data_2Q5I
# 
_entry.id   2Q5I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Q5I         
RCSB  RCSB043174   
WWPDB D_1000043174 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2Q5H 
_pdbx_database_related.details        'Crystal structure of apo wildtype Glycyl-tRNA synthetase' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Q5I 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cader, M.Z.'                               1 
'Ren, J.'                                   2 
'James, P.A.'                               3 
'Bird, L.E.'                                4 
'Talbot, K.'                                5 
'Stammers, D.K.'                            6 
'Oxford Protein Production Facility (OPPF)' 7 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of human wildtype and S581L-mutant glycyl-tRNA synthetase, an enzyme underlying distal spinal muscular atrophy.' 
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            581 
_citation.page_first                2959 
_citation.page_last                 2964 
_citation.year                      2007 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17544401 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2007.05.046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cader, M.Z.'    1 
primary 'Ren, J.'        2 
primary 'James, P.A.'    3 
primary 'Bird, L.E.'     4 
primary 'Talbot, K.'     5 
primary 'Stammers, D.K.' 6 
# 
_cell.entry_id           2Q5I 
_cell.length_a           92.530 
_cell.length_b           92.530 
_cell.length_c           246.860 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2Q5I 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycyl-tRNA synthetase' 78488.633 1  6.1.1.14 S581L 'Residues 55-739' ? 
2 non-polymer syn 'SULFATE ION'            96.063    3  ?        ?     ?                 ? 
3 water       nat water                    18.015    37 ?        ?     ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glycine-tRNA ligase, GlyRS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELLEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELLEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   ALA n 
1 5   GLY n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  PRO n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  ALA n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  GLN n 
1 21  GLY n 
1 22  ASP n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  GLU n 
1 30  ASP n 
1 31  LYS n 
1 32  ALA n 
1 33  PRO n 
1 34  GLN n 
1 35  VAL n 
1 36  ASP n 
1 37  VAL n 
1 38  ASP n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  ALA n 
1 47  ARG n 
1 48  LYS n 
1 49  ARG n 
1 50  VAL n 
1 51  LEU n 
1 52  GLU n 
1 53  ALA n 
1 54  LYS n 
1 55  GLU n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  PRO n 
1 61  LYS n 
1 62  ASP n 
1 63  ASP n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  ARG n 
1 68  ALA n 
1 69  LYS n 
1 70  MET n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LYS n 
1 76  ARG n 
1 77  ARG n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  GLN n 
1 83  ALA n 
1 84  PHE n 
1 85  ALA n 
1 86  ILE n 
1 87  TYR n 
1 88  GLY n 
1 89  GLY n 
1 90  VAL n 
1 91  SER n 
1 92  GLY n 
1 93  LEU n 
1 94  TYR n 
1 95  ASP n 
1 96  PHE n 
1 97  GLY n 
1 98  PRO n 
1 99  VAL n 
1 100 GLY n 
1 101 CYS n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 ASN n 
1 106 ASN n 
1 107 ILE n 
1 108 ILE n 
1 109 GLN n 
1 110 THR n 
1 111 TRP n 
1 112 ARG n 
1 113 GLN n 
1 114 HIS n 
1 115 PHE n 
1 116 ILE n 
1 117 GLN n 
1 118 GLU n 
1 119 GLU n 
1 120 GLN n 
1 121 ILE n 
1 122 LEU n 
1 123 GLU n 
1 124 ILE n 
1 125 ASP n 
1 126 CYS n 
1 127 THR n 
1 128 MET n 
1 129 LEU n 
1 130 THR n 
1 131 PRO n 
1 132 GLU n 
1 133 PRO n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 THR n 
1 138 SER n 
1 139 GLY n 
1 140 HIS n 
1 141 VAL n 
1 142 ASP n 
1 143 LYS n 
1 144 PHE n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 MET n 
1 149 VAL n 
1 150 LYS n 
1 151 ASP n 
1 152 VAL n 
1 153 LYS n 
1 154 ASN n 
1 155 GLY n 
1 156 GLU n 
1 157 CYS n 
1 158 PHE n 
1 159 ARG n 
1 160 ALA n 
1 161 ASP n 
1 162 HIS n 
1 163 LEU n 
1 164 LEU n 
1 165 LYS n 
1 166 ALA n 
1 167 HIS n 
1 168 LEU n 
1 169 GLN n 
1 170 LYS n 
1 171 LEU n 
1 172 MET n 
1 173 SER n 
1 174 ASP n 
1 175 LYS n 
1 176 LYS n 
1 177 CYS n 
1 178 SER n 
1 179 VAL n 
1 180 GLU n 
1 181 LYS n 
1 182 LYS n 
1 183 SER n 
1 184 GLU n 
1 185 MET n 
1 186 GLU n 
1 187 SER n 
1 188 VAL n 
1 189 LEU n 
1 190 ALA n 
1 191 GLN n 
1 192 LEU n 
1 193 ASP n 
1 194 ASN n 
1 195 TYR n 
1 196 GLY n 
1 197 GLN n 
1 198 GLN n 
1 199 GLU n 
1 200 LEU n 
1 201 ALA n 
1 202 ASP n 
1 203 LEU n 
1 204 PHE n 
1 205 VAL n 
1 206 ASN n 
1 207 TYR n 
1 208 ASN n 
1 209 VAL n 
1 210 LYS n 
1 211 SER n 
1 212 PRO n 
1 213 ILE n 
1 214 THR n 
1 215 GLY n 
1 216 ASN n 
1 217 ASP n 
1 218 LEU n 
1 219 SER n 
1 220 PRO n 
1 221 PRO n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 ASN n 
1 226 LEU n 
1 227 MET n 
1 228 PHE n 
1 229 LYS n 
1 230 THR n 
1 231 PHE n 
1 232 ILE n 
1 233 GLY n 
1 234 PRO n 
1 235 GLY n 
1 236 GLY n 
1 237 ASN n 
1 238 MET n 
1 239 PRO n 
1 240 GLY n 
1 241 TYR n 
1 242 LEU n 
1 243 ARG n 
1 244 PRO n 
1 245 GLU n 
1 246 THR n 
1 247 ALA n 
1 248 GLN n 
1 249 GLY n 
1 250 ILE n 
1 251 PHE n 
1 252 LEU n 
1 253 ASN n 
1 254 PHE n 
1 255 LYS n 
1 256 ARG n 
1 257 LEU n 
1 258 LEU n 
1 259 GLU n 
1 260 PHE n 
1 261 ASN n 
1 262 GLN n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 PRO n 
1 267 PHE n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 GLN n 
1 272 ILE n 
1 273 GLY n 
1 274 ASN n 
1 275 SER n 
1 276 PHE n 
1 277 ARG n 
1 278 ASN n 
1 279 GLU n 
1 280 ILE n 
1 281 SER n 
1 282 PRO n 
1 283 ARG n 
1 284 SER n 
1 285 GLY n 
1 286 LEU n 
1 287 ILE n 
1 288 ARG n 
1 289 VAL n 
1 290 ARG n 
1 291 GLU n 
1 292 PHE n 
1 293 THR n 
1 294 MET n 
1 295 ALA n 
1 296 GLU n 
1 297 ILE n 
1 298 GLU n 
1 299 HIS n 
1 300 PHE n 
1 301 VAL n 
1 302 ASP n 
1 303 PRO n 
1 304 SER n 
1 305 GLU n 
1 306 LYS n 
1 307 ASP n 
1 308 HIS n 
1 309 PRO n 
1 310 LYS n 
1 311 PHE n 
1 312 GLN n 
1 313 ASN n 
1 314 VAL n 
1 315 ALA n 
1 316 ASP n 
1 317 LEU n 
1 318 HIS n 
1 319 LEU n 
1 320 TYR n 
1 321 LEU n 
1 322 TYR n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ALA n 
1 327 GLN n 
1 328 VAL n 
1 329 SER n 
1 330 GLY n 
1 331 GLN n 
1 332 SER n 
1 333 ALA n 
1 334 ARG n 
1 335 LYS n 
1 336 MET n 
1 337 ARG n 
1 338 LEU n 
1 339 GLY n 
1 340 ASP n 
1 341 ALA n 
1 342 VAL n 
1 343 GLU n 
1 344 GLN n 
1 345 GLY n 
1 346 VAL n 
1 347 ILE n 
1 348 ASN n 
1 349 ASN n 
1 350 THR n 
1 351 VAL n 
1 352 LEU n 
1 353 GLY n 
1 354 TYR n 
1 355 PHE n 
1 356 ILE n 
1 357 GLY n 
1 358 ARG n 
1 359 ILE n 
1 360 TYR n 
1 361 LEU n 
1 362 TYR n 
1 363 LEU n 
1 364 THR n 
1 365 LYS n 
1 366 VAL n 
1 367 GLY n 
1 368 ILE n 
1 369 SER n 
1 370 PRO n 
1 371 ASP n 
1 372 LYS n 
1 373 LEU n 
1 374 ARG n 
1 375 PHE n 
1 376 ARG n 
1 377 GLN n 
1 378 HIS n 
1 379 MET n 
1 380 GLU n 
1 381 ASN n 
1 382 GLU n 
1 383 MET n 
1 384 ALA n 
1 385 HIS n 
1 386 TYR n 
1 387 ALA n 
1 388 CYS n 
1 389 ASP n 
1 390 CYS n 
1 391 TRP n 
1 392 ASP n 
1 393 ALA n 
1 394 GLU n 
1 395 SER n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 TYR n 
1 400 GLY n 
1 401 TRP n 
1 402 ILE n 
1 403 GLU n 
1 404 ILE n 
1 405 VAL n 
1 406 GLY n 
1 407 CYS n 
1 408 ALA n 
1 409 ASP n 
1 410 ARG n 
1 411 SER n 
1 412 CYS n 
1 413 TYR n 
1 414 ASP n 
1 415 LEU n 
1 416 SER n 
1 417 CYS n 
1 418 HIS n 
1 419 ALA n 
1 420 ARG n 
1 421 ALA n 
1 422 THR n 
1 423 LYS n 
1 424 VAL n 
1 425 PRO n 
1 426 LEU n 
1 427 VAL n 
1 428 ALA n 
1 429 GLU n 
1 430 LYS n 
1 431 PRO n 
1 432 LEU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 LYS n 
1 437 THR n 
1 438 VAL n 
1 439 ASN n 
1 440 VAL n 
1 441 VAL n 
1 442 GLN n 
1 443 PHE n 
1 444 GLU n 
1 445 PRO n 
1 446 SER n 
1 447 LYS n 
1 448 GLY n 
1 449 ALA n 
1 450 ILE n 
1 451 GLY n 
1 452 LYS n 
1 453 ALA n 
1 454 TYR n 
1 455 LYS n 
1 456 LYS n 
1 457 ASP n 
1 458 ALA n 
1 459 LYS n 
1 460 LEU n 
1 461 VAL n 
1 462 MET n 
1 463 GLU n 
1 464 TYR n 
1 465 LEU n 
1 466 ALA n 
1 467 ILE n 
1 468 CYS n 
1 469 ASP n 
1 470 GLU n 
1 471 CYS n 
1 472 TYR n 
1 473 ILE n 
1 474 THR n 
1 475 GLU n 
1 476 MET n 
1 477 GLU n 
1 478 MET n 
1 479 LEU n 
1 480 LEU n 
1 481 ASN n 
1 482 GLU n 
1 483 LYS n 
1 484 GLY n 
1 485 GLU n 
1 486 PHE n 
1 487 THR n 
1 488 ILE n 
1 489 GLU n 
1 490 THR n 
1 491 GLU n 
1 492 GLY n 
1 493 LYS n 
1 494 THR n 
1 495 PHE n 
1 496 GLN n 
1 497 LEU n 
1 498 THR n 
1 499 LYS n 
1 500 ASP n 
1 501 MET n 
1 502 ILE n 
1 503 ASN n 
1 504 VAL n 
1 505 LYS n 
1 506 ARG n 
1 507 PHE n 
1 508 GLN n 
1 509 LYS n 
1 510 THR n 
1 511 LEU n 
1 512 TYR n 
1 513 VAL n 
1 514 GLU n 
1 515 GLU n 
1 516 VAL n 
1 517 VAL n 
1 518 PRO n 
1 519 ASN n 
1 520 VAL n 
1 521 ILE n 
1 522 GLU n 
1 523 PRO n 
1 524 SER n 
1 525 PHE n 
1 526 GLY n 
1 527 LEU n 
1 528 GLY n 
1 529 ARG n 
1 530 ILE n 
1 531 MET n 
1 532 TYR n 
1 533 THR n 
1 534 VAL n 
1 535 PHE n 
1 536 GLU n 
1 537 HIS n 
1 538 THR n 
1 539 PHE n 
1 540 HIS n 
1 541 VAL n 
1 542 ARG n 
1 543 GLU n 
1 544 GLY n 
1 545 ASP n 
1 546 GLU n 
1 547 GLN n 
1 548 ARG n 
1 549 THR n 
1 550 PHE n 
1 551 PHE n 
1 552 SER n 
1 553 PHE n 
1 554 PRO n 
1 555 ALA n 
1 556 VAL n 
1 557 VAL n 
1 558 ALA n 
1 559 PRO n 
1 560 PHE n 
1 561 LYS n 
1 562 CYS n 
1 563 SER n 
1 564 VAL n 
1 565 LEU n 
1 566 PRO n 
1 567 LEU n 
1 568 SER n 
1 569 GLN n 
1 570 ASN n 
1 571 GLN n 
1 572 GLU n 
1 573 PHE n 
1 574 MET n 
1 575 PRO n 
1 576 PHE n 
1 577 VAL n 
1 578 LYS n 
1 579 GLU n 
1 580 LEU n 
1 581 LEU n 
1 582 GLU n 
1 583 ALA n 
1 584 LEU n 
1 585 THR n 
1 586 ARG n 
1 587 HIS n 
1 588 GLY n 
1 589 VAL n 
1 590 SER n 
1 591 HIS n 
1 592 LYS n 
1 593 VAL n 
1 594 ASP n 
1 595 ASP n 
1 596 SER n 
1 597 SER n 
1 598 GLY n 
1 599 SER n 
1 600 ILE n 
1 601 GLY n 
1 602 ARG n 
1 603 ARG n 
1 604 TYR n 
1 605 ALA n 
1 606 ARG n 
1 607 THR n 
1 608 ASP n 
1 609 GLU n 
1 610 ILE n 
1 611 GLY n 
1 612 VAL n 
1 613 ALA n 
1 614 PHE n 
1 615 GLY n 
1 616 VAL n 
1 617 THR n 
1 618 ILE n 
1 619 ASP n 
1 620 PHE n 
1 621 ASP n 
1 622 THR n 
1 623 VAL n 
1 624 ASN n 
1 625 LYS n 
1 626 THR n 
1 627 PRO n 
1 628 HIS n 
1 629 THR n 
1 630 ALA n 
1 631 THR n 
1 632 LEU n 
1 633 ARG n 
1 634 ASP n 
1 635 ARG n 
1 636 ASP n 
1 637 SER n 
1 638 MET n 
1 639 ARG n 
1 640 GLN n 
1 641 ILE n 
1 642 ARG n 
1 643 ALA n 
1 644 GLU n 
1 645 ILE n 
1 646 SER n 
1 647 GLU n 
1 648 LEU n 
1 649 PRO n 
1 650 SER n 
1 651 ILE n 
1 652 VAL n 
1 653 GLN n 
1 654 ASP n 
1 655 LEU n 
1 656 ALA n 
1 657 ASN n 
1 658 GLY n 
1 659 ASN n 
1 660 ILE n 
1 661 THR n 
1 662 TRP n 
1 663 ALA n 
1 664 ASP n 
1 665 VAL n 
1 666 GLU n 
1 667 ALA n 
1 668 ARG n 
1 669 TYR n 
1 670 PRO n 
1 671 LEU n 
1 672 PHE n 
1 673 GLU n 
1 674 GLY n 
1 675 GLN n 
1 676 GLU n 
1 677 THR n 
1 678 GLY n 
1 679 LYS n 
1 680 LYS n 
1 681 GLU n 
1 682 THR n 
1 683 ILE n 
1 684 GLU n 
1 685 GLU n 
1 686 HIS n 
1 687 HIS n 
1 688 HIS n 
1 689 HIS n 
1 690 HIS n 
1 691 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GARS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYG_HUMAN 
_struct_ref.pdbx_db_accession          P41250 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRA
DHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPG
YLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYG
WIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLL
NEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQ
IRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
;
_struct_ref.pdbx_align_begin           55 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2Q5I 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 685 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41250 
_struct_ref_seq.db_align_beg                  55 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  739 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       685 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Q5I LEU A 581 ? UNP P41250 SER 635 ENGINEERED       581 1 
1 2Q5I HIS A 686 ? UNP P41250 ?   ?   'EXPRESSION TAG' 686 2 
1 2Q5I HIS A 687 ? UNP P41250 ?   ?   'EXPRESSION TAG' 687 3 
1 2Q5I HIS A 688 ? UNP P41250 ?   ?   'EXPRESSION TAG' 688 4 
1 2Q5I HIS A 689 ? UNP P41250 ?   ?   'EXPRESSION TAG' 689 5 
1 2Q5I HIS A 690 ? UNP P41250 ?   ?   'EXPRESSION TAG' 690 6 
1 2Q5I HIS A 691 ? UNP P41250 ?   ?   'EXPRESSION TAG' 691 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Q5I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.36 
_exptl_crystal.density_percent_sol   63.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG 3350, 0.2M Na2SO4, 0.1M Bis-Tris propane, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-11-28 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97650 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97650 
# 
_reflns.entry_id                     2Q5I 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.8 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   27432 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.108 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           0.734 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        5.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2643 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2Q5I 
_refine.ls_number_reflns_obs                     25923 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.27 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    99.86 
_refine.ls_R_factor_obs                          0.21440 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21265 
_refine.ls_R_factor_R_free                       0.24919 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1329 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.907 
_refine.B_iso_mean                               34.963 
_refine.aniso_B[1][1]                            0.45 
_refine.aniso_B[2][2]                            0.45 
_refine.aniso_B[3][3]                            -0.90 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. O program has also been used in structure solution. CNS program has also been used in the refinement.
;
_refine.pdbx_starting_model                      'PDB entry 1ATI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.420 
_refine.pdbx_overall_ESU_R_Free                  0.288 
_refine.overall_SU_ML                            0.197 
_refine.overall_SU_B                             21.475 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4215 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               4267 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        29.27 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 4323 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2979 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.987  1.956  ? 5843 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.882  3.000  ? 7227 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.159  5.000  ? 525  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.791 23.897 ? 213  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.743 15.000 ? 742  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.649 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.100  0.200  ? 629  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 4808 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 910  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.199  0.200  ? 877  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.176  0.200  ? 3018 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.177  0.200  ? 2123 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.080  0.200  ? 2331 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.092  0.200  ? 81   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.174  0.200  ? 18   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.174  0.200  ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.260  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.996  4.000  ? 3414 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.581  4.000  ? 1064 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.829  6.000  ? 4246 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.459  6.000  ? 1972 'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.923  12.000 ? 1597 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.872 
_refine_ls_shell.number_reflns_R_work             1823 
_refine_ls_shell.R_factor_R_work                  0.397 
_refine_ls_shell.percent_reflns_obs               98.35 
_refine_ls_shell.R_factor_R_free                  0.428 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             86 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2Q5I 
_struct.title                     'Crystal structure of apo S581L Glycyl-tRNA synthetase mutant' 
_struct.pdbx_descriptor           'Glycyl-tRNA synthetase (E.C.6.1.1.14)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Q5I 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
;Aminoacyl-tRNA synthetase, ATP-binding, Structural Genomics, Glycyl-tRNA Synthetase, Oxford Protein Production Facility, OPPF, LIGASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'The biological assembly is a homodimer generated from the monomer in the asymmetric unit by the symmetry operation Y,X,-Z' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 66  ? ARG A 77  ? ASP A 66  ARG A 77  1 ? 12 
HELX_P HELX_P2  2  PHE A 84  ? GLY A 88  ? PHE A 84  GLY A 88  5 ? 5  
HELX_P HELX_P3  3  GLY A 97  ? PHE A 115 ? GLY A 97  PHE A 115 1 ? 19 
HELX_P HELX_P4  4  GLU A 132 ? SER A 138 ? GLU A 132 SER A 138 1 ? 7  
HELX_P HELX_P5  5  GLY A 139 ? PHE A 144 ? GLY A 139 PHE A 144 1 ? 6  
HELX_P HELX_P6  6  ALA A 160 ? SER A 173 ? ALA A 160 SER A 173 1 ? 14 
HELX_P HELX_P7  7  SER A 178 ? ALA A 190 ? SER A 178 ALA A 190 1 ? 13 
HELX_P HELX_P8  8  GLY A 196 ? TYR A 207 ? GLY A 196 TYR A 207 1 ? 12 
HELX_P HELX_P9  9  THR A 246 ? ASN A 253 ? THR A 246 ASN A 253 1 ? 8  
HELX_P HELX_P10 10 ASN A 253 ? ASN A 261 ? ASN A 253 ASN A 261 1 ? 9  
HELX_P HELX_P11 11 SER A 284 ? ARG A 288 ? SER A 284 ARG A 288 5 ? 5  
HELX_P HELX_P12 12 LYS A 310 ? VAL A 314 ? LYS A 310 VAL A 314 5 ? 5  
HELX_P HELX_P13 13 SER A 323 ? GLY A 330 ? SER A 323 GLY A 330 1 ? 8  
HELX_P HELX_P14 14 LEU A 338 ? GLN A 344 ? LEU A 338 GLN A 344 1 ? 7  
HELX_P HELX_P15 15 ASN A 349 ? VAL A 366 ? ASN A 349 VAL A 366 1 ? 18 
HELX_P HELX_P16 16 SER A 369 ? ASP A 371 ? SER A 369 ASP A 371 5 ? 3  
HELX_P HELX_P17 17 TYR A 413 ? LYS A 423 ? TYR A 413 LYS A 423 1 ? 11 
HELX_P HELX_P18 18 LEU A 527 ? THR A 538 ? LEU A 527 THR A 538 1 ? 12 
HELX_P HELX_P19 19 PHE A 573 ? HIS A 587 ? PHE A 573 HIS A 587 1 ? 15 
HELX_P HELX_P20 20 SER A 599 ? ILE A 610 ? SER A 599 ILE A 610 1 ? 12 
HELX_P HELX_P21 21 ASP A 619 ? LYS A 625 ? ASP A 619 LYS A 625 1 ? 7  
HELX_P HELX_P22 22 GLU A 647 ? ASN A 657 ? GLU A 647 ASN A 657 1 ? 11 
HELX_P HELX_P23 23 THR A 661 ? TYR A 669 ? THR A 661 TYR A 669 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 265 A . ? LEU 265 A PRO 266 A ? PRO 266 A 1 2.80  
2 THR 626 A . ? THR 626 A PRO 627 A ? PRO 627 A 1 -2.43 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 80  ? GLN A 82  ? TYR A 80  GLN A 82  
A 2 TYR A 94  ? PHE A 96  ? TYR A 94  PHE A 96  
B 1 LEU A 122 ? GLU A 123 ? LEU A 122 GLU A 123 
B 2 PHE A 267 ? PHE A 276 ? PHE A 267 PHE A 276 
B 3 GLU A 291 ? VAL A 301 ? GLU A 291 VAL A 301 
B 4 ASN A 519 ? GLY A 526 ? ASN A 519 GLY A 526 
B 5 GLY A 400 ? ARG A 410 ? GLY A 400 ARG A 410 
B 6 ASP A 389 ? THR A 397 ? ASP A 389 THR A 397 
B 7 LEU A 373 ? GLN A 377 ? LEU A 373 GLN A 377 
B 8 HIS A 318 ? TYR A 322 ? HIS A 318 TYR A 322 
B 9 ARG A 334 ? ARG A 337 ? ARG A 334 ARG A 337 
C 1 LEU A 129 ? PRO A 131 ? LEU A 129 PRO A 131 
C 2 PRO A 239 ? LEU A 242 ? PRO A 239 LEU A 242 
C 3 LYS A 229 ? PHE A 231 ? LYS A 229 PHE A 231 
D 1 CYS A 157 ? ARG A 159 ? CYS A 157 ARG A 159 
D 2 ALA A 145 ? LYS A 150 ? ALA A 145 LYS A 150 
D 3 VAL A 222 ? ASN A 225 ? VAL A 222 ASN A 225 
E 1 ALA A 428 ? LYS A 430 ? ALA A 428 LYS A 430 
E 2 GLU A 514 ? VAL A 516 ? GLU A 514 VAL A 516 
F 1 PHE A 539 ? VAL A 541 ? PHE A 539 VAL A 541 
F 2 THR A 549 ? PHE A 551 ? THR A 549 PHE A 551 
G 1 HIS A 591 ? VAL A 593 ? HIS A 591 VAL A 593 
G 2 CYS A 562 ? PRO A 566 ? CYS A 562 PRO A 566 
G 3 PHE A 614 ? ILE A 618 ? PHE A 614 ILE A 618 
G 4 THR A 629 ? ASP A 634 ? THR A 629 ASP A 634 
G 5 GLN A 640 ? GLU A 644 ? GLN A 640 GLU A 644 
G 6 LEU A 671 ? PHE A 672 ? LEU A 671 PHE A 672 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 81  ? N ASP A 81  O ASP A 95  ? O ASP A 95  
B 1 2 N LEU A 122 ? N LEU A 122 O ALA A 268 ? O ALA A 268 
B 2 3 N GLY A 273 ? N GLY A 273 O MET A 294 ? O MET A 294 
B 3 4 N ALA A 295 ? N ALA A 295 O PHE A 525 ? O PHE A 525 
B 4 5 O SER A 524 ? O SER A 524 N GLY A 406 ? N GLY A 406 
B 5 6 O VAL A 405 ? O VAL A 405 N ALA A 393 ? N ALA A 393 
B 6 7 O GLU A 394 ? O GLU A 394 N ARG A 374 ? N ARG A 374 
B 7 8 O PHE A 375 ? O PHE A 375 N TYR A 322 ? N TYR A 322 
B 8 9 N LEU A 321 ? N LEU A 321 O ARG A 334 ? O ARG A 334 
C 1 2 N THR A 130 ? N THR A 130 O TYR A 241 ? O TYR A 241 
C 2 3 O GLY A 240 ? O GLY A 240 N THR A 230 ? N THR A 230 
D 1 2 O PHE A 158 ? O PHE A 158 N VAL A 149 ? N VAL A 149 
D 2 3 N MET A 148 ? N MET A 148 O VAL A 222 ? O VAL A 222 
E 1 2 N ALA A 428 ? N ALA A 428 O VAL A 516 ? O VAL A 516 
F 1 2 N HIS A 540 ? N HIS A 540 O PHE A 550 ? O PHE A 550 
G 1 2 O LYS A 592 ? O LYS A 592 N VAL A 564 ? N VAL A 564 
G 2 3 N SER A 563 ? N SER A 563 O PHE A 614 ? O PHE A 614 
G 3 4 N GLY A 615 ? N GLY A 615 O ARG A 633 ? O ARG A 633 
G 4 5 N ALA A 630 ? N ALA A 630 O ALA A 643 ? O ALA A 643 
G 5 6 N GLN A 640 ? N GLN A 640 O PHE A 672 ? O PHE A 672 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 692' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 693' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 694' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 HIS A 114 ? HIS A 114 . ? 1_555 ? 
2 AC1 3 ARG A 358 ? ARG A 358 . ? 1_555 ? 
3 AC1 3 LYS A 365 ? LYS A 365 . ? 1_555 ? 
4 AC2 3 ASP A 621 ? ASP A 621 . ? 1_555 ? 
5 AC2 3 THR A 629 ? THR A 629 . ? 1_555 ? 
6 AC2 3 ARG A 642 ? ARG A 642 . ? 1_555 ? 
7 AC3 2 SER A 91  ? SER A 91  . ? 1_555 ? 
8 AC3 2 ARG A 290 ? ARG A 290 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Q5I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Q5I 
_atom_sites.fract_transf_matrix[1][1]   0.010807 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010807 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004051 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 64  ? 65.311  18.131  -120.220 1.00 57.70  ? 64  ILE A N   1 
ATOM   2    C CA  . ILE A 1 64  ? 65.091  19.011  -119.030 1.00 59.44  ? 64  ILE A CA  1 
ATOM   3    C C   . ILE A 1 64  ? 65.408  18.246  -117.732 1.00 60.56  ? 64  ILE A C   1 
ATOM   4    O O   . ILE A 1 64  ? 64.856  18.553  -116.664 1.00 59.45  ? 64  ILE A O   1 
ATOM   5    C CB  . ILE A 1 64  ? 63.631  19.571  -118.982 1.00 61.41  ? 64  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 64  ? 63.153  20.002  -120.379 1.00 67.04  ? 64  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 64  ? 63.530  20.749  -118.010 1.00 56.57  ? 64  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 64  ? 62.629  18.854  -121.254 1.00 68.46  ? 64  ILE A CD1 1 
ATOM   9    N N   . VAL A 1 65  ? 66.304  17.258  -117.831 1.00 53.53  ? 65  VAL A N   1 
ATOM   10   C CA  . VAL A 1 65  ? 66.698  16.440  -116.680 1.00 49.60  ? 65  VAL A CA  1 
ATOM   11   C C   . VAL A 1 65  ? 67.354  17.294  -115.589 1.00 45.22  ? 65  VAL A C   1 
ATOM   12   O O   . VAL A 1 65  ? 67.995  18.304  -115.884 1.00 41.43  ? 65  VAL A O   1 
ATOM   13   C CB  . VAL A 1 65  ? 67.674  15.299  -117.101 1.00 50.79  ? 65  VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 65  ? 69.002  15.862  -117.602 1.00 47.90  ? 65  VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 65  ? 67.916  14.333  -115.952 1.00 50.35  ? 65  VAL A CG2 1 
ATOM   16   N N   . ASP A 1 66  ? 67.176  16.892  -114.333 1.00 43.50  ? 66  ASP A N   1 
ATOM   17   C CA  . ASP A 1 66  ? 67.880  17.519  -113.219 1.00 42.87  ? 66  ASP A CA  1 
ATOM   18   C C   . ASP A 1 66  ? 69.307  16.964  -113.159 1.00 44.63  ? 66  ASP A C   1 
ATOM   19   O O   . ASP A 1 66  ? 69.566  15.929  -112.536 1.00 46.01  ? 66  ASP A O   1 
ATOM   20   C CB  . ASP A 1 66  ? 67.141  17.266  -111.903 1.00 42.34  ? 66  ASP A CB  1 
ATOM   21   C CG  . ASP A 1 66  ? 67.698  18.087  -110.754 1.00 47.53  ? 66  ASP A CG  1 
ATOM   22   O OD1 . ASP A 1 66  ? 68.880  18.493  -110.822 1.00 57.02  ? 66  ASP A OD1 1 
ATOM   23   O OD2 . ASP A 1 66  ? 66.952  18.327  -109.779 1.00 51.25  ? 66  ASP A OD2 1 
ATOM   24   N N   . ARG A 1 67  ? 70.229  17.660  -113.815 1.00 40.57  ? 67  ARG A N   1 
ATOM   25   C CA  . ARG A 1 67  ? 71.603  17.191  -113.939 1.00 37.97  ? 67  ARG A CA  1 
ATOM   26   C C   . ARG A 1 67  ? 72.271  17.050  -112.566 1.00 39.14  ? 67  ARG A C   1 
ATOM   27   O O   . ARG A 1 67  ? 72.960  16.062  -112.303 1.00 37.17  ? 67  ARG A O   1 
ATOM   28   C CB  . ARG A 1 67  ? 72.408  18.147  -114.820 1.00 33.75  ? 67  ARG A CB  1 
ATOM   29   C CG  . ARG A 1 67  ? 73.752  17.596  -115.270 1.00 38.29  ? 67  ARG A CG  1 
ATOM   30   C CD  . ARG A 1 67  ? 74.731  18.700  -115.633 1.00 41.92  ? 67  ARG A CD  1 
ATOM   31   N NE  . ARG A 1 67  ? 74.322  19.426  -116.831 1.00 43.64  ? 67  ARG A NE  1 
ATOM   32   C CZ  . ARG A 1 67  ? 74.988  20.449  -117.357 1.00 46.96  ? 67  ARG A CZ  1 
ATOM   33   N NH1 . ARG A 1 67  ? 76.107  20.891  -116.798 1.00 54.02  ? 67  ARG A NH1 1 
ATOM   34   N NH2 . ARG A 1 67  ? 74.526  21.040  -118.451 1.00 53.63  ? 67  ARG A NH2 1 
ATOM   35   N N   . ALA A 1 68  ? 72.059  18.034  -111.696 1.00 38.15  ? 68  ALA A N   1 
ATOM   36   C CA  . ALA A 1 68  ? 72.652  18.019  -110.361 1.00 37.29  ? 68  ALA A CA  1 
ATOM   37   C C   . ALA A 1 68  ? 72.269  16.748  -109.609 1.00 37.59  ? 68  ALA A C   1 
ATOM   38   O O   . ALA A 1 68  ? 73.119  16.091  -109.012 1.00 35.80  ? 68  ALA A O   1 
ATOM   39   C CB  . ALA A 1 68  ? 72.214  19.240  -109.580 1.00 34.64  ? 68  ALA A CB  1 
ATOM   40   N N   . LYS A 1 69  ? 70.983  16.411  -109.663 1.00 38.26  ? 69  LYS A N   1 
ATOM   41   C CA  . LYS A 1 69  ? 70.437  15.246  -108.970 1.00 38.99  ? 69  LYS A CA  1 
ATOM   42   C C   . LYS A 1 69  ? 70.980  13.950  -109.575 1.00 39.42  ? 69  LYS A C   1 
ATOM   43   O O   . LYS A 1 69  ? 71.411  13.052  -108.849 1.00 40.73  ? 69  LYS A O   1 
ATOM   44   C CB  . LYS A 1 69  ? 68.908  15.279  -109.049 1.00 40.10  ? 69  LYS A CB  1 
ATOM   45   C CG  . LYS A 1 69  ? 68.173  14.422  -108.033 1.00 39.95  ? 69  LYS A CG  1 
ATOM   46   C CD  . LYS A 1 69  ? 66.696  14.828  -107.975 1.00 43.59  ? 69  LYS A CD  1 
ATOM   47   C CE  . LYS A 1 69  ? 65.872  13.924  -107.061 1.00 46.51  ? 69  LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 69  ? 66.218  14.067  -105.621 1.00 45.29  ? 69  LYS A NZ  1 
ATOM   49   N N   . MET A 1 70  ? 70.965  13.868  -110.904 1.00 40.15  ? 70  MET A N   1 
ATOM   50   C CA  . MET A 1 70  ? 71.545  12.732  -111.627 1.00 39.93  ? 70  MET A CA  1 
ATOM   51   C C   . MET A 1 70  ? 73.025  12.596  -111.284 1.00 39.65  ? 70  MET A C   1 
ATOM   52   O O   . MET A 1 70  ? 73.490  11.515  -110.926 1.00 41.59  ? 70  MET A O   1 
ATOM   53   C CB  . MET A 1 70  ? 71.374  12.908  -113.145 1.00 39.03  ? 70  MET A CB  1 
ATOM   54   C CG  . MET A 1 70  ? 71.731  11.672  -113.962 1.00 43.32  ? 70  MET A CG  1 
ATOM   55   S SD  . MET A 1 70  ? 71.777  11.935  -115.749 1.00 41.43  ? 70  MET A SD  1 
ATOM   56   C CE  . MET A 1 70  ? 73.164  13.065  -115.887 1.00 37.80  ? 70  MET A CE  1 
ATOM   57   N N   . GLU A 1 71  ? 73.760  13.700  -111.383 1.00 40.95  ? 71  GLU A N   1 
ATOM   58   C CA  . GLU A 1 71  ? 75.191  13.693  -111.078 1.00 42.19  ? 71  GLU A CA  1 
ATOM   59   C C   . GLU A 1 71  ? 75.442  13.211  -109.660 1.00 35.64  ? 71  GLU A C   1 
ATOM   60   O O   . GLU A 1 71  ? 76.441  12.549  -109.402 1.00 36.96  ? 71  GLU A O   1 
ATOM   61   C CB  . GLU A 1 71  ? 75.821  15.080  -111.289 1.00 45.13  ? 71  GLU A CB  1 
ATOM   62   C CG  . GLU A 1 71  ? 76.117  15.418  -112.762 1.00 47.40  ? 71  GLU A CG  1 
ATOM   63   C CD  . GLU A 1 71  ? 76.508  16.878  -112.984 1.00 48.91  ? 71  GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 71  ? 75.957  17.764  -112.296 1.00 60.97  ? 71  GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 71  ? 77.353  17.146  -113.864 1.00 49.64  ? 71  GLU A OE2 1 
ATOM   66   N N   . ASP A 1 72  ? 74.534  13.532  -108.744 1.00 38.51  ? 72  ASP A N   1 
ATOM   67   C CA  . ASP A 1 72  ? 74.677  13.095  -107.359 1.00 40.52  ? 72  ASP A CA  1 
ATOM   68   C C   . ASP A 1 72  ? 74.547  11.582  -107.261 1.00 39.90  ? 72  ASP A C   1 
ATOM   69   O O   . ASP A 1 72  ? 75.359  10.937  -106.598 1.00 37.33  ? 72  ASP A O   1 
ATOM   70   C CB  . ASP A 1 72  ? 73.655  13.774  -106.442 1.00 43.18  ? 72  ASP A CB  1 
ATOM   71   C CG  . ASP A 1 72  ? 73.863  13.419  -104.974 1.00 47.78  ? 72  ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 72  ? 74.969  13.672  -104.447 1.00 58.93  ? 72  ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 72  ? 72.924  12.882  -104.347 1.00 58.00  ? 72  ASP A OD2 1 
ATOM   74   N N   . THR A 1 73  ? 73.540  11.018  -107.926 1.00 37.42  ? 73  THR A N   1 
ATOM   75   C CA  . THR A 1 73  ? 73.355  9.569   -107.934 1.00 37.56  ? 73  THR A CA  1 
ATOM   76   C C   . THR A 1 73  ? 74.547  8.888   -108.599 1.00 41.06  ? 73  THR A C   1 
ATOM   77   O O   . THR A 1 73  ? 75.121  7.941   -108.046 1.00 44.52  ? 73  THR A O   1 
ATOM   78   C CB  . THR A 1 73  ? 72.057  9.157   -108.655 1.00 34.91  ? 73  THR A CB  1 
ATOM   79   O OG1 . THR A 1 73  ? 70.929  9.711   -107.968 1.00 46.81  ? 73  THR A OG1 1 
ATOM   80   C CG2 . THR A 1 73  ? 71.913  7.645   -108.689 1.00 34.70  ? 73  THR A CG2 1 
ATOM   81   N N   . LEU A 1 74  ? 74.927  9.381   -109.777 1.00 40.61  ? 74  LEU A N   1 
ATOM   82   C CA  . LEU A 1 74  ? 76.048  8.808   -110.523 1.00 39.43  ? 74  LEU A CA  1 
ATOM   83   C C   . LEU A 1 74  ? 77.322  8.784   -109.682 1.00 38.05  ? 74  LEU A C   1 
ATOM   84   O O   . LEU A 1 74  ? 78.063  7.801   -109.696 1.00 38.52  ? 74  LEU A O   1 
ATOM   85   C CB  . LEU A 1 74  ? 76.285  9.584   -111.821 1.00 39.90  ? 74  LEU A CB  1 
ATOM   86   C CG  . LEU A 1 74  ? 75.226  9.381   -112.905 1.00 39.74  ? 74  LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 74  ? 75.327  10.465  -113.971 1.00 36.77  ? 74  LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 74  ? 75.356  7.996   -113.523 1.00 35.66  ? 74  LEU A CD2 1 
ATOM   89   N N   . LYS A 1 75  ? 77.562  9.863   -108.943 1.00 38.24  ? 75  LYS A N   1 
ATOM   90   C CA  . LYS A 1 75  ? 78.730  9.959   -108.070 1.00 39.72  ? 75  LYS A CA  1 
ATOM   91   C C   . LYS A 1 75  ? 78.585  9.036   -106.856 1.00 38.12  ? 75  LYS A C   1 
ATOM   92   O O   . LYS A 1 75  ? 79.508  8.296   -106.516 1.00 40.01  ? 75  LYS A O   1 
ATOM   93   C CB  . LYS A 1 75  ? 78.926  11.404  -107.608 1.00 40.58  ? 75  LYS A CB  1 
ATOM   94   C CG  . LYS A 1 75  ? 80.292  11.690  -107.018 1.00 41.85  ? 75  LYS A CG  1 
ATOM   95   C CD  . LYS A 1 75  ? 80.320  13.042  -106.320 1.00 46.62  ? 75  LYS A CD  1 
ATOM   96   C CE  . LYS A 1 75  ? 81.721  13.404  -105.841 1.00 56.18  ? 75  LYS A CE  1 
ATOM   97   N NZ  . LYS A 1 75  ? 82.250  12.429  -104.844 1.00 64.12  ? 75  LYS A NZ  1 
ATOM   98   N N   . ARG A 1 76  ? 77.413  9.073   -106.231 1.00 33.15  ? 76  ARG A N   1 
ATOM   99   C CA  . ARG A 1 76  ? 77.158  8.338   -104.997 1.00 34.65  ? 76  ARG A CA  1 
ATOM   100  C C   . ARG A 1 76  ? 77.190  6.826   -105.187 1.00 34.57  ? 76  ARG A C   1 
ATOM   101  O O   . ARG A 1 76  ? 77.797  6.118   -104.393 1.00 36.03  ? 76  ARG A O   1 
ATOM   102  C CB  . ARG A 1 76  ? 75.811  8.760   -104.412 1.00 34.82  ? 76  ARG A CB  1 
ATOM   103  C CG  . ARG A 1 76  ? 75.573  8.317   -102.988 1.00 33.87  ? 76  ARG A CG  1 
ATOM   104  C CD  . ARG A 1 76  ? 74.502  9.164   -102.311 1.00 39.91  ? 76  ARG A CD  1 
ATOM   105  N NE  . ARG A 1 76  ? 73.403  9.507   -103.211 1.00 39.94  ? 76  ARG A NE  1 
ATOM   106  C CZ  . ARG A 1 76  ? 72.474  8.653   -103.632 1.00 48.26  ? 76  ARG A CZ  1 
ATOM   107  N NH1 . ARG A 1 76  ? 72.490  7.380   -103.245 1.00 51.22  ? 76  ARG A NH1 1 
ATOM   108  N NH2 . ARG A 1 76  ? 71.522  9.078   -104.455 1.00 47.51  ? 76  ARG A NH2 1 
ATOM   109  N N   . ARG A 1 77  ? 76.546  6.330   -106.238 1.00 37.46  ? 77  ARG A N   1 
ATOM   110  C CA  . ARG A 1 77  ? 76.555  4.891   -106.525 1.00 36.48  ? 77  ARG A CA  1 
ATOM   111  C C   . ARG A 1 77  ? 77.783  4.446   -107.326 1.00 38.40  ? 77  ARG A C   1 
ATOM   112  O O   . ARG A 1 77  ? 77.946  3.259   -107.613 1.00 41.10  ? 77  ARG A O   1 
ATOM   113  C CB  . ARG A 1 77  ? 75.265  4.491   -107.233 1.00 33.31  ? 77  ARG A CB  1 
ATOM   114  C CG  . ARG A 1 77  ? 74.018  4.787   -106.417 1.00 31.75  ? 77  ARG A CG  1 
ATOM   115  C CD  . ARG A 1 77  ? 74.056  4.121   -105.056 1.00 27.85  ? 77  ARG A CD  1 
ATOM   116  N NE  . ARG A 1 77  ? 74.077  2.664   -105.172 1.00 29.48  ? 77  ARG A NE  1 
ATOM   117  C CZ  . ARG A 1 77  ? 72.994  1.889   -105.248 1.00 36.29  ? 77  ARG A CZ  1 
ATOM   118  N NH1 . ARG A 1 77  ? 71.779  2.416   -105.211 1.00 37.80  ? 77  ARG A NH1 1 
ATOM   119  N NH2 . ARG A 1 77  ? 73.123  0.571   -105.358 1.00 37.22  ? 77  ARG A NH2 1 
ATOM   120  N N   . PHE A 1 78  ? 78.636  5.409   -107.671 1.00 39.27  ? 78  PHE A N   1 
ATOM   121  C CA  . PHE A 1 78  ? 79.951  5.162   -108.272 1.00 37.60  ? 78  PHE A CA  1 
ATOM   122  C C   . PHE A 1 78  ? 79.857  4.534   -109.653 1.00 37.13  ? 78  PHE A C   1 
ATOM   123  O O   . PHE A 1 78  ? 80.509  3.533   -109.938 1.00 43.32  ? 78  PHE A O   1 
ATOM   124  C CB  . PHE A 1 78  ? 80.836  4.322   -107.332 1.00 35.13  ? 78  PHE A CB  1 
ATOM   125  C CG  . PHE A 1 78  ? 82.315  4.357   -107.662 1.00 32.16  ? 78  PHE A CG  1 
ATOM   126  C CD1 . PHE A 1 78  ? 82.856  5.300   -108.529 1.00 31.77  ? 78  PHE A CD1 1 
ATOM   127  C CD2 . PHE A 1 78  ? 83.174  3.453   -107.063 1.00 36.37  ? 78  PHE A CD2 1 
ATOM   128  C CE1 . PHE A 1 78  ? 84.212  5.315   -108.806 1.00 36.91  ? 78  PHE A CE1 1 
ATOM   129  C CE2 . PHE A 1 78  ? 84.534  3.464   -107.342 1.00 37.85  ? 78  PHE A CE2 1 
ATOM   130  C CZ  . PHE A 1 78  ? 85.052  4.396   -108.211 1.00 36.35  ? 78  PHE A CZ  1 
ATOM   131  N N   . PHE A 1 79  ? 79.017  5.118   -110.499 1.00 38.14  ? 79  PHE A N   1 
ATOM   132  C CA  . PHE A 1 79  ? 79.052  4.830   -111.921 1.00 36.17  ? 79  PHE A CA  1 
ATOM   133  C C   . PHE A 1 79  ? 80.396  5.334   -112.427 1.00 42.11  ? 79  PHE A C   1 
ATOM   134  O O   . PHE A 1 79  ? 81.187  4.585   -113.010 1.00 40.01  ? 79  PHE A O   1 
ATOM   135  C CB  . PHE A 1 79  ? 77.932  5.564   -112.642 1.00 35.03  ? 79  PHE A CB  1 
ATOM   136  C CG  . PHE A 1 79  ? 76.612  4.863   -112.587 1.00 35.04  ? 79  PHE A CG  1 
ATOM   137  C CD1 . PHE A 1 79  ? 76.211  4.035   -113.622 1.00 33.25  ? 79  PHE A CD1 1 
ATOM   138  C CD2 . PHE A 1 79  ? 75.765  5.041   -111.513 1.00 36.85  ? 79  PHE A CD2 1 
ATOM   139  C CE1 . PHE A 1 79  ? 74.994  3.394   -113.578 1.00 36.91  ? 79  PHE A CE1 1 
ATOM   140  C CE2 . PHE A 1 79  ? 74.540  4.398   -111.465 1.00 35.27  ? 79  PHE A CE2 1 
ATOM   141  C CZ  . PHE A 1 79  ? 74.155  3.577   -112.497 1.00 36.07  ? 79  PHE A CZ  1 
ATOM   142  N N   . TYR A 1 80  ? 80.654  6.611   -112.171 1.00 42.71  ? 80  TYR A N   1 
ATOM   143  C CA  . TYR A 1 80  ? 81.942  7.199   -112.474 1.00 42.04  ? 80  TYR A CA  1 
ATOM   144  C C   . TYR A 1 80  ? 82.196  8.392   -111.578 1.00 42.42  ? 80  TYR A C   1 
ATOM   145  O O   . TYR A 1 80  ? 81.265  8.985   -111.034 1.00 43.47  ? 80  TYR A O   1 
ATOM   146  C CB  . TYR A 1 80  ? 82.018  7.611   -113.947 1.00 45.11  ? 80  TYR A CB  1 
ATOM   147  C CG  . TYR A 1 80  ? 81.065  8.721   -114.355 1.00 45.46  ? 80  TYR A CG  1 
ATOM   148  C CD1 . TYR A 1 80  ? 79.774  8.432   -114.783 1.00 39.37  ? 80  TYR A CD1 1 
ATOM   149  C CD2 . TYR A 1 80  ? 81.467  10.060  -114.329 1.00 42.04  ? 80  TYR A CD2 1 
ATOM   150  C CE1 . TYR A 1 80  ? 78.900  9.446   -115.163 1.00 44.05  ? 80  TYR A CE1 1 
ATOM   151  C CE2 . TYR A 1 80  ? 80.606  11.075  -114.708 1.00 39.92  ? 80  TYR A CE2 1 
ATOM   152  C CZ  . TYR A 1 80  ? 79.320  10.761  -115.127 1.00 46.26  ? 80  TYR A CZ  1 
ATOM   153  O OH  . TYR A 1 80  ? 78.449  11.760  -115.509 1.00 45.70  ? 80  TYR A OH  1 
ATOM   154  N N   . ASP A 1 81  ? 83.468  8.735   -111.433 1.00 45.25  ? 81  ASP A N   1 
ATOM   155  C CA  . ASP A 1 81  ? 83.876  9.840   -110.585 1.00 44.82  ? 81  ASP A CA  1 
ATOM   156  C C   . ASP A 1 81  ? 85.238  10.364  -111.039 1.00 43.29  ? 81  ASP A C   1 
ATOM   157  O O   . ASP A 1 81  ? 85.937  9.723   -111.829 1.00 39.76  ? 81  ASP A O   1 
ATOM   158  C CB  . ASP A 1 81  ? 83.928  9.376   -109.128 1.00 49.90  ? 81  ASP A CB  1 
ATOM   159  C CG  . ASP A 1 81  ? 83.636  10.501  -108.126 1.00 56.46  ? 81  ASP A CG  1 
ATOM   160  O OD1 . ASP A 1 81  ? 82.961  10.218  -107.112 1.00 66.14  ? 81  ASP A OD1 1 
ATOM   161  O OD2 . ASP A 1 81  ? 84.089  11.647  -108.331 1.00 44.02  ? 81  ASP A OD2 1 
ATOM   162  N N   . GLN A 1 82  ? 85.589  11.541  -110.536 1.00 42.56  ? 82  GLN A N   1 
ATOM   163  C CA  . GLN A 1 82  ? 86.826  12.227  -110.884 1.00 43.16  ? 82  GLN A CA  1 
ATOM   164  C C   . GLN A 1 82  ? 88.047  11.365  -110.586 1.00 42.59  ? 82  GLN A C   1 
ATOM   165  O O   . GLN A 1 82  ? 88.154  10.770  -109.510 1.00 46.31  ? 82  GLN A O   1 
ATOM   166  C CB  . GLN A 1 82  ? 86.911  13.525  -110.084 1.00 45.42  ? 82  GLN A CB  1 
ATOM   167  C CG  . GLN A 1 82  ? 88.011  14.475  -110.495 1.00 49.51  ? 82  GLN A CG  1 
ATOM   168  C CD  . GLN A 1 82  ? 88.086  15.672  -109.567 1.00 57.71  ? 82  GLN A CD  1 
ATOM   169  O OE1 . GLN A 1 82  ? 87.981  16.818  -110.006 1.00 73.47  ? 82  GLN A OE1 1 
ATOM   170  N NE2 . GLN A 1 82  ? 88.262  15.410  -108.270 1.00 63.73  ? 82  GLN A NE2 1 
ATOM   171  N N   . ALA A 1 83  ? 88.964  11.302  -111.545 1.00 40.31  ? 83  ALA A N   1 
ATOM   172  C CA  . ALA A 1 83  ? 90.199  10.553  -111.373 1.00 34.98  ? 83  ALA A CA  1 
ATOM   173  C C   . ALA A 1 83  ? 91.102  11.321  -110.428 1.00 33.52  ? 83  ALA A C   1 
ATOM   174  O O   . ALA A 1 83  ? 91.081  12.545  -110.415 1.00 35.69  ? 83  ALA A O   1 
ATOM   175  C CB  . ALA A 1 83  ? 90.881  10.356  -112.703 1.00 32.00  ? 83  ALA A CB  1 
ATOM   176  N N   . PHE A 1 84  ? 91.876  10.595  -109.627 1.00 36.12  ? 84  PHE A N   1 
ATOM   177  C CA  . PHE A 1 84  ? 92.867  11.192  -108.736 1.00 34.66  ? 84  PHE A CA  1 
ATOM   178  C C   . PHE A 1 84  ? 92.250  12.204  -107.775 1.00 37.21  ? 84  PHE A C   1 
ATOM   179  O O   . PHE A 1 84  ? 92.875  13.213  -107.435 1.00 40.23  ? 84  PHE A O   1 
ATOM   180  C CB  . PHE A 1 84  ? 93.986  11.830  -109.568 1.00 32.72  ? 84  PHE A CB  1 
ATOM   181  C CG  . PHE A 1 84  ? 94.484  10.939  -110.661 1.00 29.79  ? 84  PHE A CG  1 
ATOM   182  C CD1 . PHE A 1 84  ? 94.135  11.168  -111.982 1.00 35.96  ? 84  PHE A CD1 1 
ATOM   183  C CD2 . PHE A 1 84  ? 95.260  9.836   -110.360 1.00 29.51  ? 84  PHE A CD2 1 
ATOM   184  C CE1 . PHE A 1 84  ? 94.577  10.320  -112.989 1.00 31.16  ? 84  PHE A CE1 1 
ATOM   185  C CE2 . PHE A 1 84  ? 95.708  8.988   -111.355 1.00 28.13  ? 84  PHE A CE2 1 
ATOM   186  C CZ  . PHE A 1 84  ? 95.364  9.231   -112.673 1.00 30.84  ? 84  PHE A CZ  1 
ATOM   187  N N   . ALA A 1 85  ? 91.030  11.913  -107.327 1.00 37.81  ? 85  ALA A N   1 
ATOM   188  C CA  . ALA A 1 85  ? 90.282  12.805  -106.443 1.00 36.47  ? 85  ALA A CA  1 
ATOM   189  C C   . ALA A 1 85  ? 91.104  13.195  -105.223 1.00 37.33  ? 85  ALA A C   1 
ATOM   190  O O   . ALA A 1 85  ? 91.214  14.380  -104.892 1.00 38.76  ? 85  ALA A O   1 
ATOM   191  C CB  . ALA A 1 85  ? 88.981  12.145  -106.010 1.00 35.35  ? 85  ALA A CB  1 
ATOM   192  N N   . ILE A 1 86  ? 91.706  12.197  -104.580 1.00 40.26  ? 86  ILE A N   1 
ATOM   193  C CA  . ILE A 1 86  ? 92.497  12.421  -103.366 1.00 40.77  ? 86  ILE A CA  1 
ATOM   194  C C   . ILE A 1 86  ? 93.773  13.232  -103.602 1.00 39.99  ? 86  ILE A C   1 
ATOM   195  O O   . ILE A 1 86  ? 94.332  13.779  -102.657 1.00 43.57  ? 86  ILE A O   1 
ATOM   196  C CB  . ILE A 1 86  ? 92.853  11.090  -102.639 1.00 42.49  ? 86  ILE A CB  1 
ATOM   197  C CG1 . ILE A 1 86  ? 93.643  10.143  -103.546 1.00 46.70  ? 86  ILE A CG1 1 
ATOM   198  C CG2 . ILE A 1 86  ? 91.592  10.392  -102.151 1.00 40.99  ? 86  ILE A CG2 1 
ATOM   199  C CD1 . ILE A 1 86  ? 94.279  8.992   -102.792 1.00 45.96  ? 86  ILE A CD1 1 
ATOM   200  N N   . TYR A 1 87  ? 94.235  13.309  -104.848 1.00 41.44  ? 87  TYR A N   1 
ATOM   201  C CA  . TYR A 1 87  ? 95.369  14.178  -105.195 1.00 39.67  ? 87  TYR A CA  1 
ATOM   202  C C   . TYR A 1 87  ? 94.907  15.536  -105.725 1.00 36.83  ? 87  TYR A C   1 
ATOM   203  O O   . TYR A 1 87  ? 95.724  16.325  -106.187 1.00 39.08  ? 87  TYR A O   1 
ATOM   204  C CB  . TYR A 1 87  ? 96.295  13.489  -106.211 1.00 40.16  ? 87  TYR A CB  1 
ATOM   205  C CG  . TYR A 1 87  ? 97.322  12.586  -105.567 1.00 36.93  ? 87  TYR A CG  1 
ATOM   206  C CD1 . TYR A 1 87  ? 97.005  11.273  -105.221 1.00 38.67  ? 87  TYR A CD1 1 
ATOM   207  C CD2 . TYR A 1 87  ? 98.604  13.045  -105.294 1.00 32.50  ? 87  TYR A CD2 1 
ATOM   208  C CE1 . TYR A 1 87  ? 97.938  10.441  -104.624 1.00 35.89  ? 87  TYR A CE1 1 
ATOM   209  C CE2 . TYR A 1 87  ? 99.547  12.223  -104.694 1.00 37.78  ? 87  TYR A CE2 1 
ATOM   210  C CZ  . TYR A 1 87  ? 99.207  10.922  -104.362 1.00 40.31  ? 87  TYR A CZ  1 
ATOM   211  O OH  . TYR A 1 87  ? 100.137 10.104  -103.768 1.00 39.69  ? 87  TYR A OH  1 
ATOM   212  N N   . GLY A 1 88  ? 93.605  15.807  -105.638 1.00 34.92  ? 88  GLY A N   1 
ATOM   213  C CA  . GLY A 1 88  ? 93.031  17.066  -106.113 1.00 36.69  ? 88  GLY A CA  1 
ATOM   214  C C   . GLY A 1 88  ? 92.254  16.916  -107.407 1.00 37.33  ? 88  GLY A C   1 
ATOM   215  O O   . GLY A 1 88  ? 91.598  17.848  -107.853 1.00 38.02  ? 88  GLY A O   1 
ATOM   216  N N   . GLY A 1 89  ? 92.330  15.739  -108.016 1.00 38.49  ? 89  GLY A N   1 
ATOM   217  C CA  . GLY A 1 89  ? 91.645  15.482  -109.273 1.00 37.83  ? 89  GLY A CA  1 
ATOM   218  C C   . GLY A 1 89  ? 92.414  15.959  -110.492 1.00 37.73  ? 89  GLY A C   1 
ATOM   219  O O   . GLY A 1 89  ? 93.378  16.708  -110.383 1.00 39.60  ? 89  GLY A O   1 
ATOM   220  N N   . VAL A 1 90  ? 91.989  15.494  -111.660 1.00 38.53  ? 90  VAL A N   1 
ATOM   221  C CA  . VAL A 1 90  ? 92.476  16.002  -112.935 1.00 37.15  ? 90  VAL A CA  1 
ATOM   222  C C   . VAL A 1 90  ? 91.260  16.112  -113.833 1.00 38.38  ? 90  VAL A C   1 
ATOM   223  O O   . VAL A 1 90  ? 90.525  15.143  -114.007 1.00 40.44  ? 90  VAL A O   1 
ATOM   224  C CB  . VAL A 1 90  ? 93.503  15.053  -113.584 1.00 38.81  ? 90  VAL A CB  1 
ATOM   225  C CG1 . VAL A 1 90  ? 93.978  15.613  -114.938 1.00 25.70  ? 90  VAL A CG1 1 
ATOM   226  C CG2 . VAL A 1 90  ? 94.674  14.809  -112.632 1.00 29.87  ? 90  VAL A CG2 1 
ATOM   227  N N   . SER A 1 91  ? 91.035  17.300  -114.381 1.00 41.42  ? 91  SER A N   1 
ATOM   228  C CA  . SER A 1 91  ? 89.860  17.538  -115.208 1.00 39.13  ? 91  SER A CA  1 
ATOM   229  C C   . SER A 1 91  ? 90.017  16.802  -116.527 1.00 36.74  ? 91  SER A C   1 
ATOM   230  O O   . SER A 1 91  ? 91.119  16.705  -117.062 1.00 39.65  ? 91  SER A O   1 
ATOM   231  C CB  . SER A 1 91  ? 89.652  19.036  -115.442 1.00 37.75  ? 91  SER A CB  1 
ATOM   232  O OG  . SER A 1 91  ? 90.839  19.636  -115.910 1.00 49.30  ? 91  SER A OG  1 
ATOM   233  N N   . GLY A 1 92  ? 88.912  16.266  -117.033 1.00 34.95  ? 92  GLY A N   1 
ATOM   234  C CA  . GLY A 1 92  ? 88.922  15.504  -118.273 1.00 34.04  ? 92  GLY A CA  1 
ATOM   235  C C   . GLY A 1 92  ? 89.196  14.025  -118.078 1.00 35.08  ? 92  GLY A C   1 
ATOM   236  O O   . GLY A 1 92  ? 89.103  13.252  -119.032 1.00 40.44  ? 92  GLY A O   1 
ATOM   237  N N   . LEU A 1 93  ? 89.528  13.624  -116.851 1.00 32.40  ? 93  LEU A N   1 
ATOM   238  C CA  . LEU A 1 93  ? 89.822  12.228  -116.542 1.00 35.17  ? 93  LEU A CA  1 
ATOM   239  C C   . LEU A 1 93  ? 88.856  11.680  -115.486 1.00 35.23  ? 93  LEU A C   1 
ATOM   240  O O   . LEU A 1 93  ? 88.598  12.332  -114.476 1.00 34.91  ? 93  LEU A O   1 
ATOM   241  C CB  . LEU A 1 93  ? 91.275  12.097  -116.074 1.00 37.76  ? 93  LEU A CB  1 
ATOM   242  C CG  . LEU A 1 93  ? 92.324  12.467  -117.132 1.00 33.97  ? 93  LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 93  ? 93.729  12.502  -116.543 1.00 29.13  ? 93  LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 93  ? 92.263  11.503  -118.301 1.00 28.79  ? 93  LEU A CD2 1 
ATOM   245  N N   . TYR A 1 94  ? 88.318  10.486  -115.740 1.00 36.92  ? 94  TYR A N   1 
ATOM   246  C CA  . TYR A 1 94  ? 87.326  9.860   -114.860 1.00 35.51  ? 94  TYR A CA  1 
ATOM   247  C C   . TYR A 1 94  ? 87.600  8.372   -114.672 1.00 38.80  ? 94  TYR A C   1 
ATOM   248  O O   . TYR A 1 94  ? 87.928  7.666   -115.630 1.00 40.08  ? 94  TYR A O   1 
ATOM   249  C CB  . TYR A 1 94  ? 85.914  10.053  -115.425 1.00 34.31  ? 94  TYR A CB  1 
ATOM   250  C CG  . TYR A 1 94  ? 85.476  11.496  -115.424 1.00 39.08  ? 94  TYR A CG  1 
ATOM   251  C CD1 . TYR A 1 94  ? 85.679  12.310  -116.538 1.00 41.06  ? 94  TYR A CD1 1 
ATOM   252  C CD2 . TYR A 1 94  ? 84.890  12.062  -114.296 1.00 36.06  ? 94  TYR A CD2 1 
ATOM   253  C CE1 . TYR A 1 94  ? 85.292  13.646  -116.531 1.00 33.69  ? 94  TYR A CE1 1 
ATOM   254  C CE2 . TYR A 1 94  ? 84.505  13.394  -114.279 1.00 34.33  ? 94  TYR A CE2 1 
ATOM   255  C CZ  . TYR A 1 94  ? 84.705  14.182  -115.397 1.00 34.36  ? 94  TYR A CZ  1 
ATOM   256  O OH  . TYR A 1 94  ? 84.322  15.506  -115.370 1.00 33.28  ? 94  TYR A OH  1 
ATOM   257  N N   . ASP A 1 95  ? 87.481  7.909   -113.429 1.00 37.68  ? 95  ASP A N   1 
ATOM   258  C CA  . ASP A 1 95  ? 87.509  6.486   -113.126 1.00 33.80  ? 95  ASP A CA  1 
ATOM   259  C C   . ASP A 1 95  ? 86.071  5.991   -113.150 1.00 35.85  ? 95  ASP A C   1 
ATOM   260  O O   . ASP A 1 95  ? 85.156  6.744   -112.811 1.00 33.81  ? 95  ASP A O   1 
ATOM   261  C CB  . ASP A 1 95  ? 88.109  6.229   -111.744 1.00 33.20  ? 95  ASP A CB  1 
ATOM   262  C CG  . ASP A 1 95  ? 89.539  6.716   -111.615 1.00 35.30  ? 95  ASP A CG  1 
ATOM   263  O OD1 . ASP A 1 95  ? 90.231  6.881   -112.642 1.00 37.10  ? 95  ASP A OD1 1 
ATOM   264  O OD2 . ASP A 1 95  ? 89.979  6.922   -110.464 1.00 46.43  ? 95  ASP A OD2 1 
ATOM   265  N N   . PHE A 1 96  ? 85.875  4.735   -113.557 1.00 36.01  ? 96  PHE A N   1 
ATOM   266  C CA  . PHE A 1 96  ? 84.557  4.106   -113.552 1.00 34.67  ? 96  PHE A CA  1 
ATOM   267  C C   . PHE A 1 96  ? 84.489  3.023   -112.485 1.00 33.65  ? 96  PHE A C   1 
ATOM   268  O O   . PHE A 1 96  ? 85.351  2.154   -112.423 1.00 30.80  ? 96  PHE A O   1 
ATOM   269  C CB  . PHE A 1 96  ? 84.243  3.526   -114.923 1.00 39.40  ? 96  PHE A CB  1 
ATOM   270  C CG  . PHE A 1 96  ? 83.952  4.573   -115.962 1.00 47.27  ? 96  PHE A CG  1 
ATOM   271  C CD1 . PHE A 1 96  ? 84.988  5.299   -116.546 1.00 54.68  ? 96  PHE A CD1 1 
ATOM   272  C CD2 . PHE A 1 96  ? 82.647  4.837   -116.356 1.00 39.72  ? 96  PHE A CD2 1 
ATOM   273  C CE1 . PHE A 1 96  ? 84.727  6.271   -117.505 1.00 49.32  ? 96  PHE A CE1 1 
ATOM   274  C CE2 . PHE A 1 96  ? 82.377  5.808   -117.307 1.00 44.66  ? 96  PHE A CE2 1 
ATOM   275  C CZ  . PHE A 1 96  ? 83.417  6.528   -117.884 1.00 46.99  ? 96  PHE A CZ  1 
ATOM   276  N N   . GLY A 1 97  ? 83.468  3.090   -111.636 1.00 36.21  ? 97  GLY A N   1 
ATOM   277  C CA  . GLY A 1 97  ? 83.300  2.120   -110.558 1.00 33.77  ? 97  GLY A CA  1 
ATOM   278  C C   . GLY A 1 97  ? 82.549  0.901   -111.050 1.00 34.03  ? 97  GLY A C   1 
ATOM   279  O O   . GLY A 1 97  ? 82.176  0.832   -112.216 1.00 35.45  ? 97  GLY A O   1 
ATOM   280  N N   . PRO A 1 98  ? 82.320  -0.072  -110.159 1.00 33.77  ? 98  PRO A N   1 
ATOM   281  C CA  . PRO A 1 98  ? 81.671  -1.340  -110.479 1.00 33.91  ? 98  PRO A CA  1 
ATOM   282  C C   . PRO A 1 98  ? 80.450  -1.258  -111.390 1.00 38.83  ? 98  PRO A C   1 
ATOM   283  O O   . PRO A 1 98  ? 80.450  -1.904  -112.446 1.00 45.68  ? 98  PRO A O   1 
ATOM   284  C CB  . PRO A 1 98  ? 81.297  -1.882  -109.108 1.00 32.57  ? 98  PRO A CB  1 
ATOM   285  C CG  . PRO A 1 98  ? 82.406  -1.402  -108.238 1.00 35.16  ? 98  PRO A CG  1 
ATOM   286  C CD  . PRO A 1 98  ? 82.719  -0.015  -108.741 1.00 31.92  ? 98  PRO A CD  1 
ATOM   287  N N   . VAL A 1 99  ? 79.427  -0.489  -111.017 1.00 38.14  ? 99  VAL A N   1 
ATOM   288  C CA  . VAL A 1 99  ? 78.220  -0.427  -111.859 1.00 35.24  ? 99  VAL A CA  1 
ATOM   289  C C   . VAL A 1 99  ? 78.563  0.272   -113.173 1.00 32.10  ? 99  VAL A C   1 
ATOM   290  O O   . VAL A 1 99  ? 78.088  -0.129  -114.231 1.00 37.19  ? 99  VAL A O   1 
ATOM   291  C CB  . VAL A 1 99  ? 76.974  0.233   -111.163 1.00 35.73  ? 99  VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 99  ? 76.872  -0.193  -109.708 1.00 25.52  ? 99  VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 99  ? 76.998  1.748   -111.268 1.00 45.60  ? 99  VAL A CG2 1 
ATOM   294  N N   . GLY A 1 100 ? 79.413  1.292   -113.107 1.00 32.70  ? 100 GLY A N   1 
ATOM   295  C CA  . GLY A 1 100 ? 79.872  1.993   -114.312 1.00 34.28  ? 100 GLY A CA  1 
ATOM   296  C C   . GLY A 1 100 ? 80.519  1.060   -115.319 1.00 33.17  ? 100 GLY A C   1 
ATOM   297  O O   . GLY A 1 100 ? 80.188  1.102   -116.500 1.00 32.60  ? 100 GLY A O   1 
ATOM   298  N N   . CYS A 1 101 ? 81.436  0.217   -114.841 1.00 30.91  ? 101 CYS A N   1 
ATOM   299  C CA  . CYS A 1 101 ? 82.092  -0.786  -115.674 1.00 30.39  ? 101 CYS A CA  1 
ATOM   300  C C   . CYS A 1 101 ? 81.109  -1.822  -116.215 1.00 30.89  ? 101 CYS A C   1 
ATOM   301  O O   . CYS A 1 101 ? 81.237  -2.257  -117.355 1.00 31.26  ? 101 CYS A O   1 
ATOM   302  C CB  . CYS A 1 101 ? 83.185  -1.499  -114.888 1.00 30.78  ? 101 CYS A CB  1 
ATOM   303  S SG  . CYS A 1 101 ? 84.580  -0.453  -114.469 1.00 38.06  ? 101 CYS A SG  1 
ATOM   304  N N   . ALA A 1 102 ? 80.135  -2.218  -115.398 1.00 27.33  ? 102 ALA A N   1 
ATOM   305  C CA  . ALA A 1 102 ? 79.109  -3.157  -115.844 1.00 30.21  ? 102 ALA A CA  1 
ATOM   306  C C   . ALA A 1 102 ? 78.343  -2.581  -117.035 1.00 33.49  ? 102 ALA A C   1 
ATOM   307  O O   . ALA A 1 102 ? 78.141  -3.252  -118.056 1.00 32.38  ? 102 ALA A O   1 
ATOM   308  C CB  . ALA A 1 102 ? 78.146  -3.492  -114.703 1.00 19.06  ? 102 ALA A CB  1 
ATOM   309  N N   . LEU A 1 103 ? 77.926  -1.329  -116.898 1.00 34.98  ? 103 LEU A N   1 
ATOM   310  C CA  . LEU A 1 103 ? 77.148  -0.667  -117.933 1.00 39.68  ? 103 LEU A CA  1 
ATOM   311  C C   . LEU A 1 103 ? 77.992  -0.480  -119.194 1.00 43.71  ? 103 LEU A C   1 
ATOM   312  O O   . LEU A 1 103 ? 77.554  -0.791  -120.310 1.00 40.72  ? 103 LEU A O   1 
ATOM   313  C CB  . LEU A 1 103 ? 76.664  0.683   -117.414 1.00 36.86  ? 103 LEU A CB  1 
ATOM   314  C CG  . LEU A 1 103 ? 75.736  1.463   -118.331 1.00 40.11  ? 103 LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 103 ? 74.362  0.851   -118.341 1.00 49.58  ? 103 LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 103 ? 75.679  2.890   -117.862 1.00 46.92  ? 103 LEU A CD2 1 
ATOM   317  N N   . LYS A 1 104 ? 79.205  0.029   -118.987 1.00 45.36  ? 104 LYS A N   1 
ATOM   318  C CA  . LYS A 1 104 ? 80.175  0.259   -120.051 1.00 43.15  ? 104 LYS A CA  1 
ATOM   319  C C   . LYS A 1 104 ? 80.427  -1.033  -120.821 1.00 42.90  ? 104 LYS A C   1 
ATOM   320  O O   . LYS A 1 104 ? 80.354  -1.054  -122.048 1.00 46.14  ? 104 LYS A O   1 
ATOM   321  C CB  . LYS A 1 104 ? 81.472  0.781   -119.429 1.00 45.91  ? 104 LYS A CB  1 
ATOM   322  C CG  . LYS A 1 104 ? 82.566  1.193   -120.394 1.00 47.14  ? 104 LYS A CG  1 
ATOM   323  C CD  . LYS A 1 104 ? 83.771  1.731   -119.604 1.00 51.59  ? 104 LYS A CD  1 
ATOM   324  C CE  . LYS A 1 104 ? 85.069  1.637   -120.396 1.00 54.35  ? 104 LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 104 ? 84.977  2.287   -121.731 1.00 51.26  ? 104 LYS A NZ  1 
ATOM   326  N N   . ASN A 1 105 ? 80.693  -2.113  -120.090 1.00 36.45  ? 105 ASN A N   1 
ATOM   327  C CA  . ASN A 1 105 ? 80.903  -3.424  -120.699 1.00 33.19  ? 105 ASN A CA  1 
ATOM   328  C C   . ASN A 1 105 ? 79.684  -3.967  -121.463 1.00 35.35  ? 105 ASN A C   1 
ATOM   329  O O   . ASN A 1 105 ? 79.845  -4.629  -122.485 1.00 39.26  ? 105 ASN A O   1 
ATOM   330  C CB  . ASN A 1 105 ? 81.353  -4.432  -119.640 1.00 26.04  ? 105 ASN A CB  1 
ATOM   331  C CG  . ASN A 1 105 ? 82.765  -4.162  -119.129 1.00 36.57  ? 105 ASN A CG  1 
ATOM   332  O OD1 . ASN A 1 105 ? 83.528  -3.397  -119.726 1.00 45.47  ? 105 ASN A OD1 1 
ATOM   333  N ND2 . ASN A 1 105 ? 83.119  -4.796  -118.019 1.00 31.71  ? 105 ASN A ND2 1 
ATOM   334  N N   . ASN A 1 106 ? 78.474  -3.689  -120.980 1.00 36.81  ? 106 ASN A N   1 
ATOM   335  C CA  . ASN A 1 106 ? 77.255  -4.116  -121.681 1.00 36.38  ? 106 ASN A CA  1 
ATOM   336  C C   . ASN A 1 106 ? 77.047  -3.341  -122.972 1.00 38.69  ? 106 ASN A C   1 
ATOM   337  O O   . ASN A 1 106 ? 76.609  -3.893  -123.980 1.00 40.36  ? 106 ASN A O   1 
ATOM   338  C CB  . ASN A 1 106 ? 76.016  -3.918  -120.808 1.00 37.85  ? 106 ASN A CB  1 
ATOM   339  C CG  . ASN A 1 106 ? 75.924  -4.907  -119.658 1.00 33.85  ? 106 ASN A CG  1 
ATOM   340  O OD1 . ASN A 1 106 ? 75.183  -4.675  -118.703 1.00 40.31  ? 106 ASN A OD1 1 
ATOM   341  N ND2 . ASN A 1 106 ? 76.667  -6.004  -119.738 1.00 36.49  ? 106 ASN A ND2 1 
ATOM   342  N N   . ILE A 1 107 ? 77.335  -2.047  -122.921 1.00 38.73  ? 107 ILE A N   1 
ATOM   343  C CA  . ILE A 1 107 ? 77.279  -1.193  -124.097 1.00 39.43  ? 107 ILE A CA  1 
ATOM   344  C C   . ILE A 1 107 ? 78.232  -1.711  -125.174 1.00 41.99  ? 107 ILE A C   1 
ATOM   345  O O   . ILE A 1 107 ? 77.869  -1.772  -126.355 1.00 42.15  ? 107 ILE A O   1 
ATOM   346  C CB  . ILE A 1 107 ? 77.617  0.270   -123.715 1.00 40.19  ? 107 ILE A CB  1 
ATOM   347  C CG1 . ILE A 1 107 ? 76.384  0.938   -123.106 1.00 40.12  ? 107 ILE A CG1 1 
ATOM   348  C CG2 . ILE A 1 107 ? 78.111  1.069   -124.916 1.00 33.51  ? 107 ILE A CG2 1 
ATOM   349  C CD1 . ILE A 1 107 ? 76.702  2.204   -122.360 1.00 47.32  ? 107 ILE A CD1 1 
ATOM   350  N N   . ILE A 1 108 ? 79.440  -2.100  -124.759 1.00 38.46  ? 108 ILE A N   1 
ATOM   351  C CA  . ILE A 1 108 ? 80.448  -2.616  -125.687 1.00 37.77  ? 108 ILE A CA  1 
ATOM   352  C C   . ILE A 1 108 ? 80.027  -3.972  -126.240 1.00 34.80  ? 108 ILE A C   1 
ATOM   353  O O   . ILE A 1 108 ? 80.139  -4.219  -127.435 1.00 36.44  ? 108 ILE A O   1 
ATOM   354  C CB  . ILE A 1 108 ? 81.848  -2.722  -125.022 1.00 38.66  ? 108 ILE A CB  1 
ATOM   355  C CG1 . ILE A 1 108 ? 82.414  -1.326  -124.765 1.00 41.74  ? 108 ILE A CG1 1 
ATOM   356  C CG2 . ILE A 1 108 ? 82.819  -3.484  -125.907 1.00 31.59  ? 108 ILE A CG2 1 
ATOM   357  C CD1 . ILE A 1 108 ? 83.738  -1.342  -124.064 1.00 38.40  ? 108 ILE A CD1 1 
ATOM   358  N N   . GLN A 1 109 ? 79.527  -4.846  -125.376 1.00 34.46  ? 109 GLN A N   1 
ATOM   359  C CA  . GLN A 1 109 ? 79.084  -6.159  -125.826 1.00 33.83  ? 109 GLN A CA  1 
ATOM   360  C C   . GLN A 1 109 ? 77.925  -6.038  -126.802 1.00 33.52  ? 109 GLN A C   1 
ATOM   361  O O   . GLN A 1 109 ? 77.887  -6.743  -127.801 1.00 38.12  ? 109 GLN A O   1 
ATOM   362  C CB  . GLN A 1 109 ? 78.685  -7.050  -124.649 1.00 31.61  ? 109 GLN A CB  1 
ATOM   363  C CG  . GLN A 1 109 ? 78.664  -8.536  -124.995 1.00 42.58  ? 109 GLN A CG  1 
ATOM   364  C CD  . GLN A 1 109 ? 80.005  -9.030  -125.566 1.00 62.99  ? 109 GLN A CD  1 
ATOM   365  O OE1 . GLN A 1 109 ? 81.095  -8.627  -125.105 1.00 50.19  ? 109 GLN A OE1 1 
ATOM   366  N NE2 . GLN A 1 109 ? 79.928  -9.900  -126.580 1.00 55.36  ? 109 GLN A NE2 1 
ATOM   367  N N   . THR A 1 110 ? 76.984  -5.142  -126.514 1.00 34.66  ? 110 THR A N   1 
ATOM   368  C CA  . THR A 1 110 ? 75.865  -4.902  -127.418 1.00 36.05  ? 110 THR A CA  1 
ATOM   369  C C   . THR A 1 110 ? 76.366  -4.384  -128.759 1.00 39.18  ? 110 THR A C   1 
ATOM   370  O O   . THR A 1 110 ? 75.874  -4.791  -129.813 1.00 41.75  ? 110 THR A O   1 
ATOM   371  C CB  . THR A 1 110 ? 74.862  -3.905  -126.830 1.00 33.31  ? 110 THR A CB  1 
ATOM   372  O OG1 . THR A 1 110 ? 74.317  -4.451  -125.629 1.00 29.66  ? 110 THR A OG1 1 
ATOM   373  C CG2 . THR A 1 110 ? 73.730  -3.644  -127.807 1.00 30.29  ? 110 THR A CG2 1 
ATOM   374  N N   . TRP A 1 111 ? 77.357  -3.499  -128.713 1.00 36.87  ? 111 TRP A N   1 
ATOM   375  C CA  . TRP A 1 111 ? 77.965  -2.973  -129.929 1.00 35.62  ? 111 TRP A CA  1 
ATOM   376  C C   . TRP A 1 111 ? 78.591  -4.084  -130.774 1.00 33.25  ? 111 TRP A C   1 
ATOM   377  O O   . TRP A 1 111 ? 78.425  -4.115  -131.993 1.00 32.72  ? 111 TRP A O   1 
ATOM   378  C CB  . TRP A 1 111 ? 79.023  -1.934  -129.582 1.00 35.80  ? 111 TRP A CB  1 
ATOM   379  C CG  . TRP A 1 111 ? 79.431  -1.132  -130.742 1.00 33.58  ? 111 TRP A CG  1 
ATOM   380  C CD1 . TRP A 1 111 ? 78.812  -0.027  -131.214 1.00 33.00  ? 111 TRP A CD1 1 
ATOM   381  C CD2 . TRP A 1 111 ? 80.555  -1.367  -131.596 1.00 34.70  ? 111 TRP A CD2 1 
ATOM   382  N NE1 . TRP A 1 111 ? 79.474  0.448   -132.314 1.00 38.22  ? 111 TRP A NE1 1 
ATOM   383  C CE2 . TRP A 1 111 ? 80.551  -0.357  -132.571 1.00 41.72  ? 111 TRP A CE2 1 
ATOM   384  C CE3 . TRP A 1 111 ? 81.563  -2.335  -131.631 1.00 35.86  ? 111 TRP A CE3 1 
ATOM   385  C CZ2 . TRP A 1 111 ? 81.518  -0.279  -133.573 1.00 42.74  ? 111 TRP A CZ2 1 
ATOM   386  C CZ3 . TRP A 1 111 ? 82.525  -2.260  -132.626 1.00 33.02  ? 111 TRP A CZ3 1 
ATOM   387  C CH2 . TRP A 1 111 ? 82.492  -1.242  -133.585 1.00 39.00  ? 111 TRP A CH2 1 
ATOM   388  N N   . ARG A 1 112 ? 79.296  -4.999  -130.118 1.00 32.13  ? 112 ARG A N   1 
ATOM   389  C CA  . ARG A 1 112 ? 79.951  -6.110  -130.807 1.00 32.90  ? 112 ARG A CA  1 
ATOM   390  C C   . ARG A 1 112 ? 78.988  -6.972  -131.595 1.00 34.02  ? 112 ARG A C   1 
ATOM   391  O O   . ARG A 1 112 ? 79.244  -7.293  -132.751 1.00 42.02  ? 112 ARG A O   1 
ATOM   392  C CB  . ARG A 1 112 ? 80.673  -6.979  -129.808 1.00 32.29  ? 112 ARG A CB  1 
ATOM   393  C CG  . ARG A 1 112 ? 81.920  -6.350  -129.305 1.00 38.25  ? 112 ARG A CG  1 
ATOM   394  C CD  . ARG A 1 112 ? 82.523  -7.182  -128.213 1.00 41.85  ? 112 ARG A CD  1 
ATOM   395  N NE  . ARG A 1 112 ? 83.878  -6.733  -127.919 1.00 49.34  ? 112 ARG A NE  1 
ATOM   396  C CZ  . ARG A 1 112 ? 84.941  -7.034  -128.654 1.00 43.77  ? 112 ARG A CZ  1 
ATOM   397  N NH1 . ARG A 1 112 ? 84.824  -7.801  -129.738 1.00 36.06  ? 112 ARG A NH1 1 
ATOM   398  N NH2 . ARG A 1 112 ? 86.124  -6.563  -128.292 1.00 51.18  ? 112 ARG A NH2 1 
ATOM   399  N N   . GLN A 1 113 ? 77.876  -7.344  -130.973 1.00 35.48  ? 113 GLN A N   1 
ATOM   400  C CA  . GLN A 1 113 ? 76.857  -8.135  -131.654 1.00 35.21  ? 113 GLN A CA  1 
ATOM   401  C C   . GLN A 1 113 ? 76.197  -7.344  -132.769 1.00 34.21  ? 113 GLN A C   1 
ATOM   402  O O   . GLN A 1 113 ? 75.965  -7.879  -133.850 1.00 34.91  ? 113 GLN A O   1 
ATOM   403  C CB  . GLN A 1 113 ? 75.802  -8.634  -130.661 1.00 36.57  ? 113 GLN A CB  1 
ATOM   404  C CG  . GLN A 1 113 ? 76.359  -9.615  -129.636 1.00 58.01  ? 113 GLN A CG  1 
ATOM   405  C CD  . GLN A 1 113 ? 77.127  -10.756 -130.291 1.00 69.85  ? 113 GLN A CD  1 
ATOM   406  O OE1 . GLN A 1 113 ? 76.563  -11.524 -131.075 1.00 75.79  ? 113 GLN A OE1 1 
ATOM   407  N NE2 . GLN A 1 113 ? 78.424  -10.857 -129.991 1.00 57.56  ? 113 GLN A NE2 1 
ATOM   408  N N   . HIS A 1 114 ? 75.921  -6.068  -132.507 1.00 32.62  ? 114 HIS A N   1 
ATOM   409  C CA  . HIS A 1 114 ? 75.157  -5.237  -133.429 1.00 34.75  ? 114 HIS A CA  1 
ATOM   410  C C   . HIS A 1 114 ? 75.930  -4.896  -134.699 1.00 38.60  ? 114 HIS A C   1 
ATOM   411  O O   . HIS A 1 114 ? 75.329  -4.770  -135.771 1.00 41.22  ? 114 HIS A O   1 
ATOM   412  C CB  . HIS A 1 114 ? 74.721  -3.950  -132.736 1.00 35.99  ? 114 HIS A CB  1 
ATOM   413  C CG  . HIS A 1 114 ? 73.688  -3.173  -133.491 1.00 32.40  ? 114 HIS A CG  1 
ATOM   414  N ND1 . HIS A 1 114 ? 72.336  -3.356  -133.303 1.00 25.83  ? 114 HIS A ND1 1 
ATOM   415  C CD2 . HIS A 1 114 ? 73.811  -2.201  -134.425 1.00 34.84  ? 114 HIS A CD2 1 
ATOM   416  C CE1 . HIS A 1 114 ? 71.669  -2.529  -134.088 1.00 35.31  ? 114 HIS A CE1 1 
ATOM   417  N NE2 . HIS A 1 114 ? 72.541  -1.816  -134.778 1.00 39.16  ? 114 HIS A NE2 1 
ATOM   418  N N   . PHE A 1 115 ? 77.251  -4.749  -134.580 1.00 36.79  ? 115 PHE A N   1 
ATOM   419  C CA  . PHE A 1 115 ? 78.092  -4.405  -135.729 1.00 33.38  ? 115 PHE A CA  1 
ATOM   420  C C   . PHE A 1 115 ? 79.083  -5.508  -136.141 1.00 35.11  ? 115 PHE A C   1 
ATOM   421  O O   . PHE A 1 115 ? 78.984  -6.041  -137.255 1.00 33.44  ? 115 PHE A O   1 
ATOM   422  C CB  . PHE A 1 115 ? 78.806  -3.088  -135.464 1.00 31.01  ? 115 PHE A CB  1 
ATOM   423  C CG  . PHE A 1 115 ? 77.875  -1.918  -135.391 1.00 30.85  ? 115 PHE A CG  1 
ATOM   424  C CD1 . PHE A 1 115 ? 77.503  -1.382  -134.172 1.00 35.00  ? 115 PHE A CD1 1 
ATOM   425  C CD2 . PHE A 1 115 ? 77.353  -1.360  -136.551 1.00 26.70  ? 115 PHE A CD2 1 
ATOM   426  C CE1 . PHE A 1 115 ? 76.633  -0.298  -134.108 1.00 36.50  ? 115 PHE A CE1 1 
ATOM   427  C CE2 . PHE A 1 115 ? 76.487  -0.284  -136.496 1.00 28.28  ? 115 PHE A CE2 1 
ATOM   428  C CZ  . PHE A 1 115 ? 76.123  0.247   -135.270 1.00 34.56  ? 115 PHE A CZ  1 
ATOM   429  N N   . ILE A 1 116 ? 80.016  -5.858  -135.254 1.00 30.12  ? 116 ILE A N   1 
ATOM   430  C CA  . ILE A 1 116 ? 81.070  -6.827  -135.592 1.00 31.54  ? 116 ILE A CA  1 
ATOM   431  C C   . ILE A 1 116 ? 80.482  -8.171  -136.018 1.00 34.40  ? 116 ILE A C   1 
ATOM   432  O O   . ILE A 1 116 ? 80.821  -8.690  -137.079 1.00 39.91  ? 116 ILE A O   1 
ATOM   433  C CB  . ILE A 1 116 ? 82.070  -7.055  -134.429 1.00 27.62  ? 116 ILE A CB  1 
ATOM   434  C CG1 . ILE A 1 116 ? 82.793  -5.748  -134.080 1.00 27.38  ? 116 ILE A CG1 1 
ATOM   435  C CG2 . ILE A 1 116 ? 83.074  -8.137  -134.798 1.00 12.48  ? 116 ILE A CG2 1 
ATOM   436  C CD1 . ILE A 1 116 ? 83.929  -5.909  -133.085 1.00 27.18  ? 116 ILE A CD1 1 
ATOM   437  N N   . GLN A 1 117 ? 79.579  -8.713  -135.208 1.00 38.77  ? 117 GLN A N   1 
ATOM   438  C CA  . GLN A 1 117 ? 78.984  -10.021 -135.494 1.00 37.19  ? 117 GLN A CA  1 
ATOM   439  C C   . GLN A 1 117 ? 77.974  -9.946  -136.635 1.00 36.02  ? 117 GLN A C   1 
ATOM   440  O O   . GLN A 1 117 ? 77.945  -10.820 -137.497 1.00 34.96  ? 117 GLN A O   1 
ATOM   441  C CB  . GLN A 1 117 ? 78.308  -10.592 -134.244 1.00 42.89  ? 117 GLN A CB  1 
ATOM   442  C CG  . GLN A 1 117 ? 78.331  -12.110 -134.172 1.00 50.67  ? 117 GLN A CG  1 
ATOM   443  C CD  . GLN A 1 117 ? 79.741  -12.655 -134.037 1.00 67.05  ? 117 GLN A CD  1 
ATOM   444  O OE1 . GLN A 1 117 ? 80.550  -12.131 -133.268 1.00 65.77  ? 117 GLN A OE1 1 
ATOM   445  N NE2 . GLN A 1 117 ? 80.048  -13.702 -134.799 1.00 81.19  ? 117 GLN A NE2 1 
ATOM   446  N N   . GLU A 1 118 ? 77.159  -8.895  -136.644 1.00 35.47  ? 118 GLU A N   1 
ATOM   447  C CA  . GLU A 1 118 ? 76.105  -8.744  -137.649 1.00 34.47  ? 118 GLU A CA  1 
ATOM   448  C C   . GLU A 1 118 ? 76.656  -8.543  -139.059 1.00 34.37  ? 118 GLU A C   1 
ATOM   449  O O   . GLU A 1 118 ? 76.065  -9.016  -140.018 1.00 39.61  ? 118 GLU A O   1 
ATOM   450  C CB  . GLU A 1 118 ? 75.184  -7.581  -137.276 1.00 35.18  ? 118 GLU A CB  1 
ATOM   451  C CG  . GLU A 1 118 ? 74.050  -7.287  -138.268 1.00 39.15  ? 118 GLU A CG  1 
ATOM   452  C CD  . GLU A 1 118 ? 73.048  -8.415  -138.397 1.00 46.14  ? 118 GLU A CD  1 
ATOM   453  O OE1 . GLU A 1 118 ? 72.807  -9.118  -137.390 1.00 43.42  ? 118 GLU A OE1 1 
ATOM   454  O OE2 . GLU A 1 118 ? 72.496  -8.591  -139.509 1.00 56.02  ? 118 GLU A OE2 1 
ATOM   455  N N   . GLU A 1 119 ? 77.774  -7.834  -139.186 1.00 36.37  ? 119 GLU A N   1 
ATOM   456  C CA  . GLU A 1 119 ? 78.379  -7.566  -140.497 1.00 34.03  ? 119 GLU A CA  1 
ATOM   457  C C   . GLU A 1 119 ? 79.656  -8.370  -140.729 1.00 36.60  ? 119 GLU A C   1 
ATOM   458  O O   . GLU A 1 119 ? 80.365  -8.141  -141.716 1.00 33.31  ? 119 GLU A O   1 
ATOM   459  C CB  . GLU A 1 119 ? 78.707  -6.075  -140.637 1.00 31.46  ? 119 GLU A CB  1 
ATOM   460  C CG  . GLU A 1 119 ? 77.584  -5.136  -140.250 1.00 28.79  ? 119 GLU A CG  1 
ATOM   461  C CD  . GLU A 1 119 ? 76.306  -5.402  -141.014 1.00 33.64  ? 119 GLU A CD  1 
ATOM   462  O OE1 . GLU A 1 119 ? 75.225  -5.152  -140.450 1.00 33.65  ? 119 GLU A OE1 1 
ATOM   463  O OE2 . GLU A 1 119 ? 76.383  -5.853  -142.176 1.00 35.20  ? 119 GLU A OE2 1 
ATOM   464  N N   . GLN A 1 120 ? 79.951  -9.298  -139.819 1.00 35.22  ? 120 GLN A N   1 
ATOM   465  C CA  . GLN A 1 120 ? 81.183  -10.073 -139.872 1.00 31.84  ? 120 GLN A CA  1 
ATOM   466  C C   . GLN A 1 120 ? 82.400  -9.175  -140.108 1.00 28.55  ? 120 GLN A C   1 
ATOM   467  O O   . GLN A 1 120 ? 83.212  -9.419  -140.994 1.00 29.14  ? 120 GLN A O   1 
ATOM   468  C CB  . GLN A 1 120 ? 81.066  -11.165 -140.937 1.00 28.86  ? 120 GLN A CB  1 
ATOM   469  C CG  . GLN A 1 120 ? 80.085  -12.276 -140.554 1.00 40.70  ? 120 GLN A CG  1 
ATOM   470  C CD  . GLN A 1 120 ? 80.520  -13.046 -139.306 1.00 52.92  ? 120 GLN A CD  1 
ATOM   471  O OE1 . GLN A 1 120 ? 81.334  -13.968 -139.380 1.00 60.12  ? 120 GLN A OE1 1 
ATOM   472  N NE2 . GLN A 1 120 ? 79.976  -12.666 -138.154 1.00 60.24  ? 120 GLN A NE2 1 
ATOM   473  N N   . ILE A 1 121 ? 82.520  -8.140  -139.284 1.00 30.06  ? 121 ILE A N   1 
ATOM   474  C CA  . ILE A 1 121 ? 83.611  -7.171  -139.404 1.00 31.42  ? 121 ILE A CA  1 
ATOM   475  C C   . ILE A 1 121 ? 84.932  -7.790  -138.968 1.00 30.96  ? 121 ILE A C   1 
ATOM   476  O O   . ILE A 1 121 ? 84.966  -8.608  -138.056 1.00 34.48  ? 121 ILE A O   1 
ATOM   477  C CB  . ILE A 1 121 ? 83.354  -5.900  -138.564 1.00 32.02  ? 121 ILE A CB  1 
ATOM   478  C CG1 . ILE A 1 121 ? 81.990  -5.285  -138.922 1.00 30.02  ? 121 ILE A CG1 1 
ATOM   479  C CG2 . ILE A 1 121 ? 84.465  -4.878  -138.794 1.00 33.27  ? 121 ILE A CG2 1 
ATOM   480  C CD1 . ILE A 1 121 ? 81.699  -3.966  -138.237 1.00 30.67  ? 121 ILE A CD1 1 
ATOM   481  N N   . LEU A 1 122 ? 86.010  -7.404  -139.645 1.00 33.67  ? 122 LEU A N   1 
ATOM   482  C CA  . LEU A 1 122 ? 87.354  -7.823  -139.282 1.00 31.37  ? 122 LEU A CA  1 
ATOM   483  C C   . LEU A 1 122 ? 87.841  -6.973  -138.113 1.00 33.55  ? 122 LEU A C   1 
ATOM   484  O O   . LEU A 1 122 ? 88.099  -5.788  -138.264 1.00 36.72  ? 122 LEU A O   1 
ATOM   485  C CB  . LEU A 1 122 ? 88.306  -7.663  -140.468 1.00 28.52  ? 122 LEU A CB  1 
ATOM   486  C CG  . LEU A 1 122 ? 87.979  -8.424  -141.754 1.00 27.15  ? 122 LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 122 ? 89.130  -8.291  -142.743 1.00 26.14  ? 122 LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 122 ? 87.699  -9.883  -141.479 1.00 25.02  ? 122 LEU A CD2 1 
ATOM   489  N N   . GLU A 1 123 ? 87.967  -7.584  -136.945 1.00 36.50  ? 123 GLU A N   1 
ATOM   490  C CA  . GLU A 1 123 ? 88.393  -6.872  -135.749 1.00 36.56  ? 123 GLU A CA  1 
ATOM   491  C C   . GLU A 1 123 ? 89.906  -6.857  -135.667 1.00 37.17  ? 123 GLU A C   1 
ATOM   492  O O   . GLU A 1 123 ? 90.541  -7.869  -135.962 1.00 37.18  ? 123 GLU A O   1 
ATOM   493  C CB  . GLU A 1 123 ? 87.823  -7.571  -134.521 1.00 35.30  ? 123 GLU A CB  1 
ATOM   494  C CG  . GLU A 1 123 ? 88.324  -7.044  -133.194 1.00 40.69  ? 123 GLU A CG  1 
ATOM   495  C CD  . GLU A 1 123 ? 87.505  -7.568  -132.025 1.00 49.13  ? 123 GLU A CD  1 
ATOM   496  O OE1 . GLU A 1 123 ? 87.449  -6.871  -130.988 1.00 45.58  ? 123 GLU A OE1 1 
ATOM   497  O OE2 . GLU A 1 123 ? 86.909  -8.669  -132.152 1.00 56.04  ? 123 GLU A OE2 1 
ATOM   498  N N   . ILE A 1 124 ? 90.483  -5.718  -135.272 1.00 35.62  ? 124 ILE A N   1 
ATOM   499  C CA  . ILE A 1 124 ? 91.919  -5.648  -134.971 1.00 36.45  ? 124 ILE A CA  1 
ATOM   500  C C   . ILE A 1 124 ? 92.200  -4.776  -133.751 1.00 37.13  ? 124 ILE A C   1 
ATOM   501  O O   . ILE A 1 124 ? 91.399  -3.917  -133.399 1.00 42.73  ? 124 ILE A O   1 
ATOM   502  C CB  . ILE A 1 124 ? 92.767  -5.139  -136.174 1.00 37.28  ? 124 ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 124 ? 92.606  -3.637  -136.398 1.00 39.93  ? 124 ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 124 ? 92.410  -5.879  -137.449 1.00 39.53  ? 124 ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 124 ? 93.678  -3.078  -137.319 1.00 39.60  ? 124 ILE A CD1 1 
ATOM   506  N N   . ASP A 1 125 ? 93.351  -4.990  -133.122 1.00 37.57  ? 125 ASP A N   1 
ATOM   507  C CA  . ASP A 1 125 ? 93.748  -4.217  -131.951 1.00 35.41  ? 125 ASP A CA  1 
ATOM   508  C C   . ASP A 1 125 ? 95.149  -3.627  -132.124 1.00 36.65  ? 125 ASP A C   1 
ATOM   509  O O   . ASP A 1 125 ? 96.151  -4.312  -131.929 1.00 37.78  ? 125 ASP A O   1 
ATOM   510  C CB  . ASP A 1 125 ? 93.686  -5.093  -130.697 1.00 36.34  ? 125 ASP A CB  1 
ATOM   511  C CG  . ASP A 1 125 ? 93.709  -4.278  -129.410 1.00 44.36  ? 125 ASP A CG  1 
ATOM   512  O OD1 . ASP A 1 125 ? 92.974  -3.273  -129.329 1.00 55.84  ? 125 ASP A OD1 1 
ATOM   513  O OD2 . ASP A 1 125 ? 94.450  -4.648  -128.475 1.00 59.94  ? 125 ASP A OD2 1 
ATOM   514  N N   . CYS A 1 126 ? 95.205  -2.349  -132.491 1.00 37.15  ? 126 CYS A N   1 
ATOM   515  C CA  . CYS A 1 126 ? 96.470  -1.646  -132.699 1.00 36.11  ? 126 CYS A CA  1 
ATOM   516  C C   . CYS A 1 126 ? 96.924  -0.874  -131.463 1.00 33.97  ? 126 CYS A C   1 
ATOM   517  O O   . CYS A 1 126 ? 96.148  -0.651  -130.543 1.00 41.70  ? 126 CYS A O   1 
ATOM   518  C CB  . CYS A 1 126 ? 96.347  -0.699  -133.885 1.00 38.09  ? 126 CYS A CB  1 
ATOM   519  S SG  . CYS A 1 126 ? 96.084  -1.544  -135.449 1.00 39.03  ? 126 CYS A SG  1 
ATOM   520  N N   . THR A 1 127 ? 98.192  -0.470  -131.455 1.00 36.38  ? 127 THR A N   1 
ATOM   521  C CA  . THR A 1 127 ? 98.794  0.194   -130.300 1.00 33.52  ? 127 THR A CA  1 
ATOM   522  C C   . THR A 1 127 ? 98.306  1.629   -130.161 1.00 35.63  ? 127 THR A C   1 
ATOM   523  O O   . THR A 1 127 ? 97.894  2.249   -131.137 1.00 39.84  ? 127 THR A O   1 
ATOM   524  C CB  . THR A 1 127 ? 100.339 0.217   -130.393 1.00 34.62  ? 127 THR A CB  1 
ATOM   525  O OG1 . THR A 1 127 ? 100.750 0.943   -131.563 1.00 34.37  ? 127 THR A OG1 1 
ATOM   526  C CG2 . THR A 1 127 ? 100.904 -1.201  -130.444 1.00 37.26  ? 127 THR A CG2 1 
ATOM   527  N N   . MET A 1 128 ? 98.358  2.145   -128.936 1.00 38.45  ? 128 MET A N   1 
ATOM   528  C CA  . MET A 1 128 ? 98.046  3.544   -128.653 1.00 34.87  ? 128 MET A CA  1 
ATOM   529  C C   . MET A 1 128 ? 99.266  4.423   -128.899 1.00 37.33  ? 128 MET A C   1 
ATOM   530  O O   . MET A 1 128 ? 99.143  5.525   -129.431 1.00 41.11  ? 128 MET A O   1 
ATOM   531  C CB  . MET A 1 128 ? 97.548  3.701   -127.219 1.00 34.42  ? 128 MET A CB  1 
ATOM   532  C CG  . MET A 1 128 ? 96.115  3.227   -127.030 1.00 38.97  ? 128 MET A CG  1 
ATOM   533  S SD  . MET A 1 128 ? 95.654  2.977   -125.305 1.00 36.22  ? 128 MET A SD  1 
ATOM   534  C CE  . MET A 1 128 ? 96.496  1.434   -124.949 1.00 23.49  ? 128 MET A CE  1 
ATOM   535  N N   . LEU A 1 129 ? 100.444 3.942   -128.511 1.00 36.56  ? 129 LEU A N   1 
ATOM   536  C CA  . LEU A 1 129 ? 101.682 4.636   -128.845 1.00 34.58  ? 129 LEU A CA  1 
ATOM   537  C C   . LEU A 1 129 ? 101.827 4.687   -130.360 1.00 30.90  ? 129 LEU A C   1 
ATOM   538  O O   . LEU A 1 129 ? 101.575 3.693   -131.036 1.00 33.33  ? 129 LEU A O   1 
ATOM   539  C CB  . LEU A 1 129 ? 102.884 3.935   -128.213 1.00 36.24  ? 129 LEU A CB  1 
ATOM   540  C CG  . LEU A 1 129 ? 103.014 4.113   -126.698 1.00 36.24  ? 129 LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 129 ? 104.137 3.235   -126.137 1.00 36.10  ? 129 LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 129 ? 103.250 5.585   -126.356 1.00 23.37  ? 129 LEU A CD2 1 
ATOM   543  N N   . THR A 1 130 ? 102.196 5.854   -130.883 1.00 28.72  ? 130 THR A N   1 
ATOM   544  C CA  . THR A 1 130 ? 102.316 6.074   -132.327 1.00 30.29  ? 130 THR A CA  1 
ATOM   545  C C   . THR A 1 130 ? 103.513 6.966   -132.630 1.00 27.89  ? 130 THR A C   1 
ATOM   546  O O   . THR A 1 130 ? 103.596 8.069   -132.102 1.00 27.74  ? 130 THR A O   1 
ATOM   547  C CB  . THR A 1 130 ? 101.081 6.795   -132.910 1.00 30.46  ? 130 THR A CB  1 
ATOM   548  O OG1 . THR A 1 130 ? 99.879  6.090   -132.569 1.00 29.39  ? 130 THR A OG1 1 
ATOM   549  C CG2 . THR A 1 130 ? 101.205 6.897   -134.424 1.00 29.36  ? 130 THR A CG2 1 
ATOM   550  N N   . PRO A 1 131 ? 104.433 6.506   -133.495 1.00 27.26  ? 131 PRO A N   1 
ATOM   551  C CA  . PRO A 1 131 ? 105.593 7.329   -133.818 1.00 27.72  ? 131 PRO A CA  1 
ATOM   552  C C   . PRO A 1 131 ? 105.196 8.512   -134.705 1.00 29.36  ? 131 PRO A C   1 
ATOM   553  O O   . PRO A 1 131 ? 104.256 8.412   -135.490 1.00 34.50  ? 131 PRO A O   1 
ATOM   554  C CB  . PRO A 1 131 ? 106.516 6.358   -134.562 1.00 23.39  ? 131 PRO A CB  1 
ATOM   555  C CG  . PRO A 1 131 ? 105.614 5.376   -135.174 1.00 22.41  ? 131 PRO A CG  1 
ATOM   556  C CD  . PRO A 1 131 ? 104.449 5.229   -134.230 1.00 28.72  ? 131 PRO A CD  1 
ATOM   557  N N   . GLU A 1 132 ? 105.919 9.614   -134.571 1.00 29.19  ? 132 GLU A N   1 
ATOM   558  C CA  . GLU A 1 132 ? 105.531 10.897  -135.155 1.00 29.36  ? 132 GLU A CA  1 
ATOM   559  C C   . GLU A 1 132 ? 105.189 10.854  -136.653 1.00 28.71  ? 132 GLU A C   1 
ATOM   560  O O   . GLU A 1 132 ? 104.138 11.363  -137.048 1.00 28.93  ? 132 GLU A O   1 
ATOM   561  C CB  . GLU A 1 132 ? 106.623 11.932  -134.859 1.00 29.35  ? 132 GLU A CB  1 
ATOM   562  C CG  . GLU A 1 132 ? 106.404 13.320  -135.422 1.00 35.08  ? 132 GLU A CG  1 
ATOM   563  C CD  . GLU A 1 132 ? 107.236 14.357  -134.683 1.00 39.44  ? 132 GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 132 ? 108.327 14.720  -135.183 1.00 39.26  ? 132 GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 132 ? 106.812 14.779  -133.583 1.00 45.91  ? 132 GLU A OE2 1 
ATOM   566  N N   . PRO A 1 133 ? 106.054 10.241  -137.489 1.00 29.34  ? 133 PRO A N   1 
ATOM   567  C CA  . PRO A 1 133 ? 105.811 10.264  -138.938 1.00 27.82  ? 133 PRO A CA  1 
ATOM   568  C C   . PRO A 1 133 ? 104.435 9.749   -139.357 1.00 29.08  ? 133 PRO A C   1 
ATOM   569  O O   . PRO A 1 133 ? 103.802 10.332  -140.240 1.00 33.76  ? 133 PRO A O   1 
ATOM   570  C CB  . PRO A 1 133 ? 106.917 9.361   -139.488 1.00 24.37  ? 133 PRO A CB  1 
ATOM   571  C CG  . PRO A 1 133 ? 108.005 9.478   -138.497 1.00 21.31  ? 133 PRO A CG  1 
ATOM   572  C CD  . PRO A 1 133 ? 107.294 9.509   -137.176 1.00 28.15  ? 133 PRO A CD  1 
ATOM   573  N N   . VAL A 1 134 ? 103.978 8.670   -138.729 1.00 31.98  ? 134 VAL A N   1 
ATOM   574  C CA  . VAL A 1 134 ? 102.622 8.156   -138.964 1.00 31.98  ? 134 VAL A CA  1 
ATOM   575  C C   . VAL A 1 134 ? 101.610 9.301   -138.930 1.00 32.44  ? 134 VAL A C   1 
ATOM   576  O O   . VAL A 1 134 ? 100.806 9.460   -139.851 1.00 30.92  ? 134 VAL A O   1 
ATOM   577  C CB  . VAL A 1 134 ? 102.219 7.088   -137.904 1.00 31.82  ? 134 VAL A CB  1 
ATOM   578  C CG1 . VAL A 1 134 ? 100.738 6.739   -138.008 1.00 26.65  ? 134 VAL A CG1 1 
ATOM   579  C CG2 . VAL A 1 134 ? 103.083 5.832   -138.037 1.00 29.67  ? 134 VAL A CG2 1 
ATOM   580  N N   . LEU A 1 135 ? 101.682 10.110  -137.876 1.00 32.37  ? 135 LEU A N   1 
ATOM   581  C CA  . LEU A 1 135 ? 100.707 11.174  -137.649 1.00 34.01  ? 135 LEU A CA  1 
ATOM   582  C C   . LEU A 1 135 ? 101.009 12.478  -138.407 1.00 33.28  ? 135 LEU A C   1 
ATOM   583  O O   . LEU A 1 135 ? 100.124 13.322  -138.561 1.00 32.07  ? 135 LEU A O   1 
ATOM   584  C CB  . LEU A 1 135 ? 100.539 11.428  -136.147 1.00 35.52  ? 135 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 135 ? 99.764  10.319  -135.419 1.00 35.14  ? 135 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 135 ? 99.937  10.433  -133.916 1.00 33.84  ? 135 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 135 ? 98.288  10.357  -135.795 1.00 28.95  ? 135 LEU A CD2 1 
ATOM   588  N N   . LYS A 1 136 ? 102.239 12.645  -138.888 1.00 34.54  ? 136 LYS A N   1 
ATOM   589  C CA  . LYS A 1 136 ? 102.532 13.726  -139.833 1.00 35.62  ? 136 LYS A CA  1 
ATOM   590  C C   . LYS A 1 136 ? 101.741 13.475  -141.116 1.00 34.95  ? 136 LYS A C   1 
ATOM   591  O O   . LYS A 1 136 ? 100.994 14.344  -141.571 1.00 32.25  ? 136 LYS A O   1 
ATOM   592  C CB  . LYS A 1 136 ? 104.031 13.811  -140.143 1.00 35.15  ? 136 LYS A CB  1 
ATOM   593  C CG  . LYS A 1 136 ? 104.454 15.055  -140.947 1.00 37.75  ? 136 LYS A CG  1 
ATOM   594  C CD  . LYS A 1 136 ? 104.224 16.353  -140.160 1.00 42.14  ? 136 LYS A CD  1 
ATOM   595  C CE  . LYS A 1 136 ? 105.218 17.457  -140.526 1.00 37.85  ? 136 LYS A CE  1 
ATOM   596  N NZ  . LYS A 1 136 ? 104.998 17.997  -141.886 1.00 39.06  ? 136 LYS A NZ  1 
ATOM   597  N N   . THR A 1 137 ? 101.887 12.269  -141.664 1.00 34.13  ? 137 THR A N   1 
ATOM   598  C CA  . THR A 1 137 ? 101.201 11.861  -142.892 1.00 37.25  ? 137 THR A CA  1 
ATOM   599  C C   . THR A 1 137 ? 99.685  12.072  -142.839 1.00 39.56  ? 137 THR A C   1 
ATOM   600  O O   . THR A 1 137 ? 99.098  12.566  -143.799 1.00 40.07  ? 137 THR A O   1 
ATOM   601  C CB  . THR A 1 137 ? 101.495 10.381  -143.223 1.00 38.86  ? 137 THR A CB  1 
ATOM   602  O OG1 . THR A 1 137 ? 102.883 10.227  -143.552 1.00 41.94  ? 137 THR A OG1 1 
ATOM   603  C CG2 . THR A 1 137 ? 100.645 9.897   -144.391 1.00 32.43  ? 137 THR A CG2 1 
ATOM   604  N N   . SER A 1 138 ? 99.054  11.712  -141.722 1.00 40.24  ? 138 SER A N   1 
ATOM   605  C CA  . SER A 1 138 ? 97.609  11.929  -141.561 1.00 40.40  ? 138 SER A CA  1 
ATOM   606  C C   . SER A 1 138 ? 97.264  13.410  -141.348 1.00 40.87  ? 138 SER A C   1 
ATOM   607  O O   . SER A 1 138 ? 96.094  13.790  -141.365 1.00 39.10  ? 138 SER A O   1 
ATOM   608  C CB  . SER A 1 138 ? 97.046  11.075  -140.416 1.00 39.61  ? 138 SER A CB  1 
ATOM   609  O OG  . SER A 1 138 ? 97.724  11.313  -139.197 1.00 39.30  ? 138 SER A OG  1 
ATOM   610  N N   . GLY A 1 139 ? 98.282  14.239  -141.138 1.00 42.17  ? 139 GLY A N   1 
ATOM   611  C CA  . GLY A 1 139 ? 98.092  15.678  -141.013 1.00 44.41  ? 139 GLY A CA  1 
ATOM   612  C C   . GLY A 1 139 ? 97.608  16.116  -139.646 1.00 45.21  ? 139 GLY A C   1 
ATOM   613  O O   . GLY A 1 139 ? 97.166  17.249  -139.479 1.00 45.23  ? 139 GLY A O   1 
ATOM   614  N N   . HIS A 1 140 ? 97.692  15.223  -138.664 1.00 46.80  ? 140 HIS A N   1 
ATOM   615  C CA  . HIS A 1 140 ? 97.323  15.558  -137.294 1.00 45.78  ? 140 HIS A CA  1 
ATOM   616  C C   . HIS A 1 140 ? 98.360  16.487  -136.668 1.00 46.49  ? 140 HIS A C   1 
ATOM   617  O O   . HIS A 1 140 ? 98.011  17.415  -135.937 1.00 46.82  ? 140 HIS A O   1 
ATOM   618  C CB  . HIS A 1 140 ? 97.177  14.292  -136.449 1.00 42.90  ? 140 HIS A CB  1 
ATOM   619  C CG  . HIS A 1 140 ? 95.935  13.512  -136.741 1.00 44.52  ? 140 HIS A CG  1 
ATOM   620  N ND1 . HIS A 1 140 ? 95.856  12.590  -137.762 1.00 42.14  ? 140 HIS A ND1 1 
ATOM   621  C CD2 . HIS A 1 140 ? 94.720  13.514  -136.141 1.00 47.50  ? 140 HIS A CD2 1 
ATOM   622  C CE1 . HIS A 1 140 ? 94.648  12.056  -137.777 1.00 48.21  ? 140 HIS A CE1 1 
ATOM   623  N NE2 . HIS A 1 140 ? 93.938  12.600  -136.805 1.00 46.62  ? 140 HIS A NE2 1 
ATOM   624  N N   . VAL A 1 141 ? 99.632  16.236  -136.966 1.00 44.97  ? 141 VAL A N   1 
ATOM   625  C CA  . VAL A 1 141 ? 100.721 17.036  -136.420 1.00 44.80  ? 141 VAL A CA  1 
ATOM   626  C C   . VAL A 1 141 ? 100.510 18.523  -136.725 1.00 44.95  ? 141 VAL A C   1 
ATOM   627  O O   . VAL A 1 141 ? 100.721 19.373  -135.859 1.00 43.67  ? 141 VAL A O   1 
ATOM   628  C CB  . VAL A 1 141 ? 102.095 16.561  -136.960 1.00 45.53  ? 141 VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 141 ? 103.215 17.506  -136.524 1.00 40.87  ? 141 VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 141 ? 102.386 15.140  -136.491 1.00 41.70  ? 141 VAL A CG2 1 
ATOM   631  N N   . ASP A 1 142 ? 100.060 18.822  -137.941 1.00 45.25  ? 142 ASP A N   1 
ATOM   632  C CA  . ASP A 1 142 ? 99.885  20.205  -138.389 1.00 44.31  ? 142 ASP A CA  1 
ATOM   633  C C   . ASP A 1 142 ? 98.484  20.769  -138.166 1.00 42.39  ? 142 ASP A C   1 
ATOM   634  O O   . ASP A 1 142 ? 98.334  21.982  -138.046 1.00 48.95  ? 142 ASP A O   1 
ATOM   635  C CB  . ASP A 1 142 ? 100.227 20.329  -139.879 1.00 45.08  ? 142 ASP A CB  1 
ATOM   636  C CG  . ASP A 1 142 ? 101.699 20.092  -140.166 1.00 47.95  ? 142 ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 142 ? 102.003 19.388  -141.152 1.00 51.90  ? 142 ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 142 ? 102.551 20.605  -139.411 1.00 49.60  ? 142 ASP A OD2 1 
ATOM   639  N N   . LYS A 1 143 ? 97.467  19.912  -138.124 1.00 41.19  ? 143 LYS A N   1 
ATOM   640  C CA  . LYS A 1 143 ? 96.074  20.374  -138.181 1.00 42.71  ? 143 LYS A CA  1 
ATOM   641  C C   . LYS A 1 143 ? 95.151  19.888  -137.052 1.00 40.42  ? 143 LYS A C   1 
ATOM   642  O O   . LYS A 1 143 ? 93.979  20.250  -137.043 1.00 44.65  ? 143 LYS A O   1 
ATOM   643  C CB  . LYS A 1 143 ? 95.459  19.991  -139.540 1.00 43.70  ? 143 LYS A CB  1 
ATOM   644  C CG  . LYS A 1 143 ? 96.093  20.690  -140.752 1.00 52.77  ? 143 LYS A CG  1 
ATOM   645  C CD  . LYS A 1 143 ? 96.099  19.810  -142.010 1.00 52.11  ? 143 LYS A CD  1 
ATOM   646  C CE  . LYS A 1 143 ? 94.693  19.410  -142.457 1.00 60.43  ? 143 LYS A CE  1 
ATOM   647  N NZ  . LYS A 1 143 ? 94.714  18.492  -143.633 1.00 57.76  ? 143 LYS A NZ  1 
ATOM   648  N N   . PHE A 1 144 ? 95.645  19.087  -136.110 1.00 38.22  ? 144 PHE A N   1 
ATOM   649  C CA  . PHE A 1 144 ? 94.795  18.602  -135.011 1.00 36.90  ? 144 PHE A CA  1 
ATOM   650  C C   . PHE A 1 144 ? 94.955  19.487  -133.779 1.00 34.90  ? 144 PHE A C   1 
ATOM   651  O O   . PHE A 1 144 ? 95.411  19.041  -132.726 1.00 35.60  ? 144 PHE A O   1 
ATOM   652  C CB  . PHE A 1 144 ? 95.107  17.140  -134.680 1.00 38.73  ? 144 PHE A CB  1 
ATOM   653  C CG  . PHE A 1 144 ? 94.104  16.496  -133.761 1.00 39.74  ? 144 PHE A CG  1 
ATOM   654  C CD1 . PHE A 1 144 ? 92.789  16.316  -134.164 1.00 43.94  ? 144 PHE A CD1 1 
ATOM   655  C CD2 . PHE A 1 144 ? 94.476  16.057  -132.499 1.00 45.44  ? 144 PHE A CD2 1 
ATOM   656  C CE1 . PHE A 1 144 ? 91.858  15.714  -133.321 1.00 40.86  ? 144 PHE A CE1 1 
ATOM   657  C CE2 . PHE A 1 144 ? 93.552  15.455  -131.653 1.00 44.16  ? 144 PHE A CE2 1 
ATOM   658  C CZ  . PHE A 1 144 ? 92.239  15.284  -132.069 1.00 40.41  ? 144 PHE A CZ  1 
ATOM   659  N N   . ALA A 1 145 ? 94.560  20.748  -133.922 1.00 34.25  ? 145 ALA A N   1 
ATOM   660  C CA  . ALA A 1 145 ? 94.776  21.753  -132.886 1.00 33.26  ? 145 ALA A CA  1 
ATOM   661  C C   . ALA A 1 145 ? 93.563  22.665  -132.691 1.00 32.25  ? 145 ALA A C   1 
ATOM   662  O O   . ALA A 1 145 ? 92.741  22.828  -133.591 1.00 34.55  ? 145 ALA A O   1 
ATOM   663  C CB  . ALA A 1 145 ? 96.001  22.584  -133.234 1.00 28.89  ? 145 ALA A CB  1 
ATOM   664  N N   . ASP A 1 146 ? 93.458  23.239  -131.496 1.00 32.48  ? 146 ASP A N   1 
ATOM   665  C CA  . ASP A 1 146 ? 92.499  24.300  -131.206 1.00 30.05  ? 146 ASP A CA  1 
ATOM   666  C C   . ASP A 1 146 ? 93.291  25.577  -130.983 1.00 29.29  ? 146 ASP A C   1 
ATOM   667  O O   . ASP A 1 146 ? 94.340  25.549  -130.334 1.00 28.42  ? 146 ASP A O   1 
ATOM   668  C CB  . ASP A 1 146 ? 91.701  23.984  -129.936 1.00 27.45  ? 146 ASP A CB  1 
ATOM   669  C CG  . ASP A 1 146 ? 90.646  22.922  -130.145 1.00 37.40  ? 146 ASP A CG  1 
ATOM   670  O OD1 . ASP A 1 146 ? 90.212  22.712  -131.299 1.00 48.06  ? 146 ASP A OD1 1 
ATOM   671  O OD2 . ASP A 1 146 ? 90.237  22.300  -129.138 1.00 49.31  ? 146 ASP A OD2 1 
ATOM   672  N N   . PHE A 1 147 ? 92.803  26.697  -131.511 1.00 29.13  ? 147 PHE A N   1 
ATOM   673  C CA  . PHE A 1 147 ? 93.429  27.984  -131.216 1.00 30.74  ? 147 PHE A CA  1 
ATOM   674  C C   . PHE A 1 147 ? 93.309  28.276  -129.725 1.00 29.85  ? 147 PHE A C   1 
ATOM   675  O O   . PHE A 1 147 ? 92.230  28.139  -129.130 1.00 29.05  ? 147 PHE A O   1 
ATOM   676  C CB  . PHE A 1 147 ? 92.815  29.125  -132.035 1.00 32.34  ? 147 PHE A CB  1 
ATOM   677  C CG  . PHE A 1 147 ? 93.228  29.123  -133.476 1.00 30.57  ? 147 PHE A CG  1 
ATOM   678  C CD1 . PHE A 1 147 ? 92.289  28.944  -134.485 1.00 27.83  ? 147 PHE A CD1 1 
ATOM   679  C CD2 . PHE A 1 147 ? 94.563  29.291  -133.826 1.00 38.35  ? 147 PHE A CD2 1 
ATOM   680  C CE1 . PHE A 1 147 ? 92.672  28.939  -135.824 1.00 33.82  ? 147 PHE A CE1 1 
ATOM   681  C CE2 . PHE A 1 147 ? 94.959  29.284  -135.164 1.00 38.11  ? 147 PHE A CE2 1 
ATOM   682  C CZ  . PHE A 1 147 ? 94.010  29.106  -136.164 1.00 37.18  ? 147 PHE A CZ  1 
ATOM   683  N N   . MET A 1 148 ? 94.433  28.661  -129.133 1.00 31.20  ? 148 MET A N   1 
ATOM   684  C CA  . MET A 1 148 ? 94.526  28.910  -127.704 1.00 32.23  ? 148 MET A CA  1 
ATOM   685  C C   . MET A 1 148 ? 95.051  30.319  -127.462 1.00 34.46  ? 148 MET A C   1 
ATOM   686  O O   . MET A 1 148 ? 95.970  30.791  -128.141 1.00 28.14  ? 148 MET A O   1 
ATOM   687  C CB  . MET A 1 148 ? 95.460  27.891  -127.056 1.00 30.13  ? 148 MET A CB  1 
ATOM   688  C CG  . MET A 1 148 ? 95.616  28.037  -125.551 1.00 30.47  ? 148 MET A CG  1 
ATOM   689  S SD  . MET A 1 148 ? 96.763  26.823  -124.872 1.00 28.18  ? 148 MET A SD  1 
ATOM   690  C CE  . MET A 1 148 ? 98.279  27.251  -125.726 1.00 27.52  ? 148 MET A CE  1 
ATOM   691  N N   . VAL A 1 149 ? 94.444  30.976  -126.482 1.00 40.00  ? 149 VAL A N   1 
ATOM   692  C CA  . VAL A 1 149 ? 94.838  32.308  -126.057 1.00 42.55  ? 149 VAL A CA  1 
ATOM   693  C C   . VAL A 1 149 ? 95.123  32.236  -124.562 1.00 46.07  ? 149 VAL A C   1 
ATOM   694  O O   . VAL A 1 149 ? 94.423  31.531  -123.828 1.00 49.18  ? 149 VAL A O   1 
ATOM   695  C CB  . VAL A 1 149 ? 93.715  33.319  -126.337 1.00 42.55  ? 149 VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 149 ? 93.978  34.611  -125.624 1.00 52.14  ? 149 VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 149 ? 93.581  33.561  -127.832 1.00 46.18  ? 149 VAL A CG2 1 
ATOM   698  N N   . LYS A 1 150 ? 96.153  32.946  -124.110 1.00 46.59  ? 150 LYS A N   1 
ATOM   699  C CA  . LYS A 1 150 ? 96.513  32.924  -122.695 1.00 46.88  ? 150 LYS A CA  1 
ATOM   700  C C   . LYS A 1 150 ? 96.715  34.315  -122.108 1.00 46.99  ? 150 LYS A C   1 
ATOM   701  O O   . LYS A 1 150 ? 97.054  35.268  -122.815 1.00 47.04  ? 150 LYS A O   1 
ATOM   702  C CB  . LYS A 1 150 ? 97.740  32.031  -122.447 1.00 49.08  ? 150 LYS A CB  1 
ATOM   703  C CG  . LYS A 1 150 ? 98.910  32.246  -123.394 1.00 49.32  ? 150 LYS A CG  1 
ATOM   704  C CD  . LYS A 1 150 ? 100.022 31.251  -123.108 1.00 46.06  ? 150 LYS A CD  1 
ATOM   705  C CE  . LYS A 1 150 ? 101.244 31.529  -123.963 1.00 50.63  ? 150 LYS A CE  1 
ATOM   706  N NZ  . LYS A 1 150 ? 102.376 30.639  -123.600 1.00 50.80  ? 150 LYS A NZ  1 
ATOM   707  N N   . ASP A 1 151 ? 96.489  34.405  -120.800 1.00 46.28  ? 151 ASP A N   1 
ATOM   708  C CA  . ASP A 1 151 ? 96.537  35.659  -120.054 1.00 46.09  ? 151 ASP A CA  1 
ATOM   709  C C   . ASP A 1 151 ? 97.973  36.184  -119.983 1.00 47.31  ? 151 ASP A C   1 
ATOM   710  O O   . ASP A 1 151 ? 98.883  35.474  -119.550 1.00 48.90  ? 151 ASP A O   1 
ATOM   711  C CB  . ASP A 1 151 ? 95.972  35.426  -118.647 1.00 44.75  ? 151 ASP A CB  1 
ATOM   712  C CG  . ASP A 1 151 ? 95.774  36.709  -117.860 1.00 44.25  ? 151 ASP A CG  1 
ATOM   713  O OD1 . ASP A 1 151 ? 94.640  36.941  -117.393 1.00 43.41  ? 151 ASP A OD1 1 
ATOM   714  O OD2 . ASP A 1 151 ? 96.746  37.472  -117.681 1.00 42.09  ? 151 ASP A OD2 1 
ATOM   715  N N   . VAL A 1 152 ? 98.162  37.434  -120.402 1.00 46.84  ? 152 VAL A N   1 
ATOM   716  C CA  . VAL A 1 152 ? 99.495  38.045  -120.484 1.00 46.13  ? 152 VAL A CA  1 
ATOM   717  C C   . VAL A 1 152 ? 100.227 38.120  -119.135 1.00 45.74  ? 152 VAL A C   1 
ATOM   718  O O   . VAL A 1 152 ? 101.458 38.067  -119.097 1.00 44.01  ? 152 VAL A O   1 
ATOM   719  C CB  . VAL A 1 152 ? 99.434  39.467  -121.108 1.00 46.61  ? 152 VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 152 ? 98.911  39.400  -122.542 1.00 46.37  ? 152 VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 152 ? 98.577  40.405  -120.258 1.00 43.66  ? 152 VAL A CG2 1 
ATOM   722  N N   . LYS A 1 153 ? 99.471  38.238  -118.041 1.00 46.45  ? 153 LYS A N   1 
ATOM   723  C CA  . LYS A 1 153 ? 100.051 38.333  -116.694 1.00 46.18  ? 153 LYS A CA  1 
ATOM   724  C C   . LYS A 1 153 ? 100.304 36.962  -116.058 1.00 47.53  ? 153 LYS A C   1 
ATOM   725  O O   . LYS A 1 153 ? 101.445 36.497  -116.034 1.00 48.24  ? 153 LYS A O   1 
ATOM   726  C CB  . LYS A 1 153 ? 99.166  39.189  -115.779 1.00 45.46  ? 153 LYS A CB  1 
ATOM   727  C CG  . LYS A 1 153 ? 99.331  40.689  -115.979 1.00 44.13  ? 153 LYS A CG  1 
ATOM   728  C CD  . LYS A 1 153 ? 98.477  41.472  -114.993 1.00 44.21  ? 153 LYS A CD  1 
ATOM   729  C CE  . LYS A 1 153 ? 98.932  42.917  -114.879 1.00 44.21  ? 153 LYS A CE  1 
ATOM   730  N NZ  . LYS A 1 153 ? 98.906  43.613  -116.189 1.00 45.14  ? 153 LYS A NZ  1 
ATOM   731  N N   . ASN A 1 154 ? 99.249  36.317  -115.555 1.00 48.37  ? 154 ASN A N   1 
ATOM   732  C CA  . ASN A 1 154 ? 99.393  35.051  -114.814 1.00 47.54  ? 154 ASN A CA  1 
ATOM   733  C C   . ASN A 1 154 ? 99.664  33.826  -115.696 1.00 47.79  ? 154 ASN A C   1 
ATOM   734  O O   . ASN A 1 154 ? 100.238 32.844  -115.227 1.00 48.63  ? 154 ASN A O   1 
ATOM   735  C CB  . ASN A 1 154 ? 98.180  34.795  -113.902 1.00 47.43  ? 154 ASN A CB  1 
ATOM   736  C CG  . ASN A 1 154 ? 96.900  34.523  -114.674 1.00 46.81  ? 154 ASN A CG  1 
ATOM   737  O OD1 . ASN A 1 154 ? 96.582  35.224  -115.627 1.00 52.90  ? 154 ASN A OD1 1 
ATOM   738  N ND2 . ASN A 1 154 ? 96.155  33.510  -114.252 1.00 42.74  ? 154 ASN A ND2 1 
ATOM   739  N N   . GLY A 1 155 ? 99.244  33.880  -116.958 1.00 47.74  ? 155 GLY A N   1 
ATOM   740  C CA  . GLY A 1 155 ? 99.568  32.830  -117.929 1.00 46.78  ? 155 GLY A CA  1 
ATOM   741  C C   . GLY A 1 155 ? 98.565  31.694  -118.069 1.00 46.17  ? 155 GLY A C   1 
ATOM   742  O O   . GLY A 1 155 ? 98.901  30.653  -118.631 1.00 46.20  ? 155 GLY A O   1 
ATOM   743  N N   . GLU A 1 156 ? 97.340  31.880  -117.576 1.00 45.90  ? 156 GLU A N   1 
ATOM   744  C CA  . GLU A 1 156 ? 96.301  30.852  -117.701 1.00 44.52  ? 156 GLU A CA  1 
ATOM   745  C C   . GLU A 1 156 ? 95.851  30.732  -119.154 1.00 42.34  ? 156 GLU A C   1 
ATOM   746  O O   . GLU A 1 156 ? 95.802  31.728  -119.873 1.00 38.77  ? 156 GLU A O   1 
ATOM   747  C CB  . GLU A 1 156 ? 95.096  31.172  -116.810 1.00 45.12  ? 156 GLU A CB  1 
ATOM   748  C CG  . GLU A 1 156 ? 94.063  30.042  -116.735 1.00 47.75  ? 156 GLU A CG  1 
ATOM   749  C CD  . GLU A 1 156 ? 92.823  30.409  -115.933 1.00 50.99  ? 156 GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 156 ? 91.772  29.764  -116.141 1.00 54.70  ? 156 GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 156 ? 92.893  31.338  -115.099 1.00 56.67  ? 156 GLU A OE2 1 
ATOM   752  N N   . CYS A 1 157 ? 95.516  29.509  -119.569 1.00 41.20  ? 157 CYS A N   1 
ATOM   753  C CA  . CYS A 1 157 ? 95.144  29.218  -120.957 1.00 38.72  ? 157 CYS A CA  1 
ATOM   754  C C   . CYS A 1 157 ? 93.642  29.124  -121.171 1.00 36.83  ? 157 CYS A C   1 
ATOM   755  O O   . CYS A 1 157 ? 92.905  28.642  -120.305 1.00 32.11  ? 157 CYS A O   1 
ATOM   756  C CB  . CYS A 1 157 ? 95.774  27.911  -121.410 1.00 38.09  ? 157 CYS A CB  1 
ATOM   757  S SG  . CYS A 1 157 ? 97.521  28.041  -121.666 1.00 45.85  ? 157 CYS A SG  1 
ATOM   758  N N   . PHE A 1 158 ? 93.209  29.573  -122.348 1.00 35.36  ? 158 PHE A N   1 
ATOM   759  C CA  . PHE A 1 158 ? 91.805  29.540  -122.732 1.00 35.07  ? 158 PHE A CA  1 
ATOM   760  C C   . PHE A 1 158 ? 91.667  29.092  -124.177 1.00 34.51  ? 158 PHE A C   1 
ATOM   761  O O   . PHE A 1 158 ? 92.461  29.475  -125.043 1.00 28.50  ? 158 PHE A O   1 
ATOM   762  C CB  . PHE A 1 158 ? 91.170  30.919  -122.569 1.00 33.18  ? 158 PHE A CB  1 
ATOM   763  C CG  . PHE A 1 158 ? 91.296  31.483  -121.188 1.00 32.84  ? 158 PHE A CG  1 
ATOM   764  C CD1 . PHE A 1 158 ? 92.418  32.225  -120.830 1.00 34.49  ? 158 PHE A CD1 1 
ATOM   765  C CD2 . PHE A 1 158 ? 90.299  31.270  -120.242 1.00 27.81  ? 158 PHE A CD2 1 
ATOM   766  C CE1 . PHE A 1 158 ? 92.547  32.748  -119.552 1.00 34.95  ? 158 PHE A CE1 1 
ATOM   767  C CE2 . PHE A 1 158 ? 90.417  31.791  -118.963 1.00 32.08  ? 158 PHE A CE2 1 
ATOM   768  C CZ  . PHE A 1 158 ? 91.544  32.533  -118.615 1.00 35.79  ? 158 PHE A CZ  1 
ATOM   769  N N   . ARG A 1 159 ? 90.651  28.275  -124.430 1.00 37.79  ? 159 ARG A N   1 
ATOM   770  C CA  . ARG A 1 159 ? 90.337  27.856  -125.784 1.00 39.21  ? 159 ARG A CA  1 
ATOM   771  C C   . ARG A 1 159 ? 89.744  29.071  -126.495 1.00 38.18  ? 159 ARG A C   1 
ATOM   772  O O   . ARG A 1 159 ? 88.706  29.590  -126.080 1.00 36.98  ? 159 ARG A O   1 
ATOM   773  C CB  . ARG A 1 159 ? 89.364  26.673  -125.774 1.00 38.25  ? 159 ARG A CB  1 
ATOM   774  C CG  . ARG A 1 159 ? 89.403  25.868  -127.050 1.00 39.11  ? 159 ARG A CG  1 
ATOM   775  C CD  . ARG A 1 159 ? 88.270  24.872  -127.138 1.00 42.93  ? 159 ARG A CD  1 
ATOM   776  N NE  . ARG A 1 159 ? 87.987  24.523  -128.528 1.00 47.78  ? 159 ARG A NE  1 
ATOM   777  C CZ  . ARG A 1 159 ? 87.100  23.611  -128.911 1.00 53.59  ? 159 ARG A CZ  1 
ATOM   778  N NH1 . ARG A 1 159 ? 86.398  22.926  -128.011 1.00 62.55  ? 159 ARG A NH1 1 
ATOM   779  N NH2 . ARG A 1 159 ? 86.916  23.376  -130.204 1.00 51.05  ? 159 ARG A NH2 1 
ATOM   780  N N   . ALA A 1 160 ? 90.418  29.528  -127.548 1.00 38.51  ? 160 ALA A N   1 
ATOM   781  C CA  . ALA A 1 160 ? 90.120  30.833  -128.152 1.00 38.95  ? 160 ALA A CA  1 
ATOM   782  C C   . ALA A 1 160 ? 88.692  30.952  -128.669 1.00 37.32  ? 160 ALA A C   1 
ATOM   783  O O   . ALA A 1 160 ? 88.012  31.935  -128.383 1.00 37.54  ? 160 ALA A O   1 
ATOM   784  C CB  . ALA A 1 160 ? 91.103  31.136  -129.268 1.00 38.67  ? 160 ALA A CB  1 
ATOM   785  N N   . ASP A 1 161 ? 88.247  29.951  -129.424 1.00 39.24  ? 161 ASP A N   1 
ATOM   786  C CA  . ASP A 1 161 ? 86.917  29.979  -130.050 1.00 40.97  ? 161 ASP A CA  1 
ATOM   787  C C   . ASP A 1 161 ? 85.779  30.200  -129.046 1.00 41.42  ? 161 ASP A C   1 
ATOM   788  O O   . ASP A 1 161 ? 84.864  30.978  -129.309 1.00 41.40  ? 161 ASP A O   1 
ATOM   789  C CB  . ASP A 1 161 ? 86.666  28.711  -130.894 1.00 41.62  ? 161 ASP A CB  1 
ATOM   790  C CG  . ASP A 1 161 ? 86.856  27.411  -130.113 1.00 47.74  ? 161 ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 161 ? 86.675  26.336  -130.718 1.00 58.07  ? 161 ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 161 ? 87.186  27.447  -128.910 1.00 55.40  ? 161 ASP A OD2 1 
ATOM   793  N N   . HIS A 1 162 ? 85.853  29.521  -127.902 1.00 43.90  ? 162 HIS A N   1 
ATOM   794  C CA  . HIS A 1 162 ? 84.834  29.613  -126.853 1.00 44.76  ? 162 HIS A CA  1 
ATOM   795  C C   . HIS A 1 162 ? 84.848  30.973  -126.158 1.00 44.55  ? 162 HIS A C   1 
ATOM   796  O O   . HIS A 1 162 ? 83.796  31.508  -125.798 1.00 44.96  ? 162 HIS A O   1 
ATOM   797  C CB  . HIS A 1 162 ? 85.056  28.520  -125.802 1.00 46.01  ? 162 HIS A CB  1 
ATOM   798  C CG  . HIS A 1 162 ? 84.714  27.142  -126.275 1.00 53.68  ? 162 HIS A CG  1 
ATOM   799  N ND1 . HIS A 1 162 ? 84.449  26.104  -125.407 1.00 50.62  ? 162 HIS A ND1 1 
ATOM   800  C CD2 . HIS A 1 162 ? 84.577  26.632  -127.523 1.00 56.71  ? 162 HIS A CD2 1 
ATOM   801  C CE1 . HIS A 1 162 ? 84.176  25.013  -126.099 1.00 51.59  ? 162 HIS A CE1 1 
ATOM   802  N NE2 . HIS A 1 162 ? 84.246  25.306  -127.386 1.00 53.74  ? 162 HIS A NE2 1 
ATOM   803  N N   . LEU A 1 163 ? 86.046  31.515  -125.958 1.00 42.19  ? 163 LEU A N   1 
ATOM   804  C CA  . LEU A 1 163 ? 86.212  32.779  -125.245 1.00 42.80  ? 163 LEU A CA  1 
ATOM   805  C C   . LEU A 1 163 ? 85.621  33.938  -126.043 1.00 45.35  ? 163 LEU A C   1 
ATOM   806  O O   . LEU A 1 163 ? 84.945  34.807  -125.486 1.00 45.90  ? 163 LEU A O   1 
ATOM   807  C CB  . LEU A 1 163 ? 87.696  33.038  -124.960 1.00 42.99  ? 163 LEU A CB  1 
ATOM   808  C CG  . LEU A 1 163 ? 88.027  34.139  -123.952 1.00 38.33  ? 163 LEU A CG  1 
ATOM   809  C CD1 . LEU A 1 163 ? 87.197  33.979  -122.691 1.00 36.39  ? 163 LEU A CD1 1 
ATOM   810  C CD2 . LEU A 1 163 ? 89.514  34.113  -123.623 1.00 34.75  ? 163 LEU A CD2 1 
ATOM   811  N N   . LEU A 1 164 ? 85.881  33.936  -127.347 1.00 42.48  ? 164 LEU A N   1 
ATOM   812  C CA  . LEU A 1 164 ? 85.311  34.926  -128.247 1.00 40.71  ? 164 LEU A CA  1 
ATOM   813  C C   . LEU A 1 164 ? 83.787  34.791  -128.281 1.00 41.18  ? 164 LEU A C   1 
ATOM   814  O O   . LEU A 1 164 ? 83.074  35.782  -128.153 1.00 42.57  ? 164 LEU A O   1 
ATOM   815  C CB  . LEU A 1 164 ? 85.909  34.765  -129.648 1.00 41.96  ? 164 LEU A CB  1 
ATOM   816  C CG  . LEU A 1 164 ? 85.561  35.806  -130.717 1.00 44.32  ? 164 LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 164 ? 86.565  35.758  -131.859 1.00 46.35  ? 164 LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 164 ? 84.159  35.585  -131.249 1.00 53.59  ? 164 LEU A CD2 1 
ATOM   819  N N   . LYS A 1 165 ? 83.294  33.564  -128.434 1.00 39.86  ? 165 LYS A N   1 
ATOM   820  C CA  . LYS A 1 165 ? 81.853  33.311  -128.481 1.00 38.87  ? 165 LYS A CA  1 
ATOM   821  C C   . LYS A 1 165 ? 81.130  33.830  -127.236 1.00 37.32  ? 165 LYS A C   1 
ATOM   822  O O   . LYS A 1 165 ? 80.013  34.335  -127.333 1.00 37.15  ? 165 LYS A O   1 
ATOM   823  C CB  . LYS A 1 165 ? 81.580  31.814  -128.658 1.00 40.86  ? 165 LYS A CB  1 
ATOM   824  C CG  . LYS A 1 165 ? 80.099  31.431  -128.656 1.00 42.23  ? 165 LYS A CG  1 
ATOM   825  C CD  . LYS A 1 165 ? 79.906  29.941  -128.914 1.00 42.05  ? 165 LYS A CD  1 
ATOM   826  C CE  . LYS A 1 165 ? 78.487  29.494  -128.591 1.00 42.65  ? 165 LYS A CE  1 
ATOM   827  N NZ  . LYS A 1 165 ? 78.408  28.019  -128.412 1.00 42.55  ? 165 LYS A NZ  1 
ATOM   828  N N   . ALA A 1 166 ? 81.763  33.699  -126.074 1.00 37.15  ? 166 ALA A N   1 
ATOM   829  C CA  . ALA A 1 166 ? 81.188  34.195  -124.823 1.00 37.87  ? 166 ALA A CA  1 
ATOM   830  C C   . ALA A 1 166 ? 81.148  35.722  -124.823 1.00 39.47  ? 166 ALA A C   1 
ATOM   831  O O   . ALA A 1 166 ? 80.152  36.329  -124.423 1.00 39.10  ? 166 ALA A O   1 
ATOM   832  C CB  . ALA A 1 166 ? 81.990  33.687  -123.635 1.00 34.93  ? 166 ALA A CB  1 
ATOM   833  N N   . HIS A 1 167 ? 82.238  36.326  -125.289 1.00 40.52  ? 167 HIS A N   1 
ATOM   834  C CA  . HIS A 1 167 ? 82.375  37.779  -125.348 1.00 40.35  ? 167 HIS A CA  1 
ATOM   835  C C   . HIS A 1 167 ? 81.338  38.421  -126.265 1.00 40.75  ? 167 HIS A C   1 
ATOM   836  O O   . HIS A 1 167 ? 80.755  39.444  -125.916 1.00 42.08  ? 167 HIS A O   1 
ATOM   837  C CB  . HIS A 1 167 ? 83.781  38.148  -125.829 1.00 41.78  ? 167 HIS A CB  1 
ATOM   838  C CG  . HIS A 1 167 ? 84.142  39.580  -125.602 1.00 41.30  ? 167 HIS A CG  1 
ATOM   839  N ND1 . HIS A 1 167 ? 83.744  40.591  -126.449 1.00 44.60  ? 167 HIS A ND1 1 
ATOM   840  C CD2 . HIS A 1 167 ? 84.874  40.171  -124.628 1.00 43.58  ? 167 HIS A CD2 1 
ATOM   841  C CE1 . HIS A 1 167 ? 84.211  41.743  -126.006 1.00 45.24  ? 167 HIS A CE1 1 
ATOM   842  N NE2 . HIS A 1 167 ? 84.902  41.516  -124.903 1.00 49.02  ? 167 HIS A NE2 1 
ATOM   843  N N   . LEU A 1 168 ? 81.116  37.828  -127.437 1.00 42.26  ? 168 LEU A N   1 
ATOM   844  C CA  . LEU A 1 168 ? 80.127  38.350  -128.385 1.00 42.07  ? 168 LEU A CA  1 
ATOM   845  C C   . LEU A 1 168 ? 78.706  38.170  -127.860 1.00 42.25  ? 168 LEU A C   1 
ATOM   846  O O   . LEU A 1 168 ? 77.883  39.080  -127.963 1.00 43.84  ? 168 LEU A O   1 
ATOM   847  C CB  . LEU A 1 168 ? 80.255  37.685  -129.762 1.00 41.81  ? 168 LEU A CB  1 
ATOM   848  C CG  . LEU A 1 168 ? 81.575  37.821  -130.535 1.00 41.01  ? 168 LEU A CG  1 
ATOM   849  C CD1 . LEU A 1 168 ? 81.361  37.455  -132.001 1.00 43.29  ? 168 LEU A CD1 1 
ATOM   850  C CD2 . LEU A 1 168 ? 82.178  39.207  -130.432 1.00 28.15  ? 168 LEU A CD2 1 
ATOM   851  N N   . GLN A 1 169 ? 78.420  36.997  -127.302 1.00 41.37  ? 169 GLN A N   1 
ATOM   852  C CA  . GLN A 1 169 ? 77.115  36.742  -126.695 1.00 43.44  ? 169 GLN A CA  1 
ATOM   853  C C   . GLN A 1 169 ? 76.825  37.728  -125.558 1.00 44.89  ? 169 GLN A C   1 
ATOM   854  O O   . GLN A 1 169 ? 75.679  38.146  -125.370 1.00 41.86  ? 169 GLN A O   1 
ATOM   855  C CB  . GLN A 1 169 ? 77.027  35.296  -126.202 1.00 43.11  ? 169 GLN A CB  1 
ATOM   856  C CG  . GLN A 1 169 ? 76.833  34.285  -127.334 1.00 44.17  ? 169 GLN A CG  1 
ATOM   857  C CD  . GLN A 1 169 ? 77.034  32.838  -126.902 1.00 43.93  ? 169 GLN A CD  1 
ATOM   858  O OE1 . GLN A 1 169 ? 76.350  31.937  -127.390 1.00 39.54  ? 169 GLN A OE1 1 
ATOM   859  N NE2 . GLN A 1 169 ? 77.978  32.609  -125.994 1.00 43.45  ? 169 GLN A NE2 1 
ATOM   860  N N   . LYS A 1 170 ? 77.870  38.103  -124.820 1.00 47.52  ? 170 LYS A N   1 
ATOM   861  C CA  . LYS A 1 170 ? 77.768  39.105  -123.751 1.00 47.50  ? 170 LYS A CA  1 
ATOM   862  C C   . LYS A 1 170 ? 77.336  40.452  -124.323 1.00 48.04  ? 170 LYS A C   1 
ATOM   863  O O   . LYS A 1 170 ? 76.359  41.048  -123.864 1.00 49.12  ? 170 LYS A O   1 
ATOM   864  C CB  . LYS A 1 170 ? 79.118  39.251  -123.028 1.00 48.41  ? 170 LYS A CB  1 
ATOM   865  C CG  . LYS A 1 170 ? 79.191  40.337  -121.946 1.00 47.49  ? 170 LYS A CG  1 
ATOM   866  C CD  . LYS A 1 170 ? 78.775  39.822  -120.572 1.00 51.71  ? 170 LYS A CD  1 
ATOM   867  C CE  . LYS A 1 170 ? 78.977  40.890  -119.498 1.00 51.40  ? 170 LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 170 ? 78.631  40.411  -118.128 1.00 46.80  ? 170 LYS A NZ  1 
ATOM   869  N N   . LEU A 1 171 ? 78.076  40.921  -125.324 1.00 47.57  ? 171 LEU A N   1 
ATOM   870  C CA  . LEU A 1 171 ? 77.779  42.191  -125.977 1.00 46.61  ? 171 LEU A CA  1 
ATOM   871  C C   . LEU A 1 171 ? 76.392  42.177  -126.624 1.00 48.99  ? 171 LEU A C   1 
ATOM   872  O O   . LEU A 1 171 ? 75.621  43.122  -126.454 1.00 52.65  ? 171 LEU A O   1 
ATOM   873  C CB  . LEU A 1 171 ? 78.855  42.529  -127.016 1.00 43.58  ? 171 LEU A CB  1 
ATOM   874  C CG  . LEU A 1 171 ? 80.247  42.853  -126.457 1.00 37.48  ? 171 LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 171 ? 81.273  42.988  -127.574 1.00 25.61  ? 171 LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 171 ? 80.220  44.120  -125.613 1.00 32.30  ? 171 LEU A CD2 1 
ATOM   877  N N   . MET A 1 172 ? 76.063  41.100  -127.335 1.00 48.41  ? 172 MET A N   1 
ATOM   878  C CA  . MET A 1 172 ? 74.750  40.977  -127.985 1.00 48.82  ? 172 MET A CA  1 
ATOM   879  C C   . MET A 1 172 ? 73.566  41.037  -127.009 1.00 50.25  ? 172 MET A C   1 
ATOM   880  O O   . MET A 1 172 ? 72.442  41.326  -127.423 1.00 51.58  ? 172 MET A O   1 
ATOM   881  C CB  . MET A 1 172 ? 74.673  39.692  -128.817 1.00 48.82  ? 172 MET A CB  1 
ATOM   882  C CG  . MET A 1 172 ? 75.406  39.786  -130.142 1.00 50.52  ? 172 MET A CG  1 
ATOM   883  S SD  . MET A 1 172 ? 75.319  38.269  -131.109 1.00 52.09  ? 172 MET A SD  1 
ATOM   884  C CE  . MET A 1 172 ? 76.403  37.208  -130.161 1.00 47.96  ? 172 MET A CE  1 
ATOM   885  N N   . SER A 1 173 ? 73.815  40.761  -125.730 1.00 50.33  ? 173 SER A N   1 
ATOM   886  C CA  . SER A 1 173 ? 72.784  40.868  -124.694 1.00 49.07  ? 173 SER A CA  1 
ATOM   887  C C   . SER A 1 173 ? 72.641  42.287  -124.134 1.00 48.81  ? 173 SER A C   1 
ATOM   888  O O   . SER A 1 173 ? 71.675  42.579  -123.429 1.00 48.92  ? 173 SER A O   1 
ATOM   889  C CB  . SER A 1 173 ? 73.091  39.906  -123.549 1.00 48.58  ? 173 SER A CB  1 
ATOM   890  O OG  . SER A 1 173 ? 73.296  38.595  -124.038 1.00 52.64  ? 173 SER A OG  1 
ATOM   891  N N   . ASP A 1 174 ? 73.601  43.160  -124.443 1.00 48.17  ? 174 ASP A N   1 
ATOM   892  C CA  . ASP A 1 174 ? 73.592  44.542  -123.950 1.00 48.15  ? 174 ASP A CA  1 
ATOM   893  C C   . ASP A 1 174 ? 72.470  45.357  -124.604 1.00 46.69  ? 174 ASP A C   1 
ATOM   894  O O   . ASP A 1 174 ? 72.234  45.256  -125.808 1.00 45.35  ? 174 ASP A O   1 
ATOM   895  C CB  . ASP A 1 174 ? 74.954  45.205  -124.215 1.00 48.41  ? 174 ASP A CB  1 
ATOM   896  C CG  . ASP A 1 174 ? 75.157  46.499  -123.431 1.00 49.01  ? 174 ASP A CG  1 
ATOM   897  O OD1 . ASP A 1 174 ? 74.164  47.177  -123.081 1.00 50.62  ? 174 ASP A OD1 1 
ATOM   898  O OD2 . ASP A 1 174 ? 76.330  46.848  -123.177 1.00 46.95  ? 174 ASP A OD2 1 
ATOM   899  N N   . LYS A 1 175 ? 71.786  46.165  -123.799 1.00 46.19  ? 175 LYS A N   1 
ATOM   900  C CA  . LYS A 1 175 ? 70.700  47.012  -124.291 1.00 45.94  ? 175 LYS A CA  1 
ATOM   901  C C   . LYS A 1 175 ? 71.242  48.251  -124.999 1.00 45.29  ? 175 LYS A C   1 
ATOM   902  O O   . LYS A 1 175 ? 70.604  48.778  -125.911 1.00 43.89  ? 175 LYS A O   1 
ATOM   903  C CB  . LYS A 1 175 ? 69.768  47.421  -123.145 1.00 45.21  ? 175 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 175 ? 69.120  46.257  -122.386 1.00 44.73  ? 175 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 175 ? 68.099  45.470  -123.226 1.00 42.25  ? 175 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 175 ? 68.689  44.222  -123.888 1.00 40.04  ? 175 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 175 ? 69.190  44.460  -125.272 1.00 39.69  ? 175 LYS A NZ  1 
ATOM   908  N N   . LYS A 1 176 ? 72.425  48.704  -124.585 1.00 46.07  ? 176 LYS A N   1 
ATOM   909  C CA  . LYS A 1 176 ? 73.091  49.850  -125.214 1.00 45.34  ? 176 LYS A CA  1 
ATOM   910  C C   . LYS A 1 176 ? 73.641  49.504  -126.605 1.00 45.75  ? 176 LYS A C   1 
ATOM   911  O O   . LYS A 1 176 ? 74.031  50.395  -127.362 1.00 47.03  ? 176 LYS A O   1 
ATOM   912  C CB  . LYS A 1 176 ? 74.220  50.372  -124.312 1.00 44.72  ? 176 LYS A CB  1 
ATOM   913  C CG  . LYS A 1 176 ? 73.741  50.872  -122.952 1.00 43.08  ? 176 LYS A CG  1 
ATOM   914  C CD  . LYS A 1 176 ? 74.880  51.388  -122.088 1.00 43.13  ? 176 LYS A CD  1 
ATOM   915  C CE  . LYS A 1 176 ? 74.357  51.964  -120.776 1.00 42.76  ? 176 LYS A CE  1 
ATOM   916  N NZ  . LYS A 1 176 ? 75.426  52.612  -119.966 1.00 40.07  ? 176 LYS A NZ  1 
ATOM   917  N N   . CYS A 1 177 ? 73.662  48.211  -126.929 1.00 45.27  ? 177 CYS A N   1 
ATOM   918  C CA  . CYS A 1 177 ? 74.148  47.721  -128.215 1.00 43.71  ? 177 CYS A CA  1 
ATOM   919  C C   . CYS A 1 177 ? 73.105  47.883  -129.321 1.00 41.52  ? 177 CYS A C   1 
ATOM   920  O O   . CYS A 1 177 ? 71.921  47.619  -129.110 1.00 39.48  ? 177 CYS A O   1 
ATOM   921  C CB  . CYS A 1 177 ? 74.526  46.245  -128.085 1.00 45.31  ? 177 CYS A CB  1 
ATOM   922  S SG  . CYS A 1 177 ? 75.311  45.556  -129.543 1.00 48.15  ? 177 CYS A SG  1 
ATOM   923  N N   . SER A 1 178 ? 73.559  48.298  -130.503 1.00 40.02  ? 178 SER A N   1 
ATOM   924  C CA  . SER A 1 178 ? 72.661  48.571  -131.626 1.00 38.67  ? 178 SER A CA  1 
ATOM   925  C C   . SER A 1 178 ? 72.281  47.294  -132.373 1.00 38.64  ? 178 SER A C   1 
ATOM   926  O O   . SER A 1 178 ? 72.945  46.265  -132.247 1.00 39.81  ? 178 SER A O   1 
ATOM   927  C CB  . SER A 1 178 ? 73.290  49.585  -132.589 1.00 36.16  ? 178 SER A CB  1 
ATOM   928  O OG  . SER A 1 178 ? 74.496  49.094  -133.142 1.00 35.19  ? 178 SER A OG  1 
ATOM   929  N N   . VAL A 1 179 ? 71.212  47.377  -133.160 1.00 38.14  ? 179 VAL A N   1 
ATOM   930  C CA  . VAL A 1 179 ? 70.667  46.211  -133.857 1.00 35.86  ? 179 VAL A CA  1 
ATOM   931  C C   . VAL A 1 179 ? 71.632  45.708  -134.931 1.00 35.33  ? 179 VAL A C   1 
ATOM   932  O O   . VAL A 1 179 ? 71.896  44.509  -135.020 1.00 34.35  ? 179 VAL A O   1 
ATOM   933  C CB  . VAL A 1 179 ? 69.294  46.518  -134.506 1.00 32.07  ? 179 VAL A CB  1 
ATOM   934  C CG1 . VAL A 1 179 ? 68.698  45.256  -135.115 1.00 28.92  ? 179 VAL A CG1 1 
ATOM   935  C CG2 . VAL A 1 179 ? 68.338  47.108  -133.484 1.00 28.98  ? 179 VAL A CG2 1 
ATOM   936  N N   . GLU A 1 180 ? 72.157  46.632  -135.733 1.00 36.05  ? 180 GLU A N   1 
ATOM   937  C CA  . GLU A 1 180 ? 73.071  46.286  -136.825 1.00 36.27  ? 180 GLU A CA  1 
ATOM   938  C C   . GLU A 1 180 ? 74.397  45.737  -136.299 1.00 34.64  ? 180 GLU A C   1 
ATOM   939  O O   . GLU A 1 180 ? 75.076  44.968  -136.984 1.00 28.35  ? 180 GLU A O   1 
ATOM   940  C CB  . GLU A 1 180 ? 73.318  47.507  -137.715 1.00 37.14  ? 180 GLU A CB  1 
ATOM   941  C CG  . GLU A 1 180 ? 73.983  47.191  -139.053 1.00 39.65  ? 180 GLU A CG  1 
ATOM   942  C CD  . GLU A 1 180 ? 74.218  48.437  -139.899 1.00 40.78  ? 180 GLU A CD  1 
ATOM   943  O OE1 . GLU A 1 180 ? 73.291  49.269  -140.017 1.00 38.97  ? 180 GLU A OE1 1 
ATOM   944  O OE2 . GLU A 1 180 ? 75.332  48.581  -140.450 1.00 40.17  ? 180 GLU A OE2 1 
ATOM   945  N N   . LYS A 1 181 ? 74.760  46.142  -135.083 1.00 35.84  ? 181 LYS A N   1 
ATOM   946  C CA  . LYS A 1 181 ? 75.940  45.612  -134.410 1.00 36.09  ? 181 LYS A CA  1 
ATOM   947  C C   . LYS A 1 181 ? 75.723  44.157  -134.018 1.00 37.03  ? 181 LYS A C   1 
ATOM   948  O O   . LYS A 1 181 ? 76.620  43.334  -134.182 1.00 37.33  ? 181 LYS A O   1 
ATOM   949  C CB  . LYS A 1 181 ? 76.277  46.446  -133.167 1.00 35.56  ? 181 LYS A CB  1 
ATOM   950  C CG  . LYS A 1 181 ? 77.501  45.973  -132.376 1.00 33.53  ? 181 LYS A CG  1 
ATOM   951  C CD  . LYS A 1 181 ? 78.725  45.845  -133.266 1.00 33.68  ? 181 LYS A CD  1 
ATOM   952  C CE  . LYS A 1 181 ? 80.005  45.708  -132.470 1.00 32.64  ? 181 LYS A CE  1 
ATOM   953  N NZ  . LYS A 1 181 ? 81.201  45.927  -133.336 1.00 28.24  ? 181 LYS A NZ  1 
ATOM   954  N N   . LYS A 1 182 ? 74.536  43.844  -133.498 1.00 38.09  ? 182 LYS A N   1 
ATOM   955  C CA  . LYS A 1 182 ? 74.215  42.471  -133.093 1.00 38.93  ? 182 LYS A CA  1 
ATOM   956  C C   . LYS A 1 182 ? 74.224  41.527  -134.290 1.00 36.22  ? 182 LYS A C   1 
ATOM   957  O O   . LYS A 1 182 ? 74.823  40.457  -134.229 1.00 36.94  ? 182 LYS A O   1 
ATOM   958  C CB  . LYS A 1 182 ? 72.870  42.406  -132.355 1.00 40.82  ? 182 LYS A CB  1 
ATOM   959  C CG  . LYS A 1 182 ? 72.919  43.072  -130.982 1.00 45.04  ? 182 LYS A CG  1 
ATOM   960  C CD  . LYS A 1 182 ? 71.590  43.025  -130.230 1.00 45.64  ? 182 LYS A CD  1 
ATOM   961  C CE  . LYS A 1 182 ? 71.600  44.002  -129.048 1.00 47.18  ? 182 LYS A CE  1 
ATOM   962  N NZ  . LYS A 1 182 ? 70.345  43.984  -128.241 1.00 44.96  ? 182 LYS A NZ  1 
ATOM   963  N N   . SER A 1 183 ? 73.588  41.937  -135.383 1.00 34.60  ? 183 SER A N   1 
ATOM   964  C CA  . SER A 1 183 ? 73.595  41.141  -136.608 1.00 36.29  ? 183 SER A CA  1 
ATOM   965  C C   . SER A 1 183 ? 75.000  41.014  -137.208 1.00 36.77  ? 183 SER A C   1 
ATOM   966  O O   . SER A 1 183 ? 75.288  40.037  -137.901 1.00 39.93  ? 183 SER A O   1 
ATOM   967  C CB  . SER A 1 183 ? 72.621  41.715  -137.635 1.00 33.83  ? 183 SER A CB  1 
ATOM   968  O OG  . SER A 1 183 ? 72.940  43.055  -137.930 1.00 39.89  ? 183 SER A OG  1 
ATOM   969  N N   . GLU A 1 184 ? 75.867  41.993  -136.942 1.00 37.84  ? 184 GLU A N   1 
ATOM   970  C CA  . GLU A 1 184 ? 77.287  41.901  -137.315 1.00 37.67  ? 184 GLU A CA  1 
ATOM   971  C C   . GLU A 1 184 ? 77.983  40.793  -136.523 1.00 35.57  ? 184 GLU A C   1 
ATOM   972  O O   . GLU A 1 184 ? 78.806  40.058  -137.068 1.00 34.12  ? 184 GLU A O   1 
ATOM   973  C CB  . GLU A 1 184 ? 78.013  43.239  -137.077 1.00 39.40  ? 184 GLU A CB  1 
ATOM   974  C CG  . GLU A 1 184 ? 79.460  43.300  -137.604 1.00 38.53  ? 184 GLU A CG  1 
ATOM   975  C CD  . GLU A 1 184 ? 80.246  44.503  -137.074 1.00 40.20  ? 184 GLU A CD  1 
ATOM   976  O OE1 . GLU A 1 184 ? 80.662  44.480  -135.893 1.00 38.98  ? 184 GLU A OE1 1 
ATOM   977  O OE2 . GLU A 1 184 ? 80.463  45.465  -137.845 1.00 36.83  ? 184 GLU A OE2 1 
ATOM   978  N N   . MET A 1 185 ? 77.655  40.684  -135.238 1.00 34.13  ? 185 MET A N   1 
ATOM   979  C CA  . MET A 1 185 ? 78.262  39.674  -134.368 1.00 35.64  ? 185 MET A CA  1 
ATOM   980  C C   . MET A 1 185 ? 77.637  38.294  -134.573 1.00 37.38  ? 185 MET A C   1 
ATOM   981  O O   . MET A 1 185 ? 78.318  37.279  -134.426 1.00 36.18  ? 185 MET A O   1 
ATOM   982  C CB  . MET A 1 185 ? 78.145  40.091  -132.903 1.00 34.55  ? 185 MET A CB  1 
ATOM   983  C CG  . MET A 1 185 ? 78.890  41.372  -132.584 1.00 37.90  ? 185 MET A CG  1 
ATOM   984  S SD  . MET A 1 185 ? 78.568  42.002  -130.928 1.00 35.35  ? 185 MET A SD  1 
ATOM   985  C CE  . MET A 1 185 ? 80.078  41.546  -130.102 1.00 44.54  ? 185 MET A CE  1 
ATOM   986  N N   . GLU A 1 186 ? 76.348  38.256  -134.907 1.00 37.17  ? 186 GLU A N   1 
ATOM   987  C CA  . GLU A 1 186 ? 75.680  37.002  -135.250 1.00 36.42  ? 186 GLU A CA  1 
ATOM   988  C C   . GLU A 1 186 ? 76.344  36.357  -136.461 1.00 36.28  ? 186 GLU A C   1 
ATOM   989  O O   . GLU A 1 186 ? 76.541  35.142  -136.494 1.00 37.60  ? 186 GLU A O   1 
ATOM   990  C CB  . GLU A 1 186 ? 74.193  37.229  -135.529 1.00 36.62  ? 186 GLU A CB  1 
ATOM   991  C CG  . GLU A 1 186 ? 73.357  37.438  -134.274 1.00 38.42  ? 186 GLU A CG  1 
ATOM   992  C CD  . GLU A 1 186 ? 71.884  37.678  -134.574 1.00 41.01  ? 186 GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 186 ? 71.569  38.590  -135.372 1.00 44.08  ? 186 GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 186 ? 71.038  36.959  -133.999 1.00 45.82  ? 186 GLU A OE2 1 
ATOM   995  N N   . SER A 1 187 ? 76.693  37.176  -137.450 1.00 36.73  ? 187 SER A N   1 
ATOM   996  C CA  . SER A 1 187 ? 77.398  36.692  -138.638 1.00 37.27  ? 187 SER A CA  1 
ATOM   997  C C   . SER A 1 187 ? 78.835  36.272  -138.320 1.00 36.93  ? 187 SER A C   1 
ATOM   998  O O   . SER A 1 187 ? 79.373  35.371  -138.966 1.00 38.88  ? 187 SER A O   1 
ATOM   999  C CB  . SER A 1 187 ? 77.387  37.748  -139.746 1.00 37.48  ? 187 SER A CB  1 
ATOM   1000 O OG  . SER A 1 187 ? 77.777  39.013  -139.250 1.00 42.63  ? 187 SER A OG  1 
ATOM   1001 N N   . VAL A 1 188 ? 79.452  36.920  -137.332 1.00 34.53  ? 188 VAL A N   1 
ATOM   1002 C CA  . VAL A 1 188 ? 80.780  36.515  -136.874 1.00 33.48  ? 188 VAL A CA  1 
ATOM   1003 C C   . VAL A 1 188 ? 80.722  35.121  -136.259 1.00 34.02  ? 188 VAL A C   1 
ATOM   1004 O O   . VAL A 1 188 ? 81.577  34.285  -136.541 1.00 36.39  ? 188 VAL A O   1 
ATOM   1005 C CB  . VAL A 1 188 ? 81.381  37.492  -135.842 1.00 31.76  ? 188 VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 188 ? 82.660  36.913  -135.255 1.00 27.58  ? 188 VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 188 ? 81.649  38.856  -136.473 1.00 19.82  ? 188 VAL A CG2 1 
ATOM   1008 N N   . LEU A 1 189 ? 79.712  34.877  -135.425 1.00 33.76  ? 189 LEU A N   1 
ATOM   1009 C CA  . LEU A 1 189 ? 79.497  33.550  -134.844 1.00 36.30  ? 189 LEU A CA  1 
ATOM   1010 C C   . LEU A 1 189 ? 79.288  32.484  -135.921 1.00 40.61  ? 189 LEU A C   1 
ATOM   1011 O O   . LEU A 1 189 ? 79.779  31.362  -135.792 1.00 41.24  ? 189 LEU A O   1 
ATOM   1012 C CB  . LEU A 1 189 ? 78.290  33.548  -133.901 1.00 32.83  ? 189 LEU A CB  1 
ATOM   1013 C CG  . LEU A 1 189 ? 78.393  34.381  -132.625 1.00 29.57  ? 189 LEU A CG  1 
ATOM   1014 C CD1 . LEU A 1 189 ? 77.189  34.113  -131.729 1.00 19.18  ? 189 LEU A CD1 1 
ATOM   1015 C CD2 . LEU A 1 189 ? 79.693  34.103  -131.884 1.00 26.83  ? 189 LEU A CD2 1 
ATOM   1016 N N   . ALA A 1 190 ? 78.576  32.846  -136.986 1.00 42.03  ? 190 ALA A N   1 
ATOM   1017 C CA  . ALA A 1 190 ? 78.321  31.929  -138.099 1.00 41.55  ? 190 ALA A CA  1 
ATOM   1018 C C   . ALA A 1 190 ? 79.586  31.515  -138.869 1.00 42.14  ? 190 ALA A C   1 
ATOM   1019 O O   . ALA A 1 190 ? 79.502  30.716  -139.800 1.00 44.44  ? 190 ALA A O   1 
ATOM   1020 C CB  . ALA A 1 190 ? 77.302  32.542  -139.059 1.00 39.29  ? 190 ALA A CB  1 
ATOM   1021 N N   . GLN A 1 191 ? 80.743  32.060  -138.492 1.00 42.40  ? 191 GLN A N   1 
ATOM   1022 C CA  . GLN A 1 191 ? 82.010  31.747  -139.155 1.00 43.06  ? 191 GLN A CA  1 
ATOM   1023 C C   . GLN A 1 191 ? 83.154  31.413  -138.193 1.00 42.47  ? 191 GLN A C   1 
ATOM   1024 O O   . GLN A 1 191 ? 84.296  31.282  -138.631 1.00 42.85  ? 191 GLN A O   1 
ATOM   1025 C CB  . GLN A 1 191 ? 82.442  32.935  -140.014 1.00 43.49  ? 191 GLN A CB  1 
ATOM   1026 C CG  . GLN A 1 191 ? 81.437  33.366  -141.062 1.00 45.62  ? 191 GLN A CG  1 
ATOM   1027 C CD  . GLN A 1 191 ? 81.925  34.556  -141.863 1.00 45.44  ? 191 GLN A CD  1 
ATOM   1028 O OE1 . GLN A 1 191 ? 83.083  34.606  -142.282 1.00 47.51  ? 191 GLN A OE1 1 
ATOM   1029 N NE2 . GLN A 1 191 ? 81.043  35.522  -142.083 1.00 46.58  ? 191 GLN A NE2 1 
ATOM   1030 N N   . LEU A 1 192 ? 82.864  31.276  -136.899 1.00 42.97  ? 192 LEU A N   1 
ATOM   1031 C CA  . LEU A 1 192 ? 83.909  31.030  -135.893 1.00 43.51  ? 192 LEU A CA  1 
ATOM   1032 C C   . LEU A 1 192 ? 84.945  30.008  -136.348 1.00 44.09  ? 192 LEU A C   1 
ATOM   1033 O O   . LEU A 1 192 ? 86.149  30.245  -136.241 1.00 44.27  ? 192 LEU A O   1 
ATOM   1034 C CB  . LEU A 1 192 ? 83.299  30.559  -134.567 1.00 43.52  ? 192 LEU A CB  1 
ATOM   1035 C CG  . LEU A 1 192 ? 83.114  31.623  -133.487 1.00 45.18  ? 192 LEU A CG  1 
ATOM   1036 C CD1 . LEU A 1 192 ? 82.335  31.056  -132.306 1.00 42.37  ? 192 LEU A CD1 1 
ATOM   1037 C CD2 . LEU A 1 192 ? 84.462  32.150  -133.034 1.00 45.09  ? 192 LEU A CD2 1 
ATOM   1038 N N   . ASP A 1 193 ? 84.465  28.881  -136.864 1.00 44.49  ? 193 ASP A N   1 
ATOM   1039 C CA  . ASP A 1 193 ? 85.329  27.751  -137.201 1.00 45.12  ? 193 ASP A CA  1 
ATOM   1040 C C   . ASP A 1 193 ? 86.181  28.013  -138.448 1.00 45.97  ? 193 ASP A C   1 
ATOM   1041 O O   . ASP A 1 193 ? 87.274  27.457  -138.582 1.00 46.72  ? 193 ASP A O   1 
ATOM   1042 C CB  . ASP A 1 193 ? 84.494  26.481  -137.396 1.00 46.34  ? 193 ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 193 ? 83.539  26.218  -136.237 1.00 47.12  ? 193 ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 193 ? 83.806  26.682  -135.107 1.00 44.85  ? 193 ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 193 ? 82.512  25.547  -136.463 1.00 48.35  ? 193 ASP A OD2 1 
ATOM   1046 N N   . ASN A 1 194 ? 85.681  28.856  -139.351 1.00 44.81  ? 194 ASN A N   1 
ATOM   1047 C CA  . ASN A 1 194 ? 86.393  29.177  -140.591 1.00 43.84  ? 194 ASN A CA  1 
ATOM   1048 C C   . ASN A 1 194 ? 87.611  30.071  -140.382 1.00 42.68  ? 194 ASN A C   1 
ATOM   1049 O O   . ASN A 1 194 ? 88.620  29.914  -141.069 1.00 44.33  ? 194 ASN A O   1 
ATOM   1050 C CB  . ASN A 1 194 ? 85.453  29.854  -141.602 1.00 45.44  ? 194 ASN A CB  1 
ATOM   1051 C CG  . ASN A 1 194 ? 84.578  28.865  -142.354 1.00 46.65  ? 194 ASN A CG  1 
ATOM   1052 O OD1 . ASN A 1 194 ? 84.953  27.708  -142.553 1.00 46.68  ? 194 ASN A OD1 1 
ATOM   1053 N ND2 . ASN A 1 194 ? 83.413  29.327  -142.796 1.00 45.87  ? 194 ASN A ND2 1 
ATOM   1054 N N   . TYR A 1 195 ? 87.511  31.009  -139.446 1.00 40.13  ? 195 TYR A N   1 
ATOM   1055 C CA  . TYR A 1 195 ? 88.550  32.018  -139.261 1.00 39.76  ? 195 TYR A CA  1 
ATOM   1056 C C   . TYR A 1 195 ? 89.913  31.390  -139.007 1.00 37.19  ? 195 TYR A C   1 
ATOM   1057 O O   . TYR A 1 195 ? 90.047  30.515  -138.157 1.00 36.06  ? 195 TYR A O   1 
ATOM   1058 C CB  . TYR A 1 195 ? 88.190  32.956  -138.105 1.00 41.72  ? 195 TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 195 ? 86.952  33.792  -138.351 1.00 42.25  ? 195 TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 195 ? 85.894  33.787  -137.447 1.00 42.32  ? 195 TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 195 ? 86.835  34.583  -139.494 1.00 44.15  ? 195 TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 195 ? 84.756  34.551  -137.666 1.00 43.54  ? 195 TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 195 ? 85.699  35.349  -139.724 1.00 44.75  ? 195 TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 195 ? 84.665  35.330  -138.805 1.00 45.98  ? 195 TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 195 ? 83.539  36.084  -139.028 1.00 46.16  ? 195 TYR A OH  1 
ATOM   1066 N N   . GLY A 1 196 ? 90.913  31.824  -139.769 1.00 37.93  ? 196 GLY A N   1 
ATOM   1067 C CA  . GLY A 1 196 ? 92.300  31.426  -139.543 1.00 40.08  ? 196 GLY A CA  1 
ATOM   1068 C C   . GLY A 1 196 ? 92.958  32.214  -138.421 1.00 41.78  ? 196 GLY A C   1 
ATOM   1069 O O   . GLY A 1 196 ? 92.312  33.028  -137.754 1.00 42.80  ? 196 GLY A O   1 
ATOM   1070 N N   . GLN A 1 197 ? 94.254  31.977  -138.228 1.00 41.24  ? 197 GLN A N   1 
ATOM   1071 C CA  . GLN A 1 197 ? 95.018  32.569  -137.125 1.00 40.91  ? 197 GLN A CA  1 
ATOM   1072 C C   . GLN A 1 197 ? 94.975  34.100  -137.152 1.00 42.12  ? 197 GLN A C   1 
ATOM   1073 O O   . GLN A 1 197 ? 94.610  34.739  -136.158 1.00 43.10  ? 197 GLN A O   1 
ATOM   1074 C CB  . GLN A 1 197 ? 96.474  32.076  -137.164 1.00 39.07  ? 197 GLN A CB  1 
ATOM   1075 C CG  . GLN A 1 197 ? 97.287  32.338  -135.891 1.00 40.55  ? 197 GLN A CG  1 
ATOM   1076 C CD  . GLN A 1 197 ? 97.793  33.770  -135.776 1.00 50.11  ? 197 GLN A CD  1 
ATOM   1077 O OE1 . GLN A 1 197 ? 98.302  34.344  -136.741 1.00 58.58  ? 197 GLN A OE1 1 
ATOM   1078 N NE2 . GLN A 1 197 ? 97.658  34.351  -134.588 1.00 51.96  ? 197 GLN A NE2 1 
ATOM   1079 N N   . GLN A 1 198 ? 95.344  34.680  -138.290 1.00 41.90  ? 198 GLN A N   1 
ATOM   1080 C CA  . GLN A 1 198 ? 95.443  36.132  -138.414 1.00 41.78  ? 198 GLN A CA  1 
ATOM   1081 C C   . GLN A 1 198 ? 94.093  36.799  -138.157 1.00 41.42  ? 198 GLN A C   1 
ATOM   1082 O O   . GLN A 1 198 ? 93.974  37.665  -137.283 1.00 39.95  ? 198 GLN A O   1 
ATOM   1083 C CB  . GLN A 1 198 ? 95.978  36.512  -139.802 1.00 42.79  ? 198 GLN A CB  1 
ATOM   1084 C CG  . GLN A 1 198 ? 96.043  38.016  -140.095 1.00 45.22  ? 198 GLN A CG  1 
ATOM   1085 C CD  . GLN A 1 198 ? 96.863  38.798  -139.078 1.00 48.53  ? 198 GLN A CD  1 
ATOM   1086 O OE1 . GLN A 1 198 ? 97.813  38.279  -138.490 1.00 45.39  ? 198 GLN A OE1 1 
ATOM   1087 N NE2 . GLN A 1 198 ? 96.498  40.059  -138.876 1.00 51.90  ? 198 GLN A NE2 1 
ATOM   1088 N N   . GLU A 1 199 ? 93.081  36.385  -138.913 1.00 38.84  ? 199 GLU A N   1 
ATOM   1089 C CA  . GLU A 1 199 ? 91.754  36.993  -138.805 1.00 40.36  ? 199 GLU A CA  1 
ATOM   1090 C C   . GLU A 1 199 ? 91.088  36.745  -137.449 1.00 39.42  ? 199 GLU A C   1 
ATOM   1091 O O   . GLU A 1 199 ? 90.246  37.540  -137.024 1.00 40.67  ? 199 GLU A O   1 
ATOM   1092 C CB  . GLU A 1 199 ? 90.837  36.573  -139.965 1.00 39.98  ? 199 GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 199 ? 90.623  35.081  -140.139 1.00 44.11  ? 199 GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 199 ? 90.107  34.726  -141.526 1.00 44.45  ? 199 GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 199 ? 89.204  35.428  -142.030 1.00 48.73  ? 199 GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 199 ? 90.603  33.737  -142.109 1.00 44.36  ? 199 GLU A OE2 1 
ATOM   1097 N N   . LEU A 1 200 ? 91.467  35.663  -136.769 1.00 38.46  ? 200 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 200 ? 91.011  35.435  -135.396 1.00 38.51  ? 200 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 200 ? 91.758  36.365  -134.441 1.00 38.02  ? 200 LEU A C   1 
ATOM   1100 O O   . LEU A 1 200 ? 91.171  36.893  -133.500 1.00 38.03  ? 200 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 200 ? 91.194  33.973  -134.973 1.00 38.34  ? 200 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 200 ? 90.482  33.561  -133.675 1.00 35.94  ? 200 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 200 ? 88.974  33.456  -133.885 1.00 25.15  ? 200 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 200 ? 91.034  32.250  -133.141 1.00 35.71  ? 200 LEU A CD2 1 
ATOM   1105 N N   . ALA A 1 201 ? 93.050  36.564  -134.687 1.00 39.63  ? 201 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 201 ? 93.833  37.533  -133.919 1.00 40.63  ? 201 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 201 ? 93.236  38.939  -134.026 1.00 40.30  ? 201 ALA A C   1 
ATOM   1108 O O   . ALA A 1 201 ? 93.174  39.666  -133.031 1.00 40.71  ? 201 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 201 ? 95.282  37.536  -134.384 1.00 39.39  ? 201 ALA A CB  1 
ATOM   1110 N N   . ASP A 1 202 ? 92.790  39.303  -135.230 1.00 39.88  ? 202 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 202 ? 92.182  40.617  -135.481 1.00 39.68  ? 202 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 202 ? 90.830  40.747  -134.799 1.00 38.48  ? 202 ASP A C   1 
ATOM   1113 O O   . ASP A 1 202 ? 90.502  41.803  -134.257 1.00 35.12  ? 202 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 202 ? 92.004  40.861  -136.983 1.00 38.60  ? 202 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 202 ? 93.322  40.938  -137.726 1.00 37.19  ? 202 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 202 ? 94.388  40.980  -137.070 1.00 25.01  ? 202 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 202 ? 93.284  40.953  -138.974 1.00 37.46  ? 202 ASP A OD2 1 
ATOM   1118 N N   . LEU A 1 203 ? 90.044  39.675  -134.847 1.00 37.95  ? 203 LEU A N   1 
ATOM   1119 C CA  . LEU A 1 203 ? 88.766  39.621  -134.139 1.00 38.28  ? 203 LEU A CA  1 
ATOM   1120 C C   . LEU A 1 203 ? 88.952  39.880  -132.645 1.00 37.68  ? 203 LEU A C   1 
ATOM   1121 O O   . LEU A 1 203 ? 88.132  40.555  -132.024 1.00 37.82  ? 203 LEU A O   1 
ATOM   1122 C CB  . LEU A 1 203 ? 88.080  38.266  -134.358 1.00 38.00  ? 203 LEU A CB  1 
ATOM   1123 C CG  . LEU A 1 203 ? 87.352  38.114  -135.698 1.00 34.72  ? 203 LEU A CG  1 
ATOM   1124 C CD1 . LEU A 1 203 ? 87.201  36.652  -136.092 1.00 30.07  ? 203 LEU A CD1 1 
ATOM   1125 C CD2 . LEU A 1 203 ? 85.993  38.796  -135.636 1.00 32.06  ? 203 LEU A CD2 1 
ATOM   1126 N N   . PHE A 1 204 ? 90.035  39.356  -132.076 1.00 35.64  ? 204 PHE A N   1 
ATOM   1127 C CA  . PHE A 1 204 ? 90.307  39.547  -130.654 1.00 38.29  ? 204 PHE A CA  1 
ATOM   1128 C C   . PHE A 1 204 ? 90.653  40.994  -130.318 1.00 40.22  ? 204 PHE A C   1 
ATOM   1129 O O   . PHE A 1 204 ? 90.248  41.501  -129.269 1.00 43.04  ? 204 PHE A O   1 
ATOM   1130 C CB  . PHE A 1 204 ? 91.398  38.586  -130.163 1.00 39.11  ? 204 PHE A CB  1 
ATOM   1131 C CG  . PHE A 1 204 ? 90.850  37.332  -129.541 1.00 40.62  ? 204 PHE A CG  1 
ATOM   1132 C CD1 . PHE A 1 204 ? 90.220  36.373  -130.321 1.00 36.42  ? 204 PHE A CD1 1 
ATOM   1133 C CD2 . PHE A 1 204 ? 90.939  37.123  -128.171 1.00 42.62  ? 204 PHE A CD2 1 
ATOM   1134 C CE1 . PHE A 1 204 ? 89.700  35.229  -129.751 1.00 37.80  ? 204 PHE A CE1 1 
ATOM   1135 C CE2 . PHE A 1 204 ? 90.422  35.975  -127.593 1.00 36.52  ? 204 PHE A CE2 1 
ATOM   1136 C CZ  . PHE A 1 204 ? 89.801  35.029  -128.383 1.00 39.48  ? 204 PHE A CZ  1 
ATOM   1137 N N   . VAL A 1 205 ? 91.381  41.660  -131.210 1.00 38.43  ? 205 VAL A N   1 
ATOM   1138 C CA  . VAL A 1 205 ? 91.698  43.078  -131.029 1.00 36.96  ? 205 VAL A CA  1 
ATOM   1139 C C   . VAL A 1 205 ? 90.444  43.930  -131.230 1.00 35.21  ? 205 VAL A C   1 
ATOM   1140 O O   . VAL A 1 205 ? 90.052  44.671  -130.335 1.00 33.64  ? 205 VAL A O   1 
ATOM   1141 C CB  . VAL A 1 205 ? 92.799  43.559  -132.000 1.00 35.41  ? 205 VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 205 ? 93.166  44.999  -131.698 1.00 22.47  ? 205 VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 205 ? 94.032  42.657  -131.914 1.00 33.03  ? 205 VAL A CG2 1 
ATOM   1144 N N   . ASN A 1 206 ? 89.814  43.792  -132.396 1.00 36.23  ? 206 ASN A N   1 
ATOM   1145 C CA  . ASN A 1 206 ? 88.608  44.558  -132.759 1.00 37.33  ? 206 ASN A CA  1 
ATOM   1146 C C   . ASN A 1 206 ? 87.513  44.569  -131.692 1.00 38.47  ? 206 ASN A C   1 
ATOM   1147 O O   . ASN A 1 206 ? 86.888  45.604  -131.448 1.00 37.72  ? 206 ASN A O   1 
ATOM   1148 C CB  . ASN A 1 206 ? 87.997  44.019  -134.061 1.00 36.46  ? 206 ASN A CB  1 
ATOM   1149 C CG  . ASN A 1 206 ? 88.830  44.342  -135.287 1.00 31.64  ? 206 ASN A CG  1 
ATOM   1150 O OD1 . ASN A 1 206 ? 89.335  45.450  -135.436 1.00 18.43  ? 206 ASN A OD1 1 
ATOM   1151 N ND2 . ASN A 1 206 ? 88.964  43.368  -136.182 1.00 39.41  ? 206 ASN A ND2 1 
ATOM   1152 N N   . TYR A 1 207 ? 87.274  43.412  -131.077 1.00 40.01  ? 207 TYR A N   1 
ATOM   1153 C CA  . TYR A 1 207 ? 86.229  43.272  -130.060 1.00 39.41  ? 207 TYR A CA  1 
ATOM   1154 C C   . TYR A 1 207 ? 86.776  43.457  -128.649 1.00 38.91  ? 207 TYR A C   1 
ATOM   1155 O O   . TYR A 1 207 ? 86.020  43.416  -127.682 1.00 38.09  ? 207 TYR A O   1 
ATOM   1156 C CB  . TYR A 1 207 ? 85.510  41.920  -130.207 1.00 38.87  ? 207 TYR A CB  1 
ATOM   1157 C CG  . TYR A 1 207 ? 84.572  41.898  -131.394 1.00 39.38  ? 207 TYR A CG  1 
ATOM   1158 C CD1 . TYR A 1 207 ? 85.011  41.491  -132.649 1.00 43.63  ? 207 TYR A CD1 1 
ATOM   1159 C CD2 . TYR A 1 207 ? 83.255  42.327  -131.272 1.00 37.11  ? 207 TYR A CD2 1 
ATOM   1160 C CE1 . TYR A 1 207 ? 84.161  41.494  -133.745 1.00 41.52  ? 207 TYR A CE1 1 
ATOM   1161 C CE2 . TYR A 1 207 ? 82.399  42.334  -132.363 1.00 37.14  ? 207 TYR A CE2 1 
ATOM   1162 C CZ  . TYR A 1 207 ? 82.858  41.916  -133.596 1.00 39.44  ? 207 TYR A CZ  1 
ATOM   1163 O OH  . TYR A 1 207 ? 82.015  41.917  -134.682 1.00 44.66  ? 207 TYR A OH  1 
ATOM   1164 N N   . ASN A 1 208 ? 88.087  43.664  -128.539 1.00 39.40  ? 208 ASN A N   1 
ATOM   1165 C CA  . ASN A 1 208 ? 88.726  43.949  -127.261 1.00 40.05  ? 208 ASN A CA  1 
ATOM   1166 C C   . ASN A 1 208 ? 88.421  42.870  -126.215 1.00 39.29  ? 208 ASN A C   1 
ATOM   1167 O O   . ASN A 1 208 ? 87.861  43.151  -125.155 1.00 39.47  ? 208 ASN A O   1 
ATOM   1168 C CB  . ASN A 1 208 ? 88.295  45.337  -126.771 1.00 40.72  ? 208 ASN A CB  1 
ATOM   1169 C CG  . ASN A 1 208 ? 89.250  45.924  -125.750 1.00 41.33  ? 208 ASN A CG  1 
ATOM   1170 O OD1 . ASN A 1 208 ? 90.444  45.622  -125.746 1.00 40.85  ? 208 ASN A OD1 1 
ATOM   1171 N ND2 . ASN A 1 208 ? 88.727  46.781  -124.883 1.00 46.47  ? 208 ASN A ND2 1 
ATOM   1172 N N   . VAL A 1 209 ? 88.792  41.633  -126.533 1.00 41.36  ? 209 VAL A N   1 
ATOM   1173 C CA  . VAL A 1 209 ? 88.514  40.485  -125.667 1.00 41.97  ? 209 VAL A CA  1 
ATOM   1174 C C   . VAL A 1 209 ? 89.575  40.364  -124.575 1.00 42.00  ? 209 VAL A C   1 
ATOM   1175 O O   . VAL A 1 209 ? 90.777  40.450  -124.855 1.00 41.26  ? 209 VAL A O   1 
ATOM   1176 C CB  . VAL A 1 209 ? 88.470  39.167  -126.474 1.00 42.93  ? 209 VAL A CB  1 
ATOM   1177 C CG1 . VAL A 1 209 ? 88.220  37.983  -125.555 1.00 39.91  ? 209 VAL A CG1 1 
ATOM   1178 C CG2 . VAL A 1 209 ? 87.401  39.236  -127.560 1.00 39.81  ? 209 VAL A CG2 1 
ATOM   1179 N N   . LYS A 1 210 ? 89.121  40.169  -123.338 1.00 40.80  ? 210 LYS A N   1 
ATOM   1180 C CA  . LYS A 1 210 ? 90.013  40.027  -122.184 1.00 41.70  ? 210 LYS A CA  1 
ATOM   1181 C C   . LYS A 1 210 ? 89.778  38.702  -121.462 1.00 42.91  ? 210 LYS A C   1 
ATOM   1182 O O   . LYS A 1 210 ? 88.867  37.945  -121.809 1.00 42.72  ? 210 LYS A O   1 
ATOM   1183 C CB  . LYS A 1 210 ? 89.810  41.192  -121.212 1.00 40.05  ? 210 LYS A CB  1 
ATOM   1184 C CG  . LYS A 1 210 ? 90.644  42.422  -121.527 1.00 37.48  ? 210 LYS A CG  1 
ATOM   1185 C CD  . LYS A 1 210 ? 90.026  43.279  -122.607 1.00 34.81  ? 210 LYS A CD  1 
ATOM   1186 C CE  . LYS A 1 210 ? 90.814  44.565  -122.782 1.00 38.46  ? 210 LYS A CE  1 
ATOM   1187 N NZ  . LYS A 1 210 ? 92.086  44.344  -123.520 1.00 36.04  ? 210 LYS A NZ  1 
ATOM   1188 N N   . SER A 1 211 ? 90.615  38.423  -120.465 1.00 44.08  ? 211 SER A N   1 
ATOM   1189 C CA  . SER A 1 211 ? 90.446  37.234  -119.632 1.00 43.28  ? 211 SER A CA  1 
ATOM   1190 C C   . SER A 1 211 ? 89.134  37.338  -118.858 1.00 41.81  ? 211 SER A C   1 
ATOM   1191 O O   . SER A 1 211 ? 88.887  38.346  -118.198 1.00 40.77  ? 211 SER A O   1 
ATOM   1192 C CB  . SER A 1 211 ? 91.615  37.078  -118.654 1.00 43.38  ? 211 SER A CB  1 
ATOM   1193 O OG  . SER A 1 211 ? 91.340  36.087  -117.678 1.00 44.15  ? 211 SER A OG  1 
ATOM   1194 N N   . PRO A 1 212 ? 88.288  36.296  -118.933 1.00 41.53  ? 212 PRO A N   1 
ATOM   1195 C CA  . PRO A 1 212 ? 87.006  36.349  -118.234 1.00 41.02  ? 212 PRO A CA  1 
ATOM   1196 C C   . PRO A 1 212 ? 87.158  36.266  -116.712 1.00 39.95  ? 212 PRO A C   1 
ATOM   1197 O O   . PRO A 1 212 ? 86.248  36.667  -115.988 1.00 38.05  ? 212 PRO A O   1 
ATOM   1198 C CB  . PRO A 1 212 ? 86.253  35.130  -118.781 1.00 41.47  ? 212 PRO A CB  1 
ATOM   1199 C CG  . PRO A 1 212 ? 87.308  34.184  -119.208 1.00 40.93  ? 212 PRO A CG  1 
ATOM   1200 C CD  . PRO A 1 212 ? 88.479  35.017  -119.644 1.00 42.33  ? 212 PRO A CD  1 
ATOM   1201 N N   . ILE A 1 213 ? 88.298  35.759  -116.242 1.00 40.56  ? 213 ILE A N   1 
ATOM   1202 C CA  . ILE A 1 213 ? 88.566  35.633  -114.811 1.00 41.42  ? 213 ILE A CA  1 
ATOM   1203 C C   . ILE A 1 213 ? 89.152  36.927  -114.249 1.00 42.71  ? 213 ILE A C   1 
ATOM   1204 O O   . ILE A 1 213 ? 88.544  37.566  -113.390 1.00 44.72  ? 213 ILE A O   1 
ATOM   1205 C CB  . ILE A 1 213 ? 89.535  34.464  -114.519 1.00 41.60  ? 213 ILE A CB  1 
ATOM   1206 C CG1 . ILE A 1 213 ? 88.944  33.144  -115.029 1.00 42.10  ? 213 ILE A CG1 1 
ATOM   1207 C CG2 . ILE A 1 213 ? 89.836  34.378  -113.024 1.00 40.57  ? 213 ILE A CG2 1 
ATOM   1208 C CD1 . ILE A 1 213 ? 89.833  31.939  -114.798 1.00 40.84  ? 213 ILE A CD1 1 
ATOM   1209 N N   . THR A 1 214 ? 90.327  37.309  -114.744 1.00 42.10  ? 214 THR A N   1 
ATOM   1210 C CA  . THR A 1 214 ? 91.058  38.464  -114.218 1.00 39.96  ? 214 THR A CA  1 
ATOM   1211 C C   . THR A 1 214 ? 90.667  39.776  -114.896 1.00 38.66  ? 214 THR A C   1 
ATOM   1212 O O   . THR A 1 214 ? 90.571  40.813  -114.239 1.00 35.48  ? 214 THR A O   1 
ATOM   1213 C CB  . THR A 1 214 ? 92.577  38.270  -114.373 1.00 39.29  ? 214 THR A CB  1 
ATOM   1214 O OG1 . THR A 1 214 ? 92.883  37.968  -115.740 1.00 39.50  ? 214 THR A OG1 1 
ATOM   1215 C CG2 . THR A 1 214 ? 93.060  37.136  -113.487 1.00 37.24  ? 214 THR A CG2 1 
ATOM   1216 N N   . GLY A 1 215 ? 90.442  39.724  -116.206 1.00 39.02  ? 215 GLY A N   1 
ATOM   1217 C CA  . GLY A 1 215 ? 90.177  40.921  -117.002 1.00 38.31  ? 215 GLY A CA  1 
ATOM   1218 C C   . GLY A 1 215 ? 91.423  41.475  -117.675 1.00 38.58  ? 215 GLY A C   1 
ATOM   1219 O O   . GLY A 1 215 ? 91.389  42.576  -118.227 1.00 39.73  ? 215 GLY A O   1 
ATOM   1220 N N   . ASN A 1 216 ? 92.519  40.715  -117.644 1.00 38.31  ? 216 ASN A N   1 
ATOM   1221 C CA  . ASN A 1 216 ? 93.787  41.160  -118.232 1.00 38.90  ? 216 ASN A CA  1 
ATOM   1222 C C   . ASN A 1 216 ? 93.771  41.025  -119.748 1.00 42.54  ? 216 ASN A C   1 
ATOM   1223 O O   . ASN A 1 216 ? 92.862  40.412  -120.323 1.00 43.06  ? 216 ASN A O   1 
ATOM   1224 C CB  . ASN A 1 216 ? 94.971  40.352  -117.689 1.00 37.29  ? 216 ASN A CB  1 
ATOM   1225 C CG  . ASN A 1 216 ? 94.979  40.248  -116.175 1.00 38.35  ? 216 ASN A CG  1 
ATOM   1226 O OD1 . ASN A 1 216 ? 95.570  39.325  -115.615 1.00 40.04  ? 216 ASN A OD1 1 
ATOM   1227 N ND2 . ASN A 1 216 ? 94.319  41.185  -115.505 1.00 41.49  ? 216 ASN A ND2 1 
ATOM   1228 N N   . ASP A 1 217 ? 94.790  41.592  -120.390 1.00 44.33  ? 217 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 217 ? 94.959  41.451  -121.834 1.00 42.57  ? 217 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 217 ? 95.286  40.008  -122.169 1.00 42.79  ? 217 ASP A C   1 
ATOM   1231 O O   . ASP A 1 217 ? 95.916  39.308  -121.379 1.00 43.03  ? 217 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 217 ? 96.080  42.353  -122.356 1.00 42.10  ? 217 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 217 ? 95.732  43.822  -122.286 1.00 35.53  ? 217 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 217 ? 94.536  44.172  -122.391 1.00 27.06  ? 217 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 217 ? 96.666  44.632  -122.137 1.00 38.29  ? 217 ASP A OD2 1 
ATOM   1236 N N   . LEU A 1 218 ? 94.855  39.576  -123.348 1.00 44.89  ? 218 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 218 ? 95.101  38.219  -123.816 1.00 44.31  ? 218 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 218 ? 96.173  38.222  -124.894 1.00 45.32  ? 218 LEU A C   1 
ATOM   1239 O O   . LEU A 1 218 ? 96.276  39.171  -125.673 1.00 46.37  ? 218 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 218 ? 93.809  37.617  -124.364 1.00 42.81  ? 218 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 218 ? 92.744  37.310  -123.308 1.00 40.66  ? 218 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 218 ? 91.399  37.028  -123.961 1.00 32.64  ? 218 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 218 ? 93.182  36.149  -122.422 1.00 35.05  ? 218 LEU A CD2 1 
ATOM   1244 N N   . SER A 1 219 ? 96.973  37.161  -124.929 1.00 45.79  ? 219 SER A N   1 
ATOM   1245 C CA  . SER A 1 219 ? 97.978  36.986  -125.974 1.00 44.41  ? 219 SER A CA  1 
ATOM   1246 C C   . SER A 1 219 ? 97.287  36.686  -127.303 1.00 43.73  ? 219 SER A C   1 
ATOM   1247 O O   . SER A 1 219 ? 96.110  36.313  -127.316 1.00 43.49  ? 219 SER A O   1 
ATOM   1248 C CB  . SER A 1 219 ? 98.926  35.842  -125.609 1.00 45.56  ? 219 SER A CB  1 
ATOM   1249 O OG  . SER A 1 219 ? 98.209  34.644  -125.351 1.00 43.33  ? 219 SER A OG  1 
ATOM   1250 N N   . PRO A 1 220 ? 98.006  36.854  -128.428 1.00 43.05  ? 220 PRO A N   1 
ATOM   1251 C CA  . PRO A 1 220 ? 97.400  36.515  -129.714 1.00 43.47  ? 220 PRO A CA  1 
ATOM   1252 C C   . PRO A 1 220 ? 97.127  35.008  -129.836 1.00 44.44  ? 220 PRO A C   1 
ATOM   1253 O O   . PRO A 1 220 ? 97.905  34.203  -129.312 1.00 41.50  ? 220 PRO A O   1 
ATOM   1254 C CB  . PRO A 1 220 ? 98.456  36.954  -130.739 1.00 39.69  ? 220 PRO A CB  1 
ATOM   1255 C CG  . PRO A 1 220 ? 99.390  37.833  -130.003 1.00 43.37  ? 220 PRO A CG  1 
ATOM   1256 C CD  . PRO A 1 220 ? 99.378  37.357  -128.591 1.00 44.17  ? 220 PRO A CD  1 
ATOM   1257 N N   . PRO A 1 221 ? 96.032  34.626  -130.522 1.00 45.12  ? 221 PRO A N   1 
ATOM   1258 C CA  . PRO A 1 221 ? 95.717  33.209  -130.694 1.00 46.59  ? 221 PRO A CA  1 
ATOM   1259 C C   . PRO A 1 221 ? 96.871  32.430  -131.319 1.00 47.16  ? 221 PRO A C   1 
ATOM   1260 O O   . PRO A 1 221 ? 97.502  32.907  -132.263 1.00 44.55  ? 221 PRO A O   1 
ATOM   1261 C CB  . PRO A 1 221 ? 94.514  33.221  -131.644 1.00 48.77  ? 221 PRO A CB  1 
ATOM   1262 C CG  . PRO A 1 221 ? 93.920  34.573  -131.506 1.00 50.35  ? 221 PRO A CG  1 
ATOM   1263 C CD  . PRO A 1 221 ? 95.043  35.497  -131.183 1.00 47.00  ? 221 PRO A CD  1 
ATOM   1264 N N   . VAL A 1 222 ? 97.146  31.248  -130.773 1.00 48.55  ? 222 VAL A N   1 
ATOM   1265 C CA  . VAL A 1 222 ? 98.194  30.372  -131.289 1.00 46.47  ? 222 VAL A CA  1 
ATOM   1266 C C   . VAL A 1 222 ? 97.647  28.957  -131.381 1.00 45.58  ? 222 VAL A C   1 
ATOM   1267 O O   . VAL A 1 222 ? 96.803  28.557  -130.582 1.00 45.55  ? 222 VAL A O   1 
ATOM   1268 C CB  . VAL A 1 222 ? 99.467  30.394  -130.400 1.00 47.45  ? 222 VAL A CB  1 
ATOM   1269 C CG1 . VAL A 1 222 ? 100.185 31.737  -130.519 1.00 44.63  ? 222 VAL A CG1 1 
ATOM   1270 C CG2 . VAL A 1 222 ? 99.123  30.097  -128.945 1.00 50.79  ? 222 VAL A CG2 1 
ATOM   1271 N N   . SER A 1 223 ? 98.125  28.210  -132.370 1.00 45.59  ? 223 SER A N   1 
ATOM   1272 C CA  . SER A 1 223 ? 97.670  26.845  -132.595 1.00 39.63  ? 223 SER A CA  1 
ATOM   1273 C C   . SER A 1 223 ? 98.284  25.943  -131.542 1.00 37.66  ? 223 SER A C   1 
ATOM   1274 O O   . SER A 1 223 ? 99.505  25.872  -131.427 1.00 38.33  ? 223 SER A O   1 
ATOM   1275 C CB  . SER A 1 223 ? 98.081  26.375  -133.989 1.00 39.08  ? 223 SER A CB  1 
ATOM   1276 O OG  . SER A 1 223 ? 97.485  25.135  -134.309 1.00 43.82  ? 223 SER A OG  1 
ATOM   1277 N N   . PHE A 1 224 ? 97.432  25.280  -130.763 1.00 34.98  ? 224 PHE A N   1 
ATOM   1278 C CA  . PHE A 1 224 ? 97.868  24.325  -129.752 1.00 32.09  ? 224 PHE A CA  1 
ATOM   1279 C C   . PHE A 1 224 ? 97.421  22.929  -130.177 1.00 32.39  ? 224 PHE A C   1 
ATOM   1280 O O   . PHE A 1 224 ? 96.226  22.634  -130.199 1.00 34.60  ? 224 PHE A O   1 
ATOM   1281 C CB  . PHE A 1 224 ? 97.276  24.691  -128.386 1.00 29.72  ? 224 PHE A CB  1 
ATOM   1282 C CG  . PHE A 1 224 ? 97.520  23.661  -127.319 1.00 30.61  ? 224 PHE A CG  1 
ATOM   1283 C CD1 . PHE A 1 224 ? 98.721  23.632  -126.622 1.00 31.17  ? 224 PHE A CD1 1 
ATOM   1284 C CD2 . PHE A 1 224 ? 96.545  22.718  -127.007 1.00 30.59  ? 224 PHE A CD2 1 
ATOM   1285 C CE1 . PHE A 1 224 ? 98.951  22.674  -125.632 1.00 30.16  ? 224 PHE A CE1 1 
ATOM   1286 C CE2 . PHE A 1 224 ? 96.762  21.764  -126.020 1.00 29.87  ? 224 PHE A CE2 1 
ATOM   1287 C CZ  . PHE A 1 224 ? 97.971  21.741  -125.329 1.00 27.77  ? 224 PHE A CZ  1 
ATOM   1288 N N   . ASN A 1 225 ? 98.382  22.080  -130.529 1.00 31.18  ? 225 ASN A N   1 
ATOM   1289 C CA  . ASN A 1 225 ? 98.088  20.719  -130.961 1.00 27.74  ? 225 ASN A CA  1 
ATOM   1290 C C   . ASN A 1 225 ? 97.541  19.918  -129.788 1.00 28.43  ? 225 ASN A C   1 
ATOM   1291 O O   . ASN A 1 225 ? 98.015  20.061  -128.662 1.00 25.26  ? 225 ASN A O   1 
ATOM   1292 C CB  . ASN A 1 225 ? 99.346  20.057  -131.521 1.00 24.35  ? 225 ASN A CB  1 
ATOM   1293 C CG  . ASN A 1 225 ? 99.065  18.712  -132.145 1.00 27.49  ? 225 ASN A CG  1 
ATOM   1294 O OD1 . ASN A 1 225 ? 99.220  17.675  -131.503 1.00 30.10  ? 225 ASN A OD1 1 
ATOM   1295 N ND2 . ASN A 1 225 ? 98.638  18.720  -133.398 1.00 22.00  ? 225 ASN A ND2 1 
ATOM   1296 N N   . LEU A 1 226 ? 96.546  19.077  -130.059 1.00 28.42  ? 226 LEU A N   1 
ATOM   1297 C CA  . LEU A 1 226 ? 95.788  18.410  -129.004 1.00 29.63  ? 226 LEU A CA  1 
ATOM   1298 C C   . LEU A 1 226 ? 96.300  17.011  -128.684 1.00 31.80  ? 226 LEU A C   1 
ATOM   1299 O O   . LEU A 1 226 ? 95.744  16.336  -127.810 1.00 34.59  ? 226 LEU A O   1 
ATOM   1300 C CB  . LEU A 1 226 ? 94.297  18.352  -129.378 1.00 30.74  ? 226 LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 226 ? 93.610  19.719  -129.495 1.00 32.52  ? 226 LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 226 ? 92.233  19.590  -130.129 1.00 30.31  ? 226 LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 226 ? 93.521  20.401  -128.128 1.00 26.42  ? 226 LEU A CD2 1 
ATOM   1304 N N   . MET A 1 227 ? 97.350  16.569  -129.371 1.00 28.05  ? 227 MET A N   1 
ATOM   1305 C CA  . MET A 1 227 ? 97.903  15.239  -129.120 1.00 28.90  ? 227 MET A CA  1 
ATOM   1306 C C   . MET A 1 227 ? 98.870  15.268  -127.940 1.00 29.19  ? 227 MET A C   1 
ATOM   1307 O O   . MET A 1 227 ? 99.659  16.199  -127.796 1.00 29.76  ? 227 MET A O   1 
ATOM   1308 C CB  . MET A 1 227 ? 98.610  14.704  -130.364 1.00 27.28  ? 227 MET A CB  1 
ATOM   1309 C CG  . MET A 1 227 ? 97.703  14.623  -131.589 1.00 30.02  ? 227 MET A CG  1 
ATOM   1310 S SD  . MET A 1 227 ? 98.418  13.677  -132.951 1.00 35.89  ? 227 MET A SD  1 
ATOM   1311 C CE  . MET A 1 227 ? 99.865  14.670  -133.315 1.00 29.69  ? 227 MET A CE  1 
ATOM   1312 N N   . PHE A 1 228 ? 98.784  14.253  -127.085 1.00 34.78  ? 228 PHE A N   1 
ATOM   1313 C CA  . PHE A 1 228 ? 99.770  14.046  -126.023 1.00 33.86  ? 228 PHE A CA  1 
ATOM   1314 C C   . PHE A 1 228 ? 101.082 13.588  -126.643 1.00 34.21  ? 228 PHE A C   1 
ATOM   1315 O O   . PHE A 1 228 ? 101.100 12.630  -127.414 1.00 32.74  ? 228 PHE A O   1 
ATOM   1316 C CB  . PHE A 1 228 ? 99.283  12.984  -125.037 1.00 34.76  ? 228 PHE A CB  1 
ATOM   1317 C CG  . PHE A 1 228 ? 98.154  13.440  -124.168 1.00 34.66  ? 228 PHE A CG  1 
ATOM   1318 C CD1 . PHE A 1 228 ? 98.406  14.102  -122.979 1.00 36.40  ? 228 PHE A CD1 1 
ATOM   1319 C CD2 . PHE A 1 228 ? 96.835  13.210  -124.538 1.00 45.01  ? 228 PHE A CD2 1 
ATOM   1320 C CE1 . PHE A 1 228 ? 97.363  14.525  -122.173 1.00 41.10  ? 228 PHE A CE1 1 
ATOM   1321 C CE2 . PHE A 1 228 ? 95.782  13.629  -123.734 1.00 37.82  ? 228 PHE A CE2 1 
ATOM   1322 C CZ  . PHE A 1 228 ? 96.046  14.284  -122.551 1.00 38.80  ? 228 PHE A CZ  1 
ATOM   1323 N N   . LYS A 1 229 ? 102.176 14.262  -126.306 1.00 36.90  ? 229 LYS A N   1 
ATOM   1324 C CA  . LYS A 1 229 ? 103.485 13.908  -126.849 1.00 38.25  ? 229 LYS A CA  1 
ATOM   1325 C C   . LYS A 1 229 ? 104.282 13.071  -125.856 1.00 34.97  ? 229 LYS A C   1 
ATOM   1326 O O   . LYS A 1 229 ? 104.148 13.248  -124.645 1.00 33.59  ? 229 LYS A O   1 
ATOM   1327 C CB  . LYS A 1 229 ? 104.265 15.169  -127.224 1.00 41.26  ? 229 LYS A CB  1 
ATOM   1328 C CG  . LYS A 1 229 ? 105.422 14.895  -128.163 1.00 45.35  ? 229 LYS A CG  1 
ATOM   1329 C CD  . LYS A 1 229 ? 105.991 16.173  -128.754 1.00 50.90  ? 229 LYS A CD  1 
ATOM   1330 C CE  . LYS A 1 229 ? 107.204 15.878  -129.638 1.00 61.19  ? 229 LYS A CE  1 
ATOM   1331 N NZ  . LYS A 1 229 ? 106.892 14.887  -130.715 1.00 70.52  ? 229 LYS A NZ  1 
ATOM   1332 N N   . THR A 1 230 ? 105.073 12.131  -126.381 1.00 38.30  ? 230 THR A N   1 
ATOM   1333 C CA  . THR A 1 230 ? 106.034 11.342  -125.585 1.00 40.26  ? 230 THR A CA  1 
ATOM   1334 C C   . THR A 1 230 ? 107.228 10.961  -126.452 1.00 37.43  ? 230 THR A C   1 
ATOM   1335 O O   . THR A 1 230 ? 107.334 11.389  -127.598 1.00 37.81  ? 230 THR A O   1 
ATOM   1336 C CB  . THR A 1 230 ? 105.430 10.024  -125.012 1.00 42.47  ? 230 THR A CB  1 
ATOM   1337 O OG1 . THR A 1 230 ? 105.449 9.000   -126.010 1.00 49.57  ? 230 THR A OG1 1 
ATOM   1338 C CG2 . THR A 1 230 ? 104.020 10.215  -124.575 1.00 52.86  ? 230 THR A CG2 1 
ATOM   1339 N N   . PHE A 1 231 ? 108.119 10.148  -125.896 1.00 38.03  ? 231 PHE A N   1 
ATOM   1340 C CA  . PHE A 1 231 ? 109.264 9.636   -126.631 1.00 34.69  ? 231 PHE A CA  1 
ATOM   1341 C C   . PHE A 1 231 ? 109.338 8.131   -126.501 1.00 32.39  ? 231 PHE A C   1 
ATOM   1342 O O   . PHE A 1 231 ? 109.335 7.604   -125.390 1.00 40.30  ? 231 PHE A O   1 
ATOM   1343 C CB  . PHE A 1 231 ? 110.539 10.254  -126.095 1.00 31.90  ? 231 PHE A CB  1 
ATOM   1344 C CG  . PHE A 1 231 ? 110.697 11.693  -126.447 1.00 33.13  ? 231 PHE A CG  1 
ATOM   1345 C CD1 . PHE A 1 231 ? 110.147 12.677  -125.644 1.00 35.00  ? 231 PHE A CD1 1 
ATOM   1346 C CD2 . PHE A 1 231 ? 111.403 12.066  -127.584 1.00 34.44  ? 231 PHE A CD2 1 
ATOM   1347 C CE1 . PHE A 1 231 ? 110.302 14.016  -125.965 1.00 37.58  ? 231 PHE A CE1 1 
ATOM   1348 C CE2 . PHE A 1 231 ? 111.562 13.399  -127.914 1.00 29.87  ? 231 PHE A CE2 1 
ATOM   1349 C CZ  . PHE A 1 231 ? 111.013 14.377  -127.106 1.00 32.98  ? 231 PHE A CZ  1 
ATOM   1350 N N   . ILE A 1 232 ? 109.400 7.445   -127.638 1.00 30.90  ? 232 ILE A N   1 
ATOM   1351 C CA  . ILE A 1 232 ? 109.488 5.992   -127.656 1.00 31.25  ? 232 ILE A CA  1 
ATOM   1352 C C   . ILE A 1 232 ? 110.952 5.598   -127.627 1.00 28.74  ? 232 ILE A C   1 
ATOM   1353 O O   . ILE A 1 232 ? 111.751 6.115   -128.395 1.00 35.36  ? 232 ILE A O   1 
ATOM   1354 C CB  . ILE A 1 232 ? 108.800 5.396   -128.888 1.00 30.24  ? 232 ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 232 ? 107.323 5.814   -128.922 1.00 27.41  ? 232 ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 232 ? 108.920 3.875   -128.874 1.00 30.91  ? 232 ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 232 ? 106.721 5.835   -130.304 1.00 25.90  ? 232 ILE A CD1 1 
ATOM   1358 N N   . GLY A 1 233 ? 111.300 4.695   -126.720 1.00 31.73  ? 233 GLY A N   1 
ATOM   1359 C CA  . GLY A 1 233 ? 112.684 4.289   -126.523 1.00 35.40  ? 233 GLY A CA  1 
ATOM   1360 C C   . GLY A 1 233 ? 113.499 5.340   -125.789 1.00 36.84  ? 233 GLY A C   1 
ATOM   1361 O O   . GLY A 1 233 ? 112.974 6.392   -125.423 1.00 36.19  ? 233 GLY A O   1 
ATOM   1362 N N   . PRO A 1 234 ? 114.794 5.056   -125.565 1.00 39.78  ? 234 PRO A N   1 
ATOM   1363 C CA  . PRO A 1 234 ? 115.707 5.988   -124.911 1.00 40.28  ? 234 PRO A CA  1 
ATOM   1364 C C   . PRO A 1 234 ? 116.282 7.015   -125.881 1.00 41.40  ? 234 PRO A C   1 
ATOM   1365 O O   . PRO A 1 234 ? 116.130 6.882   -127.095 1.00 41.47  ? 234 PRO A O   1 
ATOM   1366 C CB  . PRO A 1 234 ? 116.814 5.072   -124.390 1.00 39.71  ? 234 PRO A CB  1 
ATOM   1367 C CG  . PRO A 1 234 ? 116.869 3.958   -125.382 1.00 38.86  ? 234 PRO A CG  1 
ATOM   1368 C CD  . PRO A 1 234 ? 115.470 3.796   -125.931 1.00 41.42  ? 234 PRO A CD  1 
ATOM   1369 N N   . GLY A 1 235 ? 116.958 8.021   -125.339 1.00 45.30  ? 235 GLY A N   1 
ATOM   1370 C CA  . GLY A 1 235 ? 117.436 9.144   -126.139 1.00 45.93  ? 235 GLY A CA  1 
ATOM   1371 C C   . GLY A 1 235 ? 116.276 10.072  -126.446 1.00 48.46  ? 235 GLY A C   1 
ATOM   1372 O O   . GLY A 1 235 ? 115.438 10.341  -125.581 1.00 53.71  ? 235 GLY A O   1 
ATOM   1373 N N   . GLY A 1 236 ? 116.215 10.562  -127.677 1.00 46.43  ? 236 GLY A N   1 
ATOM   1374 C CA  . GLY A 1 236 ? 115.118 11.436  -128.086 1.00 44.05  ? 236 GLY A CA  1 
ATOM   1375 C C   . GLY A 1 236 ? 114.982 11.526  -129.587 1.00 40.16  ? 236 GLY A C   1 
ATOM   1376 O O   . GLY A 1 236 ? 114.688 12.590  -130.124 1.00 39.88  ? 236 GLY A O   1 
ATOM   1377 N N   . ASN A 1 237 ? 115.176 10.396  -130.256 1.00 37.45  ? 237 ASN A N   1 
ATOM   1378 C CA  . ASN A 1 237 ? 115.177 10.339  -131.713 1.00 41.08  ? 237 ASN A CA  1 
ATOM   1379 C C   . ASN A 1 237 ? 113.867 9.809   -132.289 1.00 38.67  ? 237 ASN A C   1 
ATOM   1380 O O   . ASN A 1 237 ? 113.579 10.025  -133.460 1.00 39.83  ? 237 ASN A O   1 
ATOM   1381 C CB  . ASN A 1 237 ? 116.360 9.498   -132.208 1.00 46.12  ? 237 ASN A CB  1 
ATOM   1382 C CG  . ASN A 1 237 ? 116.453 8.145   -131.510 1.00 53.74  ? 237 ASN A CG  1 
ATOM   1383 O OD1 . ASN A 1 237 ? 115.498 7.365   -131.508 1.00 47.08  ? 237 ASN A OD1 1 
ATOM   1384 N ND2 . ASN A 1 237 ? 117.609 7.866   -130.911 1.00 61.75  ? 237 ASN A ND2 1 
ATOM   1385 N N   . MET A 1 238 ? 113.082 9.110   -131.472 1.00 39.60  ? 238 MET A N   1 
ATOM   1386 C CA  . MET A 1 238 ? 111.754 8.663   -131.876 1.00 38.42  ? 238 MET A CA  1 
ATOM   1387 C C   . MET A 1 238 ? 110.680 9.370   -131.051 1.00 35.48  ? 238 MET A C   1 
ATOM   1388 O O   . MET A 1 238 ? 110.149 8.808   -130.095 1.00 26.90  ? 238 MET A O   1 
ATOM   1389 C CB  . MET A 1 238 ? 111.619 7.143   -131.748 1.00 39.16  ? 238 MET A CB  1 
ATOM   1390 C CG  . MET A 1 238 ? 110.259 6.617   -132.214 1.00 42.07  ? 238 MET A CG  1 
ATOM   1391 S SD  . MET A 1 238 ? 110.262 4.873   -132.642 1.00 44.55  ? 238 MET A SD  1 
ATOM   1392 C CE  . MET A 1 238 ? 111.061 4.920   -134.243 1.00 41.63  ? 238 MET A CE  1 
ATOM   1393 N N   . PRO A 1 239 ? 110.356 10.619  -131.420 1.00 36.70  ? 239 PRO A N   1 
ATOM   1394 C CA  . PRO A 1 239 ? 109.216 11.266  -130.790 1.00 35.63  ? 239 PRO A CA  1 
ATOM   1395 C C   . PRO A 1 239 ? 107.939 10.618  -131.281 1.00 34.30  ? 239 PRO A C   1 
ATOM   1396 O O   . PRO A 1 239 ? 107.899 10.125  -132.410 1.00 36.04  ? 239 PRO A O   1 
ATOM   1397 C CB  . PRO A 1 239 ? 109.304 12.703  -131.299 1.00 35.23  ? 239 PRO A CB  1 
ATOM   1398 C CG  . PRO A 1 239 ? 110.006 12.595  -132.592 1.00 36.99  ? 239 PRO A CG  1 
ATOM   1399 C CD  . PRO A 1 239 ? 110.993 11.487  -132.424 1.00 33.81  ? 239 PRO A CD  1 
ATOM   1400 N N   . GLY A 1 240 ? 106.913 10.619  -130.438 1.00 33.19  ? 240 GLY A N   1 
ATOM   1401 C CA  . GLY A 1 240 ? 105.625 10.040  -130.790 1.00 31.59  ? 240 GLY A CA  1 
ATOM   1402 C C   . GLY A 1 240 ? 104.470 10.655  -130.026 1.00 31.10  ? 240 GLY A C   1 
ATOM   1403 O O   . GLY A 1 240 ? 104.633 11.634  -129.300 1.00 30.28  ? 240 GLY A O   1 
ATOM   1404 N N   . TYR A 1 241 ? 103.293 10.068  -130.204 1.00 32.94  ? 241 TYR A N   1 
ATOM   1405 C CA  . TYR A 1 241 ? 102.073 10.569  -129.602 1.00 33.56  ? 241 TYR A CA  1 
ATOM   1406 C C   . TYR A 1 241 ? 101.199 9.412   -129.167 1.00 35.80  ? 241 TYR A C   1 
ATOM   1407 O O   . TYR A 1 241 ? 101.376 8.282   -129.625 1.00 38.47  ? 241 TYR A O   1 
ATOM   1408 C CB  . TYR A 1 241 ? 101.291 11.411  -130.610 1.00 35.29  ? 241 TYR A CB  1 
ATOM   1409 C CG  . TYR A 1 241 ? 102.082 12.547  -131.194 1.00 36.61  ? 241 TYR A CG  1 
ATOM   1410 C CD1 . TYR A 1 241 ? 102.175 13.767  -130.532 1.00 39.82  ? 241 TYR A CD1 1 
ATOM   1411 C CD2 . TYR A 1 241 ? 102.756 12.400  -132.399 1.00 37.64  ? 241 TYR A CD2 1 
ATOM   1412 C CE1 . TYR A 1 241 ? 102.918 14.815  -131.057 1.00 38.17  ? 241 TYR A CE1 1 
ATOM   1413 C CE2 . TYR A 1 241 ? 103.500 13.445  -132.936 1.00 38.44  ? 241 TYR A CE2 1 
ATOM   1414 C CZ  . TYR A 1 241 ? 103.575 14.649  -132.260 1.00 37.99  ? 241 TYR A CZ  1 
ATOM   1415 O OH  . TYR A 1 241 ? 104.304 15.689  -132.785 1.00 42.59  ? 241 TYR A OH  1 
ATOM   1416 N N   . LEU A 1 242 ? 100.261 9.705   -128.274 1.00 35.35  ? 242 LEU A N   1 
ATOM   1417 C CA  . LEU A 1 242 ? 99.149  8.810   -128.012 1.00 37.13  ? 242 LEU A CA  1 
ATOM   1418 C C   . LEU A 1 242 ? 98.141  9.055   -129.125 1.00 36.77  ? 242 LEU A C   1 
ATOM   1419 O O   . LEU A 1 242 ? 97.833  10.208  -129.444 1.00 40.50  ? 242 LEU A O   1 
ATOM   1420 C CB  . LEU A 1 242 ? 98.525  9.108   -126.650 1.00 40.94  ? 242 LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 242 ? 99.452  8.971   -125.440 1.00 44.85  ? 242 LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 242 ? 98.796  9.554   -124.197 1.00 43.25  ? 242 LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 242 ? 99.806  7.514   -125.233 1.00 52.70  ? 242 LEU A CD2 1 
ATOM   1424 N N   . ARG A 1 243 ? 97.639  7.986   -129.731 1.00 34.86  ? 243 ARG A N   1 
ATOM   1425 C CA  . ARG A 1 243 ? 96.763  8.122   -130.893 1.00 35.20  ? 243 ARG A CA  1 
ATOM   1426 C C   . ARG A 1 243 ? 95.530  8.967   -130.546 1.00 34.05  ? 243 ARG A C   1 
ATOM   1427 O O   . ARG A 1 243 ? 94.937  8.781   -129.486 1.00 30.76  ? 243 ARG A O   1 
ATOM   1428 C CB  . ARG A 1 243 ? 96.346  6.745   -131.425 1.00 32.63  ? 243 ARG A CB  1 
ATOM   1429 C CG  . ARG A 1 243 ? 95.411  5.977   -130.522 1.00 33.24  ? 243 ARG A CG  1 
ATOM   1430 C CD  . ARG A 1 243 ? 95.178  4.574   -131.017 1.00 35.46  ? 243 ARG A CD  1 
ATOM   1431 N NE  . ARG A 1 243 ? 94.229  3.866   -130.155 1.00 41.28  ? 243 ARG A NE  1 
ATOM   1432 C CZ  . ARG A 1 243 ? 94.008  2.553   -130.198 1.00 40.79  ? 243 ARG A CZ  1 
ATOM   1433 N NH1 . ARG A 1 243 ? 94.646  1.782   -131.068 1.00 46.47  ? 243 ARG A NH1 1 
ATOM   1434 N NH2 . ARG A 1 243 ? 93.122  2.006   -129.379 1.00 44.79  ? 243 ARG A NH2 1 
ATOM   1435 N N   . PRO A 1 244 ? 95.161  9.917   -131.423 1.00 34.99  ? 244 PRO A N   1 
ATOM   1436 C CA  . PRO A 1 244 ? 93.916  10.670  -131.264 1.00 36.47  ? 244 PRO A CA  1 
ATOM   1437 C C   . PRO A 1 244 ? 92.675  9.966   -131.832 1.00 39.69  ? 244 PRO A C   1 
ATOM   1438 O O   . PRO A 1 244 ? 91.561  10.435  -131.602 1.00 40.86  ? 244 PRO A O   1 
ATOM   1439 C CB  . PRO A 1 244 ? 94.192  11.954  -132.039 1.00 36.63  ? 244 PRO A CB  1 
ATOM   1440 C CG  . PRO A 1 244 ? 95.134  11.548  -133.120 1.00 39.34  ? 244 PRO A CG  1 
ATOM   1441 C CD  . PRO A 1 244 ? 95.913  10.354  -132.612 1.00 39.59  ? 244 PRO A CD  1 
ATOM   1442 N N   . GLU A 1 245 ? 92.874  8.867   -132.565 1.00 41.86  ? 245 GLU A N   1 
ATOM   1443 C CA  . GLU A 1 245 ? 91.788  8.075   -133.162 1.00 41.19  ? 245 GLU A CA  1 
ATOM   1444 C C   . GLU A 1 245 ? 92.324  6.677   -133.477 1.00 39.46  ? 245 GLU A C   1 
ATOM   1445 O O   . GLU A 1 245 ? 93.537  6.475   -133.508 1.00 44.22  ? 245 GLU A O   1 
ATOM   1446 C CB  . GLU A 1 245 ? 91.292  8.734   -134.455 1.00 40.89  ? 245 GLU A CB  1 
ATOM   1447 C CG  . GLU A 1 245 ? 92.326  8.694   -135.589 1.00 50.93  ? 245 GLU A CG  1 
ATOM   1448 C CD  . GLU A 1 245 ? 91.911  9.465   -136.833 1.00 57.60  ? 245 GLU A CD  1 
ATOM   1449 O OE1 . GLU A 1 245 ? 91.386  10.594  -136.712 1.00 68.59  ? 245 GLU A OE1 1 
ATOM   1450 O OE2 . GLU A 1 245 ? 92.138  8.942   -137.944 1.00 70.60  ? 245 GLU A OE2 1 
ATOM   1451 N N   . THR A 1 246 ? 91.437  5.722   -133.743 1.00 38.08  ? 246 THR A N   1 
ATOM   1452 C CA  . THR A 1 246 ? 91.860  4.366   -134.108 1.00 38.46  ? 246 THR A CA  1 
ATOM   1453 C C   . THR A 1 246 ? 91.834  4.077   -135.614 1.00 39.82  ? 246 THR A C   1 
ATOM   1454 O O   . THR A 1 246 ? 92.344  3.044   -136.046 1.00 46.58  ? 246 THR A O   1 
ATOM   1455 C CB  . THR A 1 246 ? 91.009  3.287   -133.413 1.00 38.37  ? 246 THR A CB  1 
ATOM   1456 O OG1 . THR A 1 246 ? 89.710  3.243   -134.011 1.00 48.42  ? 246 THR A OG1 1 
ATOM   1457 C CG2 . THR A 1 246 ? 90.889  3.548   -131.910 1.00 27.92  ? 246 THR A CG2 1 
ATOM   1458 N N   . ALA A 1 247 ? 91.255  4.968   -136.416 1.00 42.67  ? 247 ALA A N   1 
ATOM   1459 C CA  . ALA A 1 247 ? 91.161  4.737   -137.865 1.00 42.10  ? 247 ALA A CA  1 
ATOM   1460 C C   . ALA A 1 247 ? 92.521  4.513   -138.541 1.00 43.36  ? 247 ALA A C   1 
ATOM   1461 O O   . ALA A 1 247 ? 92.627  3.679   -139.439 1.00 42.61  ? 247 ALA A O   1 
ATOM   1462 C CB  . ALA A 1 247 ? 90.429  5.880   -138.545 1.00 43.81  ? 247 ALA A CB  1 
ATOM   1463 N N   . GLN A 1 248 ? 93.550  5.249   -138.110 1.00 45.85  ? 248 GLN A N   1 
ATOM   1464 C CA  . GLN A 1 248 ? 94.879  5.179   -138.750 1.00 41.19  ? 248 GLN A CA  1 
ATOM   1465 C C   . GLN A 1 248 ? 95.505  3.788   -138.637 1.00 43.63  ? 248 GLN A C   1 
ATOM   1466 O O   . GLN A 1 248 ? 96.213  3.352   -139.550 1.00 48.85  ? 248 GLN A O   1 
ATOM   1467 C CB  . GLN A 1 248 ? 95.851  6.215   -138.170 1.00 39.22  ? 248 GLN A CB  1 
ATOM   1468 C CG  . GLN A 1 248 ? 95.421  7.664   -138.306 1.00 35.21  ? 248 GLN A CG  1 
ATOM   1469 C CD  . GLN A 1 248 ? 95.220  8.094   -139.744 1.00 42.34  ? 248 GLN A CD  1 
ATOM   1470 O OE1 . GLN A 1 248 ? 95.987  7.719   -140.633 1.00 41.24  ? 248 GLN A OE1 1 
ATOM   1471 N NE2 . GLN A 1 248 ? 94.184  8.896   -139.981 1.00 40.41  ? 248 GLN A NE2 1 
ATOM   1472 N N   . GLY A 1 249 ? 95.248  3.102   -137.522 1.00 36.94  ? 249 GLY A N   1 
ATOM   1473 C CA  . GLY A 1 249 ? 95.706  1.725   -137.340 1.00 34.84  ? 249 GLY A CA  1 
ATOM   1474 C C   . GLY A 1 249 ? 95.105  0.792   -138.379 1.00 35.32  ? 249 GLY A C   1 
ATOM   1475 O O   . GLY A 1 249 ? 95.786  -0.080  -138.917 1.00 35.55  ? 249 GLY A O   1 
ATOM   1476 N N   . ILE A 1 250 ? 93.822  0.980   -138.668 1.00 35.28  ? 250 ILE A N   1 
ATOM   1477 C CA  . ILE A 1 250 ? 93.153  0.191   -139.686 1.00 34.14  ? 250 ILE A CA  1 
ATOM   1478 C C   . ILE A 1 250 ? 93.747  0.503   -141.064 1.00 37.02  ? 250 ILE A C   1 
ATOM   1479 O O   . ILE A 1 250 ? 93.926  -0.403  -141.886 1.00 40.75  ? 250 ILE A O   1 
ATOM   1480 C CB  . ILE A 1 250 ? 91.626  0.423   -139.679 1.00 33.53  ? 250 ILE A CB  1 
ATOM   1481 C CG1 . ILE A 1 250 ? 91.013  -0.096  -138.378 1.00 32.05  ? 250 ILE A CG1 1 
ATOM   1482 C CG2 . ILE A 1 250 ? 90.965  -0.270  -140.862 1.00 35.26  ? 250 ILE A CG2 1 
ATOM   1483 C CD1 . ILE A 1 250 ? 89.572  0.336   -138.160 1.00 32.07  ? 250 ILE A CD1 1 
ATOM   1484 N N   . PHE A 1 251 ? 94.079  1.769   -141.314 1.00 34.25  ? 251 PHE A N   1 
ATOM   1485 C CA  . PHE A 1 251 ? 94.675  2.134   -142.598 1.00 34.55  ? 251 PHE A CA  1 
ATOM   1486 C C   . PHE A 1 251 ? 96.059  1.512   -142.747 1.00 36.73  ? 251 PHE A C   1 
ATOM   1487 O O   . PHE A 1 251 ? 96.381  0.944   -143.796 1.00 35.90  ? 251 PHE A O   1 
ATOM   1488 C CB  . PHE A 1 251 ? 94.758  3.653   -142.778 1.00 34.59  ? 251 PHE A CB  1 
ATOM   1489 C CG  . PHE A 1 251 ? 93.421  4.345   -142.794 1.00 36.05  ? 251 PHE A CG  1 
ATOM   1490 C CD1 . PHE A 1 251 ? 92.314  3.762   -143.409 1.00 30.97  ? 251 PHE A CD1 1 
ATOM   1491 C CD2 . PHE A 1 251 ? 93.275  5.594   -142.209 1.00 34.84  ? 251 PHE A CD2 1 
ATOM   1492 C CE1 . PHE A 1 251 ? 91.092  4.403   -143.420 1.00 26.14  ? 251 PHE A CE1 1 
ATOM   1493 C CE2 . PHE A 1 251 ? 92.052  6.243   -142.218 1.00 35.69  ? 251 PHE A CE2 1 
ATOM   1494 C CZ  . PHE A 1 251 ? 90.959  5.647   -142.828 1.00 32.19  ? 251 PHE A CZ  1 
ATOM   1495 N N   . LEU A 1 252 ? 96.865  1.606   -141.691 1.00 36.21  ? 252 LEU A N   1 
ATOM   1496 C CA  . LEU A 1 252 ? 98.208  1.023   -141.700 1.00 34.59  ? 252 LEU A CA  1 
ATOM   1497 C C   . LEU A 1 252 ? 98.173  -0.483  -141.931 1.00 31.25  ? 252 LEU A C   1 
ATOM   1498 O O   . LEU A 1 252 ? 99.118  -1.046  -142.473 1.00 30.57  ? 252 LEU A O   1 
ATOM   1499 C CB  . LEU A 1 252 ? 98.951  1.338   -140.400 1.00 30.89  ? 252 LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 252 ? 99.338  2.805   -140.202 1.00 32.31  ? 252 LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 252 ? 100.093 2.961   -138.916 1.00 38.59  ? 252 LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 252 ? 100.175 3.318   -141.350 1.00 42.56  ? 252 LEU A CD2 1 
ATOM   1503 N N   . ASN A 1 253 ? 97.076  -1.120  -141.535 1.00 33.43  ? 253 ASN A N   1 
ATOM   1504 C CA  . ASN A 1 253 ? 96.891  -2.554  -141.733 1.00 37.27  ? 253 ASN A CA  1 
ATOM   1505 C C   . ASN A 1 253 ? 96.027  -2.911  -142.943 1.00 37.09  ? 253 ASN A C   1 
ATOM   1506 O O   . ASN A 1 253 ? 95.528  -4.034  -143.033 1.00 36.29  ? 253 ASN A O   1 
ATOM   1507 C CB  . ASN A 1 253 ? 96.272  -3.164  -140.475 1.00 37.87  ? 253 ASN A CB  1 
ATOM   1508 C CG  . ASN A 1 253 ? 97.238  -3.217  -139.329 1.00 36.69  ? 253 ASN A CG  1 
ATOM   1509 O OD1 . ASN A 1 253 ? 98.125  -4.063  -139.301 1.00 34.47  ? 253 ASN A OD1 1 
ATOM   1510 N ND2 . ASN A 1 253 ? 97.068  -2.321  -138.364 1.00 34.77  ? 253 ASN A ND2 1 
ATOM   1511 N N   . PHE A 1 254 ? 95.860  -1.983  -143.880 1.00 37.01  ? 254 PHE A N   1 
ATOM   1512 C CA  . PHE A 1 254 ? 94.943  -2.216  -144.994 1.00 37.73  ? 254 PHE A CA  1 
ATOM   1513 C C   . PHE A 1 254 ? 95.324  -3.432  -145.841 1.00 37.64  ? 254 PHE A C   1 
ATOM   1514 O O   . PHE A 1 254 ? 94.458  -4.220  -146.210 1.00 38.64  ? 254 PHE A O   1 
ATOM   1515 C CB  . PHE A 1 254 ? 94.832  -0.988  -145.891 1.00 38.13  ? 254 PHE A CB  1 
ATOM   1516 C CG  . PHE A 1 254 ? 93.862  -1.169  -147.019 1.00 38.89  ? 254 PHE A CG  1 
ATOM   1517 C CD1 . PHE A 1 254 ? 92.505  -1.008  -146.808 1.00 37.78  ? 254 PHE A CD1 1 
ATOM   1518 C CD2 . PHE A 1 254 ? 94.304  -1.538  -148.284 1.00 40.17  ? 254 PHE A CD2 1 
ATOM   1519 C CE1 . PHE A 1 254 ? 91.605  -1.188  -147.839 1.00 39.15  ? 254 PHE A CE1 1 
ATOM   1520 C CE2 . PHE A 1 254 ? 93.409  -1.723  -149.319 1.00 36.97  ? 254 PHE A CE2 1 
ATOM   1521 C CZ  . PHE A 1 254 ? 92.059  -1.546  -149.097 1.00 39.73  ? 254 PHE A CZ  1 
ATOM   1522 N N   . LYS A 1 255 ? 96.609  -3.569  -146.155 1.00 40.53  ? 255 LYS A N   1 
ATOM   1523 C CA  . LYS A 1 255 ? 97.094  -4.702  -146.950 1.00 41.65  ? 255 LYS A CA  1 
ATOM   1524 C C   . LYS A 1 255 ? 96.783  -6.029  -146.260 1.00 42.44  ? 255 LYS A C   1 
ATOM   1525 O O   . LYS A 1 255 ? 96.209  -6.935  -146.869 1.00 45.19  ? 255 LYS A O   1 
ATOM   1526 C CB  . LYS A 1 255 ? 98.605  -4.594  -147.198 1.00 44.67  ? 255 LYS A CB  1 
ATOM   1527 C CG  . LYS A 1 255 ? 98.994  -4.009  -148.545 1.00 47.94  ? 255 LYS A CG  1 
ATOM   1528 C CD  . LYS A 1 255 ? 99.147  -5.104  -149.604 1.00 60.18  ? 255 LYS A CD  1 
ATOM   1529 C CE  . LYS A 1 255 ? 99.627  -4.558  -150.952 1.00 58.27  ? 255 LYS A CE  1 
ATOM   1530 N NZ  . LYS A 1 255 ? 100.961 -3.889  -150.877 1.00 56.11  ? 255 LYS A NZ  1 
ATOM   1531 N N   . ARG A 1 256 ? 97.165  -6.135  -144.991 1.00 39.66  ? 256 ARG A N   1 
ATOM   1532 C CA  . ARG A 1 256 ? 96.962  -7.367  -144.234 1.00 39.50  ? 256 ARG A CA  1 
ATOM   1533 C C   . ARG A 1 256 ? 95.483  -7.733  -144.173 1.00 37.76  ? 256 ARG A C   1 
ATOM   1534 O O   . ARG A 1 256 ? 95.122  -8.893  -144.362 1.00 39.27  ? 256 ARG A O   1 
ATOM   1535 C CB  . ARG A 1 256 ? 97.566  -7.249  -142.827 1.00 38.93  ? 256 ARG A CB  1 
ATOM   1536 C CG  . ARG A 1 256 ? 99.092  -7.264  -142.840 1.00 46.65  ? 256 ARG A CG  1 
ATOM   1537 C CD  . ARG A 1 256 ? 99.737  -7.242  -141.455 1.00 49.82  ? 256 ARG A CD  1 
ATOM   1538 N NE  . ARG A 1 256 ? 99.841  -5.888  -140.896 1.00 61.15  ? 256 ARG A NE  1 
ATOM   1539 C CZ  . ARG A 1 256 ? 100.836 -5.450  -140.115 1.00 67.70  ? 256 ARG A CZ  1 
ATOM   1540 N NH1 . ARG A 1 256 ? 101.861 -6.233  -139.804 1.00 60.80  ? 256 ARG A NH1 1 
ATOM   1541 N NH2 . ARG A 1 256 ? 100.823 -4.200  -139.653 1.00 69.76  ? 256 ARG A NH2 1 
ATOM   1542 N N   . LEU A 1 257 ? 94.635  -6.735  -143.940 1.00 36.44  ? 257 LEU A N   1 
ATOM   1543 C CA  . LEU A 1 257 ? 93.191  -6.942  -143.864 1.00 36.00  ? 257 LEU A CA  1 
ATOM   1544 C C   . LEU A 1 257 ? 92.585  -7.338  -145.223 1.00 40.52  ? 257 LEU A C   1 
ATOM   1545 O O   . LEU A 1 257 ? 91.701  -8.202  -145.296 1.00 44.20  ? 257 LEU A O   1 
ATOM   1546 C CB  . LEU A 1 257 ? 92.510  -5.686  -143.313 1.00 32.92  ? 257 LEU A CB  1 
ATOM   1547 C CG  . LEU A 1 257 ? 92.889  -5.296  -141.874 1.00 33.07  ? 257 LEU A CG  1 
ATOM   1548 C CD1 . LEU A 1 257 ? 92.439  -3.869  -141.538 1.00 20.50  ? 257 LEU A CD1 1 
ATOM   1549 C CD2 . LEU A 1 257 ? 92.325  -6.279  -140.861 1.00 29.64  ? 257 LEU A CD2 1 
ATOM   1550 N N   . LEU A 1 258 ? 93.065  -6.718  -146.297 1.00 39.43  ? 258 LEU A N   1 
ATOM   1551 C CA  . LEU A 1 258 ? 92.583  -7.042  -147.637 1.00 36.38  ? 258 LEU A CA  1 
ATOM   1552 C C   . LEU A 1 258 ? 92.964  -8.471  -148.009 1.00 37.38  ? 258 LEU A C   1 
ATOM   1553 O O   . LEU A 1 258 ? 92.141  -9.231  -148.523 1.00 33.94  ? 258 LEU A O   1 
ATOM   1554 C CB  . LEU A 1 258 ? 93.154  -6.062  -148.662 1.00 37.98  ? 258 LEU A CB  1 
ATOM   1555 C CG  . LEU A 1 258 ? 92.654  -6.246  -150.097 1.00 36.87  ? 258 LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1 258 ? 91.132  -6.167  -150.136 1.00 31.77  ? 258 LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1 258 ? 93.286  -5.220  -151.024 1.00 28.09  ? 258 LEU A CD2 1 
ATOM   1558 N N   . GLU A 1 259 ? 94.221  -8.822  -147.751 1.00 40.15  ? 259 GLU A N   1 
ATOM   1559 C CA  . GLU A 1 259 ? 94.697  -10.189 -147.927 1.00 40.47  ? 259 GLU A CA  1 
ATOM   1560 C C   . GLU A 1 259 ? 93.838  -11.148 -147.101 1.00 41.28  ? 259 GLU A C   1 
ATOM   1561 O O   . GLU A 1 259 ? 93.310  -12.128 -147.626 1.00 35.47  ? 259 GLU A O   1 
ATOM   1562 C CB  . GLU A 1 259 ? 96.166  -10.288 -147.508 1.00 39.32  ? 259 GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 259 ? 96.741  -11.700 -147.559 1.00 45.00  ? 259 GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 259 ? 98.236  -11.750 -147.285 1.00 48.99  ? 259 GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 259 ? 98.829  -12.840 -147.446 1.00 56.21  ? 259 GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 259 ? 98.819  -10.711 -146.909 1.00 54.04  ? 259 GLU A OE2 1 
ATOM   1567 N N   . PHE A 1 260 ? 93.683  -10.838 -145.813 1.00 45.24  ? 260 PHE A N   1 
ATOM   1568 C CA  . PHE A 1 260 ? 92.843  -11.629 -144.903 1.00 44.77  ? 260 PHE A CA  1 
ATOM   1569 C C   . PHE A 1 260 ? 91.437  -11.851 -145.464 1.00 47.54  ? 260 PHE A C   1 
ATOM   1570 O O   . PHE A 1 260 ? 90.831  -12.892 -145.223 1.00 54.83  ? 260 PHE A O   1 
ATOM   1571 C CB  . PHE A 1 260 ? 92.753  -10.965 -143.522 1.00 43.51  ? 260 PHE A CB  1 
ATOM   1572 C CG  . PHE A 1 260 ? 92.092  -11.822 -142.479 1.00 42.99  ? 260 PHE A CG  1 
ATOM   1573 C CD1 . PHE A 1 260 ? 92.846  -12.655 -141.667 1.00 43.18  ? 260 PHE A CD1 1 
ATOM   1574 C CD2 . PHE A 1 260 ? 90.710  -11.803 -142.314 1.00 49.13  ? 260 PHE A CD2 1 
ATOM   1575 C CE1 . PHE A 1 260 ? 92.236  -13.461 -140.705 1.00 44.99  ? 260 PHE A CE1 1 
ATOM   1576 C CE2 . PHE A 1 260 ? 90.087  -12.604 -141.350 1.00 41.90  ? 260 PHE A CE2 1 
ATOM   1577 C CZ  . PHE A 1 260 ? 90.853  -13.434 -140.547 1.00 40.08  ? 260 PHE A CZ  1 
ATOM   1578 N N   . ASN A 1 261 ? 90.928  -10.880 -146.218 1.00 47.04  ? 261 ASN A N   1 
ATOM   1579 C CA  . ASN A 1 261 ? 89.621  -10.997 -146.860 1.00 43.03  ? 261 ASN A CA  1 
ATOM   1580 C C   . ASN A 1 261 ? 89.690  -11.552 -148.289 1.00 42.16  ? 261 ASN A C   1 
ATOM   1581 O O   . ASN A 1 261 ? 88.803  -11.292 -149.105 1.00 40.80  ? 261 ASN A O   1 
ATOM   1582 C CB  . ASN A 1 261 ? 88.946  -9.628  -146.867 1.00 41.99  ? 261 ASN A CB  1 
ATOM   1583 C CG  . ASN A 1 261 ? 87.454  -9.723  -146.999 1.00 39.78  ? 261 ASN A CG  1 
ATOM   1584 O OD1 . ASN A 1 261 ? 86.880  -9.282  -147.994 1.00 49.48  ? 261 ASN A OD1 1 
ATOM   1585 N ND2 . ASN A 1 261 ? 86.812  -10.321 -146.004 1.00 27.38  ? 261 ASN A ND2 1 
ATOM   1586 N N   . GLN A 1 262 ? 90.742  -12.316 -148.585 1.00 43.24  ? 262 GLN A N   1 
ATOM   1587 C CA  . GLN A 1 262 ? 90.946  -12.930 -149.908 1.00 45.70  ? 262 GLN A CA  1 
ATOM   1588 C C   . GLN A 1 262 ? 91.001  -11.912 -151.056 1.00 45.05  ? 262 GLN A C   1 
ATOM   1589 O O   . GLN A 1 262 ? 90.582  -12.207 -152.180 1.00 41.91  ? 262 GLN A O   1 
ATOM   1590 C CB  . GLN A 1 262 ? 89.867  -13.991 -150.200 1.00 48.26  ? 262 GLN A CB  1 
ATOM   1591 C CG  . GLN A 1 262 ? 89.684  -15.058 -149.120 1.00 51.28  ? 262 GLN A CG  1 
ATOM   1592 C CD  . GLN A 1 262 ? 90.961  -15.820 -148.815 1.00 60.35  ? 262 GLN A CD  1 
ATOM   1593 O OE1 . GLN A 1 262 ? 91.760  -15.406 -147.971 1.00 61.83  ? 262 GLN A OE1 1 
ATOM   1594 N NE2 . GLN A 1 262 ? 91.154  -16.949 -149.492 1.00 66.46  ? 262 GLN A NE2 1 
ATOM   1595 N N   . GLY A 1 263 ? 91.518  -10.717 -150.769 1.00 45.38  ? 263 GLY A N   1 
ATOM   1596 C CA  . GLY A 1 263 ? 91.646  -9.658  -151.775 1.00 42.84  ? 263 GLY A CA  1 
ATOM   1597 C C   . GLY A 1 263 ? 90.330  -9.073  -152.267 1.00 41.70  ? 263 GLY A C   1 
ATOM   1598 O O   . GLY A 1 263 ? 90.321  -8.221  -153.157 1.00 38.87  ? 263 GLY A O   1 
ATOM   1599 N N   . LYS A 1 264 ? 89.224  -9.503  -151.665 1.00 41.62  ? 264 LYS A N   1 
ATOM   1600 C CA  . LYS A 1 264 ? 87.891  -9.174  -152.150 1.00 40.36  ? 264 LYS A CA  1 
ATOM   1601 C C   . LYS A 1 264 ? 87.348  -7.924  -151.441 1.00 39.95  ? 264 LYS A C   1 
ATOM   1602 O O   . LYS A 1 264 ? 87.742  -7.603  -150.317 1.00 42.73  ? 264 LYS A O   1 
ATOM   1603 C CB  . LYS A 1 264 ? 86.954  -10.372 -151.930 1.00 42.60  ? 264 LYS A CB  1 
ATOM   1604 C CG  . LYS A 1 264 ? 85.983  -10.656 -153.076 1.00 52.43  ? 264 LYS A CG  1 
ATOM   1605 C CD  . LYS A 1 264 ? 86.678  -11.142 -154.365 1.00 66.11  ? 264 LYS A CD  1 
ATOM   1606 C CE  . LYS A 1 264 ? 87.573  -12.367 -154.150 1.00 71.73  ? 264 LYS A CE  1 
ATOM   1607 N NZ  . LYS A 1 264 ? 86.910  -13.439 -153.357 1.00 73.79  ? 264 LYS A NZ  1 
ATOM   1608 N N   . LEU A 1 265 ? 86.430  -7.240  -152.113 1.00 35.11  ? 265 LEU A N   1 
ATOM   1609 C CA  . LEU A 1 265 ? 85.828  -6.003  -151.626 1.00 31.37  ? 265 LEU A CA  1 
ATOM   1610 C C   . LEU A 1 265 ? 84.309  -6.135  -151.814 1.00 29.93  ? 265 LEU A C   1 
ATOM   1611 O O   . LEU A 1 265 ? 83.868  -6.758  -152.774 1.00 38.06  ? 265 LEU A O   1 
ATOM   1612 C CB  . LEU A 1 265 ? 86.384  -4.850  -152.461 1.00 28.75  ? 265 LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 265 ? 86.643  -3.467  -151.876 1.00 31.62  ? 265 LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 265 ? 87.347  -3.541  -150.534 1.00 22.60  ? 265 LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 265 ? 87.472  -2.655  -152.887 1.00 26.47  ? 265 LEU A CD2 1 
ATOM   1616 N N   . PRO A 1 266 ? 83.495  -5.565  -150.910 1.00 28.85  ? 266 PRO A N   1 
ATOM   1617 C CA  . PRO A 1 266 ? 83.791  -4.750  -149.736 1.00 28.96  ? 266 PRO A CA  1 
ATOM   1618 C C   . PRO A 1 266 ? 84.195  -5.567  -148.528 1.00 29.99  ? 266 PRO A C   1 
ATOM   1619 O O   . PRO A 1 266 ? 83.999  -6.777  -148.496 1.00 39.27  ? 266 PRO A O   1 
ATOM   1620 C CB  . PRO A 1 266 ? 82.447  -4.088  -149.438 1.00 27.34  ? 266 PRO A CB  1 
ATOM   1621 C CG  . PRO A 1 266 ? 81.446  -5.113  -149.869 1.00 16.44  ? 266 PRO A CG  1 
ATOM   1622 C CD  . PRO A 1 266 ? 82.042  -5.771  -151.069 1.00 20.69  ? 266 PRO A CD  1 
ATOM   1623 N N   . PHE A 1 267 ? 84.756  -4.891  -147.540 1.00 33.32  ? 267 PHE A N   1 
ATOM   1624 C CA  . PHE A 1 267 ? 84.992  -5.479  -146.236 1.00 30.71  ? 267 PHE A CA  1 
ATOM   1625 C C   . PHE A 1 267 ? 85.065  -4.341  -145.239 1.00 30.12  ? 267 PHE A C   1 
ATOM   1626 O O   . PHE A 1 267 ? 85.265  -3.187  -145.631 1.00 34.55  ? 267 PHE A O   1 
ATOM   1627 C CB  . PHE A 1 267 ? 86.279  -6.303  -146.233 1.00 34.11  ? 267 PHE A CB  1 
ATOM   1628 C CG  . PHE A 1 267 ? 87.535  -5.479  -146.247 1.00 36.70  ? 267 PHE A CG  1 
ATOM   1629 C CD1 . PHE A 1 267 ? 88.124  -5.066  -145.054 1.00 40.04  ? 267 PHE A CD1 1 
ATOM   1630 C CD2 . PHE A 1 267 ? 88.140  -5.130  -147.445 1.00 37.94  ? 267 PHE A CD2 1 
ATOM   1631 C CE1 . PHE A 1 267 ? 89.288  -4.310  -145.058 1.00 35.36  ? 267 PHE A CE1 1 
ATOM   1632 C CE2 . PHE A 1 267 ? 89.312  -4.371  -147.456 1.00 40.26  ? 267 PHE A CE2 1 
ATOM   1633 C CZ  . PHE A 1 267 ? 89.884  -3.960  -146.260 1.00 33.94  ? 267 PHE A CZ  1 
ATOM   1634 N N   . ALA A 1 268 ? 84.890  -4.663  -143.963 1.00 29.70  ? 268 ALA A N   1 
ATOM   1635 C CA  . ALA A 1 268 ? 84.956  -3.665  -142.896 1.00 31.23  ? 268 ALA A CA  1 
ATOM   1636 C C   . ALA A 1 268 ? 85.883  -4.135  -141.786 1.00 33.05  ? 268 ALA A C   1 
ATOM   1637 O O   . ALA A 1 268 ? 85.973  -5.328  -141.506 1.00 37.48  ? 268 ALA A O   1 
ATOM   1638 C CB  . ALA A 1 268 ? 83.566  -3.381  -142.341 1.00 27.34  ? 268 ALA A CB  1 
ATOM   1639 N N   . ALA A 1 269 ? 86.580  -3.189  -141.167 1.00 33.33  ? 269 ALA A N   1 
ATOM   1640 C CA  . ALA A 1 269 ? 87.432  -3.482  -140.029 1.00 30.63  ? 269 ALA A CA  1 
ATOM   1641 C C   . ALA A 1 269 ? 87.013  -2.601  -138.870 1.00 32.19  ? 269 ALA A C   1 
ATOM   1642 O O   . ALA A 1 269 ? 86.454  -1.530  -139.087 1.00 32.27  ? 269 ALA A O   1 
ATOM   1643 C CB  . ALA A 1 269 ? 88.885  -3.251  -140.377 1.00 26.92  ? 269 ALA A CB  1 
ATOM   1644 N N   . ALA A 1 270 ? 87.280  -3.055  -137.645 1.00 32.35  ? 270 ALA A N   1 
ATOM   1645 C CA  . ALA A 1 270 ? 86.921  -2.299  -136.451 1.00 31.49  ? 270 ALA A CA  1 
ATOM   1646 C C   . ALA A 1 270 ? 87.972  -2.384  -135.342 1.00 31.66  ? 270 ALA A C   1 
ATOM   1647 O O   . ALA A 1 270 ? 88.712  -3.366  -135.241 1.00 33.38  ? 270 ALA A O   1 
ATOM   1648 C CB  . ALA A 1 270 ? 85.566  -2.767  -135.924 1.00 29.88  ? 270 ALA A CB  1 
ATOM   1649 N N   . GLN A 1 271 ? 88.021  -1.330  -134.527 1.00 30.73  ? 271 GLN A N   1 
ATOM   1650 C CA  . GLN A 1 271 ? 88.772  -1.300  -133.274 1.00 30.46  ? 271 GLN A CA  1 
ATOM   1651 C C   . GLN A 1 271 ? 87.860  -0.819  -132.156 1.00 31.20  ? 271 GLN A C   1 
ATOM   1652 O O   . GLN A 1 271 ? 87.049  0.082   -132.371 1.00 35.60  ? 271 GLN A O   1 
ATOM   1653 C CB  . GLN A 1 271 ? 89.954  -0.339  -133.360 1.00 27.36  ? 271 GLN A CB  1 
ATOM   1654 C CG  . GLN A 1 271 ? 91.016  -0.725  -134.360 1.00 32.95  ? 271 GLN A CG  1 
ATOM   1655 C CD  . GLN A 1 271 ? 92.371  -0.138  -134.014 1.00 37.05  ? 271 GLN A CD  1 
ATOM   1656 O OE1 . GLN A 1 271 ? 92.922  0.676   -134.759 1.00 42.89  ? 271 GLN A OE1 1 
ATOM   1657 N NE2 . GLN A 1 271 ? 92.907  -0.537  -132.871 1.00 36.42  ? 271 GLN A NE2 1 
ATOM   1658 N N   . ILE A 1 272 ? 87.975  -1.442  -130.983 1.00 29.11  ? 272 ILE A N   1 
ATOM   1659 C CA  . ILE A 1 272 ? 87.421  -0.903  -129.743 1.00 29.85  ? 272 ILE A CA  1 
ATOM   1660 C C   . ILE A 1 272 ? 88.582  -0.610  -128.799 1.00 27.78  ? 272 ILE A C   1 
ATOM   1661 O O   . ILE A 1 272 ? 89.240  -1.515  -128.313 1.00 28.88  ? 272 ILE A O   1 
ATOM   1662 C CB  . ILE A 1 272 ? 86.449  -1.870  -129.044 1.00 29.21  ? 272 ILE A CB  1 
ATOM   1663 C CG1 . ILE A 1 272 ? 85.229  -2.148  -129.921 1.00 38.24  ? 272 ILE A CG1 1 
ATOM   1664 C CG2 . ILE A 1 272 ? 85.990  -1.283  -127.710 1.00 26.55  ? 272 ILE A CG2 1 
ATOM   1665 C CD1 . ILE A 1 272 ? 85.336  -3.392  -130.733 1.00 53.99  ? 272 ILE A CD1 1 
ATOM   1666 N N   . GLY A 1 273 ? 88.844  0.657   -128.537 1.00 33.08  ? 273 GLY A N   1 
ATOM   1667 C CA  . GLY A 1 273 ? 89.998  1.003   -127.737 1.00 33.41  ? 273 GLY A CA  1 
ATOM   1668 C C   . GLY A 1 273 ? 90.020  2.461   -127.377 1.00 38.07  ? 273 GLY A C   1 
ATOM   1669 O O   . GLY A 1 273 ? 89.124  3.217   -127.750 1.00 40.35  ? 273 GLY A O   1 
ATOM   1670 N N   . ASN A 1 274 ? 91.057  2.844   -126.642 1.00 38.78  ? 274 ASN A N   1 
ATOM   1671 C CA  . ASN A 1 274 ? 91.175  4.189   -126.138 1.00 39.52  ? 274 ASN A CA  1 
ATOM   1672 C C   . ASN A 1 274 ? 91.984  5.067   -127.053 1.00 43.53  ? 274 ASN A C   1 
ATOM   1673 O O   . ASN A 1 274 ? 92.966  4.636   -127.672 1.00 44.37  ? 274 ASN A O   1 
ATOM   1674 C CB  . ASN A 1 274 ? 91.802  4.193   -124.748 1.00 44.34  ? 274 ASN A CB  1 
ATOM   1675 C CG  . ASN A 1 274 ? 90.878  3.631   -123.698 1.00 50.68  ? 274 ASN A CG  1 
ATOM   1676 O OD1 . ASN A 1 274 ? 89.671  3.837   -123.746 1.00 45.76  ? 274 ASN A OD1 1 
ATOM   1677 N ND2 . ASN A 1 274 ? 91.440  2.916   -122.740 1.00 69.64  ? 274 ASN A ND2 1 
ATOM   1678 N N   . SER A 1 275 ? 91.545  6.315   -127.125 1.00 41.58  ? 275 SER A N   1 
ATOM   1679 C CA  . SER A 1 275 ? 92.260  7.353   -127.814 1.00 42.60  ? 275 SER A CA  1 
ATOM   1680 C C   . SER A 1 275 ? 92.336  8.513   -126.843 1.00 41.91  ? 275 SER A C   1 
ATOM   1681 O O   . SER A 1 275 ? 91.655  8.499   -125.810 1.00 38.83  ? 275 SER A O   1 
ATOM   1682 C CB  . SER A 1 275 ? 91.520  7.723   -129.094 1.00 46.14  ? 275 SER A CB  1 
ATOM   1683 O OG  . SER A 1 275 ? 91.199  6.545   -129.821 1.00 48.17  ? 275 SER A OG  1 
ATOM   1684 N N   . PHE A 1 276 ? 93.174  9.497   -127.165 1.00 41.51  ? 276 PHE A N   1 
ATOM   1685 C CA  . PHE A 1 276 ? 93.499  10.581  -126.242 1.00 39.88  ? 276 PHE A CA  1 
ATOM   1686 C C   . PHE A 1 276 ? 93.479  11.932  -126.945 1.00 39.75  ? 276 PHE A C   1 
ATOM   1687 O O   . PHE A 1 276 ? 93.898  12.054  -128.093 1.00 40.37  ? 276 PHE A O   1 
ATOM   1688 C CB  . PHE A 1 276 ? 94.885  10.361  -125.636 1.00 39.75  ? 276 PHE A CB  1 
ATOM   1689 C CG  . PHE A 1 276 ? 95.059  9.026   -124.966 1.00 38.64  ? 276 PHE A CG  1 
ATOM   1690 C CD1 . PHE A 1 276 ? 95.155  7.863   -125.716 1.00 36.23  ? 276 PHE A CD1 1 
ATOM   1691 C CD2 . PHE A 1 276 ? 95.155  8.933   -123.587 1.00 43.19  ? 276 PHE A CD2 1 
ATOM   1692 C CE1 . PHE A 1 276 ? 95.324  6.636   -125.107 1.00 39.31  ? 276 PHE A CE1 1 
ATOM   1693 C CE2 . PHE A 1 276 ? 95.326  7.705   -122.970 1.00 42.14  ? 276 PHE A CE2 1 
ATOM   1694 C CZ  . PHE A 1 276 ? 95.408  6.555   -123.733 1.00 43.23  ? 276 PHE A CZ  1 
ATOM   1695 N N   . ARG A 1 277 ? 93.020  12.951  -126.233 1.00 39.65  ? 277 ARG A N   1 
ATOM   1696 C CA  . ARG A 1 277 ? 92.852  14.272  -126.803 1.00 37.58  ? 277 ARG A CA  1 
ATOM   1697 C C   . ARG A 1 277 ? 93.127  15.296  -125.707 1.00 36.76  ? 277 ARG A C   1 
ATOM   1698 O O   . ARG A 1 277 ? 92.317  15.471  -124.806 1.00 34.50  ? 277 ARG A O   1 
ATOM   1699 C CB  . ARG A 1 277 ? 91.429  14.392  -127.345 1.00 35.89  ? 277 ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 277 ? 91.170  15.603  -128.207 1.00 44.27  ? 277 ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 277 ? 89.703  15.695  -128.607 1.00 48.69  ? 277 ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 277 ? 89.320  17.072  -128.926 1.00 52.35  ? 277 ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 277 ? 88.993  17.530  -130.134 1.00 56.90  ? 277 ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 277 ? 88.988  16.742  -131.205 1.00 56.42  ? 277 ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 277 ? 88.668  18.813  -130.270 1.00 65.62  ? 277 ARG A NH2 1 
ATOM   1706 N N   . ASN A 1 278 ? 94.287  15.949  -125.765 1.00 39.69  ? 278 ASN A N   1 
ATOM   1707 C CA  . ASN A 1 278 ? 94.717  16.847  -124.688 1.00 39.45  ? 278 ASN A CA  1 
ATOM   1708 C C   . ASN A 1 278 ? 93.953  18.164  -124.708 1.00 40.08  ? 278 ASN A C   1 
ATOM   1709 O O   . ASN A 1 278 ? 94.481  19.197  -125.112 1.00 45.33  ? 278 ASN A O   1 
ATOM   1710 C CB  . ASN A 1 278 ? 96.227  17.103  -124.764 1.00 40.76  ? 278 ASN A CB  1 
ATOM   1711 C CG  . ASN A 1 278 ? 96.783  17.743  -123.497 1.00 38.51  ? 278 ASN A CG  1 
ATOM   1712 O OD1 . ASN A 1 278 ? 96.321  17.469  -122.392 1.00 35.35  ? 278 ASN A OD1 1 
ATOM   1713 N ND2 . ASN A 1 278 ? 97.790  18.588  -123.657 1.00 37.42  ? 278 ASN A ND2 1 
ATOM   1714 N N   . GLU A 1 279 ? 92.705  18.109  -124.258 1.00 38.41  ? 279 GLU A N   1 
ATOM   1715 C CA  . GLU A 1 279 ? 91.811  19.262  -124.261 1.00 39.26  ? 279 GLU A CA  1 
ATOM   1716 C C   . GLU A 1 279 ? 92.364  20.384  -123.375 1.00 36.90  ? 279 GLU A C   1 
ATOM   1717 O O   . GLU A 1 279 ? 92.907  20.106  -122.319 1.00 34.83  ? 279 GLU A O   1 
ATOM   1718 C CB  . GLU A 1 279 ? 90.424  18.833  -123.766 1.00 41.05  ? 279 GLU A CB  1 
ATOM   1719 C CG  . GLU A 1 279 ? 89.267  19.530  -124.473 1.00 53.57  ? 279 GLU A CG  1 
ATOM   1720 C CD  . GLU A 1 279 ? 88.996  18.960  -125.851 1.00 56.61  ? 279 GLU A CD  1 
ATOM   1721 O OE1 . GLU A 1 279 ? 88.872  17.717  -125.970 1.00 50.15  ? 279 GLU A OE1 1 
ATOM   1722 O OE2 . GLU A 1 279 ? 88.906  19.760  -126.811 1.00 61.48  ? 279 GLU A OE2 1 
ATOM   1723 N N   . ILE A 1 280 ? 92.231  21.641  -123.803 1.00 36.72  ? 280 ILE A N   1 
ATOM   1724 C CA  . ILE A 1 280 ? 92.772  22.782  -123.038 1.00 37.83  ? 280 ILE A CA  1 
ATOM   1725 C C   . ILE A 1 280 ? 92.168  22.891  -121.636 1.00 38.45  ? 280 ILE A C   1 
ATOM   1726 O O   . ILE A 1 280 ? 92.901  22.956  -120.642 1.00 40.25  ? 280 ILE A O   1 
ATOM   1727 C CB  . ILE A 1 280 ? 92.551  24.149  -123.752 1.00 36.56  ? 280 ILE A CB  1 
ATOM   1728 C CG1 . ILE A 1 280 ? 93.477  24.312  -124.964 1.00 42.35  ? 280 ILE A CG1 1 
ATOM   1729 C CG2 . ILE A 1 280 ? 92.797  25.297  -122.796 1.00 31.11  ? 280 ILE A CG2 1 
ATOM   1730 C CD1 . ILE A 1 280 ? 92.806  24.039  -126.287 1.00 56.90  ? 280 ILE A CD1 1 
ATOM   1731 N N   . SER A 1 281 ? 90.839  22.927  -121.568 1.00 38.19  ? 281 SER A N   1 
ATOM   1732 C CA  . SER A 1 281 ? 90.126  23.067  -120.297 1.00 38.60  ? 281 SER A CA  1 
ATOM   1733 C C   . SER A 1 281 ? 88.779  22.364  -120.333 1.00 40.75  ? 281 SER A C   1 
ATOM   1734 O O   . SER A 1 281 ? 87.756  22.992  -120.610 1.00 45.32  ? 281 SER A O   1 
ATOM   1735 C CB  . SER A 1 281 ? 89.930  24.543  -119.953 1.00 33.51  ? 281 SER A CB  1 
ATOM   1736 O OG  . SER A 1 281 ? 91.086  25.050  -119.319 1.00 36.95  ? 281 SER A OG  1 
ATOM   1737 N N   . PRO A 1 282 ? 88.774  21.050  -120.066 1.00 42.90  ? 282 PRO A N   1 
ATOM   1738 C CA  . PRO A 1 282 ? 87.508  20.317  -120.007 1.00 44.75  ? 282 PRO A CA  1 
ATOM   1739 C C   . PRO A 1 282 ? 86.698  20.657  -118.751 1.00 44.96  ? 282 PRO A C   1 
ATOM   1740 O O   . PRO A 1 282 ? 87.227  20.585  -117.640 1.00 42.45  ? 282 PRO A O   1 
ATOM   1741 C CB  . PRO A 1 282 ? 87.951  18.851  -120.003 1.00 40.89  ? 282 PRO A CB  1 
ATOM   1742 C CG  . PRO A 1 282 ? 89.329  18.863  -119.466 1.00 40.54  ? 282 PRO A CG  1 
ATOM   1743 C CD  . PRO A 1 282 ? 89.939  20.177  -119.830 1.00 40.85  ? 282 PRO A CD  1 
ATOM   1744 N N   . ARG A 1 283 ? 85.438  21.049  -118.940 1.00 48.26  ? 283 ARG A N   1 
ATOM   1745 C CA  . ARG A 1 283 ? 84.533  21.365  -117.824 1.00 52.32  ? 283 ARG A CA  1 
ATOM   1746 C C   . ARG A 1 283 ? 83.084  20.977  -118.133 1.00 50.84  ? 283 ARG A C   1 
ATOM   1747 O O   . ARG A 1 283 ? 82.148  21.630  -117.676 1.00 51.94  ? 283 ARG A O   1 
ATOM   1748 C CB  . ARG A 1 283 ? 84.610  22.859  -117.485 1.00 54.05  ? 283 ARG A CB  1 
ATOM   1749 C CG  . ARG A 1 283 ? 85.987  23.314  -117.052 1.00 58.90  ? 283 ARG A CG  1 
ATOM   1750 C CD  . ARG A 1 283 ? 86.008  24.770  -116.668 1.00 64.39  ? 283 ARG A CD  1 
ATOM   1751 N NE  . ARG A 1 283 ? 87.326  25.164  -116.172 1.00 71.31  ? 283 ARG A NE  1 
ATOM   1752 C CZ  . ARG A 1 283 ? 87.627  26.372  -115.695 1.00 76.83  ? 283 ARG A CZ  1 
ATOM   1753 N NH1 . ARG A 1 283 ? 86.705  27.331  -115.642 1.00 73.64  ? 283 ARG A NH1 1 
ATOM   1754 N NH2 . ARG A 1 283 ? 88.860  26.623  -115.266 1.00 77.16  ? 283 ARG A NH2 1 
ATOM   1755 N N   . SER A 1 284 ? 82.910  19.899  -118.892 1.00 51.89  ? 284 SER A N   1 
ATOM   1756 C CA  . SER A 1 284 ? 81.592  19.458  -119.344 1.00 49.07  ? 284 SER A CA  1 
ATOM   1757 C C   . SER A 1 284 ? 81.348  18.004  -118.945 1.00 49.44  ? 284 SER A C   1 
ATOM   1758 O O   . SER A 1 284 ? 80.809  17.215  -119.724 1.00 50.15  ? 284 SER A O   1 
ATOM   1759 C CB  . SER A 1 284 ? 81.501  19.611  -120.861 1.00 49.35  ? 284 SER A CB  1 
ATOM   1760 O OG  . SER A 1 284 ? 82.015  20.867  -121.263 1.00 52.12  ? 284 SER A OG  1 
ATOM   1761 N N   . GLY A 1 285 ? 81.751  17.651  -117.727 1.00 45.69  ? 285 GLY A N   1 
ATOM   1762 C CA  . GLY A 1 285 ? 81.653  16.276  -117.263 1.00 41.10  ? 285 GLY A CA  1 
ATOM   1763 C C   . GLY A 1 285 ? 82.227  15.304  -118.274 1.00 40.26  ? 285 GLY A C   1 
ATOM   1764 O O   . GLY A 1 285 ? 83.261  15.573  -118.885 1.00 39.03  ? 285 GLY A O   1 
ATOM   1765 N N   . LEU A 1 286 ? 81.531  14.185  -118.465 1.00 40.39  ? 286 LEU A N   1 
ATOM   1766 C CA  . LEU A 1 286 ? 81.947  13.120  -119.394 1.00 40.63  ? 286 LEU A CA  1 
ATOM   1767 C C   . LEU A 1 286 ? 81.988  13.495  -120.879 1.00 42.44  ? 286 LEU A C   1 
ATOM   1768 O O   . LEU A 1 286 ? 82.567  12.757  -121.677 1.00 45.14  ? 286 LEU A O   1 
ATOM   1769 C CB  . LEU A 1 286 ? 81.005  11.920  -119.267 1.00 40.29  ? 286 LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 286 ? 81.386  10.750  -118.379 1.00 38.18  ? 286 LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 286 ? 80.307  9.694   -118.545 1.00 32.20  ? 286 LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 286 ? 82.764  10.202  -118.746 1.00 35.81  ? 286 LEU A CD2 1 
ATOM   1773 N N   . ILE A 1 287 ? 81.342  14.598  -121.254 1.00 42.52  ? 287 ILE A N   1 
ATOM   1774 C CA  . ILE A 1 287 ? 81.265  15.015  -122.653 1.00 41.86  ? 287 ILE A CA  1 
ATOM   1775 C C   . ILE A 1 287 ? 82.652  15.394  -123.184 1.00 41.67  ? 287 ILE A C   1 
ATOM   1776 O O   . ILE A 1 287 ? 83.042  14.964  -124.259 1.00 49.26  ? 287 ILE A O   1 
ATOM   1777 C CB  . ILE A 1 287 ? 80.235  16.172  -122.837 1.00 44.61  ? 287 ILE A CB  1 
ATOM   1778 C CG1 . ILE A 1 287 ? 78.811  15.613  -122.969 1.00 46.93  ? 287 ILE A CG1 1 
ATOM   1779 C CG2 . ILE A 1 287 ? 80.547  17.010  -124.068 1.00 43.54  ? 287 ILE A CG2 1 
ATOM   1780 C CD1 . ILE A 1 287 ? 78.498  14.437  -122.068 1.00 38.96  ? 287 ILE A CD1 1 
ATOM   1781 N N   . ARG A 1 288 ? 83.412  16.160  -122.413 1.00 43.10  ? 288 ARG A N   1 
ATOM   1782 C CA  . ARG A 1 288 ? 84.757  16.561  -122.818 1.00 46.22  ? 288 ARG A CA  1 
ATOM   1783 C C   . ARG A 1 288 ? 85.828  15.929  -121.935 1.00 44.49  ? 288 ARG A C   1 
ATOM   1784 O O   . ARG A 1 288 ? 86.158  16.454  -120.876 1.00 48.93  ? 288 ARG A O   1 
ATOM   1785 C CB  . ARG A 1 288 ? 84.879  18.083  -122.785 1.00 53.05  ? 288 ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 288 ? 84.158  18.762  -123.925 1.00 62.09  ? 288 ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 288 ? 84.976  18.688  -125.209 1.00 72.38  ? 288 ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 288 ? 84.286  19.317  -126.334 1.00 76.25  ? 288 ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 288 ? 84.124  20.631  -126.487 1.00 80.40  ? 288 ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 288 ? 84.593  21.485  -125.580 1.00 79.89  ? 288 ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 288 ? 83.483  21.096  -127.554 1.00 79.50  ? 288 ARG A NH2 1 
ATOM   1792 N N   . VAL A 1 289 ? 86.370  14.805  -122.391 1.00 41.72  ? 289 VAL A N   1 
ATOM   1793 C CA  . VAL A 1 289 ? 87.405  14.079  -121.661 1.00 40.02  ? 289 VAL A CA  1 
ATOM   1794 C C   . VAL A 1 289 ? 88.695  14.026  -122.469 1.00 37.94  ? 289 VAL A C   1 
ATOM   1795 O O   . VAL A 1 289 ? 88.680  14.172  -123.691 1.00 33.07  ? 289 VAL A O   1 
ATOM   1796 C CB  . VAL A 1 289 ? 86.965  12.628  -121.348 1.00 38.21  ? 289 VAL A CB  1 
ATOM   1797 C CG1 . VAL A 1 289 ? 85.871  12.620  -120.295 1.00 33.21  ? 289 VAL A CG1 1 
ATOM   1798 C CG2 . VAL A 1 289 ? 86.505  11.923  -122.620 1.00 33.89  ? 289 VAL A CG2 1 
ATOM   1799 N N   . ARG A 1 290 ? 89.802  13.791  -121.772 1.00 40.64  ? 290 ARG A N   1 
ATOM   1800 C CA  . ARG A 1 290 ? 91.127  13.696  -122.388 1.00 38.44  ? 290 ARG A CA  1 
ATOM   1801 C C   . ARG A 1 290 ? 91.536  12.262  -122.718 1.00 38.69  ? 290 ARG A C   1 
ATOM   1802 O O   . ARG A 1 290 ? 92.492  12.042  -123.460 1.00 37.89  ? 290 ARG A O   1 
ATOM   1803 C CB  . ARG A 1 290 ? 92.161  14.313  -121.461 1.00 38.74  ? 290 ARG A CB  1 
ATOM   1804 C CG  . ARG A 1 290 ? 91.931  15.784  -121.215 1.00 38.60  ? 290 ARG A CG  1 
ATOM   1805 C CD  . ARG A 1 290 ? 92.873  16.334  -120.167 1.00 36.04  ? 290 ARG A CD  1 
ATOM   1806 N NE  . ARG A 1 290 ? 93.019  17.780  -120.314 1.00 33.72  ? 290 ARG A NE  1 
ATOM   1807 C CZ  . ARG A 1 290 ? 93.268  18.624  -119.315 1.00 35.68  ? 290 ARG A CZ  1 
ATOM   1808 N NH1 . ARG A 1 290 ? 93.410  18.190  -118.068 1.00 39.28  ? 290 ARG A NH1 1 
ATOM   1809 N NH2 . ARG A 1 290 ? 93.381  19.920  -119.566 1.00 41.31  ? 290 ARG A NH2 1 
ATOM   1810 N N   . GLU A 1 291 ? 90.816  11.298  -122.149 1.00 38.91  ? 291 GLU A N   1 
ATOM   1811 C CA  . GLU A 1 291 ? 91.034  9.876   -122.402 1.00 36.75  ? 291 GLU A CA  1 
ATOM   1812 C C   . GLU A 1 291 ? 89.667  9.216   -122.502 1.00 35.07  ? 291 GLU A C   1 
ATOM   1813 O O   . GLU A 1 291 ? 88.797  9.464   -121.669 1.00 30.41  ? 291 GLU A O   1 
ATOM   1814 C CB  . GLU A 1 291 ? 91.843  9.262   -121.259 1.00 35.41  ? 291 GLU A CB  1 
ATOM   1815 C CG  . GLU A 1 291 ? 92.138  7.786   -121.423 1.00 41.29  ? 291 GLU A CG  1 
ATOM   1816 C CD  . GLU A 1 291 ? 92.966  7.211   -120.282 1.00 43.28  ? 291 GLU A CD  1 
ATOM   1817 O OE1 . GLU A 1 291 ? 93.913  7.888   -119.815 1.00 47.49  ? 291 GLU A OE1 1 
ATOM   1818 O OE2 . GLU A 1 291 ? 92.676  6.065   -119.860 1.00 45.71  ? 291 GLU A OE2 1 
ATOM   1819 N N   . PHE A 1 292 ? 89.465  8.388   -123.524 1.00 39.14  ? 292 PHE A N   1 
ATOM   1820 C CA  . PHE A 1 292 ? 88.132  7.853   -123.809 1.00 34.94  ? 292 PHE A CA  1 
ATOM   1821 C C   . PHE A 1 292 ? 88.160  6.639   -124.728 1.00 33.38  ? 292 PHE A C   1 
ATOM   1822 O O   . PHE A 1 292 ? 89.011  6.537   -125.597 1.00 33.70  ? 292 PHE A O   1 
ATOM   1823 C CB  . PHE A 1 292 ? 87.277  8.943   -124.447 1.00 32.44  ? 292 PHE A CB  1 
ATOM   1824 C CG  . PHE A 1 292 ? 87.974  9.682   -125.543 1.00 33.33  ? 292 PHE A CG  1 
ATOM   1825 C CD1 . PHE A 1 292 ? 88.666  10.856  -125.274 1.00 42.86  ? 292 PHE A CD1 1 
ATOM   1826 C CD2 . PHE A 1 292 ? 87.959  9.200   -126.841 1.00 36.57  ? 292 PHE A CD2 1 
ATOM   1827 C CE1 . PHE A 1 292 ? 89.326  11.539  -126.286 1.00 36.53  ? 292 PHE A CE1 1 
ATOM   1828 C CE2 . PHE A 1 292 ? 88.616  9.876   -127.859 1.00 32.36  ? 292 PHE A CE2 1 
ATOM   1829 C CZ  . PHE A 1 292 ? 89.299  11.048  -127.580 1.00 31.17  ? 292 PHE A CZ  1 
ATOM   1830 N N   . THR A 1 293 ? 87.203  5.736   -124.537 1.00 36.51  ? 293 THR A N   1 
ATOM   1831 C CA  . THR A 1 293 ? 87.073  4.561   -125.382 1.00 37.39  ? 293 THR A CA  1 
ATOM   1832 C C   . THR A 1 293 ? 86.229  4.870   -126.611 1.00 39.43  ? 293 THR A C   1 
ATOM   1833 O O   . THR A 1 293 ? 85.151  5.470   -126.513 1.00 39.65  ? 293 THR A O   1 
ATOM   1834 C CB  . THR A 1 293 ? 86.426  3.381   -124.635 1.00 37.09  ? 293 THR A CB  1 
ATOM   1835 O OG1 . THR A 1 293 ? 87.102  3.166   -123.391 1.00 35.98  ? 293 THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 293 ? 86.507  2.111   -125.478 1.00 39.77  ? 293 THR A CG2 1 
ATOM   1837 N N   . MET A 1 294 ? 86.739  4.447   -127.762 1.00 39.18  ? 294 MET A N   1 
ATOM   1838 C CA  . MET A 1 294 ? 86.047  4.572   -129.030 1.00 36.81  ? 294 MET A CA  1 
ATOM   1839 C C   . MET A 1 294 ? 85.771  3.187   -129.584 1.00 38.17  ? 294 MET A C   1 
ATOM   1840 O O   . MET A 1 294 ? 86.466  2.216   -129.262 1.00 31.54  ? 294 MET A O   1 
ATOM   1841 C CB  . MET A 1 294 ? 86.906  5.337   -130.037 1.00 35.99  ? 294 MET A CB  1 
ATOM   1842 C CG  . MET A 1 294 ? 87.223  6.765   -129.644 1.00 42.43  ? 294 MET A CG  1 
ATOM   1843 S SD  . MET A 1 294 ? 85.761  7.823   -129.641 1.00 58.81  ? 294 MET A SD  1 
ATOM   1844 C CE  . MET A 1 294 ? 85.367  7.880   -131.385 1.00 66.72  ? 294 MET A CE  1 
ATOM   1845 N N   . ALA A 1 295 ? 84.727  3.109   -130.397 1.00 38.38  ? 295 ALA A N   1 
ATOM   1846 C CA  . ALA A 1 295 ? 84.468  1.957   -131.233 1.00 36.20  ? 295 ALA A CA  1 
ATOM   1847 C C   . ALA A 1 295 ? 84.354  2.539   -132.629 1.00 32.75  ? 295 ALA A C   1 
ATOM   1848 O O   . ALA A 1 295 ? 83.441  3.291   -132.907 1.00 36.72  ? 295 ALA A O   1 
ATOM   1849 C CB  . ALA A 1 295 ? 83.184  1.262   -130.816 1.00 32.31  ? 295 ALA A CB  1 
ATOM   1850 N N   . GLU A 1 296 ? 85.307  2.229   -133.492 1.00 34.29  ? 296 GLU A N   1 
ATOM   1851 C CA  . GLU A 1 296 ? 85.315  2.776   -134.834 1.00 33.59  ? 296 GLU A CA  1 
ATOM   1852 C C   . GLU A 1 296 ? 85.309  1.664   -135.868 1.00 35.94  ? 296 GLU A C   1 
ATOM   1853 O O   . GLU A 1 296 ? 85.980  0.648   -135.702 1.00 41.96  ? 296 GLU A O   1 
ATOM   1854 C CB  . GLU A 1 296 ? 86.532  3.660   -135.025 1.00 34.98  ? 296 GLU A CB  1 
ATOM   1855 C CG  . GLU A 1 296 ? 86.575  4.848   -134.072 1.00 40.16  ? 296 GLU A CG  1 
ATOM   1856 C CD  . GLU A 1 296 ? 87.637  5.857   -134.458 1.00 41.43  ? 296 GLU A CD  1 
ATOM   1857 O OE1 . GLU A 1 296 ? 88.830  5.502   -134.413 1.00 49.33  ? 296 GLU A OE1 1 
ATOM   1858 O OE2 . GLU A 1 296 ? 87.282  7.002   -134.815 1.00 56.29  ? 296 GLU A OE2 1 
ATOM   1859 N N   . ILE A 1 297 ? 84.515  1.860   -136.917 1.00 33.89  ? 297 ILE A N   1 
ATOM   1860 C CA  . ILE A 1 297 ? 84.432  0.939   -138.032 1.00 30.59  ? 297 ILE A CA  1 
ATOM   1861 C C   . ILE A 1 297 ? 84.930  1.670   -139.263 1.00 33.04  ? 297 ILE A C   1 
ATOM   1862 O O   . ILE A 1 297 ? 84.667  2.855   -139.433 1.00 40.03  ? 297 ILE A O   1 
ATOM   1863 C CB  . ILE A 1 297 ? 82.983  0.496   -138.277 1.00 32.20  ? 297 ILE A CB  1 
ATOM   1864 C CG1 . ILE A 1 297 ? 82.429  -0.219  -137.040 1.00 32.95  ? 297 ILE A CG1 1 
ATOM   1865 C CG2 . ILE A 1 297 ? 82.899  -0.405  -139.507 1.00 30.49  ? 297 ILE A CG2 1 
ATOM   1866 C CD1 . ILE A 1 297 ? 81.002  -0.665  -137.176 1.00 27.02  ? 297 ILE A CD1 1 
ATOM   1867 N N   . GLU A 1 298 ? 85.662  0.965   -140.113 1.00 34.97  ? 298 GLU A N   1 
ATOM   1868 C CA  . GLU A 1 298 ? 86.070  1.498   -141.402 1.00 32.42  ? 298 GLU A CA  1 
ATOM   1869 C C   . GLU A 1 298 ? 85.568  0.524   -142.456 1.00 30.79  ? 298 GLU A C   1 
ATOM   1870 O O   . GLU A 1 298 ? 86.087  -0.579  -142.584 1.00 28.15  ? 298 GLU A O   1 
ATOM   1871 C CB  . GLU A 1 298 ? 87.593  1.656   -141.467 1.00 33.55  ? 298 GLU A CB  1 
ATOM   1872 C CG  . GLU A 1 298 ? 88.160  2.674   -140.465 1.00 33.95  ? 298 GLU A CG  1 
ATOM   1873 C CD  . GLU A 1 298 ? 87.907  4.124   -140.867 1.00 41.45  ? 298 GLU A CD  1 
ATOM   1874 O OE1 . GLU A 1 298 ? 88.119  4.458   -142.048 1.00 51.41  ? 298 GLU A OE1 1 
ATOM   1875 O OE2 . GLU A 1 298 ? 87.510  4.939   -140.006 1.00 43.96  ? 298 GLU A OE2 1 
ATOM   1876 N N   . HIS A 1 299 ? 84.537  0.934   -143.187 1.00 33.59  ? 299 HIS A N   1 
ATOM   1877 C CA  . HIS A 1 299 ? 83.902  0.083   -144.187 1.00 33.45  ? 299 HIS A CA  1 
ATOM   1878 C C   . HIS A 1 299 ? 84.370  0.448   -145.592 1.00 33.12  ? 299 HIS A C   1 
ATOM   1879 O O   . HIS A 1 299 ? 83.946  1.455   -146.149 1.00 32.68  ? 299 HIS A O   1 
ATOM   1880 C CB  . HIS A 1 299 ? 82.384  0.219   -144.097 1.00 33.48  ? 299 HIS A CB  1 
ATOM   1881 C CG  . HIS A 1 299 ? 81.646  -0.676  -145.038 1.00 35.10  ? 299 HIS A CG  1 
ATOM   1882 N ND1 . HIS A 1 299 ? 81.363  -0.316  -146.338 1.00 34.96  ? 299 HIS A ND1 1 
ATOM   1883 C CD2 . HIS A 1 299 ? 81.141  -1.920  -144.872 1.00 32.87  ? 299 HIS A CD2 1 
ATOM   1884 C CE1 . HIS A 1 299 ? 80.712  -1.300  -146.931 1.00 34.73  ? 299 HIS A CE1 1 
ATOM   1885 N NE2 . HIS A 1 299 ? 80.563  -2.284  -146.063 1.00 23.81  ? 299 HIS A NE2 1 
ATOM   1886 N N   . PHE A 1 300 ? 85.232  -0.387  -146.164 1.00 33.77  ? 300 PHE A N   1 
ATOM   1887 C CA  . PHE A 1 300 ? 85.787  -0.136  -147.485 1.00 33.92  ? 300 PHE A CA  1 
ATOM   1888 C C   . PHE A 1 300 ? 84.871  -0.693  -148.567 1.00 34.33  ? 300 PHE A C   1 
ATOM   1889 O O   . PHE A 1 300 ? 84.377  -1.814  -148.456 1.00 36.66  ? 300 PHE A O   1 
ATOM   1890 C CB  . PHE A 1 300 ? 87.173  -0.758  -147.604 1.00 36.25  ? 300 PHE A CB  1 
ATOM   1891 C CG  . PHE A 1 300 ? 88.128  -0.292  -146.551 1.00 37.35  ? 300 PHE A CG  1 
ATOM   1892 C CD1 . PHE A 1 300 ? 88.780  0.920   -146.680 1.00 37.76  ? 300 PHE A CD1 1 
ATOM   1893 C CD2 . PHE A 1 300 ? 88.371  -1.065  -145.426 1.00 40.00  ? 300 PHE A CD2 1 
ATOM   1894 C CE1 . PHE A 1 300 ? 89.663  1.354   -145.704 1.00 38.36  ? 300 PHE A CE1 1 
ATOM   1895 C CE2 . PHE A 1 300 ? 89.252  -0.637  -144.448 1.00 35.85  ? 300 PHE A CE2 1 
ATOM   1896 C CZ  . PHE A 1 300 ? 89.898  0.571   -144.586 1.00 34.86  ? 300 PHE A CZ  1 
ATOM   1897 N N   . VAL A 1 301 ? 84.666  0.096   -149.617 1.00 32.99  ? 301 VAL A N   1 
ATOM   1898 C CA  . VAL A 1 301 ? 83.702  -0.230  -150.667 1.00 33.59  ? 301 VAL A CA  1 
ATOM   1899 C C   . VAL A 1 301 ? 84.190  0.277   -152.032 1.00 35.65  ? 301 VAL A C   1 
ATOM   1900 O O   . VAL A 1 301 ? 84.796  1.352   -152.125 1.00 32.57  ? 301 VAL A O   1 
ATOM   1901 C CB  . VAL A 1 301 ? 82.317  0.384   -150.338 1.00 27.98  ? 301 VAL A CB  1 
ATOM   1902 C CG1 . VAL A 1 301 ? 82.445  1.884   -150.106 1.00 19.24  ? 301 VAL A CG1 1 
ATOM   1903 C CG2 . VAL A 1 301 ? 81.301  0.081   -151.440 1.00 28.91  ? 301 VAL A CG2 1 
ATOM   1904 N N   . ASP A 1 302 ? 83.936  -0.508  -153.082 1.00 36.17  ? 302 ASP A N   1 
ATOM   1905 C CA  . ASP A 1 302 ? 84.249  -0.089  -154.449 1.00 37.90  ? 302 ASP A CA  1 
ATOM   1906 C C   . ASP A 1 302 ? 83.301  1.043   -154.839 1.00 39.56  ? 302 ASP A C   1 
ATOM   1907 O O   . ASP A 1 302 ? 82.086  0.873   -154.769 1.00 43.10  ? 302 ASP A O   1 
ATOM   1908 C CB  . ASP A 1 302 ? 84.095  -1.263  -155.424 1.00 39.81  ? 302 ASP A CB  1 
ATOM   1909 C CG  . ASP A 1 302 ? 84.622  -0.950  -156.824 1.00 39.14  ? 302 ASP A CG  1 
ATOM   1910 O OD1 . ASP A 1 302 ? 84.512  0.209   -157.275 1.00 40.95  ? 302 ASP A OD1 1 
ATOM   1911 O OD2 . ASP A 1 302 ? 85.135  -1.878  -157.485 1.00 35.01  ? 302 ASP A OD2 1 
ATOM   1912 N N   . PRO A 1 303 ? 83.845  2.204   -155.248 1.00 40.53  ? 303 PRO A N   1 
ATOM   1913 C CA  . PRO A 1 303 ? 82.959  3.317   -155.596 1.00 40.34  ? 303 PRO A CA  1 
ATOM   1914 C C   . PRO A 1 303 ? 81.935  2.978   -156.692 1.00 40.67  ? 303 PRO A C   1 
ATOM   1915 O O   . PRO A 1 303 ? 80.862  3.579   -156.728 1.00 38.84  ? 303 PRO A O   1 
ATOM   1916 C CB  . PRO A 1 303 ? 83.930  4.410   -156.063 1.00 39.61  ? 303 PRO A CB  1 
ATOM   1917 C CG  . PRO A 1 303 ? 85.207  3.704   -156.361 1.00 38.98  ? 303 PRO A CG  1 
ATOM   1918 C CD  . PRO A 1 303 ? 85.264  2.570   -155.410 1.00 42.08  ? 303 PRO A CD  1 
ATOM   1919 N N   . SER A 1 304 ? 82.262  2.023   -157.562 1.00 41.13  ? 304 SER A N   1 
ATOM   1920 C CA  . SER A 1 304 ? 81.321  1.547   -158.575 1.00 41.30  ? 304 SER A CA  1 
ATOM   1921 C C   . SER A 1 304 ? 80.203  0.704   -157.949 1.00 44.03  ? 304 SER A C   1 
ATOM   1922 O O   . SER A 1 304 ? 79.027  0.915   -158.249 1.00 48.63  ? 304 SER A O   1 
ATOM   1923 C CB  . SER A 1 304 ? 82.053  0.750   -159.660 1.00 37.75  ? 304 SER A CB  1 
ATOM   1924 O OG  . SER A 1 304 ? 82.547  -0.478  -159.158 1.00 35.50  ? 304 SER A OG  1 
ATOM   1925 N N   . GLU A 1 305 ? 80.570  -0.238  -157.076 1.00 46.23  ? 305 GLU A N   1 
ATOM   1926 C CA  . GLU A 1 305 ? 79.596  -1.108  -156.394 1.00 43.74  ? 305 GLU A CA  1 
ATOM   1927 C C   . GLU A 1 305 ? 79.185  -0.520  -155.048 1.00 41.01  ? 305 GLU A C   1 
ATOM   1928 O O   . GLU A 1 305 ? 79.270  -1.191  -154.021 1.00 44.63  ? 305 GLU A O   1 
ATOM   1929 C CB  . GLU A 1 305 ? 80.175  -2.515  -156.181 1.00 43.51  ? 305 GLU A CB  1 
ATOM   1930 C CG  . GLU A 1 305 ? 80.644  -3.223  -157.444 1.00 53.93  ? 305 GLU A CG  1 
ATOM   1931 C CD  . GLU A 1 305 ? 79.544  -3.387  -158.466 1.00 63.40  ? 305 GLU A CD  1 
ATOM   1932 O OE1 . GLU A 1 305 ? 79.311  -2.439  -159.245 1.00 72.47  ? 305 GLU A OE1 1 
ATOM   1933 O OE2 . GLU A 1 305 ? 78.919  -4.467  -158.497 1.00 71.41  ? 305 GLU A OE2 1 
ATOM   1934 N N   . LYS A 1 306 ? 78.727  0.727   -155.048 1.00 40.03  ? 306 LYS A N   1 
ATOM   1935 C CA  . LYS A 1 306 ? 78.421  1.425   -153.801 1.00 40.80  ? 306 LYS A CA  1 
ATOM   1936 C C   . LYS A 1 306 ? 76.929  1.353   -153.489 1.00 39.04  ? 306 LYS A C   1 
ATOM   1937 O O   . LYS A 1 306 ? 76.255  2.372   -153.356 1.00 38.99  ? 306 LYS A O   1 
ATOM   1938 C CB  . LYS A 1 306 ? 78.908  2.877   -153.863 1.00 41.39  ? 306 LYS A CB  1 
ATOM   1939 C CG  . LYS A 1 306 ? 78.950  3.581   -152.512 1.00 40.11  ? 306 LYS A CG  1 
ATOM   1940 C CD  . LYS A 1 306 ? 79.770  4.854   -152.576 1.00 41.38  ? 306 LYS A CD  1 
ATOM   1941 C CE  . LYS A 1 306 ? 79.993  5.440   -151.196 1.00 43.49  ? 306 LYS A CE  1 
ATOM   1942 N NZ  . LYS A 1 306 ? 80.704  6.743   -151.255 1.00 40.77  ? 306 LYS A NZ  1 
ATOM   1943 N N   . ASP A 1 307 ? 76.431  0.128   -153.371 1.00 40.62  ? 307 ASP A N   1 
ATOM   1944 C CA  . ASP A 1 307 ? 75.048  -0.130  -153.000 1.00 39.54  ? 307 ASP A CA  1 
ATOM   1945 C C   . ASP A 1 307 ? 75.052  -1.275  -151.995 1.00 38.26  ? 307 ASP A C   1 
ATOM   1946 O O   . ASP A 1 307 ? 75.630  -2.326  -152.268 1.00 37.44  ? 307 ASP A O   1 
ATOM   1947 C CB  . ASP A 1 307 ? 74.237  -0.501  -154.244 1.00 43.29  ? 307 ASP A CB  1 
ATOM   1948 C CG  . ASP A 1 307 ? 72.783  -0.802  -153.927 1.00 53.21  ? 307 ASP A CG  1 
ATOM   1949 O OD1 . ASP A 1 307 ? 72.073  0.107   -153.439 1.00 67.92  ? 307 ASP A OD1 1 
ATOM   1950 O OD2 . ASP A 1 307 ? 72.349  -1.950  -154.173 1.00 67.63  ? 307 ASP A OD2 1 
ATOM   1951 N N   . HIS A 1 308 ? 74.428  -1.080  -150.835 1.00 36.12  ? 308 HIS A N   1 
ATOM   1952 C CA  . HIS A 1 308 ? 74.502  -2.081  -149.765 1.00 34.39  ? 308 HIS A CA  1 
ATOM   1953 C C   . HIS A 1 308 ? 73.366  -3.109  -149.849 1.00 32.11  ? 308 HIS A C   1 
ATOM   1954 O O   . HIS A 1 308 ? 72.199  -2.745  -149.729 1.00 32.20  ? 308 HIS A O   1 
ATOM   1955 C CB  . HIS A 1 308 ? 74.495  -1.419  -148.388 1.00 32.62  ? 308 HIS A CB  1 
ATOM   1956 C CG  . HIS A 1 308 ? 74.993  -2.315  -147.297 1.00 32.79  ? 308 HIS A CG  1 
ATOM   1957 N ND1 . HIS A 1 308 ? 74.481  -3.575  -147.081 1.00 35.12  ? 308 HIS A ND1 1 
ATOM   1958 C CD2 . HIS A 1 308 ? 75.963  -2.142  -146.370 1.00 30.51  ? 308 HIS A CD2 1 
ATOM   1959 C CE1 . HIS A 1 308 ? 75.107  -4.136  -146.064 1.00 32.10  ? 308 HIS A CE1 1 
ATOM   1960 N NE2 . HIS A 1 308 ? 76.013  -3.288  -145.616 1.00 30.61  ? 308 HIS A NE2 1 
ATOM   1961 N N   . PRO A 1 309 ? 73.708  -4.402  -150.024 1.00 34.15  ? 309 PRO A N   1 
ATOM   1962 C CA  . PRO A 1 309 ? 72.706  -5.465  -150.178 1.00 33.06  ? 309 PRO A CA  1 
ATOM   1963 C C   . PRO A 1 309 ? 71.638  -5.516  -149.083 1.00 33.71  ? 309 PRO A C   1 
ATOM   1964 O O   . PRO A 1 309 ? 70.496  -5.863  -149.365 1.00 40.18  ? 309 PRO A O   1 
ATOM   1965 C CB  . PRO A 1 309 ? 73.546  -6.745  -150.144 1.00 34.01  ? 309 PRO A CB  1 
ATOM   1966 C CG  . PRO A 1 309 ? 74.883  -6.336  -150.598 1.00 37.19  ? 309 PRO A CG  1 
ATOM   1967 C CD  . PRO A 1 309 ? 75.080  -4.942  -150.091 1.00 36.35  ? 309 PRO A CD  1 
ATOM   1968 N N   . LYS A 1 310 ? 72.004  -5.176  -147.851 1.00 32.12  ? 310 LYS A N   1 
ATOM   1969 C CA  . LYS A 1 310 ? 71.072  -5.239  -146.728 1.00 32.33  ? 310 LYS A CA  1 
ATOM   1970 C C   . LYS A 1 310 ? 70.328  -3.935  -146.466 1.00 31.52  ? 310 LYS A C   1 
ATOM   1971 O O   . LYS A 1 310 ? 69.651  -3.816  -145.444 1.00 27.45  ? 310 LYS A O   1 
ATOM   1972 C CB  . LYS A 1 310 ? 71.807  -5.668  -145.455 1.00 31.56  ? 310 LYS A CB  1 
ATOM   1973 C CG  . LYS A 1 310 ? 72.476  -7.023  -145.593 1.00 37.93  ? 310 LYS A CG  1 
ATOM   1974 C CD  . LYS A 1 310 ? 72.856  -7.642  -144.258 1.00 34.45  ? 310 LYS A CD  1 
ATOM   1975 C CE  . LYS A 1 310 ? 74.176  -7.124  -143.741 1.00 36.28  ? 310 LYS A CE  1 
ATOM   1976 N NZ  . LYS A 1 310 ? 74.643  -7.908  -142.560 1.00 34.78  ? 310 LYS A NZ  1 
ATOM   1977 N N   . PHE A 1 311 ? 70.415  -2.966  -147.377 1.00 31.87  ? 311 PHE A N   1 
ATOM   1978 C CA  . PHE A 1 311 ? 69.803  -1.664  -147.104 1.00 35.42  ? 311 PHE A CA  1 
ATOM   1979 C C   . PHE A 1 311 ? 68.318  -1.775  -146.760 1.00 36.12  ? 311 PHE A C   1 
ATOM   1980 O O   . PHE A 1 311 ? 67.821  -1.058  -145.883 1.00 39.27  ? 311 PHE A O   1 
ATOM   1981 C CB  . PHE A 1 311 ? 69.976  -0.664  -148.253 1.00 31.47  ? 311 PHE A CB  1 
ATOM   1982 C CG  . PHE A 1 311 ? 69.346  0.677   -147.958 1.00 30.50  ? 311 PHE A CG  1 
ATOM   1983 C CD1 . PHE A 1 311 ? 69.862  1.490   -146.957 1.00 31.25  ? 311 PHE A CD1 1 
ATOM   1984 C CD2 . PHE A 1 311 ? 68.208  1.096   -148.631 1.00 29.46  ? 311 PHE A CD2 1 
ATOM   1985 C CE1 . PHE A 1 311 ? 69.273  2.707   -146.656 1.00 31.92  ? 311 PHE A CE1 1 
ATOM   1986 C CE2 . PHE A 1 311 ? 67.613  2.319   -148.338 1.00 28.11  ? 311 PHE A CE2 1 
ATOM   1987 C CZ  . PHE A 1 311 ? 68.143  3.122   -147.352 1.00 35.79  ? 311 PHE A CZ  1 
ATOM   1988 N N   . GLN A 1 312 ? 67.616  -2.683  -147.429 1.00 37.75  ? 312 GLN A N   1 
ATOM   1989 C CA  . GLN A 1 312 ? 66.165  -2.760  -147.285 1.00 38.03  ? 312 GLN A CA  1 
ATOM   1990 C C   . GLN A 1 312 ? 65.737  -3.208  -145.893 1.00 38.99  ? 312 GLN A C   1 
ATOM   1991 O O   . GLN A 1 312 ? 64.558  -3.146  -145.558 1.00 42.91  ? 312 GLN A O   1 
ATOM   1992 C CB  . GLN A 1 312 ? 65.550  -3.669  -148.355 1.00 40.46  ? 312 GLN A CB  1 
ATOM   1993 C CG  . GLN A 1 312 ? 64.147  -3.222  -148.801 1.00 47.03  ? 312 GLN A CG  1 
ATOM   1994 C CD  . GLN A 1 312 ? 64.121  -1.812  -149.396 1.00 47.91  ? 312 GLN A CD  1 
ATOM   1995 O OE1 . GLN A 1 312 ? 65.064  -1.384  -150.063 1.00 41.26  ? 312 GLN A OE1 1 
ATOM   1996 N NE2 . GLN A 1 312 ? 63.034  -1.088  -149.152 1.00 52.71  ? 312 GLN A NE2 1 
ATOM   1997 N N   . ASN A 1 313 ? 66.695  -3.639  -145.079 1.00 38.62  ? 313 ASN A N   1 
ATOM   1998 C CA  . ASN A 1 313 ? 66.418  -3.968  -143.689 1.00 36.04  ? 313 ASN A CA  1 
ATOM   1999 C C   . ASN A 1 313 ? 66.194  -2.727  -142.829 1.00 37.46  ? 313 ASN A C   1 
ATOM   2000 O O   . ASN A 1 313 ? 65.599  -2.822  -141.764 1.00 44.17  ? 313 ASN A O   1 
ATOM   2001 C CB  . ASN A 1 313 ? 67.554  -4.803  -143.096 1.00 33.07  ? 313 ASN A CB  1 
ATOM   2002 C CG  . ASN A 1 313 ? 67.778  -6.119  -143.832 1.00 31.78  ? 313 ASN A CG  1 
ATOM   2003 O OD1 . ASN A 1 313 ? 68.753  -6.815  -143.566 1.00 41.34  ? 313 ASN A OD1 1 
ATOM   2004 N ND2 . ASN A 1 313 ? 66.889  -6.460  -144.761 1.00 32.08  ? 313 ASN A ND2 1 
ATOM   2005 N N   . VAL A 1 314 ? 66.679  -1.573  -143.279 1.00 40.91  ? 314 VAL A N   1 
ATOM   2006 C CA  . VAL A 1 314 ? 66.546  -0.325  -142.514 1.00 39.76  ? 314 VAL A CA  1 
ATOM   2007 C C   . VAL A 1 314 ? 65.784  0.774   -143.269 1.00 40.43  ? 314 VAL A C   1 
ATOM   2008 O O   . VAL A 1 314 ? 65.548  1.853   -142.720 1.00 38.58  ? 314 VAL A O   1 
ATOM   2009 C CB  . VAL A 1 314 ? 67.932  0.227   -142.096 1.00 41.06  ? 314 VAL A CB  1 
ATOM   2010 C CG1 . VAL A 1 314 ? 68.641  -0.751  -141.187 1.00 36.79  ? 314 VAL A CG1 1 
ATOM   2011 C CG2 . VAL A 1 314 ? 68.787  0.526   -143.318 1.00 43.68  ? 314 VAL A CG2 1 
ATOM   2012 N N   . ALA A 1 315 ? 65.384  0.494   -144.509 1.00 36.12  ? 315 ALA A N   1 
ATOM   2013 C CA  . ALA A 1 315 ? 64.727  1.491   -145.357 1.00 35.88  ? 315 ALA A CA  1 
ATOM   2014 C C   . ALA A 1 315 ? 63.436  2.056   -144.757 1.00 37.85  ? 315 ALA A C   1 
ATOM   2015 O O   . ALA A 1 315 ? 63.080  3.198   -145.039 1.00 41.15  ? 315 ALA A O   1 
ATOM   2016 C CB  . ALA A 1 315 ? 64.452  0.905   -146.733 1.00 30.09  ? 315 ALA A CB  1 
ATOM   2017 N N   . ASP A 1 316 ? 62.743  1.266   -143.936 1.00 39.57  ? 316 ASP A N   1 
ATOM   2018 C CA  . ASP A 1 316 ? 61.455  1.673   -143.356 1.00 39.98  ? 316 ASP A CA  1 
ATOM   2019 C C   . ASP A 1 316 ? 61.580  2.469   -142.057 1.00 36.28  ? 316 ASP A C   1 
ATOM   2020 O O   . ASP A 1 316 ? 60.579  2.962   -141.543 1.00 37.46  ? 316 ASP A O   1 
ATOM   2021 C CB  . ASP A 1 316 ? 60.558  0.447   -143.111 1.00 43.88  ? 316 ASP A CB  1 
ATOM   2022 C CG  . ASP A 1 316 ? 60.059  -0.186  -144.400 1.00 53.82  ? 316 ASP A CG  1 
ATOM   2023 O OD1 . ASP A 1 316 ? 59.610  0.555   -145.293 1.00 63.03  ? 316 ASP A OD1 1 
ATOM   2024 O OD2 . ASP A 1 316 ? 60.101  -1.430  -144.517 1.00 60.48  ? 316 ASP A OD2 1 
ATOM   2025 N N   . LEU A 1 317 ? 62.789  2.596   -141.520 1.00 38.16  ? 317 LEU A N   1 
ATOM   2026 C CA  . LEU A 1 317 ? 62.987  3.381   -140.298 1.00 41.00  ? 317 LEU A CA  1 
ATOM   2027 C C   . LEU A 1 317 ? 62.658  4.852   -140.541 1.00 42.21  ? 317 LEU A C   1 
ATOM   2028 O O   . LEU A 1 317 ? 63.001  5.404   -141.585 1.00 44.11  ? 317 LEU A O   1 
ATOM   2029 C CB  . LEU A 1 317 ? 64.422  3.252   -139.782 1.00 40.79  ? 317 LEU A CB  1 
ATOM   2030 C CG  . LEU A 1 317 ? 64.761  1.913   -139.131 1.00 41.21  ? 317 LEU A CG  1 
ATOM   2031 C CD1 . LEU A 1 317 ? 66.267  1.770   -138.944 1.00 48.09  ? 317 LEU A CD1 1 
ATOM   2032 C CD2 . LEU A 1 317 ? 64.032  1.769   -137.800 1.00 38.85  ? 317 LEU A CD2 1 
ATOM   2033 N N   . HIS A 1 318 ? 61.975  5.469   -139.582 1.00 42.27  ? 318 HIS A N   1 
ATOM   2034 C CA  . HIS A 1 318 ? 61.663  6.892   -139.645 1.00 41.54  ? 318 HIS A CA  1 
ATOM   2035 C C   . HIS A 1 318 ? 62.502  7.618   -138.615 1.00 40.78  ? 318 HIS A C   1 
ATOM   2036 O O   . HIS A 1 318 ? 62.363  7.385   -137.419 1.00 44.29  ? 318 HIS A O   1 
ATOM   2037 C CB  . HIS A 1 318 ? 60.176  7.127   -139.400 1.00 41.36  ? 318 HIS A CB  1 
ATOM   2038 C CG  . HIS A 1 318 ? 59.301  6.496   -140.436 1.00 45.24  ? 318 HIS A CG  1 
ATOM   2039 N ND1 . HIS A 1 318 ? 58.946  7.140   -141.602 1.00 46.25  ? 318 HIS A ND1 1 
ATOM   2040 C CD2 . HIS A 1 318 ? 58.737  5.267   -140.497 1.00 48.47  ? 318 HIS A CD2 1 
ATOM   2041 C CE1 . HIS A 1 318 ? 58.190  6.338   -142.331 1.00 52.27  ? 318 HIS A CE1 1 
ATOM   2042 N NE2 . HIS A 1 318 ? 58.050  5.195   -141.683 1.00 53.60  ? 318 HIS A NE2 1 
ATOM   2043 N N   . LEU A 1 319 ? 63.398  8.478   -139.080 1.00 42.60  ? 319 LEU A N   1 
ATOM   2044 C CA  . LEU A 1 319 ? 64.294  9.186   -138.178 1.00 41.60  ? 319 LEU A CA  1 
ATOM   2045 C C   . LEU A 1 319 ? 64.508  10.633  -138.593 1.00 40.17  ? 319 LEU A C   1 
ATOM   2046 O O   . LEU A 1 319 ? 64.378  10.984  -139.762 1.00 45.39  ? 319 LEU A O   1 
ATOM   2047 C CB  . LEU A 1 319 ? 65.622  8.433   -138.038 1.00 45.57  ? 319 LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 319 ? 66.147  7.643   -139.239 1.00 45.22  ? 319 LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 319 ? 66.741  8.576   -140.265 1.00 44.42  ? 319 LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 319 ? 67.179  6.630   -138.781 1.00 39.02  ? 319 LEU A CD2 1 
ATOM   2051 N N   . TYR A 1 320 ? 64.811  11.469  -137.605 1.00 38.83  ? 320 TYR A N   1 
ATOM   2052 C CA  . TYR A 1 320 ? 65.020  12.889  -137.821 1.00 35.35  ? 320 TYR A CA  1 
ATOM   2053 C C   . TYR A 1 320 ? 66.347  13.126  -138.531 1.00 33.16  ? 320 TYR A C   1 
ATOM   2054 O O   . TYR A 1 320 ? 67.409  12.794  -138.013 1.00 30.36  ? 320 TYR A O   1 
ATOM   2055 C CB  . TYR A 1 320 ? 64.959  13.658  -136.496 1.00 38.15  ? 320 TYR A CB  1 
ATOM   2056 C CG  . TYR A 1 320 ? 63.567  13.698  -135.902 1.00 39.34  ? 320 TYR A CG  1 
ATOM   2057 C CD1 . TYR A 1 320 ? 63.129  12.694  -135.046 1.00 45.50  ? 320 TYR A CD1 1 
ATOM   2058 C CD2 . TYR A 1 320 ? 62.679  14.729  -136.212 1.00 40.94  ? 320 TYR A CD2 1 
ATOM   2059 C CE1 . TYR A 1 320 ? 61.851  12.714  -134.505 1.00 47.01  ? 320 TYR A CE1 1 
ATOM   2060 C CE2 . TYR A 1 320 ? 61.396  14.759  -135.679 1.00 39.44  ? 320 TYR A CE2 1 
ATOM   2061 C CZ  . TYR A 1 320 ? 60.989  13.746  -134.824 1.00 48.79  ? 320 TYR A CZ  1 
ATOM   2062 O OH  . TYR A 1 320 ? 59.723  13.753  -134.284 1.00 47.38  ? 320 TYR A OH  1 
ATOM   2063 N N   . LEU A 1 321 ? 66.264  13.686  -139.732 1.00 33.88  ? 321 LEU A N   1 
ATOM   2064 C CA  . LEU A 1 321 ? 67.430  14.046  -140.516 1.00 33.39  ? 321 LEU A CA  1 
ATOM   2065 C C   . LEU A 1 321 ? 67.525  15.564  -140.601 1.00 35.59  ? 321 LEU A C   1 
ATOM   2066 O O   . LEU A 1 321 ? 66.511  16.250  -140.757 1.00 39.31  ? 321 LEU A O   1 
ATOM   2067 C CB  . LEU A 1 321 ? 67.327  13.421  -141.906 1.00 30.70  ? 321 LEU A CB  1 
ATOM   2068 C CG  . LEU A 1 321 ? 67.277  11.887  -141.895 1.00 31.16  ? 321 LEU A CG  1 
ATOM   2069 C CD1 . LEU A 1 321 ? 67.244  11.333  -143.301 1.00 27.26  ? 321 LEU A CD1 1 
ATOM   2070 C CD2 . LEU A 1 321 ? 68.463  11.299  -141.129 1.00 29.48  ? 321 LEU A CD2 1 
ATOM   2071 N N   . TYR A 1 322 ? 68.744  16.083  -140.488 1.00 36.50  ? 322 TYR A N   1 
ATOM   2072 C CA  . TYR A 1 322 ? 68.979  17.523  -140.444 1.00 36.10  ? 322 TYR A CA  1 
ATOM   2073 C C   . TYR A 1 322 ? 70.037  17.867  -141.486 1.00 38.03  ? 322 TYR A C   1 
ATOM   2074 O O   . TYR A 1 322 ? 71.237  17.847  -141.210 1.00 34.77  ? 322 TYR A O   1 
ATOM   2075 C CB  . TYR A 1 322 ? 69.410  17.908  -139.030 1.00 34.18  ? 322 TYR A CB  1 
ATOM   2076 C CG  . TYR A 1 322 ? 69.446  19.388  -138.691 1.00 35.38  ? 322 TYR A CG  1 
ATOM   2077 C CD1 . TYR A 1 322 ? 68.479  20.278  -139.157 1.00 39.02  ? 322 TYR A CD1 1 
ATOM   2078 C CD2 . TYR A 1 322 ? 70.425  19.885  -137.833 1.00 42.06  ? 322 TYR A CD2 1 
ATOM   2079 C CE1 . TYR A 1 322 ? 68.519  21.637  -138.803 1.00 36.21  ? 322 TYR A CE1 1 
ATOM   2080 C CE2 . TYR A 1 322 ? 70.469  21.225  -137.476 1.00 38.23  ? 322 TYR A CE2 1 
ATOM   2081 C CZ  . TYR A 1 322 ? 69.518  22.096  -137.958 1.00 34.64  ? 322 TYR A CZ  1 
ATOM   2082 O OH  . TYR A 1 322 ? 69.592  23.419  -137.584 1.00 30.07  ? 322 TYR A OH  1 
ATOM   2083 N N   . SER A 1 323 ? 69.572  18.172  -142.695 1.00 39.89  ? 323 SER A N   1 
ATOM   2084 C CA  . SER A 1 323 ? 70.449  18.318  -143.855 1.00 37.84  ? 323 SER A CA  1 
ATOM   2085 C C   . SER A 1 323 ? 71.345  19.540  -143.762 1.00 38.98  ? 323 SER A C   1 
ATOM   2086 O O   . SER A 1 323 ? 71.091  20.449  -142.971 1.00 39.46  ? 323 SER A O   1 
ATOM   2087 C CB  . SER A 1 323 ? 69.616  18.417  -145.129 1.00 37.31  ? 323 SER A CB  1 
ATOM   2088 O OG  . SER A 1 323 ? 68.861  19.617  -145.145 1.00 38.12  ? 323 SER A OG  1 
ATOM   2089 N N   . ALA A 1 324 ? 72.389  19.555  -144.587 1.00 38.49  ? 324 ALA A N   1 
ATOM   2090 C CA  . ALA A 1 324 ? 73.229  20.737  -144.739 1.00 37.18  ? 324 ALA A CA  1 
ATOM   2091 C C   . ALA A 1 324 ? 72.407  21.880  -145.332 1.00 39.26  ? 324 ALA A C   1 
ATOM   2092 O O   . ALA A 1 324 ? 72.619  23.042  -144.993 1.00 42.55  ? 324 ALA A O   1 
ATOM   2093 C CB  . ALA A 1 324 ? 74.430  20.432  -145.614 1.00 29.31  ? 324 ALA A CB  1 
ATOM   2094 N N   . LYS A 1 325 ? 71.465  21.548  -146.211 1.00 38.69  ? 325 LYS A N   1 
ATOM   2095 C CA  . LYS A 1 325 ? 70.570  22.556  -146.775 1.00 42.27  ? 325 LYS A CA  1 
ATOM   2096 C C   . LYS A 1 325 ? 69.657  23.145  -145.703 1.00 41.87  ? 325 LYS A C   1 
ATOM   2097 O O   . LYS A 1 325 ? 69.522  24.363  -145.598 1.00 40.06  ? 325 LYS A O   1 
ATOM   2098 C CB  . LYS A 1 325 ? 69.724  21.975  -147.915 1.00 43.86  ? 325 LYS A CB  1 
ATOM   2099 C CG  . LYS A 1 325 ? 70.441  21.918  -149.265 1.00 49.75  ? 325 LYS A CG  1 
ATOM   2100 C CD  . LYS A 1 325 ? 69.650  21.114  -150.301 1.00 50.06  ? 325 LYS A CD  1 
ATOM   2101 C CE  . LYS A 1 325 ? 68.375  21.836  -150.747 1.00 59.90  ? 325 LYS A CE  1 
ATOM   2102 N NZ  . LYS A 1 325 ? 67.414  20.920  -151.419 1.00 56.55  ? 325 LYS A NZ  1 
ATOM   2103 N N   . ALA A 1 326 ? 69.032  22.277  -144.912 1.00 42.24  ? 326 ALA A N   1 
ATOM   2104 C CA  . ALA A 1 326 ? 68.109  22.721  -143.867 1.00 41.39  ? 326 ALA A CA  1 
ATOM   2105 C C   . ALA A 1 326 ? 68.781  23.709  -142.915 1.00 41.15  ? 326 ALA A C   1 
ATOM   2106 O O   . ALA A 1 326 ? 68.164  24.686  -142.484 1.00 38.62  ? 326 ALA A O   1 
ATOM   2107 C CB  . ALA A 1 326 ? 67.567  21.530  -143.094 1.00 40.15  ? 326 ALA A CB  1 
ATOM   2108 N N   . GLN A 1 327 ? 70.048  23.444  -142.601 1.00 40.09  ? 327 GLN A N   1 
ATOM   2109 C CA  . GLN A 1 327 ? 70.846  24.315  -141.738 1.00 39.00  ? 327 GLN A CA  1 
ATOM   2110 C C   . GLN A 1 327 ? 71.183  25.645  -142.412 1.00 40.60  ? 327 GLN A C   1 
ATOM   2111 O O   . GLN A 1 327 ? 71.168  26.689  -141.766 1.00 44.35  ? 327 GLN A O   1 
ATOM   2112 C CB  . GLN A 1 327 ? 72.140  23.611  -141.329 1.00 34.02  ? 327 GLN A CB  1 
ATOM   2113 C CG  . GLN A 1 327 ? 71.919  22.418  -140.437 1.00 33.68  ? 327 GLN A CG  1 
ATOM   2114 C CD  . GLN A 1 327 ? 73.134  21.528  -140.359 1.00 37.94  ? 327 GLN A CD  1 
ATOM   2115 O OE1 . GLN A 1 327 ? 74.153  21.913  -139.789 1.00 40.26  ? 327 GLN A OE1 1 
ATOM   2116 N NE2 . GLN A 1 327 ? 73.036  20.327  -140.930 1.00 27.39  ? 327 GLN A NE2 1 
ATOM   2117 N N   . VAL A 1 328 ? 71.497  25.596  -143.704 1.00 40.58  ? 328 VAL A N   1 
ATOM   2118 C CA  . VAL A 1 328 ? 71.828  26.798  -144.467 1.00 38.87  ? 328 VAL A CA  1 
ATOM   2119 C C   . VAL A 1 328 ? 70.588  27.669  -144.668 1.00 40.06  ? 328 VAL A C   1 
ATOM   2120 O O   . VAL A 1 328 ? 70.629  28.877  -144.440 1.00 40.69  ? 328 VAL A O   1 
ATOM   2121 C CB  . VAL A 1 328 ? 72.454  26.440  -145.838 1.00 39.27  ? 328 VAL A CB  1 
ATOM   2122 C CG1 . VAL A 1 328 ? 72.564  27.678  -146.726 1.00 27.13  ? 328 VAL A CG1 1 
ATOM   2123 C CG2 . VAL A 1 328 ? 73.824  25.774  -145.640 1.00 31.80  ? 328 VAL A CG2 1 
ATOM   2124 N N   . SER A 1 329 ? 69.489  27.046  -145.091 1.00 41.55  ? 329 SER A N   1 
ATOM   2125 C CA  . SER A 1 329 ? 68.209  27.738  -145.251 1.00 38.35  ? 329 SER A CA  1 
ATOM   2126 C C   . SER A 1 329 ? 67.596  28.129  -143.905 1.00 36.49  ? 329 SER A C   1 
ATOM   2127 O O   . SER A 1 329 ? 66.740  29.001  -143.844 1.00 34.38  ? 329 SER A O   1 
ATOM   2128 C CB  . SER A 1 329 ? 67.224  26.863  -146.030 1.00 38.20  ? 329 SER A CB  1 
ATOM   2129 O OG  . SER A 1 329 ? 66.879  25.698  -145.299 1.00 42.72  ? 329 SER A OG  1 
ATOM   2130 N N   . GLY A 1 330 ? 68.028  27.476  -142.830 1.00 41.85  ? 330 GLY A N   1 
ATOM   2131 C CA  . GLY A 1 330 ? 67.562  27.807  -141.485 1.00 43.06  ? 330 GLY A CA  1 
ATOM   2132 C C   . GLY A 1 330 ? 66.178  27.269  -141.159 1.00 44.56  ? 330 GLY A C   1 
ATOM   2133 O O   . GLY A 1 330 ? 65.406  27.922  -140.459 1.00 39.88  ? 330 GLY A O   1 
ATOM   2134 N N   . GLN A 1 331 ? 65.865  26.076  -141.662 1.00 47.12  ? 331 GLN A N   1 
ATOM   2135 C CA  . GLN A 1 331 ? 64.620  25.388  -141.318 1.00 48.24  ? 331 GLN A CA  1 
ATOM   2136 C C   . GLN A 1 331 ? 64.935  24.206  -140.408 1.00 46.70  ? 331 GLN A C   1 
ATOM   2137 O O   . GLN A 1 331 ? 66.101  23.879  -140.201 1.00 50.48  ? 331 GLN A O   1 
ATOM   2138 C CB  . GLN A 1 331 ? 63.869  24.940  -142.577 1.00 51.24  ? 331 GLN A CB  1 
ATOM   2139 C CG  . GLN A 1 331 ? 64.574  23.875  -143.407 1.00 54.10  ? 331 GLN A CG  1 
ATOM   2140 C CD  . GLN A 1 331 ? 63.832  23.539  -144.690 1.00 53.96  ? 331 GLN A CD  1 
ATOM   2141 O OE1 . GLN A 1 331 ? 63.745  22.372  -145.080 1.00 61.69  ? 331 GLN A OE1 1 
ATOM   2142 N NE2 . GLN A 1 331 ? 63.291  24.561  -145.352 1.00 42.16  ? 331 GLN A NE2 1 
ATOM   2143 N N   . SER A 1 332 ? 63.897  23.572  -139.868 1.00 44.61  ? 332 SER A N   1 
ATOM   2144 C CA  . SER A 1 332 ? 64.067  22.529  -138.849 1.00 43.49  ? 332 SER A CA  1 
ATOM   2145 C C   . SER A 1 332 ? 64.460  21.177  -139.433 1.00 43.45  ? 332 SER A C   1 
ATOM   2146 O O   . SER A 1 332 ? 64.456  20.980  -140.649 1.00 40.69  ? 332 SER A O   1 
ATOM   2147 C CB  . SER A 1 332 ? 62.784  22.365  -138.023 1.00 43.81  ? 332 SER A CB  1 
ATOM   2148 O OG  . SER A 1 332 ? 62.591  23.462  -137.148 1.00 45.92  ? 332 SER A OG  1 
ATOM   2149 N N   . ALA A 1 333 ? 64.805  20.249  -138.543 1.00 46.08  ? 333 ALA A N   1 
ATOM   2150 C CA  . ALA A 1 333 ? 65.089  18.873  -138.920 1.00 45.23  ? 333 ALA A CA  1 
ATOM   2151 C C   . ALA A 1 333 ? 63.793  18.180  -139.332 1.00 48.45  ? 333 ALA A C   1 
ATOM   2152 O O   . ALA A 1 333 ? 62.720  18.515  -138.831 1.00 49.11  ? 333 ALA A O   1 
ATOM   2153 C CB  . ALA A 1 333 ? 65.732  18.143  -137.772 1.00 43.76  ? 333 ALA A CB  1 
ATOM   2154 N N   . ARG A 1 334 ? 63.907  17.221  -140.248 1.00 50.33  ? 334 ARG A N   1 
ATOM   2155 C CA  . ARG A 1 334 ? 62.756  16.511  -140.802 1.00 51.00  ? 334 ARG A CA  1 
ATOM   2156 C C   . ARG A 1 334 ? 62.798  15.049  -140.398 1.00 49.08  ? 334 ARG A C   1 
ATOM   2157 O O   . ARG A 1 334 ? 63.843  14.410  -140.498 1.00 48.06  ? 334 ARG A O   1 
ATOM   2158 C CB  . ARG A 1 334 ? 62.780  16.577  -142.329 1.00 52.03  ? 334 ARG A CB  1 
ATOM   2159 C CG  . ARG A 1 334 ? 62.540  17.953  -142.917 1.00 60.34  ? 334 ARG A CG  1 
ATOM   2160 C CD  . ARG A 1 334 ? 63.046  18.037  -144.356 1.00 61.75  ? 334 ARG A CD  1 
ATOM   2161 N NE  . ARG A 1 334 ? 62.569  16.936  -145.195 1.00 64.10  ? 334 ARG A NE  1 
ATOM   2162 C CZ  . ARG A 1 334 ? 62.950  16.734  -146.456 1.00 68.95  ? 334 ARG A CZ  1 
ATOM   2163 N NH1 . ARG A 1 334 ? 63.812  17.559  -147.046 1.00 75.89  ? 334 ARG A NH1 1 
ATOM   2164 N NH2 . ARG A 1 334 ? 62.463  15.702  -147.138 1.00 68.06  ? 334 ARG A NH2 1 
ATOM   2165 N N   . LYS A 1 335 ? 61.660  14.517  -139.961 1.00 48.01  ? 335 LYS A N   1 
ATOM   2166 C CA  . LYS A 1 335 ? 61.522  13.082  -139.745 1.00 46.95  ? 335 LYS A CA  1 
ATOM   2167 C C   . LYS A 1 335 ? 61.179  12.432  -141.077 1.00 44.87  ? 335 LYS A C   1 
ATOM   2168 O O   . LYS A 1 335 ? 60.089  12.636  -141.604 1.00 47.90  ? 335 LYS A O   1 
ATOM   2169 C CB  . LYS A 1 335 ? 60.441  12.785  -138.707 1.00 45.52  ? 335 LYS A CB  1 
ATOM   2170 C CG  . LYS A 1 335 ? 60.263  11.307  -138.433 1.00 53.02  ? 335 LYS A CG  1 
ATOM   2171 C CD  . LYS A 1 335 ? 59.638  11.031  -137.069 1.00 54.06  ? 335 LYS A CD  1 
ATOM   2172 C CE  . LYS A 1 335 ? 59.573  9.531   -136.806 1.00 56.21  ? 335 LYS A CE  1 
ATOM   2173 N NZ  . LYS A 1 335 ? 59.266  9.191   -135.389 1.00 61.68  ? 335 LYS A NZ  1 
ATOM   2174 N N   . MET A 1 336 ? 62.120  11.668  -141.626 1.00 43.56  ? 336 MET A N   1 
ATOM   2175 C CA  . MET A 1 336 ? 61.942  11.027  -142.925 1.00 41.30  ? 336 MET A CA  1 
ATOM   2176 C C   . MET A 1 336 ? 62.062  9.521   -142.821 1.00 39.44  ? 336 MET A C   1 
ATOM   2177 O O   . MET A 1 336 ? 62.705  9.000   -141.915 1.00 40.58  ? 336 MET A O   1 
ATOM   2178 C CB  . MET A 1 336 ? 63.015  11.488  -143.908 1.00 39.20  ? 336 MET A CB  1 
ATOM   2179 C CG  . MET A 1 336 ? 62.950  12.924  -144.316 1.00 37.34  ? 336 MET A CG  1 
ATOM   2180 S SD  . MET A 1 336 ? 63.964  13.186  -145.782 1.00 48.78  ? 336 MET A SD  1 
ATOM   2181 C CE  . MET A 1 336 ? 62.930  12.506  -147.084 1.00 47.84  ? 336 MET A CE  1 
ATOM   2182 N N   . ARG A 1 337 ? 61.461  8.836   -143.787 1.00 38.82  ? 337 ARG A N   1 
ATOM   2183 C CA  . ARG A 1 337 ? 61.685  7.415   -143.995 1.00 35.94  ? 337 ARG A CA  1 
ATOM   2184 C C   . ARG A 1 337 ? 63.063  7.255   -144.628 1.00 31.36  ? 337 ARG A C   1 
ATOM   2185 O O   . ARG A 1 337 ? 63.353  7.873   -145.650 1.00 32.11  ? 337 ARG A O   1 
ATOM   2186 C CB  . ARG A 1 337 ? 60.607  6.836   -144.919 1.00 35.97  ? 337 ARG A CB  1 
ATOM   2187 C CG  . ARG A 1 337 ? 60.757  5.347   -145.203 1.00 41.39  ? 337 ARG A CG  1 
ATOM   2188 C CD  . ARG A 1 337 ? 59.586  4.786   -145.993 1.00 37.53  ? 337 ARG A CD  1 
ATOM   2189 N NE  . ARG A 1 337 ? 59.851  3.420   -146.449 1.00 36.80  ? 337 ARG A NE  1 
ATOM   2190 C CZ  . ARG A 1 337 ? 60.560  3.102   -147.534 1.00 39.24  ? 337 ARG A CZ  1 
ATOM   2191 N NH1 . ARG A 1 337 ? 61.078  4.049   -148.312 1.00 40.70  ? 337 ARG A NH1 1 
ATOM   2192 N NH2 . ARG A 1 337 ? 60.751  1.825   -147.856 1.00 35.37  ? 337 ARG A NH2 1 
ATOM   2193 N N   . LEU A 1 338 ? 63.904  6.420   -144.028 1.00 31.31  ? 338 LEU A N   1 
ATOM   2194 C CA  . LEU A 1 338 ? 65.287  6.247   -144.487 1.00 31.13  ? 338 LEU A CA  1 
ATOM   2195 C C   . LEU A 1 338 ? 65.327  6.016   -146.003 1.00 33.50  ? 338 LEU A C   1 
ATOM   2196 O O   . LEU A 1 338 ? 66.112  6.646   -146.721 1.00 35.51  ? 338 LEU A O   1 
ATOM   2197 C CB  . LEU A 1 338 ? 65.962  5.092   -143.739 1.00 29.84  ? 338 LEU A CB  1 
ATOM   2198 C CG  . LEU A 1 338 ? 67.434  5.274   -143.353 1.00 35.55  ? 338 LEU A CG  1 
ATOM   2199 C CD1 . LEU A 1 338 ? 67.989  4.019   -142.615 1.00 26.12  ? 338 LEU A CD1 1 
ATOM   2200 C CD2 . LEU A 1 338 ? 68.274  5.604   -144.579 1.00 39.22  ? 338 LEU A CD2 1 
ATOM   2201 N N   . GLY A 1 339 ? 64.457  5.131   -146.483 1.00 31.34  ? 339 GLY A N   1 
ATOM   2202 C CA  . GLY A 1 339 ? 64.353  4.849   -147.902 1.00 31.01  ? 339 GLY A CA  1 
ATOM   2203 C C   . GLY A 1 339 ? 64.063  6.087   -148.732 1.00 32.69  ? 339 GLY A C   1 
ATOM   2204 O O   . GLY A 1 339 ? 64.728  6.323   -149.746 1.00 28.98  ? 339 GLY A O   1 
ATOM   2205 N N   . ASP A 1 340 ? 63.079  6.881   -148.302 1.00 33.38  ? 340 ASP A N   1 
ATOM   2206 C CA  . ASP A 1 340 ? 62.709  8.120   -149.010 1.00 33.14  ? 340 ASP A CA  1 
ATOM   2207 C C   . ASP A 1 340 ? 63.885  9.081   -149.083 1.00 34.86  ? 340 ASP A C   1 
ATOM   2208 O O   . ASP A 1 340 ? 64.154  9.661   -150.142 1.00 37.64  ? 340 ASP A O   1 
ATOM   2209 C CB  . ASP A 1 340 ? 61.538  8.836   -148.330 1.00 31.50  ? 340 ASP A CB  1 
ATOM   2210 C CG  . ASP A 1 340 ? 60.247  8.040   -148.381 1.00 35.30  ? 340 ASP A CG  1 
ATOM   2211 O OD1 . ASP A 1 340 ? 60.228  6.933   -148.961 1.00 32.89  ? 340 ASP A OD1 1 
ATOM   2212 O OD2 . ASP A 1 340 ? 59.243  8.529   -147.824 1.00 35.67  ? 340 ASP A OD2 1 
ATOM   2213 N N   . ALA A 1 341 ? 64.575  9.240   -147.954 1.00 33.54  ? 341 ALA A N   1 
ATOM   2214 C CA  . ALA A 1 341 ? 65.748  10.105  -147.865 1.00 31.92  ? 341 ALA A CA  1 
ATOM   2215 C C   . ALA A 1 341 ? 66.787  9.762   -148.932 1.00 32.46  ? 341 ALA A C   1 
ATOM   2216 O O   . ALA A 1 341 ? 67.370  10.661  -149.544 1.00 33.14  ? 341 ALA A O   1 
ATOM   2217 C CB  . ALA A 1 341 ? 66.365  10.017  -146.470 1.00 31.18  ? 341 ALA A CB  1 
ATOM   2218 N N   . VAL A 1 342 ? 67.013  8.470   -149.162 1.00 31.49  ? 342 VAL A N   1 
ATOM   2219 C CA  . VAL A 1 342 ? 67.972  8.047   -150.181 1.00 29.79  ? 342 VAL A CA  1 
ATOM   2220 C C   . VAL A 1 342 ? 67.436  8.311   -151.585 1.00 31.36  ? 342 VAL A C   1 
ATOM   2221 O O   . VAL A 1 342 ? 68.180  8.775   -152.443 1.00 35.38  ? 342 VAL A O   1 
ATOM   2222 C CB  . VAL A 1 342 ? 68.345  6.564   -150.053 1.00 29.34  ? 342 VAL A CB  1 
ATOM   2223 C CG1 . VAL A 1 342 ? 69.314  6.166   -151.164 1.00 21.26  ? 342 VAL A CG1 1 
ATOM   2224 C CG2 . VAL A 1 342 ? 68.953  6.291   -148.693 1.00 22.44  ? 342 VAL A CG2 1 
ATOM   2225 N N   . GLU A 1 343 ? 66.153  8.034   -151.820 1.00 34.60  ? 343 GLU A N   1 
ATOM   2226 C CA  . GLU A 1 343 ? 65.567  8.255   -153.150 1.00 35.89  ? 343 GLU A CA  1 
ATOM   2227 C C   . GLU A 1 343 ? 65.609  9.732   -153.515 1.00 34.61  ? 343 GLU A C   1 
ATOM   2228 O O   . GLU A 1 343 ? 65.873  10.084  -154.665 1.00 29.06  ? 343 GLU A O   1 
ATOM   2229 C CB  . GLU A 1 343 ? 64.116  7.752   -153.244 1.00 39.94  ? 343 GLU A CB  1 
ATOM   2230 C CG  . GLU A 1 343 ? 63.861  6.292   -152.802 1.00 56.24  ? 343 GLU A CG  1 
ATOM   2231 C CD  . GLU A 1 343 ? 64.898  5.286   -153.310 1.00 65.28  ? 343 GLU A CD  1 
ATOM   2232 O OE1 . GLU A 1 343 ? 64.987  5.100   -154.546 1.00 60.67  ? 343 GLU A OE1 1 
ATOM   2233 O OE2 . GLU A 1 343 ? 65.605  4.668   -152.469 1.00 59.68  ? 343 GLU A OE2 1 
ATOM   2234 N N   . GLN A 1 344 ? 65.361  10.591  -152.528 1.00 37.85  ? 344 GLN A N   1 
ATOM   2235 C CA  . GLN A 1 344 ? 65.268  12.034  -152.763 1.00 40.85  ? 344 GLN A CA  1 
ATOM   2236 C C   . GLN A 1 344 ? 66.623  12.742  -152.861 1.00 39.65  ? 344 GLN A C   1 
ATOM   2237 O O   . GLN A 1 344 ? 66.678  13.928  -153.205 1.00 44.63  ? 344 GLN A O   1 
ATOM   2238 C CB  . GLN A 1 344 ? 64.411  12.694  -151.678 1.00 42.33  ? 344 GLN A CB  1 
ATOM   2239 C CG  . GLN A 1 344 ? 62.937  12.306  -151.762 1.00 49.60  ? 344 GLN A CG  1 
ATOM   2240 C CD  . GLN A 1 344 ? 62.089  12.950  -150.682 1.00 43.28  ? 344 GLN A CD  1 
ATOM   2241 O OE1 . GLN A 1 344 ? 62.369  14.067  -150.233 1.00 45.37  ? 344 GLN A OE1 1 
ATOM   2242 N NE2 . GLN A 1 344 ? 61.038  12.250  -150.264 1.00 36.69  ? 344 GLN A NE2 1 
ATOM   2243 N N   . GLY A 1 345 ? 67.706  12.025  -152.577 1.00 34.38  ? 345 GLY A N   1 
ATOM   2244 C CA  . GLY A 1 345 ? 69.044  12.600  -152.659 1.00 35.22  ? 345 GLY A CA  1 
ATOM   2245 C C   . GLY A 1 345 ? 69.593  13.117  -151.338 1.00 35.48  ? 345 GLY A C   1 
ATOM   2246 O O   . GLY A 1 345 ? 70.755  13.510  -151.272 1.00 36.04  ? 345 GLY A O   1 
ATOM   2247 N N   . VAL A 1 346 ? 68.779  13.100  -150.281 1.00 34.22  ? 346 VAL A N   1 
ATOM   2248 C CA  . VAL A 1 346 ? 69.194  13.627  -148.976 1.00 32.16  ? 346 VAL A CA  1 
ATOM   2249 C C   . VAL A 1 346 ? 70.348  12.823  -148.371 1.00 34.66  ? 346 VAL A C   1 
ATOM   2250 O O   . VAL A 1 346 ? 71.306  13.412  -147.886 1.00 39.46  ? 346 VAL A O   1 
ATOM   2251 C CB  . VAL A 1 346 ? 68.019  13.694  -147.979 1.00 29.99  ? 346 VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 346 ? 68.506  14.110  -146.596 1.00 25.80  ? 346 VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 346 ? 66.974  14.659  -148.474 1.00 21.03  ? 346 VAL A CG2 1 
ATOM   2254 N N   . ILE A 1 347 ? 70.245  11.493  -148.376 1.00 34.68  ? 347 ILE A N   1 
ATOM   2255 C CA  . ILE A 1 347 ? 71.407  10.628  -148.135 1.00 33.91  ? 347 ILE A CA  1 
ATOM   2256 C C   . ILE A 1 347 ? 71.940  10.184  -149.501 1.00 33.65  ? 347 ILE A C   1 
ATOM   2257 O O   . ILE A 1 347 ? 71.178  9.709   -150.344 1.00 35.67  ? 347 ILE A O   1 
ATOM   2258 C CB  . ILE A 1 347 ? 71.076  9.377   -147.272 1.00 36.32  ? 347 ILE A CB  1 
ATOM   2259 C CG1 . ILE A 1 347 ? 70.908  9.741   -145.794 1.00 38.18  ? 347 ILE A CG1 1 
ATOM   2260 C CG2 . ILE A 1 347 ? 72.188  8.341   -147.377 1.00 35.17  ? 347 ILE A CG2 1 
ATOM   2261 C CD1 . ILE A 1 347 ? 69.539  10.236  -145.437 1.00 51.05  ? 347 ILE A CD1 1 
ATOM   2262 N N   . ASN A 1 348 ? 73.244  10.341  -149.709 1.00 30.77  ? 348 ASN A N   1 
ATOM   2263 C CA  . ASN A 1 348 ? 73.866  10.094  -151.012 1.00 32.32  ? 348 ASN A CA  1 
ATOM   2264 C C   . ASN A 1 348 ? 73.677  8.680   -151.555 1.00 32.52  ? 348 ASN A C   1 
ATOM   2265 O O   . ASN A 1 348 ? 73.422  8.508   -152.740 1.00 37.79  ? 348 ASN A O   1 
ATOM   2266 C CB  . ASN A 1 348 ? 75.365  10.400  -150.954 1.00 36.06  ? 348 ASN A CB  1 
ATOM   2267 C CG  . ASN A 1 348 ? 76.088  10.002  -152.224 1.00 31.99  ? 348 ASN A CG  1 
ATOM   2268 O OD1 . ASN A 1 348 ? 76.850  9.036   -152.250 1.00 43.67  ? 348 ASN A OD1 1 
ATOM   2269 N ND2 . ASN A 1 348 ? 75.835  10.734  -153.289 1.00 18.24  ? 348 ASN A ND2 1 
ATOM   2270 N N   . ASN A 1 349 ? 73.823  7.673   -150.700 1.00 33.02  ? 349 ASN A N   1 
ATOM   2271 C CA  . ASN A 1 349 ? 73.788  6.276   -151.148 1.00 31.71  ? 349 ASN A CA  1 
ATOM   2272 C C   . ASN A 1 349 ? 73.359  5.302   -150.049 1.00 32.18  ? 349 ASN A C   1 
ATOM   2273 O O   . ASN A 1 349 ? 73.297  5.666   -148.872 1.00 33.38  ? 349 ASN A O   1 
ATOM   2274 C CB  . ASN A 1 349 ? 75.160  5.877   -151.683 1.00 26.50  ? 349 ASN A CB  1 
ATOM   2275 C CG  . ASN A 1 349 ? 76.219  5.891   -150.613 1.00 30.69  ? 349 ASN A CG  1 
ATOM   2276 O OD1 . ASN A 1 349 ? 76.349  4.942   -149.844 1.00 42.02  ? 349 ASN A OD1 1 
ATOM   2277 N ND2 . ASN A 1 349 ? 76.978  6.974   -150.547 1.00 34.78  ? 349 ASN A ND2 1 
ATOM   2278 N N   . THR A 1 350 ? 73.085  4.060   -150.439 1.00 32.44  ? 350 THR A N   1 
ATOM   2279 C CA  . THR A 1 350 ? 72.554  3.060   -149.509 1.00 31.85  ? 350 THR A CA  1 
ATOM   2280 C C   . THR A 1 350 ? 73.598  2.427   -148.587 1.00 32.78  ? 350 THR A C   1 
ATOM   2281 O O   . THR A 1 350 ? 73.231  1.747   -147.631 1.00 37.03  ? 350 THR A O   1 
ATOM   2282 C CB  . THR A 1 350 ? 71.820  1.930   -150.252 1.00 32.70  ? 350 THR A CB  1 
ATOM   2283 O OG1 . THR A 1 350 ? 72.716  1.281   -151.164 1.00 30.05  ? 350 THR A OG1 1 
ATOM   2284 C CG2 . THR A 1 350 ? 70.611  2.480   -151.003 1.00 21.38  ? 350 THR A CG2 1 
ATOM   2285 N N   . VAL A 1 351 ? 74.886  2.632   -148.861 1.00 32.11  ? 351 VAL A N   1 
ATOM   2286 C CA  . VAL A 1 351 ? 75.927  2.118   -147.968 1.00 31.62  ? 351 VAL A CA  1 
ATOM   2287 C C   . VAL A 1 351 ? 75.974  3.016   -146.750 1.00 33.17  ? 351 VAL A C   1 
ATOM   2288 O O   . VAL A 1 351 ? 75.859  2.546   -145.619 1.00 34.33  ? 351 VAL A O   1 
ATOM   2289 C CB  . VAL A 1 351 ? 77.323  2.060   -148.622 1.00 30.83  ? 351 VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 351 ? 78.326  1.460   -147.648 1.00 27.40  ? 351 VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 351 ? 77.286  1.247   -149.908 1.00 25.37  ? 351 VAL A CG2 1 
ATOM   2292 N N   . LEU A 1 352 ? 76.139  4.312   -146.994 1.00 35.49  ? 352 LEU A N   1 
ATOM   2293 C CA  . LEU A 1 352 ? 76.021  5.325   -145.942 1.00 32.82  ? 352 LEU A CA  1 
ATOM   2294 C C   . LEU A 1 352 ? 74.664  5.196   -145.249 1.00 30.27  ? 352 LEU A C   1 
ATOM   2295 O O   . LEU A 1 352 ? 74.585  5.202   -144.023 1.00 31.77  ? 352 LEU A O   1 
ATOM   2296 C CB  . LEU A 1 352 ? 76.191  6.726   -146.535 1.00 30.42  ? 352 LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 352 ? 75.892  7.911   -145.623 1.00 33.38  ? 352 LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 352 ? 76.793  7.875   -144.401 1.00 36.00  ? 352 LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 352 ? 76.046  9.218   -146.394 1.00 31.01  ? 352 LEU A CD2 1 
ATOM   2300 N N   . GLY A 1 353 ? 73.607  5.055   -146.046 1.00 29.78  ? 353 GLY A N   1 
ATOM   2301 C CA  . GLY A 1 353 ? 72.250  4.903   -145.526 1.00 31.77  ? 353 GLY A CA  1 
ATOM   2302 C C   . GLY A 1 353 ? 72.102  3.729   -144.579 1.00 30.03  ? 353 GLY A C   1 
ATOM   2303 O O   . GLY A 1 353 ? 71.556  3.874   -143.485 1.00 27.78  ? 353 GLY A O   1 
ATOM   2304 N N   . TYR A 1 354 ? 72.596  2.566   -144.994 1.00 29.51  ? 354 TYR A N   1 
ATOM   2305 C CA  . TYR A 1 354 ? 72.510  1.367   -144.170 1.00 31.01  ? 354 TYR A CA  1 
ATOM   2306 C C   . TYR A 1 354 ? 73.078  1.631   -142.784 1.00 29.89  ? 354 TYR A C   1 
ATOM   2307 O O   . TYR A 1 354 ? 72.411  1.391   -141.784 1.00 31.36  ? 354 TYR A O   1 
ATOM   2308 C CB  . TYR A 1 354 ? 73.244  0.190   -144.820 1.00 34.49  ? 354 TYR A CB  1 
ATOM   2309 C CG  . TYR A 1 354 ? 73.234  -1.061  -143.968 1.00 32.71  ? 354 TYR A CG  1 
ATOM   2310 C CD1 . TYR A 1 354 ? 72.053  -1.759  -143.748 1.00 39.42  ? 354 TYR A CD1 1 
ATOM   2311 C CD2 . TYR A 1 354 ? 74.395  -1.536  -143.374 1.00 34.21  ? 354 TYR A CD2 1 
ATOM   2312 C CE1 . TYR A 1 354 ? 72.025  -2.897  -142.967 1.00 39.02  ? 354 TYR A CE1 1 
ATOM   2313 C CE2 . TYR A 1 354 ? 74.380  -2.681  -142.587 1.00 37.78  ? 354 TYR A CE2 1 
ATOM   2314 C CZ  . TYR A 1 354 ? 73.190  -3.356  -142.384 1.00 39.29  ? 354 TYR A CZ  1 
ATOM   2315 O OH  . TYR A 1 354 ? 73.154  -4.496  -141.609 1.00 32.02  ? 354 TYR A OH  1 
ATOM   2316 N N   . PHE A 1 355 ? 74.301  2.151   -142.731 1.00 32.34  ? 355 PHE A N   1 
ATOM   2317 C CA  . PHE A 1 355 ? 74.963  2.401   -141.450 1.00 34.58  ? 355 PHE A CA  1 
ATOM   2318 C C   . PHE A 1 355 ? 74.265  3.451   -140.593 1.00 33.12  ? 355 PHE A C   1 
ATOM   2319 O O   . PHE A 1 355 ? 74.225  3.305   -139.373 1.00 30.66  ? 355 PHE A O   1 
ATOM   2320 C CB  . PHE A 1 355 ? 76.445  2.734   -141.643 1.00 37.11  ? 355 PHE A CB  1 
ATOM   2321 C CG  . PHE A 1 355 ? 77.288  1.528   -141.911 1.00 35.88  ? 355 PHE A CG  1 
ATOM   2322 C CD1 . PHE A 1 355 ? 77.599  1.155   -143.207 1.00 39.48  ? 355 PHE A CD1 1 
ATOM   2323 C CD2 . PHE A 1 355 ? 77.732  0.736   -140.863 1.00 36.01  ? 355 PHE A CD2 1 
ATOM   2324 C CE1 . PHE A 1 355 ? 78.370  0.021   -143.460 1.00 39.60  ? 355 PHE A CE1 1 
ATOM   2325 C CE2 . PHE A 1 355 ? 78.498  -0.400  -141.104 1.00 38.19  ? 355 PHE A CE2 1 
ATOM   2326 C CZ  . PHE A 1 355 ? 78.820  -0.755  -142.409 1.00 39.06  ? 355 PHE A CZ  1 
ATOM   2327 N N   . ILE A 1 356 ? 73.704  4.488   -141.217 1.00 32.14  ? 356 ILE A N   1 
ATOM   2328 C CA  . ILE A 1 356 ? 72.893  5.473   -140.485 1.00 33.02  ? 356 ILE A CA  1 
ATOM   2329 C C   . ILE A 1 356 ? 71.793  4.735   -139.710 1.00 35.29  ? 356 ILE A C   1 
ATOM   2330 O O   . ILE A 1 356 ? 71.606  4.950   -138.511 1.00 33.96  ? 356 ILE A O   1 
ATOM   2331 C CB  . ILE A 1 356 ? 72.223  6.512   -141.424 1.00 34.72  ? 356 ILE A CB  1 
ATOM   2332 C CG1 . ILE A 1 356 ? 73.271  7.307   -142.228 1.00 37.73  ? 356 ILE A CG1 1 
ATOM   2333 C CG2 . ILE A 1 356 ? 71.311  7.457   -140.626 1.00 28.73  ? 356 ILE A CG2 1 
ATOM   2334 C CD1 . ILE A 1 356 ? 73.533  8.695   -141.733 1.00 40.19  ? 356 ILE A CD1 1 
ATOM   2335 N N   . GLY A 1 357 ? 71.078  3.855   -140.405 1.00 37.07  ? 357 GLY A N   1 
ATOM   2336 C CA  . GLY A 1 357 ? 69.994  3.089   -139.798 1.00 38.80  ? 357 GLY A CA  1 
ATOM   2337 C C   . GLY A 1 357 ? 70.476  2.118   -138.737 1.00 39.46  ? 357 GLY A C   1 
ATOM   2338 O O   . GLY A 1 357 ? 69.806  1.900   -137.727 1.00 40.64  ? 357 GLY A O   1 
ATOM   2339 N N   . ARG A 1 358 ? 71.642  1.530   -138.968 1.00 38.78  ? 358 ARG A N   1 
ATOM   2340 C CA  . ARG A 1 358 ? 72.241  0.615   -138.000 1.00 39.28  ? 358 ARG A CA  1 
ATOM   2341 C C   . ARG A 1 358 ? 72.709  1.357   -136.750 1.00 41.91  ? 358 ARG A C   1 
ATOM   2342 O O   . ARG A 1 358 ? 72.555  0.854   -135.632 1.00 46.79  ? 358 ARG A O   1 
ATOM   2343 C CB  . ARG A 1 358 ? 73.404  -0.127  -138.637 1.00 38.31  ? 358 ARG A CB  1 
ATOM   2344 C CG  . ARG A 1 358 ? 72.973  -1.292  -139.513 1.00 38.26  ? 358 ARG A CG  1 
ATOM   2345 C CD  . ARG A 1 358 ? 72.966  -2.587  -138.725 1.00 46.59  ? 358 ARG A CD  1 
ATOM   2346 N NE  . ARG A 1 358 ? 71.629  -3.002  -138.314 1.00 46.51  ? 358 ARG A NE  1 
ATOM   2347 C CZ  . ARG A 1 358 ? 71.377  -3.896  -137.358 1.00 35.20  ? 358 ARG A CZ  1 
ATOM   2348 N NH1 . ARG A 1 358 ? 72.363  -4.466  -136.669 1.00 25.64  ? 358 ARG A NH1 1 
ATOM   2349 N NH2 . ARG A 1 358 ? 70.122  -4.208  -137.076 1.00 38.55  ? 358 ARG A NH2 1 
ATOM   2350 N N   . ILE A 1 359 ? 73.289  2.542   -136.949 1.00 37.46  ? 359 ILE A N   1 
ATOM   2351 C CA  . ILE A 1 359 ? 73.644  3.426   -135.845 1.00 34.99  ? 359 ILE A CA  1 
ATOM   2352 C C   . ILE A 1 359 ? 72.378  3.786   -135.075 1.00 34.93  ? 359 ILE A C   1 
ATOM   2353 O O   . ILE A 1 359 ? 72.353  3.741   -133.846 1.00 38.46  ? 359 ILE A O   1 
ATOM   2354 C CB  . ILE A 1 359 ? 74.327  4.721   -136.330 1.00 32.55  ? 359 ILE A CB  1 
ATOM   2355 C CG1 . ILE A 1 359 ? 75.724  4.427   -136.885 1.00 35.71  ? 359 ILE A CG1 1 
ATOM   2356 C CG2 . ILE A 1 359 ? 74.426  5.730   -135.190 1.00 28.80  ? 359 ILE A CG2 1 
ATOM   2357 C CD1 . ILE A 1 359 ? 76.204  5.443   -137.956 1.00 29.06  ? 359 ILE A CD1 1 
ATOM   2358 N N   . TYR A 1 360 ? 71.326  4.137   -135.806 1.00 38.75  ? 360 TYR A N   1 
ATOM   2359 C CA  . TYR A 1 360 ? 70.048  4.492   -135.186 1.00 38.78  ? 360 TYR A CA  1 
ATOM   2360 C C   . TYR A 1 360 ? 69.532  3.358   -134.311 1.00 39.19  ? 360 TYR A C   1 
ATOM   2361 O O   . TYR A 1 360 ? 69.170  3.579   -133.160 1.00 41.27  ? 360 TYR A O   1 
ATOM   2362 C CB  . TYR A 1 360 ? 68.995  4.827   -136.242 1.00 37.52  ? 360 TYR A CB  1 
ATOM   2363 C CG  . TYR A 1 360 ? 67.638  5.053   -135.642 1.00 37.45  ? 360 TYR A CG  1 
ATOM   2364 C CD1 . TYR A 1 360 ? 67.289  6.300   -135.132 1.00 37.98  ? 360 TYR A CD1 1 
ATOM   2365 C CD2 . TYR A 1 360 ? 66.704  4.022   -135.564 1.00 38.30  ? 360 TYR A CD2 1 
ATOM   2366 C CE1 . TYR A 1 360 ? 66.043  6.523   -134.565 1.00 38.01  ? 360 TYR A CE1 1 
ATOM   2367 C CE2 . TYR A 1 360 ? 65.444  4.236   -134.995 1.00 35.45  ? 360 TYR A CE2 1 
ATOM   2368 C CZ  . TYR A 1 360 ? 65.125  5.491   -134.496 1.00 35.30  ? 360 TYR A CZ  1 
ATOM   2369 O OH  . TYR A 1 360 ? 63.895  5.731   -133.929 1.00 38.16  ? 360 TYR A OH  1 
ATOM   2370 N N   . LEU A 1 361 ? 69.498  2.149   -134.864 1.00 37.16  ? 361 LEU A N   1 
ATOM   2371 C CA  . LEU A 1 361 ? 69.027  0.989   -134.119 1.00 34.62  ? 361 LEU A CA  1 
ATOM   2372 C C   . LEU A 1 361 ? 69.890  0.717   -132.890 1.00 38.04  ? 361 LEU A C   1 
ATOM   2373 O O   . LEU A 1 361 ? 69.354  0.401   -131.831 1.00 37.58  ? 361 LEU A O   1 
ATOM   2374 C CB  . LEU A 1 361 ? 68.983  -0.254  -135.007 1.00 30.40  ? 361 LEU A CB  1 
ATOM   2375 C CG  . LEU A 1 361 ? 67.909  -0.250  -136.095 1.00 30.31  ? 361 LEU A CG  1 
ATOM   2376 C CD1 . LEU A 1 361 ? 68.076  -1.457  -137.019 1.00 10.15  ? 361 LEU A CD1 1 
ATOM   2377 C CD2 . LEU A 1 361 ? 66.511  -0.199  -135.487 1.00 13.08  ? 361 LEU A CD2 1 
ATOM   2378 N N   . TYR A 1 362 ? 71.213  0.841   -133.022 1.00 39.26  ? 362 TYR A N   1 
ATOM   2379 C CA  . TYR A 1 362 ? 72.105  0.595   -131.883 1.00 39.39  ? 362 TYR A CA  1 
ATOM   2380 C C   . TYR A 1 362 ? 71.858  1.573   -130.737 1.00 39.42  ? 362 TYR A C   1 
ATOM   2381 O O   . TYR A 1 362 ? 71.744  1.164   -129.579 1.00 33.96  ? 362 TYR A O   1 
ATOM   2382 C CB  . TYR A 1 362 ? 73.588  0.656   -132.270 1.00 39.69  ? 362 TYR A CB  1 
ATOM   2383 C CG  . TYR A 1 362 ? 74.487  0.567   -131.049 1.00 37.18  ? 362 TYR A CG  1 
ATOM   2384 C CD1 . TYR A 1 362 ? 74.652  -0.631  -130.371 1.00 39.79  ? 362 TYR A CD1 1 
ATOM   2385 C CD2 . TYR A 1 362 ? 75.132  1.687   -130.551 1.00 40.78  ? 362 TYR A CD2 1 
ATOM   2386 C CE1 . TYR A 1 362 ? 75.452  -0.711  -129.241 1.00 41.91  ? 362 TYR A CE1 1 
ATOM   2387 C CE2 . TYR A 1 362 ? 75.936  1.615   -129.425 1.00 36.25  ? 362 TYR A CE2 1 
ATOM   2388 C CZ  . TYR A 1 362 ? 76.088  0.420   -128.773 1.00 37.09  ? 362 TYR A CZ  1 
ATOM   2389 O OH  . TYR A 1 362 ? 76.882  0.359   -127.651 1.00 39.40  ? 362 TYR A OH  1 
ATOM   2390 N N   . LEU A 1 363 ? 71.789  2.860   -131.065 1.00 39.42  ? 363 LEU A N   1 
ATOM   2391 C CA  . LEU A 1 363 ? 71.657  3.908   -130.047 1.00 39.14  ? 363 LEU A CA  1 
ATOM   2392 C C   . LEU A 1 363 ? 70.332  3.763   -129.317 1.00 36.85  ? 363 LEU A C   1 
ATOM   2393 O O   . LEU A 1 363 ? 70.239  3.903   -128.100 1.00 37.09  ? 363 LEU A O   1 
ATOM   2394 C CB  . LEU A 1 363 ? 71.751  5.292   -130.692 1.00 35.34  ? 363 LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 363 ? 73.112  5.624   -131.312 1.00 34.88  ? 363 LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 363 ? 73.020  6.856   -132.184 1.00 34.15  ? 363 LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 363 ? 74.168  5.802   -130.237 1.00 30.35  ? 363 LEU A CD2 1 
ATOM   2398 N N   . THR A 1 364 ? 69.311  3.447   -130.088 1.00 37.52  ? 364 THR A N   1 
ATOM   2399 C CA  . THR A 1 364 ? 67.966  3.340   -129.578 1.00 35.80  ? 364 THR A CA  1 
ATOM   2400 C C   . THR A 1 364 ? 67.827  2.070   -128.715 1.00 36.62  ? 364 THR A C   1 
ATOM   2401 O O   . THR A 1 364 ? 67.125  2.068   -127.710 1.00 43.28  ? 364 THR A O   1 
ATOM   2402 C CB  . THR A 1 364 ? 66.976  3.397   -130.767 1.00 30.67  ? 364 THR A CB  1 
ATOM   2403 O OG1 . THR A 1 364 ? 65.722  3.916   -130.326 1.00 55.81  ? 364 THR A OG1 1 
ATOM   2404 C CG2 . THR A 1 364 ? 66.806  2.038   -131.428 1.00 22.73  ? 364 THR A CG2 1 
ATOM   2405 N N   . LYS A 1 365 ? 68.541  1.016   -129.093 1.00 37.26  ? 365 LYS A N   1 
ATOM   2406 C CA  . LYS A 1 365 ? 68.544  -0.257  -128.364 1.00 36.00  ? 365 LYS A CA  1 
ATOM   2407 C C   . LYS A 1 365 ? 69.235  -0.139  -127.007 1.00 38.99  ? 365 LYS A C   1 
ATOM   2408 O O   . LYS A 1 365 ? 68.914  -0.867  -126.061 1.00 42.06  ? 365 LYS A O   1 
ATOM   2409 C CB  . LYS A 1 365 ? 69.233  -1.336  -129.222 1.00 34.86  ? 365 LYS A CB  1 
ATOM   2410 C CG  . LYS A 1 365 ? 69.719  -2.574  -128.481 1.00 38.18  ? 365 LYS A CG  1 
ATOM   2411 C CD  . LYS A 1 365 ? 69.756  -3.824  -129.374 1.00 41.06  ? 365 LYS A CD  1 
ATOM   2412 C CE  . LYS A 1 365 ? 70.685  -3.685  -130.557 1.00 45.91  ? 365 LYS A CE  1 
ATOM   2413 N NZ  . LYS A 1 365 ? 70.834  -4.973  -131.288 1.00 43.44  ? 365 LYS A NZ  1 
ATOM   2414 N N   . VAL A 1 366 ? 70.182  0.784   -126.919 1.00 40.92  ? 366 VAL A N   1 
ATOM   2415 C CA  . VAL A 1 366 ? 71.046  0.909   -125.755 1.00 34.80  ? 366 VAL A CA  1 
ATOM   2416 C C   . VAL A 1 366 ? 70.491  1.954   -124.763 1.00 38.60  ? 366 VAL A C   1 
ATOM   2417 O O   . VAL A 1 366 ? 71.042  2.134   -123.671 1.00 40.51  ? 366 VAL A O   1 
ATOM   2418 C CB  . VAL A 1 366 ? 72.482  1.264   -126.226 1.00 31.82  ? 366 VAL A CB  1 
ATOM   2419 C CG1 . VAL A 1 366 ? 72.755  2.756   -126.100 1.00 22.91  ? 366 VAL A CG1 1 
ATOM   2420 C CG2 . VAL A 1 366 ? 73.514  0.446   -125.488 1.00 42.26  ? 366 VAL A CG2 1 
ATOM   2421 N N   . GLY A 1 367 ? 69.408  2.641   -125.145 1.00 36.78  ? 367 GLY A N   1 
ATOM   2422 C CA  . GLY A 1 367 ? 68.689  3.537   -124.228 1.00 36.40  ? 367 GLY A CA  1 
ATOM   2423 C C   . GLY A 1 367 ? 68.432  4.978   -124.663 1.00 37.64  ? 367 GLY A C   1 
ATOM   2424 O O   . GLY A 1 367 ? 67.759  5.718   -123.949 1.00 39.55  ? 367 GLY A O   1 
ATOM   2425 N N   . ILE A 1 368 ? 68.949  5.394   -125.818 1.00 36.65  ? 368 ILE A N   1 
ATOM   2426 C CA  . ILE A 1 368 ? 68.746  6.768   -126.283 1.00 33.85  ? 368 ILE A CA  1 
ATOM   2427 C C   . ILE A 1 368 ? 67.300  6.899   -126.766 1.00 34.20  ? 368 ILE A C   1 
ATOM   2428 O O   . ILE A 1 368 ? 66.765  5.979   -127.381 1.00 39.11  ? 368 ILE A O   1 
ATOM   2429 C CB  . ILE A 1 368 ? 69.712  7.153   -127.436 1.00 35.60  ? 368 ILE A CB  1 
ATOM   2430 C CG1 . ILE A 1 368 ? 71.173  6.802   -127.106 1.00 35.82  ? 368 ILE A CG1 1 
ATOM   2431 C CG2 . ILE A 1 368 ? 69.603  8.642   -127.760 1.00 33.27  ? 368 ILE A CG2 1 
ATOM   2432 C CD1 . ILE A 1 368 ? 71.842  7.749   -126.196 1.00 35.68  ? 368 ILE A CD1 1 
ATOM   2433 N N   . SER A 1 369 ? 66.669  8.034   -126.478 1.00 37.90  ? 369 SER A N   1 
ATOM   2434 C CA  . SER A 1 369 ? 65.274  8.277   -126.867 1.00 37.85  ? 369 SER A CA  1 
ATOM   2435 C C   . SER A 1 369 ? 65.203  8.804   -128.296 1.00 40.67  ? 369 SER A C   1 
ATOM   2436 O O   . SER A 1 369 ? 65.884  9.782   -128.629 1.00 40.29  ? 369 SER A O   1 
ATOM   2437 C CB  . SER A 1 369 ? 64.615  9.298   -125.943 1.00 37.62  ? 369 SER A CB  1 
ATOM   2438 O OG  . SER A 1 369 ? 64.984  9.090   -124.594 1.00 52.99  ? 369 SER A OG  1 
ATOM   2439 N N   . PRO A 1 370 ? 64.375  8.169   -129.145 1.00 41.45  ? 370 PRO A N   1 
ATOM   2440 C CA  . PRO A 1 370 ? 64.228  8.606   -130.532 1.00 40.06  ? 370 PRO A CA  1 
ATOM   2441 C C   . PRO A 1 370 ? 63.852  10.078  -130.689 1.00 39.69  ? 370 PRO A C   1 
ATOM   2442 O O   . PRO A 1 370 ? 64.351  10.745  -131.593 1.00 45.19  ? 370 PRO A O   1 
ATOM   2443 C CB  . PRO A 1 370 ? 63.105  7.711   -131.064 1.00 38.78  ? 370 PRO A CB  1 
ATOM   2444 C CG  . PRO A 1 370 ? 63.134  6.521   -130.211 1.00 36.80  ? 370 PRO A CG  1 
ATOM   2445 C CD  . PRO A 1 370 ? 63.545  6.984   -128.860 1.00 39.55  ? 370 PRO A CD  1 
ATOM   2446 N N   . ASP A 1 371 ? 62.983  10.578  -129.819 1.00 40.05  ? 371 ASP A N   1 
ATOM   2447 C CA  . ASP A 1 371 ? 62.549  11.979  -129.895 1.00 43.99  ? 371 ASP A CA  1 
ATOM   2448 C C   . ASP A 1 371 ? 63.685  12.962  -129.598 1.00 44.00  ? 371 ASP A C   1 
ATOM   2449 O O   . ASP A 1 371 ? 63.592  14.134  -129.952 1.00 46.99  ? 371 ASP A O   1 
ATOM   2450 C CB  . ASP A 1 371 ? 61.357  12.251  -128.963 1.00 45.99  ? 371 ASP A CB  1 
ATOM   2451 C CG  . ASP A 1 371 ? 61.636  11.863  -127.514 1.00 56.98  ? 371 ASP A CG  1 
ATOM   2452 O OD1 . ASP A 1 371 ? 62.070  10.715  -127.276 1.00 69.42  ? 371 ASP A OD1 1 
ATOM   2453 O OD2 . ASP A 1 371 ? 61.410  12.697  -126.613 1.00 55.17  ? 371 ASP A OD2 1 
ATOM   2454 N N   . LYS A 1 372 ? 64.743  12.481  -128.946 1.00 43.94  ? 372 LYS A N   1 
ATOM   2455 C CA  . LYS A 1 372 ? 65.926  13.291  -128.665 1.00 41.56  ? 372 LYS A CA  1 
ATOM   2456 C C   . LYS A 1 372 ? 67.154  12.768  -129.422 1.00 39.83  ? 372 LYS A C   1 
ATOM   2457 O O   . LYS A 1 372 ? 68.281  12.842  -128.933 1.00 37.20  ? 372 LYS A O   1 
ATOM   2458 C CB  . LYS A 1 372 ? 66.166  13.332  -127.156 1.00 40.62  ? 372 LYS A CB  1 
ATOM   2459 C CG  . LYS A 1 372 ? 65.192  14.234  -126.426 1.00 43.00  ? 372 LYS A CG  1 
ATOM   2460 C CD  . LYS A 1 372 ? 65.165  13.963  -124.936 1.00 45.36  ? 372 LYS A CD  1 
ATOM   2461 C CE  . LYS A 1 372 ? 64.195  12.844  -124.596 1.00 52.29  ? 372 LYS A CE  1 
ATOM   2462 N NZ  . LYS A 1 372 ? 64.241  12.473  -123.151 1.00 57.97  ? 372 LYS A NZ  1 
ATOM   2463 N N   . LEU A 1 373 ? 66.920  12.256  -130.630 1.00 42.13  ? 373 LEU A N   1 
ATOM   2464 C CA  . LEU A 1 373 ? 67.984  11.743  -131.497 1.00 39.71  ? 373 LEU A CA  1 
ATOM   2465 C C   . LEU A 1 373 ? 67.788  12.263  -132.917 1.00 40.19  ? 373 LEU A C   1 
ATOM   2466 O O   . LEU A 1 373 ? 66.684  12.203  -133.461 1.00 39.80  ? 373 LEU A O   1 
ATOM   2467 C CB  . LEU A 1 373 ? 67.972  10.214  -131.508 1.00 39.33  ? 373 LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 373 ? 69.059  9.515   -132.334 1.00 40.03  ? 373 LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 373 ? 70.446  9.872   -131.816 1.00 38.21  ? 373 LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 373 ? 68.849  8.002   -132.333 1.00 30.25  ? 373 LEU A CD2 1 
ATOM   2471 N N   . ARG A 1 374 ? 68.860  12.773  -133.513 1.00 36.89  ? 374 ARG A N   1 
ATOM   2472 C CA  . ARG A 1 374 ? 68.806  13.265  -134.883 1.00 35.91  ? 374 ARG A CA  1 
ATOM   2473 C C   . ARG A 1 374 ? 70.136  13.036  -135.582 1.00 34.04  ? 374 ARG A C   1 
ATOM   2474 O O   . ARG A 1 374 ? 71.171  12.874  -134.933 1.00 35.21  ? 374 ARG A O   1 
ATOM   2475 C CB  . ARG A 1 374 ? 68.467  14.755  -134.895 1.00 35.20  ? 374 ARG A CB  1 
ATOM   2476 C CG  . ARG A 1 374 ? 69.648  15.652  -134.582 1.00 33.72  ? 374 ARG A CG  1 
ATOM   2477 C CD  . ARG A 1 374 ? 69.260  17.108  -134.473 1.00 37.08  ? 374 ARG A CD  1 
ATOM   2478 N NE  . ARG A 1 374 ? 70.428  17.936  -134.168 1.00 41.16  ? 374 ARG A NE  1 
ATOM   2479 C CZ  . ARG A 1 374 ? 70.391  19.236  -133.878 1.00 40.34  ? 374 ARG A CZ  1 
ATOM   2480 N NH1 . ARG A 1 374 ? 69.240  19.907  -133.845 1.00 38.30  ? 374 ARG A NH1 1 
ATOM   2481 N NH2 . ARG A 1 374 ? 71.520  19.873  -133.613 1.00 38.70  ? 374 ARG A NH2 1 
ATOM   2482 N N   . PHE A 1 375 ? 70.103  13.037  -136.909 1.00 32.94  ? 375 PHE A N   1 
ATOM   2483 C CA  . PHE A 1 375 ? 71.313  12.913  -137.706 1.00 34.11  ? 375 PHE A CA  1 
ATOM   2484 C C   . PHE A 1 375 ? 71.547  14.202  -138.462 1.00 32.03  ? 375 PHE A C   1 
ATOM   2485 O O   . PHE A 1 375 ? 70.708  14.624  -139.252 1.00 33.35  ? 375 PHE A O   1 
ATOM   2486 C CB  . PHE A 1 375 ? 71.201  11.741  -138.669 1.00 34.70  ? 375 PHE A CB  1 
ATOM   2487 C CG  . PHE A 1 375 ? 71.266  10.406  -137.993 1.00 30.46  ? 375 PHE A CG  1 
ATOM   2488 C CD1 . PHE A 1 375 ? 70.152  9.888   -137.357 1.00 34.00  ? 375 PHE A CD1 1 
ATOM   2489 C CD2 . PHE A 1 375 ? 72.438  9.675   -137.987 1.00 29.42  ? 375 PHE A CD2 1 
ATOM   2490 C CE1 . PHE A 1 375 ? 70.205  8.666   -136.733 1.00 36.54  ? 375 PHE A CE1 1 
ATOM   2491 C CE2 . PHE A 1 375 ? 72.500  8.453   -137.363 1.00 35.17  ? 375 PHE A CE2 1 
ATOM   2492 C CZ  . PHE A 1 375 ? 71.381  7.944   -136.735 1.00 38.32  ? 375 PHE A CZ  1 
ATOM   2493 N N   . ARG A 1 376 ? 72.690  14.828  -138.205 1.00 35.49  ? 376 ARG A N   1 
ATOM   2494 C CA  . ARG A 1 376 ? 73.021  16.107  -138.817 1.00 36.55  ? 376 ARG A CA  1 
ATOM   2495 C C   . ARG A 1 376 ? 74.127  15.965  -139.843 1.00 32.86  ? 376 ARG A C   1 
ATOM   2496 O O   . ARG A 1 376 ? 75.205  15.477  -139.544 1.00 35.79  ? 376 ARG A O   1 
ATOM   2497 C CB  . ARG A 1 376 ? 73.447  17.117  -137.757 1.00 35.62  ? 376 ARG A CB  1 
ATOM   2498 C CG  . ARG A 1 376 ? 73.622  18.506  -138.311 1.00 36.44  ? 376 ARG A CG  1 
ATOM   2499 C CD  . ARG A 1 376 ? 74.000  19.499  -137.229 1.00 39.60  ? 376 ARG A CD  1 
ATOM   2500 N NE  . ARG A 1 376 ? 75.398  19.360  -136.820 1.00 37.89  ? 376 ARG A NE  1 
ATOM   2501 C CZ  . ARG A 1 376 ? 76.439  19.721  -137.567 1.00 38.83  ? 376 ARG A CZ  1 
ATOM   2502 N NH1 . ARG A 1 376 ? 76.267  20.250  -138.773 1.00 45.12  ? 376 ARG A NH1 1 
ATOM   2503 N NH2 . ARG A 1 376 ? 77.666  19.550  -137.106 1.00 37.62  ? 376 ARG A NH2 1 
ATOM   2504 N N   . GLN A 1 377 ? 73.842  16.409  -141.056 1.00 38.51  ? 377 GLN A N   1 
ATOM   2505 C CA  . GLN A 1 377 ? 74.833  16.470  -142.114 1.00 39.01  ? 377 GLN A CA  1 
ATOM   2506 C C   . GLN A 1 377 ? 75.751  17.665  -141.886 1.00 40.56  ? 377 GLN A C   1 
ATOM   2507 O O   . GLN A 1 377 ? 75.300  18.731  -141.467 1.00 43.79  ? 377 GLN A O   1 
ATOM   2508 C CB  . GLN A 1 377 ? 74.134  16.617  -143.460 1.00 37.48  ? 377 GLN A CB  1 
ATOM   2509 C CG  . GLN A 1 377 ? 75.058  16.514  -144.641 1.00 35.85  ? 377 GLN A CG  1 
ATOM   2510 C CD  . GLN A 1 377 ? 74.315  16.509  -145.956 1.00 31.58  ? 377 GLN A CD  1 
ATOM   2511 O OE1 . GLN A 1 377 ? 73.306  17.195  -146.125 1.00 28.83  ? 377 GLN A OE1 1 
ATOM   2512 N NE2 . GLN A 1 377 ? 74.817  15.738  -146.900 1.00 21.38  ? 377 GLN A NE2 1 
ATOM   2513 N N   . HIS A 1 378 ? 77.035  17.490  -142.173 1.00 41.27  ? 378 HIS A N   1 
ATOM   2514 C CA  . HIS A 1 378 ? 77.988  18.586  -142.053 1.00 44.07  ? 378 HIS A CA  1 
ATOM   2515 C C   . HIS A 1 378 ? 77.778  19.614  -143.152 1.00 46.86  ? 378 HIS A C   1 
ATOM   2516 O O   . HIS A 1 378 ? 77.349  19.282  -144.257 1.00 44.94  ? 378 HIS A O   1 
ATOM   2517 C CB  . HIS A 1 378 ? 79.422  18.067  -142.107 1.00 43.57  ? 378 HIS A CB  1 
ATOM   2518 C CG  . HIS A 1 378 ? 79.874  17.422  -140.837 1.00 47.12  ? 378 HIS A CG  1 
ATOM   2519 N ND1 . HIS A 1 378 ? 81.187  17.444  -140.418 1.00 42.57  ? 378 HIS A ND1 1 
ATOM   2520 C CD2 . HIS A 1 378 ? 79.184  16.751  -139.884 1.00 50.29  ? 378 HIS A CD2 1 
ATOM   2521 C CE1 . HIS A 1 378 ? 81.289  16.800  -139.269 1.00 45.25  ? 378 HIS A CE1 1 
ATOM   2522 N NE2 . HIS A 1 378 ? 80.087  16.374  -138.922 1.00 46.51  ? 378 HIS A NE2 1 
ATOM   2523 N N   . MET A 1 379 ? 78.089  20.866  -142.828 1.00 51.81  ? 379 MET A N   1 
ATOM   2524 C CA  . MET A 1 379 ? 78.071  21.960  -143.796 1.00 53.11  ? 379 MET A CA  1 
ATOM   2525 C C   . MET A 1 379 ? 79.347  21.856  -144.629 1.00 54.49  ? 379 MET A C   1 
ATOM   2526 O O   . MET A 1 379 ? 80.238  21.067  -144.308 1.00 57.26  ? 379 MET A O   1 
ATOM   2527 C CB  . MET A 1 379 ? 78.047  23.316  -143.078 1.00 53.61  ? 379 MET A CB  1 
ATOM   2528 C CG  . MET A 1 379 ? 77.046  23.449  -141.922 1.00 50.79  ? 379 MET A CG  1 
ATOM   2529 S SD  . MET A 1 379 ? 75.524  24.286  -142.371 1.00 49.98  ? 379 MET A SD  1 
ATOM   2530 C CE  . MET A 1 379 ? 76.113  25.968  -142.590 1.00 52.33  ? 379 MET A CE  1 
ATOM   2531 N N   . GLU A 1 380 ? 79.448  22.658  -145.683 1.00 57.51  ? 380 GLU A N   1 
ATOM   2532 C CA  . GLU A 1 380 ? 80.655  22.670  -146.517 1.00 62.43  ? 380 GLU A CA  1 
ATOM   2533 C C   . GLU A 1 380 ? 81.832  23.323  -145.789 1.00 63.27  ? 380 GLU A C   1 
ATOM   2534 O O   . GLU A 1 380 ? 82.972  22.874  -145.912 1.00 60.05  ? 380 GLU A O   1 
ATOM   2535 C CB  . GLU A 1 380 ? 80.388  23.381  -147.843 1.00 61.54  ? 380 GLU A CB  1 
ATOM   2536 C CG  . GLU A 1 380 ? 79.260  22.745  -148.645 1.00 67.37  ? 380 GLU A CG  1 
ATOM   2537 C CD  . GLU A 1 380 ? 79.224  23.213  -150.084 1.00 71.82  ? 380 GLU A CD  1 
ATOM   2538 O OE1 . GLU A 1 380 ? 80.168  22.893  -150.835 1.00 81.79  ? 380 GLU A OE1 1 
ATOM   2539 O OE2 . GLU A 1 380 ? 78.247  23.892  -150.469 1.00 81.70  ? 380 GLU A OE2 1 
ATOM   2540 N N   . ASN A 1 381 ? 81.538  24.369  -145.018 1.00 67.34  ? 381 ASN A N   1 
ATOM   2541 C CA  . ASN A 1 381 ? 82.559  25.109  -144.266 1.00 69.18  ? 381 ASN A CA  1 
ATOM   2542 C C   . ASN A 1 381 ? 83.327  24.287  -143.224 1.00 70.16  ? 381 ASN A C   1 
ATOM   2543 O O   . ASN A 1 381 ? 84.432  24.661  -142.835 1.00 73.28  ? 381 ASN A O   1 
ATOM   2544 C CB  . ASN A 1 381 ? 81.949  26.353  -143.593 1.00 71.15  ? 381 ASN A CB  1 
ATOM   2545 C CG  . ASN A 1 381 ? 80.721  26.034  -142.748 1.00 72.16  ? 381 ASN A CG  1 
ATOM   2546 O OD1 . ASN A 1 381 ? 79.591  26.083  -143.236 1.00 74.22  ? 381 ASN A OD1 1 
ATOM   2547 N ND2 . ASN A 1 381 ? 80.939  25.728  -141.472 1.00 68.59  ? 381 ASN A ND2 1 
ATOM   2548 N N   . GLU A 1 382 ? 82.752  23.172  -142.784 1.00 70.64  ? 382 GLU A N   1 
ATOM   2549 C CA  . GLU A 1 382 ? 83.372  22.344  -141.749 1.00 71.96  ? 382 GLU A CA  1 
ATOM   2550 C C   . GLU A 1 382 ? 84.586  21.576  -142.298 1.00 77.62  ? 382 GLU A C   1 
ATOM   2551 O O   . GLU A 1 382 ? 85.583  21.403  -141.593 1.00 79.13  ? 382 GLU A O   1 
ATOM   2552 C CB  . GLU A 1 382 ? 82.331  21.396  -141.132 1.00 69.86  ? 382 GLU A CB  1 
ATOM   2553 C CG  . GLU A 1 382 ? 81.090  22.141  -140.611 1.00 65.59  ? 382 GLU A CG  1 
ATOM   2554 C CD  . GLU A 1 382 ? 80.064  21.259  -139.911 1.00 60.71  ? 382 GLU A CD  1 
ATOM   2555 O OE1 . GLU A 1 382 ? 78.862  21.590  -140.009 1.00 29.73  ? 382 GLU A OE1 1 
ATOM   2556 O OE2 . GLU A 1 382 ? 80.442  20.258  -139.264 1.00 52.52  ? 382 GLU A OE2 1 
ATOM   2557 N N   . MET A 1 383 ? 84.494  21.149  -143.560 1.00 81.86  ? 383 MET A N   1 
ATOM   2558 C CA  . MET A 1 383 ? 85.566  20.427  -144.275 1.00 82.70  ? 383 MET A CA  1 
ATOM   2559 C C   . MET A 1 383 ? 86.582  19.732  -143.364 1.00 80.89  ? 383 MET A C   1 
ATOM   2560 O O   . MET A 1 383 ? 86.889  18.554  -143.548 1.00 77.74  ? 383 MET A O   1 
ATOM   2561 C CB  . MET A 1 383 ? 86.286  21.362  -145.266 1.00 83.08  ? 383 MET A CB  1 
ATOM   2562 C CG  . MET A 1 383 ? 87.179  22.438  -144.641 1.00 85.66  ? 383 MET A CG  1 
ATOM   2563 S SD  . MET A 1 383 ? 87.817  23.614  -145.869 1.00 94.28  ? 383 MET A SD  1 
ATOM   2564 C CE  . MET A 1 383 ? 88.808  22.549  -146.924 1.00 88.18  ? 383 MET A CE  1 
ATOM   2565 N N   . TYR A 1 386 ? 90.336  17.623  -149.483 1.00 81.75  ? 386 TYR A N   1 
ATOM   2566 C CA  . TYR A 1 386 ? 89.909  16.336  -148.943 1.00 81.90  ? 386 TYR A CA  1 
ATOM   2567 C C   . TYR A 1 386 ? 88.644  16.503  -148.092 1.00 80.34  ? 386 TYR A C   1 
ATOM   2568 O O   . TYR A 1 386 ? 88.702  16.525  -146.859 1.00 79.70  ? 386 TYR A O   1 
ATOM   2569 C CB  . TYR A 1 386 ? 91.036  15.705  -148.121 1.00 88.01  ? 386 TYR A CB  1 
ATOM   2570 C CG  . TYR A 1 386 ? 92.125  15.039  -148.945 1.00 91.95  ? 386 TYR A CG  1 
ATOM   2571 C CD1 . TYR A 1 386 ? 92.927  15.775  -149.818 1.00 92.19  ? 386 TYR A CD1 1 
ATOM   2572 C CD2 . TYR A 1 386 ? 92.368  13.670  -148.829 1.00 96.03  ? 386 TYR A CD2 1 
ATOM   2573 C CE1 . TYR A 1 386 ? 93.933  15.160  -150.567 1.00 91.39  ? 386 TYR A CE1 1 
ATOM   2574 C CE2 . TYR A 1 386 ? 93.369  13.046  -149.570 1.00 93.20  ? 386 TYR A CE2 1 
ATOM   2575 C CZ  . TYR A 1 386 ? 94.148  13.794  -150.436 1.00 92.20  ? 386 TYR A CZ  1 
ATOM   2576 O OH  . TYR A 1 386 ? 95.138  13.172  -151.164 1.00 89.11  ? 386 TYR A OH  1 
ATOM   2577 N N   . ALA A 1 387 ? 87.505  16.620  -148.772 1.00 77.77  ? 387 ALA A N   1 
ATOM   2578 C CA  . ALA A 1 387 ? 86.209  16.821  -148.124 1.00 74.24  ? 387 ALA A CA  1 
ATOM   2579 C C   . ALA A 1 387 ? 85.517  15.482  -147.837 1.00 72.61  ? 387 ALA A C   1 
ATOM   2580 O O   . ALA A 1 387 ? 86.133  14.415  -147.928 1.00 69.28  ? 387 ALA A O   1 
ATOM   2581 C CB  . ALA A 1 387 ? 85.319  17.707  -149.000 1.00 72.70  ? 387 ALA A CB  1 
ATOM   2582 N N   . CYS A 1 388 ? 84.237  15.549  -147.475 1.00 68.39  ? 388 CYS A N   1 
ATOM   2583 C CA  . CYS A 1 388 ? 83.444  14.356  -147.219 1.00 62.47  ? 388 CYS A CA  1 
ATOM   2584 C C   . CYS A 1 388 ? 81.957  14.673  -147.070 1.00 57.35  ? 388 CYS A C   1 
ATOM   2585 O O   . CYS A 1 388 ? 81.565  15.803  -146.770 1.00 57.41  ? 388 CYS A O   1 
ATOM   2586 C CB  . CYS A 1 388 ? 83.925  13.659  -145.946 1.00 62.59  ? 388 CYS A CB  1 
ATOM   2587 S SG  . CYS A 1 388 ? 83.326  14.415  -144.430 1.00 68.22  ? 388 CYS A SG  1 
ATOM   2588 N N   . ASP A 1 389 ? 81.140  13.650  -147.280 1.00 51.56  ? 389 ASP A N   1 
ATOM   2589 C CA  . ASP A 1 389 ? 79.726  13.703  -146.976 1.00 50.00  ? 389 ASP A CA  1 
ATOM   2590 C C   . ASP A 1 389 ? 79.591  13.072  -145.604 1.00 48.23  ? 389 ASP A C   1 
ATOM   2591 O O   . ASP A 1 389 ? 79.623  11.852  -145.479 1.00 49.93  ? 389 ASP A O   1 
ATOM   2592 C CB  . ASP A 1 389 ? 78.935  12.917  -148.026 1.00 47.48  ? 389 ASP A CB  1 
ATOM   2593 C CG  . ASP A 1 389 ? 77.436  12.976  -147.807 1.00 45.31  ? 389 ASP A CG  1 
ATOM   2594 O OD1 . ASP A 1 389 ? 76.973  13.817  -147.005 1.00 34.43  ? 389 ASP A OD1 1 
ATOM   2595 O OD2 . ASP A 1 389 ? 76.720  12.179  -148.453 1.00 42.12  ? 389 ASP A OD2 1 
ATOM   2596 N N   . CYS A 1 390 ? 79.461  13.906  -144.575 1.00 50.20  ? 390 CYS A N   1 
ATOM   2597 C CA  . CYS A 1 390 ? 79.472  13.430  -143.197 1.00 44.87  ? 390 CYS A CA  1 
ATOM   2598 C C   . CYS A 1 390 ? 78.164  13.673  -142.451 1.00 40.29  ? 390 CYS A C   1 
ATOM   2599 O O   . CYS A 1 390 ? 77.646  14.784  -142.451 1.00 37.74  ? 390 CYS A O   1 
ATOM   2600 C CB  . CYS A 1 390 ? 80.610  14.085  -142.420 1.00 44.52  ? 390 CYS A CB  1 
ATOM   2601 S SG  . CYS A 1 390 ? 80.689  13.500  -140.714 1.00 68.43  ? 390 CYS A SG  1 
ATOM   2602 N N   . TRP A 1 391 ? 77.669  12.624  -141.791 1.00 41.05  ? 391 TRP A N   1 
ATOM   2603 C CA  . TRP A 1 391 ? 76.489  12.693  -140.925 1.00 40.28  ? 391 TRP A CA  1 
ATOM   2604 C C   . TRP A 1 391 ? 76.838  12.299  -139.490 1.00 39.21  ? 391 TRP A C   1 
ATOM   2605 O O   . TRP A 1 391 ? 77.339  11.202  -139.252 1.00 42.85  ? 391 TRP A O   1 
ATOM   2606 C CB  . TRP A 1 391 ? 75.403  11.746  -141.437 1.00 38.31  ? 391 TRP A CB  1 
ATOM   2607 C CG  . TRP A 1 391 ? 74.763  12.189  -142.711 1.00 36.74  ? 391 TRP A CG  1 
ATOM   2608 C CD1 . TRP A 1 391 ? 75.258  12.040  -143.968 1.00 33.43  ? 391 TRP A CD1 1 
ATOM   2609 C CD2 . TRP A 1 391 ? 73.499  12.848  -142.850 1.00 34.96  ? 391 TRP A CD2 1 
ATOM   2610 N NE1 . TRP A 1 391 ? 74.385  12.567  -144.885 1.00 39.38  ? 391 TRP A NE1 1 
ATOM   2611 C CE2 . TRP A 1 391 ? 73.296  13.071  -144.223 1.00 36.40  ? 391 TRP A CE2 1 
ATOM   2612 C CE3 . TRP A 1 391 ? 72.521  13.274  -141.944 1.00 38.79  ? 391 TRP A CE3 1 
ATOM   2613 C CZ2 . TRP A 1 391 ? 72.156  13.709  -144.718 1.00 35.29  ? 391 TRP A CZ2 1 
ATOM   2614 C CZ3 . TRP A 1 391 ? 71.386  13.906  -142.436 1.00 37.53  ? 391 TRP A CZ3 1 
ATOM   2615 C CH2 . TRP A 1 391 ? 71.216  14.116  -143.809 1.00 36.24  ? 391 TRP A CH2 1 
ATOM   2616 N N   . ASP A 1 392 ? 76.559  13.183  -138.537 1.00 39.03  ? 392 ASP A N   1 
ATOM   2617 C CA  . ASP A 1 392 ? 76.742  12.874  -137.114 1.00 39.60  ? 392 ASP A CA  1 
ATOM   2618 C C   . ASP A 1 392 ? 75.418  12.538  -136.426 1.00 37.61  ? 392 ASP A C   1 
ATOM   2619 O O   . ASP A 1 392 ? 74.454  13.298  -136.533 1.00 37.08  ? 392 ASP A O   1 
ATOM   2620 C CB  . ASP A 1 392 ? 77.378  14.063  -136.387 1.00 38.49  ? 392 ASP A CB  1 
ATOM   2621 C CG  . ASP A 1 392 ? 78.820  14.298  -136.790 1.00 41.84  ? 392 ASP A CG  1 
ATOM   2622 O OD1 . ASP A 1 392 ? 79.343  15.392  -136.468 1.00 35.31  ? 392 ASP A OD1 1 
ATOM   2623 O OD2 . ASP A 1 392 ? 79.427  13.399  -137.420 1.00 43.35  ? 392 ASP A OD2 1 
ATOM   2624 N N   . ALA A 1 393 ? 75.379  11.408  -135.718 1.00 35.66  ? 393 ALA A N   1 
ATOM   2625 C CA  . ALA A 1 393 ? 74.302  11.137  -134.759 1.00 35.35  ? 393 ALA A CA  1 
ATOM   2626 C C   . ALA A 1 393 ? 74.466  12.104  -133.600 1.00 37.23  ? 393 ALA A C   1 
ATOM   2627 O O   . ALA A 1 393 ? 75.541  12.170  -132.999 1.00 36.54  ? 393 ALA A O   1 
ATOM   2628 C CB  . ALA A 1 393 ? 74.363  9.720   -134.249 1.00 20.30  ? 393 ALA A CB  1 
ATOM   2629 N N   . GLU A 1 394 ? 73.408  12.856  -133.301 1.00 37.97  ? 394 GLU A N   1 
ATOM   2630 C CA  . GLU A 1 394 ? 73.426  13.824  -132.208 1.00 38.88  ? 394 GLU A CA  1 
ATOM   2631 C C   . GLU A 1 394 ? 72.244  13.600  -131.278 1.00 40.09  ? 394 GLU A C   1 
ATOM   2632 O O   . GLU A 1 394 ? 71.127  13.345  -131.734 1.00 44.94  ? 394 GLU A O   1 
ATOM   2633 C CB  . GLU A 1 394 ? 73.403  15.254  -132.753 1.00 37.03  ? 394 GLU A CB  1 
ATOM   2634 C CG  . GLU A 1 394 ? 74.572  15.561  -133.670 1.00 38.84  ? 394 GLU A CG  1 
ATOM   2635 C CD  . GLU A 1 394 ? 74.659  17.021  -134.058 1.00 39.06  ? 394 GLU A CD  1 
ATOM   2636 O OE1 . GLU A 1 394 ? 73.601  17.672  -134.177 1.00 34.64  ? 394 GLU A OE1 1 
ATOM   2637 O OE2 . GLU A 1 394 ? 75.794  17.513  -134.253 1.00 34.75  ? 394 GLU A OE2 1 
ATOM   2638 N N   . SER A 1 395 ? 72.499  13.695  -129.976 1.00 39.42  ? 395 SER A N   1 
ATOM   2639 C CA  . SER A 1 395 ? 71.469  13.506  -128.965 1.00 39.27  ? 395 SER A CA  1 
ATOM   2640 C C   . SER A 1 395 ? 71.193  14.827  -128.269 1.00 40.49  ? 395 SER A C   1 
ATOM   2641 O O   . SER A 1 395 ? 72.096  15.648  -128.111 1.00 39.75  ? 395 SER A O   1 
ATOM   2642 C CB  . SER A 1 395 ? 71.909  12.455  -127.942 1.00 42.62  ? 395 SER A CB  1 
ATOM   2643 O OG  . SER A 1 395 ? 73.189  12.753  -127.398 1.00 45.70  ? 395 SER A OG  1 
ATOM   2644 N N   . LYS A 1 396 ? 69.942  15.021  -127.858 1.00 40.65  ? 396 LYS A N   1 
ATOM   2645 C CA  . LYS A 1 396 ? 69.534  16.215  -127.123 1.00 41.43  ? 396 LYS A CA  1 
ATOM   2646 C C   . LYS A 1 396 ? 69.794  15.961  -125.638 1.00 40.31  ? 396 LYS A C   1 
ATOM   2647 O O   . LYS A 1 396 ? 69.211  15.047  -125.058 1.00 43.42  ? 396 LYS A O   1 
ATOM   2648 C CB  . LYS A 1 396 ? 68.048  16.507  -127.368 1.00 43.30  ? 396 LYS A CB  1 
ATOM   2649 C CG  . LYS A 1 396 ? 67.682  17.981  -127.557 1.00 42.54  ? 396 LYS A CG  1 
ATOM   2650 C CD  . LYS A 1 396 ? 67.697  18.775  -126.266 1.00 47.23  ? 396 LYS A CD  1 
ATOM   2651 C CE  . LYS A 1 396 ? 66.597  19.847  -126.250 1.00 50.16  ? 396 LYS A CE  1 
ATOM   2652 N NZ  . LYS A 1 396 ? 66.495  20.613  -127.525 1.00 52.97  ? 396 LYS A NZ  1 
ATOM   2653 N N   . THR A 1 397 ? 70.676  16.760  -125.041 1.00 39.09  ? 397 THR A N   1 
ATOM   2654 C CA  . THR A 1 397 ? 71.046  16.623  -123.627 1.00 41.00  ? 397 THR A CA  1 
ATOM   2655 C C   . THR A 1 397 ? 70.935  17.976  -122.917 1.00 39.69  ? 397 THR A C   1 
ATOM   2656 O O   . THR A 1 397 ? 70.561  18.978  -123.526 1.00 32.95  ? 397 THR A O   1 
ATOM   2657 C CB  . THR A 1 397 ? 72.502  16.101  -123.468 1.00 42.41  ? 397 THR A CB  1 
ATOM   2658 O OG1 . THR A 1 397 ? 73.425  17.092  -123.945 1.00 41.67  ? 397 THR A OG1 1 
ATOM   2659 C CG2 . THR A 1 397 ? 72.709  14.795  -124.234 1.00 36.36  ? 397 THR A CG2 1 
ATOM   2660 N N   . SER A 1 398 ? 71.269  18.000  -121.628 1.00 39.22  ? 398 SER A N   1 
ATOM   2661 C CA  . SER A 1 398 ? 71.305  19.251  -120.867 1.00 37.55  ? 398 SER A CA  1 
ATOM   2662 C C   . SER A 1 398 ? 72.439  20.163  -121.336 1.00 36.66  ? 398 SER A C   1 
ATOM   2663 O O   . SER A 1 398 ? 72.427  21.362  -121.058 1.00 34.46  ? 398 SER A O   1 
ATOM   2664 C CB  . SER A 1 398 ? 71.449  18.974  -119.370 1.00 33.60  ? 398 SER A CB  1 
ATOM   2665 O OG  . SER A 1 398 ? 72.664  18.312  -119.090 1.00 42.60  ? 398 SER A OG  1 
ATOM   2666 N N   . TYR A 1 399 ? 73.419  19.591  -122.037 1.00 37.71  ? 399 TYR A N   1 
ATOM   2667 C CA  . TYR A 1 399 ? 74.458  20.380  -122.699 1.00 38.18  ? 399 TYR A CA  1 
ATOM   2668 C C   . TYR A 1 399 ? 74.064  20.769  -124.126 1.00 39.02  ? 399 TYR A C   1 
ATOM   2669 O O   . TYR A 1 399 ? 74.880  21.313  -124.863 1.00 39.98  ? 399 TYR A O   1 
ATOM   2670 C CB  . TYR A 1 399 ? 75.770  19.605  -122.739 1.00 36.69  ? 399 TYR A CB  1 
ATOM   2671 C CG  . TYR A 1 399 ? 76.337  19.264  -121.381 1.00 34.98  ? 399 TYR A CG  1 
ATOM   2672 C CD1 . TYR A 1 399 ? 76.005  18.070  -120.746 1.00 38.34  ? 399 TYR A CD1 1 
ATOM   2673 C CD2 . TYR A 1 399 ? 77.229  20.121  -120.743 1.00 25.44  ? 399 TYR A CD2 1 
ATOM   2674 C CE1 . TYR A 1 399 ? 76.541  17.746  -119.501 1.00 44.46  ? 399 TYR A CE1 1 
ATOM   2675 C CE2 . TYR A 1 399 ? 77.766  19.809  -119.497 1.00 36.34  ? 399 TYR A CE2 1 
ATOM   2676 C CZ  . TYR A 1 399 ? 77.419  18.621  -118.881 1.00 42.30  ? 399 TYR A CZ  1 
ATOM   2677 O OH  . TYR A 1 399 ? 77.950  18.308  -117.651 1.00 37.69  ? 399 TYR A OH  1 
ATOM   2678 N N   . GLY A 1 400 ? 72.815  20.500  -124.505 1.00 40.22  ? 400 GLY A N   1 
ATOM   2679 C CA  . GLY A 1 400 ? 72.339  20.735  -125.866 1.00 36.32  ? 400 GLY A CA  1 
ATOM   2680 C C   . GLY A 1 400 ? 72.560  19.521  -126.748 1.00 34.48  ? 400 GLY A C   1 
ATOM   2681 O O   . GLY A 1 400 ? 72.857  18.426  -126.260 1.00 36.91  ? 400 GLY A O   1 
ATOM   2682 N N   . TRP A 1 401 ? 72.405  19.720  -128.050 1.00 31.54  ? 401 TRP A N   1 
ATOM   2683 C CA  . TRP A 1 401 ? 72.697  18.681  -129.029 1.00 32.61  ? 401 TRP A CA  1 
ATOM   2684 C C   . TRP A 1 401 ? 74.190  18.414  -129.098 1.00 34.06  ? 401 TRP A C   1 
ATOM   2685 O O   . TRP A 1 401 ? 74.960  19.335  -129.339 1.00 34.37  ? 401 TRP A O   1 
ATOM   2686 C CB  . TRP A 1 401 ? 72.219  19.105  -130.406 1.00 29.26  ? 401 TRP A CB  1 
ATOM   2687 C CG  . TRP A 1 401 ? 70.760  19.134  -130.513 1.00 31.40  ? 401 TRP A CG  1 
ATOM   2688 C CD1 . TRP A 1 401 ? 69.953  20.227  -130.416 1.00 25.58  ? 401 TRP A CD1 1 
ATOM   2689 C CD2 . TRP A 1 401 ? 69.902  18.011  -130.727 1.00 36.83  ? 401 TRP A CD2 1 
ATOM   2690 N NE1 . TRP A 1 401 ? 68.641  19.854  -130.562 1.00 28.20  ? 401 TRP A NE1 1 
ATOM   2691 C CE2 . TRP A 1 401 ? 68.581  18.499  -130.764 1.00 30.91  ? 401 TRP A CE2 1 
ATOM   2692 C CE3 . TRP A 1 401 ? 70.122  16.639  -130.900 1.00 34.76  ? 401 TRP A CE3 1 
ATOM   2693 C CZ2 . TRP A 1 401 ? 67.482  17.665  -130.961 1.00 23.86  ? 401 TRP A CZ2 1 
ATOM   2694 C CZ3 . TRP A 1 401 ? 69.026  15.812  -131.102 1.00 33.50  ? 401 TRP A CZ3 1 
ATOM   2695 C CH2 . TRP A 1 401 ? 67.723  16.330  -131.130 1.00 30.11  ? 401 TRP A CH2 1 
ATOM   2696 N N   . ILE A 1 402 ? 74.587  17.156  -128.894 1.00 36.61  ? 402 ILE A N   1 
ATOM   2697 C CA  . ILE A 1 402 ? 75.995  16.760  -128.949 1.00 37.58  ? 402 ILE A CA  1 
ATOM   2698 C C   . ILE A 1 402 ? 76.170  15.563  -129.879 1.00 38.02  ? 402 ILE A C   1 
ATOM   2699 O O   . ILE A 1 402 ? 75.314  14.677  -129.906 1.00 34.62  ? 402 ILE A O   1 
ATOM   2700 C CB  . ILE A 1 402 ? 76.556  16.398  -127.542 1.00 38.87  ? 402 ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 402 ? 75.762  15.252  -126.899 1.00 44.66  ? 402 ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 402 ? 76.538  17.608  -126.622 1.00 25.76  ? 402 ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 402 ? 76.370  14.748  -125.614 1.00 42.09  ? 402 ILE A CD1 1 
ATOM   2704 N N   . GLU A 1 403 ? 77.276  15.535  -130.628 1.00 38.32  ? 403 GLU A N   1 
ATOM   2705 C CA  . GLU A 1 403 ? 77.584  14.388  -131.481 1.00 40.60  ? 403 GLU A CA  1 
ATOM   2706 C C   . GLU A 1 403 ? 78.040  13.213  -130.632 1.00 39.26  ? 403 GLU A C   1 
ATOM   2707 O O   . GLU A 1 403 ? 78.843  13.372  -129.715 1.00 38.32  ? 403 GLU A O   1 
ATOM   2708 C CB  . GLU A 1 403 ? 78.630  14.711  -132.557 1.00 40.67  ? 403 GLU A CB  1 
ATOM   2709 C CG  . GLU A 1 403 ? 80.042  15.020  -132.065 1.00 57.43  ? 403 GLU A CG  1 
ATOM   2710 C CD  . GLU A 1 403 ? 81.121  14.580  -133.048 1.00 62.35  ? 403 GLU A CD  1 
ATOM   2711 O OE1 . GLU A 1 403 ? 82.017  15.403  -133.349 1.00 81.38  ? 403 GLU A OE1 1 
ATOM   2712 O OE2 . GLU A 1 403 ? 81.073  13.415  -133.514 1.00 69.98  ? 403 GLU A OE2 1 
ATOM   2713 N N   . ILE A 1 404 ? 77.500  12.038  -130.929 1.00 36.29  ? 404 ILE A N   1 
ATOM   2714 C CA  . ILE A 1 404 ? 77.819  10.837  -130.168 1.00 34.45  ? 404 ILE A CA  1 
ATOM   2715 C C   . ILE A 1 404 ? 78.304  9.712   -131.079 1.00 33.73  ? 404 ILE A C   1 
ATOM   2716 O O   . ILE A 1 404 ? 79.000  8.808   -130.628 1.00 36.11  ? 404 ILE A O   1 
ATOM   2717 C CB  . ILE A 1 404 ? 76.623  10.405  -129.281 1.00 36.52  ? 404 ILE A CB  1 
ATOM   2718 C CG1 . ILE A 1 404 ? 75.395  10.036  -130.124 1.00 38.87  ? 404 ILE A CG1 1 
ATOM   2719 C CG2 . ILE A 1 404 ? 76.272  11.528  -128.298 1.00 28.40  ? 404 ILE A CG2 1 
ATOM   2720 C CD1 . ILE A 1 404 ? 74.124  9.839   -129.316 1.00 31.49  ? 404 ILE A CD1 1 
ATOM   2721 N N   . VAL A 1 405 ? 77.940  9.778   -132.357 1.00 33.64  ? 405 VAL A N   1 
ATOM   2722 C CA  . VAL A 1 405 ? 78.498  8.901   -133.381 1.00 33.05  ? 405 VAL A CA  1 
ATOM   2723 C C   . VAL A 1 405 ? 78.717  9.691   -134.670 1.00 35.28  ? 405 VAL A C   1 
ATOM   2724 O O   . VAL A 1 405 ? 77.776  10.277  -135.201 1.00 36.88  ? 405 VAL A O   1 
ATOM   2725 C CB  . VAL A 1 405 ? 77.555  7.739   -133.700 1.00 31.49  ? 405 VAL A CB  1 
ATOM   2726 C CG1 . VAL A 1 405 ? 78.188  6.811   -134.736 1.00 31.01  ? 405 VAL A CG1 1 
ATOM   2727 C CG2 . VAL A 1 405 ? 77.200  6.990   -132.442 1.00 29.91  ? 405 VAL A CG2 1 
ATOM   2728 N N   . GLY A 1 406 ? 79.954  9.720   -135.164 1.00 34.82  ? 406 GLY A N   1 
ATOM   2729 C CA  . GLY A 1 406 ? 80.234  10.281  -136.484 1.00 32.89  ? 406 GLY A CA  1 
ATOM   2730 C C   . GLY A 1 406 ? 80.068  9.206   -137.548 1.00 36.18  ? 406 GLY A C   1 
ATOM   2731 O O   . GLY A 1 406 ? 80.238  8.014   -137.266 1.00 38.37  ? 406 GLY A O   1 
ATOM   2732 N N   . CYS A 1 407 ? 79.717  9.616   -138.763 1.00 35.78  ? 407 CYS A N   1 
ATOM   2733 C CA  . CYS A 1 407 ? 79.645  8.684   -139.891 1.00 36.08  ? 407 CYS A CA  1 
ATOM   2734 C C   . CYS A 1 407 ? 80.016  9.364   -141.220 1.00 37.79  ? 407 CYS A C   1 
ATOM   2735 O O   . CYS A 1 407 ? 79.152  9.903   -141.914 1.00 37.70  ? 407 CYS A O   1 
ATOM   2736 C CB  . CYS A 1 407 ? 78.256  8.054   -139.973 1.00 35.44  ? 407 CYS A CB  1 
ATOM   2737 S SG  . CYS A 1 407 ? 78.188  6.648   -141.100 1.00 43.39  ? 407 CYS A SG  1 
ATOM   2738 N N   . ALA A 1 408 ? 81.304  9.320   -141.566 1.00 35.16  ? 408 ALA A N   1 
ATOM   2739 C CA  . ALA A 1 408 ? 81.823  10.016  -142.744 1.00 36.45  ? 408 ALA A CA  1 
ATOM   2740 C C   . ALA A 1 408 ? 81.923  9.106   -143.966 1.00 40.03  ? 408 ALA A C   1 
ATOM   2741 O O   . ALA A 1 408 ? 82.275  7.929   -143.855 1.00 42.90  ? 408 ALA A O   1 
ATOM   2742 C CB  . ALA A 1 408 ? 83.179  10.627  -142.442 1.00 31.01  ? 408 ALA A CB  1 
ATOM   2743 N N   . ASP A 1 409 ? 81.613  9.675   -145.128 1.00 41.03  ? 409 ASP A N   1 
ATOM   2744 C CA  . ASP A 1 409 ? 81.751  9.003   -146.413 1.00 39.48  ? 409 ASP A CA  1 
ATOM   2745 C C   . ASP A 1 409 ? 82.869  9.725   -147.152 1.00 40.28  ? 409 ASP A C   1 
ATOM   2746 O O   . ASP A 1 409 ? 82.751  10.913  -147.419 1.00 39.64  ? 409 ASP A O   1 
ATOM   2747 C CB  . ASP A 1 409 ? 80.433  9.097   -147.187 1.00 37.60  ? 409 ASP A CB  1 
ATOM   2748 C CG  . ASP A 1 409 ? 80.403  8.217   -148.425 1.00 41.85  ? 409 ASP A CG  1 
ATOM   2749 O OD1 . ASP A 1 409 ? 81.482  7.853   -148.944 1.00 40.92  ? 409 ASP A OD1 1 
ATOM   2750 O OD2 . ASP A 1 409 ? 79.285  7.891   -148.889 1.00 42.41  ? 409 ASP A OD2 1 
ATOM   2751 N N   . ARG A 1 410 ? 83.951  9.015   -147.468 1.00 44.48  ? 410 ARG A N   1 
ATOM   2752 C CA  . ARG A 1 410 ? 85.134  9.626   -148.082 1.00 48.01  ? 410 ARG A CA  1 
ATOM   2753 C C   . ARG A 1 410 ? 85.575  8.904   -149.345 1.00 47.34  ? 410 ARG A C   1 
ATOM   2754 O O   . ARG A 1 410 ? 85.432  7.692   -149.448 1.00 45.56  ? 410 ARG A O   1 
ATOM   2755 C CB  . ARG A 1 410 ? 86.310  9.614   -147.108 1.00 50.00  ? 410 ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 410 ? 86.029  10.192  -145.745 1.00 52.91  ? 410 ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 410 ? 87.317  10.267  -144.924 1.00 55.94  ? 410 ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 410 ? 87.103  10.903  -143.625 1.00 59.36  ? 410 ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 410 ? 86.917  12.210  -143.441 1.00 59.10  ? 410 ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 410 ? 86.946  13.062  -144.461 1.00 63.33  ? 410 ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 410 ? 86.721  12.676  -142.214 1.00 65.91  ? 410 ARG A NH2 1 
ATOM   2762 N N   . SER A 1 411 ? 86.139  9.663   -150.285 1.00 53.93  ? 411 SER A N   1 
ATOM   2763 C CA  . SER A 1 411 ? 86.701  9.123   -151.529 1.00 57.95  ? 411 SER A CA  1 
ATOM   2764 C C   . SER A 1 411 ? 88.228  9.214   -151.507 1.00 59.96  ? 411 SER A C   1 
ATOM   2765 O O   . SER A 1 411 ? 88.917  8.229   -151.772 1.00 60.31  ? 411 SER A O   1 
ATOM   2766 C CB  . SER A 1 411 ? 86.159  9.893   -152.738 1.00 58.39  ? 411 SER A CB  1 
ATOM   2767 O OG  . SER A 1 411 ? 84.744  9.967   -152.716 1.00 62.77  ? 411 SER A OG  1 
ATOM   2768 N N   . CYS A 1 412 ? 88.739  10.410  -151.213 1.00 63.33  ? 412 CYS A N   1 
ATOM   2769 C CA  . CYS A 1 412 ? 90.171  10.654  -151.010 1.00 62.95  ? 412 CYS A CA  1 
ATOM   2770 C C   . CYS A 1 412 ? 90.423  10.876  -149.525 1.00 65.39  ? 412 CYS A C   1 
ATOM   2771 O O   . CYS A 1 412 ? 89.750  11.695  -148.890 1.00 65.04  ? 412 CYS A O   1 
ATOM   2772 C CB  . CYS A 1 412 ? 90.629  11.893  -151.778 1.00 63.39  ? 412 CYS A CB  1 
ATOM   2773 S SG  . CYS A 1 412 ? 90.498  11.760  -153.565 1.00 67.86  ? 412 CYS A SG  1 
ATOM   2774 N N   . TYR A 1 413 ? 91.392  10.152  -148.971 1.00 65.52  ? 413 TYR A N   1 
ATOM   2775 C CA  . TYR A 1 413 ? 91.652  10.197  -147.531 1.00 60.65  ? 413 TYR A CA  1 
ATOM   2776 C C   . TYR A 1 413 ? 93.030  9.599   -147.207 1.00 57.63  ? 413 TYR A C   1 
ATOM   2777 O O   . TYR A 1 413 ? 93.884  9.485   -148.096 1.00 54.87  ? 413 TYR A O   1 
ATOM   2778 C CB  . TYR A 1 413 ? 90.509  9.499   -146.771 1.00 60.51  ? 413 TYR A CB  1 
ATOM   2779 C CG  . TYR A 1 413 ? 90.298  8.061   -147.177 1.00 62.56  ? 413 TYR A CG  1 
ATOM   2780 C CD1 . TYR A 1 413 ? 90.801  7.021   -146.399 1.00 59.27  ? 413 TYR A CD1 1 
ATOM   2781 C CD2 . TYR A 1 413 ? 89.606  7.739   -148.345 1.00 58.08  ? 413 TYR A CD2 1 
ATOM   2782 C CE1 . TYR A 1 413 ? 90.619  5.704   -146.766 1.00 55.86  ? 413 TYR A CE1 1 
ATOM   2783 C CE2 . TYR A 1 413 ? 89.420  6.425   -148.722 1.00 58.13  ? 413 TYR A CE2 1 
ATOM   2784 C CZ  . TYR A 1 413 ? 89.930  5.408   -147.925 1.00 61.52  ? 413 TYR A CZ  1 
ATOM   2785 O OH  . TYR A 1 413 ? 89.757  4.089   -148.276 1.00 65.81  ? 413 TYR A OH  1 
ATOM   2786 N N   . ASP A 1 414 ? 93.235  9.218   -145.947 1.00 54.22  ? 414 ASP A N   1 
ATOM   2787 C CA  . ASP A 1 414 ? 94.567  8.919   -145.411 1.00 53.99  ? 414 ASP A CA  1 
ATOM   2788 C C   . ASP A 1 414 ? 95.277  7.751   -146.094 1.00 51.85  ? 414 ASP A C   1 
ATOM   2789 O O   . ASP A 1 414 ? 96.507  7.741   -146.193 1.00 49.01  ? 414 ASP A O   1 
ATOM   2790 C CB  . ASP A 1 414 ? 94.471  8.642   -143.911 1.00 55.62  ? 414 ASP A CB  1 
ATOM   2791 C CG  . ASP A 1 414 ? 93.802  9.770   -143.155 1.00 60.18  ? 414 ASP A CG  1 
ATOM   2792 O OD1 . ASP A 1 414 ? 94.500  10.735  -142.774 1.00 65.00  ? 414 ASP A OD1 1 
ATOM   2793 O OD2 . ASP A 1 414 ? 92.573  9.688   -142.947 1.00 63.86  ? 414 ASP A OD2 1 
ATOM   2794 N N   . LEU A 1 415 ? 94.499  6.774   -146.556 1.00 49.43  ? 415 LEU A N   1 
ATOM   2795 C CA  . LEU A 1 415 ? 95.040  5.574   -147.201 1.00 48.75  ? 415 LEU A CA  1 
ATOM   2796 C C   . LEU A 1 415 ? 96.010  5.913   -148.335 1.00 49.02  ? 415 LEU A C   1 
ATOM   2797 O O   . LEU A 1 415 ? 97.032  5.246   -148.509 1.00 52.28  ? 415 LEU A O   1 
ATOM   2798 C CB  . LEU A 1 415 ? 93.894  4.701   -147.732 1.00 48.62  ? 415 LEU A CB  1 
ATOM   2799 C CG  . LEU A 1 415 ? 94.225  3.258   -148.112 1.00 44.64  ? 415 LEU A CG  1 
ATOM   2800 C CD1 . LEU A 1 415 ? 94.564  2.443   -146.872 1.00 37.68  ? 415 LEU A CD1 1 
ATOM   2801 C CD2 . LEU A 1 415 ? 93.058  2.642   -148.855 1.00 41.60  ? 415 LEU A CD2 1 
ATOM   2802 N N   . SER A 1 416 ? 95.689  6.951   -149.101 1.00 49.78  ? 416 SER A N   1 
ATOM   2803 C CA  . SER A 1 416 ? 96.545  7.378   -150.205 1.00 50.60  ? 416 SER A CA  1 
ATOM   2804 C C   . SER A 1 416 ? 97.787  8.131   -149.720 1.00 49.31  ? 416 SER A C   1 
ATOM   2805 O O   . SER A 1 416 ? 98.848  8.045   -150.336 1.00 47.73  ? 416 SER A O   1 
ATOM   2806 C CB  . SER A 1 416 ? 95.753  8.238   -151.188 1.00 51.95  ? 416 SER A CB  1 
ATOM   2807 O OG  . SER A 1 416 ? 94.718  7.476   -151.785 1.00 53.88  ? 416 SER A OG  1 
ATOM   2808 N N   . CYS A 1 417 ? 97.651  8.870   -148.622 1.00 49.06  ? 417 CYS A N   1 
ATOM   2809 C CA  . CYS A 1 417 ? 98.781  9.589   -148.037 1.00 49.04  ? 417 CYS A CA  1 
ATOM   2810 C C   . CYS A 1 417 ? 99.841  8.628   -147.507 1.00 48.57  ? 417 CYS A C   1 
ATOM   2811 O O   . CYS A 1 417 ? 101.027 8.780   -147.808 1.00 46.86  ? 417 CYS A O   1 
ATOM   2812 C CB  . CYS A 1 417 ? 98.306  10.498  -146.907 1.00 49.60  ? 417 CYS A CB  1 
ATOM   2813 S SG  . CYS A 1 417 ? 97.242  11.831  -147.460 1.00 53.47  ? 417 CYS A SG  1 
ATOM   2814 N N   . HIS A 1 418 ? 99.404  7.644   -146.720 1.00 48.30  ? 418 HIS A N   1 
ATOM   2815 C CA  . HIS A 1 418 ? 100.300 6.608   -146.191 1.00 48.08  ? 418 HIS A CA  1 
ATOM   2816 C C   . HIS A 1 418 ? 100.963 5.799   -147.305 1.00 48.32  ? 418 HIS A C   1 
ATOM   2817 O O   . HIS A 1 418 ? 102.120 5.388   -147.176 1.00 46.44  ? 418 HIS A O   1 
ATOM   2818 C CB  . HIS A 1 418 ? 99.548  5.654   -145.263 1.00 45.62  ? 418 HIS A CB  1 
ATOM   2819 C CG  . HIS A 1 418 ? 99.068  6.294   -144.000 1.00 46.70  ? 418 HIS A CG  1 
ATOM   2820 N ND1 . HIS A 1 418 ? 99.920  6.923   -143.118 1.00 41.37  ? 418 HIS A ND1 1 
ATOM   2821 C CD2 . HIS A 1 418 ? 97.828  6.390   -143.464 1.00 45.91  ? 418 HIS A CD2 1 
ATOM   2822 C CE1 . HIS A 1 418 ? 99.223  7.387   -142.094 1.00 44.61  ? 418 HIS A CE1 1 
ATOM   2823 N NE2 . HIS A 1 418 ? 97.952  7.076   -142.279 1.00 47.35  ? 418 HIS A NE2 1 
ATOM   2824 N N   . ALA A 1 419 ? 100.224 5.572   -148.389 1.00 47.29  ? 419 ALA A N   1 
ATOM   2825 C CA  . ALA A 1 419 ? 100.745 4.836   -149.532 1.00 46.27  ? 419 ALA A CA  1 
ATOM   2826 C C   . ALA A 1 419 ? 102.011 5.490   -150.090 1.00 46.45  ? 419 ALA A C   1 
ATOM   2827 O O   . ALA A 1 419 ? 103.059 4.847   -150.150 1.00 50.38  ? 419 ALA A O   1 
ATOM   2828 C CB  . ALA A 1 419 ? 99.683  4.714   -150.611 1.00 46.21  ? 419 ALA A CB  1 
ATOM   2829 N N   . ARG A 1 420 ? 101.923 6.762   -150.479 1.00 44.62  ? 420 ARG A N   1 
ATOM   2830 C CA  . ARG A 1 420 ? 103.086 7.464   -151.051 1.00 47.14  ? 420 ARG A CA  1 
ATOM   2831 C C   . ARG A 1 420 ? 104.125 7.843   -149.992 1.00 46.12  ? 420 ARG A C   1 
ATOM   2832 O O   . ARG A 1 420 ? 105.314 7.951   -150.301 1.00 45.09  ? 420 ARG A O   1 
ATOM   2833 C CB  . ARG A 1 420 ? 102.673 8.694   -151.880 1.00 48.41  ? 420 ARG A CB  1 
ATOM   2834 C CG  . ARG A 1 420 ? 101.941 9.787   -151.114 1.00 53.62  ? 420 ARG A CG  1 
ATOM   2835 C CD  . ARG A 1 420 ? 101.586 10.985  -152.010 1.00 50.93  ? 420 ARG A CD  1 
ATOM   2836 N NE  . ARG A 1 420 ? 100.325 11.606  -151.594 1.00 54.21  ? 420 ARG A NE  1 
ATOM   2837 C CZ  . ARG A 1 420 ? 100.150 12.329  -150.484 1.00 58.89  ? 420 ARG A CZ  1 
ATOM   2838 N NH1 . ARG A 1 420 ? 101.157 12.556  -149.641 1.00 63.78  ? 420 ARG A NH1 1 
ATOM   2839 N NH2 . ARG A 1 420 ? 98.950  12.831  -150.209 1.00 55.92  ? 420 ARG A NH2 1 
ATOM   2840 N N   . ALA A 1 421 ? 103.680 8.039   -148.751 1.00 45.86  ? 421 ALA A N   1 
ATOM   2841 C CA  . ALA A 1 421 ? 104.597 8.282   -147.634 1.00 44.62  ? 421 ALA A CA  1 
ATOM   2842 C C   . ALA A 1 421 ? 105.573 7.118   -147.448 1.00 44.73  ? 421 ALA A C   1 
ATOM   2843 O O   . ALA A 1 421 ? 106.751 7.331   -147.168 1.00 46.30  ? 421 ALA A O   1 
ATOM   2844 C CB  . ALA A 1 421 ? 103.819 8.525   -146.348 1.00 39.56  ? 421 ALA A CB  1 
ATOM   2845 N N   . THR A 1 422 ? 105.076 5.895   -147.625 1.00 45.93  ? 422 THR A N   1 
ATOM   2846 C CA  . THR A 1 422 ? 105.845 4.674   -147.370 1.00 44.61  ? 422 THR A CA  1 
ATOM   2847 C C   . THR A 1 422 ? 106.290 3.929   -148.633 1.00 45.74  ? 422 THR A C   1 
ATOM   2848 O O   . THR A 1 422 ? 107.054 2.968   -148.537 1.00 46.85  ? 422 THR A O   1 
ATOM   2849 C CB  . THR A 1 422 ? 105.009 3.686   -146.538 1.00 44.79  ? 422 THR A CB  1 
ATOM   2850 O OG1 . THR A 1 422 ? 103.814 3.353   -147.257 1.00 39.11  ? 422 THR A OG1 1 
ATOM   2851 C CG2 . THR A 1 422 ? 104.640 4.288   -145.181 1.00 38.74  ? 422 THR A CG2 1 
ATOM   2852 N N   . LYS A 1 423 ? 105.804 4.362   -149.799 1.00 47.40  ? 423 LYS A N   1 
ATOM   2853 C CA  . LYS A 1 423 ? 106.026 3.668   -151.083 1.00 46.12  ? 423 LYS A CA  1 
ATOM   2854 C C   . LYS A 1 423 ? 105.467 2.235   -151.103 1.00 46.17  ? 423 LYS A C   1 
ATOM   2855 O O   . LYS A 1 423 ? 105.972 1.377   -151.830 1.00 46.38  ? 423 LYS A O   1 
ATOM   2856 C CB  . LYS A 1 423 ? 107.515 3.650   -151.465 1.00 45.21  ? 423 LYS A CB  1 
ATOM   2857 C CG  . LYS A 1 423 ? 108.202 5.009   -151.483 1.00 43.36  ? 423 LYS A CG  1 
ATOM   2858 C CD  . LYS A 1 423 ? 109.665 4.852   -151.892 1.00 47.83  ? 423 LYS A CD  1 
ATOM   2859 C CE  . LYS A 1 423 ? 110.419 6.170   -151.866 1.00 51.97  ? 423 LYS A CE  1 
ATOM   2860 N NZ  . LYS A 1 423 ? 110.569 6.692   -150.479 1.00 60.01  ? 423 LYS A NZ  1 
ATOM   2861 N N   . VAL A 1 424 ? 104.428 1.986   -150.307 1.00 47.60  ? 424 VAL A N   1 
ATOM   2862 C CA  . VAL A 1 424 ? 103.762 0.686   -150.262 1.00 47.38  ? 424 VAL A CA  1 
ATOM   2863 C C   . VAL A 1 424 ? 102.339 0.857   -150.799 1.00 50.42  ? 424 VAL A C   1 
ATOM   2864 O O   . VAL A 1 424 ? 101.547 1.597   -150.215 1.00 49.51  ? 424 VAL A O   1 
ATOM   2865 C CB  . VAL A 1 424 ? 103.697 0.123   -148.823 1.00 45.50  ? 424 VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 424 ? 103.093 -1.277  -148.820 1.00 38.58  ? 424 VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 424 ? 105.078 0.111   -148.189 1.00 38.40  ? 424 VAL A CG2 1 
ATOM   2868 N N   . PRO A 1 425 ? 102.008 0.180   -151.916 1.00 53.13  ? 425 PRO A N   1 
ATOM   2869 C CA  . PRO A 1 425 ? 100.692 0.376   -152.525 1.00 50.97  ? 425 PRO A CA  1 
ATOM   2870 C C   . PRO A 1 425 ? 99.549  -0.149  -151.657 1.00 51.29  ? 425 PRO A C   1 
ATOM   2871 O O   . PRO A 1 425 ? 99.462  -1.353  -151.407 1.00 49.19  ? 425 PRO A O   1 
ATOM   2872 C CB  . PRO A 1 425 ? 100.787 -0.414  -153.835 1.00 53.72  ? 425 PRO A CB  1 
ATOM   2873 C CG  . PRO A 1 425 ? 101.838 -1.431  -153.596 1.00 57.33  ? 425 PRO A CG  1 
ATOM   2874 C CD  . PRO A 1 425 ? 102.823 -0.794  -152.666 1.00 56.66  ? 425 PRO A CD  1 
ATOM   2875 N N   . LEU A 1 426 ? 98.693  0.767   -151.205 1.00 49.42  ? 426 LEU A N   1 
ATOM   2876 C CA  . LEU A 1 426 ? 97.518  0.431   -150.410 1.00 47.38  ? 426 LEU A CA  1 
ATOM   2877 C C   . LEU A 1 426 ? 96.263  0.557   -151.276 1.00 47.30  ? 426 LEU A C   1 
ATOM   2878 O O   . LEU A 1 426 ? 95.451  1.471   -151.105 1.00 47.08  ? 426 LEU A O   1 
ATOM   2879 C CB  . LEU A 1 426 ? 97.438  1.342   -149.180 1.00 47.68  ? 426 LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 426 ? 98.653  1.298   -148.245 1.00 44.39  ? 426 LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 426 ? 98.462  2.251   -147.080 1.00 32.73  ? 426 LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 426 ? 98.920  -0.118  -147.739 1.00 46.78  ? 426 LEU A CD2 1 
ATOM   2883 N N   . VAL A 1 427 ? 96.120  -0.382  -152.206 1.00 47.49  ? 427 VAL A N   1 
ATOM   2884 C CA  . VAL A 1 427 ? 95.029  -0.377  -153.180 1.00 46.69  ? 427 VAL A CA  1 
ATOM   2885 C C   . VAL A 1 427 ? 94.439  -1.776  -153.339 1.00 43.91  ? 427 VAL A C   1 
ATOM   2886 O O   . VAL A 1 427 ? 95.053  -2.764  -152.937 1.00 39.51  ? 427 VAL A O   1 
ATOM   2887 C CB  . VAL A 1 427 ? 95.523  0.123   -154.563 1.00 48.57  ? 427 VAL A CB  1 
ATOM   2888 C CG1 . VAL A 1 427 ? 95.994  1.570   -154.471 1.00 49.39  ? 427 VAL A CG1 1 
ATOM   2889 C CG2 . VAL A 1 427 ? 96.644  -0.768  -155.099 1.00 36.25  ? 427 VAL A CG2 1 
ATOM   2890 N N   . ALA A 1 428 ? 93.247  -1.847  -153.925 1.00 44.45  ? 428 ALA A N   1 
ATOM   2891 C CA  . ALA A 1 428 ? 92.597  -3.122  -154.221 1.00 46.49  ? 428 ALA A CA  1 
ATOM   2892 C C   . ALA A 1 428 ? 92.731  -3.418  -155.708 1.00 48.78  ? 428 ALA A C   1 
ATOM   2893 O O   . ALA A 1 428 ? 92.813  -2.501  -156.525 1.00 53.16  ? 428 ALA A O   1 
ATOM   2894 C CB  . ALA A 1 428 ? 91.138  -3.080  -153.815 1.00 44.54  ? 428 ALA A CB  1 
ATOM   2895 N N   . GLU A 1 429 ? 92.752  -4.703  -156.051 1.00 50.51  ? 429 GLU A N   1 
ATOM   2896 C CA  . GLU A 1 429 ? 92.980  -5.147  -157.424 1.00 51.47  ? 429 GLU A CA  1 
ATOM   2897 C C   . GLU A 1 429 ? 91.813  -6.018  -157.889 1.00 51.44  ? 429 GLU A C   1 
ATOM   2898 O O   . GLU A 1 429 ? 91.645  -7.136  -157.401 1.00 51.72  ? 429 GLU A O   1 
ATOM   2899 C CB  . GLU A 1 429 ? 94.293  -5.935  -157.483 1.00 50.46  ? 429 GLU A CB  1 
ATOM   2900 C CG  . GLU A 1 429 ? 94.665  -6.485  -158.855 1.00 54.33  ? 429 GLU A CG  1 
ATOM   2901 C CD  . GLU A 1 429 ? 95.977  -7.260  -158.845 1.00 57.36  ? 429 GLU A CD  1 
ATOM   2902 O OE1 . GLU A 1 429 ? 96.583  -7.399  -157.759 1.00 57.53  ? 429 GLU A OE1 1 
ATOM   2903 O OE2 . GLU A 1 429 ? 96.402  -7.731  -159.927 1.00 56.33  ? 429 GLU A OE2 1 
ATOM   2904 N N   . LYS A 1 430 ? 91.008  -5.503  -158.820 1.00 52.97  ? 430 LYS A N   1 
ATOM   2905 C CA  . LYS A 1 430 ? 89.864  -6.256  -159.361 1.00 54.80  ? 430 LYS A CA  1 
ATOM   2906 C C   . LYS A 1 430 ? 90.104  -6.704  -160.810 1.00 58.58  ? 430 LYS A C   1 
ATOM   2907 O O   . LYS A 1 430 ? 90.223  -5.869  -161.712 1.00 60.92  ? 430 LYS A O   1 
ATOM   2908 C CB  . LYS A 1 430 ? 88.551  -5.456  -159.246 1.00 53.42  ? 430 LYS A CB  1 
ATOM   2909 C CG  . LYS A 1 430 ? 88.452  -4.194  -160.100 1.00 51.88  ? 430 LYS A CG  1 
ATOM   2910 C CD  . LYS A 1 430 ? 87.248  -3.329  -159.721 1.00 52.55  ? 430 LYS A CD  1 
ATOM   2911 C CE  . LYS A 1 430 ? 85.925  -3.955  -160.138 1.00 49.83  ? 430 LYS A CE  1 
ATOM   2912 N NZ  . LYS A 1 430 ? 84.790  -2.992  -160.012 1.00 46.20  ? 430 LYS A NZ  1 
ATOM   2913 N N   . PRO A 1 431 ? 90.211  -8.030  -161.033 1.00 60.79  ? 431 PRO A N   1 
ATOM   2914 C CA  . PRO A 1 431 ? 90.213  -8.567  -162.384 1.00 59.02  ? 431 PRO A CA  1 
ATOM   2915 C C   . PRO A 1 431 ? 88.799  -8.926  -162.824 1.00 58.35  ? 431 PRO A C   1 
ATOM   2916 O O   . PRO A 1 431 ? 88.511  -8.932  -164.017 1.00 61.09  ? 431 PRO A O   1 
ATOM   2917 C CB  . PRO A 1 431 ? 91.077  -9.821  -162.253 1.00 58.85  ? 431 PRO A CB  1 
ATOM   2918 C CG  . PRO A 1 431 ? 90.835  -10.296 -160.851 1.00 60.45  ? 431 PRO A CG  1 
ATOM   2919 C CD  . PRO A 1 431 ? 90.367  -9.104  -160.033 1.00 61.54  ? 431 PRO A CD  1 
ATOM   2920 N N   . TYR A 1 512 ? 92.196  -8.007  -167.612 1.00 73.66  ? 512 TYR A N   1 
ATOM   2921 C CA  . TYR A 1 512 ? 91.555  -7.003  -166.778 1.00 73.01  ? 512 TYR A CA  1 
ATOM   2922 C C   . TYR A 1 512 ? 92.217  -6.983  -165.402 1.00 74.21  ? 512 TYR A C   1 
ATOM   2923 O O   . TYR A 1 512 ? 92.207  -7.987  -164.689 1.00 78.12  ? 512 TYR A O   1 
ATOM   2924 C CB  . TYR A 1 512 ? 90.056  -7.301  -166.649 1.00 74.45  ? 512 TYR A CB  1 
ATOM   2925 C CG  . TYR A 1 512 ? 89.233  -6.160  -166.086 1.00 74.51  ? 512 TYR A CG  1 
ATOM   2926 C CD1 . TYR A 1 512 ? 88.603  -5.246  -166.927 1.00 73.54  ? 512 TYR A CD1 1 
ATOM   2927 C CD2 . TYR A 1 512 ? 89.076  -6.001  -164.711 1.00 74.68  ? 512 TYR A CD2 1 
ATOM   2928 C CE1 . TYR A 1 512 ? 87.844  -4.200  -166.410 1.00 75.37  ? 512 TYR A CE1 1 
ATOM   2929 C CE2 . TYR A 1 512 ? 88.323  -4.966  -164.184 1.00 74.68  ? 512 TYR A CE2 1 
ATOM   2930 C CZ  . TYR A 1 512 ? 87.710  -4.067  -165.034 1.00 77.46  ? 512 TYR A CZ  1 
ATOM   2931 O OH  . TYR A 1 512 ? 86.963  -3.040  -164.502 1.00 76.82  ? 512 TYR A OH  1 
ATOM   2932 N N   . VAL A 1 513 ? 92.817  -5.846  -165.053 1.00 71.60  ? 513 VAL A N   1 
ATOM   2933 C CA  . VAL A 1 513 ? 93.378  -5.620  -163.716 1.00 67.37  ? 513 VAL A CA  1 
ATOM   2934 C C   . VAL A 1 513 ? 93.299  -4.133  -163.393 1.00 63.34  ? 513 VAL A C   1 
ATOM   2935 O O   . VAL A 1 513 ? 94.161  -3.351  -163.805 1.00 58.52  ? 513 VAL A O   1 
ATOM   2936 C CB  . VAL A 1 513 ? 94.850  -6.102  -163.589 1.00 68.44  ? 513 VAL A CB  1 
ATOM   2937 C CG1 . VAL A 1 513 ? 94.905  -7.564  -163.157 1.00 68.41  ? 513 VAL A CG1 1 
ATOM   2938 C CG2 . VAL A 1 513 ? 95.617  -5.878  -164.893 1.00 68.43  ? 513 VAL A CG2 1 
ATOM   2939 N N   . GLU A 1 514 ? 92.249  -3.754  -162.668 1.00 59.84  ? 514 GLU A N   1 
ATOM   2940 C CA  . GLU A 1 514 ? 92.005  -2.360  -162.326 1.00 58.48  ? 514 GLU A CA  1 
ATOM   2941 C C   . GLU A 1 514 ? 92.474  -2.061  -160.906 1.00 55.72  ? 514 GLU A C   1 
ATOM   2942 O O   . GLU A 1 514 ? 92.239  -2.841  -159.983 1.00 55.87  ? 514 GLU A O   1 
ATOM   2943 C CB  . GLU A 1 514 ? 90.518  -2.035  -162.474 1.00 58.96  ? 514 GLU A CB  1 
ATOM   2944 C CG  . GLU A 1 514 ? 90.157  -0.569  -162.233 1.00 61.24  ? 514 GLU A CG  1 
ATOM   2945 C CD  . GLU A 1 514 ? 88.672  -0.291  -162.411 1.00 62.38  ? 514 GLU A CD  1 
ATOM   2946 O OE1 . GLU A 1 514 ? 88.064  -0.857  -163.344 1.00 61.27  ? 514 GLU A OE1 1 
ATOM   2947 O OE2 . GLU A 1 514 ? 88.114  0.497   -161.618 1.00 68.05  ? 514 GLU A OE2 1 
ATOM   2948 N N   . GLU A 1 515 ? 93.147  -0.925  -160.752 1.00 53.34  ? 515 GLU A N   1 
ATOM   2949 C CA  . GLU A 1 515 ? 93.536  -0.411  -159.447 1.00 50.78  ? 515 GLU A CA  1 
ATOM   2950 C C   . GLU A 1 515 ? 92.310  0.244   -158.823 1.00 48.79  ? 515 GLU A C   1 
ATOM   2951 O O   . GLU A 1 515 ? 91.768  1.197   -159.379 1.00 51.56  ? 515 GLU A O   1 
ATOM   2952 C CB  . GLU A 1 515 ? 94.666  0.612   -159.606 1.00 50.61  ? 515 GLU A CB  1 
ATOM   2953 C CG  . GLU A 1 515 ? 95.039  1.385   -158.345 1.00 53.59  ? 515 GLU A CG  1 
ATOM   2954 C CD  . GLU A 1 515 ? 95.999  2.533   -158.620 1.00 53.63  ? 515 GLU A CD  1 
ATOM   2955 O OE1 . GLU A 1 515 ? 95.987  3.513   -157.842 1.00 52.58  ? 515 GLU A OE1 1 
ATOM   2956 O OE2 . GLU A 1 515 ? 96.760  2.461   -159.611 1.00 56.18  ? 515 GLU A OE2 1 
ATOM   2957 N N   . VAL A 1 516 ? 91.873  -0.272  -157.678 1.00 46.21  ? 516 VAL A N   1 
ATOM   2958 C CA  . VAL A 1 516 ? 90.706  0.263   -156.982 1.00 43.55  ? 516 VAL A CA  1 
ATOM   2959 C C   . VAL A 1 516 ? 91.130  0.920   -155.675 1.00 42.33  ? 516 VAL A C   1 
ATOM   2960 O O   . VAL A 1 516 ? 91.658  0.254   -154.784 1.00 36.66  ? 516 VAL A O   1 
ATOM   2961 C CB  . VAL A 1 516 ? 89.680  -0.842  -156.665 1.00 42.28  ? 516 VAL A CB  1 
ATOM   2962 C CG1 . VAL A 1 516 ? 88.350  -0.228  -156.254 1.00 36.66  ? 516 VAL A CG1 1 
ATOM   2963 C CG2 . VAL A 1 516 ? 89.499  -1.754  -157.863 1.00 39.78  ? 516 VAL A CG2 1 
ATOM   2964 N N   . VAL A 1 517 ? 90.908  2.229   -155.581 1.00 43.56  ? 517 VAL A N   1 
ATOM   2965 C CA  . VAL A 1 517 ? 91.131  2.983   -154.345 1.00 43.23  ? 517 VAL A CA  1 
ATOM   2966 C C   . VAL A 1 517 ? 89.791  3.114   -153.632 1.00 41.26  ? 517 VAL A C   1 
ATOM   2967 O O   . VAL A 1 517 ? 88.956  3.930   -154.033 1.00 39.18  ? 517 VAL A O   1 
ATOM   2968 C CB  . VAL A 1 517 ? 91.746  4.391   -154.599 1.00 47.21  ? 517 VAL A CB  1 
ATOM   2969 C CG1 . VAL A 1 517 ? 93.269  4.296   -154.673 1.00 48.26  ? 517 VAL A CG1 1 
ATOM   2970 C CG2 . VAL A 1 517 ? 91.165  5.047   -155.867 1.00 42.46  ? 517 VAL A CG2 1 
ATOM   2971 N N   . PRO A 1 518 ? 89.576  2.314   -152.570 1.00 40.73  ? 518 PRO A N   1 
ATOM   2972 C CA  . PRO A 1 518 ? 88.221  2.210   -152.031 1.00 39.47  ? 518 PRO A CA  1 
ATOM   2973 C C   . PRO A 1 518 ? 87.718  3.504   -151.419 1.00 37.53  ? 518 PRO A C   1 
ATOM   2974 O O   . PRO A 1 518 ? 88.515  4.338   -150.992 1.00 36.57  ? 518 PRO A O   1 
ATOM   2975 C CB  . PRO A 1 518 ? 88.344  1.131   -150.945 1.00 39.24  ? 518 PRO A CB  1 
ATOM   2976 C CG  . PRO A 1 518 ? 89.652  0.472   -151.170 1.00 39.56  ? 518 PRO A CG  1 
ATOM   2977 C CD  . PRO A 1 518 ? 90.526  1.494   -151.799 1.00 41.71  ? 518 PRO A CD  1 
ATOM   2978 N N   . ASN A 1 519 ? 86.400  3.671   -151.416 1.00 38.17  ? 519 ASN A N   1 
ATOM   2979 C CA  . ASN A 1 519 ? 85.752  4.687   -150.599 1.00 37.74  ? 519 ASN A CA  1 
ATOM   2980 C C   . ASN A 1 519 ? 85.596  4.091   -149.216 1.00 34.87  ? 519 ASN A C   1 
ATOM   2981 O O   . ASN A 1 519 ? 85.755  2.883   -149.044 1.00 32.07  ? 519 ASN A O   1 
ATOM   2982 C CB  . ASN A 1 519 ? 84.375  5.061   -151.157 1.00 39.66  ? 519 ASN A CB  1 
ATOM   2983 C CG  . ASN A 1 519 ? 84.455  5.885   -152.431 1.00 44.73  ? 519 ASN A CG  1 
ATOM   2984 O OD1 . ASN A 1 519 ? 85.532  6.081   -153.004 1.00 50.17  ? 519 ASN A OD1 1 
ATOM   2985 N ND2 . ASN A 1 519 ? 83.306  6.372   -152.882 1.00 46.36  ? 519 ASN A ND2 1 
ATOM   2986 N N   . VAL A 1 520 ? 85.291  4.931   -148.233 1.00 34.57  ? 520 VAL A N   1 
ATOM   2987 C CA  . VAL A 1 520 ? 85.031  4.448   -146.880 1.00 38.15  ? 520 VAL A CA  1 
ATOM   2988 C C   . VAL A 1 520 ? 83.813  5.110   -146.262 1.00 36.11  ? 520 VAL A C   1 
ATOM   2989 O O   . VAL A 1 520 ? 83.606  6.307   -146.420 1.00 39.36  ? 520 VAL A O   1 
ATOM   2990 C CB  . VAL A 1 520 ? 86.240  4.670   -145.934 1.00 38.41  ? 520 VAL A CB  1 
ATOM   2991 C CG1 . VAL A 1 520 ? 87.335  3.687   -146.242 1.00 43.46  ? 520 VAL A CG1 1 
ATOM   2992 C CG2 . VAL A 1 520 ? 86.758  6.097   -146.036 1.00 42.91  ? 520 VAL A CG2 1 
ATOM   2993 N N   . ILE A 1 521 ? 83.004  4.315   -145.572 1.00 35.16  ? 521 ILE A N   1 
ATOM   2994 C CA  . ILE A 1 521 ? 82.059  4.844   -144.604 1.00 35.10  ? 521 ILE A CA  1 
ATOM   2995 C C   . ILE A 1 521 ? 82.688  4.597   -143.237 1.00 36.52  ? 521 ILE A C   1 
ATOM   2996 O O   . ILE A 1 521 ? 83.113  3.478   -142.940 1.00 37.46  ? 521 ILE A O   1 
ATOM   2997 C CB  . ILE A 1 521 ? 80.696  4.158   -144.691 1.00 34.23  ? 521 ILE A CB  1 
ATOM   2998 C CG1 . ILE A 1 521 ? 80.207  4.111   -146.140 1.00 40.07  ? 521 ILE A CG1 1 
ATOM   2999 C CG2 . ILE A 1 521 ? 79.688  4.893   -143.839 1.00 35.18  ? 521 ILE A CG2 1 
ATOM   3000 C CD1 . ILE A 1 521 ? 80.099  5.458   -146.795 1.00 37.60  ? 521 ILE A CD1 1 
ATOM   3001 N N   . GLU A 1 522 ? 82.755  5.638   -142.410 1.00 36.51  ? 522 GLU A N   1 
ATOM   3002 C CA  . GLU A 1 522 ? 83.481  5.575   -141.141 1.00 35.89  ? 522 GLU A CA  1 
ATOM   3003 C C   . GLU A 1 522 ? 82.611  5.861   -139.909 1.00 33.27  ? 522 GLU A C   1 
ATOM   3004 O O   . GLU A 1 522 ? 82.683  6.951   -139.346 1.00 34.20  ? 522 GLU A O   1 
ATOM   3005 C CB  . GLU A 1 522 ? 84.635  6.575   -141.166 1.00 36.09  ? 522 GLU A CB  1 
ATOM   3006 C CG  . GLU A 1 522 ? 85.561  6.466   -142.360 1.00 41.61  ? 522 GLU A CG  1 
ATOM   3007 C CD  . GLU A 1 522 ? 86.617  7.555   -142.356 1.00 44.60  ? 522 GLU A CD  1 
ATOM   3008 O OE1 . GLU A 1 522 ? 86.237  8.737   -142.227 1.00 53.79  ? 522 GLU A OE1 1 
ATOM   3009 O OE2 . GLU A 1 522 ? 87.819  7.238   -142.474 1.00 50.10  ? 522 GLU A OE2 1 
ATOM   3010 N N   . PRO A 1 523 ? 81.787  4.887   -139.484 1.00 32.05  ? 523 PRO A N   1 
ATOM   3011 C CA  . PRO A 1 523 ? 81.079  5.007   -138.209 1.00 34.52  ? 523 PRO A CA  1 
ATOM   3012 C C   . PRO A 1 523 ? 82.027  5.069   -137.005 1.00 34.94  ? 523 PRO A C   1 
ATOM   3013 O O   . PRO A 1 523 ? 82.797  4.141   -136.779 1.00 35.74  ? 523 PRO A O   1 
ATOM   3014 C CB  . PRO A 1 523 ? 80.224  3.732   -138.154 1.00 32.04  ? 523 PRO A CB  1 
ATOM   3015 C CG  . PRO A 1 523 ? 80.136  3.266   -139.534 1.00 36.79  ? 523 PRO A CG  1 
ATOM   3016 C CD  . PRO A 1 523 ? 81.428  3.644   -140.180 1.00 33.28  ? 523 PRO A CD  1 
ATOM   3017 N N   . SER A 1 524 ? 81.951  6.158   -136.246 1.00 34.19  ? 524 SER A N   1 
ATOM   3018 C CA  . SER A 1 524 ? 82.837  6.395   -135.119 1.00 32.76  ? 524 SER A CA  1 
ATOM   3019 C C   . SER A 1 524 ? 82.019  6.679   -133.858 1.00 35.90  ? 524 SER A C   1 
ATOM   3020 O O   . SER A 1 524 ? 81.344  7.706   -133.768 1.00 36.83  ? 524 SER A O   1 
ATOM   3021 C CB  . SER A 1 524 ? 83.740  7.577   -135.434 1.00 29.95  ? 524 SER A CB  1 
ATOM   3022 O OG  . SER A 1 524 ? 84.741  7.726   -134.451 1.00 38.04  ? 524 SER A OG  1 
ATOM   3023 N N   . PHE A 1 525 ? 82.103  5.775   -132.886 1.00 34.41  ? 525 PHE A N   1 
ATOM   3024 C CA  . PHE A 1 525 ? 81.239  5.796   -131.708 1.00 38.53  ? 525 PHE A CA  1 
ATOM   3025 C C   . PHE A 1 525 ? 81.968  6.267   -130.454 1.00 40.81  ? 525 PHE A C   1 
ATOM   3026 O O   . PHE A 1 525 ? 82.937  5.654   -130.022 1.00 43.47  ? 525 PHE A O   1 
ATOM   3027 C CB  . PHE A 1 525 ? 80.684  4.398   -131.443 1.00 37.77  ? 525 PHE A CB  1 
ATOM   3028 C CG  . PHE A 1 525 ? 79.826  3.857   -132.554 1.00 36.65  ? 525 PHE A CG  1 
ATOM   3029 C CD1 . PHE A 1 525 ? 80.398  3.397   -133.736 1.00 30.30  ? 525 PHE A CD1 1 
ATOM   3030 C CD2 . PHE A 1 525 ? 78.447  3.784   -132.408 1.00 29.68  ? 525 PHE A CD2 1 
ATOM   3031 C CE1 . PHE A 1 525 ? 79.618  2.884   -134.751 1.00 31.57  ? 525 PHE A CE1 1 
ATOM   3032 C CE2 . PHE A 1 525 ? 77.662  3.267   -133.419 1.00 37.46  ? 525 PHE A CE2 1 
ATOM   3033 C CZ  . PHE A 1 525 ? 78.252  2.817   -134.598 1.00 36.22  ? 525 PHE A CZ  1 
ATOM   3034 N N   . GLY A 1 526 ? 81.477  7.347   -129.864 1.00 40.80  ? 526 GLY A N   1 
ATOM   3035 C CA  . GLY A 1 526 ? 82.034  7.865   -128.632 1.00 38.68  ? 526 GLY A CA  1 
ATOM   3036 C C   . GLY A 1 526 ? 81.292  7.245   -127.478 1.00 40.02  ? 526 GLY A C   1 
ATOM   3037 O O   . GLY A 1 526 ? 80.277  7.771   -127.027 1.00 46.32  ? 526 GLY A O   1 
ATOM   3038 N N   . LEU A 1 527 ? 81.812  6.124   -126.999 1.00 37.77  ? 527 LEU A N   1 
ATOM   3039 C CA  . LEU A 1 527 ? 81.121  5.315   -126.008 1.00 34.27  ? 527 LEU A CA  1 
ATOM   3040 C C   . LEU A 1 527 ? 80.757  6.093   -124.750 1.00 34.22  ? 527 LEU A C   1 
ATOM   3041 O O   . LEU A 1 527 ? 79.635  6.003   -124.271 1.00 42.35  ? 527 LEU A O   1 
ATOM   3042 C CB  . LEU A 1 527 ? 81.965  4.094   -125.656 1.00 32.57  ? 527 LEU A CB  1 
ATOM   3043 C CG  . LEU A 1 527 ? 82.192  3.118   -126.816 1.00 32.45  ? 527 LEU A CG  1 
ATOM   3044 C CD1 . LEU A 1 527 ? 83.044  1.924   -126.376 1.00 34.81  ? 527 LEU A CD1 1 
ATOM   3045 C CD2 . LEU A 1 527 ? 80.852  2.647   -127.385 1.00 19.42  ? 527 LEU A CD2 1 
ATOM   3046 N N   . GLY A 1 528 ? 81.690  6.875   -124.228 1.00 35.26  ? 528 GLY A N   1 
ATOM   3047 C CA  . GLY A 1 528 ? 81.416  7.689   -123.042 1.00 36.24  ? 528 GLY A CA  1 
ATOM   3048 C C   . GLY A 1 528 ? 80.228  8.621   -123.215 1.00 36.18  ? 528 GLY A C   1 
ATOM   3049 O O   . GLY A 1 528 ? 79.372  8.713   -122.341 1.00 38.49  ? 528 GLY A O   1 
ATOM   3050 N N   . ARG A 1 529 ? 80.179  9.312   -124.349 1.00 36.11  ? 529 ARG A N   1 
ATOM   3051 C CA  . ARG A 1 529 ? 79.065  10.199  -124.660 1.00 36.98  ? 529 ARG A CA  1 
ATOM   3052 C C   . ARG A 1 529 ? 77.743  9.457   -124.853 1.00 39.38  ? 529 ARG A C   1 
ATOM   3053 O O   . ARG A 1 529 ? 76.674  9.980   -124.526 1.00 42.31  ? 529 ARG A O   1 
ATOM   3054 C CB  . ARG A 1 529 ? 79.371  10.998  -125.919 1.00 36.27  ? 529 ARG A CB  1 
ATOM   3055 C CG  . ARG A 1 529 ? 80.456  12.021  -125.723 1.00 42.24  ? 529 ARG A CG  1 
ATOM   3056 C CD  . ARG A 1 529 ? 80.544  12.962  -126.900 1.00 43.14  ? 529 ARG A CD  1 
ATOM   3057 N NE  . ARG A 1 529 ? 81.375  14.113  -126.575 1.00 45.59  ? 529 ARG A NE  1 
ATOM   3058 C CZ  . ARG A 1 529 ? 81.385  15.253  -127.258 1.00 46.21  ? 529 ARG A CZ  1 
ATOM   3059 N NH1 . ARG A 1 529 ? 80.625  15.406  -128.333 1.00 52.00  ? 529 ARG A NH1 1 
ATOM   3060 N NH2 . ARG A 1 529 ? 82.175  16.247  -126.872 1.00 55.89  ? 529 ARG A NH2 1 
ATOM   3061 N N   . ILE A 1 530 ? 77.813  8.253   -125.411 1.00 36.10  ? 530 ILE A N   1 
ATOM   3062 C CA  . ILE A 1 530 ? 76.617  7.440   -125.592 1.00 38.31  ? 530 ILE A CA  1 
ATOM   3063 C C   . ILE A 1 530 ? 76.054  7.085   -124.218 1.00 37.14  ? 530 ILE A C   1 
ATOM   3064 O O   . ILE A 1 530 ? 74.857  7.199   -123.975 1.00 41.01  ? 530 ILE A O   1 
ATOM   3065 C CB  . ILE A 1 530 ? 76.911  6.158   -126.406 1.00 35.97  ? 530 ILE A CB  1 
ATOM   3066 C CG1 . ILE A 1 530 ? 77.250  6.517   -127.856 1.00 32.33  ? 530 ILE A CG1 1 
ATOM   3067 C CG2 . ILE A 1 530 ? 75.716  5.214   -126.359 1.00 26.16  ? 530 ILE A CG2 1 
ATOM   3068 C CD1 . ILE A 1 530 ? 77.834  5.368   -128.653 1.00 35.05  ? 530 ILE A CD1 1 
ATOM   3069 N N   . MET A 1 531 ? 76.945  6.686   -123.323 1.00 37.58  ? 531 MET A N   1 
ATOM   3070 C CA  . MET A 1 531 ? 76.590  6.316   -121.963 1.00 41.94  ? 531 MET A CA  1 
ATOM   3071 C C   . MET A 1 531 ? 75.998  7.516   -121.211 1.00 41.18  ? 531 MET A C   1 
ATOM   3072 O O   . MET A 1 531 ? 74.930  7.413   -120.591 1.00 39.45  ? 531 MET A O   1 
ATOM   3073 C CB  . MET A 1 531 ? 77.839  5.817   -121.254 1.00 41.79  ? 531 MET A CB  1 
ATOM   3074 C CG  . MET A 1 531 ? 77.612  4.809   -120.156 1.00 52.48  ? 531 MET A CG  1 
ATOM   3075 S SD  . MET A 1 531 ? 79.215  4.207   -119.580 1.00 66.72  ? 531 MET A SD  1 
ATOM   3076 C CE  . MET A 1 531 ? 80.007  3.761   -121.141 1.00 45.49  ? 531 MET A CE  1 
ATOM   3077 N N   . TYR A 1 532 ? 76.670  8.663   -121.286 1.00 39.56  ? 532 TYR A N   1 
ATOM   3078 C CA  . TYR A 1 532 ? 76.157  9.857   -120.625 1.00 36.30  ? 532 TYR A CA  1 
ATOM   3079 C C   . TYR A 1 532 ? 74.764  10.222  -121.107 1.00 33.92  ? 532 TYR A C   1 
ATOM   3080 O O   . TYR A 1 532 ? 73.949  10.681  -120.318 1.00 35.61  ? 532 TYR A O   1 
ATOM   3081 C CB  . TYR A 1 532 ? 77.066  11.075  -120.796 1.00 36.91  ? 532 TYR A CB  1 
ATOM   3082 C CG  . TYR A 1 532 ? 76.546  12.229  -119.972 1.00 37.79  ? 532 TYR A CG  1 
ATOM   3083 C CD1 . TYR A 1 532 ? 76.681  12.222  -118.591 1.00 37.10  ? 532 TYR A CD1 1 
ATOM   3084 C CD2 . TYR A 1 532 ? 75.853  13.285  -120.561 1.00 36.07  ? 532 TYR A CD2 1 
ATOM   3085 C CE1 . TYR A 1 532 ? 76.176  13.251  -117.813 1.00 38.66  ? 532 TYR A CE1 1 
ATOM   3086 C CE2 . TYR A 1 532 ? 75.345  14.325  -119.791 1.00 35.73  ? 532 TYR A CE2 1 
ATOM   3087 C CZ  . TYR A 1 532 ? 75.513  14.299  -118.414 1.00 38.48  ? 532 TYR A CZ  1 
ATOM   3088 O OH  . TYR A 1 532 ? 75.023  15.315  -117.629 1.00 38.75  ? 532 TYR A OH  1 
ATOM   3089 N N   . THR A 1 533 ? 74.505  10.040  -122.400 1.00 32.43  ? 533 THR A N   1 
ATOM   3090 C CA  . THR A 1 533 ? 73.202  10.351  -122.968 1.00 31.49  ? 533 THR A CA  1 
ATOM   3091 C C   . THR A 1 533 ? 72.163  9.388   -122.424 1.00 36.59  ? 533 THR A C   1 
ATOM   3092 O O   . THR A 1 533 ? 71.052  9.800   -122.067 1.00 34.42  ? 533 THR A O   1 
ATOM   3093 C CB  . THR A 1 533 ? 73.207  10.256  -124.488 1.00 28.15  ? 533 THR A CB  1 
ATOM   3094 O OG1 . THR A 1 533 ? 74.200  11.142  -125.014 1.00 35.17  ? 533 THR A OG1 1 
ATOM   3095 C CG2 . THR A 1 533 ? 71.835  10.626  -125.051 1.00 23.07  ? 533 THR A CG2 1 
ATOM   3096 N N   . VAL A 1 534 ? 72.525  8.107   -122.349 1.00 36.54  ? 534 VAL A N   1 
ATOM   3097 C CA  . VAL A 1 534 ? 71.637  7.120   -121.753 1.00 35.41  ? 534 VAL A CA  1 
ATOM   3098 C C   . VAL A 1 534 ? 71.277  7.533   -120.315 1.00 37.11  ? 534 VAL A C   1 
ATOM   3099 O O   . VAL A 1 534 ? 70.118  7.416   -119.913 1.00 33.78  ? 534 VAL A O   1 
ATOM   3100 C CB  . VAL A 1 534 ? 72.235  5.699   -121.777 1.00 35.67  ? 534 VAL A CB  1 
ATOM   3101 C CG1 . VAL A 1 534 ? 71.336  4.731   -121.014 1.00 28.45  ? 534 VAL A CG1 1 
ATOM   3102 C CG2 . VAL A 1 534 ? 72.418  5.220   -123.216 1.00 32.90  ? 534 VAL A CG2 1 
ATOM   3103 N N   . PHE A 1 535 ? 72.252  8.039   -119.559 1.00 34.60  ? 535 PHE A N   1 
ATOM   3104 C CA  . PHE A 1 535 ? 71.980  8.494   -118.194 1.00 36.13  ? 535 PHE A CA  1 
ATOM   3105 C C   . PHE A 1 535 ? 70.914  9.578   -118.190 1.00 37.71  ? 535 PHE A C   1 
ATOM   3106 O O   . PHE A 1 535 ? 69.941  9.489   -117.443 1.00 40.14  ? 535 PHE A O   1 
ATOM   3107 C CB  . PHE A 1 535 ? 73.235  9.029   -117.484 1.00 37.28  ? 535 PHE A CB  1 
ATOM   3108 C CG  . PHE A 1 535 ? 74.310  7.994   -117.232 1.00 29.25  ? 535 PHE A CG  1 
ATOM   3109 C CD1 . PHE A 1 535 ? 73.994  6.676   -116.946 1.00 36.33  ? 535 PHE A CD1 1 
ATOM   3110 C CD2 . PHE A 1 535 ? 75.648  8.366   -117.239 1.00 31.93  ? 535 PHE A CD2 1 
ATOM   3111 C CE1 . PHE A 1 535 ? 74.992  5.746   -116.713 1.00 41.36  ? 535 PHE A CE1 1 
ATOM   3112 C CE2 . PHE A 1 535 ? 76.654  7.438   -116.998 1.00 37.38  ? 535 PHE A CE2 1 
ATOM   3113 C CZ  . PHE A 1 535 ? 76.329  6.130   -116.733 1.00 38.66  ? 535 PHE A CZ  1 
ATOM   3114 N N   . GLU A 1 536 ? 71.094  10.597  -119.024 1.00 38.82  ? 536 GLU A N   1 
ATOM   3115 C CA  . GLU A 1 536 ? 70.143  11.713  -119.073 1.00 38.70  ? 536 GLU A CA  1 
ATOM   3116 C C   . GLU A 1 536 ? 68.770  11.295  -119.609 1.00 35.75  ? 536 GLU A C   1 
ATOM   3117 O O   . GLU A 1 536 ? 67.752  11.818  -119.171 1.00 40.80  ? 536 GLU A O   1 
ATOM   3118 C CB  . GLU A 1 536 ? 70.697  12.879  -119.901 1.00 38.36  ? 536 GLU A CB  1 
ATOM   3119 C CG  . GLU A 1 536 ? 71.896  13.572  -119.263 1.00 37.43  ? 536 GLU A CG  1 
ATOM   3120 C CD  . GLU A 1 536 ? 71.949  15.083  -119.509 1.00 42.08  ? 536 GLU A CD  1 
ATOM   3121 O OE1 . GLU A 1 536 ? 72.780  15.736  -118.843 1.00 38.61  ? 536 GLU A OE1 1 
ATOM   3122 O OE2 . GLU A 1 536 ? 71.176  15.624  -120.343 1.00 36.17  ? 536 GLU A OE2 1 
ATOM   3123 N N   . HIS A 1 537 ? 68.747  10.350  -120.540 1.00 32.80  ? 537 HIS A N   1 
ATOM   3124 C CA  . HIS A 1 537 ? 67.507  9.925   -121.174 1.00 33.70  ? 537 HIS A CA  1 
ATOM   3125 C C   . HIS A 1 537 ? 66.743  8.877   -120.364 1.00 34.01  ? 537 HIS A C   1 
ATOM   3126 O O   . HIS A 1 537 ? 65.539  8.721   -120.554 1.00 41.97  ? 537 HIS A O   1 
ATOM   3127 C CB  . HIS A 1 537 ? 67.795  9.386   -122.576 1.00 36.87  ? 537 HIS A CB  1 
ATOM   3128 C CG  . HIS A 1 537 ? 68.154  10.445  -123.572 1.00 38.34  ? 537 HIS A CG  1 
ATOM   3129 N ND1 . HIS A 1 537 ? 67.991  10.272  -124.929 1.00 38.57  ? 537 HIS A ND1 1 
ATOM   3130 C CD2 . HIS A 1 537 ? 68.652  11.694  -123.409 1.00 40.18  ? 537 HIS A CD2 1 
ATOM   3131 C CE1 . HIS A 1 537 ? 68.385  11.364  -125.560 1.00 46.13  ? 537 HIS A CE1 1 
ATOM   3132 N NE2 . HIS A 1 537 ? 68.784  12.245  -124.660 1.00 40.84  ? 537 HIS A NE2 1 
ATOM   3133 N N   . THR A 1 538 ? 67.426  8.161   -119.470 1.00 35.46  ? 538 THR A N   1 
ATOM   3134 C CA  . THR A 1 538 ? 66.774  7.128   -118.645 1.00 34.53  ? 538 THR A CA  1 
ATOM   3135 C C   . THR A 1 538 ? 66.607  7.476   -117.153 1.00 34.42  ? 538 THR A C   1 
ATOM   3136 O O   . THR A 1 538 ? 65.916  6.756   -116.437 1.00 37.15  ? 538 THR A O   1 
ATOM   3137 C CB  . THR A 1 538 ? 67.510  5.783   -118.752 1.00 34.55  ? 538 THR A CB  1 
ATOM   3138 O OG1 . THR A 1 538 ? 68.786  5.879   -118.108 1.00 40.53  ? 538 THR A OG1 1 
ATOM   3139 C CG2 . THR A 1 538 ? 67.695  5.392   -120.212 1.00 28.46  ? 538 THR A CG2 1 
ATOM   3140 N N   . PHE A 1 539 ? 67.223  8.566   -116.692 1.00 33.84  ? 539 PHE A N   1 
ATOM   3141 C CA  . PHE A 1 539 ? 67.067  9.034   -115.303 1.00 33.28  ? 539 PHE A CA  1 
ATOM   3142 C C   . PHE A 1 539 ? 65.658  9.562   -115.023 1.00 28.92  ? 539 PHE A C   1 
ATOM   3143 O O   . PHE A 1 539 ? 65.171  10.440  -115.721 1.00 32.00  ? 539 PHE A O   1 
ATOM   3144 C CB  . PHE A 1 539 ? 68.088  10.140  -115.002 1.00 35.42  ? 539 PHE A CB  1 
ATOM   3145 C CG  . PHE A 1 539 ? 68.100  10.600  -113.563 1.00 34.95  ? 539 PHE A CG  1 
ATOM   3146 C CD1 . PHE A 1 539 ? 67.692  11.880  -113.225 1.00 31.83  ? 539 PHE A CD1 1 
ATOM   3147 C CD2 . PHE A 1 539 ? 68.546  9.755   -112.552 1.00 35.55  ? 539 PHE A CD2 1 
ATOM   3148 C CE1 . PHE A 1 539 ? 67.713  12.310  -111.901 1.00 35.64  ? 539 PHE A CE1 1 
ATOM   3149 C CE2 . PHE A 1 539 ? 68.571  10.175  -111.225 1.00 33.24  ? 539 PHE A CE2 1 
ATOM   3150 C CZ  . PHE A 1 539 ? 68.152  11.453  -110.899 1.00 37.55  ? 539 PHE A CZ  1 
ATOM   3151 N N   . HIS A 1 540 ? 65.015  9.017   -113.998 1.00 32.00  ? 540 HIS A N   1 
ATOM   3152 C CA  . HIS A 1 540 ? 63.695  9.468   -113.560 1.00 32.93  ? 540 HIS A CA  1 
ATOM   3153 C C   . HIS A 1 540 ? 63.654  9.608   -112.044 1.00 34.90  ? 540 HIS A C   1 
ATOM   3154 O O   . HIS A 1 540 ? 64.447  8.993   -111.328 1.00 41.59  ? 540 HIS A O   1 
ATOM   3155 C CB  . HIS A 1 540 ? 62.612  8.480   -113.990 1.00 33.70  ? 540 HIS A CB  1 
ATOM   3156 C CG  . HIS A 1 540 ? 62.585  8.215   -115.461 1.00 37.24  ? 540 HIS A CG  1 
ATOM   3157 N ND1 . HIS A 1 540 ? 62.159  9.150   -116.378 1.00 28.24  ? 540 HIS A ND1 1 
ATOM   3158 C CD2 . HIS A 1 540 ? 62.931  7.117   -116.174 1.00 40.41  ? 540 HIS A CD2 1 
ATOM   3159 C CE1 . HIS A 1 540 ? 62.249  8.640   -117.593 1.00 39.78  ? 540 HIS A CE1 1 
ATOM   3160 N NE2 . HIS A 1 540 ? 62.714  7.408   -117.497 1.00 40.91  ? 540 HIS A NE2 1 
ATOM   3161 N N   . VAL A 1 541 ? 62.715  10.415  -111.567 1.00 36.30  ? 541 VAL A N   1 
ATOM   3162 C CA  . VAL A 1 541 ? 62.520  10.634  -110.144 1.00 34.67  ? 541 VAL A CA  1 
ATOM   3163 C C   . VAL A 1 541 ? 61.139  10.130  -109.756 1.00 37.51  ? 541 VAL A C   1 
ATOM   3164 O O   . VAL A 1 541 ? 60.134  10.564  -110.315 1.00 38.31  ? 541 VAL A O   1 
ATOM   3165 C CB  . VAL A 1 541 ? 62.651  12.124  -109.794 1.00 32.59  ? 541 VAL A CB  1 
ATOM   3166 C CG1 . VAL A 1 541 ? 62.306  12.367  -108.325 1.00 21.51  ? 541 VAL A CG1 1 
ATOM   3167 C CG2 . VAL A 1 541 ? 64.063  12.615  -110.122 1.00 24.73  ? 541 VAL A CG2 1 
ATOM   3168 N N   . ARG A 1 542 ? 61.098  9.209   -108.801 1.00 40.35  ? 542 ARG A N   1 
ATOM   3169 C CA  . ARG A 1 542 ? 59.846  8.610   -108.352 1.00 40.23  ? 542 ARG A CA  1 
ATOM   3170 C C   . ARG A 1 542 ? 58.907  9.630   -107.712 1.00 42.44  ? 542 ARG A C   1 
ATOM   3171 O O   . ARG A 1 542 ? 59.345  10.643  -107.172 1.00 42.73  ? 542 ARG A O   1 
ATOM   3172 C CB  . ARG A 1 542 ? 60.129  7.470   -107.371 1.00 36.54  ? 542 ARG A CB  1 
ATOM   3173 C CG  . ARG A 1 542 ? 60.681  6.221   -108.045 1.00 38.27  ? 542 ARG A CG  1 
ATOM   3174 C CD  . ARG A 1 542 ? 59.546  5.357   -108.569 1.00 42.13  ? 542 ARG A CD  1 
ATOM   3175 N NE  . ARG A 1 542 ? 59.941  4.471   -109.658 1.00 35.41  ? 542 ARG A NE  1 
ATOM   3176 C CZ  . ARG A 1 542 ? 60.685  3.385   -109.515 1.00 36.67  ? 542 ARG A CZ  1 
ATOM   3177 N NH1 . ARG A 1 542 ? 61.163  3.034   -108.327 1.00 52.22  ? 542 ARG A NH1 1 
ATOM   3178 N NH2 . ARG A 1 542 ? 60.969  2.650   -110.573 1.00 43.77  ? 542 ARG A NH2 1 
ATOM   3179 N N   . GLU A 1 543 ? 57.611  9.348   -107.789 1.00 47.67  ? 543 GLU A N   1 
ATOM   3180 C CA  . GLU A 1 543 ? 56.594  10.188  -107.179 1.00 49.00  ? 543 GLU A CA  1 
ATOM   3181 C C   . GLU A 1 543 ? 56.525  9.879   -105.686 1.00 50.98  ? 543 GLU A C   1 
ATOM   3182 O O   . GLU A 1 543 ? 55.836  8.950   -105.270 1.00 54.42  ? 543 GLU A O   1 
ATOM   3183 C CB  . GLU A 1 543 ? 55.240  9.932   -107.848 1.00 49.96  ? 543 GLU A CB  1 
ATOM   3184 C CG  . GLU A 1 543 ? 54.112  10.839  -107.368 1.00 53.92  ? 543 GLU A CG  1 
ATOM   3185 C CD  . GLU A 1 543 ? 52.741  10.419  -107.886 1.00 57.50  ? 543 GLU A CD  1 
ATOM   3186 O OE1 . GLU A 1 543 ? 51.769  11.178  -107.663 1.00 60.97  ? 543 GLU A OE1 1 
ATOM   3187 O OE2 . GLU A 1 543 ? 52.630  9.337   -108.508 1.00 59.08  ? 543 GLU A OE2 1 
ATOM   3188 N N   . GLY A 1 544 ? 57.258  10.651  -104.888 1.00 53.44  ? 544 GLY A N   1 
ATOM   3189 C CA  . GLY A 1 544 ? 57.257  10.492  -103.430 1.00 52.01  ? 544 GLY A CA  1 
ATOM   3190 C C   . GLY A 1 544 ? 57.876  11.680  -102.708 1.00 52.55  ? 544 GLY A C   1 
ATOM   3191 O O   . GLY A 1 544 ? 58.381  12.607  -103.343 1.00 54.58  ? 544 GLY A O   1 
ATOM   3192 N N   . ASP A 1 545 ? 57.829  11.655  -101.378 1.00 51.91  ? 545 ASP A N   1 
ATOM   3193 C CA  . ASP A 1 545 ? 58.467  12.691  -100.560 1.00 50.62  ? 545 ASP A CA  1 
ATOM   3194 C C   . ASP A 1 545 ? 59.979  12.467  -100.483 1.00 50.28  ? 545 ASP A C   1 
ATOM   3195 O O   . ASP A 1 545 ? 60.751  13.428  -100.450 1.00 49.28  ? 545 ASP A O   1 
ATOM   3196 C CB  . ASP A 1 545 ? 57.878  12.719  -99.144  1.00 49.73  ? 545 ASP A CB  1 
ATOM   3197 C CG  . ASP A 1 545 ? 56.399  13.077  -99.125  1.00 50.80  ? 545 ASP A CG  1 
ATOM   3198 O OD1 . ASP A 1 545 ? 55.605  12.371  -99.779  1.00 56.21  ? 545 ASP A OD1 1 
ATOM   3199 O OD2 . ASP A 1 545 ? 56.026  14.055  -98.443  1.00 43.79  ? 545 ASP A OD2 1 
ATOM   3200 N N   . GLU A 1 546 ? 60.392  11.198  -100.466 1.00 49.91  ? 546 GLU A N   1 
ATOM   3201 C CA  . GLU A 1 546 ? 61.806  10.833  -100.342 1.00 49.58  ? 546 GLU A CA  1 
ATOM   3202 C C   . GLU A 1 546 ? 62.605  11.069  -101.635 1.00 47.06  ? 546 GLU A C   1 
ATOM   3203 O O   . GLU A 1 546 ? 63.833  10.982  -101.627 1.00 44.93  ? 546 GLU A O   1 
ATOM   3204 C CB  . GLU A 1 546 ? 61.942  9.367   -99.901  1.00 49.95  ? 546 GLU A CB  1 
ATOM   3205 C CG  . GLU A 1 546 ? 63.311  9.010   -99.301  1.00 54.88  ? 546 GLU A CG  1 
ATOM   3206 C CD  . GLU A 1 546 ? 63.563  7.511   -99.240  1.00 58.72  ? 546 GLU A CD  1 
ATOM   3207 O OE1 . GLU A 1 546 ? 62.673  6.778   -98.756  1.00 70.28  ? 546 GLU A OE1 1 
ATOM   3208 O OE2 . GLU A 1 546 ? 64.656  7.068   -99.669  1.00 58.31  ? 546 GLU A OE2 1 
ATOM   3209 N N   . GLN A 1 547 ? 61.918  11.363  -102.737 1.00 45.18  ? 547 GLN A N   1 
ATOM   3210 C CA  . GLN A 1 547 ? 62.581  11.644  -104.008 1.00 44.97  ? 547 GLN A CA  1 
ATOM   3211 C C   . GLN A 1 547 ? 63.544  10.519  -104.360 1.00 44.50  ? 547 GLN A C   1 
ATOM   3212 O O   . GLN A 1 547 ? 64.734  10.748  -104.587 1.00 46.74  ? 547 GLN A O   1 
ATOM   3213 C CB  . GLN A 1 547 ? 63.331  12.984  -103.965 1.00 46.66  ? 547 GLN A CB  1 
ATOM   3214 C CG  . GLN A 1 547 ? 62.458  14.203  -103.685 1.00 51.91  ? 547 GLN A CG  1 
ATOM   3215 C CD  . GLN A 1 547 ? 61.663  14.650  -104.899 1.00 53.89  ? 547 GLN A CD  1 
ATOM   3216 O OE1 . GLN A 1 547 ? 60.777  13.938  -105.378 1.00 47.92  ? 547 GLN A OE1 1 
ATOM   3217 N NE2 . GLN A 1 547 ? 61.972  15.843  -105.398 1.00 54.73  ? 547 GLN A NE2 1 
ATOM   3218 N N   . ARG A 1 548 ? 63.023  9.297   -104.372 1.00 41.76  ? 548 ARG A N   1 
ATOM   3219 C CA  . ARG A 1 548 ? 63.770  8.152   -104.869 1.00 38.64  ? 548 ARG A CA  1 
ATOM   3220 C C   . ARG A 1 548 ? 63.926  8.294   -106.374 1.00 37.72  ? 548 ARG A C   1 
ATOM   3221 O O   . ARG A 1 548 ? 63.052  8.840   -107.039 1.00 40.47  ? 548 ARG A O   1 
ATOM   3222 C CB  . ARG A 1 548 ? 63.056  6.847   -104.522 1.00 34.44  ? 548 ARG A CB  1 
ATOM   3223 C CG  . ARG A 1 548 ? 63.146  6.503   -103.054 1.00 34.55  ? 548 ARG A CG  1 
ATOM   3224 C CD  . ARG A 1 548 ? 62.358  5.251   -102.698 1.00 40.79  ? 548 ARG A CD  1 
ATOM   3225 N NE  . ARG A 1 548 ? 62.560  4.874   -101.297 1.00 44.46  ? 548 ARG A NE  1 
ATOM   3226 C CZ  . ARG A 1 548 ? 61.865  3.940   -100.651 1.00 46.23  ? 548 ARG A CZ  1 
ATOM   3227 N NH1 . ARG A 1 548 ? 60.909  3.255   -101.268 1.00 51.76  ? 548 ARG A NH1 1 
ATOM   3228 N NH2 . ARG A 1 548 ? 62.132  3.683   -99.375  1.00 44.70  ? 548 ARG A NH2 1 
ATOM   3229 N N   . THR A 1 549 ? 65.050  7.826   -106.903 1.00 39.50  ? 549 THR A N   1 
ATOM   3230 C CA  . THR A 1 549 ? 65.328  7.925   -108.334 1.00 37.14  ? 549 THR A CA  1 
ATOM   3231 C C   . THR A 1 549 ? 65.589  6.553   -108.917 1.00 36.69  ? 549 THR A C   1 
ATOM   3232 O O   . THR A 1 549 ? 65.921  5.609   -108.195 1.00 36.58  ? 549 THR A O   1 
ATOM   3233 C CB  . THR A 1 549 ? 66.559  8.807   -108.620 1.00 34.91  ? 549 THR A CB  1 
ATOM   3234 O OG1 . THR A 1 549 ? 67.748  8.150   -108.158 1.00 34.78  ? 549 THR A OG1 1 
ATOM   3235 C CG2 . THR A 1 549 ? 66.419  10.155  -107.937 1.00 26.54  ? 549 THR A CG2 1 
ATOM   3236 N N   . PHE A 1 550 ? 65.435  6.447   -110.231 1.00 35.75  ? 550 PHE A N   1 
ATOM   3237 C CA  . PHE A 1 550 ? 65.827  5.233   -110.933 1.00 35.93  ? 550 PHE A CA  1 
ATOM   3238 C C   . PHE A 1 550 ? 66.242  5.556   -112.357 1.00 36.70  ? 550 PHE A C   1 
ATOM   3239 O O   . PHE A 1 550 ? 65.916  6.624   -112.881 1.00 34.45  ? 550 PHE A O   1 
ATOM   3240 C CB  . PHE A 1 550 ? 64.707  4.184   -110.896 1.00 29.66  ? 550 PHE A CB  1 
ATOM   3241 C CG  . PHE A 1 550 ? 63.490  4.547   -111.703 1.00 21.49  ? 550 PHE A CG  1 
ATOM   3242 C CD1 . PHE A 1 550 ? 62.645  5.565   -111.294 1.00 32.54  ? 550 PHE A CD1 1 
ATOM   3243 C CD2 . PHE A 1 550 ? 63.170  3.843   -112.856 1.00 27.71  ? 550 PHE A CD2 1 
ATOM   3244 C CE1 . PHE A 1 550 ? 61.507  5.893   -112.030 1.00 28.92  ? 550 PHE A CE1 1 
ATOM   3245 C CE2 . PHE A 1 550 ? 62.038  4.165   -113.602 1.00 31.77  ? 550 PHE A CE2 1 
ATOM   3246 C CZ  . PHE A 1 550 ? 61.205  5.192   -113.185 1.00 27.61  ? 550 PHE A CZ  1 
ATOM   3247 N N   . PHE A 1 551 ? 66.999  4.637   -112.948 1.00 34.60  ? 551 PHE A N   1 
ATOM   3248 C CA  . PHE A 1 551 ? 67.346  4.686   -114.359 1.00 35.02  ? 551 PHE A CA  1 
ATOM   3249 C C   . PHE A 1 551 ? 66.514  3.622   -115.066 1.00 35.17  ? 551 PHE A C   1 
ATOM   3250 O O   . PHE A 1 551 ? 66.522  2.455   -114.666 1.00 36.48  ? 551 PHE A O   1 
ATOM   3251 C CB  . PHE A 1 551 ? 68.839  4.393   -114.575 1.00 33.11  ? 551 PHE A CB  1 
ATOM   3252 C CG  . PHE A 1 551 ? 69.763  5.507   -114.139 1.00 29.89  ? 551 PHE A CG  1 
ATOM   3253 C CD1 . PHE A 1 551 ? 70.506  5.397   -112.971 1.00 31.81  ? 551 PHE A CD1 1 
ATOM   3254 C CD2 . PHE A 1 551 ? 69.912  6.652   -114.913 1.00 33.96  ? 551 PHE A CD2 1 
ATOM   3255 C CE1 . PHE A 1 551 ? 71.368  6.419   -112.566 1.00 31.27  ? 551 PHE A CE1 1 
ATOM   3256 C CE2 . PHE A 1 551 ? 70.774  7.678   -114.518 1.00 35.74  ? 551 PHE A CE2 1 
ATOM   3257 C CZ  . PHE A 1 551 ? 71.503  7.560   -113.342 1.00 30.85  ? 551 PHE A CZ  1 
ATOM   3258 N N   . SER A 1 552 ? 65.807  4.015   -116.120 1.00 38.86  ? 552 SER A N   1 
ATOM   3259 C CA  . SER A 1 552 ? 65.037  3.065   -116.929 1.00 38.01  ? 552 SER A CA  1 
ATOM   3260 C C   . SER A 1 552 ? 65.904  2.405   -118.013 1.00 37.39  ? 552 SER A C   1 
ATOM   3261 O O   . SER A 1 552 ? 65.506  2.350   -119.175 1.00 33.88  ? 552 SER A O   1 
ATOM   3262 C CB  . SER A 1 552 ? 63.842  3.771   -117.570 1.00 38.21  ? 552 SER A CB  1 
ATOM   3263 O OG  . SER A 1 552 ? 64.279  4.745   -118.499 1.00 46.68  ? 552 SER A OG  1 
ATOM   3264 N N   . PHE A 1 553 ? 67.072  1.890   -117.619 1.00 36.36  ? 553 PHE A N   1 
ATOM   3265 C CA  . PHE A 1 553 ? 68.001  1.227   -118.541 1.00 35.74  ? 553 PHE A CA  1 
ATOM   3266 C C   . PHE A 1 553 ? 67.355  0.039   -119.231 1.00 34.79  ? 553 PHE A C   1 
ATOM   3267 O O   . PHE A 1 553 ? 66.748  -0.790  -118.575 1.00 33.09  ? 553 PHE A O   1 
ATOM   3268 C CB  . PHE A 1 553 ? 69.218  0.667   -117.788 1.00 36.65  ? 553 PHE A CB  1 
ATOM   3269 C CG  . PHE A 1 553 ? 70.138  1.712   -117.210 1.00 31.86  ? 553 PHE A CG  1 
ATOM   3270 C CD1 . PHE A 1 553 ? 70.801  1.466   -116.023 1.00 36.81  ? 553 PHE A CD1 1 
ATOM   3271 C CD2 . PHE A 1 553 ? 70.360  2.916   -117.850 1.00 32.43  ? 553 PHE A CD2 1 
ATOM   3272 C CE1 . PHE A 1 553 ? 71.664  2.402   -115.484 1.00 38.66  ? 553 PHE A CE1 1 
ATOM   3273 C CE2 . PHE A 1 553 ? 71.214  3.854   -117.313 1.00 36.16  ? 553 PHE A CE2 1 
ATOM   3274 C CZ  . PHE A 1 553 ? 71.867  3.600   -116.133 1.00 35.57  ? 553 PHE A CZ  1 
ATOM   3275 N N   . PRO A 1 554 ? 67.504  -0.072  -120.556 1.00 35.54  ? 554 PRO A N   1 
ATOM   3276 C CA  . PRO A 1 554 ? 67.059  -1.318  -121.180 1.00 33.97  ? 554 PRO A CA  1 
ATOM   3277 C C   . PRO A 1 554 ? 67.744  -2.529  -120.544 1.00 32.95  ? 554 PRO A C   1 
ATOM   3278 O O   . PRO A 1 554 ? 68.857  -2.404  -120.026 1.00 29.49  ? 554 PRO A O   1 
ATOM   3279 C CB  . PRO A 1 554 ? 67.490  -1.156  -122.638 1.00 35.53  ? 554 PRO A CB  1 
ATOM   3280 C CG  . PRO A 1 554 ? 67.624  0.311   -122.846 1.00 36.00  ? 554 PRO A CG  1 
ATOM   3281 C CD  . PRO A 1 554 ? 68.040  0.889   -121.535 1.00 35.88  ? 554 PRO A CD  1 
ATOM   3282 N N   . ALA A 1 555 ? 67.081  -3.684  -120.581 1.00 32.13  ? 555 ALA A N   1 
ATOM   3283 C CA  . ALA A 1 555 ? 67.614  -4.904  -119.960 1.00 31.06  ? 555 ALA A CA  1 
ATOM   3284 C C   . ALA A 1 555 ? 68.983  -5.328  -120.510 1.00 32.50  ? 555 ALA A C   1 
ATOM   3285 O O   . ALA A 1 555 ? 69.782  -5.894  -119.774 1.00 43.00  ? 555 ALA A O   1 
ATOM   3286 C CB  . ALA A 1 555 ? 66.619  -6.048  -120.100 1.00 24.19  ? 555 ALA A CB  1 
ATOM   3287 N N   . VAL A 1 556 ? 69.256  -5.060  -121.787 1.00 32.37  ? 556 VAL A N   1 
ATOM   3288 C CA  . VAL A 1 556 ? 70.558  -5.400  -122.377 1.00 34.44  ? 556 VAL A CA  1 
ATOM   3289 C C   . VAL A 1 556 ? 71.731  -4.552  -121.876 1.00 37.59  ? 556 VAL A C   1 
ATOM   3290 O O   . VAL A 1 556 ? 72.879  -4.940  -122.076 1.00 37.50  ? 556 VAL A O   1 
ATOM   3291 C CB  . VAL A 1 556 ? 70.568  -5.317  -123.927 1.00 33.54  ? 556 VAL A CB  1 
ATOM   3292 C CG1 . VAL A 1 556 ? 69.726  -6.422  -124.517 1.00 34.84  ? 556 VAL A CG1 1 
ATOM   3293 C CG2 . VAL A 1 556 ? 70.117  -3.931  -124.404 1.00 30.28  ? 556 VAL A CG2 1 
ATOM   3294 N N   . VAL A 1 557 ? 71.463  -3.396  -121.264 1.00 40.82  ? 557 VAL A N   1 
ATOM   3295 C CA  . VAL A 1 557 ? 72.548  -2.564  -120.712 1.00 37.37  ? 557 VAL A CA  1 
ATOM   3296 C C   . VAL A 1 557 ? 72.527  -2.410  -119.195 1.00 36.61  ? 557 VAL A C   1 
ATOM   3297 O O   . VAL A 1 557 ? 73.531  -2.004  -118.621 1.00 42.96  ? 557 VAL A O   1 
ATOM   3298 C CB  . VAL A 1 557 ? 72.612  -1.157  -121.354 1.00 34.80  ? 557 VAL A CB  1 
ATOM   3299 C CG1 . VAL A 1 557 ? 72.904  -1.270  -122.829 1.00 29.03  ? 557 VAL A CG1 1 
ATOM   3300 C CG2 . VAL A 1 557 ? 71.336  -0.387  -121.110 1.00 33.80  ? 557 VAL A CG2 1 
ATOM   3301 N N   . ALA A 1 558 ? 71.413  -2.738  -118.544 1.00 38.56  ? 558 ALA A N   1 
ATOM   3302 C CA  . ALA A 1 558 ? 71.329  -2.637  -117.082 1.00 38.42  ? 558 ALA A CA  1 
ATOM   3303 C C   . ALA A 1 558 ? 72.502  -3.377  -116.445 1.00 39.45  ? 558 ALA A C   1 
ATOM   3304 O O   . ALA A 1 558 ? 72.850  -4.471  -116.895 1.00 39.16  ? 558 ALA A O   1 
ATOM   3305 C CB  . ALA A 1 558 ? 70.023  -3.206  -116.581 1.00 36.69  ? 558 ALA A CB  1 
ATOM   3306 N N   . PRO A 1 559 ? 73.128  -2.780  -115.412 1.00 38.49  ? 559 PRO A N   1 
ATOM   3307 C CA  . PRO A 1 559 ? 74.326  -3.355  -114.808 1.00 39.19  ? 559 PRO A CA  1 
ATOM   3308 C C   . PRO A 1 559 ? 74.175  -4.845  -114.572 1.00 38.39  ? 559 PRO A C   1 
ATOM   3309 O O   . PRO A 1 559 ? 75.079  -5.616  -114.880 1.00 41.86  ? 559 PRO A O   1 
ATOM   3310 C CB  . PRO A 1 559 ? 74.444  -2.601  -113.489 1.00 39.59  ? 559 PRO A CB  1 
ATOM   3311 C CG  . PRO A 1 559 ? 73.844  -1.311  -113.752 1.00 40.18  ? 559 PRO A CG  1 
ATOM   3312 C CD  . PRO A 1 559 ? 72.744  -1.526  -114.748 1.00 40.18  ? 559 PRO A CD  1 
ATOM   3313 N N   . PHE A 1 560 ? 73.036  -5.236  -114.014 1.00 38.08  ? 560 PHE A N   1 
ATOM   3314 C CA  . PHE A 1 560 ? 72.564  -6.604  -114.148 1.00 39.11  ? 560 PHE A CA  1 
ATOM   3315 C C   . PHE A 1 560 ? 71.047  -6.614  -114.297 1.00 38.31  ? 560 PHE A C   1 
ATOM   3316 O O   . PHE A 1 560 ? 70.368  -5.645  -113.948 1.00 37.55  ? 560 PHE A O   1 
ATOM   3317 C CB  . PHE A 1 560 ? 73.047  -7.495  -113.006 1.00 36.81  ? 560 PHE A CB  1 
ATOM   3318 C CG  . PHE A 1 560 ? 72.774  -6.955  -111.637 1.00 38.78  ? 560 PHE A CG  1 
ATOM   3319 C CD1 . PHE A 1 560 ? 71.635  -7.337  -110.940 1.00 41.29  ? 560 PHE A CD1 1 
ATOM   3320 C CD2 . PHE A 1 560 ? 73.683  -6.107  -111.016 1.00 42.81  ? 560 PHE A CD2 1 
ATOM   3321 C CE1 . PHE A 1 560 ? 71.396  -6.864  -109.656 1.00 43.10  ? 560 PHE A CE1 1 
ATOM   3322 C CE2 . PHE A 1 560 ? 73.449  -5.627  -109.729 1.00 41.04  ? 560 PHE A CE2 1 
ATOM   3323 C CZ  . PHE A 1 560 ? 72.306  -6.006  -109.049 1.00 38.50  ? 560 PHE A CZ  1 
ATOM   3324 N N   . LYS A 1 561 ? 70.527  -7.702  -114.848 1.00 36.77  ? 561 LYS A N   1 
ATOM   3325 C CA  . LYS A 1 561 ? 69.123  -7.757  -115.232 1.00 39.58  ? 561 LYS A CA  1 
ATOM   3326 C C   . LYS A 1 561 ? 68.180  -8.034  -114.053 1.00 40.29  ? 561 LYS A C   1 
ATOM   3327 O O   . LYS A 1 561 ? 67.061  -7.530  -114.040 1.00 42.53  ? 561 LYS A O   1 
ATOM   3328 C CB  . LYS A 1 561 ? 68.911  -8.796  -116.344 1.00 38.27  ? 561 LYS A CB  1 
ATOM   3329 C CG  . LYS A 1 561 ? 69.762  -8.562  -117.591 1.00 34.40  ? 561 LYS A CG  1 
ATOM   3330 C CD  . LYS A 1 561 ? 69.217  -9.308  -118.804 1.00 35.18  ? 561 LYS A CD  1 
ATOM   3331 C CE  . LYS A 1 561 ? 70.253  -9.474  -119.900 1.00 33.74  ? 561 LYS A CE  1 
ATOM   3332 N NZ  . LYS A 1 561 ? 71.312  -10.460 -119.476 1.00 57.73  ? 561 LYS A NZ  1 
ATOM   3333 N N   . CYS A 1 562 ? 68.626  -8.811  -113.067 1.00 41.05  ? 562 CYS A N   1 
ATOM   3334 C CA  . CYS A 1 562 ? 67.719  -9.304  -112.026 1.00 41.49  ? 562 CYS A CA  1 
ATOM   3335 C C   . CYS A 1 562 ? 68.302  -9.356  -110.610 1.00 40.23  ? 562 CYS A C   1 
ATOM   3336 O O   . CYS A 1 562 ? 69.241  -10.097 -110.337 1.00 37.06  ? 562 CYS A O   1 
ATOM   3337 C CB  . CYS A 1 562 ? 67.246  -10.704 -112.397 1.00 45.45  ? 562 CYS A CB  1 
ATOM   3338 S SG  . CYS A 1 562 ? 65.898  -11.281 -111.368 1.00 47.62  ? 562 CYS A SG  1 
ATOM   3339 N N   . SER A 1 563 ? 67.724  -8.578  -109.705 1.00 36.79  ? 563 SER A N   1 
ATOM   3340 C CA  . SER A 1 563 ? 68.076  -8.669  -108.296 1.00 37.96  ? 563 SER A CA  1 
ATOM   3341 C C   . SER A 1 563 ? 67.287  -9.811  -107.670 1.00 37.05  ? 563 SER A C   1 
ATOM   3342 O O   . SER A 1 563 ? 66.092  -9.944  -107.913 1.00 37.53  ? 563 SER A O   1 
ATOM   3343 C CB  . SER A 1 563 ? 67.755  -7.366  -107.573 1.00 37.61  ? 563 SER A CB  1 
ATOM   3344 O OG  . SER A 1 563 ? 67.827  -7.547  -106.173 1.00 49.44  ? 563 SER A OG  1 
ATOM   3345 N N   . VAL A 1 564 ? 67.958  -10.638 -106.876 1.00 36.63  ? 564 VAL A N   1 
ATOM   3346 C CA  . VAL A 1 564 ? 67.298  -11.720 -106.162 1.00 38.02  ? 564 VAL A CA  1 
ATOM   3347 C C   . VAL A 1 564 ? 67.390  -11.418 -104.681 1.00 38.72  ? 564 VAL A C   1 
ATOM   3348 O O   . VAL A 1 564 ? 68.478  -11.490 -104.112 1.00 42.08  ? 564 VAL A O   1 
ATOM   3349 C CB  . VAL A 1 564 ? 67.961  -13.071 -106.452 1.00 38.39  ? 564 VAL A CB  1 
ATOM   3350 C CG1 . VAL A 1 564 ? 67.339  -14.165 -105.598 1.00 38.33  ? 564 VAL A CG1 1 
ATOM   3351 C CG2 . VAL A 1 564 ? 67.831  -13.407 -107.919 1.00 34.00  ? 564 VAL A CG2 1 
ATOM   3352 N N   . LEU A 1 565 ? 66.266  -11.058 -104.059 1.00 38.13  ? 565 LEU A N   1 
ATOM   3353 C CA  . LEU A 1 565 ? 66.259  -10.822 -102.613 1.00 44.31  ? 565 LEU A CA  1 
ATOM   3354 C C   . LEU A 1 565 ? 65.472  -11.874 -101.846 1.00 42.62  ? 565 LEU A C   1 
ATOM   3355 O O   . LEU A 1 565 ? 64.243  -11.928 -101.930 1.00 40.90  ? 565 LEU A O   1 
ATOM   3356 C CB  . LEU A 1 565 ? 65.786  -9.409  -102.229 1.00 45.74  ? 565 LEU A CB  1 
ATOM   3357 C CG  . LEU A 1 565 ? 64.799  -8.621  -103.067 1.00 53.43  ? 565 LEU A CG  1 
ATOM   3358 C CD1 . LEU A 1 565 ? 63.532  -9.397  -103.222 1.00 67.30  ? 565 LEU A CD1 1 
ATOM   3359 C CD2 . LEU A 1 565 ? 64.536  -7.285  -102.382 1.00 52.40  ? 565 LEU A CD2 1 
ATOM   3360 N N   . PRO A 1 566 ? 66.193  -12.731 -101.105 1.00 40.19  ? 566 PRO A N   1 
ATOM   3361 C CA  . PRO A 1 566 ? 65.567  -13.644 -100.169 1.00 41.31  ? 566 PRO A CA  1 
ATOM   3362 C C   . PRO A 1 566 ? 65.373  -12.976 -98.812  1.00 40.85  ? 566 PRO A C   1 
ATOM   3363 O O   . PRO A 1 566 ? 66.203  -12.167 -98.399  1.00 40.85  ? 566 PRO A O   1 
ATOM   3364 C CB  . PRO A 1 566 ? 66.585  -14.771 -100.071 1.00 42.25  ? 566 PRO A CB  1 
ATOM   3365 C CG  . PRO A 1 566 ? 67.899  -14.091 -100.245 1.00 39.12  ? 566 PRO A CG  1 
ATOM   3366 C CD  . PRO A 1 566 ? 67.659  -12.891 -101.121 1.00 37.00  ? 566 PRO A CD  1 
ATOM   3367 N N   . LEU A 1 567 ? 64.282  -13.306 -98.130  1.00 42.99  ? 567 LEU A N   1 
ATOM   3368 C CA  . LEU A 1 567 ? 64.024  -12.762 -96.797  1.00 40.50  ? 567 LEU A CA  1 
ATOM   3369 C C   . LEU A 1 567 ? 64.953  -13.370 -95.750  1.00 44.15  ? 567 LEU A C   1 
ATOM   3370 O O   . LEU A 1 567 ? 65.239  -12.731 -94.742  1.00 47.40  ? 567 LEU A O   1 
ATOM   3371 C CB  . LEU A 1 567 ? 62.554  -12.935 -96.399  1.00 39.14  ? 567 LEU A CB  1 
ATOM   3372 C CG  . LEU A 1 567 ? 61.659  -11.710 -96.636  1.00 33.63  ? 567 LEU A CG  1 
ATOM   3373 C CD1 . LEU A 1 567 ? 61.938  -11.058 -97.971  1.00 26.10  ? 567 LEU A CD1 1 
ATOM   3374 C CD2 . LEU A 1 567 ? 60.196  -12.083 -96.538  1.00 32.33  ? 567 LEU A CD2 1 
ATOM   3375 N N   . SER A 1 568 ? 65.431  -14.591 -95.998  1.00 46.38  ? 568 SER A N   1 
ATOM   3376 C CA  . SER A 1 568 ? 66.424  -15.229 -95.132  1.00 47.39  ? 568 SER A CA  1 
ATOM   3377 C C   . SER A 1 568 ? 67.512  -15.924 -95.942  1.00 49.03  ? 568 SER A C   1 
ATOM   3378 O O   . SER A 1 568 ? 67.322  -16.234 -97.116  1.00 44.43  ? 568 SER A O   1 
ATOM   3379 C CB  . SER A 1 568 ? 65.761  -16.249 -94.209  1.00 48.95  ? 568 SER A CB  1 
ATOM   3380 O OG  . SER A 1 568 ? 66.721  -16.863 -93.361  1.00 51.58  ? 568 SER A OG  1 
ATOM   3381 N N   . GLN A 1 569 ? 68.646  -16.177 -95.289  1.00 53.50  ? 569 GLN A N   1 
ATOM   3382 C CA  . GLN A 1 569 ? 69.771  -16.879 -95.907  1.00 51.38  ? 569 GLN A CA  1 
ATOM   3383 C C   . GLN A 1 569 ? 70.083  -18.183 -95.160  1.00 48.37  ? 569 GLN A C   1 
ATOM   3384 O O   . GLN A 1 569 ? 71.167  -18.741 -95.307  1.00 48.66  ? 569 GLN A O   1 
ATOM   3385 C CB  . GLN A 1 569 ? 71.003  -15.959 -95.950  1.00 55.05  ? 569 GLN A CB  1 
ATOM   3386 C CG  . GLN A 1 569 ? 71.999  -16.235 -97.095  1.00 57.50  ? 569 GLN A CG  1 
ATOM   3387 C CD  . GLN A 1 569 ? 71.531  -15.721 -98.464  1.00 61.29  ? 569 GLN A CD  1 
ATOM   3388 O OE1 . GLN A 1 569 ? 72.346  -15.393 -99.328  1.00 47.07  ? 569 GLN A OE1 1 
ATOM   3389 N NE2 . GLN A 1 569 ? 70.219  -15.653 -98.661  1.00 68.85  ? 569 GLN A NE2 1 
ATOM   3390 N N   . ASN A 1 570 ? 69.120  -18.673 -94.382  1.00 42.88  ? 570 ASN A N   1 
ATOM   3391 C CA  . ASN A 1 570 ? 69.279  -19.928 -93.648  1.00 42.79  ? 570 ASN A CA  1 
ATOM   3392 C C   . ASN A 1 570 ? 69.276  -21.160 -94.557  1.00 39.14  ? 570 ASN A C   1 
ATOM   3393 O O   . ASN A 1 570 ? 69.031  -21.054 -95.753  1.00 35.32  ? 570 ASN A O   1 
ATOM   3394 C CB  . ASN A 1 570 ? 68.187  -20.061 -92.575  1.00 43.63  ? 570 ASN A CB  1 
ATOM   3395 C CG  . ASN A 1 570 ? 66.809  -20.355 -93.157  1.00 42.25  ? 570 ASN A CG  1 
ATOM   3396 O OD1 . ASN A 1 570 ? 65.858  -20.611 -92.422  1.00 42.54  ? 570 ASN A OD1 1 
ATOM   3397 N ND2 . ASN A 1 570 ? 66.700  -20.326 -94.473  1.00 41.62  ? 570 ASN A ND2 1 
ATOM   3398 N N   . GLN A 1 571 ? 69.518  -22.329 -93.968  1.00 43.91  ? 571 GLN A N   1 
ATOM   3399 C CA  . GLN A 1 571 ? 69.619  -23.587 -94.720  1.00 45.33  ? 571 GLN A CA  1 
ATOM   3400 C C   . GLN A 1 571 ? 68.332  -23.980 -95.454  1.00 46.70  ? 571 GLN A C   1 
ATOM   3401 O O   . GLN A 1 571 ? 68.367  -24.785 -96.384  1.00 47.91  ? 571 GLN A O   1 
ATOM   3402 C CB  . GLN A 1 571 ? 70.039  -24.730 -93.790  1.00 43.09  ? 571 GLN A CB  1 
ATOM   3403 C CG  . GLN A 1 571 ? 70.564  -25.947 -94.533  1.00 45.20  ? 571 GLN A CG  1 
ATOM   3404 C CD  . GLN A 1 571 ? 71.215  -26.961 -93.616  1.00 45.59  ? 571 GLN A CD  1 
ATOM   3405 O OE1 . GLN A 1 571 ? 70.581  -27.481 -92.696  1.00 47.66  ? 571 GLN A OE1 1 
ATOM   3406 N NE2 . GLN A 1 571 ? 72.486  -27.259 -93.872  1.00 39.28  ? 571 GLN A NE2 1 
ATOM   3407 N N   . GLU A 1 572 ? 67.206  -23.414 -95.029  1.00 48.50  ? 572 GLU A N   1 
ATOM   3408 C CA  . GLU A 1 572 ? 65.905  -23.700 -95.637  1.00 46.60  ? 572 GLU A CA  1 
ATOM   3409 C C   . GLU A 1 572 ? 65.716  -22.903 -96.925  1.00 44.46  ? 572 GLU A C   1 
ATOM   3410 O O   . GLU A 1 572 ? 64.974  -23.322 -97.811  1.00 44.20  ? 572 GLU A O   1 
ATOM   3411 C CB  . GLU A 1 572 ? 64.759  -23.383 -94.659  1.00 48.72  ? 572 GLU A CB  1 
ATOM   3412 C CG  . GLU A 1 572 ? 65.017  -23.737 -93.181  1.00 45.79  ? 572 GLU A CG  1 
ATOM   3413 C CD  . GLU A 1 572 ? 65.455  -25.175 -92.968  1.00 54.43  ? 572 GLU A CD  1 
ATOM   3414 O OE1 . GLU A 1 572 ? 65.123  -26.032 -93.814  1.00 62.23  ? 572 GLU A OE1 1 
ATOM   3415 O OE2 . GLU A 1 572 ? 66.120  -25.452 -91.942  1.00 52.07  ? 572 GLU A OE2 1 
ATOM   3416 N N   . PHE A 1 573 ? 66.407  -21.768 -97.024  1.00 43.37  ? 573 PHE A N   1 
ATOM   3417 C CA  . PHE A 1 573 ? 66.272  -20.839 -98.151  1.00 42.17  ? 573 PHE A CA  1 
ATOM   3418 C C   . PHE A 1 573 ? 67.304  -21.072 -99.259  1.00 41.77  ? 573 PHE A C   1 
ATOM   3419 O O   . PHE A 1 573 ? 67.055  -20.721 -100.411 1.00 44.46  ? 573 PHE A O   1 
ATOM   3420 C CB  . PHE A 1 573 ? 66.403  -19.387 -97.665  1.00 37.54  ? 573 PHE A CB  1 
ATOM   3421 C CG  . PHE A 1 573 ? 65.101  -18.757 -97.254  1.00 39.55  ? 573 PHE A CG  1 
ATOM   3422 C CD1 . PHE A 1 573 ? 64.383  -19.251 -96.174  1.00 37.25  ? 573 PHE A CD1 1 
ATOM   3423 C CD2 . PHE A 1 573 ? 64.600  -17.655 -97.940  1.00 36.96  ? 573 PHE A CD2 1 
ATOM   3424 C CE1 . PHE A 1 573 ? 63.189  -18.665 -95.793  1.00 35.78  ? 573 PHE A CE1 1 
ATOM   3425 C CE2 . PHE A 1 573 ? 63.407  -17.066 -97.564  1.00 32.24  ? 573 PHE A CE2 1 
ATOM   3426 C CZ  . PHE A 1 573 ? 62.702  -17.570 -96.491  1.00 38.66  ? 573 PHE A CZ  1 
ATOM   3427 N N   . MET A 1 574 ? 68.458  -21.643 -98.920  1.00 42.41  ? 574 MET A N   1 
ATOM   3428 C CA  . MET A 1 574 ? 69.565  -21.744 -99.882  1.00 44.03  ? 574 MET A CA  1 
ATOM   3429 C C   . MET A 1 574 ? 69.294  -22.634 -101.100 1.00 43.69  ? 574 MET A C   1 
ATOM   3430 O O   . MET A 1 574 ? 69.677  -22.271 -102.214 1.00 45.68  ? 574 MET A O   1 
ATOM   3431 C CB  . MET A 1 574 ? 70.871  -22.160 -99.192  1.00 45.18  ? 574 MET A CB  1 
ATOM   3432 C CG  . MET A 1 574 ? 71.469  -21.077 -98.293  1.00 48.88  ? 574 MET A CG  1 
ATOM   3433 S SD  . MET A 1 574 ? 71.350  -19.385 -98.943  1.00 61.02  ? 574 MET A SD  1 
ATOM   3434 C CE  . MET A 1 574 ? 72.271  -19.482 -100.481 1.00 29.64  ? 574 MET A CE  1 
ATOM   3435 N N   . PRO A 1 575 ? 68.647  -23.798 -100.904 1.00 40.22  ? 575 PRO A N   1 
ATOM   3436 C CA  . PRO A 1 575 ? 68.266  -24.611 -102.063 1.00 40.15  ? 575 PRO A CA  1 
ATOM   3437 C C   . PRO A 1 575 ? 67.473  -23.840 -103.130 1.00 39.58  ? 575 PRO A C   1 
ATOM   3438 O O   . PRO A 1 575 ? 67.648  -24.087 -104.322 1.00 38.94  ? 575 PRO A O   1 
ATOM   3439 C CB  . PRO A 1 575 ? 67.401  -25.715 -101.442 1.00 37.57  ? 575 PRO A CB  1 
ATOM   3440 C CG  . PRO A 1 575 ? 67.910  -25.843 -100.062 1.00 35.54  ? 575 PRO A CG  1 
ATOM   3441 C CD  . PRO A 1 575 ? 68.259  -24.446 -99.639  1.00 39.12  ? 575 PRO A CD  1 
ATOM   3442 N N   . PHE A 1 576 ? 66.617  -22.919 -102.695 1.00 39.29  ? 576 PHE A N   1 
ATOM   3443 C CA  . PHE A 1 576 ? 65.787  -22.132 -103.608 1.00 37.75  ? 576 PHE A CA  1 
ATOM   3444 C C   . PHE A 1 576 ? 66.564  -21.011 -104.280 1.00 33.85  ? 576 PHE A C   1 
ATOM   3445 O O   . PHE A 1 576 ? 66.348  -20.732 -105.458 1.00 38.27  ? 576 PHE A O   1 
ATOM   3446 C CB  . PHE A 1 576 ? 64.580  -21.544 -102.869 1.00 40.31  ? 576 PHE A CB  1 
ATOM   3447 C CG  . PHE A 1 576 ? 63.576  -22.572 -102.434 1.00 38.32  ? 576 PHE A CG  1 
ATOM   3448 C CD1 . PHE A 1 576 ? 63.518  -22.991 -101.111 1.00 44.77  ? 576 PHE A CD1 1 
ATOM   3449 C CD2 . PHE A 1 576 ? 62.689  -23.124 -103.349 1.00 39.27  ? 576 PHE A CD2 1 
ATOM   3450 C CE1 . PHE A 1 576 ? 62.587  -23.940 -100.706 1.00 43.96  ? 576 PHE A CE1 1 
ATOM   3451 C CE2 . PHE A 1 576 ? 61.756  -24.072 -102.955 1.00 40.44  ? 576 PHE A CE2 1 
ATOM   3452 C CZ  . PHE A 1 576 ? 61.704  -24.480 -101.631 1.00 42.13  ? 576 PHE A CZ  1 
ATOM   3453 N N   . VAL A 1 577 ? 67.447  -20.358 -103.530 1.00 33.44  ? 577 VAL A N   1 
ATOM   3454 C CA  . VAL A 1 577 ? 68.286  -19.293 -104.084 1.00 34.98  ? 577 VAL A CA  1 
ATOM   3455 C C   . VAL A 1 577 ? 69.309  -19.876 -105.056 1.00 37.46  ? 577 VAL A C   1 
ATOM   3456 O O   . VAL A 1 577 ? 69.480  -19.377 -106.167 1.00 42.06  ? 577 VAL A O   1 
ATOM   3457 C CB  . VAL A 1 577 ? 69.043  -18.516 -102.984 1.00 32.39  ? 577 VAL A CB  1 
ATOM   3458 C CG1 . VAL A 1 577 ? 69.991  -17.490 -103.614 1.00 27.42  ? 577 VAL A CG1 1 
ATOM   3459 C CG2 . VAL A 1 577 ? 68.065  -17.839 -102.034 1.00 30.36  ? 577 VAL A CG2 1 
ATOM   3460 N N   . LYS A 1 578 ? 69.987  -20.935 -104.624 1.00 35.76  ? 578 LYS A N   1 
ATOM   3461 C CA  . LYS A 1 578 ? 70.973  -21.609 -105.451 1.00 34.87  ? 578 LYS A CA  1 
ATOM   3462 C C   . LYS A 1 578 ? 70.342  -22.041 -106.766 1.00 35.58  ? 578 LYS A C   1 
ATOM   3463 O O   . LYS A 1 578 ? 70.897  -21.798 -107.836 1.00 42.36  ? 578 LYS A O   1 
ATOM   3464 C CB  . LYS A 1 578 ? 71.543  -22.822 -104.715 1.00 35.91  ? 578 LYS A CB  1 
ATOM   3465 C CG  . LYS A 1 578 ? 72.643  -23.553 -105.467 1.00 38.84  ? 578 LYS A CG  1 
ATOM   3466 C CD  . LYS A 1 578 ? 73.058  -24.831 -104.760 1.00 36.19  ? 578 LYS A CD  1 
ATOM   3467 C CE  . LYS A 1 578 ? 73.909  -25.711 -105.669 1.00 39.41  ? 578 LYS A CE  1 
ATOM   3468 N NZ  . LYS A 1 578 ? 74.338  -26.974 -105.002 1.00 42.00  ? 578 LYS A NZ  1 
ATOM   3469 N N   . GLU A 1 579 ? 69.173  -22.667 -106.686 1.00 35.42  ? 579 GLU A N   1 
ATOM   3470 C CA  . GLU A 1 579 ? 68.485  -23.142 -107.881 1.00 33.96  ? 579 GLU A CA  1 
ATOM   3471 C C   . GLU A 1 579 ? 68.131  -21.981 -108.791 1.00 34.15  ? 579 GLU A C   1 
ATOM   3472 O O   . GLU A 1 579 ? 68.346  -22.051 -110.007 1.00 28.58  ? 579 GLU A O   1 
ATOM   3473 C CB  . GLU A 1 579 ? 67.223  -23.922 -107.515 1.00 30.53  ? 579 GLU A CB  1 
ATOM   3474 C CG  . GLU A 1 579 ? 66.399  -24.400 -108.709 1.00 36.37  ? 579 GLU A CG  1 
ATOM   3475 C CD  . GLU A 1 579 ? 67.214  -25.160 -109.753 1.00 43.44  ? 579 GLU A CD  1 
ATOM   3476 O OE1 . GLU A 1 579 ? 66.889  -25.028 -110.951 1.00 43.48  ? 579 GLU A OE1 1 
ATOM   3477 O OE2 . GLU A 1 579 ? 68.168  -25.885 -109.386 1.00 37.42  ? 579 GLU A OE2 1 
ATOM   3478 N N   . LEU A 1 580 ? 67.602  -20.912 -108.200 1.00 35.60  ? 580 LEU A N   1 
ATOM   3479 C CA  . LEU A 1 580 ? 67.216  -19.736 -108.975 1.00 36.39  ? 580 LEU A CA  1 
ATOM   3480 C C   . LEU A 1 580 ? 68.427  -19.130 -109.680 1.00 37.50  ? 580 LEU A C   1 
ATOM   3481 O O   . LEU A 1 580 ? 68.343  -18.766 -110.850 1.00 41.37  ? 580 LEU A O   1 
ATOM   3482 C CB  . LEU A 1 580 ? 66.529  -18.691 -108.093 1.00 33.09  ? 580 LEU A CB  1 
ATOM   3483 C CG  . LEU A 1 580 ? 65.875  -17.536 -108.856 1.00 34.65  ? 580 LEU A CG  1 
ATOM   3484 C CD1 . LEU A 1 580 ? 64.706  -18.033 -109.701 1.00 31.22  ? 580 LEU A CD1 1 
ATOM   3485 C CD2 . LEU A 1 580 ? 65.423  -16.447 -107.895 1.00 36.54  ? 580 LEU A CD2 1 
ATOM   3486 N N   . LEU A 1 581 ? 69.552  -19.044 -108.977 1.00 36.22  ? 581 LEU A N   1 
ATOM   3487 C CA  . LEU A 1 581 ? 70.760  -18.473 -109.557 1.00 38.43  ? 581 LEU A CA  1 
ATOM   3488 C C   . LEU A 1 581 ? 71.280  -19.327 -110.719 1.00 40.22  ? 581 LEU A C   1 
ATOM   3489 O O   . LEU A 1 581 ? 71.624  -18.805 -111.784 1.00 36.87  ? 581 LEU A O   1 
ATOM   3490 C CB  . LEU A 1 581 ? 71.844  -18.311 -108.488 1.00 38.36  ? 581 LEU A CB  1 
ATOM   3491 C CG  . LEU A 1 581 ? 71.555  -17.317 -107.359 1.00 41.99  ? 581 LEU A CG  1 
ATOM   3492 C CD1 . LEU A 1 581 ? 72.818  -17.084 -106.544 1.00 29.23  ? 581 LEU A CD1 1 
ATOM   3493 C CD2 . LEU A 1 581 ? 70.994  -15.990 -107.884 1.00 39.45  ? 581 LEU A CD2 1 
ATOM   3494 N N   . GLU A 1 582 ? 71.324  -20.639 -110.515 1.00 38.58  ? 582 GLU A N   1 
ATOM   3495 C CA  . GLU A 1 582 ? 71.768  -21.549 -111.568 1.00 37.74  ? 582 GLU A CA  1 
ATOM   3496 C C   . GLU A 1 582 ? 70.846  -21.487 -112.790 1.00 38.07  ? 582 GLU A C   1 
ATOM   3497 O O   . GLU A 1 582 ? 71.326  -21.443 -113.920 1.00 41.16  ? 582 GLU A O   1 
ATOM   3498 C CB  . GLU A 1 582 ? 71.894  -22.972 -111.027 1.00 33.27  ? 582 GLU A CB  1 
ATOM   3499 C CG  . GLU A 1 582 ? 73.065  -23.119 -110.063 1.00 34.69  ? 582 GLU A CG  1 
ATOM   3500 C CD  . GLU A 1 582 ? 73.158  -24.485 -109.410 1.00 41.61  ? 582 GLU A CD  1 
ATOM   3501 O OE1 . GLU A 1 582 ? 74.179  -24.739 -108.736 1.00 47.54  ? 582 GLU A OE1 1 
ATOM   3502 O OE2 . GLU A 1 582 ? 72.223  -25.303 -109.561 1.00 49.56  ? 582 GLU A OE2 1 
ATOM   3503 N N   . ALA A 1 583 ? 69.535  -21.451 -112.557 1.00 38.68  ? 583 ALA A N   1 
ATOM   3504 C CA  . ALA A 1 583 ? 68.556  -21.315 -113.640 1.00 36.56  ? 583 ALA A CA  1 
ATOM   3505 C C   . ALA A 1 583 ? 68.727  -19.994 -114.394 1.00 36.59  ? 583 ALA A C   1 
ATOM   3506 O O   . ALA A 1 583 ? 68.801  -19.983 -115.622 1.00 37.08  ? 583 ALA A O   1 
ATOM   3507 C CB  . ALA A 1 583 ? 67.139  -21.434 -113.102 1.00 30.67  ? 583 ALA A CB  1 
ATOM   3508 N N   . LEU A 1 584 ? 68.805  -18.881 -113.672 1.00 34.57  ? 584 LEU A N   1 
ATOM   3509 C CA  . LEU A 1 584 ? 69.048  -17.597 -114.329 1.00 36.24  ? 584 LEU A CA  1 
ATOM   3510 C C   . LEU A 1 584 ? 70.318  -17.663 -115.186 1.00 34.95  ? 584 LEU A C   1 
ATOM   3511 O O   . LEU A 1 584 ? 70.315  -17.210 -116.329 1.00 34.38  ? 584 LEU A O   1 
ATOM   3512 C CB  . LEU A 1 584 ? 69.132  -16.451 -113.315 1.00 35.24  ? 584 LEU A CB  1 
ATOM   3513 C CG  . LEU A 1 584 ? 67.809  -16.052 -112.647 1.00 35.56  ? 584 LEU A CG  1 
ATOM   3514 C CD1 . LEU A 1 584 ? 68.059  -15.081 -111.494 1.00 24.44  ? 584 LEU A CD1 1 
ATOM   3515 C CD2 . LEU A 1 584 ? 66.837  -15.455 -113.657 1.00 29.85  ? 584 LEU A CD2 1 
ATOM   3516 N N   . THR A 1 585 ? 71.386  -18.255 -114.652 1.00 33.86  ? 585 THR A N   1 
ATOM   3517 C CA  . THR A 1 585 ? 72.622  -18.411 -115.421 1.00 36.69  ? 585 THR A CA  1 
ATOM   3518 C C   . THR A 1 585 ? 72.361  -19.233 -116.680 1.00 37.76  ? 585 THR A C   1 
ATOM   3519 O O   . THR A 1 585 ? 72.719  -18.812 -117.781 1.00 37.77  ? 585 THR A O   1 
ATOM   3520 C CB  . THR A 1 585 ? 73.752  -19.086 -114.621 1.00 34.24  ? 585 THR A CB  1 
ATOM   3521 O OG1 . THR A 1 585 ? 74.088  -18.287 -113.483 1.00 41.21  ? 585 THR A OG1 1 
ATOM   3522 C CG2 . THR A 1 585 ? 74.978  -19.240 -115.491 1.00 17.88  ? 585 THR A CG2 1 
ATOM   3523 N N   . ARG A 1 586 ? 71.723  -20.390 -116.513 1.00 37.37  ? 586 ARG A N   1 
ATOM   3524 C CA  . ARG A 1 586 ? 71.366  -21.249 -117.646 1.00 37.43  ? 586 ARG A CA  1 
ATOM   3525 C C   . ARG A 1 586 ? 70.573  -20.503 -118.723 1.00 40.25  ? 586 ARG A C   1 
ATOM   3526 O O   . ARG A 1 586 ? 70.691  -20.829 -119.901 1.00 40.83  ? 586 ARG A O   1 
ATOM   3527 C CB  . ARG A 1 586 ? 70.572  -22.472 -117.178 1.00 36.10  ? 586 ARG A CB  1 
ATOM   3528 C CG  . ARG A 1 586 ? 71.422  -23.582 -116.562 1.00 39.62  ? 586 ARG A CG  1 
ATOM   3529 C CD  . ARG A 1 586 ? 70.668  -24.907 -116.526 1.00 40.56  ? 586 ARG A CD  1 
ATOM   3530 N NE  . ARG A 1 586 ? 69.445  -24.821 -115.729 1.00 43.26  ? 586 ARG A NE  1 
ATOM   3531 C CZ  . ARG A 1 586 ? 69.396  -24.891 -114.398 1.00 47.71  ? 586 ARG A CZ  1 
ATOM   3532 N NH1 . ARG A 1 586 ? 70.504  -25.048 -113.678 1.00 46.56  ? 586 ARG A NH1 1 
ATOM   3533 N NH2 . ARG A 1 586 ? 68.226  -24.797 -113.779 1.00 47.73  ? 586 ARG A NH2 1 
ATOM   3534 N N   . HIS A 1 587 ? 69.779  -19.509 -118.308 1.00 43.81  ? 587 HIS A N   1 
ATOM   3535 C CA  . HIS A 1 587 ? 68.977  -18.672 -119.220 1.00 40.59  ? 587 HIS A CA  1 
ATOM   3536 C C   . HIS A 1 587 ? 69.673  -17.373 -119.651 1.00 40.67  ? 587 HIS A C   1 
ATOM   3537 O O   . HIS A 1 587 ? 69.055  -16.514 -120.299 1.00 40.88  ? 587 HIS A O   1 
ATOM   3538 C CB  . HIS A 1 587 ? 67.631  -18.325 -118.568 1.00 42.00  ? 587 HIS A CB  1 
ATOM   3539 C CG  . HIS A 1 587 ? 66.654  -19.457 -118.562 1.00 39.25  ? 587 HIS A CG  1 
ATOM   3540 N ND1 . HIS A 1 587 ? 65.639  -19.563 -119.488 1.00 40.69  ? 587 HIS A ND1 1 
ATOM   3541 C CD2 . HIS A 1 587 ? 66.538  -20.534 -117.748 1.00 34.22  ? 587 HIS A CD2 1 
ATOM   3542 C CE1 . HIS A 1 587 ? 64.939  -20.657 -119.243 1.00 48.76  ? 587 HIS A CE1 1 
ATOM   3543 N NE2 . HIS A 1 587 ? 65.463  -21.263 -118.192 1.00 38.31  ? 587 HIS A NE2 1 
ATOM   3544 N N   . GLY A 1 588 ? 70.944  -17.220 -119.285 1.00 37.95  ? 588 GLY A N   1 
ATOM   3545 C CA  . GLY A 1 588 ? 71.730  -16.057 -119.697 1.00 37.18  ? 588 GLY A CA  1 
ATOM   3546 C C   . GLY A 1 588 ? 71.232  -14.738 -119.142 1.00 38.39  ? 588 GLY A C   1 
ATOM   3547 O O   . GLY A 1 588 ? 71.427  -13.692 -119.766 1.00 40.42  ? 588 GLY A O   1 
ATOM   3548 N N   . VAL A 1 589 ? 70.604  -14.792 -117.965 1.00 35.85  ? 589 VAL A N   1 
ATOM   3549 C CA  . VAL A 1 589 ? 70.105  -13.613 -117.267 1.00 33.84  ? 589 VAL A CA  1 
ATOM   3550 C C   . VAL A 1 589 ? 71.022  -13.303 -116.087 1.00 35.59  ? 589 VAL A C   1 
ATOM   3551 O O   . VAL A 1 589 ? 71.126  -14.094 -115.151 1.00 37.71  ? 589 VAL A O   1 
ATOM   3552 C CB  . VAL A 1 589 ? 68.688  -13.852 -116.741 1.00 34.98  ? 589 VAL A CB  1 
ATOM   3553 C CG1 . VAL A 1 589 ? 68.195  -12.645 -115.931 1.00 33.63  ? 589 VAL A CG1 1 
ATOM   3554 C CG2 . VAL A 1 589 ? 67.749  -14.179 -117.894 1.00 35.23  ? 589 VAL A CG2 1 
ATOM   3555 N N   . SER A 1 590 ? 71.685  -12.150 -116.134 1.00 36.17  ? 590 SER A N   1 
ATOM   3556 C CA  . SER A 1 590 ? 72.615  -11.762 -115.078 1.00 31.68  ? 590 SER A CA  1 
ATOM   3557 C C   . SER A 1 590 ? 71.850  -11.350 -113.835 1.00 32.27  ? 590 SER A C   1 
ATOM   3558 O O   . SER A 1 590 ? 70.701  -10.910 -113.917 1.00 37.72  ? 590 SER A O   1 
ATOM   3559 C CB  . SER A 1 590 ? 73.525  -10.627 -115.540 1.00 22.29  ? 590 SER A CB  1 
ATOM   3560 O OG  . SER A 1 590 ? 72.768  -9.524  -115.981 1.00 33.28  ? 590 SER A OG  1 
ATOM   3561 N N   . HIS A 1 591 ? 72.501  -11.488 -112.686 1.00 31.56  ? 591 HIS A N   1 
ATOM   3562 C CA  . HIS A 1 591 ? 71.835  -11.314 -111.410 1.00 32.76  ? 591 HIS A CA  1 
ATOM   3563 C C   . HIS A 1 591 ? 72.790  -11.088 -110.245 1.00 33.09  ? 591 HIS A C   1 
ATOM   3564 O O   . HIS A 1 591 ? 74.000  -11.237 -110.373 1.00 36.62  ? 591 HIS A O   1 
ATOM   3565 C CB  . HIS A 1 591 ? 71.013  -12.562 -111.120 1.00 35.49  ? 591 HIS A CB  1 
ATOM   3566 C CG  . HIS A 1 591 ? 71.810  -13.821 -111.184 1.00 33.43  ? 591 HIS A CG  1 
ATOM   3567 N ND1 . HIS A 1 591 ? 71.914  -14.572 -112.332 1.00 34.44  ? 591 HIS A ND1 1 
ATOM   3568 C CD2 . HIS A 1 591 ? 72.566  -14.447 -110.251 1.00 34.08  ? 591 HIS A CD2 1 
ATOM   3569 C CE1 . HIS A 1 591 ? 72.686  -15.620 -112.100 1.00 35.90  ? 591 HIS A CE1 1 
ATOM   3570 N NE2 . HIS A 1 591 ? 73.091  -15.570 -110.843 1.00 33.23  ? 591 HIS A NE2 1 
ATOM   3571 N N   . LYS A 1 592 ? 72.219  -10.737 -109.100 1.00 33.56  ? 592 LYS A N   1 
ATOM   3572 C CA  . LYS A 1 592 ? 72.988  -10.543 -107.883 1.00 34.30  ? 592 LYS A CA  1 
ATOM   3573 C C   . LYS A 1 592 ? 72.067  -10.679 -106.693 1.00 32.61  ? 592 LYS A C   1 
ATOM   3574 O O   . LYS A 1 592 ? 71.049  -9.989  -106.616 1.00 36.68  ? 592 LYS A O   1 
ATOM   3575 C CB  . LYS A 1 592 ? 73.635  -9.159  -107.862 1.00 35.30  ? 592 LYS A CB  1 
ATOM   3576 C CG  . LYS A 1 592 ? 74.497  -8.892  -106.635 1.00 33.32  ? 592 LYS A CG  1 
ATOM   3577 C CD  . LYS A 1 592 ? 75.112  -7.504  -106.693 1.00 39.60  ? 592 LYS A CD  1 
ATOM   3578 C CE  . LYS A 1 592 ? 75.964  -7.205  -105.466 1.00 40.43  ? 592 LYS A CE  1 
ATOM   3579 N NZ  . LYS A 1 592 ? 77.263  -7.938  -105.491 1.00 41.06  ? 592 LYS A NZ  1 
ATOM   3580 N N   . VAL A 1 593 ? 72.434  -11.558 -105.766 1.00 31.63  ? 593 VAL A N   1 
ATOM   3581 C CA  . VAL A 1 593 ? 71.692  -11.711 -104.530 1.00 32.49  ? 593 VAL A CA  1 
ATOM   3582 C C   . VAL A 1 593 ? 71.802  -10.419 -103.718 1.00 34.55  ? 593 VAL A C   1 
ATOM   3583 O O   . VAL A 1 593 ? 72.903  -9.918  -103.493 1.00 30.61  ? 593 VAL A O   1 
ATOM   3584 C CB  . VAL A 1 593 ? 72.208  -12.891 -103.692 1.00 27.04  ? 593 VAL A CB  1 
ATOM   3585 C CG1 . VAL A 1 593 ? 71.499  -12.923 -102.353 1.00 23.74  ? 593 VAL A CG1 1 
ATOM   3586 C CG2 . VAL A 1 593 ? 72.007  -14.208 -104.446 1.00 20.87  ? 593 VAL A CG2 1 
ATOM   3587 N N   . ASP A 1 594 ? 70.651  -9.881  -103.315 1.00 37.47  ? 594 ASP A N   1 
ATOM   3588 C CA  . ASP A 1 594 ? 70.580  -8.671  -102.506 1.00 40.34  ? 594 ASP A CA  1 
ATOM   3589 C C   . ASP A 1 594 ? 70.772  -9.050  -101.036 1.00 45.52  ? 594 ASP A C   1 
ATOM   3590 O O   . ASP A 1 594 ? 69.985  -9.823  -100.485 1.00 48.96  ? 594 ASP A O   1 
ATOM   3591 C CB  . ASP A 1 594 ? 69.216  -7.998  -102.712 1.00 39.28  ? 594 ASP A CB  1 
ATOM   3592 C CG  . ASP A 1 594 ? 69.082  -6.662  -101.978 1.00 39.85  ? 594 ASP A CG  1 
ATOM   3593 O OD1 . ASP A 1 594 ? 68.419  -5.751  -102.509 1.00 51.14  ? 594 ASP A OD1 1 
ATOM   3594 O OD2 . ASP A 1 594 ? 69.628  -6.515  -100.870 1.00 47.16  ? 594 ASP A OD2 1 
ATOM   3595 N N   . ASP A 1 595 ? 71.813  -8.498  -100.411 1.00 45.91  ? 595 ASP A N   1 
ATOM   3596 C CA  . ASP A 1 595 ? 72.097  -8.725  -98.990  1.00 49.63  ? 595 ASP A CA  1 
ATOM   3597 C C   . ASP A 1 595 ? 72.137  -7.411  -98.202  1.00 48.78  ? 595 ASP A C   1 
ATOM   3598 O O   . ASP A 1 595 ? 72.864  -7.299  -97.214  1.00 51.10  ? 595 ASP A O   1 
ATOM   3599 C CB  . ASP A 1 595 ? 73.435  -9.470  -98.828  1.00 55.59  ? 595 ASP A CB  1 
ATOM   3600 C CG  . ASP A 1 595 ? 73.311  -10.973 -99.052  1.00 71.01  ? 595 ASP A CG  1 
ATOM   3601 O OD1 . ASP A 1 595 ? 72.196  -11.459 -99.355  1.00 82.98  ? 595 ASP A OD1 1 
ATOM   3602 O OD2 . ASP A 1 595 ? 74.340  -11.674 -98.915  1.00 79.32  ? 595 ASP A OD2 1 
ATOM   3603 N N   . SER A 1 596 ? 71.347  -6.427  -98.623  1.00 45.94  ? 596 SER A N   1 
ATOM   3604 C CA  . SER A 1 596 ? 71.356  -5.114  -97.982  1.00 46.28  ? 596 SER A CA  1 
ATOM   3605 C C   . SER A 1 596 ? 70.340  -5.048  -96.838  1.00 44.34  ? 596 SER A C   1 
ATOM   3606 O O   . SER A 1 596 ? 69.608  -6.011  -96.585  1.00 44.06  ? 596 SER A O   1 
ATOM   3607 C CB  . SER A 1 596 ? 71.097  -4.014  -99.015  1.00 48.08  ? 596 SER A CB  1 
ATOM   3608 O OG  . SER A 1 596 ? 69.806  -4.126  -99.590  1.00 61.89  ? 596 SER A OG  1 
ATOM   3609 N N   . SER A 1 597 ? 70.312  -3.915  -96.142  1.00 43.50  ? 597 SER A N   1 
ATOM   3610 C CA  . SER A 1 597 ? 69.434  -3.736  -94.984  1.00 44.81  ? 597 SER A CA  1 
ATOM   3611 C C   . SER A 1 597 ? 68.090  -3.112  -95.365  1.00 43.53  ? 597 SER A C   1 
ATOM   3612 O O   . SER A 1 597 ? 67.921  -2.605  -96.472  1.00 49.79  ? 597 SER A O   1 
ATOM   3613 C CB  . SER A 1 597 ? 70.129  -2.856  -93.942  1.00 44.77  ? 597 SER A CB  1 
ATOM   3614 O OG  . SER A 1 597 ? 70.505  -1.611  -94.504  1.00 46.11  ? 597 SER A OG  1 
ATOM   3615 N N   . GLY A 1 598 ? 67.138  -3.163  -94.438  1.00 42.93  ? 598 GLY A N   1 
ATOM   3616 C CA  . GLY A 1 598 ? 65.858  -2.468  -94.585  1.00 41.16  ? 598 GLY A CA  1 
ATOM   3617 C C   . GLY A 1 598 ? 64.745  -3.307  -95.183  1.00 38.43  ? 598 GLY A C   1 
ATOM   3618 O O   . GLY A 1 598 ? 64.951  -4.464  -95.548  1.00 37.62  ? 598 GLY A O   1 
ATOM   3619 N N   . SER A 1 599 ? 63.561  -2.708  -95.291  1.00 36.23  ? 599 SER A N   1 
ATOM   3620 C CA  . SER A 1 599 ? 62.391  -3.393  -95.838  1.00 37.43  ? 599 SER A CA  1 
ATOM   3621 C C   . SER A 1 599 ? 62.590  -3.764  -97.301  1.00 37.22  ? 599 SER A C   1 
ATOM   3622 O O   . SER A 1 599 ? 63.392  -3.147  -97.999  1.00 36.16  ? 599 SER A O   1 
ATOM   3623 C CB  . SER A 1 599 ? 61.144  -2.513  -95.707  1.00 36.06  ? 599 SER A CB  1 
ATOM   3624 O OG  . SER A 1 599 ? 61.271  -1.321  -96.464  1.00 32.21  ? 599 SER A OG  1 
ATOM   3625 N N   . ILE A 1 600 ? 61.847  -4.769  -97.754  1.00 38.40  ? 600 ILE A N   1 
ATOM   3626 C CA  . ILE A 1 600 ? 61.859  -5.185  -99.158  1.00 41.38  ? 600 ILE A CA  1 
ATOM   3627 C C   . ILE A 1 600 ? 61.839  -3.985  -100.122 1.00 43.33  ? 600 ILE A C   1 
ATOM   3628 O O   . ILE A 1 600 ? 62.612  -3.939  -101.083 1.00 50.33  ? 600 ILE A O   1 
ATOM   3629 C CB  . ILE A 1 600 ? 60.682  -6.162  -99.478  1.00 39.83  ? 600 ILE A CB  1 
ATOM   3630 C CG1 . ILE A 1 600 ? 60.586  -6.416  -100.987 1.00 48.15  ? 600 ILE A CG1 1 
ATOM   3631 C CG2 . ILE A 1 600 ? 59.355  -5.620  -98.963  1.00 44.74  ? 600 ILE A CG2 1 
ATOM   3632 C CD1 . ILE A 1 600 ? 59.635  -7.537  -101.362 1.00 54.97  ? 600 ILE A CD1 1 
ATOM   3633 N N   . GLY A 1 601 ? 60.971  -3.013  -99.854  1.00 41.40  ? 601 GLY A N   1 
ATOM   3634 C CA  . GLY A 1 601 ? 60.836  -1.838  -100.710 1.00 39.07  ? 601 GLY A CA  1 
ATOM   3635 C C   . GLY A 1 601 ? 62.055  -0.936  -100.709 1.00 37.73  ? 601 GLY A C   1 
ATOM   3636 O O   . GLY A 1 601 ? 62.419  -0.384  -101.745 1.00 38.13  ? 601 GLY A O   1 
ATOM   3637 N N   . ARG A 1 602 ? 62.675  -0.772  -99.544  1.00 39.45  ? 602 ARG A N   1 
ATOM   3638 C CA  . ARG A 1 602 ? 63.918  -0.010  -99.432  1.00 42.00  ? 602 ARG A CA  1 
ATOM   3639 C C   . ARG A 1 602 ? 65.066  -0.729  -100.144 1.00 40.24  ? 602 ARG A C   1 
ATOM   3640 O O   . ARG A 1 602 ? 65.931  -0.087  -100.743 1.00 35.34  ? 602 ARG A O   1 
ATOM   3641 C CB  . ARG A 1 602 ? 64.271  0.207   -97.962  1.00 43.43  ? 602 ARG A CB  1 
ATOM   3642 C CG  . ARG A 1 602 ? 65.475  1.116   -97.705  1.00 46.36  ? 602 ARG A CG  1 
ATOM   3643 C CD  . ARG A 1 602 ? 65.695  1.257   -96.200  1.00 55.36  ? 602 ARG A CD  1 
ATOM   3644 N NE  . ARG A 1 602 ? 66.978  1.865   -95.841  1.00 61.06  ? 602 ARG A NE  1 
ATOM   3645 C CZ  . ARG A 1 602 ? 67.514  1.845   -94.618  1.00 60.48  ? 602 ARG A CZ  1 
ATOM   3646 N NH1 . ARG A 1 602 ? 66.895  1.242   -93.602  1.00 57.91  ? 602 ARG A NH1 1 
ATOM   3647 N NH2 . ARG A 1 602 ? 68.687  2.434   -94.406  1.00 65.28  ? 602 ARG A NH2 1 
ATOM   3648 N N   . ARG A 1 603 ? 65.062  -2.060  -100.081 1.00 41.15  ? 603 ARG A N   1 
ATOM   3649 C CA  . ARG A 1 603 ? 66.105  -2.873  -100.715 1.00 41.06  ? 603 ARG A CA  1 
ATOM   3650 C C   . ARG A 1 603 ? 66.000  -2.688  -102.223 1.00 39.43  ? 603 ARG A C   1 
ATOM   3651 O O   . ARG A 1 603 ? 66.988  -2.369  -102.884 1.00 38.90  ? 603 ARG A O   1 
ATOM   3652 C CB  . ARG A 1 603 ? 65.969  -4.365  -100.355 1.00 42.97  ? 603 ARG A CB  1 
ATOM   3653 C CG  . ARG A 1 603 ? 65.760  -4.684  -98.853  1.00 44.08  ? 603 ARG A CG  1 
ATOM   3654 C CD  . ARG A 1 603 ? 66.953  -5.321  -98.189  1.00 45.23  ? 603 ARG A CD  1 
ATOM   3655 N NE  . ARG A 1 603 ? 67.344  -6.579  -98.825  1.00 53.02  ? 603 ARG A NE  1 
ATOM   3656 C CZ  . ARG A 1 603 ? 66.835  -7.778  -98.544  1.00 44.87  ? 603 ARG A CZ  1 
ATOM   3657 N NH1 . ARG A 1 603 ? 65.899  -7.929  -97.621  1.00 37.42  ? 603 ARG A NH1 1 
ATOM   3658 N NH2 . ARG A 1 603 ? 67.279  -8.843  -99.201  1.00 47.76  ? 603 ARG A NH2 1 
ATOM   3659 N N   . TYR A 1 604 ? 64.790  -2.864  -102.753 1.00 38.98  ? 604 TYR A N   1 
ATOM   3660 C CA  . TYR A 1 604 ? 64.541  -2.679  -104.186 1.00 38.60  ? 604 TYR A CA  1 
ATOM   3661 C C   . TYR A 1 604 ? 64.834  -1.257  -104.667 1.00 38.90  ? 604 TYR A C   1 
ATOM   3662 O O   . TYR A 1 604 ? 65.292  -1.070  -105.793 1.00 42.10  ? 604 TYR A O   1 
ATOM   3663 C CB  . TYR A 1 604 ? 63.100  -3.053  -104.549 1.00 38.01  ? 604 TYR A CB  1 
ATOM   3664 C CG  . TYR A 1 604 ? 62.874  -4.525  -104.811 1.00 34.79  ? 604 TYR A CG  1 
ATOM   3665 C CD1 . TYR A 1 604 ? 63.688  -5.232  -105.691 1.00 38.87  ? 604 TYR A CD1 1 
ATOM   3666 C CD2 . TYR A 1 604 ? 61.824  -5.204  -104.208 1.00 41.99  ? 604 TYR A CD2 1 
ATOM   3667 C CE1 . TYR A 1 604 ? 63.480  -6.581  -105.942 1.00 39.02  ? 604 TYR A CE1 1 
ATOM   3668 C CE2 . TYR A 1 604 ? 61.602  -6.555  -104.456 1.00 44.12  ? 604 TYR A CE2 1 
ATOM   3669 C CZ  . TYR A 1 604 ? 62.433  -7.237  -105.325 1.00 40.95  ? 604 TYR A CZ  1 
ATOM   3670 O OH  . TYR A 1 604 ? 62.215  -8.574  -105.572 1.00 37.76  ? 604 TYR A OH  1 
ATOM   3671 N N   . ALA A 1 605 ? 64.567  -0.267  -103.818 1.00 36.77  ? 605 ALA A N   1 
ATOM   3672 C CA  . ALA A 1 605 ? 64.870  1.134   -104.124 1.00 36.90  ? 605 ALA A CA  1 
ATOM   3673 C C   . ALA A 1 605 ? 66.348  1.359   -104.477 1.00 38.61  ? 605 ALA A C   1 
ATOM   3674 O O   . ALA A 1 605 ? 66.653  2.140   -105.377 1.00 35.88  ? 605 ALA A O   1 
ATOM   3675 C CB  . ALA A 1 605 ? 64.463  2.032   -102.958 1.00 29.32  ? 605 ALA A CB  1 
ATOM   3676 N N   . ARG A 1 606 ? 67.255  0.675   -103.774 1.00 42.16  ? 606 ARG A N   1 
ATOM   3677 C CA  . ARG A 1 606 ? 68.699  0.767   -104.060 1.00 43.49  ? 606 ARG A CA  1 
ATOM   3678 C C   . ARG A 1 606 ? 68.982  0.127   -105.407 1.00 41.95  ? 606 ARG A C   1 
ATOM   3679 O O   . ARG A 1 606 ? 69.653  0.691   -106.271 1.00 42.17  ? 606 ARG A O   1 
ATOM   3680 C CB  . ARG A 1 606 ? 69.523  0.061   -102.975 1.00 43.73  ? 606 ARG A CB  1 
ATOM   3681 C CG  . ARG A 1 606 ? 69.346  0.645   -101.587 1.00 46.83  ? 606 ARG A CG  1 
ATOM   3682 C CD  . ARG A 1 606 ? 70.167  -0.083  -100.520 1.00 52.28  ? 606 ARG A CD  1 
ATOM   3683 N NE  . ARG A 1 606 ? 69.790  0.367   -99.175  1.00 56.99  ? 606 ARG A NE  1 
ATOM   3684 C CZ  . ARG A 1 606 ? 70.467  0.117   -98.055  1.00 66.20  ? 606 ARG A CZ  1 
ATOM   3685 N NH1 . ARG A 1 606 ? 71.595  -0.589  -98.072  1.00 73.75  ? 606 ARG A NH1 1 
ATOM   3686 N NH2 . ARG A 1 606 ? 70.012  0.590   -96.899  1.00 67.50  ? 606 ARG A NH2 1 
ATOM   3687 N N   . THR A 1 607 ? 68.452  -1.073  -105.566 1.00 41.00  ? 607 THR A N   1 
ATOM   3688 C CA  . THR A 1 607 ? 68.480  -1.782  -106.826 1.00 40.23  ? 607 THR A CA  1 
ATOM   3689 C C   . THR A 1 607 ? 67.993  -0.923  -108.001 1.00 41.62  ? 607 THR A C   1 
ATOM   3690 O O   . THR A 1 607 ? 68.623  -0.906  -109.057 1.00 37.68  ? 607 THR A O   1 
ATOM   3691 C CB  . THR A 1 607 ? 67.649  -3.068  -106.691 1.00 41.19  ? 607 THR A CB  1 
ATOM   3692 O OG1 . THR A 1 607 ? 68.549  -4.173  -106.566 1.00 39.54  ? 607 THR A OG1 1 
ATOM   3693 C CG2 . THR A 1 607 ? 66.694  -3.273  -107.884 1.00 46.95  ? 607 THR A CG2 1 
ATOM   3694 N N   . ASP A 1 608 ? 66.879  -0.215  -107.805 1.00 44.71  ? 608 ASP A N   1 
ATOM   3695 C CA  . ASP A 1 608 ? 66.305  0.662   -108.835 1.00 41.15  ? 608 ASP A CA  1 
ATOM   3696 C C   . ASP A 1 608 ? 67.227  1.827   -109.168 1.00 39.28  ? 608 ASP A C   1 
ATOM   3697 O O   . ASP A 1 608 ? 67.341  2.235   -110.324 1.00 36.76  ? 608 ASP A O   1 
ATOM   3698 C CB  . ASP A 1 608 ? 64.972  1.251   -108.363 1.00 43.58  ? 608 ASP A CB  1 
ATOM   3699 C CG  . ASP A 1 608 ? 63.872  0.219   -108.249 1.00 46.00  ? 608 ASP A CG  1 
ATOM   3700 O OD1 . ASP A 1 608 ? 63.997  -0.867  -108.852 1.00 48.61  ? 608 ASP A OD1 1 
ATOM   3701 O OD2 . ASP A 1 608 ? 62.880  0.508   -107.549 1.00 39.88  ? 608 ASP A OD2 1 
ATOM   3702 N N   . GLU A 1 609 ? 67.872  2.359   -108.137 1.00 35.85  ? 609 GLU A N   1 
ATOM   3703 C CA  . GLU A 1 609 ? 68.700  3.551   -108.257 1.00 35.51  ? 609 GLU A CA  1 
ATOM   3704 C C   . GLU A 1 609 ? 69.862  3.354   -109.240 1.00 34.19  ? 609 GLU A C   1 
ATOM   3705 O O   . GLU A 1 609 ? 70.295  4.302   -109.892 1.00 36.48  ? 609 GLU A O   1 
ATOM   3706 C CB  . GLU A 1 609 ? 69.223  3.944   -106.874 1.00 33.32  ? 609 GLU A CB  1 
ATOM   3707 C CG  . GLU A 1 609 ? 69.641  5.386   -106.735 1.00 35.52  ? 609 GLU A CG  1 
ATOM   3708 C CD  . GLU A 1 609 ? 69.945  5.750   -105.296 1.00 37.70  ? 609 GLU A CD  1 
ATOM   3709 O OE1 . GLU A 1 609 ? 70.718  5.011   -104.657 1.00 26.63  ? 609 GLU A OE1 1 
ATOM   3710 O OE2 . GLU A 1 609 ? 69.407  6.765   -104.799 1.00 42.11  ? 609 GLU A OE2 1 
ATOM   3711 N N   . ILE A 1 610 ? 70.357  2.124   -109.343 1.00 34.70  ? 610 ILE A N   1 
ATOM   3712 C CA  . ILE A 1 610 ? 71.388  1.777   -110.325 1.00 31.18  ? 610 ILE A CA  1 
ATOM   3713 C C   . ILE A 1 610 ? 70.802  1.089   -111.579 1.00 31.80  ? 610 ILE A C   1 
ATOM   3714 O O   . ILE A 1 610 ? 71.537  0.600   -112.431 1.00 35.95  ? 610 ILE A O   1 
ATOM   3715 C CB  . ILE A 1 610 ? 72.524  0.921   -109.690 1.00 31.46  ? 610 ILE A CB  1 
ATOM   3716 C CG1 . ILE A 1 610 ? 71.998  -0.396  -109.106 1.00 30.14  ? 610 ILE A CG1 1 
ATOM   3717 C CG2 . ILE A 1 610 ? 73.243  1.710   -108.599 1.00 24.31  ? 610 ILE A CG2 1 
ATOM   3718 C CD1 . ILE A 1 610 ? 73.103  -1.378  -108.765 1.00 26.88  ? 610 ILE A CD1 1 
ATOM   3719 N N   . GLY A 1 611 ? 69.479  1.057   -111.693 1.00 32.49  ? 611 GLY A N   1 
ATOM   3720 C CA  . GLY A 1 611 ? 68.817  0.661   -112.940 1.00 34.21  ? 611 GLY A CA  1 
ATOM   3721 C C   . GLY A 1 611 ? 68.654  -0.826  -113.215 1.00 35.71  ? 611 GLY A C   1 
ATOM   3722 O O   . GLY A 1 611 ? 68.498  -1.215  -114.365 1.00 39.95  ? 611 GLY A O   1 
ATOM   3723 N N   . VAL A 1 612 ? 68.668  -1.658  -112.175 1.00 37.34  ? 612 VAL A N   1 
ATOM   3724 C CA  . VAL A 1 612 ? 68.463  -3.100  -112.337 1.00 35.30  ? 612 VAL A CA  1 
ATOM   3725 C C   . VAL A 1 612 ? 67.028  -3.379  -112.806 1.00 40.25  ? 612 VAL A C   1 
ATOM   3726 O O   . VAL A 1 612 ? 66.070  -2.915  -112.190 1.00 44.24  ? 612 VAL A O   1 
ATOM   3727 C CB  . VAL A 1 612 ? 68.728  -3.857  -111.024 1.00 32.71  ? 612 VAL A CB  1 
ATOM   3728 C CG1 . VAL A 1 612 ? 68.433  -5.340  -111.193 1.00 33.97  ? 612 VAL A CG1 1 
ATOM   3729 C CG2 . VAL A 1 612 ? 70.160  -3.650  -110.565 1.00 32.11  ? 612 VAL A CG2 1 
ATOM   3730 N N   . ALA A 1 613 ? 66.893  -4.156  -113.878 1.00 38.59  ? 613 ALA A N   1 
ATOM   3731 C CA  . ALA A 1 613 ? 65.621  -4.289  -114.599 1.00 38.47  ? 613 ALA A CA  1 
ATOM   3732 C C   . ALA A 1 613 ? 64.496  -4.987  -113.821 1.00 36.18  ? 613 ALA A C   1 
ATOM   3733 O O   . ALA A 1 613 ? 63.360  -4.520  -113.809 1.00 31.75  ? 613 ALA A O   1 
ATOM   3734 C CB  . ALA A 1 613 ? 65.854  -5.013  -115.935 1.00 35.45  ? 613 ALA A CB  1 
ATOM   3735 N N   . PHE A 1 614 ? 64.813  -6.113  -113.193 1.00 38.82  ? 614 PHE A N   1 
ATOM   3736 C CA  . PHE A 1 614 ? 63.806  -6.962  -112.558 1.00 36.93  ? 614 PHE A CA  1 
ATOM   3737 C C   . PHE A 1 614 ? 64.239  -7.414  -111.172 1.00 38.94  ? 614 PHE A C   1 
ATOM   3738 O O   . PHE A 1 614 ? 65.384  -7.217  -110.764 1.00 42.23  ? 614 PHE A O   1 
ATOM   3739 C CB  . PHE A 1 614 ? 63.529  -8.184  -113.434 1.00 39.78  ? 614 PHE A CB  1 
ATOM   3740 C CG  . PHE A 1 614 ? 63.130  -7.835  -114.830 1.00 39.82  ? 614 PHE A CG  1 
ATOM   3741 C CD1 . PHE A 1 614 ? 61.882  -7.280  -115.086 1.00 37.62  ? 614 PHE A CD1 1 
ATOM   3742 C CD2 . PHE A 1 614 ? 64.005  -8.037  -115.886 1.00 41.80  ? 614 PHE A CD2 1 
ATOM   3743 C CE1 . PHE A 1 614 ? 61.508  -6.939  -116.370 1.00 42.94  ? 614 PHE A CE1 1 
ATOM   3744 C CE2 . PHE A 1 614 ? 63.640  -7.700  -117.183 1.00 44.90  ? 614 PHE A CE2 1 
ATOM   3745 C CZ  . PHE A 1 614 ? 62.390  -7.147  -117.426 1.00 47.33  ? 614 PHE A CZ  1 
ATOM   3746 N N   . GLY A 1 615 ? 63.309  -8.029  -110.453 1.00 37.05  ? 615 GLY A N   1 
ATOM   3747 C CA  . GLY A 1 615 ? 63.557  -8.459  -109.089 1.00 33.63  ? 615 GLY A CA  1 
ATOM   3748 C C   . GLY A 1 615 ? 62.713  -9.660  -108.721 1.00 35.05  ? 615 GLY A C   1 
ATOM   3749 O O   . GLY A 1 615 ? 61.540  -9.735  -109.084 1.00 36.18  ? 615 GLY A O   1 
ATOM   3750 N N   . VAL A 1 616 ? 63.316  -10.602 -108.002 1.00 33.96  ? 616 VAL A N   1 
ATOM   3751 C CA  . VAL A 1 616 ? 62.615  -11.782 -107.534 1.00 28.64  ? 616 VAL A CA  1 
ATOM   3752 C C   . VAL A 1 616 ? 62.765  -11.885 -106.028 1.00 31.81  ? 616 VAL A C   1 
ATOM   3753 O O   . VAL A 1 616 ? 63.868  -12.105 -105.519 1.00 32.40  ? 616 VAL A O   1 
ATOM   3754 C CB  . VAL A 1 616 ? 63.150  -13.051 -108.204 1.00 30.67  ? 616 VAL A CB  1 
ATOM   3755 C CG1 . VAL A 1 616 ? 62.526  -14.295 -107.570 1.00 28.61  ? 616 VAL A CG1 1 
ATOM   3756 C CG2 . VAL A 1 616 ? 62.886  -12.999 -109.714 1.00 18.00  ? 616 VAL A CG2 1 
ATOM   3757 N N   . THR A 1 617 ? 61.648  -11.697 -105.323 1.00 35.47  ? 617 THR A N   1 
ATOM   3758 C CA  . THR A 1 617 ? 61.598  -11.840 -103.872 1.00 33.97  ? 617 THR A CA  1 
ATOM   3759 C C   . THR A 1 617 ? 61.284  -13.273 -103.490 1.00 35.81  ? 617 THR A C   1 
ATOM   3760 O O   . THR A 1 617 ? 60.305  -13.852 -103.973 1.00 35.81  ? 617 THR A O   1 
ATOM   3761 C CB  . THR A 1 617 ? 60.522  -10.951 -103.239 1.00 33.64  ? 617 THR A CB  1 
ATOM   3762 O OG1 . THR A 1 617 ? 60.656  -9.611  -103.725 1.00 36.85  ? 617 THR A OG1 1 
ATOM   3763 C CG2 . THR A 1 617 ? 60.646  -10.971 -101.708 1.00 25.24  ? 617 THR A CG2 1 
ATOM   3764 N N   . ILE A 1 618 ? 62.122  -13.828 -102.619 1.00 33.69  ? 618 ILE A N   1 
ATOM   3765 C CA  . ILE A 1 618 ? 61.908  -15.151 -102.048 1.00 35.21  ? 618 ILE A CA  1 
ATOM   3766 C C   . ILE A 1 618 ? 61.564  -14.968 -100.579 1.00 33.96  ? 618 ILE A C   1 
ATOM   3767 O O   . ILE A 1 618 ? 62.394  -14.505 -99.800  1.00 36.92  ? 618 ILE A O   1 
ATOM   3768 C CB  . ILE A 1 618 ? 63.172  -16.025 -102.186 1.00 36.44  ? 618 ILE A CB  1 
ATOM   3769 C CG1 . ILE A 1 618 ? 63.480  -16.268 -103.668 1.00 37.23  ? 618 ILE A CG1 1 
ATOM   3770 C CG2 . ILE A 1 618 ? 63.000  -17.338 -101.446 1.00 30.47  ? 618 ILE A CG2 1 
ATOM   3771 C CD1 . ILE A 1 618 ? 64.722  -17.090 -103.910 1.00 38.04  ? 618 ILE A CD1 1 
ATOM   3772 N N   . ASP A 1 619 ? 60.339  -15.317 -100.204 1.00 33.31  ? 619 ASP A N   1 
ATOM   3773 C CA  . ASP A 1 619 ? 59.890  -15.141 -98.824  1.00 31.88  ? 619 ASP A CA  1 
ATOM   3774 C C   . ASP A 1 619 ? 59.527  -16.479 -98.188  1.00 30.35  ? 619 ASP A C   1 
ATOM   3775 O O   . ASP A 1 619 ? 59.734  -17.537 -98.788  1.00 29.42  ? 619 ASP A O   1 
ATOM   3776 C CB  . ASP A 1 619 ? 58.732  -14.136 -98.758  1.00 32.83  ? 619 ASP A CB  1 
ATOM   3777 C CG  . ASP A 1 619 ? 57.538  -14.545 -99.598  1.00 35.92  ? 619 ASP A CG  1 
ATOM   3778 O OD1 . ASP A 1 619 ? 57.201  -15.749 -99.649  1.00 40.23  ? 619 ASP A OD1 1 
ATOM   3779 O OD2 . ASP A 1 619 ? 56.923  -13.640 -100.196 1.00 33.14  ? 619 ASP A OD2 1 
ATOM   3780 N N   . PHE A 1 620 ? 59.004  -16.436 -96.968  1.00 29.64  ? 620 PHE A N   1 
ATOM   3781 C CA  . PHE A 1 620 ? 58.728  -17.651 -96.234  1.00 31.13  ? 620 PHE A CA  1 
ATOM   3782 C C   . PHE A 1 620 ? 57.677  -18.519 -96.918  1.00 31.12  ? 620 PHE A C   1 
ATOM   3783 O O   . PHE A 1 620 ? 57.805  -19.739 -96.927  1.00 35.10  ? 620 PHE A O   1 
ATOM   3784 C CB  . PHE A 1 620 ? 58.326  -17.321 -94.803  1.00 38.52  ? 620 PHE A CB  1 
ATOM   3785 C CG  . PHE A 1 620 ? 59.457  -16.773 -93.977  1.00 39.95  ? 620 PHE A CG  1 
ATOM   3786 C CD1 . PHE A 1 620 ? 59.554  -15.408 -93.725  1.00 38.79  ? 620 PHE A CD1 1 
ATOM   3787 C CD2 . PHE A 1 620 ? 60.437  -17.629 -93.459  1.00 38.38  ? 620 PHE A CD2 1 
ATOM   3788 C CE1 . PHE A 1 620 ? 60.601  -14.902 -92.955  1.00 42.12  ? 620 PHE A CE1 1 
ATOM   3789 C CE2 . PHE A 1 620 ? 61.489  -17.133 -92.687  1.00 35.70  ? 620 PHE A CE2 1 
ATOM   3790 C CZ  . PHE A 1 620 ? 61.572  -15.767 -92.436  1.00 39.15  ? 620 PHE A CZ  1 
ATOM   3791 N N   . ASP A 1 621 ? 56.658  -17.906 -97.513  1.00 30.76  ? 621 ASP A N   1 
ATOM   3792 C CA  . ASP A 1 621 ? 55.667  -18.680 -98.266  1.00 33.21  ? 621 ASP A CA  1 
ATOM   3793 C C   . ASP A 1 621 ? 56.316  -19.422 -99.440  1.00 32.10  ? 621 ASP A C   1 
ATOM   3794 O O   . ASP A 1 621 ? 55.963  -20.564 -99.733  1.00 32.15  ? 621 ASP A O   1 
ATOM   3795 C CB  . ASP A 1 621 ? 54.513  -17.797 -98.751  1.00 35.73  ? 621 ASP A CB  1 
ATOM   3796 C CG  . ASP A 1 621 ? 53.661  -17.275 -97.608  1.00 42.39  ? 621 ASP A CG  1 
ATOM   3797 O OD1 . ASP A 1 621 ? 54.081  -16.291 -96.966  1.00 57.88  ? 621 ASP A OD1 1 
ATOM   3798 O OD2 . ASP A 1 621 ? 52.575  -17.841 -97.350  1.00 37.18  ? 621 ASP A OD2 1 
ATOM   3799 N N   . THR A 1 622 ? 57.274  -18.781 -100.102 1.00 30.58  ? 622 THR A N   1 
ATOM   3800 C CA  . THR A 1 622 ? 58.003  -19.436 -101.186 1.00 32.61  ? 622 THR A CA  1 
ATOM   3801 C C   . THR A 1 622 ? 58.631  -20.737 -100.706 1.00 33.78  ? 622 THR A C   1 
ATOM   3802 O O   . THR A 1 622 ? 58.536  -21.760 -101.378 1.00 35.79  ? 622 THR A O   1 
ATOM   3803 C CB  . THR A 1 622 ? 59.122  -18.552 -101.747 1.00 29.83  ? 622 THR A CB  1 
ATOM   3804 O OG1 . THR A 1 622 ? 58.609  -17.243 -102.015 1.00 26.24  ? 622 THR A OG1 1 
ATOM   3805 C CG2 . THR A 1 622 ? 59.672  -19.158 -103.017 1.00 25.56  ? 622 THR A CG2 1 
ATOM   3806 N N   . VAL A 1 623 ? 59.261  -20.685 -99.535  1.00 34.59  ? 623 VAL A N   1 
ATOM   3807 C CA  . VAL A 1 623 ? 59.985  -21.831 -98.983  1.00 34.86  ? 623 VAL A CA  1 
ATOM   3808 C C   . VAL A 1 623 ? 59.069  -22.850 -98.290  1.00 35.64  ? 623 VAL A C   1 
ATOM   3809 O O   . VAL A 1 623 ? 59.362  -24.047 -98.299  1.00 38.02  ? 623 VAL A O   1 
ATOM   3810 C CB  . VAL A 1 623 ? 61.066  -21.360 -97.982  1.00 33.49  ? 623 VAL A CB  1 
ATOM   3811 C CG1 . VAL A 1 623 ? 61.775  -22.549 -97.343  1.00 25.47  ? 623 VAL A CG1 1 
ATOM   3812 C CG2 . VAL A 1 623 ? 62.063  -20.433 -98.675  1.00 32.15  ? 623 VAL A CG2 1 
ATOM   3813 N N   . ASN A 1 624 ? 57.966  -22.380 -97.706  1.00 35.15  ? 624 ASN A N   1 
ATOM   3814 C CA  . ASN A 1 624 ? 57.112  -23.218 -96.849  1.00 36.47  ? 624 ASN A CA  1 
ATOM   3815 C C   . ASN A 1 624 ? 55.802  -23.693 -97.487  1.00 38.16  ? 624 ASN A C   1 
ATOM   3816 O O   . ASN A 1 624 ? 55.342  -24.792 -97.192  1.00 43.76  ? 624 ASN A O   1 
ATOM   3817 C CB  . ASN A 1 624 ? 56.811  -22.487 -95.538  1.00 32.94  ? 624 ASN A CB  1 
ATOM   3818 C CG  . ASN A 1 624 ? 58.067  -22.194 -94.738  1.00 32.85  ? 624 ASN A CG  1 
ATOM   3819 O OD1 . ASN A 1 624 ? 58.764  -23.106 -94.300  1.00 22.43  ? 624 ASN A OD1 1 
ATOM   3820 N ND2 . ASN A 1 624 ? 58.361  -20.916 -94.544  1.00 37.55  ? 624 ASN A ND2 1 
ATOM   3821 N N   . LYS A 1 625 ? 55.194  -22.874 -98.340  1.00 38.35  ? 625 LYS A N   1 
ATOM   3822 C CA  . LYS A 1 625 ? 53.972  -23.281 -99.037  1.00 40.15  ? 625 LYS A CA  1 
ATOM   3823 C C   . LYS A 1 625 ? 54.296  -24.063 -100.317 1.00 41.18  ? 625 LYS A C   1 
ATOM   3824 O O   . LYS A 1 625 ? 55.175  -23.671 -101.083 1.00 41.54  ? 625 LYS A O   1 
ATOM   3825 C CB  . LYS A 1 625 ? 53.100  -22.058 -99.383  1.00 40.25  ? 625 LYS A CB  1 
ATOM   3826 C CG  . LYS A 1 625 ? 51.903  -21.821 -98.467  1.00 41.76  ? 625 LYS A CG  1 
ATOM   3827 C CD  . LYS A 1 625 ? 52.302  -21.256 -97.116  1.00 47.05  ? 625 LYS A CD  1 
ATOM   3828 C CE  . LYS A 1 625 ? 51.077  -20.844 -96.303  1.00 45.20  ? 625 LYS A CE  1 
ATOM   3829 N NZ  . LYS A 1 625 ? 50.463  -19.596 -96.829  1.00 49.07  ? 625 LYS A NZ  1 
ATOM   3830 N N   . THR A 1 626 ? 53.597  -25.180 -100.529 1.00 45.06  ? 626 THR A N   1 
ATOM   3831 C CA  . THR A 1 626 ? 53.490  -25.787 -101.871 1.00 44.58  ? 626 THR A CA  1 
ATOM   3832 C C   . THR A 1 626 ? 52.293  -25.325 -102.761 1.00 43.49  ? 626 THR A C   1 
ATOM   3833 O O   . THR A 1 626 ? 51.155  -25.336 -102.285 1.00 40.71  ? 626 THR A O   1 
ATOM   3834 C CB  . THR A 1 626 ? 54.440  -26.986 -102.208 1.00 44.13  ? 626 THR A CB  1 
ATOM   3835 O OG1 . THR A 1 626 ? 53.927  -27.731 -103.318 1.00 47.97  ? 626 THR A OG1 1 
ATOM   3836 C CG2 . THR A 1 626 ? 54.602  -27.911 -101.006 1.00 44.03  ? 626 THR A CG2 1 
ATOM   3837 N N   . PRO A 1 627 ? 52.532  -24.988 -104.044 1.00 44.60  ? 627 PRO A N   1 
ATOM   3838 C CA  . PRO A 1 627 ? 53.813  -24.946 -104.742 1.00 44.87  ? 627 PRO A CA  1 
ATOM   3839 C C   . PRO A 1 627 ? 54.630  -23.715 -104.381 1.00 44.67  ? 627 PRO A C   1 
ATOM   3840 O O   . PRO A 1 627 ? 54.097  -22.736 -103.858 1.00 43.79  ? 627 PRO A O   1 
ATOM   3841 C CB  . PRO A 1 627 ? 53.414  -24.905 -106.230 1.00 46.54  ? 627 PRO A CB  1 
ATOM   3842 C CG  . PRO A 1 627 ? 51.924  -25.077 -106.269 1.00 43.58  ? 627 PRO A CG  1 
ATOM   3843 C CD  . PRO A 1 627 ? 51.430  -24.614 -104.947 1.00 43.39  ? 627 PRO A CD  1 
ATOM   3844 N N   . HIS A 1 628 ? 55.919  -23.773 -104.686 1.00 43.75  ? 628 HIS A N   1 
ATOM   3845 C CA  . HIS A 1 628 ? 56.846  -22.725 -104.295 1.00 40.62  ? 628 HIS A CA  1 
ATOM   3846 C C   . HIS A 1 628 ? 56.838  -21.614 -105.334 1.00 39.85  ? 628 HIS A C   1 
ATOM   3847 O O   . HIS A 1 628 ? 57.370  -21.776 -106.433 1.00 40.24  ? 628 HIS A O   1 
ATOM   3848 C CB  . HIS A 1 628 ? 58.246  -23.305 -104.121 1.00 38.18  ? 628 HIS A CB  1 
ATOM   3849 C CG  . HIS A 1 628 ? 58.289  -24.479 -103.197 1.00 30.53  ? 628 HIS A CG  1 
ATOM   3850 N ND1 . HIS A 1 628 ? 58.284  -24.347 -101.826 1.00 33.83  ? 628 HIS A ND1 1 
ATOM   3851 C CD2 . HIS A 1 628 ? 58.322  -25.809 -103.447 1.00 30.75  ? 628 HIS A CD2 1 
ATOM   3852 C CE1 . HIS A 1 628 ? 58.321  -25.546 -101.270 1.00 38.53  ? 628 HIS A CE1 1 
ATOM   3853 N NE2 . HIS A 1 628 ? 58.348  -26.450 -102.232 1.00 39.56  ? 628 HIS A NE2 1 
ATOM   3854 N N   . THR A 1 629 ? 56.216  -20.494 -104.971 1.00 39.59  ? 629 THR A N   1 
ATOM   3855 C CA  . THR A 1 629 ? 56.097  -19.329 -105.845 1.00 37.15  ? 629 THR A CA  1 
ATOM   3856 C C   . THR A 1 629 ? 56.848  -18.133 -105.255 1.00 36.39  ? 629 THR A C   1 
ATOM   3857 O O   . THR A 1 629 ? 57.062  -18.062 -104.047 1.00 34.88  ? 629 THR A O   1 
ATOM   3858 C CB  . THR A 1 629 ? 54.619  -18.948 -106.041 1.00 35.27  ? 629 THR A CB  1 
ATOM   3859 O OG1 . THR A 1 629 ? 54.094  -18.435 -104.816 1.00 24.03  ? 629 THR A OG1 1 
ATOM   3860 C CG2 . THR A 1 629 ? 53.798  -20.160 -106.456 1.00 30.92  ? 629 THR A CG2 1 
ATOM   3861 N N   . ALA A 1 630 ? 57.245  -17.200 -106.115 1.00 37.14  ? 630 ALA A N   1 
ATOM   3862 C CA  . ALA A 1 630 ? 58.007  -16.025 -105.686 1.00 37.34  ? 630 ALA A CA  1 
ATOM   3863 C C   . ALA A 1 630 ? 57.539  -14.779 -106.433 1.00 37.99  ? 630 ALA A C   1 
ATOM   3864 O O   . ALA A 1 630 ? 56.959  -14.883 -107.512 1.00 40.65  ? 630 ALA A O   1 
ATOM   3865 C CB  . ALA A 1 630 ? 59.489  -16.256 -105.907 1.00 34.67  ? 630 ALA A CB  1 
ATOM   3866 N N   . THR A 1 631 ? 57.778  -13.606 -105.852 1.00 35.33  ? 631 THR A N   1 
ATOM   3867 C CA  . THR A 1 631 ? 57.323  -12.356 -106.447 1.00 36.04  ? 631 THR A CA  1 
ATOM   3868 C C   . THR A 1 631 ? 58.289  -11.915 -107.538 1.00 36.88  ? 631 THR A C   1 
ATOM   3869 O O   . THR A 1 631 ? 59.491  -11.920 -107.327 1.00 45.99  ? 631 THR A O   1 
ATOM   3870 C CB  . THR A 1 631 ? 57.208  -11.223 -105.401 1.00 36.76  ? 631 THR A CB  1 
ATOM   3871 O OG1 . THR A 1 631 ? 56.287  -11.600 -104.367 1.00 34.76  ? 631 THR A OG1 1 
ATOM   3872 C CG2 . THR A 1 631 ? 56.728  -9.927  -106.053 1.00 30.98  ? 631 THR A CG2 1 
ATOM   3873 N N   . LEU A 1 632 ? 57.762  -11.555 -108.705 1.00 39.02  ? 632 LEU A N   1 
ATOM   3874 C CA  . LEU A 1 632 ? 58.550  -10.921 -109.765 1.00 36.85  ? 632 LEU A CA  1 
ATOM   3875 C C   . LEU A 1 632 ? 58.123  -9.463  -109.827 1.00 39.46  ? 632 LEU A C   1 
ATOM   3876 O O   . LEU A 1 632 ? 56.931  -9.170  -109.934 1.00 38.66  ? 632 LEU A O   1 
ATOM   3877 C CB  . LEU A 1 632 ? 58.312  -11.601 -111.119 1.00 37.49  ? 632 LEU A CB  1 
ATOM   3878 C CG  . LEU A 1 632 ? 58.935  -10.933 -112.353 1.00 39.39  ? 632 LEU A CG  1 
ATOM   3879 C CD1 . LEU A 1 632 ? 60.451  -10.847 -112.211 1.00 40.98  ? 632 LEU A CD1 1 
ATOM   3880 C CD2 . LEU A 1 632 ? 58.552  -11.659 -113.643 1.00 30.40  ? 632 LEU A CD2 1 
ATOM   3881 N N   . ARG A 1 633 ? 59.095  -8.558  -109.770 1.00 39.47  ? 633 ARG A N   1 
ATOM   3882 C CA  . ARG A 1 633 ? 58.827  -7.124  -109.683 1.00 36.03  ? 633 ARG A CA  1 
ATOM   3883 C C   . ARG A 1 633 ? 59.429  -6.407  -110.876 1.00 35.67  ? 633 ARG A C   1 
ATOM   3884 O O   . ARG A 1 633 ? 60.617  -6.584  -111.164 1.00 35.95  ? 633 ARG A O   1 
ATOM   3885 C CB  . ARG A 1 633 ? 59.448  -6.578  -108.403 1.00 35.53  ? 633 ARG A CB  1 
ATOM   3886 C CG  . ARG A 1 633 ? 59.209  -5.106  -108.146 1.00 36.07  ? 633 ARG A CG  1 
ATOM   3887 C CD  . ARG A 1 633 ? 59.895  -4.704  -106.856 1.00 34.99  ? 633 ARG A CD  1 
ATOM   3888 N NE  . ARG A 1 633 ? 59.892  -3.260  -106.652 1.00 33.18  ? 633 ARG A NE  1 
ATOM   3889 C CZ  . ARG A 1 633 ? 60.690  -2.397  -107.272 1.00 34.83  ? 633 ARG A CZ  1 
ATOM   3890 N NH1 . ARG A 1 633 ? 61.577  -2.800  -108.176 1.00 40.91  ? 633 ARG A NH1 1 
ATOM   3891 N NH2 . ARG A 1 633 ? 60.586  -1.111  -106.988 1.00 43.84  ? 633 ARG A NH2 1 
ATOM   3892 N N   . ASP A 1 634 ? 58.613  -5.592  -111.551 1.00 33.77  ? 634 ASP A N   1 
ATOM   3893 C CA  . ASP A 1 634 ? 59.067  -4.784  -112.694 1.00 34.11  ? 634 ASP A CA  1 
ATOM   3894 C C   . ASP A 1 634 ? 59.623  -3.455  -112.205 1.00 32.00  ? 634 ASP A C   1 
ATOM   3895 O O   . ASP A 1 634 ? 58.951  -2.743  -111.467 1.00 31.38  ? 634 ASP A O   1 
ATOM   3896 C CB  . ASP A 1 634 ? 57.911  -4.520  -113.659 1.00 37.44  ? 634 ASP A CB  1 
ATOM   3897 C CG  . ASP A 1 634 ? 58.251  -3.479  -114.706 1.00 37.98  ? 634 ASP A CG  1 
ATOM   3898 O OD1 . ASP A 1 634 ? 57.586  -2.419  -114.728 1.00 38.82  ? 634 ASP A OD1 1 
ATOM   3899 O OD2 . ASP A 1 634 ? 59.191  -3.713  -115.496 1.00 47.57  ? 634 ASP A OD2 1 
ATOM   3900 N N   . ARG A 1 635 ? 60.840  -3.118  -112.623 1.00 33.48  ? 635 ARG A N   1 
ATOM   3901 C CA  . ARG A 1 635 ? 61.515  -1.915  -112.121 1.00 34.64  ? 635 ARG A CA  1 
ATOM   3902 C C   . ARG A 1 635 ? 60.726  -0.639  -112.396 1.00 34.64  ? 635 ARG A C   1 
ATOM   3903 O O   . ARG A 1 635 ? 60.463  0.127   -111.479 1.00 36.77  ? 635 ARG A O   1 
ATOM   3904 C CB  . ARG A 1 635 ? 62.919  -1.783  -112.715 1.00 29.97  ? 635 ARG A CB  1 
ATOM   3905 C CG  . ARG A 1 635 ? 63.579  -0.412  -112.495 1.00 33.47  ? 635 ARG A CG  1 
ATOM   3906 C CD  . ARG A 1 635 ? 64.680  -0.169  -113.507 1.00 37.72  ? 635 ARG A CD  1 
ATOM   3907 N NE  . ARG A 1 635 ? 64.132  -0.098  -114.863 1.00 46.56  ? 635 ARG A NE  1 
ATOM   3908 C CZ  . ARG A 1 635 ? 64.812  -0.356  -115.975 1.00 40.30  ? 635 ARG A CZ  1 
ATOM   3909 N NH1 . ARG A 1 635 ? 66.087  -0.714  -115.915 1.00 44.47  ? 635 ARG A NH1 1 
ATOM   3910 N NH2 . ARG A 1 635 ? 64.201  -0.258  -117.152 1.00 44.21  ? 635 ARG A NH2 1 
ATOM   3911 N N   . ASP A 1 636 ? 60.355  -0.416  -113.654 1.00 36.80  ? 636 ASP A N   1 
ATOM   3912 C CA  . ASP A 1 636 ? 59.724  0.844   -114.047 1.00 36.74  ? 636 ASP A CA  1 
ATOM   3913 C C   . ASP A 1 636 ? 58.414  1.087   -113.305 1.00 36.59  ? 636 ASP A C   1 
ATOM   3914 O O   . ASP A 1 636 ? 58.253  2.117   -112.649 1.00 37.07  ? 636 ASP A O   1 
ATOM   3915 C CB  . ASP A 1 636 ? 59.495  0.896   -115.561 1.00 37.51  ? 636 ASP A CB  1 
ATOM   3916 C CG  . ASP A 1 636 ? 60.791  0.997   -116.345 1.00 43.79  ? 636 ASP A CG  1 
ATOM   3917 O OD1 . ASP A 1 636 ? 61.832  1.333   -115.742 1.00 51.89  ? 636 ASP A OD1 1 
ATOM   3918 O OD2 . ASP A 1 636 ? 60.769  0.749   -117.569 1.00 45.57  ? 636 ASP A OD2 1 
ATOM   3919 N N   . SER A 1 637 ? 57.494  0.132   -113.392 1.00 36.51  ? 637 SER A N   1 
ATOM   3920 C CA  . SER A 1 637 ? 56.172  0.290   -112.786 1.00 36.06  ? 637 SER A CA  1 
ATOM   3921 C C   . SER A 1 637 ? 56.172  0.004   -111.286 1.00 34.63  ? 637 SER A C   1 
ATOM   3922 O O   . SER A 1 637 ? 55.325  0.515   -110.564 1.00 33.43  ? 637 SER A O   1 
ATOM   3923 C CB  . SER A 1 637 ? 55.155  -0.621  -113.475 1.00 33.27  ? 637 SER A CB  1 
ATOM   3924 O OG  . SER A 1 637 ? 55.426  -1.979  -113.194 1.00 41.72  ? 637 SER A OG  1 
ATOM   3925 N N   . MET A 1 638 ? 57.115  -0.817  -110.828 1.00 35.43  ? 638 MET A N   1 
ATOM   3926 C CA  . MET A 1 638 ? 57.111  -1.357  -109.459 1.00 38.37  ? 638 MET A CA  1 
ATOM   3927 C C   . MET A 1 638 ? 55.971  -2.361  -109.234 1.00 39.00  ? 638 MET A C   1 
ATOM   3928 O O   . MET A 1 638 ? 55.738  -2.794  -108.104 1.00 38.89  ? 638 MET A O   1 
ATOM   3929 C CB  . MET A 1 638 ? 57.047  -0.248  -108.401 1.00 36.60  ? 638 MET A CB  1 
ATOM   3930 C CG  . MET A 1 638 ? 58.100  0.831   -108.548 1.00 40.87  ? 638 MET A CG  1 
ATOM   3931 S SD  . MET A 1 638 ? 57.922  2.085   -107.263 1.00 41.66  ? 638 MET A SD  1 
ATOM   3932 C CE  . MET A 1 638 ? 58.948  1.406   -105.959 1.00 36.45  ? 638 MET A CE  1 
ATOM   3933 N N   . ARG A 1 639 ? 55.281  -2.748  -110.305 1.00 39.30  ? 639 ARG A N   1 
ATOM   3934 C CA  . ARG A 1 639 ? 54.198  -3.716  -110.206 1.00 40.20  ? 639 ARG A CA  1 
ATOM   3935 C C   . ARG A 1 639 ? 54.780  -5.097  -110.007 1.00 37.89  ? 639 ARG A C   1 
ATOM   3936 O O   . ARG A 1 639 ? 55.858  -5.393  -110.504 1.00 47.39  ? 639 ARG A O   1 
ATOM   3937 C CB  . ARG A 1 639 ? 53.337  -3.697  -111.464 1.00 43.70  ? 639 ARG A CB  1 
ATOM   3938 C CG  . ARG A 1 639 ? 52.487  -2.450  -111.620 1.00 41.61  ? 639 ARG A CG  1 
ATOM   3939 C CD  . ARG A 1 639 ? 51.765  -2.450  -112.959 1.00 42.42  ? 639 ARG A CD  1 
ATOM   3940 N NE  . ARG A 1 639 ? 50.406  -1.922  -112.851 1.00 43.86  ? 639 ARG A NE  1 
ATOM   3941 C CZ  . ARG A 1 639 ? 49.376  -2.571  -112.311 1.00 45.56  ? 639 ARG A CZ  1 
ATOM   3942 N NH1 . ARG A 1 639 ? 49.522  -3.788  -111.801 1.00 53.69  ? 639 ARG A NH1 1 
ATOM   3943 N NH2 . ARG A 1 639 ? 48.186  -1.994  -112.270 1.00 48.01  ? 639 ARG A NH2 1 
ATOM   3944 N N   . GLN A 1 640 ? 54.058  -5.938  -109.279 1.00 40.97  ? 640 GLN A N   1 
ATOM   3945 C CA  . GLN A 1 640 ? 54.546  -7.257  -108.899 1.00 39.99  ? 640 GLN A CA  1 
ATOM   3946 C C   . GLN A 1 640 ? 53.590  -8.380  -109.305 1.00 39.12  ? 640 GLN A C   1 
ATOM   3947 O O   . GLN A 1 640 ? 52.388  -8.181  -109.473 1.00 35.15  ? 640 GLN A O   1 
ATOM   3948 C CB  . GLN A 1 640 ? 54.784  -7.307  -107.392 1.00 40.48  ? 640 GLN A CB  1 
ATOM   3949 C CG  . GLN A 1 640 ? 55.989  -6.521  -106.913 1.00 37.25  ? 640 GLN A CG  1 
ATOM   3950 C CD  . GLN A 1 640 ? 56.078  -6.476  -105.398 1.00 39.41  ? 640 GLN A CD  1 
ATOM   3951 O OE1 . GLN A 1 640 ? 55.058  -6.402  -104.706 1.00 44.66  ? 640 GLN A OE1 1 
ATOM   3952 N NE2 . GLN A 1 640 ? 57.298  -6.525  -104.873 1.00 38.75  ? 640 GLN A NE2 1 
ATOM   3953 N N   . ILE A 1 641 ? 54.157  -9.572  -109.424 1.00 43.33  ? 641 ILE A N   1 
ATOM   3954 C CA  . ILE A 1 641 ? 53.471  -10.753 -109.933 1.00 41.52  ? 641 ILE A CA  1 
ATOM   3955 C C   . ILE A 1 641 ? 53.913  -11.957 -109.104 1.00 41.09  ? 641 ILE A C   1 
ATOM   3956 O O   . ILE A 1 641 ? 54.937  -11.899 -108.433 1.00 40.26  ? 641 ILE A O   1 
ATOM   3957 C CB  . ILE A 1 641 ? 53.814  -10.934 -111.436 1.00 42.63  ? 641 ILE A CB  1 
ATOM   3958 C CG1 . ILE A 1 641 ? 52.646  -10.447 -112.285 1.00 42.78  ? 641 ILE A CG1 1 
ATOM   3959 C CG2 . ILE A 1 641 ? 54.206  -12.379 -111.781 1.00 30.79  ? 641 ILE A CG2 1 
ATOM   3960 C CD1 . ILE A 1 641 ? 51.447  -11.318 -112.194 1.00 51.58  ? 641 ILE A CD1 1 
ATOM   3961 N N   . ARG A 1 642 ? 53.140  -13.036 -109.140 1.00 39.05  ? 642 ARG A N   1 
ATOM   3962 C CA  . ARG A 1 642 ? 53.466  -14.232 -108.368 1.00 39.47  ? 642 ARG A CA  1 
ATOM   3963 C C   . ARG A 1 642 ? 53.405  -15.475 -109.253 1.00 38.72  ? 642 ARG A C   1 
ATOM   3964 O O   . ARG A 1 642 ? 52.325  -15.905 -109.660 1.00 41.77  ? 642 ARG A O   1 
ATOM   3965 C CB  . ARG A 1 642 ? 52.499  -14.363 -107.191 1.00 38.92  ? 642 ARG A CB  1 
ATOM   3966 C CG  . ARG A 1 642 ? 52.898  -15.390 -106.152 1.00 39.11  ? 642 ARG A CG  1 
ATOM   3967 C CD  . ARG A 1 642 ? 54.023  -14.888 -105.259 1.00 40.88  ? 642 ARG A CD  1 
ATOM   3968 N NE  . ARG A 1 642 ? 54.230  -15.774 -104.111 1.00 39.58  ? 642 ARG A NE  1 
ATOM   3969 C CZ  . ARG A 1 642 ? 55.030  -15.508 -103.080 1.00 35.50  ? 642 ARG A CZ  1 
ATOM   3970 N NH1 . ARG A 1 642 ? 55.710  -14.371 -103.024 1.00 25.69  ? 642 ARG A NH1 1 
ATOM   3971 N NH2 . ARG A 1 642 ? 55.139  -16.385 -102.088 1.00 39.74  ? 642 ARG A NH2 1 
ATOM   3972 N N   . ALA A 1 643 ? 54.568  -16.045 -109.550 1.00 37.09  ? 643 ALA A N   1 
ATOM   3973 C CA  . ALA A 1 643 ? 54.660  -17.255 -110.368 1.00 40.58  ? 643 ALA A CA  1 
ATOM   3974 C C   . ALA A 1 643 ? 55.518  -18.303 -109.668 1.00 42.66  ? 643 ALA A C   1 
ATOM   3975 O O   . ALA A 1 643 ? 56.247  -17.988 -108.720 1.00 40.10  ? 643 ALA A O   1 
ATOM   3976 C CB  . ALA A 1 643 ? 55.241  -16.921 -111.727 1.00 41.22  ? 643 ALA A CB  1 
ATOM   3977 N N   . GLU A 1 644 ? 55.431  -19.547 -110.132 1.00 46.57  ? 644 GLU A N   1 
ATOM   3978 C CA  . GLU A 1 644 ? 56.209  -20.626 -109.534 1.00 48.13  ? 644 GLU A CA  1 
ATOM   3979 C C   . GLU A 1 644 ? 57.694  -20.336 -109.715 1.00 46.48  ? 644 GLU A C   1 
ATOM   3980 O O   . GLU A 1 644 ? 58.128  -19.962 -110.803 1.00 44.02  ? 644 GLU A O   1 
ATOM   3981 C CB  . GLU A 1 644 ? 55.853  -21.987 -110.138 1.00 49.24  ? 644 GLU A CB  1 
ATOM   3982 C CG  . GLU A 1 644 ? 56.551  -23.155 -109.432 1.00 55.03  ? 644 GLU A CG  1 
ATOM   3983 C CD  . GLU A 1 644 ? 56.021  -24.522 -109.842 1.00 62.23  ? 644 GLU A CD  1 
ATOM   3984 O OE1 . GLU A 1 644 ? 54.783  -24.684 -109.972 1.00 58.71  ? 644 GLU A OE1 1 
ATOM   3985 O OE2 . GLU A 1 644 ? 56.854  -25.442 -110.016 1.00 69.22  ? 644 GLU A OE2 1 
ATOM   3986 N N   . ILE A 1 645 ? 58.458  -20.514 -108.638 1.00 47.65  ? 645 ILE A N   1 
ATOM   3987 C CA  . ILE A 1 645 ? 59.900  -20.232 -108.620 1.00 45.95  ? 645 ILE A CA  1 
ATOM   3988 C C   . ILE A 1 645 ? 60.637  -20.850 -109.815 1.00 43.52  ? 645 ILE A C   1 
ATOM   3989 O O   . ILE A 1 645 ? 61.584  -20.267 -110.320 1.00 44.24  ? 645 ILE A O   1 
ATOM   3990 C CB  . ILE A 1 645 ? 60.537  -20.711 -107.278 1.00 46.64  ? 645 ILE A CB  1 
ATOM   3991 C CG1 . ILE A 1 645 ? 61.954  -20.158 -107.098 1.00 48.50  ? 645 ILE A CG1 1 
ATOM   3992 C CG2 . ILE A 1 645 ? 60.532  -22.237 -107.180 1.00 48.44  ? 645 ILE A CG2 1 
ATOM   3993 C CD1 . ILE A 1 645 ? 61.996  -18.672 -106.872 1.00 49.34  ? 645 ILE A CD1 1 
ATOM   3994 N N   . SER A 1 646 ? 60.186  -22.020 -110.261 1.00 43.42  ? 646 SER A N   1 
ATOM   3995 C CA  . SER A 1 646 ? 60.765  -22.711 -111.413 1.00 40.70  ? 646 SER A CA  1 
ATOM   3996 C C   . SER A 1 646 ? 60.435  -22.076 -112.760 1.00 40.41  ? 646 SER A C   1 
ATOM   3997 O O   . SER A 1 646 ? 61.206  -22.223 -113.702 1.00 45.28  ? 646 SER A O   1 
ATOM   3998 C CB  . SER A 1 646 ? 60.283  -24.157 -111.445 1.00 37.72  ? 646 SER A CB  1 
ATOM   3999 O OG  . SER A 1 646 ? 58.882  -24.206 -111.661 1.00 38.56  ? 646 SER A OG  1 
ATOM   4000 N N   . GLU A 1 647 ? 59.285  -21.412 -112.868 1.00 40.57  ? 647 GLU A N   1 
ATOM   4001 C CA  . GLU A 1 647 ? 58.881  -20.766 -114.128 1.00 43.71  ? 647 GLU A CA  1 
ATOM   4002 C C   . GLU A 1 647 ? 59.572  -19.418 -114.368 1.00 41.40  ? 647 GLU A C   1 
ATOM   4003 O O   . GLU A 1 647 ? 59.727  -18.996 -115.511 1.00 40.48  ? 647 GLU A O   1 
ATOM   4004 C CB  . GLU A 1 647 ? 57.363  -20.554 -114.175 1.00 43.44  ? 647 GLU A CB  1 
ATOM   4005 C CG  . GLU A 1 647 ? 56.550  -21.816 -114.395 1.00 49.49  ? 647 GLU A CG  1 
ATOM   4006 C CD  . GLU A 1 647 ? 55.053  -21.535 -114.496 1.00 57.50  ? 647 GLU A CD  1 
ATOM   4007 O OE1 . GLU A 1 647 ? 54.650  -20.721 -115.359 1.00 63.01  ? 647 GLU A OE1 1 
ATOM   4008 O OE2 . GLU A 1 647 ? 54.276  -22.133 -113.716 1.00 69.98  ? 647 GLU A OE2 1 
ATOM   4009 N N   . LEU A 1 648 ? 59.986  -18.753 -113.293 1.00 40.65  ? 648 LEU A N   1 
ATOM   4010 C CA  . LEU A 1 648 ? 60.473  -17.374 -113.368 1.00 42.08  ? 648 LEU A CA  1 
ATOM   4011 C C   . LEU A 1 648 ? 61.709  -17.157 -114.243 1.00 42.57  ? 648 LEU A C   1 
ATOM   4012 O O   . LEU A 1 648 ? 61.797  -16.145 -114.931 1.00 50.03  ? 648 LEU A O   1 
ATOM   4013 C CB  . LEU A 1 648 ? 60.734  -16.823 -111.960 1.00 41.26  ? 648 LEU A CB  1 
ATOM   4014 C CG  . LEU A 1 648 ? 59.466  -16.436 -111.195 1.00 43.59  ? 648 LEU A CG  1 
ATOM   4015 C CD1 . LEU A 1 648 ? 59.772  -16.191 -109.727 1.00 40.05  ? 648 LEU A CD1 1 
ATOM   4016 C CD2 . LEU A 1 648 ? 58.821  -15.210 -111.837 1.00 38.67  ? 648 LEU A CD2 1 
ATOM   4017 N N   . PRO A 1 649 ? 62.679  -18.083 -114.208 1.00 41.03  ? 649 PRO A N   1 
ATOM   4018 C CA  . PRO A 1 649 ? 63.855  -17.884 -115.053 1.00 40.93  ? 649 PRO A CA  1 
ATOM   4019 C C   . PRO A 1 649 ? 63.505  -17.616 -116.513 1.00 40.19  ? 649 PRO A C   1 
ATOM   4020 O O   . PRO A 1 649 ? 64.013  -16.659 -117.099 1.00 42.21  ? 649 PRO A O   1 
ATOM   4021 C CB  . PRO A 1 649 ? 64.622  -19.203 -114.898 1.00 43.47  ? 649 PRO A CB  1 
ATOM   4022 C CG  . PRO A 1 649 ? 64.229  -19.697 -113.547 1.00 39.08  ? 649 PRO A CG  1 
ATOM   4023 C CD  . PRO A 1 649 ? 62.789  -19.309 -113.398 1.00 40.13  ? 649 PRO A CD  1 
ATOM   4024 N N   . SER A 1 650 ? 62.630  -18.440 -117.082 1.00 39.87  ? 650 SER A N   1 
ATOM   4025 C CA  . SER A 1 650 ? 62.210  -18.268 -118.473 1.00 38.12  ? 650 SER A CA  1 
ATOM   4026 C C   . SER A 1 650 ? 61.348  -17.014 -118.666 1.00 36.89  ? 650 SER A C   1 
ATOM   4027 O O   . SER A 1 650 ? 61.365  -16.414 -119.741 1.00 40.47  ? 650 SER A O   1 
ATOM   4028 C CB  . SER A 1 650 ? 61.462  -19.505 -118.969 1.00 34.72  ? 650 SER A CB  1 
ATOM   4029 O OG  . SER A 1 650 ? 60.164  -19.573 -118.411 1.00 43.01  ? 650 SER A OG  1 
ATOM   4030 N N   . ILE A 1 651 ? 60.603  -16.624 -117.632 1.00 34.78  ? 651 ILE A N   1 
ATOM   4031 C CA  . ILE A 1 651 ? 59.775  -15.412 -117.685 1.00 36.87  ? 651 ILE A CA  1 
ATOM   4032 C C   . ILE A 1 651 ? 60.641  -14.142 -117.693 1.00 39.81  ? 651 ILE A C   1 
ATOM   4033 O O   . ILE A 1 651 ? 60.372  -13.199 -118.442 1.00 39.32  ? 651 ILE A O   1 
ATOM   4034 C CB  . ILE A 1 651 ? 58.762  -15.355 -116.514 1.00 34.14  ? 651 ILE A CB  1 
ATOM   4035 C CG1 . ILE A 1 651 ? 57.730  -16.475 -116.644 1.00 34.73  ? 651 ILE A CG1 1 
ATOM   4036 C CG2 . ILE A 1 651 ? 58.027  -14.029 -116.496 1.00 33.22  ? 651 ILE A CG2 1 
ATOM   4037 C CD1 . ILE A 1 651 ? 56.904  -16.691 -115.395 1.00 34.61  ? 651 ILE A CD1 1 
ATOM   4038 N N   . VAL A 1 652 ? 61.684  -14.123 -116.870 1.00 39.98  ? 652 VAL A N   1 
ATOM   4039 C CA  . VAL A 1 652 ? 62.592  -12.978 -116.825 1.00 39.29  ? 652 VAL A CA  1 
ATOM   4040 C C   . VAL A 1 652 ? 63.374  -12.873 -118.129 1.00 39.03  ? 652 VAL A C   1 
ATOM   4041 O O   . VAL A 1 652 ? 63.542  -11.784 -118.671 1.00 39.15  ? 652 VAL A O   1 
ATOM   4042 C CB  . VAL A 1 652 ? 63.556  -13.063 -115.629 1.00 38.91  ? 652 VAL A CB  1 
ATOM   4043 C CG1 . VAL A 1 652 ? 64.608  -11.959 -115.702 1.00 35.82  ? 652 VAL A CG1 1 
ATOM   4044 C CG2 . VAL A 1 652 ? 62.765  -12.981 -114.318 1.00 37.45  ? 652 VAL A CG2 1 
ATOM   4045 N N   . GLN A 1 653 ? 63.831  -14.014 -118.634 1.00 37.85  ? 653 GLN A N   1 
ATOM   4046 C CA  . GLN A 1 653 ? 64.571  -14.064 -119.894 1.00 38.01  ? 653 GLN A CA  1 
ATOM   4047 C C   . GLN A 1 653 ? 63.784  -13.459 -121.053 1.00 40.77  ? 653 GLN A C   1 
ATOM   4048 O O   . GLN A 1 653 ? 64.329  -12.680 -121.838 1.00 40.51  ? 653 GLN A O   1 
ATOM   4049 C CB  . GLN A 1 653 ? 64.917  -15.512 -120.226 1.00 38.16  ? 653 GLN A CB  1 
ATOM   4050 C CG  . GLN A 1 653 ? 65.669  -15.717 -121.533 1.00 35.53  ? 653 GLN A CG  1 
ATOM   4051 C CD  . GLN A 1 653 ? 65.666  -17.165 -121.958 1.00 34.01  ? 653 GLN A CD  1 
ATOM   4052 O OE1 . GLN A 1 653 ? 64.615  -17.804 -122.019 1.00 43.70  ? 653 GLN A OE1 1 
ATOM   4053 N NE2 . GLN A 1 653 ? 66.837  -17.695 -122.247 1.00 22.83  ? 653 GLN A NE2 1 
ATOM   4054 N N   . ASP A 1 654 ? 62.511  -13.836 -121.164 1.00 42.88  ? 654 ASP A N   1 
ATOM   4055 C CA  . ASP A 1 654 ? 61.654  -13.344 -122.243 1.00 39.29  ? 654 ASP A CA  1 
ATOM   4056 C C   . ASP A 1 654 ? 61.386  -11.851 -122.084 1.00 37.13  ? 654 ASP A C   1 
ATOM   4057 O O   . ASP A 1 654 ? 61.381  -11.120 -123.069 1.00 39.62  ? 654 ASP A O   1 
ATOM   4058 C CB  . ASP A 1 654 ? 60.335  -14.123 -122.306 1.00 40.42  ? 654 ASP A CB  1 
ATOM   4059 C CG  . ASP A 1 654 ? 60.497  -15.513 -122.907 1.00 45.23  ? 654 ASP A CG  1 
ATOM   4060 O OD1 . ASP A 1 654 ? 61.465  -15.731 -123.665 1.00 49.74  ? 654 ASP A OD1 1 
ATOM   4061 O OD2 . ASP A 1 654 ? 59.641  -16.388 -122.634 1.00 45.23  ? 654 ASP A OD2 1 
ATOM   4062 N N   . LEU A 1 655 ? 61.177  -11.398 -120.851 1.00 36.08  ? 655 LEU A N   1 
ATOM   4063 C CA  . LEU A 1 655 ? 61.040  -9.966  -120.585 1.00 37.09  ? 655 LEU A CA  1 
ATOM   4064 C C   . LEU A 1 655 ? 62.304  -9.246  -121.017 1.00 37.28  ? 655 LEU A C   1 
ATOM   4065 O O   . LEU A 1 655 ? 62.250  -8.321  -121.822 1.00 42.39  ? 655 LEU A O   1 
ATOM   4066 C CB  . LEU A 1 655 ? 60.769  -9.692  -119.106 1.00 34.23  ? 655 LEU A CB  1 
ATOM   4067 C CG  . LEU A 1 655 ? 59.366  -10.036 -118.608 1.00 32.94  ? 655 LEU A CG  1 
ATOM   4068 C CD1 . LEU A 1 655 ? 59.359  -10.133 -117.101 1.00 33.67  ? 655 LEU A CD1 1 
ATOM   4069 C CD2 . LEU A 1 655 ? 58.336  -9.013  -119.100 1.00 22.42  ? 655 LEU A CD2 1 
ATOM   4070 N N   . ALA A 1 656 ? 63.443  -9.703  -120.503 1.00 39.84  ? 656 ALA A N   1 
ATOM   4071 C CA  . ALA A 1 656 ? 64.742  -9.103  -120.832 1.00 40.29  ? 656 ALA A CA  1 
ATOM   4072 C C   . ALA A 1 656 ? 65.029  -9.072  -122.339 1.00 40.17  ? 656 ALA A C   1 
ATOM   4073 O O   . ALA A 1 656 ? 65.596  -8.105  -122.835 1.00 46.29  ? 656 ALA A O   1 
ATOM   4074 C CB  . ALA A 1 656 ? 65.869  -9.818  -120.088 1.00 31.36  ? 656 ALA A CB  1 
ATOM   4075 N N   . ASN A 1 657 ? 64.624  -10.113 -123.061 1.00 38.64  ? 657 ASN A N   1 
ATOM   4076 C CA  . ASN A 1 657 ? 64.877  -10.194 -124.503 1.00 35.65  ? 657 ASN A CA  1 
ATOM   4077 C C   . ASN A 1 657 ? 63.758  -9.608  -125.366 1.00 36.35  ? 657 ASN A C   1 
ATOM   4078 O O   . ASN A 1 657 ? 63.790  -9.731  -126.592 1.00 35.57  ? 657 ASN A O   1 
ATOM   4079 C CB  . ASN A 1 657 ? 65.132  -11.646 -124.910 1.00 35.61  ? 657 ASN A CB  1 
ATOM   4080 C CG  . ASN A 1 657 ? 66.383  -12.226 -124.272 1.00 38.21  ? 657 ASN A CG  1 
ATOM   4081 O OD1 . ASN A 1 657 ? 66.602  -13.437 -124.313 1.00 40.79  ? 657 ASN A OD1 1 
ATOM   4082 N ND2 . ASN A 1 657 ? 67.206  -11.367 -123.674 1.00 33.79  ? 657 ASN A ND2 1 
ATOM   4083 N N   . GLY A 1 658 ? 62.769  -8.980  -124.733 1.00 33.91  ? 658 GLY A N   1 
ATOM   4084 C CA  . GLY A 1 658 ? 61.684  -8.334  -125.462 1.00 33.78  ? 658 GLY A CA  1 
ATOM   4085 C C   . GLY A 1 658 ? 60.746  -9.278  -126.195 1.00 35.20  ? 658 GLY A C   1 
ATOM   4086 O O   . GLY A 1 658 ? 59.993  -8.851  -127.069 1.00 35.17  ? 658 GLY A O   1 
ATOM   4087 N N   . ASN A 1 659 ? 60.784  -10.560 -125.839 1.00 38.04  ? 659 ASN A N   1 
ATOM   4088 C CA  . ASN A 1 659 ? 59.858  -11.547 -126.394 1.00 38.62  ? 659 ASN A CA  1 
ATOM   4089 C C   . ASN A 1 659 ? 58.463  -11.402 -125.793 1.00 37.59  ? 659 ASN A C   1 
ATOM   4090 O O   . ASN A 1 659 ? 57.475  -11.804 -126.399 1.00 42.73  ? 659 ASN A O   1 
ATOM   4091 C CB  . ASN A 1 659 ? 60.380  -12.970 -126.149 1.00 40.34  ? 659 ASN A CB  1 
ATOM   4092 C CG  . ASN A 1 659 ? 61.729  -13.227 -126.811 1.00 47.86  ? 659 ASN A CG  1 
ATOM   4093 O OD1 . ASN A 1 659 ? 62.521  -14.041 -126.337 1.00 52.08  ? 659 ASN A OD1 1 
ATOM   4094 N ND2 . ASN A 1 659 ? 61.996  -12.528 -127.909 1.00 52.39  ? 659 ASN A ND2 1 
ATOM   4095 N N   . ILE A 1 660 ? 58.401  -10.816 -124.603 1.00 37.60  ? 660 ILE A N   1 
ATOM   4096 C CA  . ILE A 1 660 ? 57.174  -10.689 -123.832 1.00 39.35  ? 660 ILE A CA  1 
ATOM   4097 C C   . ILE A 1 660 ? 57.149  -9.312  -123.161 1.00 40.76  ? 660 ILE A C   1 
ATOM   4098 O O   . ILE A 1 660 ? 58.200  -8.759  -122.813 1.00 40.70  ? 660 ILE A O   1 
ATOM   4099 C CB  . ILE A 1 660 ? 57.094  -11.834 -122.768 1.00 43.27  ? 660 ILE A CB  1 
ATOM   4100 C CG1 . ILE A 1 660 ? 56.223  -12.984 -123.274 1.00 41.05  ? 660 ILE A CG1 1 
ATOM   4101 C CG2 . ILE A 1 660 ? 56.568  -11.344 -121.427 1.00 47.15  ? 660 ILE A CG2 1 
ATOM   4102 C CD1 . ILE A 1 660 ? 56.902  -13.862 -124.292 1.00 45.60  ? 660 ILE A CD1 1 
ATOM   4103 N N   . THR A 1 661 ? 55.945  -8.768  -122.997 1.00 41.29  ? 661 THR A N   1 
ATOM   4104 C CA  . THR A 1 661 ? 55.720  -7.509  -122.285 1.00 40.88  ? 661 THR A CA  1 
ATOM   4105 C C   . THR A 1 661 ? 55.403  -7.768  -120.812 1.00 40.92  ? 661 THR A C   1 
ATOM   4106 O O   . THR A 1 661 ? 54.995  -8.870  -120.438 1.00 39.51  ? 661 THR A O   1 
ATOM   4107 C CB  . THR A 1 661 ? 54.541  -6.755  -122.920 1.00 42.17  ? 661 THR A CB  1 
ATOM   4108 O OG1 . THR A 1 661 ? 54.873  -6.437  -124.274 1.00 42.25  ? 661 THR A OG1 1 
ATOM   4109 C CG2 . THR A 1 661 ? 54.218  -5.469  -122.167 1.00 46.82  ? 661 THR A CG2 1 
ATOM   4110 N N   . TRP A 1 662 ? 55.590  -6.754  -119.971 1.00 39.50  ? 662 TRP A N   1 
ATOM   4111 C CA  . TRP A 1 662 ? 55.098  -6.832  -118.599 1.00 39.10  ? 662 TRP A CA  1 
ATOM   4112 C C   . TRP A 1 662 ? 53.589  -7.084  -118.601 1.00 42.14  ? 662 TRP A C   1 
ATOM   4113 O O   . TRP A 1 662 ? 53.091  -7.940  -117.867 1.00 43.77  ? 662 TRP A O   1 
ATOM   4114 C CB  . TRP A 1 662 ? 55.411  -5.560  -117.814 1.00 36.93  ? 662 TRP A CB  1 
ATOM   4115 C CG  . TRP A 1 662 ? 55.076  -5.714  -116.374 1.00 40.58  ? 662 TRP A CG  1 
ATOM   4116 C CD1 . TRP A 1 662 ? 54.078  -5.085  -115.689 1.00 41.68  ? 662 TRP A CD1 1 
ATOM   4117 C CD2 . TRP A 1 662 ? 55.704  -6.601  -115.444 1.00 39.02  ? 662 TRP A CD2 1 
ATOM   4118 N NE1 . TRP A 1 662 ? 54.062  -5.507  -114.383 1.00 39.18  ? 662 TRP A NE1 1 
ATOM   4119 C CE2 . TRP A 1 662 ? 55.051  -6.437  -114.205 1.00 39.48  ? 662 TRP A CE2 1 
ATOM   4120 C CE3 . TRP A 1 662 ? 56.763  -7.509  -115.535 1.00 39.66  ? 662 TRP A CE3 1 
ATOM   4121 C CZ2 . TRP A 1 662 ? 55.420  -7.150  -113.065 1.00 39.06  ? 662 TRP A CZ2 1 
ATOM   4122 C CZ3 . TRP A 1 662 ? 57.135  -8.215  -114.398 1.00 42.03  ? 662 TRP A CZ3 1 
ATOM   4123 C CH2 . TRP A 1 662 ? 56.463  -8.030  -113.181 1.00 40.53  ? 662 TRP A CH2 1 
ATOM   4124 N N   . ALA A 1 663 ? 52.870  -6.330  -119.430 1.00 40.55  ? 663 ALA A N   1 
ATOM   4125 C CA  . ALA A 1 663 ? 51.447  -6.561  -119.666 1.00 37.61  ? 663 ALA A CA  1 
ATOM   4126 C C   . ALA A 1 663 ? 51.142  -8.030  -119.963 1.00 37.83  ? 663 ALA A C   1 
ATOM   4127 O O   . ALA A 1 663 ? 50.185  -8.583  -119.427 1.00 45.19  ? 663 ALA A O   1 
ATOM   4128 C CB  . ALA A 1 663 ? 50.954  -5.684  -120.804 1.00 33.26  ? 663 ALA A CB  1 
ATOM   4129 N N   . ASP A 1 664 ? 51.951  -8.658  -120.815 1.00 37.74  ? 664 ASP A N   1 
ATOM   4130 C CA  . ASP A 1 664 ? 51.795  -10.087 -121.109 1.00 37.33  ? 664 ASP A CA  1 
ATOM   4131 C C   . ASP A 1 664 ? 51.885  -10.909 -119.828 1.00 36.90  ? 664 ASP A C   1 
ATOM   4132 O O   . ASP A 1 664 ? 51.008  -11.724 -119.540 1.00 30.67  ? 664 ASP A O   1 
ATOM   4133 C CB  . ASP A 1 664 ? 52.857  -10.572 -122.105 1.00 40.17  ? 664 ASP A CB  1 
ATOM   4134 C CG  . ASP A 1 664 ? 52.635  -10.043 -123.512 1.00 43.12  ? 664 ASP A CG  1 
ATOM   4135 O OD1 . ASP A 1 664 ? 51.492  -10.112 -124.015 1.00 42.95  ? 664 ASP A OD1 1 
ATOM   4136 O OD2 . ASP A 1 664 ? 53.617  -9.572  -124.124 1.00 44.73  ? 664 ASP A OD2 1 
ATOM   4137 N N   . VAL A 1 665 ? 52.948  -10.682 -119.057 1.00 39.66  ? 665 VAL A N   1 
ATOM   4138 C CA  . VAL A 1 665 ? 53.132  -11.377 -117.783 1.00 38.79  ? 665 VAL A CA  1 
ATOM   4139 C C   . VAL A 1 665 ? 51.870  -11.252 -116.920 1.00 38.59  ? 665 VAL A C   1 
ATOM   4140 O O   . VAL A 1 665 ? 51.364  -12.249 -116.404 1.00 37.73  ? 665 VAL A O   1 
ATOM   4141 C CB  . VAL A 1 665 ? 54.354  -10.834 -117.000 1.00 40.25  ? 665 VAL A CB  1 
ATOM   4142 C CG1 . VAL A 1 665 ? 54.540  -11.600 -115.687 1.00 37.43  ? 665 VAL A CG1 1 
ATOM   4143 C CG2 . VAL A 1 665 ? 55.613  -10.911 -117.848 1.00 37.69  ? 665 VAL A CG2 1 
ATOM   4144 N N   . GLU A 1 666 ? 51.353  -10.031 -116.794 1.00 39.95  ? 666 GLU A N   1 
ATOM   4145 C CA  . GLU A 1 666 ? 50.170  -9.770  -115.964 1.00 39.96  ? 666 GLU A CA  1 
ATOM   4146 C C   . GLU A 1 666 ? 48.925  -10.490 -116.463 1.00 36.44  ? 666 GLU A C   1 
ATOM   4147 O O   . GLU A 1 666 ? 48.127  -10.969 -115.663 1.00 38.57  ? 666 GLU A O   1 
ATOM   4148 C CB  . GLU A 1 666 ? 49.892  -8.269  -115.855 1.00 37.58  ? 666 GLU A CB  1 
ATOM   4149 C CG  . GLU A 1 666 ? 50.998  -7.511  -115.129 1.00 41.78  ? 666 GLU A CG  1 
ATOM   4150 C CD  . GLU A 1 666 ? 50.547  -6.180  -114.569 1.00 41.17  ? 666 GLU A CD  1 
ATOM   4151 O OE1 . GLU A 1 666 ? 51.168  -5.719  -113.597 1.00 36.92  ? 666 GLU A OE1 1 
ATOM   4152 O OE2 . GLU A 1 666 ? 49.576  -5.594  -115.087 1.00 51.73  ? 666 GLU A OE2 1 
ATOM   4153 N N   . ALA A 1 667 ? 48.771  -10.578 -117.780 1.00 35.67  ? 667 ALA A N   1 
ATOM   4154 C CA  . ALA A 1 667 ? 47.653  -11.310 -118.375 1.00 39.04  ? 667 ALA A CA  1 
ATOM   4155 C C   . ALA A 1 667 ? 47.721  -12.820 -118.092 1.00 41.74  ? 667 ALA A C   1 
ATOM   4156 O O   . ALA A 1 667 ? 46.691  -13.495 -118.091 1.00 40.37  ? 667 ALA A O   1 
ATOM   4157 C CB  . ALA A 1 667 ? 47.601  -11.055 -119.875 1.00 33.34  ? 667 ALA A CB  1 
ATOM   4158 N N   . ARG A 1 668 ? 48.929  -13.332 -117.843 1.00 46.09  ? 668 ARG A N   1 
ATOM   4159 C CA  . ARG A 1 668 ? 49.165  -14.772 -117.674 1.00 47.65  ? 668 ARG A CA  1 
ATOM   4160 C C   . ARG A 1 668 ? 49.344  -15.219 -116.217 1.00 44.94  ? 668 ARG A C   1 
ATOM   4161 O O   . ARG A 1 668 ? 49.088  -16.378 -115.896 1.00 43.60  ? 668 ARG A O   1 
ATOM   4162 C CB  . ARG A 1 668 ? 50.406  -15.185 -118.473 1.00 52.80  ? 668 ARG A CB  1 
ATOM   4163 C CG  . ARG A 1 668 ? 50.248  -15.088 -119.987 1.00 55.44  ? 668 ARG A CG  1 
ATOM   4164 C CD  . ARG A 1 668 ? 51.603  -14.918 -120.672 1.00 59.47  ? 668 ARG A CD  1 
ATOM   4165 N NE  . ARG A 1 668 ? 51.514  -14.954 -122.134 1.00 66.54  ? 668 ARG A NE  1 
ATOM   4166 C CZ  . ARG A 1 668 ? 51.028  -13.976 -122.900 1.00 72.89  ? 668 ARG A CZ  1 
ATOM   4167 N NH1 . ARG A 1 668 ? 50.561  -12.855 -122.364 1.00 78.21  ? 668 ARG A NH1 1 
ATOM   4168 N NH2 . ARG A 1 668 ? 50.996  -14.122 -124.220 1.00 72.15  ? 668 ARG A NH2 1 
ATOM   4169 N N   . TYR A 1 669 ? 49.788  -14.313 -115.348 1.00 43.32  ? 669 TYR A N   1 
ATOM   4170 C CA  . TYR A 1 669 ? 50.125  -14.659 -113.964 1.00 42.73  ? 669 TYR A CA  1 
ATOM   4171 C C   . TYR A 1 669 ? 49.381  -13.782 -112.967 1.00 40.99  ? 669 TYR A C   1 
ATOM   4172 O O   . TYR A 1 669 ? 49.043  -12.641 -113.280 1.00 42.71  ? 669 TYR A O   1 
ATOM   4173 C CB  . TYR A 1 669 ? 51.635  -14.527 -113.750 1.00 43.33  ? 669 TYR A CB  1 
ATOM   4174 C CG  . TYR A 1 669 ? 52.413  -15.520 -114.571 1.00 44.28  ? 669 TYR A CG  1 
ATOM   4175 C CD1 . TYR A 1 669 ? 53.068  -15.134 -115.735 1.00 38.57  ? 669 TYR A CD1 1 
ATOM   4176 C CD2 . TYR A 1 669 ? 52.456  -16.862 -114.206 1.00 45.32  ? 669 TYR A CD2 1 
ATOM   4177 C CE1 . TYR A 1 669 ? 53.765  -16.055 -116.502 1.00 38.92  ? 669 TYR A CE1 1 
ATOM   4178 C CE2 . TYR A 1 669 ? 53.147  -17.788 -114.964 1.00 42.37  ? 669 TYR A CE2 1 
ATOM   4179 C CZ  . TYR A 1 669 ? 53.798  -17.378 -116.109 1.00 41.56  ? 669 TYR A CZ  1 
ATOM   4180 O OH  . TYR A 1 669 ? 54.485  -18.298 -116.858 1.00 47.19  ? 669 TYR A OH  1 
ATOM   4181 N N   . PRO A 1 670 ? 49.120  -14.314 -111.759 1.00 41.45  ? 670 PRO A N   1 
ATOM   4182 C CA  . PRO A 1 670 ? 48.370  -13.573 -110.745 1.00 42.20  ? 670 PRO A CA  1 
ATOM   4183 C C   . PRO A 1 670 ? 49.111  -12.357 -110.211 1.00 40.78  ? 670 PRO A C   1 
ATOM   4184 O O   . PRO A 1 670 ? 50.279  -12.454 -109.852 1.00 42.84  ? 670 PRO A O   1 
ATOM   4185 C CB  . PRO A 1 670 ? 48.162  -14.604 -109.631 1.00 41.99  ? 670 PRO A CB  1 
ATOM   4186 C CG  . PRO A 1 670 ? 49.238  -15.579 -109.805 1.00 41.66  ? 670 PRO A CG  1 
ATOM   4187 C CD  . PRO A 1 670 ? 49.500  -15.654 -111.279 1.00 44.23  ? 670 PRO A CD  1 
ATOM   4188 N N   . LEU A 1 671 ? 48.414  -11.226 -110.160 1.00 44.07  ? 671 LEU A N   1 
ATOM   4189 C CA  . LEU A 1 671 ? 48.971  -9.978  -109.650 1.00 42.78  ? 671 LEU A CA  1 
ATOM   4190 C C   . LEU A 1 671 ? 49.204  -10.108 -108.149 1.00 43.88  ? 671 LEU A C   1 
ATOM   4191 O O   . LEU A 1 671 ? 48.491  -10.842 -107.466 1.00 48.25  ? 671 LEU A O   1 
ATOM   4192 C CB  . LEU A 1 671 ? 48.025  -8.801  -109.933 1.00 43.10  ? 671 LEU A CB  1 
ATOM   4193 C CG  . LEU A 1 671 ? 47.345  -8.714  -111.307 1.00 39.20  ? 671 LEU A CG  1 
ATOM   4194 C CD1 . LEU A 1 671 ? 46.810  -7.308  -111.529 1.00 26.58  ? 671 LEU A CD1 1 
ATOM   4195 C CD2 . LEU A 1 671 ? 48.293  -9.115  -112.439 1.00 35.40  ? 671 LEU A CD2 1 
ATOM   4196 N N   . PHE A 1 672 ? 50.194  -9.381  -107.641 1.00 45.66  ? 672 PHE A N   1 
ATOM   4197 C CA  . PHE A 1 672 ? 50.647  -9.544  -106.264 1.00 46.28  ? 672 PHE A CA  1 
ATOM   4198 C C   . PHE A 1 672 ? 51.154  -8.222  -105.705 1.00 49.56  ? 672 PHE A C   1 
ATOM   4199 O O   . PHE A 1 672 ? 51.827  -7.474  -106.408 1.00 55.78  ? 672 PHE A O   1 
ATOM   4200 C CB  . PHE A 1 672 ? 51.769  -10.574 -106.233 1.00 44.12  ? 672 PHE A CB  1 
ATOM   4201 C CG  . PHE A 1 672 ? 52.113  -11.053 -104.858 1.00 46.48  ? 672 PHE A CG  1 
ATOM   4202 C CD1 . PHE A 1 672 ? 51.449  -12.142 -104.306 1.00 45.91  ? 672 PHE A CD1 1 
ATOM   4203 C CD2 . PHE A 1 672 ? 53.101  -10.420 -104.114 1.00 45.81  ? 672 PHE A CD2 1 
ATOM   4204 C CE1 . PHE A 1 672 ? 51.764  -12.595 -103.032 1.00 43.38  ? 672 PHE A CE1 1 
ATOM   4205 C CE2 . PHE A 1 672 ? 53.424  -10.866 -102.838 1.00 42.63  ? 672 PHE A CE2 1 
ATOM   4206 C CZ  . PHE A 1 672 ? 52.753  -11.957 -102.296 1.00 40.46  ? 672 PHE A CZ  1 
ATOM   4207 N N   . GLU A 1 673 ? 50.846  -7.946  -104.442 1.00 52.02  ? 673 GLU A N   1 
ATOM   4208 C CA  . GLU A 1 673 ? 51.254  -6.695  -103.811 1.00 52.13  ? 673 GLU A CA  1 
ATOM   4209 C C   . GLU A 1 673 ? 51.984  -6.949  -102.496 1.00 52.31  ? 673 GLU A C   1 
ATOM   4210 O O   . GLU A 1 673 ? 51.379  -7.418  -101.525 1.00 53.99  ? 673 GLU A O   1 
ATOM   4211 C CB  . GLU A 1 673 ? 50.027  -5.802  -103.590 1.00 54.27  ? 673 GLU A CB  1 
ATOM   4212 C CG  . GLU A 1 673 ? 50.299  -4.472  -102.880 1.00 60.85  ? 673 GLU A CG  1 
ATOM   4213 C CD  . GLU A 1 673 ? 51.388  -3.641  -103.551 1.00 73.83  ? 673 GLU A CD  1 
ATOM   4214 O OE1 . GLU A 1 673 ? 51.044  -2.611  -104.172 1.00 77.42  ? 673 GLU A OE1 1 
ATOM   4215 O OE2 . GLU A 1 673 ? 52.583  -4.013  -103.457 1.00 71.27  ? 673 GLU A OE2 1 
HETATM 4216 S S   . SO4 B 2 .   ? 69.241  -6.371  -134.295 1.00 84.02  ? 692 SO4 A S   1 
HETATM 4217 O O1  . SO4 B 2 .   ? 70.705  -6.438  -134.353 1.00 70.19  ? 692 SO4 A O1  1 
HETATM 4218 O O2  . SO4 B 2 .   ? 68.704  -6.787  -135.591 1.00 78.44  ? 692 SO4 A O2  1 
HETATM 4219 O O3  . SO4 B 2 .   ? 68.763  -7.275  -133.249 1.00 86.73  ? 692 SO4 A O3  1 
HETATM 4220 O O4  . SO4 B 2 .   ? 68.790  -5.005  -134.001 1.00 76.25  ? 692 SO4 A O4  1 
HETATM 4221 S S   . SO4 C 2 .   ? 51.605  -18.323 -102.526 1.00 87.36  ? 693 SO4 A S   1 
HETATM 4222 O O1  . SO4 C 2 .   ? 50.429  -18.847 -101.842 1.00 100.15 ? 693 SO4 A O1  1 
HETATM 4223 O O2  . SO4 C 2 .   ? 52.776  -18.477 -101.654 1.00 73.11  ? 693 SO4 A O2  1 
HETATM 4224 O O3  . SO4 C 2 .   ? 51.777  -19.076 -103.772 1.00 79.90  ? 693 SO4 A O3  1 
HETATM 4225 O O4  . SO4 C 2 .   ? 51.367  -16.909 -102.815 1.00 83.51  ? 693 SO4 A O4  1 
HETATM 4226 S S   . SO4 D 2 .   ? 93.809  21.489  -116.129 1.00 96.57  ? 694 SO4 A S   1 
HETATM 4227 O O1  . SO4 D 2 .   ? 94.939  21.296  -117.036 1.00 88.01  ? 694 SO4 A O1  1 
HETATM 4228 O O2  . SO4 D 2 .   ? 92.606  21.857  -116.879 1.00 84.02  ? 694 SO4 A O2  1 
HETATM 4229 O O3  . SO4 D 2 .   ? 93.575  20.263  -115.362 1.00 92.66  ? 694 SO4 A O3  1 
HETATM 4230 O O4  . SO4 D 2 .   ? 94.132  22.573  -115.207 1.00 104.98 ? 694 SO4 A O4  1 
HETATM 4231 O O   . HOH E 3 .   ? 79.182  20.214  -115.646 1.00 33.65  ? 695 HOH A O   1 
HETATM 4232 O O   . HOH E 3 .   ? 83.167  19.220  -115.608 1.00 30.01  ? 696 HOH A O   1 
HETATM 4233 O O   . HOH E 3 .   ? 80.932  12.181  -110.416 1.00 43.62  ? 697 HOH A O   1 
HETATM 4234 O O   . HOH E 3 .   ? 85.181  13.019  -125.940 1.00 43.22  ? 698 HOH A O   1 
HETATM 4235 O O   . HOH E 3 .   ? 88.604  5.480   -117.512 1.00 24.70  ? 699 HOH A O   1 
HETATM 4236 O O   . HOH E 3 .   ? 72.121  -6.351  -118.671 1.00 21.41  ? 700 HOH A O   1 
HETATM 4237 O O   . HOH E 3 .   ? 64.142  -4.153  -122.031 1.00 37.21  ? 701 HOH A O   1 
HETATM 4238 O O   . HOH E 3 .   ? 82.630  11.798  -151.545 1.00 37.40  ? 702 HOH A O   1 
HETATM 4239 O O   . HOH E 3 .   ? 86.864  -12.810 -144.687 1.00 39.16  ? 703 HOH A O   1 
HETATM 4240 O O   . HOH E 3 .   ? 82.730  -15.691 -137.433 1.00 33.29  ? 704 HOH A O   1 
HETATM 4241 O O   . HOH E 3 .   ? 84.998  6.464   -122.232 1.00 26.96  ? 705 HOH A O   1 
HETATM 4242 O O   . HOH E 3 .   ? 91.670  -2.344  -127.248 1.00 25.22  ? 706 HOH A O   1 
HETATM 4243 O O   . HOH E 3 .   ? 93.585  15.545  -139.481 1.00 45.15  ? 707 HOH A O   1 
HETATM 4244 O O   . HOH E 3 .   ? 89.497  20.408  -133.042 1.00 28.66  ? 708 HOH A O   1 
HETATM 4245 O O   . HOH E 3 .   ? 92.751  24.997  -136.011 1.00 32.69  ? 709 HOH A O   1 
HETATM 4246 O O   . HOH E 3 .   ? 92.860  41.013  -126.455 1.00 44.39  ? 710 HOH A O   1 
HETATM 4247 O O   . HOH E 3 .   ? 84.528  21.745  -121.703 1.00 24.51  ? 711 HOH A O   1 
HETATM 4248 O O   . HOH E 3 .   ? 85.514  8.082   -120.790 1.00 38.38  ? 712 HOH A O   1 
HETATM 4249 O O   . HOH E 3 .   ? 69.353  -8.499  -146.826 1.00 47.54  ? 713 HOH A O   1 
HETATM 4250 O O   . HOH E 3 .   ? 61.116  24.960  -140.310 1.00 41.76  ? 714 HOH A O   1 
HETATM 4251 O O   . HOH E 3 .   ? 65.660  21.397  -136.184 1.00 35.74  ? 715 HOH A O   1 
HETATM 4252 O O   . HOH E 3 .   ? 78.280  17.328  -134.920 1.00 31.25  ? 716 HOH A O   1 
HETATM 4253 O O   . HOH E 3 .   ? 79.930  18.477  -129.193 1.00 46.12  ? 717 HOH A O   1 
HETATM 4254 O O   . HOH E 3 .   ? 64.959  4.088   -106.034 1.00 27.12  ? 718 HOH A O   1 
HETATM 4255 O O   . HOH E 3 .   ? 63.600  -0.058  -121.051 1.00 42.02  ? 719 HOH A O   1 
HETATM 4256 O O   . HOH E 3 .   ? 61.658  -2.832  -118.238 1.00 48.15  ? 720 HOH A O   1 
HETATM 4257 O O   . HOH E 3 .   ? 60.052  4.905   -118.027 1.00 44.57  ? 721 HOH A O   1 
HETATM 4258 O O   . HOH E 3 .   ? 64.849  -25.951 -104.068 1.00 47.49  ? 722 HOH A O   1 
HETATM 4259 O O   . HOH E 3 .   ? 51.728  -21.145 -117.554 1.00 50.30  ? 723 HOH A O   1 
HETATM 4260 O O   . HOH E 3 .   ? 72.500  -13.185 -122.471 1.00 28.32  ? 724 HOH A O   1 
HETATM 4261 O O   . HOH E 3 .   ? 74.322  -15.005 -116.716 1.00 41.34  ? 725 HOH A O   1 
HETATM 4262 O O   . HOH E 3 .   ? 76.228  -13.096 -108.777 1.00 31.98  ? 726 HOH A O   1 
HETATM 4263 O O   . HOH E 3 .   ? 65.907  -24.804 -116.823 1.00 31.38  ? 727 HOH A O   1 
HETATM 4264 O O   . HOH E 3 .   ? 63.335  0.504   -94.235  1.00 37.70  ? 728 HOH A O   1 
HETATM 4265 O O   . HOH E 3 .   ? 97.020  12.143  -127.910 1.00 26.04  ? 729 HOH A O   1 
HETATM 4266 O O   . HOH E 3 .   ? 68.240  15.563  -120.934 1.00 35.26  ? 730 HOH A O   1 
HETATM 4267 O O   . HOH E 3 .   ? 66.004  8.374   -156.892 1.00 42.36  ? 731 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  LEU 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  LEU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  ASP 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  LYS 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  LYS 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  ASP 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  VAL 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  VAL 37  37  ?   ?   ?   A . n 
A 1 38  ASP 38  38  ?   ?   ?   A . n 
A 1 39  LYS 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  VAL 41  41  ?   ?   ?   A . n 
A 1 42  ALA 42  42  ?   ?   ?   A . n 
A 1 43  GLU 43  43  ?   ?   ?   A . n 
A 1 44  LEU 44  44  ?   ?   ?   A . n 
A 1 45  LYS 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  ARG 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  ARG 49  49  ?   ?   ?   A . n 
A 1 50  VAL 50  50  ?   ?   ?   A . n 
A 1 51  LEU 51  51  ?   ?   ?   A . n 
A 1 52  GLU 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  LYS 54  54  ?   ?   ?   A . n 
A 1 55  GLU 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  LEU 58  58  ?   ?   ?   A . n 
A 1 59  GLN 59  59  ?   ?   ?   A . n 
A 1 60  PRO 60  60  ?   ?   ?   A . n 
A 1 61  LYS 61  61  ?   ?   ?   A . n 
A 1 62  ASP 62  62  ?   ?   ?   A . n 
A 1 63  ASP 63  63  ?   ?   ?   A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 CYS 177 177 177 CYS CYS A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 MET 227 227 227 MET MET A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 MET 238 238 238 MET MET A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ARG 288 288 288 ARG ARG A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 HIS 318 318 318 HIS HIS A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 TYR 320 320 320 TYR TYR A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 MET 336 336 336 MET MET A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 TYR 360 360 360 TYR TYR A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 PHE 375 375 375 PHE PHE A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 HIS 378 378 378 HIS HIS A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 ASN 381 381 381 ASN ASN A . n 
A 1 382 GLU 382 382 382 GLU GLU A . n 
A 1 383 MET 383 383 383 MET MET A . n 
A 1 384 ALA 384 384 ?   ?   ?   A . n 
A 1 385 HIS 385 385 ?   ?   ?   A . n 
A 1 386 TYR 386 386 386 TYR TYR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 CYS 388 388 388 CYS CYS A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 CYS 390 390 390 CYS CYS A . n 
A 1 391 TRP 391 391 391 TRP TRP A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 ASP 409 409 409 ASP ASP A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 CYS 412 412 412 CYS CYS A . n 
A 1 413 TYR 413 413 413 TYR TYR A . n 
A 1 414 ASP 414 414 414 ASP ASP A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 HIS 418 418 418 HIS HIS A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ARG 420 420 420 ARG ARG A . n 
A 1 421 ALA 421 421 421 ALA ALA A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 LYS 423 423 423 LYS LYS A . n 
A 1 424 VAL 424 424 424 VAL VAL A . n 
A 1 425 PRO 425 425 425 PRO PRO A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 VAL 427 427 427 VAL VAL A . n 
A 1 428 ALA 428 428 428 ALA ALA A . n 
A 1 429 GLU 429 429 429 GLU GLU A . n 
A 1 430 LYS 430 430 430 LYS LYS A . n 
A 1 431 PRO 431 431 431 PRO PRO A . n 
A 1 432 LEU 432 432 ?   ?   ?   A . n 
A 1 433 LYS 433 433 ?   ?   ?   A . n 
A 1 434 GLU 434 434 ?   ?   ?   A . n 
A 1 435 PRO 435 435 ?   ?   ?   A . n 
A 1 436 LYS 436 436 ?   ?   ?   A . n 
A 1 437 THR 437 437 ?   ?   ?   A . n 
A 1 438 VAL 438 438 ?   ?   ?   A . n 
A 1 439 ASN 439 439 ?   ?   ?   A . n 
A 1 440 VAL 440 440 ?   ?   ?   A . n 
A 1 441 VAL 441 441 ?   ?   ?   A . n 
A 1 442 GLN 442 442 ?   ?   ?   A . n 
A 1 443 PHE 443 443 ?   ?   ?   A . n 
A 1 444 GLU 444 444 ?   ?   ?   A . n 
A 1 445 PRO 445 445 ?   ?   ?   A . n 
A 1 446 SER 446 446 ?   ?   ?   A . n 
A 1 447 LYS 447 447 ?   ?   ?   A . n 
A 1 448 GLY 448 448 ?   ?   ?   A . n 
A 1 449 ALA 449 449 ?   ?   ?   A . n 
A 1 450 ILE 450 450 ?   ?   ?   A . n 
A 1 451 GLY 451 451 ?   ?   ?   A . n 
A 1 452 LYS 452 452 ?   ?   ?   A . n 
A 1 453 ALA 453 453 ?   ?   ?   A . n 
A 1 454 TYR 454 454 ?   ?   ?   A . n 
A 1 455 LYS 455 455 ?   ?   ?   A . n 
A 1 456 LYS 456 456 ?   ?   ?   A . n 
A 1 457 ASP 457 457 ?   ?   ?   A . n 
A 1 458 ALA 458 458 ?   ?   ?   A . n 
A 1 459 LYS 459 459 ?   ?   ?   A . n 
A 1 460 LEU 460 460 ?   ?   ?   A . n 
A 1 461 VAL 461 461 ?   ?   ?   A . n 
A 1 462 MET 462 462 ?   ?   ?   A . n 
A 1 463 GLU 463 463 ?   ?   ?   A . n 
A 1 464 TYR 464 464 ?   ?   ?   A . n 
A 1 465 LEU 465 465 ?   ?   ?   A . n 
A 1 466 ALA 466 466 ?   ?   ?   A . n 
A 1 467 ILE 467 467 ?   ?   ?   A . n 
A 1 468 CYS 468 468 ?   ?   ?   A . n 
A 1 469 ASP 469 469 ?   ?   ?   A . n 
A 1 470 GLU 470 470 ?   ?   ?   A . n 
A 1 471 CYS 471 471 ?   ?   ?   A . n 
A 1 472 TYR 472 472 ?   ?   ?   A . n 
A 1 473 ILE 473 473 ?   ?   ?   A . n 
A 1 474 THR 474 474 ?   ?   ?   A . n 
A 1 475 GLU 475 475 ?   ?   ?   A . n 
A 1 476 MET 476 476 ?   ?   ?   A . n 
A 1 477 GLU 477 477 ?   ?   ?   A . n 
A 1 478 MET 478 478 ?   ?   ?   A . n 
A 1 479 LEU 479 479 ?   ?   ?   A . n 
A 1 480 LEU 480 480 ?   ?   ?   A . n 
A 1 481 ASN 481 481 ?   ?   ?   A . n 
A 1 482 GLU 482 482 ?   ?   ?   A . n 
A 1 483 LYS 483 483 ?   ?   ?   A . n 
A 1 484 GLY 484 484 ?   ?   ?   A . n 
A 1 485 GLU 485 485 ?   ?   ?   A . n 
A 1 486 PHE 486 486 ?   ?   ?   A . n 
A 1 487 THR 487 487 ?   ?   ?   A . n 
A 1 488 ILE 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 THR 490 490 ?   ?   ?   A . n 
A 1 491 GLU 491 491 ?   ?   ?   A . n 
A 1 492 GLY 492 492 ?   ?   ?   A . n 
A 1 493 LYS 493 493 ?   ?   ?   A . n 
A 1 494 THR 494 494 ?   ?   ?   A . n 
A 1 495 PHE 495 495 ?   ?   ?   A . n 
A 1 496 GLN 496 496 ?   ?   ?   A . n 
A 1 497 LEU 497 497 ?   ?   ?   A . n 
A 1 498 THR 498 498 ?   ?   ?   A . n 
A 1 499 LYS 499 499 ?   ?   ?   A . n 
A 1 500 ASP 500 500 ?   ?   ?   A . n 
A 1 501 MET 501 501 ?   ?   ?   A . n 
A 1 502 ILE 502 502 ?   ?   ?   A . n 
A 1 503 ASN 503 503 ?   ?   ?   A . n 
A 1 504 VAL 504 504 ?   ?   ?   A . n 
A 1 505 LYS 505 505 ?   ?   ?   A . n 
A 1 506 ARG 506 506 ?   ?   ?   A . n 
A 1 507 PHE 507 507 ?   ?   ?   A . n 
A 1 508 GLN 508 508 ?   ?   ?   A . n 
A 1 509 LYS 509 509 ?   ?   ?   A . n 
A 1 510 THR 510 510 ?   ?   ?   A . n 
A 1 511 LEU 511 511 ?   ?   ?   A . n 
A 1 512 TYR 512 512 512 TYR TYR A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 VAL 517 517 517 VAL VAL A . n 
A 1 518 PRO 518 518 518 PRO PRO A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 GLU 522 522 522 GLU GLU A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 ARG 529 529 529 ARG ARG A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 MET 531 531 531 MET MET A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 THR 533 533 533 THR THR A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 GLU 536 536 536 GLU GLU A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 PHE 539 539 539 PHE PHE A . n 
A 1 540 HIS 540 540 540 HIS HIS A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ARG 542 542 542 ARG ARG A . n 
A 1 543 GLU 543 543 543 GLU GLU A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 PHE 550 550 550 PHE PHE A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 PHE 553 553 553 PHE PHE A . n 
A 1 554 PRO 554 554 554 PRO PRO A . n 
A 1 555 ALA 555 555 555 ALA ALA A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 PRO 559 559 559 PRO PRO A . n 
A 1 560 PHE 560 560 560 PHE PHE A . n 
A 1 561 LYS 561 561 561 LYS LYS A . n 
A 1 562 CYS 562 562 562 CYS CYS A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 PRO 566 566 566 PRO PRO A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 SER 568 568 568 SER SER A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLN 571 571 571 GLN GLN A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 PHE 573 573 573 PHE PHE A . n 
A 1 574 MET 574 574 574 MET MET A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 PHE 576 576 576 PHE PHE A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 LEU 581 581 581 LEU LEU A . n 
A 1 582 GLU 582 582 582 GLU GLU A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 HIS 587 587 587 HIS HIS A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 VAL 589 589 589 VAL VAL A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 HIS 591 591 591 HIS HIS A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 VAL 593 593 593 VAL VAL A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 SER 596 596 596 SER SER A . n 
A 1 597 SER 597 597 597 SER SER A . n 
A 1 598 GLY 598 598 598 GLY GLY A . n 
A 1 599 SER 599 599 599 SER SER A . n 
A 1 600 ILE 600 600 600 ILE ILE A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 ARG 602 602 602 ARG ARG A . n 
A 1 603 ARG 603 603 603 ARG ARG A . n 
A 1 604 TYR 604 604 604 TYR TYR A . n 
A 1 605 ALA 605 605 605 ALA ALA A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 ASP 608 608 608 ASP ASP A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 VAL 612 612 612 VAL VAL A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 PHE 614 614 614 PHE PHE A . n 
A 1 615 GLY 615 615 615 GLY GLY A . n 
A 1 616 VAL 616 616 616 VAL VAL A . n 
A 1 617 THR 617 617 617 THR THR A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ASP 619 619 619 ASP ASP A . n 
A 1 620 PHE 620 620 620 PHE PHE A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 THR 622 622 622 THR THR A . n 
A 1 623 VAL 623 623 623 VAL VAL A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 LYS 625 625 625 LYS LYS A . n 
A 1 626 THR 626 626 626 THR THR A . n 
A 1 627 PRO 627 627 627 PRO PRO A . n 
A 1 628 HIS 628 628 628 HIS HIS A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 ALA 630 630 630 ALA ALA A . n 
A 1 631 THR 631 631 631 THR THR A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 ARG 633 633 633 ARG ARG A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 ARG 635 635 635 ARG ARG A . n 
A 1 636 ASP 636 636 636 ASP ASP A . n 
A 1 637 SER 637 637 637 SER SER A . n 
A 1 638 MET 638 638 638 MET MET A . n 
A 1 639 ARG 639 639 639 ARG ARG A . n 
A 1 640 GLN 640 640 640 GLN GLN A . n 
A 1 641 ILE 641 641 641 ILE ILE A . n 
A 1 642 ARG 642 642 642 ARG ARG A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 ILE 645 645 645 ILE ILE A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 GLU 647 647 647 GLU GLU A . n 
A 1 648 LEU 648 648 648 LEU LEU A . n 
A 1 649 PRO 649 649 649 PRO PRO A . n 
A 1 650 SER 650 650 650 SER SER A . n 
A 1 651 ILE 651 651 651 ILE ILE A . n 
A 1 652 VAL 652 652 652 VAL VAL A . n 
A 1 653 GLN 653 653 653 GLN GLN A . n 
A 1 654 ASP 654 654 654 ASP ASP A . n 
A 1 655 LEU 655 655 655 LEU LEU A . n 
A 1 656 ALA 656 656 656 ALA ALA A . n 
A 1 657 ASN 657 657 657 ASN ASN A . n 
A 1 658 GLY 658 658 658 GLY GLY A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 TRP 662 662 662 TRP TRP A . n 
A 1 663 ALA 663 663 663 ALA ALA A . n 
A 1 664 ASP 664 664 664 ASP ASP A . n 
A 1 665 VAL 665 665 665 VAL VAL A . n 
A 1 666 GLU 666 666 666 GLU GLU A . n 
A 1 667 ALA 667 667 667 ALA ALA A . n 
A 1 668 ARG 668 668 668 ARG ARG A . n 
A 1 669 TYR 669 669 669 TYR TYR A . n 
A 1 670 PRO 670 670 670 PRO PRO A . n 
A 1 671 LEU 671 671 671 LEU LEU A . n 
A 1 672 PHE 672 672 672 PHE PHE A . n 
A 1 673 GLU 673 673 673 GLU GLU A . n 
A 1 674 GLY 674 674 ?   ?   ?   A . n 
A 1 675 GLN 675 675 ?   ?   ?   A . n 
A 1 676 GLU 676 676 ?   ?   ?   A . n 
A 1 677 THR 677 677 ?   ?   ?   A . n 
A 1 678 GLY 678 678 ?   ?   ?   A . n 
A 1 679 LYS 679 679 ?   ?   ?   A . n 
A 1 680 LYS 680 680 ?   ?   ?   A . n 
A 1 681 GLU 681 681 ?   ?   ?   A . n 
A 1 682 THR 682 682 ?   ?   ?   A . n 
A 1 683 ILE 683 683 ?   ?   ?   A . n 
A 1 684 GLU 684 684 ?   ?   ?   A . n 
A 1 685 GLU 685 685 ?   ?   ?   A . n 
A 1 686 HIS 686 686 ?   ?   ?   A . n 
A 1 687 HIS 687 687 ?   ?   ?   A . n 
A 1 688 HIS 688 688 ?   ?   ?   A . n 
A 1 689 HIS 689 689 ?   ?   ?   A . n 
A 1 690 HIS 690 690 ?   ?   ?   A . n 
A 1 691 HIS 691 691 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Oxford Protein Production Facility' 
_pdbx_SG_project.initial_of_center     OPPF 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1  692 1  SO4 SO4 A . 
C 2 SO4 1  693 2  SO4 SO4 A . 
D 2 SO4 1  694 3  SO4 SO4 A . 
E 3 HOH 1  695 1  HOH HOH A . 
E 3 HOH 2  696 2  HOH HOH A . 
E 3 HOH 3  697 3  HOH HOH A . 
E 3 HOH 4  698 4  HOH HOH A . 
E 3 HOH 5  699 5  HOH HOH A . 
E 3 HOH 6  700 6  HOH HOH A . 
E 3 HOH 7  701 7  HOH HOH A . 
E 3 HOH 8  702 8  HOH HOH A . 
E 3 HOH 9  703 9  HOH HOH A . 
E 3 HOH 10 704 10 HOH HOH A . 
E 3 HOH 11 705 11 HOH HOH A . 
E 3 HOH 12 706 12 HOH HOH A . 
E 3 HOH 13 707 13 HOH HOH A . 
E 3 HOH 14 708 14 HOH HOH A . 
E 3 HOH 15 709 15 HOH HOH A . 
E 3 HOH 16 710 16 HOH HOH A . 
E 3 HOH 17 711 17 HOH HOH A . 
E 3 HOH 18 712 18 HOH HOH A . 
E 3 HOH 19 713 20 HOH HOH A . 
E 3 HOH 20 714 21 HOH HOH A . 
E 3 HOH 21 715 22 HOH HOH A . 
E 3 HOH 22 716 23 HOH HOH A . 
E 3 HOH 23 717 24 HOH HOH A . 
E 3 HOH 24 718 25 HOH HOH A . 
E 3 HOH 25 719 26 HOH HOH A . 
E 3 HOH 26 720 27 HOH HOH A . 
E 3 HOH 27 721 28 HOH HOH A . 
E 3 HOH 28 722 29 HOH HOH A . 
E 3 HOH 29 723 30 HOH HOH A . 
E 3 HOH 30 724 31 HOH HOH A . 
E 3 HOH 31 725 32 HOH HOH A . 
E 3 HOH 32 726 33 HOH HOH A . 
E 3 HOH 33 727 34 HOH HOH A . 
E 3 HOH 34 728 35 HOH HOH A . 
E 3 HOH 35 729 39 HOH HOH A . 
E 3 HOH 36 730 42 HOH HOH A . 
E 3 HOH 37 731 52 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6520  ? 
1 MORE         -119  ? 
1 'SSA (A^2)'  46600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 7_644 y+1,x-1,-z-1 0.0000000000 1.0000000000 0.0000000000 92.5300000000 1.0000000000 0.0000000000 
0.0000000000 -92.5300000000 0.0000000000 0.0000000000 -1.0000000000 -246.8600000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 83.0943 7.0415  -134.5374 -0.1283 -0.2604 -0.2102 0.0247  -0.0227 0.0583 2.5783 1.6410  1.9156 -0.0704 0.7196  -0.4460 
-0.0597 0.3918  0.3220  -0.2945 0.0337 -0.0666 -0.3233 0.0938  0.0260  'X-RAY DIFFRACTION' 
2 ? refined 86.9919 35.9823 -128.7955 0.3447  -0.0674 0.2099  -0.0710 0.0541  0.0415 6.2543 12.1430 1.3570 -5.7280 1.5055  -1.8791 
-0.1443 -0.0939 0.1737  0.5372  0.1009 0.2142  -0.3995 -0.1972 0.0434  'X-RAY DIFFRACTION' 
3 ? refined 62.8208 -9.4126 -108.7484 -0.2864 0.0449  -0.2059 0.1092  0.0650  0.1134 4.2843 5.3179  3.3871 0.9225  -0.8218 -2.2871 
-0.0448 -0.6285 -0.2424 0.3396  0.1681 0.4156  -0.0641 -0.4556 -0.1234 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 64  A 64  A 143 A 143 ? 'X-RAY DIFFRACTION' ? 
2 1 A 226 A 226 A 538 A 538 ? 'X-RAY DIFFRACTION' ? 
3 2 A 144 A 144 A 225 A 225 ? 'X-RAY DIFFRACTION' ? 
4 3 A 539 A 539 A 673 A 673 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
HKL-2000  'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
CNS       phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 153 ? ? -87.12  -77.64  
2 1 MET A 238 ? ? -113.61 79.88   
3 1 ARG A 283 ? ? -145.84 33.46   
4 1 GLU A 305 ? ? -92.76  53.91   
5 1 LYS A 306 ? ? -97.72  58.65   
6 1 TYR A 413 ? ? -164.26 -160.92 
7 1 LEU A 426 ? ? -105.40 71.26   
8 1 SER A 552 ? ? -85.45  49.41   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    THR 
_pdbx_validate_chiral.auth_seq_id     626 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ASP 2   ? A ASP 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ALA 4   ? A ALA 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A ALA 6   ? A ALA 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A GLU 8   ? A GLU 8   
9   1 Y 1 A VAL 9   ? A VAL 9   
10  1 Y 1 A LEU 10  ? A LEU 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A LEU 13  ? A LEU 13  
14  1 Y 1 A ARG 14  ? A ARG 14  
15  1 Y 1 A LEU 15  ? A LEU 15  
16  1 Y 1 A ALA 16  ? A ALA 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A ARG 18  ? A ARG 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A ASP 22  ? A ASP 22  
23  1 Y 1 A LEU 23  ? A LEU 23  
24  1 Y 1 A VAL 24  ? A VAL 24  
25  1 Y 1 A ARG 25  ? A ARG 25  
26  1 Y 1 A LYS 26  ? A LYS 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A LYS 28  ? A LYS 28  
29  1 Y 1 A GLU 29  ? A GLU 29  
30  1 Y 1 A ASP 30  ? A ASP 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A ALA 32  ? A ALA 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A GLN 34  ? A GLN 34  
35  1 Y 1 A VAL 35  ? A VAL 35  
36  1 Y 1 A ASP 36  ? A ASP 36  
37  1 Y 1 A VAL 37  ? A VAL 37  
38  1 Y 1 A ASP 38  ? A ASP 38  
39  1 Y 1 A LYS 39  ? A LYS 39  
40  1 Y 1 A ALA 40  ? A ALA 40  
41  1 Y 1 A VAL 41  ? A VAL 41  
42  1 Y 1 A ALA 42  ? A ALA 42  
43  1 Y 1 A GLU 43  ? A GLU 43  
44  1 Y 1 A LEU 44  ? A LEU 44  
45  1 Y 1 A LYS 45  ? A LYS 45  
46  1 Y 1 A ALA 46  ? A ALA 46  
47  1 Y 1 A ARG 47  ? A ARG 47  
48  1 Y 1 A LYS 48  ? A LYS 48  
49  1 Y 1 A ARG 49  ? A ARG 49  
50  1 Y 1 A VAL 50  ? A VAL 50  
51  1 Y 1 A LEU 51  ? A LEU 51  
52  1 Y 1 A GLU 52  ? A GLU 52  
53  1 Y 1 A ALA 53  ? A ALA 53  
54  1 Y 1 A LYS 54  ? A LYS 54  
55  1 Y 1 A GLU 55  ? A GLU 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A ALA 57  ? A ALA 57  
58  1 Y 1 A LEU 58  ? A LEU 58  
59  1 Y 1 A GLN 59  ? A GLN 59  
60  1 Y 1 A PRO 60  ? A PRO 60  
61  1 Y 1 A LYS 61  ? A LYS 61  
62  1 Y 1 A ASP 62  ? A ASP 62  
63  1 Y 1 A ASP 63  ? A ASP 63  
64  1 Y 1 A ALA 384 ? A ALA 384 
65  1 Y 1 A HIS 385 ? A HIS 385 
66  1 Y 1 A LEU 432 ? A LEU 432 
67  1 Y 1 A LYS 433 ? A LYS 433 
68  1 Y 1 A GLU 434 ? A GLU 434 
69  1 Y 1 A PRO 435 ? A PRO 435 
70  1 Y 1 A LYS 436 ? A LYS 436 
71  1 Y 1 A THR 437 ? A THR 437 
72  1 Y 1 A VAL 438 ? A VAL 438 
73  1 Y 1 A ASN 439 ? A ASN 439 
74  1 Y 1 A VAL 440 ? A VAL 440 
75  1 Y 1 A VAL 441 ? A VAL 441 
76  1 Y 1 A GLN 442 ? A GLN 442 
77  1 Y 1 A PHE 443 ? A PHE 443 
78  1 Y 1 A GLU 444 ? A GLU 444 
79  1 Y 1 A PRO 445 ? A PRO 445 
80  1 Y 1 A SER 446 ? A SER 446 
81  1 Y 1 A LYS 447 ? A LYS 447 
82  1 Y 1 A GLY 448 ? A GLY 448 
83  1 Y 1 A ALA 449 ? A ALA 449 
84  1 Y 1 A ILE 450 ? A ILE 450 
85  1 Y 1 A GLY 451 ? A GLY 451 
86  1 Y 1 A LYS 452 ? A LYS 452 
87  1 Y 1 A ALA 453 ? A ALA 453 
88  1 Y 1 A TYR 454 ? A TYR 454 
89  1 Y 1 A LYS 455 ? A LYS 455 
90  1 Y 1 A LYS 456 ? A LYS 456 
91  1 Y 1 A ASP 457 ? A ASP 457 
92  1 Y 1 A ALA 458 ? A ALA 458 
93  1 Y 1 A LYS 459 ? A LYS 459 
94  1 Y 1 A LEU 460 ? A LEU 460 
95  1 Y 1 A VAL 461 ? A VAL 461 
96  1 Y 1 A MET 462 ? A MET 462 
97  1 Y 1 A GLU 463 ? A GLU 463 
98  1 Y 1 A TYR 464 ? A TYR 464 
99  1 Y 1 A LEU 465 ? A LEU 465 
100 1 Y 1 A ALA 466 ? A ALA 466 
101 1 Y 1 A ILE 467 ? A ILE 467 
102 1 Y 1 A CYS 468 ? A CYS 468 
103 1 Y 1 A ASP 469 ? A ASP 469 
104 1 Y 1 A GLU 470 ? A GLU 470 
105 1 Y 1 A CYS 471 ? A CYS 471 
106 1 Y 1 A TYR 472 ? A TYR 472 
107 1 Y 1 A ILE 473 ? A ILE 473 
108 1 Y 1 A THR 474 ? A THR 474 
109 1 Y 1 A GLU 475 ? A GLU 475 
110 1 Y 1 A MET 476 ? A MET 476 
111 1 Y 1 A GLU 477 ? A GLU 477 
112 1 Y 1 A MET 478 ? A MET 478 
113 1 Y 1 A LEU 479 ? A LEU 479 
114 1 Y 1 A LEU 480 ? A LEU 480 
115 1 Y 1 A ASN 481 ? A ASN 481 
116 1 Y 1 A GLU 482 ? A GLU 482 
117 1 Y 1 A LYS 483 ? A LYS 483 
118 1 Y 1 A GLY 484 ? A GLY 484 
119 1 Y 1 A GLU 485 ? A GLU 485 
120 1 Y 1 A PHE 486 ? A PHE 486 
121 1 Y 1 A THR 487 ? A THR 487 
122 1 Y 1 A ILE 488 ? A ILE 488 
123 1 Y 1 A GLU 489 ? A GLU 489 
124 1 Y 1 A THR 490 ? A THR 490 
125 1 Y 1 A GLU 491 ? A GLU 491 
126 1 Y 1 A GLY 492 ? A GLY 492 
127 1 Y 1 A LYS 493 ? A LYS 493 
128 1 Y 1 A THR 494 ? A THR 494 
129 1 Y 1 A PHE 495 ? A PHE 495 
130 1 Y 1 A GLN 496 ? A GLN 496 
131 1 Y 1 A LEU 497 ? A LEU 497 
132 1 Y 1 A THR 498 ? A THR 498 
133 1 Y 1 A LYS 499 ? A LYS 499 
134 1 Y 1 A ASP 500 ? A ASP 500 
135 1 Y 1 A MET 501 ? A MET 501 
136 1 Y 1 A ILE 502 ? A ILE 502 
137 1 Y 1 A ASN 503 ? A ASN 503 
138 1 Y 1 A VAL 504 ? A VAL 504 
139 1 Y 1 A LYS 505 ? A LYS 505 
140 1 Y 1 A ARG 506 ? A ARG 506 
141 1 Y 1 A PHE 507 ? A PHE 507 
142 1 Y 1 A GLN 508 ? A GLN 508 
143 1 Y 1 A LYS 509 ? A LYS 509 
144 1 Y 1 A THR 510 ? A THR 510 
145 1 Y 1 A LEU 511 ? A LEU 511 
146 1 Y 1 A GLY 674 ? A GLY 674 
147 1 Y 1 A GLN 675 ? A GLN 675 
148 1 Y 1 A GLU 676 ? A GLU 676 
149 1 Y 1 A THR 677 ? A THR 677 
150 1 Y 1 A GLY 678 ? A GLY 678 
151 1 Y 1 A LYS 679 ? A LYS 679 
152 1 Y 1 A LYS 680 ? A LYS 680 
153 1 Y 1 A GLU 681 ? A GLU 681 
154 1 Y 1 A THR 682 ? A THR 682 
155 1 Y 1 A ILE 683 ? A ILE 683 
156 1 Y 1 A GLU 684 ? A GLU 684 
157 1 Y 1 A GLU 685 ? A GLU 685 
158 1 Y 1 A HIS 686 ? A HIS 686 
159 1 Y 1 A HIS 687 ? A HIS 687 
160 1 Y 1 A HIS 688 ? A HIS 688 
161 1 Y 1 A HIS 689 ? A HIS 689 
162 1 Y 1 A HIS 690 ? A HIS 690 
163 1 Y 1 A HIS 691 ? A HIS 691 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#