112.865 4.681   -126.479 1.00 33.78  ? 233 GLY A CA  1 
ATOM   1360 C C   . GLY A 1 233 ? 113.693 5.713   -125.730 1.00 36.29  ? 233 GLY A C   1 
ATOM   1361 O O   . GLY A 1 233 ? 113.133 6.629   -125.127 1.00 36.20  ? 233 GLY A O   1 
ATOM   1362 N N   . PRO A 1 234 ? 115.037 5.578   -125.767 1.00 37.63  ? 234 PRO A N   1 
ATOM   1363 C CA  . PRO A 1 234 ? 115.927 6.442   -125.003 1.00 35.66  ? 234 PRO A CA  1 
ATOM   1364 C C   . PRO A 1 234 ? 116.451 7.635   -125.803 1.00 37.07  ? 234 PRO A C   1 
ATOM   1365 O O   . PRO A 1 234 ? 116.463 7.609   -127.040 1.00 34.97  ? 234 PRO A O   1 
ATOM   1366 C CB  . PRO A 1 234 ? 117.070 5.498   -124.640 1.00 33.99  ? 234 PRO A CB  1 
ATOM   1367 C CG  . PRO A 1 234 ? 117.112 4.496   -125.779 1.00 34.74  ? 234 PRO A CG  1 
ATOM   1368 C CD  . PRO A 1 234 ? 115.809 4.585   -126.535 1.00 37.11  ? 234 PRO A CD  1 
ATOM   1369 N N   . GLY A 1 235 ? 116.891 8.667   -125.085 1.00 39.86  ? 235 GLY A N   1 
ATOM   1370 C CA  . GLY A 1 235 ? 117.319 9.921   -125.698 1.00 40.41  ? 235 GLY A CA  1 
ATOM   1371 C C   . GLY A 1 235 ? 116.136 10.693  -126.263 1.00 43.65  ? 235 GLY A C   1 
ATOM   1372 O O   . GLY A 1 235 ? 115.066 10.751  -125.650 1.00 46.72  ? 235 GLY A O   1 
ATOM   1373 N N   . GLY A 1 236 ? 116.331 11.287  -127.436 1.00 42.93  ? 236 GLY A N   1 
ATOM   1374 C CA  . GLY A 1 236 ? 115.265 12.002  -128.135 1.00 39.35  ? 236 GLY A CA  1 
ATOM   1375 C C   . GLY A 1 236 ? 115.301 11.702  -129.618 1.00 36.91  ? 236 GLY A C   1 
ATOM   1376 O O   . GLY A 1 236 ? 115.175 12.599  -130.441 1.00 34.77  ? 236 GLY A O   1 
ATOM   1377 N N   . ASN A 1 237 ? 115.460 10.427  -129.953 1.00 37.16  ? 237 ASN A N   1 
ATOM   1378 C CA  . ASN A 1 237 ? 115.608 10.003  -131.338 1.00 36.01  ? 237 ASN A CA  1 
ATOM   1379 C C   . ASN A 1 237 ? 114.240 9.827   -131.977 1.00 35.51  ? 237 ASN A C   1 
ATOM   1380 O O   . ASN A 1 237 ? 113.977 10.372  -133.043 1.00 34.94  ? 237 ASN A O   1 
ATOM   1381 C CB  . ASN A 1 237 ? 116.392 8.686   -131.421 1.00 36.31  ? 237 ASN A CB  1 
ATOM   1382 C CG  . ASN A 1 237 ? 117.721 8.737   -130.670 1.00 42.63  ? 237 ASN A CG  1 
ATOM   1383 O OD1 . ASN A 1 237 ? 118.765 9.032   -131.254 1.00 47.01  ? 237 ASN A OD1 1 
ATOM   1384 N ND2 . ASN A 1 237 ? 117.684 8.449   -129.369 1.00 40.05  ? 237 ASN A ND2 1 
ATOM   1385 N N   . MET A 1 238 ? 113.373 9.070   -131.306 1.00 36.84  ? 238 MET A N   1 
ATOM   1386 C CA  . MET A 1 238 ? 112.041 8.761   -131.812 1.00 35.52  ? 238 MET A CA  1 
ATOM   1387 C C   . MET A 1 238 ? 110.966 9.446   -130.964 1.00 34.24  ? 238 MET A C   1 
ATOM   1388 O O   . MET A 1 238 ? 110.481 8.873   -129.989 1.00 31.41  ? 238 MET A O   1 
ATOM   1389 C CB  . MET A 1 238 ? 111.819 7.241   -131.824 1.00 36.56  ? 238 MET A CB  1 
ATOM   1390 C CG  . MET A 1 238 ? 110.437 6.804   -132.344 1.00 39.26  ? 238 MET A CG  1 
ATOM   1391 S SD  . MET A 1 238 ? 110.276 5.035   -132.686 1.00 37.36  ? 238 MET A SD  1 
ATOM   1392 C CE  . MET A 1 238 ? 111.368 4.845   -134.097 1.00 29.67  ? 238 MET A CE  1 
ATOM   1393 N N   . PRO A 1 239 ? 110.591 10.681  -131.333 1.00 32.93  ? 239 PRO A N   1 
ATOM   1394 C CA  . PRO A 1 239 ? 109.442 11.310  -130.693 1.00 33.67  ? 239 PRO A CA  1 
ATOM   1395 C C   . PRO A 1 239 ? 108.145 10.715  -131.222 1.00 34.61  ? 239 PRO A C   1 
ATOM   1396 O O   . PRO A 1 239 ? 108.086 10.297  -132.380 1.00 35.58  ? 239 PRO A O   1 
ATOM   1397 C CB  . PRO A 1 239 ? 109.560 12.772  -131.115 1.00 33.75  ? 239 PRO A CB  1 
ATOM   1398 C CG  . PRO A 1 239 ? 110.239 12.716  -132.429 1.00 36.45  ? 239 PRO A CG  1 
ATOM   1399 C CD  . PRO A 1 239 ? 111.196 11.557  -132.351 1.00 34.44  ? 239 PRO A CD  1 
ATOM   1400 N N   . GLY A 1 240 ? 107.120 10.682  -130.378 1.00 32.76  ? 240 GLY A N   1 
ATOM   1401 C CA  . GLY A 1 240 ? 105.826 10.137  -130.762 1.00 30.36  ? 240 GLY A CA  1 
ATOM   1402 C C   . GLY A 1 240 ? 104.676 10.799  -130.030 1.00 30.17  ? 240 GLY A C   1 
ATOM   1403 O O   . GLY A 1 240 ? 104.869 11.746  -129.258 1.00 29.45  ? 240 GLY A O   1 
ATOM   1404 N N   . TYR A 1 241 ? 103.473 10.295  -130.285 1.00 27.94  ? 241 TYR A N   1 
ATOM   1405 C CA  . TYR A 1 241 ? 102.275 10.801  -129.646 1.00 31.18  ? 241 TYR A CA  1 
ATOM   1406 C C   . TYR A 1 241 ? 101.369 9.663   -129.234 1.00 32.50  ? 241 TYR A C   1 
ATOM   1407 O O   . TYR A 1 241 ? 101.504 8.542   -129.726 1.00 37.62  ? 241 TYR A O   1 
ATOM   1408 C CB  . TYR A 1 241 ? 101.492 11.678  -130.615 1.00 37.97  ? 241 TYR A CB  1 
ATOM   1409 C CG  . TYR A 1 241 ? 102.268 12.820  -131.218 1.00 39.60  ? 241 TYR A CG  1 
ATOM   1410 C CD1 . TYR A 1 241 ? 102.493 13.987  -130.498 1.00 39.57  ? 241 TYR A CD1 1 
ATOM   1411 C CD2 . TYR A 1 241 ? 102.755 12.742  -132.517 1.00 39.72  ? 241 TYR A CD2 1 
ATOM   1412 C CE1 . TYR A 1 241 ? 103.196 15.044  -131.049 1.00 42.71  ? 241 TYR A CE1 1 
ATOM   1413 C CE2 . TYR A 1 241 ? 103.457 13.794  -133.082 1.00 41.33  ? 241 TYR A CE2 1 
ATOM   1414 C CZ  . TYR A 1 241 ? 103.675 14.944  -132.343 1.00 44.76  ? 241 TYR A CZ  1 
ATOM   1415 O OH  . TYR A 1 241 ? 104.374 15.994  -132.897 1.00 47.73  ? 241 TYR A OH  1 
ATOM   1416 N N   . LEU A 1 242 ? 100.426 9.968   -128.348 1.00 31.02  ? 242 LEU A N   1 
ATOM   1417 C CA  . LEU A 1 242 ? 99.311  9.065   -128.074 1.00 30.85  ? 242 LEU A CA  1 
ATOM   1418 C C   . LEU A 1 242 ? 98.262  9.279   -129.172 1.00 31.89  ? 242 LEU A C   1 
ATOM   1419 O O   . LEU A 1 242 ? 97.928  10.420  -129.505 1.00 31.34  ? 242 LEU A O   1 
ATOM   1420 C CB  . LEU A 1 242 ? 98.697  9.344   -126.702 1.00 29.53  ? 242 LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 242 ? 99.652  9.550   -125.530 1.00 26.45  ? 242 LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 242 ? 98.873  9.542   -124.235 1.00 22.86  ? 242 LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 242 ? 100.721 8.480   -125.521 1.00 35.25  ? 242 LEU A CD2 1 
ATOM   1424 N N   . ARG A 1 243 ? 97.744  8.187   -129.726 1.00 27.99  ? 243 ARG A N   1 
ATOM   1425 C CA  . ARG A 1 243 ? 96.862  8.277   -130.873 1.00 29.01  ? 243 ARG A CA  1 
ATOM   1426 C C   . ARG A 1 243 ? 95.649  9.152   -130.555 1.00 29.36  ? 243 ARG A C   1 
ATOM   1427 O O   . ARG A 1 243 ? 95.023  8.984   -129.513 1.00 31.36  ? 243 ARG A O   1 
ATOM   1428 C CB  . ARG A 1 243 ? 96.431  6.881   -131.347 1.00 29.34  ? 243 ARG A CB  1 
ATOM   1429 C CG  . ARG A 1 243 ? 95.502  6.122   -130.411 1.00 34.48  ? 243 ARG A CG  1 
ATOM   1430 C CD  . ARG A 1 243 ? 95.289  4.686   -130.870 1.00 34.47  ? 243 ARG A CD  1 
ATOM   1431 N NE  . ARG A 1 243 ? 94.380  3.973   -129.976 1.00 36.24  ? 243 ARG A NE  1 
ATOM   1432 C CZ  . ARG A 1 243 ? 94.202  2.651   -129.965 1.00 43.06  ? 243 ARG A CZ  1 
ATOM   1433 N NH1 . ARG A 1 243 ? 94.851  1.858   -130.809 1.00 43.64  ? 243 ARG A NH1 1 
ATOM   1434 N NH2 . ARG A 1 243 ? 93.349  2.112   -129.102 1.00 49.82  ? 243 ARG A NH2 1 
ATOM   1435 N N   . PRO A 1 244 ? 95.340  10.121  -131.432 1.00 30.27  ? 244 PRO A N   1 
ATOM   1436 C CA  . PRO A 1 244 ? 94.099  10.869  -131.292 1.00 31.45  ? 244 PRO A CA  1 
ATOM   1437 C C   . PRO A 1 244 ? 92.882  10.102  -131.818 1.00 31.74  ? 244 PRO A C   1 
ATOM   1438 O O   . PRO A 1 244 ? 91.758  10.427  -131.456 1.00 31.17  ? 244 PRO A O   1 
ATOM   1439 C CB  . PRO A 1 244 ? 94.355  12.120  -132.126 1.00 31.62  ? 244 PRO A CB  1 
ATOM   1440 C CG  . PRO A 1 244 ? 95.287  11.677  -133.179 1.00 34.84  ? 244 PRO A CG  1 
ATOM   1441 C CD  . PRO A 1 244 ? 96.130  10.585  -132.585 1.00 31.83  ? 244 PRO A CD  1 
ATOM   1442 N N   . GLU A 1 245 ? 93.107  9.095   -132.658 1.00 34.05  ? 245 GLU A N   1 
ATOM   1443 C CA  . GLU A 1 245 ? 92.032  8.233   -133.149 1.00 35.62  ? 245 GLU A CA  1 
ATOM   1444 C C   . GLU A 1 245 ? 92.557  6.838   -133.513 1.00 37.37  ? 245 GLU A C   1 
ATOM   1445 O O   . GLU A 1 245 ? 93.760  6.636   -133.719 1.00 37.14  ? 245 GLU A O   1 
ATOM   1446 C CB  . GLU A 1 245 ? 91.350  8.878   -134.361 1.00 35.91  ? 245 GLU A CB  1 
ATOM   1447 C CG  . GLU A 1 245 ? 92.200  8.907   -135.631 1.00 34.56  ? 245 GLU A CG  1 
ATOM   1448 C CD  . GLU A 1 245 ? 91.698  9.905   -136.656 1.00 45.33  ? 245 GLU A CD  1 
ATOM   1449 O OE1 . GLU A 1 245 ? 92.321  9.990   -137.735 1.00 59.68  ? 245 GLU A OE1 1 
ATOM   1450 O OE2 . GLU A 1 245 ? 90.691  10.607  -136.395 1.00 48.72  ? 245 GLU A OE2 1 
ATOM   1451 N N   . THR A 1 246 ? 91.651  5.875   -133.600 1.00 36.41  ? 246 THR A N   1 
ATOM   1452 C CA  . THR A 1 246 ? 92.038  4.515   -133.950 1.00 36.36  ? 246 THR A CA  1 
ATOM   1453 C C   . THR A 1 246 ? 91.979  4.297   -135.469 1.00 37.97  ? 246 THR A C   1 
ATOM   1454 O O   . THR A 1 246 ? 92.440  3.270   -135.975 1.00 40.88  ? 246 THR A O   1 
ATOM   1455 C CB  . THR A 1 246 ? 91.168  3.470   -133.209 1.00 34.42  ? 246 THR A CB  1 
ATOM   1456 O OG1 . THR A 1 246 ? 89.853  3.445   -133.769 1.00 34.43  ? 246 THR A OG1 1 
ATOM   1457 C CG2 . THR A 1 246 ? 91.077  3.799   -131.714 1.00 32.54  ? 246 THR A CG2 1 
ATOM   1458 N N   . ALA A 1 247 ? 91.430  5.265   -136.198 1.00 35.31  ? 247 ALA A N   1 
ATOM   1459 C CA  . ALA A 1 247 ? 91.296  5.129   -137.646 1.00 37.46  ? 247 ALA A CA  1 
ATOM   1460 C C   . ALA A 1 247 ? 92.635  4.856   -138.347 1.00 38.14  ? 247 ALA A C   1 
ATOM   1461 O O   . ALA A 1 247 ? 92.694  4.058   -139.280 1.00 38.12  ? 247 ALA A O   1 
ATOM   1462 C CB  . ALA A 1 247 ? 90.630  6.359   -138.233 1.00 38.12  ? 247 ALA A CB  1 
ATOM   1463 N N   . GLN A 1 248 ? 93.705  5.502   -137.887 1.00 39.39  ? 248 GLN A N   1 
ATOM   1464 C CA  . GLN A 1 248 ? 95.016  5.417   -138.556 1.00 34.82  ? 248 GLN A CA  1 
ATOM   1465 C C   . GLN A 1 248 ? 95.673  4.038   -138.439 1.00 33.68  ? 248 GLN A C   1 
ATOM   1466 O O   . GLN A 1 248 ? 96.385  3.601   -139.358 1.00 25.02  ? 248 GLN A O   1 
ATOM   1467 C CB  . GLN A 1 248 ? 95.968  6.482   -138.009 1.00 31.02  ? 248 GLN A CB  1 
ATOM   1468 C CG  . GLN A 1 248 ? 95.501  7.909   -138.227 1.00 32.36  ? 248 GLN A CG  1 
ATOM   1469 C CD  . GLN A 1 248 ? 95.469  8.306   -139.688 1.00 38.67  ? 248 GLN A CD  1 
ATOM   1470 O OE1 . GLN A 1 248 ? 96.004  7.606   -140.542 1.00 42.76  ? 248 GLN A OE1 1 
ATOM   1471 N NE2 . GLN A 1 248 ? 94.843  9.442   -139.982 1.00 41.48  ? 248 GLN A NE2 1 
ATOM   1472 N N   . GLY A 1 249 ? 95.443  3.369   -137.309 1.00 30.57  ? 249 GLY A N   1 
ATOM   1473 C CA  . GLY A 1 249 ? 95.879  1.984   -137.125 1.00 30.21  ? 249 GLY A CA  1 
ATOM   1474 C C   . GLY A 1 249 ? 95.282  1.055   -138.172 1.00 29.44  ? 249 GLY A C   1 
ATOM   1475 O O   . GLY A 1 249 ? 95.972  0.213   -138.742 1.00 23.48  ? 249 GLY A O   1 
ATOM   1476 N N   . ILE A 1 250 ? 93.991  1.216   -138.433 1.00 31.65  ? 250 ILE A N   1 
ATOM   1477 C CA  . ILE A 1 250 ? 93.331  0.435   -139.463 1.00 29.00  ? 250 ILE A CA  1 
ATOM   1478 C C   . ILE A 1 250 ? 93.965  0.736   -140.817 1.00 30.96  ? 250 ILE A C   1 
ATOM   1479 O O   . ILE A 1 250 ? 94.230  -0.181  -141.595 1.00 35.19  ? 250 ILE A O   1 
ATOM   1480 C CB  . ILE A 1 250 ? 91.805  0.700   -139.503 1.00 30.41  ? 250 ILE A CB  1 
ATOM   1481 C CG1 . ILE A 1 250 ? 91.117  0.052   -138.292 1.00 27.49  ? 250 ILE A CG1 1 
ATOM   1482 C CG2 . ILE A 1 250 ? 91.205  0.167   -140.794 1.00 33.07  ? 250 ILE A CG2 1 
ATOM   1483 C CD1 . ILE A 1 250 ? 89.606  0.239   -138.251 1.00 19.49  ? 250 ILE A CD1 1 
ATOM   1484 N N   . PHE A 1 251 ? 94.236  2.008   -141.096 1.00 31.10  ? 251 PHE A N   1 
ATOM   1485 C CA  . PHE A 1 251 ? 94.807  2.365   -142.394 1.00 33.26  ? 251 PHE A CA  1 
ATOM   1486 C C   . PHE A 1 251 ? 96.163  1.709   -142.575 1.00 32.37  ? 251 PHE A C   1 
ATOM   1487 O O   . PHE A 1 251 ? 96.432  1.109   -143.620 1.00 28.02  ? 251 PHE A O   1 
ATOM   1488 C CB  . PHE A 1 251 ? 94.921  3.887   -142.578 1.00 36.51  ? 251 PHE A CB  1 
ATOM   1489 C CG  . PHE A 1 251 ? 93.593  4.599   -142.665 1.00 37.01  ? 251 PHE A CG  1 
ATOM   1490 C CD1 . PHE A 1 251 ? 92.466  3.977   -143.207 1.00 39.08  ? 251 PHE A CD1 1 
ATOM   1491 C CD2 . PHE A 1 251 ? 93.476  5.907   -142.227 1.00 41.20  ? 251 PHE A CD2 1 
ATOM   1492 C CE1 . PHE A 1 251 ? 91.251  4.642   -143.288 1.00 37.86  ? 251 PHE A CE1 1 
ATOM   1493 C CE2 . PHE A 1 251 ? 92.258  6.580   -142.308 1.00 44.09  ? 251 PHE A CE2 1 
ATOM   1494 C CZ  . PHE A 1 251 ? 91.147  5.945   -142.840 1.00 40.26  ? 251 PHE A CZ  1 
ATOM   1495 N N   . LEU A 1 252 ? 96.995  1.808   -141.538 1.00 31.87  ? 252 LEU A N   1 
ATOM   1496 C CA  . LEU A 1 252 ? 98.347  1.247   -141.556 1.00 30.50  ? 252 LEU A CA  1 
ATOM   1497 C C   . LEU A 1 252 ? 98.358  -0.259  -141.772 1.00 28.86  ? 252 LEU A C   1 
ATOM   1498 O O   . LEU A 1 252 ? 99.337  -0.808  -142.274 1.00 33.71  ? 252 LEU A O   1 
ATOM   1499 C CB  . LEU A 1 252 ? 99.077  1.585   -140.261 1.00 27.91  ? 252 LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 252 ? 99.617  3.010   -140.194 1.00 25.75  ? 252 LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 252 ? 99.865  3.421   -138.760 1.00 26.01  ? 252 LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 252 ? 100.893 3.116   -141.008 1.00 28.36  ? 252 LEU A CD2 1 
ATOM   1503 N N   . ASN A 1 253 ? 97.270  -0.918  -141.393 1.00 30.51  ? 253 ASN A N   1 
ATOM   1504 C CA  . ASN A 1 253 ? 97.101  -2.344  -141.640 1.00 35.24  ? 253 ASN A CA  1 
ATOM   1505 C C   . ASN A 1 253 ? 96.219  -2.654  -142.856 1.00 39.47  ? 253 ASN A C   1 
ATOM   1506 O O   . ASN A 1 253 ? 95.680  -3.759  -142.963 1.00 44.70  ? 253 ASN A O   1 
ATOM   1507 C CB  . ASN A 1 253 ? 96.495  -3.005  -140.401 1.00 34.30  ? 253 ASN A CB  1 
ATOM   1508 C CG  . ASN A 1 253 ? 97.375  -2.869  -139.187 1.00 28.19  ? 253 ASN A CG  1 
ATOM   1509 O OD1 . ASN A 1 253 ? 98.461  -3.431  -139.136 1.00 20.33  ? 253 ASN A OD1 1 
ATOM   1510 N ND2 . ASN A 1 253 ? 96.905  -2.131  -138.195 1.00 34.26  ? 253 ASN A ND2 1 
ATOM   1511 N N   . PHE A 1 254 ? 96.064  -1.703  -143.776 1.00 37.79  ? 254 PHE A N   1 
ATOM   1512 C CA  . PHE A 1 254 ? 95.145  -1.924  -144.882 1.00 34.83  ? 254 PHE A CA  1 
ATOM   1513 C C   . PHE A 1 254 ? 95.504  -3.175  -145.673 1.00 34.39  ? 254 PHE A C   1 
ATOM   1514 O O   . PHE A 1 254 ? 94.630  -3.981  -145.988 1.00 33.55  ? 254 PHE A O   1 
ATOM   1515 C CB  . PHE A 1 254 ? 95.081  -0.741  -145.832 1.00 34.80  ? 254 PHE A CB  1 
ATOM   1516 C CG  . PHE A 1 254 ? 94.158  -0.977  -146.989 1.00 37.95  ? 254 PHE A CG  1 
ATOM   1517 C CD1 . PHE A 1 254 ? 92.788  -0.836  -146.834 1.00 38.98  ? 254 PHE A CD1 1 
ATOM   1518 C CD2 . PHE A 1 254 ? 94.647  -1.397  -148.214 1.00 39.57  ? 254 PHE A CD2 1 
ATOM   1519 C CE1 . PHE A 1 254 ? 91.925  -1.076  -147.887 1.00 34.20  ? 254 PHE A CE1 1 
ATOM   1520 C CE2 . PHE A 1 254 ? 93.787  -1.639  -149.274 1.00 38.06  ? 254 PHE A CE2 1 
ATOM   1521 C CZ  . PHE A 1 254 ? 92.424  -1.476  -149.108 1.00 34.49  ? 254 PHE A CZ  1 
ATOM   1522 N N   . LYS A 1 255 ? 96.786  -3.328  -145.993 1.00 33.50  ? 255 LYS A N   1 
ATOM   1523 C CA  . LYS A 1 255 ? 97.241  -4.461  -146.795 1.00 35.12  ? 255 LYS A CA  1 
ATOM   1524 C C   . LYS A 1 255 ? 96.959  -5.787  -146.103 1.00 34.62  ? 255 LYS A C   1 
ATOM   1525 O O   . LYS A 1 255 ? 96.336  -6.676  -146.688 1.00 37.66  ? 255 LYS A O   1 
ATOM   1526 C CB  . LYS A 1 255 ? 98.740  -4.355  -147.116 1.00 34.62  ? 255 LYS A CB  1 
ATOM   1527 C CG  . LYS A 1 255 ? 99.047  -3.691  -148.451 1.00 36.34  ? 255 LYS A CG  1 
ATOM   1528 C CD  . LYS A 1 255 ? 100.493 -3.952  -148.895 1.00 41.40  ? 255 LYS A CD  1 
ATOM   1529 C CE  . LYS A 1 255 ? 100.668 -5.314  -149.581 1.00 42.03  ? 255 LYS A CE  1 
ATOM   1530 N NZ  . LYS A 1 255 ? 100.276 -5.294  -151.025 1.00 37.37  ? 255 LYS A NZ  1 
ATOM   1531 N N   . ARG A 1 256 ? 97.417  -5.914  -144.860 1.00 33.28  ? 256 ARG A N   1 
ATOM   1532 C CA  . ARG A 1 256 ? 97.245  -7.157  -144.103 1.00 33.53  ? 256 ARG A CA  1 
ATOM   1533 C C   . ARG A 1 256 ? 95.757  -7.545  -144.067 1.00 30.78  ? 256 ARG A C   1 
ATOM   1534 O O   . ARG A 1 256 ? 95.401  -8.692  -144.351 1.00 27.06  ? 256 ARG A O   1 
ATOM   1535 C CB  . ARG A 1 256 ? 97.841  -7.033  -142.681 1.00 33.63  ? 256 ARG A CB  1 
ATOM   1536 C CG  . ARG A 1 256 ? 99.349  -6.703  -142.661 1.00 37.38  ? 256 ARG A CG  1 
ATOM   1537 C CD  . ARG A 1 256 ? 100.057 -7.056  -141.342 1.00 39.52  ? 256 ARG A CD  1 
ATOM   1538 N NE  . ARG A 1 256 ? 100.037 -5.967  -140.343 1.00 48.55  ? 256 ARG A NE  1 
ATOM   1539 C CZ  . ARG A 1 256 ? 101.106 -5.449  -139.714 1.00 44.91  ? 256 ARG A CZ  1 
ATOM   1540 N NH1 . ARG A 1 256 ? 102.344 -5.889  -139.954 1.00 42.28  ? 256 ARG A NH1 1 
ATOM   1541 N NH2 . ARG A 1 256 ? 100.940 -4.477  -138.818 1.00 36.00  ? 256 ARG A NH2 1 
ATOM   1542 N N   . LEU A 1 257 ? 94.902  -6.567  -143.764 1.00 27.14  ? 257 LEU A N   1 
ATOM   1543 C CA  . LEU A 1 257 ? 93.456  -6.769  -143.699 1.00 28.24  ? 257 LEU A CA  1 
ATOM   1544 C C   . LEU A 1 257 ? 92.827  -7.156  -145.036 1.00 29.89  ? 257 LEU A C   1 
ATOM   1545 O O   . LEU A 1 257 ? 91.993  -8.057  -145.098 1.00 31.27  ? 257 LEU A O   1 
ATOM   1546 C CB  . LEU A 1 257 ? 92.777  -5.501  -143.185 1.00 28.38  ? 257 LEU A CB  1 
ATOM   1547 C CG  . LEU A 1 257 ? 92.983  -5.178  -141.703 1.00 32.28  ? 257 LEU A CG  1 
ATOM   1548 C CD1 . LEU A 1 257 ? 92.260  -3.886  -141.328 1.00 22.53  ? 257 LEU A CD1 1 
ATOM   1549 C CD2 . LEU A 1 257 ? 92.504  -6.325  -140.827 1.00 29.73  ? 257 LEU A CD2 1 
ATOM   1550 N N   . LEU A 1 258 ? 93.212  -6.453  -146.095 1.00 32.29  ? 258 LEU A N   1 
ATOM   1551 C CA  . LEU A 1 258 ? 92.702  -6.725  -147.439 1.00 30.60  ? 258 LEU A CA  1 
ATOM   1552 C C   . LEU A 1 258 ? 93.048  -8.146  -147.858 1.00 27.23  ? 258 LEU A C   1 
ATOM   1553 O O   . LEU A 1 258 ? 92.215  -8.864  -148.405 1.00 24.77  ? 258 LEU A O   1 
ATOM   1554 C CB  . LEU A 1 258 ? 93.294  -5.716  -148.436 1.00 33.01  ? 258 LEU A CB  1 
ATOM   1555 C CG  . LEU A 1 258 ? 92.893  -5.783  -149.916 1.00 30.89  ? 258 LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1 258 ? 93.735  -6.809  -150.683 1.00 34.05  ? 258 LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1 258 ? 91.403  -6.062  -150.057 1.00 21.13  ? 258 LEU A CD2 1 
ATOM   1558 N N   . GLU A 1 259 ? 94.288  -8.539  -147.596 1.00 28.59  ? 259 GLU A N   1 
ATOM   1559 C CA  . GLU A 1 259 ? 94.744  -9.888  -147.880 1.00 32.89  ? 259 GLU A CA  1 
ATOM   1560 C C   . GLU A 1 259 ? 93.943  -10.890 -147.062 1.00 33.06  ? 259 GLU A C   1 
ATOM   1561 O O   . GLU A 1 259 ? 93.445  -11.887 -147.593 1.00 28.63  ? 259 GLU A O   1 
ATOM   1562 C CB  . GLU A 1 259 ? 96.230  -10.023 -147.545 1.00 33.62  ? 259 GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 259 ? 96.743  -11.456 -147.564 1.00 32.95  ? 259 GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 259 ? 98.241  -11.546 -147.373 1.00 39.41  ? 259 GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 259 ? 98.819  -12.591 -147.740 1.00 48.64  ? 259 GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 259 ? 98.841  -10.578 -146.860 1.00 50.40  ? 259 GLU A OE2 1 
ATOM   1567 N N   . PHE A 1 260 ? 93.832  -10.614 -145.763 1.00 34.28  ? 260 PHE A N   1 
ATOM   1568 C CA  . PHE A 1 260 ? 93.090  -11.477 -144.848 1.00 32.59  ? 260 PHE A CA  1 
ATOM   1569 C C   . PHE A 1 260 ? 91.687  -11.723 -145.381 1.00 31.84  ? 260 PHE A C   1 
ATOM   1570 O O   . PHE A 1 260 ? 91.134  -12.801 -145.191 1.00 33.99  ? 260 PHE A O   1 
ATOM   1571 C CB  . PHE A 1 260 ? 93.027  -10.862 -143.446 1.00 32.56  ? 260 PHE A CB  1 
ATOM   1572 C CG  . PHE A 1 260 ? 92.387  -11.754 -142.419 1.00 33.62  ? 260 PHE A CG  1 
ATOM   1573 C CD1 . PHE A 1 260 ? 93.161  -12.602 -141.638 1.00 31.98  ? 260 PHE A CD1 1 
ATOM   1574 C CD2 . PHE A 1 260 ? 91.005  -11.742 -142.230 1.00 38.44  ? 260 PHE A CD2 1 
ATOM   1575 C CE1 . PHE A 1 260 ? 92.571  -13.433 -140.688 1.00 34.88  ? 260 PHE A CE1 1 
ATOM   1576 C CE2 . PHE A 1 260 ? 90.403  -12.567 -141.279 1.00 32.44  ? 260 PHE A CE2 1 
ATOM   1577 C CZ  . PHE A 1 260 ? 91.189  -13.417 -140.509 1.00 33.33  ? 260 PHE A CZ  1 
ATOM   1578 N N   . ASN A 1 261 ? 91.126  -10.729 -146.066 1.00 32.45  ? 261 ASN A N   1 
ATOM   1579 C CA  . ASN A 1 261 ? 89.813  -10.862 -146.690 1.00 32.78  ? 261 ASN A CA  1 
ATOM   1580 C C   . ASN A 1 261 ? 89.873  -11.486 -148.086 1.00 32.45  ? 261 ASN A C   1 
ATOM   1581 O O   . ASN A 1 261 ? 88.996  -11.242 -148.925 1.00 26.42  ? 261 ASN A O   1 
ATOM   1582 C CB  . ASN A 1 261 ? 89.124  -9.497  -146.759 1.00 31.93  ? 261 ASN A CB  1 
ATOM   1583 C CG  . ASN A 1 261 ? 87.664  -9.606  -147.128 1.00 33.78  ? 261 ASN A CG  1 
ATOM   1584 O OD1 . ASN A 1 261 ? 87.207  -9.005  -148.105 1.00 40.46  ? 261 ASN A OD1 1 
ATOM   1585 N ND2 . ASN A 1 261 ? 86.926  -10.400 -146.366 1.00 32.00  ? 261 ASN A ND2 1 
ATOM   1586 N N   . GLN A 1 262 ? 90.903  -12.296 -148.331 1.00 35.03  ? 262 GLN A N   1 
ATOM   1587 C CA  . GLN A 1 262 ? 91.024  -13.034 -149.583 1.00 38.30  ? 262 GLN A CA  1 
ATOM   1588 C C   . GLN A 1 262 ? 91.188  -12.082 -150.775 1.00 37.99  ? 262 GLN A C   1 
ATOM   1589 O O   . GLN A 1 262 ? 90.836  -12.423 -151.901 1.00 38.30  ? 262 GLN A O   1 
ATOM   1590 C CB  . GLN A 1 262 ? 89.788  -13.937 -149.770 1.00 41.92  ? 262 GLN A CB  1 
ATOM   1591 C CG  . GLN A 1 262 ? 90.089  -15.334 -150.294 1.00 52.03  ? 262 GLN A CG  1 
ATOM   1592 C CD  . GLN A 1 262 ? 90.854  -16.194 -149.291 1.00 58.08  ? 262 GLN A CD  1 
ATOM   1593 O OE1 . GLN A 1 262 ? 91.174  -15.746 -148.179 1.00 50.17  ? 262 GLN A OE1 1 
ATOM   1594 N NE2 . GLN A 1 262 ? 91.156  -17.436 -149.684 1.00 50.42  ? 262 GLN A NE2 1 
ATOM   1595 N N   . GLY A 1 263 ? 91.711  -10.884 -150.517 1.00 38.59  ? 263 GLY A N   1 
ATOM   1596 C CA  . GLY A 1 263 ? 91.857  -9.857  -151.547 1.00 38.52  ? 263 GLY A CA  1 
ATOM   1597 C C   . GLY A 1 263 ? 90.576  -9.147  -151.973 1.00 38.47  ? 263 GLY A C   1 
ATOM   1598 O O   . GLY A 1 263 ? 90.632  -8.142  -152.681 1.00 39.35  ? 263 GLY A O   1 
ATOM   1599 N N   . LYS A 1 264 ? 89.422  -9.643  -151.538 1.00 39.03  ? 264 LYS A N   1 
ATOM   1600 C CA  . LYS A 1 264 ? 88.139  -9.178  -152.069 1.00 39.36  ? 264 LYS A CA  1 
ATOM   1601 C C   . LYS A 1 264 ? 87.673  -7.882  -151.408 1.00 37.18  ? 264 LYS A C   1 
ATOM   1602 O O   . LYS A 1 264 ? 88.307  -7.386  -150.481 1.00 39.73  ? 264 LYS A O   1 
ATOM   1603 C CB  . LYS A 1 264 ? 87.082  -10.281 -151.924 1.00 41.43  ? 264 LYS A CB  1 
ATOM   1604 C CG  . LYS A 1 264 ? 87.409  -11.518 -152.757 1.00 48.23  ? 264 LYS A CG  1 
ATOM   1605 C CD  . LYS A 1 264 ? 86.439  -12.671 -152.531 1.00 48.37  ? 264 LYS A CD  1 
ATOM   1606 C CE  . LYS A 1 264 ? 86.873  -13.903 -153.326 1.00 49.77  ? 264 LYS A CE  1 
ATOM   1607 N NZ  . LYS A 1 264 ? 86.081  -15.113 -152.977 1.00 53.86  ? 264 LYS A NZ  1 
ATOM   1608 N N   . LEU A 1 265 ? 86.565  -7.344  -151.910 1.00 33.50  ? 265 LEU A N   1 
ATOM   1609 C CA  . LEU A 1 265 ? 85.996  -6.080  -151.445 1.00 30.27  ? 265 LEU A CA  1 
ATOM   1610 C C   . LEU A 1 265 ? 84.480  -6.164  -151.679 1.00 33.74  ? 265 LEU A C   1 
ATOM   1611 O O   . LEU A 1 265 ? 84.047  -6.718  -152.695 1.00 40.31  ? 265 LEU A O   1 
ATOM   1612 C CB  . LEU A 1 265 ? 86.616  -4.929  -152.245 1.00 25.50  ? 265 LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 265 ? 86.808  -3.545  -151.626 1.00 26.38  ? 265 LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 265 ? 87.414  -3.644  -150.253 1.00 30.08  ? 265 LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 265 ? 87.690  -2.664  -152.522 1.00 21.64  ? 265 LEU A CD2 1 
ATOM   1616 N N   . PRO A 1 266 ? 83.660  -5.611  -150.767 1.00 31.07  ? 266 PRO A N   1 
ATOM   1617 C CA  . PRO A 1 266 ? 83.995  -4.776  -149.627 1.00 30.47  ? 266 PRO A CA  1 
ATOM   1618 C C   . PRO A 1 266 ? 84.485  -5.566  -148.437 1.00 29.07  ? 266 PRO A C   1 
ATOM   1619 O O   . PRO A 1 266 ? 84.421  -6.788  -148.431 1.00 32.87  ? 266 PRO A O   1 
ATOM   1620 C CB  . PRO A 1 266 ? 82.660  -4.114  -149.279 1.00 31.78  ? 266 PRO A CB  1 
ATOM   1621 C CG  . PRO A 1 266 ? 81.647  -5.100  -149.679 1.00 30.98  ? 266 PRO A CG  1 
ATOM   1622 C CD  . PRO A 1 266 ? 82.208  -5.853  -150.851 1.00 28.27  ? 266 PRO A CD  1 
ATOM   1623 N N   . PHE A 1 267 ? 85.003  -4.850  -147.453 1.00 27.89  ? 267 PHE A N   1 
ATOM   1624 C CA  . PHE A 1 267 ? 85.297  -5.417  -146.152 1.00 30.08  ? 267 PHE A CA  1 
ATOM   1625 C C   . PHE A 1 267 ? 85.350  -4.265  -145.164 1.00 32.41  ? 267 PHE A C   1 
ATOM   1626 O O   . PHE A 1 267 ? 85.594  -3.116  -145.562 1.00 34.05  ? 267 PHE A O   1 
ATOM   1627 C CB  . PHE A 1 267 ? 86.611  -6.199  -146.165 1.00 32.49  ? 267 PHE A CB  1 
ATOM   1628 C CG  . PHE A 1 267 ? 87.842  -5.334  -146.165 1.00 35.60  ? 267 PHE A CG  1 
ATOM   1629 C CD1 . PHE A 1 267 ? 88.379  -4.864  -144.971 1.00 36.37  ? 267 PHE A CD1 1 
ATOM   1630 C CD2 . PHE A 1 267 ? 88.476  -5.007  -147.354 1.00 38.87  ? 267 PHE A CD2 1 
ATOM   1631 C CE1 . PHE A 1 267 ? 89.518  -4.067  -144.964 1.00 33.30  ? 267 PHE A CE1 1 
ATOM   1632 C CE2 . PHE A 1 267 ? 89.620  -4.213  -147.357 1.00 38.60  ? 267 PHE A CE2 1 
ATOM   1633 C CZ  . PHE A 1 267 ? 90.140  -3.741  -146.159 1.00 36.21  ? 267 PHE A CZ  1 
ATOM   1634 N N   . ALA A 1 268 ? 85.106  -4.570  -143.891 1.00 30.99  ? 268 ALA A N   1 
ATOM   1635 C CA  . ALA A 1 268 ? 85.125  -3.558  -142.839 1.00 32.04  ? 268 ALA A CA  1 
ATOM   1636 C C   . ALA A 1 268 ? 86.033  -3.994  -141.688 1.00 32.27  ? 268 ALA A C   1 
ATOM   1637 O O   . ALA A 1 268 ? 85.993  -5.142  -141.261 1.00 35.96  ? 268 ALA A O   1 
ATOM   1638 C CB  . ALA A 1 268 ? 83.708  -3.284  -142.339 1.00 30.97  ? 268 ALA A CB  1 
ATOM   1639 N N   . ALA A 1 269 ? 86.866  -3.073  -141.212 1.00 32.05  ? 269 ALA A N   1 
ATOM   1640 C CA  . ALA A 1 269 ? 87.684  -3.300  -140.025 1.00 31.91  ? 269 ALA A CA  1 
ATOM   1641 C C   . ALA A 1 269 ? 87.167  -2.471  -138.833 1.00 33.49  ? 269 ALA A C   1 
ATOM   1642 O O   . ALA A 1 269 ? 86.525  -1.426  -139.010 1.00 29.91  ? 269 ALA A O   1 
ATOM   1643 C CB  . ALA A 1 269 ? 89.136  -2.968  -140.317 1.00 31.27  ? 269 ALA A CB  1 
ATOM   1644 N N   . ALA A 1 270 ? 87.439  -2.951  -137.621 1.00 32.89  ? 270 ALA A N   1 
ATOM   1645 C CA  . ALA A 1 270 ? 87.030  -2.248  -136.404 1.00 30.82  ? 270 ALA A CA  1 
ATOM   1646 C C   . ALA A 1 270 ? 88.131  -2.221  -135.338 1.00 30.20  ? 270 ALA A C   1 
ATOM   1647 O O   . ALA A 1 270 ? 89.090  -2.998  -135.377 1.00 31.53  ? 270 ALA A O   1 
ATOM   1648 C CB  . ALA A 1 270 ? 85.756  -2.859  -135.839 1.00 23.95  ? 270 ALA A CB  1 
ATOM   1649 N N   . GLN A 1 271 ? 87.976  -1.291  -134.402 1.00 30.76  ? 271 GLN A N   1 
ATOM   1650 C CA  . GLN A 1 271 ? 88.846  -1.158  -133.236 1.00 29.26  ? 271 GLN A CA  1 
ATOM   1651 C C   . GLN A 1 271 ? 88.037  -0.604  -132.061 1.00 24.21  ? 271 GLN A C   1 
ATOM   1652 O O   . GLN A 1 271 ? 87.231  0.312   -132.220 1.00 20.91  ? 271 GLN A O   1 
ATOM   1653 C CB  . GLN A 1 271 ? 90.034  -0.231  -133.534 1.00 29.39  ? 271 GLN A CB  1 
ATOM   1654 C CG  . GLN A 1 271 ? 91.333  -0.961  -133.877 1.00 38.95  ? 271 GLN A CG  1 
ATOM   1655 C CD  . GLN A 1 271 ? 92.571  -0.078  -133.740 1.00 40.60  ? 271 GLN A CD  1 
ATOM   1656 O OE1 . GLN A 1 271 ? 92.901  0.699   -134.639 1.00 46.07  ? 271 GLN A OE1 1 
ATOM   1657 N NE2 . GLN A 1 271 ? 93.267  -0.205  -132.608 1.00 42.25  ? 271 GLN A NE2 1 
ATOM   1658 N N   . ILE A 1 272 ? 88.235  -1.187  -130.888 1.00 24.18  ? 272 ILE A N   1 
ATOM   1659 C CA  . ILE A 1 272 ? 87.663  -0.659  -129.662 1.00 25.47  ? 272 ILE A CA  1 
ATOM   1660 C C   . ILE A 1 272 ? 88.837  -0.392  -128.734 1.00 29.32  ? 272 ILE A C   1 
ATOM   1661 O O   . ILE A 1 272 ? 89.527  -1.323  -128.310 1.00 39.31  ? 272 ILE A O   1 
ATOM   1662 C CB  . ILE A 1 272 ? 86.673  -1.632  -129.019 1.00 15.79  ? 272 ILE A CB  1 
ATOM   1663 C CG1 . ILE A 1 272 ? 85.549  -1.968  -129.994 1.00 23.44  ? 272 ILE A CG1 1 
ATOM   1664 C CG2 . ILE A 1 272 ? 86.066  -1.015  -127.793 1.00 24.71  ? 272 ILE A CG2 1 
ATOM   1665 C CD1 . ILE A 1 272 ? 84.567  -3.000  -129.469 1.00 23.69  ? 272 ILE A CD1 1 
ATOM   1666 N N   . GLY A 1 273 ? 89.090  0.881   -128.452 1.00 29.24  ? 273 GLY A N   1 
ATOM   1667 C CA  . GLY A 1 273 ? 90.231  1.253   -127.630 1.00 31.26  ? 273 GLY A CA  1 
ATOM   1668 C C   . GLY A 1 273 ? 90.242  2.724   -127.277 1.00 32.87  ? 273 GLY A C   1 
ATOM   1669 O O   . GLY A 1 273 ? 89.336  3.472   -127.644 1.00 28.91  ? 273 GLY A O   1 
ATOM   1670 N N   . ASN A 1 274 ? 91.285  3.136   -126.570 1.00 33.65  ? 274 ASN A N   1 
ATOM   1671 C CA  . ASN A 1 274 ? 91.400  4.510   -126.134 1.00 34.94  ? 274 ASN A CA  1 
ATOM   1672 C C   . ASN A 1 274 ? 92.262  5.373   -127.025 1.00 37.39  ? 274 ASN A C   1 
ATOM   1673 O O   . ASN A 1 274 ? 93.300  4.944   -127.531 1.00 36.07  ? 274 ASN A O   1 
ATOM   1674 C CB  . ASN A 1 274 ? 91.943  4.569   -124.716 1.00 37.83  ? 274 ASN A CB  1 
ATOM   1675 C CG  . ASN A 1 274 ? 91.016  3.932   -123.735 1.00 37.06  ? 274 ASN A CG  1 
ATOM   1676 O OD1 . ASN A 1 274 ? 89.802  4.048   -123.858 1.00 30.74  ? 274 ASN A OD1 1 
ATOM   1677 N ND2 . ASN A 1 274 ? 91.575  3.243   -122.758 1.00 48.14  ? 274 ASN A ND2 1 
ATOM   1678 N N   . SER A 1 275 ? 91.805  6.606   -127.190 1.00 37.46  ? 275 SER A N   1 
ATOM   1679 C CA  . SER A 1 275 ? 92.560  7.645   -127.842 1.00 38.01  ? 275 SER A CA  1 
ATOM   1680 C C   . SER A 1 275 ? 92.633  8.809   -126.860 1.00 37.29  ? 275 SER A C   1 
ATOM   1681 O O   . SER A 1 275 ? 91.944  8.809   -125.840 1.00 34.51  ? 275 SER A O   1 
ATOM   1682 C CB  . SER A 1 275 ? 91.866  8.034   -129.137 1.00 38.69  ? 275 SER A CB  1 
ATOM   1683 O OG  . SER A 1 275 ? 91.416  6.870   -129.816 1.00 45.22  ? 275 SER A OG  1 
ATOM   1684 N N   . PHE A 1 276 ? 93.482  9.787   -127.156 1.00 38.86  ? 276 PHE A N   1 
ATOM   1685 C CA  . PHE A 1 276 ? 93.791  10.854  -126.208 1.00 36.68  ? 276 PHE A CA  1 
ATOM   1686 C C   . PHE A 1 276 ? 93.720  12.194  -126.897 1.00 34.08  ? 276 PHE A C   1 
ATOM   1687 O O   . PHE A 1 276 ? 94.014  12.297  -128.074 1.00 39.33  ? 276 PHE A O   1 
ATOM   1688 C CB  . PHE A 1 276 ? 95.183  10.652  -125.616 1.00 38.09  ? 276 PHE A CB  1 
ATOM   1689 C CG  . PHE A 1 276 ? 95.361  9.326   -124.924 1.00 37.95  ? 276 PHE A CG  1 
ATOM   1690 C CD1 . PHE A 1 276 ? 95.442  8.149   -125.657 1.00 38.15  ? 276 PHE A CD1 1 
ATOM   1691 C CD2 . PHE A 1 276 ? 95.455  9.255   -123.545 1.00 40.38  ? 276 PHE A CD2 1 
ATOM   1692 C CE1 . PHE A 1 276 ? 95.606  6.935   -125.031 1.00 42.20  ? 276 PHE A CE1 1 
ATOM   1693 C CE2 . PHE A 1 276 ? 95.619  8.037   -122.911 1.00 39.90  ? 276 PHE A CE2 1 
ATOM   1694 C CZ  . PHE A 1 276 ? 95.693  6.875   -123.656 1.00 41.48  ? 276 PHE A CZ  1 
ATOM   1695 N N   . ARG A 1 277 ? 93.334  13.216  -126.150 1.00 34.97  ? 277 ARG A N   1 
ATOM   1696 C CA  . ARG A 1 277 ? 93.058  14.526  -126.711 1.00 33.69  ? 277 ARG A CA  1 
ATOM   1697 C C   . ARG A 1 277 ? 93.315  15.592  -125.631 1.00 33.49  ? 277 ARG A C   1 
ATOM   1698 O O   . ARG A 1 277 ? 92.505  15.787  -124.723 1.00 32.76  ? 277 ARG A O   1 
ATOM   1699 C CB  . ARG A 1 277 ? 91.611  14.549  -127.214 1.00 32.33  ? 277 ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 277 ? 91.308  15.630  -128.230 1.00 39.88  ? 277 ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 277 ? 89.808  15.807  -128.474 1.00 41.24  ? 277 ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 277 ? 89.504  17.203  -128.800 1.00 47.02  ? 277 ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 277 ? 89.299  17.687  -130.025 1.00 54.21  ? 277 ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 277 ? 89.347  16.899  -131.099 1.00 54.94  ? 277 ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 277 ? 89.037  18.985  -130.174 1.00 54.93  ? 277 ARG A NH2 1 
ATOM   1706 N N   . ASN A 1 278 ? 94.462  16.261  -125.724 1.00 32.40  ? 278 ASN A N   1 
ATOM   1707 C CA  . ASN A 1 278 ? 94.943  17.154  -124.660 1.00 31.50  ? 278 ASN A CA  1 
ATOM   1708 C C   . ASN A 1 278 ? 94.177  18.469  -124.619 1.00 30.39  ? 278 ASN A C   1 
ATOM   1709 O O   . ASN A 1 278 ? 94.694  19.520  -125.005 1.00 34.83  ? 278 ASN A O   1 
ATOM   1710 C CB  . ASN A 1 278 ? 96.448  17.413  -124.831 1.00 30.99  ? 278 ASN A CB  1 
ATOM   1711 C CG  . ASN A 1 278 ? 97.080  18.098  -123.627 1.00 28.13  ? 278 ASN A CG  1 
ATOM   1712 O OD1 . ASN A 1 278 ? 96.629  17.955  -122.488 1.00 20.58  ? 278 ASN A OD1 1 
ATOM   1713 N ND2 . ASN A 1 278 ? 98.143  18.840  -123.881 1.00 26.11  ? 278 ASN A ND2 1 
ATOM   1714 N N   . GLU A 1 279 ? 92.944  18.397  -124.129 1.00 29.03  ? 279 GLU A N   1 
ATOM   1715 C CA  . GLU A 1 279 ? 92.039  19.545  -124.129 1.00 31.34  ? 279 GLU A CA  1 
ATOM   1716 C C   . GLU A 1 279 ? 92.595  20.679  -123.262 1.00 28.58  ? 279 GLU A C   1 
ATOM   1717 O O   . GLU A 1 279 ? 93.140  20.430  -122.193 1.00 28.54  ? 279 GLU A O   1 
ATOM   1718 C CB  . GLU A 1 279 ? 90.648  19.122  -123.638 1.00 33.55  ? 279 GLU A CB  1 
ATOM   1719 C CG  . GLU A 1 279 ? 89.495  19.833  -124.349 1.00 43.07  ? 279 GLU A CG  1 
ATOM   1720 C CD  . GLU A 1 279 ? 89.160  19.210  -125.702 1.00 45.49  ? 279 GLU A CD  1 
ATOM   1721 O OE1 . GLU A 1 279 ? 88.946  17.972  -125.759 1.00 23.19  ? 279 GLU A OE1 1 
ATOM   1722 O OE2 . GLU A 1 279 ? 89.103  19.968  -126.702 1.00 53.92  ? 279 GLU A OE2 1 
ATOM   1723 N N   . ILE A 1 280 ? 92.466  21.918  -123.733 1.00 28.18  ? 280 ILE A N   1 
ATOM   1724 C CA  . ILE A 1 280 ? 93.042  23.079  -123.039 1.00 30.60  ? 280 ILE A CA  1 
ATOM   1725 C C   . ILE A 1 280 ? 92.463  23.278  -121.643 1.00 32.54  ? 280 ILE A C   1 
ATOM   1726 O O   . ILE A 1 280 ? 93.203  23.411  -120.657 1.00 31.68  ? 280 ILE A O   1 
ATOM   1727 C CB  . ILE A 1 280 ? 92.815  24.383  -123.824 1.00 27.31  ? 280 ILE A CB  1 
ATOM   1728 C CG1 . ILE A 1 280 ? 93.732  24.427  -125.045 1.00 30.16  ? 280 ILE A CG1 1 
ATOM   1729 C CG2 . ILE A 1 280 ? 93.075  25.589  -122.934 1.00 24.16  ? 280 ILE A CG2 1 
ATOM   1730 C CD1 . ILE A 1 280 ? 93.527  25.649  -125.922 1.00 32.13  ? 280 ILE A CD1 1 
ATOM   1731 N N   . SER A 1 281 ? 91.138  23.318  -121.569 1.00 32.52  ? 281 SER A N   1 
ATOM   1732 C CA  . SER A 1 281 ? 90.469  23.491  -120.298 1.00 32.28  ? 281 SER A CA  1 
ATOM   1733 C C   . SER A 1 281 ? 89.072  22.882  -120.317 1.00 32.55  ? 281 SER A C   1 
ATOM   1734 O O   . SER A 1 281 ? 88.086  23.594  -120.528 1.00 28.68  ? 281 SER A O   1 
ATOM   1735 C CB  . SER A 1 281 ? 90.411  24.961  -119.930 1.00 29.76  ? 281 SER A CB  1 
ATOM   1736 O OG  . SER A 1 281 ? 90.106  25.079  -118.560 1.00 42.69  ? 281 SER A OG  1 
ATOM   1737 N N   . PRO A 1 282 ? 88.993  21.552  -120.099 1.00 35.66  ? 282 PRO A N   1 
ATOM   1738 C CA  . PRO A 1 282 ? 87.724  20.828  -120.027 1.00 38.39  ? 282 PRO A CA  1 
ATOM   1739 C C   . PRO A 1 282 ? 86.948  21.151  -118.759 1.00 41.72  ? 282 PRO A C   1 
ATOM   1740 O O   . PRO A 1 282 ? 87.485  21.046  -117.653 1.00 41.89  ? 282 PRO A O   1 
ATOM   1741 C CB  . PRO A 1 282 ? 88.153  19.360  -120.018 1.00 38.20  ? 282 PRO A CB  1 
ATOM   1742 C CG  . PRO A 1 282 ? 89.526  19.363  -119.481 1.00 33.91  ? 282 PRO A CG  1 
ATOM   1743 C CD  . PRO A 1 282 ? 90.145  20.651  -119.905 1.00 32.09  ? 282 PRO A CD  1 
ATOM   1744 N N   . ARG A 1 283 ? 85.698  21.559  -118.935 1.00 45.97  ? 283 ARG A N   1 
ATOM   1745 C CA  . ARG A 1 283 ? 84.815  21.851  -117.816 1.00 47.28  ? 283 ARG A CA  1 
ATOM   1746 C C   . ARG A 1 283 ? 83.366  21.503  -118.166 1.00 44.80  ? 283 ARG A C   1 
ATOM   1747 O O   . ARG A 1 283 ? 82.440  22.119  -117.652 1.00 44.47  ? 283 ARG A O   1 
ATOM   1748 C CB  . ARG A 1 283 ? 84.971  23.325  -117.375 1.00 55.97  ? 283 ARG A CB  1 
ATOM   1749 C CG  . ARG A 1 283 ? 85.117  24.364  -118.509 1.00 71.76  ? 283 ARG A CG  1 
ATOM   1750 C CD  . ARG A 1 283 ? 83.858  24.462  -119.386 1.00 85.84  ? 283 ARG A CD  1 
ATOM   1751 N NE  . ARG A 1 283 ? 83.962  25.461  -120.458 1.00 83.89  ? 283 ARG A NE  1 
ATOM   1752 C CZ  . ARG A 1 283 ? 83.070  25.622  -121.441 1.00 85.49  ? 283 ARG A CZ  1 
ATOM   1753 N NH1 . ARG A 1 283 ? 81.984  24.855  -121.516 1.00 90.46  ? 283 ARG A NH1 1 
ATOM   1754 N NH2 . ARG A 1 283 ? 83.263  26.559  -122.363 1.00 86.96  ? 283 ARG A NH2 1 
ATOM   1755 N N   . SER A 1 284 ? 83.180  20.506  -119.031 1.00 44.02  ? 284 SER A N   1 
ATOM   1756 C CA  . SER A 1 284 ? 81.849  20.083  -119.472 1.00 42.76  ? 284 SER A CA  1 
ATOM   1757 C C   . SER A 1 284 ? 81.593  18.641  -119.047 1.00 41.63  ? 284 SER A C   1 
ATOM   1758 O O   . SER A 1 284 ? 81.055  17.840  -119.810 1.00 42.81  ? 284 SER A O   1 
ATOM   1759 C CB  . SER A 1 284 ? 81.729  20.210  -120.992 1.00 42.18  ? 284 SER A CB  1 
ATOM   1760 O OG  . SER A 1 284 ? 82.278  21.435  -121.441 1.00 48.77  ? 284 SER A OG  1 
ATOM   1761 N N   . GLY A 1 285 ? 81.988  18.313  -117.821 1.00 40.62  ? 285 GLY A N   1 
ATOM   1762 C CA  . GLY A 1 285 ? 81.834  16.962  -117.301 1.00 37.62  ? 285 GLY A CA  1 
ATOM   1763 C C   . GLY A 1 285 ? 82.403  15.926  -118.243 1.00 35.01  ? 285 GLY A C   1 
ATOM   1764 O O   . GLY A 1 285 ? 83.421  16.149  -118.890 1.00 36.69  ? 285 GLY A O   1 
ATOM   1765 N N   . LEU A 1 286 ? 81.712  14.802  -118.350 1.00 36.92  ? 286 LEU A N   1 
ATOM   1766 C CA  . LEU A 1 286 ? 82.182  13.656  -119.129 1.00 38.51  ? 286 LEU A CA  1 
ATOM   1767 C C   . LEU A 1 286 ? 82.131  13.882  -120.655 1.00 38.25  ? 286 LEU A C   1 
ATOM   1768 O O   . LEU A 1 286 ? 82.640  13.066  -121.419 1.00 37.60  ? 286 LEU A O   1 
ATOM   1769 C CB  . LEU A 1 286 ? 81.350  12.426  -118.734 1.00 40.48  ? 286 LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 286 ? 81.931  11.027  -118.941 1.00 40.72  ? 286 LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 286 ? 81.601  10.152  -117.745 1.00 35.96  ? 286 LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 286 ? 81.423  10.392  -120.236 1.00 43.88  ? 286 LEU A CD2 1 
ATOM   1773 N N   . ILE A 1 287 ? 81.529  14.987  -121.092 1.00 38.28  ? 287 ILE A N   1 
ATOM   1774 C CA  . ILE A 1 287 ? 81.375  15.274  -122.518 1.00 39.37  ? 287 ILE A CA  1 
ATOM   1775 C C   . ILE A 1 287 ? 82.713  15.648  -123.161 1.00 40.02  ? 287 ILE A C   1 
ATOM   1776 O O   . ILE A 1 287 ? 83.014  15.194  -124.259 1.00 42.52  ? 287 ILE A O   1 
ATOM   1777 C CB  . ILE A 1 287 ? 80.315  16.391  -122.773 1.00 41.03  ? 287 ILE A CB  1 
ATOM   1778 C CG1 . ILE A 1 287 ? 78.897  15.819  -122.725 1.00 39.52  ? 287 ILE A CG1 1 
ATOM   1779 C CG2 . ILE A 1 287 ? 80.503  17.022  -124.138 1.00 41.82  ? 287 ILE A CG2 1 
ATOM   1780 C CD1 . ILE A 1 287 ? 78.625  14.908  -121.552 1.00 41.19  ? 287 ILE A CD1 1 
ATOM   1781 N N   . ARG A 1 288 ? 83.507  16.468  -122.477 1.00 41.33  ? 288 ARG A N   1 
ATOM   1782 C CA  . ARG A 1 288 ? 84.835  16.870  -122.965 1.00 42.44  ? 288 ARG A CA  1 
ATOM   1783 C C   . ARG A 1 288 ? 85.950  16.295  -122.093 1.00 34.06  ? 288 ARG A C   1 
ATOM   1784 O O   . ARG A 1 288 ? 86.311  16.887  -121.085 1.00 34.02  ? 288 ARG A O   1 
ATOM   1785 C CB  . ARG A 1 288 ? 84.956  18.393  -122.978 1.00 45.70  ? 288 ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 288 ? 83.994  19.088  -123.914 1.00 57.82  ? 288 ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 288 ? 84.350  20.568  -124.090 1.00 61.81  ? 288 ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 288 ? 84.192  20.988  -125.478 1.00 76.19  ? 288 ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 288 ? 84.978  20.594  -126.481 1.00 83.89  ? 288 ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 288 ? 85.995  19.759  -126.269 1.00 84.38  ? 288 ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 288 ? 84.743  21.032  -127.713 1.00 85.33  ? 288 ARG A NH2 1 
ATOM   1792 N N   . VAL A 1 289 ? 86.506  15.157  -122.491 1.00 30.80  ? 289 VAL A N   1 
ATOM   1793 C CA  . VAL A 1 289 ? 87.551  14.495  -121.713 1.00 32.04  ? 289 VAL A CA  1 
ATOM   1794 C C   . VAL A 1 289 ? 88.860  14.361  -122.484 1.00 33.75  ? 289 VAL A C   1 
ATOM   1795 O O   . VAL A 1 289 ? 88.896  14.476  -123.719 1.00 31.26  ? 289 VAL A O   1 
ATOM   1796 C CB  . VAL A 1 289 ? 87.110  13.097  -121.257 1.00 30.53  ? 289 VAL A CB  1 
ATOM   1797 C CG1 . VAL A 1 289 ? 86.002  13.210  -120.226 1.00 31.35  ? 289 VAL A CG1 1 
ATOM   1798 C CG2 . VAL A 1 289 ? 86.672  12.253  -122.455 1.00 23.34  ? 289 VAL A CG2 1 
ATOM   1799 N N   . ARG A 1 290 ? 89.922  14.092  -121.724 1.00 33.16  ? 290 ARG A N   1 
ATOM   1800 C CA  . ARG A 1 290 ? 91.294  14.031  -122.227 1.00 33.63  ? 290 ARG A CA  1 
ATOM   1801 C C   . ARG A 1 290 ? 91.692  12.626  -122.697 1.00 34.84  ? 290 ARG A C   1 
ATOM   1802 O O   . ARG A 1 290 ? 92.543  12.475  -123.570 1.00 35.83  ? 290 ARG A O   1 
ATOM   1803 C CB  . ARG A 1 290 ? 92.252  14.471  -121.119 1.00 35.62  ? 290 ARG A CB  1 
ATOM   1804 C CG  . ARG A 1 290 ? 92.061  15.908  -120.625 1.00 34.97  ? 290 ARG A CG  1 
ATOM   1805 C CD  . ARG A 1 290 ? 93.317  16.735  -120.845 1.00 37.58  ? 290 ARG A CD  1 
ATOM   1806 N NE  . ARG A 1 290 ? 93.141  18.161  -120.560 1.00 35.68  ? 290 ARG A NE  1 
ATOM   1807 C CZ  . ARG A 1 290 ? 93.296  18.735  -119.367 1.00 30.31  ? 290 ARG A CZ  1 
ATOM   1808 N NH1 . ARG A 1 290 ? 93.589  18.027  -118.284 1.00 26.43  ? 290 ARG A NH1 1 
ATOM   1809 N NH2 . ARG A 1 290 ? 93.132  20.043  -119.249 1.00 39.16  ? 290 ARG A NH2 1 
ATOM   1810 N N   . GLU A 1 291 ? 91.091  11.611  -122.085 1.00 35.34  ? 291 GLU A N   1 
ATOM   1811 C CA  . GLU A 1 291 ? 91.323  10.205  -122.418 1.00 31.74  ? 291 GLU A CA  1 
ATOM   1812 C C   . GLU A 1 291 ? 89.944  9.563   -122.529 1.00 31.28  ? 291 GLU A C   1 
ATOM   1813 O O   . GLU A 1 291 ? 89.055  9.891   -121.744 1.00 31.52  ? 291 GLU A O   1 
ATOM   1814 C CB  . GLU A 1 291 ? 92.145  9.550   -121.307 1.00 28.07  ? 291 GLU A CB  1 
ATOM   1815 C CG  . GLU A 1 291 ? 92.381  8.058   -121.462 1.00 37.40  ? 291 GLU A CG  1 
ATOM   1816 C CD  . GLU A 1 291 ? 93.197  7.451   -120.318 1.00 38.14  ? 291 GLU A CD  1 
ATOM   1817 O OE1 . GLU A 1 291 ? 94.162  8.107   -119.843 1.00 27.94  ? 291 GLU A OE1 1 
ATOM   1818 O OE2 . GLU A 1 291 ? 92.877  6.304   -119.905 1.00 34.17  ? 291 GLU A OE2 1 
ATOM   1819 N N   . PHE A 1 292 ? 89.746  8.672   -123.500 1.00 30.69  ? 292 PHE A N   1 
ATOM   1820 C CA  . PHE A 1 292 ? 88.397  8.140   -123.783 1.00 30.56  ? 292 PHE A CA  1 
ATOM   1821 C C   . PHE A 1 292 ? 88.426  6.930   -124.693 1.00 31.06  ? 292 PHE A C   1 
ATOM   1822 O O   . PHE A 1 292 ? 89.352  6.781   -125.480 1.00 38.01  ? 292 PHE A O   1 
ATOM   1823 C CB  . PHE A 1 292 ? 87.527  9.215   -124.438 1.00 30.21  ? 292 PHE A CB  1 
ATOM   1824 C CG  . PHE A 1 292 ? 88.206  9.930   -125.559 1.00 29.40  ? 292 PHE A CG  1 
ATOM   1825 C CD1 . PHE A 1 292 ? 88.898  11.106  -125.327 1.00 31.95  ? 292 PHE A CD1 1 
ATOM   1826 C CD2 . PHE A 1 292 ? 88.184  9.411   -126.842 1.00 34.15  ? 292 PHE A CD2 1 
ATOM   1827 C CE1 . PHE A 1 292 ? 89.544  11.756  -126.356 1.00 34.28  ? 292 PHE A CE1 1 
ATOM   1828 C CE2 . PHE A 1 292 ? 88.827  10.063  -127.882 1.00 31.15  ? 292 PHE A CE2 1 
ATOM   1829 C CZ  . PHE A 1 292 ? 89.507  11.237  -127.638 1.00 32.02  ? 292 PHE A CZ  1 
ATOM   1830 N N   . THR A 1 293 ? 87.395  6.089   -124.597 1.00 31.72  ? 293 THR A N   1 
ATOM   1831 C CA  . THR A 1 293 ? 87.290  4.883   -125.421 1.00 31.70  ? 293 THR A CA  1 
ATOM   1832 C C   . THR A 1 293 ? 86.400  5.085   -126.641 1.00 32.28  ? 293 THR A C   1 
ATOM   1833 O O   . THR A 1 293 ? 85.275  5.574   -126.542 1.00 34.61  ? 293 THR A O   1 
ATOM   1834 C CB  . THR A 1 293 ? 86.714  3.695   -124.641 1.00 32.37  ? 293 THR A CB  1 
ATOM   1835 O OG1 . THR A 1 293 ? 87.463  3.494   -123.439 1.00 29.15  ? 293 THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 293 ? 86.752  2.420   -125.493 1.00 31.73  ? 293 THR A CG2 1 
ATOM   1837 N N   . MET A 1 294 ? 86.916  4.669   -127.787 1.00 32.91  ? 294 MET A N   1 
ATOM   1838 C CA  . MET A 1 294 ? 86.191  4.726   -129.030 1.00 35.32  ? 294 MET A CA  1 
ATOM   1839 C C   . MET A 1 294 ? 85.905  3.316   -129.515 1.00 34.48  ? 294 MET A C   1 
ATOM   1840 O O   . MET A 1 294 ? 86.622  2.369   -129.185 1.00 30.92  ? 294 MET A O   1 
ATOM   1841 C CB  . MET A 1 294 ? 87.032  5.450   -130.077 1.00 42.45  ? 294 MET A CB  1 
ATOM   1842 C CG  . MET A 1 294 ? 87.531  6.824   -129.643 1.00 47.75  ? 294 MET A CG  1 
ATOM   1843 S SD  . MET A 1 294 ? 86.198  8.027   -129.591 1.00 48.58  ? 294 MET A SD  1 
ATOM   1844 C CE  . MET A 1 294 ? 86.053  8.438   -131.332 1.00 48.17  ? 294 MET A CE  1 
ATOM   1845 N N   . ALA A 1 295 ? 84.822  3.184   -130.267 1.00 33.43  ? 295 ALA A N   1 
ATOM   1846 C CA  . ALA A 1 295 ? 84.621  2.040   -131.136 1.00 33.91  ? 295 ALA A CA  1 
ATOM   1847 C C   . ALA A 1 295 ? 84.503  2.659   -132.513 1.00 31.81  ? 295 ALA A C   1 
ATOM   1848 O O   . ALA A 1 295 ? 83.592  3.439   -132.762 1.00 32.57  ? 295 ALA A O   1 
ATOM   1849 C CB  . ALA A 1 295 ? 83.359  1.277   -130.771 1.00 34.45  ? 295 ALA A CB  1 
ATOM   1850 N N   . GLU A 1 296 ? 85.449  2.352   -133.390 1.00 28.67  ? 296 GLU A N   1 
ATOM   1851 C CA  . GLU A 1 296 ? 85.471  2.944   -134.716 1.00 30.82  ? 296 GLU A CA  1 
ATOM   1852 C C   . GLU A 1 296 ? 85.448  1.847   -135.782 1.00 32.00  ? 296 GLU A C   1 
ATOM   1853 O O   . GLU A 1 296 ? 86.115  0.821   -135.644 1.00 28.90  ? 296 GLU A O   1 
ATOM   1854 C CB  . GLU A 1 296 ? 86.701  3.843   -134.875 1.00 28.11  ? 296 GLU A CB  1 
ATOM   1855 C CG  . GLU A 1 296 ? 86.704  5.080   -133.961 1.00 36.19  ? 296 GLU A CG  1 
ATOM   1856 C CD  . GLU A 1 296 ? 87.748  6.141   -134.359 1.00 39.16  ? 296 GLU A CD  1 
ATOM   1857 O OE1 . GLU A 1 296 ? 87.439  7.017   -135.205 1.00 42.17  ? 296 GLU A OE1 1 
ATOM   1858 O OE2 . GLU A 1 296 ? 88.871  6.113   -133.803 1.00 48.88  ? 296 GLU A OE2 1 
ATOM   1859 N N   . ILE A 1 297 ? 84.649  2.067   -136.827 1.00 32.25  ? 297 ILE A N   1 
ATOM   1860 C CA  . ILE A 1 297 ? 84.562  1.159   -137.966 1.00 31.07  ? 297 ILE A CA  1 
ATOM   1861 C C   . ILE A 1 297 ? 85.080  1.853   -139.215 1.00 32.00  ? 297 ILE A C   1 
ATOM   1862 O O   . ILE A 1 297 ? 84.852  3.049   -139.417 1.00 34.52  ? 297 ILE A O   1 
ATOM   1863 C CB  . ILE A 1 297 ? 83.119  0.729   -138.228 1.00 27.45  ? 297 ILE A CB  1 
ATOM   1864 C CG1 . ILE A 1 297 ? 82.580  -0.040  -137.027 1.00 34.52  ? 297 ILE A CG1 1 
ATOM   1865 C CG2 . ILE A 1 297 ? 83.037  -0.123  -139.480 1.00 25.54  ? 297 ILE A CG2 1 
ATOM   1866 C CD1 . ILE A 1 297 ? 81.229  -0.671  -137.263 1.00 37.59  ? 297 ILE A CD1 1 
ATOM   1867 N N   . GLU A 1 298 ? 85.786  1.098   -140.046 1.00 31.01  ? 298 GLU A N   1 
ATOM   1868 C CA  . GLU A 1 298 ? 86.223  1.582   -141.343 1.00 31.13  ? 298 GLU A CA  1 
ATOM   1869 C C   . GLU A 1 298 ? 85.725  0.606   -142.392 1.00 29.28  ? 298 GLU A C   1 
ATOM   1870 O O   . GLU A 1 298 ? 86.269  -0.487  -142.535 1.00 23.70  ? 298 GLU A O   1 
ATOM   1871 C CB  . GLU A 1 298 ? 87.746  1.698   -141.392 1.00 32.60  ? 298 GLU A CB  1 
ATOM   1872 C CG  . GLU A 1 298 ? 88.318  2.781   -140.464 1.00 39.27  ? 298 GLU A CG  1 
ATOM   1873 C CD  . GLU A 1 298 ? 88.022  4.203   -140.926 1.00 41.05  ? 298 GLU A CD  1 
ATOM   1874 O OE1 . GLU A 1 298 ? 87.833  4.411   -142.142 1.00 50.67  ? 298 GLU A OE1 1 
ATOM   1875 O OE2 . GLU A 1 298 ? 87.993  5.116   -140.072 1.00 41.56  ? 298 GLU A OE2 1 
ATOM   1876 N N   . HIS A 1 299 ? 84.682  1.013   -143.109 1.00 29.65  ? 299 HIS A N   1 
ATOM   1877 C CA  . HIS A 1 299 ? 84.036  0.176   -144.112 1.00 30.85  ? 299 HIS A CA  1 
ATOM   1878 C C   . HIS A 1 299 ? 84.523  0.544   -145.510 1.00 29.31  ? 299 HIS A C   1 
ATOM   1879 O O   . HIS A 1 299 ? 84.088  1.541   -146.083 1.00 30.99  ? 299 HIS A O   1 
ATOM   1880 C CB  . HIS A 1 299 ? 82.524  0.357   -144.019 1.00 32.24  ? 299 HIS A CB  1 
ATOM   1881 C CG  . HIS A 1 299 ? 81.750  -0.532  -144.936 1.00 31.46  ? 299 HIS A CG  1 
ATOM   1882 N ND1 . HIS A 1 299 ? 81.567  -0.245  -146.270 1.00 35.09  ? 299 HIS A ND1 1 
ATOM   1883 C CD2 . HIS A 1 299 ? 81.102  -1.696  -144.708 1.00 33.02  ? 299 HIS A CD2 1 
ATOM   1884 C CE1 . HIS A 1 299 ? 80.842  -1.197  -146.827 1.00 37.68  ? 299 HIS A CE1 1 
ATOM   1885 N NE2 . HIS A 1 299 ? 80.545  -2.088  -145.900 1.00 37.92  ? 299 HIS A NE2 1 
ATOM   1886 N N   . PHE A 1 300 ? 85.416  -0.274  -146.057 1.00 27.12  ? 300 PHE A N   1 
ATOM   1887 C CA  . PHE A 1 300 ? 86.007  -0.007  -147.361 1.00 29.91  ? 300 PHE A CA  1 
ATOM   1888 C C   . PHE A 1 300 ? 85.117  -0.578  -148.456 1.00 31.43  ? 300 PHE A C   1 
ATOM   1889 O O   . PHE A 1 300 ? 84.834  -1.777  -148.464 1.00 34.36  ? 300 PHE A O   1 
ATOM   1890 C CB  . PHE A 1 300 ? 87.400  -0.626  -147.448 1.00 32.32  ? 300 PHE A CB  1 
ATOM   1891 C CG  . PHE A 1 300 ? 88.338  -0.157  -146.371 1.00 34.48  ? 300 PHE A CG  1 
ATOM   1892 C CD1 . PHE A 1 300 ? 89.096  0.990   -146.542 1.00 31.35  ? 300 PHE A CD1 1 
ATOM   1893 C CD2 . PHE A 1 300 ? 88.463  -0.864  -145.180 1.00 41.16  ? 300 PHE A CD2 1 
ATOM   1894 C CE1 . PHE A 1 300 ? 89.957  1.428   -145.545 1.00 30.93  ? 300 PHE A CE1 1 
ATOM   1895 C CE2 . PHE A 1 300 ? 89.327  -0.432  -144.175 1.00 35.70  ? 300 PHE A CE2 1 
ATOM   1896 C CZ  . PHE A 1 300 ? 90.072  0.714   -144.359 1.00 33.03  ? 300 PHE A CZ  1 
ATOM   1897 N N   . VAL A 1 301 ? 84.683  0.282   -149.376 1.00 29.71  ? 301 VAL A N   1 
ATOM   1898 C CA  . VAL A 1 301 ? 83.774  -0.109  -150.459 1.00 30.71  ? 301 VAL A CA  1 
ATOM   1899 C C   . VAL A 1 301 ? 84.299  0.364   -151.816 1.00 30.69  ? 301 VAL A C   1 
ATOM   1900 O O   . VAL A 1 301 ? 84.906  1.435   -151.921 1.00 28.09  ? 301 VAL A O   1 
ATOM   1901 C CB  . VAL A 1 301 ? 82.359  0.493   -150.245 1.00 31.50  ? 301 VAL A CB  1 
ATOM   1902 C CG1 . VAL A 1 301 ? 82.429  2.016   -150.180 1.00 31.54  ? 301 VAL A CG1 1 
ATOM   1903 C CG2 . VAL A 1 301 ? 81.394  0.046   -151.346 1.00 27.03  ? 301 VAL A CG2 1 
ATOM   1904 N N   . ASP A 1 302 ? 84.062  -0.442  -152.849 1.00 29.97  ? 302 ASP A N   1 
ATOM   1905 C CA  . ASP A 1 302 ? 84.329  -0.029  -154.225 1.00 32.08  ? 302 ASP A CA  1 
ATOM   1906 C C   . ASP A 1 302 ? 83.355  1.097   -154.605 1.00 32.25  ? 302 ASP A C   1 
ATOM   1907 O O   . ASP A 1 302 ? 82.143  0.949   -154.438 1.00 32.49  ? 302 ASP A O   1 
ATOM   1908 C CB  . ASP A 1 302 ? 84.169  -1.218  -155.182 1.00 32.69  ? 302 ASP A CB  1 
ATOM   1909 C CG  . ASP A 1 302 ? 84.556  -0.884  -156.620 1.00 28.97  ? 302 ASP A CG  1 
ATOM   1910 O OD1 . ASP A 1 302 ? 84.236  0.218   -157.104 1.00 26.05  ? 302 ASP A OD1 1 
ATOM   1911 O OD2 . ASP A 1 302 ? 85.170  -1.740  -157.280 1.00 29.01  ? 302 ASP A OD2 1 
ATOM   1912 N N   . PRO A 1 303 ? 83.879  2.229   -155.112 1.00 30.57  ? 303 PRO A N   1 
ATOM   1913 C CA  . PRO A 1 303 ? 82.972  3.306   -155.496 1.00 30.06  ? 303 PRO A CA  1 
ATOM   1914 C C   . PRO A 1 303 ? 81.926  2.875   -156.532 1.00 30.71  ? 303 PRO A C   1 
ATOM   1915 O O   . PRO A 1 303 ? 80.793  3.357   -156.485 1.00 31.78  ? 303 PRO A O   1 
ATOM   1916 C CB  . PRO A 1 303 ? 83.910  4.368   -156.080 1.00 31.18  ? 303 PRO A CB  1 
ATOM   1917 C CG  . PRO A 1 303 ? 85.245  4.060   -155.523 1.00 30.22  ? 303 PRO A CG  1 
ATOM   1918 C CD  . PRO A 1 303 ? 85.290  2.585   -155.354 1.00 29.67  ? 303 PRO A CD  1 
ATOM   1919 N N   . SER A 1 304 ? 82.306  1.975   -157.444 1.00 30.06  ? 304 SER A N   1 
ATOM   1920 C CA  . SER A 1 304 ? 81.397  1.459   -158.479 1.00 28.30  ? 304 SER A CA  1 
ATOM   1921 C C   . SER A 1 304 ? 80.358  0.451   -157.943 1.00 29.49  ? 304 SER A C   1 
ATOM   1922 O O   . SER A 1 304 ? 79.259  0.355   -158.490 1.00 31.30  ? 304 SER A O   1 
ATOM   1923 C CB  . SER A 1 304 ? 82.195  0.838   -159.635 1.00 26.75  ? 304 SER A CB  1 
ATOM   1924 O OG  . SER A 1 304 ? 82.765  -0.407  -159.275 1.00 23.68  ? 304 SER A OG  1 
ATOM   1925 N N   . GLU A 1 305 ? 80.708  -0.293  -156.892 1.00 29.03  ? 305 GLU A N   1 
ATOM   1926 C CA  . GLU A 1 305 ? 79.770  -1.205  -156.213 1.00 27.97  ? 305 GLU A CA  1 
ATOM   1927 C C   . GLU A 1 305 ? 79.339  -0.616  -154.861 1.00 28.37  ? 305 GLU A C   1 
ATOM   1928 O O   . GLU A 1 305 ? 79.510  -1.244  -153.815 1.00 28.68  ? 305 GLU A O   1 
ATOM   1929 C CB  . GLU A 1 305 ? 80.404  -2.600  -156.029 1.00 26.55  ? 305 GLU A CB  1 
ATOM   1930 C CG  . GLU A 1 305 ? 79.780  -3.712  -156.864 1.00 31.34  ? 305 GLU A CG  1 
ATOM   1931 C CD  . GLU A 1 305 ? 79.879  -3.475  -158.366 1.00 42.92  ? 305 GLU A CD  1 
ATOM   1932 O OE1 . GLU A 1 305 ? 78.904  -3.797  -159.080 1.00 48.73  ? 305 GLU A OE1 1 
ATOM   1933 O OE2 . GLU A 1 305 ? 80.922  -2.971  -158.837 1.00 45.28  ? 305 GLU A OE2 1 
ATOM   1934 N N   . LYS A 1 306 ? 78.768  0.588   -154.888 1.00 28.14  ? 306 LYS A N   1 
ATOM   1935 C CA  . LYS A 1 306 ? 78.399  1.301   -153.659 1.00 28.49  ? 306 LYS A CA  1 
ATOM   1936 C C   . LYS A 1 306 ? 76.893  1.256   -153.384 1.00 29.15  ? 306 LYS A C   1 
ATOM   1937 O O   . LYS A 1 306 ? 76.229  2.286   -153.284 1.00 33.49  ? 306 LYS A O   1 
ATOM   1938 C CB  . LYS A 1 306 ? 78.888  2.750   -153.727 1.00 30.67  ? 306 LYS A CB  1 
ATOM   1939 C CG  . LYS A 1 306 ? 78.913  3.478   -152.384 1.00 26.48  ? 306 LYS A CG  1 
ATOM   1940 C CD  . LYS A 1 306 ? 79.574  4.844   -152.518 1.00 26.45  ? 306 LYS A CD  1 
ATOM   1941 C CE  . LYS A 1 306 ? 80.109  5.357   -151.192 1.00 28.39  ? 306 LYS A CE  1 
ATOM   1942 N NZ  . LYS A 1 306 ? 80.978  6.552   -151.362 1.00 22.72  ? 306 LYS A NZ  1 
ATOM   1943 N N   . ASP A 1 307 ? 76.362  0.048   -153.266 1.00 29.80  ? 307 ASP A N   1 
ATOM   1944 C CA  . ASP A 1 307 ? 74.987  -0.155  -152.830 1.00 29.26  ? 307 ASP A CA  1 
ATOM   1945 C C   . ASP A 1 307 ? 75.023  -1.253  -151.769 1.00 27.83  ? 307 ASP A C   1 
ATOM   1946 O O   . ASP A 1 307 ? 75.555  -2.334  -152.024 1.00 26.90  ? 307 ASP A O   1 
ATOM   1947 C CB  . ASP A 1 307 ? 74.116  -0.558  -154.023 1.00 28.07  ? 307 ASP A CB  1 
ATOM   1948 C CG  . ASP A 1 307 ? 72.629  -0.589  -153.692 1.00 38.26  ? 307 ASP A CG  1 
ATOM   1949 O OD1 . ASP A 1 307 ? 71.819  -0.550  -154.646 1.00 51.38  ? 307 ASP A OD1 1 
ATOM   1950 O OD2 . ASP A 1 307 ? 72.260  -0.659  -152.495 1.00 49.32  ? 307 ASP A OD2 1 
ATOM   1951 N N   . HIS A 1 308 ? 74.486  -0.986  -150.580 1.00 26.04  ? 308 HIS A N   1 
ATOM   1952 C CA  . HIS A 1 308 ? 74.553  -1.980  -149.507 1.00 29.60  ? 308 HIS A CA  1 
ATOM   1953 C C   . HIS A 1 308 ? 73.440  -3.018  -149.633 1.00 29.92  ? 308 HIS A C   1 
ATOM   1954 O O   . HIS A 1 308 ? 72.262  -2.662  -149.612 1.00 34.81  ? 308 HIS A O   1 
ATOM   1955 C CB  . HIS A 1 308 ? 74.501  -1.342  -148.121 1.00 30.64  ? 308 HIS A CB  1 
ATOM   1956 C CG  . HIS A 1 308 ? 75.088  -2.209  -147.052 1.00 29.25  ? 308 HIS A CG  1 
ATOM   1957 N ND1 . HIS A 1 308 ? 74.541  -3.420  -146.694 1.00 33.58  ? 308 HIS A ND1 1 
ATOM   1958 C CD2 . HIS A 1 308 ? 76.192  -2.055  -146.283 1.00 33.73  ? 308 HIS A CD2 1 
ATOM   1959 C CE1 . HIS A 1 308 ? 75.272  -3.967  -145.739 1.00 37.31  ? 308 HIS A CE1 1 
ATOM   1960 N NE2 . HIS A 1 308 ? 76.279  -3.158  -145.469 1.00 28.95  ? 308 HIS A NE2 1 
ATOM   1961 N N   . PRO A 1 309 ? 73.808  -4.307  -149.747 1.00 29.19  ? 309 PRO A N   1 
ATOM   1962 C CA  . PRO A 1 309 ? 72.818  -5.359  -149.954 1.00 28.81  ? 309 PRO A CA  1 
ATOM   1963 C C   . PRO A 1 309 ? 71.774  -5.477  -148.852 1.00 30.47  ? 309 PRO A C   1 
ATOM   1964 O O   . PRO A 1 309 ? 70.644  -5.875  -149.127 1.00 39.83  ? 309 PRO A O   1 
ATOM   1965 C CB  . PRO A 1 309 ? 73.668  -6.631  -150.006 1.00 29.89  ? 309 PRO A CB  1 
ATOM   1966 C CG  . PRO A 1 309 ? 75.010  -6.168  -150.402 1.00 31.92  ? 309 PRO A CG  1 
ATOM   1967 C CD  . PRO A 1 309 ? 75.170  -4.863  -149.707 1.00 31.34  ? 309 PRO A CD  1 
ATOM   1968 N N   . LYS A 1 310 ? 72.137  -5.132  -147.624 1.00 27.16  ? 310 LYS A N   1 
ATOM   1969 C CA  . LYS A 1 310 ? 71.214  -5.261  -146.507 1.00 27.84  ? 310 LYS A CA  1 
ATOM   1970 C C   . LYS A 1 310 ? 70.419  -3.982  -146.242 1.00 25.40  ? 310 LYS A C   1 
ATOM   1971 O O   . LYS A 1 310 ? 69.769  -3.878  -145.205 1.00 21.72  ? 310 LYS A O   1 
ATOM   1972 C CB  . LYS A 1 310 ? 71.977  -5.675  -145.242 1.00 29.49  ? 310 LYS A CB  1 
ATOM   1973 C CG  . LYS A 1 310 ? 72.707  -7.013  -145.351 1.00 30.41  ? 310 LYS A CG  1 
ATOM   1974 C CD  . LYS A 1 310 ? 73.860  -7.142  -144.332 1.00 31.44  ? 310 LYS A CD  1 
ATOM   1975 C CE  . LYS A 1 310 ? 73.367  -7.369  -142.915 1.00 35.48  ? 310 LYS A CE  1 
ATOM   1976 N NZ  . LYS A 1 310 ? 74.490  -7.633  -141.970 1.00 31.87  ? 310 LYS A NZ  1 
ATOM   1977 N N   . PHE A 1 311 ? 70.432  -3.020  -147.167 1.00 27.46  ? 311 PHE A N   1 
ATOM   1978 C CA  . PHE A 1 311 ? 69.816  -1.711  -146.882 1.00 30.81  ? 311 PHE A CA  1 
ATOM   1979 C C   . PHE A 1 311 ? 68.325  -1.791  -146.573 1.00 31.61  ? 311 PHE A C   1 
ATOM   1980 O O   . PHE A 1 311 ? 67.837  -1.108  -145.667 1.00 32.58  ? 311 PHE A O   1 
ATOM   1981 C CB  . PHE A 1 311 ? 70.046  -0.694  -148.002 1.00 25.54  ? 311 PHE A CB  1 
ATOM   1982 C CG  . PHE A 1 311 ? 69.389  0.647   -147.742 1.00 27.95  ? 311 PHE A CG  1 
ATOM   1983 C CD1 . PHE A 1 311 ? 69.899  1.510   -146.783 1.00 29.23  ? 311 PHE A CD1 1 
ATOM   1984 C CD2 . PHE A 1 311 ? 68.256  1.041   -148.452 1.00 28.34  ? 311 PHE A CD2 1 
ATOM   1985 C CE1 . PHE A 1 311 ? 69.296  2.744   -146.540 1.00 29.73  ? 311 PHE A CE1 1 
ATOM   1986 C CE2 . PHE A 1 311 ? 67.650  2.272   -148.218 1.00 20.14  ? 311 PHE A CE2 1 
ATOM   1987 C CZ  . PHE A 1 311 ? 68.168  3.122   -147.265 1.00 27.76  ? 311 PHE A CZ  1 
ATOM   1988 N N   . GLN A 1 312 ? 67.604  -2.630  -147.306 1.00 33.41  ? 312 GLN A N   1 
ATOM   1989 C CA  . GLN A 1 312 ? 66.160  -2.702  -147.127 1.00 36.12  ? 312 GLN A CA  1 
ATOM   1990 C C   . GLN A 1 312 ? 65.758  -3.172  -145.730 1.00 36.90  ? 312 GLN A C   1 
ATOM   1991 O O   . GLN A 1 312 ? 64.600  -3.032  -145.341 1.00 40.06  ? 312 GLN A O   1 
ATOM   1992 C CB  . GLN A 1 312 ? 65.514  -3.561  -148.215 1.00 40.38  ? 312 GLN A CB  1 
ATOM   1993 C CG  . GLN A 1 312 ? 65.346  -2.812  -149.547 1.00 43.58  ? 312 GLN A CG  1 
ATOM   1994 C CD  . GLN A 1 312 ? 64.373  -1.634  -149.460 1.00 44.73  ? 312 GLN A CD  1 
ATOM   1995 O OE1 . GLN A 1 312 ? 64.706  -0.509  -149.837 1.00 47.33  ? 312 GLN A OE1 1 
ATOM   1996 N NE2 . GLN A 1 312 ? 63.169  -1.892  -148.956 1.00 40.04  ? 312 GLN A NE2 1 
ATOM   1997 N N   . ASN A 1 313 ? 66.712  -3.695  -144.966 1.00 35.41  ? 313 ASN A N   1 
ATOM   1998 C CA  . ASN A 1 313 ? 66.462  -4.001  -143.564 1.00 33.50  ? 313 ASN A CA  1 
ATOM   1999 C C   . ASN A 1 313 ? 66.147  -2.748  -142.765 1.00 34.56  ? 313 ASN A C   1 
ATOM   2000 O O   . ASN A 1 313 ? 65.317  -2.790  -141.863 1.00 42.68  ? 313 ASN A O   1 
ATOM   2001 C CB  . ASN A 1 313 ? 67.647  -4.725  -142.933 1.00 33.01  ? 313 ASN A CB  1 
ATOM   2002 C CG  . ASN A 1 313 ? 67.993  -6.019  -143.644 1.00 29.00  ? 313 ASN A CG  1 
ATOM   2003 O OD1 . ASN A 1 313 ? 67.232  -6.513  -144.468 1.00 25.32  ? 313 ASN A OD1 1 
ATOM   2004 N ND2 . ASN A 1 313 ? 69.157  -6.566  -143.331 1.00 35.49  ? 313 ASN A ND2 1 
ATOM   2005 N N   . VAL A 1 314 ? 66.792  -1.632  -143.095 1.00 36.65  ? 314 VAL A N   1 
ATOM   2006 C CA  . VAL A 1 314 ? 66.573  -0.380  -142.352 1.00 36.79  ? 314 VAL A CA  1 
ATOM   2007 C C   . VAL A 1 314 ? 65.849  0.708   -143.160 1.00 33.58  ? 314 VAL A C   1 
ATOM   2008 O O   . VAL A 1 314 ? 65.629  1.805   -142.652 1.00 31.43  ? 314 VAL A O   1 
ATOM   2009 C CB  . VAL A 1 314 ? 67.905  0.191   -141.784 1.00 35.48  ? 314 VAL A CB  1 
ATOM   2010 C CG1 . VAL A 1 314 ? 68.780  -0.930  -141.264 1.00 37.88  ? 314 VAL A CG1 1 
ATOM   2011 C CG2 . VAL A 1 314 ? 68.652  0.987   -142.832 1.00 38.63  ? 314 VAL A CG2 1 
ATOM   2012 N N   . ALA A 1 315 ? 65.459  0.400   -144.395 1.00 32.35  ? 315 ALA A N   1 
ATOM   2013 C CA  . ALA A 1 315 ? 64.827  1.392   -145.277 1.00 33.60  ? 315 ALA A CA  1 
ATOM   2014 C C   . ALA A 1 315 ? 63.554  2.009   -144.687 1.00 35.32  ? 315 ALA A C   1 
ATOM   2015 O O   . ALA A 1 315 ? 63.236  3.157   -144.980 1.00 34.11  ? 315 ALA A O   1 
ATOM   2016 C CB  . ALA A 1 315 ? 64.525  0.780   -146.633 1.00 25.13  ? 315 ALA A CB  1 
ATOM   2017 N N   . ASP A 1 316 ? 62.845  1.251   -143.850 1.00 40.21  ? 316 ASP A N   1 
ATOM   2018 C CA  . ASP A 1 316 ? 61.562  1.692   -143.283 1.00 38.78  ? 316 ASP A CA  1 
ATOM   2019 C C   . ASP A 1 316 ? 61.688  2.577   -142.045 1.00 36.62  ? 316 ASP A C   1 
ATOM   2020 O O   . ASP A 1 316 ? 60.695  3.166   -141.612 1.00 33.77  ? 316 ASP A O   1 
ATOM   2021 C CB  . ASP A 1 316 ? 60.671  0.483   -142.957 1.00 41.09  ? 316 ASP A CB  1 
ATOM   2022 C CG  . ASP A 1 316 ? 59.660  0.195   -144.051 1.00 53.13  ? 316 ASP A CG  1 
ATOM   2023 O OD1 . ASP A 1 316 ? 59.889  -0.744  -144.846 1.00 56.57  ? 316 ASP A OD1 1 
ATOM   2024 O OD2 . ASP A 1 316 ? 58.638  0.918   -144.118 1.00 65.20  ? 316 ASP A OD2 1 
ATOM   2025 N N   . LEU A 1 317 ? 62.890  2.676   -141.477 1.00 36.43  ? 317 LEU A N   1 
ATOM   2026 C CA  . LEU A 1 317 ? 63.102  3.514   -140.287 1.00 36.25  ? 317 LEU A CA  1 
ATOM   2027 C C   . LEU A 1 317 ? 62.784  4.996   -140.527 1.00 36.25  ? 317 LEU A C   1 
ATOM   2028 O O   . LEU A 1 317 ? 63.256  5.602   -141.494 1.00 33.20  ? 317 LEU A O   1 
ATOM   2029 C CB  . LEU A 1 317 ? 64.539  3.389   -139.768 1.00 31.04  ? 317 LEU A CB  1 
ATOM   2030 C CG  . LEU A 1 317 ? 64.895  2.079   -139.072 1.00 34.02  ? 317 LEU A CG  1 
ATOM   2031 C CD1 . LEU A 1 317 ? 66.340  2.127   -138.615 1.00 33.48  ? 317 LEU A CD1 1 
ATOM   2032 C CD2 . LEU A 1 317 ? 63.972  1.793   -137.887 1.00 34.25  ? 317 LEU A CD2 1 
ATOM   2033 N N   . HIS A 1 318 ? 61.979  5.562   -139.633 1.00 34.65  ? 318 HIS A N   1 
ATOM   2034 C CA  . HIS A 1 318 ? 61.723  6.993   -139.609 1.00 33.75  ? 318 HIS A CA  1 
ATOM   2035 C C   . HIS A 1 318 ? 62.648  7.651   -138.600 1.00 33.85  ? 318 HIS A C   1 
ATOM   2036 O O   . HIS A 1 318 ? 62.761  7.186   -137.467 1.00 41.40  ? 318 HIS A O   1 
ATOM   2037 C CB  . HIS A 1 318 ? 60.267  7.261   -139.247 1.00 33.08  ? 318 HIS A CB  1 
ATOM   2038 C CG  . HIS A 1 318 ? 59.303  6.767   -140.278 1.00 35.77  ? 318 HIS A CG  1 
ATOM   2039 N ND1 . HIS A 1 318 ? 58.717  7.599   -141.209 1.00 30.53  ? 318 HIS A ND1 1 
ATOM   2040 C CD2 . HIS A 1 318 ? 58.851  5.520   -140.546 1.00 30.75  ? 318 HIS A CD2 1 
ATOM   2041 C CE1 . HIS A 1 318 ? 57.933  6.886   -141.996 1.00 31.15  ? 318 HIS A CE1 1 
ATOM   2042 N NE2 . HIS A 1 318 ? 57.999  5.621   -141.617 1.00 30.04  ? 318 HIS A NE2 1 
ATOM   2043 N N   . LEU A 1 319 ? 63.320  8.723   -139.006 1.00 32.19  ? 319 LEU A N   1 
ATOM   2044 C CA  . LEU A 1 319 ? 64.221  9.430   -138.099 1.00 33.14  ? 319 LEU A CA  1 
ATOM   2045 C C   . LEU A 1 319 ? 64.532  10.861  -138.537 1.00 30.50  ? 319 LEU A C   1 
ATOM   2046 O O   . LEU A 1 319 ? 64.461  11.200  -139.718 1.00 30.30  ? 319 LEU A O   1 
ATOM   2047 C CB  . LEU A 1 319 ? 65.515  8.631   -137.884 1.00 33.75  ? 319 LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 319 ? 66.501  8.456   -139.036 1.00 31.92  ? 319 LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 319 ? 67.480  7.366   -138.666 1.00 23.28  ? 319 LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 319 ? 65.794  8.111   -140.332 1.00 38.64  ? 319 LEU A CD2 1 
ATOM   2051 N N   . TYR A 1 320 ? 64.877  11.691  -137.559 1.00 30.48  ? 320 TYR A N   1 
ATOM   2052 C CA  . TYR A 1 320 ? 65.139  13.107  -137.799 1.00 33.44  ? 320 TYR A CA  1 
ATOM   2053 C C   . TYR A 1 320 ? 66.492  13.349  -138.476 1.00 33.02  ? 320 TYR A C   1 
ATOM   2054 O O   . TYR A 1 320 ? 67.554  13.003  -137.941 1.00 31.83  ? 320 TYR A O   1 
ATOM   2055 C CB  . TYR A 1 320 ? 65.044  13.908  -136.493 1.00 37.30  ? 320 TYR A CB  1 
ATOM   2056 C CG  . TYR A 1 320 ? 63.639  13.977  -135.939 1.00 31.84  ? 320 TYR A CG  1 
ATOM   2057 C CD1 . TYR A 1 320 ? 63.160  12.988  -135.096 1.00 32.34  ? 320 TYR A CD1 1 
ATOM   2058 C CD2 . TYR A 1 320 ? 62.791  15.024  -136.272 1.00 32.68  ? 320 TYR A CD2 1 
ATOM   2059 C CE1 . TYR A 1 320 ? 61.878  13.040  -134.590 1.00 39.27  ? 320 TYR A CE1 1 
ATOM   2060 C CE2 . TYR A 1 320 ? 61.506  15.088  -135.771 1.00 37.17  ? 320 TYR A CE2 1 
ATOM   2061 C CZ  . TYR A 1 320 ? 61.053  14.091  -134.931 1.00 41.29  ? 320 TYR A CZ  1 
ATOM   2062 O OH  . TYR A 1 320 ? 59.773  14.136  -134.426 1.00 40.19  ? 320 TYR A OH  1 
ATOM   2063 N N   . LEU A 1 321 ? 66.429  13.946  -139.661 1.00 29.54  ? 321 LEU A N   1 
ATOM   2064 C CA  . LEU A 1 321 ? 67.609  14.321  -140.410 1.00 27.87  ? 321 LEU A CA  1 
ATOM   2065 C C   . LEU A 1 321 ? 67.659  15.834  -140.523 1.00 27.63  ? 321 LEU A C   1 
ATOM   2066 O O   . LEU A 1 321 ? 66.628  16.504  -140.525 1.00 30.01  ? 321 LEU A O   1 
ATOM   2067 C CB  . LEU A 1 321 ? 67.568  13.691  -141.793 1.00 25.49  ? 321 LEU A CB  1 
ATOM   2068 C CG  . LEU A 1 321 ? 67.426  12.172  -141.811 1.00 19.24  ? 321 LEU A CG  1 
ATOM   2069 C CD1 . LEU A 1 321 ? 67.256  11.701  -143.236 1.00 11.50  ? 321 LEU A CD1 1 
ATOM   2070 C CD2 . LEU A 1 321 ? 68.631  11.517  -141.157 1.00 12.45  ? 321 LEU A CD2 1 
ATOM   2071 N N   . TYR A 1 322 ? 68.870  16.362  -140.630 1.00 29.77  ? 322 TYR A N   1 
ATOM   2072 C CA  . TYR A 1 322 ? 69.094  17.793  -140.573 1.00 30.09  ? 322 TYR A CA  1 
ATOM   2073 C C   . TYR A 1 322 ? 70.200  18.136  -141.562 1.00 29.88  ? 322 TYR A C   1 
ATOM   2074 O O   . TYR A 1 322 ? 71.382  18.131  -141.230 1.00 32.01  ? 322 TYR A O   1 
ATOM   2075 C CB  . TYR A 1 322 ? 69.457  18.161  -139.135 1.00 29.42  ? 322 TYR A CB  1 
ATOM   2076 C CG  . TYR A 1 322 ? 69.494  19.638  -138.800 1.00 33.49  ? 322 TYR A CG  1 
ATOM   2077 C CD1 . TYR A 1 322 ? 68.564  20.540  -139.329 1.00 32.67  ? 322 TYR A CD1 1 
ATOM   2078 C CD2 . TYR A 1 322 ? 70.438  20.128  -137.900 1.00 36.79  ? 322 TYR A CD2 1 
ATOM   2079 C CE1 . TYR A 1 322 ? 68.606  21.895  -138.985 1.00 30.62  ? 322 TYR A CE1 1 
ATOM   2080 C CE2 . TYR A 1 322 ? 70.484  21.471  -137.557 1.00 30.92  ? 322 TYR A CE2 1 
ATOM   2081 C CZ  . TYR A 1 322 ? 69.571  22.344  -138.094 1.00 26.07  ? 322 TYR A CZ  1 
ATOM   2082 O OH  . TYR A 1 322 ? 69.646  23.659  -137.726 1.00 26.70  ? 322 TYR A OH  1 
ATOM   2083 N N   . SER A 1 323 ? 69.794  18.414  -142.794 1.00 30.35  ? 323 SER A N   1 
ATOM   2084 C CA  . SER A 1 323 ? 70.725  18.556  -143.899 1.00 32.22  ? 323 SER A CA  1 
ATOM   2085 C C   . SER A 1 323 ? 71.520  19.844  -143.813 1.00 35.39  ? 323 SER A C   1 
ATOM   2086 O O   . SER A 1 323 ? 71.106  20.800  -143.156 1.00 34.14  ? 323 SER A O   1 
ATOM   2087 C CB  . SER A 1 323 ? 69.965  18.545  -145.220 1.00 34.36  ? 323 SER A CB  1 
ATOM   2088 O OG  . SER A 1 323 ? 69.074  19.646  -145.294 1.00 35.89  ? 323 SER A OG  1 
ATOM   2089 N N   . ALA A 1 324 ? 72.652  19.864  -144.515 1.00 36.81  ? 324 ALA A N   1 
ATOM   2090 C CA  . ALA A 1 324 ? 73.465  21.067  -144.648 1.00 34.23  ? 324 ALA A CA  1 
ATOM   2091 C C   . ALA A 1 324 ? 72.690  22.147  -145.378 1.00 35.23  ? 324 ALA A C   1 
ATOM   2092 O O   . ALA A 1 324 ? 72.990  23.330  -145.230 1.00 40.94  ? 324 ALA A O   1 
ATOM   2093 C CB  . ALA A 1 324 ? 74.757  20.764  -145.386 1.00 27.74  ? 324 ALA A CB  1 
ATOM   2094 N N   . LYS A 1 325 ? 71.700  21.742  -146.171 1.00 36.00  ? 325 LYS A N   1 
ATOM   2095 C CA  . LYS A 1 325 ? 70.849  22.697  -146.877 1.00 40.14  ? 325 LYS A CA  1 
ATOM   2096 C C   . LYS A 1 325 ? 69.727  23.212  -145.975 1.00 36.01  ? 325 LYS A C   1 
ATOM   2097 O O   . LYS A 1 325 ? 69.309  24.360  -146.094 1.00 31.06  ? 325 LYS A O   1 
ATOM   2098 C CB  . LYS A 1 325 ? 70.302  22.075  -148.171 1.00 42.90  ? 325 LYS A CB  1 
ATOM   2099 C CG  . LYS A 1 325 ? 71.416  21.701  -149.184 1.00 49.65  ? 325 LYS A CG  1 
ATOM   2100 C CD  . LYS A 1 325 ? 70.895  21.461  -150.621 1.00 49.74  ? 325 LYS A CD  1 
ATOM   2101 C CE  . LYS A 1 325 ? 72.044  21.307  -151.637 1.00 46.32  ? 325 LYS A CE  1 
ATOM   2102 N NZ  . LYS A 1 325 ? 71.574  21.022  -153.031 1.00 40.64  ? 325 LYS A NZ  1 
ATOM   2103 N N   . ALA A 1 326 ? 69.257  22.365  -145.064 1.00 37.96  ? 326 ALA A N   1 
ATOM   2104 C CA  . ALA A 1 326 ? 68.250  22.771  -144.078 1.00 39.45  ? 326 ALA A CA  1 
ATOM   2105 C C   . ALA A 1 326 ? 68.833  23.758  -143.071 1.00 41.38  ? 326 ALA A C   1 
ATOM   2106 O O   . ALA A 1 326 ? 68.118  24.601  -142.524 1.00 43.91  ? 326 ALA A O   1 
ATOM   2107 C CB  . ALA A 1 326 ? 67.703  21.556  -143.350 1.00 40.39  ? 326 ALA A CB  1 
ATOM   2108 N N   . GLN A 1 327 ? 70.133  23.633  -142.824 1.00 38.30  ? 327 GLN A N   1 
ATOM   2109 C CA  . GLN A 1 327 ? 70.834  24.487  -141.877 1.00 32.36  ? 327 GLN A CA  1 
ATOM   2110 C C   . GLN A 1 327 ? 71.099  25.870  -142.449 1.00 31.95  ? 327 GLN A C   1 
ATOM   2111 O O   . GLN A 1 327 ? 70.952  26.862  -141.740 1.00 28.66  ? 327 GLN A O   1 
ATOM   2112 C CB  . GLN A 1 327 ? 72.144  23.830  -141.462 1.00 27.94  ? 327 GLN A CB  1 
ATOM   2113 C CG  . GLN A 1 327 ? 71.925  22.589  -140.636 1.00 30.80  ? 327 GLN A CG  1 
ATOM   2114 C CD  . GLN A 1 327 ? 73.187  21.795  -140.426 1.00 29.97  ? 327 GLN A CD  1 
ATOM   2115 O OE1 . GLN A 1 327 ? 74.034  22.169  -139.613 1.00 19.15  ? 327 GLN A OE1 1 
ATOM   2116 N NE2 . GLN A 1 327 ? 73.317  20.679  -141.144 1.00 19.96  ? 327 GLN A NE2 1 
ATOM   2117 N N   . VAL A 1 328 ? 71.488  25.935  -143.723 1.00 33.33  ? 328 VAL A N   1 
ATOM   2118 C CA  . VAL A 1 328 ? 71.734  27.222  -144.379 1.00 34.88  ? 328 VAL A CA  1 
ATOM   2119 C C   . VAL A 1 328 ? 70.438  28.002  -144.597 1.00 34.68  ? 328 VAL A C   1 
ATOM   2120 O O   . VAL A 1 328 ? 70.452  29.233  -144.640 1.00 33.79  ? 328 VAL A O   1 
ATOM   2121 C CB  . VAL A 1 328 ? 72.454  27.074  -145.739 1.00 36.96  ? 328 VAL A CB  1 
ATOM   2122 C CG1 . VAL A 1 328 ? 71.536  26.438  -146.786 1.00 40.68  ? 328 VAL A CG1 1 
ATOM   2123 C CG2 . VAL A 1 328 ? 72.931  28.440  -146.225 1.00 35.81  ? 328 VAL A CG2 1 
ATOM   2124 N N   . SER A 1 329 ? 69.327  27.282  -144.742 1.00 34.87  ? 329 SER A N   1 
ATOM   2125 C CA  . SER A 1 329 ? 68.017  27.906  -144.925 1.00 34.46  ? 329 SER A CA  1 
ATOM   2126 C C   . SER A 1 329 ? 67.462  28.470  -143.624 1.00 33.01  ? 329 SER A C   1 
ATOM   2127 O O   . SER A 1 329 ? 66.681  29.412  -143.638 1.00 30.80  ? 329 SER A O   1 
ATOM   2128 C CB  . SER A 1 329 ? 67.022  26.894  -145.492 1.00 32.92  ? 329 SER A CB  1 
ATOM   2129 O OG  . SER A 1 329 ? 67.441  26.434  -146.761 1.00 33.84  ? 329 SER A OG  1 
ATOM   2130 N N   . GLY A 1 330 ? 67.866  27.893  -142.498 1.00 36.52  ? 330 GLY A N   1 
ATOM   2131 C CA  . GLY A 1 330 ? 67.248  28.212  -141.219 1.00 38.95  ? 330 GLY A CA  1 
ATOM   2132 C C   . GLY A 1 330 ? 65.979  27.405  -141.000 1.00 40.19  ? 330 GLY A C   1 
ATOM   2133 O O   . GLY A 1 330 ? 65.158  27.751  -140.152 1.00 37.79  ? 330 GLY A O   1 
ATOM   2134 N N   . GLN A 1 331 ? 65.816  26.331  -141.771 1.00 42.29  ? 331 GLN A N   1 
ATOM   2135 C CA  . GLN A 1 331 ? 64.745  25.366  -141.545 1.00 43.70  ? 331 GLN A CA  1 
ATOM   2136 C C   . GLN A 1 331 ? 65.087  24.474  -140.355 1.00 40.36  ? 331 GLN A C   1 
ATOM   2137 O O   . GLN A 1 331 ? 66.251  24.368  -139.961 1.00 40.12  ? 331 GLN A O   1 
ATOM   2138 C CB  . GLN A 1 331 ? 64.534  24.498  -142.788 1.00 45.44  ? 331 GLN A CB  1 
ATOM   2139 C CG  . GLN A 1 331 ? 64.032  25.263  -144.000 1.00 49.03  ? 331 GLN A CG  1 
ATOM   2140 C CD  . GLN A 1 331 ? 63.921  24.390  -145.237 1.00 52.60  ? 331 GLN A CD  1 
ATOM   2141 O OE1 . GLN A 1 331 ? 64.639  23.393  -145.384 1.00 57.28  ? 331 GLN A OE1 1 
ATOM   2142 N NE2 . GLN A 1 331 ? 63.019  24.765  -146.142 1.00 55.39  ? 331 GLN A NE2 1 
ATOM   2143 N N   . SER A 1 332 ? 64.064  23.840  -139.789 1.00 36.76  ? 332 SER A N   1 
ATOM   2144 C CA  . SER A 1 332 ? 64.246  22.899  -138.690 1.00 39.30  ? 332 SER A CA  1 
ATOM   2145 C C   . SER A 1 332 ? 64.442  21.498  -139.247 1.00 39.26  ? 332 SER A C   1 
ATOM   2146 O O   . SER A 1 332 ? 64.237  21.271  -140.440 1.00 41.22  ? 332 SER A O   1 
ATOM   2147 C CB  . SER A 1 332 ? 63.036  22.922  -137.755 1.00 41.14  ? 332 SER A CB  1 
ATOM   2148 O OG  . SER A 1 332 ? 62.827  24.220  -137.224 1.00 45.76  ? 332 SER A OG  1 
ATOM   2149 N N   . ALA A 1 333 ? 64.828  20.564  -138.378 1.00 36.73  ? 333 ALA A N   1 
ATOM   2150 C CA  . ALA A 1 333 ? 65.064  19.176  -138.780 1.00 34.80  ? 333 ALA A CA  1 
ATOM   2151 C C   . ALA A 1 333 ? 63.791  18.506  -139.309 1.00 33.23  ? 333 ALA A C   1 
ATOM   2152 O O   . ALA A 1 333 ? 62.681  18.972  -139.055 1.00 33.07  ? 333 ALA A O   1 
ATOM   2153 C CB  . ALA A 1 333 ? 65.637  18.381  -137.615 1.00 33.67  ? 333 ALA A CB  1 
ATOM   2154 N N   . ARG A 1 334 ? 63.971  17.417  -140.053 1.00 34.26  ? 334 ARG A N   1 
ATOM   2155 C CA  . ARG A 1 334 ? 62.867  16.687  -140.675 1.00 35.61  ? 334 ARG A CA  1 
ATOM   2156 C C   . ARG A 1 334 ? 62.921  15.225  -140.289 1.00 36.03  ? 334 ARG A C   1 
ATOM   2157 O O   . ARG A 1 334 ? 63.978  14.607  -140.391 1.00 41.09  ? 334 ARG A O   1 
ATOM   2158 C CB  . ARG A 1 334 ? 62.974  16.732  -142.197 1.00 35.67  ? 334 ARG A CB  1 
ATOM   2159 C CG  . ARG A 1 334 ? 63.082  18.111  -142.826 1.00 41.89  ? 334 ARG A CG  1 
ATOM   2160 C CD  . ARG A 1 334 ? 63.308  17.982  -144.332 1.00 43.16  ? 334 ARG A CD  1 
ATOM   2161 N NE  . ARG A 1 334 ? 62.299  17.121  -144.956 1.00 47.58  ? 334 ARG A NE  1 
ATOM   2162 C CZ  . ARG A 1 334 ? 62.399  16.575  -146.167 1.00 50.62  ? 334 ARG A CZ  1 
ATOM   2163 N NH1 . ARG A 1 334 ? 63.471  16.783  -146.929 1.00 53.66  ? 334 ARG A NH1 1 
ATOM   2164 N NH2 . ARG A 1 334 ? 61.415  15.804  -146.621 1.00 50.36  ? 334 ARG A NH2 1 
ATOM   2165 N N   . LYS A 1 335 ? 61.786  14.665  -139.884 1.00 35.45  ? 335 LYS A N   1 
ATOM   2166 C CA  . LYS A 1 335 ? 61.671  13.224  -139.689 1.00 34.95  ? 335 LYS A CA  1 
ATOM   2167 C C   . LYS A 1 335 ? 61.267  12.588  -141.007 1.00 33.01  ? 335 LYS A C   1 
ATOM   2168 O O   . LYS A 1 335 ? 60.218  12.911  -141.556 1.00 37.46  ? 335 LYS A O   1 
ATOM   2169 C CB  . LYS A 1 335 ? 60.638  12.906  -138.619 1.00 35.68  ? 335 LYS A CB  1 
ATOM   2170 C CG  . LYS A 1 335 ? 60.595  11.446  -138.215 1.00 39.28  ? 335 LYS A CG  1 
ATOM   2171 C CD  . LYS A 1 335 ? 59.622  11.245  -137.069 1.00 40.43  ? 335 LYS A CD  1 
ATOM   2172 C CE  . LYS A 1 335 ? 59.822  9.904   -136.402 1.00 45.20  ? 335 LYS A CE  1 
ATOM   2173 N NZ  . LYS A 1 335 ? 58.886  9.729   -135.259 1.00 51.16  ? 335 LYS A NZ  1 
ATOM   2174 N N   . MET A 1 336 ? 62.105  11.695  -141.520 1.00 31.28  ? 336 MET A N   1 
ATOM   2175 C CA  . MET A 1 336 ? 61.856  11.058  -142.808 1.00 33.80  ? 336 MET A CA  1 
ATOM   2176 C C   . MET A 1 336 ? 62.044  9.559   -142.710 1.00 32.58  ? 336 MET A C   1 
ATOM   2177 O O   . MET A 1 336 ? 62.695  9.074   -141.793 1.00 37.05  ? 336 MET A O   1 
ATOM   2178 C CB  . MET A 1 336 ? 62.826  11.588  -143.857 1.00 33.52  ? 336 MET A CB  1 
ATOM   2179 C CG  . MET A 1 336 ? 62.747  13.075  -144.104 1.00 36.12  ? 336 MET A CG  1 
ATOM   2180 S SD  . MET A 1 336 ? 63.853  13.558  -145.445 1.00 40.47  ? 336 MET A SD  1 
ATOM   2181 C CE  . MET A 1 336 ? 63.040  12.856  -146.886 1.00 45.76  ? 336 MET A CE  1 
ATOM   2182 N N   . ARG A 1 337 ? 61.482  8.835   -143.674 1.00 34.72  ? 337 ARG A N   1 
ATOM   2183 C CA  . ARG A 1 337 ? 61.715  7.401   -143.815 1.00 33.54  ? 337 ARG A CA  1 
ATOM   2184 C C   . ARG A 1 337 ? 63.040  7.222   -144.547 1.00 31.04  ? 337 ARG A C   1 
ATOM   2185 O O   . ARG A 1 337 ? 63.229  7.790   -145.622 1.00 28.09  ? 337 ARG A O   1 
ATOM   2186 C CB  . ARG A 1 337 ? 60.577  6.735   -144.600 1.00 34.16  ? 337 ARG A CB  1 
ATOM   2187 C CG  . ARG A 1 337 ? 60.773  5.241   -144.820 1.00 39.25  ? 337 ARG A CG  1 
ATOM   2188 C CD  . ARG A 1 337 ? 59.638  4.603   -145.612 1.00 39.59  ? 337 ARG A CD  1 
ATOM   2189 N NE  . ARG A 1 337 ? 60.033  3.293   -146.143 1.00 39.61  ? 337 ARG A NE  1 
ATOM   2190 C CZ  . ARG A 1 337 ? 60.727  3.098   -147.268 1.00 45.57  ? 337 ARG A CZ  1 
ATOM   2191 N NH1 . ARG A 1 337 ? 61.118  4.123   -148.024 1.00 41.63  ? 337 ARG A NH1 1 
ATOM   2192 N NH2 . ARG A 1 337 ? 61.033  1.861   -147.647 1.00 46.13  ? 337 ARG A NH2 1 
ATOM   2193 N N   . LEU A 1 338 ? 63.950  6.440   -143.967 1.00 30.67  ? 338 LEU A N   1 
ATOM   2194 C CA  . LEU A 1 338 ? 65.310  6.316   -144.503 1.00 30.67  ? 338 LEU A CA  1 
ATOM   2195 C C   . LEU A 1 338 ? 65.323  6.116   -146.009 1.00 31.64  ? 338 LEU A C   1 
ATOM   2196 O O   . LEU A 1 338 ? 66.037  6.823   -146.729 1.00 33.97  ? 338 LEU A O   1 
ATOM   2197 C CB  . LEU A 1 338 ? 66.089  5.180   -143.831 1.00 29.62  ? 338 LEU A CB  1 
ATOM   2198 C CG  . LEU A 1 338 ? 67.369  5.591   -143.108 1.00 28.59  ? 338 LEU A CG  1 
ATOM   2199 C CD1 . LEU A 1 338 ? 68.122  4.360   -142.656 1.00 34.25  ? 338 LEU A CD1 1 
ATOM   2200 C CD2 . LEU A 1 338 ? 68.248  6.439   -144.004 1.00 32.69  ? 338 LEU A CD2 1 
ATOM   2201 N N   . GLY A 1 339 ? 64.536  5.149   -146.473 1.00 29.34  ? 339 GLY A N   1 
ATOM   2202 C CA  . GLY A 1 339 ? 64.387  4.903   -147.897 1.00 29.45  ? 339 GLY A CA  1 
ATOM   2203 C C   . GLY A 1 339 ? 64.116  6.207   -148.617 1.00 28.27  ? 339 GLY A C   1 
ATOM   2204 O O   . GLY A 1 339 ? 64.915  6.628   -149.449 1.00 24.08  ? 339 GLY A O   1 
ATOM   2205 N N   . ASP A 1 340 ? 63.019  6.870   -148.253 1.00 28.45  ? 340 ASP A N   1 
ATOM   2206 C CA  . ASP A 1 340 ? 62.622  8.139   -148.887 1.00 29.25  ? 340 ASP A CA  1 
ATOM   2207 C C   . ASP A 1 340 ? 63.756  9.152   -148.948 1.00 32.00  ? 340 ASP A C   1 
ATOM   2208 O O   . ASP A 1 340 ? 63.948  9.807   -149.974 1.00 34.88  ? 340 ASP A O   1 
ATOM   2209 C CB  . ASP A 1 340 ? 61.443  8.778   -148.156 1.00 26.53  ? 340 ASP A CB  1 
ATOM   2210 C CG  . ASP A 1 340 ? 60.196  7.932   -148.213 1.00 29.08  ? 340 ASP A CG  1 
ATOM   2211 O OD1 . ASP A 1 340 ? 60.193  6.895   -148.906 1.00 28.55  ? 340 ASP A OD1 1 
ATOM   2212 O OD2 . ASP A 1 340 ? 59.211  8.304   -147.551 1.00 40.33  ? 340 ASP A OD2 1 
ATOM   2213 N N   . ALA A 1 341 ? 64.497  9.279   -147.848 1.00 31.50  ? 341 ALA A N   1 
ATOM   2214 C CA  . ALA A 1 341 ? 65.609  10.224  -147.774 1.00 29.71  ? 341 ALA A CA  1 
ATOM   2215 C C   . ALA A 1 341 ? 66.659  9.930   -148.847 1.00 30.46  ? 341 ALA A C   1 
ATOM   2216 O O   . ALA A 1 341 ? 67.065  10.829  -149.586 1.00 29.07  ? 341 ALA A O   1 
ATOM   2217 C CB  . ALA A 1 341 ? 66.234  10.199  -146.393 1.00 28.37  ? 341 ALA A CB  1 
ATOM   2218 N N   . VAL A 1 342 ? 67.084  8.671   -148.941 1.00 31.00  ? 342 VAL A N   1 
ATOM   2219 C CA  . VAL A 1 342 ? 68.086  8.279   -149.939 1.00 28.74  ? 342 VAL A CA  1 
ATOM   2220 C C   . VAL A 1 342 ? 67.516  8.360   -151.357 1.00 25.20  ? 342 VAL A C   1 
ATOM   2221 O O   . VAL A 1 342 ? 68.217  8.751   -152.277 1.00 25.88  ? 342 VAL A O   1 
ATOM   2222 C CB  . VAL A 1 342 ? 68.683  6.874   -149.662 1.00 27.62  ? 342 VAL A CB  1 
ATOM   2223 C CG1 . VAL A 1 342 ? 67.607  5.815   -149.672 1.00 34.73  ? 342 VAL A CG1 1 
ATOM   2224 C CG2 . VAL A 1 342 ? 69.762  6.542   -150.675 1.00 27.94  ? 342 VAL A CG2 1 
ATOM   2225 N N   . GLU A 1 343 ? 66.242  8.016   -151.520 1.00 25.16  ? 343 GLU A N   1 
ATOM   2226 C CA  . GLU A 1 343 ? 65.571  8.124   -152.819 1.00 27.31  ? 343 GLU A CA  1 
ATOM   2227 C C   . GLU A 1 343 ? 65.488  9.582   -153.307 1.00 25.12  ? 343 GLU A C   1 
ATOM   2228 O O   . GLU A 1 343 ? 65.522  9.845   -154.510 1.00 17.26  ? 343 GLU A O   1 
ATOM   2229 C CB  . GLU A 1 343 ? 64.165  7.483   -152.772 1.00 30.83  ? 343 GLU A CB  1 
ATOM   2230 C CG  . GLU A 1 343 ? 64.042  6.103   -153.469 1.00 42.60  ? 343 GLU A CG  1 
ATOM   2231 C CD  . GLU A 1 343 ? 64.888  4.988   -152.830 1.00 60.64  ? 343 GLU A CD  1 
ATOM   2232 O OE1 . GLU A 1 343 ? 64.711  4.685   -151.625 1.00 66.93  ? 343 GLU A OE1 1 
ATOM   2233 O OE2 . GLU A 1 343 ? 65.719  4.388   -153.547 1.00 67.49  ? 343 GLU A OE2 1 
ATOM   2234 N N   . GLN A 1 344 ? 65.392  10.522  -152.371 1.00 27.22  ? 344 GLN A N   1 
ATOM   2235 C CA  . GLN A 1 344 ? 65.266  11.944  -152.710 1.00 28.03  ? 344 GLN A CA  1 
ATOM   2236 C C   . GLN A 1 344 ? 66.604  12.682  -152.741 1.00 26.78  ? 344 GLN A C   1 
ATOM   2237 O O   . GLN A 1 344 ? 66.641  13.874  -153.019 1.00 29.40  ? 344 GLN A O   1 
ATOM   2238 C CB  . GLN A 1 344 ? 64.320  12.643  -151.728 1.00 29.68  ? 344 GLN A CB  1 
ATOM   2239 C CG  . GLN A 1 344 ? 62.864  12.234  -151.881 1.00 31.75  ? 344 GLN A CG  1 
ATOM   2240 C CD  . GLN A 1 344 ? 62.007  12.642  -150.699 1.00 31.43  ? 344 GLN A CD  1 
ATOM   2241 O OE1 . GLN A 1 344 ? 62.284  13.638  -150.024 1.00 37.04  ? 344 GLN A OE1 1 
ATOM   2242 N NE2 . GLN A 1 344 ? 60.953  11.870  -150.443 1.00 26.27  ? 344 GLN A NE2 1 
ATOM   2243 N N   . GLY A 1 345 ? 67.697  11.988  -152.446 1.00 28.31  ? 345 GLY A N   1 
ATOM   2244 C CA  . GLY A 1 345 ? 69.025  12.584  -152.531 1.00 26.51  ? 345 GLY A CA  1 
ATOM   2245 C C   . GLY A 1 345 ? 69.566  13.198  -151.253 1.00 26.33  ? 345 GLY A C   1 
ATOM   2246 O O   . GLY A 1 345 ? 70.741  13.556  -151.202 1.00 29.67  ? 345 GLY A O   1 
ATOM   2247 N N   . VAL A 1 346 ? 68.736  13.332  -150.220 1.00 26.76  ? 346 VAL A N   1 
ATOM   2248 C CA  . VAL A 1 346 ? 69.208  13.869  -148.938 1.00 25.10  ? 346 VAL A CA  1 
ATOM   2249 C C   . VAL A 1 346 ? 70.426  13.084  -148.470 1.00 26.33  ? 346 VAL A C   1 
ATOM   2250 O O   . VAL A 1 346 ? 71.521  13.634  -148.369 1.00 28.11  ? 346 VAL A O   1 
ATOM   2251 C CB  . VAL A 1 346 ? 68.125  13.828  -147.841 1.00 20.76  ? 346 VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 346 ? 68.755  14.032  -146.470 1.00 16.31  ? 346 VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 346 ? 67.069  14.883  -148.108 1.00 17.65  ? 346 VAL A CG2 1 
ATOM   2254 N N   . ILE A 1 347 ? 70.225  11.800  -148.189 1.00 28.89  ? 347 ILE A N   1 
ATOM   2255 C CA  . ILE A 1 347 ? 71.333  10.882  -147.954 1.00 26.88  ? 347 ILE A CA  1 
ATOM   2256 C C   . ILE A 1 347 ? 71.794  10.392  -149.315 1.00 25.72  ? 347 ILE A C   1 
ATOM   2257 O O   . ILE A 1 347 ? 70.976  10.118  -150.196 1.00 25.12  ? 347 ILE A O   1 
ATOM   2258 C CB  . ILE A 1 347 ? 70.932  9.698   -147.067 1.00 25.54  ? 347 ILE A CB  1 
ATOM   2259 C CG1 . ILE A 1 347 ? 70.685  10.187  -145.639 1.00 24.04  ? 347 ILE A CG1 1 
ATOM   2260 C CG2 . ILE A 1 347 ? 72.023  8.631   -147.080 1.00 30.33  ? 347 ILE A CG2 1 
ATOM   2261 C CD1 . ILE A 1 347 ? 70.155  9.119   -144.708 1.00 28.85  ? 347 ILE A CD1 1 
ATOM   2262 N N   . ASN A 1 348 ? 73.106  10.297  -149.481 1.00 23.39  ? 348 ASN A N   1 
ATOM   2263 C CA  . ASN A 1 348 ? 73.691  10.066  -150.787 1.00 26.00  ? 348 ASN A CA  1 
ATOM   2264 C C   . ASN A 1 348 ? 73.437  8.653   -151.316 1.00 29.41  ? 348 ASN A C   1 
ATOM   2265 O O   . ASN A 1 348 ? 72.755  8.483   -152.326 1.00 36.42  ? 348 ASN A O   1 
ATOM   2266 C CB  . ASN A 1 348 ? 75.184  10.366  -150.732 1.00 24.08  ? 348 ASN A CB  1 
ATOM   2267 C CG  . ASN A 1 348 ? 75.856  10.201  -152.060 1.00 23.66  ? 348 ASN A CG  1 
ATOM   2268 O OD1 . ASN A 1 348 ? 76.541  11.101  -152.519 1.00 35.43  ? 348 ASN A OD1 1 
ATOM   2269 N ND2 . ASN A 1 348 ? 75.670  9.049   -152.690 1.00 26.45  ? 348 ASN A ND2 1 
ATOM   2270 N N   . ASN A 1 349 ? 73.984  7.652   -150.635 1.00 28.72  ? 349 ASN A N   1 
ATOM   2271 C CA  . ASN A 1 349 ? 73.907  6.263   -151.088 1.00 27.49  ? 349 ASN A CA  1 
ATOM   2272 C C   . ASN A 1 349 ? 73.451  5.345   -149.962 1.00 27.57  ? 349 ASN A C   1 
ATOM   2273 O O   . ASN A 1 349 ? 73.418  5.759   -148.804 1.00 27.44  ? 349 ASN A O   1 
ATOM   2274 C CB  . ASN A 1 349 ? 75.268  5.815   -151.605 1.00 26.89  ? 349 ASN A CB  1 
ATOM   2275 C CG  . ASN A 1 349 ? 76.353  5.947   -150.563 1.00 27.49  ? 349 ASN A CG  1 
ATOM   2276 O OD1 . ASN A 1 349 ? 76.488  5.100   -149.682 1.00 30.90  ? 349 ASN A OD1 1 
ATOM   2277 N ND2 . ASN A 1 349 ? 77.128  7.019   -150.651 1.00 27.51  ? 349 ASN A ND2 1 
ATOM   2278 N N   . THR A 1 350 ? 73.115  4.100   -150.298 1.00 28.31  ? 350 THR A N   1 
ATOM   2279 C CA  . THR A 1 350 ? 72.573  3.160   -149.309 1.00 28.05  ? 350 THR A CA  1 
ATOM   2280 C C   . THR A 1 350 ? 73.631  2.486   -148.453 1.00 27.68  ? 350 THR A C   1 
ATOM   2281 O O   . THR A 1 350 ? 73.283  1.736   -147.542 1.00 26.87  ? 350 THR A O   1 
ATOM   2282 C CB  . THR A 1 350 ? 71.732  2.042   -149.952 1.00 27.27  ? 350 THR A CB  1 
ATOM   2283 O OG1 . THR A 1 350 ? 72.528  1.309   -150.893 1.00 24.94  ? 350 THR A OG1 1 
ATOM   2284 C CG2 . THR A 1 350 ? 70.509  2.622   -150.626 1.00 24.75  ? 350 THR A CG2 1 
ATOM   2285 N N   . VAL A 1 351 ? 74.908  2.719   -148.744 1.00 26.78  ? 351 VAL A N   1 
ATOM   2286 C CA  . VAL A 1 351 ? 75.958  2.240   -147.853 1.00 28.78  ? 351 VAL A CA  1 
ATOM   2287 C C   . VAL A 1 351 ? 75.986  3.152   -146.636 1.00 29.91  ? 351 VAL A C   1 
ATOM   2288 O O   . VAL A 1 351 ? 75.840  2.691   -145.509 1.00 32.57  ? 351 VAL A O   1 
ATOM   2289 C CB  . VAL A 1 351 ? 77.330  2.178   -148.542 1.00 27.03  ? 351 VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 351 ? 78.421  1.837   -147.530 1.00 20.08  ? 351 VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 351 ? 77.291  1.153   -149.661 1.00 25.97  ? 351 VAL A CG2 1 
ATOM   2292 N N   . LEU A 1 352 ? 76.146  4.448   -146.882 1.00 30.98  ? 352 LEU A N   1 
ATOM   2293 C CA  . LEU A 1 352 ? 76.036  5.461   -145.837 1.00 29.31  ? 352 LEU A CA  1 
ATOM   2294 C C   . LEU A 1 352 ? 74.683  5.333   -145.139 1.00 32.30  ? 352 LEU A C   1 
ATOM   2295 O O   . LEU A 1 352 ? 74.600  5.386   -143.906 1.00 35.07  ? 352 LEU A O   1 
ATOM   2296 C CB  . LEU A 1 352 ? 76.209  6.862   -146.443 1.00 31.10  ? 352 LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 352 ? 75.960  8.096   -145.564 1.00 28.45  ? 352 LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 352 ? 76.524  7.931   -144.164 1.00 17.97  ? 352 LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 352 ? 76.545  9.332   -146.230 1.00 23.94  ? 352 LEU A CD2 1 
ATOM   2300 N N   . GLY A 1 353 ? 73.634  5.146   -145.939 1.00 33.27  ? 353 GLY A N   1 
ATOM   2301 C CA  . GLY A 1 353 ? 72.275  4.977   -145.431 1.00 30.38  ? 353 GLY A CA  1 
ATOM   2302 C C   . GLY A 1 353 ? 72.179  3.816   -144.471 1.00 28.31  ? 353 GLY A C   1 
ATOM   2303 O O   . GLY A 1 353 ? 71.718  3.971   -143.338 1.00 28.40  ? 353 GLY A O   1 
ATOM   2304 N N   . TYR A 1 354 ? 72.648  2.657   -144.914 1.00 30.07  ? 354 TYR A N   1 
ATOM   2305 C CA  . TYR A 1 354 ? 72.606  1.452   -144.088 1.00 31.80  ? 354 TYR A CA  1 
ATOM   2306 C C   . TYR A 1 354 ? 73.159  1.721   -142.701 1.00 28.89  ? 354 TYR A C   1 
ATOM   2307 O O   . TYR A 1 354 ? 72.515  1.397   -141.706 1.00 28.28  ? 354 TYR A O   1 
ATOM   2308 C CB  . TYR A 1 354 ? 73.385  0.294   -144.731 1.00 33.23  ? 354 TYR A CB  1 
ATOM   2309 C CG  . TYR A 1 354 ? 73.356  -0.967  -143.898 1.00 31.01  ? 354 TYR A CG  1 
ATOM   2310 C CD1 . TYR A 1 354 ? 72.212  -1.746  -143.835 1.00 32.49  ? 354 TYR A CD1 1 
ATOM   2311 C CD2 . TYR A 1 354 ? 74.460  -1.365  -143.155 1.00 28.22  ? 354 TYR A CD2 1 
ATOM   2312 C CE1 . TYR A 1 354 ? 72.167  -2.890  -143.061 1.00 38.32  ? 354 TYR A CE1 1 
ATOM   2313 C CE2 . TYR A 1 354 ? 74.425  -2.514  -142.385 1.00 31.66  ? 354 TYR A CE2 1 
ATOM   2314 C CZ  . TYR A 1 354 ? 73.275  -3.272  -142.339 1.00 31.62  ? 354 TYR A CZ  1 
ATOM   2315 O OH  . TYR A 1 354 ? 73.218  -4.419  -141.578 1.00 30.40  ? 354 TYR A OH  1 
ATOM   2316 N N   . PHE A 1 355 ? 74.345  2.319   -142.645 1.00 27.17  ? 355 PHE A N   1 
ATOM   2317 C CA  . PHE A 1 355 ? 75.024  2.528   -141.371 1.00 30.89  ? 355 PHE A CA  1 
ATOM   2318 C C   . PHE A 1 355 ? 74.329  3.567   -140.516 1.00 32.61  ? 355 PHE A C   1 
ATOM   2319 O O   . PHE A 1 355 ? 74.256  3.419   -139.293 1.00 34.50  ? 355 PHE A O   1 
ATOM   2320 C CB  . PHE A 1 355 ? 76.499  2.873   -141.580 1.00 31.88  ? 355 PHE A CB  1 
ATOM   2321 C CG  . PHE A 1 355 ? 77.341  1.673   -141.873 1.00 34.21  ? 355 PHE A CG  1 
ATOM   2322 C CD1 . PHE A 1 355 ? 77.804  1.419   -143.153 1.00 35.82  ? 355 PHE A CD1 1 
ATOM   2323 C CD2 . PHE A 1 355 ? 77.626  0.764   -140.871 1.00 33.34  ? 355 PHE A CD2 1 
ATOM   2324 C CE1 . PHE A 1 355 ? 78.565  0.289   -143.420 1.00 33.19  ? 355 PHE A CE1 1 
ATOM   2325 C CE2 . PHE A 1 355 ? 78.375  -0.364  -141.132 1.00 32.88  ? 355 PHE A CE2 1 
ATOM   2326 C CZ  . PHE A 1 355 ? 78.845  -0.603  -142.408 1.00 31.84  ? 355 PHE A CZ  1 
ATOM   2327 N N   . ILE A 1 356 ? 73.796  4.606   -141.149 1.00 29.37  ? 356 ILE A N   1 
ATOM   2328 C CA  . ILE A 1 356 ? 73.019  5.582   -140.403 1.00 33.04  ? 356 ILE A CA  1 
ATOM   2329 C C   . ILE A 1 356 ? 71.864  4.876   -139.686 1.00 35.18  ? 356 ILE A C   1 
ATOM   2330 O O   . ILE A 1 356 ? 71.623  5.113   -138.502 1.00 39.70  ? 356 ILE A O   1 
ATOM   2331 C CB  . ILE A 1 356 ? 72.524  6.732   -141.299 1.00 32.25  ? 356 ILE A CB  1 
ATOM   2332 C CG1 . ILE A 1 356 ? 73.711  7.635   -141.649 1.00 28.94  ? 356 ILE A CG1 1 
ATOM   2333 C CG2 . ILE A 1 356 ? 71.421  7.539   -140.593 1.00 25.77  ? 356 ILE A CG2 1 
ATOM   2334 C CD1 . ILE A 1 356 ? 73.464  8.580   -142.791 1.00 34.20  ? 356 ILE A CD1 1 
ATOM   2335 N N   . GLY A 1 357 ? 71.180  3.984   -140.392 1.00 33.84  ? 357 GLY A N   1 
ATOM   2336 C CA  . GLY A 1 357 ? 70.104  3.204   -139.792 1.00 33.72  ? 357 GLY A CA  1 
ATOM   2337 C C   . GLY A 1 357 ? 70.571  2.328   -138.640 1.00 31.99  ? 357 GLY A C   1 
ATOM   2338 O O   . GLY A 1 357 ? 69.936  2.276   -137.582 1.00 32.36  ? 357 GLY A O   1 
ATOM   2339 N N   . ARG A 1 358 ? 71.681  1.631   -138.850 1.00 29.98  ? 358 ARG A N   1 
ATOM   2340 C CA  . ARG A 1 358 ? 72.232  0.755   -137.829 1.00 30.70  ? 358 ARG A CA  1 
ATOM   2341 C C   . ARG A 1 358 ? 72.609  1.551   -136.597 1.00 30.01  ? 358 ARG A C   1 
ATOM   2342 O O   . ARG A 1 358 ? 72.281  1.156   -135.474 1.00 29.94  ? 358 ARG A O   1 
ATOM   2343 C CB  . ARG A 1 358 ? 73.454  0.038   -138.365 1.00 32.83  ? 358 ARG A CB  1 
ATOM   2344 C CG  . ARG A 1 358 ? 73.128  -1.036  -139.387 1.00 39.22  ? 358 ARG A CG  1 
ATOM   2345 C CD  . ARG A 1 358 ? 73.185  -2.414  -138.754 1.00 41.15  ? 358 ARG A CD  1 
ATOM   2346 N NE  . ARG A 1 358 ? 71.939  -2.768  -138.087 1.00 34.41  ? 358 ARG A NE  1 
ATOM   2347 C CZ  . ARG A 1 358 ? 71.818  -3.742  -137.190 1.00 31.50  ? 358 ARG A CZ  1 
ATOM   2348 N NH1 . ARG A 1 358 ? 72.869  -4.462  -136.811 1.00 33.57  ? 358 ARG A NH1 1 
ATOM   2349 N NH2 . ARG A 1 358 ? 70.634  -3.985  -136.652 1.00 41.26  ? 358 ARG A NH2 1 
ATOM   2350 N N   . ILE A 1 359 ? 73.280  2.681   -136.818 1.00 25.36  ? 359 ILE A N   1 
ATOM   2351 C CA  . ILE A 1 359 ? 73.653  3.568   -135.730 1.00 26.50  ? 359 ILE A CA  1 
ATOM   2352 C C   . ILE A 1 359 ? 72.401  3.981   -134.955 1.00 29.32  ? 359 ILE A C   1 
ATOM   2353 O O   . ILE A 1 359 ? 72.349  3.845   -133.732 1.00 31.84  ? 359 ILE A O   1 
ATOM   2354 C CB  . ILE A 1 359 ? 74.405  4.811   -136.227 1.00 25.23  ? 359 ILE A CB  1 
ATOM   2355 C CG1 . ILE A 1 359 ? 75.791  4.425   -136.772 1.00 30.34  ? 359 ILE A CG1 1 
ATOM   2356 C CG2 . ILE A 1 359 ? 74.581  5.803   -135.085 1.00 20.51  ? 359 ILE A CG2 1 
ATOM   2357 C CD1 . ILE A 1 359 ? 76.386  5.407   -137.807 1.00 23.30  ? 359 ILE A CD1 1 
ATOM   2358 N N   . TYR A 1 360 ? 71.382  4.454   -135.664 1.00 32.87  ? 360 TYR A N   1 
ATOM   2359 C CA  . TYR A 1 360 ? 70.106  4.780   -135.025 1.00 34.49  ? 360 TYR A CA  1 
ATOM   2360 C C   . TYR A 1 360 ? 69.544  3.608   -134.213 1.00 37.36  ? 360 TYR A C   1 
ATOM   2361 O O   . TYR A 1 360 ? 69.176  3.777   -133.047 1.00 38.14  ? 360 TYR A O   1 
ATOM   2362 C CB  . TYR A 1 360 ? 69.073  5.213   -136.058 1.00 37.44  ? 360 TYR A CB  1 
ATOM   2363 C CG  . TYR A 1 360 ? 67.689  5.352   -135.479 1.00 37.57  ? 360 TYR A CG  1 
ATOM   2364 C CD1 . TYR A 1 360 ? 67.258  6.559   -134.931 1.00 34.34  ? 360 TYR A CD1 1 
ATOM   2365 C CD2 . TYR A 1 360 ? 66.815  4.269   -135.460 1.00 40.85  ? 360 TYR A CD2 1 
ATOM   2366 C CE1 . TYR A 1 360 ? 65.984  6.687   -134.398 1.00 37.85  ? 360 TYR A CE1 1 
ATOM   2367 C CE2 . TYR A 1 360 ? 65.540  4.385   -134.923 1.00 41.16  ? 360 TYR A CE2 1 
ATOM   2368 C CZ  . TYR A 1 360 ? 65.131  5.594   -134.394 1.00 40.20  ? 360 TYR A CZ  1 
ATOM   2369 O OH  . TYR A 1 360 ? 63.868  5.700   -133.866 1.00 43.84  ? 360 TYR A OH  1 
ATOM   2370 N N   . LEU A 1 361 ? 69.469  2.432   -134.833 1.00 33.66  ? 361 LEU A N   1 
ATOM   2371 C CA  . LEU A 1 361 ? 69.013  1.236   -134.131 1.00 33.33  ? 361 LEU A CA  1 
ATOM   2372 C C   . LEU A 1 361 ? 69.844  0.985   -132.862 1.00 36.24  ? 361 LEU A C   1 
ATOM   2373 O O   . LEU A 1 361 ? 69.287  0.828   -131.773 1.00 36.85  ? 361 LEU A O   1 
ATOM   2374 C CB  . LEU A 1 361 ? 69.055  0.011   -135.051 1.00 30.23  ? 361 LEU A CB  1 
ATOM   2375 C CG  . LEU A 1 361 ? 67.966  -0.072  -136.130 1.00 23.85  ? 361 LEU A CG  1 
ATOM   2376 C CD1 . LEU A 1 361 ? 68.294  -1.155  -137.152 1.00 11.83  ? 361 LEU A CD1 1 
ATOM   2377 C CD2 . LEU A 1 361 ? 66.592  -0.315  -135.519 1.00 13.32  ? 361 LEU A CD2 1 
ATOM   2378 N N   . TYR A 1 362 ? 71.167  0.972   -132.999 1.00 34.46  ? 362 TYR A N   1 
ATOM   2379 C CA  . TYR A 1 362 ? 72.051  0.735   -131.853 1.00 34.80  ? 362 TYR A CA  1 
ATOM   2380 C C   . TYR A 1 362 ? 71.807  1.694   -130.692 1.00 33.70  ? 362 TYR A C   1 
ATOM   2381 O O   . TYR A 1 362 ? 71.770  1.281   -129.539 1.00 31.24  ? 362 TYR A O   1 
ATOM   2382 C CB  . TYR A 1 362 ? 73.524  0.854   -132.258 1.00 35.58  ? 362 TYR A CB  1 
ATOM   2383 C CG  . TYR A 1 362 ? 74.463  0.786   -131.073 1.00 35.77  ? 362 TYR A CG  1 
ATOM   2384 C CD1 . TYR A 1 362 ? 74.756  -0.428  -130.463 1.00 39.03  ? 362 TYR A CD1 1 
ATOM   2385 C CD2 . TYR A 1 362 ? 75.037  1.934   -130.544 1.00 39.75  ? 362 TYR A CD2 1 
ATOM   2386 C CE1 . TYR A 1 362 ? 75.606  -0.496  -129.370 1.00 32.24  ? 362 TYR A CE1 1 
ATOM   2387 C CE2 . TYR A 1 362 ? 75.889  1.871   -129.446 1.00 36.45  ? 362 TYR A CE2 1 
ATOM   2388 C CZ  . TYR A 1 362 ? 76.163  0.654   -128.871 1.00 30.94  ? 362 TYR A CZ  1 
ATOM   2389 O OH  . TYR A 1 362 ? 76.993  0.585   -127.790 1.00 38.15  ? 362 TYR A OH  1 
ATOM   2390 N N   . LEU A 1 363 ? 71.687  2.980   -131.001 1.00 35.87  ? 363 LEU A N   1 
ATOM   2391 C CA  . LEU A 1 363 ? 71.577  4.006   -129.962 1.00 36.06  ? 363 LEU A CA  1 
ATOM   2392 C C   . LEU A 1 363 ? 70.241  3.900   -129.239 1.00 35.46  ? 363 LEU A C   1 
ATOM   2393 O O   . LEU A 1 363 ? 70.151  4.151   -128.035 1.00 33.79  ? 363 LEU A O   1 
ATOM   2394 C CB  . LEU A 1 363 ? 71.744  5.408   -130.564 1.00 34.92  ? 363 LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 363 ? 73.131  5.713   -131.135 1.00 33.11  ? 363 LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 363 ? 73.126  6.988   -131.965 1.00 31.76  ? 363 LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 363 ? 74.143  5.808   -130.016 1.00 33.86  ? 363 LEU A CD2 1 
ATOM   2398 N N   . THR A 1 364 ? 69.207  3.535   -129.987 1.00 33.16  ? 364 THR A N   1 
ATOM   2399 C CA  . THR A 1 364 ? 67.893  3.324   -129.417 1.00 32.35  ? 364 THR A CA  1 
ATOM   2400 C C   . THR A 1 364 ? 67.959  2.168   -128.438 1.00 33.01  ? 364 THR A C   1 
ATOM   2401 O O   . THR A 1 364 ? 67.461  2.254   -127.316 1.00 37.25  ? 364 THR A O   1 
ATOM   2402 C CB  . THR A 1 364 ? 66.886  2.974   -130.504 1.00 29.61  ? 364 THR A CB  1 
ATOM   2403 O OG1 . THR A 1 364 ? 66.975  3.939   -131.551 1.00 32.12  ? 364 THR A OG1 1 
ATOM   2404 C CG2 . THR A 1 364 ? 65.480  2.968   -129.940 1.00 40.41  ? 364 THR A CG2 1 
ATOM   2405 N N   . LYS A 1 365 ? 68.597  1.093   -128.885 1.00 30.70  ? 365 LYS A N   1 
ATOM   2406 C CA  . LYS A 1 365 ? 68.714  -0.135  -128.124 1.00 28.78  ? 365 LYS A CA  1 
ATOM   2407 C C   . LYS A 1 365 ? 69.335  0.133   -126.769 1.00 29.25  ? 365 LYS A C   1 
ATOM   2408 O O   . LYS A 1 365 ? 68.910  -0.416  -125.758 1.00 35.68  ? 365 LYS A O   1 
ATOM   2409 C CB  . LYS A 1 365 ? 69.566  -1.132  -128.914 1.00 26.34  ? 365 LYS A CB  1 
ATOM   2410 C CG  . LYS A 1 365 ? 69.642  -2.515  -128.311 1.00 36.12  ? 365 LYS A CG  1 
ATOM   2411 C CD  . LYS A 1 365 ? 69.695  -3.629  -129.372 1.00 39.62  ? 365 LYS A CD  1 
ATOM   2412 C CE  . LYS A 1 365 ? 70.916  -3.551  -130.269 1.00 39.85  ? 365 LYS A CE  1 
ATOM   2413 N NZ  . LYS A 1 365 ? 70.979  -4.739  -131.159 1.00 39.91  ? 365 LYS A NZ  1 
ATOM   2414 N N   . VAL A 1 366 ? 70.330  1.009   -126.758 1.00 35.06  ? 366 VAL A N   1 
ATOM   2415 C CA  . VAL A 1 366 ? 71.125  1.289   -125.571 1.00 33.19  ? 366 VAL A CA  1 
ATOM   2416 C C   . VAL A 1 366 ? 70.501  2.375   -124.675 1.00 33.15  ? 366 VAL A C   1 
ATOM   2417 O O   . VAL A 1 366 ? 71.063  2.730   -123.642 1.00 27.98  ? 366 VAL A O   1 
ATOM   2418 C CB  . VAL A 1 366 ? 72.555  1.647   -126.006 1.00 33.78  ? 366 VAL A CB  1 
ATOM   2419 C CG1 . VAL A 1 366 ? 73.371  2.203   -124.864 1.00 43.88  ? 366 VAL A CG1 1 
ATOM   2420 C CG2 . VAL A 1 366 ? 73.221  0.404   -126.573 1.00 41.46  ? 366 VAL A CG2 1 
ATOM   2421 N N   . GLY A 1 367 ? 69.337  2.893   -125.065 1.00 34.07  ? 367 GLY A N   1 
ATOM   2422 C CA  . GLY A 1 367 ? 68.538  3.739   -124.179 1.00 33.29  ? 367 GLY A CA  1 
ATOM   2423 C C   . GLY A 1 367 ? 68.304  5.189   -124.585 1.00 35.56  ? 367 GLY A C   1 
ATOM   2424 O O   . GLY A 1 367 ? 67.643  5.939   -123.848 1.00 39.80  ? 367 GLY A O   1 
ATOM   2425 N N   . ILE A 1 368 ? 68.811  5.605   -125.744 1.00 28.53  ? 368 ILE A N   1 
ATOM   2426 C CA  . ILE A 1 368 ? 68.630  6.991   -126.152 1.00 28.24  ? 368 ILE A CA  1 
ATOM   2427 C C   . ILE A 1 368 ? 67.215  7.178   -126.701 1.00 30.66  ? 368 ILE A C   1 
ATOM   2428 O O   . ILE A 1 368 ? 66.663  6.283   -127.360 1.00 30.34  ? 368 ILE A O   1 
ATOM   2429 C CB  . ILE A 1 368 ? 69.708  7.447   -127.137 1.00 23.92  ? 368 ILE A CB  1 
ATOM   2430 C CG1 . ILE A 1 368 ? 71.083  7.333   -126.468 1.00 23.37  ? 368 ILE A CG1 1 
ATOM   2431 C CG2 . ILE A 1 368 ? 69.448  8.895   -127.565 1.00 17.77  ? 368 ILE A CG2 1 
ATOM   2432 C CD1 . ILE A 1 368 ? 72.253  7.332   -127.421 1.00 28.09  ? 368 ILE A CD1 1 
ATOM   2433 N N   . SER A 1 369 ? 66.627  8.332   -126.388 1.00 31.62  ? 369 SER A N   1 
ATOM   2434 C CA  . SER A 1 369 ? 65.239  8.623   -126.725 1.00 33.37  ? 369 SER A CA  1 
ATOM   2435 C C   . SER A 1 369 ? 65.163  9.078   -128.168 1.00 32.10  ? 369 SER A C   1 
ATOM   2436 O O   . SER A 1 369 ? 65.801  10.062  -128.535 1.00 34.17  ? 369 SER A O   1 
ATOM   2437 C CB  . SER A 1 369 ? 64.669  9.715   -125.816 1.00 35.60  ? 369 SER A CB  1 
ATOM   2438 O OG  . SER A 1 369 ? 64.987  9.473   -124.457 1.00 45.06  ? 369 SER A OG  1 
ATOM   2439 N N   . PRO A 1 370 ? 64.387  8.365   -128.996 1.00 31.51  ? 370 PRO A N   1 
ATOM   2440 C CA  . PRO A 1 370 ? 64.278  8.722   -130.408 1.00 32.83  ? 370 PRO A CA  1 
ATOM   2441 C C   . PRO A 1 370 ? 63.917  10.178  -130.652 1.00 32.32  ? 370 PRO A C   1 
ATOM   2442 O O   . PRO A 1 370 ? 64.359  10.761  -131.637 1.00 37.31  ? 370 PRO A O   1 
ATOM   2443 C CB  . PRO A 1 370 ? 63.162  7.807   -130.913 1.00 31.82  ? 370 PRO A CB  1 
ATOM   2444 C CG  . PRO A 1 370 ? 63.211  6.630   -130.013 1.00 33.39  ? 370 PRO A CG  1 
ATOM   2445 C CD  . PRO A 1 370 ? 63.589  7.170   -128.672 1.00 32.75  ? 370 PRO A CD  1 
ATOM   2446 N N   . ASP A 1 371 ? 63.124  10.758  -129.761 1.00 35.65  ? 371 ASP A N   1 
ATOM   2447 C CA  . ASP A 1 371 ? 62.692  12.144  -129.915 1.00 38.85  ? 371 ASP A CA  1 
ATOM   2448 C C   . ASP A 1 371 ? 63.774  13.150  -129.514 1.00 38.44  ? 371 ASP A C   1 
ATOM   2449 O O   . ASP A 1 371 ? 63.551  14.354  -129.591 1.00 43.22  ? 371 ASP A O   1 
ATOM   2450 C CB  . ASP A 1 371 ? 61.409  12.400  -129.109 1.00 44.13  ? 371 ASP A CB  1 
ATOM   2451 C CG  . ASP A 1 371 ? 61.609  12.228  -127.605 1.00 57.96  ? 371 ASP A CG  1 
ATOM   2452 O OD1 . ASP A 1 371 ? 62.243  11.231  -127.188 1.00 66.93  ? 371 ASP A OD1 1 
ATOM   2453 O OD2 . ASP A 1 371 ? 61.121  13.087  -126.840 1.00 65.45  ? 371 ASP A OD2 1 
ATOM   2454 N N   . LYS A 1 372 ? 64.934  12.667  -129.074 1.00 38.65  ? 372 LYS A N   1 
ATOM   2455 C CA  . LYS A 1 372 ? 66.058  13.543  -128.724 1.00 36.66  ? 372 LYS A CA  1 
ATOM   2456 C C   . LYS A 1 372 ? 67.318  13.095  -129.457 1.00 35.19  ? 372 LYS A C   1 
ATOM   2457 O O   . LYS A 1 372 ? 68.424  13.180  -128.925 1.00 31.92  ? 372 LYS A O   1 
ATOM   2458 C CB  . LYS A 1 372 ? 66.275  13.527  -127.216 1.00 33.88  ? 372 LYS A CB  1 
ATOM   2459 C CG  . LYS A 1 372 ? 65.017  13.850  -126.437 1.00 33.36  ? 372 LYS A CG  1 
ATOM   2460 C CD  . LYS A 1 372 ? 65.246  13.746  -124.955 1.00 34.22  ? 372 LYS A CD  1 
ATOM   2461 C CE  . LYS A 1 372 ? 63.951  13.502  -124.213 1.00 33.03  ? 372 LYS A CE  1 
ATOM   2462 N NZ  . LYS A 1 372 ? 64.235  13.214  -122.783 1.00 39.23  ? 372 LYS A NZ  1 
ATOM   2463 N N   . LEU A 1 373 ? 67.121  12.641  -130.695 1.00 35.63  ? 373 LEU A N   1 
ATOM   2464 C CA  . LEU A 1 373 ? 68.164  12.032  -131.512 1.00 35.41  ? 373 LEU A CA  1 
ATOM   2465 C C   . LEU A 1 373 ? 67.989  12.519  -132.940 1.00 37.10  ? 373 LEU A C   1 
ATOM   2466 O O   . LEU A 1 373 ? 66.890  12.456  -133.497 1.00 39.92  ? 373 LEU A O   1 
ATOM   2467 C CB  . LEU A 1 373 ? 68.030  10.503  -131.489 1.00 34.89  ? 373 LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 373 ? 69.263  9.621   -131.737 1.00 34.26  ? 373 LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 373 ? 68.854  8.311   -132.414 1.00 28.11  ? 373 LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 373 ? 70.312  10.330  -132.563 1.00 34.95  ? 373 LEU A CD2 1 
ATOM   2471 N N   . ARG A 1 374 ? 69.067  13.003  -133.539 1.00 35.28  ? 374 ARG A N   1 
ATOM   2472 C CA  . ARG A 1 374 ? 68.997  13.489  -134.904 1.00 33.40  ? 374 ARG A CA  1 
ATOM   2473 C C   . ARG A 1 374 ? 70.323  13.290  -135.620 1.00 31.01  ? 374 ARG A C   1 
ATOM   2474 O O   . ARG A 1 374 ? 71.364  13.110  -134.986 1.00 25.30  ? 374 ARG A O   1 
ATOM   2475 C CB  . ARG A 1 374 ? 68.622  14.968  -134.905 1.00 30.86  ? 374 ARG A CB  1 
ATOM   2476 C CG  . ARG A 1 374 ? 69.800  15.902  -134.658 1.00 32.40  ? 374 ARG A CG  1 
ATOM   2477 C CD  . ARG A 1 374 ? 69.358  17.340  -134.550 1.00 35.60  ? 374 ARG A CD  1 
ATOM   2478 N NE  . ARG A 1 374 ? 70.471  18.228  -134.226 1.00 34.04  ? 374 ARG A NE  1 
ATOM   2479 C CZ  . ARG A 1 374 ? 70.327  19.488  -133.825 1.00 38.94  ? 374 ARG A CZ  1 
ATOM   2480 N NH1 . ARG A 1 374 ? 69.118  20.035  -133.704 1.00 36.50  ? 374 ARG A NH1 1 
ATOM   2481 N NH2 . ARG A 1 374 ? 71.400  20.213  -133.542 1.00 44.19  ? 374 ARG A NH2 1 
ATOM   2482 N N   . PHE A 1 375 ? 70.275  13.345  -136.946 1.00 29.04  ? 375 PHE A N   1 
ATOM   2483 C CA  . PHE A 1 375 ? 71.472  13.227  -137.756 1.00 30.80  ? 375 PHE A CA  1 
ATOM   2484 C C   . PHE A 1 375 ? 71.709  14.506  -138.538 1.00 30.39  ? 375 PHE A C   1 
ATOM   2485 O O   . PHE A 1 375 ? 70.900  14.891  -139.377 1.00 33.43  ? 375 PHE A O   1 
ATOM   2486 C CB  . PHE A 1 375 ? 71.354  12.033  -138.690 1.00 30.39  ? 375 PHE A CB  1 
ATOM   2487 C CG  . PHE A 1 375 ? 71.394  10.716  -137.978 1.00 27.25  ? 375 PHE A CG  1 
ATOM   2488 C CD1 . PHE A 1 375 ? 70.245  10.182  -137.422 1.00 25.38  ? 375 PHE A CD1 1 
ATOM   2489 C CD2 . PHE A 1 375 ? 72.586  10.015  -137.856 1.00 28.02  ? 375 PHE A CD2 1 
ATOM   2490 C CE1 . PHE A 1 375 ? 70.282  8.970   -136.764 1.00 30.14  ? 375 PHE A CE1 1 
ATOM   2491 C CE2 . PHE A 1 375 ? 72.630  8.798   -137.197 1.00 26.74  ? 375 PHE A CE2 1 
ATOM   2492 C CZ  . PHE A 1 375 ? 71.480  8.274   -136.652 1.00 27.70  ? 375 PHE A CZ  1 
ATOM   2493 N N   . ARG A 1 376 ? 72.830  15.156  -138.248 1.00 32.36  ? 376 ARG A N   1 
ATOM   2494 C CA  . ARG A 1 376 ? 73.162  16.438  -138.842 1.00 32.50  ? 376 ARG A CA  1 
ATOM   2495 C C   . ARG A 1 376 ? 74.300  16.276  -139.829 1.00 33.10  ? 376 ARG A C   1 
ATOM   2496 O O   . ARG A 1 376 ? 75.306  15.630  -139.544 1.00 36.36  ? 376 ARG A O   1 
ATOM   2497 C CB  . ARG A 1 376 ? 73.564  17.433  -137.762 1.00 31.34  ? 376 ARG A CB  1 
ATOM   2498 C CG  . ARG A 1 376 ? 73.797  18.821  -138.289 1.00 33.20  ? 376 ARG A CG  1 
ATOM   2499 C CD  . ARG A 1 376 ? 74.249  19.750  -137.193 1.00 37.22  ? 376 ARG A CD  1 
ATOM   2500 N NE  . ARG A 1 376 ? 75.659  19.564  -136.858 1.00 37.43  ? 376 ARG A NE  1 
ATOM   2501 C CZ  . ARG A 1 376 ? 76.676  19.990  -137.602 1.00 38.72  ? 376 ARG A CZ  1 
ATOM   2502 N NH1 . ARG A 1 376 ? 76.469  20.640  -138.742 1.00 44.58  ? 376 ARG A NH1 1 
ATOM   2503 N NH2 . ARG A 1 376 ? 77.918  19.763  -137.199 1.00 41.39  ? 376 ARG A NH2 1 
ATOM   2504 N N   . GLN A 1 377 ? 74.136  16.895  -140.984 1.00 34.00  ? 377 GLN A N   1 
ATOM   2505 C CA  . GLN A 1 377 ? 75.090  16.792  -142.066 1.00 34.21  ? 377 GLN A CA  1 
ATOM   2506 C C   . GLN A 1 377 ? 76.067  17.951  -141.982 1.00 32.44  ? 377 GLN A C   1 
ATOM   2507 O O   . GLN A 1 377 ? 75.668  19.086  -141.722 1.00 32.10  ? 377 GLN A O   1 
ATOM   2508 C CB  . GLN A 1 377 ? 74.328  16.854  -143.382 1.00 36.41  ? 377 GLN A CB  1 
ATOM   2509 C CG  . GLN A 1 377 ? 75.141  16.569  -144.612 1.00 34.27  ? 377 GLN A CG  1 
ATOM   2510 C CD  . GLN A 1 377 ? 74.310  16.692  -145.870 1.00 32.68  ? 377 GLN A CD  1 
ATOM   2511 O OE1 . GLN A 1 377 ? 73.407  17.530  -145.961 1.00 29.13  ? 377 GLN A OE1 1 
ATOM   2512 N NE2 . GLN A 1 377 ? 74.611  15.855  -146.853 1.00 35.81  ? 377 GLN A NE2 1 
ATOM   2513 N N   . HIS A 1 378 ? 77.342  17.676  -142.214 1.00 33.55  ? 378 HIS A N   1 
ATOM   2514 C CA  . HIS A 1 378 ? 78.339  18.737  -142.213 1.00 39.97  ? 378 HIS A CA  1 
ATOM   2515 C C   . HIS A 1 378 ? 78.060  19.710  -143.340 1.00 43.09  ? 378 HIS A C   1 
ATOM   2516 O O   . HIS A 1 378 ? 77.519  19.338  -144.377 1.00 46.12  ? 378 HIS A O   1 
ATOM   2517 C CB  . HIS A 1 378 ? 79.752  18.176  -142.366 1.00 42.01  ? 378 HIS A CB  1 
ATOM   2518 C CG  . HIS A 1 378 ? 80.375  17.746  -141.075 1.00 49.35  ? 378 HIS A CG  1 
ATOM   2519 N ND1 . HIS A 1 378 ? 79.679  17.059  -140.103 1.00 46.81  ? 378 HIS A ND1 1 
ATOM   2520 C CD2 . HIS A 1 378 ? 81.637  17.892  -140.603 1.00 48.27  ? 378 HIS A CD2 1 
ATOM   2521 C CE1 . HIS A 1 378 ? 80.482  16.811  -139.085 1.00 40.14  ? 378 HIS A CE1 1 
ATOM   2522 N NE2 . HIS A 1 378 ? 81.675  17.304  -139.363 1.00 45.12  ? 378 HIS A NE2 1 
ATOM   2523 N N   . MET A 1 379 ? 78.432  20.962  -143.121 1.00 48.08  ? 379 MET A N   1 
ATOM   2524 C CA  . MET A 1 379 ? 78.314  21.993  -144.134 1.00 50.66  ? 379 MET A CA  1 
ATOM   2525 C C   . MET A 1 379 ? 79.646  22.130  -144.862 1.00 55.12  ? 379 MET A C   1 
ATOM   2526 O O   . MET A 1 379 ? 80.659  21.588  -144.414 1.00 53.77  ? 379 MET A O   1 
ATOM   2527 C CB  . MET A 1 379 ? 77.903  23.306  -143.477 1.00 50.81  ? 379 MET A CB  1 
ATOM   2528 C CG  . MET A 1 379 ? 76.682  23.146  -142.587 1.00 50.52  ? 379 MET A CG  1 
ATOM   2529 S SD  . MET A 1 379 ? 75.926  24.698  -142.109 1.00 47.78  ? 379 MET A SD  1 
ATOM   2530 C CE  . MET A 1 379 ? 75.154  25.214  -143.649 1.00 61.41  ? 379 MET A CE  1 
ATOM   2531 N N   . GLU A 1 380 ? 79.632  22.854  -145.982 1.00 61.22  ? 380 GLU A N   1 
ATOM   2532 C CA  . GLU A 1 380 ? 80.799  22.971  -146.873 1.00 63.61  ? 380 GLU A CA  1 
ATOM   2533 C C   . GLU A 1 380 ? 82.066  23.415  -146.127 1.00 66.97  ? 380 GLU A C   1 
ATOM   2534 O O   . GLU A 1 380 ? 83.153  22.870  -146.339 1.00 66.27  ? 380 GLU A O   1 
ATOM   2535 C CB  . GLU A 1 380 ? 80.512  23.957  -148.021 1.00 64.72  ? 380 GLU A CB  1 
ATOM   2536 C CG  . GLU A 1 380 ? 79.314  23.605  -148.925 1.00 66.17  ? 380 GLU A CG  1 
ATOM   2537 C CD  . GLU A 1 380 ? 79.607  22.509  -149.945 1.00 66.16  ? 380 GLU A CD  1 
ATOM   2538 O OE1 . GLU A 1 380 ? 78.925  22.483  -150.989 1.00 65.99  ? 380 GLU A OE1 1 
ATOM   2539 O OE2 . GLU A 1 380 ? 80.509  21.675  -149.715 1.00 65.58  ? 380 GLU A OE2 1 
ATOM   2540 N N   . ASN A 1 381 ? 81.904  24.393  -145.241 1.00 71.04  ? 381 ASN A N   1 
ATOM   2541 C CA  . ASN A 1 381 ? 83.031  25.022  -144.543 1.00 72.49  ? 381 ASN A CA  1 
ATOM   2542 C C   . ASN A 1 381 ? 83.773  24.146  -143.524 1.00 72.39  ? 381 ASN A C   1 
ATOM   2543 O O   . ASN A 1 381 ? 84.991  24.243  -143.394 1.00 72.77  ? 381 ASN A O   1 
ATOM   2544 C CB  . ASN A 1 381 ? 82.577  26.333  -143.870 1.00 74.80  ? 381 ASN A CB  1 
ATOM   2545 C CG  . ASN A 1 381 ? 81.317  26.168  -143.022 1.00 75.37  ? 381 ASN A CG  1 
ATOM   2546 O OD1 . ASN A 1 381 ? 80.259  26.695  -143.367 1.00 78.42  ? 381 ASN A OD1 1 
ATOM   2547 N ND2 . ASN A 1 381 ? 81.428  25.437  -141.915 1.00 69.22  ? 381 ASN A ND2 1 
ATOM   2548 N N   . GLU A 1 382 ? 83.055  23.280  -142.821 1.00 72.49  ? 382 GLU A N   1 
ATOM   2549 C CA  . GLU A 1 382 ? 83.628  22.611  -141.648 1.00 74.43  ? 382 GLU A CA  1 
ATOM   2550 C C   . GLU A 1 382 ? 84.515  21.386  -141.952 1.00 80.97  ? 382 GLU A C   1 
ATOM   2551 O O   . GLU A 1 382 ? 85.086  20.811  -141.022 1.00 86.45  ? 382 GLU A O   1 
ATOM   2552 C CB  . GLU A 1 382 ? 82.538  22.258  -140.608 1.00 72.60  ? 382 GLU A CB  1 
ATOM   2553 C CG  . GLU A 1 382 ? 81.121  22.035  -141.153 1.00 67.89  ? 382 GLU A CG  1 
ATOM   2554 C CD  . GLU A 1 382 ? 80.131  21.545  -140.097 1.00 63.36  ? 382 GLU A CD  1 
ATOM   2555 O OE1 . GLU A 1 382 ? 78.938  21.892  -140.211 1.00 45.44  ? 382 GLU A OE1 1 
ATOM   2556 O OE2 . GLU A 1 382 ? 80.533  20.810  -139.168 1.00 54.20  ? 382 GLU A OE2 1 
ATOM   2557 N N   . MET A 1 383 ? 84.655  21.005  -143.227 1.00 85.10  ? 383 MET A N   1 
ATOM   2558 C CA  . MET A 1 383 ? 85.367  19.765  -143.623 1.00 86.22  ? 383 MET A CA  1 
ATOM   2559 C C   . MET A 1 383 ? 85.836  18.909  -142.434 1.00 88.33  ? 383 MET A C   1 
ATOM   2560 O O   . MET A 1 383 ? 86.485  17.873  -142.605 1.00 86.30  ? 383 MET A O   1 
ATOM   2561 C CB  . MET A 1 383 ? 86.555  20.069  -144.551 1.00 87.67  ? 383 MET A CB  1 
ATOM   2562 C CG  . MET A 1 383 ? 87.665  20.917  -143.938 1.00 90.87  ? 383 MET A CG  1 
ATOM   2563 S SD  . MET A 1 383 ? 87.572  22.640  -144.462 1.00 102.33 ? 383 MET A SD  1 
ATOM   2564 C CE  . MET A 1 383 ? 88.071  22.516  -146.186 1.00 89.89  ? 383 MET A CE  1 
ATOM   2565 N N   . TYR A 1 386 ? 90.739  17.611  -148.053 1.00 81.55  ? 386 TYR A N   1 
ATOM   2566 C CA  . TYR A 1 386 ? 89.698  16.852  -148.739 1.00 79.81  ? 386 TYR A CA  1 
ATOM   2567 C C   . TYR A 1 386 ? 88.402  16.874  -147.918 1.00 78.92  ? 386 TYR A C   1 
ATOM   2568 O O   . TYR A 1 386 ? 88.395  16.513  -146.735 1.00 77.03  ? 386 TYR A O   1 
ATOM   2569 C CB  . TYR A 1 386 ? 90.146  15.401  -148.983 1.00 83.83  ? 386 TYR A CB  1 
ATOM   2570 C CG  . TYR A 1 386 ? 91.649  15.204  -149.014 1.00 88.20  ? 386 TYR A CG  1 
ATOM   2571 C CD1 . TYR A 1 386 ? 92.415  15.678  -150.080 1.00 87.55  ? 386 TYR A CD1 1 
ATOM   2572 C CD2 . TYR A 1 386 ? 92.308  14.542  -147.972 1.00 91.77  ? 386 TYR A CD2 1 
ATOM   2573 C CE1 . TYR A 1 386 ? 93.799  15.501  -150.107 1.00 86.80  ? 386 TYR A CE1 1 
ATOM   2574 C CE2 . TYR A 1 386 ? 93.689  14.360  -147.991 1.00 88.60  ? 386 TYR A CE2 1 
ATOM   2575 C CZ  . TYR A 1 386 ? 94.426  14.842  -149.060 1.00 87.51  ? 386 TYR A CZ  1 
ATOM   2576 O OH  . TYR A 1 386 ? 95.790  14.666  -149.078 1.00 88.58  ? 386 TYR A OH  1 
ATOM   2577 N N   . ALA A 1 387 ? 87.311  17.305  -148.554 1.00 75.53  ? 387 ALA A N   1 
ATOM   2578 C CA  . ALA A 1 387 ? 85.991  17.326  -147.922 1.00 70.12  ? 387 ALA A CA  1 
ATOM   2579 C C   . ALA A 1 387 ? 85.367  15.928  -147.908 1.00 66.51  ? 387 ALA A C   1 
ATOM   2580 O O   . ALA A 1 387 ? 86.006  14.937  -148.276 1.00 63.44  ? 387 ALA A O   1 
ATOM   2581 C CB  . ALA A 1 387 ? 85.072  18.313  -148.640 1.00 68.04  ? 387 ALA A CB  1 
ATOM   2582 N N   . CYS A 1 388 ? 84.116  15.854  -147.470 1.00 62.33  ? 388 CYS A N   1 
ATOM   2583 C CA  . CYS A 1 388 ? 83.424  14.583  -147.353 1.00 57.12  ? 388 CYS A CA  1 
ATOM   2584 C C   . CYS A 1 388 ? 81.937  14.786  -147.077 1.00 52.30  ? 388 CYS A C   1 
ATOM   2585 O O   . CYS A 1 388 ? 81.526  15.774  -146.464 1.00 50.62  ? 388 CYS A O   1 
ATOM   2586 C CB  . CYS A 1 388 ? 84.036  13.752  -146.219 1.00 58.15  ? 388 CYS A CB  1 
ATOM   2587 S SG  . CYS A 1 388 ? 83.546  14.269  -144.557 1.00 58.95  ? 388 CYS A SG  1 
ATOM   2588 N N   . ASP A 1 389 ? 81.133  13.844  -147.546 1.00 49.05  ? 389 ASP A N   1 
ATOM   2589 C CA  . ASP A 1 389 ? 79.748  13.757  -147.132 1.00 48.23  ? 389 ASP A CA  1 
ATOM   2590 C C   . ASP A 1 389 ? 79.824  13.185  -145.736 1.00 46.21  ? 389 ASP A C   1 
ATOM   2591 O O   . ASP A 1 389 ? 80.363  12.098  -145.539 1.00 46.37  ? 389 ASP A O   1 
ATOM   2592 C CB  . ASP A 1 389 ? 78.961  12.833  -148.064 1.00 47.93  ? 389 ASP A CB  1 
ATOM   2593 C CG  . ASP A 1 389 ? 77.471  12.869  -147.811 1.00 45.60  ? 389 ASP A CG  1 
ATOM   2594 O OD1 . ASP A 1 389 ? 77.024  13.641  -146.934 1.00 42.15  ? 389 ASP A OD1 1 
ATOM   2595 O OD2 . ASP A 1 389 ? 76.746  12.119  -148.501 1.00 39.61  ? 389 ASP A OD2 1 
ATOM   2596 N N   . CYS A 1 390 ? 79.310  13.924  -144.764 1.00 49.31  ? 390 CYS A N   1 
ATOM   2597 C CA  . CYS A 1 390 ? 79.513  13.566  -143.373 1.00 44.15  ? 390 CYS A CA  1 
ATOM   2598 C C   . CYS A 1 390 ? 78.311  13.878  -142.495 1.00 40.49  ? 390 CYS A C   1 
ATOM   2599 O O   . CYS A 1 390 ? 77.854  15.018  -142.443 1.00 45.02  ? 390 CYS A O   1 
ATOM   2600 C CB  . CYS A 1 390 ? 80.732  14.299  -142.843 1.00 43.23  ? 390 CYS A CB  1 
ATOM   2601 S SG  . CYS A 1 390 ? 80.852  14.218  -141.076 1.00 65.88  ? 390 CYS A SG  1 
ATOM   2602 N N   . TRP A 1 391 ? 77.820  12.855  -141.799 1.00 34.09  ? 391 TRP A N   1 
ATOM   2603 C CA  . TRP A 1 391 ? 76.699  12.989  -140.886 1.00 32.14  ? 391 TRP A CA  1 
ATOM   2604 C C   . TRP A 1 391 ? 77.141  12.624  -139.481 1.00 34.06  ? 391 TRP A C   1 
ATOM   2605 O O   . TRP A 1 391 ? 77.941  11.704  -139.298 1.00 38.43  ? 391 TRP A O   1 
ATOM   2606 C CB  . TRP A 1 391 ? 75.559  12.069  -141.314 1.00 30.58  ? 391 TRP A CB  1 
ATOM   2607 C CG  . TRP A 1 391 ? 74.928  12.464  -142.608 1.00 29.34  ? 391 TRP A CG  1 
ATOM   2608 C CD1 . TRP A 1 391 ? 75.439  12.271  -143.851 1.00 27.08  ? 391 TRP A CD1 1 
ATOM   2609 C CD2 . TRP A 1 391 ? 73.663  13.122  -142.790 1.00 29.91  ? 391 TRP A CD2 1 
ATOM   2610 N NE1 . TRP A 1 391 ? 74.580  12.768  -144.799 1.00 32.37  ? 391 TRP A NE1 1 
ATOM   2611 C CE2 . TRP A 1 391 ? 73.480  13.296  -144.175 1.00 27.07  ? 391 TRP A CE2 1 
ATOM   2612 C CE3 . TRP A 1 391 ? 72.670  13.582  -141.915 1.00 32.21  ? 391 TRP A CE3 1 
ATOM   2613 C CZ2 . TRP A 1 391 ? 72.344  13.909  -144.713 1.00 25.47  ? 391 TRP A CZ2 1 
ATOM   2614 C CZ3 . TRP A 1 391 ? 71.540  14.194  -142.451 1.00 30.68  ? 391 TRP A CZ3 1 
ATOM   2615 C CH2 . TRP A 1 391 ? 71.390  14.350  -143.837 1.00 29.36  ? 391 TRP A CH2 1 
ATOM   2616 N N   . ASP A 1 392 ? 76.621  13.351  -138.494 1.00 34.62  ? 392 ASP A N   1 
ATOM   2617 C CA  . ASP A 1 392 ? 76.888  13.073  -137.082 1.00 31.08  ? 392 ASP A CA  1 
ATOM   2618 C C   . ASP A 1 392 ? 75.584  12.750  -136.392 1.00 27.35  ? 392 ASP A C   1 
ATOM   2619 O O   . ASP A 1 392 ? 74.602  13.465  -136.571 1.00 21.63  ? 392 ASP A O   1 
ATOM   2620 C CB  . ASP A 1 392 ? 77.478  14.299  -136.379 1.00 32.22  ? 392 ASP A CB  1 
ATOM   2621 C CG  . ASP A 1 392 ? 78.918  14.592  -136.773 1.00 37.76  ? 392 ASP A CG  1 
ATOM   2622 O OD1 . ASP A 1 392 ? 79.374  15.712  -136.438 1.00 35.55  ? 392 ASP A OD1 1 
ATOM   2623 O OD2 . ASP A 1 392 ? 79.593  13.733  -137.393 1.00 40.72  ? 392 ASP A OD2 1 
ATOM   2624 N N   . ALA A 1 393 ? 75.577  11.689  -135.591 1.00 29.91  ? 393 ALA A N   1 
ATOM   2625 C CA  . ALA A 1 393 ? 74.480  11.448  -134.657 1.00 30.10  ? 393 ALA A CA  1 
ATOM   2626 C C   . ALA A 1 393 ? 74.657  12.412  -133.494 1.00 32.39  ? 393 ALA A C   1 
ATOM   2627 O O   . ALA A 1 393 ? 75.713  12.424  -132.852 1.00 35.94  ? 393 ALA A O   1 
ATOM   2628 C CB  . ALA A 1 393 ? 74.494  10.023  -134.158 1.00 23.98  ? 393 ALA A CB  1 
ATOM   2629 N N   . GLU A 1 394 ? 73.636  13.229  -133.242 1.00 33.18  ? 394 GLU A N   1 
ATOM   2630 C CA  . GLU A 1 394 ? 73.639  14.159  -132.116 1.00 32.60  ? 394 GLU A CA  1 
ATOM   2631 C C   . GLU A 1 394 ? 72.444  13.896  -131.204 1.00 33.60  ? 394 GLU A C   1 
ATOM   2632 O O   . GLU A 1 394 ? 71.339  13.609  -131.671 1.00 36.10  ? 394 GLU A O   1 
ATOM   2633 C CB  . GLU A 1 394 ? 73.601  15.604  -132.610 1.00 30.93  ? 394 GLU A CB  1 
ATOM   2634 C CG  . GLU A 1 394 ? 74.763  15.981  -133.513 1.00 27.81  ? 394 GLU A CG  1 
ATOM   2635 C CD  . GLU A 1 394 ? 74.689  17.416  -134.015 1.00 35.06  ? 394 GLU A CD  1 
ATOM   2636 O OE1 . GLU A 1 394 ? 73.571  17.973  -134.119 1.00 33.36  ? 394 GLU A OE1 1 
ATOM   2637 O OE2 . GLU A 1 394 ? 75.760  17.986  -134.311 1.00 37.96  ? 394 GLU A OE2 1 
ATOM   2638 N N   . SER A 1 395 ? 72.672  13.993  -129.903 1.00 31.96  ? 395 SER A N   1 
ATOM   2639 C CA  . SER A 1 395 ? 71.615  13.780  -128.934 1.00 32.60  ? 395 SER A CA  1 
ATOM   2640 C C   . SER A 1 395 ? 71.350  15.084  -128.225 1.00 31.48  ? 395 SER A C   1 
ATOM   2641 O O   . SER A 1 395 ? 72.292  15.812  -127.899 1.00 28.95  ? 395 SER A O   1 
ATOM   2642 C CB  . SER A 1 395 ? 72.008  12.702  -127.921 1.00 37.81  ? 395 SER A CB  1 
ATOM   2643 O OG  . SER A 1 395 ? 73.278  12.956  -127.335 1.00 42.12  ? 395 SER A OG  1 
ATOM   2644 N N   . LYS A 1 396 ? 70.070  15.375  -128.001 1.00 32.65  ? 396 LYS A N   1 
ATOM   2645 C CA  . LYS A 1 396 ? 69.664  16.589  -127.306 1.00 32.72  ? 396 LYS A CA  1 
ATOM   2646 C C   . LYS A 1 396 ? 69.847  16.345  -125.827 1.00 32.40  ? 396 LYS A C   1 
ATOM   2647 O O   . LYS A 1 396 ? 69.287  15.398  -125.279 1.00 35.32  ? 396 LYS A O   1 
ATOM   2648 C CB  . LYS A 1 396 ? 68.206  16.933  -127.604 1.00 34.69  ? 396 LYS A CB  1 
ATOM   2649 C CG  . LYS A 1 396 ? 67.853  18.420  -127.471 1.00 34.42  ? 396 LYS A CG  1 
ATOM   2650 C CD  . LYS A 1 396 ? 67.656  18.846  -126.024 1.00 36.26  ? 396 LYS A CD  1 
ATOM   2651 C CE  . LYS A 1 396 ? 66.792  20.097  -125.923 1.00 33.78  ? 396 LYS A CE  1 
ATOM   2652 N NZ  . LYS A 1 396 ? 65.385  19.840  -126.334 1.00 28.23  ? 396 LYS A NZ  1 
ATOM   2653 N N   . THR A 1 397 ? 70.631  17.205  -125.188 1.00 32.49  ? 397 THR A N   1 
ATOM   2654 C CA  . THR A 1 397 ? 71.041  16.997  -123.809 1.00 31.21  ? 397 THR A CA  1 
ATOM   2655 C C   . THR A 1 397 ? 71.013  18.305  -123.029 1.00 28.49  ? 397 THR A C   1 
ATOM   2656 O O   . THR A 1 397 ? 70.622  19.337  -123.561 1.00 28.77  ? 397 THR A O   1 
ATOM   2657 C CB  . THR A 1 397 ? 72.447  16.385  -123.758 1.00 30.49  ? 397 THR A CB  1 
ATOM   2658 O OG1 . THR A 1 397 ? 72.745  16.016  -122.412 1.00 40.10  ? 397 THR A OG1 1 
ATOM   2659 C CG2 . THR A 1 397 ? 73.488  17.369  -124.249 1.00 28.00  ? 397 THR A CG2 1 
ATOM   2660 N N   . SER A 1 398 ? 71.420  18.258  -121.765 1.00 27.25  ? 398 SER A N   1 
ATOM   2661 C CA  . SER A 1 398 ? 71.445  19.455  -120.928 1.00 27.62  ? 398 SER A CA  1 
ATOM   2662 C C   . SER A 1 398 ? 72.579  20.369  -121.353 1.00 26.03  ? 398 SER A C   1 
ATOM   2663 O O   . SER A 1 398 ? 72.579  21.551  -121.040 1.00 22.68  ? 398 SER A O   1 
ATOM   2664 C CB  . SER A 1 398 ? 71.606  19.089  -119.455 1.00 26.71  ? 398 SER A CB  1 
ATOM   2665 O OG  . SER A 1 398 ? 72.917  18.641  -119.189 1.00 37.34  ? 398 SER A OG  1 
ATOM   2666 N N   . TYR A 1 399 ? 73.558  19.804  -122.050 1.00 29.78  ? 399 TYR A N   1 
ATOM   2667 C CA  . TYR A 1 399 ? 74.610  20.589  -122.674 1.00 31.30  ? 399 TYR A CA  1 
ATOM   2668 C C   . TYR A 1 399 ? 74.237  21.007  -124.101 1.00 30.66  ? 399 TYR A C   1 
ATOM   2669 O O   . TYR A 1 399 ? 75.086  21.484  -124.842 1.00 36.53  ? 399 TYR A O   1 
ATOM   2670 C CB  . TYR A 1 399 ? 75.904  19.779  -122.702 1.00 34.20  ? 399 TYR A CB  1 
ATOM   2671 C CG  . TYR A 1 399 ? 76.467  19.440  -121.337 1.00 36.47  ? 399 TYR A CG  1 
ATOM   2672 C CD1 . TYR A 1 399 ? 76.188  18.226  -120.730 1.00 41.67  ? 399 TYR A CD1 1 
ATOM   2673 C CD2 . TYR A 1 399 ? 77.297  20.329  -120.663 1.00 40.50  ? 399 TYR A CD2 1 
ATOM   2674 C CE1 . TYR A 1 399 ? 76.715  17.912  -119.479 1.00 41.29  ? 399 TYR A CE1 1 
ATOM   2675 C CE2 . TYR A 1 399 ? 77.830  20.019  -119.416 1.00 35.40  ? 399 TYR A CE2 1 
ATOM   2676 C CZ  . TYR A 1 399 ? 77.534  18.811  -118.829 1.00 35.48  ? 399 TYR A CZ  1 
ATOM   2677 O OH  . TYR A 1 399 ? 78.058  18.494  -117.593 1.00 33.74  ? 399 TYR A OH  1 
ATOM   2678 N N   . GLY A 1 400 ? 72.975  20.839  -124.485 1.00 28.91  ? 400 GLY A N   1 
ATOM   2679 C CA  . GLY A 1 400 ? 72.537  21.103  -125.858 1.00 29.64  ? 400 GLY A CA  1 
ATOM   2680 C C   . GLY A 1 400 ? 72.660  19.869  -126.731 1.00 29.25  ? 400 GLY A C   1 
ATOM   2681 O O   . GLY A 1 400 ? 72.964  18.784  -126.241 1.00 30.25  ? 400 GLY A O   1 
ATOM   2682 N N   . TRP A 1 401 ? 72.407  20.026  -128.026 1.00 28.60  ? 401 TRP A N   1 
ATOM   2683 C CA  . TRP A 1 401 ? 72.636  18.942  -128.977 1.00 28.91  ? 401 TRP A CA  1 
ATOM   2684 C C   . TRP A 1 401 ? 74.128  18.693  -129.088 1.00 28.58  ? 401 TRP A C   1 
ATOM   2685 O O   . TRP A 1 401 ? 74.864  19.615  -129.407 1.00 30.11  ? 401 TRP A O   1 
ATOM   2686 C CB  . TRP A 1 401 ? 72.096  19.307  -130.353 1.00 27.50  ? 401 TRP A CB  1 
ATOM   2687 C CG  . TRP A 1 401 ? 70.622  19.292  -130.430 1.00 25.51  ? 401 TRP A CG  1 
ATOM   2688 C CD1 . TRP A 1 401 ? 69.788  20.353  -130.278 1.00 24.59  ? 401 TRP A CD1 1 
ATOM   2689 C CD2 . TRP A 1 401 ? 69.793  18.154  -130.686 1.00 24.42  ? 401 TRP A CD2 1 
ATOM   2690 N NE1 . TRP A 1 401 ? 68.484  19.950  -130.424 1.00 27.67  ? 401 TRP A NE1 1 
ATOM   2691 C CE2 . TRP A 1 401 ? 68.459  18.604  -130.680 1.00 22.84  ? 401 TRP A CE2 1 
ATOM   2692 C CE3 . TRP A 1 401 ? 70.048  16.796  -130.922 1.00 29.96  ? 401 TRP A CE3 1 
ATOM   2693 C CZ2 . TRP A 1 401 ? 67.378  17.747  -130.905 1.00 24.48  ? 401 TRP A CZ2 1 
ATOM   2694 C CZ3 . TRP A 1 401 ? 68.970  15.939  -131.140 1.00 27.43  ? 401 TRP A CZ3 1 
ATOM   2695 C CH2 . TRP A 1 401 ? 67.653  16.422  -131.132 1.00 27.15  ? 401 TRP A CH2 1 
ATOM   2696 N N   . ILE A 1 402 ? 74.573  17.464  -128.821 1.00 31.11  ? 402 ILE A N   1 
ATOM   2697 C CA  . ILE A 1 402 ? 76.006  17.130  -128.886 1.00 32.12  ? 402 ILE A CA  1 
ATOM   2698 C C   . ILE A 1 402 ? 76.253  15.890  -129.754 1.00 33.89  ? 402 ILE A C   1 
ATOM   2699 O O   . ILE A 1 402 ? 75.424  14.976  -129.784 1.00 32.72  ? 402 ILE A O   1 
ATOM   2700 C CB  . ILE A 1 402 ? 76.618  16.926  -127.468 1.00 29.98  ? 402 ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 402 ? 76.288  15.542  -126.902 1.00 30.86  ? 402 ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 402 ? 76.123  17.998  -126.510 1.00 26.58  ? 402 ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 402 ? 76.764  15.350  -125.478 1.00 33.57  ? 402 ILE A CD1 1 
ATOM   2704 N N   . GLU A 1 403 ? 77.395  15.866  -130.447 1.00 34.46  ? 403 GLU A N   1 
ATOM   2705 C CA  . GLU A 1 403 ? 77.714  14.773  -131.370 1.00 35.45  ? 403 GLU A CA  1 
ATOM   2706 C C   . GLU A 1 403 ? 78.254  13.575  -130.592 1.00 38.90  ? 403 GLU A C   1 
ATOM   2707 O O   . GLU A 1 403 ? 79.132  13.712  -129.734 1.00 39.44  ? 403 GLU A O   1 
ATOM   2708 C CB  . GLU A 1 403 ? 78.649  15.238  -132.513 1.00 35.00  ? 403 GLU A CB  1 
ATOM   2709 C CG  . GLU A 1 403 ? 80.158  15.028  -132.358 1.00 46.22  ? 403 GLU A CG  1 
ATOM   2710 C CD  . GLU A 1 403 ? 80.669  13.750  -133.048 1.00 62.65  ? 403 GLU A CD  1 
ATOM   2711 O OE1 . GLU A 1 403 ? 80.227  12.634  -132.685 1.00 69.60  ? 403 GLU A OE1 1 
ATOM   2712 O OE2 . GLU A 1 403 ? 81.533  13.865  -133.950 1.00 67.75  ? 403 GLU A OE2 1 
ATOM   2713 N N   . ILE A 1 404 ? 77.695  12.402  -130.875 1.00 37.24  ? 404 ILE A N   1 
ATOM   2714 C CA  . ILE A 1 404 ? 78.022  11.199  -130.119 1.00 32.88  ? 404 ILE A CA  1 
ATOM   2715 C C   . ILE A 1 404 ? 78.412  10.019  -131.008 1.00 32.67  ? 404 ILE A C   1 
ATOM   2716 O O   . ILE A 1 404 ? 79.028  9.070   -130.524 1.00 34.60  ? 404 ILE A O   1 
ATOM   2717 C CB  . ILE A 1 404 ? 76.875  10.818  -129.158 1.00 33.93  ? 404 ILE A CB  1 
ATOM   2718 C CG1 . ILE A 1 404 ? 75.558  10.620  -129.915 1.00 37.48  ? 404 ILE A CG1 1 
ATOM   2719 C CG2 . ILE A 1 404 ? 76.695  11.904  -128.100 1.00 28.37  ? 404 ILE A CG2 1 
ATOM   2720 C CD1 . ILE A 1 404 ? 74.421  10.145  -129.035 1.00 33.07  ? 404 ILE A CD1 1 
ATOM   2721 N N   . VAL A 1 405 ? 78.047  10.061  -132.289 1.00 32.41  ? 405 VAL A N   1 
ATOM   2722 C CA  . VAL A 1 405 ? 78.603  9.127   -133.273 1.00 32.61  ? 405 VAL A CA  1 
ATOM   2723 C C   . VAL A 1 405 ? 78.884  9.832   -134.599 1.00 33.80  ? 405 VAL A C   1 
ATOM   2724 O O   . VAL A 1 405 ? 77.959  10.302  -135.260 1.00 35.90  ? 405 VAL A O   1 
ATOM   2725 C CB  . VAL A 1 405 ? 77.670  7.936   -133.546 1.00 27.95  ? 405 VAL A CB  1 
ATOM   2726 C CG1 . VAL A 1 405 ? 78.314  6.986   -134.530 1.00 29.23  ? 405 VAL A CG1 1 
ATOM   2727 C CG2 . VAL A 1 405 ? 77.355  7.211   -132.278 1.00 26.86  ? 405 VAL A CG2 1 
ATOM   2728 N N   . GLY A 1 406 ? 80.160  9.913   -134.973 1.00 32.60  ? 406 GLY A N   1 
ATOM   2729 C CA  . GLY A 1 406 ? 80.552  10.420  -136.284 1.00 32.35  ? 406 GLY A CA  1 
ATOM   2730 C C   . GLY A 1 406 ? 80.247  9.405   -137.374 1.00 33.72  ? 406 GLY A C   1 
ATOM   2731 O O   . GLY A 1 406 ? 80.190  8.201   -137.109 1.00 31.72  ? 406 GLY A O   1 
ATOM   2732 N N   . CYS A 1 407 ? 80.033  9.891   -138.598 1.00 33.64  ? 407 CYS A N   1 
ATOM   2733 C CA  . CYS A 1 407 ? 79.805  9.014   -139.749 1.00 32.34  ? 407 CYS A CA  1 
ATOM   2734 C C   . CYS A 1 407 ? 80.189  9.683   -141.072 1.00 32.77  ? 407 CYS A C   1 
ATOM   2735 O O   . CYS A 1 407 ? 79.364  10.321  -141.724 1.00 33.38  ? 407 CYS A O   1 
ATOM   2736 C CB  . CYS A 1 407 ? 78.353  8.548   -139.792 1.00 29.79  ? 407 CYS A CB  1 
ATOM   2737 S SG  . CYS A 1 407 ? 78.129  7.095   -140.817 1.00 31.81  ? 407 CYS A SG  1 
ATOM   2738 N N   . ALA A 1 408 ? 81.452  9.517   -141.457 1.00 33.74  ? 408 ALA A N   1 
ATOM   2739 C CA  . ALA A 1 408 ? 82.005  10.161  -142.645 1.00 33.41  ? 408 ALA A CA  1 
ATOM   2740 C C   . ALA A 1 408 ? 81.919  9.238   -143.843 1.00 35.35  ? 408 ALA A C   1 
ATOM   2741 O O   . ALA A 1 408 ? 81.886  8.016   -143.691 1.00 36.07  ? 408 ALA A O   1 
ATOM   2742 C CB  . ALA A 1 408 ? 83.448  10.553  -142.408 1.00 29.96  ? 408 ALA A CB  1 
ATOM   2743 N N   . ASP A 1 409 ? 81.870  9.849   -145.027 1.00 35.16  ? 409 ASP A N   1 
ATOM   2744 C CA  . ASP A 1 409 ? 81.947  9.149   -146.304 1.00 35.56  ? 409 ASP A CA  1 
ATOM   2745 C C   . ASP A 1 409 ? 83.039  9.856   -147.091 1.00 36.25  ? 409 ASP A C   1 
ATOM   2746 O O   . ASP A 1 409 ? 82.898  11.030  -147.409 1.00 38.96  ? 409 ASP A O   1 
ATOM   2747 C CB  . ASP A 1 409 ? 80.607  9.234   -147.048 1.00 34.09  ? 409 ASP A CB  1 
ATOM   2748 C CG  . ASP A 1 409 ? 80.542  8.321   -148.274 1.00 33.54  ? 409 ASP A CG  1 
ATOM   2749 O OD1 . ASP A 1 409 ? 81.590  8.030   -148.890 1.00 24.35  ? 409 ASP A OD1 1 
ATOM   2750 O OD2 . ASP A 1 409 ? 79.422  7.893   -148.625 1.00 39.43  ? 409 ASP A OD2 1 
ATOM   2751 N N   . ARG A 1 410 ? 84.122  9.152   -147.399 1.00 36.63  ? 410 ARG A N   1 
ATOM   2752 C CA  . ARG A 1 410 ? 85.278  9.782   -148.025 1.00 40.16  ? 410 ARG A CA  1 
ATOM   2753 C C   . ARG A 1 410 ? 85.667  9.098   -149.317 1.00 38.76  ? 410 ARG A C   1 
ATOM   2754 O O   . ARG A 1 410 ? 85.521  7.889   -149.451 1.00 37.88  ? 410 ARG A O   1 
ATOM   2755 C CB  . ARG A 1 410 ? 86.476  9.757   -147.078 1.00 43.72  ? 410 ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 410 ? 86.190  10.296  -145.693 1.00 46.91  ? 410 ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 410 ? 87.471  10.459  -144.878 1.00 48.68  ? 410 ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 410 ? 87.194  11.052  -143.573 1.00 52.77  ? 410 ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 410 ? 86.886  12.335  -143.375 1.00 57.74  ? 410 ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 410 ? 86.846  13.205  -144.387 1.00 55.98  ? 410 ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 410 ? 86.632  12.760  -142.139 1.00 58.33  ? 410 ARG A NH2 1 
ATOM   2762 N N   . SER A 1 411 ? 86.166  9.895   -150.259 1.00 42.86  ? 411 SER A N   1 
ATOM   2763 C CA  . SER A 1 411 ? 86.801  9.394   -151.470 1.00 45.62  ? 411 SER A CA  1 
ATOM   2764 C C   . SER A 1 411 ? 88.311  9.481   -151.280 1.00 46.27  ? 411 SER A C   1 
ATOM   2765 O O   . SER A 1 411 ? 88.993  8.459   -151.302 1.00 45.19  ? 411 SER A O   1 
ATOM   2766 C CB  . SER A 1 411 ? 86.360  10.208  -152.692 1.00 46.58  ? 411 SER A CB  1 
ATOM   2767 O OG  . SER A 1 411 ? 84.948  10.235  -152.798 1.00 53.41  ? 411 SER A OG  1 
ATOM   2768 N N   . CYS A 1 412 ? 88.814  10.702  -151.070 1.00 48.88  ? 412 CYS A N   1 
ATOM   2769 C CA  . CYS A 1 412 ? 90.237  10.954  -150.799 1.00 48.31  ? 412 CYS A CA  1 
ATOM   2770 C C   . CYS A 1 412 ? 90.457  11.162  -149.308 1.00 48.28  ? 412 CYS A C   1 
ATOM   2771 O O   . CYS A 1 412 ? 89.819  12.017  -148.690 1.00 43.45  ? 412 CYS A O   1 
ATOM   2772 C CB  . CYS A 1 412 ? 90.724  12.195  -151.545 1.00 48.61  ? 412 CYS A CB  1 
ATOM   2773 S SG  . CYS A 1 412 ? 90.615  12.070  -153.334 1.00 56.58  ? 412 CYS A SG  1 
ATOM   2774 N N   . TYR A 1 413 ? 91.372  10.384  -148.740 1.00 51.15  ? 413 TYR A N   1 
ATOM   2775 C CA  . TYR A 1 413 ? 91.623  10.409  -147.301 1.00 49.69  ? 413 TYR A CA  1 
ATOM   2776 C C   . TYR A 1 413 ? 93.014  9.841   -146.999 1.00 47.68  ? 413 TYR A C   1 
ATOM   2777 O O   . TYR A 1 413 ? 93.819  9.650   -147.913 1.00 44.19  ? 413 TYR A O   1 
ATOM   2778 C CB  . TYR A 1 413 ? 90.510  9.647   -146.567 1.00 51.13  ? 413 TYR A CB  1 
ATOM   2779 C CG  . TYR A 1 413 ? 90.344  8.215   -147.018 1.00 50.29  ? 413 TYR A CG  1 
ATOM   2780 C CD1 . TYR A 1 413 ? 90.909  7.170   -146.299 1.00 52.49  ? 413 TYR A CD1 1 
ATOM   2781 C CD2 . TYR A 1 413 ? 89.625  7.909   -148.168 1.00 48.60  ? 413 TYR A CD2 1 
ATOM   2782 C CE1 . TYR A 1 413 ? 90.764  5.857   -146.711 1.00 51.77  ? 413 TYR A CE1 1 
ATOM   2783 C CE2 . TYR A 1 413 ? 89.474  6.603   -148.590 1.00 50.38  ? 413 TYR A CE2 1 
ATOM   2784 C CZ  . TYR A 1 413 ? 90.046  5.577   -147.856 1.00 52.18  ? 413 TYR A CZ  1 
ATOM   2785 O OH  . TYR A 1 413 ? 89.904  4.269   -148.261 1.00 52.18  ? 413 TYR A OH  1 
ATOM   2786 N N   . ASP A 1 414 ? 93.283  9.566   -145.724 1.00 48.72  ? 414 ASP A N   1 
ATOM   2787 C CA  . ASP A 1 414 ? 94.640  9.293   -145.236 1.00 49.90  ? 414 ASP A CA  1 
ATOM   2788 C C   . ASP A 1 414 ? 95.332  8.063   -145.825 1.00 50.62  ? 414 ASP A C   1 
ATOM   2789 O O   . ASP A 1 414 ? 96.567  8.006   -145.859 1.00 48.52  ? 414 ASP A O   1 
ATOM   2790 C CB  . ASP A 1 414 ? 94.623  9.172   -143.714 1.00 50.09  ? 414 ASP A CB  1 
ATOM   2791 C CG  . ASP A 1 414 ? 94.172  10.444  -143.042 1.00 53.84  ? 414 ASP A CG  1 
ATOM   2792 O OD1 . ASP A 1 414 ? 94.915  11.448  -143.102 1.00 54.24  ? 414 ASP A OD1 1 
ATOM   2793 O OD2 . ASP A 1 414 ? 93.067  10.440  -142.465 1.00 60.34  ? 414 ASP A OD2 1 
ATOM   2794 N N   . LEU A 1 415 ? 94.550  7.083   -146.276 1.00 50.93  ? 415 LEU A N   1 
ATOM   2795 C CA  . LEU A 1 415 ? 95.109  5.868   -146.881 1.00 49.66  ? 415 LEU A CA  1 
ATOM   2796 C C   . LEU A 1 415 ? 96.028  6.205   -148.063 1.00 48.54  ? 415 LEU A C   1 
ATOM   2797 O O   . LEU A 1 415 ? 97.121  5.646   -148.187 1.00 48.08  ? 415 LEU A O   1 
ATOM   2798 C CB  . LEU A 1 415 ? 93.983  4.921   -147.324 1.00 50.16  ? 415 LEU A CB  1 
ATOM   2799 C CG  . LEU A 1 415 ? 94.383  3.530   -147.837 1.00 52.26  ? 415 LEU A CG  1 
ATOM   2800 C CD1 . LEU A 1 415 ? 95.082  2.718   -146.747 1.00 51.24  ? 415 LEU A CD1 1 
ATOM   2801 C CD2 . LEU A 1 415 ? 93.164  2.785   -148.363 1.00 47.02  ? 415 LEU A CD2 1 
ATOM   2802 N N   . SER A 1 416 ? 95.577  7.126   -148.914 1.00 47.25  ? 416 SER A N   1 
ATOM   2803 C CA  . SER A 1 416 ? 96.356  7.593   -150.059 1.00 47.61  ? 416 SER A CA  1 
ATOM   2804 C C   . SER A 1 416 ? 97.653  8.270   -149.612 1.00 49.44  ? 416 SER A C   1 
ATOM   2805 O O   . SER A 1 416 ? 98.703  8.071   -150.223 1.00 51.35  ? 416 SER A O   1 
ATOM   2806 C CB  . SER A 1 416 ? 95.538  8.585   -150.893 1.00 48.88  ? 416 SER A CB  1 
ATOM   2807 O OG  . SER A 1 416 ? 94.171  8.217   -150.947 1.00 50.74  ? 416 SER A OG  1 
ATOM   2808 N N   . CYS A 1 417 ? 97.568  9.071   -148.549 1.00 47.84  ? 417 CYS A N   1 
ATOM   2809 C CA  . CYS A 1 417 ? 98.719  9.818   -148.039 1.00 44.25  ? 417 CYS A CA  1 
ATOM   2810 C C   . CYS A 1 417 ? 99.817  8.885   -147.565 1.00 40.90  ? 417 CYS A C   1 
ATOM   2811 O O   . CYS A 1 417 ? 100.947 8.965   -148.035 1.00 38.41  ? 417 CYS A O   1 
ATOM   2812 C CB  . CYS A 1 417 ? 98.299  10.739  -146.895 1.00 43.79  ? 417 CYS A CB  1 
ATOM   2813 S SG  . CYS A 1 417 ? 97.279  12.132  -147.417 1.00 49.46  ? 417 CYS A SG  1 
ATOM   2814 N N   . HIS A 1 418 ? 99.475  7.997   -146.639 1.00 42.98  ? 418 HIS A N   1 
ATOM   2815 C CA  . HIS A 1 418 ? 100.426 7.004   -146.128 1.00 44.22  ? 418 HIS A CA  1 
ATOM   2816 C C   . HIS A 1 418 ? 101.081 6.207   -147.257 1.00 45.10  ? 418 HIS A C   1 
ATOM   2817 O O   . HIS A 1 418 ? 102.293 5.961   -147.238 1.00 40.41  ? 418 HIS A O   1 
ATOM   2818 C CB  . HIS A 1 418 ? 99.734  6.032   -145.168 1.00 41.41  ? 418 HIS A CB  1 
ATOM   2819 C CG  . HIS A 1 418 ? 99.284  6.665   -143.889 1.00 39.82  ? 418 HIS A CG  1 
ATOM   2820 N ND1 . HIS A 1 418 ? 100.156 7.284   -143.019 1.00 38.25  ? 418 HIS A ND1 1 
ATOM   2821 C CD2 . HIS A 1 418 ? 98.056  6.765   -143.327 1.00 31.38  ? 418 HIS A CD2 1 
ATOM   2822 C CE1 . HIS A 1 418 ? 99.483  7.744   -141.980 1.00 38.53  ? 418 HIS A CE1 1 
ATOM   2823 N NE2 . HIS A 1 418 ? 98.208  7.441   -142.141 1.00 31.74  ? 418 HIS A NE2 1 
ATOM   2824 N N   . ALA A 1 419 ? 100.264 5.811   -148.233 1.00 45.14  ? 419 ALA A N   1 
ATOM   2825 C CA  . ALA A 1 419 ? 100.721 5.006   -149.357 1.00 43.01  ? 419 ALA A CA  1 
ATOM   2826 C C   . ALA A 1 419 ? 101.932 5.646   -150.037 1.00 44.21  ? 419 ALA A C   1 
ATOM   2827 O O   . ALA A 1 419 ? 102.994 5.026   -150.130 1.00 47.21  ? 419 ALA A O   1 
ATOM   2828 C CB  . ALA A 1 419 ? 99.585  4.795   -150.353 1.00 38.52  ? 419 ALA A CB  1 
ATOM   2829 N N   . ARG A 1 420 ? 101.774 6.889   -150.491 1.00 42.68  ? 420 ARG A N   1 
ATOM   2830 C CA  . ARG A 1 420 ? 102.862 7.615   -151.161 1.00 41.76  ? 420 ARG A CA  1 
ATOM   2831 C C   . ARG A 1 420 ? 103.918 8.125   -150.177 1.00 37.91  ? 420 ARG A C   1 
ATOM   2832 O O   . ARG A 1 420 ? 105.061 8.367   -150.561 1.00 36.66  ? 420 ARG A O   1 
ATOM   2833 C CB  . ARG A 1 420 ? 102.320 8.765   -152.030 1.00 45.54  ? 420 ARG A CB  1 
ATOM   2834 C CG  . ARG A 1 420 ? 101.607 9.889   -151.276 1.00 51.31  ? 420 ARG A CG  1 
ATOM   2835 C CD  . ARG A 1 420 ? 100.978 10.924  -152.221 1.00 47.35  ? 420 ARG A CD  1 
ATOM   2836 N NE  . ARG A 1 420 ? 99.848  11.608  -151.587 1.00 52.04  ? 420 ARG A NE  1 
ATOM   2837 C CZ  . ARG A 1 420 ? 99.947  12.555  -150.651 1.00 52.84  ? 420 ARG A CZ  1 
ATOM   2838 N NH1 . ARG A 1 420 ? 101.134 12.969  -150.215 1.00 57.13  ? 420 ARG A NH1 1 
ATOM   2839 N NH2 . ARG A 1 420 ? 98.844  13.094  -150.139 1.00 46.89  ? 420 ARG A NH2 1 
ATOM   2840 N N   . ALA A 1 421 ? 103.533 8.283   -148.914 1.00 38.19  ? 421 ALA A N   1 
ATOM   2841 C CA  . ALA A 1 421 ? 104.478 8.621   -147.845 1.00 37.45  ? 421 ALA A CA  1 
ATOM   2842 C C   . ALA A 1 421 ? 105.533 7.525   -147.664 1.00 34.90  ? 421 ALA A C   1 
ATOM   2843 O O   . ALA A 1 421 ? 106.732 7.803   -147.660 1.00 29.82  ? 421 ALA A O   1 
ATOM   2844 C CB  . ALA A 1 421 ? 103.726 8.854   -146.526 1.00 33.50  ? 421 ALA A CB  1 
ATOM   2845 N N   . THR A 1 422 ? 105.070 6.284   -147.521 1.00 37.64  ? 422 THR A N   1 
ATOM   2846 C CA  . THR A 1 422 ? 105.941 5.136   -147.246 1.00 36.99  ? 422 THR A CA  1 
ATOM   2847 C C   . THR A 1 422 ? 106.435 4.439   -148.515 1.00 37.04  ? 422 THR A C   1 
ATOM   2848 O O   . THR A 1 422 ? 107.362 3.632   -148.453 1.00 35.66  ? 422 THR A O   1 
ATOM   2849 C CB  . THR A 1 422 ? 105.210 4.085   -146.376 1.00 35.37  ? 422 THR A CB  1 
ATOM   2850 O OG1 . THR A 1 422 ? 104.080 3.572   -147.090 1.00 33.69  ? 422 THR A OG1 1 
ATOM   2851 C CG2 . THR A 1 422 ? 104.738 4.700   -145.060 1.00 25.98  ? 422 THR A CG2 1 
ATOM   2852 N N   . LYS A 1 423 ? 105.813 4.760   -149.652 1.00 40.27  ? 423 LYS A N   1 
ATOM   2853 C CA  . LYS A 1 423 ? 106.080 4.109   -150.947 1.00 40.89  ? 423 LYS A CA  1 
ATOM   2854 C C   . LYS A 1 423 ? 105.595 2.648   -150.975 1.00 40.85  ? 423 LYS A C   1 
ATOM   2855 O O   . LYS A 1 423 ? 106.140 1.820   -151.704 1.00 39.44  ? 423 LYS A O   1 
ATOM   2856 C CB  . LYS A 1 423 ? 107.569 4.196   -151.337 1.00 41.02  ? 423 LYS A CB  1 
ATOM   2857 C CG  . LYS A 1 423 ? 108.203 5.596   -151.244 1.00 40.65  ? 423 LYS A CG  1 
ATOM   2858 C CD  . LYS A 1 423 ? 109.724 5.519   -151.456 1.00 42.97  ? 423 LYS A CD  1 
ATOM   2859 C CE  . LYS A 1 423 ? 110.435 6.856   -151.237 1.00 42.38  ? 423 LYS A CE  1 
ATOM   2860 N NZ  . LYS A 1 423 ? 110.471 7.707   -152.460 1.00 38.83  ? 423 LYS A NZ  1 
ATOM   2861 N N   . VAL A 1 424 ? 104.569 2.348   -150.177 1.00 42.05  ? 424 VAL A N   1 
ATOM   2862 C CA  . VAL A 1 424 ? 103.943 1.025   -150.138 1.00 42.87  ? 424 VAL A CA  1 
ATOM   2863 C C   . VAL A 1 424 ? 102.522 1.157   -150.698 1.00 47.07  ? 424 VAL A C   1 
ATOM   2864 O O   . VAL A 1 424 ? 101.698 1.856   -150.107 1.00 47.16  ? 424 VAL A O   1 
ATOM   2865 C CB  . VAL A 1 424 ? 103.853 0.478   -148.686 1.00 40.55  ? 424 VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 424 ? 103.240 -0.920  -148.671 1.00 34.63  ? 424 VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 424 ? 105.222 0.480   -148.011 1.00 28.38  ? 424 VAL A CG2 1 
ATOM   2868 N N   . PRO A 1 425 ? 102.222 0.493   -151.832 1.00 50.00  ? 425 PRO A N   1 
ATOM   2869 C CA  . PRO A 1 425 ? 100.884 0.659   -152.410 1.00 48.38  ? 425 PRO A CA  1 
ATOM   2870 C C   . PRO A 1 425 ? 99.783  0.117   -151.496 1.00 48.77  ? 425 PRO A C   1 
ATOM   2871 O O   . PRO A 1 425 ? 99.903  -0.998  -150.979 1.00 47.54  ? 425 PRO A O   1 
ATOM   2872 C CB  . PRO A 1 425 ? 100.955 -0.140  -153.718 1.00 49.09  ? 425 PRO A CB  1 
ATOM   2873 C CG  . PRO A 1 425 ? 102.053 -1.113  -153.516 1.00 52.48  ? 425 PRO A CG  1 
ATOM   2874 C CD  . PRO A 1 425 ? 103.050 -0.434  -152.624 1.00 51.18  ? 425 PRO A CD  1 
ATOM   2875 N N   . LEU A 1 426 ? 98.742  0.926   -151.293 1.00 49.25  ? 426 LEU A N   1 
ATOM   2876 C CA  . LEU A 1 426 ? 97.581  0.565   -150.470 1.00 46.79  ? 426 LEU A CA  1 
ATOM   2877 C C   . LEU A 1 426 ? 96.313  0.690   -151.326 1.00 45.61  ? 426 LEU A C   1 
ATOM   2878 O O   . LEU A 1 426 ? 95.552  1.662   -151.229 1.00 42.64  ? 426 LEU A O   1 
ATOM   2879 C CB  . LEU A 1 426 ? 97.506  1.451   -149.214 1.00 45.81  ? 426 LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 426 ? 98.782  1.486   -148.358 1.00 39.69  ? 426 LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 426 ? 98.649  2.435   -147.169 1.00 28.80  ? 426 LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 426 ? 99.164  0.088   -147.895 1.00 27.87  ? 426 LEU A CD2 1 
ATOM   2883 N N   . VAL A 1 427 ? 96.115  -0.316  -152.174 1.00 44.19  ? 427 VAL A N   1 
ATOM   2884 C CA  . VAL A 1 427 ? 95.057  -0.320  -153.180 1.00 42.29  ? 427 VAL A CA  1 
ATOM   2885 C C   . VAL A 1 427 ? 94.511  -1.736  -153.342 1.00 40.50  ? 427 VAL A C   1 
ATOM   2886 O O   . VAL A 1 427 ? 95.103  -2.694  -152.844 1.00 40.60  ? 427 VAL A O   1 
ATOM   2887 C CB  . VAL A 1 427 ? 95.598  0.176   -154.538 1.00 41.19  ? 427 VAL A CB  1 
ATOM   2888 C CG1 . VAL A 1 427 ? 96.012  1.636   -154.442 1.00 39.88  ? 427 VAL A CG1 1 
ATOM   2889 C CG2 . VAL A 1 427 ? 96.778  -0.676  -154.990 1.00 33.04  ? 427 VAL A CG2 1 
ATOM   2890 N N   . ALA A 1 428 ? 93.389  -1.864  -154.040 1.00 37.74  ? 428 ALA A N   1 
ATOM   2891 C CA  . ALA A 1 428 ? 92.771  -3.164  -154.265 1.00 40.11  ? 428 ALA A CA  1 
ATOM   2892 C C   . ALA A 1 428 ? 92.781  -3.498  -155.755 1.00 43.39  ? 428 ALA A C   1 
ATOM   2893 O O   . ALA A 1 428 ? 92.499  -2.634  -156.586 1.00 50.21  ? 428 ALA A O   1 
ATOM   2894 C CB  . ALA A 1 428 ? 91.356  -3.157  -153.734 1.00 37.47  ? 428 ALA A CB  1 
ATOM   2895 N N   . GLU A 1 429 ? 93.106  -4.745  -156.092 1.00 42.04  ? 429 GLU A N   1 
ATOM   2896 C CA  . GLU A 1 429 ? 93.092  -5.186  -157.489 1.00 42.75  ? 429 GLU A CA  1 
ATOM   2897 C C   . GLU A 1 429 ? 91.733  -5.752  -157.882 1.00 40.46  ? 429 GLU A C   1 
ATOM   2898 O O   . GLU A 1 429 ? 90.985  -6.239  -157.036 1.00 40.02  ? 429 GLU A O   1 
ATOM   2899 C CB  . GLU A 1 429 ? 94.182  -6.226  -157.741 1.00 43.06  ? 429 GLU A CB  1 
ATOM   2900 C CG  . GLU A 1 429 ? 95.584  -5.653  -157.670 1.00 47.98  ? 429 GLU A CG  1 
ATOM   2901 C CD  . GLU A 1 429 ? 96.640  -6.632  -158.137 1.00 50.63  ? 429 GLU A CD  1 
ATOM   2902 O OE1 . GLU A 1 429 ? 97.564  -6.928  -157.349 1.00 61.14  ? 429 GLU A OE1 1 
ATOM   2903 O OE2 . GLU A 1 429 ? 96.547  -7.110  -159.287 1.00 57.34  ? 429 GLU A OE2 1 
ATOM   2904 N N   . LYS A 1 430 ? 91.422  -5.682  -159.171 1.00 40.36  ? 430 LYS A N   1 
ATOM   2905 C CA  . LYS A 1 430 ? 90.159  -6.192  -159.688 1.00 42.36  ? 430 LYS A CA  1 
ATOM   2906 C C   . LYS A 1 430 ? 90.375  -6.729  -161.105 1.00 45.46  ? 430 LYS A C   1 
ATOM   2907 O O   . LYS A 1 430 ? 90.822  -5.991  -161.984 1.00 45.45  ? 430 LYS A O   1 
ATOM   2908 C CB  . LYS A 1 430 ? 89.103  -5.085  -159.690 1.00 42.23  ? 430 LYS A CB  1 
ATOM   2909 C CG  . LYS A 1 430 ? 87.669  -5.582  -159.526 1.00 41.31  ? 430 LYS A CG  1 
ATOM   2910 C CD  . LYS A 1 430 ? 86.638  -4.577  -160.052 1.00 42.99  ? 430 LYS A CD  1 
ATOM   2911 C CE  . LYS A 1 430 ? 86.836  -3.171  -159.482 1.00 39.37  ? 430 LYS A CE  1 
ATOM   2912 N NZ  . LYS A 1 430 ? 85.704  -2.253  -159.813 1.00 37.14  ? 430 LYS A NZ  1 
ATOM   2913 N N   . PRO A 1 431 ? 90.063  -8.019  -161.332 1.00 47.25  ? 431 PRO A N   1 
ATOM   2914 C CA  . PRO A 1 431 ? 90.334  -8.648  -162.619 1.00 44.59  ? 431 PRO A CA  1 
ATOM   2915 C C   . PRO A 1 431 ? 89.312  -8.268  -163.685 1.00 45.13  ? 431 PRO A C   1 
ATOM   2916 O O   . PRO A 1 431 ? 89.542  -8.505  -164.875 1.00 43.91  ? 431 PRO A O   1 
ATOM   2917 C CB  . PRO A 1 431 ? 90.235  -10.137 -162.296 1.00 45.68  ? 431 PRO A CB  1 
ATOM   2918 C CG  . PRO A 1 431 ? 89.230  -10.205 -161.205 1.00 47.36  ? 431 PRO A CG  1 
ATOM   2919 C CD  . PRO A 1 431 ? 89.430  -8.960  -160.387 1.00 48.59  ? 431 PRO A CD  1 
ATOM   2920 N N   . TYR A 1 512 ? 92.423  -7.361  -167.648 1.00 56.54  ? 512 TYR A N   1 
ATOM   2921 C CA  . TYR A 1 512 ? 92.658  -6.078  -167.000 1.00 56.72  ? 512 TYR A CA  1 
ATOM   2922 C C   . TYR A 1 512 ? 92.889  -6.257  -165.498 1.00 57.64  ? 512 TYR A C   1 
ATOM   2923 O O   . TYR A 1 512 ? 92.446  -7.243  -164.905 1.00 59.16  ? 512 TYR A O   1 
ATOM   2924 C CB  . TYR A 1 512 ? 91.481  -5.119  -167.262 1.00 57.46  ? 512 TYR A CB  1 
ATOM   2925 C CG  . TYR A 1 512 ? 90.258  -5.304  -166.365 1.00 59.31  ? 512 TYR A CG  1 
ATOM   2926 C CD1 . TYR A 1 512 ? 90.206  -4.722  -165.096 1.00 61.63  ? 512 TYR A CD1 1 
ATOM   2927 C CD2 . TYR A 1 512 ? 89.145  -6.030  -166.796 1.00 57.72  ? 512 TYR A CD2 1 
ATOM   2928 C CE1 . TYR A 1 512 ? 89.093  -4.871  -164.275 1.00 58.32  ? 512 TYR A CE1 1 
ATOM   2929 C CE2 . TYR A 1 512 ? 88.022  -6.183  -165.979 1.00 56.43  ? 512 TYR A CE2 1 
ATOM   2930 C CZ  . TYR A 1 512 ? 88.008  -5.598  -164.720 1.00 58.24  ? 512 TYR A CZ  1 
ATOM   2931 O OH  . TYR A 1 512 ? 86.919  -5.738  -163.893 1.00 58.52  ? 512 TYR A OH  1 
ATOM   2932 N N   . VAL A 1 513 ? 93.592  -5.298  -164.899 1.00 56.42  ? 513 VAL A N   1 
ATOM   2933 C CA  . VAL A 1 513 ? 93.823  -5.268  -163.455 1.00 55.03  ? 513 VAL A CA  1 
ATOM   2934 C C   . VAL A 1 513 ? 93.542  -3.855  -162.940 1.00 55.36  ? 513 VAL A C   1 
ATOM   2935 O O   . VAL A 1 513 ? 94.432  -3.002  -162.937 1.00 56.56  ? 513 VAL A O   1 
ATOM   2936 C CB  . VAL A 1 513 ? 95.274  -5.666  -163.099 1.00 54.82  ? 513 VAL A CB  1 
ATOM   2937 C CG1 . VAL A 1 513 ? 95.471  -5.657  -161.587 1.00 51.28  ? 513 VAL A CG1 1 
ATOM   2938 C CG2 . VAL A 1 513 ? 95.616  -7.030  -163.681 1.00 51.74  ? 513 VAL A CG2 1 
ATOM   2939 N N   . GLU A 1 514 ? 92.303  -3.611  -162.514 1.00 53.41  ? 514 GLU A N   1 
ATOM   2940 C CA  . GLU A 1 514 ? 91.898  -2.276  -162.076 1.00 51.45  ? 514 GLU A CA  1 
ATOM   2941 C C   . GLU A 1 514 ? 92.394  -1.978  -160.666 1.00 49.45  ? 514 GLU A C   1 
ATOM   2942 O O   . GLU A 1 514 ? 91.989  -2.629  -159.704 1.00 50.88  ? 514 GLU A O   1 
ATOM   2943 C CB  . GLU A 1 514 ? 90.374  -2.105  -162.146 1.00 52.24  ? 514 GLU A CB  1 
ATOM   2944 C CG  . GLU A 1 514 ? 89.892  -0.697  -161.752 1.00 53.69  ? 514 GLU A CG  1 
ATOM   2945 C CD  . GLU A 1 514 ? 88.456  -0.399  -162.172 1.00 52.62  ? 514 GLU A CD  1 
ATOM   2946 O OE1 . GLU A 1 514 ? 88.063  -0.760  -163.305 1.00 48.41  ? 514 GLU A OE1 1 
ATOM   2947 O OE2 . GLU A 1 514 ? 87.723  0.217   -161.366 1.00 50.35  ? 514 GLU A OE2 1 
ATOM   2948 N N   . GLU A 1 515 ? 93.283  -0.994  -160.559 1.00 48.24  ? 515 GLU A N   1 
ATOM   2949 C CA  . GLU A 1 515 ? 93.696  -0.458  -159.271 1.00 46.58  ? 515 GLU A CA  1 
ATOM   2950 C C   . GLU A 1 515 ? 92.511  0.313   -158.711 1.00 44.93  ? 515 GLU A C   1 
ATOM   2951 O O   . GLU A 1 515 ? 92.045  1.270   -159.331 1.00 47.82  ? 515 GLU A O   1 
ATOM   2952 C CB  . GLU A 1 515 ? 94.899  0.479   -159.437 1.00 46.89  ? 515 GLU A CB  1 
ATOM   2953 C CG  . GLU A 1 515 ? 95.540  0.936   -158.128 1.00 51.22  ? 515 GLU A CG  1 
ATOM   2954 C CD  . GLU A 1 515 ? 96.292  2.257   -158.261 1.00 54.73  ? 515 GLU A CD  1 
ATOM   2955 O OE1 . GLU A 1 515 ? 95.634  3.321   -158.300 1.00 61.07  ? 515 GLU A OE1 1 
ATOM   2956 O OE2 . GLU A 1 515 ? 97.542  2.233   -158.310 1.00 60.80  ? 515 GLU A OE2 1 
ATOM   2957 N N   . VAL A 1 516 ? 92.014  -0.115  -157.555 1.00 41.34  ? 516 VAL A N   1 
ATOM   2958 C CA  . VAL A 1 516 ? 90.879  0.534   -156.917 1.00 37.71  ? 516 VAL A CA  1 
ATOM   2959 C C   . VAL A 1 516 ? 91.334  1.184   -155.629 1.00 35.22  ? 516 VAL A C   1 
ATOM   2960 O O   . VAL A 1 516 ? 91.918  0.519   -154.778 1.00 36.18  ? 516 VAL A O   1 
ATOM   2961 C CB  . VAL A 1 516 ? 89.763  -0.476  -156.590 1.00 36.44  ? 516 VAL A CB  1 
ATOM   2962 C CG1 . VAL A 1 516 ? 88.574  0.220   -155.923 1.00 31.47  ? 516 VAL A CG1 1 
ATOM   2963 C CG2 . VAL A 1 516 ? 89.322  -1.199  -157.854 1.00 35.47  ? 516 VAL A CG2 1 
ATOM   2964 N N   . VAL A 1 517 ? 91.084  2.487   -155.511 1.00 36.90  ? 517 VAL A N   1 
ATOM   2965 C CA  . VAL A 1 517 ? 91.217  3.207   -154.238 1.00 36.03  ? 517 VAL A CA  1 
ATOM   2966 C C   . VAL A 1 517 ? 89.829  3.255   -153.598 1.00 36.54  ? 517 VAL A C   1 
ATOM   2967 O O   . VAL A 1 517 ? 88.956  3.997   -154.064 1.00 36.89  ? 517 VAL A O   1 
ATOM   2968 C CB  . VAL A 1 517 ? 91.794  4.649   -154.392 1.00 33.26  ? 517 VAL A CB  1 
ATOM   2969 C CG1 . VAL A 1 517 ? 93.149  4.750   -153.710 1.00 24.21  ? 517 VAL A CG1 1 
ATOM   2970 C CG2 . VAL A 1 517 ? 91.864  5.088   -155.871 1.00 28.57  ? 517 VAL A CG2 1 
ATOM   2971 N N   . PRO A 1 518 ? 89.608  2.452   -152.541 1.00 35.21  ? 518 PRO A N   1 
ATOM   2972 C CA  . PRO A 1 518 ? 88.254  2.350   -152.005 1.00 35.85  ? 518 PRO A CA  1 
ATOM   2973 C C   . PRO A 1 518 ? 87.788  3.621   -151.327 1.00 34.57  ? 518 PRO A C   1 
ATOM   2974 O O   . PRO A 1 518 ? 88.602  4.370   -150.795 1.00 31.02  ? 518 PRO A O   1 
ATOM   2975 C CB  . PRO A 1 518 ? 88.357  1.224   -150.962 1.00 35.91  ? 518 PRO A CB  1 
ATOM   2976 C CG  . PRO A 1 518 ? 89.664  0.567   -151.202 1.00 37.35  ? 518 PRO A CG  1 
ATOM   2977 C CD  . PRO A 1 518 ? 90.552  1.609   -151.789 1.00 34.62  ? 518 PRO A CD  1 
ATOM   2978 N N   . ASN A 1 519 ? 86.482  3.861   -151.372 1.00 36.66  ? 519 ASN A N   1 
ATOM   2979 C CA  . ASN A 1 519 ? 85.859  4.843   -150.502 1.00 36.90  ? 519 ASN A CA  1 
ATOM   2980 C C   . ASN A 1 519 ? 85.762  4.223   -149.118 1.00 36.39  ? 519 ASN A C   1 
ATOM   2981 O O   . ASN A 1 519 ? 85.886  3.001   -148.972 1.00 36.45  ? 519 ASN A O   1 
ATOM   2982 C CB  . ASN A 1 519 ? 84.456  5.213   -150.998 1.00 37.37  ? 519 ASN A CB  1 
ATOM   2983 C CG  . ASN A 1 519 ? 84.471  5.954   -152.327 1.00 35.55  ? 519 ASN A CG  1 
ATOM   2984 O OD1 . ASN A 1 519 ? 85.455  6.605   -152.688 1.00 37.94  ? 519 ASN A OD1 1 
ATOM   2985 N ND2 . ASN A 1 519 ? 83.367  5.859   -153.061 1.00 24.26  ? 519 ASN A ND2 1 
ATOM   2986 N N   . VAL A 1 520 ? 85.556  5.061   -148.107 1.00 34.74  ? 520 VAL A N   1 
ATOM   2987 C CA  . VAL A 1 520 ? 85.259  4.566   -146.766 1.00 37.06  ? 520 VAL A CA  1 
ATOM   2988 C C   . VAL A 1 520 ? 84.059  5.267   -146.149 1.00 37.72  ? 520 VAL A C   1 
ATOM   2989 O O   . VAL A 1 520 ? 83.872  6.476   -146.312 1.00 35.72  ? 520 VAL A O   1 
ATOM   2990 C CB  . VAL A 1 520 ? 86.454  4.702   -145.798 1.00 35.43  ? 520 VAL A CB  1 
ATOM   2991 C CG1 . VAL A 1 520 ? 87.513  3.695   -146.136 1.00 42.14  ? 520 VAL A CG1 1 
ATOM   2992 C CG2 . VAL A 1 520 ? 87.024  6.106   -145.829 1.00 42.60  ? 520 VAL A CG2 1 
ATOM   2993 N N   . ILE A 1 521 ? 83.239  4.480   -145.464 1.00 37.74  ? 521 ILE A N   1 
ATOM   2994 C CA  . ILE A 1 521 ? 82.279  5.002   -144.509 1.00 35.63  ? 521 ILE A CA  1 
ATOM   2995 C C   . ILE A 1 521 ? 82.955  4.842   -143.138 1.00 32.95  ? 521 ILE A C   1 
ATOM   2996 O O   . ILE A 1 521 ? 83.531  3.790   -142.850 1.00 30.02  ? 521 ILE A O   1 
ATOM   2997 C CB  . ILE A 1 521 ? 80.933  4.250   -144.586 1.00 33.12  ? 521 ILE A CB  1 
ATOM   2998 C CG1 . ILE A 1 521 ? 80.189  4.616   -145.867 1.00 29.84  ? 521 ILE A CG1 1 
ATOM   2999 C CG2 . ILE A 1 521 ? 80.050  4.609   -143.415 1.00 39.53  ? 521 ILE A CG2 1 
ATOM   3000 C CD1 . ILE A 1 521 ? 80.991  4.418   -147.126 1.00 37.21  ? 521 ILE A CD1 1 
ATOM   3001 N N   . GLU A 1 522 ? 82.908  5.883   -142.309 1.00 30.79  ? 522 GLU A N   1 
ATOM   3002 C CA  . GLU A 1 522 ? 83.649  5.889   -141.043 1.00 35.09  ? 522 GLU A CA  1 
ATOM   3003 C C   . GLU A 1 522 ? 82.759  6.119   -139.809 1.00 35.01  ? 522 GLU A C   1 
ATOM   3004 O O   . GLU A 1 522 ? 82.766  7.204   -139.219 1.00 36.45  ? 522 GLU A O   1 
ATOM   3005 C CB  . GLU A 1 522 ? 84.749  6.953   -141.090 1.00 35.63  ? 522 GLU A CB  1 
ATOM   3006 C CG  . GLU A 1 522 ? 85.725  6.797   -142.244 1.00 41.83  ? 522 GLU A CG  1 
ATOM   3007 C CD  . GLU A 1 522 ? 86.895  7.767   -142.155 1.00 45.45  ? 522 GLU A CD  1 
ATOM   3008 O OE1 . GLU A 1 522 ? 86.652  8.968   -141.914 1.00 57.28  ? 522 GLU A OE1 1 
ATOM   3009 O OE2 . GLU A 1 522 ? 88.054  7.334   -142.324 1.00 50.59  ? 522 GLU A OE2 1 
ATOM   3010 N N   . PRO A 1 523 ? 81.978  5.100   -139.415 1.00 31.31  ? 523 PRO A N   1 
ATOM   3011 C CA  . PRO A 1 523 ? 81.244  5.184   -138.156 1.00 31.86  ? 523 PRO A CA  1 
ATOM   3012 C C   . PRO A 1 523 ? 82.184  5.292   -136.950 1.00 31.35  ? 523 PRO A C   1 
ATOM   3013 O O   . PRO A 1 523 ? 83.025  4.417   -136.742 1.00 31.14  ? 523 PRO A O   1 
ATOM   3014 C CB  . PRO A 1 523 ? 80.464  3.866   -138.120 1.00 33.08  ? 523 PRO A CB  1 
ATOM   3015 C CG  . PRO A 1 523 ? 80.420  3.403   -139.533 1.00 29.65  ? 523 PRO A CG  1 
ATOM   3016 C CD  . PRO A 1 523 ? 81.703  3.841   -140.124 1.00 28.96  ? 523 PRO A CD  1 
ATOM   3017 N N   . SER A 1 524 ? 82.039  6.359   -136.172 1.00 28.82  ? 524 SER A N   1 
ATOM   3018 C CA  . SER A 1 524 ? 82.960  6.649   -135.082 1.00 30.87  ? 524 SER A CA  1 
ATOM   3019 C C   . SER A 1 524 ? 82.188  6.870   -133.795 1.00 29.84  ? 524 SER A C   1 
ATOM   3020 O O   . SER A 1 524 ? 81.523  7.886   -133.634 1.00 31.68  ? 524 SER A O   1 
ATOM   3021 C CB  . SER A 1 524 ? 83.790  7.887   -135.418 1.00 29.32  ? 524 SER A CB  1 
ATOM   3022 O OG  . SER A 1 524 ? 84.731  8.165   -134.398 1.00 37.26  ? 524 SER A OG  1 
ATOM   3023 N N   . PHE A 1 525 ? 82.290  5.921   -132.874 1.00 33.65  ? 525 PHE A N   1 
ATOM   3024 C CA  . PHE A 1 525 ? 81.472  5.938   -131.662 1.00 38.91  ? 525 PHE A CA  1 
ATOM   3025 C C   . PHE A 1 525 ? 82.251  6.413   -130.438 1.00 41.31  ? 525 PHE A C   1 
ATOM   3026 O O   . PHE A 1 525 ? 83.225  5.780   -130.020 1.00 44.00  ? 525 PHE A O   1 
ATOM   3027 C CB  . PHE A 1 525 ? 80.894  4.548   -131.397 1.00 39.95  ? 525 PHE A CB  1 
ATOM   3028 C CG  . PHE A 1 525 ? 80.016  4.039   -132.504 1.00 38.53  ? 525 PHE A CG  1 
ATOM   3029 C CD1 . PHE A 1 525 ? 80.570  3.514   -133.664 1.00 38.84  ? 525 PHE A CD1 1 
ATOM   3030 C CD2 . PHE A 1 525 ? 78.638  4.086   -132.389 1.00 31.09  ? 525 PHE A CD2 1 
ATOM   3031 C CE1 . PHE A 1 525 ? 79.764  3.047   -134.687 1.00 38.27  ? 525 PHE A CE1 1 
ATOM   3032 C CE2 . PHE A 1 525 ? 77.833  3.619   -133.408 1.00 35.36  ? 525 PHE A CE2 1 
ATOM   3033 C CZ  . PHE A 1 525 ? 78.399  3.097   -134.558 1.00 34.97  ? 525 PHE A CZ  1 
ATOM   3034 N N   . GLY A 1 526 ? 81.805  7.530   -129.871 1.00 39.79  ? 526 GLY A N   1 
ATOM   3035 C CA  . GLY A 1 526 ? 82.382  8.070   -128.651 1.00 38.69  ? 526 GLY A CA  1 
ATOM   3036 C C   . GLY A 1 526 ? 81.617  7.491   -127.494 1.00 38.28  ? 526 GLY A C   1 
ATOM   3037 O O   . GLY A 1 526 ? 80.607  8.049   -127.074 1.00 42.74  ? 526 GLY A O   1 
ATOM   3038 N N   . LEU A 1 527 ? 82.108  6.372   -126.976 1.00 38.15  ? 527 LEU A N   1 
ATOM   3039 C CA  . LEU A 1 527 ? 81.346  5.557   -126.038 1.00 38.10  ? 527 LEU A CA  1 
ATOM   3040 C C   . LEU A 1 527 ? 80.934  6.359   -124.824 1.00 36.77  ? 527 LEU A C   1 
ATOM   3041 O O   . LEU A 1 527 ? 79.788  6.289   -124.389 1.00 38.83  ? 527 LEU A O   1 
ATOM   3042 C CB  . LEU A 1 527 ? 82.154  4.335   -125.615 1.00 38.11  ? 527 LEU A CB  1 
ATOM   3043 C CG  . LEU A 1 527 ? 82.548  3.385   -126.758 1.00 44.84  ? 527 LEU A CG  1 
ATOM   3044 C CD1 . LEU A 1 527 ? 83.443  2.264   -126.244 1.00 42.97  ? 527 LEU A CD1 1 
ATOM   3045 C CD2 . LEU A 1 527 ? 81.312  2.825   -127.468 1.00 33.48  ? 527 LEU A CD2 1 
ATOM   3046 N N   . GLY A 1 528 ? 81.865  7.148   -124.302 1.00 40.61  ? 528 GLY A N   1 
ATOM   3047 C CA  . GLY A 1 528 ? 81.596  7.995   -123.139 1.00 41.43  ? 528 GLY A CA  1 
ATOM   3048 C C   . GLY A 1 528 ? 80.342  8.832   -123.275 1.00 39.54  ? 528 GLY A C   1 
ATOM   3049 O O   . GLY A 1 528 ? 79.456  8.781   -122.425 1.00 42.37  ? 528 GLY A O   1 
ATOM   3050 N N   . ARG A 1 529 ? 80.261  9.591   -124.359 1.00 35.95  ? 529 ARG A N   1 
ATOM   3051 C CA  . ARG A 1 529 ? 79.112  10.455  -124.595 1.00 36.70  ? 529 ARG A CA  1 
ATOM   3052 C C   . ARG A 1 529 ? 77.803  9.691   -124.826 1.00 33.56  ? 529 ARG A C   1 
ATOM   3053 O O   . ARG A 1 529 ? 76.726  10.177  -124.477 1.00 30.73  ? 529 ARG A O   1 
ATOM   3054 C CB  . ARG A 1 529 ? 79.372  11.355  -125.797 1.00 38.91  ? 529 ARG A CB  1 
ATOM   3055 C CG  . ARG A 1 529 ? 80.499  12.343  -125.626 1.00 34.82  ? 529 ARG A CG  1 
ATOM   3056 C CD  . ARG A 1 529 ? 80.346  13.449  -126.644 1.00 38.25  ? 529 ARG A CD  1 
ATOM   3057 N NE  . ARG A 1 529 ? 81.460  14.380  -126.626 1.00 37.54  ? 529 ARG A NE  1 
ATOM   3058 C CZ  . ARG A 1 529 ? 81.514  15.493  -127.347 1.00 44.71  ? 529 ARG A CZ  1 
ATOM   3059 N NH1 . ARG A 1 529 ? 80.518  15.824  -128.159 1.00 54.15  ? 529 ARG A NH1 1 
ATOM   3060 N NH2 . ARG A 1 529 ? 82.576  16.285  -127.260 1.00 56.43  ? 529 ARG A NH2 1 
ATOM   3061 N N   . ILE A 1 530 ? 77.884  8.516   -125.439 1.00 29.87  ? 530 ILE A N   1 
ATOM   3062 C CA  . ILE A 1 530 ? 76.692  7.699   -125.613 1.00 33.96  ? 530 ILE A CA  1 
ATOM   3063 C C   . ILE A 1 530 ? 76.168  7.386   -124.214 1.00 35.74  ? 530 ILE A C   1 
ATOM   3064 O O   . ILE A 1 530 ? 75.012  7.668   -123.877 1.00 36.43  ? 530 ILE A O   1 
ATOM   3065 C CB  . ILE A 1 530 ? 76.985  6.385   -126.377 1.00 33.22  ? 530 ILE A CB  1 
ATOM   3066 C CG1 . ILE A 1 530 ? 77.481  6.681   -127.802 1.00 35.28  ? 530 ILE A CG1 1 
ATOM   3067 C CG2 . ILE A 1 530 ? 75.727  5.515   -126.430 1.00 22.95  ? 530 ILE A CG2 1 
ATOM   3068 C CD1 . ILE A 1 530 ? 78.166  5.502   -128.483 1.00 32.44  ? 530 ILE A CD1 1 
ATOM   3069 N N   . MET A 1 531 ? 77.064  6.842   -123.400 1.00 33.51  ? 531 MET A N   1 
ATOM   3070 C CA  . MET A 1 531 ? 76.781  6.494   -122.019 1.00 34.32  ? 531 MET A CA  1 
ATOM   3071 C C   . MET A 1 531 ? 76.157  7.661   -121.244 1.00 32.21  ? 531 MET A C   1 
ATOM   3072 O O   . MET A 1 531 ? 75.177  7.478   -120.521 1.00 34.67  ? 531 MET A O   1 
ATOM   3073 C CB  . MET A 1 531 ? 78.074  6.029   -121.336 1.00 33.34  ? 531 MET A CB  1 
ATOM   3074 C CG  . MET A 1 531 ? 77.870  4.950   -120.295 1.00 41.17  ? 531 MET A CG  1 
ATOM   3075 S SD  . MET A 1 531 ? 79.400  4.087   -119.901 1.00 49.91  ? 531 MET A SD  1 
ATOM   3076 C CE  . MET A 1 531 ? 79.978  5.047   -118.507 1.00 38.90  ? 531 MET A CE  1 
ATOM   3077 N N   . TYR A 1 532 ? 76.713  8.860   -121.396 1.00 31.28  ? 532 TYR A N   1 
ATOM   3078 C CA  . TYR A 1 532 ? 76.152  10.030  -120.714 1.00 33.63  ? 532 TYR A CA  1 
ATOM   3079 C C   . TYR A 1 532 ? 74.755  10.362  -121.225 1.00 34.96  ? 532 TYR A C   1 
ATOM   3080 O O   . TYR A 1 532 ? 73.849  10.613  -120.427 1.00 37.66  ? 532 TYR A O   1 
ATOM   3081 C CB  . TYR A 1 532 ? 77.046  11.262  -120.858 1.00 34.54  ? 532 TYR A CB  1 
ATOM   3082 C CG  . TYR A 1 532 ? 76.554  12.430  -120.035 1.00 29.96  ? 532 TYR A CG  1 
ATOM   3083 C CD1 . TYR A 1 532 ? 76.827  12.511  -118.672 1.00 33.29  ? 532 TYR A CD1 1 
ATOM   3084 C CD2 . TYR A 1 532 ? 75.796  13.439  -120.612 1.00 28.87  ? 532 TYR A CD2 1 
ATOM   3085 C CE1 . TYR A 1 532 ? 76.364  13.584  -117.904 1.00 37.33  ? 532 TYR A CE1 1 
ATOM   3086 C CE2 . TYR A 1 532 ? 75.328  14.517  -119.859 1.00 33.81  ? 532 TYR A CE2 1 
ATOM   3087 C CZ  . TYR A 1 532 ? 75.610  14.586  -118.506 1.00 38.61  ? 532 TYR A CZ  1 
ATOM   3088 O OH  . TYR A 1 532 ? 75.142  15.657  -117.765 1.00 31.40  ? 532 TYR A OH  1 
ATOM   3089 N N   . THR A 1 533 ? 74.582  10.364  -122.547 1.00 32.25  ? 533 THR A N   1 
ATOM   3090 C CA  . THR A 1 533 ? 73.275  10.629  -123.140 1.00 31.97  ? 533 THR A CA  1 
ATOM   3091 C C   . THR A 1 533 ? 72.243  9.673   -122.578 1.00 33.46  ? 533 THR A C   1 
ATOM   3092 O O   . THR A 1 533 ? 71.095  10.064  -122.334 1.00 32.42  ? 533 THR A O   1 
ATOM   3093 C CB  . THR A 1 533 ? 73.275  10.467  -124.658 1.00 33.18  ? 533 THR A CB  1 
ATOM   3094 O OG1 . THR A 1 533 ? 74.226  11.365  -125.239 1.00 38.21  ? 533 THR A OG1 1 
ATOM   3095 C CG2 . THR A 1 533 ? 71.889  10.766  -125.217 1.00 28.84  ? 533 THR A CG2 1 
ATOM   3096 N N   . VAL A 1 534 ? 72.658  8.422   -122.376 1.00 32.74  ? 534 VAL A N   1 
ATOM   3097 C CA  . VAL A 1 534 ? 71.780  7.423   -121.774 1.00 31.49  ? 534 VAL A CA  1 
ATOM   3098 C C   . VAL A 1 534 ? 71.440  7.805   -120.333 1.00 32.65  ? 534 VAL A C   1 
ATOM   3099 O O   . VAL A 1 534 ? 70.287  7.666   -119.914 1.00 33.93  ? 534 VAL A O   1 
ATOM   3100 C CB  . VAL A 1 534 ? 72.382  6.004   -121.816 1.00 27.32  ? 534 VAL A CB  1 
ATOM   3101 C CG1 . VAL A 1 534 ? 71.489  5.043   -121.061 1.00 18.72  ? 534 VAL A CG1 1 
ATOM   3102 C CG2 . VAL A 1 534 ? 72.555  5.540   -123.253 1.00 14.36  ? 534 VAL A CG2 1 
ATOM   3103 N N   . PHE A 1 535 ? 72.424  8.303   -119.584 1.00 30.86  ? 535 PHE A N   1 
ATOM   3104 C CA  . PHE A 1 535 ? 72.159  8.729   -118.211 1.00 32.00  ? 535 PHE A CA  1 
ATOM   3105 C C   . PHE A 1 535 ? 71.095  9.802   -118.197 1.00 30.97  ? 535 PHE A C   1 
ATOM   3106 O O   . PHE A 1 535 ? 70.140  9.709   -117.435 1.00 33.76  ? 535 PHE A O   1 
ATOM   3107 C CB  . PHE A 1 535 ? 73.415  9.240   -117.491 1.00 32.65  ? 535 PHE A CB  1 
ATOM   3108 C CG  . PHE A 1 535 ? 74.453  8.176   -117.218 1.00 30.42  ? 535 PHE A CG  1 
ATOM   3109 C CD1 . PHE A 1 535 ? 74.090  6.898   -116.820 1.00 32.68  ? 535 PHE A CD1 1 
ATOM   3110 C CD2 . PHE A 1 535 ? 75.799  8.469   -117.328 1.00 30.56  ? 535 PHE A CD2 1 
ATOM   3111 C CE1 . PHE A 1 535 ? 75.049  5.933   -116.570 1.00 31.18  ? 535 PHE A CE1 1 
ATOM   3112 C CE2 . PHE A 1 535 ? 76.762  7.511   -117.067 1.00 30.34  ? 535 PHE A CE2 1 
ATOM   3113 C CZ  . PHE A 1 535 ? 76.387  6.245   -116.692 1.00 32.95  ? 535 PHE A CZ  1 
ATOM   3114 N N   . GLU A 1 536 ? 71.239  10.808  -119.052 1.00 30.81  ? 536 GLU A N   1 
ATOM   3115 C CA  . GLU A 1 536 ? 70.284  11.911  -119.054 1.00 32.37  ? 536 GLU A CA  1 
ATOM   3116 C C   . GLU A 1 536 ? 68.910  11.485  -119.552 1.00 31.45  ? 536 GLU A C   1 
ATOM   3117 O O   . GLU A 1 536 ? 67.892  11.974  -119.062 1.00 34.41  ? 536 GLU A O   1 
ATOM   3118 C CB  . GLU A 1 536 ? 70.792  13.086  -119.885 1.00 33.31  ? 536 GLU A CB  1 
ATOM   3119 C CG  . GLU A 1 536 ? 71.917  13.865  -119.215 1.00 32.89  ? 536 GLU A CG  1 
ATOM   3120 C CD  . GLU A 1 536 ? 71.874  15.366  -119.498 1.00 35.20  ? 536 GLU A CD  1 
ATOM   3121 O OE1 . GLU A 1 536 ? 70.985  15.835  -120.257 1.00 22.87  ? 536 GLU A OE1 1 
ATOM   3122 O OE2 . GLU A 1 536 ? 72.742  16.077  -118.944 1.00 36.25  ? 536 GLU A OE2 1 
ATOM   3123 N N   . HIS A 1 537 ? 68.882  10.570  -120.511 1.00 27.78  ? 537 HIS A N   1 
ATOM   3124 C CA  . HIS A 1 537 ? 67.624  10.159  -121.119 1.00 29.94  ? 537 HIS A CA  1 
ATOM   3125 C C   . HIS A 1 537 ? 66.837  9.162   -120.257 1.00 31.91  ? 537 HIS A C   1 
ATOM   3126 O O   . HIS A 1 537 ? 65.604  9.168   -120.279 1.00 35.38  ? 537 HIS A O   1 
ATOM   3127 C CB  . HIS A 1 537 ? 67.882  9.620   -122.528 1.00 30.91  ? 537 HIS A CB  1 
ATOM   3128 C CG  . HIS A 1 537 ? 68.207  10.690  -123.528 1.00 34.14  ? 537 HIS A CG  1 
ATOM   3129 N ND1 . HIS A 1 537 ? 68.214  10.464  -124.887 1.00 33.26  ? 537 HIS A ND1 1 
ATOM   3130 C CD2 . HIS A 1 537 ? 68.505  12.002  -123.366 1.00 33.15  ? 537 HIS A CD2 1 
ATOM   3131 C CE1 . HIS A 1 537 ? 68.518  11.585  -125.517 1.00 33.42  ? 537 HIS A CE1 1 
ATOM   3132 N NE2 . HIS A 1 537 ? 68.698  12.534  -124.617 1.00 23.20  ? 537 HIS A NE2 1 
ATOM   3133 N N   . THR A 1 538 ? 67.529  8.334   -119.477 1.00 31.43  ? 538 THR A N   1 
ATOM   3134 C CA  . THR A 1 538 ? 66.846  7.344   -118.630 1.00 31.57  ? 538 THR A CA  1 
ATOM   3135 C C   . THR A 1 538 ? 66.616  7.767   -117.164 1.00 32.29  ? 538 THR A C   1 
ATOM   3136 O O   . THR A 1 538 ? 65.869  7.106   -116.453 1.00 29.88  ? 538 THR A O   1 
ATOM   3137 C CB  . THR A 1 538 ? 67.602  6.017   -118.622 1.00 28.20  ? 538 THR A CB  1 
ATOM   3138 O OG1 . THR A 1 538 ? 68.946  6.251   -118.192 1.00 40.18  ? 538 THR A OG1 1 
ATOM   3139 C CG2 . THR A 1 538 ? 67.599  5.387   -120.007 1.00 16.38  ? 538 THR A CG2 1 
ATOM   3140 N N   . PHE A 1 539 ? 67.251  8.850   -116.718 1.00 31.79  ? 539 PHE A N   1 
ATOM   3141 C CA  . PHE A 1 539 ? 67.084  9.349   -115.342 1.00 31.41  ? 539 PHE A CA  1 
ATOM   3142 C C   . PHE A 1 539 ? 65.652  9.840   -115.102 1.00 30.07  ? 539 PHE A C   1 
ATOM   3143 O O   . PHE A 1 539 ? 65.106  10.575  -115.917 1.00 34.80  ? 539 PHE A O   1 
ATOM   3144 C CB  . PHE A 1 539 ? 68.082  10.486  -115.079 1.00 32.37  ? 539 PHE A CB  1 
ATOM   3145 C CG  . PHE A 1 539 ? 68.144  10.940  -113.647 1.00 29.87  ? 539 PHE A CG  1 
ATOM   3146 C CD1 . PHE A 1 539 ? 67.506  12.097  -113.241 1.00 32.77  ? 539 PHE A CD1 1 
ATOM   3147 C CD2 . PHE A 1 539 ? 68.865  10.221  -112.709 1.00 36.80  ? 539 PHE A CD2 1 
ATOM   3148 C CE1 . PHE A 1 539 ? 67.573  12.524  -111.916 1.00 33.00  ? 539 PHE A CE1 1 
ATOM   3149 C CE2 . PHE A 1 539 ? 68.932  10.637  -111.381 1.00 34.79  ? 539 PHE A CE2 1 
ATOM   3150 C CZ  . PHE A 1 539 ? 68.286  11.790  -110.988 1.00 33.10  ? 539 PHE A CZ  1 
ATOM   3151 N N   . HIS A 1 540 ? 65.044  9.409   -113.998 1.00 29.92  ? 540 HIS A N   1 
ATOM   3152 C CA  . HIS A 1 540 ? 63.691  9.837   -113.617 1.00 32.34  ? 540 HIS A CA  1 
ATOM   3153 C C   . HIS A 1 540 ? 63.583  9.909   -112.102 1.00 34.37  ? 540 HIS A C   1 
ATOM   3154 O O   . HIS A 1 540 ? 64.200  9.116   -111.395 1.00 38.02  ? 540 HIS A O   1 
ATOM   3155 C CB  . HIS A 1 540 ? 62.611  8.852   -114.089 1.00 34.53  ? 540 HIS A CB  1 
ATOM   3156 C CG  . HIS A 1 540 ? 62.670  8.506   -115.543 1.00 34.96  ? 540 HIS A CG  1 
ATOM   3157 N ND1 . HIS A 1 540 ? 62.172  9.331   -116.526 1.00 34.73  ? 540 HIS A ND1 1 
ATOM   3158 C CD2 . HIS A 1 540 ? 63.129  7.400   -116.174 1.00 34.66  ? 540 HIS A CD2 1 
ATOM   3159 C CE1 . HIS A 1 540 ? 62.348  8.759   -117.704 1.00 46.27  ? 540 HIS A CE1 1 
ATOM   3160 N NE2 . HIS A 1 540 ? 62.928  7.586   -117.518 1.00 40.73  ? 540 HIS A NE2 1 
ATOM   3161 N N   . VAL A 1 541 ? 62.768  10.838  -111.615 1.00 35.06  ? 541 VAL A N   1 
ATOM   3162 C CA  . VAL A 1 541 ? 62.470  10.953  -110.193 1.00 33.57  ? 541 VAL A CA  1 
ATOM   3163 C C   . VAL A 1 541 ? 61.077  10.393  -109.941 1.00 33.75  ? 541 VAL A C   1 
ATOM   3164 O O   . VAL A 1 541 ? 60.120  10.830  -110.576 1.00 33.08  ? 541 VAL A O   1 
ATOM   3165 C CB  . VAL A 1 541 ? 62.503  12.422  -109.749 1.00 32.81  ? 541 VAL A CB  1 
ATOM   3166 C CG1 . VAL A 1 541 ? 62.191  12.549  -108.261 1.00 28.21  ? 541 VAL A CG1 1 
ATOM   3167 C CG2 . VAL A 1 541 ? 63.856  13.029  -110.075 1.00 30.60  ? 541 VAL A CG2 1 
ATOM   3168 N N   . ARG A 1 542 ? 60.957  9.445   -109.014 1.00 33.28  ? 542 ARG A N   1 
ATOM   3169 C CA  . ARG A 1 542 ? 59.654  8.847   -108.700 1.00 35.19  ? 542 ARG A CA  1 
ATOM   3170 C C   . ARG A 1 542 ? 58.799  9.854   -107.943 1.00 35.77  ? 542 ARG A C   1 
ATOM   3171 O O   . ARG A 1 542 ? 59.325  10.778  -107.320 1.00 33.05  ? 542 ARG A O   1 
ATOM   3172 C CB  . ARG A 1 542 ? 59.793  7.563   -107.872 1.00 32.56  ? 542 ARG A CB  1 
ATOM   3173 C CG  . ARG A 1 542 ? 60.973  6.689   -108.257 1.00 37.97  ? 542 ARG A CG  1 
ATOM   3174 C CD  . ARG A 1 542 ? 60.720  5.198   -108.091 1.00 34.18  ? 542 ARG A CD  1 
ATOM   3175 N NE  . ARG A 1 542 ? 60.133  4.642   -109.307 1.00 31.52  ? 542 ARG A NE  1 
ATOM   3176 C CZ  . ARG A 1 542 ? 60.428  3.454   -109.837 1.00 38.28  ? 542 ARG A CZ  1 
ATOM   3177 N NH1 . ARG A 1 542 ? 61.326  2.639   -109.279 1.00 42.55  ? 542 ARG A NH1 1 
ATOM   3178 N NH2 . ARG A 1 542 ? 59.812  3.082   -110.950 1.00 31.48  ? 542 ARG A NH2 1 
ATOM   3179 N N   . GLU A 1 543 ? 57.482  9.663   -107.994 1.00 39.85  ? 543 GLU A N   1 
ATOM   3180 C CA  . GLU A 1 543 ? 56.542  10.560  -107.320 1.00 45.83  ? 543 GLU A CA  1 
ATOM   3181 C C   . GLU A 1 543 ? 56.648  10.501  -105.795 1.00 46.60  ? 543 GLU A C   1 
ATOM   3182 O O   . GLU A 1 543 ? 56.158  11.399  -105.110 1.00 39.86  ? 543 GLU A O   1 
ATOM   3183 C CB  . GLU A 1 543 ? 55.105  10.243  -107.730 1.00 49.55  ? 543 GLU A CB  1 
ATOM   3184 C CG  . GLU A 1 543 ? 54.811  10.428  -109.214 1.00 53.80  ? 543 GLU A CG  1 
ATOM   3185 C CD  . GLU A 1 543 ? 53.320  10.561  -109.502 1.00 55.20  ? 543 GLU A CD  1 
ATOM   3186 O OE1 . GLU A 1 543 ? 52.495  10.081  -108.690 1.00 54.31  ? 543 GLU A OE1 1 
ATOM   3187 O OE2 . GLU A 1 543 ? 52.976  11.150  -110.546 1.00 65.18  ? 543 GLU A OE2 1 
ATOM   3188 N N   . GLY A 1 544 ? 57.270  9.438   -105.274 1.00 52.21  ? 544 GLY A N   1 
ATOM   3189 C CA  . GLY A 1 544 ? 57.536  9.294   -103.840 1.00 52.78  ? 544 GLY A CA  1 
ATOM   3190 C C   . GLY A 1 544 ? 58.193  10.526  -103.238 1.00 57.08  ? 544 GLY A C   1 
ATOM   3191 O O   . GLY A 1 544 ? 59.306  10.897  -103.634 1.00 60.67  ? 544 GLY A O   1 
ATOM   3192 N N   . ASP A 1 545 ? 57.493  11.140  -102.275 1.00 55.19  ? 545 ASP A N   1 
ATOM   3193 C CA  . ASP A 1 545 ? 57.886  12.401  -101.613 1.00 51.30  ? 545 ASP A CA  1 
ATOM   3194 C C   . ASP A 1 545 ? 59.327  12.416  -101.077 1.00 50.63  ? 545 ASP A C   1 
ATOM   3195 O O   . ASP A 1 545 ? 59.937  13.480  -100.951 1.00 43.65  ? 545 ASP A O   1 
ATOM   3196 C CB  . ASP A 1 545 ? 56.911  12.694  -100.462 1.00 49.87  ? 545 ASP A CB  1 
ATOM   3197 C CG  . ASP A 1 545 ? 56.872  14.160  -100.076 1.00 53.25  ? 545 ASP A CG  1 
ATOM   3198 O OD1 . ASP A 1 545 ? 56.346  14.466  -98.986  1.00 50.16  ? 545 ASP A OD1 1 
ATOM   3199 O OD2 . ASP A 1 545 ? 57.352  15.008  -100.858 1.00 56.45  ? 545 ASP A OD2 1 
ATOM   3200 N N   . GLU A 1 546 ? 59.851  11.228  -100.767 1.00 53.78  ? 546 GLU A N   1 
ATOM   3201 C CA  . GLU A 1 546 ? 61.261  11.026  -100.397 1.00 52.21  ? 546 GLU A CA  1 
ATOM   3202 C C   . GLU A 1 546 ? 62.247  11.295  -101.557 1.00 51.09  ? 546 GLU A C   1 
ATOM   3203 O O   . GLU A 1 546 ? 63.463  11.251  -101.359 1.00 50.40  ? 546 GLU A O   1 
ATOM   3204 C CB  . GLU A 1 546 ? 61.454  9.590   -99.882  1.00 52.02  ? 546 GLU A CB  1 
ATOM   3205 C CG  . GLU A 1 546 ? 62.756  9.336   -99.119  1.00 54.64  ? 546 GLU A CG  1 
ATOM   3206 C CD  . GLU A 1 546 ? 63.367  7.980   -99.446  1.00 57.29  ? 546 GLU A CD  1 
ATOM   3207 O OE1 . GLU A 1 546 ? 62.825  6.958   -98.978  1.00 68.31  ? 546 GLU A OE1 1 
ATOM   3208 O OE2 . GLU A 1 546 ? 64.389  7.933   -100.167 1.00 51.41  ? 546 GLU A OE2 1 
ATOM   3209 N N   . GLN A 1 547 ? 61.727  11.562  -102.758 1.00 48.17  ? 547 GLN A N   1 
ATOM   3210 C CA  . GLN A 1 547 ? 62.547  11.896  -103.920 1.00 44.69  ? 547 GLN A CA  1 
ATOM   3211 C C   . GLN A 1 547 ? 63.474  10.750  -104.244 1.00 41.56  ? 547 GLN A C   1 
ATOM   3212 O O   . GLN A 1 547 ? 64.695  10.856  -104.118 1.00 40.59  ? 547 GLN A O   1 
ATOM   3213 C CB  . GLN A 1 547 ? 63.347  13.186  -103.696 1.00 45.30  ? 547 GLN A CB  1 
ATOM   3214 C CG  . GLN A 1 547 ? 62.516  14.441  -103.726 1.00 48.38  ? 547 GLN A CG  1 
ATOM   3215 C CD  . GLN A 1 547 ? 62.126  14.817  -105.130 1.00 50.74  ? 547 GLN A CD  1 
ATOM   3216 O OE1 . GLN A 1 547 ? 61.294  14.159  -105.750 1.00 52.94  ? 547 GLN A OE1 1 
ATOM   3217 N NE2 . GLN A 1 547 ? 62.731  15.878  -105.648 1.00 55.79  ? 547 GLN A NE2 1 
ATOM   3218 N N   . ARG A 1 548 ? 62.876  9.638   -104.638 1.00 39.82  ? 548 ARG A N   1 
ATOM   3219 C CA  . ARG A 1 548 ? 63.638  8.495   -105.098 1.00 39.65  ? 548 ARG A CA  1 
ATOM   3220 C C   . ARG A 1 548 ? 63.841  8.631   -106.598 1.00 38.19  ? 548 ARG A C   1 
ATOM   3221 O O   . ARG A 1 548 ? 62.927  9.043   -107.314 1.00 40.45  ? 548 ARG A O   1 
ATOM   3222 C CB  . ARG A 1 548 ? 62.919  7.196   -104.739 1.00 39.29  ? 548 ARG A CB  1 
ATOM   3223 C CG  . ARG A 1 548 ? 63.001  6.899   -103.257 1.00 38.64  ? 548 ARG A CG  1 
ATOM   3224 C CD  . ARG A 1 548 ? 62.206  5.673   -102.848 1.00 43.59  ? 548 ARG A CD  1 
ATOM   3225 N NE  . ARG A 1 548 ? 62.608  5.202   -101.521 1.00 46.37  ? 548 ARG A NE  1 
ATOM   3226 C CZ  . ARG A 1 548 ? 61.943  4.314   -100.783 1.00 48.60  ? 548 ARG A CZ  1 
ATOM   3227 N NH1 . ARG A 1 548 ? 60.809  3.772   -101.214 1.00 48.98  ? 548 ARG A NH1 1 
ATOM   3228 N NH2 . ARG A 1 548 ? 62.419  3.968   -99.592  1.00 55.08  ? 548 ARG A NH2 1 
ATOM   3229 N N   . THR A 1 549 ? 65.053  8.331   -107.061 1.00 35.66  ? 549 THR A N   1 
ATOM   3230 C CA  . THR A 1 549 ? 65.362  8.341   -108.486 1.00 33.27  ? 549 THR A CA  1 
ATOM   3231 C C   . THR A 1 549 ? 65.569  6.924   -108.976 1.00 31.69  ? 549 THR A C   1 
ATOM   3232 O O   . THR A 1 549 ? 65.717  6.001   -108.179 1.00 31.72  ? 549 THR A O   1 
ATOM   3233 C CB  . THR A 1 549 ? 66.638  9.162   -108.806 1.00 30.62  ? 549 THR A CB  1 
ATOM   3234 O OG1 . THR A 1 549 ? 67.777  8.599   -108.137 1.00 26.38  ? 549 THR A OG1 1 
ATOM   3235 C CG2 . THR A 1 549 ? 66.458  10.597  -108.383 1.00 26.10  ? 549 THR A CG2 1 
ATOM   3236 N N   . PHE A 1 550 ? 65.567  6.765   -110.295 1.00 33.63  ? 550 PHE A N   1 
ATOM   3237 C CA  . PHE A 1 550 ? 65.979  5.518   -110.932 1.00 33.48  ? 550 PHE A CA  1 
ATOM   3238 C C   . PHE A 1 550 ? 66.339  5.777   -112.382 1.00 32.54  ? 550 PHE A C   1 
ATOM   3239 O O   . PHE A 1 550 ? 65.912  6.776   -112.956 1.00 29.60  ? 550 PHE A O   1 
ATOM   3240 C CB  . PHE A 1 550 ? 64.869  4.462   -110.850 1.00 33.54  ? 550 PHE A CB  1 
ATOM   3241 C CG  . PHE A 1 550 ? 63.688  4.742   -111.733 1.00 27.88  ? 550 PHE A CG  1 
ATOM   3242 C CD1 . PHE A 1 550 ? 62.737  5.664   -111.360 1.00 30.27  ? 550 PHE A CD1 1 
ATOM   3243 C CD2 . PHE A 1 550 ? 63.524  4.065   -112.933 1.00 34.14  ? 550 PHE A CD2 1 
ATOM   3244 C CE1 . PHE A 1 550 ? 61.640  5.922   -112.178 1.00 36.09  ? 550 PHE A CE1 1 
ATOM   3245 C CE2 . PHE A 1 550 ? 62.426  4.310   -113.753 1.00 32.93  ? 550 PHE A CE2 1 
ATOM   3246 C CZ  . PHE A 1 550 ? 61.487  5.240   -113.378 1.00 28.23  ? 550 PHE A CZ  1 
ATOM   3247 N N   . PHE A 1 551 ? 67.127  4.875   -112.960 1.00 34.97  ? 551 PHE A N   1 
ATOM   3248 C CA  . PHE A 1 551 ? 67.422  4.897   -114.395 1.00 34.35  ? 551 PHE A CA  1 
ATOM   3249 C C   . PHE A 1 551 ? 66.588  3.836   -115.097 1.00 31.65  ? 551 PHE A C   1 
ATOM   3250 O O   . PHE A 1 551 ? 66.611  2.672   -114.707 1.00 27.97  ? 551 PHE A O   1 
ATOM   3251 C CB  . PHE A 1 551 ? 68.900  4.619   -114.660 1.00 32.62  ? 551 PHE A CB  1 
ATOM   3252 C CG  . PHE A 1 551 ? 69.821  5.723   -114.215 1.00 40.07  ? 551 PHE A CG  1 
ATOM   3253 C CD1 . PHE A 1 551 ? 70.529  5.618   -113.017 1.00 34.46  ? 551 PHE A CD1 1 
ATOM   3254 C CD2 . PHE A 1 551 ? 69.998  6.860   -115.001 1.00 35.02  ? 551 PHE A CD2 1 
ATOM   3255 C CE1 . PHE A 1 551 ? 71.391  6.628   -112.610 1.00 28.96  ? 551 PHE A CE1 1 
ATOM   3256 C CE2 . PHE A 1 551 ? 70.861  7.872   -114.602 1.00 27.94  ? 551 PHE A CE2 1 
ATOM   3257 C CZ  . PHE A 1 551 ? 71.558  7.756   -113.404 1.00 27.19  ? 551 PHE A CZ  1 
ATOM   3258 N N   . SER A 1 552 ? 65.855  4.244   -116.132 1.00 33.64  ? 552 SER A N   1 
ATOM   3259 C CA  . SER A 1 552 ? 65.071  3.315   -116.945 1.00 33.13  ? 552 SER A CA  1 
ATOM   3260 C C   . SER A 1 552 ? 65.932  2.640   -118.019 1.00 33.34  ? 552 SER A C   1 
ATOM   3261 O O   . SER A 1 552 ? 65.584  2.684   -119.197 1.00 33.66  ? 552 SER A O   1 
ATOM   3262 C CB  . SER A 1 552 ? 63.896  4.042   -117.601 1.00 30.13  ? 552 SER A CB  1 
ATOM   3263 O OG  . SER A 1 552 ? 64.337  4.905   -118.634 1.00 35.03  ? 552 SER A OG  1 
ATOM   3264 N N   . PHE A 1 553 ? 67.034  2.003   -117.606 1.00 31.88  ? 553 PHE A N   1 
ATOM   3265 C CA  . PHE A 1 553 ? 67.965  1.351   -118.538 1.00 31.24  ? 553 PHE A CA  1 
ATOM   3266 C C   . PHE A 1 553 ? 67.360  0.130   -119.225 1.00 27.52  ? 553 PHE A C   1 
ATOM   3267 O O   . PHE A 1 553 ? 66.885  -0.773  -118.559 1.00 27.12  ? 553 PHE A O   1 
ATOM   3268 C CB  . PHE A 1 553 ? 69.210  0.838   -117.813 1.00 34.56  ? 553 PHE A CB  1 
ATOM   3269 C CG  . PHE A 1 553 ? 70.119  1.905   -117.281 1.00 33.42  ? 553 PHE A CG  1 
ATOM   3270 C CD1 . PHE A 1 553 ? 70.765  1.716   -116.067 1.00 41.53  ? 553 PHE A CD1 1 
ATOM   3271 C CD2 . PHE A 1 553 ? 70.371  3.062   -117.990 1.00 34.59  ? 553 PHE A CD2 1 
ATOM   3272 C CE1 . PHE A 1 553 ? 71.629  2.668   -115.567 1.00 39.32  ? 553 PHE A CE1 1 
ATOM   3273 C CE2 . PHE A 1 553 ? 71.227  4.024   -117.488 1.00 38.12  ? 553 PHE A CE2 1 
ATOM   3274 C CZ  . PHE A 1 553 ? 71.858  3.825   -116.278 1.00 41.19  ? 553 PHE A CZ  1 
ATOM   3275 N N   . PRO A 1 554 ? 67.412  0.068   -120.560 1.00 25.32  ? 554 PRO A N   1 
ATOM   3276 C CA  . PRO A 1 554 ? 67.033  -1.217  -121.141 1.00 28.94  ? 554 PRO A CA  1 
ATOM   3277 C C   . PRO A 1 554 ? 67.870  -2.354  -120.549 1.00 26.00  ? 554 PRO A C   1 
ATOM   3278 O O   . PRO A 1 554 ? 69.031  -2.144  -120.219 1.00 29.89  ? 554 PRO A O   1 
ATOM   3279 C CB  . PRO A 1 554 ? 67.318  -1.041  -122.640 1.00 35.98  ? 554 PRO A CB  1 
ATOM   3280 C CG  . PRO A 1 554 ? 68.087  0.249   -122.770 1.00 35.24  ? 554 PRO A CG  1 
ATOM   3281 C CD  . PRO A 1 554 ? 67.767  1.070   -121.577 1.00 27.30  ? 554 PRO A CD  1 
ATOM   3282 N N   . ALA A 1 555 ? 67.271  -3.533  -120.410 1.00 25.89  ? 555 ALA A N   1 
ATOM   3283 C CA  . ALA A 1 555 ? 67.914  -4.679  -119.756 1.00 22.92  ? 555 ALA A CA  1 
ATOM   3284 C C   . ALA A 1 555 ? 69.246  -5.037  -120.397 1.00 24.91  ? 555 ALA A C   1 
ATOM   3285 O O   . ALA A 1 555 ? 70.190  -5.412  -119.700 1.00 27.33  ? 555 ALA A O   1 
ATOM   3286 C CB  . ALA A 1 555 ? 66.985  -5.893  -119.777 1.00 15.92  ? 555 ALA A CB  1 
ATOM   3287 N N   . VAL A 1 556 ? 69.317  -4.911  -121.722 1.00 27.12  ? 556 VAL A N   1 
ATOM   3288 C CA  . VAL A 1 556 ? 70.532  -5.235  -122.480 1.00 26.78  ? 556 VAL A CA  1 
ATOM   3289 C C   . VAL A 1 556 ? 71.765  -4.406  -122.057 1.00 27.21  ? 556 VAL A C   1 
ATOM   3290 O O   . VAL A 1 556 ? 72.888  -4.834  -122.292 1.00 36.30  ? 556 VAL A O   1 
ATOM   3291 C CB  . VAL A 1 556 ? 70.292  -5.128  -124.028 1.00 27.31  ? 556 VAL A CB  1 
ATOM   3292 C CG1 . VAL A 1 556 ? 69.955  -3.691  -124.451 1.00 23.03  ? 556 VAL A CG1 1 
ATOM   3293 C CG2 . VAL A 1 556 ? 71.496  -5.641  -124.803 1.00 29.72  ? 556 VAL A CG2 1 
ATOM   3294 N N   . VAL A 1 557 ? 71.565  -3.243  -121.433 1.00 26.25  ? 557 VAL A N   1 
ATOM   3295 C CA  . VAL A 1 557 ? 72.689  -2.453  -120.896 1.00 28.92  ? 557 VAL A CA  1 
ATOM   3296 C C   . VAL A 1 557 ? 72.702  -2.279  -119.369 1.00 31.97  ? 557 VAL A C   1 
ATOM   3297 O O   . VAL A 1 557 ? 73.721  -1.869  -118.812 1.00 36.01  ? 557 VAL A O   1 
ATOM   3298 C CB  . VAL A 1 557 ? 72.799  -1.040  -121.544 1.00 25.47  ? 557 VAL A CB  1 
ATOM   3299 C CG1 . VAL A 1 557 ? 73.228  -1.151  -122.995 1.00 20.97  ? 557 VAL A CG1 1 
ATOM   3300 C CG2 . VAL A 1 557 ? 71.498  -0.270  -121.406 1.00 27.31  ? 557 VAL A CG2 1 
ATOM   3301 N N   . ALA A 1 558 ? 71.597  -2.590  -118.694 1.00 34.91  ? 558 ALA A N   1 
ATOM   3302 C CA  . ALA A 1 558 ? 71.513  -2.425  -117.233 1.00 34.02  ? 558 ALA A CA  1 
ATOM   3303 C C   . ALA A 1 558 ? 72.681  -3.131  -116.529 1.00 32.12  ? 558 ALA A C   1 
ATOM   3304 O O   . ALA A 1 558 ? 73.062  -4.231  -116.923 1.00 32.55  ? 558 ALA A O   1 
ATOM   3305 C CB  . ALA A 1 558 ? 70.184  -2.954  -116.717 1.00 34.55  ? 558 ALA A CB  1 
ATOM   3306 N N   . PRO A 1 559 ? 73.256  -2.499  -115.491 1.00 29.96  ? 559 PRO A N   1 
ATOM   3307 C CA  . PRO A 1 559 ? 74.445  -3.024  -114.803 1.00 33.99  ? 559 PRO A CA  1 
ATOM   3308 C C   . PRO A 1 559 ? 74.354  -4.519  -114.517 1.00 32.08  ? 559 PRO A C   1 
ATOM   3309 O O   . PRO A 1 559 ? 75.345  -5.234  -114.600 1.00 27.18  ? 559 PRO A O   1 
ATOM   3310 C CB  . PRO A 1 559 ? 74.462  -2.235  -113.495 1.00 31.88  ? 559 PRO A CB  1 
ATOM   3311 C CG  . PRO A 1 559 ? 73.850  -0.968  -113.833 1.00 34.00  ? 559 PRO A CG  1 
ATOM   3312 C CD  . PRO A 1 559 ? 72.809  -1.236  -114.889 1.00 30.51  ? 559 PRO A CD  1 
ATOM   3313 N N   . PHE A 1 560 ? 73.162  -4.957  -114.142 1.00 33.18  ? 560 PHE A N   1 
ATOM   3314 C CA  . PHE A 1 560 ? 72.787  -6.354  -114.247 1.00 34.14  ? 560 PHE A CA  1 
ATOM   3315 C C   . PHE A 1 560 ? 71.272  -6.443  -114.332 1.00 32.59  ? 560 PHE A C   1 
ATOM   3316 O O   . PHE A 1 560 ? 70.558  -5.546  -113.880 1.00 31.25  ? 560 PHE A O   1 
ATOM   3317 C CB  . PHE A 1 560 ? 73.345  -7.190  -113.099 1.00 33.14  ? 560 PHE A CB  1 
ATOM   3318 C CG  . PHE A 1 560 ? 73.038  -6.651  -111.743 1.00 30.29  ? 560 PHE A CG  1 
ATOM   3319 C CD1 . PHE A 1 560 ? 71.817  -6.897  -111.149 1.00 35.36  ? 560 PHE A CD1 1 
ATOM   3320 C CD2 . PHE A 1 560 ? 73.982  -5.924  -111.046 1.00 34.16  ? 560 PHE A CD2 1 
ATOM   3321 C CE1 . PHE A 1 560 ? 71.535  -6.415  -109.892 1.00 38.59  ? 560 PHE A CE1 1 
ATOM   3322 C CE2 . PHE A 1 560 ? 73.709  -5.443  -109.783 1.00 32.65  ? 560 PHE A CE2 1 
ATOM   3323 C CZ  . PHE A 1 560 ? 72.485  -5.686  -109.208 1.00 37.11  ? 560 PHE A CZ  1 
ATOM   3324 N N   . LYS A 1 561 ? 70.787  -7.522  -114.928 1.00 31.27  ? 561 LYS A N   1 
ATOM   3325 C CA  . LYS A 1 561 ? 69.387  -7.590  -115.323 1.00 35.80  ? 561 LYS A CA  1 
ATOM   3326 C C   . LYS A 1 561 ? 68.436  -7.780  -114.138 1.00 33.48  ? 561 LYS A C   1 
ATOM   3327 O O   . LYS A 1 561 ? 67.312  -7.298  -114.167 1.00 35.30  ? 561 LYS A O   1 
ATOM   3328 C CB  . LYS A 1 561 ? 69.180  -8.701  -116.360 1.00 35.19  ? 561 LYS A CB  1 
ATOM   3329 C CG  . LYS A 1 561 ? 69.954  -8.522  -117.679 1.00 29.49  ? 561 LYS A CG  1 
ATOM   3330 C CD  . LYS A 1 561 ? 69.908  -9.819  -118.488 1.00 39.23  ? 561 LYS A CD  1 
ATOM   3331 C CE  . LYS A 1 561 ? 70.905  -9.855  -119.622 1.00 34.34  ? 561 LYS A CE  1 
ATOM   3332 N NZ  . LYS A 1 561 ? 70.504  -8.867  -120.639 1.00 39.91  ? 561 LYS A NZ  1 
ATOM   3333 N N   . CYS A 1 562 ? 68.885  -8.456  -113.088 1.00 37.94  ? 562 CYS A N   1 
ATOM   3334 C CA  . CYS A 1 562 ? 67.975  -8.842  -112.016 1.00 37.97  ? 562 CYS A CA  1 
ATOM   3335 C C   . CYS A 1 562 ? 68.586  -8.923  -110.606 1.00 36.70  ? 562 CYS A C   1 
ATOM   3336 O O   . CYS A 1 562 ? 69.750  -9.258  -110.430 1.00 33.82  ? 562 CYS A O   1 
ATOM   3337 C CB  . CYS A 1 562 ? 67.365  -10.184 -112.371 1.00 37.94  ? 562 CYS A CB  1 
ATOM   3338 S SG  . CYS A 1 562 ? 66.240  -10.734 -111.139 1.00 44.12  ? 562 CYS A SG  1 
ATOM   3339 N N   . SER A 1 563 ? 67.774  -8.623  -109.600 1.00 37.73  ? 563 SER A N   1 
ATOM   3340 C CA  . SER A 1 563 ? 68.213  -8.675  -108.216 1.00 38.08  ? 563 SER A CA  1 
ATOM   3341 C C   . SER A 1 563 ? 67.407  -9.726  -107.465 1.00 37.62  ? 563 SER A C   1 
ATOM   3342 O O   . SER A 1 563 ? 66.182  -9.670  -107.452 1.00 38.20  ? 563 SER A O   1 
ATOM   3343 C CB  . SER A 1 563 ? 68.028  -7.313  -107.555 1.00 37.62  ? 563 SER A CB  1 
ATOM   3344 O OG  . SER A 1 563 ? 68.521  -7.334  -106.230 1.00 43.94  ? 563 SER A OG  1 
ATOM   3345 N N   . VAL A 1 564 ? 68.097  -10.683 -106.851 1.00 37.29  ? 564 VAL A N   1 
ATOM   3346 C CA  . VAL A 1 564 ? 67.457  -11.646 -105.969 1.00 36.36  ? 564 VAL A CA  1 
ATOM   3347 C C   . VAL A 1 564 ? 67.451  -11.064 -104.559 1.00 37.51  ? 564 VAL A C   1 
ATOM   3348 O O   . VAL A 1 564 ? 68.515  -10.816 -103.985 1.00 33.96  ? 564 VAL A O   1 
ATOM   3349 C CB  . VAL A 1 564 ? 68.203  -12.984 -105.962 1.00 37.02  ? 564 VAL A CB  1 
ATOM   3350 C CG1 . VAL A 1 564 ? 67.534  -13.952 -105.003 1.00 44.34  ? 564 VAL A CG1 1 
ATOM   3351 C CG2 . VAL A 1 564 ? 68.249  -13.570 -107.364 1.00 35.06  ? 564 VAL A CG2 1 
ATOM   3352 N N   . LEU A 1 565 ? 66.249  -10.827 -104.028 1.00 37.17  ? 565 LEU A N   1 
ATOM   3353 C CA  . LEU A 1 565 ? 66.058  -10.322 -102.665 1.00 37.80  ? 565 LEU A CA  1 
ATOM   3354 C C   . LEU A 1 565 ? 65.545  -11.462 -101.784 1.00 37.54  ? 565 LEU A C   1 
ATOM   3355 O O   . LEU A 1 565 ? 64.371  -11.818 -101.856 1.00 39.35  ? 565 LEU A O   1 
ATOM   3356 C CB  . LEU A 1 565 ? 65.032  -9.178  -102.641 1.00 41.24  ? 565 LEU A CB  1 
ATOM   3357 C CG  . LEU A 1 565 ? 65.462  -7.734  -102.936 1.00 50.11  ? 565 LEU A CG  1 
ATOM   3358 C CD1 . LEU A 1 565 ? 66.388  -7.224  -101.848 1.00 52.55  ? 565 LEU A CD1 1 
ATOM   3359 C CD2 . LEU A 1 565 ? 66.108  -7.587  -104.317 1.00 53.60  ? 565 LEU A CD2 1 
ATOM   3360 N N   . PRO A 1 566 ? 66.422  -12.060 -100.970 1.00 35.58  ? 566 PRO A N   1 
ATOM   3361 C CA  . PRO A 1 566 ? 65.945  -13.007 -99.978  1.00 35.48  ? 566 PRO A CA  1 
ATOM   3362 C C   . PRO A 1 566 ? 65.627  -12.309 -98.662  1.00 32.48  ? 566 PRO A C   1 
ATOM   3363 O O   . PRO A 1 566 ? 66.516  -11.718 -98.056  1.00 31.94  ? 566 PRO A O   1 
ATOM   3364 C CB  . PRO A 1 566 ? 67.131  -13.959 -99.819  1.00 35.53  ? 566 PRO A CB  1 
ATOM   3365 C CG  . PRO A 1 566 ? 68.335  -13.120 -100.107 1.00 37.48  ? 566 PRO A CG  1 
ATOM   3366 C CD  . PRO A 1 566 ? 67.887  -11.934 -100.940 1.00 38.45  ? 566 PRO A CD  1 
ATOM   3367 N N   . LEU A 1 567 ? 64.371  -12.381 -98.228  1.00 34.24  ? 567 LEU A N   1 
ATOM   3368 C CA  . LEU A 1 567 ? 63.948  -11.786 -96.951  1.00 38.40  ? 567 LEU A CA  1 
ATOM   3369 C C   . LEU A 1 567 ? 64.886  -12.085 -95.782  1.00 40.52  ? 567 LEU A C   1 
ATOM   3370 O O   . LEU A 1 567 ? 65.109  -11.224 -94.929  1.00 39.73  ? 567 LEU A O   1 
ATOM   3371 C CB  . LEU A 1 567 ? 62.526  -12.221 -96.574  1.00 38.19  ? 567 LEU A CB  1 
ATOM   3372 C CG  . LEU A 1 567 ? 61.503  -11.094 -96.444  1.00 35.72  ? 567 LEU A CG  1 
ATOM   3373 C CD1 . LEU A 1 567 ? 60.165  -11.659 -96.007  1.00 35.06  ? 567 LEU A CD1 1 
ATOM   3374 C CD2 . LEU A 1 567 ? 61.984  -10.044 -95.451  1.00 33.61  ? 567 LEU A CD2 1 
ATOM   3375 N N   . SER A 1 568 ? 65.415  -13.305 -95.732  1.00 42.41  ? 568 SER A N   1 
ATOM   3376 C CA  . SER A 1 568 ? 66.413  -13.648 -94.729  1.00 44.82  ? 568 SER A CA  1 
ATOM   3377 C C   . SER A 1 568 ? 67.582  -14.399 -95.324  1.00 48.50  ? 568 SER A C   1 
ATOM   3378 O O   . SER A 1 568 ? 67.499  -14.958 -96.424  1.00 47.30  ? 568 SER A O   1 
ATOM   3379 C CB  . SER A 1 568 ? 65.808  -14.494 -93.611  1.00 45.08  ? 568 SER A CB  1 
ATOM   3380 O OG  . SER A 1 568 ? 66.787  -14.784 -92.621  1.00 41.25  ? 568 SER A OG  1 
ATOM   3381 N N   . GLN A 1 569 ? 68.671  -14.392 -94.561  1.00 51.00  ? 569 GLN A N   1 
ATOM   3382 C CA  . GLN A 1 569 ? 69.852  -15.192 -94.843  1.00 50.17  ? 569 GLN A CA  1 
ATOM   3383 C C   . GLN A 1 569 ? 69.747  -16.541 -94.118  1.00 48.12  ? 569 GLN A C   1 
ATOM   3384 O O   . GLN A 1 569 ? 70.569  -17.435 -94.325  1.00 46.68  ? 569 GLN A O   1 
ATOM   3385 C CB  . GLN A 1 569 ? 71.109  -14.429 -94.415  1.00 53.38  ? 569 GLN A CB  1 
ATOM   3386 C CG  . GLN A 1 569 ? 71.354  -13.144 -95.207  1.00 54.64  ? 569 GLN A CG  1 
ATOM   3387 C CD  . GLN A 1 569 ? 72.045  -13.401 -96.533  1.00 66.09  ? 569 GLN A CD  1 
ATOM   3388 O OE1 . GLN A 1 569 ? 73.235  -13.717 -96.567  1.00 71.25  ? 569 GLN A OE1 1 
ATOM   3389 N NE2 . GLN A 1 569 ? 71.304  -13.262 -97.635  1.00 69.09  ? 569 GLN A NE2 1 
ATOM   3390 N N   . ASN A 1 570 ? 68.735  -16.674 -93.263  1.00 46.92  ? 570 ASN A N   1 
ATOM   3391 C CA  . ASN A 1 570 ? 68.329  -17.968 -92.720  1.00 48.16  ? 570 ASN A CA  1 
ATOM   3392 C C   . ASN A 1 570 ? 68.670  -19.098 -93.707  1.00 45.44  ? 570 ASN A C   1 
ATOM   3393 O O   . ASN A 1 570 ? 68.110  -19.166 -94.797  1.00 42.59  ? 570 ASN A O   1 
ATOM   3394 C CB  . ASN A 1 570 ? 66.822  -17.921 -92.410  1.00 49.56  ? 570 ASN A CB  1 
ATOM   3395 C CG  . ASN A 1 570 ? 66.273  -19.239 -91.899  1.00 50.13  ? 570 ASN A CG  1 
ATOM   3396 O OD1 . ASN A 1 570 ? 66.840  -19.854 -90.997  1.00 63.80  ? 570 ASN A OD1 1 
ATOM   3397 N ND2 . ASN A 1 570 ? 65.144  -19.670 -92.463  1.00 42.36  ? 570 ASN A ND2 1 
ATOM   3398 N N   . GLN A 1 571 ? 69.600  -19.971 -93.322  1.00 45.79  ? 571 GLN A N   1 
ATOM   3399 C CA  . GLN A 1 571 ? 70.128  -21.018 -94.220  1.00 47.70  ? 571 GLN A CA  1 
ATOM   3400 C C   . GLN A 1 571 ? 69.082  -21.917 -94.890  1.00 47.37  ? 571 GLN A C   1 
ATOM   3401 O O   . GLN A 1 571 ? 69.422  -22.681 -95.789  1.00 49.78  ? 571 GLN A O   1 
ATOM   3402 C CB  . GLN A 1 571 ? 71.200  -21.878 -93.511  1.00 48.76  ? 571 GLN A CB  1 
ATOM   3403 C CG  . GLN A 1 571 ? 70.803  -22.487 -92.151  1.00 55.39  ? 571 GLN A CG  1 
ATOM   3404 C CD  . GLN A 1 571 ? 70.173  -23.873 -92.239  1.00 59.02  ? 571 GLN A CD  1 
ATOM   3405 O OE1 . GLN A 1 571 ? 70.244  -24.652 -91.283  1.00 49.56  ? 571 GLN A OE1 1 
ATOM   3406 N NE2 . GLN A 1 571 ? 69.550  -24.185 -93.375  1.00 58.50  ? 571 GLN A NE2 1 
ATOM   3407 N N   . GLU A 1 572 ? 67.826  -21.843 -94.458  1.00 47.63  ? 572 GLU A N   1 
ATOM   3408 C CA  . GLU A 1 572 ? 66.742  -22.554 -95.140  1.00 46.63  ? 572 GLU A CA  1 
ATOM   3409 C C   . GLU A 1 572 ? 66.299  -21.787 -96.396  1.00 41.05  ? 572 GLU A C   1 
ATOM   3410 O O   . GLU A 1 572 ? 65.542  -22.312 -97.210  1.00 33.89  ? 572 GLU A O   1 
ATOM   3411 C CB  . GLU A 1 572 ? 65.560  -22.791 -94.188  1.00 50.50  ? 572 GLU A CB  1 
ATOM   3412 C CG  . GLU A 1 572 ? 65.074  -24.252 -94.119  1.00 59.04  ? 572 GLU A CG  1 
ATOM   3413 C CD  . GLU A 1 572 ? 64.149  -24.657 -95.272  1.00 64.68  ? 572 GLU A CD  1 
ATOM   3414 O OE1 . GLU A 1 572 ? 64.524  -24.466 -96.456  1.00 65.59  ? 572 GLU A OE1 1 
ATOM   3415 O OE2 . GLU A 1 572 ? 63.048  -25.190 -94.984  1.00 48.31  ? 572 GLU A OE2 1 
ATOM   3416 N N   . PHE A 1 573 ? 66.774  -20.550 -96.542  1.00 39.32  ? 573 PHE A N   1 
ATOM   3417 C CA  . PHE A 1 573 ? 66.607  -19.780 -97.781  1.00 41.60  ? 573 PHE A CA  1 
ATOM   3418 C C   . PHE A 1 573 ? 67.656  -20.134 -98.848  1.00 42.45  ? 573 PHE A C   1 
ATOM   3419 O O   . PHE A 1 573 ? 67.406  -19.976 -100.045 1.00 42.37  ? 573 PHE A O   1 
ATOM   3420 C CB  . PHE A 1 573 ? 66.683  -18.267 -97.504  1.00 35.53  ? 573 PHE A CB  1 
ATOM   3421 C CG  . PHE A 1 573 ? 65.406  -17.672 -96.982  1.00 36.80  ? 573 PHE A CG  1 
ATOM   3422 C CD1 . PHE A 1 573 ? 64.939  -17.992 -95.718  1.00 37.26  ? 573 PHE A CD1 1 
ATOM   3423 C CD2 . PHE A 1 573 ? 64.676  -16.774 -97.750  1.00 32.68  ? 573 PHE A CD2 1 
ATOM   3424 C CE1 . PHE A 1 573 ? 63.763  -17.435 -95.234  1.00 31.17  ? 573 PHE A CE1 1 
ATOM   3425 C CE2 . PHE A 1 573 ? 63.498  -16.219 -97.267  1.00 31.32  ? 573 PHE A CE2 1 
ATOM   3426 C CZ  . PHE A 1 573 ? 63.046  -16.549 -96.011  1.00 27.09  ? 573 PHE A CZ  1 
ATOM   3427 N N   . MET A 1 574 ? 68.829  -20.595 -98.420  1.00 44.35  ? 574 MET A N   1 
ATOM   3428 C CA  . MET A 1 574 ? 69.966  -20.771 -99.340  1.00 45.82  ? 574 MET A CA  1 
ATOM   3429 C C   . MET A 1 574 ? 69.711  -21.675 -100.554 1.00 45.46  ? 574 MET A C   1 
ATOM   3430 O O   . MET A 1 574 ? 69.970  -21.256 -101.685 1.00 46.42  ? 574 MET A O   1 
ATOM   3431 C CB  . MET A 1 574 ? 71.226  -21.212 -98.581  1.00 47.48  ? 574 MET A CB  1 
ATOM   3432 C CG  . MET A 1 574 ? 72.161  -20.058 -98.189  1.00 57.58  ? 574 MET A CG  1 
ATOM   3433 S SD  . MET A 1 574 ? 71.381  -18.433 -97.956  1.00 72.75  ? 574 MET A SD  1 
ATOM   3434 C CE  . MET A 1 574 ? 71.716  -17.619 -99.533  1.00 56.75  ? 574 MET A CE  1 
ATOM   3435 N N   . PRO A 1 575 ? 69.213  -22.906 -100.337 1.00 42.77  ? 575 PRO A N   1 
ATOM   3436 C CA  . PRO A 1 575 ? 68.912  -23.768 -101.488 1.00 41.18  ? 575 PRO A CA  1 
ATOM   3437 C C   . PRO A 1 575 ? 68.090  -23.073 -102.580 1.00 38.89  ? 575 PRO A C   1 
ATOM   3438 O O   . PRO A 1 575 ? 68.389  -23.219 -103.763 1.00 37.97  ? 575 PRO A O   1 
ATOM   3439 C CB  . PRO A 1 575 ? 68.119  -24.930 -100.870 1.00 41.31  ? 575 PRO A CB  1 
ATOM   3440 C CG  . PRO A 1 575 ? 67.845  -24.533 -99.450  1.00 44.10  ? 575 PRO A CG  1 
ATOM   3441 C CD  . PRO A 1 575 ? 68.913  -23.581 -99.066  1.00 43.11  ? 575 PRO A CD  1 
ATOM   3442 N N   . PHE A 1 576 ? 67.079  -22.311 -102.175 1.00 36.87  ? 576 PHE A N   1 
ATOM   3443 C CA  . PHE A 1 576 ? 66.219  -21.593 -103.114 1.00 34.95  ? 576 PHE A CA  1 
ATOM   3444 C C   . PHE A 1 576 ? 66.973  -20.515 -103.888 1.00 31.30  ? 576 PHE A C   1 
ATOM   3445 O O   . PHE A 1 576 ? 66.789  -20.365 -105.097 1.00 29.73  ? 576 PHE A O   1 
ATOM   3446 C CB  . PHE A 1 576 ? 65.040  -20.954 -102.371 1.00 37.30  ? 576 PHE A CB  1 
ATOM   3447 C CG  . PHE A 1 576 ? 64.039  -21.947 -101.842 1.00 36.36  ? 576 PHE A CG  1 
ATOM   3448 C CD1 . PHE A 1 576 ? 64.103  -22.389 -100.529 1.00 41.60  ? 576 PHE A CD1 1 
ATOM   3449 C CD2 . PHE A 1 576 ? 63.029  -22.437 -102.662 1.00 30.02  ? 576 PHE A CD2 1 
ATOM   3450 C CE1 . PHE A 1 576 ? 63.175  -23.308 -100.044 1.00 43.10  ? 576 PHE A CE1 1 
ATOM   3451 C CE2 . PHE A 1 576 ? 62.103  -23.349 -102.189 1.00 32.30  ? 576 PHE A CE2 1 
ATOM   3452 C CZ  . PHE A 1 576 ? 62.171  -23.785 -100.877 1.00 36.86  ? 576 PHE A CZ  1 
ATOM   3453 N N   . VAL A 1 577 ? 67.810  -19.763 -103.175 1.00 31.22  ? 577 VAL A N   1 
ATOM   3454 C CA  . VAL A 1 577 ? 68.606  -18.684 -103.770 1.00 30.00  ? 577 VAL A CA  1 
ATOM   3455 C C   . VAL A 1 577 ? 69.655  -19.260 -104.718 1.00 29.39  ? 577 VAL A C   1 
ATOM   3456 O O   . VAL A 1 577 ? 69.792  -18.816 -105.856 1.00 24.26  ? 577 VAL A O   1 
ATOM   3457 C CB  . VAL A 1 577 ? 69.338  -17.853 -102.685 1.00 28.53  ? 577 VAL A CB  1 
ATOM   3458 C CG1 . VAL A 1 577 ? 70.093  -16.679 -103.313 1.00 20.82  ? 577 VAL A CG1 1 
ATOM   3459 C CG2 . VAL A 1 577 ? 68.358  -17.367 -101.625 1.00 27.69  ? 577 VAL A CG2 1 
ATOM   3460 N N   . LYS A 1 578 ? 70.395  -20.251 -104.230 1.00 30.74  ? 578 LYS A N   1 
ATOM   3461 C CA  . LYS A 1 578 ? 71.411  -20.915 -105.028 1.00 30.06  ? 578 LYS A CA  1 
ATOM   3462 C C   . LYS A 1 578 ? 70.769  -21.380 -106.321 1.00 29.71  ? 578 LYS A C   1 
ATOM   3463 O O   . LYS A 1 578 ? 71.183  -20.979 -107.402 1.00 32.48  ? 578 LYS A O   1 
ATOM   3464 C CB  . LYS A 1 578 ? 72.011  -22.098 -104.265 1.00 28.96  ? 578 LYS A CB  1 
ATOM   3465 C CG  . LYS A 1 578 ? 73.207  -22.751 -104.942 1.00 29.43  ? 578 LYS A CG  1 
ATOM   3466 C CD  . LYS A 1 578 ? 73.928  -23.694 -103.982 1.00 32.63  ? 578 LYS A CD  1 
ATOM   3467 C CE  . LYS A 1 578 ? 75.108  -24.414 -104.638 1.00 37.66  ? 578 LYS A CE  1 
ATOM   3468 N NZ  . LYS A 1 578 ? 74.692  -25.614 -105.428 1.00 44.03  ? 578 LYS A NZ  1 
ATOM   3469 N N   . GLU A 1 579 ? 69.721  -22.183 -106.205 1.00 29.47  ? 579 GLU A N   1 
ATOM   3470 C CA  . GLU A 1 579 ? 69.077  -22.737 -107.386 1.00 31.18  ? 579 GLU A CA  1 
ATOM   3471 C C   . GLU A 1 579 ? 68.646  -21.623 -108.333 1.00 31.63  ? 579 GLU A C   1 
ATOM   3472 O O   . GLU A 1 579 ? 68.951  -21.667 -109.526 1.00 36.52  ? 579 GLU A O   1 
ATOM   3473 C CB  . GLU A 1 579 ? 67.872  -23.605 -107.011 1.00 34.92  ? 579 GLU A CB  1 
ATOM   3474 C CG  . GLU A 1 579 ? 67.935  -25.011 -107.585 1.00 39.27  ? 579 GLU A CG  1 
ATOM   3475 C CD  . GLU A 1 579 ? 68.177  -25.018 -109.078 1.00 45.27  ? 579 GLU A CD  1 
ATOM   3476 O OE1 . GLU A 1 579 ? 67.485  -24.260 -109.792 1.00 43.32  ? 579 GLU A OE1 1 
ATOM   3477 O OE2 . GLU A 1 579 ? 69.061  -25.777 -109.532 1.00 48.00  ? 579 GLU A OE2 1 
ATOM   3478 N N   . LEU A 1 580 ? 67.957  -20.616 -107.802 1.00 28.05  ? 580 LEU A N   1 
ATOM   3479 C CA  . LEU A 1 580 ? 67.528  -19.480 -108.623 1.00 26.57  ? 580 LEU A CA  1 
ATOM   3480 C C   . LEU A 1 580 ? 68.706  -18.817 -109.331 1.00 26.49  ? 580 LEU A C   1 
ATOM   3481 O O   . LEU A 1 580 ? 68.628  -18.483 -110.510 1.00 28.71  ? 580 LEU A O   1 
ATOM   3482 C CB  . LEU A 1 580 ? 66.800  -18.433 -107.781 1.00 22.61  ? 580 LEU A CB  1 
ATOM   3483 C CG  . LEU A 1 580 ? 66.222  -17.279 -108.602 1.00 20.78  ? 580 LEU A CG  1 
ATOM   3484 C CD1 . LEU A 1 580 ? 65.277  -17.830 -109.653 1.00 18.45  ? 580 LEU A CD1 1 
ATOM   3485 C CD2 . LEU A 1 580 ? 65.517  -16.247 -107.723 1.00 19.08  ? 580 LEU A CD2 1 
ATOM   3486 N N   . SER A 1 581 ? 69.794  -18.627 -108.600 1.00 26.41  ? 581 SER A N   1 
ATOM   3487 C CA  . SER A 1 581 ? 70.968  -17.969 -109.138 1.00 27.05  ? 581 SER A CA  1 
ATOM   3488 C C   . SER A 1 581 ? 71.573  -18.823 -110.236 1.00 30.48  ? 581 SER A C   1 
ATOM   3489 O O   . SER A 1 581 ? 71.888  -18.334 -111.324 1.00 37.64  ? 581 SER A O   1 
ATOM   3490 C CB  . SER A 1 581 ? 71.989  -17.741 -108.028 1.00 26.24  ? 581 SER A CB  1 
ATOM   3491 O OG  . SER A 1 581 ? 73.076  -16.965 -108.487 1.00 26.07  ? 581 SER A OG  1 
ATOM   3492 N N   . GLU A 1 582 ? 71.728  -20.107 -109.944 1.00 31.14  ? 582 GLU A N   1 
ATOM   3493 C CA  . GLU A 1 582 ? 72.254  -21.051 -110.918 1.00 30.00  ? 582 GLU A CA  1 
ATOM   3494 C C   . GLU A 1 582 ? 71.365  -21.065 -112.151 1.00 29.77  ? 582 GLU A C   1 
ATOM   3495 O O   . GLU A 1 582 ? 71.860  -20.951 -113.267 1.00 35.04  ? 582 GLU A O   1 
ATOM   3496 C CB  . GLU A 1 582 ? 72.379  -22.449 -110.306 1.00 27.20  ? 582 GLU A CB  1 
ATOM   3497 C CG  . GLU A 1 582 ? 73.484  -22.530 -109.264 1.00 23.76  ? 582 GLU A CG  1 
ATOM   3498 C CD  . GLU A 1 582 ? 73.713  -23.927 -108.743 1.00 29.92  ? 582 GLU A CD  1 
ATOM   3499 O OE1 . GLU A 1 582 ? 72.807  -24.779 -108.873 1.00 36.27  ? 582 GLU A OE1 1 
ATOM   3500 O OE2 . GLU A 1 582 ? 74.809  -24.170 -108.197 1.00 28.45  ? 582 GLU A OE2 1 
ATOM   3501 N N   . ALA A 1 583 ? 70.055  -21.171 -111.942 1.00 27.74  ? 583 ALA A N   1 
ATOM   3502 C CA  . ALA A 1 583 ? 69.095  -21.107 -113.040 1.00 30.80  ? 583 ALA A CA  1 
ATOM   3503 C C   . ALA A 1 583 ? 69.285  -19.848 -113.895 1.00 32.50  ? 583 ALA A C   1 
ATOM   3504 O O   . ALA A 1 583 ? 69.417  -19.935 -115.113 1.00 33.24  ? 583 ALA A O   1 
ATOM   3505 C CB  . ALA A 1 583 ? 67.684  -21.163 -112.505 1.00 30.53  ? 583 ALA A CB  1 
ATOM   3506 N N   . LEU A 1 584 ? 69.304  -18.683 -113.254 1.00 31.81  ? 584 LEU A N   1 
ATOM   3507 C CA  . LEU A 1 584 ? 69.474  -17.419 -113.971 1.00 30.83  ? 584 LEU A CA  1 
ATOM   3508 C C   . LEU A 1 584 ? 70.761  -17.437 -114.794 1.00 30.45  ? 584 LEU A C   1 
ATOM   3509 O O   . LEU A 1 584 ? 70.772  -17.029 -115.956 1.00 23.60  ? 584 LEU A O   1 
ATOM   3510 C CB  . LEU A 1 584 ? 69.484  -16.241 -112.992 1.00 31.55  ? 584 LEU A CB  1 
ATOM   3511 C CG  . LEU A 1 584 ? 68.132  -15.883 -112.366 1.00 29.63  ? 584 LEU A CG  1 
ATOM   3512 C CD1 . LEU A 1 584 ? 68.310  -14.924 -111.196 1.00 25.19  ? 584 LEU A CD1 1 
ATOM   3513 C CD2 . LEU A 1 584 ? 67.211  -15.283 -113.410 1.00 24.21  ? 584 LEU A CD2 1 
ATOM   3514 N N   . THR A 1 585 ? 71.834  -17.922 -114.177 1.00 29.70  ? 585 THR A N   1 
ATOM   3515 C CA  . THR A 1 585 ? 73.107  -18.103 -114.861 1.00 30.36  ? 585 THR A CA  1 
ATOM   3516 C C   . THR A 1 585 ? 72.964  -19.023 -116.067 1.00 31.36  ? 585 THR A C   1 
ATOM   3517 O O   . THR A 1 585 ? 73.407  -18.694 -117.158 1.00 32.60  ? 585 THR A O   1 
ATOM   3518 C CB  . THR A 1 585 ? 74.173  -18.673 -113.908 1.00 30.47  ? 585 THR A CB  1 
ATOM   3519 O OG1 . THR A 1 585 ? 74.921  -17.594 -113.343 1.00 29.77  ? 585 THR A OG1 1 
ATOM   3520 C CG2 . THR A 1 585 ? 75.117  -19.618 -114.639 1.00 22.89  ? 585 THR A CG2 1 
ATOM   3521 N N   . ARG A 1 586 ? 72.326  -20.169 -115.864 1.00 36.66  ? 586 ARG A N   1 
ATOM   3522 C CA  . ARG A 1 586 ? 72.088  -21.135 -116.937 1.00 34.93  ? 586 ARG A CA  1 
ATOM   3523 C C   . ARG A 1 586 ? 71.278  -20.525 -118.088 1.00 34.26  ? 586 ARG A C   1 
ATOM   3524 O O   . ARG A 1 586 ? 71.379  -20.978 -119.225 1.00 32.83  ? 586 ARG A O   1 
ATOM   3525 C CB  . ARG A 1 586 ? 71.381  -22.358 -116.356 1.00 32.10  ? 586 ARG A CB  1 
ATOM   3526 C CG  . ARG A 1 586 ? 71.109  -23.477 -117.330 1.00 38.92  ? 586 ARG A CG  1 
ATOM   3527 C CD  . ARG A 1 586 ? 70.823  -24.796 -116.609 1.00 41.54  ? 586 ARG A CD  1 
ATOM   3528 N NE  . ARG A 1 586 ? 69.950  -24.645 -115.433 1.00 50.28  ? 586 ARG A NE  1 
ATOM   3529 C CZ  . ARG A 1 586 ? 70.363  -24.542 -114.166 1.00 48.53  ? 586 ARG A CZ  1 
ATOM   3530 N NH1 . ARG A 1 586 ? 71.659  -24.558 -113.862 1.00 52.65  ? 586 ARG A NH1 1 
ATOM   3531 N NH2 . ARG A 1 586 ? 69.471  -24.413 -113.188 1.00 37.45  ? 586 ARG A NH2 1 
ATOM   3532 N N   . HIS A 1 587 ? 70.493  -19.491 -117.773 1.00 35.96  ? 587 HIS A N   1 
ATOM   3533 C CA  . HIS A 1 587 ? 69.723  -18.716 -118.754 1.00 35.53  ? 587 HIS A CA  1 
ATOM   3534 C C   . HIS A 1 587 ? 70.434  -17.438 -119.232 1.00 35.25  ? 587 HIS A C   1 
ATOM   3535 O O   . HIS A 1 587 ? 69.841  -16.621 -119.944 1.00 37.10  ? 587 HIS A O   1 
ATOM   3536 C CB  . HIS A 1 587 ? 68.367  -18.321 -118.149 1.00 36.11  ? 587 HIS A CB  1 
ATOM   3537 C CG  . HIS A 1 587 ? 67.370  -19.438 -118.107 1.00 38.46  ? 587 HIS A CG  1 
ATOM   3538 N ND1 . HIS A 1 587 ? 66.200  -19.416 -118.836 1.00 37.61  ? 587 HIS A ND1 1 
ATOM   3539 C CD2 . HIS A 1 587 ? 67.362  -20.602 -117.417 1.00 31.84  ? 587 HIS A CD2 1 
ATOM   3540 C CE1 . HIS A 1 587 ? 65.516  -20.520 -118.600 1.00 33.85  ? 587 HIS A CE1 1 
ATOM   3541 N NE2 . HIS A 1 587 ? 66.200  -21.258 -117.744 1.00 30.86  ? 587 HIS A NE2 1 
ATOM   3542 N N   . GLY A 1 588 ? 71.687  -17.250 -118.834 1.00 34.89  ? 588 GLY A N   1 
ATOM   3543 C CA  . GLY A 1 588 ? 72.446  -16.053 -119.208 1.00 34.24  ? 588 GLY A CA  1 
ATOM   3544 C C   . GLY A 1 588 ? 71.850  -14.737 -118.734 1.00 33.18  ? 588 GLY A C   1 
ATOM   3545 O O   . GLY A 1 588 ? 72.017  -13.706 -119.385 1.00 39.90  ? 588 GLY A O   1 
ATOM   3546 N N   . VAL A 1 589 ? 71.166  -14.766 -117.594 1.00 33.51  ? 589 VAL A N   1 
ATOM   3547 C CA  . VAL A 1 589 ? 70.549  -13.570 -117.023 1.00 30.69  ? 589 VAL A CA  1 
ATOM   3548 C C   . VAL A 1 589 ? 71.378  -13.043 -115.857 1.00 29.72  ? 589 VAL A C   1 
ATOM   3549 O O   . VAL A 1 589 ? 71.341  -13.606 -114.761 1.00 31.22  ? 589 VAL A O   1 
ATOM   3550 C CB  . VAL A 1 589 ? 69.127  -13.869 -116.539 1.00 29.43  ? 589 VAL A CB  1 
ATOM   3551 C CG1 . VAL A 1 589 ? 68.573  -12.695 -115.733 1.00 22.24  ? 589 VAL A CG1 1 
ATOM   3552 C CG2 . VAL A 1 589 ? 68.242  -14.202 -117.736 1.00 24.39  ? 589 VAL A CG2 1 
ATOM   3553 N N   . SER A 1 590 ? 72.118  -11.961 -116.097 1.00 26.06  ? 590 SER A N   1 
ATOM   3554 C CA  . SER A 1 590 ? 72.992  -11.396 -115.077 1.00 25.22  ? 590 SER A CA  1 
ATOM   3555 C C   . SER A 1 590 ? 72.171  -11.000 -113.874 1.00 28.10  ? 590 SER A C   1 
ATOM   3556 O O   . SER A 1 590 ? 71.034  -10.551 -114.007 1.00 26.59  ? 590 SER A O   1 
ATOM   3557 C CB  . SER A 1 590 ? 73.758  -10.185 -115.603 1.00 20.93  ? 590 SER A CB  1 
ATOM   3558 O OG  . SER A 1 590 ? 72.885  -9.175  -116.046 1.00 27.49  ? 590 SER A OG  1 
ATOM   3559 N N   . HIS A 1 591 ? 72.754  -11.183 -112.696 1.00 32.16  ? 591 HIS A N   1 
ATOM   3560 C CA  . HIS A 1 591 ? 72.039  -10.961 -111.458 1.00 31.79  ? 591 HIS A CA  1 
ATOM   3561 C C   . HIS A 1 591 ? 72.973  -10.835 -110.260 1.00 34.52  ? 591 HIS A C   1 
ATOM   3562 O O   . HIS A 1 591 ? 74.109  -11.306 -110.298 1.00 35.09  ? 591 HIS A O   1 
ATOM   3563 C CB  . HIS A 1 591 ? 71.098  -12.131 -111.225 1.00 33.05  ? 591 HIS A CB  1 
ATOM   3564 C CG  . HIS A 1 591 ? 71.810  -13.429 -111.039 1.00 27.93  ? 591 HIS A CG  1 
ATOM   3565 N ND1 . HIS A 1 591 ? 72.434  -14.086 -112.074 1.00 30.02  ? 591 HIS A ND1 1 
ATOM   3566 C CD2 . HIS A 1 591 ? 72.017  -14.182 -109.934 1.00 26.80  ? 591 HIS A CD2 1 
ATOM   3567 C CE1 . HIS A 1 591 ? 72.983  -15.197 -111.618 1.00 30.89  ? 591 HIS A CE1 1 
ATOM   3568 N NE2 . HIS A 1 591 ? 72.746  -15.278 -110.322 1.00 23.65  ? 591 HIS A NE2 1 
ATOM   3569 N N   . LYS A 1 592 ? 72.476  -10.212 -109.193 1.00 38.57  ? 592 LYS A N   1 
ATOM   3570 C CA  . LYS A 1 592 ? 73.227  -10.093 -107.949 1.00 38.41  ? 592 LYS A CA  1 
ATOM   3571 C C   . LYS A 1 592 ? 72.307  -10.308 -106.756 1.00 36.40  ? 592 LYS A C   1 
ATOM   3572 O O   . LYS A 1 592 ? 71.280  -9.633  -106.637 1.00 39.34  ? 592 LYS A O   1 
ATOM   3573 C CB  . LYS A 1 592 ? 73.905  -8.724  -107.858 1.00 42.71  ? 592 LYS A CB  1 
ATOM   3574 C CG  . LYS A 1 592 ? 74.934  -8.624  -106.728 1.00 47.28  ? 592 LYS A CG  1 
ATOM   3575 C CD  . LYS A 1 592 ? 76.093  -7.688  -107.081 1.00 51.55  ? 592 LYS A CD  1 
ATOM   3576 C CE  . LYS A 1 592 ? 77.222  -7.753  -106.038 1.00 56.57  ? 592 LYS A CE  1 
ATOM   3577 N NZ  . LYS A 1 592 ? 78.539  -7.255  -106.574 1.00 58.11  ? 592 LYS A NZ  1 
ATOM   3578 N N   . VAL A 1 593 ? 72.688  -11.244 -105.880 1.00 32.71  ? 593 VAL A N   1 
ATOM   3579 C CA  . VAL A 1 593 ? 71.887  -11.596 -104.703 1.00 29.28  ? 593 VAL A CA  1 
ATOM   3580 C C   . VAL A 1 593 ? 72.078  -10.518 -103.648 1.00 25.87  ? 593 VAL A C   1 
ATOM   3581 O O   . VAL A 1 593 ? 73.203  -10.273 -103.218 1.00 19.52  ? 593 VAL A O   1 
ATOM   3582 C CB  . VAL A 1 593 ? 72.269  -12.985 -104.119 1.00 21.88  ? 593 VAL A CB  1 
ATOM   3583 C CG1 . VAL A 1 593 ? 71.405  -13.328 -102.933 1.00 8.67   ? 593 VAL A CG1 1 
ATOM   3584 C CG2 . VAL A 1 593 ? 72.104  -14.060 -105.160 1.00 23.01  ? 593 VAL A CG2 1 
ATOM   3585 N N   . ASP A 1 594 ? 70.974  -9.886  -103.243 1.00 30.47  ? 594 ASP A N   1 
ATOM   3586 C CA  . ASP A 1 594 ? 71.017  -8.696  -102.391 1.00 33.56  ? 594 ASP A CA  1 
ATOM   3587 C C   . ASP A 1 594 ? 71.256  -9.052  -100.929 1.00 31.64  ? 594 ASP A C   1 
ATOM   3588 O O   . ASP A 1 594 ? 70.474  -9.788  -100.340 1.00 28.17  ? 594 ASP A O   1 
ATOM   3589 C CB  . ASP A 1 594 ? 69.717  -7.896  -102.527 1.00 36.36  ? 594 ASP A CB  1 
ATOM   3590 C CG  . ASP A 1 594 ? 69.821  -6.497  -101.933 1.00 39.83  ? 594 ASP A CG  1 
ATOM   3591 O OD1 . ASP A 1 594 ? 69.226  -5.557  -102.501 1.00 54.14  ? 594 ASP A OD1 1 
ATOM   3592 O OD2 . ASP A 1 594 ? 70.494  -6.329  -100.898 1.00 42.20  ? 594 ASP A OD2 1 
ATOM   3593 N N   . ASP A 1 595 ? 72.336  -8.514  -100.357 1.00 36.17  ? 595 ASP A N   1 
ATOM   3594 C CA  . ASP A 1 595 ? 72.699  -8.745  -98.956  1.00 41.08  ? 595 ASP A CA  1 
ATOM   3595 C C   . ASP A 1 595 ? 72.662  -7.452  -98.143  1.00 41.15  ? 595 ASP A C   1 
ATOM   3596 O O   . ASP A 1 595 ? 73.414  -7.298  -97.184  1.00 42.26  ? 595 ASP A O   1 
ATOM   3597 C CB  . ASP A 1 595 ? 74.100  -9.361  -98.875  1.00 47.35  ? 595 ASP A CB  1 
ATOM   3598 C CG  . ASP A 1 595 ? 74.148  -10.781 -99.407  1.00 64.04  ? 595 ASP A CG  1 
ATOM   3599 O OD1 . ASP A 1 595 ? 73.174  -11.539 -99.195  1.00 79.17  ? 595 ASP A OD1 1 
ATOM   3600 O OD2 . ASP A 1 595 ? 75.173  -11.145 -100.027 1.00 74.71  ? 595 ASP A OD2 1 
ATOM   3601 N N   . SER A 1 596 ? 71.771  -6.536  -98.514  1.00 43.45  ? 596 SER A N   1 
ATOM   3602 C CA  . SER A 1 596 ? 71.689  -5.227  -97.873  1.00 42.60  ? 596 SER A CA  1 
ATOM   3603 C C   . SER A 1 596 ? 70.713  -5.243  -96.708  1.00 41.93  ? 596 SER A C   1 
ATOM   3604 O O   . SER A 1 596 ? 69.806  -6.073  -96.656  1.00 40.43  ? 596 SER A O   1 
ATOM   3605 C CB  . SER A 1 596 ? 71.253  -4.169  -98.883  1.00 44.44  ? 596 SER A CB  1 
ATOM   3606 O OG  . SER A 1 596 ? 71.364  -2.875  -98.325  1.00 56.73  ? 596 SER A OG  1 
ATOM   3607 N N   . SER A 1 597 ? 70.912  -4.322  -95.770  1.00 44.42  ? 597 SER A N   1 
ATOM   3608 C CA  . SER A 1 597 ? 70.003  -4.167  -94.637  1.00 45.07  ? 597 SER A CA  1 
ATOM   3609 C C   . SER A 1 597 ? 68.833  -3.296  -95.071  1.00 45.39  ? 597 SER A C   1 
ATOM   3610 O O   . SER A 1 597 ? 68.887  -2.660  -96.122  1.00 47.34  ? 597 SER A O   1 
ATOM   3611 C CB  . SER A 1 597 ? 70.726  -3.526  -93.452  1.00 46.70  ? 597 SER A CB  1 
ATOM   3612 O OG  . SER A 1 597 ? 71.313  -2.292  -93.832  1.00 49.87  ? 597 SER A OG  1 
ATOM   3613 N N   . GLY A 1 598 ? 67.773  -3.275  -94.268  1.00 42.48  ? 598 GLY A N   1 
ATOM   3614 C CA  . GLY A 1 598 ? 66.625  -2.407  -94.537  1.00 39.14  ? 598 GLY A CA  1 
ATOM   3615 C C   . GLY A 1 598 ? 65.472  -3.125  -95.208  1.00 35.16  ? 598 GLY A C   1 
ATOM   3616 O O   . GLY A 1 598 ? 65.621  -4.249  -95.691  1.00 37.06  ? 598 GLY A O   1 
ATOM   3617 N N   . SER A 1 599 ? 64.321  -2.459  -95.253  1.00 29.69  ? 599 SER A N   1 
ATOM   3618 C CA  . SER A 1 599 ? 63.096  -3.097  -95.715  1.00 30.75  ? 599 SER A CA  1 
ATOM   3619 C C   . SER A 1 599 ? 63.177  -3.508  -97.175  1.00 31.58  ? 599 SER A C   1 
ATOM   3620 O O   . SER A 1 599 ? 63.899  -2.908  -97.973  1.00 28.30  ? 599 SER A O   1 
ATOM   3621 C CB  . SER A 1 599 ? 61.878  -2.188  -95.506  1.00 28.57  ? 599 SER A CB  1 
ATOM   3622 O OG  . SER A 1 599 ? 61.759  -1.218  -96.530  1.00 22.51  ? 599 SER A OG  1 
ATOM   3623 N N   . ILE A 1 600 ? 62.419  -4.546  -97.504  1.00 35.40  ? 600 ILE A N   1 
ATOM   3624 C CA  . ILE A 1 600 ? 62.228  -4.980  -98.879  1.00 35.88  ? 600 ILE A CA  1 
ATOM   3625 C C   . ILE A 1 600 ? 62.078  -3.777  -99.833  1.00 36.98  ? 600 ILE A C   1 
ATOM   3626 O O   . ILE A 1 600 ? 62.722  -3.728  -100.883 1.00 43.92  ? 600 ILE A O   1 
ATOM   3627 C CB  . ILE A 1 600 ? 61.007  -5.949  -98.971  1.00 36.84  ? 600 ILE A CB  1 
ATOM   3628 C CG1 . ILE A 1 600 ? 60.838  -6.486  -100.388 1.00 37.76  ? 600 ILE A CG1 1 
ATOM   3629 C CG2 . ILE A 1 600 ? 59.717  -5.279  -98.463  1.00 45.65  ? 600 ILE A CG2 1 
ATOM   3630 C CD1 . ILE A 1 600 ? 62.003  -7.337  -100.843 1.00 49.29  ? 600 ILE A CD1 1 
ATOM   3631 N N   . GLY A 1 601 ? 61.267  -2.795  -99.447  1.00 35.69  ? 601 GLY A N   1 
ATOM   3632 C CA  . GLY A 1 601 ? 61.036  -1.611  -100.273 1.00 33.98  ? 601 GLY A CA  1 
ATOM   3633 C C   . GLY A 1 601 ? 62.265  -0.743  -100.472 1.00 30.93  ? 601 GLY A C   1 
ATOM   3634 O O   . GLY A 1 601 ? 62.570  -0.340  -101.593 1.00 29.13  ? 601 GLY A O   1 
ATOM   3635 N N   . ARG A 1 602 ? 62.976  -0.468  -99.383  1.00 31.05  ? 602 ARG A N   1 
ATOM   3636 C CA  . ARG A 1 602 ? 64.172  0.376   -99.431  1.00 35.78  ? 602 ARG A CA  1 
ATOM   3637 C C   . ARG A 1 602 ? 65.307  -0.309  -100.196 1.00 36.24  ? 602 ARG A C   1 
ATOM   3638 O O   . ARG A 1 602 ? 66.108  0.351   -100.862 1.00 34.27  ? 602 ARG A O   1 
ATOM   3639 C CB  . ARG A 1 602 ? 64.633  0.739   -98.015  1.00 34.81  ? 602 ARG A CB  1 
ATOM   3640 C CG  . ARG A 1 602 ? 65.240  2.131   -97.883  1.00 39.07  ? 602 ARG A CG  1 
ATOM   3641 C CD  . ARG A 1 602 ? 65.444  2.500   -96.417  1.00 46.16  ? 602 ARG A CD  1 
ATOM   3642 N NE  . ARG A 1 602 ? 66.547  1.743   -95.816  1.00 56.32  ? 602 ARG A NE  1 
ATOM   3643 C CZ  . ARG A 1 602 ? 66.737  1.560   -94.507  1.00 57.02  ? 602 ARG A CZ  1 
ATOM   3644 N NH1 . ARG A 1 602 ? 65.896  2.067   -93.606  1.00 59.05  ? 602 ARG A NH1 1 
ATOM   3645 N NH2 . ARG A 1 602 ? 67.783  0.851   -94.095  1.00 53.18  ? 602 ARG A NH2 1 
ATOM   3646 N N   . ARG A 1 603 ? 65.367  -1.634  -100.101 1.00 39.11  ? 603 ARG A N   1 
ATOM   3647 C CA  . ARG A 1 603 ? 66.384  -2.405  -100.810 1.00 39.11  ? 603 ARG A CA  1 
ATOM   3648 C C   . ARG A 1 603 ? 66.215  -2.267  -102.315 1.00 38.51  ? 603 ARG A C   1 
ATOM   3649 O O   . ARG A 1 603 ? 67.193  -2.051  -103.031 1.00 36.71  ? 603 ARG A O   1 
ATOM   3650 C CB  . ARG A 1 603 ? 66.337  -3.875  -100.394 1.00 40.92  ? 603 ARG A CB  1 
ATOM   3651 C CG  . ARG A 1 603 ? 66.721  -4.095  -98.928  1.00 43.05  ? 603 ARG A CG  1 
ATOM   3652 C CD  . ARG A 1 603 ? 67.466  -5.397  -98.717  1.00 42.19  ? 603 ARG A CD  1 
ATOM   3653 N NE  . ARG A 1 603 ? 66.576  -6.528  -98.466  1.00 37.82  ? 603 ARG A NE  1 
ATOM   3654 C CZ  . ARG A 1 603 ? 66.875  -7.803  -98.715  1.00 41.18  ? 603 ARG A CZ  1 
ATOM   3655 N NH1 . ARG A 1 603 ? 68.041  -8.154  -99.255  1.00 38.80  ? 603 ARG A NH1 1 
ATOM   3656 N NH2 . ARG A 1 603 ? 65.985  -8.745  -98.440  1.00 45.47  ? 603 ARG A NH2 1 
ATOM   3657 N N   . TYR A 1 604 ? 64.975  -2.379  -102.788 1.00 37.12  ? 604 TYR A N   1 
ATOM   3658 C CA  . TYR A 1 604 ? 64.682  -2.156  -104.204 1.00 37.11  ? 604 TYR A CA  1 
ATOM   3659 C C   . TYR A 1 604 ? 64.980  -0.705  -104.624 1.00 36.10  ? 604 TYR A C   1 
ATOM   3660 O O   . TYR A 1 604 ? 65.503  -0.473  -105.707 1.00 35.27  ? 604 TYR A O   1 
ATOM   3661 C CB  . TYR A 1 604 ? 63.232  -2.544  -104.546 1.00 37.04  ? 604 TYR A CB  1 
ATOM   3662 C CG  . TYR A 1 604 ? 63.036  -4.029  -104.787 1.00 31.72  ? 604 TYR A CG  1 
ATOM   3663 C CD1 . TYR A 1 604 ? 63.756  -4.684  -105.769 1.00 43.01  ? 604 TYR A CD1 1 
ATOM   3664 C CD2 . TYR A 1 604 ? 62.127  -4.774  -104.045 1.00 30.49  ? 604 TYR A CD2 1 
ATOM   3665 C CE1 . TYR A 1 604 ? 63.588  -6.045  -106.007 1.00 45.36  ? 604 TYR A CE1 1 
ATOM   3666 C CE2 . TYR A 1 604 ? 61.949  -6.142  -104.274 1.00 33.12  ? 604 TYR A CE2 1 
ATOM   3667 C CZ  . TYR A 1 604 ? 62.686  -6.772  -105.263 1.00 38.65  ? 604 TYR A CZ  1 
ATOM   3668 O OH  . TYR A 1 604 ? 62.546  -8.123  -105.525 1.00 30.41  ? 604 TYR A OH  1 
ATOM   3669 N N   . ALA A 1 605 ? 64.672  0.262   -103.763 1.00 33.75  ? 605 ALA A N   1 
ATOM   3670 C CA  . ALA A 1 605 ? 65.017  1.663   -104.029 1.00 33.97  ? 605 ALA A CA  1 
ATOM   3671 C C   . ALA A 1 605 ? 66.452  1.800   -104.530 1.00 34.96  ? 605 ALA A C   1 
ATOM   3672 O O   . ALA A 1 605 ? 66.688  2.443   -105.547 1.00 35.39  ? 605 ALA A O   1 
ATOM   3673 C CB  . ALA A 1 605 ? 64.821  2.504   -102.787 1.00 29.10  ? 605 ALA A CB  1 
ATOM   3674 N N   . ARG A 1 606 ? 67.397  1.185   -103.816 1.00 40.51  ? 606 ARG A N   1 
ATOM   3675 C CA  . ARG A 1 606 ? 68.821  1.189   -104.203 1.00 41.45  ? 606 ARG A CA  1 
ATOM   3676 C C   . ARG A 1 606 ? 69.045  0.519   -105.562 1.00 40.49  ? 606 ARG A C   1 
ATOM   3677 O O   . ARG A 1 606 ? 69.686  1.077   -106.452 1.00 38.31  ? 606 ARG A O   1 
ATOM   3678 C CB  . ARG A 1 606 ? 69.676  0.471   -103.149 1.00 43.40  ? 606 ARG A CB  1 
ATOM   3679 C CG  . ARG A 1 606 ? 69.926  1.270   -101.885 1.00 45.30  ? 606 ARG A CG  1 
ATOM   3680 C CD  . ARG A 1 606 ? 70.094  0.366   -100.663 1.00 49.82  ? 606 ARG A CD  1 
ATOM   3681 N NE  . ARG A 1 606 ? 70.259  1.142   -99.427  1.00 57.11  ? 606 ARG A NE  1 
ATOM   3682 C CZ  . ARG A 1 606 ? 70.059  0.681   -98.188  1.00 56.49  ? 606 ARG A CZ  1 
ATOM   3683 N NH1 . ARG A 1 606 ? 69.670  -0.571  -97.977  1.00 55.63  ? 606 ARG A NH1 1 
ATOM   3684 N NH2 . ARG A 1 606 ? 70.244  1.484   -97.144  1.00 53.46  ? 606 ARG A NH2 1 
ATOM   3685 N N   . THR A 1 607 ? 68.533  -0.698  -105.693 1.00 38.33  ? 607 THR A N   1 
ATOM   3686 C CA  . THR A 1 607 ? 68.487  -1.393  -106.967 1.00 34.88  ? 607 THR A CA  1 
ATOM   3687 C C   . THR A 1 607 ? 68.065  -0.437  -108.080 1.00 36.51  ? 607 THR A C   1 
ATOM   3688 O O   . THR A 1 607 ? 68.776  -0.270  -109.068 1.00 32.40  ? 607 THR A O   1 
ATOM   3689 C CB  . THR A 1 607 ? 67.509  -2.583  -106.873 1.00 33.70  ? 607 THR A CB  1 
ATOM   3690 O OG1 . THR A 1 607 ? 68.253  -3.761  -106.570 1.00 29.18  ? 607 THR A OG1 1 
ATOM   3691 C CG2 . THR A 1 607 ? 66.698  -2.788  -108.170 1.00 36.65  ? 607 THR A CG2 1 
ATOM   3692 N N   . ASP A 1 608 ? 66.919  0.212   -107.884 1.00 38.87  ? 608 ASP A N   1 
ATOM   3693 C CA  . ASP A 1 608 ? 66.349  1.132   -108.872 1.00 34.22  ? 608 ASP A CA  1 
ATOM   3694 C C   . ASP A 1 608 ? 67.273  2.311   -109.130 1.00 30.84  ? 608 ASP A C   1 
ATOM   3695 O O   . ASP A 1 608 ? 67.400  2.762   -110.263 1.00 31.00  ? 608 ASP A O   1 
ATOM   3696 C CB  . ASP A 1 608 ? 64.993  1.680   -108.405 1.00 34.51  ? 608 ASP A CB  1 
ATOM   3697 C CG  . ASP A 1 608 ? 63.996  0.588   -108.043 1.00 35.86  ? 608 ASP A CG  1 
ATOM   3698 O OD1 . ASP A 1 608 ? 64.136  -0.572  -108.508 1.00 30.12  ? 608 ASP A OD1 1 
ATOM   3699 O OD2 . ASP A 1 608 ? 63.070  0.911   -107.277 1.00 29.12  ? 608 ASP A OD2 1 
ATOM   3700 N N   . GLU A 1 609 ? 67.916  2.804   -108.074 1.00 27.36  ? 609 GLU A N   1 
ATOM   3701 C CA  . GLU A 1 609 ? 68.799  3.963   -108.179 1.00 26.97  ? 609 GLU A CA  1 
ATOM   3702 C C   . GLU A 1 609 ? 69.914  3.732   -109.199 1.00 25.78  ? 609 GLU A C   1 
ATOM   3703 O O   . GLU A 1 609 ? 70.324  4.663   -109.892 1.00 27.78  ? 609 GLU A O   1 
ATOM   3704 C CB  . GLU A 1 609 ? 69.397  4.305   -106.812 1.00 25.53  ? 609 GLU A CB  1 
ATOM   3705 C CG  . GLU A 1 609 ? 70.169  5.617   -106.773 1.00 28.36  ? 609 GLU A CG  1 
ATOM   3706 C CD  . GLU A 1 609 ? 70.231  6.230   -105.384 1.00 26.60  ? 609 GLU A CD  1 
ATOM   3707 O OE1 . GLU A 1 609 ? 71.074  5.807   -104.575 1.00 23.70  ? 609 GLU A OE1 1 
ATOM   3708 O OE2 . GLU A 1 609 ? 69.441  7.155   -105.104 1.00 33.34  ? 609 GLU A OE2 1 
ATOM   3709 N N   . ILE A 1 610 ? 70.387  2.491   -109.287 1.00 24.69  ? 610 ILE A N   1 
ATOM   3710 C CA  . ILE A 1 610 ? 71.412  2.112   -110.262 1.00 24.03  ? 610 ILE A CA  1 
ATOM   3711 C C   . ILE A 1 610 ? 70.827  1.372   -111.478 1.00 25.55  ? 610 ILE A C   1 
ATOM   3712 O O   . ILE A 1 610 ? 71.569  0.804   -112.274 1.00 22.87  ? 610 ILE A O   1 
ATOM   3713 C CB  . ILE A 1 610 ? 72.538  1.255   -109.614 1.00 24.32  ? 610 ILE A CB  1 
ATOM   3714 C CG1 . ILE A 1 610 ? 71.998  -0.085  -109.100 1.00 20.21  ? 610 ILE A CG1 1 
ATOM   3715 C CG2 . ILE A 1 610 ? 73.207  2.024   -108.487 1.00 15.93  ? 610 ILE A CG2 1 
ATOM   3716 C CD1 . ILE A 1 610 ? 73.033  -1.170  -109.097 1.00 19.93  ? 610 ILE A CD1 1 
ATOM   3717 N N   . GLY A 1 611 ? 69.503  1.362   -111.602 1.00 25.41  ? 611 GLY A N   1 
ATOM   3718 C CA  . GLY A 1 611 ? 68.836  0.927   -112.828 1.00 27.37  ? 611 GLY A CA  1 
ATOM   3719 C C   . GLY A 1 611 ? 68.754  -0.563  -113.130 1.00 30.64  ? 611 GLY A C   1 
ATOM   3720 O O   . GLY A 1 611 ? 68.768  -0.947  -114.300 1.00 36.39  ? 611 GLY A O   1 
ATOM   3721 N N   . VAL A 1 612 ? 68.646  -1.404  -112.101 1.00 31.39  ? 612 VAL A N   1 
ATOM   3722 C CA  . VAL A 1 612 ? 68.486  -2.853  -112.303 1.00 31.82  ? 612 VAL A CA  1 
ATOM   3723 C C   . VAL A 1 612 ? 67.071  -3.162  -112.796 1.00 34.99  ? 612 VAL A C   1 
ATOM   3724 O O   . VAL A 1 612 ? 66.092  -2.798  -112.142 1.00 39.54  ? 612 VAL A O   1 
ATOM   3725 C CB  . VAL A 1 612 ? 68.756  -3.647  -111.007 1.00 31.17  ? 612 VAL A CB  1 
ATOM   3726 C CG1 . VAL A 1 612 ? 68.495  -5.131  -111.223 1.00 30.26  ? 612 VAL A CG1 1 
ATOM   3727 C CG2 . VAL A 1 612 ? 70.185  -3.415  -110.515 1.00 28.25  ? 612 VAL A CG2 1 
ATOM   3728 N N   . ALA A 1 613 ? 66.969  -3.848  -113.933 1.00 35.11  ? 613 ALA A N   1 
ATOM   3729 C CA  . ALA A 1 613 ? 65.687  -4.010  -114.647 1.00 36.59  ? 613 ALA A CA  1 
ATOM   3730 C C   . ALA A 1 613 ? 64.590  -4.761  -113.881 1.00 36.78  ? 613 ALA A C   1 
ATOM   3731 O O   . ALA A 1 613 ? 63.414  -4.416  -113.989 1.00 39.78  ? 613 ALA A O   1 
ATOM   3732 C CB  . ALA A 1 613 ? 65.920  -4.697  -115.991 1.00 34.47  ? 613 ALA A CB  1 
ATOM   3733 N N   . PHE A 1 614 ? 64.971  -5.797  -113.138 1.00 35.81  ? 614 PHE A N   1 
ATOM   3734 C CA  . PHE A 1 614 ? 63.998  -6.676  -112.495 1.00 36.18  ? 614 PHE A CA  1 
ATOM   3735 C C   . PHE A 1 614 ? 64.405  -7.066  -111.086 1.00 40.43  ? 614 PHE A C   1 
ATOM   3736 O O   . PHE A 1 614 ? 65.520  -6.781  -110.638 1.00 42.99  ? 614 PHE A O   1 
ATOM   3737 C CB  . PHE A 1 614 ? 63.806  -7.938  -113.328 1.00 34.70  ? 614 PHE A CB  1 
ATOM   3738 C CG  . PHE A 1 614 ? 63.309  -7.665  -114.704 1.00 35.73  ? 614 PHE A CG  1 
ATOM   3739 C CD1 . PHE A 1 614 ? 62.006  -7.222  -114.903 1.00 33.95  ? 614 PHE A CD1 1 
ATOM   3740 C CD2 . PHE A 1 614 ? 64.144  -7.826  -115.805 1.00 35.56  ? 614 PHE A CD2 1 
ATOM   3741 C CE1 . PHE A 1 614 ? 61.534  -6.956  -116.180 1.00 36.05  ? 614 PHE A CE1 1 
ATOM   3742 C CE2 . PHE A 1 614 ? 63.687  -7.560  -117.087 1.00 35.06  ? 614 PHE A CE2 1 
ATOM   3743 C CZ  . PHE A 1 614 ? 62.378  -7.123  -117.278 1.00 37.80  ? 614 PHE A CZ  1 
ATOM   3744 N N   . GLY A 1 615 ? 63.476  -7.713  -110.391 1.00 41.30  ? 615 GLY A N   1 
ATOM   3745 C CA  . GLY A 1 615 ? 63.733  -8.237  -109.055 1.00 39.23  ? 615 GLY A CA  1 
ATOM   3746 C C   . GLY A 1 615 ? 62.883  -9.450  -108.721 1.00 38.67  ? 615 GLY A C   1 
ATOM   3747 O O   . GLY A 1 615 ? 61.762  -9.600  -109.217 1.00 43.77  ? 615 GLY A O   1 
ATOM   3748 N N   . VAL A 1 616 ? 63.425  -10.317 -107.876 1.00 32.04  ? 616 VAL A N   1 
ATOM   3749 C CA  . VAL A 1 616 ? 62.708  -11.489 -107.407 1.00 28.17  ? 616 VAL A CA  1 
ATOM   3750 C C   . VAL A 1 616 ? 62.875  -11.620 -105.905 1.00 25.47  ? 616 VAL A C   1 
ATOM   3751 O O   . VAL A 1 616 ? 63.947  -11.980 -105.421 1.00 25.59  ? 616 VAL A O   1 
ATOM   3752 C CB  . VAL A 1 616 ? 63.216  -12.763 -108.083 1.00 26.31  ? 616 VAL A CB  1 
ATOM   3753 C CG1 . VAL A 1 616 ? 62.505  -13.982 -107.509 1.00 24.09  ? 616 VAL A CG1 1 
ATOM   3754 C CG2 . VAL A 1 616 ? 63.029  -12.662 -109.593 1.00 16.54  ? 616 VAL A CG2 1 
ATOM   3755 N N   . THR A 1 617 ? 61.814  -11.304 -105.172 1.00 29.81  ? 617 THR A N   1 
ATOM   3756 C CA  . THR A 1 617 ? 61.822  -11.440 -103.725 1.00 29.28  ? 617 THR A CA  1 
ATOM   3757 C C   . THR A 1 617 ? 61.531  -12.874 -103.333 1.00 28.11  ? 617 THR A C   1 
ATOM   3758 O O   . THR A 1 617 ? 60.586  -13.477 -103.843 1.00 29.62  ? 617 THR A O   1 
ATOM   3759 C CB  . THR A 1 617 ? 60.765  -10.564 -103.062 1.00 27.85  ? 617 THR A CB  1 
ATOM   3760 O OG1 . THR A 1 617 ? 60.860  -9.226  -103.564 1.00 27.36  ? 617 THR A OG1 1 
ATOM   3761 C CG2 . THR A 1 617 ? 60.976  -10.568 -101.555 1.00 28.86  ? 617 THR A CG2 1 
ATOM   3762 N N   . ILE A 1 618 ? 62.346  -13.408 -102.428 1.00 29.15  ? 618 ILE A N   1 
ATOM   3763 C CA  . ILE A 1 618 ? 62.113  -14.728 -101.840 1.00 32.22  ? 618 ILE A CA  1 
ATOM   3764 C C   . ILE A 1 618 ? 61.702  -14.544 -100.388 1.00 30.53  ? 618 ILE A C   1 
ATOM   3765 O O   . ILE A 1 618 ? 62.470  -14.033 -99.576  1.00 30.77  ? 618 ILE A O   1 
ATOM   3766 C CB  . ILE A 1 618 ? 63.373  -15.615 -101.893 1.00 34.47  ? 618 ILE A CB  1 
ATOM   3767 C CG1 . ILE A 1 618 ? 63.793  -15.870 -103.343 1.00 35.91  ? 618 ILE A CG1 1 
ATOM   3768 C CG2 . ILE A 1 618 ? 63.122  -16.936 -101.184 1.00 31.08  ? 618 ILE A CG2 1 
ATOM   3769 C CD1 . ILE A 1 618 ? 65.141  -16.542 -103.471 1.00 34.70  ? 618 ILE A CD1 1 
ATOM   3770 N N   . ASP A 1 619 ? 60.487  -14.962 -100.063 1.00 31.12  ? 619 ASP A N   1 
ATOM   3771 C CA  . ASP A 1 619 ? 59.961  -14.796 -98.711  1.00 29.21  ? 619 ASP A CA  1 
ATOM   3772 C C   . ASP A 1 619 ? 59.594  -16.141 -98.104  1.00 23.47  ? 619 ASP A C   1 
ATOM   3773 O O   . ASP A 1 619 ? 59.722  -17.176 -98.755  1.00 20.64  ? 619 ASP A O   1 
ATOM   3774 C CB  . ASP A 1 619 ? 58.763  -13.838 -98.717  1.00 31.78  ? 619 ASP A CB  1 
ATOM   3775 C CG  . ASP A 1 619 ? 57.671  -14.257 -99.679  1.00 27.63  ? 619 ASP A CG  1 
ATOM   3776 O OD1 . ASP A 1 619 ? 57.474  -15.473 -99.896  1.00 24.83  ? 619 ASP A OD1 1 
ATOM   3777 O OD2 . ASP A 1 619 ? 57.001  -13.351 -100.208 1.00 23.12  ? 619 ASP A OD2 1 
ATOM   3778 N N   . PHE A 1 620 ? 59.138  -16.121 -96.858  1.00 21.22  ? 620 PHE A N   1 
ATOM   3779 C CA  . PHE A 1 620 ? 58.879  -17.358 -96.132  1.00 22.39  ? 620 PHE A CA  1 
ATOM   3780 C C   . PHE A 1 620 ? 57.848  -18.231 -96.841  1.00 22.93  ? 620 PHE A C   1 
ATOM   3781 O O   . PHE A 1 620 ? 57.983  -19.452 -96.853  1.00 24.87  ? 620 PHE A O   1 
ATOM   3782 C CB  . PHE A 1 620 ? 58.426  -17.065 -94.708  1.00 20.44  ? 620 PHE A CB  1 
ATOM   3783 C CG  . PHE A 1 620 ? 59.502  -16.487 -93.833  1.00 18.72  ? 620 PHE A CG  1 
ATOM   3784 C CD1 . PHE A 1 620 ? 59.601  -15.115 -93.644  1.00 15.84  ? 620 PHE A CD1 1 
ATOM   3785 C CD2 . PHE A 1 620 ? 60.407  -17.316 -93.185  1.00 22.44  ? 620 PHE A CD2 1 
ATOM   3786 C CE1 . PHE A 1 620 ? 60.580  -14.580 -92.828  1.00 14.36  ? 620 PHE A CE1 1 
ATOM   3787 C CE2 . PHE A 1 620 ? 61.392  -16.787 -92.366  1.00 20.93  ? 620 PHE A CE2 1 
ATOM   3788 C CZ  . PHE A 1 620 ? 61.478  -15.415 -92.189  1.00 17.61  ? 620 PHE A CZ  1 
ATOM   3789 N N   . ASP A 1 621 ? 56.834  -17.610 -97.439  1.00 21.87  ? 621 ASP A N   1 
ATOM   3790 C CA  . ASP A 1 621 ? 55.858  -18.358 -98.235  1.00 22.53  ? 621 ASP A CA  1 
ATOM   3791 C C   . ASP A 1 621 ? 56.510  -19.083 -99.414  1.00 22.05  ? 621 ASP A C   1 
ATOM   3792 O O   . ASP A 1 621 ? 56.062  -20.160 -99.809  1.00 20.02  ? 621 ASP A O   1 
ATOM   3793 C CB  . ASP A 1 621 ? 54.734  -17.444 -98.736  1.00 23.66  ? 621 ASP A CB  1 
ATOM   3794 C CG  . ASP A 1 621 ? 53.639  -17.247 -97.708  1.00 24.76  ? 621 ASP A CG  1 
ATOM   3795 O OD1 . ASP A 1 621 ? 53.841  -17.593 -96.526  1.00 30.92  ? 621 ASP A OD1 1 
ATOM   3796 O OD2 . ASP A 1 621 ? 52.565  -16.747 -98.083  1.00 28.54  ? 621 ASP A OD2 1 
ATOM   3797 N N   . THR A 1 622 ? 57.562  -18.500 -99.978  1.00 20.43  ? 622 THR A N   1 
ATOM   3798 C CA  . THR A 1 622 ? 58.296  -19.182 -101.028 1.00 21.56  ? 622 THR A CA  1 
ATOM   3799 C C   . THR A 1 622 ? 58.921  -20.435 -100.448 1.00 23.40  ? 622 THR A C   1 
ATOM   3800 O O   . THR A 1 622 ? 58.761  -21.522 -100.994 1.00 26.85  ? 622 THR A O   1 
ATOM   3801 C CB  . THR A 1 622 ? 59.406  -18.317 -101.627 1.00 19.39  ? 622 THR A CB  1 
ATOM   3802 O OG1 . THR A 1 622 ? 58.881  -17.030 -101.971 1.00 15.63  ? 622 THR A OG1 1 
ATOM   3803 C CG2 . THR A 1 622 ? 59.975  -18.984 -102.865 1.00 19.38  ? 622 THR A CG2 1 
ATOM   3804 N N   . VAL A 1 623 ? 59.608  -20.270 -99.322  1.00 24.65  ? 623 VAL A N   1 
ATOM   3805 C CA  . VAL A 1 623 ? 60.387  -21.349 -98.718  1.00 24.42  ? 623 VAL A CA  1 
ATOM   3806 C C   . VAL A 1 623 ? 59.505  -22.425 -98.083  1.00 25.42  ? 623 VAL A C   1 
ATOM   3807 O O   . VAL A 1 623 ? 59.876  -23.599 -98.077  1.00 26.32  ? 623 VAL A O   1 
ATOM   3808 C CB  . VAL A 1 623 ? 61.377  -20.796 -97.652  1.00 24.61  ? 623 VAL A CB  1 
ATOM   3809 C CG1 . VAL A 1 623 ? 62.093  -21.933 -96.923  1.00 21.53  ? 623 VAL A CG1 1 
ATOM   3810 C CG2 . VAL A 1 623 ? 62.388  -19.836 -98.292  1.00 15.74  ? 623 VAL A CG2 1 
ATOM   3811 N N   . ASN A 1 624 ? 58.340  -22.030 -97.569  1.00 25.81  ? 624 ASN A N   1 
ATOM   3812 C CA  . ASN A 1 624 ? 57.502  -22.928 -96.763  1.00 26.27  ? 624 ASN A CA  1 
ATOM   3813 C C   . ASN A 1 624 ? 56.253  -23.455 -97.465  1.00 28.99  ? 624 ASN A C   1 
ATOM   3814 O O   . ASN A 1 624 ? 55.961  -24.643 -97.374  1.00 35.62  ? 624 ASN A O   1 
ATOM   3815 C CB  . ASN A 1 624 ? 57.117  -22.248 -95.451  1.00 22.10  ? 624 ASN A CB  1 
ATOM   3816 C CG  . ASN A 1 624 ? 58.311  -22.021 -94.555  1.00 18.44  ? 624 ASN A CG  1 
ATOM   3817 O OD1 . ASN A 1 624 ? 58.839  -22.956 -93.972  1.00 16.54  ? 624 ASN A OD1 1 
ATOM   3818 N ND2 . ASN A 1 624 ? 58.753  -20.778 -94.454  1.00 23.55  ? 624 ASN A ND2 1 
ATOM   3819 N N   . LYS A 1 625 ? 55.515  -22.593 -98.154  1.00 28.90  ? 625 LYS A N   1 
ATOM   3820 C CA  . LYS A 1 625 ? 54.308  -23.036 -98.850  1.00 30.37  ? 625 LYS A CA  1 
ATOM   3821 C C   . LYS A 1 625 ? 54.693  -23.816 -100.114 1.00 33.50  ? 625 LYS A C   1 
ATOM   3822 O O   . LYS A 1 625 ? 55.714  -23.522 -100.746 1.00 34.19  ? 625 LYS A O   1 
ATOM   3823 C CB  . LYS A 1 625 ? 53.412  -21.846 -99.218  1.00 31.11  ? 625 LYS A CB  1 
ATOM   3824 C CG  . LYS A 1 625 ? 52.962  -20.953 -98.047  1.00 29.32  ? 625 LYS A CG  1 
ATOM   3825 C CD  . LYS A 1 625 ? 51.679  -21.451 -97.380  1.00 30.70  ? 625 LYS A CD  1 
ATOM   3826 C CE  . LYS A 1 625 ? 50.753  -20.299 -96.981  1.00 31.02  ? 625 LYS A CE  1 
ATOM   3827 N NZ  . LYS A 1 625 ? 51.331  -19.411 -95.940  1.00 30.55  ? 625 LYS A NZ  1 
ATOM   3828 N N   . THR A 1 626 ? 53.879  -24.816 -100.461 1.00 36.56  ? 626 THR A N   1 
ATOM   3829 C CA  . THR A 1 626 ? 54.053  -25.594 -101.695 1.00 34.47  ? 626 THR A CA  1 
ATOM   3830 C C   . THR A 1 626 ? 52.791  -25.501 -102.566 1.00 34.56  ? 626 THR A C   1 
ATOM   3831 O O   . THR A 1 626 ? 51.685  -25.779 -102.085 1.00 35.40  ? 626 THR A O   1 
ATOM   3832 C CB  . THR A 1 626 ? 54.365  -27.074 -101.409 1.00 32.89  ? 626 THR A CB  1 
ATOM   3833 O OG1 . THR A 1 626 ? 54.723  -27.727 -102.632 1.00 26.94  ? 626 THR A OG1 1 
ATOM   3834 C CG2 . THR A 1 626 ? 53.160  -27.782 -100.774 1.00 34.22  ? 626 THR A CG2 1 
ATOM   3835 N N   . PRO A 1 627 ? 52.951  -25.129 -103.852 1.00 33.11  ? 627 PRO A N   1 
ATOM   3836 C CA  . PRO A 1 627 ? 54.226  -24.981 -104.561 1.00 36.85  ? 627 PRO A CA  1 
ATOM   3837 C C   . PRO A 1 627 ? 54.999  -23.735 -104.140 1.00 38.84  ? 627 PRO A C   1 
ATOM   3838 O O   . PRO A 1 627 ? 54.416  -22.784 -103.619 1.00 44.92  ? 627 PRO A O   1 
ATOM   3839 C CB  . PRO A 1 627 ? 53.815  -24.881 -106.041 1.00 36.26  ? 627 PRO A CB  1 
ATOM   3840 C CG  . PRO A 1 627 ? 52.327  -25.037 -106.072 1.00 37.05  ? 627 PRO A CG  1 
ATOM   3841 C CD  . PRO A 1 627 ? 51.816  -24.759 -104.708 1.00 32.60  ? 627 PRO A CD  1 
ATOM   3842 N N   . HIS A 1 628 ? 56.307  -23.757 -104.362 1.00 37.78  ? 628 HIS A N   1 
ATOM   3843 C CA  . HIS A 1 628 ? 57.177  -22.646 -103.985 1.00 36.08  ? 628 HIS A CA  1 
ATOM   3844 C C   . HIS A 1 628 ? 57.157  -21.573 -105.067 1.00 34.41  ? 628 HIS A C   1 
ATOM   3845 O O   . HIS A 1 628 ? 57.642  -21.798 -106.177 1.00 34.54  ? 628 HIS A O   1 
ATOM   3846 C CB  . HIS A 1 628 ? 58.611  -23.141 -103.779 1.00 36.34  ? 628 HIS A CB  1 
ATOM   3847 C CG  . HIS A 1 628 ? 58.722  -24.287 -102.821 1.00 37.68  ? 628 HIS A CG  1 
ATOM   3848 N ND1 . HIS A 1 628 ? 58.723  -24.118 -101.453 1.00 32.82  ? 628 HIS A ND1 1 
ATOM   3849 C CD2 . HIS A 1 628 ? 58.837  -25.619 -103.036 1.00 32.41  ? 628 HIS A CD2 1 
ATOM   3850 C CE1 . HIS A 1 628 ? 58.836  -25.296 -100.867 1.00 29.55  ? 628 HIS A CE1 1 
ATOM   3851 N NE2 . HIS A 1 628 ? 58.908  -26.223 -101.805 1.00 31.69  ? 628 HIS A NE2 1 
ATOM   3852 N N   . THR A 1 629 ? 56.602  -20.409 -104.737 1.00 33.92  ? 629 THR A N   1 
ATOM   3853 C CA  . THR A 1 629 ? 56.528  -19.278 -105.669 1.00 31.97  ? 629 THR A CA  1 
ATOM   3854 C C   . THR A 1 629 ? 57.223  -18.039 -105.074 1.00 32.10  ? 629 THR A C   1 
ATOM   3855 O O   . THR A 1 629 ? 57.364  -17.930 -103.859 1.00 35.54  ? 629 THR A O   1 
ATOM   3856 C CB  . THR A 1 629 ? 55.054  -18.950 -106.017 1.00 29.09  ? 629 THR A CB  1 
ATOM   3857 O OG1 . THR A 1 629 ? 54.438  -18.253 -104.933 1.00 24.50  ? 629 THR A OG1 1 
ATOM   3858 C CG2 . THR A 1 629 ? 54.265  -20.223 -106.287 1.00 21.23  ? 629 THR A CG2 1 
ATOM   3859 N N   . ALA A 1 630 ? 57.667  -17.120 -105.927 1.00 28.27  ? 630 ALA A N   1 
ATOM   3860 C CA  . ALA A 1 630 ? 58.300  -15.880 -105.471 1.00 29.82  ? 630 ALA A CA  1 
ATOM   3861 C C   . ALA A 1 630 ? 57.689  -14.687 -106.196 1.00 33.89  ? 630 ALA A C   1 
ATOM   3862 O O   . ALA A 1 630 ? 56.931  -14.871 -107.146 1.00 40.17  ? 630 ALA A O   1 
ATOM   3863 C CB  . ALA A 1 630 ? 59.787  -15.937 -105.710 1.00 27.12  ? 630 ALA A CB  1 
ATOM   3864 N N   . THR A 1 631 ? 58.004  -13.471 -105.748 1.00 31.92  ? 631 THR A N   1 
ATOM   3865 C CA  . THR A 1 631 ? 57.459  -12.265 -106.377 1.00 33.27  ? 631 THR A CA  1 
ATOM   3866 C C   . THR A 1 631 ? 58.414  -11.691 -107.420 1.00 37.40  ? 631 THR A C   1 
ATOM   3867 O O   . THR A 1 631 ? 59.586  -11.495 -107.134 1.00 42.09  ? 631 THR A O   1 
ATOM   3868 C CB  . THR A 1 631 ? 57.161  -11.169 -105.350 1.00 33.24  ? 631 THR A CB  1 
ATOM   3869 O OG1 . THR A 1 631 ? 56.084  -11.584 -104.500 1.00 36.50  ? 631 THR A OG1 1 
ATOM   3870 C CG2 . THR A 1 631 ? 56.768  -9.873  -106.055 1.00 25.89  ? 631 THR A CG2 1 
ATOM   3871 N N   . LEU A 1 632 ? 57.905  -11.423 -108.625 1.00 39.69  ? 632 LEU A N   1 
ATOM   3872 C CA  . LEU A 1 632 ? 58.670  -10.744 -109.675 1.00 35.57  ? 632 LEU A CA  1 
ATOM   3873 C C   . LEU A 1 632 ? 58.224  -9.291  -109.697 1.00 36.99  ? 632 LEU A C   1 
ATOM   3874 O O   . LEU A 1 632 ? 57.028  -9.018  -109.772 1.00 33.41  ? 632 LEU A O   1 
ATOM   3875 C CB  . LEU A 1 632 ? 58.431  -11.395 -111.049 1.00 36.20  ? 632 LEU A CB  1 
ATOM   3876 C CG  . LEU A 1 632 ? 59.173  -10.815 -112.268 1.00 36.25  ? 632 LEU A CG  1 
ATOM   3877 C CD1 . LEU A 1 632 ? 60.624  -10.576 -111.951 1.00 39.46  ? 632 LEU A CD1 1 
ATOM   3878 C CD2 . LEU A 1 632 ? 59.063  -11.716 -113.493 1.00 32.38  ? 632 LEU A CD2 1 
ATOM   3879 N N   . ARG A 1 633 ? 59.184  -8.369  -109.630 1.00 36.22  ? 633 ARG A N   1 
ATOM   3880 C CA  . ARG A 1 633 ? 58.904  -6.935  -109.563 1.00 34.39  ? 633 ARG A CA  1 
ATOM   3881 C C   . ARG A 1 633 ? 59.518  -6.223  -110.760 1.00 31.80  ? 633 ARG A C   1 
ATOM   3882 O O   . ARG A 1 633 ? 60.723  -6.319  -110.980 1.00 38.23  ? 633 ARG A O   1 
ATOM   3883 C CB  . ARG A 1 633 ? 59.490  -6.369  -108.268 1.00 35.63  ? 633 ARG A CB  1 
ATOM   3884 C CG  . ARG A 1 633 ? 59.297  -4.869  -108.052 1.00 36.65  ? 633 ARG A CG  1 
ATOM   3885 C CD  . ARG A 1 633 ? 60.146  -4.381  -106.877 1.00 38.44  ? 633 ARG A CD  1 
ATOM   3886 N NE  . ARG A 1 633 ? 60.117  -2.924  -106.742 1.00 41.30  ? 633 ARG A NE  1 
ATOM   3887 C CZ  . ARG A 1 633 ? 60.821  -2.070  -107.485 1.00 45.97  ? 633 ARG A CZ  1 
ATOM   3888 N NH1 . ARG A 1 633 ? 61.626  -2.499  -108.453 1.00 52.42  ? 633 ARG A NH1 1 
ATOM   3889 N NH2 . ARG A 1 633 ? 60.708  -0.768  -107.270 1.00 43.68  ? 633 ARG A NH2 1 
ATOM   3890 N N   . ASP A 1 634 ? 58.693  -5.507  -111.522 1.00 32.36  ? 634 ASP A N   1 
ATOM   3891 C CA  . ASP A 1 634 ? 59.166  -4.701  -112.657 1.00 35.20  ? 634 ASP A CA  1 
ATOM   3892 C C   . ASP A 1 634 ? 59.667  -3.337  -112.190 1.00 36.64  ? 634 ASP A C   1 
ATOM   3893 O O   . ASP A 1 634 ? 58.935  -2.591  -111.542 1.00 38.51  ? 634 ASP A O   1 
ATOM   3894 C CB  . ASP A 1 634 ? 58.051  -4.498  -113.694 1.00 35.66  ? 634 ASP A CB  1 
ATOM   3895 C CG  . ASP A 1 634 ? 58.401  -3.442  -114.743 1.00 40.07  ? 634 ASP A CG  1 
ATOM   3896 O OD1 . ASP A 1 634 ? 57.509  -2.633  -115.085 1.00 47.24  ? 634 ASP A OD1 1 
ATOM   3897 O OD2 . ASP A 1 634 ? 59.564  -3.411  -115.219 1.00 55.45  ? 634 ASP A OD2 1 
ATOM   3898 N N   . ARG A 1 635 ? 60.899  -3.002  -112.559 1.00 36.63  ? 635 ARG A N   1 
ATOM   3899 C CA  . ARG A 1 635 ? 61.517  -1.746  -112.137 1.00 36.04  ? 635 ARG A CA  1 
ATOM   3900 C C   . ARG A 1 635 ? 60.689  -0.514  -112.466 1.00 34.80  ? 635 ARG A C   1 
ATOM   3901 O O   . ARG A 1 635 ? 60.405  0.288   -111.582 1.00 34.47  ? 635 ARG A O   1 
ATOM   3902 C CB  . ARG A 1 635 ? 62.888  -1.582  -112.780 1.00 33.12  ? 635 ARG A CB  1 
ATOM   3903 C CG  . ARG A 1 635 ? 63.514  -0.213  -112.529 1.00 36.17  ? 635 ARG A CG  1 
ATOM   3904 C CD  . ARG A 1 635 ? 64.625  0.055   -113.498 1.00 40.51  ? 635 ARG A CD  1 
ATOM   3905 N NE  . ARG A 1 635 ? 64.111  0.146   -114.862 1.00 45.90  ? 635 ARG A NE  1 
ATOM   3906 C CZ  . ARG A 1 635 ? 64.843  -0.051  -115.949 1.00 41.27  ? 635 ARG A CZ  1 
ATOM   3907 N NH1 . ARG A 1 635 ? 66.131  -0.363  -115.838 1.00 36.49  ? 635 ARG A NH1 1 
ATOM   3908 N NH2 . ARG A 1 635 ? 64.280  0.059   -117.148 1.00 41.78  ? 635 ARG A NH2 1 
ATOM   3909 N N   . ASP A 1 636 ? 60.337  -0.366  -113.741 1.00 36.08  ? 636 ASP A N   1 
ATOM   3910 C CA  . ASP A 1 636 ? 59.696  0.851   -114.242 1.00 33.93  ? 636 ASP A CA  1 
ATOM   3911 C C   . ASP A 1 636 ? 58.329  1.091   -113.610 1.00 33.66  ? 636 ASP A C   1 
ATOM   3912 O O   . ASP A 1 636 ? 58.085  2.137   -113.009 1.00 31.92  ? 636 ASP A O   1 
ATOM   3913 C CB  . ASP A 1 636 ? 59.554  0.789   -115.768 1.00 35.03  ? 636 ASP A CB  1 
ATOM   3914 C CG  . ASP A 1 636 ? 60.845  1.128   -116.499 1.00 38.03  ? 636 ASP A CG  1 
ATOM   3915 O OD1 . ASP A 1 636 ? 61.854  1.472   -115.839 1.00 32.57  ? 636 ASP A OD1 1 
ATOM   3916 O OD2 . ASP A 1 636 ? 60.837  1.065   -117.750 1.00 36.16  ? 636 ASP A OD2 1 
ATOM   3917 N N   . SER A 1 637 ? 57.437  0.119   -113.749 1.00 34.82  ? 637 SER A N   1 
ATOM   3918 C CA  . SER A 1 637 ? 56.096  0.232   -113.177 1.00 32.84  ? 637 SER A CA  1 
ATOM   3919 C C   . SER A 1 637 ? 56.087  0.095   -111.654 1.00 30.75  ? 637 SER A C   1 
ATOM   3920 O O   . SER A 1 637 ? 55.174  0.583   -111.005 1.00 28.64  ? 637 SER A O   1 
ATOM   3921 C CB  . SER A 1 637 ? 55.190  -0.841  -113.766 1.00 30.27  ? 637 SER A CB  1 
ATOM   3922 O OG  . SER A 1 637 ? 55.599  -2.118  -113.322 1.00 31.89  ? 637 SER A OG  1 
ATOM   3923 N N   . MET A 1 638 ? 57.096  -0.580  -111.101 1.00 32.89  ? 638 MET A N   1 
ATOM   3924 C CA  . MET A 1 638 ? 57.103  -1.026  -109.696 1.00 33.25  ? 638 MET A CA  1 
ATOM   3925 C C   . MET A 1 638 ? 56.046  -2.095  -109.407 1.00 33.30  ? 638 MET A C   1 
ATOM   3926 O O   . MET A 1 638 ? 55.822  -2.445  -108.246 1.00 31.08  ? 638 MET A O   1 
ATOM   3927 C CB  . MET A 1 638 ? 56.933  0.142   -108.722 1.00 33.00  ? 638 MET A CB  1 
ATOM   3928 C CG  . MET A 1 638 ? 58.039  1.164   -108.791 1.00 36.00  ? 638 MET A CG  1 
ATOM   3929 S SD  . MET A 1 638 ? 57.956  2.322   -107.418 1.00 34.84  ? 638 MET A SD  1 
ATOM   3930 C CE  . MET A 1 638 ? 58.294  1.240   -106.021 1.00 44.17  ? 638 MET A CE  1 
ATOM   3931 N N   . ARG A 1 639 ? 55.421  -2.629  -110.458 1.00 32.86  ? 639 ARG A N   1 
ATOM   3932 C CA  . ARG A 1 639 ? 54.360  -3.614  -110.300 1.00 30.79  ? 639 ARG A CA  1 
ATOM   3933 C C   . ARG A 1 639 ? 54.969  -4.969  -110.036 1.00 30.53  ? 639 ARG A C   1 
ATOM   3934 O O   . ARG A 1 639 ? 56.154  -5.176  -110.272 1.00 32.35  ? 639 ARG A O   1 
ATOM   3935 C CB  . ARG A 1 639 ? 53.470  -3.678  -111.541 1.00 30.97  ? 639 ARG A CB  1 
ATOM   3936 C CG  . ARG A 1 639 ? 52.548  -2.492  -111.685 1.00 26.59  ? 639 ARG A CG  1 
ATOM   3937 C CD  . ARG A 1 639 ? 51.654  -2.611  -112.904 1.00 26.27  ? 639 ARG A CD  1 
ATOM   3938 N NE  . ARG A 1 639 ? 50.392  -1.899  -112.696 1.00 25.02  ? 639 ARG A NE  1 
ATOM   3939 C CZ  . ARG A 1 639 ? 49.209  -2.464  -112.447 1.00 26.68  ? 639 ARG A CZ  1 
ATOM   3940 N NH1 . ARG A 1 639 ? 49.069  -3.783  -112.378 1.00 31.06  ? 639 ARG A NH1 1 
ATOM   3941 N NH2 . ARG A 1 639 ? 48.140  -1.693  -112.274 1.00 34.83  ? 639 ARG A NH2 1 
ATOM   3942 N N   . GLN A 1 640 ? 54.145  -5.887  -109.545 1.00 33.84  ? 640 GLN A N   1 
ATOM   3943 C CA  . GLN A 1 640 ? 54.609  -7.200  -109.137 1.00 34.26  ? 640 GLN A CA  1 
ATOM   3944 C C   . GLN A 1 640 ? 53.655  -8.314  -109.544 1.00 35.46  ? 640 GLN A C   1 
ATOM   3945 O O   . GLN A 1 640 ? 52.466  -8.087  -109.774 1.00 36.92  ? 640 GLN A O   1 
ATOM   3946 C CB  . GLN A 1 640 ? 54.789  -7.237  -107.623 1.00 38.00  ? 640 GLN A CB  1 
ATOM   3947 C CG  . GLN A 1 640 ? 55.881  -6.331  -107.085 1.00 34.33  ? 640 GLN A CG  1 
ATOM   3948 C CD  . GLN A 1 640 ? 56.012  -6.414  -105.577 1.00 32.10  ? 640 GLN A CD  1 
ATOM   3949 O OE1 . GLN A 1 640 ? 57.098  -6.232  -105.036 1.00 34.16  ? 640 GLN A OE1 1 
ATOM   3950 N NE2 . GLN A 1 640 ? 54.902  -6.691  -104.890 1.00 32.16  ? 640 GLN A NE2 1 
ATOM   3951 N N   . ILE A 1 641 ? 54.206  -9.523  -109.593 1.00 38.47  ? 641 ILE A N   1 
ATOM   3952 C CA  . ILE A 1 641 ? 53.498  -10.729 -110.003 1.00 36.99  ? 641 ILE A CA  1 
ATOM   3953 C C   . ILE A 1 641 ? 54.004  -11.883 -109.136 1.00 38.47  ? 641 ILE A C   1 
ATOM   3954 O O   . ILE A 1 641 ? 55.043  -11.762 -108.491 1.00 42.73  ? 641 ILE A O   1 
ATOM   3955 C CB  . ILE A 1 641 ? 53.763  -11.026 -111.509 1.00 37.47  ? 641 ILE A CB  1 
ATOM   3956 C CG1 . ILE A 1 641 ? 52.482  -11.476 -112.207 1.00 45.10  ? 641 ILE A CG1 1 
ATOM   3957 C CG2 . ILE A 1 641 ? 54.894  -12.059 -111.693 1.00 24.07  ? 641 ILE A CG2 1 
ATOM   3958 C CD1 . ILE A 1 641 ? 51.367  -10.442 -112.184 1.00 47.39  ? 641 ILE A CD1 1 
ATOM   3959 N N   . ARG A 1 642 ? 53.281  -12.995 -109.117 1.00 37.60  ? 642 ARG A N   1 
ATOM   3960 C CA  . ARG A 1 642 ? 53.685  -14.150 -108.318 1.00 37.07  ? 642 ARG A CA  1 
ATOM   3961 C C   . ARG A 1 642 ? 53.645  -15.410 -109.174 1.00 38.27  ? 642 ARG A C   1 
ATOM   3962 O O   . ARG A 1 642 ? 52.597  -15.766 -109.717 1.00 38.60  ? 642 ARG A O   1 
ATOM   3963 C CB  . ARG A 1 642 ? 52.759  -14.297 -107.114 1.00 37.21  ? 642 ARG A CB  1 
ATOM   3964 C CG  . ARG A 1 642 ? 53.201  -15.334 -106.094 1.00 38.30  ? 642 ARG A CG  1 
ATOM   3965 C CD  . ARG A 1 642 ? 54.296  -14.803 -105.184 1.00 38.44  ? 642 ARG A CD  1 
ATOM   3966 N NE  . ARG A 1 642 ? 54.491  -15.653 -104.007 1.00 37.51  ? 642 ARG A NE  1 
ATOM   3967 C CZ  . ARG A 1 642 ? 55.296  -15.357 -102.989 1.00 31.87  ? 642 ARG A CZ  1 
ATOM   3968 N NH1 . ARG A 1 642 ? 55.983  -14.224 -102.987 1.00 35.64  ? 642 ARG A NH1 1 
ATOM   3969 N NH2 . ARG A 1 642 ? 55.403  -16.191 -101.959 1.00 27.00  ? 642 ARG A NH2 1 
ATOM   3970 N N   . ALA A 1 643 ? 54.791  -16.079 -109.297 1.00 39.50  ? 643 ALA A N   1 
ATOM   3971 C CA  . ALA A 1 643 ? 54.905  -17.290 -110.119 1.00 40.11  ? 643 ALA A CA  1 
ATOM   3972 C C   . ALA A 1 643 ? 55.860  -18.296 -109.489 1.00 40.59  ? 643 ALA A C   1 
ATOM   3973 O O   . ALA A 1 643 ? 56.724  -17.934 -108.685 1.00 40.38  ? 643 ALA A O   1 
ATOM   3974 C CB  . ALA A 1 643 ? 55.361  -16.941 -111.531 1.00 35.18  ? 643 ALA A CB  1 
ATOM   3975 N N   . GLU A 1 644 ? 55.692  -19.563 -109.859 1.00 43.83  ? 644 GLU A N   1 
ATOM   3976 C CA  . GLU A 1 644 ? 56.522  -20.633 -109.322 1.00 45.00  ? 644 GLU A CA  1 
ATOM   3977 C C   . GLU A 1 644 ? 57.998  -20.360 -109.617 1.00 43.96  ? 644 GLU A C   1 
ATOM   3978 O O   . GLU A 1 644 ? 58.378  -20.100 -110.758 1.00 44.55  ? 644 GLU A O   1 
ATOM   3979 C CB  . GLU A 1 644 ? 56.098  -21.989 -109.888 1.00 44.90  ? 644 GLU A CB  1 
ATOM   3980 C CG  . GLU A 1 644 ? 56.750  -23.166 -109.178 1.00 49.52  ? 644 GLU A CG  1 
ATOM   3981 C CD  . GLU A 1 644 ? 56.130  -24.501 -109.547 1.00 57.56  ? 644 GLU A CD  1 
ATOM   3982 O OE1 . GLU A 1 644 ? 54.907  -24.551 -109.811 1.00 65.31  ? 644 GLU A OE1 1 
ATOM   3983 O OE2 . GLU A 1 644 ? 56.869  -25.508 -109.558 1.00 71.14  ? 644 GLU A OE2 1 
ATOM   3984 N N   . ILE A 1 645 ? 58.816  -20.426 -108.572 1.00 42.88  ? 645 ILE A N   1 
ATOM   3985 C CA  . ILE A 1 645 ? 60.234  -20.055 -108.629 1.00 40.50  ? 645 ILE A CA  1 
ATOM   3986 C C   . ILE A 1 645 ? 61.057  -20.826 -109.685 1.00 41.17  ? 645 ILE A C   1 
ATOM   3987 O O   . ILE A 1 645 ? 62.097  -20.348 -110.146 1.00 39.15  ? 645 ILE A O   1 
ATOM   3988 C CB  . ILE A 1 645 ? 60.868  -20.227 -107.228 1.00 38.22  ? 645 ILE A CB  1 
ATOM   3989 C CG1 . ILE A 1 645 ? 62.261  -19.604 -107.176 1.00 40.30  ? 645 ILE A CG1 1 
ATOM   3990 C CG2 . ILE A 1 645 ? 60.897  -21.702 -106.829 1.00 34.47  ? 645 ILE A CG2 1 
ATOM   3991 C CD1 . ILE A 1 645 ? 62.712  -19.298 -105.771 1.00 45.28  ? 645 ILE A CD1 1 
ATOM   3992 N N   . SER A 1 646 ? 60.594  -22.019 -110.052 1.00 41.00  ? 646 SER A N   1 
ATOM   3993 C CA  . SER A 1 646 ? 61.182  -22.784 -111.150 1.00 36.49  ? 646 SER A CA  1 
ATOM   3994 C C   . SER A 1 646 ? 60.949  -22.099 -112.489 1.00 34.49  ? 646 SER A C   1 
ATOM   3995 O O   . SER A 1 646 ? 61.811  -22.117 -113.365 1.00 36.01  ? 646 SER A O   1 
ATOM   3996 C CB  . SER A 1 646 ? 60.556  -24.168 -111.197 1.00 34.88  ? 646 SER A CB  1 
ATOM   3997 O OG  . SER A 1 646 ? 59.146  -24.051 -111.200 1.00 36.74  ? 646 SER A OG  1 
ATOM   3998 N N   . GLU A 1 647 ? 59.774  -21.501 -112.645 1.00 34.11  ? 647 GLU A N   1 
ATOM   3999 C CA  . GLU A 1 647 ? 59.397  -20.865 -113.904 1.00 36.40  ? 647 GLU A CA  1 
ATOM   4000 C C   . GLU A 1 647 ? 60.090  -19.517 -114.135 1.00 32.80  ? 647 GLU A C   1 
ATOM   4001 O O   . GLU A 1 647 ? 60.295  -19.109 -115.277 1.00 30.75  ? 647 GLU A O   1 
ATOM   4002 C CB  . GLU A 1 647 ? 57.872  -20.695 -113.974 1.00 34.99  ? 647 GLU A CB  1 
ATOM   4003 C CG  . GLU A 1 647 ? 57.100  -22.016 -113.913 1.00 37.86  ? 647 GLU A CG  1 
ATOM   4004 C CD  . GLU A 1 647 ? 55.584  -21.827 -113.877 1.00 45.38  ? 647 GLU A CD  1 
ATOM   4005 O OE1 . GLU A 1 647 ? 55.070  -20.949 -114.612 1.00 51.55  ? 647 GLU A OE1 1 
ATOM   4006 O OE2 . GLU A 1 647 ? 54.905  -22.564 -113.117 1.00 46.04  ? 647 GLU A OE2 1 
ATOM   4007 N N   . LEU A 1 648 ? 60.460  -18.836 -113.058 1.00 30.19  ? 648 LEU A N   1 
ATOM   4008 C CA  . LEU A 1 648 ? 60.889  -17.444 -113.160 1.00 32.36  ? 648 LEU A CA  1 
ATOM   4009 C C   . LEU A 1 648 ? 62.111  -17.195 -114.049 1.00 33.45  ? 648 LEU A C   1 
ATOM   4010 O O   . LEU A 1 648 ? 62.107  -16.255 -114.839 1.00 35.02  ? 648 LEU A O   1 
ATOM   4011 C CB  . LEU A 1 648 ? 61.104  -16.835 -111.770 1.00 32.50  ? 648 LEU A CB  1 
ATOM   4012 C CG  . LEU A 1 648 ? 59.821  -16.269 -111.157 1.00 37.53  ? 648 LEU A CG  1 
ATOM   4013 C CD1 . LEU A 1 648 ? 60.027  -15.852 -109.699 1.00 37.70  ? 648 LEU A CD1 1 
ATOM   4014 C CD2 . LEU A 1 648 ? 59.307  -15.092 -112.001 1.00 40.61  ? 648 LEU A CD2 1 
ATOM   4015 N N   . PRO A 1 649 ? 63.163  -18.018 -113.923 1.00 35.74  ? 649 PRO A N   1 
ATOM   4016 C CA  . PRO A 1 649 ? 64.315  -17.791 -114.801 1.00 34.67  ? 649 PRO A CA  1 
ATOM   4017 C C   . PRO A 1 649 ? 63.909  -17.654 -116.273 1.00 33.51  ? 649 PRO A C   1 
ATOM   4018 O O   . PRO A 1 649 ? 64.330  -16.709 -116.939 1.00 33.50  ? 649 PRO A O   1 
ATOM   4019 C CB  . PRO A 1 649 ? 65.190  -19.030 -114.563 1.00 37.65  ? 649 PRO A CB  1 
ATOM   4020 C CG  . PRO A 1 649 ? 64.849  -19.459 -113.170 1.00 36.17  ? 649 PRO A CG  1 
ATOM   4021 C CD  . PRO A 1 649 ? 63.384  -19.147 -113.000 1.00 35.99  ? 649 PRO A CD  1 
ATOM   4022 N N   . SER A 1 650 ? 63.074  -18.574 -116.751 1.00 32.47  ? 650 SER A N   1 
ATOM   4023 C CA  . SER A 1 650 ? 62.528  -18.520 -118.110 1.00 32.15  ? 650 SER A CA  1 
ATOM   4024 C C   . SER A 1 650 ? 61.781  -17.221 -118.361 1.00 30.31  ? 650 SER A C   1 
ATOM   4025 O O   . SER A 1 650 ? 61.977  -16.573 -119.386 1.00 29.85  ? 650 SER A O   1 
ATOM   4026 C CB  . SER A 1 650 ? 61.569  -19.686 -118.339 1.00 32.70  ? 650 SER A CB  1 
ATOM   4027 O OG  . SER A 1 650 ? 62.091  -20.881 -117.783 1.00 47.40  ? 650 SER A OG  1 
ATOM   4028 N N   . ILE A 1 651 ? 60.922  -16.854 -117.414 1.00 29.45  ? 651 ILE A N   1 
ATOM   4029 C CA  . ILE A 1 651 ? 60.119  -15.636 -117.509 1.00 30.60  ? 651 ILE A CA  1 
ATOM   4030 C C   . ILE A 1 651 ? 61.006  -14.402 -117.652 1.00 32.19  ? 651 ILE A C   1 
ATOM   4031 O O   . ILE A 1 651 ? 60.848  -13.612 -118.583 1.00 36.45  ? 651 ILE A O   1 
ATOM   4032 C CB  . ILE A 1 651 ? 59.192  -15.487 -116.272 1.00 28.06  ? 651 ILE A CB  1 
ATOM   4033 C CG1 . ILE A 1 651 ? 58.024  -16.471 -116.371 1.00 29.68  ? 651 ILE A CG1 1 
ATOM   4034 C CG2 . ILE A 1 651 ? 58.670  -14.062 -116.129 1.00 25.40  ? 651 ILE A CG2 1 
ATOM   4035 C CD1 . ILE A 1 651 ? 57.513  -16.954 -115.021 1.00 32.75  ? 651 ILE A CD1 1 
ATOM   4036 N N   . VAL A 1 652 ? 61.956  -14.257 -116.740 1.00 34.43  ? 652 VAL A N   1 
ATOM   4037 C CA  . VAL A 1 652 ? 62.813  -13.075 -116.710 1.00 33.95  ? 652 VAL A CA  1 
ATOM   4038 C C   . VAL A 1 652 ? 63.637  -12.942 -117.988 1.00 36.52  ? 652 VAL A C   1 
ATOM   4039 O O   . VAL A 1 652 ? 63.771  -11.843 -118.531 1.00 35.41  ? 652 VAL A O   1 
ATOM   4040 C CB  . VAL A 1 652 ? 63.764  -13.106 -115.506 1.00 31.71  ? 652 VAL A CB  1 
ATOM   4041 C CG1 . VAL A 1 652 ? 64.644  -11.864 -115.501 1.00 26.59  ? 652 VAL A CG1 1 
ATOM   4042 C CG2 . VAL A 1 652 ? 62.962  -13.230 -114.207 1.00 22.42  ? 652 VAL A CG2 1 
ATOM   4043 N N   . GLN A 1 653 ? 64.181  -14.067 -118.453 1.00 35.56  ? 653 GLN A N   1 
ATOM   4044 C CA  . GLN A 1 653 ? 64.943  -14.116 -119.702 1.00 34.33  ? 653 GLN A CA  1 
ATOM   4045 C C   . GLN A 1 653 ? 64.159  -13.500 -120.849 1.00 36.24  ? 653 GLN A C   1 
ATOM   4046 O O   . GLN A 1 653 ? 64.666  -12.650 -121.580 1.00 36.98  ? 653 GLN A O   1 
ATOM   4047 C CB  . GLN A 1 653 ? 65.286  -15.562 -120.055 1.00 34.34  ? 653 GLN A CB  1 
ATOM   4048 C CG  . GLN A 1 653 ? 66.126  -15.714 -121.304 1.00 34.52  ? 653 GLN A CG  1 
ATOM   4049 C CD  . GLN A 1 653 ? 66.529  -17.144 -121.548 1.00 31.89  ? 653 GLN A CD  1 
ATOM   4050 O OE1 . GLN A 1 653 ? 65.728  -17.962 -121.987 1.00 29.96  ? 653 GLN A OE1 1 
ATOM   4051 N NE2 . GLN A 1 653 ? 67.780  -17.454 -121.271 1.00 35.30  ? 653 GLN A NE2 1 
ATOM   4052 N N   . ASP A 1 654 ? 62.914  -13.940 -120.995 1.00 38.63  ? 654 ASP A N   1 
ATOM   4053 C CA  . ASP A 1 654 ? 62.050  -13.463 -122.065 1.00 35.04  ? 654 ASP A CA  1 
ATOM   4054 C C   . ASP A 1 654 ? 61.745  -11.978 -121.904 1.00 30.54  ? 654 ASP A C   1 
ATOM   4055 O O   . ASP A 1 654 ? 61.713  -11.249 -122.890 1.00 30.42  ? 654 ASP A O   1 
ATOM   4056 C CB  . ASP A 1 654 ? 60.757  -14.295 -122.127 1.00 36.23  ? 654 ASP A CB  1 
ATOM   4057 C CG  . ASP A 1 654 ? 60.976  -15.696 -122.722 1.00 38.42  ? 654 ASP A CG  1 
ATOM   4058 O OD1 . ASP A 1 654 ? 61.971  -15.912 -123.448 1.00 32.15  ? 654 ASP A OD1 1 
ATOM   4059 O OD2 . ASP A 1 654 ? 60.136  -16.590 -122.476 1.00 48.94  ? 654 ASP A OD2 1 
ATOM   4060 N N   . LEU A 1 655 ? 61.544  -11.529 -120.667 1.00 30.53  ? 655 LEU A N   1 
ATOM   4061 C CA  . LEU A 1 655 ? 61.326  -10.104 -120.398 1.00 33.30  ? 655 LEU A CA  1 
ATOM   4062 C C   . LEU A 1 655 ? 62.522  -9.264  -120.840 1.00 33.60  ? 655 LEU A C   1 
ATOM   4063 O O   . LEU A 1 655 ? 62.359  -8.279  -121.558 1.00 37.68  ? 655 LEU A O   1 
ATOM   4064 C CB  . LEU A 1 655 ? 61.052  -9.852  -118.914 1.00 32.27  ? 655 LEU A CB  1 
ATOM   4065 C CG  . LEU A 1 655 ? 59.651  -10.186 -118.403 1.00 33.90  ? 655 LEU A CG  1 
ATOM   4066 C CD1 . LEU A 1 655 ? 59.621  -10.125 -116.885 1.00 30.51  ? 655 LEU A CD1 1 
ATOM   4067 C CD2 . LEU A 1 655 ? 58.618  -9.245  -119.004 1.00 24.79  ? 655 LEU A CD2 1 
ATOM   4068 N N   . ALA A 1 656 ? 63.716  -9.669  -120.414 1.00 35.15  ? 656 ALA A N   1 
ATOM   4069 C CA  . ALA A 1 656 ? 64.956  -8.958  -120.743 1.00 31.94  ? 656 ALA A CA  1 
ATOM   4070 C C   . ALA A 1 656 ? 65.317  -9.075  -122.217 1.00 32.75  ? 656 ALA A C   1 
ATOM   4071 O O   . ALA A 1 656 ? 65.923  -8.171  -122.777 1.00 39.04  ? 656 ALA A O   1 
ATOM   4072 C CB  . ALA A 1 656 ? 66.104  -9.473  -119.887 1.00 29.05  ? 656 ALA A CB  1 
ATOM   4073 N N   . ASN A 1 657 ? 64.954  -10.190 -122.843 1.00 33.33  ? 657 ASN A N   1 
ATOM   4074 C CA  . ASN A 1 657 ? 65.236  -10.392 -124.263 1.00 31.20  ? 657 ASN A CA  1 
ATOM   4075 C C   . ASN A 1 657 ? 64.148  -9.812  -125.155 1.00 26.43  ? 657 ASN A C   1 
ATOM   4076 O O   . ASN A 1 657 ? 64.247  -9.880  -126.377 1.00 27.92  ? 657 ASN A O   1 
ATOM   4077 C CB  . ASN A 1 657 ? 65.422  -11.883 -124.570 1.00 32.15  ? 657 ASN A CB  1 
ATOM   4078 C CG  . ASN A 1 657 ? 66.611  -12.489 -123.841 1.00 38.87  ? 657 ASN A CG  1 
ATOM   4079 O OD1 . ASN A 1 657 ? 66.853  -13.692 -123.931 1.00 49.15  ? 657 ASN A OD1 1 
ATOM   4080 N ND2 . ASN A 1 657 ? 67.352  -11.663 -123.108 1.00 43.64  ? 657 ASN A ND2 1 
ATOM   4081 N N   . GLY A 1 658 ? 63.104  -9.262  -124.545 1.00 23.34  ? 658 GLY A N   1 
ATOM   4082 C CA  . GLY A 1 658 ? 62.046  -8.595  -125.286 1.00 27.62  ? 658 GLY A CA  1 
ATOM   4083 C C   . GLY A 1 658 ? 61.140  -9.534  -126.055 1.00 28.26  ? 658 GLY A C   1 
ATOM   4084 O O   . GLY A 1 658 ? 60.449  -9.119  -126.990 1.00 25.48  ? 658 GLY A O   1 
ATOM   4085 N N   . ASN A 1 659 ? 61.138  -10.804 -125.662 1.00 31.87  ? 659 ASN A N   1 
ATOM   4086 C CA  . ASN A 1 659 ? 60.207  -11.776 -126.219 1.00 32.42  ? 659 ASN A CA  1 
ATOM   4087 C C   . ASN A 1 659 ? 58.803  -11.537 -125.670 1.00 34.21  ? 659 ASN A C   1 
ATOM   4088 O O   . ASN A 1 659 ? 57.814  -11.798 -126.349 1.00 40.25  ? 659 ASN A O   1 
ATOM   4089 C CB  . ASN A 1 659 ? 60.665  -13.202 -125.901 1.00 30.26  ? 659 ASN A CB  1 
ATOM   4090 C CG  . ASN A 1 659 ? 62.050  -13.508 -126.455 1.00 30.78  ? 659 ASN A CG  1 
ATOM   4091 O OD1 . ASN A 1 659 ? 62.368  -13.152 -127.584 1.00 36.96  ? 659 ASN A OD1 1 
ATOM   4092 N ND2 . ASN A 1 659 ? 62.877  -14.166 -125.655 1.00 35.98  ? 659 ASN A ND2 1 
ATOM   4093 N N   . ILE A 1 660 ? 58.738  -11.000 -124.455 1.00 33.88  ? 660 ILE A N   1 
ATOM   4094 C CA  . ILE A 1 660 ? 57.502  -10.867 -123.703 1.00 33.71  ? 660 ILE A CA  1 
ATOM   4095 C C   . ILE A 1 660 ? 57.429  -9.482  -123.044 1.00 36.32  ? 660 ILE A C   1 
ATOM   4096 O O   . ILE A 1 660 ? 58.456  -8.935  -122.624 1.00 38.36  ? 660 ILE A O   1 
ATOM   4097 C CB  . ILE A 1 660 ? 57.435  -12.011 -122.646 1.00 35.03  ? 660 ILE A CB  1 
ATOM   4098 C CG1 . ILE A 1 660 ? 56.485  -13.113 -123.117 1.00 33.31  ? 660 ILE A CG1 1 
ATOM   4099 C CG2 . ILE A 1 660 ? 57.043  -11.505 -121.260 1.00 37.82  ? 660 ILE A CG2 1 
ATOM   4100 C CD1 . ILE A 1 660 ? 57.038  -13.962 -124.255 1.00 35.20  ? 660 ILE A CD1 1 
ATOM   4101 N N   . THR A 1 661 ? 56.219  -8.921  -122.978 1.00 35.76  ? 661 THR A N   1 
ATOM   4102 C CA  . THR A 1 661 ? 55.949  -7.656  -122.273 1.00 35.80  ? 661 THR A CA  1 
ATOM   4103 C C   . THR A 1 661 ? 55.681  -7.912  -120.797 1.00 35.72  ? 661 THR A C   1 
ATOM   4104 O O   . THR A 1 661 ? 55.307  -9.022  -120.407 1.00 35.14  ? 661 THR A O   1 
ATOM   4105 C CB  . THR A 1 661 ? 54.678  -6.962  -122.825 1.00 35.19  ? 661 THR A CB  1 
ATOM   4106 O OG1 . THR A 1 661 ? 54.720  -6.948  -124.248 1.00 46.13  ? 661 THR A OG1 1 
ATOM   4107 C CG2 . THR A 1 661 ? 54.540  -5.531  -122.310 1.00 37.95  ? 661 THR A CG2 1 
ATOM   4108 N N   . TRP A 1 662 ? 55.841  -6.879  -119.974 1.00 33.09  ? 662 TRP A N   1 
ATOM   4109 C CA  . TRP A 1 662 ? 55.302  -6.937  -118.626 1.00 33.91  ? 662 TRP A CA  1 
ATOM   4110 C C   . TRP A 1 662 ? 53.813  -7.195  -118.715 1.00 33.88  ? 662 TRP A C   1 
ATOM   4111 O O   . TRP A 1 662 ? 53.278  -8.028  -117.993 1.00 34.66  ? 662 TRP A O   1 
ATOM   4112 C CB  . TRP A 1 662 ? 55.533  -5.641  -117.856 1.00 37.20  ? 662 TRP A CB  1 
ATOM   4113 C CG  . TRP A 1 662 ? 55.158  -5.780  -116.411 1.00 37.20  ? 662 TRP A CG  1 
ATOM   4114 C CD1 . TRP A 1 662 ? 54.110  -5.189  -115.773 1.00 39.30  ? 662 TRP A CD1 1 
ATOM   4115 C CD2 . TRP A 1 662 ? 55.815  -6.596  -115.435 1.00 32.87  ? 662 TRP A CD2 1 
ATOM   4116 N NE1 . TRP A 1 662 ? 54.083  -5.574  -114.454 1.00 37.75  ? 662 TRP A NE1 1 
ATOM   4117 C CE2 . TRP A 1 662 ? 55.120  -6.436  -114.222 1.00 34.42  ? 662 TRP A CE2 1 
ATOM   4118 C CE3 . TRP A 1 662 ? 56.928  -7.441  -115.470 1.00 35.10  ? 662 TRP A CE3 1 
ATOM   4119 C CZ2 . TRP A 1 662 ? 55.502  -7.089  -113.050 1.00 42.17  ? 662 TRP A CZ2 1 
ATOM   4120 C CZ3 . TRP A 1 662 ? 57.310  -8.090  -114.305 1.00 38.51  ? 662 TRP A CZ3 1 
ATOM   4121 C CH2 . TRP A 1 662 ? 56.600  -7.910  -113.112 1.00 40.14  ? 662 TRP A CH2 1 
ATOM   4122 N N   . ALA A 1 663 ? 53.153  -6.453  -119.602 1.00 36.23  ? 663 ALA A N   1 
ATOM   4123 C CA  . ALA A 1 663 ? 51.744  -6.663  -119.914 1.00 34.88  ? 663 ALA A CA  1 
ATOM   4124 C C   . ALA A 1 663 ? 51.445  -8.149  -120.090 1.00 35.35  ? 663 ALA A C   1 
ATOM   4125 O O   . ALA A 1 663 ? 50.551  -8.686  -119.432 1.00 36.26  ? 663 ALA A O   1 
ATOM   4126 C CB  . ALA A 1 663 ? 51.368  -5.897  -121.166 1.00 34.85  ? 663 ALA A CB  1 
ATOM   4127 N N   . ASP A 1 664 ? 52.211  -8.807  -120.959 1.00 33.87  ? 664 ASP A N   1 
ATOM   4128 C CA  . ASP A 1 664 ? 52.057  -10.241 -121.203 1.00 33.57  ? 664 ASP A CA  1 
ATOM   4129 C C   . ASP A 1 664 ? 52.102  -11.017 -119.889 1.00 31.87  ? 664 ASP A C   1 
ATOM   4130 O O   . ASP A 1 664 ? 51.208  -11.813 -119.595 1.00 28.90  ? 664 ASP A O   1 
ATOM   4131 C CB  . ASP A 1 664 ? 53.153  -10.758 -122.140 1.00 34.23  ? 664 ASP A CB  1 
ATOM   4132 C CG  . ASP A 1 664 ? 52.973  -10.288 -123.567 1.00 37.03  ? 664 ASP A CG  1 
ATOM   4133 O OD1 . ASP A 1 664 ? 53.888  -9.625  -124.089 1.00 39.62  ? 664 ASP A OD1 1 
ATOM   4134 O OD2 . ASP A 1 664 ? 51.923  -10.584 -124.171 1.00 39.67  ? 664 ASP A OD2 1 
ATOM   4135 N N   . VAL A 1 665 ? 53.140  -10.759 -119.098 1.00 30.33  ? 665 VAL A N   1 
ATOM   4136 C CA  . VAL A 1 665 ? 53.329  -11.444 -117.822 1.00 32.31  ? 665 VAL A CA  1 
ATOM   4137 C C   . VAL A 1 665 ? 52.090  -11.352 -116.917 1.00 35.14  ? 665 VAL A C   1 
ATOM   4138 O O   . VAL A 1 665 ? 51.620  -12.368 -116.402 1.00 33.72  ? 665 VAL A O   1 
ATOM   4139 C CB  . VAL A 1 665 ? 54.550  -10.888 -117.068 1.00 30.08  ? 665 VAL A CB  1 
ATOM   4140 C CG1 . VAL A 1 665 ? 54.672  -11.546 -115.700 1.00 33.25  ? 665 VAL A CG1 1 
ATOM   4141 C CG2 . VAL A 1 665 ? 55.813  -11.097 -117.886 1.00 30.86  ? 665 VAL A CG2 1 
ATOM   4142 N N   . GLU A 1 666 ? 51.562  -10.138 -116.744 1.00 36.49  ? 666 GLU A N   1 
ATOM   4143 C CA  . GLU A 1 666 ? 50.390  -9.907  -115.890 1.00 34.79  ? 666 GLU A CA  1 
ATOM   4144 C C   . GLU A 1 666 ? 49.165  -10.641 -116.421 1.00 34.65  ? 666 GLU A C   1 
ATOM   4145 O O   . GLU A 1 666 ? 48.344  -11.140 -115.649 1.00 33.61  ? 666 GLU A O   1 
ATOM   4146 C CB  . GLU A 1 666 ? 50.091  -8.409  -115.762 1.00 33.51  ? 666 GLU A CB  1 
ATOM   4147 C CG  . GLU A 1 666 ? 51.210  -7.623  -115.082 1.00 40.28  ? 666 GLU A CG  1 
ATOM   4148 C CD  . GLU A 1 666 ? 50.764  -6.268  -114.552 1.00 39.66  ? 666 GLU A CD  1 
ATOM   4149 O OE1 . GLU A 1 666 ? 51.151  -5.916  -113.417 1.00 34.70  ? 666 GLU A OE1 1 
ATOM   4150 O OE2 . GLU A 1 666 ? 50.033  -5.556  -115.266 1.00 46.07  ? 666 GLU A OE2 1 
ATOM   4151 N N   . ALA A 1 667 ? 49.054  -10.707 -117.743 1.00 35.01  ? 667 ALA A N   1 
ATOM   4152 C CA  . ALA A 1 667 ? 47.998  -11.469 -118.391 1.00 36.10  ? 667 ALA A CA  1 
ATOM   4153 C C   . ALA A 1 667 ? 48.066  -12.951 -118.016 1.00 37.55  ? 667 ALA A C   1 
ATOM   4154 O O   . ALA A 1 667 ? 47.035  -13.613 -117.906 1.00 33.54  ? 667 ALA A O   1 
ATOM   4155 C CB  . ALA A 1 667 ? 48.095  -11.304 -119.900 1.00 32.57  ? 667 ALA A CB  1 
ATOM   4156 N N   . ARG A 1 668 ? 49.282  -13.454 -117.809 1.00 41.86  ? 668 ARG A N   1 
ATOM   4157 C CA  . ARG A 1 668 ? 49.532  -14.886 -117.624 1.00 44.45  ? 668 ARG A CA  1 
ATOM   4158 C C   . ARG A 1 668 ? 49.675  -15.310 -116.164 1.00 41.38  ? 668 ARG A C   1 
ATOM   4159 O O   . ARG A 1 668 ? 49.409  -16.461 -115.827 1.00 39.96  ? 668 ARG A O   1 
ATOM   4160 C CB  . ARG A 1 668 ? 50.803  -15.285 -118.387 1.00 49.24  ? 668 ARG A CB  1 
ATOM   4161 C CG  . ARG A 1 668 ? 50.700  -15.133 -119.906 1.00 51.65  ? 668 ARG A CG  1 
ATOM   4162 C CD  . ARG A 1 668 ? 52.076  -14.986 -120.557 1.00 55.88  ? 668 ARG A CD  1 
ATOM   4163 N NE  . ARG A 1 668 ? 52.048  -15.303 -121.986 1.00 60.58  ? 668 ARG A NE  1 
ATOM   4164 C CZ  . ARG A 1 668 ? 51.537  -14.522 -122.940 1.00 70.47  ? 668 ARG A CZ  1 
ATOM   4165 N NH1 . ARG A 1 668 ? 50.987  -13.344 -122.651 1.00 75.61  ? 668 ARG A NH1 1 
ATOM   4166 N NH2 . ARG A 1 668 ? 51.568  -14.927 -124.205 1.00 72.54  ? 668 ARG A NH2 1 
ATOM   4167 N N   . TYR A 1 669 ? 50.101  -14.391 -115.304 1.00 41.25  ? 669 TYR A N   1 
ATOM   4168 C CA  . TYR A 1 669 ? 50.422  -14.723 -113.918 1.00 40.90  ? 669 TYR A CA  1 
ATOM   4169 C C   . TYR A 1 669 ? 49.667  -13.838 -112.929 1.00 38.71  ? 669 TYR A C   1 
ATOM   4170 O O   . TYR A 1 669 ? 49.373  -12.685 -113.231 1.00 39.86  ? 669 TYR A O   1 
ATOM   4171 C CB  . TYR A 1 669 ? 51.930  -14.599 -113.698 1.00 41.70  ? 669 TYR A CB  1 
ATOM   4172 C CG  . TYR A 1 669 ? 52.717  -15.606 -114.494 1.00 41.89  ? 669 TYR A CG  1 
ATOM   4173 C CD1 . TYR A 1 669 ? 53.325  -15.260 -115.699 1.00 43.98  ? 669 TYR A CD1 1 
ATOM   4174 C CD2 . TYR A 1 669 ? 52.834  -16.914 -114.054 1.00 46.44  ? 669 TYR A CD2 1 
ATOM   4175 C CE1 . TYR A 1 669 ? 54.042  -16.198 -116.437 1.00 41.49  ? 669 TYR A CE1 1 
ATOM   4176 C CE2 . TYR A 1 669 ? 53.547  -17.854 -114.781 1.00 45.76  ? 669 TYR A CE2 1 
ATOM   4177 C CZ  . TYR A 1 669 ? 54.146  -17.493 -115.967 1.00 40.17  ? 669 TYR A CZ  1 
ATOM   4178 O OH  . TYR A 1 669 ? 54.842  -18.440 -116.670 1.00 40.50  ? 669 TYR A OH  1 
ATOM   4179 N N   . PRO A 1 670 ? 49.350  -14.381 -111.741 1.00 39.26  ? 670 PRO A N   1 
ATOM   4180 C CA  . PRO A 1 670 ? 48.574  -13.649 -110.733 1.00 39.80  ? 670 PRO A CA  1 
ATOM   4181 C C   . PRO A 1 670 ? 49.285  -12.418 -110.158 1.00 40.28  ? 670 PRO A C   1 
ATOM   4182 O O   . PRO A 1 670 ? 50.480  -12.462 -109.852 1.00 35.71  ? 670 PRO A O   1 
ATOM   4183 C CB  . PRO A 1 670 ? 48.333  -14.699 -109.645 1.00 40.34  ? 670 PRO A CB  1 
ATOM   4184 C CG  . PRO A 1 670 ? 49.406  -15.706 -109.826 1.00 38.07  ? 670 PRO A CG  1 
ATOM   4185 C CD  . PRO A 1 670 ? 49.705  -15.738 -111.284 1.00 39.85  ? 670 PRO A CD  1 
ATOM   4186 N N   . LEU A 1 671 ? 48.529  -11.333 -110.014 1.00 42.64  ? 671 LEU A N   1 
ATOM   4187 C CA  . LEU A 1 671 ? 49.065  -10.049 -109.560 1.00 42.48  ? 671 LEU A CA  1 
ATOM   4188 C C   . LEU A 1 671 ? 49.330  -10.071 -108.055 1.00 42.75  ? 671 LEU A C   1 
ATOM   4189 O O   . LEU A 1 671 ? 48.592  -10.706 -107.298 1.00 45.13  ? 671 LEU A O   1 
ATOM   4190 C CB  . LEU A 1 671 ? 48.097  -8.906  -109.920 1.00 44.60  ? 671 LEU A CB  1 
ATOM   4191 C CG  . LEU A 1 671 ? 48.147  -8.343  -111.351 1.00 44.27  ? 671 LEU A CG  1 
ATOM   4192 C CD1 . LEU A 1 671 ? 48.126  -9.435  -112.412 1.00 41.00  ? 671 LEU A CD1 1 
ATOM   4193 C CD2 . LEU A 1 671 ? 47.007  -7.352  -111.579 1.00 37.33  ? 671 LEU A CD2 1 
ATOM   4194 N N   . PHE A 1 672 ? 50.373  -9.360  -107.629 1.00 42.87  ? 672 PHE A N   1 
ATOM   4195 C CA  . PHE A 1 672 ? 50.817  -9.388  -106.238 1.00 43.40  ? 672 PHE A CA  1 
ATOM   4196 C C   . PHE A 1 672 ? 51.139  -7.994  -105.694 1.00 44.79  ? 672 PHE A C   1 
ATOM   4197 O O   . PHE A 1 672 ? 51.783  -7.190  -106.369 1.00 41.78  ? 672 PHE A O   1 
ATOM   4198 C CB  . PHE A 1 672 ? 52.049  -10.281 -106.127 1.00 42.41  ? 672 PHE A CB  1 
ATOM   4199 C CG  . PHE A 1 672 ? 52.327  -10.745 -104.737 1.00 42.29  ? 672 PHE A CG  1 
ATOM   4200 C CD1 . PHE A 1 672 ? 51.671  -11.856 -104.224 1.00 40.83  ? 672 PHE A CD1 1 
ATOM   4201 C CD2 . PHE A 1 672 ? 53.236  -10.071 -103.935 1.00 45.40  ? 672 PHE A CD2 1 
ATOM   4202 C CE1 . PHE A 1 672 ? 51.917  -12.294 -102.932 1.00 41.30  ? 672 PHE A CE1 1 
ATOM   4203 C CE2 . PHE A 1 672 ? 53.491  -10.502 -102.642 1.00 48.74  ? 672 PHE A CE2 1 
ATOM   4204 C CZ  . PHE A 1 672 ? 52.826  -11.618 -102.138 1.00 46.02  ? 672 PHE A CZ  1 
ATOM   4205 N N   . GLU A 1 673 ? 50.687  -7.717  -104.471 1.00 49.68  ? 673 GLU A N   1 
ATOM   4206 C CA  . GLU A 1 673 ? 50.996  -6.456  -103.792 1.00 51.11  ? 673 GLU A CA  1 
ATOM   4207 C C   . GLU A 1 673 ? 51.665  -6.722  -102.444 1.00 52.43  ? 673 GLU A C   1 
ATOM   4208 O O   . GLU A 1 673 ? 51.031  -7.140  -101.475 1.00 51.95  ? 673 GLU A O   1 
ATOM   4209 C CB  . GLU A 1 673 ? 49.721  -5.623  -103.606 1.00 55.12  ? 673 GLU A CB  1 
ATOM   4210 C CG  . GLU A 1 673 ? 49.926  -4.237  -102.969 1.00 58.17  ? 673 GLU A CG  1 
ATOM   4211 C CD  . GLU A 1 673 ? 50.585  -3.219  -103.903 1.00 66.95  ? 673 GLU A CD  1 
ATOM   4212 O OE1 . GLU A 1 673 ? 50.045  -2.097  -104.011 1.00 71.69  ? 673 GLU A OE1 1 
ATOM   4213 O OE2 . GLU A 1 673 ? 51.633  -3.523  -104.521 1.00 60.70  ? 673 GLU A OE2 1 
HETATM 4214 O O   . HOH B 2 .   ? 82.953  9.541   -125.536 1.00 7.47   ? 692 HOH A O   1 
HETATM 4215 O O   . HOH B 2 .   ? 82.724  -9.335  -131.116 1.00 3.36   ? 693 HOH A O   1 
HETATM 4216 O O   . HOH B 2 .   ? 84.855  22.275  -121.642 1.00 4.00   ? 694 HOH A O   1 
HETATM 4217 O O   . HOH B 2 .   ? 94.494  20.014  -114.886 1.00 11.16  ? 695 HOH A O   1 
HETATM 4218 O O   . HOH B 2 .   ? 92.565  40.726  -126.531 1.00 23.38  ? 696 HOH A O   1 
HETATM 4219 O O   . HOH B 2 .   ? 93.091  1.585   -125.002 1.00 22.16  ? 697 HOH A O   1 
HETATM 4220 O O   . HOH B 2 .   ? 72.301  -6.195  -118.468 1.00 2.00   ? 698 HOH A O   1 
HETATM 4221 O O   . HOH B 2 .   ? 83.085  10.833  -133.056 1.00 13.58  ? 699 HOH A O   1 
HETATM 4222 O O   . HOH B 2 .   ? 67.837  15.911  -120.960 1.00 19.01  ? 700 HOH A O   1 
HETATM 4223 O O   . HOH B 2 .   ? 86.681  -7.280  -154.763 1.00 17.30  ? 701 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  LEU 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  ASP 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  LYS 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  LYS 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  ASP 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  VAL 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  VAL 37  37  ?   ?   ?   A . n 
A 1 38  ASP 38  38  ?   ?   ?   A . n 
A 1 39  LYS 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  VAL 41  41  ?   ?   ?   A . n 
A 1 42  ALA 42  42  ?   ?   ?   A . n 
A 1 43  GLU 43  43  ?   ?   ?   A . n 
A 1 44  LEU 44  44  ?   ?   ?   A . n 
A 1 45  LYS 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  ARG 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  ARG 49  49  ?   ?   ?   A . n 
A 1 50  VAL 50  50  ?   ?   ?   A . n 
A 1 51  LEU 51  51  ?   ?   ?   A . n 
A 1 52  GLU 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  LYS 54  54  ?   ?   ?   A . n 
A 1 55  GLU 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  LEU 58  58  ?   ?   ?   A . n 
A 1 59  GLN 59  59  ?   ?   ?   A . n 
A 1 60  PRO 60  60  ?   ?   ?   A . n 
A 1 61  LYS 61  61  ?   ?   ?   A . n 
A 1 62  ASP 62  62  ?   ?   ?   A . n 
A 1 63  ASP 63  63  ?   ?   ?   A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 CYS 177 177 177 CYS CYS A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 MET 227 227 227 MET MET A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 MET 238 238 238 MET MET A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ARG 288 288 288 ARG ARG A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 MET 336 336 336 MET MET A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 TYR 360 360 360 TYR TYR A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 PHE 375 375 375 PHE PHE A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 HIS 378 378 378 HIS HIS A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 ASN 381 381 381 ASN ASN A . n 
A 1 382 GLU 382 382 382 GLU GLU A . n 
A 1 383 MET 383 383 383 MET MET A . n 
A 1 384 ALA 384 384 ?   ?   ?   A . n 
A 1 385 HIS 385 385 ?   ?   ?   A . n 
A 1 386 TYR 386 386 386 TYR TYR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 CYS 388 388 388 CYS CYS A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 CYS 390 390 390 CYS CYS A . n 
A 1 391 TRP 391 391 391 TRP TRP A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 ASP 409 409 409 ASP ASP A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 CYS 412 412 412 CYS CYS A . n 
A 1 413 TYR 413 413 413 TYR TYR A . n 
A 1 414 ASP 414 414 414 ASP ASP A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 HIS 418 418 418 HIS HIS A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ARG 420 420 420 ARG ARG A . n 
A 1 421 ALA 421 421 421 ALA ALA A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 LYS 423 423 423 LYS LYS A . n 
A 1 424 VAL 424 424 424 VAL VAL A . n 
A 1 425 PRO 425 425 425 PRO PRO A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 VAL 427 427 427 VAL VAL A . n 
A 1 428 ALA 428 428 428 ALA ALA A . n 
A 1 429 GLU 429 429 429 GLU GLU A . n 
A 1 430 LYS 430 430 430 LYS LYS A . n 
A 1 431 PRO 431 431 431 PRO PRO A . n 
A 1 432 LEU 432 432 ?   ?   ?   A . n 
A 1 433 LYS 433 433 ?   ?   ?   A . n 
A 1 434 GLU 434 434 ?   ?   ?   A . n 
A 1 435 PRO 435 435 ?   ?   ?   A . n 
A 1 436 LYS 436 436 ?   ?   ?   A . n 
A 1 437 THR 437 437 ?   ?   ?   A . n 
A 1 438 VAL 438 438 ?   ?   ?   A . n 
A 1 439 ASN 439 439 ?   ?   ?   A . n 
A 1 440 VAL 440 440 ?   ?   ?   A . n 
A 1 441 VAL 441 441 ?   ?   ?   A . n 
A 1 442 GLN 442 442 ?   ?   ?   A . n 
A 1 443 PHE 443 443 ?   ?   ?   A . n 
A 1 444 GLU 444 444 ?   ?   ?   A . n 
A 1 445 PRO 445 445 ?   ?   ?   A . n 
A 1 446 SER 446 446 ?   ?   ?   A . n 
A 1 447 LYS 447 447 ?   ?   ?   A . n 
A 1 448 GLY 448 448 ?   ?   ?   A . n 
A 1 449 ALA 449 449 ?   ?   ?   A . n 
A 1 450 ILE 450 450 ?   ?   ?   A . n 
A 1 451 GLY 451 451 ?   ?   ?   A . n 
A 1 452 LYS 452 452 ?   ?   ?   A . n 
A 1 453 ALA 453 453 ?   ?   ?   A . n 
A 1 454 TYR 454 454 ?   ?   ?   A . n 
A 1 455 LYS 455 455 ?   ?   ?   A . n 
A 1 456 LYS 456 456 ?   ?   ?   A . n 
A 1 457 ASP 457 457 ?   ?   ?   A . n 
A 1 458 ALA 458 458 ?   ?   ?   A . n 
A 1 459 LYS 459 459 ?   ?   ?   A . n 
A 1 460 LEU 460 460 ?   ?   ?   A . n 
A 1 461 VAL 461 461 ?   ?   ?   A . n 
A 1 462 MET 462 462 ?   ?   ?   A . n 
A 1 463 GLU 463 463 ?   ?   ?   A . n 
A 1 464 TYR 464 464 ?   ?   ?   A . n 
A 1 465 LEU 465 465 ?   ?   ?   A . n 
A 1 466 ALA 466 466 ?   ?   ?   A . n 
A 1 467 ILE 467 467 ?   ?   ?   A . n 
A 1 468 CYS 468 468 ?   ?   ?   A . n 
A 1 469 ASP 469 469 ?   ?   ?   A . n 
A 1 470 GLU 470 470 ?   ?   ?   A . n 
A 1 471 CYS 471 471 ?   ?   ?   A . n 
A 1 472 TYR 472 472 ?   ?   ?   A . n 
A 1 473 ILE 473 473 ?   ?   ?   A . n 
A 1 474 THR 474 474 ?   ?   ?   A . n 
A 1 475 GLU 475 475 ?   ?   ?   A . n 
A 1 476 MET 476 476 ?   ?   ?   A . n 
A 1 477 GLU 477 477 ?   ?   ?   A . n 
A 1 478 MET 478 478 ?   ?   ?   A . n 
A 1 479 LEU 479 479 ?   ?   ?   A . n 
A 1 480 LEU 480 480 ?   ?   ?   A . n 
A 1 481 ASN 481 481 ?   ?   ?   A . n 
A 1 482 GLU 482 482 ?   ?   ?   A . n 
A 1 483 LYS 483 483 ?   ?   ?   A . n 
A 1 484 GLY 484 484 ?   ?   ?   A . n 
A 1 485 GLU 485 485 ?   ?   ?   A . n 
A 1 486 PHE 486 486 ?   ?   ?   A . n 
A 1 487 THR 487 487 ?   ?   ?   A . n 
A 1 488 ILE 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 THR 490 490 ?   ?   ?   A . n 
A 1 491 GLU 491 491 ?   ?   ?   A . n 
A 1 492 GLY 492 492 ?   ?   ?   A . n 
A 1 493 LYS 493 493 ?   ?   ?   A . n 
A 1 494 THR 494 494 ?   ?   ?   A . n 
A 1 495 PHE 495 495 ?   ?   ?   A . n 
A 1 496 GLN 496 496 ?   ?   ?   A . n 
A 1 497 LEU 497 497 ?   ?   ?   A . n 
A 1 498 THR 498 498 ?   ?   ?   A . n 
A 1 499 LYS 499 499 ?   ?   ?   A . n 
A 1 500 ASP 500 500 ?   ?   ?   A . n 
A 1 501 MET 501 501 ?   ?   ?   A . n 
A 1 502 ILE 502 502 ?   ?   ?   A . n 
A 1 503 ASN 503 503 ?   ?   ?   A . n 
A 1 504 VAL 504 504 ?   ?   ?   A . n 
A 1 505 LYS 505 505 ?   ?   ?   A . n 
A 1 506 ARG 506 506 ?   ?   ?   A . n 
A 1 507 PHE 507 507 ?   ?   ?   A . n 
A 1 508 GLN 508 508 ?   ?   ?   A . n 
A 1 509 LYS 509 509 ?   ?   ?   A . n 
A 1 510 THR 510 510 ?   ?   ?   A . n 
A 1 511 LEU 511 511 ?   ?   ?   A . n 
A 1 512 TYR 512 512 512 TYR TYR A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 VAL 517 517 517 VAL VAL A . n 
A 1 518 PRO 518 518 518 PRO PRO A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 GLU 522 522 522 GLU GLU A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 ARG 529 529 529 ARG ARG A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 MET 531 531 531 MET MET A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 THR 533 533 533 THR THR A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 GLU 536 536 536 GLU GLU A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 PHE 539 539 539 PHE PHE A . n 
A 1 540 HIS 540 540 540 HIS HIS A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ARG 542 542 542 ARG ARG A . n 
A 1 543 GLU 543 543 543 GLU GLU A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 PHE 550 550 550 PHE PHE A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 PHE 553 553 553 PHE PHE A . n 
A 1 554 PRO 554 554 554 PRO PRO A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 PRO 559 559 559 PRO PRO A . n 
A 1 560 PHE 560 560 560 PHE PHE A . n 
A 1 561 LYS 561 561 561 LYS LYS A . n 
A 1 562 CYS 562 562 562 CYS CYS A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 PRO 566 566 566 PRO PRO A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 SER 568 568 568 SER SER A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLN 571 571 571 GLN GLN A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 PHE 573 573 573 PHE PHE A . n 
A 1 574 MET 574 574 574 MET MET A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 PHE 576 576 576 PHE PHE A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 SER 581 581 581 SER SER A . n 
A 1 582 GLU 582 582 582 GLU GLU A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 HIS 587 587 587 HIS HIS A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 HIS 591 591 591 HIS HIS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 VAL 593 593 593 VAL VAL A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 SER 596 596 596 SER SER A . n 
A 1 597 SER 597 597 597 SER SER A . n 
A 1 598 GLY 598 598 598 GLY GLY A . n 
A 1 599 SER 599 599 599 SER SER A . n 
A 1 600 ILE 600 600 600 ILE ILE A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 ARG 602 602 602 ARG ARG A . n 
A 1 603 ARG 603 603 603 ARG ARG A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 ALA 605 605 605 ALA ALA A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 ASP 608 608 608 ASP ASP A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 VAL 612 612 612 VAL VAL A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 PHE 614 614 614 PHE PHE A . n 
A 1 615 GLY 615 615 615 GLY GLY A . n 
A 1 616 VAL 616 616 616 VAL VAL A . n 
A 1 617 THR 617 617 617 THR THR A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ASP 619 619 619 ASP ASP A . n 
A 1 620 PHE 620 620 620 PHE PHE A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 VAL 623 623 623 VAL VAL A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 LYS 625 625 625 LYS LYS A . n 
A 1 626 THR 626 626 626 THR THR A . n 
A 1 627 PRO 627 627 627 PRO PRO A . n 
A 1 628 HIS 628 628 628 HIS HIS A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 THR 631 631 631 THR THR A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 ARG 633 633 633 ARG ARG A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 ARG 635 635 635 ARG ARG A . n 
A 1 636 ASP 636 636 636 ASP ASP A . n 
A 1 637 SER 637 637 637 SER SER A . n 
A 1 638 MET 638 638 638 MET MET A . n 
A 1 639 ARG 639 639 639 ARG ARG A . n 
A 1 640 GLN 640 640 640 GLN GLN A . n 
A 1 641 ILE 641 641 641 ILE ILE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 ILE 645 645 645 ILE ILE A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 GLU 647 647 647 GLU GLU A . n 
A 1 648 LEU 648 648 648 LEU LEU A . n 
A 1 649 PRO 649 649 649 PRO PRO A . n 
A 1 650 SER 650 650 650 SER SER A . n 
A 1 651 ILE 651 651 651 ILE ILE A . n 
A 1 652 VAL 652 652 652 VAL VAL A . n 
A 1 653 GLN 653 653 653 GLN GLN A . n 
A 1 654 ASP 654 654 654 ASP ASP A . n 
A 1 655 LEU 655 655 655 LEU LEU A . n 
A 1 656 ALA 656 656 656 ALA ALA A . n 
A 1 657 ASN 657 657 657 ASN ASN A . n 
A 1 658 GLY 658 658 658 GLY GLY A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 TRP 662 662 662 TRP TRP A . n 
A 1 663 ALA 663 663 663 ALA ALA A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 VAL 665 665 665 VAL VAL A . n 
A 1 666 GLU 666 666 666 GLU GLU A . n 
A 1 667 ALA 667 667 667 ALA ALA A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 TYR 669 669 669 TYR TYR A . n 
A 1 670 PRO 670 670 670 PRO PRO A . n 
A 1 671 LEU 671 671 671 LEU LEU A . n 
A 1 672 PHE 672 672 672 PHE PHE A . n 
A 1 673 GLU 673 673 673 GLU GLU A . n 
A 1 674 GLY 674 674 ?   ?   ?   A . n 
A 1 675 GLN 675 675 ?   ?   ?   A . n 
A 1 676 GLU 676 676 ?   ?   ?   A . n 
A 1 677 THR 677 677 ?   ?   ?   A . n 
A 1 678 GLY 678 678 ?   ?   ?   A . n 
A 1 679 LYS 679 679 ?   ?   ?   A . n 
A 1 680 LYS 680 680 ?   ?   ?   A . n 
A 1 681 GLU 681 681 ?   ?   ?   A . n 
A 1 682 THR 682 682 ?   ?   ?   A . n 
A 1 683 ILE 683 683 ?   ?   ?   A . n 
A 1 684 GLU 684 684 ?   ?   ?   A . n 
A 1 685 GLU 685 685 ?   ?   ?   A . n 
A 1 686 HIS 686 686 ?   ?   ?   A . n 
A 1 687 HIS 687 687 ?   ?   ?   A . n 
A 1 688 HIS 688 688 ?   ?   ?   A . n 
A 1 689 HIS 689 689 ?   ?   ?   A . n 
A 1 690 HIS 690 690 ?   ?   ?   A . n 
A 1 691 HIS 691 691 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Oxford Protein Production Facility' 
_pdbx_SG_project.initial_of_center     OPPF 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  692 2  HOH HOH A . 
B 2 HOH 2  693 4  HOH HOH A . 
B 2 HOH 3  694 6  HOH HOH A . 
B 2 HOH 4  695 8  HOH HOH A . 
B 2 HOH 5  696 12 HOH HOH A . 
B 2 HOH 6  697 16 HOH HOH A . 
B 2 HOH 7  698 17 HOH HOH A . 
B 2 HOH 8  699 18 HOH HOH A . 
B 2 HOH 9  700 20 HOH HOH A . 
B 2 HOH 10 701 22 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5510  ? 
1 MORE         -40   ? 
1 'SSA (A^2)'  46740 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 7_644 y+1,x-1,-z-1 0.0000000000 1.0000000000 0.0000000000 92.5300000000 1.0000000000 0.0000000000 
0.0000000000 -92.5300000000 0.0000000000 0.0000000000 -1.0000000000 -246.8600000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 83.2221 7.2475  -134.5053 -0.1531 -0.2473 -0.2313 0.0251  -0.0367 0.1053 2.4704 1.6798 1.9873 -0.0375 0.6363  -0.4395 
-0.0892 0.4569  0.3680  -0.2751 0.0693 -0.0565 -0.3741 0.1160  0.0199  'X-RAY DIFFRACTION' 
2 ? refined 86.9769 36.2537 -128.7350 0.3355  0.0425  0.3139  -0.0452 -0.0193 0.0562 4.4334 9.4291 1.8046 -4.4347 2.7503  -2.0504 
-0.1797 -0.4896 0.1460  0.7435  0.1975 0.0166  -0.6172 -0.3193 -0.0179 'X-RAY DIFFRACTION' 
3 ? refined 63.0129 -9.1464 -108.6475 -0.3139 0.0004  -0.2615 0.1134  0.0480  0.1177 5.0347 7.3140 3.4994 0.7591  -1.3713 -2.4547 
-0.0838 -0.5856 -0.2932 0.4786  0.1825 0.3950  -0.0694 -0.4138 -0.0987 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 64  A 64  A 143 A 143 ? 'X-RAY DIFFRACTION' ? 
2 1 A 226 A 226 A 538 A 538 ? 'X-RAY DIFFRACTION' ? 
3 2 A 144 A 144 A 225 A 225 ? 'X-RAY DIFFRACTION' ? 
4 3 A 539 A 539 A 673 A 673 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
HKL-2000  'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
CNS       phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 154 ? ? -77.99  -83.64 
2  1 TYR A 195 ? ? -38.95  127.56 
3  1 ASN A 208 ? ? 36.59   67.21  
4  1 SER A 281 ? ? -153.45 82.32  
5  1 ARG A 283 ? ? -147.01 29.99  
6  1 GLU A 305 ? ? -106.06 57.44  
7  1 LYS A 306 ? ? -103.90 58.43  
8  1 CYS A 407 ? ? -154.86 89.34  
9  1 SER A 411 ? ? -100.76 -60.64 
10 1 GLN A 547 ? ? 60.95   65.39  
11 1 ASN A 570 ? ? -28.17  113.69 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ASP 2   ? A ASP 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A ALA 6   ? A ALA 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A GLU 8   ? A GLU 8   
9   1 Y 1 A VAL 9   ? A VAL 9   
10  1 Y 1 A LEU 10  ? A LEU 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A LEU 13  ? A LEU 13  
14  1 Y 1 A ARG 14  ? A ARG 14  
15  1 Y 1 A LEU 15  ? A LEU 15  
16  1 Y 1 A ALA 16  ? A ALA 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A ARG 18  ? A ARG 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A ASP 22  ? A ASP 22  
23  1 Y 1 A LEU 23  ? A LEU 23  
24  1 Y 1 A VAL 24  ? A VAL 24  
25  1 Y 1 A ARG 25  ? A ARG 25  
26  1 Y 1 A LYS 26  ? A LYS 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A LYS 28  ? A LYS 28  
29  1 Y 1 A GLU 29  ? A GLU 29  
30  1 Y 1 A ASP 30  ? A ASP 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A ALA 32  ? A ALA 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A GLN 34  ? A GLN 34  
35  1 Y 1 A VAL 35  ? A VAL 35  
36  1 Y 1 A ASP 36  ? A ASP 36  
37  1 Y 1 A VAL 37  ? A VAL 37  
38  1 Y 1 A ASP 38  ? A ASP 38  
39  1 Y 1 A LYS 39  ? A LYS 39  
40  1 Y 1 A ALA 40  ? A ALA 40  
41  1 Y 1 A VAL 41  ? A VAL 41  
42  1 Y 1 A ALA 42  ? A ALA 42  
43  1 Y 1 A GLU 43  ? A GLU 43  
44  1 Y 1 A LEU 44  ? A LEU 44  
45  1 Y 1 A LYS 45  ? A LYS 45  
46  1 Y 1 A ALA 46  ? A ALA 46  
47  1 Y 1 A ARG 47  ? A ARG 47  
48  1 Y 1 A LYS 48  ? A LYS 48  
49  1 Y 1 A ARG 49  ? A ARG 49  
50  1 Y 1 A VAL 50  ? A VAL 50  
51  1 Y 1 A LEU 51  ? A LEU 51  
52  1 Y 1 A GLU 52  ? A GLU 52  
53  1 Y 1 A ALA 53  ? A ALA 53  
54  1 Y 1 A LYS 54  ? A LYS 54  
55  1 Y 1 A GLU 55  ? A GLU 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A ALA 57  ? A ALA 57  
58  1 Y 1 A LEU 58  ? A LEU 58  
59  1 Y 1 A GLN 59  ? A GLN 59  
60  1 Y 1 A PRO 60  ? A PRO 60  
61  1 Y 1 A LYS 61  ? A LYS 61  
62  1 Y 1 A ASP 62  ? A ASP 62  
63  1 Y 1 A ASP 63  ? A ASP 63  
64  1 Y 1 A ALA 384 ? A ALA 384 
65  1 Y 1 A HIS 385 ? A HIS 385 
66  1 Y 1 A LEU 432 ? A LEU 432 
67  1 Y 1 A LYS 433 ? A LYS 433 
68  1 Y 1 A GLU 434 ? A GLU 434 
69  1 Y 1 A PRO 435 ? A PRO 435 
70  1 Y 1 A LYS 436 ? A LYS 436 
71  1 Y 1 A THR 437 ? A THR 437 
72  1 Y 1 A VAL 438 ? A VAL 438 
73  1 Y 1 A ASN 439 ? A ASN 439 
74  1 Y 1 A VAL 440 ? A VAL 440 
75  1 Y 1 A VAL 441 ? A VAL 441 
76  1 Y 1 A GLN 442 ? A GLN 442 
77  1 Y 1 A PHE 443 ? A PHE 443 
78  1 Y 1 A GLU 444 ? A GLU 444 
79  1 Y 1 A PRO 445 ? A PRO 445 
80  1 Y 1 A SER 446 ? A SER 446 
81  1 Y 1 A LYS 447 ? A LYS 447 
82  1 Y 1 A GLY 448 ? A GLY 448 
83  1 Y 1 A ALA 449 ? A ALA 449 
84  1 Y 1 A ILE 450 ? A ILE 450 
85  1 Y 1 A GLY 451 ? A GLY 451 
86  1 Y 1 A LYS 452 ? A LYS 452 
87  1 Y 1 A ALA 453 ? A ALA 453 
88  1 Y 1 A TYR 454 ? A TYR 454 
89  1 Y 1 A LYS 455 ? A LYS 455 
90  1 Y 1 A LYS 456 ? A LYS 456 
91  1 Y 1 A ASP 457 ? A ASP 457 
92  1 Y 1 A ALA 458 ? A ALA 458 
93  1 Y 1 A LYS 459 ? A LYS 459 
94  1 Y 1 A LEU 460 ? A LEU 460 
95  1 Y 1 A VAL 461 ? A VAL 461 
96  1 Y 1 A MET 462 ? A MET 462 
97  1 Y 1 A GLU 463 ? A GLU 463 
98  1 Y 1 A TYR 464 ? A TYR 464 
99  1 Y 1 A LEU 465 ? A LEU 465 
100 1 Y 1 A ALA 466 ? A ALA 466 
101 1 Y 1 A ILE 467 ? A ILE 467 
102 1 Y 1 A CYS 468 ? A CYS 468 
103 1 Y 1 A ASP 469 ? A ASP 469 
104 1 Y 1 A GLU 470 ? A GLU 470 
105 1 Y 1 A CYS 471 ? A CYS 471 
106 1 Y 1 A TYR 472 ? A TYR 472 
107 1 Y 1 A ILE 473 ? A ILE 473 
108 1 Y 1 A THR 474 ? A THR 474 
109 1 Y 1 A GLU 475 ? A GLU 475 
110 1 Y 1 A MET 476 ? A MET 476 
111 1 Y 1 A GLU 477 ? A GLU 477 
112 1 Y 1 A MET 478 ? A MET 478 
113 1 Y 1 A LEU 479 ? A LEU 479 
114 1 Y 1 A LEU 480 ? A LEU 480 
115 1 Y 1 A ASN 481 ? A ASN 481 
116 1 Y 1 A GLU 482 ? A GLU 482 
117 1 Y 1 A LYS 483 ? A LYS 483 
118 1 Y 1 A GLY 484 ? A GLY 484 
119 1 Y 1 A GLU 485 ? A GLU 485 
120 1 Y 1 A PHE 486 ? A PHE 486 
121 1 Y 1 A THR 487 ? A THR 487 
122 1 Y 1 A ILE 488 ? A ILE 488 
123 1 Y 1 A GLU 489 ? A GLU 489 
124 1 Y 1 A THR 490 ? A THR 490 
125 1 Y 1 A GLU 491 ? A GLU 491 
126 1 Y 1 A GLY 492 ? A GLY 492 
127 1 Y 1 A LYS 493 ? A LYS 493 
128 1 Y 1 A THR 494 ? A THR 494 
129 1 Y 1 A PHE 495 ? A PHE 495 
130 1 Y 1 A GLN 496 ? A GLN 496 
131 1 Y 1 A LEU 497 ? A LEU 497 
132 1 Y 1 A THR 498 ? A THR 498 
133 1 Y 1 A LYS 499 ? A LYS 499 
134 1 Y 1 A ASP 500 ? A ASP 500 
135 1 Y 1 A MET 501 ? A MET 501 
136 1 Y 1 A ILE 502 ? A ILE 502 
137 1 Y 1 A ASN 503 ? A ASN 503 
138 1 Y 1 A VAL 504 ? A VAL 504 
139 1 Y 1 A LYS 505 ? A LYS 505 
140 1 Y 1 A ARG 506 ? A ARG 506 
141 1 Y 1 A PHE 507 ? A PHE 507 
142 1 Y 1 A GLN 508 ? A GLN 508 
143 1 Y 1 A LYS 509 ? A LYS 509 
144 1 Y 1 A THR 510 ? A THR 510 
145 1 Y 1 A LEU 511 ? A LEU 511 
146 1 Y 1 A GLY 674 ? A GLY 674 
147 1 Y 1 A GLN 675 ? A GLN 675 
148 1 Y 1 A GLU 676 ? A GLU 676 
149 1 Y 1 A THR 677 ? A THR 677 
150 1 Y 1 A GLY 678 ? A GLY 678 
151 1 Y 1 A LYS 679 ? A LYS 679 
152 1 Y 1 A LYS 680 ? A LYS 680 
153 1 Y 1 A GLU 681 ? A GLU 681 
154 1 Y 1 A THR 682 ? A THR 682 
155 1 Y 1 A ILE 683 ? A ILE 683 
156 1 Y 1 A GLU 684 ? A GLU 684 
157 1 Y 1 A GLU 685 ? A GLU 685 
158 1 Y 1 A HIS 686 ? A HIS 686 
159 1 Y 1 A HIS 687 ? A HIS 687 
160 1 Y 1 A HIS 688 ? A HIS 688 
161 1 Y 1 A HIS 689 ? A HIS 689 
162 1 Y 1 A HIS 690 ? A HIS 690 
163 1 Y 1 A HIS 691 ? A HIS 691 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#