data_2Q7M
# 
_entry.id   2Q7M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Q7M         
RCSB  RCSB043250   
WWPDB D_1000043250 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2Q7R 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Q7M 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Ferguson, A.D.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            317 
_citation.page_first                510 
_citation.page_last                 512 
_citation.year                      2007 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17600184 
_citation.pdbx_database_id_DOI      10.1126/science.1144346 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ferguson, A.D.'   1  
primary 'McKeever, B.M.'   2  
primary 'Xu, S.'           3  
primary 'Wisniewski, D.'   4  
primary 'Miller, D.K.'     5  
primary 'Yamin, T.T.'      6  
primary 'Spencer, R.H.'    7  
primary 'Chu, L.'          8  
primary 'Ujjainwalla, F.'  9  
primary 'Cunningham, B.R.' 10 
primary 'Evans, J.F.'      11 
primary 'Becker, J.W.'     12 
# 
_cell.entry_id           2Q7M 
_cell.length_a           180.600 
_cell.length_b           180.600 
_cell.length_c           140.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2Q7M 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arachidonate 5-lipoxygenase-activating protein'                                                              
18111.910 6 ? K148A ? ? 
2 non-polymer syn '3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID' 
587.171   6 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'FLAP, MK-886-binding protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ
VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIATISTTISPLLLI
P
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ
VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIATISTTISPLLLI
P
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLN n 
1 4   GLU n 
1 5   THR n 
1 6   VAL n 
1 7   GLY n 
1 8   ASN n 
1 9   VAL n 
1 10  VAL n 
1 11  LEU n 
1 12  LEU n 
1 13  ALA n 
1 14  ILE n 
1 15  VAL n 
1 16  THR n 
1 17  LEU n 
1 18  ILE n 
1 19  SER n 
1 20  VAL n 
1 21  VAL n 
1 22  GLN n 
1 23  ASN n 
1 24  GLY n 
1 25  PHE n 
1 26  PHE n 
1 27  ALA n 
1 28  HIS n 
1 29  LYS n 
1 30  VAL n 
1 31  GLU n 
1 32  HIS n 
1 33  GLU n 
1 34  SER n 
1 35  ARG n 
1 36  THR n 
1 37  GLN n 
1 38  ASN n 
1 39  GLY n 
1 40  ARG n 
1 41  SER n 
1 42  PHE n 
1 43  GLN n 
1 44  ARG n 
1 45  THR n 
1 46  GLY n 
1 47  THR n 
1 48  LEU n 
1 49  ALA n 
1 50  PHE n 
1 51  GLU n 
1 52  ARG n 
1 53  VAL n 
1 54  TYR n 
1 55  THR n 
1 56  ALA n 
1 57  ASN n 
1 58  GLN n 
1 59  ASN n 
1 60  CYS n 
1 61  VAL n 
1 62  ASP n 
1 63  ALA n 
1 64  TYR n 
1 65  PRO n 
1 66  THR n 
1 67  PHE n 
1 68  LEU n 
1 69  ALA n 
1 70  VAL n 
1 71  LEU n 
1 72  TRP n 
1 73  SER n 
1 74  ALA n 
1 75  GLY n 
1 76  LEU n 
1 77  LEU n 
1 78  CYS n 
1 79  SER n 
1 80  GLN n 
1 81  VAL n 
1 82  PRO n 
1 83  ALA n 
1 84  ALA n 
1 85  PHE n 
1 86  ALA n 
1 87  GLY n 
1 88  LEU n 
1 89  MET n 
1 90  TYR n 
1 91  LEU n 
1 92  PHE n 
1 93  VAL n 
1 94  ARG n 
1 95  GLN n 
1 96  LYS n 
1 97  TYR n 
1 98  PHE n 
1 99  VAL n 
1 100 GLY n 
1 101 TYR n 
1 102 LEU n 
1 103 GLY n 
1 104 GLU n 
1 105 ARG n 
1 106 THR n 
1 107 GLN n 
1 108 SER n 
1 109 THR n 
1 110 PRO n 
1 111 GLY n 
1 112 TYR n 
1 113 ILE n 
1 114 PHE n 
1 115 GLY n 
1 116 LYS n 
1 117 ARG n 
1 118 ILE n 
1 119 ILE n 
1 120 LEU n 
1 121 PHE n 
1 122 LEU n 
1 123 PHE n 
1 124 LEU n 
1 125 MET n 
1 126 SER n 
1 127 VAL n 
1 128 ALA n 
1 129 GLY n 
1 130 ILE n 
1 131 PHE n 
1 132 ASN n 
1 133 TYR n 
1 134 TYR n 
1 135 LEU n 
1 136 ILE n 
1 137 PHE n 
1 138 PHE n 
1 139 PHE n 
1 140 GLY n 
1 141 SER n 
1 142 ASP n 
1 143 PHE n 
1 144 GLU n 
1 145 ASN n 
1 146 TYR n 
1 147 ILE n 
1 148 ALA n 
1 149 THR n 
1 150 ILE n 
1 151 SER n 
1 152 THR n 
1 153 THR n 
1 154 ILE n 
1 155 SER n 
1 156 PRO n 
1 157 LEU n 
1 158 LEU n 
1 159 LEU n 
1 160 ILE n 
1 161 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ALOX5AP, FLAP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AL5AP_HUMAN 
_struct_ref.pdbx_db_accession          P20292 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ
VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLI
P
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Q7M A 1 ? 161 ? P20292 1 ? 161 ? 1 161 
2 1 2Q7M B 1 ? 161 ? P20292 1 ? 161 ? 1 161 
3 1 2Q7M C 1 ? 161 ? P20292 1 ? 161 ? 1 161 
4 1 2Q7M D 1 ? 161 ? P20292 1 ? 161 ? 1 161 
5 1 2Q7M E 1 ? 161 ? P20292 1 ? 161 ? 1 161 
6 1 2Q7M F 1 ? 161 ? P20292 1 ? 161 ? 1 161 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Q7M ALA A 148 ? UNP P20292 LYS 148 ENGINEERED 148 1 
2 2Q7M ALA B 148 ? UNP P20292 LYS 148 ENGINEERED 148 2 
3 2Q7M ALA C 148 ? UNP P20292 LYS 148 ENGINEERED 148 3 
4 2Q7M ALA D 148 ? UNP P20292 LYS 148 ENGINEERED 148 4 
5 2Q7M ALA E 148 ? UNP P20292 LYS 148 ENGINEERED 148 5 
6 2Q7M ALA F 148 ? UNP P20292 LYS 148 ENGINEERED 148 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2CS non-polymer         . 
'3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID' ? 
'C34 H35 Cl N2 O3 S' 587.171 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          2Q7M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.272281 
_exptl_crystal.density_percent_sol   76.670441 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    '10% PEG4000, 0.32 LiCl2, 1mM TCEP , pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2Q7M 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             38.8 
_reflns.d_resolution_high            4.25 
_reflns.number_obs                   16875 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.058 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.7 
_reflns.B_iso_Wilson_estimate        164.450 
_reflns.pdbx_redundancy              9.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             4.25 
_reflns_shell.d_res_low              4.51 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.555 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.57 
_reflns_shell.pdbx_redundancy        9.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2Q7M 
_refine.ls_number_reflns_obs                     16647 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            4.25 
_refine.ls_percent_reflns_obs                    99.30 
_refine.ls_R_factor_obs                          0.2440 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2419 
_refine.ls_R_factor_R_free                       0.2835 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  843 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               191.78 
_refine.aniso_B[1][1]                            -4.59548494 
_refine.aniso_B[2][2]                            -4.59548494 
_refine.aniso_B[3][3]                            9.19096988 
_refine.aniso_B[1][2]                            0.00000000 
_refine.aniso_B[1][3]                            0.00000000 
_refine.aniso_B[2][3]                            0.00000000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6987 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         246 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7233 
_refine_hist.d_res_high                       4.25 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.006  ? 2.00  7439  'X-RAY DIFFRACTION' ? 
t_angle_deg        0.908  ? 2.00  10104 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 32.557 ? 0.00  1350  'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?      ? ?     ?     'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?      ? ?     ?     'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.006  ? 2.00  210   'X-RAY DIFFRACTION' ? 
t_gen_planes       0.009  ? 5.00  1090  'X-RAY DIFFRACTION' ? 
t_it               5.264  ? 20.00 7439  'X-RAY DIFFRACTION' ? 
t_nbd              0.045  ? 5.00  739   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       4.25 
_refine_ls_shell.d_res_low                        4.51 
_refine_ls_shell.number_reflns_R_work             2517 
_refine_ls_shell.R_factor_R_work                  0.2833 
_refine_ls_shell.percent_reflns_obs               99.30 
_refine_ls_shell.R_factor_R_free                  0.3639 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.84 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                2645 
_refine_ls_shell.R_factor_all                     0.2875 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2Q7M 
_struct.title                     'Crystal structure of human FLAP with MK-591' 
_struct.pdbx_descriptor           'Arachidonate 5-lipoxygenase-activating protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Q7M 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN, LIPID TRANSPORT' 
_struct_keywords.text            'MAPEG, membrane protein, FLAP, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 'The biological unit is a trimer' 
2 ?                                 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 2   ? ASN A 8   ? ASP A 2   ASN A 8   1 ? 7  
HELX_P HELX_P2  2  VAL A 9   ? GLN A 37  ? VAL A 9   GLN A 37  1 ? 29 
HELX_P HELX_P3  3  THR A 47  ? LEU A 77  ? THR A 47  LEU A 77  1 ? 31 
HELX_P HELX_P4  4  SER A 79  ? GLY A 100 ? SER A 79  GLY A 100 1 ? 22 
HELX_P HELX_P5  5  GLY A 115 ? PHE A 139 ? GLY A 115 PHE A 139 1 ? 25 
HELX_P HELX_P6  6  ASP B 2   ? THR B 36  ? ASP B 2   THR B 36  1 ? 35 
HELX_P HELX_P7  7  THR B 47  ? LEU B 77  ? THR B 47  LEU B 77  1 ? 31 
HELX_P HELX_P8  8  SER B 79  ? GLY B 100 ? SER B 79  GLY B 100 1 ? 22 
HELX_P HELX_P9  9  LYS B 116 ? PHE B 143 ? LYS B 116 PHE B 143 1 ? 28 
HELX_P HELX_P10 10 ASP C 2   ? ASN C 8   ? ASP C 2   ASN C 8   1 ? 7  
HELX_P HELX_P11 11 VAL C 9   ? GLN C 37  ? VAL C 9   GLN C 37  1 ? 29 
HELX_P HELX_P12 12 THR C 47  ? LEU C 77  ? THR C 47  LEU C 77  1 ? 31 
HELX_P HELX_P13 13 GLN C 80  ? GLY C 100 ? GLN C 80  GLY C 100 1 ? 21 
HELX_P HELX_P14 14 GLY C 115 ? PHE C 139 ? GLY C 115 PHE C 139 1 ? 25 
HELX_P HELX_P15 15 ASP D 2   ? ASN D 8   ? ASP D 2   ASN D 8   1 ? 7  
HELX_P HELX_P16 16 VAL D 9   ? THR D 36  ? VAL D 9   THR D 36  1 ? 28 
HELX_P HELX_P17 17 THR D 47  ? LEU D 77  ? THR D 47  LEU D 77  1 ? 31 
HELX_P HELX_P18 18 GLN D 80  ? TYR D 101 ? GLN D 80  TYR D 101 1 ? 22 
HELX_P HELX_P19 19 GLY D 115 ? PHE D 139 ? GLY D 115 PHE D 139 1 ? 25 
HELX_P HELX_P20 20 GLY D 140 ? PHE D 143 ? GLY D 140 PHE D 143 5 ? 4  
HELX_P HELX_P21 21 ASP E 2   ? ASN E 8   ? ASP E 2   ASN E 8   1 ? 7  
HELX_P HELX_P22 22 VAL E 9   ? THR E 36  ? VAL E 9   THR E 36  1 ? 28 
HELX_P HELX_P23 23 THR E 47  ? LEU E 77  ? THR E 47  LEU E 77  1 ? 31 
HELX_P HELX_P24 24 GLN E 80  ? GLY E 103 ? GLN E 80  GLY E 103 1 ? 24 
HELX_P HELX_P25 25 GLY E 115 ? PHE E 139 ? GLY E 115 PHE E 139 1 ? 25 
HELX_P HELX_P26 26 ASP F 2   ? GLN F 37  ? ASP F 2   GLN F 37  1 ? 36 
HELX_P HELX_P27 27 THR F 47  ? LEU F 77  ? THR F 47  LEU F 77  1 ? 31 
HELX_P HELX_P28 28 GLN F 80  ? GLY F 100 ? GLN F 80  GLY F 100 1 ? 21 
HELX_P HELX_P29 29 ARG F 117 ? PHE F 139 ? ARG F 117 PHE F 139 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 2CS C 501' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 2CS A 502' 
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 2CS A 503' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 2CS D 504' 
AC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 2CS E 505' 
AC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 2CS E 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 ASP B 62  ? ASP B 62  . ? 1_555 ? 
2  AC1 11 ALA B 63  ? ALA B 63  . ? 1_555 ? 
3  AC1 11 LYS B 116 ? LYS B 116 . ? 1_555 ? 
4  AC1 11 ILE B 119 ? ILE B 119 . ? 1_555 ? 
5  AC1 11 LEU B 120 ? LEU B 120 . ? 1_555 ? 
6  AC1 11 PHE B 123 ? PHE B 123 . ? 1_555 ? 
7  AC1 11 VAL C 21  ? VAL C 21  . ? 1_555 ? 
8  AC1 11 ASN C 23  ? ASN C 23  . ? 1_555 ? 
9  AC1 11 GLY C 24  ? GLY C 24  . ? 1_555 ? 
10 AC1 11 PHE C 25  ? PHE C 25  . ? 1_555 ? 
11 AC1 11 ALA C 27  ? ALA C 27  . ? 1_555 ? 
12 AC2 11 VAL A 21  ? VAL A 21  . ? 1_555 ? 
13 AC2 11 ASN A 23  ? ASN A 23  . ? 1_555 ? 
14 AC2 11 GLY A 24  ? GLY A 24  . ? 1_555 ? 
15 AC2 11 PHE A 25  ? PHE A 25  . ? 1_555 ? 
16 AC2 11 ALA A 27  ? ALA A 27  . ? 1_555 ? 
17 AC2 11 HIS A 28  ? HIS A 28  . ? 1_555 ? 
18 AC2 11 ASP C 62  ? ASP C 62  . ? 1_555 ? 
19 AC2 11 ALA C 63  ? ALA C 63  . ? 1_555 ? 
20 AC2 11 ILE C 113 ? ILE C 113 . ? 1_555 ? 
21 AC2 11 ILE C 119 ? ILE C 119 . ? 1_555 ? 
22 AC2 11 LEU C 120 ? LEU C 120 . ? 1_555 ? 
23 AC3 14 ASP A 62  ? ASP A 62  . ? 1_555 ? 
24 AC3 14 ALA A 63  ? ALA A 63  . ? 1_555 ? 
25 AC3 14 TYR A 112 ? TYR A 112 . ? 1_555 ? 
26 AC3 14 ILE A 113 ? ILE A 113 . ? 1_555 ? 
27 AC3 14 LYS A 116 ? LYS A 116 . ? 1_555 ? 
28 AC3 14 ILE A 119 ? ILE A 119 . ? 1_555 ? 
29 AC3 14 LEU A 120 ? LEU A 120 . ? 1_555 ? 
30 AC3 14 PHE A 123 ? PHE A 123 . ? 1_555 ? 
31 AC3 14 VAL B 21  ? VAL B 21  . ? 1_555 ? 
32 AC3 14 ASN B 23  ? ASN B 23  . ? 1_555 ? 
33 AC3 14 GLY B 24  ? GLY B 24  . ? 1_555 ? 
34 AC3 14 PHE B 25  ? PHE B 25  . ? 1_555 ? 
35 AC3 14 ALA B 27  ? ALA B 27  . ? 1_555 ? 
36 AC3 14 HIS B 28  ? HIS B 28  . ? 1_555 ? 
37 AC4 11 VAL D 21  ? VAL D 21  . ? 1_555 ? 
38 AC4 11 ASN D 23  ? ASN D 23  . ? 1_555 ? 
39 AC4 11 GLY D 24  ? GLY D 24  . ? 1_555 ? 
40 AC4 11 PHE D 25  ? PHE D 25  . ? 1_555 ? 
41 AC4 11 ALA D 27  ? ALA D 27  . ? 1_555 ? 
42 AC4 11 ASN D 57  ? ASN D 57  . ? 1_555 ? 
43 AC4 11 ASP F 62  ? ASP F 62  . ? 1_555 ? 
44 AC4 11 ALA F 63  ? ALA F 63  . ? 1_555 ? 
45 AC4 11 LYS F 116 ? LYS F 116 . ? 1_555 ? 
46 AC4 11 ILE F 119 ? ILE F 119 . ? 1_555 ? 
47 AC4 11 LEU F 120 ? LEU F 120 . ? 1_555 ? 
48 AC5 13 ASP D 62  ? ASP D 62  . ? 1_555 ? 
49 AC5 13 ALA D 63  ? ALA D 63  . ? 1_555 ? 
50 AC5 13 LYS D 116 ? LYS D 116 . ? 1_555 ? 
51 AC5 13 ILE D 119 ? ILE D 119 . ? 1_555 ? 
52 AC5 13 LEU D 120 ? LEU D 120 . ? 1_555 ? 
53 AC5 13 PHE D 123 ? PHE D 123 . ? 1_555 ? 
54 AC5 13 VAL E 21  ? VAL E 21  . ? 1_555 ? 
55 AC5 13 ASN E 23  ? ASN E 23  . ? 1_555 ? 
56 AC5 13 GLY E 24  ? GLY E 24  . ? 1_555 ? 
57 AC5 13 PHE E 25  ? PHE E 25  . ? 1_555 ? 
58 AC5 13 ALA E 27  ? ALA E 27  . ? 1_555 ? 
59 AC5 13 HIS E 28  ? HIS E 28  . ? 1_555 ? 
60 AC5 13 VAL E 61  ? VAL E 61  . ? 1_555 ? 
61 AC6 12 ASP E 62  ? ASP E 62  . ? 1_555 ? 
62 AC6 12 ALA E 63  ? ALA E 63  . ? 1_555 ? 
63 AC6 12 ILE E 113 ? ILE E 113 . ? 1_555 ? 
64 AC6 12 LYS E 116 ? LYS E 116 . ? 1_555 ? 
65 AC6 12 ILE E 119 ? ILE E 119 . ? 1_555 ? 
66 AC6 12 LEU E 120 ? LEU E 120 . ? 1_555 ? 
67 AC6 12 PHE E 123 ? PHE E 123 . ? 1_555 ? 
68 AC6 12 VAL F 21  ? VAL F 21  . ? 1_555 ? 
69 AC6 12 ASN F 23  ? ASN F 23  . ? 1_555 ? 
70 AC6 12 GLY F 24  ? GLY F 24  . ? 1_555 ? 
71 AC6 12 PHE F 25  ? PHE F 25  . ? 1_555 ? 
72 AC6 12 ALA F 27  ? ALA F 27  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Q7M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Q7M 
_atom_sites.fract_transf_matrix[1][1]   0.005537 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007114 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . MET A 1 1   ? 49.551 61.439 9.892   1.00 191.54 ? 1   MET A N    1 
ATOM   2    C  CA   . MET A 1 1   ? 49.143 62.701 10.499  1.00 191.54 ? 1   MET A CA   1 
ATOM   3    C  C    . MET A 1 1   ? 48.313 63.583 9.557   1.00 191.54 ? 1   MET A C    1 
ATOM   4    O  O    . MET A 1 1   ? 48.636 63.724 8.373   1.00 300.00 ? 1   MET A O    1 
ATOM   5    C  CB   . MET A 1 1   ? 50.353 63.461 11.043  1.00 191.54 ? 1   MET A CB   1 
ATOM   6    C  CG   . MET A 1 1   ? 50.316 63.681 12.551  1.00 191.54 ? 1   MET A CG   1 
ATOM   7    S  SD   . MET A 1 1   ? 49.984 65.400 13.029  1.00 191.54 ? 1   MET A SD   1 
ATOM   8    C  CE   . MET A 1 1   ? 51.647 65.995 13.423  1.00 191.54 ? 1   MET A CE   1 
ATOM   9    N  N    . ASP A 1 2   ? 47.238 64.169 10.094  1.00 195.64 ? 2   ASP A N    1 
ATOM   10   C  CA   . ASP A 1 2   ? 46.312 65.015 9.324   1.00 196.43 ? 2   ASP A CA   1 
ATOM   11   C  C    . ASP A 1 2   ? 46.988 66.157 8.571   1.00 192.47 ? 2   ASP A C    1 
ATOM   12   O  O    . ASP A 1 2   ? 47.430 67.132 9.173   1.00 190.16 ? 2   ASP A O    1 
ATOM   13   C  CB   . ASP A 1 2   ? 45.165 65.545 10.198  1.00 201.84 ? 2   ASP A CB   1 
ATOM   14   C  CG   . ASP A 1 2   ? 45.280 65.111 11.660  1.00 236.49 ? 2   ASP A CG   1 
ATOM   15   O  OD1  . ASP A 1 2   ? 45.760 63.987 11.933  1.00 240.52 ? 2   ASP A OD1  1 
ATOM   16   O  OD2  . ASP A 1 2   ? 44.854 65.891 12.540  1.00 245.88 ? 2   ASP A OD2  1 
ATOM   17   N  N    . GLN A 1 3   ? 47.056 66.025 7.251   1.00 192.48 ? 3   GLN A N    1 
ATOM   18   C  CA   . GLN A 1 3   ? 47.715 67.009 6.409   1.00 192.02 ? 3   GLN A CA   1 
ATOM   19   C  C    . GLN A 1 3   ? 47.447 68.466 6.770   1.00 192.26 ? 3   GLN A C    1 
ATOM   20   O  O    . GLN A 1 3   ? 48.329 69.309 6.633   1.00 190.78 ? 3   GLN A O    1 
ATOM   21   C  CB   . GLN A 1 3   ? 47.458 66.740 4.931   1.00 193.75 ? 3   GLN A CB   1 
ATOM   22   C  CG   . GLN A 1 3   ? 47.866 67.888 4.023   1.00 206.75 ? 3   GLN A CG   1 
ATOM   23   C  CD   . GLN A 1 3   ? 49.196 67.652 3.339   1.00 222.90 ? 3   GLN A CD   1 
ATOM   24   O  OE1  . GLN A 1 3   ? 49.873 66.657 3.601   1.00 217.93 ? 3   GLN A OE1  1 
ATOM   25   N  NE2  . GLN A 1 3   ? 49.578 68.569 2.456   1.00 214.59 ? 3   GLN A NE2  1 
ATOM   26   N  N    . GLU A 1 4   ? 46.250 68.773 7.256   1.00 189.98 ? 4   GLU A N    1 
ATOM   27   C  CA   . GLU A 1 4   ? 45.961 70.152 7.648   1.00 190.44 ? 4   GLU A CA   1 
ATOM   28   C  C    . GLU A 1 4   ? 46.910 70.544 8.778   1.00 180.86 ? 4   GLU A C    1 
ATOM   29   O  O    . GLU A 1 4   ? 47.701 71.484 8.658   1.00 177.19 ? 4   GLU A O    1 
ATOM   30   C  CB   . GLU A 1 4   ? 44.509 70.297 8.120   1.00 194.28 ? 4   GLU A CB   1 
ATOM   31   C  CG   . GLU A 1 4   ? 44.290 71.400 9.163   1.00 218.54 ? 4   GLU A CG   1 
ATOM   32   C  CD   . GLU A 1 4   ? 43.798 70.866 10.505  1.00 267.10 ? 4   GLU A CD   1 
ATOM   33   O  OE1  . GLU A 1 4   ? 43.420 69.675 10.573  1.00 268.99 ? 4   GLU A OE1  1 
ATOM   34   O  OE2  . GLU A 1 4   ? 43.788 71.640 11.491  1.00 268.74 ? 4   GLU A OE2  1 
ATOM   35   N  N    . THR A 1 5   ? 46.825 69.779 9.862   1.00 177.14 ? 5   THR A N    1 
ATOM   36   C  CA   . THR A 1 5   ? 47.614 69.974 11.071  1.00 176.31 ? 5   THR A CA   1 
ATOM   37   C  C    . THR A 1 5   ? 49.098 70.046 10.796  1.00 177.01 ? 5   THR A C    1 
ATOM   38   O  O    . THR A 1 5   ? 49.761 70.975 11.239  1.00 176.17 ? 5   THR A O    1 
ATOM   39   C  CB   . THR A 1 5   ? 47.322 68.861 12.081  1.00 186.53 ? 5   THR A CB   1 
ATOM   40   O  OG1  . THR A 1 5   ? 47.418 67.591 11.420  1.00 186.57 ? 5   THR A OG1  1 
ATOM   41   C  CG2  . THR A 1 5   ? 45.916 69.028 12.667  1.00 185.60 ? 5   THR A CG2  1 
ATOM   42   N  N    . VAL A 1 6   ? 49.624 69.034 10.114  1.00 174.98 ? 6   VAL A N    1 
ATOM   43   C  CA   . VAL A 1 6   ? 51.043 68.999 9.792   1.00 175.11 ? 6   VAL A CA   1 
ATOM   44   C  C    . VAL A 1 6   ? 51.437 70.328 9.188   1.00 175.96 ? 6   VAL A C    1 
ATOM   45   O  O    . VAL A 1 6   ? 52.555 70.804 9.378   1.00 173.28 ? 6   VAL A O    1 
ATOM   46   C  CB   . VAL A 1 6   ? 51.392 67.866 8.833   1.00 181.95 ? 6   VAL A CB   1 
ATOM   47   C  CG1  . VAL A 1 6   ? 52.392 68.357 7.796   1.00 182.28 ? 6   VAL A CG1  1 
ATOM   48   C  CG2  . VAL A 1 6   ? 51.966 66.697 9.603   1.00 182.30 ? 6   VAL A CG2  1 
ATOM   49   N  N    . GLY A 1 7   ? 50.487 70.940 8.492   1.00 173.10 ? 7   GLY A N    1 
ATOM   50   C  CA   . GLY A 1 7   ? 50.688 72.230 7.864   1.00 173.90 ? 7   GLY A CA   1 
ATOM   51   C  C    . GLY A 1 7   ? 51.020 73.305 8.878   1.00 176.83 ? 7   GLY A C    1 
ATOM   52   O  O    . GLY A 1 7   ? 51.986 74.050 8.704   1.00 176.27 ? 7   GLY A O    1 
ATOM   53   N  N    . ASN A 1 8   ? 50.227 73.370 9.947   1.00 172.34 ? 8   ASN A N    1 
ATOM   54   C  CA   . ASN A 1 8   ? 50.403 74.371 11.008  1.00 171.07 ? 8   ASN A CA   1 
ATOM   55   C  C    . ASN A 1 8   ? 51.464 74.029 12.087  1.00 169.61 ? 8   ASN A C    1 
ATOM   56   O  O    . ASN A 1 8   ? 51.330 74.417 13.257  1.00 168.33 ? 8   ASN A O    1 
ATOM   57   C  CB   . ASN A 1 8   ? 49.043 74.727 11.650  1.00 175.67 ? 8   ASN A CB   1 
ATOM   58   C  CG   . ASN A 1 8   ? 48.035 73.567 11.615  1.00 214.52 ? 8   ASN A CG   1 
ATOM   59   O  OD1  . ASN A 1 8   ? 47.166 73.459 12.488  1.00 211.16 ? 8   ASN A OD1  1 
ATOM   60   N  ND2  . ASN A 1 8   ? 48.134 72.717 10.595  1.00 208.71 ? 8   ASN A ND2  1 
ATOM   61   N  N    . VAL A 1 9   ? 52.530 73.338 11.686  1.00 162.01 ? 9   VAL A N    1 
ATOM   62   C  CA   . VAL A 1 9   ? 53.579 72.954 12.619  1.00 159.45 ? 9   VAL A CA   1 
ATOM   63   C  C    . VAL A 1 9   ? 54.850 72.674 11.851  1.00 169.32 ? 9   VAL A C    1 
ATOM   64   O  O    . VAL A 1 9   ? 55.941 72.663 12.415  1.00 170.32 ? 9   VAL A O    1 
ATOM   65   C  CB   . VAL A 1 9   ? 53.168 71.737 13.445  1.00 156.89 ? 9   VAL A CB   1 
ATOM   66   C  CG1  . VAL A 1 9   ? 52.174 70.897 12.686  1.00 155.63 ? 9   VAL A CG1  1 
ATOM   67   C  CG2  . VAL A 1 9   ? 54.367 70.906 13.782  1.00 155.63 ? 9   VAL A CG2  1 
ATOM   68   N  N    . VAL A 1 10  ? 54.703 72.472 10.550  1.00 162.19 ? 10  VAL A N    1 
ATOM   69   C  CA   . VAL A 1 10  ? 55.842 72.180 9.696   1.00 163.15 ? 10  VAL A CA   1 
ATOM   70   C  C    . VAL A 1 10  ? 57.017 73.116 9.926   1.00 161.33 ? 10  VAL A C    1 
ATOM   71   O  O    . VAL A 1 10  ? 58.167 72.748 9.701   1.00 159.82 ? 10  VAL A O    1 
ATOM   72   C  CB   . VAL A 1 10  ? 55.457 72.163 8.227   1.00 171.87 ? 10  VAL A CB   1 
ATOM   73   C  CG1  . VAL A 1 10  ? 56.669 72.522 7.368   1.00 172.48 ? 10  VAL A CG1  1 
ATOM   74   C  CG2  . VAL A 1 10  ? 54.890 70.799 7.849   1.00 172.49 ? 10  VAL A CG2  1 
ATOM   75   N  N    . LEU A 1 11  ? 56.724 74.321 10.396  1.00 157.94 ? 11  LEU A N    1 
ATOM   76   C  CA   . LEU A 1 11  ? 57.755 75.322 10.653  1.00 156.83 ? 11  LEU A CA   1 
ATOM   77   C  C    . LEU A 1 11  ? 58.546 74.972 11.901  1.00 156.15 ? 11  LEU A C    1 
ATOM   78   O  O    . LEU A 1 11  ? 59.777 74.990 11.901  1.00 154.73 ? 11  LEU A O    1 
ATOM   79   C  CB   . LEU A 1 11  ? 57.111 76.689 10.869  1.00 157.15 ? 11  LEU A CB   1 
ATOM   80   C  CG   . LEU A 1 11  ? 56.141 77.265 9.835   1.00 162.03 ? 11  LEU A CG   1 
ATOM   81   C  CD1  . LEU A 1 11  ? 55.416 76.213 9.012   1.00 162.23 ? 11  LEU A CD1  1 
ATOM   82   C  CD2  . LEU A 1 11  ? 55.155 78.209 10.505  1.00 164.52 ? 11  LEU A CD2  1 
ATOM   83   N  N    . LEU A 1 12  ? 57.817 74.706 12.979  1.00 152.08 ? 12  LEU A N    1 
ATOM   84   C  CA   . LEU A 1 12  ? 58.422 74.357 14.249  1.00 151.72 ? 12  LEU A CA   1 
ATOM   85   C  C    . LEU A 1 12  ? 59.147 73.028 14.103  1.00 156.13 ? 12  LEU A C    1 
ATOM   86   O  O    . LEU A 1 12  ? 60.169 72.794 14.743  1.00 155.74 ? 12  LEU A O    1 
ATOM   87   C  CB   . LEU A 1 12  ? 57.355 74.294 15.338  1.00 151.60 ? 12  LEU A CB   1 
ATOM   88   C  CG   . LEU A 1 12  ? 56.214 75.292 15.133  1.00 156.11 ? 12  LEU A CG   1 
ATOM   89   C  CD1  . LEU A 1 12  ? 54.922 74.809 15.781  1.00 156.23 ? 12  LEU A CD1  1 
ATOM   90   C  CD2  . LEU A 1 12  ? 56.595 76.671 15.639  1.00 158.53 ? 12  LEU A CD2  1 
ATOM   91   N  N    . ALA A 1 13  ? 58.632 72.175 13.226  1.00 151.20 ? 13  ALA A N    1 
ATOM   92   C  CA   . ALA A 1 13  ? 59.262 70.898 12.956  1.00 151.10 ? 13  ALA A CA   1 
ATOM   93   C  C    . ALA A 1 13  ? 60.579 71.204 12.258  1.00 148.75 ? 13  ALA A C    1 
ATOM   94   O  O    . ALA A 1 13  ? 61.644 70.746 12.674  1.00 146.78 ? 13  ALA A O    1 
ATOM   95   C  CB   . ALA A 1 13  ? 58.368 70.064 12.056  1.00 152.58 ? 13  ALA A CB   1 
ATOM   96   N  N    . ILE A 1 14  ? 60.494 72.024 11.216  1.00 144.37 ? 14  ILE A N    1 
ATOM   97   C  CA   . ILE A 1 14  ? 61.656 72.424 10.439  1.00 143.63 ? 14  ILE A CA   1 
ATOM   98   C  C    . ILE A 1 14  ? 62.752 73.009 11.328  1.00 146.57 ? 14  ILE A C    1 
ATOM   99   O  O    . ILE A 1 14  ? 63.851 72.455 11.424  1.00 145.57 ? 14  ILE A O    1 
ATOM   100  C  CB   . ILE A 1 14  ? 61.240 73.393 9.338   1.00 146.42 ? 14  ILE A CB   1 
ATOM   101  C  CG1  . ILE A 1 14  ? 61.122 72.662 7.997   1.00 146.69 ? 14  ILE A CG1  1 
ATOM   102  C  CG2  . ILE A 1 14  ? 62.200 74.550 9.270   1.00 147.03 ? 14  ILE A CG2  1 
ATOM   103  C  CD1  . ILE A 1 14  ? 59.721 72.668 7.406   1.00 153.88 ? 14  ILE A CD1  1 
ATOM   104  N  N    . VAL A 1 15  ? 62.439 74.123 11.982  1.00 143.39 ? 15  VAL A N    1 
ATOM   105  C  CA   . VAL A 1 15  ? 63.379 74.772 12.879  1.00 142.15 ? 15  VAL A CA   1 
ATOM   106  C  C    . VAL A 1 15  ? 63.930 73.760 13.869  1.00 147.12 ? 15  VAL A C    1 
ATOM   107  O  O    . VAL A 1 15  ? 65.128 73.734 14.144  1.00 147.46 ? 15  VAL A O    1 
ATOM   108  C  CB   . VAL A 1 15  ? 62.726 75.939 13.609  1.00 142.97 ? 15  VAL A CB   1 
ATOM   109  C  CG1  . VAL A 1 15  ? 62.282 75.517 14.994  1.00 142.22 ? 15  VAL A CG1  1 
ATOM   110  C  CG2  . VAL A 1 15  ? 63.686 77.091 13.697  1.00 142.24 ? 15  VAL A CG2  1 
ATOM   111  N  N    . THR A 1 16  ? 63.051 72.907 14.382  1.00 143.68 ? 16  THR A N    1 
ATOM   112  C  CA   . THR A 1 16  ? 63.446 71.884 15.338  1.00 143.65 ? 16  THR A CA   1 
ATOM   113  C  C    . THR A 1 16  ? 64.454 70.903 14.737  1.00 148.69 ? 16  THR A C    1 
ATOM   114  O  O    . THR A 1 16  ? 65.508 70.656 15.319  1.00 147.55 ? 16  THR A O    1 
ATOM   115  C  CB   . THR A 1 16  ? 62.226 71.183 15.933  1.00 157.96 ? 16  THR A CB   1 
ATOM   116  O  OG1  . THR A 1 16  ? 61.667 71.999 16.970  1.00 159.03 ? 16  THR A OG1  1 
ATOM   117  C  CG2  . THR A 1 16  ? 62.621 69.844 16.504  1.00 158.05 ? 16  THR A CG2  1 
ATOM   118  N  N    . LEU A 1 17  ? 64.145 70.375 13.556  1.00 144.90 ? 17  LEU A N    1 
ATOM   119  C  CA   . LEU A 1 17  ? 65.039 69.442 12.873  1.00 146.03 ? 17  LEU A CA   1 
ATOM   120  C  C    . LEU A 1 17  ? 66.366 70.119 12.574  1.00 151.43 ? 17  LEU A C    1 
ATOM   121  O  O    . LEU A 1 17  ? 67.405 69.468 12.458  1.00 151.52 ? 17  LEU A O    1 
ATOM   122  C  CB   . LEU A 1 17  ? 64.414 68.956 11.565  1.00 145.82 ? 17  LEU A CB   1 
ATOM   123  C  CG   . LEU A 1 17  ? 63.673 67.616 11.603  1.00 149.17 ? 17  LEU A CG   1 
ATOM   124  C  CD1  . LEU A 1 17  ? 64.651 66.458 11.589  1.00 148.82 ? 17  LEU A CD1  1 
ATOM   125  C  CD2  . LEU A 1 17  ? 62.747 67.522 12.814  1.00 151.12 ? 17  LEU A CD2  1 
ATOM   126  N  N    . ILE A 1 18  ? 66.318 71.434 12.422  1.00 150.14 ? 18  ILE A N    1 
ATOM   127  C  CA   . ILE A 1 18  ? 67.525 72.186 12.150  1.00 149.96 ? 18  ILE A CA   1 
ATOM   128  C  C    . ILE A 1 18  ? 68.363 72.155 13.410  1.00 152.71 ? 18  ILE A C    1 
ATOM   129  O  O    . ILE A 1 18  ? 69.475 71.644 13.407  1.00 151.28 ? 18  ILE A O    1 
ATOM   130  C  CB   . ILE A 1 18  ? 67.227 73.628 11.714  1.00 153.80 ? 18  ILE A CB   1 
ATOM   131  C  CG1  . ILE A 1 18  ? 67.069 73.709 10.194  1.00 154.61 ? 18  ILE A CG1  1 
ATOM   132  C  CG2  . ILE A 1 18  ? 68.346 74.551 12.161  1.00 154.84 ? 18  ILE A CG2  1 
ATOM   133  C  CD1  . ILE A 1 18  ? 65.635 73.778 9.737   1.00 162.46 ? 18  ILE A CD1  1 
ATOM   134  N  N    . SER A 1 19  ? 67.797 72.669 14.496  1.00 154.06 ? 19  SER A N    1 
ATOM   135  C  CA   . SER A 1 19  ? 68.478 72.692 15.783  1.00 154.65 ? 19  SER A CA   1 
ATOM   136  C  C    . SER A 1 19  ? 68.910 71.289 16.209  1.00 157.78 ? 19  SER A C    1 
ATOM   137  O  O    . SER A 1 19  ? 69.884 71.131 16.949  1.00 157.08 ? 19  SER A O    1 
ATOM   138  C  CB   . SER A 1 19  ? 67.587 73.325 16.849  1.00 159.27 ? 19  SER A CB   1 
ATOM   139  O  OG   . SER A 1 19  ? 66.666 72.379 17.363  1.00 168.95 ? 19  SER A OG   1 
ATOM   140  N  N    . VAL A 1 20  ? 68.182 70.276 15.743  1.00 159.81 ? 20  VAL A N    1 
ATOM   141  C  CA   . VAL A 1 20  ? 68.526 68.887 16.047  1.00 162.77 ? 20  VAL A CA   1 
ATOM   142  C  C    . VAL A 1 20  ? 69.855 68.560 15.395  1.00 157.91 ? 20  VAL A C    1 
ATOM   143  O  O    . VAL A 1 20  ? 70.675 67.841 15.967  1.00 153.46 ? 20  VAL A O    1 
ATOM   144  C  CB   . VAL A 1 20  ? 67.470 67.887 15.533  1.00 177.01 ? 20  VAL A CB   1 
ATOM   145  C  CG1  . VAL A 1 20  ? 67.979 67.188 14.262  1.00 178.57 ? 20  VAL A CG1  1 
ATOM   146  C  CG2  . VAL A 1 20  ? 67.155 66.846 16.609  1.00 178.58 ? 20  VAL A CG2  1 
ATOM   147  N  N    . VAL A 1 21  ? 70.042 69.057 14.173  1.00 155.02 ? 21  VAL A N    1 
ATOM   148  C  CA   . VAL A 1 21  ? 71.273 68.819 13.432  1.00 158.62 ? 21  VAL A CA   1 
ATOM   149  C  C    . VAL A 1 21  ? 72.430 69.714 13.879  1.00 164.32 ? 21  VAL A C    1 
ATOM   150  O  O    . VAL A 1 21  ? 73.579 69.277 13.926  1.00 163.48 ? 21  VAL A O    1 
ATOM   151  C  CB   . VAL A 1 21  ? 71.058 68.863 11.936  1.00 165.55 ? 21  VAL A CB   1 
ATOM   152  C  CG1  . VAL A 1 21  ? 71.344 70.261 11.407  1.00 165.82 ? 21  VAL A CG1  1 
ATOM   153  C  CG2  . VAL A 1 21  ? 71.950 67.830 11.278  1.00 165.84 ? 21  VAL A CG2  1 
ATOM   154  N  N    . GLN A 1 22  ? 72.125 70.962 14.221  1.00 160.31 ? 22  GLN A N    1 
ATOM   155  C  CA   . GLN A 1 22  ? 73.145 71.859 14.742  1.00 161.70 ? 22  GLN A CA   1 
ATOM   156  C  C    . GLN A 1 22  ? 73.629 71.225 16.046  1.00 168.28 ? 22  GLN A C    1 
ATOM   157  O  O    . GLN A 1 22  ? 74.810 71.268 16.380  1.00 167.79 ? 22  GLN A O    1 
ATOM   158  C  CB   . GLN A 1 22  ? 72.562 73.258 15.019  1.00 163.12 ? 22  GLN A CB   1 
ATOM   159  C  CG   . GLN A 1 22  ? 72.041 73.466 16.455  1.00 169.40 ? 22  GLN A CG   1 
ATOM   160  C  CD   . GLN A 1 22  ? 72.363 74.848 17.042  1.00 179.35 ? 22  GLN A CD   1 
ATOM   161  O  OE1  . GLN A 1 22  ? 71.917 75.182 18.140  1.00 173.46 ? 22  GLN A OE1  1 
ATOM   162  N  NE2  . GLN A 1 22  ? 73.149 75.642 16.319  1.00 170.12 ? 22  GLN A NE2  1 
ATOM   163  N  N    . ASN A 1 23  ? 72.705 70.610 16.769  1.00 167.98 ? 23  ASN A N    1 
ATOM   164  C  CA   . ASN A 1 23  ? 73.038 69.971 18.023  1.00 168.21 ? 23  ASN A CA   1 
ATOM   165  C  C    . ASN A 1 23  ? 74.071 68.885 17.832  1.00 173.01 ? 23  ASN A C    1 
ATOM   166  O  O    . ASN A 1 23  ? 75.074 68.859 18.530  1.00 172.37 ? 23  ASN A O    1 
ATOM   167  C  CB   . ASN A 1 23  ? 71.790 69.412 18.676  1.00 166.54 ? 23  ASN A CB   1 
ATOM   168  C  CG   . ASN A 1 23  ? 71.097 70.432 19.515  1.00 175.64 ? 23  ASN A CG   1 
ATOM   169  O  OD1  . ASN A 1 23  ? 70.861 71.550 19.065  1.00 167.95 ? 23  ASN A OD1  1 
ATOM   170  N  ND2  . ASN A 1 23  ? 70.881 70.107 20.779  1.00 165.50 ? 23  ASN A ND2  1 
ATOM   171  N  N    . GLY A 1 24  ? 73.826 67.991 16.885  1.00 172.31 ? 24  GLY A N    1 
ATOM   172  C  CA   . GLY A 1 24  ? 74.748 66.908 16.604  1.00 173.43 ? 24  GLY A CA   1 
ATOM   173  C  C    . GLY A 1 24  ? 76.116 67.436 16.217  1.00 181.88 ? 24  GLY A C    1 
ATOM   174  O  O    . GLY A 1 24  ? 77.127 66.742 16.337  1.00 181.23 ? 24  GLY A O    1 
ATOM   175  N  N    . PHE A 1 25  ? 76.158 68.669 15.730  1.00 179.82 ? 25  PHE A N    1 
ATOM   176  C  CA   . PHE A 1 25  ? 77.435 69.237 15.348  1.00 183.60 ? 25  PHE A CA   1 
ATOM   177  C  C    . PHE A 1 25  ? 78.213 69.625 16.597  1.00 181.17 ? 25  PHE A C    1 
ATOM   178  O  O    . PHE A 1 25  ? 79.380 69.264 16.735  1.00 179.46 ? 25  PHE A O    1 
ATOM   179  C  CB   . PHE A 1 25  ? 77.270 70.413 14.392  1.00 190.68 ? 25  PHE A CB   1 
ATOM   180  C  CG   . PHE A 1 25  ? 78.437 71.345 14.388  1.00 198.46 ? 25  PHE A CG   1 
ATOM   181  C  CD1  . PHE A 1 25  ? 79.727 70.854 14.399  1.00 205.73 ? 25  PHE A CD1  1 
ATOM   182  C  CD2  . PHE A 1 25  ? 78.244 72.712 14.424  1.00 204.83 ? 25  PHE A CD2  1 
ATOM   183  C  CE1  . PHE A 1 25  ? 80.798 71.706 14.452  1.00 208.22 ? 25  PHE A CE1  1 
ATOM   184  C  CE2  . PHE A 1 25  ? 79.312 73.570 14.465  1.00 209.41 ? 25  PHE A CE2  1 
ATOM   185  C  CZ   . PHE A 1 25  ? 80.592 73.067 14.480  1.00 207.95 ? 25  PHE A CZ   1 
ATOM   186  N  N    . PHE A 1 26  ? 77.559 70.341 17.510  1.00 181.95 ? 26  PHE A N    1 
ATOM   187  C  CA   . PHE A 1 26  ? 78.185 70.740 18.772  1.00 181.64 ? 26  PHE A CA   1 
ATOM   188  C  C    . PHE A 1 26  ? 78.765 69.495 19.433  1.00 183.87 ? 26  PHE A C    1 
ATOM   189  O  O    . PHE A 1 26  ? 79.841 69.531 20.037  1.00 182.36 ? 26  PHE A O    1 
ATOM   190  C  CB   . PHE A 1 26  ? 77.140 71.353 19.710  1.00 184.08 ? 26  PHE A CB   1 
ATOM   191  C  CG   . PHE A 1 26  ? 76.581 72.653 19.227  1.00 186.50 ? 26  PHE A CG   1 
ATOM   192  C  CD1  . PHE A 1 26  ? 76.938 73.155 17.988  1.00 190.11 ? 26  PHE A CD1  1 
ATOM   193  C  CD2  . PHE A 1 26  ? 75.713 73.382 20.018  1.00 189.19 ? 26  PHE A CD2  1 
ATOM   194  C  CE1  . PHE A 1 26  ? 76.427 74.355 17.535  1.00 191.16 ? 26  PHE A CE1  1 
ATOM   195  C  CE2  . PHE A 1 26  ? 75.201 74.585 19.575  1.00 192.15 ? 26  PHE A CE2  1 
ATOM   196  C  CZ   . PHE A 1 26  ? 75.555 75.071 18.327  1.00 190.25 ? 26  PHE A CZ   1 
ATOM   197  N  N    . ALA A 1 27  ? 78.026 68.398 19.293  1.00 183.02 ? 27  ALA A N    1 
ATOM   198  C  CA   . ALA A 1 27  ? 78.382 67.100 19.851  1.00 184.04 ? 27  ALA A CA   1 
ATOM   199  C  C    . ALA A 1 27  ? 79.457 66.430 19.018  1.00 187.72 ? 27  ALA A C    1 
ATOM   200  O  O    . ALA A 1 27  ? 79.951 65.358 19.361  1.00 186.67 ? 27  ALA A O    1 
ATOM   201  C  CB   . ALA A 1 27  ? 77.145 66.207 19.904  1.00 185.14 ? 27  ALA A CB   1 
ATOM   202  N  N    . HIS A 1 28  ? 79.787 67.046 17.896  1.00 187.67 ? 28  HIS A N    1 
ATOM   203  C  CA   . HIS A 1 28  ? 80.810 66.506 17.022  1.00 190.81 ? 28  HIS A CA   1 
ATOM   204  C  C    . HIS A 1 28  ? 82.127 67.196 17.340  1.00 188.34 ? 28  HIS A C    1 
ATOM   205  O  O    . HIS A 1 28  ? 83.174 66.556 17.437  1.00 186.71 ? 28  HIS A O    1 
ATOM   206  C  CB   . HIS A 1 28  ? 80.436 66.747 15.560  1.00 197.31 ? 28  HIS A CB   1 
ATOM   207  C  CG   . HIS A 1 28  ? 81.587 66.607 14.612  1.00 206.40 ? 28  HIS A CG   1 
ATOM   208  N  ND1  . HIS A 1 28  ? 81.789 65.477 13.849  1.00 211.01 ? 28  HIS A ND1  1 
ATOM   209  C  CD2  . HIS A 1 28  ? 82.596 67.456 14.302  1.00 211.99 ? 28  HIS A CD2  1 
ATOM   210  C  CE1  . HIS A 1 28  ? 82.872 65.635 13.111  1.00 212.23 ? 28  HIS A CE1  1 
ATOM   211  N  NE2  . HIS A 1 28  ? 83.379 66.829 13.365  1.00 212.73 ? 28  HIS A NE2  1 
ATOM   212  N  N    . LYS A 1 29  ? 82.062 68.513 17.509  1.00 189.07 ? 29  LYS A N    1 
ATOM   213  C  CA   . LYS A 1 29  ? 83.244 69.296 17.834  1.00 189.32 ? 29  LYS A CA   1 
ATOM   214  C  C    . LYS A 1 29  ? 83.715 68.953 19.247  1.00 193.03 ? 29  LYS A C    1 
ATOM   215  O  O    . LYS A 1 29  ? 84.772 69.406 19.689  1.00 190.72 ? 29  LYS A O    1 
ATOM   216  C  CB   . LYS A 1 29  ? 82.970 70.793 17.680  1.00 193.47 ? 29  LYS A CB   1 
ATOM   217  C  CG   . LYS A 1 29  ? 83.710 71.442 16.509  1.00 223.88 ? 29  LYS A CG   1 
ATOM   218  C  CD   . LYS A 1 29  ? 84.491 70.425 15.681  1.00 241.58 ? 29  LYS A CD   1 
ATOM   219  C  CE   . LYS A 1 29  ? 85.693 71.070 14.997  1.00 257.01 ? 29  LYS A CE   1 
ATOM   220  N  NZ   . LYS A 1 29  ? 85.453 71.367 13.557  1.00 267.28 ? 29  LYS A NZ   1 
ATOM   221  N  N    . VAL A 1 30  ? 82.939 68.120 19.939  1.00 191.78 ? 30  VAL A N    1 
ATOM   222  C  CA   . VAL A 1 30  ? 83.303 67.662 21.277  1.00 191.49 ? 30  VAL A CA   1 
ATOM   223  C  C    . VAL A 1 30  ? 84.020 66.318 21.161  1.00 202.86 ? 30  VAL A C    1 
ATOM   224  O  O    . VAL A 1 30  ? 84.799 65.936 22.036  1.00 205.16 ? 30  VAL A O    1 
ATOM   225  C  CB   . VAL A 1 30  ? 82.085 67.611 22.226  1.00 188.76 ? 30  VAL A CB   1 
ATOM   226  C  CG1  . VAL A 1 30  ? 82.089 66.335 23.061  1.00 187.38 ? 30  VAL A CG1  1 
ATOM   227  C  CG2  . VAL A 1 30  ? 82.067 68.837 23.119  1.00 187.40 ? 30  VAL A CG2  1 
ATOM   228  N  N    . GLU A 1 31  ? 83.776 65.623 20.053  1.00 206.14 ? 31  GLU A N    1 
ATOM   229  C  CA   . GLU A 1 31  ? 84.419 64.343 19.786  1.00 205.48 ? 31  GLU A CA   1 
ATOM   230  C  C    . GLU A 1 31  ? 85.850 64.606 19.326  1.00 205.97 ? 31  GLU A C    1 
ATOM   231  O  O    . GLU A 1 31  ? 86.784 63.903 19.716  1.00 202.81 ? 31  GLU A O    1 
ATOM   232  C  CB   . GLU A 1 31  ? 83.654 63.595 18.691  1.00 207.90 ? 31  GLU A CB   1 
ATOM   233  C  CG   . GLU A 1 31  ? 83.720 62.086 18.810  1.00 228.15 ? 31  GLU A CG   1 
ATOM   234  C  CD   . GLU A 1 31  ? 83.450 61.607 20.217  1.00 269.31 ? 31  GLU A CD   1 
ATOM   235  O  OE1  . GLU A 1 31  ? 82.658 62.262 20.924  1.00 269.21 ? 31  GLU A OE1  1 
ATOM   236  O  OE2  . GLU A 1 31  ? 83.994 60.552 20.605  1.00 268.95 ? 31  GLU A OE2  1 
ATOM   237  N  N    . HIS A 1 32  ? 86.008 65.640 18.505  1.00 206.33 ? 32  HIS A N    1 
ATOM   238  C  CA   . HIS A 1 32  ? 87.308 66.037 17.981  1.00 212.47 ? 32  HIS A CA   1 
ATOM   239  C  C    . HIS A 1 32  ? 88.290 66.317 19.096  1.00 214.51 ? 32  HIS A C    1 
ATOM   240  O  O    . HIS A 1 32  ? 89.473 66.005 18.978  1.00 213.23 ? 32  HIS A O    1 
ATOM   241  C  CB   . HIS A 1 32  ? 87.172 67.307 17.148  1.00 219.94 ? 32  HIS A CB   1 
ATOM   242  C  CG   . HIS A 1 32  ? 87.604 67.143 15.728  1.00 229.76 ? 32  HIS A CG   1 
ATOM   243  N  ND1  . HIS A 1 32  ? 87.941 68.210 14.925  1.00 234.68 ? 32  HIS A ND1  1 
ATOM   244  C  CD2  . HIS A 1 32  ? 87.741 66.035 14.963  1.00 235.74 ? 32  HIS A CD2  1 
ATOM   245  C  CE1  . HIS A 1 32  ? 88.267 67.766 13.724  1.00 236.07 ? 32  HIS A CE1  1 
ATOM   246  N  NE2  . HIS A 1 32  ? 88.152 66.450 13.720  1.00 236.58 ? 32  HIS A NE2  1 
ATOM   247  N  N    . GLU A 1 33  ? 87.808 66.968 20.151  1.00 212.18 ? 33  GLU A N    1 
ATOM   248  C  CA   . GLU A 1 33  ? 88.667 67.317 21.270  1.00 213.84 ? 33  GLU A CA   1 
ATOM   249  C  C    . GLU A 1 33  ? 88.885 66.238 22.316  1.00 218.23 ? 33  GLU A C    1 
ATOM   250  O  O    . GLU A 1 33  ? 89.843 66.295 23.079  1.00 217.01 ? 33  GLU A O    1 
ATOM   251  C  CB   . GLU A 1 33  ? 88.322 68.675 21.862  1.00 215.98 ? 33  GLU A CB   1 
ATOM   252  C  CG   . GLU A 1 33  ? 89.059 69.768 21.128  1.00 230.22 ? 33  GLU A CG   1 
ATOM   253  C  CD   . GLU A 1 33  ? 89.927 69.197 20.006  1.00 256.81 ? 33  GLU A CD   1 
ATOM   254  O  OE1  . GLU A 1 33  ? 89.378 68.871 18.929  1.00 252.60 ? 33  GLU A OE1  1 
ATOM   255  O  OE2  . GLU A 1 33  ? 91.148 69.022 20.222  1.00 252.34 ? 33  GLU A OE2  1 
ATOM   256  N  N    . SER A 1 34  ? 88.035 65.219 22.311  1.00 215.12 ? 34  SER A N    1 
ATOM   257  C  CA   . SER A 1 34  ? 88.211 64.098 23.222  1.00 216.14 ? 34  SER A CA   1 
ATOM   258  C  C    . SER A 1 34  ? 89.075 63.053 22.526  1.00 228.18 ? 34  SER A C    1 
ATOM   259  O  O    . SER A 1 34  ? 89.550 62.108 23.146  1.00 226.24 ? 34  SER A O    1 
ATOM   260  C  CB   . SER A 1 34  ? 86.862 63.494 23.572  1.00 216.76 ? 34  SER A CB   1 
ATOM   261  O  OG   . SER A 1 34  ? 86.065 63.385 22.410  1.00 222.05 ? 34  SER A OG   1 
ATOM   262  N  N    . ARG A 1 35  ? 89.274 63.238 21.226  1.00 228.48 ? 35  ARG A N    1 
ATOM   263  C  CA   . ARG A 1 35  ? 90.081 62.318 20.434  1.00 230.72 ? 35  ARG A CA   1 
ATOM   264  C  C    . ARG A 1 35  ? 91.543 62.766 20.325  1.00 231.80 ? 35  ARG A C    1 
ATOM   265  O  O    . ARG A 1 35  ? 92.452 61.957 20.508  1.00 233.03 ? 35  ARG A O    1 
ATOM   266  C  CB   . ARG A 1 35  ? 89.465 62.097 19.047  1.00 231.39 ? 35  ARG A CB   1 
ATOM   267  C  CG   . ARG A 1 35  ? 89.296 60.634 18.670  1.00 235.85 ? 35  ARG A CG   1 
ATOM   268  C  CD   . ARG A 1 35  ? 88.023 60.402 17.864  1.00 235.71 ? 35  ARG A CD   1 
ATOM   269  N  NE   . ARG A 1 35  ? 86.950 59.841 18.686  1.00 234.99 ? 35  ARG A NE   1 
ATOM   270  C  CZ   . ARG A 1 35  ? 85.783 59.405 18.214  1.00 243.54 ? 35  ARG A CZ   1 
ATOM   271  N  NH1  . ARG A 1 35  ? 85.527 59.458 16.913  1.00 229.65 ? 35  ARG A NH1  1 
ATOM   272  N  NH2  . ARG A 1 35  ? 84.868 58.915 19.044  1.00 229.07 ? 35  ARG A NH2  1 
ATOM   273  N  N    . THR A 1 36  ? 91.763 64.051 20.040  1.00 238.47 ? 36  THR A N    1 
ATOM   274  C  CA   . THR A 1 36  ? 93.116 64.616 19.920  1.00 237.03 ? 36  THR A CA   1 
ATOM   275  C  C    . THR A 1 36  ? 93.827 64.545 21.274  1.00 238.45 ? 36  THR A C    1 
ATOM   276  O  O    . THR A 1 36  ? 95.060 64.504 21.355  1.00 237.73 ? 36  THR A O    1 
ATOM   277  C  CB   . THR A 1 36  ? 93.074 66.075 19.382  1.00 262.72 ? 36  THR A CB   1 
ATOM   278  O  OG1  . THR A 1 36  ? 92.375 66.118 18.129  1.00 266.42 ? 36  THR A OG1  1 
ATOM   279  C  CG2  . THR A 1 36  ? 94.481 66.618 19.192  1.00 265.45 ? 36  THR A CG2  1 
ATOM   280  N  N    . GLN A 1 37  ? 93.018 64.590 22.331  1.00 236.21 ? 37  GLN A N    1 
ATOM   281  C  CA   . GLN A 1 37  ? 93.484 64.510 23.705  1.00 236.58 ? 37  GLN A CA   1 
ATOM   282  C  C    . GLN A 1 37  ? 92.615 63.463 24.376  1.00 241.53 ? 37  GLN A C    1 
ATOM   283  O  O    . GLN A 1 37  ? 91.483 63.732 24.772  1.00 240.57 ? 37  GLN A O    1 
ATOM   284  C  CB   . GLN A 1 37  ? 93.331 65.858 24.413  1.00 238.06 ? 37  GLN A CB   1 
ATOM   285  C  CG   . GLN A 1 37  ? 92.488 66.875 23.660  1.00 248.02 ? 37  GLN A CG   1 
ATOM   286  C  CD   . GLN A 1 37  ? 93.318 67.906 22.918  1.00 261.46 ? 37  GLN A CD   1 
ATOM   287  O  OE1  . GLN A 1 37  ? 94.452 68.192 23.293  1.00 256.10 ? 37  GLN A OE1  1 
ATOM   288  N  NE2  . GLN A 1 37  ? 92.750 68.477 21.861  1.00 252.75 ? 37  GLN A NE2  1 
ATOM   289  N  N    . ASN A 1 38  ? 93.142 62.250 24.438  1.00 241.38 ? 38  ASN A N    1 
ATOM   290  C  CA   . ASN A 1 38  ? 92.440 61.109 25.003  1.00 243.35 ? 38  ASN A CA   1 
ATOM   291  C  C    . ASN A 1 38  ? 91.669 61.371 26.296  1.00 251.77 ? 38  ASN A C    1 
ATOM   292  O  O    . ASN A 1 38  ? 91.836 62.413 26.937  1.00 251.79 ? 38  ASN A O    1 
ATOM   293  C  CB   . ASN A 1 38  ? 93.416 59.952 25.188  1.00 248.84 ? 38  ASN A CB   1 
ATOM   294  C  CG   . ASN A 1 38  ? 94.485 59.926 24.118  1.00 294.72 ? 38  ASN A CG   1 
ATOM   295  O  OD1  . ASN A 1 38  ? 94.264 60.384 22.997  1.00 292.43 ? 38  ASN A OD1  1 
ATOM   296  N  ND2  . ASN A 1 38  ? 95.661 59.418 24.466  1.00 289.98 ? 38  ASN A ND2  1 
ATOM   297  N  N    . GLY A 1 39  ? 90.823 60.406 26.664  1.00 250.86 ? 39  GLY A N    1 
ATOM   298  C  CA   . GLY A 1 39  ? 90.006 60.458 27.865  1.00 248.45 ? 39  GLY A CA   1 
ATOM   299  C  C    . GLY A 1 39  ? 88.864 59.450 27.888  1.00 239.48 ? 39  GLY A C    1 
ATOM   300  O  O    . GLY A 1 39  ? 88.343 59.048 26.844  1.00 245.35 ? 39  GLY A O    1 
ATOM   301  N  N    . ARG A 1 40  ? 88.486 59.037 29.095  1.00 238.25 ? 40  ARG A N    1 
ATOM   302  C  CA   . ARG A 1 40  ? 87.364 58.121 29.306  1.00 228.40 ? 40  ARG A CA   1 
ATOM   303  C  C    . ARG A 1 40  ? 86.397 58.852 30.241  1.00 218.44 ? 40  ARG A C    1 
ATOM   304  O  O    . ARG A 1 40  ? 85.191 58.591 30.261  1.00 225.47 ? 40  ARG A O    1 
ATOM   305  C  CB   . ARG A 1 40  ? 87.832 56.794 29.926  1.00 221.39 ? 40  ARG A CB   1 
ATOM   306  C  CG   . ARG A 1 40  ? 89.051 56.177 29.240  1.00 224.54 ? 40  ARG A CG   1 
ATOM   307  C  CD   . ARG A 1 40  ? 88.785 54.774 28.678  1.00 223.62 ? 40  ARG A CD   1 
ATOM   308  N  NE   . ARG A 1 40  ? 89.892 54.320 27.829  1.00 221.84 ? 40  ARG A NE   1 
ATOM   309  C  CZ   . ARG A 1 40  ? 90.840 53.459 28.205  1.00 230.15 ? 40  ARG A CZ   1 
ATOM   310  N  NH1  . ARG A 1 40  ? 90.820 52.926 29.420  1.00 216.77 ? 40  ARG A NH1  1 
ATOM   311  N  NH2  . ARG A 1 40  ? 91.812 53.125 27.363  1.00 216.37 ? 40  ARG A NH2  1 
ATOM   312  N  N    . SER A 1 41  ? 86.946 59.812 30.979  1.00 214.91 ? 41  SER A N    1 
ATOM   313  C  CA   . SER A 1 41  ? 86.164 60.659 31.863  1.00 204.74 ? 41  SER A CA   1 
ATOM   314  C  C    . SER A 1 41  ? 86.523 62.120 31.599  1.00 205.96 ? 41  SER A C    1 
ATOM   315  O  O    . SER A 1 41  ? 87.694 62.515 31.616  1.00 205.31 ? 41  SER A O    1 
ATOM   316  C  CB   . SER A 1 41  ? 86.373 60.294 33.332  1.00 205.94 ? 41  SER A CB   1 
ATOM   317  O  OG   . SER A 1 41  ? 85.795 61.273 34.174  1.00 209.33 ? 41  SER A OG   1 
ATOM   318  N  N    . PHE A 1 42  ? 85.493 62.892 31.280  1.00 204.27 ? 42  PHE A N    1 
ATOM   319  C  CA   . PHE A 1 42  ? 85.616 64.309 30.974  1.00 203.47 ? 42  PHE A CA   1 
ATOM   320  C  C    . PHE A 1 42  ? 84.890 65.017 32.098  1.00 218.76 ? 42  PHE A C    1 
ATOM   321  O  O    . PHE A 1 42  ? 83.755 65.464 31.926  1.00 203.93 ? 42  PHE A O    1 
ATOM   322  C  CB   . PHE A 1 42  ? 84.903 64.626 29.651  1.00 204.29 ? 42  PHE A CB   1 
ATOM   323  C  CG   . PHE A 1 42  ? 85.045 63.550 28.613  1.00 203.87 ? 42  PHE A CG   1 
ATOM   324  C  CD1  . PHE A 1 42  ? 84.478 62.300 28.802  1.00 204.47 ? 42  PHE A CD1  1 
ATOM   325  C  CD2  . PHE A 1 42  ? 85.765 63.781 27.453  1.00 203.83 ? 42  PHE A CD2  1 
ATOM   326  C  CE1  . PHE A 1 42  ? 84.643 61.299 27.861  1.00 204.53 ? 42  PHE A CE1  1 
ATOM   327  C  CE2  . PHE A 1 42  ? 85.929 62.783 26.504  1.00 205.15 ? 42  PHE A CE2  1 
ATOM   328  C  CZ   . PHE A 1 42  ? 85.365 61.538 26.711  1.00 203.46 ? 42  PHE A CZ   1 
ATOM   329  N  N    . GLN A 1 43  ? 85.510 65.055 33.271  1.00 214.68 ? 43  GLN A N    1 
ATOM   330  C  CA   . GLN A 1 43  ? 84.876 65.671 34.424  1.00 227.71 ? 43  GLN A CA   1 
ATOM   331  C  C    . GLN A 1 43  ? 85.835 66.498 35.262  1.00 224.05 ? 43  GLN A C    1 
ATOM   332  O  O    . GLN A 1 43  ? 85.439 67.111 36.250  1.00 221.77 ? 43  GLN A O    1 
ATOM   333  C  CB   . GLN A 1 43  ? 84.179 64.614 35.271  1.00 230.11 ? 43  GLN A CB   1 
ATOM   334  C  CG   . GLN A 1 43  ? 83.231 63.744 34.471  1.00 247.78 ? 43  GLN A CG   1 
ATOM   335  C  CD   . GLN A 1 43  ? 81.801 63.851 34.951  1.00 267.42 ? 43  GLN A CD   1 
ATOM   336  O  OE1  . GLN A 1 43  ? 81.333 64.931 35.318  1.00 262.93 ? 43  GLN A OE1  1 
ATOM   337  N  NE2  . GLN A 1 43  ? 81.098 62.724 34.962  1.00 259.58 ? 43  GLN A NE2  1 
ATOM   338  N  N    . ARG A 1 44  ? 87.099 66.519 34.857  1.00 220.38 ? 44  ARG A N    1 
ATOM   339  C  CA   . ARG A 1 44  ? 88.104 67.317 35.545  1.00 219.44 ? 44  ARG A CA   1 
ATOM   340  C  C    . ARG A 1 44  ? 88.646 68.337 34.552  1.00 222.70 ? 44  ARG A C    1 
ATOM   341  O  O    . ARG A 1 44  ? 88.996 67.983 33.424  1.00 221.92 ? 44  ARG A O    1 
ATOM   342  C  CB   . ARG A 1 44  ? 89.218 66.433 36.124  1.00 216.58 ? 44  ARG A CB   1 
ATOM   343  C  CG   . ARG A 1 44  ? 88.909 65.890 37.525  1.00 215.98 ? 44  ARG A CG   1 
ATOM   344  C  CD   . ARG A 1 44  ? 89.960 64.893 38.022  1.00 210.02 ? 44  ARG A CD   1 
ATOM   345  N  NE   . ARG A 1 44  ? 89.353 63.754 38.715  1.00 203.81 ? 44  ARG A NE   1 
ATOM   346  C  CZ   . ARG A 1 44  ? 89.732 63.302 39.909  1.00 208.65 ? 44  ARG A CZ   1 
ATOM   347  N  NH1  . ARG A 1 44  ? 90.733 63.886 40.561  1.00 193.86 ? 44  ARG A NH1  1 
ATOM   348  N  NH2  . ARG A 1 44  ? 89.109 62.262 40.456  1.00 193.28 ? 44  ARG A NH2  1 
ATOM   349  N  N    . THR A 1 45  ? 88.616 69.607 34.952  1.00 218.18 ? 45  THR A N    1 
ATOM   350  C  CA   . THR A 1 45  ? 89.066 70.711 34.112  1.00 220.46 ? 45  THR A CA   1 
ATOM   351  C  C    . THR A 1 45  ? 90.321 70.303 33.340  1.00 228.03 ? 45  THR A C    1 
ATOM   352  O  O    . THR A 1 45  ? 91.397 70.213 33.916  1.00 228.36 ? 45  THR A O    1 
ATOM   353  C  CB   . THR A 1 45  ? 89.275 71.983 34.961  1.00 247.43 ? 45  THR A CB   1 
ATOM   354  O  OG1  . THR A 1 45  ? 88.466 71.907 36.142  1.00 251.29 ? 45  THR A OG1  1 
ATOM   355  C  CG2  . THR A 1 45  ? 88.875 73.217 34.177  1.00 250.32 ? 45  THR A CG2  1 
ATOM   356  N  N    . GLY A 1 46  ? 90.158 69.957 32.065  1.00 224.83 ? 46  GLY A N    1 
ATOM   357  C  CA   . GLY A 1 46  ? 91.260 69.473 31.251  1.00 226.36 ? 46  GLY A CA   1 
ATOM   358  C  C    . GLY A 1 46  ? 91.779 70.396 30.164  1.00 236.64 ? 46  GLY A C    1 
ATOM   359  O  O    . GLY A 1 46  ? 91.812 71.615 30.340  1.00 237.27 ? 46  GLY A O    1 
ATOM   360  N  N    . THR A 1 47  ? 92.231 69.783 29.066  1.00 235.43 ? 47  THR A N    1 
ATOM   361  C  CA   . THR A 1 47  ? 92.780 70.476 27.893  1.00 231.60 ? 47  THR A CA   1 
ATOM   362  C  C    . THR A 1 47  ? 91.992 71.746 27.649  1.00 228.22 ? 47  THR A C    1 
ATOM   363  O  O    . THR A 1 47  ? 90.773 71.726 27.717  1.00 225.80 ? 47  THR A O    1 
ATOM   364  C  CB   . THR A 1 47  ? 92.689 69.584 26.643  1.00 211.71 ? 47  THR A CB   1 
ATOM   365  O  OG1  . THR A 1 47  ? 92.844 68.205 27.008  1.00 204.92 ? 47  THR A OG1  1 
ATOM   366  C  CG2  . THR A 1 47  ? 93.730 69.987 25.616  1.00 203.95 ? 47  THR A CG2  1 
ATOM   367  N  N    . LEU A 1 48  ? 92.660 72.858 27.380  1.00 228.25 ? 48  LEU A N    1 
ATOM   368  C  CA   . LEU A 1 48  ? 91.903 74.086 27.211  1.00 223.80 ? 48  LEU A CA   1 
ATOM   369  C  C    . LEU A 1 48  ? 91.122 74.207 25.908  1.00 215.86 ? 48  LEU A C    1 
ATOM   370  O  O    . LEU A 1 48  ? 90.257 75.071 25.766  1.00 221.14 ? 48  LEU A O    1 
ATOM   371  C  CB   . LEU A 1 48  ? 92.688 75.336 27.603  1.00 221.88 ? 48  LEU A CB   1 
ATOM   372  C  CG   . LEU A 1 48  ? 92.592 75.652 29.103  1.00 221.53 ? 48  LEU A CG   1 
ATOM   373  C  CD1  . LEU A 1 48  ? 91.493 76.670 29.385  1.00 220.18 ? 48  LEU A CD1  1 
ATOM   374  C  CD2  . LEU A 1 48  ? 92.365 74.374 29.913  1.00 222.46 ? 48  LEU A CD2  1 
ATOM   375  N  N    . ALA A 1 49  ? 91.377 73.281 24.992  1.00 220.03 ? 49  ALA A N    1 
ATOM   376  C  CA   . ALA A 1 49  ? 90.663 73.241 23.729  1.00 209.89 ? 49  ALA A CA   1 
ATOM   377  C  C    . ALA A 1 49  ? 89.459 72.335 23.907  1.00 222.33 ? 49  ALA A C    1 
ATOM   378  O  O    . ALA A 1 49  ? 88.368 72.629 23.425  1.00 215.48 ? 49  ALA A O    1 
ATOM   379  C  CB   . ALA A 1 49  ? 91.565 72.700 22.647  1.00 206.93 ? 49  ALA A CB   1 
ATOM   380  N  N    . PHE A 1 50  ? 89.670 71.220 24.600  1.00 205.23 ? 50  PHE A N    1 
ATOM   381  C  CA   . PHE A 1 50  ? 88.586 70.283 24.858  1.00 215.22 ? 50  PHE A CA   1 
ATOM   382  C  C    . PHE A 1 50  ? 87.783 70.706 26.079  1.00 221.79 ? 50  PHE A C    1 
ATOM   383  O  O    . PHE A 1 50  ? 86.618 70.342 26.212  1.00 221.30 ? 50  PHE A O    1 
ATOM   384  C  CB   . PHE A 1 50  ? 89.064 68.841 25.038  1.00 218.77 ? 50  PHE A CB   1 
ATOM   385  C  CG   . PHE A 1 50  ? 88.152 68.024 25.912  1.00 218.26 ? 50  PHE A CG   1 
ATOM   386  C  CD1  . PHE A 1 50  ? 87.085 67.329 25.366  1.00 219.65 ? 50  PHE A CD1  1 
ATOM   387  C  CD2  . PHE A 1 50  ? 88.293 68.049 27.293  1.00 218.47 ? 50  PHE A CD2  1 
ATOM   388  C  CE1  . PHE A 1 50  ? 86.208 66.636 26.177  1.00 219.67 ? 50  PHE A CE1  1 
ATOM   389  C  CE2  . PHE A 1 50  ? 87.419 67.366 28.108  1.00 220.27 ? 50  PHE A CE2  1 
ATOM   390  C  CZ   . PHE A 1 50  ? 86.372 66.664 27.551  1.00 218.10 ? 50  PHE A CZ   1 
ATOM   391  N  N    . GLU A 1 51  ? 88.408 71.437 26.995  1.00 208.63 ? 51  GLU A N    1 
ATOM   392  C  CA   . GLU A 1 51  ? 87.688 71.899 28.172  1.00 208.87 ? 51  GLU A CA   1 
ATOM   393  C  C    . GLU A 1 51  ? 86.904 73.130 27.763  1.00 213.79 ? 51  GLU A C    1 
ATOM   394  O  O    . GLU A 1 51  ? 85.907 73.479 28.383  1.00 211.29 ? 51  GLU A O    1 
ATOM   395  C  CB   . GLU A 1 51  ? 88.630 72.237 29.325  1.00 210.45 ? 51  GLU A CB   1 
ATOM   396  C  CG   . GLU A 1 51  ? 87.916 72.637 30.604  1.00 220.74 ? 51  GLU A CG   1 
ATOM   397  C  CD   . GLU A 1 51  ? 87.267 71.456 31.305  1.00 238.41 ? 51  GLU A CD   1 
ATOM   398  O  OE1  . GLU A 1 51  ? 87.477 70.304 30.859  1.00 231.69 ? 51  GLU A OE1  1 
ATOM   399  O  OE2  . GLU A 1 51  ? 86.546 71.684 32.303  1.00 231.45 ? 51  GLU A OE2  1 
ATOM   400  N  N    . ARG A 1 52  ? 87.351 73.779 26.697  1.00 202.98 ? 52  ARG A N    1 
ATOM   401  C  CA   . ARG A 1 52  ? 86.658 74.958 26.202  1.00 203.79 ? 52  ARG A CA   1 
ATOM   402  C  C    . ARG A 1 52  ? 85.436 74.538 25.399  1.00 201.34 ? 52  ARG A C    1 
ATOM   403  O  O    . ARG A 1 52  ? 84.425 75.234 25.386  1.00 202.65 ? 52  ARG A O    1 
ATOM   404  C  CB   . ARG A 1 52  ? 87.585 75.814 25.334  1.00 205.21 ? 52  ARG A CB   1 
ATOM   405  C  CG   . ARG A 1 52  ? 87.316 77.315 25.428  1.00 211.56 ? 52  ARG A CG   1 
ATOM   406  C  CD   . ARG A 1 52  ? 88.575 78.079 25.821  1.00 212.70 ? 52  ARG A CD   1 
ATOM   407  N  NE   . ARG A 1 52  ? 88.296 79.340 26.511  1.00 212.21 ? 52  ARG A NE   1 
ATOM   408  C  CZ   . ARG A 1 52  ? 87.944 79.439 27.791  1.00 220.61 ? 52  ARG A CZ   1 
ATOM   409  N  NH1  . ARG A 1 52  ? 87.798 78.350 28.538  1.00 206.67 ? 52  ARG A NH1  1 
ATOM   410  N  NH2  . ARG A 1 52  ? 87.729 80.633 28.326  1.00 206.10 ? 52  ARG A NH2  1 
ATOM   411  N  N    . VAL A 1 53  ? 85.539 73.392 24.732  1.00 197.85 ? 53  VAL A N    1 
ATOM   412  C  CA   . VAL A 1 53  ? 84.449 72.883 23.905  1.00 189.45 ? 53  VAL A CA   1 
ATOM   413  C  C    . VAL A 1 53  ? 83.393 72.139 24.702  1.00 198.21 ? 53  VAL A C    1 
ATOM   414  O  O    . VAL A 1 53  ? 82.202 72.397 24.546  1.00 199.18 ? 53  VAL A O    1 
ATOM   415  C  CB   . VAL A 1 53  ? 84.958 72.023 22.734  1.00 181.18 ? 53  VAL A CB   1 
ATOM   416  C  CG1  . VAL A 1 53  ? 83.851 71.104 22.232  1.00 179.02 ? 53  VAL A CG1  1 
ATOM   417  C  CG2  . VAL A 1 53  ? 85.482 72.905 21.612  1.00 179.03 ? 53  VAL A CG2  1 
ATOM   418  N  N    . TYR A 1 54  ? 83.813 71.194 25.537  1.00 193.89 ? 54  TYR A N    1 
ATOM   419  C  CA   . TYR A 1 54  ? 82.833 70.465 26.318  1.00 192.84 ? 54  TYR A CA   1 
ATOM   420  C  C    . TYR A 1 54  ? 82.052 71.438 27.178  1.00 192.31 ? 54  TYR A C    1 
ATOM   421  O  O    . TYR A 1 54  ? 80.910 71.171 27.550  1.00 191.94 ? 54  TYR A O    1 
ATOM   422  C  CB   . TYR A 1 54  ? 83.433 69.371 27.190  1.00 194.72 ? 54  TYR A CB   1 
ATOM   423  C  CG   . TYR A 1 54  ? 82.338 68.603 27.883  1.00 197.59 ? 54  TYR A CG   1 
ATOM   424  C  CD1  . TYR A 1 54  ? 81.187 68.247 27.186  1.00 199.67 ? 54  TYR A CD1  1 
ATOM   425  C  CD2  . TYR A 1 54  ? 82.378 68.360 29.250  1.00 198.63 ? 54  TYR A CD2  1 
ATOM   426  C  CE1  . TYR A 1 54  ? 80.135 67.595 27.809  1.00 200.33 ? 54  TYR A CE1  1 
ATOM   427  C  CE2  . TYR A 1 54  ? 81.330 67.696 29.887  1.00 199.53 ? 54  TYR A CE2  1 
ATOM   428  C  CZ   . TYR A 1 54  ? 80.208 67.319 29.158  1.00 206.14 ? 54  TYR A CZ   1 
ATOM   429  O  OH   . TYR A 1 54  ? 79.156 66.668 29.768  1.00 206.59 ? 54  TYR A OH   1 
ATOM   430  N  N    . THR A 1 55  ? 82.665 72.581 27.475  1.00 188.70 ? 55  THR A N    1 
ATOM   431  C  CA   . THR A 1 55  ? 81.988 73.611 28.254  1.00 187.24 ? 55  THR A CA   1 
ATOM   432  C  C    . THR A 1 55  ? 80.916 74.259 27.383  1.00 189.94 ? 55  THR A C    1 
ATOM   433  O  O    . THR A 1 55  ? 79.727 74.213 27.709  1.00 189.44 ? 55  THR A O    1 
ATOM   434  C  CB   . THR A 1 55  ? 82.956 74.687 28.799  1.00 192.72 ? 55  THR A CB   1 
ATOM   435  O  OG1  . THR A 1 55  ? 84.042 74.066 29.485  1.00 191.78 ? 55  THR A OG1  1 
ATOM   436  C  CG2  . THR A 1 55  ? 82.235 75.597 29.780  1.00 190.81 ? 55  THR A CG2  1 
ATOM   437  N  N    . ALA A 1 56  ? 81.346 74.854 26.269  1.00 189.48 ? 56  ALA A N    1 
ATOM   438  C  CA   . ALA A 1 56  ? 80.437 75.525 25.333  1.00 188.84 ? 56  ALA A CA   1 
ATOM   439  C  C    . ALA A 1 56  ? 79.270 74.628 24.965  1.00 175.89 ? 56  ALA A C    1 
ATOM   440  O  O    . ALA A 1 56  ? 78.129 75.070 24.883  1.00 188.93 ? 56  ALA A O    1 
ATOM   441  C  CB   . ALA A 1 56  ? 81.185 75.948 24.072  1.00 189.74 ? 56  ALA A CB   1 
ATOM   442  N  N    . ASN A 1 57  ? 79.576 73.362 24.725  1.00 181.63 ? 57  ASN A N    1 
ATOM   443  C  CA   . ASN A 1 57  ? 78.563 72.391 24.379  1.00 181.63 ? 57  ASN A CA   1 
ATOM   444  C  C    . ASN A 1 57  ? 77.616 72.192 25.552  1.00 181.63 ? 57  ASN A C    1 
ATOM   445  O  O    . ASN A 1 57  ? 76.423 72.457 25.442  1.00 181.63 ? 57  ASN A O    1 
ATOM   446  C  CB   . ASN A 1 57  ? 79.215 71.064 24.009  1.00 181.63 ? 57  ASN A CB   1 
ATOM   447  C  CG   . ASN A 1 57  ? 78.199 69.975 23.753  1.00 181.63 ? 57  ASN A CG   1 
ATOM   448  O  OD1  . ASN A 1 57  ? 78.288 68.871 24.307  1.00 181.63 ? 57  ASN A OD1  1 
ATOM   449  N  ND2  . ASN A 1 57  ? 77.215 70.279 22.914  1.00 181.63 ? 57  ASN A ND2  1 
ATOM   450  N  N    . GLN A 1 58  ? 78.148 71.734 26.679  1.00 174.06 ? 58  GLN A N    1 
ATOM   451  C  CA   . GLN A 1 58  ? 77.322 71.498 27.859  1.00 186.54 ? 58  GLN A CA   1 
ATOM   452  C  C    . GLN A 1 58  ? 76.755 72.789 28.445  1.00 184.25 ? 58  GLN A C    1 
ATOM   453  O  O    . GLN A 1 58  ? 76.442 72.864 29.635  1.00 182.61 ? 58  GLN A O    1 
ATOM   454  C  CB   . GLN A 1 58  ? 78.079 70.694 28.919  1.00 188.69 ? 58  GLN A CB   1 
ATOM   455  C  CG   . GLN A 1 58  ? 77.234 70.283 30.131  1.00 210.15 ? 58  GLN A CG   1 
ATOM   456  C  CD   . GLN A 1 58  ? 76.229 69.183 29.825  1.00 234.04 ? 58  GLN A CD   1 
ATOM   457  O  OE1  . GLN A 1 58  ? 75.107 69.187 30.338  1.00 230.22 ? 58  GLN A OE1  1 
ATOM   458  N  NE2  . GLN A 1 58  ? 76.644 68.212 29.022  1.00 226.88 ? 58  GLN A NE2  1 
ATOM   459  N  N    . ASN A 1 59  ? 76.611 73.799 27.592  1.00 177.99 ? 59  ASN A N    1 
ATOM   460  C  CA   . ASN A 1 59  ? 76.044 75.091 27.987  1.00 178.08 ? 59  ASN A CA   1 
ATOM   461  C  C    . ASN A 1 59  ? 74.840 75.344 27.067  1.00 184.05 ? 59  ASN A C    1 
ATOM   462  O  O    . ASN A 1 59  ? 73.906 76.087 27.399  1.00 182.94 ? 59  ASN A O    1 
ATOM   463  C  CB   . ASN A 1 59  ? 77.095 76.208 27.831  1.00 179.88 ? 59  ASN A CB   1 
ATOM   464  C  CG   . ASN A 1 59  ? 78.155 76.198 28.942  1.00 209.54 ? 59  ASN A CG   1 
ATOM   465  O  OD1  . ASN A 1 59  ? 78.124 75.362 29.849  1.00 204.91 ? 59  ASN A OD1  1 
ATOM   466  N  ND2  . ASN A 1 59  ? 79.089 77.143 28.873  1.00 202.46 ? 59  ASN A ND2  1 
ATOM   467  N  N    . CYS A 1 60  ? 74.882 74.691 25.909  1.00 176.51 ? 60  CYS A N    1 
ATOM   468  C  CA   . CYS A 1 60  ? 73.821 74.773 24.925  1.00 178.40 ? 60  CYS A CA   1 
ATOM   469  C  C    . CYS A 1 60  ? 72.886 73.613 25.184  1.00 182.00 ? 60  CYS A C    1 
ATOM   470  O  O    . CYS A 1 60  ? 71.712 73.668 24.841  1.00 182.13 ? 60  CYS A O    1 
ATOM   471  C  CB   . CYS A 1 60  ? 74.384 74.645 23.510  1.00 179.73 ? 60  CYS A CB   1 
ATOM   472  S  SG   . CYS A 1 60  ? 75.260 76.083 22.902  1.00 183.85 ? 60  CYS A SG   1 
ATOM   473  N  N    . VAL A 1 61  ? 73.419 72.551 25.776  1.00 178.00 ? 61  VAL A N    1 
ATOM   474  C  CA   . VAL A 1 61  ? 72.619 71.376 26.071  1.00 177.39 ? 61  VAL A CA   1 
ATOM   475  C  C    . VAL A 1 61  ? 71.715 71.622 27.269  1.00 180.52 ? 61  VAL A C    1 
ATOM   476  O  O    . VAL A 1 61  ? 70.767 70.879 27.493  1.00 179.21 ? 61  VAL A O    1 
ATOM   477  C  CB   . VAL A 1 61  ? 73.474 70.100 26.202  1.00 182.07 ? 61  VAL A CB   1 
ATOM   478  C  CG1  . VAL A 1 61  ? 72.596 68.866 26.198  1.00 182.04 ? 61  VAL A CG1  1 
ATOM   479  C  CG2  . VAL A 1 61  ? 74.460 70.015 25.059  1.00 182.05 ? 61  VAL A CG2  1 
ATOM   480  N  N    . ASP A 1 62  ? 71.983 72.684 28.022  1.00 175.96 ? 62  ASP A N    1 
ATOM   481  C  CA   . ASP A 1 62  ? 71.126 73.026 29.156  1.00 176.29 ? 62  ASP A CA   1 
ATOM   482  C  C    . ASP A 1 62  ? 70.047 73.963 28.646  1.00 176.80 ? 62  ASP A C    1 
ATOM   483  O  O    . ASP A 1 62  ? 68.989 74.109 29.256  1.00 176.45 ? 62  ASP A O    1 
ATOM   484  C  CB   . ASP A 1 62  ? 71.900 73.732 30.276  1.00 178.60 ? 62  ASP A CB   1 
ATOM   485  C  CG   . ASP A 1 62  ? 73.377 73.420 30.258  1.00 186.60 ? 62  ASP A CG   1 
ATOM   486  O  OD1  . ASP A 1 62  ? 73.794 72.594 29.422  1.00 186.75 ? 62  ASP A OD1  1 
ATOM   487  O  OD2  . ASP A 1 62  ? 74.118 73.996 31.087  1.00 192.11 ? 62  ASP A OD2  1 
ATOM   488  N  N    . ALA A 1 63  ? 70.332 74.591 27.512  1.00 173.87 ? 63  ALA A N    1 
ATOM   489  C  CA   . ALA A 1 63  ? 69.428 75.552 26.895  1.00 172.25 ? 63  ALA A CA   1 
ATOM   490  C  C    . ALA A 1 63  ? 68.385 74.919 25.975  1.00 172.98 ? 63  ALA A C    1 
ATOM   491  O  O    . ALA A 1 63  ? 67.276 75.429 25.846  1.00 171.61 ? 63  ALA A O    1 
ATOM   492  C  CB   . ALA A 1 63  ? 70.232 76.595 26.130  1.00 173.03 ? 63  ALA A CB   1 
ATOM   493  N  N    . TYR A 1 64  ? 68.762 73.836 25.305  1.00 168.67 ? 64  TYR A N    1 
ATOM   494  C  CA   . TYR A 1 64  ? 67.871 73.142 24.380  1.00 167.75 ? 64  TYR A CA   1 
ATOM   495  C  C    . TYR A 1 64  ? 66.450 72.961 24.878  1.00 171.71 ? 64  TYR A C    1 
ATOM   496  O  O    . TYR A 1 64  ? 65.502 73.413 24.243  1.00 172.07 ? 64  TYR A O    1 
ATOM   497  C  CB   . TYR A 1 64  ? 68.431 71.775 24.021  1.00 166.68 ? 64  TYR A CB   1 
ATOM   498  C  CG   . TYR A 1 64  ? 67.926 71.271 22.700  1.00 163.89 ? 64  TYR A CG   1 
ATOM   499  C  CD1  . TYR A 1 64  ? 67.353 72.141 21.775  1.00 164.94 ? 64  TYR A CD1  1 
ATOM   500  C  CD2  . TYR A 1 64  ? 68.036 69.927 22.359  1.00 163.33 ? 64  TYR A CD2  1 
ATOM   501  C  CE1  . TYR A 1 64  ? 66.915 71.685 20.526  1.00 164.57 ? 64  TYR A CE1  1 
ATOM   502  C  CE2  . TYR A 1 64  ? 67.576 69.452 21.123  1.00 163.60 ? 64  TYR A CE2  1 
ATOM   503  C  CZ   . TYR A 1 64  ? 67.004 70.332 20.215  1.00 169.42 ? 64  TYR A CZ   1 
ATOM   504  O  OH   . TYR A 1 64  ? 66.547 69.861 18.998  1.00 169.49 ? 64  TYR A OH   1 
ATOM   505  N  N    . PRO A 1 65  ? 66.283 72.253 26.000  1.00 164.86 ? 65  PRO A N    1 
ATOM   506  C  CA   . PRO A 1 65  ? 64.975 71.974 26.600  1.00 163.91 ? 65  PRO A CA   1 
ATOM   507  C  C    . PRO A 1 65  ? 64.135 73.233 26.867  1.00 168.76 ? 65  PRO A C    1 
ATOM   508  O  O    . PRO A 1 65  ? 63.025 73.385 26.333  1.00 168.81 ? 65  PRO A O    1 
ATOM   509  C  CB   . PRO A 1 65  ? 65.352 71.320 27.927  1.00 164.79 ? 65  PRO A CB   1 
ATOM   510  C  CG   . PRO A 1 65  ? 66.621 71.990 28.296  1.00 168.31 ? 65  PRO A CG   1 
ATOM   511  C  CD   . PRO A 1 65  ? 67.359 72.208 27.003  1.00 163.91 ? 65  PRO A CD   1 
ATOM   512  N  N    . THR A 1 66  ? 64.663 74.115 27.717  1.00 162.85 ? 66  THR A N    1 
ATOM   513  C  CA   . THR A 1 66  ? 63.980 75.358 28.098  1.00 162.15 ? 66  THR A CA   1 
ATOM   514  C  C    . THR A 1 66  ? 63.699 76.277 26.908  1.00 165.52 ? 66  THR A C    1 
ATOM   515  O  O    . THR A 1 66  ? 62.966 77.254 27.028  1.00 164.93 ? 66  THR A O    1 
ATOM   516  C  CB   . THR A 1 66  ? 64.739 76.113 29.230  1.00 167.74 ? 66  THR A CB   1 
ATOM   517  O  OG1  . THR A 1 66  ? 65.848 75.322 29.684  1.00 166.78 ? 66  THR A OG1  1 
ATOM   518  C  CG2  . THR A 1 66  ? 63.806 76.422 30.415  1.00 165.80 ? 66  THR A CG2  1 
ATOM   519  N  N    . PHE A 1 67  ? 64.297 75.965 25.766  1.00 159.92 ? 67  PHE A N    1 
ATOM   520  C  CA   . PHE A 1 67  ? 64.107 76.752 24.558  1.00 157.90 ? 67  PHE A CA   1 
ATOM   521  C  C    . PHE A 1 67  ? 63.017 76.084 23.749  1.00 165.27 ? 67  PHE A C    1 
ATOM   522  O  O    . PHE A 1 67  ? 62.054 76.726 23.331  1.00 165.76 ? 67  PHE A O    1 
ATOM   523  C  CB   . PHE A 1 67  ? 65.411 76.791 23.767  1.00 155.76 ? 67  PHE A CB   1 
ATOM   524  C  CG   . PHE A 1 67  ? 65.228 76.892 22.283  1.00 151.09 ? 67  PHE A CG   1 
ATOM   525  C  CD1  . PHE A 1 67  ? 64.321 77.784 21.737  1.00 149.10 ? 67  PHE A CD1  1 
ATOM   526  C  CD2  . PHE A 1 67  ? 66.031 76.149 21.430  1.00 147.86 ? 67  PHE A CD2  1 
ATOM   527  C  CE1  . PHE A 1 67  ? 64.190 77.902 20.369  1.00 147.64 ? 67  PHE A CE1  1 
ATOM   528  C  CE2  . PHE A 1 67  ? 65.915 76.272 20.060  1.00 148.00 ? 67  PHE A CE2  1 
ATOM   529  C  CZ   . PHE A 1 67  ? 64.999 77.153 19.527  1.00 145.36 ? 67  PHE A CZ   1 
ATOM   530  N  N    . LEU A 1 68  ? 63.179 74.784 23.543  1.00 159.02 ? 68  LEU A N    1 
ATOM   531  C  CA   . LEU A 1 68  ? 62.205 74.012 22.805  1.00 156.73 ? 68  LEU A CA   1 
ATOM   532  C  C    . LEU A 1 68  ? 60.853 74.208 23.439  1.00 163.75 ? 68  LEU A C    1 
ATOM   533  O  O    . LEU A 1 68  ? 59.833 74.241 22.756  1.00 164.50 ? 68  LEU A O    1 
ATOM   534  C  CB   . LEU A 1 68  ? 62.577 72.541 22.811  1.00 153.84 ? 68  LEU A CB   1 
ATOM   535  C  CG   . LEU A 1 68  ? 62.795 72.055 21.386  1.00 152.60 ? 68  LEU A CG   1 
ATOM   536  C  CD1  . LEU A 1 68  ? 62.711 73.224 20.419  1.00 150.80 ? 68  LEU A CD1  1 
ATOM   537  C  CD2  . LEU A 1 68  ? 64.120 71.359 21.273  1.00 153.10 ? 68  LEU A CD2  1 
ATOM   538  N  N    . ALA A 1 69  ? 60.851 74.379 24.752  1.00 159.54 ? 69  ALA A N    1 
ATOM   539  C  CA   . ALA A 1 69  ? 59.610 74.618 25.458  1.00 158.69 ? 69  ALA A CA   1 
ATOM   540  C  C    . ALA A 1 69  ? 58.855 75.803 24.829  1.00 163.01 ? 69  ALA A C    1 
ATOM   541  O  O    . ALA A 1 69  ? 57.876 75.601 24.101  1.00 162.74 ? 69  ALA A O    1 
ATOM   542  C  CB   . ALA A 1 69  ? 59.881 74.844 26.932  1.00 159.25 ? 69  ALA A CB   1 
ATOM   543  N  N    . VAL A 1 70  ? 59.332 77.026 25.061  1.00 158.22 ? 70  VAL A N    1 
ATOM   544  C  CA   . VAL A 1 70  ? 58.674 78.210 24.510  1.00 158.71 ? 70  VAL A CA   1 
ATOM   545  C  C    . VAL A 1 70  ? 58.630 78.251 22.990  1.00 161.51 ? 70  VAL A C    1 
ATOM   546  O  O    . VAL A 1 70  ? 57.864 79.026 22.419  1.00 161.10 ? 70  VAL A O    1 
ATOM   547  C  CB   . VAL A 1 70  ? 59.233 79.507 25.068  1.00 164.36 ? 70  VAL A CB   1 
ATOM   548  C  CG1  . VAL A 1 70  ? 59.079 79.547 26.585  1.00 164.47 ? 70  VAL A CG1  1 
ATOM   549  C  CG2  . VAL A 1 70  ? 60.673 79.675 24.625  1.00 164.48 ? 70  VAL A CG2  1 
ATOM   550  N  N    . LEU A 1 71  ? 59.449 77.427 22.339  1.00 158.44 ? 71  LEU A N    1 
ATOM   551  C  CA   . LEU A 1 71  ? 59.469 77.351 20.877  1.00 158.80 ? 71  LEU A CA   1 
ATOM   552  C  C    . LEU A 1 71  ? 58.122 76.828 20.373  1.00 160.24 ? 71  LEU A C    1 
ATOM   553  O  O    . LEU A 1 71  ? 57.595 77.299 19.363  1.00 158.29 ? 71  LEU A O    1 
ATOM   554  C  CB   . LEU A 1 71  ? 60.595 76.424 20.406  1.00 160.30 ? 71  LEU A CB   1 
ATOM   555  C  CG   . LEU A 1 71  ? 60.796 76.266 18.899  1.00 167.72 ? 71  LEU A CG   1 
ATOM   556  C  CD1  . LEU A 1 71  ? 59.735 75.376 18.301  1.00 168.75 ? 71  LEU A CD1  1 
ATOM   557  C  CD2  . LEU A 1 71  ? 60.815 77.609 18.211  1.00 171.06 ? 71  LEU A CD2  1 
ATOM   558  N  N    . TRP A 1 72  ? 57.566 75.856 21.089  1.00 156.47 ? 72  TRP A N    1 
ATOM   559  C  CA   . TRP A 1 72  ? 56.284 75.284 20.716  1.00 157.07 ? 72  TRP A CA   1 
ATOM   560  C  C    . TRP A 1 72  ? 55.143 75.979 21.419  1.00 161.44 ? 72  TRP A C    1 
ATOM   561  O  O    . TRP A 1 72  ? 54.154 76.328 20.785  1.00 161.46 ? 72  TRP A O    1 
ATOM   562  C  CB   . TRP A 1 72  ? 56.229 73.812 21.057  1.00 155.33 ? 72  TRP A CB   1 
ATOM   563  C  CG   . TRP A 1 72  ? 57.200 73.014 20.318  1.00 155.42 ? 72  TRP A CG   1 
ATOM   564  C  CD1  . TRP A 1 72  ? 58.426 72.628 20.751  1.00 158.06 ? 72  TRP A CD1  1 
ATOM   565  C  CD2  . TRP A 1 72  ? 57.032 72.446 19.019  1.00 154.81 ? 72  TRP A CD2  1 
ATOM   566  N  NE1  . TRP A 1 72  ? 59.042 71.852 19.799  1.00 156.97 ? 72  TRP A NE1  1 
ATOM   567  C  CE2  . TRP A 1 72  ? 58.205 71.723 18.725  1.00 158.10 ? 72  TRP A CE2  1 
ATOM   568  C  CE3  . TRP A 1 72  ? 56.010 72.483 18.073  1.00 155.72 ? 72  TRP A CE3  1 
ATOM   569  C  CZ2  . TRP A 1 72  ? 58.388 71.050 17.521  1.00 157.13 ? 72  TRP A CZ2  1 
ATOM   570  C  CZ3  . TRP A 1 72  ? 56.193 71.811 16.876  1.00 156.79 ? 72  TRP A CZ3  1 
ATOM   571  C  CH2  . TRP A 1 72  ? 57.372 71.102 16.612  1.00 157.28 ? 72  TRP A CH2  1 
ATOM   572  N  N    . SER A 1 73  ? 55.262 76.138 22.733  1.00 156.99 ? 73  SER A N    1 
ATOM   573  C  CA   . SER A 1 73  ? 54.233 76.810 23.520  1.00 156.40 ? 73  SER A CA   1 
ATOM   574  C  C    . SER A 1 73  ? 53.840 78.104 22.810  1.00 160.80 ? 73  SER A C    1 
ATOM   575  O  O    . SER A 1 73  ? 52.666 78.459 22.704  1.00 160.57 ? 73  SER A O    1 
ATOM   576  C  CB   . SER A 1 73  ? 54.799 77.151 24.897  1.00 159.35 ? 73  SER A CB   1 
ATOM   577  O  OG   . SER A 1 73  ? 55.717 78.231 24.815  1.00 167.47 ? 73  SER A OG   1 
ATOM   578  N  N    . ALA A 1 74  ? 54.847 78.780 22.281  1.00 157.47 ? 74  ALA A N    1 
ATOM   579  C  CA   . ALA A 1 74  ? 54.632 80.014 21.560  1.00 156.74 ? 74  ALA A CA   1 
ATOM   580  C  C    . ALA A 1 74  ? 54.347 79.708 20.099  1.00 160.20 ? 74  ALA A C    1 
ATOM   581  O  O    . ALA A 1 74  ? 54.127 80.615 19.311  1.00 159.58 ? 74  ALA A O    1 
ATOM   582  C  CB   . ALA A 1 74  ? 55.849 80.907 21.686  1.00 157.34 ? 74  ALA A CB   1 
ATOM   583  N  N    . GLY A 1 75  ? 54.364 78.431 19.733  1.00 157.53 ? 75  GLY A N    1 
ATOM   584  C  CA   . GLY A 1 75  ? 54.101 78.010 18.365  1.00 157.62 ? 75  GLY A CA   1 
ATOM   585  C  C    . GLY A 1 75  ? 52.665 77.539 18.170  1.00 162.46 ? 75  GLY A C    1 
ATOM   586  O  O    . GLY A 1 75  ? 52.096 77.667 17.076  1.00 161.83 ? 75  GLY A O    1 
ATOM   587  N  N    . LEU A 1 76  ? 52.085 76.982 19.236  1.00 159.12 ? 76  LEU A N    1 
ATOM   588  C  CA   . LEU A 1 76  ? 50.701 76.504 19.228  1.00 159.04 ? 76  LEU A CA   1 
ATOM   589  C  C    . LEU A 1 76  ? 49.832 77.553 19.905  1.00 167.12 ? 76  LEU A C    1 
ATOM   590  O  O    . LEU A 1 76  ? 48.866 78.057 19.325  1.00 167.66 ? 76  LEU A O    1 
ATOM   591  C  CB   . LEU A 1 76  ? 50.577 75.182 19.992  1.00 157.53 ? 76  LEU A CB   1 
ATOM   592  C  CG   . LEU A 1 76  ? 51.519 74.086 19.509  1.00 158.63 ? 76  LEU A CG   1 
ATOM   593  C  CD1  . LEU A 1 76  ? 52.088 74.427 18.129  1.00 157.57 ? 76  LEU A CD1  1 
ATOM   594  C  CD2  . LEU A 1 76  ? 52.628 73.882 20.524  1.00 159.86 ? 76  LEU A CD2  1 
ATOM   595  N  N    . LEU A 1 77  ? 50.200 77.896 21.132  1.00 167.15 ? 77  LEU A N    1 
ATOM   596  C  CA   . LEU A 1 77  ? 49.466 78.895 21.877  1.00 165.38 ? 77  LEU A CA   1 
ATOM   597  C  C    . LEU A 1 77  ? 49.486 80.254 21.206  1.00 171.54 ? 77  LEU A C    1 
ATOM   598  O  O    . LEU A 1 77  ? 49.003 81.219 21.786  1.00 172.35 ? 77  LEU A O    1 
ATOM   599  C  CB   . LEU A 1 77  ? 50.049 79.049 23.272  1.00 163.34 ? 77  LEU A CB   1 
ATOM   600  C  CG   . LEU A 1 77  ? 49.439 78.144 24.331  1.00 163.35 ? 77  LEU A CG   1 
ATOM   601  C  CD1  . LEU A 1 77  ? 49.601 76.693 23.892  1.00 161.98 ? 77  LEU A CD1  1 
ATOM   602  C  CD2  . LEU A 1 77  ? 50.075 78.399 25.703  1.00 164.28 ? 77  LEU A CD2  1 
ATOM   603  N  N    . CYS A 1 78  ? 50.057 80.341 20.007  1.00 176.91 ? 78  CYS A N    1 
ATOM   604  C  CA   . CYS A 1 78  ? 50.143 81.619 19.291  1.00 174.18 ? 78  CYS A CA   1 
ATOM   605  C  C    . CYS A 1 78  ? 51.033 81.543 18.044  1.00 175.54 ? 78  CYS A C    1 
ATOM   606  O  O    . CYS A 1 78  ? 52.177 81.096 18.124  1.00 173.85 ? 78  CYS A O    1 
ATOM   607  C  CB   . CYS A 1 78  ? 50.667 82.716 20.235  1.00 172.75 ? 78  CYS A CB   1 
ATOM   608  S  SG   . CYS A 1 78  ? 51.304 84.232 19.464  1.00 176.07 ? 78  CYS A SG   1 
ATOM   609  N  N    . SER A 1 79  ? 50.502 81.994 16.908  1.00 173.87 ? 79  SER A N    1 
ATOM   610  C  CA   . SER A 1 79  ? 51.224 82.041 15.628  1.00 174.45 ? 79  SER A CA   1 
ATOM   611  C  C    . SER A 1 79  ? 52.406 81.099 15.407  1.00 179.78 ? 79  SER A C    1 
ATOM   612  O  O    . SER A 1 79  ? 53.471 81.253 16.008  1.00 178.34 ? 79  SER A O    1 
ATOM   613  C  CB   . SER A 1 79  ? 51.638 83.473 15.289  1.00 175.56 ? 79  SER A CB   1 
ATOM   614  O  OG   . SER A 1 79  ? 51.845 83.621 13.893  1.00 180.99 ? 79  SER A OG   1 
ATOM   615  N  N    . GLN A 1 80  ? 52.226 80.166 14.483  1.00 172.91 ? 80  GLN A N    1 
ATOM   616  C  CA   . GLN A 1 80  ? 53.262 79.201 14.144  1.00 175.02 ? 80  GLN A CA   1 
ATOM   617  C  C    . GLN A 1 80  ? 54.405 79.827 13.331  1.00 177.29 ? 80  GLN A C    1 
ATOM   618  O  O    . GLN A 1 80  ? 55.436 79.189 13.112  1.00 176.33 ? 80  GLN A O    1 
ATOM   619  C  CB   . GLN A 1 80  ? 52.638 78.031 13.372  1.00 177.78 ? 80  GLN A CB   1 
ATOM   620  C  CG   . GLN A 1 80  ? 53.580 76.863 13.108  1.00 188.06 ? 80  GLN A CG   1 
ATOM   621  C  CD   . GLN A 1 80  ? 53.375 76.262 11.739  1.00 202.11 ? 80  GLN A CD   1 
ATOM   622  O  OE1  . GLN A 1 80  ? 52.485 76.678 11.003  1.00 196.86 ? 80  GLN A OE1  1 
ATOM   623  N  NE2  . GLN A 1 80  ? 54.242 75.334 11.360  1.00 193.51 ? 80  GLN A NE2  1 
ATOM   624  N  N    . VAL A 1 81  ? 54.220 81.068 12.885  1.00 171.14 ? 81  VAL A N    1 
ATOM   625  C  CA   . VAL A 1 81  ? 55.227 81.767 12.080  1.00 168.72 ? 81  VAL A CA   1 
ATOM   626  C  C    . VAL A 1 81  ? 56.293 82.490 12.892  1.00 177.27 ? 81  VAL A C    1 
ATOM   627  O  O    . VAL A 1 81  ? 57.492 82.232 12.744  1.00 178.22 ? 81  VAL A O    1 
ATOM   628  C  CB   . VAL A 1 81  ? 54.573 82.749 11.115  1.00 166.55 ? 81  VAL A CB   1 
ATOM   629  C  CG1  . VAL A 1 81  ? 55.231 82.663 9.756   1.00 165.33 ? 81  VAL A CG1  1 
ATOM   630  C  CG2  . VAL A 1 81  ? 53.084 82.488 11.026  1.00 165.34 ? 81  VAL A CG2  1 
ATOM   631  N  N    . PRO A 1 82  ? 55.871 83.464 13.710  1.00 175.70 ? 82  PRO A N    1 
ATOM   632  C  CA   . PRO A 1 82  ? 56.819 84.222 14.528  1.00 174.57 ? 82  PRO A CA   1 
ATOM   633  C  C    . PRO A 1 82  ? 57.581 83.263 15.423  1.00 177.28 ? 82  PRO A C    1 
ATOM   634  O  O    . PRO A 1 82  ? 58.806 83.345 15.557  1.00 176.36 ? 82  PRO A O    1 
ATOM   635  C  CB   . PRO A 1 82  ? 55.893 85.055 15.404  1.00 176.10 ? 82  PRO A CB   1 
ATOM   636  C  CG   . PRO A 1 82  ? 54.720 84.140 15.644  1.00 180.59 ? 82  PRO A CG   1 
ATOM   637  C  CD   . PRO A 1 82  ? 54.565 83.325 14.381  1.00 175.99 ? 82  PRO A CD   1 
ATOM   638  N  N    . ALA A 1 83  ? 56.826 82.364 16.048  1.00 175.96 ? 83  ALA A N    1 
ATOM   639  C  CA   . ALA A 1 83  ? 57.385 81.360 16.936  1.00 176.07 ? 83  ALA A CA   1 
ATOM   640  C  C    . ALA A 1 83  ? 58.513 80.644 16.212  1.00 178.61 ? 83  ALA A C    1 
ATOM   641  O  O    . ALA A 1 83  ? 59.611 80.501 16.750  1.00 177.37 ? 83  ALA A O    1 
ATOM   642  C  CB   . ALA A 1 83  ? 56.302 80.360 17.346  1.00 177.06 ? 83  ALA A CB   1 
ATOM   643  N  N    . ALA A 1 84  ? 58.228 80.211 14.985  1.00 177.77 ? 84  ALA A N    1 
ATOM   644  C  CA   . ALA A 1 84  ? 59.183 79.484 14.151  1.00 178.11 ? 84  ALA A CA   1 
ATOM   645  C  C    . ALA A 1 84  ? 60.374 80.335 13.748  1.00 177.09 ? 84  ALA A C    1 
ATOM   646  O  O    . ALA A 1 84  ? 61.493 79.841 13.621  1.00 174.92 ? 84  ALA A O    1 
ATOM   647  C  CB   . ALA A 1 84  ? 58.495 78.941 12.909  1.00 179.51 ? 84  ALA A CB   1 
ATOM   648  N  N    . PHE A 1 85  ? 60.130 81.611 13.505  1.00 174.92 ? 85  PHE A N    1 
ATOM   649  C  CA   . PHE A 1 85  ? 61.215 82.488 13.115  1.00 177.90 ? 85  PHE A CA   1 
ATOM   650  C  C    . PHE A 1 85  ? 62.127 82.742 14.305  1.00 174.16 ? 85  PHE A C    1 
ATOM   651  O  O    . PHE A 1 85  ? 63.331 82.478 14.251  1.00 171.62 ? 85  PHE A O    1 
ATOM   652  C  CB   . PHE A 1 85  ? 60.666 83.814 12.603  1.00 185.75 ? 85  PHE A CB   1 
ATOM   653  C  CG   . PHE A 1 85  ? 61.717 84.702 12.007  1.00 195.52 ? 85  PHE A CG   1 
ATOM   654  C  CD1  . PHE A 1 85  ? 62.049 85.907 12.604  1.00 204.64 ? 85  PHE A CD1  1 
ATOM   655  C  CD2  . PHE A 1 85  ? 62.413 84.302 10.875  1.00 203.89 ? 85  PHE A CD2  1 
ATOM   656  C  CE1  . PHE A 1 85  ? 63.033 86.711 12.060  1.00 208.04 ? 85  PHE A CE1  1 
ATOM   657  C  CE2  . PHE A 1 85  ? 63.401 85.098 10.328  1.00 209.50 ? 85  PHE A CE2  1 
ATOM   658  C  CZ   . PHE A 1 85  ? 63.711 86.304 10.919  1.00 208.31 ? 85  PHE A CZ   1 
ATOM   659  N  N    . ALA A 1 86  ? 61.537 83.281 15.369  1.00 170.13 ? 86  ALA A N    1 
ATOM   660  C  CA   . ALA A 1 86  ? 62.263 83.587 16.598  1.00 170.54 ? 86  ALA A CA   1 
ATOM   661  C  C    . ALA A 1 86  ? 63.122 82.398 17.000  1.00 178.02 ? 86  ALA A C    1 
ATOM   662  O  O    . ALA A 1 86  ? 64.280 82.553 17.400  1.00 178.03 ? 86  ALA A O    1 
ATOM   663  C  CB   . ALA A 1 86  ? 61.292 83.935 17.710  1.00 171.01 ? 86  ALA A CB   1 
ATOM   664  N  N    . GLY A 1 87  ? 62.550 81.208 16.860  1.00 175.27 ? 87  GLY A N    1 
ATOM   665  C  CA   . GLY A 1 87  ? 63.248 79.975 17.162  1.00 175.12 ? 87  GLY A CA   1 
ATOM   666  C  C    . GLY A 1 87  ? 64.396 79.779 16.192  1.00 178.09 ? 87  GLY A C    1 
ATOM   667  O  O    . GLY A 1 87  ? 65.379 79.110 16.508  1.00 177.16 ? 87  GLY A O    1 
ATOM   668  N  N    . LEU A 1 88  ? 64.274 80.384 15.015  1.00 172.88 ? 88  LEU A N    1 
ATOM   669  C  CA   . LEU A 1 88  ? 65.301 80.283 13.999  1.00 171.71 ? 88  LEU A CA   1 
ATOM   670  C  C    . LEU A 1 88  ? 66.506 81.120 14.384  1.00 177.08 ? 88  LEU A C    1 
ATOM   671  O  O    . LEU A 1 88  ? 67.646 80.694 14.236  1.00 176.79 ? 88  LEU A O    1 
ATOM   672  C  CB   . LEU A 1 88  ? 64.749 80.739 12.659  1.00 170.09 ? 88  LEU A CB   1 
ATOM   673  C  CG   . LEU A 1 88  ? 65.705 80.501 11.505  1.00 171.04 ? 88  LEU A CG   1 
ATOM   674  C  CD1  . LEU A 1 88  ? 66.465 81.770 11.199  1.00 169.94 ? 88  LEU A CD1  1 
ATOM   675  C  CD2  . LEU A 1 88  ? 66.659 79.380 11.857  1.00 172.24 ? 88  LEU A CD2  1 
ATOM   676  N  N    . MET A 1 89  ? 66.246 82.313 14.901  1.00 173.37 ? 89  MET A N    1 
ATOM   677  C  CA   . MET A 1 89  ? 67.317 83.206 15.320  1.00 173.37 ? 89  MET A CA   1 
ATOM   678  C  C    . MET A 1 89  ? 68.079 82.579 16.463  1.00 173.37 ? 89  MET A C    1 
ATOM   679  O  O    . MET A 1 89  ? 69.304 82.673 16.536  1.00 253.60 ? 89  MET A O    1 
ATOM   680  C  CB   . MET A 1 89  ? 66.755 84.561 15.742  1.00 173.37 ? 89  MET A CB   1 
ATOM   681  C  CG   . MET A 1 89  ? 66.551 85.508 14.566  1.00 173.37 ? 89  MET A CG   1 
ATOM   682  S  SD   . MET A 1 89  ? 66.468 84.625 12.949  1.00 173.37 ? 89  MET A SD   1 
ATOM   683  C  CE   . MET A 1 89  ? 66.837 85.978 11.717  1.00 173.37 ? 89  MET A CE   1 
ATOM   684  N  N    . TYR A 1 90  ? 67.338 81.928 17.352  1.00 173.29 ? 90  TYR A N    1 
ATOM   685  C  CA   . TYR A 1 90  ? 67.934 81.255 18.492  1.00 173.84 ? 90  TYR A CA   1 
ATOM   686  C  C    . TYR A 1 90  ? 68.982 80.271 18.018  1.00 180.31 ? 90  TYR A C    1 
ATOM   687  O  O    . TYR A 1 90  ? 69.957 80.019 18.718  1.00 179.94 ? 90  TYR A O    1 
ATOM   688  C  CB   . TYR A 1 90  ? 66.882 80.508 19.295  1.00 174.25 ? 90  TYR A CB   1 
ATOM   689  C  CG   . TYR A 1 90  ? 67.420 79.935 20.578  1.00 173.87 ? 90  TYR A CG   1 
ATOM   690  C  CD1  . TYR A 1 90  ? 68.213 78.799 20.576  1.00 175.37 ? 90  TYR A CD1  1 
ATOM   691  C  CD2  . TYR A 1 90  ? 67.155 80.547 21.795  1.00 173.78 ? 90  TYR A CD2  1 
ATOM   692  C  CE1  . TYR A 1 90  ? 68.706 78.271 21.762  1.00 175.25 ? 90  TYR A CE1  1 
ATOM   693  C  CE2  . TYR A 1 90  ? 67.637 80.027 22.984  1.00 174.17 ? 90  TYR A CE2  1 
ATOM   694  C  CZ   . TYR A 1 90  ? 68.412 78.891 22.963  1.00 180.00 ? 90  TYR A CZ   1 
ATOM   695  O  OH   . TYR A 1 90  ? 68.893 78.380 24.146  1.00 179.98 ? 90  TYR A OH   1 
ATOM   696  N  N    . LEU A 1 91  ? 68.770 79.707 16.832  1.00 177.83 ? 91  LEU A N    1 
ATOM   697  C  CA   . LEU A 1 91  ? 69.719 78.759 16.251  1.00 179.50 ? 91  LEU A CA   1 
ATOM   698  C  C    . LEU A 1 91  ? 70.934 79.504 15.707  1.00 182.65 ? 91  LEU A C    1 
ATOM   699  O  O    . LEU A 1 91  ? 71.992 78.907 15.473  1.00 181.32 ? 91  LEU A O    1 
ATOM   700  C  CB   . LEU A 1 91  ? 69.064 77.926 15.144  1.00 181.40 ? 91  LEU A CB   1 
ATOM   701  C  CG   . LEU A 1 91  ? 68.609 76.526 15.565  1.00 189.85 ? 91  LEU A CG   1 
ATOM   702  C  CD1  . LEU A 1 91  ? 68.051 76.541 16.985  1.00 191.26 ? 91  LEU A CD1  1 
ATOM   703  C  CD2  . LEU A 1 91  ? 67.575 75.984 14.607  1.00 193.55 ? 91  LEU A CD2  1 
ATOM   704  N  N    . PHE A 1 92  ? 70.778 80.815 15.528  1.00 180.93 ? 92  PHE A N    1 
ATOM   705  C  CA   . PHE A 1 92  ? 71.868 81.663 15.055  1.00 183.31 ? 92  PHE A CA   1 
ATOM   706  C  C    . PHE A 1 92  ? 72.707 82.156 16.219  1.00 180.89 ? 92  PHE A C    1 
ATOM   707  O  O    . PHE A 1 92  ? 73.933 82.146 16.152  1.00 178.62 ? 92  PHE A O    1 
ATOM   708  C  CB   . PHE A 1 92  ? 71.341 82.817 14.221  1.00 189.35 ? 92  PHE A CB   1 
ATOM   709  C  CG   . PHE A 1 92  ? 70.787 82.375 12.911  1.00 195.93 ? 92  PHE A CG   1 
ATOM   710  C  CD1  . PHE A 1 92  ? 70.974 81.070 12.490  1.00 202.45 ? 92  PHE A CD1  1 
ATOM   711  C  CD2  . PHE A 1 92  ? 70.056 83.235 12.116  1.00 201.73 ? 92  PHE A CD2  1 
ATOM   712  C  CE1  . PHE A 1 92  ? 70.452 80.633 11.292  1.00 204.81 ? 92  PHE A CE1  1 
ATOM   713  C  CE2  . PHE A 1 92  ? 69.531 82.806 10.907  1.00 206.17 ? 92  PHE A CE2  1 
ATOM   714  C  CZ   . PHE A 1 92  ? 69.729 81.504 10.496  1.00 204.66 ? 92  PHE A CZ   1 
ATOM   715  N  N    . VAL A 1 93  ? 72.047 82.530 17.309  1.00 177.93 ? 93  VAL A N    1 
ATOM   716  C  CA   . VAL A 1 93  ? 72.753 82.938 18.516  1.00 178.52 ? 93  VAL A CA   1 
ATOM   717  C  C    . VAL A 1 93  ? 73.555 81.742 19.014  1.00 182.06 ? 93  VAL A C    1 
ATOM   718  O  O    . VAL A 1 93  ? 74.717 81.871 19.400  1.00 180.78 ? 93  VAL A O    1 
ATOM   719  C  CB   . VAL A 1 93  ? 71.769 83.379 19.604  1.00 183.64 ? 93  VAL A CB   1 
ATOM   720  C  CG1  . VAL A 1 93  ? 72.494 84.148 20.701  1.00 183.67 ? 93  VAL A CG1  1 
ATOM   721  C  CG2  . VAL A 1 93  ? 70.642 84.192 19.002  1.00 183.68 ? 93  VAL A CG2  1 
ATOM   722  N  N    . ARG A 1 94  ? 72.902 80.582 19.017  1.00 180.22 ? 94  ARG A N    1 
ATOM   723  C  CA   . ARG A 1 94  ? 73.510 79.332 19.444  1.00 181.78 ? 94  ARG A CA   1 
ATOM   724  C  C    . ARG A 1 94  ? 74.785 79.108 18.673  1.00 191.62 ? 94  ARG A C    1 
ATOM   725  O  O    . ARG A 1 94  ? 75.796 78.708 19.232  1.00 191.78 ? 94  ARG A O    1 
ATOM   726  C  CB   . ARG A 1 94  ? 72.569 78.165 19.167  1.00 179.95 ? 94  ARG A CB   1 
ATOM   727  C  CG   . ARG A 1 94  ? 71.706 77.802 20.349  1.00 181.26 ? 94  ARG A CG   1 
ATOM   728  C  CD   . ARG A 1 94  ? 72.231 76.569 21.050  1.00 176.98 ? 94  ARG A CD   1 
ATOM   729  N  NE   . ARG A 1 94  ? 71.599 75.360 20.538  1.00 172.12 ? 94  ARG A NE   1 
ATOM   730  C  CZ   . ARG A 1 94  ? 70.597 74.727 21.140  1.00 177.91 ? 94  ARG A CZ   1 
ATOM   731  N  NH1  . ARG A 1 94  ? 70.105 75.186 22.289  1.00 163.37 ? 94  ARG A NH1  1 
ATOM   732  N  NH2  . ARG A 1 94  ? 70.092 73.631 20.591  1.00 162.78 ? 94  ARG A NH2  1 
ATOM   733  N  N    . GLN A 1 95  ? 74.730 79.348 17.373  1.00 195.11 ? 95  GLN A N    1 
ATOM   734  C  CA   . GLN A 1 95  ? 75.903 79.173 16.542  1.00 196.16 ? 95  GLN A CA   1 
ATOM   735  C  C    . GLN A 1 95  ? 76.987 80.174 16.933  1.00 183.99 ? 95  GLN A C    1 
ATOM   736  O  O    . GLN A 1 95  ? 78.149 79.813 17.130  1.00 200.51 ? 95  GLN A O    1 
ATOM   737  C  CB   . GLN A 1 95  ? 75.535 79.346 15.072  1.00 197.75 ? 95  GLN A CB   1 
ATOM   738  C  CG   . GLN A 1 95  ? 76.241 78.370 14.167  1.00 206.42 ? 95  GLN A CG   1 
ATOM   739  C  CD   . GLN A 1 95  ? 76.999 77.323 14.953  1.00 218.75 ? 95  GLN A CD   1 
ATOM   740  O  OE1  . GLN A 1 95  ? 76.423 76.332 15.403  1.00 213.23 ? 95  GLN A OE1  1 
ATOM   741  N  NE2  . GLN A 1 95  ? 78.289 77.562 15.165  1.00 209.89 ? 95  GLN A NE2  1 
ATOM   742  N  N    . LYS A 1 96  ? 76.586 81.434 17.054  1.00 194.76 ? 96  LYS A N    1 
ATOM   743  C  CA   . LYS A 1 96  ? 77.498 82.523 17.377  1.00 194.76 ? 96  LYS A CA   1 
ATOM   744  C  C    . LYS A 1 96  ? 78.028 82.485 18.804  1.00 194.76 ? 96  LYS A C    1 
ATOM   745  O  O    . LYS A 1 96  ? 79.067 83.076 19.103  1.00 194.76 ? 96  LYS A O    1 
ATOM   746  C  CB   . LYS A 1 96  ? 76.826 83.870 17.095  1.00 194.76 ? 96  LYS A CB   1 
ATOM   747  C  CG   . LYS A 1 96  ? 76.803 84.263 15.610  1.00 194.76 ? 96  LYS A CG   1 
ATOM   748  C  CD   . LYS A 1 96  ? 76.669 83.038 14.694  1.00 194.76 ? 96  LYS A CD   1 
ATOM   749  C  CE   . LYS A 1 96  ? 77.716 83.034 13.575  1.00 194.76 ? 96  LYS A CE   1 
ATOM   750  N  NZ   . LYS A 1 96  ? 77.767 81.728 12.846  1.00 194.76 ? 96  LYS A NZ   1 
ATOM   751  N  N    . TYR A 1 97  ? 77.311 81.802 19.688  1.00 186.91 ? 97  TYR A N    1 
ATOM   752  C  CA   . TYR A 1 97  ? 77.748 81.686 21.075  1.00 202.93 ? 97  TYR A CA   1 
ATOM   753  C  C    . TYR A 1 97  ? 78.677 80.487 21.223  1.00 210.02 ? 97  TYR A C    1 
ATOM   754  O  O    . TYR A 1 97  ? 79.743 80.589 21.826  1.00 209.51 ? 97  TYR A O    1 
ATOM   755  C  CB   . TYR A 1 97  ? 76.553 81.558 22.029  1.00 201.74 ? 97  TYR A CB   1 
ATOM   756  C  CG   . TYR A 1 97  ? 76.909 81.031 23.410  1.00 198.79 ? 97  TYR A CG   1 
ATOM   757  C  CD1  . TYR A 1 97  ? 78.137 81.317 23.992  1.00 199.76 ? 97  TYR A CD1  1 
ATOM   758  C  CD2  . TYR A 1 97  ? 76.005 80.270 24.145  1.00 198.15 ? 97  TYR A CD2  1 
ATOM   759  C  CE1  . TYR A 1 97  ? 78.467 80.836 25.251  1.00 199.10 ? 97  TYR A CE1  1 
ATOM   760  C  CE2  . TYR A 1 97  ? 76.325 79.792 25.415  1.00 198.31 ? 97  TYR A CE2  1 
ATOM   761  C  CZ   . TYR A 1 97  ? 77.559 80.081 25.961  1.00 203.34 ? 97  TYR A CZ   1 
ATOM   762  O  OH   . TYR A 1 97  ? 77.896 79.618 27.216  1.00 202.92 ? 97  TYR A OH   1 
ATOM   763  N  N    . PHE A 1 98  ? 78.264 79.352 20.669  1.00 206.54 ? 98  PHE A N    1 
ATOM   764  C  CA   . PHE A 1 98  ? 79.060 78.133 20.738  1.00 206.15 ? 98  PHE A CA   1 
ATOM   765  C  C    . PHE A 1 98  ? 80.281 78.257 19.830  1.00 219.77 ? 98  PHE A C    1 
ATOM   766  O  O    . PHE A 1 98  ? 81.180 77.417 19.855  1.00 220.50 ? 98  PHE A O    1 
ATOM   767  C  CB   . PHE A 1 98  ? 78.198 76.915 20.392  1.00 203.42 ? 98  PHE A CB   1 
ATOM   768  C  CG   . PHE A 1 98  ? 78.968 75.750 19.851  1.00 197.67 ? 98  PHE A CG   1 
ATOM   769  C  CD1  . PHE A 1 98  ? 79.617 74.877 20.706  1.00 194.66 ? 98  PHE A CD1  1 
ATOM   770  C  CD2  . PHE A 1 98  ? 79.015 75.507 18.485  1.00 193.34 ? 98  PHE A CD2  1 
ATOM   771  C  CE1  . PHE A 1 98  ? 80.318 73.788 20.206  1.00 192.67 ? 98  PHE A CE1  1 
ATOM   772  C  CE2  . PHE A 1 98  ? 79.708 74.420 17.976  1.00 192.89 ? 98  PHE A CE2  1 
ATOM   773  C  CZ   . PHE A 1 98  ? 80.364 73.561 18.835  1.00 190.09 ? 98  PHE A CZ   1 
ATOM   774  N  N    . VAL A 1 99  ? 80.334 79.349 19.073  1.00 219.26 ? 99  VAL A N    1 
ATOM   775  C  CA   . VAL A 1 99  ? 81.458 79.604 18.190  1.00 224.97 ? 99  VAL A CA   1 
ATOM   776  C  C    . VAL A 1 99  ? 82.521 80.440 18.912  1.00 224.54 ? 99  VAL A C    1 
ATOM   777  O  O    . VAL A 1 99  ? 83.682 80.028 19.016  1.00 222.60 ? 99  VAL A O    1 
ATOM   778  C  CB   . VAL A 1 99  ? 80.982 80.223 16.866  1.00 240.45 ? 99  VAL A CB   1 
ATOM   779  C  CG1  . VAL A 1 99  ? 81.338 81.691 16.793  1.00 242.21 ? 99  VAL A CG1  1 
ATOM   780  C  CG2  . VAL A 1 99  ? 81.532 79.448 15.678  1.00 242.23 ? 99  VAL A CG2  1 
ATOM   781  N  N    . GLY A 1 100 ? 82.108 81.578 19.465  1.00 229.28 ? 100 GLY A N    1 
ATOM   782  C  CA   . GLY A 1 100 ? 83.002 82.458 20.198  1.00 230.26 ? 100 GLY A CA   1 
ATOM   783  C  C    . GLY A 1 100 ? 83.548 81.809 21.454  1.00 221.77 ? 100 GLY A C    1 
ATOM   784  O  O    . GLY A 1 100 ? 84.593 82.201 21.978  1.00 236.45 ? 100 GLY A O    1 
ATOM   785  N  N    . TYR A 1 101 ? 82.830 80.808 21.943  1.00 239.51 ? 101 TYR A N    1 
ATOM   786  C  CA   . TYR A 1 101 ? 83.244 80.086 23.131  1.00 224.68 ? 101 TYR A CA   1 
ATOM   787  C  C    . TYR A 1 101 ? 84.253 79.021 22.734  1.00 242.46 ? 101 TYR A C    1 
ATOM   788  O  O    . TYR A 1 101 ? 84.277 77.924 23.290  1.00 225.00 ? 101 TYR A O    1 
ATOM   789  C  CB   . TYR A 1 101 ? 82.035 79.451 23.792  1.00 225.23 ? 101 TYR A CB   1 
ATOM   790  C  CG   . TYR A 1 101 ? 82.143 79.375 25.284  1.00 224.93 ? 101 TYR A CG   1 
ATOM   791  C  CD1  . TYR A 1 101 ? 83.354 79.583 25.920  1.00 225.74 ? 101 TYR A CD1  1 
ATOM   792  C  CD2  . TYR A 1 101 ? 81.031 79.082 26.059  1.00 225.15 ? 101 TYR A CD2  1 
ATOM   793  C  CE1  . TYR A 1 101 ? 83.453 79.498 27.287  1.00 224.83 ? 101 TYR A CE1  1 
ATOM   794  C  CE2  . TYR A 1 101 ? 81.117 78.999 27.426  1.00 225.17 ? 101 TYR A CE2  1 
ATOM   795  C  CZ   . TYR A 1 101 ? 82.330 79.207 28.034  1.00 227.06 ? 101 TYR A CZ   1 
ATOM   796  O  OH   . TYR A 1 101 ? 82.423 79.088 29.394  1.00 225.61 ? 101 TYR A OH   1 
ATOM   797  N  N    . LEU A 1 102 ? 85.039 79.346 21.713  1.00 241.30 ? 102 LEU A N    1 
ATOM   798  C  CA   . LEU A 1 102 ? 86.089 78.473 21.203  1.00 263.12 ? 102 LEU A CA   1 
ATOM   799  C  C    . LEU A 1 102 ? 87.314 79.337 20.933  1.00 254.02 ? 102 LEU A C    1 
ATOM   800  O  O    . LEU A 1 102 ? 88.116 79.589 21.835  1.00 250.65 ? 102 LEU A O    1 
ATOM   801  C  CB   . LEU A 1 102 ? 85.656 77.771 19.913  1.00 272.05 ? 102 LEU A CB   1 
ATOM   802  C  CG   . LEU A 1 102 ? 86.816 77.236 19.067  1.00 293.44 ? 102 LEU A CG   1 
ATOM   803  C  CD1  . LEU A 1 102 ? 86.978 75.736 19.205  1.00 299.01 ? 102 LEU A CD1  1 
ATOM   804  C  CD2  . LEU A 1 102 ? 86.676 77.644 17.617  1.00 299.01 ? 102 LEU A CD2  1 
ATOM   805  N  N    . GLY A 1 103 ? 87.425 79.835 19.705  1.00 253.88 ? 103 GLY A N    1 
ATOM   806  C  CA   . GLY A 1 103 ? 88.540 80.674 19.313  1.00 253.35 ? 103 GLY A CA   1 
ATOM   807  C  C    . GLY A 1 103 ? 89.866 80.063 19.723  1.00 255.65 ? 103 GLY A C    1 
ATOM   808  O  O    . GLY A 1 103 ? 90.182 78.934 19.347  1.00 254.47 ? 103 GLY A O    1 
ATOM   809  N  N    . GLU A 1 104 ? 90.628 80.811 20.514  1.00 255.58 ? 104 GLU A N    1 
ATOM   810  C  CA   . GLU A 1 104 ? 91.934 80.375 20.998  1.00 256.96 ? 104 GLU A CA   1 
ATOM   811  C  C    . GLU A 1 104 ? 92.614 81.599 21.580  1.00 268.67 ? 104 GLU A C    1 
ATOM   812  O  O    . GLU A 1 104 ? 92.722 82.622 20.906  1.00 269.47 ? 104 GLU A O    1 
ATOM   813  C  CB   . GLU A 1 104 ? 92.780 79.829 19.847  1.00 257.84 ? 104 GLU A CB   1 
ATOM   814  C  CG   . GLU A 1 104 ? 93.144 78.362 19.982  1.00 263.95 ? 104 GLU A CG   1 
ATOM   815  C  CD   . GLU A 1 104 ? 92.586 77.518 18.851  1.00 273.02 ? 104 GLU A CD   1 
ATOM   816  O  OE1  . GLU A 1 104 ? 93.293 77.349 17.832  1.00 263.98 ? 104 GLU A OE1  1 
ATOM   817  O  OE2  . GLU A 1 104 ? 91.441 77.025 18.980  1.00 263.73 ? 104 GLU A OE2  1 
ATOM   818  N  N    . ARG A 1 105 ? 93.048 81.510 22.836  1.00 268.55 ? 105 ARG A N    1 
ATOM   819  C  CA   . ARG A 1 105 ? 93.680 82.640 23.522  1.00 269.56 ? 105 ARG A CA   1 
ATOM   820  C  C    . ARG A 1 105 ? 92.755 83.859 23.579  1.00 279.04 ? 105 ARG A C    1 
ATOM   821  O  O    . ARG A 1 105 ? 92.724 84.574 24.581  1.00 279.52 ? 105 ARG A O    1 
ATOM   822  C  CB   . ARG A 1 105 ? 95.022 83.019 22.881  1.00 266.03 ? 105 ARG A CB   1 
ATOM   823  C  CG   . ARG A 1 105 ? 95.528 82.053 21.817  1.00 262.21 ? 105 ARG A CG   1 
ATOM   824  C  CD   . ARG A 1 105 ? 95.475 82.685 20.428  1.00 252.63 ? 105 ARG A CD   1 
ATOM   825  N  NE   . ARG A 1 105 ? 96.804 82.838 19.840  1.00 245.38 ? 105 ARG A NE   1 
ATOM   826  C  CZ   . ARG A 1 105 ? 97.523 83.956 19.892  1.00 251.05 ? 105 ARG A CZ   1 
ATOM   827  N  NH1  . ARG A 1 105 ? 97.045 85.032 20.504  1.00 236.65 ? 105 ARG A NH1  1 
ATOM   828  N  NH2  . ARG A 1 105 ? 98.724 83.997 19.330  1.00 236.06 ? 105 ARG A NH2  1 
ATOM   829  N  N    . THR A 1 106 ? 92.010 84.087 22.499  1.00 277.53 ? 106 THR A N    1 
ATOM   830  C  CA   . THR A 1 106 ? 91.063 85.192 22.415  1.00 274.02 ? 106 THR A CA   1 
ATOM   831  C  C    . THR A 1 106 ? 90.073 85.080 23.563  1.00 244.17 ? 106 THR A C    1 
ATOM   832  O  O    . THR A 1 106 ? 89.848 83.992 24.097  1.00 263.30 ? 106 THR A O    1 
ATOM   833  C  CB   . THR A 1 106 ? 90.334 85.212 21.053  1.00 289.02 ? 106 THR A CB   1 
ATOM   834  O  OG1  . THR A 1 106 ? 91.284 85.417 19.999  1.00 289.53 ? 106 THR A OG1  1 
ATOM   835  C  CG2  . THR A 1 106 ? 89.299 86.326 21.016  1.00 288.56 ? 106 THR A CG2  1 
ATOM   836  N  N    . GLN A 1 107 ? 89.493 86.211 23.946  1.00 242.05 ? 107 GLN A N    1 
ATOM   837  C  CA   . GLN A 1 107 ? 88.542 86.246 25.051  1.00 227.26 ? 107 GLN A CA   1 
ATOM   838  C  C    . GLN A 1 107 ? 87.320 85.358 24.809  1.00 243.48 ? 107 GLN A C    1 
ATOM   839  O  O    . GLN A 1 107 ? 86.228 85.861 24.522  1.00 227.26 ? 107 GLN A O    1 
ATOM   840  C  CB   . GLN A 1 107 ? 88.107 87.687 25.336  1.00 227.81 ? 107 GLN A CB   1 
ATOM   841  C  CG   . GLN A 1 107 ? 88.259 88.635 24.149  1.00 227.26 ? 107 GLN A CG   1 
ATOM   842  C  CD   . GLN A 1 107 ? 87.368 89.866 24.262  1.00 231.49 ? 107 GLN A CD   1 
ATOM   843  O  OE1  . GLN A 1 107 ? 86.145 89.777 24.131  1.00 227.26 ? 107 GLN A OE1  1 
ATOM   844  N  NE2  . GLN A 1 107 ? 87.981 91.023 24.497  1.00 227.26 ? 107 GLN A NE2  1 
ATOM   845  N  N    . SER A 1 108 ? 87.505 84.043 24.940  1.00 239.22 ? 108 SER A N    1 
ATOM   846  C  CA   . SER A 1 108 ? 86.414 83.090 24.740  1.00 260.58 ? 108 SER A CA   1 
ATOM   847  C  C    . SER A 1 108 ? 85.185 83.509 25.537  1.00 242.73 ? 108 SER A C    1 
ATOM   848  O  O    . SER A 1 108 ? 85.236 83.627 26.762  1.00 258.57 ? 108 SER A O    1 
ATOM   849  C  CB   . SER A 1 108 ? 86.842 81.669 25.115  1.00 270.96 ? 108 SER A CB   1 
ATOM   850  O  OG   . SER A 1 108 ? 85.879 80.720 24.682  1.00 280.57 ? 108 SER A OG   1 
ATOM   851  N  N    . THR A 1 109 ? 84.098 83.767 24.816  1.00 237.94 ? 109 THR A N    1 
ATOM   852  C  CA   . THR A 1 109 ? 82.847 84.229 25.406  1.00 225.04 ? 109 THR A CA   1 
ATOM   853  C  C    . THR A 1 109 ? 82.454 83.539 26.706  1.00 238.78 ? 109 THR A C    1 
ATOM   854  O  O    . THR A 1 109 ? 82.406 82.306 26.784  1.00 225.60 ? 109 THR A O    1 
ATOM   855  C  CB   . THR A 1 109 ? 81.691 84.194 24.390  1.00 227.24 ? 109 THR A CB   1 
ATOM   856  O  OG1  . THR A 1 109 ? 81.691 82.934 23.706  1.00 225.63 ? 109 THR A OG1  1 
ATOM   857  C  CG2  . THR A 1 109 ? 81.836 85.326 23.381  1.00 225.21 ? 109 THR A CG2  1 
ATOM   858  N  N    . PRO A 1 110 ? 82.144 84.340 27.741  1.00 232.92 ? 110 PRO A N    1 
ATOM   859  C  CA   . PRO A 1 110 ? 81.686 83.881 29.053  1.00 243.01 ? 110 PRO A CA   1 
ATOM   860  C  C    . PRO A 1 110 ? 80.165 83.718 29.055  1.00 231.22 ? 110 PRO A C    1 
ATOM   861  O  O    . PRO A 1 110 ? 79.532 83.656 27.998  1.00 226.97 ? 110 PRO A O    1 
ATOM   862  C  CB   . PRO A 1 110 ? 82.087 85.033 29.987  1.00 250.19 ? 110 PRO A CB   1 
ATOM   863  C  CG   . PRO A 1 110 ? 83.186 85.787 29.267  1.00 260.21 ? 110 PRO A CG   1 
ATOM   864  C  CD   . PRO A 1 110 ? 83.286 85.267 27.854  1.00 252.56 ? 110 PRO A CD   1 
ATOM   865  N  N    . GLY A 1 111 ? 79.586 83.671 30.250  1.00 224.59 ? 111 GLY A N    1 
ATOM   866  C  CA   . GLY A 1 111 ? 78.155 83.530 30.425  1.00 225.15 ? 111 GLY A CA   1 
ATOM   867  C  C    . GLY A 1 111 ? 77.548 82.453 29.553  1.00 232.29 ? 111 GLY A C    1 
ATOM   868  O  O    . GLY A 1 111 ? 77.558 82.551 28.329  1.00 232.53 ? 111 GLY A O    1 
ATOM   869  N  N    . TYR A 1 112 ? 77.008 81.419 30.185  1.00 226.22 ? 112 TYR A N    1 
ATOM   870  C  CA   . TYR A 1 112 ? 76.374 80.351 29.435  1.00 222.66 ? 112 TYR A CA   1 
ATOM   871  C  C    . TYR A 1 112 ? 74.908 80.668 29.173  1.00 245.17 ? 112 TYR A C    1 
ATOM   872  O  O    . TYR A 1 112 ? 74.212 79.938 28.462  1.00 248.91 ? 112 TYR A O    1 
ATOM   873  C  CB   . TYR A 1 112 ? 76.630 78.972 30.065  1.00 208.15 ? 112 TYR A CB   1 
ATOM   874  C  CG   . TYR A 1 112 ? 75.650 78.479 31.121  1.00 183.18 ? 112 TYR A CG   1 
ATOM   875  C  CD1  . TYR A 1 112 ? 75.138 79.329 32.102  1.00 180.52 ? 112 TYR A CD1  1 
ATOM   876  C  CD2  . TYR A 1 112 ? 75.332 77.120 31.197  1.00 176.79 ? 112 TYR A CD2  1 
ATOM   877  C  CE1  . TYR A 1 112 ? 74.268 78.845 33.083  1.00 176.78 ? 112 TYR A CE1  1 
ATOM   878  C  CE2  . TYR A 1 112 ? 74.477 76.627 32.169  1.00 174.91 ? 112 TYR A CE2  1 
ATOM   879  C  CZ   . TYR A 1 112 ? 73.949 77.487 33.113  1.00 178.36 ? 112 TYR A CZ   1 
ATOM   880  O  OH   . TYR A 1 112 ? 73.104 76.969 34.077  1.00 177.23 ? 112 TYR A OH   1 
ATOM   881  N  N    . ILE A 1 113 ? 74.480 81.818 29.692  1.00 236.93 ? 113 ILE A N    1 
ATOM   882  C  CA   . ILE A 1 113 ? 73.129 82.320 29.484  1.00 233.58 ? 113 ILE A CA   1 
ATOM   883  C  C    . ILE A 1 113 ? 73.148 83.086 28.179  1.00 221.85 ? 113 ILE A C    1 
ATOM   884  O  O    . ILE A 1 113 ? 73.857 84.079 28.055  1.00 224.24 ? 113 ILE A O    1 
ATOM   885  C  CB   . ILE A 1 113 ? 72.722 83.306 30.578  1.00 236.87 ? 113 ILE A CB   1 
ATOM   886  C  CG1  . ILE A 1 113 ? 72.544 82.621 31.926  1.00 236.68 ? 113 ILE A CG1  1 
ATOM   887  C  CG2  . ILE A 1 113 ? 71.461 84.033 30.173  1.00 237.24 ? 113 ILE A CG2  1 
ATOM   888  C  CD1  . ILE A 1 113 ? 72.302 83.625 33.025  1.00 242.96 ? 113 ILE A CD1  1 
ATOM   889  N  N    . PHE A 1 114 ? 72.354 82.657 27.210  1.00 215.81 ? 114 PHE A N    1 
ATOM   890  C  CA   . PHE A 1 114 ? 72.327 83.371 25.947  1.00 207.92 ? 114 PHE A CA   1 
ATOM   891  C  C    . PHE A 1 114 ? 70.955 83.434 25.290  1.00 215.90 ? 114 PHE A C    1 
ATOM   892  O  O    . PHE A 1 114 ? 70.053 82.657 25.612  1.00 211.53 ? 114 PHE A O    1 
ATOM   893  C  CB   . PHE A 1 114 ? 73.398 82.855 24.992  1.00 205.97 ? 114 PHE A CB   1 
ATOM   894  C  CG   . PHE A 1 114 ? 73.039 81.566 24.328  1.00 205.56 ? 114 PHE A CG   1 
ATOM   895  C  CD1  . PHE A 1 114 ? 72.742 80.447 25.085  1.00 206.51 ? 114 PHE A CD1  1 
ATOM   896  C  CD2  . PHE A 1 114 ? 72.982 81.477 22.946  1.00 205.66 ? 114 PHE A CD2  1 
ATOM   897  C  CE1  . PHE A 1 114 ? 72.404 79.258 24.476  1.00 206.53 ? 114 PHE A CE1  1 
ATOM   898  C  CE2  . PHE A 1 114 ? 72.645 80.293 22.328  1.00 207.31 ? 114 PHE A CE2  1 
ATOM   899  C  CZ   . PHE A 1 114 ? 72.355 79.179 23.094  1.00 205.21 ? 114 PHE A CZ   1 
ATOM   900  N  N    . GLY A 1 115 ? 70.817 84.392 24.379  1.00 209.51 ? 115 GLY A N    1 
ATOM   901  C  CA   . GLY A 1 115 ? 69.596 84.708 23.667  1.00 213.70 ? 115 GLY A CA   1 
ATOM   902  C  C    . GLY A 1 115 ? 68.419 84.980 24.579  1.00 219.70 ? 115 GLY A C    1 
ATOM   903  O  O    . GLY A 1 115 ? 67.281 84.744 24.186  1.00 219.51 ? 115 GLY A O    1 
ATOM   904  N  N    . LYS A 1 116 ? 68.700 85.458 25.789  1.00 205.34 ? 116 LYS A N    1 
ATOM   905  C  CA   . LYS A 1 116 ? 67.688 85.770 26.797  1.00 203.85 ? 116 LYS A CA   1 
ATOM   906  C  C    . LYS A 1 116 ? 66.448 86.395 26.172  1.00 209.93 ? 116 LYS A C    1 
ATOM   907  O  O    . LYS A 1 116 ? 65.315 86.052 26.521  1.00 210.58 ? 116 LYS A O    1 
ATOM   908  C  CB   . LYS A 1 116 ? 68.290 86.767 27.781  1.00 203.08 ? 116 LYS A CB   1 
ATOM   909  C  CG   . LYS A 1 116 ? 67.974 86.515 29.238  1.00 181.93 ? 116 LYS A CG   1 
ATOM   910  C  CD   . LYS A 1 116 ? 68.931 87.318 30.143  1.00 171.58 ? 116 LYS A CD   1 
ATOM   911  C  CE   . LYS A 1 116 ? 68.407 88.735 30.461  1.00 164.43 ? 116 LYS A CE   1 
ATOM   912  N  NZ   . LYS A 1 116 ? 68.507 89.109 31.913  1.00 167.63 ? 116 LYS A NZ   1 
ATOM   913  N  N    . ARG A 1 117 ? 66.680 87.310 25.235  1.00 202.28 ? 117 ARG A N    1 
ATOM   914  C  CA   . ARG A 1 117 ? 65.594 88.009 24.563  1.00 201.20 ? 117 ARG A CA   1 
ATOM   915  C  C    . ARG A 1 117 ? 64.703 87.084 23.723  1.00 196.92 ? 117 ARG A C    1 
ATOM   916  O  O    . ARG A 1 117 ? 63.475 87.162 23.798  1.00 194.97 ? 117 ARG A O    1 
ATOM   917  C  CB   . ARG A 1 117 ? 66.116 89.213 23.762  1.00 209.14 ? 117 ARG A CB   1 
ATOM   918  C  CG   . ARG A 1 117 ? 66.718 90.334 24.628  1.00 240.02 ? 117 ARG A CG   1 
ATOM   919  C  CD   . ARG A 1 117 ? 65.774 91.537 24.790  1.00 271.69 ? 117 ARG A CD   1 
ATOM   920  N  NE   . ARG A 1 117 ? 65.943 92.214 26.080  1.00 293.68 ? 117 ARG A NE   1 
ATOM   921  C  CZ   . ARG A 1 117 ? 65.648 93.493 26.311  1.00 299.97 ? 117 ARG A CZ   1 
ATOM   922  N  NH1  . ARG A 1 117 ? 65.167 94.255 25.338  1.00 299.97 ? 117 ARG A NH1  1 
ATOM   923  N  NH2  . ARG A 1 117 ? 65.838 94.012 27.519  1.00 299.97 ? 117 ARG A NH2  1 
ATOM   924  N  N    . ILE A 1 118 ? 65.305 86.178 22.960  1.00 189.89 ? 118 ILE A N    1 
ATOM   925  C  CA   . ILE A 1 118 ? 64.496 85.268 22.165  1.00 188.64 ? 118 ILE A CA   1 
ATOM   926  C  C    . ILE A 1 118 ? 63.513 84.485 23.023  1.00 188.42 ? 118 ILE A C    1 
ATOM   927  O  O    . ILE A 1 118 ? 62.307 84.655 22.885  1.00 187.27 ? 118 ILE A O    1 
ATOM   928  C  CB   . ILE A 1 118 ? 65.325 84.346 21.268  1.00 192.07 ? 118 ILE A CB   1 
ATOM   929  C  CG1  . ILE A 1 118 ? 66.045 85.157 20.193  1.00 192.64 ? 118 ILE A CG1  1 
ATOM   930  C  CG2  . ILE A 1 118 ? 64.412 83.328 20.585  1.00 192.93 ? 118 ILE A CG2  1 
ATOM   931  C  CD1  . ILE A 1 118 ? 65.967 84.533 18.807  1.00 200.13 ? 118 ILE A CD1  1 
ATOM   932  N  N    . ILE A 1 119 ? 64.032 83.628 23.902  1.00 180.25 ? 119 ILE A N    1 
ATOM   933  C  CA   . ILE A 1 119 ? 63.188 82.802 24.774  1.00 177.34 ? 119 ILE A CA   1 
ATOM   934  C  C    . ILE A 1 119 ? 62.221 83.665 25.558  1.00 186.37 ? 119 ILE A C    1 
ATOM   935  O  O    . ILE A 1 119 ? 61.086 83.271 25.832  1.00 188.33 ? 119 ILE A O    1 
ATOM   936  C  CB   . ILE A 1 119 ? 64.007 81.894 25.726  1.00 175.52 ? 119 ILE A CB   1 
ATOM   937  C  CG1  . ILE A 1 119 ? 65.062 82.705 26.475  1.00 173.47 ? 119 ILE A CG1  1 
ATOM   938  C  CG2  . ILE A 1 119 ? 64.651 80.732 24.960  1.00 174.40 ? 119 ILE A CG2  1 
ATOM   939  C  CD1  . ILE A 1 119 ? 66.475 82.277 26.142  1.00 177.75 ? 119 ILE A CD1  1 
ATOM   940  N  N    . LEU A 1 120 ? 62.687 84.844 25.936  1.00 177.34 ? 120 LEU A N    1 
ATOM   941  C  CA   . LEU A 1 120 ? 61.844 85.770 26.657  1.00 175.18 ? 120 LEU A CA   1 
ATOM   942  C  C    . LEU A 1 120 ? 60.636 86.043 25.762  1.00 178.17 ? 120 LEU A C    1 
ATOM   943  O  O    . LEU A 1 120 ? 59.482 85.845 26.164  1.00 176.81 ? 120 LEU A O    1 
ATOM   944  C  CB   . LEU A 1 120 ? 62.619 87.059 26.932  1.00 174.68 ? 120 LEU A CB   1 
ATOM   945  C  CG   . LEU A 1 120 ? 61.792 88.176 27.551  1.00 178.82 ? 120 LEU A CG   1 
ATOM   946  C  CD1  . LEU A 1 120 ? 61.093 88.926 26.432  1.00 178.83 ? 120 LEU A CD1  1 
ATOM   947  C  CD2  . LEU A 1 120 ? 60.787 87.586 28.532  1.00 181.13 ? 120 LEU A CD2  1 
ATOM   948  N  N    . PHE A 1 121 ? 60.927 86.447 24.528  1.00 173.67 ? 121 PHE A N    1 
ATOM   949  C  CA   . PHE A 1 121 ? 59.915 86.739 23.517  1.00 173.50 ? 121 PHE A CA   1 
ATOM   950  C  C    . PHE A 1 121 ? 58.967 85.563 23.305  1.00 172.78 ? 121 PHE A C    1 
ATOM   951  O  O    . PHE A 1 121 ? 57.747 85.704 23.412  1.00 172.29 ? 121 PHE A O    1 
ATOM   952  C  CB   . PHE A 1 121 ? 60.626 87.081 22.200  1.00 175.46 ? 121 PHE A CB   1 
ATOM   953  C  CG   . PHE A 1 121 ? 59.775 86.920 20.960  1.00 176.33 ? 121 PHE A CG   1 
ATOM   954  C  CD1  . PHE A 1 121 ? 58.405 87.152 20.979  1.00 178.65 ? 121 PHE A CD1  1 
ATOM   955  C  CD2  . PHE A 1 121 ? 60.375 86.629 19.742  1.00 177.71 ? 121 PHE A CD2  1 
ATOM   956  C  CE1  . PHE A 1 121 ? 57.646 87.023 19.824  1.00 179.21 ? 121 PHE A CE1  1 
ATOM   957  C  CE2  . PHE A 1 121 ? 59.622 86.516 18.577  1.00 180.13 ? 121 PHE A CE2  1 
ATOM   958  C  CZ   . PHE A 1 121 ? 58.261 86.717 18.618  1.00 178.10 ? 121 PHE A CZ   1 
ATOM   959  N  N    . LEU A 1 122 ? 59.536 84.434 22.897  1.00 167.86 ? 122 LEU A N    1 
ATOM   960  C  CA   . LEU A 1 122 ? 58.758 83.225 22.630  1.00 165.40 ? 122 LEU A CA   1 
ATOM   961  C  C    . LEU A 1 122 ? 57.857 82.970 23.829  1.00 171.59 ? 122 LEU A C    1 
ATOM   962  O  O    . LEU A 1 122 ? 56.689 82.634 23.680  1.00 171.54 ? 122 LEU A O    1 
ATOM   963  C  CB   . LEU A 1 122 ? 59.687 82.014 22.420  1.00 163.70 ? 122 LEU A CB   1 
ATOM   964  C  CG   . LEU A 1 122 ? 59.965 81.368 21.049  1.00 165.72 ? 122 LEU A CG   1 
ATOM   965  C  CD1  . LEU A 1 122 ? 60.173 82.382 19.942  1.00 165.08 ? 122 LEU A CD1  1 
ATOM   966  C  CD2  . LEU A 1 122 ? 61.172 80.441 21.141  1.00 167.37 ? 122 LEU A CD2  1 
ATOM   967  N  N    . PHE A 1 123 ? 58.413 83.166 25.020  1.00 165.54 ? 123 PHE A N    1 
ATOM   968  C  CA   . PHE A 1 123 ? 57.686 82.965 26.262  1.00 163.85 ? 123 PHE A CA   1 
ATOM   969  C  C    . PHE A 1 123 ? 56.509 83.918 26.363  1.00 172.69 ? 123 PHE A C    1 
ATOM   970  O  O    . PHE A 1 123 ? 55.540 83.661 27.077  1.00 174.35 ? 123 PHE A O    1 
ATOM   971  C  CB   . PHE A 1 123 ? 58.612 83.184 27.455  1.00 161.27 ? 123 PHE A CB   1 
ATOM   972  C  CG   . PHE A 1 123 ? 57.900 83.176 28.774  1.00 155.83 ? 123 PHE A CG   1 
ATOM   973  C  CD1  . PHE A 1 123 ? 57.462 84.355 29.346  1.00 153.13 ? 123 PHE A CD1  1 
ATOM   974  C  CD2  . PHE A 1 123 ? 57.634 81.981 29.426  1.00 152.04 ? 123 PHE A CD2  1 
ATOM   975  C  CE1  . PHE A 1 123 ? 56.787 84.343 30.559  1.00 151.45 ? 123 PHE A CE1  1 
ATOM   976  C  CE2  . PHE A 1 123 ? 56.960 81.964 30.643  1.00 151.94 ? 123 PHE A CE2  1 
ATOM   977  C  CZ   . PHE A 1 123 ? 56.534 83.145 31.206  1.00 149.20 ? 123 PHE A CZ   1 
ATOM   978  N  N    . LEU A 1 124 ? 56.604 85.035 25.658  1.00 169.13 ? 124 LEU A N    1 
ATOM   979  C  CA   . LEU A 1 124 ? 55.538 86.020 25.690  1.00 165.93 ? 124 LEU A CA   1 
ATOM   980  C  C    . LEU A 1 124 ? 54.421 85.720 24.696  1.00 164.64 ? 124 LEU A C    1 
ATOM   981  O  O    . LEU A 1 124 ? 53.292 86.178 24.862  1.00 163.67 ? 124 LEU A O    1 
ATOM   982  C  CB   . LEU A 1 124 ? 56.094 87.426 25.523  1.00 164.92 ? 124 LEU A CB   1 
ATOM   983  C  CG   . LEU A 1 124 ? 56.740 87.884 26.826  1.00 167.26 ? 124 LEU A CG   1 
ATOM   984  C  CD1  . LEU A 1 124 ? 56.645 86.773 27.855  1.00 166.63 ? 124 LEU A CD1  1 
ATOM   985  C  CD2  . LEU A 1 124 ? 58.182 88.269 26.591  1.00 168.93 ? 124 LEU A CD2  1 
ATOM   986  N  N    . MET A 1 125 ? 54.729 84.915 23.685  1.00 162.15 ? 125 MET A N    1 
ATOM   987  C  CA   . MET A 1 125 ? 53.724 84.499 22.722  1.00 162.15 ? 125 MET A CA   1 
ATOM   988  C  C    . MET A 1 125 ? 52.924 83.407 23.407  1.00 162.15 ? 125 MET A C    1 
ATOM   989  O  O    . MET A 1 125 ? 51.704 83.334 23.273  1.00 235.11 ? 125 MET A O    1 
ATOM   990  C  CB   . MET A 1 125 ? 54.406 83.911 21.499  1.00 162.15 ? 125 MET A CB   1 
ATOM   991  C  CG   . MET A 1 125 ? 55.252 84.896 20.736  1.00 162.15 ? 125 MET A CG   1 
ATOM   992  S  SD   . MET A 1 125 ? 55.177 84.525 18.975  1.00 162.15 ? 125 MET A SD   1 
ATOM   993  C  CE   . MET A 1 125 ? 56.741 83.638 18.747  1.00 162.15 ? 125 MET A CE   1 
ATOM   994  N  N    . SER A 1 126 ? 53.636 82.565 24.154  1.00 160.02 ? 126 SER A N    1 
ATOM   995  C  CA   . SER A 1 126 ? 53.026 81.467 24.896  1.00 160.92 ? 126 SER A CA   1 
ATOM   996  C  C    . SER A 1 126 ? 52.127 82.022 25.990  1.00 165.77 ? 126 SER A C    1 
ATOM   997  O  O    . SER A 1 126 ? 50.981 81.595 26.149  1.00 165.27 ? 126 SER A O    1 
ATOM   998  C  CB   . SER A 1 126 ? 54.094 80.547 25.509  1.00 165.99 ? 126 SER A CB   1 
ATOM   999  O  OG   . SER A 1 126 ? 55.296 81.238 25.800  1.00 176.21 ? 126 SER A OG   1 
ATOM   1000 N  N    . VAL A 1 127 ? 52.650 82.986 26.736  1.00 162.80 ? 127 VAL A N    1 
ATOM   1001 C  CA   . VAL A 1 127 ? 51.882 83.613 27.798  1.00 163.35 ? 127 VAL A CA   1 
ATOM   1002 C  C    . VAL A 1 127 ? 50.781 84.466 27.179  1.00 167.19 ? 127 VAL A C    1 
ATOM   1003 O  O    . VAL A 1 127 ? 49.813 84.858 27.842  1.00 166.16 ? 127 VAL A O    1 
ATOM   1004 C  CB   . VAL A 1 127 ? 52.783 84.435 28.709  1.00 168.44 ? 127 VAL A CB   1 
ATOM   1005 C  CG1  . VAL A 1 127 ? 53.512 85.509 27.908  1.00 168.44 ? 127 VAL A CG1  1 
ATOM   1006 C  CG2  . VAL A 1 127 ? 51.966 85.038 29.825  1.00 168.45 ? 127 VAL A CG2  1 
ATOM   1007 N  N    . ALA A 1 128 ? 50.941 84.731 25.887  1.00 166.13 ? 128 ALA A N    1 
ATOM   1008 C  CA   . ALA A 1 128 ? 49.990 85.519 25.124  1.00 167.59 ? 128 ALA A CA   1 
ATOM   1009 C  C    . ALA A 1 128 ? 48.718 84.721 24.958  1.00 173.69 ? 128 ALA A C    1 
ATOM   1010 O  O    . ALA A 1 128 ? 47.726 84.951 25.645  1.00 173.06 ? 128 ALA A O    1 
ATOM   1011 C  CB   . ALA A 1 128 ? 50.577 85.832 23.754  1.00 168.63 ? 128 ALA A CB   1 
ATOM   1012 N  N    . GLY A 1 129 ? 48.767 83.781 24.024  1.00 172.73 ? 129 GLY A N    1 
ATOM   1013 C  CA   . GLY A 1 129 ? 47.639 82.931 23.720  1.00 173.53 ? 129 GLY A CA   1 
ATOM   1014 C  C    . GLY A 1 129 ? 47.074 82.280 24.961  1.00 179.82 ? 129 GLY A C    1 
ATOM   1015 O  O    . GLY A 1 129 ? 45.857 82.144 25.103  1.00 178.82 ? 129 GLY A O    1 
ATOM   1016 N  N    . ILE A 1 130 ? 47.965 81.870 25.855  1.00 181.49 ? 130 ILE A N    1 
ATOM   1017 C  CA   . ILE A 1 130 ? 47.568 81.218 27.095  1.00 181.29 ? 130 ILE A CA   1 
ATOM   1018 C  C    . ILE A 1 130 ? 46.494 82.035 27.800  1.00 176.37 ? 130 ILE A C    1 
ATOM   1019 O  O    . ILE A 1 130 ? 45.521 81.494 28.337  1.00 170.98 ? 130 ILE A O    1 
ATOM   1020 C  CB   . ILE A 1 130 ? 48.780 81.014 28.008  1.00 186.99 ? 130 ILE A CB   1 
ATOM   1021 C  CG1  . ILE A 1 130 ? 48.605 79.750 28.857  1.00 188.31 ? 130 ILE A CG1  1 
ATOM   1022 C  CG2  . ILE A 1 130 ? 49.015 82.259 28.855  1.00 188.52 ? 130 ILE A CG2  1 
ATOM   1023 C  CD1  . ILE A 1 130 ? 47.269 79.661 29.569  1.00 196.20 ? 130 ILE A CD1  1 
ATOM   1024 N  N    . PHE A 1 131 ? 46.673 83.347 27.794  1.00 176.70 ? 131 PHE A N    1 
ATOM   1025 C  CA   . PHE A 1 131 ? 45.697 84.217 28.418  1.00 174.83 ? 131 PHE A CA   1 
ATOM   1026 C  C    . PHE A 1 131 ? 44.531 84.490 27.463  1.00 179.50 ? 131 PHE A C    1 
ATOM   1027 O  O    . PHE A 1 131 ? 43.367 84.264 27.813  1.00 183.38 ? 131 PHE A O    1 
ATOM   1028 C  CB   . PHE A 1 131 ? 46.332 85.537 28.850  1.00 172.06 ? 131 PHE A CB   1 
ATOM   1029 C  CG   . PHE A 1 131 ? 45.439 86.719 28.621  1.00 170.22 ? 131 PHE A CG   1 
ATOM   1030 C  CD1  . PHE A 1 131 ? 45.764 87.676 27.660  1.00 171.09 ? 131 PHE A CD1  1 
ATOM   1031 C  CD2  . PHE A 1 131 ? 44.209 86.814 29.287  1.00 170.24 ? 131 PHE A CD2  1 
ATOM   1032 C  CE1  . PHE A 1 131 ? 44.910 88.751 27.411  1.00 171.11 ? 131 PHE A CE1  1 
ATOM   1033 C  CE2  . PHE A 1 131 ? 43.345 87.876 29.048  1.00 171.89 ? 131 PHE A CE2  1 
ATOM   1034 C  CZ   . PHE A 1 131 ? 43.697 88.855 28.113  1.00 169.79 ? 131 PHE A CZ   1 
ATOM   1035 N  N    . ASN A 1 132 ? 44.856 85.002 26.273  1.00 176.28 ? 132 ASN A N    1 
ATOM   1036 C  CA   . ASN A 1 132 ? 43.854 85.340 25.265  1.00 175.78 ? 132 ASN A CA   1 
ATOM   1037 C  C    . ASN A 1 132 ? 42.857 84.216 25.100  1.00 183.79 ? 132 ASN A C    1 
ATOM   1038 O  O    . ASN A 1 132 ? 41.727 84.445 24.679  1.00 183.78 ? 132 ASN A O    1 
ATOM   1039 C  CB   . ASN A 1 132 ? 44.490 85.622 23.909  1.00 188.32 ? 132 ASN A CB   1 
ATOM   1040 C  CG   . ASN A 1 132 ? 43.683 85.035 22.771  1.00 250.18 ? 132 ASN A CG   1 
ATOM   1041 O  OD1  . ASN A 1 132 ? 43.995 83.957 22.267  1.00 249.77 ? 132 ASN A OD1  1 
ATOM   1042 N  ND2  . ASN A 1 132 ? 42.574 85.687 22.438  1.00 247.32 ? 132 ASN A ND2  1 
ATOM   1043 N  N    . TYR A 1 133 ? 43.292 82.997 25.400  1.00 179.28 ? 133 TYR A N    1 
ATOM   1044 C  CA   . TYR A 1 133 ? 42.419 81.837 25.300  1.00 180.95 ? 133 TYR A CA   1 
ATOM   1045 C  C    . TYR A 1 133 ? 41.370 81.947 26.399  1.00 185.47 ? 133 TYR A C    1 
ATOM   1046 O  O    . TYR A 1 133 ? 40.194 81.631 26.202  1.00 184.41 ? 133 TYR A O    1 
ATOM   1047 C  CB   . TYR A 1 133 ? 43.209 80.538 25.507  1.00 185.10 ? 133 TYR A CB   1 
ATOM   1048 C  CG   . TYR A 1 133 ? 42.434 79.511 26.311  1.00 191.67 ? 133 TYR A CG   1 
ATOM   1049 C  CD1  . TYR A 1 133 ? 42.413 79.558 27.703  1.00 194.27 ? 133 TYR A CD1  1 
ATOM   1050 C  CD2  . TYR A 1 133 ? 41.668 78.541 25.679  1.00 193.62 ? 133 TYR A CD2  1 
ATOM   1051 C  CE1  . TYR A 1 133 ? 41.655 78.671 28.434  1.00 195.24 ? 133 TYR A CE1  1 
ATOM   1052 C  CE2  . TYR A 1 133 ? 40.923 77.635 26.409  1.00 194.79 ? 133 TYR A CE2  1 
ATOM   1053 C  CZ   . TYR A 1 133 ? 40.925 77.705 27.784  1.00 201.28 ? 133 TYR A CZ   1 
ATOM   1054 O  OH   . TYR A 1 133 ? 40.193 76.801 28.510  1.00 201.66 ? 133 TYR A OH   1 
ATOM   1055 N  N    . TYR A 1 134 ? 41.827 82.336 27.580  1.00 180.26 ? 134 TYR A N    1 
ATOM   1056 C  CA   . TYR A 1 134 ? 40.955 82.473 28.726  1.00 182.66 ? 134 TYR A CA   1 
ATOM   1057 C  C    . TYR A 1 134 ? 39.809 83.452 28.462  1.00 188.27 ? 134 TYR A C    1 
ATOM   1058 O  O    . TYR A 1 134 ? 38.718 83.334 29.035  1.00 186.95 ? 134 TYR A O    1 
ATOM   1059 C  CB   . TYR A 1 134 ? 41.804 82.909 29.900  1.00 186.93 ? 134 TYR A CB   1 
ATOM   1060 C  CG   . TYR A 1 134 ? 42.375 81.734 30.642  1.00 193.83 ? 134 TYR A CG   1 
ATOM   1061 C  CD1  . TYR A 1 134 ? 41.636 80.569 30.790  1.00 196.57 ? 134 TYR A CD1  1 
ATOM   1062 C  CD2  . TYR A 1 134 ? 43.645 81.783 31.202  1.00 195.92 ? 134 TYR A CD2  1 
ATOM   1063 C  CE1  . TYR A 1 134 ? 42.126 79.496 31.512  1.00 197.84 ? 134 TYR A CE1  1 
ATOM   1064 C  CE2  . TYR A 1 134 ? 44.151 80.709 31.920  1.00 197.22 ? 134 TYR A CE2  1 
ATOM   1065 C  CZ   . TYR A 1 134 ? 43.385 79.568 32.075  1.00 204.43 ? 134 TYR A CZ   1 
ATOM   1066 O  OH   . TYR A 1 134 ? 43.876 78.493 32.782  1.00 205.24 ? 134 TYR A OH   1 
ATOM   1067 N  N    . LEU A 1 135 ? 40.057 84.399 27.565  1.00 184.65 ? 135 LEU A N    1 
ATOM   1068 C  CA   . LEU A 1 135 ? 39.040 85.369 27.191  1.00 185.16 ? 135 LEU A CA   1 
ATOM   1069 C  C    . LEU A 1 135 ? 38.045 84.745 26.224  1.00 190.55 ? 135 LEU A C    1 
ATOM   1070 O  O    . LEU A 1 135 ? 36.849 84.787 26.461  1.00 190.22 ? 135 LEU A O    1 
ATOM   1071 C  CB   . LEU A 1 135 ? 39.679 86.626 26.625  1.00 184.04 ? 135 LEU A CB   1 
ATOM   1072 C  CG   . LEU A 1 135 ? 40.699 87.187 27.615  1.00 185.15 ? 135 LEU A CG   1 
ATOM   1073 C  CD1  . LEU A 1 135 ? 40.790 88.693 27.472  1.00 184.04 ? 135 LEU A CD1  1 
ATOM   1074 C  CD2  . LEU A 1 135 ? 40.350 86.790 29.055  1.00 186.34 ? 135 LEU A CD2  1 
ATOM   1075 N  N    . ILE A 1 136 ? 38.547 84.107 25.174  1.00 194.52 ? 136 ILE A N    1 
ATOM   1076 C  CA   . ILE A 1 136 ? 37.695 83.415 24.215  1.00 193.45 ? 136 ILE A CA   1 
ATOM   1077 C  C    . ILE A 1 136 ? 36.803 82.398 24.941  1.00 193.95 ? 136 ILE A C    1 
ATOM   1078 O  O    . ILE A 1 136 ? 35.700 82.074 24.489  1.00 196.23 ? 136 ILE A O    1 
ATOM   1079 C  CB   . ILE A 1 136 ? 38.558 82.752 23.131  1.00 196.10 ? 136 ILE A CB   1 
ATOM   1080 C  CG1  . ILE A 1 136 ? 39.766 83.639 22.812  1.00 196.03 ? 136 ILE A CG1  1 
ATOM   1081 C  CG2  . ILE A 1 136 ? 37.743 82.499 21.879  1.00 196.43 ? 136 ILE A CG2  1 
ATOM   1082 C  CD1  . ILE A 1 136 ? 41.030 82.860 22.492  1.00 202.89 ? 136 ILE A CD1  1 
ATOM   1083 N  N    . PHE A 1 137 ? 37.287 81.915 26.082  1.00 204.35 ? 137 PHE A N    1 
ATOM   1084 C  CA   . PHE A 1 137 ? 36.540 80.969 26.901  1.00 198.49 ? 137 PHE A CA   1 
ATOM   1085 C  C    . PHE A 1 137 ? 35.489 81.712 27.712  1.00 199.22 ? 137 PHE A C    1 
ATOM   1086 O  O    . PHE A 1 137 ? 34.383 81.218 27.927  1.00 198.00 ? 137 PHE A O    1 
ATOM   1087 C  CB   . PHE A 1 137 ? 37.459 80.274 27.901  1.00 197.91 ? 137 PHE A CB   1 
ATOM   1088 C  CG   . PHE A 1 137 ? 36.767 79.911 29.189  1.00 197.50 ? 137 PHE A CG   1 
ATOM   1089 C  CD1  . PHE A 1 137 ? 35.693 79.027 29.184  1.00 198.45 ? 137 PHE A CD1  1 
ATOM   1090 C  CD2  . PHE A 1 137 ? 37.139 80.489 30.391  1.00 197.60 ? 137 PHE A CD2  1 
ATOM   1091 C  CE1  . PHE A 1 137 ? 35.035 78.683 30.363  1.00 198.47 ? 137 PHE A CE1  1 
ATOM   1092 C  CE2  . PHE A 1 137 ? 36.498 80.127 31.576  1.00 199.25 ? 137 PHE A CE2  1 
ATOM   1093 C  CZ   . PHE A 1 137 ? 35.433 79.243 31.556  1.00 197.15 ? 137 PHE A CZ   1 
ATOM   1094 N  N    . PHE A 1 138 ? 35.865 82.883 28.206  1.00 201.33 ? 138 PHE A N    1 
ATOM   1095 C  CA   . PHE A 1 138 ? 34.968 83.691 29.015  1.00 200.96 ? 138 PHE A CA   1 
ATOM   1096 C  C    . PHE A 1 138 ? 34.146 84.683 28.204  1.00 195.61 ? 138 PHE A C    1 
ATOM   1097 O  O    . PHE A 1 138 ? 32.972 84.920 28.506  1.00 202.10 ? 138 PHE A O    1 
ATOM   1098 C  CB   . PHE A 1 138 ? 35.767 84.451 30.058  1.00 202.01 ? 138 PHE A CB   1 
ATOM   1099 C  CG   . PHE A 1 138 ? 35.399 84.094 31.453  1.00 201.60 ? 138 PHE A CG   1 
ATOM   1100 C  CD1  . PHE A 1 138 ? 35.873 82.927 32.013  1.00 202.55 ? 138 PHE A CD1  1 
ATOM   1101 C  CD2  . PHE A 1 138 ? 34.527 84.888 32.183  1.00 201.70 ? 138 PHE A CD2  1 
ATOM   1102 C  CE1  . PHE A 1 138 ? 35.521 82.558 33.297  1.00 202.57 ? 138 PHE A CE1  1 
ATOM   1103 C  CE2  . PHE A 1 138 ? 34.171 84.537 33.478  1.00 203.35 ? 138 PHE A CE2  1 
ATOM   1104 C  CZ   . PHE A 1 138 ? 34.670 83.366 34.037  1.00 201.25 ? 138 PHE A CZ   1 
ATOM   1105 N  N    . PHE A 1 139 ? 34.806 85.332 27.244  1.00 194.34 ? 139 PHE A N    1 
ATOM   1106 C  CA   . PHE A 1 139 ? 34.199 86.360 26.398  1.00 186.41 ? 139 PHE A CA   1 
ATOM   1107 C  C    . PHE A 1 139 ? 34.247 85.965 24.920  1.00 197.93 ? 139 PHE A C    1 
ATOM   1108 O  O    . PHE A 1 139 ? 34.780 86.701 24.088  1.00 186.87 ? 139 PHE A O    1 
ATOM   1109 C  CB   . PHE A 1 139 ? 34.919 87.704 26.592  1.00 187.23 ? 139 PHE A CB   1 
ATOM   1110 C  CG   . PHE A 1 139 ? 35.230 88.037 28.033  1.00 186.81 ? 139 PHE A CG   1 
ATOM   1111 C  CD1  . PHE A 1 139 ? 34.560 87.407 29.078  1.00 187.41 ? 139 PHE A CD1  1 
ATOM   1112 C  CD2  . PHE A 1 139 ? 36.166 89.017 28.343  1.00 186.77 ? 139 PHE A CD2  1 
ATOM   1113 C  CE1  . PHE A 1 139 ? 34.852 87.701 30.402  1.00 187.47 ? 139 PHE A CE1  1 
ATOM   1114 C  CE2  . PHE A 1 139 ? 36.452 89.337 29.666  1.00 188.09 ? 139 PHE A CE2  1 
ATOM   1115 C  CZ   . PHE A 1 139 ? 35.792 88.674 30.698  1.00 186.40 ? 139 PHE A CZ   1 
ATOM   1116 N  N    . MET B 1 1   ? 45.270 77.487 16.876  1.00 182.31 ? 1   MET B N    1 
ATOM   1117 C  CA   . MET B 1 1   ? 45.045 76.409 17.829  1.00 182.31 ? 1   MET B CA   1 
ATOM   1118 C  C    . MET B 1 1   ? 43.564 76.293 18.209  1.00 182.31 ? 1   MET B C    1 
ATOM   1119 O  O    . MET B 1 1   ? 42.983 77.239 18.741  1.00 285.85 ? 1   MET B O    1 
ATOM   1120 C  CB   . MET B 1 1   ? 45.873 76.681 19.083  1.00 182.31 ? 1   MET B CB   1 
ATOM   1121 C  CG   . MET B 1 1   ? 45.825 75.578 20.111  1.00 182.31 ? 1   MET B CG   1 
ATOM   1122 S  SD   . MET B 1 1   ? 46.544 74.057 19.510  1.00 182.31 ? 1   MET B SD   1 
ATOM   1123 C  CE   . MET B 1 1   ? 45.911 72.898 20.736  1.00 182.31 ? 1   MET B CE   1 
ATOM   1124 N  N    . ASP B 1 2   ? 42.968 75.125 17.956  1.00 182.70 ? 2   ASP B N    1 
ATOM   1125 C  CA   . ASP B 1 2   ? 41.547 74.880 18.255  1.00 183.22 ? 2   ASP B CA   1 
ATOM   1126 C  C    . ASP B 1 2   ? 41.188 75.122 19.717  1.00 184.41 ? 2   ASP B C    1 
ATOM   1127 O  O    . ASP B 1 2   ? 41.530 74.324 20.587  1.00 183.61 ? 2   ASP B O    1 
ATOM   1128 C  CB   . ASP B 1 2   ? 41.100 73.472 17.813  1.00 186.08 ? 2   ASP B CB   1 
ATOM   1129 C  CG   . ASP B 1 2   ? 42.187 72.706 17.035  1.00 195.55 ? 2   ASP B CG   1 
ATOM   1130 O  OD1  . ASP B 1 2   ? 42.631 73.172 15.953  1.00 195.83 ? 2   ASP B OD1  1 
ATOM   1131 O  OD2  . ASP B 1 2   ? 42.553 71.593 17.484  1.00 201.21 ? 2   ASP B OD2  1 
ATOM   1132 N  N    . GLN B 1 3   ? 40.489 76.227 19.967  1.00 181.74 ? 3   GLN B N    1 
ATOM   1133 C  CA   . GLN B 1 3   ? 40.099 76.633 21.319  1.00 180.36 ? 3   GLN B CA   1 
ATOM   1134 C  C    . GLN B 1 3   ? 39.675 75.505 22.275  1.00 182.92 ? 3   GLN B C    1 
ATOM   1135 O  O    . GLN B 1 3   ? 39.931 75.569 23.483  1.00 180.05 ? 3   GLN B O    1 
ATOM   1136 C  CB   . GLN B 1 3   ? 39.065 77.764 21.280  1.00 181.47 ? 3   GLN B CB   1 
ATOM   1137 C  CG   . GLN B 1 3   ? 38.416 78.071 22.629  1.00 197.29 ? 3   GLN B CG   1 
ATOM   1138 C  CD   . GLN B 1 3   ? 39.188 79.099 23.437  1.00 217.06 ? 3   GLN B CD   1 
ATOM   1139 O  OE1  . GLN B 1 3   ? 40.214 79.621 22.988  1.00 212.69 ? 3   GLN B OE1  1 
ATOM   1140 N  NE2  . GLN B 1 3   ? 38.697 79.394 24.639  1.00 209.35 ? 3   GLN B NE2  1 
ATOM   1141 N  N    . GLU B 1 4   ? 39.042 74.468 21.740  1.00 176.63 ? 4   GLU B N    1 
ATOM   1142 C  CA   . GLU B 1 4   ? 38.643 73.344 22.572  1.00 179.53 ? 4   GLU B CA   1 
ATOM   1143 C  C    . GLU B 1 4   ? 39.908 72.731 23.169  1.00 172.05 ? 4   GLU B C    1 
ATOM   1144 O  O    . GLU B 1 4   ? 40.089 72.708 24.396  1.00 170.76 ? 4   GLU B O    1 
ATOM   1145 C  CB   . GLU B 1 4   ? 37.935 72.291 21.717  1.00 183.29 ? 4   GLU B CB   1 
ATOM   1146 C  CG   . GLU B 1 4   ? 38.139 70.851 22.202  1.00 201.23 ? 4   GLU B CG   1 
ATOM   1147 C  CD   . GLU B 1 4   ? 39.213 70.099 21.417  1.00 234.23 ? 4   GLU B CD   1 
ATOM   1148 O  OE1  . GLU B 1 4   ? 39.578 70.570 20.313  1.00 231.72 ? 4   GLU B OE1  1 
ATOM   1149 O  OE2  . GLU B 1 4   ? 39.690 69.043 21.907  1.00 231.46 ? 4   GLU B OE2  1 
ATOM   1150 N  N    . THR B 1 5   ? 40.774 72.247 22.270  1.00 168.89 ? 5   THR B N    1 
ATOM   1151 C  CA   . THR B 1 5   ? 42.042 71.576 22.597  1.00 165.92 ? 5   THR B CA   1 
ATOM   1152 C  C    . THR B 1 5   ? 42.902 72.375 23.547  1.00 165.40 ? 5   THR B C    1 
ATOM   1153 O  O    . THR B 1 5   ? 43.339 71.863 24.572  1.00 163.54 ? 5   THR B O    1 
ATOM   1154 C  CB   . THR B 1 5   ? 42.862 71.230 21.326  1.00 172.56 ? 5   THR B CB   1 
ATOM   1155 O  OG1  . THR B 1 5   ? 42.860 72.346 20.429  1.00 171.94 ? 5   THR B OG1  1 
ATOM   1156 C  CG2  . THR B 1 5   ? 42.294 70.004 20.620  1.00 170.97 ? 5   THR B CG2  1 
ATOM   1157 N  N    . VAL B 1 6   ? 43.187 73.613 23.162  1.00 161.25 ? 6   VAL B N    1 
ATOM   1158 C  CA   . VAL B 1 6   ? 44.004 74.495 23.972  1.00 158.89 ? 6   VAL B CA   1 
ATOM   1159 C  C    . VAL B 1 6   ? 43.484 74.461 25.392  1.00 168.97 ? 6   VAL B C    1 
ATOM   1160 O  O    . VAL B 1 6   ? 44.255 74.544 26.344  1.00 170.06 ? 6   VAL B O    1 
ATOM   1161 C  CB   . VAL B 1 6   ? 44.008 75.919 23.419  1.00 155.08 ? 6   VAL B CB   1 
ATOM   1162 C  CG1  . VAL B 1 6   ? 45.417 76.308 22.989  1.00 153.56 ? 6   VAL B CG1  1 
ATOM   1163 C  CG2  . VAL B 1 6   ? 43.030 76.042 22.260  1.00 153.57 ? 6   VAL B CG2  1 
ATOM   1164 N  N    . GLY B 1 7   ? 42.176 74.271 25.524  1.00 166.26 ? 7   GLY B N    1 
ATOM   1165 C  CA   . GLY B 1 7   ? 41.540 74.175 26.821  1.00 164.74 ? 7   GLY B CA   1 
ATOM   1166 C  C    . GLY B 1 7   ? 42.096 73.025 27.644  1.00 164.18 ? 7   GLY B C    1 
ATOM   1167 O  O    . GLY B 1 7   ? 42.485 73.218 28.802  1.00 162.88 ? 7   GLY B O    1 
ATOM   1168 N  N    . ASN B 1 8   ? 42.152 71.833 27.043  1.00 161.89 ? 8   ASN B N    1 
ATOM   1169 C  CA   . ASN B 1 8   ? 42.648 70.630 27.732  1.00 160.75 ? 8   ASN B CA   1 
ATOM   1170 C  C    . ASN B 1 8   ? 44.176 70.440 27.768  1.00 158.33 ? 8   ASN B C    1 
ATOM   1171 O  O    . ASN B 1 8   ? 44.664 69.309 27.760  1.00 156.71 ? 8   ASN B O    1 
ATOM   1172 C  CB   . ASN B 1 8   ? 41.951 69.349 27.229  1.00 168.39 ? 8   ASN B CB   1 
ATOM   1173 C  CG   . ASN B 1 8   ? 41.534 69.428 25.763  1.00 221.57 ? 8   ASN B CG   1 
ATOM   1174 O  OD1  . ASN B 1 8   ? 41.377 68.402 25.093  1.00 220.31 ? 8   ASN B OD1  1 
ATOM   1175 N  ND2  . ASN B 1 8   ? 41.310 70.641 25.276  1.00 217.86 ? 8   ASN B ND2  1 
ATOM   1176 N  N    . VAL B 1 9   ? 44.917 71.546 27.840  1.00 152.54 ? 9   VAL B N    1 
ATOM   1177 C  CA   . VAL B 1 9   ? 46.384 71.522 27.881  1.00 149.84 ? 9   VAL B CA   1 
ATOM   1178 C  C    . VAL B 1 9   ? 46.884 72.768 28.601  1.00 158.46 ? 9   VAL B C    1 
ATOM   1179 O  O    . VAL B 1 9   ? 48.011 72.804 29.098  1.00 159.16 ? 9   VAL B O    1 
ATOM   1180 C  CB   . VAL B 1 9   ? 46.993 71.484 26.460  1.00 147.37 ? 9   VAL B CB   1 
ATOM   1181 C  CG1  . VAL B 1 9   ? 45.963 71.889 25.433  1.00 146.12 ? 9   VAL B CG1  1 
ATOM   1182 C  CG2  . VAL B 1 9   ? 48.162 72.435 26.366  1.00 146.12 ? 9   VAL B CG2  1 
ATOM   1183 N  N    . VAL B 1 10  ? 46.043 73.797 28.607  1.00 153.87 ? 10  VAL B N    1 
ATOM   1184 C  CA   . VAL B 1 10  ? 46.351 75.074 29.231  1.00 156.75 ? 10  VAL B CA   1 
ATOM   1185 C  C    . VAL B 1 10  ? 47.107 74.910 30.537  1.00 148.95 ? 10  VAL B C    1 
ATOM   1186 O  O    . VAL B 1 10  ? 47.963 75.721 30.874  1.00 145.33 ? 10  VAL B O    1 
ATOM   1187 C  CB   . VAL B 1 10  ? 45.066 75.866 29.499  1.00 172.02 ? 10  VAL B CB   1 
ATOM   1188 C  CG1  . VAL B 1 10  ? 45.308 76.901 30.579  1.00 173.76 ? 10  VAL B CG1  1 
ATOM   1189 C  CG2  . VAL B 1 10  ? 44.567 76.527 28.234  1.00 173.75 ? 10  VAL B CG2  1 
ATOM   1190 N  N    . LEU B 1 11  ? 46.768 73.869 31.285  1.00 145.04 ? 11  LEU B N    1 
ATOM   1191 C  CA   . LEU B 1 11  ? 47.386 73.650 32.580  1.00 146.18 ? 11  LEU B CA   1 
ATOM   1192 C  C    . LEU B 1 11  ? 48.819 73.211 32.449  1.00 146.16 ? 11  LEU B C    1 
ATOM   1193 O  O    . LEU B 1 11  ? 49.689 73.732 33.136  1.00 144.39 ? 11  LEU B O    1 
ATOM   1194 C  CB   . LEU B 1 11  ? 46.603 72.625 33.385  1.00 147.96 ? 11  LEU B CB   1 
ATOM   1195 C  CG   . LEU B 1 11  ? 45.202 73.054 33.815  1.00 155.51 ? 11  LEU B CG   1 
ATOM   1196 C  CD1  . LEU B 1 11  ? 44.820 74.379 33.167  1.00 156.57 ? 11  LEU B CD1  1 
ATOM   1197 C  CD2  . LEU B 1 11  ? 44.167 71.968 33.503  1.00 158.87 ? 11  LEU B CD2  1 
ATOM   1198 N  N    . LEU B 1 12  ? 49.053 72.234 31.580  1.00 141.01 ? 12  LEU B N    1 
ATOM   1199 C  CA   . LEU B 1 12  ? 50.397 71.717 31.358  1.00 140.99 ? 12  LEU B CA   1 
ATOM   1200 C  C    . LEU B 1 12  ? 51.260 72.781 30.690  1.00 145.56 ? 12  LEU B C    1 
ATOM   1201 O  O    . LEU B 1 12  ? 52.476 72.815 30.875  1.00 145.59 ? 12  LEU B O    1 
ATOM   1202 C  CB   . LEU B 1 12  ? 50.350 70.425 30.546  1.00 140.56 ? 12  LEU B CB   1 
ATOM   1203 C  CG   . LEU B 1 12  ? 49.082 69.621 30.819  1.00 143.98 ? 12  LEU B CG   1 
ATOM   1204 C  CD1  . LEU B 1 12  ? 48.665 68.860 29.578  1.00 143.71 ? 12  LEU B CD1  1 
ATOM   1205 C  CD2  . LEU B 1 12  ? 49.272 68.700 32.010  1.00 146.01 ? 12  LEU B CD2  1 
ATOM   1206 N  N    . ALA B 1 13  ? 50.608 73.678 29.956  1.00 139.45 ? 13  ALA B N    1 
ATOM   1207 C  CA   . ALA B 1 13  ? 51.283 74.799 29.314  1.00 138.57 ? 13  ALA B CA   1 
ATOM   1208 C  C    . ALA B 1 13  ? 51.740 75.730 30.432  1.00 139.38 ? 13  ALA B C    1 
ATOM   1209 O  O    . ALA B 1 13  ? 52.908 76.125 30.524  1.00 138.61 ? 13  ALA B O    1 
ATOM   1210 C  CB   . ALA B 1 13  ? 50.297 75.536 28.408  1.00 139.44 ? 13  ALA B CB   1 
ATOM   1211 N  N    . ILE B 1 14  ? 50.782 76.069 31.285  1.00 135.06 ? 14  ILE B N    1 
ATOM   1212 C  CA   . ILE B 1 14  ? 51.015 76.934 32.431  1.00 133.74 ? 14  ILE B CA   1 
ATOM   1213 C  C    . ILE B 1 14  ? 52.201 76.429 33.219  1.00 135.68 ? 14  ILE B C    1 
ATOM   1214 O  O    . ILE B 1 14  ? 53.242 77.080 33.290  1.00 134.50 ? 14  ILE B O    1 
ATOM   1215 C  CB   . ILE B 1 14  ? 49.788 76.927 33.345  1.00 136.49 ? 14  ILE B CB   1 
ATOM   1216 C  CG1  . ILE B 1 14  ? 48.707 77.860 32.800  1.00 136.78 ? 14  ILE B CG1  1 
ATOM   1217 C  CG2  . ILE B 1 14  ? 50.189 77.275 34.769  1.00 137.09 ? 14  ILE B CG2  1 
ATOM   1218 C  CD1  . ILE B 1 14  ? 47.494 77.968 33.697  1.00 144.02 ? 14  ILE B CD1  1 
ATOM   1219 N  N    . VAL B 1 15  ? 51.993 75.280 33.852  1.00 131.56 ? 15  VAL B N    1 
ATOM   1220 C  CA   . VAL B 1 15  ? 53.001 74.630 34.659  1.00 130.80 ? 15  VAL B CA   1 
ATOM   1221 C  C    . VAL B 1 15  ? 54.319 74.628 33.909  1.00 137.57 ? 15  VAL B C    1 
ATOM   1222 O  O    . VAL B 1 15  ? 55.364 74.926 34.471  1.00 137.58 ? 15  VAL B O    1 
ATOM   1223 C  CB   . VAL B 1 15  ? 52.582 73.199 34.971  1.00 131.92 ? 15  VAL B CB   1 
ATOM   1224 C  CG1  . VAL B 1 15  ? 52.099 72.525 33.712  1.00 131.25 ? 15  VAL B CG1  1 
ATOM   1225 C  CG2  . VAL B 1 15  ? 53.748 72.427 35.530  1.00 131.25 ? 15  VAL B CG2  1 
ATOM   1226 N  N    . THR B 1 16  ? 54.264 74.302 32.628  1.00 133.08 ? 16  THR B N    1 
ATOM   1227 C  CA   . THR B 1 16  ? 55.470 74.260 31.818  1.00 133.22 ? 16  THR B CA   1 
ATOM   1228 C  C    . THR B 1 16  ? 56.136 75.622 31.690  1.00 138.71 ? 16  THR B C    1 
ATOM   1229 O  O    . THR B 1 16  ? 57.347 75.752 31.879  1.00 138.45 ? 16  THR B O    1 
ATOM   1230 C  CB   . THR B 1 16  ? 55.206 73.636 30.452  1.00 138.79 ? 16  THR B CB   1 
ATOM   1231 O  OG1  . THR B 1 16  ? 55.139 72.208 30.594  1.00 137.82 ? 16  THR B OG1  1 
ATOM   1232 C  CG2  . THR B 1 16  ? 56.316 74.025 29.471  1.00 136.85 ? 16  THR B CG2  1 
ATOM   1233 N  N    . LEU B 1 17  ? 55.342 76.637 31.375  1.00 136.70 ? 17  LEU B N    1 
ATOM   1234 C  CA   . LEU B 1 17  ? 55.873 77.987 31.242  1.00 136.60 ? 17  LEU B CA   1 
ATOM   1235 C  C    . LEU B 1 17  ? 56.394 78.487 32.598  1.00 139.79 ? 17  LEU B C    1 
ATOM   1236 O  O    . LEU B 1 17  ? 57.275 79.353 32.684  1.00 139.01 ? 17  LEU B O    1 
ATOM   1237 C  CB   . LEU B 1 17  ? 54.816 78.918 30.645  1.00 136.57 ? 17  LEU B CB   1 
ATOM   1238 C  CG   . LEU B 1 17  ? 54.864 79.084 29.117  1.00 140.58 ? 17  LEU B CG   1 
ATOM   1239 C  CD1  . LEU B 1 17  ? 56.160 78.541 28.493  1.00 140.47 ? 17  LEU B CD1  1 
ATOM   1240 C  CD2  . LEU B 1 17  ? 53.641 78.463 28.464  1.00 142.75 ? 17  LEU B CD2  1 
ATOM   1241 N  N    . ILE B 1 18  ? 55.867 77.888 33.657  1.00 138.05 ? 18  ILE B N    1 
ATOM   1242 C  CA   . ILE B 1 18  ? 56.284 78.193 35.019  1.00 138.40 ? 18  ILE B CA   1 
ATOM   1243 C  C    . ILE B 1 18  ? 57.704 77.674 35.173  1.00 142.84 ? 18  ILE B C    1 
ATOM   1244 O  O    . ILE B 1 18  ? 58.642 78.434 35.393  1.00 142.12 ? 18  ILE B O    1 
ATOM   1245 C  CB   . ILE B 1 18  ? 55.345 77.487 36.021  1.00 141.96 ? 18  ILE B CB   1 
ATOM   1246 C  CG1  . ILE B 1 18  ? 54.079 78.317 36.260  1.00 142.63 ? 18  ILE B CG1  1 
ATOM   1247 C  CG2  . ILE B 1 18  ? 56.091 77.090 37.294  1.00 142.87 ? 18  ILE B CG2  1 
ATOM   1248 C  CD1  . ILE B 1 18  ? 53.685 79.195 35.069  1.00 150.31 ? 18  ILE B CD1  1 
ATOM   1249 N  N    . SER B 1 19  ? 57.835 76.361 35.023  1.00 141.84 ? 19  SER B N    1 
ATOM   1250 C  CA   . SER B 1 19  ? 59.113 75.671 35.109  1.00 142.40 ? 19  SER B CA   1 
ATOM   1251 C  C    . SER B 1 19  ? 60.120 76.263 34.122  1.00 148.75 ? 19  SER B C    1 
ATOM   1252 O  O    . SER B 1 19  ? 61.328 76.263 34.374  1.00 148.28 ? 19  SER B O    1 
ATOM   1253 C  CB   . SER B 1 19  ? 58.918 74.170 34.836  1.00 145.58 ? 19  SER B CB   1 
ATOM   1254 O  OG   . SER B 1 19  ? 58.091 73.943 33.704  1.00 153.88 ? 19  SER B OG   1 
ATOM   1255 N  N    . VAL B 1 20  ? 59.609 76.760 33.000  1.00 146.63 ? 20  VAL B N    1 
ATOM   1256 C  CA   . VAL B 1 20  ? 60.422 77.388 31.970  1.00 146.28 ? 20  VAL B CA   1 
ATOM   1257 C  C    . VAL B 1 20  ? 61.105 78.600 32.572  1.00 149.87 ? 20  VAL B C    1 
ATOM   1258 O  O    . VAL B 1 20  ? 62.278 78.864 32.312  1.00 149.08 ? 20  VAL B O    1 
ATOM   1259 C  CB   . VAL B 1 20  ? 59.527 77.848 30.820  1.00 149.13 ? 20  VAL B CB   1 
ATOM   1260 C  CG1  . VAL B 1 20  ? 59.866 79.266 30.416  1.00 148.73 ? 20  VAL B CG1  1 
ATOM   1261 C  CG2  . VAL B 1 20  ? 59.643 76.912 29.651  1.00 148.74 ? 20  VAL B CG2  1 
ATOM   1262 N  N    . VAL B 1 21  ? 60.336 79.341 33.365  1.00 148.89 ? 21  VAL B N    1 
ATOM   1263 C  CA   . VAL B 1 21  ? 60.801 80.553 34.028  1.00 149.65 ? 21  VAL B CA   1 
ATOM   1264 C  C    . VAL B 1 21  ? 61.682 80.265 35.258  1.00 151.19 ? 21  VAL B C    1 
ATOM   1265 O  O    . VAL B 1 21  ? 62.703 80.922 35.465  1.00 149.69 ? 21  VAL B O    1 
ATOM   1266 C  CB   . VAL B 1 21  ? 59.612 81.489 34.329  1.00 156.21 ? 21  VAL B CB   1 
ATOM   1267 C  CG1  . VAL B 1 21  ? 59.185 81.403 35.802  1.00 156.46 ? 21  VAL B CG1  1 
ATOM   1268 C  CG2  . VAL B 1 21  ? 59.937 82.911 33.894  1.00 156.48 ? 21  VAL B CG2  1 
ATOM   1269 N  N    . GLN B 1 22  ? 61.301 79.267 36.054  1.00 149.73 ? 22  GLN B N    1 
ATOM   1270 C  CA   . GLN B 1 22  ? 62.088 78.872 37.218  1.00 150.76 ? 22  GLN B CA   1 
ATOM   1271 C  C    . GLN B 1 22  ? 63.444 78.429 36.709  1.00 157.14 ? 22  GLN B C    1 
ATOM   1272 O  O    . GLN B 1 22  ? 64.468 78.658 37.343  1.00 156.55 ? 22  GLN B O    1 
ATOM   1273 C  CB   . GLN B 1 22  ? 61.414 77.707 37.941  1.00 152.18 ? 22  GLN B CB   1 
ATOM   1274 C  CG   . GLN B 1 22  ? 62.132 76.375 37.803  1.00 163.28 ? 22  GLN B CG   1 
ATOM   1275 C  CD   . GLN B 1 22  ? 61.832 75.437 38.967  1.00 178.09 ? 22  GLN B CD   1 
ATOM   1276 O  OE1  . GLN B 1 22  ? 61.630 74.234 38.779  1.00 172.95 ? 22  GLN B OE1  1 
ATOM   1277 N  NE2  . GLN B 1 22  ? 61.801 75.989 40.179  1.00 169.61 ? 22  GLN B NE2  1 
ATOM   1278 N  N    . ASN B 1 23  ? 63.433 77.812 35.536  1.00 155.83 ? 23  ASN B N    1 
ATOM   1279 C  CA   . ASN B 1 23  ? 64.647 77.342 34.881  1.00 156.77 ? 23  ASN B CA   1 
ATOM   1280 C  C    . ASN B 1 23  ? 65.639 78.463 34.600  1.00 163.89 ? 23  ASN B C    1 
ATOM   1281 O  O    . ASN B 1 23  ? 66.825 78.344 34.915  1.00 163.78 ? 23  ASN B O    1 
ATOM   1282 C  CB   . ASN B 1 23  ? 64.294 76.669 33.566  1.00 155.85 ? 23  ASN B CB   1 
ATOM   1283 C  CG   . ASN B 1 23  ? 63.935 75.236 33.749  1.00 169.43 ? 23  ASN B CG   1 
ATOM   1284 O  OD1  . ASN B 1 23  ? 63.861 74.747 34.879  1.00 162.40 ? 23  ASN B OD1  1 
ATOM   1285 N  ND2  . ASN B 1 23  ? 63.728 74.535 32.644  1.00 159.95 ? 23  ASN B ND2  1 
ATOM   1286 N  N    . GLY B 1 24  ? 65.160 79.525 33.958  1.00 161.65 ? 24  GLY B N    1 
ATOM   1287 C  CA   . GLY B 1 24  ? 65.987 80.674 33.642  1.00 162.93 ? 24  GLY B CA   1 
ATOM   1288 C  C    . GLY B 1 24  ? 66.553 81.288 34.914  1.00 172.04 ? 24  GLY B C    1 
ATOM   1289 O  O    . GLY B 1 24  ? 67.568 81.993 34.880  1.00 171.22 ? 24  GLY B O    1 
ATOM   1290 N  N    . PHE B 1 25  ? 65.894 81.017 36.041  1.00 168.58 ? 25  PHE B N    1 
ATOM   1291 C  CA   . PHE B 1 25  ? 66.346 81.526 37.326  1.00 172.39 ? 25  PHE B CA   1 
ATOM   1292 C  C    . PHE B 1 25  ? 67.580 80.757 37.749  1.00 171.55 ? 25  PHE B C    1 
ATOM   1293 O  O    . PHE B 1 25  ? 68.606 81.344 38.070  1.00 170.36 ? 25  PHE B O    1 
ATOM   1294 C  CB   . PHE B 1 25  ? 65.279 81.338 38.390  1.00 178.61 ? 25  PHE B CB   1 
ATOM   1295 C  CG   . PHE B 1 25  ? 65.824 81.374 39.782  1.00 185.12 ? 25  PHE B CG   1 
ATOM   1296 C  CD1  . PHE B 1 25  ? 66.793 82.296 40.129  1.00 191.44 ? 25  PHE B CD1  1 
ATOM   1297 C  CD2  . PHE B 1 25  ? 65.405 80.459 40.731  1.00 190.50 ? 25  PHE B CD2  1 
ATOM   1298 C  CE1  . PHE B 1 25  ? 67.326 82.314 41.401  1.00 193.54 ? 25  PHE B CE1  1 
ATOM   1299 C  CE2  . PHE B 1 25  ? 65.924 80.480 42.014  1.00 194.63 ? 25  PHE B CE2  1 
ATOM   1300 C  CZ   . PHE B 1 25  ? 66.887 81.406 42.348  1.00 193.07 ? 25  PHE B CZ   1 
ATOM   1301 N  N    . PHE B 1 26  ? 67.449 79.438 37.795  1.00 171.53 ? 26  PHE B N    1 
ATOM   1302 C  CA   . PHE B 1 26  ? 68.554 78.574 38.166  1.00 170.52 ? 26  PHE B CA   1 
ATOM   1303 C  C    . PHE B 1 26  ? 69.755 78.952 37.327  1.00 173.92 ? 26  PHE B C    1 
ATOM   1304 O  O    . PHE B 1 26  ? 70.885 78.969 37.816  1.00 172.71 ? 26  PHE B O    1 
ATOM   1305 C  CB   . PHE B 1 26  ? 68.187 77.123 37.882  1.00 171.89 ? 26  PHE B CB   1 
ATOM   1306 C  CG   . PHE B 1 26  ? 67.049 76.625 38.711  1.00 172.97 ? 26  PHE B CG   1 
ATOM   1307 C  CD1  . PHE B 1 26  ? 66.440 77.457 39.638  1.00 175.69 ? 26  PHE B CD1  1 
ATOM   1308 C  CD2  . PHE B 1 26  ? 66.598 75.322 38.586  1.00 174.68 ? 26  PHE B CD2  1 
ATOM   1309 C  CE1  . PHE B 1 26  ? 65.398 76.999 40.430  1.00 176.39 ? 26  PHE B CE1  1 
ATOM   1310 C  CE2  . PHE B 1 26  ? 65.555 74.855 39.378  1.00 177.26 ? 26  PHE B CE2  1 
ATOM   1311 C  CZ   . PHE B 1 26  ? 64.953 75.699 40.301  1.00 175.29 ? 26  PHE B CZ   1 
ATOM   1312 N  N    . ALA B 1 27  ? 69.481 79.282 36.064  1.00 174.92 ? 27  ALA B N    1 
ATOM   1313 C  CA   . ALA B 1 27  ? 70.499 79.660 35.082  1.00 175.84 ? 27  ALA B CA   1 
ATOM   1314 C  C    . ALA B 1 27  ? 71.003 81.073 35.296  1.00 174.84 ? 27  ALA B C    1 
ATOM   1315 O  O    . ALA B 1 27  ? 71.949 81.512 34.653  1.00 171.94 ? 27  ALA B O    1 
ATOM   1316 C  CB   . ALA B 1 27  ? 69.940 79.519 33.675  1.00 177.47 ? 27  ALA B CB   1 
ATOM   1317 N  N    . HIS B 1 28  ? 70.349 81.779 36.202  1.00 172.51 ? 28  HIS B N    1 
ATOM   1318 C  CA   . HIS B 1 28  ? 70.712 83.146 36.519  1.00 176.72 ? 28  HIS B CA   1 
ATOM   1319 C  C    . HIS B 1 28  ? 71.616 83.143 37.750  1.00 182.16 ? 28  HIS B C    1 
ATOM   1320 O  O    . HIS B 1 28  ? 72.622 83.852 37.804  1.00 179.68 ? 28  HIS B O    1 
ATOM   1321 C  CB   . HIS B 1 28  ? 69.436 83.961 36.750  1.00 181.96 ? 28  HIS B CB   1 
ATOM   1322 C  CG   . HIS B 1 28  ? 69.633 85.192 37.579  1.00 190.00 ? 28  HIS B CG   1 
ATOM   1323 N  ND1  . HIS B 1 28  ? 70.044 86.393 37.041  1.00 194.14 ? 28  HIS B ND1  1 
ATOM   1324 C  CD2  . HIS B 1 28  ? 69.409 85.424 38.894  1.00 195.00 ? 28  HIS B CD2  1 
ATOM   1325 C  CE1  . HIS B 1 28  ? 70.098 87.303 37.998  1.00 195.12 ? 28  HIS B CE1  1 
ATOM   1326 N  NE2  . HIS B 1 28  ? 69.716 86.742 39.131  1.00 195.60 ? 28  HIS B NE2  1 
ATOM   1327 N  N    . LYS B 1 29  ? 71.278 82.305 38.722  1.00 178.29 ? 29  LYS B N    1 
ATOM   1328 C  CA   . LYS B 1 29  ? 72.088 82.196 39.918  1.00 180.48 ? 29  LYS B CA   1 
ATOM   1329 C  C    . LYS B 1 29  ? 73.399 81.512 39.582  1.00 181.60 ? 29  LYS B C    1 
ATOM   1330 O  O    . LYS B 1 29  ? 74.290 81.415 40.420  1.00 182.58 ? 29  LYS B O    1 
ATOM   1331 C  CB   . LYS B 1 29  ? 71.341 81.470 41.026  1.00 183.98 ? 29  LYS B CB   1 
ATOM   1332 C  CG   . LYS B 1 29  ? 70.607 82.430 41.939  1.00 189.54 ? 29  LYS B CG   1 
ATOM   1333 C  CD   . LYS B 1 29  ? 70.547 83.819 41.306  1.00 193.28 ? 29  LYS B CD   1 
ATOM   1334 C  CE   . LYS B 1 29  ? 70.027 84.862 42.288  1.00 197.66 ? 29  LYS B CE   1 
ATOM   1335 N  NZ   . LYS B 1 29  ? 69.377 86.033 41.618  1.00 204.56 ? 29  LYS B NZ   1 
ATOM   1336 N  N    . VAL B 1 30  ? 73.531 81.082 38.331  1.00 185.62 ? 30  VAL B N    1 
ATOM   1337 C  CA   . VAL B 1 30  ? 74.774 80.474 37.857  1.00 182.46 ? 30  VAL B CA   1 
ATOM   1338 C  C    . VAL B 1 30  ? 75.632 81.547 37.201  1.00 189.78 ? 30  VAL B C    1 
ATOM   1339 O  O    . VAL B 1 30  ? 76.854 81.404 37.082  1.00 188.63 ? 30  VAL B O    1 
ATOM   1340 C  CB   . VAL B 1 30  ? 74.533 79.319 36.882  1.00 183.20 ? 30  VAL B CB   1 
ATOM   1341 C  CG1  . VAL B 1 30  ? 75.513 79.422 35.708  1.00 182.58 ? 30  VAL B CG1  1 
ATOM   1342 C  CG2  . VAL B 1 30  ? 74.693 77.985 37.605  1.00 182.59 ? 30  VAL B CG2  1 
ATOM   1343 N  N    . GLU B 1 31  ? 74.977 82.622 36.771  1.00 189.96 ? 31  GLU B N    1 
ATOM   1344 C  CA   . GLU B 1 31  ? 75.671 83.757 36.170  1.00 193.07 ? 31  GLU B CA   1 
ATOM   1345 C  C    . GLU B 1 31  ? 76.333 84.558 37.291  1.00 199.00 ? 31  GLU B C    1 
ATOM   1346 O  O    . GLU B 1 31  ? 77.483 84.992 37.177  1.00 198.00 ? 31  GLU B O    1 
ATOM   1347 C  CB   . GLU B 1 31  ? 74.686 84.646 35.402  1.00 195.34 ? 31  GLU B CB   1 
ATOM   1348 C  CG   . GLU B 1 31  ? 75.030 84.796 33.930  1.00 208.27 ? 31  GLU B CG   1 
ATOM   1349 C  CD   . GLU B 1 31  ? 76.250 83.978 33.536  1.00 231.48 ? 31  GLU B CD   1 
ATOM   1350 O  OE1  . GLU B 1 31  ? 76.190 82.730 33.630  1.00 226.31 ? 31  GLU B OE1  1 
ATOM   1351 O  OE2  . GLU B 1 31  ? 77.273 84.586 33.151  1.00 226.05 ? 31  GLU B OE2  1 
ATOM   1352 N  N    . HIS B 1 32  ? 75.589 84.728 38.380  1.00 198.46 ? 32  HIS B N    1 
ATOM   1353 C  CA   . HIS B 1 32  ? 76.050 85.433 39.569  1.00 200.13 ? 32  HIS B CA   1 
ATOM   1354 C  C    . HIS B 1 32  ? 77.406 84.890 40.005  1.00 203.66 ? 32  HIS B C    1 
ATOM   1355 O  O    . HIS B 1 32  ? 78.329 85.644 40.308  1.00 203.47 ? 32  HIS B O    1 
ATOM   1356 C  CB   . HIS B 1 32  ? 75.060 85.160 40.707  1.00 202.08 ? 32  HIS B CB   1 
ATOM   1357 C  CG   . HIS B 1 32  ? 74.424 86.388 41.278  1.00 206.22 ? 32  HIS B CG   1 
ATOM   1358 N  ND1  . HIS B 1 32  ? 74.411 86.654 42.631  1.00 208.23 ? 32  HIS B ND1  1 
ATOM   1359 C  CD2  . HIS B 1 32  ? 73.736 87.395 40.690  1.00 208.23 ? 32  HIS B CD2  1 
ATOM   1360 C  CE1  . HIS B 1 32  ? 73.761 87.783 42.849  1.00 207.72 ? 32  HIS B CE1  1 
ATOM   1361 N  NE2  . HIS B 1 32  ? 73.338 88.251 41.689  1.00 208.04 ? 32  HIS B NE2  1 
ATOM   1362 N  N    . GLU B 1 33  ? 77.490 83.568 40.082  1.00 205.27 ? 33  GLU B N    1 
ATOM   1363 C  CA   . GLU B 1 33  ? 78.688 82.892 40.547  1.00 204.84 ? 33  GLU B CA   1 
ATOM   1364 C  C    . GLU B 1 33  ? 79.839 82.865 39.553  1.00 205.03 ? 33  GLU B C    1 
ATOM   1365 O  O    . GLU B 1 33  ? 80.998 82.764 39.947  1.00 203.09 ? 33  GLU B O    1 
ATOM   1366 C  CB   . GLU B 1 33  ? 78.349 81.475 40.996  1.00 206.79 ? 33  GLU B CB   1 
ATOM   1367 C  CG   . GLU B 1 33  ? 77.427 81.426 42.191  1.00 219.38 ? 33  GLU B CG   1 
ATOM   1368 C  CD   . GLU B 1 33  ? 77.546 82.656 43.060  1.00 242.50 ? 33  GLU B CD   1 
ATOM   1369 O  OE1  . GLU B 1 33  ? 78.670 82.964 43.506  1.00 237.34 ? 33  GLU B OE1  1 
ATOM   1370 O  OE2  . GLU B 1 33  ? 76.515 83.315 43.299  1.00 237.08 ? 33  GLU B OE2  1 
ATOM   1371 N  N    . SER B 1 34  ? 79.531 82.921 38.264  1.00 208.89 ? 34  SER B N    1 
ATOM   1372 C  CA   . SER B 1 34  ? 80.589 82.900 37.266  1.00 209.61 ? 34  SER B CA   1 
ATOM   1373 C  C    . SER B 1 34  ? 81.103 84.310 37.062  1.00 212.56 ? 34  SER B C    1 
ATOM   1374 O  O    . SER B 1 34  ? 82.129 84.520 36.415  1.00 212.16 ? 34  SER B O    1 
ATOM   1375 C  CB   . SER B 1 34  ? 80.086 82.343 35.939  1.00 214.85 ? 34  SER B CB   1 
ATOM   1376 O  OG   . SER B 1 34  ? 81.096 82.458 34.953  1.00 225.48 ? 34  SER B OG   1 
ATOM   1377 N  N    . ARG B 1 35  ? 80.369 85.271 37.618  1.00 217.62 ? 35  ARG B N    1 
ATOM   1378 C  CA   . ARG B 1 35  ? 80.710 86.689 37.506  1.00 217.97 ? 35  ARG B CA   1 
ATOM   1379 C  C    . ARG B 1 35  ? 81.563 87.168 38.679  1.00 222.26 ? 35  ARG B C    1 
ATOM   1380 O  O    . ARG B 1 35  ? 82.572 87.854 38.486  1.00 221.65 ? 35  ARG B O    1 
ATOM   1381 C  CB   . ARG B 1 35  ? 79.440 87.544 37.378  1.00 221.44 ? 35  ARG B CB   1 
ATOM   1382 C  CG   . ARG B 1 35  ? 79.127 87.978 35.944  1.00 239.80 ? 35  ARG B CG   1 
ATOM   1383 C  CD   . ARG B 1 35  ? 79.348 86.836 34.944  1.00 256.78 ? 35  ARG B CD   1 
ATOM   1384 N  NE   . ARG B 1 35  ? 80.520 87.047 34.093  1.00 268.47 ? 35  ARG B NE   1 
ATOM   1385 C  CZ   . ARG B 1 35  ? 80.774 86.366 32.978  1.00 283.24 ? 35  ARG B CZ   1 
ATOM   1386 N  NH1  . ARG B 1 35  ? 79.937 85.423 32.569  1.00 270.65 ? 35  ARG B NH1  1 
ATOM   1387 N  NH2  . ARG B 1 35  ? 81.865 86.631 32.269  1.00 270.06 ? 35  ARG B NH2  1 
ATOM   1388 N  N    . THR B 1 36  ? 81.174 86.772 39.890  1.00 223.99 ? 36  THR B N    1 
ATOM   1389 C  CA   . THR B 1 36  ? 81.901 87.138 41.104  1.00 226.31 ? 36  THR B CA   1 
ATOM   1390 C  C    . THR B 1 36  ? 83.410 86.878 41.046  1.00 230.59 ? 36  THR B C    1 
ATOM   1391 O  O    . THR B 1 36  ? 84.127 87.130 42.011  1.00 229.70 ? 36  THR B O    1 
ATOM   1392 C  CB   . THR B 1 36  ? 81.260 86.538 42.372  1.00 264.06 ? 36  THR B CB   1 
ATOM   1393 O  OG1  . THR B 1 36  ? 81.224 85.110 42.269  1.00 270.32 ? 36  THR B OG1  1 
ATOM   1394 C  CG2  . THR B 1 36  ? 79.847 87.061 42.551  1.00 269.34 ? 36  THR B CG2  1 
ATOM   1395 N  N    . GLN B 1 37  ? 83.922 86.484 39.889  1.00 231.55 ? 37  GLN B N    1 
ATOM   1396 C  CA   . GLN B 1 37  ? 85.362 86.328 39.761  1.00 234.21 ? 37  GLN B CA   1 
ATOM   1397 C  C    . GLN B 1 37  ? 85.867 86.199 38.337  1.00 243.59 ? 37  GLN B C    1 
ATOM   1398 O  O    . GLN B 1 37  ? 85.350 86.841 37.413  1.00 244.04 ? 37  GLN B O    1 
ATOM   1399 C  CB   . GLN B 1 37  ? 85.907 85.210 40.651  1.00 236.20 ? 37  GLN B CB   1 
ATOM   1400 C  CG   . GLN B 1 37  ? 87.271 85.524 41.291  1.00 256.50 ? 37  GLN B CG   1 
ATOM   1401 C  CD   . GLN B 1 37  ? 87.629 87.009 41.284  1.00 279.30 ? 37  GLN B CD   1 
ATOM   1402 O  OE1  . GLN B 1 37  ? 86.980 87.822 41.945  1.00 275.31 ? 37  GLN B OE1  1 
ATOM   1403 N  NE2  . GLN B 1 37  ? 88.704 87.355 40.581  1.00 271.97 ? 37  GLN B NE2  1 
ATOM   1404 N  N    . ASN B 1 38  ? 86.910 85.392 38.178  1.00 244.22 ? 38  ASN B N    1 
ATOM   1405 C  CA   . ASN B 1 38  ? 87.526 85.199 36.878  1.00 244.26 ? 38  ASN B CA   1 
ATOM   1406 C  C    . ASN B 1 38  ? 86.717 84.339 35.920  1.00 247.88 ? 38  ASN B C    1 
ATOM   1407 O  O    . ASN B 1 38  ? 87.269 83.768 34.980  1.00 246.98 ? 38  ASN B O    1 
ATOM   1408 C  CB   . ASN B 1 38  ? 88.967 84.712 37.001  1.00 245.04 ? 38  ASN B CB   1 
ATOM   1409 C  CG   . ASN B 1 38  ? 89.960 85.723 36.470  1.00 264.17 ? 38  ASN B CG   1 
ATOM   1410 O  OD1  . ASN B 1 38  ? 90.034 85.957 35.262  1.00 257.89 ? 38  ASN B OD1  1 
ATOM   1411 N  ND2  . ASN B 1 38  ? 90.684 86.378 37.375  1.00 255.43 ? 38  ASN B ND2  1 
ATOM   1412 N  N    . GLY B 1 39  ? 85.399 84.316 36.115  1.00 246.76 ? 39  GLY B N    1 
ATOM   1413 C  CA   . GLY B 1 39  ? 84.490 83.621 35.222  1.00 245.05 ? 39  GLY B CA   1 
ATOM   1414 C  C    . GLY B 1 39  ? 84.467 84.370 33.895  1.00 242.26 ? 39  GLY B C    1 
ATOM   1415 O  O    . GLY B 1 39  ? 83.634 84.101 33.025  1.00 239.70 ? 39  GLY B O    1 
ATOM   1416 N  N    . ARG B 1 40  ? 85.390 85.327 33.763  1.00 239.12 ? 40  ARG B N    1 
ATOM   1417 C  CA   . ARG B 1 40  ? 85.576 86.142 32.561  1.00 240.14 ? 40  ARG B CA   1 
ATOM   1418 C  C    . ARG B 1 40  ? 86.310 85.305 31.512  1.00 245.78 ? 40  ARG B C    1 
ATOM   1419 O  O    . ARG B 1 40  ? 87.514 85.479 31.283  1.00 245.48 ? 40  ARG B O    1 
ATOM   1420 C  CB   . ARG B 1 40  ? 86.390 87.385 32.913  1.00 242.61 ? 40  ARG B CB   1 
ATOM   1421 C  CG   . ARG B 1 40  ? 86.210 87.837 34.354  1.00 258.66 ? 40  ARG B CG   1 
ATOM   1422 C  CD   . ARG B 1 40  ? 87.252 88.856 34.743  1.00 272.69 ? 40  ARG B CD   1 
ATOM   1423 N  NE   . ARG B 1 40  ? 86.837 90.204 34.375  1.00 280.90 ? 40  ARG B NE   1 
ATOM   1424 C  CZ   . ARG B 1 40  ? 86.822 90.668 33.129  1.00 292.78 ? 40  ARG B CZ   1 
ATOM   1425 N  NH1  . ARG B 1 40  ? 87.212 89.896 32.123  1.00 279.41 ? 40  ARG B NH1  1 
ATOM   1426 N  NH2  . ARG B 1 40  ? 86.427 91.912 32.885  1.00 278.82 ? 40  ARG B NH2  1 
ATOM   1427 N  N    . SER B 1 41  ? 85.539 84.402 30.904  1.00 241.11 ? 41  SER B N    1 
ATOM   1428 C  CA   . SER B 1 41  ? 85.950 83.397 29.918  1.00 238.15 ? 41  SER B CA   1 
ATOM   1429 C  C    . SER B 1 41  ? 85.177 82.166 30.404  1.00 225.82 ? 41  SER B C    1 
ATOM   1430 O  O    . SER B 1 41  ? 85.404 81.038 29.958  1.00 225.33 ? 41  SER B O    1 
ATOM   1431 C  CB   . SER B 1 41  ? 87.461 83.115 29.967  1.00 245.54 ? 41  SER B CB   1 
ATOM   1432 O  OG   . SER B 1 41  ? 88.160 83.831 28.959  1.00 256.37 ? 41  SER B OG   1 
ATOM   1433 N  N    . PHE B 1 42  ? 84.278 82.423 31.356  1.00 220.81 ? 42  PHE B N    1 
ATOM   1434 C  CA   . PHE B 1 42  ? 83.440 81.417 32.010  1.00 209.63 ? 42  PHE B CA   1 
ATOM   1435 C  C    . PHE B 1 42  ? 84.167 80.166 32.471  1.00 227.89 ? 42  PHE B C    1 
ATOM   1436 O  O    . PHE B 1 42  ? 83.958 79.066 31.945  1.00 227.56 ? 42  PHE B O    1 
ATOM   1437 C  CB   . PHE B 1 42  ? 82.195 81.077 31.198  1.00 201.12 ? 42  PHE B CB   1 
ATOM   1438 C  CG   . PHE B 1 42  ? 81.167 80.289 31.967  1.00 197.26 ? 42  PHE B CG   1 
ATOM   1439 C  CD1  . PHE B 1 42  ? 81.241 80.190 33.350  1.00 197.89 ? 42  PHE B CD1  1 
ATOM   1440 C  CD2  . PHE B 1 42  ? 80.118 79.659 31.310  1.00 197.04 ? 42  PHE B CD2  1 
ATOM   1441 C  CE1  . PHE B 1 42  ? 80.279 79.489 34.070  1.00 197.91 ? 42  PHE B CE1  1 
ATOM   1442 C  CE2  . PHE B 1 42  ? 79.157 78.948 32.021  1.00 198.69 ? 42  PHE B CE2  1 
ATOM   1443 C  CZ   . PHE B 1 42  ? 79.234 78.870 33.404  1.00 196.59 ? 42  PHE B CZ   1 
ATOM   1444 N  N    . GLN B 1 43  ? 85.005 80.341 33.482  1.00 221.36 ? 43  GLN B N    1 
ATOM   1445 C  CA   . GLN B 1 43  ? 85.750 79.226 34.027  1.00 233.11 ? 43  GLN B CA   1 
ATOM   1446 C  C    . GLN B 1 43  ? 84.768 78.355 34.801  1.00 248.14 ? 43  GLN B C    1 
ATOM   1447 O  O    . GLN B 1 43  ? 84.158 78.810 35.767  1.00 249.74 ? 43  GLN B O    1 
ATOM   1448 C  CB   . GLN B 1 43  ? 86.899 79.723 34.913  1.00 238.21 ? 43  GLN B CB   1 
ATOM   1449 C  CG   . GLN B 1 43  ? 87.513 81.061 34.460  1.00 222.26 ? 43  GLN B CG   1 
ATOM   1450 C  CD   . GLN B 1 43  ? 88.500 80.936 33.289  1.00 207.84 ? 43  GLN B CD   1 
ATOM   1451 O  OE1  . GLN B 1 43  ? 88.869 79.831 32.881  1.00 198.23 ? 43  GLN B OE1  1 
ATOM   1452 N  NE2  . GLN B 1 43  ? 88.938 82.081 32.756  1.00 194.88 ? 43  GLN B NE2  1 
ATOM   1453 N  N    . ARG B 1 44  ? 84.574 77.129 34.318  1.00 239.52 ? 44  ARG B N    1 
ATOM   1454 C  CA   . ARG B 1 44  ? 83.650 76.172 34.923  1.00 239.61 ? 44  ARG B CA   1 
ATOM   1455 C  C    . ARG B 1 44  ? 84.200 75.545 36.211  1.00 244.03 ? 44  ARG B C    1 
ATOM   1456 O  O    . ARG B 1 44  ? 84.231 74.321 36.359  1.00 243.87 ? 44  ARG B O    1 
ATOM   1457 C  CB   . ARG B 1 44  ? 83.300 75.082 33.907  1.00 240.97 ? 44  ARG B CB   1 
ATOM   1458 C  CG   . ARG B 1 44  ? 84.478 74.225 33.474  1.00 253.74 ? 44  ARG B CG   1 
ATOM   1459 C  CD   . ARG B 1 44  ? 84.345 72.809 34.015  1.00 263.49 ? 44  ARG B CD   1 
ATOM   1460 N  NE   . ARG B 1 44  ? 84.347 71.804 32.954  1.00 268.36 ? 44  ARG B NE   1 
ATOM   1461 C  CZ   . ARG B 1 44  ? 83.287 71.485 32.216  1.00 278.52 ? 44  ARG B CZ   1 
ATOM   1462 N  NH1  . ARG B 1 44  ? 82.128 72.097 32.415  1.00 264.80 ? 44  ARG B NH1  1 
ATOM   1463 N  NH2  . ARG B 1 44  ? 83.388 70.554 31.276  1.00 264.22 ? 44  ARG B NH2  1 
ATOM   1464 N  N    . THR B 1 45  ? 84.612 76.396 37.146  1.00 236.72 ? 45  THR B N    1 
ATOM   1465 C  CA   . THR B 1 45  ? 85.187 75.952 38.414  1.00 236.89 ? 45  THR B CA   1 
ATOM   1466 C  C    . THR B 1 45  ? 85.627 77.167 39.239  1.00 241.45 ? 45  THR B C    1 
ATOM   1467 O  O    . THR B 1 45  ? 86.798 77.292 39.607  1.00 241.27 ? 45  THR B O    1 
ATOM   1468 C  CB   . THR B 1 45  ? 86.367 74.990 38.165  1.00 248.44 ? 45  THR B CB   1 
ATOM   1469 O  OG1  . THR B 1 45  ? 86.866 74.501 39.415  1.00 248.82 ? 45  THR B OG1  1 
ATOM   1470 C  CG2  . THR B 1 45  ? 87.491 75.701 37.417  1.00 247.85 ? 45  THR B CG2  1 
ATOM   1471 N  N    . GLY B 1 46  ? 84.680 78.060 39.516  1.00 233.71 ? 46  GLY B N    1 
ATOM   1472 C  CA   . GLY B 1 46  ? 84.919 79.292 40.252  1.00 231.98 ? 46  GLY B CA   1 
ATOM   1473 C  C    . GLY B 1 46  ? 85.225 79.113 41.725  1.00 230.05 ? 46  GLY B C    1 
ATOM   1474 O  O    . GLY B 1 46  ? 85.952 79.921 42.296  1.00 228.26 ? 46  GLY B O    1 
ATOM   1475 N  N    . THR B 1 47  ? 84.623 78.089 42.332  1.00 221.90 ? 47  THR B N    1 
ATOM   1476 C  CA   . THR B 1 47  ? 84.825 77.715 43.738  1.00 221.57 ? 47  THR B CA   1 
ATOM   1477 C  C    . THR B 1 47  ? 83.671 77.855 44.734  1.00 218.98 ? 47  THR B C    1 
ATOM   1478 O  O    . THR B 1 47  ? 82.905 78.819 44.733  1.00 217.27 ? 47  THR B O    1 
ATOM   1479 C  CB   . THR B 1 47  ? 86.170 78.153 44.332  1.00 250.32 ? 47  THR B CB   1 
ATOM   1480 O  OG1  . THR B 1 47  ? 86.162 79.570 44.541  1.00 254.48 ? 47  THR B OG1  1 
ATOM   1481 C  CG2  . THR B 1 47  ? 87.320 77.767 43.404  1.00 253.51 ? 47  THR B CG2  1 
ATOM   1482 N  N    . LEU B 1 48  ? 83.636 76.865 45.615  1.00 210.57 ? 48  LEU B N    1 
ATOM   1483 C  CA   . LEU B 1 48  ? 82.645 76.644 46.648  1.00 207.46 ? 48  LEU B CA   1 
ATOM   1484 C  C    . LEU B 1 48  ? 81.229 77.111 46.388  1.00 214.18 ? 48  LEU B C    1 
ATOM   1485 O  O    . LEU B 1 48  ? 80.274 76.355 46.570  1.00 214.58 ? 48  LEU B O    1 
ATOM   1486 C  CB   . LEU B 1 48  ? 83.138 77.170 47.992  1.00 203.67 ? 48  LEU B CB   1 
ATOM   1487 C  CG   . LEU B 1 48  ? 82.191 77.019 49.191  1.00 200.29 ? 48  LEU B CG   1 
ATOM   1488 C  CD1  . LEU B 1 48  ? 81.306 75.776 49.086  1.00 197.75 ? 48  LEU B CD1  1 
ATOM   1489 C  CD2  . LEU B 1 48  ? 82.975 77.022 50.506  1.00 200.04 ? 48  LEU B CD2  1 
ATOM   1490 N  N    . ALA B 1 49  ? 81.086 78.383 46.046  1.00 207.82 ? 49  ALA B N    1 
ATOM   1491 C  CA   . ALA B 1 49  ? 79.765 78.950 45.825  1.00 206.00 ? 49  ALA B CA   1 
ATOM   1492 C  C    . ALA B 1 49  ? 79.335 78.771 44.379  1.00 208.87 ? 49  ALA B C    1 
ATOM   1493 O  O    . ALA B 1 49  ? 78.160 78.533 44.101  1.00 208.56 ? 49  ALA B O    1 
ATOM   1494 C  CB   . ALA B 1 49  ? 79.744 80.415 46.208  1.00 206.24 ? 49  ALA B CB   1 
ATOM   1495 N  N    . PHE B 1 50  ? 80.299 78.883 43.468  1.00 204.26 ? 50  PHE B N    1 
ATOM   1496 C  CA   . PHE B 1 50  ? 80.049 78.737 42.039  1.00 201.14 ? 50  PHE B CA   1 
ATOM   1497 C  C    . PHE B 1 50  ? 80.052 77.274 41.657  1.00 207.54 ? 50  PHE B C    1 
ATOM   1498 O  O    . PHE B 1 50  ? 79.370 76.856 40.731  1.00 207.83 ? 50  PHE B O    1 
ATOM   1499 C  CB   . PHE B 1 50  ? 81.133 79.453 41.249  1.00 198.51 ? 50  PHE B CB   1 
ATOM   1500 C  CG   . PHE B 1 50  ? 81.068 79.206 39.773  1.00 193.75 ? 50  PHE B CG   1 
ATOM   1501 C  CD1  . PHE B 1 50  ? 79.854 79.017 39.138  1.00 191.99 ? 50  PHE B CD1  1 
ATOM   1502 C  CD2  . PHE B 1 50  ? 82.219 79.219 39.009  1.00 191.04 ? 50  PHE B CD2  1 
ATOM   1503 C  CE1  . PHE B 1 50  ? 79.795 78.803 37.769  1.00 190.87 ? 50  PHE B CE1  1 
ATOM   1504 C  CE2  . PHE B 1 50  ? 82.170 79.019 37.646  1.00 191.58 ? 50  PHE B CE2  1 
ATOM   1505 C  CZ   . PHE B 1 50  ? 80.959 78.808 37.022  1.00 189.02 ? 50  PHE B CZ   1 
ATOM   1506 N  N    . GLU B 1 51  ? 80.844 76.490 42.365  1.00 203.14 ? 51  GLU B N    1 
ATOM   1507 C  CA   . GLU B 1 51  ? 80.880 75.072 42.092  1.00 202.04 ? 51  GLU B CA   1 
ATOM   1508 C  C    . GLU B 1 51  ? 79.680 74.414 42.773  1.00 198.30 ? 51  GLU B C    1 
ATOM   1509 O  O    . GLU B 1 51  ? 79.239 73.337 42.373  1.00 197.14 ? 51  GLU B O    1 
ATOM   1510 C  CB   . GLU B 1 51  ? 82.189 74.466 42.580  1.00 203.98 ? 51  GLU B CB   1 
ATOM   1511 C  CG   . GLU B 1 51  ? 83.369 74.749 41.671  1.00 214.38 ? 51  GLU B CG   1 
ATOM   1512 C  CD   . GLU B 1 51  ? 84.690 74.573 42.390  1.00 231.99 ? 51  GLU B CD   1 
ATOM   1513 O  OE1  . GLU B 1 51  ? 84.697 73.930 43.464  1.00 225.28 ? 51  GLU B OE1  1 
ATOM   1514 O  OE2  . GLU B 1 51  ? 85.714 75.094 41.898  1.00 225.01 ? 51  GLU B OE2  1 
ATOM   1515 N  N    . ARG B 1 52  ? 79.128 75.085 43.779  1.00 194.33 ? 52  ARG B N    1 
ATOM   1516 C  CA   . ARG B 1 52  ? 77.953 74.567 44.472  1.00 192.37 ? 52  ARG B CA   1 
ATOM   1517 C  C    . ARG B 1 52  ? 76.683 74.864 43.674  1.00 190.05 ? 52  ARG B C    1 
ATOM   1518 O  O    . ARG B 1 52  ? 75.726 74.093 43.706  1.00 187.99 ? 52  ARG B O    1 
ATOM   1519 C  CB   . ARG B 1 52  ? 77.854 75.140 45.884  1.00 195.94 ? 52  ARG B CB   1 
ATOM   1520 C  CG   . ARG B 1 52  ? 77.816 74.076 46.969  1.00 215.08 ? 52  ARG B CG   1 
ATOM   1521 C  CD   . ARG B 1 52  ? 79.039 74.145 47.868  1.00 232.90 ? 52  ARG B CD   1 
ATOM   1522 N  NE   . ARG B 1 52  ? 78.737 73.750 49.242  1.00 244.51 ? 52  ARG B NE   1 
ATOM   1523 C  CZ   . ARG B 1 52  ? 78.042 72.666 49.576  1.00 258.64 ? 52  ARG B CZ   1 
ATOM   1524 N  NH1  . ARG B 1 52  ? 77.569 71.861 48.633  1.00 245.82 ? 52  ARG B NH1  1 
ATOM   1525 N  NH2  . ARG B 1 52  ? 77.821 72.386 50.854  1.00 245.24 ? 52  ARG B NH2  1 
ATOM   1526 N  N    . VAL B 1 53  ? 76.698 75.969 42.933  1.00 182.42 ? 53  VAL B N    1 
ATOM   1527 C  CA   . VAL B 1 53  ? 75.560 76.364 42.103  1.00 180.48 ? 53  VAL B CA   1 
ATOM   1528 C  C    . VAL B 1 53  ? 75.520 75.681 40.742  1.00 189.22 ? 53  VAL B C    1 
ATOM   1529 O  O    . VAL B 1 53  ? 74.491 75.134 40.357  1.00 189.92 ? 53  VAL B O    1 
ATOM   1530 C  CB   . VAL B 1 53  ? 75.452 77.880 41.947  1.00 178.65 ? 53  VAL B CB   1 
ATOM   1531 C  CG1  . VAL B 1 53  ? 74.844 78.232 40.594  1.00 177.49 ? 53  VAL B CG1  1 
ATOM   1532 C  CG2  . VAL B 1 53  ? 74.622 78.444 43.074  1.00 177.49 ? 53  VAL B CG2  1 
ATOM   1533 N  N    . TYR B 1 54  ? 76.621 75.743 39.997  1.00 180.93 ? 54  TYR B N    1 
ATOM   1534 C  CA   . TYR B 1 54  ? 76.657 75.106 38.687  1.00 180.91 ? 54  TYR B CA   1 
ATOM   1535 C  C    . TYR B 1 54  ? 76.328 73.640 38.866  1.00 184.10 ? 54  TYR B C    1 
ATOM   1536 O  O    . TYR B 1 54  ? 75.829 72.983 37.958  1.00 183.46 ? 54  TYR B O    1 
ATOM   1537 C  CB   . TYR B 1 54  ? 78.024 75.245 38.021  1.00 182.97 ? 54  TYR B CB   1 
ATOM   1538 C  CG   . TYR B 1 54  ? 78.012 74.795 36.576  1.00 186.30 ? 54  TYR B CG   1 
ATOM   1539 C  CD1  . TYR B 1 54  ? 77.093 75.321 35.675  1.00 188.37 ? 54  TYR B CD1  1 
ATOM   1540 C  CD2  . TYR B 1 54  ? 78.879 73.804 36.119  1.00 187.57 ? 54  TYR B CD2  1 
ATOM   1541 C  CE1  . TYR B 1 54  ? 77.059 74.899 34.339  1.00 189.04 ? 54  TYR B CE1  1 
ATOM   1542 C  CE2  . TYR B 1 54  ? 78.856 73.375 34.779  1.00 188.55 ? 54  TYR B CE2  1 
ATOM   1543 C  CZ   . TYR B 1 54  ? 77.943 73.930 33.896  1.00 195.12 ? 54  TYR B CZ   1 
ATOM   1544 O  OH   . TYR B 1 54  ? 77.910 73.531 32.573  1.00 195.62 ? 54  TYR B OH   1 
ATOM   1545 N  N    . THR B 1 55  ? 76.604 73.137 40.058  1.00 177.92 ? 55  THR B N    1 
ATOM   1546 C  CA   . THR B 1 55  ? 76.325 71.756 40.381  1.00 176.51 ? 55  THR B CA   1 
ATOM   1547 C  C    . THR B 1 55  ? 74.816 71.568 40.563  1.00 178.92 ? 55  THR B C    1 
ATOM   1548 O  O    . THR B 1 55  ? 74.189 70.809 39.822  1.00 179.53 ? 55  THR B O    1 
ATOM   1549 C  CB   . THR B 1 55  ? 77.149 71.318 41.598  1.00 170.00 ? 55  THR B CB   1 
ATOM   1550 O  OG1  . THR B 1 55  ? 78.251 70.505 41.165  1.00 166.27 ? 55  THR B OG1  1 
ATOM   1551 C  CG2  . THR B 1 55  ? 76.291 70.557 42.589  1.00 165.30 ? 55  THR B CG2  1 
ATOM   1552 N  N    . ALA B 1 56  ? 74.228 72.309 41.501  1.00 175.33 ? 56  ALA B N    1 
ATOM   1553 C  CA   . ALA B 1 56  ? 72.785 72.240 41.755  1.00 172.74 ? 56  ALA B CA   1 
ATOM   1554 C  C    . ALA B 1 56  ? 71.955 72.475 40.490  1.00 174.84 ? 56  ALA B C    1 
ATOM   1555 O  O    . ALA B 1 56  ? 70.934 71.819 40.269  1.00 174.75 ? 56  ALA B O    1 
ATOM   1556 C  CB   . ALA B 1 56  ? 72.391 73.227 42.837  1.00 173.03 ? 56  ALA B CB   1 
ATOM   1557 N  N    . ASN B 1 57  ? 72.398 73.421 39.669  1.00 168.36 ? 57  ASN B N    1 
ATOM   1558 C  CA   . ASN B 1 57  ? 71.724 73.726 38.413  1.00 168.22 ? 57  ASN B CA   1 
ATOM   1559 C  C    . ASN B 1 57  ? 71.862 72.546 37.436  1.00 175.71 ? 57  ASN B C    1 
ATOM   1560 O  O    . ASN B 1 57  ? 70.861 71.974 36.997  1.00 174.79 ? 57  ASN B O    1 
ATOM   1561 C  CB   . ASN B 1 57  ? 72.261 75.041 37.823  1.00 167.62 ? 57  ASN B CB   1 
ATOM   1562 C  CG   . ASN B 1 57  ? 72.390 75.009 36.310  1.00 186.83 ? 57  ASN B CG   1 
ATOM   1563 O  OD1  . ASN B 1 57  ? 73.242 74.315 35.758  1.00 180.67 ? 57  ASN B OD1  1 
ATOM   1564 N  ND2  . ASN B 1 57  ? 71.608 75.839 35.639  1.00 178.22 ? 57  ASN B ND2  1 
ATOM   1565 N  N    . GLN B 1 58  ? 73.100 72.146 37.153  1.00 169.66 ? 58  GLN B N    1 
ATOM   1566 C  CA   . GLN B 1 58  ? 73.368 71.020 36.260  1.00 171.03 ? 58  GLN B CA   1 
ATOM   1567 C  C    . GLN B 1 58  ? 72.880 69.692 36.826  1.00 173.20 ? 58  GLN B C    1 
ATOM   1568 O  O    . GLN B 1 58  ? 73.370 68.630 36.442  1.00 173.21 ? 58  GLN B O    1 
ATOM   1569 C  CB   . GLN B 1 58  ? 74.861 70.919 35.978  1.00 172.72 ? 58  GLN B CB   1 
ATOM   1570 C  CG   . GLN B 1 58  ? 75.178 70.651 34.531  1.00 174.70 ? 58  GLN B CG   1 
ATOM   1571 C  CD   . GLN B 1 58  ? 74.473 71.618 33.599  1.00 180.48 ? 58  GLN B CD   1 
ATOM   1572 O  OE1  . GLN B 1 58  ? 74.238 71.309 32.430  1.00 173.97 ? 58  GLN B OE1  1 
ATOM   1573 N  NE2  . GLN B 1 58  ? 74.134 72.800 34.110  1.00 170.64 ? 58  GLN B NE2  1 
ATOM   1574 N  N    . ASN B 1 59  ? 71.938 69.764 37.761  1.00 171.76 ? 59  ASN B N    1 
ATOM   1575 C  CA   . ASN B 1 59  ? 71.363 68.582 38.397  1.00 169.65 ? 59  ASN B CA   1 
ATOM   1576 C  C    . ASN B 1 59  ? 69.873 68.647 38.155  1.00 170.47 ? 59  ASN B C    1 
ATOM   1577 O  O    . ASN B 1 59  ? 69.166 67.640 38.224  1.00 169.88 ? 59  ASN B O    1 
ATOM   1578 C  CB   . ASN B 1 59  ? 71.620 68.617 39.900  1.00 166.20 ? 59  ASN B CB   1 
ATOM   1579 C  CG   . ASN B 1 59  ? 73.017 68.164 40.259  1.00 169.68 ? 59  ASN B CG   1 
ATOM   1580 O  OD1  . ASN B 1 59  ? 73.807 67.794 39.385  1.00 161.22 ? 59  ASN B OD1  1 
ATOM   1581 N  ND2  . ASN B 1 59  ? 73.333 68.186 41.552  1.00 158.77 ? 59  ASN B ND2  1 
ATOM   1582 N  N    . CYS B 1 60  ? 69.416 69.869 37.899  1.00 170.97 ? 60  CYS B N    1 
ATOM   1583 C  CA   . CYS B 1 60  ? 68.017 70.159 37.616  1.00 171.33 ? 60  CYS B CA   1 
ATOM   1584 C  C    . CYS B 1 60  ? 67.845 70.156 36.104  1.00 168.21 ? 60  CYS B C    1 
ATOM   1585 O  O    . CYS B 1 60  ? 66.749 69.907 35.588  1.00 166.49 ? 60  CYS B O    1 
ATOM   1586 C  CB   . CYS B 1 60  ? 67.643 71.540 38.169  1.00 174.49 ? 60  CYS B CB   1 
ATOM   1587 S  SG   . CYS B 1 60  ? 67.164 71.565 39.919  1.00 179.31 ? 60  CYS B SG   1 
ATOM   1588 N  N    . VAL B 1 61  ? 68.945 70.430 35.404  1.00 167.98 ? 61  VAL B N    1 
ATOM   1589 C  CA   . VAL B 1 61  ? 68.958 70.452 33.943  1.00 169.18 ? 61  VAL B CA   1 
ATOM   1590 C  C    . VAL B 1 61  ? 68.911 69.032 33.359  1.00 168.89 ? 61  VAL B C    1 
ATOM   1591 O  O    . VAL B 1 61  ? 68.584 68.841 32.177  1.00 167.57 ? 61  VAL B O    1 
ATOM   1592 C  CB   . VAL B 1 61  ? 70.166 71.257 33.395  1.00 177.95 ? 61  VAL B CB   1 
ATOM   1593 C  CG1  . VAL B 1 61  ? 70.732 70.603 32.133  1.00 178.60 ? 61  VAL B CG1  1 
ATOM   1594 C  CG2  . VAL B 1 61  ? 69.765 72.693 33.112  1.00 178.61 ? 61  VAL B CG2  1 
ATOM   1595 N  N    . ASP B 1 62  ? 69.223 68.043 34.195  1.00 166.35 ? 62  ASP B N    1 
ATOM   1596 C  CA   . ASP B 1 62  ? 69.197 66.643 33.783  1.00 166.51 ? 62  ASP B CA   1 
ATOM   1597 C  C    . ASP B 1 62  ? 67.831 66.046 34.124  1.00 165.97 ? 62  ASP B C    1 
ATOM   1598 O  O    . ASP B 1 62  ? 67.403 65.046 33.547  1.00 163.49 ? 62  ASP B O    1 
ATOM   1599 C  CB   . ASP B 1 62  ? 70.324 65.896 34.486  1.00 170.30 ? 62  ASP B CB   1 
ATOM   1600 C  CG   . ASP B 1 62  ? 71.489 66.807 34.824  1.00 194.61 ? 62  ASP B CG   1 
ATOM   1601 O  OD1  . ASP B 1 62  ? 71.968 67.516 33.909  1.00 197.16 ? 62  ASP B OD1  1 
ATOM   1602 O  OD2  . ASP B 1 62  ? 71.881 66.867 36.010  1.00 202.53 ? 62  ASP B OD2  1 
ATOM   1603 N  N    . ALA B 1 63  ? 67.131 66.721 35.027  1.00 161.95 ? 63  ALA B N    1 
ATOM   1604 C  CA   . ALA B 1 63  ? 65.812 66.313 35.474  1.00 163.09 ? 63  ALA B CA   1 
ATOM   1605 C  C    . ALA B 1 63  ? 64.712 66.869 34.589  1.00 162.31 ? 63  ALA B C    1 
ATOM   1606 O  O    . ALA B 1 63  ? 63.680 66.231 34.408  1.00 160.09 ? 63  ALA B O    1 
ATOM   1607 C  CB   . ALA B 1 63  ? 65.596 66.775 36.904  1.00 164.67 ? 63  ALA B CB   1 
ATOM   1608 N  N    . TYR B 1 64  ? 64.909 68.079 34.082  1.00 157.63 ? 64  TYR B N    1 
ATOM   1609 C  CA   . TYR B 1 64  ? 63.899 68.726 33.258  1.00 157.17 ? 64  TYR B CA   1 
ATOM   1610 C  C    . TYR B 1 64  ? 63.227 67.834 32.207  1.00 162.22 ? 64  TYR B C    1 
ATOM   1611 O  O    . TYR B 1 64  ? 62.007 67.632 32.225  1.00 162.59 ? 64  TYR B O    1 
ATOM   1612 C  CB   . TYR B 1 64  ? 64.436 70.005 32.630  1.00 155.64 ? 64  TYR B CB   1 
ATOM   1613 C  CG   . TYR B 1 64  ? 63.320 70.955 32.295  1.00 151.46 ? 64  TYR B CG   1 
ATOM   1614 C  CD1  . TYR B 1 64  ? 62.219 71.080 33.146  1.00 152.22 ? 64  TYR B CD1  1 
ATOM   1615 C  CD2  . TYR B 1 64  ? 63.301 71.641 31.082  1.00 150.54 ? 64  TYR B CD2  1 
ATOM   1616 C  CE1  . TYR B 1 64  ? 61.153 71.914 32.826  1.00 151.63 ? 64  TYR B CE1  1 
ATOM   1617 C  CE2  . TYR B 1 64  ? 62.238 72.478 30.744  1.00 150.68 ? 64  TYR B CE2  1 
ATOM   1618 C  CZ   . TYR B 1 64  ? 61.170 72.618 31.625  1.00 156.45 ? 64  TYR B CZ   1 
ATOM   1619 O  OH   . TYR B 1 64  ? 60.120 73.460 31.306  1.00 156.56 ? 64  TYR B OH   1 
ATOM   1620 N  N    . PRO B 1 65  ? 64.016 67.297 31.269  1.00 158.64 ? 65  PRO B N    1 
ATOM   1621 C  CA   . PRO B 1 65  ? 63.567 66.417 30.183  1.00 156.31 ? 65  PRO B CA   1 
ATOM   1622 C  C    . PRO B 1 65  ? 62.716 65.247 30.675  1.00 155.08 ? 65  PRO B C    1 
ATOM   1623 O  O    . PRO B 1 65  ? 61.541 65.116 30.325  1.00 153.06 ? 65  PRO B O    1 
ATOM   1624 C  CB   . PRO B 1 65  ? 64.884 65.870 29.632  1.00 158.44 ? 65  PRO B CB   1 
ATOM   1625 C  CG   . PRO B 1 65  ? 65.843 65.980 30.784  1.00 164.18 ? 65  PRO B CG   1 
ATOM   1626 C  CD   . PRO B 1 65  ? 65.477 67.270 31.434  1.00 159.74 ? 65  PRO B CD   1 
ATOM   1627 N  N    . THR B 1 66  ? 63.345 64.385 31.467  1.00 150.86 ? 66  THR B N    1 
ATOM   1628 C  CA   . THR B 1 66  ? 62.708 63.192 32.010  1.00 151.15 ? 66  THR B CA   1 
ATOM   1629 C  C    . THR B 1 66  ? 61.493 63.504 32.887  1.00 154.98 ? 66  THR B C    1 
ATOM   1630 O  O    . THR B 1 66  ? 60.757 62.601 33.290  1.00 154.84 ? 66  THR B O    1 
ATOM   1631 C  CB   . THR B 1 66  ? 63.742 62.314 32.737  1.00 160.80 ? 66  THR B CB   1 
ATOM   1632 O  OG1  . THR B 1 66  ? 65.032 62.934 32.648  1.00 160.72 ? 66  THR B OG1  1 
ATOM   1633 C  CG2  . THR B 1 66  ? 63.813 60.933 32.099  1.00 159.74 ? 66  THR B CG2  1 
ATOM   1634 N  N    . PHE B 1 67  ? 61.289 64.787 33.175  1.00 151.17 ? 67  PHE B N    1 
ATOM   1635 C  CA   . PHE B 1 67  ? 60.156 65.236 33.983  1.00 149.36 ? 67  PHE B CA   1 
ATOM   1636 C  C    . PHE B 1 67  ? 59.060 65.658 33.038  1.00 153.81 ? 67  PHE B C    1 
ATOM   1637 O  O    . PHE B 1 67  ? 57.909 65.223 33.144  1.00 153.62 ? 67  PHE B O    1 
ATOM   1638 C  CB   . PHE B 1 67  ? 60.549 66.464 34.804  1.00 148.92 ? 67  PHE B CB   1 
ATOM   1639 C  CG   . PHE B 1 67  ? 59.388 67.373 35.142  1.00 146.79 ? 67  PHE B CG   1 
ATOM   1640 C  CD1  . PHE B 1 67  ? 58.371 66.939 35.990  1.00 146.71 ? 67  PHE B CD1  1 
ATOM   1641 C  CD2  . PHE B 1 67  ? 59.335 68.679 34.656  1.00 145.56 ? 67  PHE B CD2  1 
ATOM   1642 C  CE1  . PHE B 1 67  ? 57.312 67.781 36.343  1.00 146.09 ? 67  PHE B CE1  1 
ATOM   1643 C  CE2  . PHE B 1 67  ? 58.275 69.533 35.005  1.00 146.64 ? 67  PHE B CE2  1 
ATOM   1644 C  CZ   . PHE B 1 67  ? 57.262 69.077 35.852  1.00 144.25 ? 67  PHE B CZ   1 
ATOM   1645 N  N    . LEU B 1 68  ? 59.435 66.551 32.133  1.00 149.14 ? 68  LEU B N    1 
ATOM   1646 C  CA   . LEU B 1 68  ? 58.518 67.056 31.139  1.00 148.79 ? 68  LEU B CA   1 
ATOM   1647 C  C    . LEU B 1 68  ? 57.853 65.876 30.463  1.00 151.95 ? 68  LEU B C    1 
ATOM   1648 O  O    . LEU B 1 68  ? 56.661 65.913 30.159  1.00 150.44 ? 68  LEU B O    1 
ATOM   1649 C  CB   . LEU B 1 68  ? 59.272 67.885 30.112  1.00 149.22 ? 68  LEU B CB   1 
ATOM   1650 C  CG   . LEU B 1 68  ? 58.741 69.310 30.059  1.00 154.95 ? 68  LEU B CG   1 
ATOM   1651 C  CD1  . LEU B 1 68  ? 57.864 69.567 31.276  1.00 155.48 ? 68  LEU B CD1  1 
ATOM   1652 C  CD2  . LEU B 1 68  ? 59.883 70.307 29.984  1.00 157.78 ? 68  LEU B CD2  1 
ATOM   1653 N  N    . ALA B 1 69  ? 58.633 64.819 30.264  1.00 146.49 ? 69  ALA B N    1 
ATOM   1654 C  CA   . ALA B 1 69  ? 58.131 63.610 29.640  1.00 147.95 ? 69  ALA B CA   1 
ATOM   1655 C  C    . ALA B 1 69  ? 56.843 63.182 30.325  1.00 153.28 ? 69  ALA B C    1 
ATOM   1656 O  O    . ALA B 1 69  ? 55.751 63.406 29.809  1.00 153.22 ? 69  ALA B O    1 
ATOM   1657 C  CB   . ALA B 1 69  ? 59.172 62.512 29.720  1.00 148.95 ? 69  ALA B CB   1 
ATOM   1658 N  N    . VAL B 1 70  ? 56.970 62.612 31.513  1.00 147.02 ? 70  VAL B N    1 
ATOM   1659 C  CA   . VAL B 1 70  ? 55.807 62.156 32.252  1.00 147.26 ? 70  VAL B CA   1 
ATOM   1660 C  C    . VAL B 1 70  ? 54.818 63.265 32.610  1.00 152.21 ? 70  VAL B C    1 
ATOM   1661 O  O    . VAL B 1 70  ? 53.678 62.975 32.969  1.00 152.18 ? 70  VAL B O    1 
ATOM   1662 C  CB   . VAL B 1 70  ? 56.206 61.323 33.466  1.00 151.56 ? 70  VAL B CB   1 
ATOM   1663 C  CG1  . VAL B 1 70  ? 57.023 60.113 33.026  1.00 151.44 ? 70  VAL B CG1  1 
ATOM   1664 C  CG2  . VAL B 1 70  ? 56.981 62.182 34.449  1.00 151.45 ? 70  VAL B CG2  1 
ATOM   1665 N  N    . LEU B 1 71  ? 55.235 64.526 32.511  1.00 148.64 ? 71  LEU B N    1 
ATOM   1666 C  CA   . LEU B 1 71  ? 54.324 65.634 32.818  1.00 148.01 ? 71  LEU B CA   1 
ATOM   1667 C  C    . LEU B 1 71  ? 53.218 65.714 31.774  1.00 149.26 ? 71  LEU B C    1 
ATOM   1668 O  O    . LEU B 1 71  ? 52.075 66.060 32.072  1.00 148.60 ? 71  LEU B O    1 
ATOM   1669 C  CB   . LEU B 1 71  ? 55.068 66.969 32.871  1.00 148.20 ? 71  LEU B CB   1 
ATOM   1670 C  CG   . LEU B 1 71  ? 54.346 68.146 33.554  1.00 152.86 ? 71  LEU B CG   1 
ATOM   1671 C  CD1  . LEU B 1 71  ? 54.288 69.396 32.667  1.00 152.98 ? 71  LEU B CD1  1 
ATOM   1672 C  CD2  . LEU B 1 71  ? 52.955 67.775 34.053  1.00 155.28 ? 71  LEU B CD2  1 
ATOM   1673 N  N    . TRP B 1 72  ? 53.567 65.386 30.542  1.00 146.73 ? 72  TRP B N    1 
ATOM   1674 C  CA   . TRP B 1 72  ? 52.604 65.422 29.465  1.00 146.85 ? 72  TRP B CA   1 
ATOM   1675 C  C    . TRP B 1 72  ? 51.985 64.061 29.214  1.00 150.40 ? 72  TRP B C    1 
ATOM   1676 O  O    . TRP B 1 72  ? 50.768 63.938 29.128  1.00 149.56 ? 72  TRP B O    1 
ATOM   1677 C  CB   . TRP B 1 72  ? 53.265 65.959 28.210  1.00 146.74 ? 72  TRP B CB   1 
ATOM   1678 C  CG   . TRP B 1 72  ? 53.580 67.403 28.325  1.00 149.00 ? 72  TRP B CG   1 
ATOM   1679 C  CD1  . TRP B 1 72  ? 54.735 67.954 28.786  1.00 152.12 ? 72  TRP B CD1  1 
ATOM   1680 C  CD2  . TRP B 1 72  ? 52.699 68.492 28.040  1.00 149.28 ? 72  TRP B CD2  1 
ATOM   1681 N  NE1  . TRP B 1 72  ? 54.645 69.324 28.766  1.00 151.65 ? 72  TRP B NE1  1 
ATOM   1682 C  CE2  . TRP B 1 72  ? 53.404 69.679 28.309  1.00 153.09 ? 72  TRP B CE2  1 
ATOM   1683 C  CE3  . TRP B 1 72  ? 51.387 68.578 27.558  1.00 150.74 ? 72  TRP B CE3  1 
ATOM   1684 C  CZ2  . TRP B 1 72  ? 52.839 70.938 28.124  1.00 152.40 ? 72  TRP B CZ2  1 
ATOM   1685 C  CZ3  . TRP B 1 72  ? 50.831 69.828 27.364  1.00 152.18 ? 72  TRP B CZ3  1 
ATOM   1686 C  CH2  . TRP B 1 72  ? 51.557 70.991 27.647  1.00 152.74 ? 72  TRP B CH2  1 
ATOM   1687 N  N    . SER B 1 73  ? 52.824 63.039 29.104  1.00 145.12 ? 73  SER B N    1 
ATOM   1688 C  CA   . SER B 1 73  ? 52.330 61.694 28.881  1.00 145.46 ? 73  SER B CA   1 
ATOM   1689 C  C    . SER B 1 73  ? 51.247 61.375 29.898  1.00 150.57 ? 73  SER B C    1 
ATOM   1690 O  O    . SER B 1 73  ? 50.234 60.766 29.573  1.00 150.51 ? 73  SER B O    1 
ATOM   1691 C  CB   . SER B 1 73  ? 53.473 60.695 28.959  1.00 148.72 ? 73  SER B CB   1 
ATOM   1692 O  OG   . SER B 1 73  ? 54.377 60.924 27.889  1.00 157.00 ? 73  SER B OG   1 
ATOM   1693 N  N    . ALA B 1 74  ? 51.413 61.881 31.109  1.00 146.70 ? 74  ALA B N    1 
ATOM   1694 C  CA   . ALA B 1 74  ? 50.410 61.678 32.136  1.00 145.88 ? 74  ALA B CA   1 
ATOM   1695 C  C    . ALA B 1 74  ? 49.400 62.801 32.077  1.00 149.50 ? 74  ALA B C    1 
ATOM   1696 O  O    . ALA B 1 74  ? 48.473 62.855 32.874  1.00 148.89 ? 74  ALA B O    1 
ATOM   1697 C  CB   . ALA B 1 74  ? 51.054 61.632 33.488  1.00 146.42 ? 74  ALA B CB   1 
ATOM   1698 N  N    . GLY B 1 75  ? 49.603 63.715 31.142  1.00 147.47 ? 75  GLY B N    1 
ATOM   1699 C  CA   . GLY B 1 75  ? 48.714 64.845 30.979  1.00 147.40 ? 75  GLY B CA   1 
ATOM   1700 C  C    . GLY B 1 75  ? 47.701 64.591 29.884  1.00 151.38 ? 75  GLY B C    1 
ATOM   1701 O  O    . GLY B 1 75  ? 46.563 65.047 29.969  1.00 150.77 ? 75  GLY B O    1 
ATOM   1702 N  N    . LEU B 1 76  ? 48.123 63.875 28.845  1.00 149.40 ? 76  LEU B N    1 
ATOM   1703 C  CA   . LEU B 1 76  ? 47.244 63.542 27.729  1.00 149.47 ? 76  LEU B CA   1 
ATOM   1704 C  C    . LEU B 1 76  ? 46.708 62.141 27.932  1.00 155.09 ? 76  LEU B C    1 
ATOM   1705 O  O    . LEU B 1 76  ? 45.498 61.923 27.958  1.00 154.81 ? 76  LEU B O    1 
ATOM   1706 C  CB   . LEU B 1 76  ? 47.999 63.605 26.408  1.00 149.08 ? 76  LEU B CB   1 
ATOM   1707 C  CG   . LEU B 1 76  ? 48.556 64.988 26.109  1.00 152.61 ? 76  LEU B CG   1 
ATOM   1708 C  CD1  . LEU B 1 76  ? 47.640 66.042 26.689  1.00 152.37 ? 76  LEU B CD1  1 
ATOM   1709 C  CD2  . LEU B 1 76  ? 49.929 65.090 26.725  1.00 154.67 ? 76  LEU B CD2  1 
ATOM   1710 N  N    . LEU B 1 77  ? 47.618 61.196 28.109  1.00 152.84 ? 77  LEU B N    1 
ATOM   1711 C  CA   . LEU B 1 77  ? 47.221 59.824 28.326  1.00 152.34 ? 77  LEU B CA   1 
ATOM   1712 C  C    . LEU B 1 77  ? 46.456 59.662 29.631  1.00 162.62 ? 77  LEU B C    1 
ATOM   1713 O  O    . LEU B 1 77  ? 46.176 58.538 30.045  1.00 164.11 ? 77  LEU B O    1 
ATOM   1714 C  CB   . LEU B 1 77  ? 48.436 58.907 28.316  1.00 150.08 ? 77  LEU B CB   1 
ATOM   1715 C  CG   . LEU B 1 77  ? 48.888 58.521 26.916  1.00 150.30 ? 77  LEU B CG   1 
ATOM   1716 C  CD1  . LEU B 1 77  ? 48.821 59.760 26.026  1.00 148.99 ? 77  LEU B CD1  1 
ATOM   1717 C  CD2  . LEU B 1 77  ? 50.287 57.912 26.957  1.00 151.30 ? 77  LEU B CD2  1 
ATOM   1718 N  N    . CYS B 1 78  ? 46.095 60.776 30.262  1.00 162.16 ? 78  CYS B N    1 
ATOM   1719 C  CA   . CYS B 1 78  ? 45.377 60.716 31.523  1.00 162.65 ? 78  CYS B CA   1 
ATOM   1720 C  C    . CYS B 1 78  ? 45.245 62.083 32.190  1.00 167.31 ? 78  CYS B C    1 
ATOM   1721 O  O    . CYS B 1 78  ? 46.248 62.772 32.382  1.00 166.81 ? 78  CYS B O    1 
ATOM   1722 C  CB   . CYS B 1 78  ? 46.133 59.795 32.464  1.00 163.87 ? 78  CYS B CB   1 
ATOM   1723 S  SG   . CYS B 1 78  ? 45.226 59.445 33.935  1.00 168.05 ? 78  CYS B SG   1 
ATOM   1724 N  N    . SER B 1 79  ? 44.020 62.430 32.596  1.00 165.24 ? 79  SER B N    1 
ATOM   1725 C  CA   . SER B 1 79  ? 43.693 63.705 33.266  1.00 165.20 ? 79  SER B CA   1 
ATOM   1726 C  C    . SER B 1 79  ? 44.713 64.847 33.250  1.00 167.77 ? 79  SER B C    1 
ATOM   1727 O  O    . SER B 1 79  ? 45.810 64.742 33.801  1.00 166.34 ? 79  SER B O    1 
ATOM   1728 C  CB   . SER B 1 79  ? 43.087 63.506 34.662  1.00 169.81 ? 79  SER B CB   1 
ATOM   1729 O  OG   . SER B 1 79  ? 43.811 62.557 35.424  1.00 179.63 ? 79  SER B OG   1 
ATOM   1730 N  N    . GLN B 1 80  ? 44.327 65.943 32.609  1.00 164.69 ? 80  GLN B N    1 
ATOM   1731 C  CA   . GLN B 1 80  ? 45.188 67.108 32.476  1.00 164.61 ? 80  GLN B CA   1 
ATOM   1732 C  C    . GLN B 1 80  ? 45.263 67.913 33.763  1.00 165.32 ? 80  GLN B C    1 
ATOM   1733 O  O    . GLN B 1 80  ? 46.034 68.861 33.858  1.00 163.61 ? 80  GLN B O    1 
ATOM   1734 C  CB   . GLN B 1 80  ? 44.697 68.001 31.331  1.00 166.20 ? 80  GLN B CB   1 
ATOM   1735 C  CG   . GLN B 1 80  ? 45.490 69.282 31.146  1.00 176.19 ? 80  GLN B CG   1 
ATOM   1736 C  CD   . GLN B 1 80  ? 44.591 70.480 30.962  1.00 189.73 ? 80  GLN B CD   1 
ATOM   1737 O  OE1  . GLN B 1 80  ? 43.380 70.391 31.159  1.00 184.39 ? 80  GLN B OE1  1 
ATOM   1738 N  NE2  . GLN B 1 80  ? 45.181 71.618 30.618  1.00 181.05 ? 80  GLN B NE2  1 
ATOM   1739 N  N    . VAL B 1 81  ? 44.466 67.530 34.754  1.00 160.86 ? 81  VAL B N    1 
ATOM   1740 C  CA   . VAL B 1 81  ? 44.443 68.244 36.020  1.00 157.93 ? 81  VAL B CA   1 
ATOM   1741 C  C    . VAL B 1 81  ? 45.442 67.711 37.042  1.00 167.05 ? 81  VAL B C    1 
ATOM   1742 O  O    . VAL B 1 81  ? 46.284 68.450 37.537  1.00 168.00 ? 81  VAL B O    1 
ATOM   1743 C  CB   . VAL B 1 81  ? 43.030 68.321 36.584  1.00 153.59 ? 81  VAL B CB   1 
ATOM   1744 C  CG1  . VAL B 1 81  ? 42.054 67.667 35.627  1.00 151.97 ? 81  VAL B CG1  1 
ATOM   1745 C  CG2  . VAL B 1 81  ? 42.966 67.665 37.949  1.00 151.98 ? 81  VAL B CG2  1 
ATOM   1746 N  N    . PRO B 1 82  ? 45.350 66.421 37.383  1.00 167.06 ? 82  PRO B N    1 
ATOM   1747 C  CA   . PRO B 1 82  ? 46.301 65.897 38.362  1.00 165.25 ? 82  PRO B CA   1 
ATOM   1748 C  C    . PRO B 1 82  ? 47.708 65.958 37.786  1.00 164.92 ? 82  PRO B C    1 
ATOM   1749 O  O    . PRO B 1 82  ? 48.665 66.315 38.472  1.00 162.96 ? 82  PRO B O    1 
ATOM   1750 C  CB   . PRO B 1 82  ? 45.860 64.449 38.502  1.00 167.56 ? 82  PRO B CB   1 
ATOM   1751 C  CG   . PRO B 1 82  ? 45.380 64.095 37.121  1.00 173.37 ? 82  PRO B CG   1 
ATOM   1752 C  CD   . PRO B 1 82  ? 44.850 65.364 36.489  1.00 168.65 ? 82  PRO B CD   1 
ATOM   1753 N  N    . ALA B 1 83  ? 47.821 65.619 36.510  1.00 163.39 ? 83  ALA B N    1 
ATOM   1754 C  CA   . ALA B 1 83  ? 49.101 65.654 35.830  1.00 164.13 ? 83  ALA B CA   1 
ATOM   1755 C  C    . ALA B 1 83  ? 49.720 67.036 35.983  1.00 168.56 ? 83  ALA B C    1 
ATOM   1756 O  O    . ALA B 1 83  ? 50.894 67.163 36.320  1.00 168.50 ? 83  ALA B O    1 
ATOM   1757 C  CB   . ALA B 1 83  ? 48.923 65.310 34.361  1.00 165.03 ? 83  ALA B CB   1 
ATOM   1758 N  N    . ALA B 1 84  ? 48.924 68.074 35.743  1.00 165.35 ? 84  ALA B N    1 
ATOM   1759 C  CA   . ALA B 1 84  ? 49.422 69.442 35.846  1.00 164.68 ? 84  ALA B CA   1 
ATOM   1760 C  C    . ALA B 1 84  ? 49.690 69.908 37.280  1.00 168.38 ? 84  ALA B C    1 
ATOM   1761 O  O    . ALA B 1 84  ? 50.538 70.775 37.502  1.00 167.94 ? 84  ALA B O    1 
ATOM   1762 C  CB   . ALA B 1 84  ? 48.521 70.414 35.102  1.00 165.29 ? 84  ALA B CB   1 
ATOM   1763 N  N    . PHE B 1 85  ? 48.988 69.326 38.252  1.00 166.14 ? 85  PHE B N    1 
ATOM   1764 C  CA   . PHE B 1 85  ? 49.209 69.678 39.651  1.00 168.13 ? 85  PHE B CA   1 
ATOM   1765 C  C    . PHE B 1 85  ? 50.482 69.008 40.153  1.00 162.98 ? 85  PHE B C    1 
ATOM   1766 O  O    . PHE B 1 85  ? 51.372 69.673 40.669  1.00 159.57 ? 85  PHE B O    1 
ATOM   1767 C  CB   . PHE B 1 85  ? 48.025 69.275 40.524  1.00 175.91 ? 85  PHE B CB   1 
ATOM   1768 C  CG   . PHE B 1 85  ? 48.222 69.573 41.981  1.00 185.80 ? 85  PHE B CG   1 
ATOM   1769 C  CD1  . PHE B 1 85  ? 47.386 69.012 42.936  1.00 195.07 ? 85  PHE B CD1  1 
ATOM   1770 C  CD2  . PHE B 1 85  ? 49.230 70.428 42.398  1.00 194.38 ? 85  PHE B CD2  1 
ATOM   1771 C  CE1  . PHE B 1 85  ? 47.549 69.300 44.277  1.00 198.58 ? 85  PHE B CE1  1 
ATOM   1772 C  CE2  . PHE B 1 85  ? 49.410 70.709 43.736  1.00 200.10 ? 85  PHE B CE2  1 
ATOM   1773 C  CZ   . PHE B 1 85  ? 48.566 70.147 44.679  1.00 198.94 ? 85  PHE B CZ   1 
ATOM   1774 N  N    . ALA B 1 86  ? 50.562 67.692 40.020  1.00 160.29 ? 86  ALA B N    1 
ATOM   1775 C  CA   . ALA B 1 86  ? 51.755 66.991 40.453  1.00 161.68 ? 86  ALA B CA   1 
ATOM   1776 C  C    . ALA B 1 86  ? 52.978 67.617 39.797  1.00 165.86 ? 86  ALA B C    1 
ATOM   1777 O  O    . ALA B 1 86  ? 54.033 67.712 40.414  1.00 164.94 ? 86  ALA B O    1 
ATOM   1778 C  CB   . ALA B 1 86  ? 51.661 65.536 40.122  1.00 162.79 ? 86  ALA B CB   1 
ATOM   1779 N  N    . GLY B 1 87  ? 52.818 68.084 38.560  1.00 163.28 ? 87  GLY B N    1 
ATOM   1780 C  CA   . GLY B 1 87  ? 53.882 68.745 37.823  1.00 163.58 ? 87  GLY B CA   1 
ATOM   1781 C  C    . GLY B 1 87  ? 54.227 70.070 38.473  1.00 168.11 ? 87  GLY B C    1 
ATOM   1782 O  O    . GLY B 1 87  ? 55.350 70.561 38.353  1.00 167.64 ? 87  GLY B O    1 
ATOM   1783 N  N    . LEU B 1 88  ? 53.258 70.646 39.180  1.00 164.53 ? 88  LEU B N    1 
ATOM   1784 C  CA   . LEU B 1 88  ? 53.469 71.912 39.879  1.00 163.81 ? 88  LEU B CA   1 
ATOM   1785 C  C    . LEU B 1 88  ? 54.282 71.699 41.160  1.00 165.02 ? 88  LEU B C    1 
ATOM   1786 O  O    . LEU B 1 88  ? 55.163 72.486 41.482  1.00 163.76 ? 88  LEU B O    1 
ATOM   1787 C  CB   . LEU B 1 88  ? 52.137 72.602 40.177  1.00 163.79 ? 88  LEU B CB   1 
ATOM   1788 C  CG   . LEU B 1 88  ? 52.109 73.626 41.312  1.00 167.97 ? 88  LEU B CG   1 
ATOM   1789 C  CD1  . LEU B 1 88  ? 52.010 72.959 42.675  1.00 167.93 ? 88  LEU B CD1  1 
ATOM   1790 C  CD2  . LEU B 1 88  ? 53.312 74.534 41.237  1.00 170.24 ? 88  LEU B CD2  1 
ATOM   1791 N  N    . MET B 1 89  ? 54.015 70.602 41.859  1.00 163.93 ? 89  MET B N    1 
ATOM   1792 C  CA   . MET B 1 89  ? 54.734 70.258 43.082  1.00 163.93 ? 89  MET B CA   1 
ATOM   1793 C  C    . MET B 1 89  ? 56.184 70.049 42.747  1.00 163.93 ? 89  MET B C    1 
ATOM   1794 O  O    . MET B 1 89  ? 57.078 70.451 43.489  1.00 238.93 ? 89  MET B O    1 
ATOM   1795 C  CB   . MET B 1 89  ? 54.177 68.956 43.632  1.00 163.93 ? 89  MET B CB   1 
ATOM   1796 C  CG   . MET B 1 89  ? 52.676 69.004 43.790  1.00 163.93 ? 89  MET B CG   1 
ATOM   1797 S  SD   . MET B 1 89  ? 52.312 70.325 44.942  1.00 163.93 ? 89  MET B SD   1 
ATOM   1798 C  CE   . MET B 1 89  ? 53.817 70.209 45.957  1.00 163.93 ? 89  MET B CE   1 
ATOM   1799 N  N    . TYR B 1 90  ? 56.398 69.391 41.616  1.00 162.96 ? 90  TYR B N    1 
ATOM   1800 C  CA   . TYR B 1 90  ? 57.732 69.123 41.117  1.00 163.70 ? 90  TYR B CA   1 
ATOM   1801 C  C    . TYR B 1 90  ? 58.500 70.438 40.987  1.00 169.57 ? 90  TYR B C    1 
ATOM   1802 O  O    . TYR B 1 90  ? 59.722 70.472 41.149  1.00 169.07 ? 90  TYR B O    1 
ATOM   1803 C  CB   . TYR B 1 90  ? 57.673 68.422 39.762  1.00 164.98 ? 90  TYR B CB   1 
ATOM   1804 C  CG   . TYR B 1 90  ? 59.034 68.186 39.175  1.00 166.30 ? 90  TYR B CG   1 
ATOM   1805 C  CD1  . TYR B 1 90  ? 59.658 69.161 38.422  1.00 168.09 ? 90  TYR B CD1  1 
ATOM   1806 C  CD2  . TYR B 1 90  ? 59.733 67.020 39.449  1.00 166.68 ? 90  TYR B CD2  1 
ATOM   1807 C  CE1  . TYR B 1 90  ? 60.929 68.963 37.913  1.00 168.21 ? 90  TYR B CE1  1 
ATOM   1808 C  CE2  . TYR B 1 90  ? 61.001 66.803 38.938  1.00 167.25 ? 90  TYR B CE2  1 
ATOM   1809 C  CZ   . TYR B 1 90  ? 61.597 67.779 38.168  1.00 173.16 ? 90  TYR B CZ   1 
ATOM   1810 O  OH   . TYR B 1 90  ? 62.865 67.576 37.657  1.00 173.18 ? 90  TYR B OH   1 
ATOM   1811 N  N    . LEU B 1 91  ? 57.783 71.522 40.700  1.00 168.40 ? 91  LEU B N    1 
ATOM   1812 C  CA   . LEU B 1 91  ? 58.408 72.840 40.581  1.00 169.89 ? 91  LEU B CA   1 
ATOM   1813 C  C    . LEU B 1 91  ? 58.720 73.392 41.979  1.00 171.35 ? 91  LEU B C    1 
ATOM   1814 O  O    . LEU B 1 91  ? 59.529 74.310 42.140  1.00 169.79 ? 91  LEU B O    1 
ATOM   1815 C  CB   . LEU B 1 91  ? 57.490 73.798 39.814  1.00 171.83 ? 91  LEU B CB   1 
ATOM   1816 C  CG   . LEU B 1 91  ? 57.517 73.740 38.284  1.00 179.84 ? 91  LEU B CG   1 
ATOM   1817 C  CD1  . LEU B 1 91  ? 58.393 72.601 37.789  1.00 181.06 ? 91  LEU B CD1  1 
ATOM   1818 C  CD2  . LEU B 1 91  ? 56.111 73.616 37.736  1.00 183.36 ? 91  LEU B CD2  1 
ATOM   1819 N  N    . PHE B 1 92  ? 58.065 72.810 42.982  1.00 171.25 ? 92  PHE B N    1 
ATOM   1820 C  CA   . PHE B 1 92  ? 58.264 73.190 44.373  1.00 174.31 ? 92  PHE B CA   1 
ATOM   1821 C  C    . PHE B 1 92  ? 59.469 72.444 44.915  1.00 168.95 ? 92  PHE B C    1 
ATOM   1822 O  O    . PHE B 1 92  ? 60.338 73.028 45.549  1.00 166.04 ? 92  PHE B O    1 
ATOM   1823 C  CB   . PHE B 1 92  ? 57.032 72.839 45.209  1.00 182.60 ? 92  PHE B CB   1 
ATOM   1824 C  CG   . PHE B 1 92  ? 56.002 73.931 45.255  1.00 192.72 ? 92  PHE B CG   1 
ATOM   1825 C  CD1  . PHE B 1 92  ? 55.998 74.940 44.301  1.00 202.06 ? 92  PHE B CD1  1 
ATOM   1826 C  CD2  . PHE B 1 92  ? 55.034 73.945 46.247  1.00 201.31 ? 92  PHE B CD2  1 
ATOM   1827 C  CE1  . PHE B 1 92  ? 55.045 75.936 44.330  1.00 205.56 ? 92  PHE B CE1  1 
ATOM   1828 C  CE2  . PHE B 1 92  ? 54.076 74.939 46.283  1.00 207.02 ? 92  PHE B CE2  1 
ATOM   1829 C  CZ   . PHE B 1 92  ? 54.082 75.936 45.322  1.00 205.87 ? 92  PHE B CZ   1 
ATOM   1830 N  N    . VAL B 1 93  ? 59.521 71.147 44.662  1.00 167.24 ? 93  VAL B N    1 
ATOM   1831 C  CA   . VAL B 1 93  ? 60.652 70.362 45.106  1.00 168.29 ? 93  VAL B CA   1 
ATOM   1832 C  C    . VAL B 1 93  ? 61.907 70.901 44.441  1.00 171.06 ? 93  VAL B C    1 
ATOM   1833 O  O    . VAL B 1 93  ? 62.941 71.047 45.089  1.00 169.89 ? 93  VAL B O    1 
ATOM   1834 C  CB   . VAL B 1 93  ? 60.458 68.894 44.773  1.00 174.46 ? 93  VAL B CB   1 
ATOM   1835 C  CG1  . VAL B 1 93  ? 61.183 68.015 45.784  1.00 174.64 ? 93  VAL B CG1  1 
ATOM   1836 C  CG2  . VAL B 1 93  ? 58.976 68.579 44.703  1.00 174.66 ? 93  VAL B CG2  1 
ATOM   1837 N  N    . ARG B 1 94  ? 61.812 71.200 43.147  1.00 170.43 ? 94  ARG B N    1 
ATOM   1838 C  CA   . ARG B 1 94  ? 62.948 71.722 42.397  1.00 171.50 ? 94  ARG B CA   1 
ATOM   1839 C  C    . ARG B 1 94  ? 63.468 72.998 43.036  1.00 179.38 ? 94  ARG B C    1 
ATOM   1840 O  O    . ARG B 1 94  ? 64.679 73.231 43.094  1.00 179.21 ? 94  ARG B O    1 
ATOM   1841 C  CB   . ARG B 1 94  ? 62.570 71.960 40.945  1.00 171.06 ? 94  ARG B CB   1 
ATOM   1842 C  CG   . ARG B 1 94  ? 62.972 70.814 40.061  1.00 177.64 ? 94  ARG B CG   1 
ATOM   1843 C  CD   . ARG B 1 94  ? 63.996 71.254 39.057  1.00 179.67 ? 94  ARG B CD   1 
ATOM   1844 N  NE   . ARG B 1 94  ? 63.430 72.262 38.172  1.00 178.99 ? 94  ARG B NE   1 
ATOM   1845 C  CZ   . ARG B 1 94  ? 63.381 72.157 36.849  1.00 186.54 ? 94  ARG B CZ   1 
ATOM   1846 N  NH1  . ARG B 1 94  ? 63.874 71.083 36.237  1.00 172.32 ? 94  ARG B NH1  1 
ATOM   1847 N  NH2  . ARG B 1 94  ? 62.839 73.134 36.137  1.00 171.73 ? 94  ARG B NH2  1 
ATOM   1848 N  N    . GLN B 1 95  ? 62.542 73.804 43.545  1.00 178.36 ? 95  GLN B N    1 
ATOM   1849 C  CA   . GLN B 1 95  ? 62.899 75.038 44.230  1.00 180.15 ? 95  GLN B CA   1 
ATOM   1850 C  C    . GLN B 1 95  ? 63.618 74.728 45.538  1.00 186.94 ? 95  GLN B C    1 
ATOM   1851 O  O    . GLN B 1 95  ? 64.696 75.253 45.803  1.00 186.43 ? 95  GLN B O    1 
ATOM   1852 C  CB   . GLN B 1 95  ? 61.649 75.875 44.517  1.00 182.03 ? 95  GLN B CB   1 
ATOM   1853 C  CG   . GLN B 1 95  ? 61.878 77.353 44.317  1.00 201.02 ? 95  GLN B CG   1 
ATOM   1854 C  CD   . GLN B 1 95  ? 63.127 77.622 43.499  1.00 222.86 ? 95  GLN B CD   1 
ATOM   1855 O  OE1  . GLN B 1 95  ? 63.264 77.130 42.377  1.00 218.76 ? 95  GLN B OE1  1 
ATOM   1856 N  NE2  . GLN B 1 95  ? 64.066 78.364 44.076  1.00 215.41 ? 95  GLN B NE2  1 
ATOM   1857 N  N    . LYS B 1 96  ? 63.017 73.858 46.342  1.00 183.96 ? 96  LYS B N    1 
ATOM   1858 C  CA   . LYS B 1 96  ? 63.567 73.496 47.640  1.00 184.98 ? 96  LYS B CA   1 
ATOM   1859 C  C    . LYS B 1 96  ? 64.791 72.593 47.575  1.00 186.92 ? 96  LYS B C    1 
ATOM   1860 O  O    . LYS B 1 96  ? 65.488 72.413 48.567  1.00 185.42 ? 96  LYS B O    1 
ATOM   1861 C  CB   . LYS B 1 96  ? 62.486 72.913 48.542  1.00 189.71 ? 96  LYS B CB   1 
ATOM   1862 C  CG   . LYS B 1 96  ? 61.513 73.963 49.081  1.00 218.34 ? 96  LYS B CG   1 
ATOM   1863 C  CD   . LYS B 1 96  ? 61.082 74.960 47.997  1.00 235.17 ? 96  LYS B CD   1 
ATOM   1864 C  CE   . LYS B 1 96  ? 61.015 76.391 48.524  1.00 250.50 ? 96  LYS B CE   1 
ATOM   1865 N  NZ   . LYS B 1 96  ? 60.139 77.269 47.693  1.00 260.89 ? 96  LYS B NZ   1 
ATOM   1866 N  N    . TYR B 1 97  ? 65.069 72.052 46.397  1.00 188.50 ? 97  TYR B N    1 
ATOM   1867 C  CA   . TYR B 1 97  ? 66.248 71.221 46.213  1.00 187.81 ? 97  TYR B CA   1 
ATOM   1868 C  C    . TYR B 1 97  ? 67.376 72.108 45.699  1.00 194.44 ? 97  TYR B C    1 
ATOM   1869 O  O    . TYR B 1 97  ? 68.482 72.082 46.231  1.00 193.93 ? 97  TYR B O    1 
ATOM   1870 C  CB   . TYR B 1 97  ? 65.957 70.083 45.241  1.00 185.92 ? 97  TYR B CB   1 
ATOM   1871 C  CG   . TYR B 1 97  ? 67.159 69.579 44.482  1.00 181.96 ? 97  TYR B CG   1 
ATOM   1872 C  CD1  . TYR B 1 97  ? 68.036 68.669 45.053  1.00 182.81 ? 97  TYR B CD1  1 
ATOM   1873 C  CD2  . TYR B 1 97  ? 67.386 69.973 43.172  1.00 181.06 ? 97  TYR B CD2  1 
ATOM   1874 C  CE1  . TYR B 1 97  ? 69.126 68.182 44.347  1.00 182.11 ? 97  TYR B CE1  1 
ATOM   1875 C  CE2  . TYR B 1 97  ? 68.471 69.494 42.454  1.00 181.14 ? 97  TYR B CE2  1 
ATOM   1876 C  CZ   . TYR B 1 97  ? 69.338 68.597 43.047  1.00 186.32 ? 97  TYR B CZ   1 
ATOM   1877 O  OH   . TYR B 1 97  ? 70.416 68.116 42.339  1.00 185.99 ? 97  TYR B OH   1 
ATOM   1878 N  N    . PHE B 1 98  ? 67.076 72.929 44.696  1.00 194.02 ? 98  PHE B N    1 
ATOM   1879 C  CA   . PHE B 1 98  ? 68.067 73.850 44.141  1.00 192.77 ? 98  PHE B CA   1 
ATOM   1880 C  C    . PHE B 1 98  ? 68.402 74.931 45.152  1.00 209.95 ? 98  PHE B C    1 
ATOM   1881 O  O    . PHE B 1 98  ? 69.328 75.717 44.961  1.00 211.90 ? 98  PHE B O    1 
ATOM   1882 C  CB   . PHE B 1 98  ? 67.538 74.521 42.876  1.00 187.94 ? 98  PHE B CB   1 
ATOM   1883 C  CG   . PHE B 1 98  ? 68.510 75.488 42.247  1.00 179.46 ? 98  PHE B CG   1 
ATOM   1884 C  CD1  . PHE B 1 98  ? 69.602 75.023 41.516  1.00 174.39 ? 98  PHE B CD1  1 
ATOM   1885 C  CD2  . PHE B 1 98  ? 68.320 76.860 42.358  1.00 173.17 ? 98  PHE B CD2  1 
ATOM   1886 C  CE1  . PHE B 1 98  ? 70.487 75.910 40.903  1.00 171.59 ? 98  PHE B CE1  1 
ATOM   1887 C  CE2  . PHE B 1 98  ? 69.201 77.755 41.748  1.00 171.79 ? 98  PHE B CE2  1 
ATOM   1888 C  CZ   . PHE B 1 98  ? 70.286 77.279 41.018  1.00 168.70 ? 98  PHE B CZ   1 
ATOM   1889 N  N    . VAL B 1 99  ? 67.613 74.985 46.215  1.00 207.16 ? 99  VAL B N    1 
ATOM   1890 C  CA   . VAL B 1 99  ? 67.799 75.971 47.267  1.00 206.06 ? 99  VAL B CA   1 
ATOM   1891 C  C    . VAL B 1 99  ? 68.779 75.437 48.297  1.00 217.17 ? 99  VAL B C    1 
ATOM   1892 O  O    . VAL B 1 99  ? 69.830 76.027 48.535  1.00 217.77 ? 99  VAL B O    1 
ATOM   1893 C  CB   . VAL B 1 99  ? 66.452 76.324 47.929  1.00 204.35 ? 99  VAL B CB   1 
ATOM   1894 C  CG1  . VAL B 1 99  ? 66.556 76.267 49.450  1.00 203.20 ? 99  VAL B CG1  1 
ATOM   1895 C  CG2  . VAL B 1 99  ? 65.960 77.682 47.457  1.00 203.21 ? 99  VAL B CG2  1 
ATOM   1896 N  N    . GLY B 1 100 ? 68.427 74.307 48.898  1.00 215.10 ? 100 GLY B N    1 
ATOM   1897 C  CA   . GLY B 1 100 ? 69.249 73.677 49.909  1.00 215.62 ? 100 GLY B CA   1 
ATOM   1898 C  C    . GLY B 1 100 ? 70.617 73.337 49.364  1.00 220.94 ? 100 GLY B C    1 
ATOM   1899 O  O    . GLY B 1 100 ? 71.584 73.202 50.115  1.00 220.25 ? 100 GLY B O    1 
ATOM   1900 N  N    . TYR B 1 101 ? 70.694 73.195 48.047  1.00 218.30 ? 101 TYR B N    1 
ATOM   1901 C  CA   . TYR B 1 101 ? 71.951 72.879 47.391  1.00 219.54 ? 101 TYR B CA   1 
ATOM   1902 C  C    . TYR B 1 101 ? 72.755 74.154 47.213  1.00 228.91 ? 101 TYR B C    1 
ATOM   1903 O  O    . TYR B 1 101 ? 73.488 74.308 46.237  1.00 229.07 ? 101 TYR B O    1 
ATOM   1904 C  CB   . TYR B 1 101 ? 71.702 72.235 46.030  1.00 219.87 ? 101 TYR B CB   1 
ATOM   1905 C  CG   . TYR B 1 101 ? 72.656 71.112 45.722  1.00 219.73 ? 101 TYR B CG   1 
ATOM   1906 C  CD1  . TYR B 1 101 ? 73.831 70.964 46.443  1.00 221.29 ? 101 TYR B CD1  1 
ATOM   1907 C  CD2  . TYR B 1 101 ? 72.376 70.194 44.724  1.00 219.70 ? 101 TYR B CD2  1 
ATOM   1908 C  CE1  . TYR B 1 101 ? 74.697 69.938 46.179  1.00 221.20 ? 101 TYR B CE1  1 
ATOM   1909 C  CE2  . TYR B 1 101 ? 73.235 69.164 44.452  1.00 220.11 ? 101 TYR B CE2  1 
ATOM   1910 C  CZ   . TYR B 1 101 ? 74.393 69.043 45.180  1.00 225.93 ? 101 TYR B CZ   1 
ATOM   1911 O  OH   . TYR B 1 101 ? 75.259 68.018 44.905  1.00 225.90 ? 101 TYR B OH   1 
ATOM   1912 N  N    . LEU B 1 102 ? 72.563 75.089 48.137  1.00 232.61 ? 102 LEU B N    1 
ATOM   1913 C  CA   . LEU B 1 102 ? 73.276 76.356 48.103  1.00 237.03 ? 102 LEU B CA   1 
ATOM   1914 C  C    . LEU B 1 102 ? 74.713 76.170 48.584  1.00 226.81 ? 102 LEU B C    1 
ATOM   1915 O  O    . LEU B 1 102 ? 75.655 76.509 47.861  1.00 222.91 ? 102 LEU B O    1 
ATOM   1916 C  CB   . LEU B 1 102 ? 72.563 77.401 48.959  1.00 244.76 ? 102 LEU B CB   1 
ATOM   1917 C  CG   . LEU B 1 102 ? 72.869 78.847 48.573  1.00 263.67 ? 102 LEU B CG   1 
ATOM   1918 C  CD1  . LEU B 1 102 ? 73.266 79.659 49.798  1.00 268.43 ? 102 LEU B CD1  1 
ATOM   1919 C  CD2  . LEU B 1 102 ? 73.967 78.885 47.516  1.00 270.73 ? 102 LEU B CD2  1 
ATOM   1920 N  N    . GLY B 1 103 ? 74.879 75.621 49.792  1.00 230.54 ? 103 GLY B N    1 
ATOM   1921 C  CA   . GLY B 1 103 ? 76.192 75.356 50.374  1.00 230.24 ? 103 GLY B CA   1 
ATOM   1922 C  C    . GLY B 1 103 ? 76.316 75.496 51.889  1.00 232.86 ? 103 GLY B C    1 
ATOM   1923 O  O    . GLY B 1 103 ? 75.583 74.844 52.646  1.00 231.69 ? 103 GLY B O    1 
ATOM   1924 N  N    . GLU B 1 104 ? 77.275 76.325 52.318  1.00 234.81 ? 104 GLU B N    1 
ATOM   1925 C  CA   . GLU B 1 104 ? 77.546 76.612 53.735  1.00 236.20 ? 104 GLU B CA   1 
ATOM   1926 C  C    . GLU B 1 104 ? 77.921 75.393 54.573  1.00 247.64 ? 104 GLU B C    1 
ATOM   1927 O  O    . GLU B 1 104 ? 77.574 75.318 55.755  1.00 248.59 ? 104 GLU B O    1 
ATOM   1928 C  CB   . GLU B 1 104 ? 76.366 77.350 54.383  1.00 237.07 ? 104 GLU B CB   1 
ATOM   1929 C  CG   . GLU B 1 104 ? 76.139 78.762 53.859  1.00 243.17 ? 104 GLU B CG   1 
ATOM   1930 C  CD   . GLU B 1 104 ? 75.306 78.789 52.584  1.00 252.24 ? 104 GLU B CD   1 
ATOM   1931 O  OE1  . GLU B 1 104 ? 74.105 78.432 52.642  1.00 243.20 ? 104 GLU B OE1  1 
ATOM   1932 O  OE2  . GLU B 1 104 ? 75.855 79.168 51.524  1.00 242.95 ? 104 GLU B OE2  1 
ATOM   1933 N  N    . ARG B 1 105 ? 78.638 74.455 53.960  1.00 246.90 ? 105 ARG B N    1 
ATOM   1934 C  CA   . ARG B 1 105 ? 79.044 73.221 54.622  1.00 247.78 ? 105 ARG B CA   1 
ATOM   1935 C  C    . ARG B 1 105 ? 77.924 72.171 54.623  1.00 253.09 ? 105 ARG B C    1 
ATOM   1936 O  O    . ARG B 1 105 ? 77.169 72.062 53.651  1.00 252.82 ? 105 ARG B O    1 
ATOM   1937 C  CB   . ARG B 1 105 ? 79.575 73.490 56.037  1.00 249.27 ? 105 ARG B CB   1 
ATOM   1938 C  CG   . ARG B 1 105 ? 81.064 73.261 56.164  1.00 258.66 ? 105 ARG B CG   1 
ATOM   1939 C  CD   . ARG B 1 105 ? 81.518 72.248 55.122  1.00 262.96 ? 105 ARG B CD   1 
ATOM   1940 N  NE   . ARG B 1 105 ? 81.733 70.903 55.664  1.00 264.23 ? 105 ARG B NE   1 
ATOM   1941 C  CZ   . ARG B 1 105 ? 80.982 70.315 56.599  1.00 273.29 ? 105 ARG B CZ   1 
ATOM   1942 N  NH1  . ARG B 1 105 ? 79.946 70.945 57.142  1.00 259.47 ? 105 ARG B NH1  1 
ATOM   1943 N  NH2  . ARG B 1 105 ? 81.278 69.084 57.001  1.00 258.88 ? 105 ARG B NH2  1 
ATOM   1944 N  N    . THR B 1 106 ? 77.835 71.399 55.707  1.00 250.67 ? 106 THR B N    1 
ATOM   1945 C  CA   . THR B 1 106 ? 76.835 70.331 55.858  1.00 248.94 ? 106 THR B CA   1 
ATOM   1946 C  C    . THR B 1 106 ? 76.586 69.508 54.584  1.00 249.12 ? 106 THR B C    1 
ATOM   1947 O  O    . THR B 1 106 ? 77.299 69.653 53.583  1.00 247.71 ? 106 THR B O    1 
ATOM   1948 C  CB   . THR B 1 106 ? 75.508 70.832 56.505  1.00 248.13 ? 106 THR B CB   1 
ATOM   1949 O  OG1  . THR B 1 106 ? 75.768 71.970 57.338  1.00 245.67 ? 106 THR B OG1  1 
ATOM   1950 C  CG2  . THR B 1 106 ? 74.867 69.730 57.351  1.00 244.70 ? 106 THR B CG2  1 
ATOM   1951 N  N    . GLN B 1 107 ? 75.577 68.639 54.639  1.00 244.28 ? 107 GLN B N    1 
ATOM   1952 C  CA   . GLN B 1 107 ? 75.206 67.791 53.503  1.00 243.48 ? 107 GLN B CA   1 
ATOM   1953 C  C    . GLN B 1 107 ? 74.216 68.511 52.581  1.00 240.72 ? 107 GLN B C    1 
ATOM   1954 O  O    . GLN B 1 107 ? 73.027 68.181 52.544  1.00 238.82 ? 107 GLN B O    1 
ATOM   1955 C  CB   . GLN B 1 107 ? 74.612 66.463 53.989  1.00 245.51 ? 107 GLN B CB   1 
ATOM   1956 C  CG   . GLN B 1 107 ? 74.855 66.170 55.463  1.00 259.96 ? 107 GLN B CG   1 
ATOM   1957 C  CD   . GLN B 1 107 ? 74.622 64.713 55.815  1.00 277.28 ? 107 GLN B CD   1 
ATOM   1958 O  OE1  . GLN B 1 107 ? 74.138 64.396 56.902  1.00 272.48 ? 107 GLN B OE1  1 
ATOM   1959 N  NE2  . GLN B 1 107 ? 74.967 63.817 54.894  1.00 269.14 ? 107 GLN B NE2  1 
ATOM   1960 N  N    . SER B 1 108 ? 74.723 69.500 51.847  1.00 234.34 ? 108 SER B N    1 
ATOM   1961 C  CA   . SER B 1 108 ? 73.912 70.292 50.926  1.00 233.64 ? 108 SER B CA   1 
ATOM   1962 C  C    . SER B 1 108 ? 73.203 69.434 49.875  1.00 236.41 ? 108 SER B C    1 
ATOM   1963 O  O    . SER B 1 108 ? 73.685 69.303 48.745  1.00 235.94 ? 108 SER B O    1 
ATOM   1964 C  CB   . SER B 1 108 ? 74.779 71.354 50.241  1.00 236.84 ? 108 SER B CB   1 
ATOM   1965 O  OG   . SER B 1 108 ? 75.675 70.763 49.312  1.00 245.21 ? 108 SER B OG   1 
ATOM   1966 N  N    . THR B 1 109 ? 72.049 68.879 50.253  1.00 229.32 ? 109 THR B N    1 
ATOM   1967 C  CA   . THR B 1 109 ? 71.250 68.034 49.368  1.00 229.06 ? 109 THR B CA   1 
ATOM   1968 C  C    . THR B 1 109 ? 72.133 67.078 48.608  1.00 236.58 ? 109 THR B C    1 
ATOM   1969 O  O    . THR B 1 109 ? 72.174 67.115 47.377  1.00 237.37 ? 109 THR B O    1 
ATOM   1970 C  CB   . THR B 1 109 ? 70.439 68.860 48.375  1.00 225.43 ? 109 THR B CB   1 
ATOM   1971 O  OG1  . THR B 1 109 ? 70.234 70.178 48.896  1.00 222.46 ? 109 THR B OG1  1 
ATOM   1972 C  CG2  . THR B 1 109 ? 69.103 68.199 48.111  1.00 221.48 ? 109 THR B CG2  1 
ATOM   1973 N  N    . PRO B 1 110 ? 72.884 66.231 49.328  1.00 230.31 ? 110 PRO B N    1 
ATOM   1974 C  CA   . PRO B 1 110 ? 73.804 65.278 48.697  1.00 230.71 ? 110 PRO B CA   1 
ATOM   1975 C  C    . PRO B 1 110 ? 73.090 64.357 47.702  1.00 238.72 ? 110 PRO B C    1 
ATOM   1976 O  O    . PRO B 1 110 ? 73.423 63.175 47.589  1.00 239.65 ? 110 PRO B O    1 
ATOM   1977 C  CB   . PRO B 1 110 ? 74.357 64.467 49.886  1.00 230.88 ? 110 PRO B CB   1 
ATOM   1978 C  CG   . PRO B 1 110 ? 73.781 65.098 51.137  1.00 232.66 ? 110 PRO B CG   1 
ATOM   1979 C  CD   . PRO B 1 110 ? 72.557 65.843 50.709  1.00 228.16 ? 110 PRO B CD   1 
ATOM   1980 N  N    . GLY B 1 111 ? 72.122 64.905 46.971  1.00 230.30 ? 111 GLY B N    1 
ATOM   1981 C  CA   . GLY B 1 111 ? 71.356 64.147 46.008  1.00 228.08 ? 111 GLY B CA   1 
ATOM   1982 C  C    . GLY B 1 111 ? 71.367 64.712 44.606  1.00 225.26 ? 111 GLY B C    1 
ATOM   1983 O  O    . GLY B 1 111 ? 71.277 65.920 44.396  1.00 223.81 ? 111 GLY B O    1 
ATOM   1984 N  N    . TYR B 1 112 ? 71.477 63.807 43.645  1.00 217.83 ? 112 TYR B N    1 
ATOM   1985 C  CA   . TYR B 1 112 ? 71.435 64.155 42.238  1.00 214.86 ? 112 TYR B CA   1 
ATOM   1986 C  C    . TYR B 1 112 ? 69.956 64.108 41.873  1.00 231.99 ? 112 TYR B C    1 
ATOM   1987 O  O    . TYR B 1 112 ? 69.441 64.979 41.169  1.00 234.84 ? 112 TYR B O    1 
ATOM   1988 C  CB   . TYR B 1 112 ? 72.201 63.104 41.433  1.00 205.55 ? 112 TYR B CB   1 
ATOM   1989 C  CG   . TYR B 1 112 ? 72.322 63.404 39.954  1.00 190.48 ? 112 TYR B CG   1 
ATOM   1990 C  CD1  . TYR B 1 112 ? 72.532 64.702 39.496  1.00 189.54 ? 112 TYR B CD1  1 
ATOM   1991 C  CD2  . TYR B 1 112 ? 72.251 62.384 39.014  1.00 186.84 ? 112 TYR B CD2  1 
ATOM   1992 C  CE1  . TYR B 1 112 ? 72.659 64.974 38.138  1.00 187.43 ? 112 TYR B CE1  1 
ATOM   1993 C  CE2  . TYR B 1 112 ? 72.383 62.644 37.658  1.00 186.00 ? 112 TYR B CE2  1 
ATOM   1994 C  CZ   . TYR B 1 112 ? 72.584 63.941 37.226  1.00 190.53 ? 112 TYR B CZ   1 
ATOM   1995 O  OH   . TYR B 1 112 ? 72.714 64.202 35.883  1.00 189.91 ? 112 TYR B OH   1 
ATOM   1996 N  N    . ILE B 1 113 ? 69.275 63.099 42.411  1.00 225.13 ? 113 ILE B N    1 
ATOM   1997 C  CA   . ILE B 1 113 ? 67.849 62.904 42.186  1.00 224.28 ? 113 ILE B CA   1 
ATOM   1998 C  C    . ILE B 1 113 ? 67.042 63.492 43.333  1.00 220.09 ? 113 ILE B C    1 
ATOM   1999 O  O    . ILE B 1 113 ? 67.554 63.685 44.433  1.00 218.42 ? 113 ILE B O    1 
ATOM   2000 C  CB   . ILE B 1 113 ? 67.508 61.412 42.009  1.00 229.16 ? 113 ILE B CB   1 
ATOM   2001 C  CG1  . ILE B 1 113 ? 66.812 60.876 43.262  1.00 230.23 ? 113 ILE B CG1  1 
ATOM   2002 C  CG2  . ILE B 1 113 ? 68.753 60.607 41.692  1.00 230.50 ? 113 ILE B CG2  1 
ATOM   2003 C  CD1  . ILE B 1 113 ? 67.691 60.847 44.496  1.00 237.97 ? 113 ILE B CD1  1 
ATOM   2004 N  N    . PHE B 1 114 ? 65.761 63.727 43.084  1.00 215.20 ? 114 PHE B N    1 
ATOM   2005 C  CA   . PHE B 1 114 ? 64.894 64.269 44.115  1.00 209.19 ? 114 PHE B CA   1 
ATOM   2006 C  C    . PHE B 1 114 ? 63.474 63.714 44.082  1.00 212.12 ? 114 PHE B C    1 
ATOM   2007 O  O    . PHE B 1 114 ? 63.254 62.562 44.449  1.00 211.80 ? 114 PHE B O    1 
ATOM   2008 C  CB   . PHE B 1 114 ? 64.897 65.797 44.115  1.00 204.43 ? 114 PHE B CB   1 
ATOM   2009 C  CG   . PHE B 1 114 ? 65.051 66.409 42.755  1.00 196.78 ? 114 PHE B CG   1 
ATOM   2010 C  CD1  . PHE B 1 114 ? 66.207 66.217 42.015  1.00 193.04 ? 114 PHE B CD1  1 
ATOM   2011 C  CD2  . PHE B 1 114 ? 64.065 67.231 42.245  1.00 191.84 ? 114 PHE B CD2  1 
ATOM   2012 C  CE1  . PHE B 1 114 ? 66.357 66.799 40.773  1.00 191.06 ? 114 PHE B CE1  1 
ATOM   2013 C  CE2  . PHE B 1 114 ? 64.213 67.825 41.010  1.00 191.41 ? 114 PHE B CE2  1 
ATOM   2014 C  CZ   . PHE B 1 114 ? 65.358 67.608 40.270  1.00 188.64 ? 114 PHE B CZ   1 
ATOM   2015 N  N    . GLY B 1 115 ? 62.514 64.536 43.670  1.00 206.50 ? 115 GLY B N    1 
ATOM   2016 C  CA   . GLY B 1 115 ? 61.107 64.169 43.638  1.00 204.92 ? 115 GLY B CA   1 
ATOM   2017 C  C    . GLY B 1 115 ? 60.732 62.866 42.958  1.00 204.75 ? 115 GLY B C    1 
ATOM   2018 O  O    . GLY B 1 115 ? 59.747 62.820 42.228  1.00 203.92 ? 115 GLY B O    1 
ATOM   2019 N  N    . LYS B 1 116 ? 61.494 61.811 43.230  1.00 196.66 ? 116 LYS B N    1 
ATOM   2020 C  CA   . LYS B 1 116 ? 61.255 60.486 42.669  1.00 194.77 ? 116 LYS B CA   1 
ATOM   2021 C  C    . LYS B 1 116 ? 59.785 60.152 42.700  1.00 196.74 ? 116 LYS B C    1 
ATOM   2022 O  O    . LYS B 1 116 ? 59.250 59.591 41.754  1.00 196.30 ? 116 LYS B O    1 
ATOM   2023 C  CB   . LYS B 1 116 ? 61.981 59.428 43.492  1.00 195.34 ? 116 LYS B CB   1 
ATOM   2024 C  CG   . LYS B 1 116 ? 63.133 58.766 42.783  1.00 188.14 ? 116 LYS B CG   1 
ATOM   2025 C  CD   . LYS B 1 116 ? 64.412 58.855 43.617  1.00 185.31 ? 116 LYS B CD   1 
ATOM   2026 C  CE   . LYS B 1 116 ? 64.516 57.717 44.633  1.00 184.02 ? 116 LYS B CE   1 
ATOM   2027 N  NZ   . LYS B 1 116 ? 65.767 57.794 45.451  1.00 188.99 ? 116 LYS B NZ   1 
ATOM   2028 N  N    . ARG B 1 117 ? 59.138 60.508 43.802  1.00 188.66 ? 117 ARG B N    1 
ATOM   2029 C  CA   . ARG B 1 117 ? 57.721 60.237 43.984  1.00 187.91 ? 117 ARG B CA   1 
ATOM   2030 C  C    . ARG B 1 117 ? 56.861 60.895 42.914  1.00 188.19 ? 117 ARG B C    1 
ATOM   2031 O  O    . ARG B 1 117 ? 56.003 60.250 42.311  1.00 187.43 ? 117 ARG B O    1 
ATOM   2032 C  CB   . ARG B 1 117 ? 57.264 60.669 45.381  1.00 191.36 ? 117 ARG B CB   1 
ATOM   2033 C  CG   . ARG B 1 117 ? 57.259 59.543 46.409  1.00 210.63 ? 117 ARG B CG   1 
ATOM   2034 C  CD   . ARG B 1 117 ? 56.183 59.763 47.463  1.00 230.40 ? 117 ARG B CD   1 
ATOM   2035 N  NE   . ARG B 1 117 ? 55.534 58.519 47.869  1.00 245.64 ? 117 ARG B NE   1 
ATOM   2036 C  CZ   . ARG B 1 117 ? 54.245 58.413 48.177  1.00 263.00 ? 117 ARG B CZ   1 
ATOM   2037 N  NH1  . ARG B 1 117 ? 53.453 59.478 48.123  1.00 251.05 ? 117 ARG B NH1  1 
ATOM   2038 N  NH2  . ARG B 1 117 ? 53.745 57.239 48.538  1.00 250.46 ? 117 ARG B NH2  1 
ATOM   2039 N  N    . ILE B 1 118 ? 57.090 62.177 42.669  1.00 179.81 ? 118 ILE B N    1 
ATOM   2040 C  CA   . ILE B 1 118 ? 56.305 62.876 41.665  1.00 177.79 ? 118 ILE B CA   1 
ATOM   2041 C  C    . ILE B 1 118 ? 56.386 62.215 40.285  1.00 178.40 ? 118 ILE B C    1 
ATOM   2042 O  O    . ILE B 1 118 ? 55.373 61.729 39.777  1.00 177.67 ? 118 ILE B O    1 
ATOM   2043 C  CB   . ILE B 1 118 ? 56.599 64.381 41.627  1.00 180.03 ? 118 ILE B CB   1 
ATOM   2044 C  CG1  . ILE B 1 118 ? 55.433 65.166 42.226  1.00 179.97 ? 118 ILE B CG1  1 
ATOM   2045 C  CG2  . ILE B 1 118 ? 56.821 64.836 40.202  1.00 180.44 ? 118 ILE B CG2  1 
ATOM   2046 C  CD1  . ILE B 1 118 ? 55.713 66.653 42.365  1.00 186.64 ? 118 ILE B CD1  1 
ATOM   2047 N  N    . ILE B 1 119 ? 57.577 62.177 39.683  1.00 171.52 ? 119 ILE B N    1 
ATOM   2048 C  CA   . ILE B 1 119 ? 57.716 61.557 38.361  1.00 168.78 ? 119 ILE B CA   1 
ATOM   2049 C  C    . ILE B 1 119 ? 57.255 60.105 38.379  1.00 174.57 ? 119 ILE B C    1 
ATOM   2050 O  O    . ILE B 1 119 ? 56.740 59.599 37.386  1.00 175.01 ? 119 ILE B O    1 
ATOM   2051 C  CB   . ILE B 1 119 ? 59.121 61.693 37.734  1.00 168.58 ? 119 ILE B CB   1 
ATOM   2052 C  CG1  . ILE B 1 119 ? 60.160 60.909 38.533  1.00 167.37 ? 119 ILE B CG1  1 
ATOM   2053 C  CG2  . ILE B 1 119 ? 59.487 63.141 37.491  1.00 168.06 ? 119 ILE B CG2  1 
ATOM   2054 C  CD1  . ILE B 1 119 ? 60.365 61.400 39.950  1.00 172.73 ? 119 ILE B CD1  1 
ATOM   2055 N  N    . LEU B 1 120 ? 57.448 59.427 39.502  1.00 166.80 ? 120 LEU B N    1 
ATOM   2056 C  CA   . LEU B 1 120 ? 57.000 58.050 39.598  1.00 165.55 ? 120 LEU B CA   1 
ATOM   2057 C  C    . LEU B 1 120 ? 55.507 58.084 39.383  1.00 165.77 ? 120 LEU B C    1 
ATOM   2058 O  O    . LEU B 1 120 ? 54.985 57.393 38.520  1.00 164.85 ? 120 LEU B O    1 
ATOM   2059 C  CB   . LEU B 1 120 ? 57.299 57.466 40.973  1.00 165.70 ? 120 LEU B CB   1 
ATOM   2060 C  CG   . LEU B 1 120 ? 56.666 56.110 41.254  1.00 170.36 ? 120 LEU B CG   1 
ATOM   2061 C  CD1  . LEU B 1 120 ? 55.230 56.285 41.697  1.00 170.48 ? 120 LEU B CD1  1 
ATOM   2062 C  CD2  . LEU B 1 120 ? 56.750 55.247 40.031  1.00 172.79 ? 120 LEU B CD2  1 
ATOM   2063 N  N    . PHE B 1 121 ? 54.829 58.923 40.155  1.00 162.04 ? 121 PHE B N    1 
ATOM   2064 C  CA   . PHE B 1 121 ? 53.383 59.062 40.048  1.00 162.41 ? 121 PHE B CA   1 
ATOM   2065 C  C    . PHE B 1 121 ? 52.934 59.456 38.642  1.00 162.43 ? 121 PHE B C    1 
ATOM   2066 O  O    . PHE B 1 121 ? 52.094 58.776 38.046  1.00 161.15 ? 121 PHE B O    1 
ATOM   2067 C  CB   . PHE B 1 121 ? 52.854 60.063 41.068  1.00 166.64 ? 121 PHE B CB   1 
ATOM   2068 C  CG   . PHE B 1 121 ? 51.605 60.769 40.626  1.00 171.67 ? 121 PHE B CG   1 
ATOM   2069 C  CD1  . PHE B 1 121 ? 50.501 60.056 40.205  1.00 177.15 ? 121 PHE B CD1  1 
ATOM   2070 C  CD2  . PHE B 1 121 ? 51.538 62.146 40.622  1.00 176.52 ? 121 PHE B CD2  1 
ATOM   2071 C  CE1  . PHE B 1 121 ? 49.357 60.706 39.778  1.00 179.06 ? 121 PHE B CE1  1 
ATOM   2072 C  CE2  . PHE B 1 121 ? 50.392 62.799 40.203  1.00 180.43 ? 121 PHE B CE2  1 
ATOM   2073 C  CZ   . PHE B 1 121 ? 49.302 62.077 39.782  1.00 178.71 ? 121 PHE B CZ   1 
ATOM   2074 N  N    . LEU B 1 122 ? 53.457 60.573 38.136  1.00 157.06 ? 122 LEU B N    1 
ATOM   2075 C  CA   . LEU B 1 122 ? 53.127 61.043 36.790  1.00 155.93 ? 122 LEU B CA   1 
ATOM   2076 C  C    . LEU B 1 122 ? 53.277 59.891 35.800  1.00 160.51 ? 122 LEU B C    1 
ATOM   2077 O  O    . LEU B 1 122 ? 52.443 59.686 34.921  1.00 160.77 ? 122 LEU B O    1 
ATOM   2078 C  CB   . LEU B 1 122 ? 54.074 62.167 36.375  1.00 154.53 ? 122 LEU B CB   1 
ATOM   2079 C  CG   . LEU B 1 122 ? 53.468 63.557 36.304  1.00 155.94 ? 122 LEU B CG   1 
ATOM   2080 C  CD1  . LEU B 1 122 ? 51.984 63.487 36.571  1.00 154.99 ? 122 LEU B CD1  1 
ATOM   2081 C  CD2  . LEU B 1 122 ? 54.153 64.396 37.336  1.00 157.29 ? 122 LEU B CD2  1 
ATOM   2082 N  N    . PHE B 1 123 ? 54.353 59.134 35.959  1.00 157.13 ? 123 PHE B N    1 
ATOM   2083 C  CA   . PHE B 1 123 ? 54.633 57.997 35.100  1.00 155.02 ? 123 PHE B CA   1 
ATOM   2084 C  C    . PHE B 1 123 ? 53.549 56.947 35.244  1.00 160.52 ? 123 PHE B C    1 
ATOM   2085 O  O    . PHE B 1 123 ? 53.380 56.108 34.368  1.00 160.46 ? 123 PHE B O    1 
ATOM   2086 C  CB   . PHE B 1 123 ? 55.986 57.405 35.478  1.00 154.40 ? 123 PHE B CB   1 
ATOM   2087 C  CG   . PHE B 1 123 ? 56.280 56.081 34.840  1.00 152.59 ? 123 PHE B CG   1 
ATOM   2088 C  CD1  . PHE B 1 123 ? 55.703 54.918 35.328  1.00 152.96 ? 123 PHE B CD1  1 
ATOM   2089 C  CD2  . PHE B 1 123 ? 57.224 55.990 33.826  1.00 152.18 ? 123 PHE B CD2  1 
ATOM   2090 C  CE1  . PHE B 1 123 ? 56.010 53.699 34.772  1.00 152.73 ? 123 PHE B CE1  1 
ATOM   2091 C  CE2  . PHE B 1 123 ? 57.545 54.774 33.267  1.00 153.72 ? 123 PHE B CE2  1 
ATOM   2092 C  CZ   . PHE B 1 123 ? 56.937 53.625 33.739  1.00 151.37 ? 123 PHE B CZ   1 
ATOM   2093 N  N    . LEU B 1 124 ? 52.820 56.990 36.354  1.00 157.37 ? 124 LEU B N    1 
ATOM   2094 C  CA   . LEU B 1 124 ? 51.753 56.035 36.592  1.00 156.62 ? 124 LEU B CA   1 
ATOM   2095 C  C    . LEU B 1 124 ? 50.448 56.438 35.950  1.00 154.01 ? 124 LEU B C    1 
ATOM   2096 O  O    . LEU B 1 124 ? 49.614 55.595 35.654  1.00 152.05 ? 124 LEU B O    1 
ATOM   2097 C  CB   . LEU B 1 124 ? 51.569 55.770 38.073  1.00 157.57 ? 124 LEU B CB   1 
ATOM   2098 C  CG   . LEU B 1 124 ? 52.545 54.666 38.455  1.00 163.25 ? 124 LEU B CG   1 
ATOM   2099 C  CD1  . LEU B 1 124 ? 53.480 54.412 37.270  1.00 163.67 ? 124 LEU B CD1  1 
ATOM   2100 C  CD2  . LEU B 1 124 ? 53.338 55.051 39.692  1.00 165.97 ? 124 LEU B CD2  1 
ATOM   2101 N  N    . MET B 1 125 ? 50.274 57.728 35.711  1.00 151.71 ? 125 MET B N    1 
ATOM   2102 C  CA   . MET B 1 125 ? 49.079 58.191 35.026  1.00 151.71 ? 125 MET B CA   1 
ATOM   2103 C  C    . MET B 1 125 ? 49.300 57.878 33.561  1.00 151.71 ? 125 MET B C    1 
ATOM   2104 O  O    . MET B 1 125 ? 48.379 57.483 32.852  1.00 220.66 ? 125 MET B O    1 
ATOM   2105 C  CB   . MET B 1 125 ? 48.900 59.692 35.200  1.00 151.71 ? 125 MET B CB   1 
ATOM   2106 C  CG   . MET B 1 125 ? 48.834 60.130 36.637  1.00 151.71 ? 125 MET B CG   1 
ATOM   2107 S  SD   . MET B 1 125 ? 48.186 61.788 36.795  1.00 151.71 ? 125 MET B SD   1 
ATOM   2108 C  CE   . MET B 1 125 ? 49.248 62.655 35.676  1.00 151.71 ? 125 MET B CE   1 
ATOM   2109 N  N    . SER B 1 126 ? 50.548 58.043 33.127  1.00 148.80 ? 126 SER B N    1 
ATOM   2110 C  CA   . SER B 1 126 ? 50.964 57.767 31.750  1.00 150.01 ? 126 SER B CA   1 
ATOM   2111 C  C    . SER B 1 126 ? 50.755 56.282 31.471  1.00 155.50 ? 126 SER B C    1 
ATOM   2112 O  O    . SER B 1 126 ? 50.142 55.900 30.474  1.00 155.20 ? 126 SER B O    1 
ATOM   2113 C  CB   . SER B 1 126 ? 52.457 58.101 31.560  1.00 155.56 ? 126 SER B CB   1 
ATOM   2114 O  OG   . SER B 1 126 ? 52.675 59.483 31.320  1.00 166.54 ? 126 SER B OG   1 
ATOM   2115 N  N    . VAL B 1 127 ? 51.283 55.450 32.362  1.00 151.17 ? 127 VAL B N    1 
ATOM   2116 C  CA   . VAL B 1 127 ? 51.164 54.004 32.229  1.00 151.36 ? 127 VAL B CA   1 
ATOM   2117 C  C    . VAL B 1 127 ? 49.721 53.608 32.406  1.00 157.43 ? 127 VAL B C    1 
ATOM   2118 O  O    . VAL B 1 127 ? 49.317 52.511 32.037  1.00 157.63 ? 127 VAL B O    1 
ATOM   2119 C  CB   . VAL B 1 127 ? 51.995 53.280 33.280  1.00 154.63 ? 127 VAL B CB   1 
ATOM   2120 C  CG1  . VAL B 1 127 ? 51.510 53.656 34.672  1.00 154.32 ? 127 VAL B CG1  1 
ATOM   2121 C  CG2  . VAL B 1 127 ? 51.907 51.779 33.066  1.00 154.35 ? 127 VAL B CG2  1 
ATOM   2122 N  N    . ALA B 1 128 ? 48.957 54.492 33.026  1.00 155.37 ? 128 ALA B N    1 
ATOM   2123 C  CA   . ALA B 1 128 ? 47.554 54.223 33.276  1.00 155.57 ? 128 ALA B CA   1 
ATOM   2124 C  C    . ALA B 1 128 ? 46.790 54.242 31.970  1.00 163.46 ? 128 ALA B C    1 
ATOM   2125 O  O    . ALA B 1 128 ? 46.406 53.200 31.442  1.00 163.76 ? 128 ALA B O    1 
ATOM   2126 C  CB   . ALA B 1 128 ? 46.991 55.252 34.215  1.00 156.04 ? 128 ALA B CB   1 
ATOM   2127 N  N    . GLY B 1 129 ? 46.576 55.446 31.455  1.00 162.30 ? 129 GLY B N    1 
ATOM   2128 C  CA   . GLY B 1 129 ? 45.858 55.642 30.214  1.00 162.69 ? 129 GLY B CA   1 
ATOM   2129 C  C    . GLY B 1 129 ? 46.419 54.791 29.100  1.00 168.12 ? 129 GLY B C    1 
ATOM   2130 O  O    . GLY B 1 129 ? 45.668 54.237 28.305  1.00 168.01 ? 129 GLY B O    1 
ATOM   2131 N  N    . ILE B 1 130 ? 47.741 54.689 29.041  1.00 166.89 ? 130 ILE B N    1 
ATOM   2132 C  CA   . ILE B 1 130 ? 48.389 53.897 28.006  1.00 167.22 ? 130 ILE B CA   1 
ATOM   2133 C  C    . ILE B 1 130 ? 47.813 52.501 27.967  1.00 167.53 ? 130 ILE B C    1 
ATOM   2134 O  O    . ILE B 1 130 ? 47.675 51.911 26.898  1.00 168.35 ? 130 ILE B O    1 
ATOM   2135 C  CB   . ILE B 1 130 ? 49.898 53.820 28.203  1.00 171.60 ? 130 ILE B CB   1 
ATOM   2136 C  CG1  . ILE B 1 130 ? 50.596 54.869 27.337  1.00 172.61 ? 130 ILE B CG1  1 
ATOM   2137 C  CG2  . ILE B 1 130 ? 50.393 52.420 27.847  1.00 172.77 ? 130 ILE B CG2  1 
ATOM   2138 C  CD1  . ILE B 1 130 ? 51.348 54.276 26.165  1.00 180.67 ? 130 ILE B CD1  1 
ATOM   2139 N  N    . PHE B 1 131 ? 47.507 51.968 29.146  1.00 169.24 ? 131 PHE B N    1 
ATOM   2140 C  CA   . PHE B 1 131 ? 46.916 50.640 29.265  1.00 169.41 ? 131 PHE B CA   1 
ATOM   2141 C  C    . PHE B 1 131 ? 45.418 50.730 29.025  1.00 167.38 ? 131 PHE B C    1 
ATOM   2142 O  O    . PHE B 1 131 ? 44.876 50.065 28.137  1.00 162.76 ? 131 PHE B O    1 
ATOM   2143 C  CB   . PHE B 1 131 ? 47.133 50.078 30.675  1.00 176.28 ? 131 PHE B CB   1 
ATOM   2144 C  CG   . PHE B 1 131 ? 45.894 49.453 31.282  1.00 185.07 ? 131 PHE B CG   1 
ATOM   2145 C  CD1  . PHE B 1 131 ? 45.129 50.145 32.205  1.00 193.38 ? 131 PHE B CD1  1 
ATOM   2146 C  CD2  . PHE B 1 131 ? 45.501 48.170 30.933  1.00 192.64 ? 131 PHE B CD2  1 
ATOM   2147 C  CE1  . PHE B 1 131 ? 43.994 49.578 32.750  1.00 196.45 ? 131 PHE B CE1  1 
ATOM   2148 C  CE2  . PHE B 1 131 ? 44.368 47.600 31.485  1.00 197.88 ? 131 PHE B CE2  1 
ATOM   2149 C  CZ   . PHE B 1 131 ? 43.617 48.304 32.392  1.00 196.58 ? 131 PHE B CZ   1 
ATOM   2150 N  N    . ASN B 1 132 ? 44.756 51.536 29.850  1.00 166.27 ? 132 ASN B N    1 
ATOM   2151 C  CA   . ASN B 1 132 ? 43.316 51.705 29.772  1.00 168.67 ? 132 ASN B CA   1 
ATOM   2152 C  C    . ASN B 1 132 ? 42.862 51.913 28.345  1.00 171.27 ? 132 ASN B C    1 
ATOM   2153 O  O    . ASN B 1 132 ? 41.719 51.632 28.022  1.00 169.27 ? 132 ASN B O    1 
ATOM   2154 C  CB   . ASN B 1 132 ? 42.870 52.918 30.560  1.00 176.12 ? 132 ASN B CB   1 
ATOM   2155 C  CG   . ASN B 1 132 ? 41.934 53.787 29.759  1.00 226.46 ? 132 ASN B CG   1 
ATOM   2156 O  OD1  . ASN B 1 132 ? 42.372 54.599 28.944  1.00 224.81 ? 132 ASN B OD1  1 
ATOM   2157 N  ND2  . ASN B 1 132 ? 40.647 53.486 29.844  1.00 222.35 ? 132 ASN B ND2  1 
ATOM   2158 N  N    . TYR B 1 133 ? 43.743 52.454 27.508  1.00 168.01 ? 133 TYR B N    1 
ATOM   2159 C  CA   . TYR B 1 133 ? 43.422 52.684 26.099  1.00 169.91 ? 133 TYR B CA   1 
ATOM   2160 C  C    . TYR B 1 133 ? 43.315 51.356 25.368  1.00 175.01 ? 133 TYR B C    1 
ATOM   2161 O  O    . TYR B 1 133 ? 42.449 51.173 24.520  1.00 173.24 ? 133 TYR B O    1 
ATOM   2162 C  CB   . TYR B 1 133 ? 44.496 53.522 25.401  1.00 173.00 ? 133 TYR B CB   1 
ATOM   2163 C  CG   . TYR B 1 133 ? 44.493 53.344 23.896  1.00 177.45 ? 133 TYR B CG   1 
ATOM   2164 C  CD1  . TYR B 1 133 ? 45.177 52.293 23.289  1.00 179.79 ? 133 TYR B CD1  1 
ATOM   2165 C  CD2  . TYR B 1 133 ? 43.775 54.209 23.087  1.00 178.70 ? 133 TYR B CD2  1 
ATOM   2166 C  CE1  . TYR B 1 133 ? 45.146 52.120 21.912  1.00 180.47 ? 133 TYR B CE1  1 
ATOM   2167 C  CE2  . TYR B 1 133 ? 43.744 54.051 21.712  1.00 179.61 ? 133 TYR B CE2  1 
ATOM   2168 C  CZ   . TYR B 1 133 ? 44.424 53.008 21.126  1.00 185.99 ? 133 TYR B CZ   1 
ATOM   2169 O  OH   . TYR B 1 133 ? 44.371 52.870 19.754  1.00 186.25 ? 133 TYR B OH   1 
ATOM   2170 N  N    . TYR B 1 134 ? 44.242 50.453 25.652  1.00 170.74 ? 134 TYR B N    1 
ATOM   2171 C  CA   . TYR B 1 134 ? 44.228 49.151 25.016  1.00 172.54 ? 134 TYR B CA   1 
ATOM   2172 C  C    . TYR B 1 134 ? 42.946 48.425 25.295  1.00 176.33 ? 134 TYR B C    1 
ATOM   2173 O  O    . TYR B 1 134 ? 42.536 47.570 24.528  1.00 176.27 ? 134 TYR B O    1 
ATOM   2174 C  CB   . TYR B 1 134 ? 45.399 48.311 25.468  1.00 174.56 ? 134 TYR B CB   1 
ATOM   2175 C  CG   . TYR B 1 134 ? 46.590 48.592 24.622  1.00 176.55 ? 134 TYR B CG   1 
ATOM   2176 C  CD1  . TYR B 1 134 ? 46.646 49.759 23.868  1.00 178.39 ? 134 TYR B CD1  1 
ATOM   2177 C  CD2  . TYR B 1 134 ? 47.642 47.692 24.544  1.00 177.40 ? 134 TYR B CD2  1 
ATOM   2178 C  CE1  . TYR B 1 134 ? 47.724 50.037 23.078  1.00 179.00 ? 134 TYR B CE1  1 
ATOM   2179 C  CE2  . TYR B 1 134 ? 48.735 47.957 23.752  1.00 178.29 ? 134 TYR B CE2  1 
ATOM   2180 C  CZ   . TYR B 1 134 ? 48.770 49.133 23.019  1.00 185.23 ? 134 TYR B CZ   1 
ATOM   2181 O  OH   . TYR B 1 134 ? 49.858 49.398 22.221  1.00 185.99 ? 134 TYR B OH   1 
ATOM   2182 N  N    . LEU B 1 135 ? 42.311 48.775 26.401  1.00 176.05 ? 135 LEU B N    1 
ATOM   2183 C  CA   . LEU B 1 135 ? 41.036 48.183 26.754  1.00 176.05 ? 135 LEU B CA   1 
ATOM   2184 C  C    . LEU B 1 135 ? 39.944 48.759 25.853  1.00 177.80 ? 135 LEU B C    1 
ATOM   2185 O  O    . LEU B 1 135 ? 39.262 48.016 25.153  1.00 175.67 ? 135 LEU B O    1 
ATOM   2186 C  CB   . LEU B 1 135 ? 40.709 48.452 28.218  1.00 177.48 ? 135 LEU B CB   1 
ATOM   2187 C  CG   . LEU B 1 135 ? 40.636 47.167 29.025  1.00 185.16 ? 135 LEU B CG   1 
ATOM   2188 C  CD1  . LEU B 1 135 ? 39.272 46.554 28.819  1.00 186.32 ? 135 LEU B CD1  1 
ATOM   2189 C  CD2  . LEU B 1 135 ? 41.729 46.230 28.546  1.00 188.62 ? 135 LEU B CD2  1 
ATOM   2190 N  N    . ILE B 1 136 ? 39.794 50.084 25.857  1.00 175.38 ? 136 ILE B N    1 
ATOM   2191 C  CA   . ILE B 1 136 ? 38.791 50.757 25.029  1.00 176.49 ? 136 ILE B CA   1 
ATOM   2192 C  C    . ILE B 1 136 ? 38.943 50.301 23.595  1.00 189.17 ? 136 ILE B C    1 
ATOM   2193 O  O    . ILE B 1 136 ? 38.009 50.367 22.807  1.00 189.89 ? 136 ILE B O    1 
ATOM   2194 C  CB   . ILE B 1 136 ? 38.934 52.285 25.084  1.00 177.36 ? 136 ILE B CB   1 
ATOM   2195 C  CG1  . ILE B 1 136 ? 38.856 52.794 26.523  1.00 176.63 ? 136 ILE B CG1  1 
ATOM   2196 C  CG2  . ILE B 1 136 ? 37.882 52.938 24.220  1.00 177.24 ? 136 ILE B CG2  1 
ATOM   2197 C  CD1  . ILE B 1 136 ? 39.977 53.758 26.898  1.00 182.52 ? 136 ILE B CD1  1 
ATOM   2198 N  N    . PHE B 1 137 ? 40.144 49.854 23.267  1.00 182.47 ? 137 PHE B N    1 
ATOM   2199 C  CA   . PHE B 1 137 ? 40.469 49.390 21.934  1.00 185.41 ? 137 PHE B CA   1 
ATOM   2200 C  C    . PHE B 1 137 ? 39.931 47.975 21.671  1.00 196.33 ? 137 PHE B C    1 
ATOM   2201 O  O    . PHE B 1 137 ? 39.423 47.694 20.594  1.00 196.73 ? 137 PHE B O    1 
ATOM   2202 C  CB   . PHE B 1 137 ? 41.986 49.457 21.776  1.00 188.26 ? 137 PHE B CB   1 
ATOM   2203 C  CG   . PHE B 1 137 ? 42.503 48.897 20.488  1.00 191.31 ? 137 PHE B CG   1 
ATOM   2204 C  CD1  . PHE B 1 137 ? 41.666 48.688 19.409  1.00 195.39 ? 137 PHE B CD1  1 
ATOM   2205 C  CD2  . PHE B 1 137 ? 43.859 48.631 20.344  1.00 194.44 ? 137 PHE B CD2  1 
ATOM   2206 C  CE1  . PHE B 1 137 ? 42.150 48.150 18.238  1.00 196.63 ? 137 PHE B CE1  1 
ATOM   2207 C  CE2  . PHE B 1 137 ? 44.362 48.115 19.166  1.00 197.61 ? 137 PHE B CE2  1 
ATOM   2208 C  CZ   . PHE B 1 137 ? 43.508 47.868 18.113  1.00 195.79 ? 137 PHE B CZ   1 
ATOM   2209 N  N    . PHE B 1 138 ? 40.003 47.086 22.652  1.00 192.43 ? 138 PHE B N    1 
ATOM   2210 C  CA   . PHE B 1 138 ? 39.501 45.733 22.436  1.00 192.28 ? 138 PHE B CA   1 
ATOM   2211 C  C    . PHE B 1 138 ? 38.108 45.489 22.976  1.00 211.26 ? 138 PHE B C    1 
ATOM   2212 O  O    . PHE B 1 138 ? 37.130 45.667 22.261  1.00 213.23 ? 138 PHE B O    1 
ATOM   2213 C  CB   . PHE B 1 138 ? 40.493 44.690 22.927  1.00 188.02 ? 138 PHE B CB   1 
ATOM   2214 C  CG   . PHE B 1 138 ? 41.818 44.765 22.232  1.00 180.24 ? 138 PHE B CG   1 
ATOM   2215 C  CD1  . PHE B 1 138 ? 42.007 45.661 21.195  1.00 175.63 ? 138 PHE B CD1  1 
ATOM   2216 C  CD2  . PHE B 1 138 ? 42.878 43.962 22.622  1.00 174.30 ? 138 PHE B CD2  1 
ATOM   2217 C  CE1  . PHE B 1 138 ? 43.218 45.737 20.545  1.00 172.95 ? 138 PHE B CE1  1 
ATOM   2218 C  CE2  . PHE B 1 138 ? 44.104 44.050 21.985  1.00 173.06 ? 138 PHE B CE2  1 
ATOM   2219 C  CZ   . PHE B 1 138 ? 44.274 44.941 20.946  1.00 170.04 ? 138 PHE B CZ   1 
ATOM   2220 N  N    . PHE B 1 139 ? 38.003 45.119 24.245  1.00 210.08 ? 139 PHE B N    1 
ATOM   2221 C  CA   . PHE B 1 139 ? 36.694 44.894 24.848  1.00 216.75 ? 139 PHE B CA   1 
ATOM   2222 C  C    . PHE B 1 139 ? 35.840 46.158 24.828  1.00 209.74 ? 139 PHE B C    1 
ATOM   2223 O  O    . PHE B 1 139 ? 34.715 46.175 25.342  1.00 206.35 ? 139 PHE B O    1 
ATOM   2224 C  CB   . PHE B 1 139 ? 36.843 44.353 26.259  1.00 229.95 ? 139 PHE B CB   1 
ATOM   2225 C  CG   . PHE B 1 139 ? 37.902 43.321 26.373  1.00 246.85 ? 139 PHE B CG   1 
ATOM   2226 C  CD1  . PHE B 1 139 ? 38.230 42.554 25.279  1.00 260.99 ? 139 PHE B CD1  1 
ATOM   2227 C  CD2  . PHE B 1 139 ? 38.613 43.164 27.538  1.00 260.24 ? 139 PHE B CD2  1 
ATOM   2228 C  CE1  . PHE B 1 139 ? 39.221 41.623 25.352  1.00 266.27 ? 139 PHE B CE1  1 
ATOM   2229 C  CE2  . PHE B 1 139 ? 39.598 42.222 27.622  1.00 267.90 ? 139 PHE B CE2  1 
ATOM   2230 C  CZ   . PHE B 1 139 ? 39.907 41.453 26.525  1.00 267.24 ? 139 PHE B CZ   1 
ATOM   2231 N  N    . GLY B 1 140 ? 36.386 47.210 24.220  1.00 212.52 ? 140 GLY B N    1 
ATOM   2232 C  CA   . GLY B 1 140 ? 35.725 48.490 24.050  1.00 214.81 ? 140 GLY B CA   1 
ATOM   2233 C  C    . GLY B 1 140 ? 34.986 48.470 22.727  1.00 226.55 ? 140 GLY B C    1 
ATOM   2234 O  O    . GLY B 1 140 ? 33.890 49.022 22.604  1.00 227.29 ? 140 GLY B O    1 
ATOM   2235 N  N    . SER B 1 141 ? 35.583 47.810 21.736  1.00 229.01 ? 141 SER B N    1 
ATOM   2236 C  CA   . SER B 1 141 ? 34.940 47.644 20.435  1.00 230.23 ? 141 SER B CA   1 
ATOM   2237 C  C    . SER B 1 141 ? 33.965 46.476 20.592  1.00 239.20 ? 141 SER B C    1 
ATOM   2238 O  O    . SER B 1 141 ? 32.987 46.609 21.333  1.00 239.32 ? 141 SER B O    1 
ATOM   2239 C  CB   . SER B 1 141 ? 35.972 47.392 19.323  1.00 232.84 ? 141 SER B CB   1 
ATOM   2240 O  OG   . SER B 1 141 ? 36.308 46.019 19.194  1.00 240.53 ? 141 SER B OG   1 
ATOM   2241 N  N    . ASP B 1 142 ? 34.288 45.330 19.980  1.00 239.90 ? 142 ASP B N    1 
ATOM   2242 C  CA   . ASP B 1 142 ? 33.488 44.100 20.068  1.00 238.99 ? 142 ASP B CA   1 
ATOM   2243 C  C    . ASP B 1 142 ? 32.036 44.431 20.337  1.00 241.64 ? 142 ASP B C    1 
ATOM   2244 O  O    . ASP B 1 142 ? 31.299 44.807 19.425  1.00 240.25 ? 142 ASP B O    1 
ATOM   2245 C  CB   . ASP B 1 142 ? 34.007 43.197 21.194  1.00 238.91 ? 142 ASP B CB   1 
ATOM   2246 C  CG   . ASP B 1 142 ? 35.216 42.379 20.782  1.00 224.33 ? 142 ASP B CG   1 
ATOM   2247 O  OD1  . ASP B 1 142 ? 35.966 42.828 19.891  1.00 221.15 ? 142 ASP B OD1  1 
ATOM   2248 O  OD2  . ASP B 1 142 ? 35.430 41.297 21.367  1.00 226.51 ? 142 ASP B OD2  1 
ATOM   2249 N  N    . PHE B 1 143 ? 31.686 44.386 21.625  1.00 243.26 ? 143 PHE B N    1 
ATOM   2250 C  CA   . PHE B 1 143 ? 30.363 44.735 22.148  1.00 244.96 ? 143 PHE B CA   1 
ATOM   2251 C  C    . PHE B 1 143 ? 29.209 44.597 21.152  1.00 226.02 ? 143 PHE B C    1 
ATOM   2252 O  O    . PHE B 1 143 ? 28.168 45.250 21.285  1.00 219.98 ? 143 PHE B O    1 
ATOM   2253 C  CB   . PHE B 1 143 ? 30.399 46.145 22.760  1.00 255.69 ? 143 PHE B CB   1 
ATOM   2254 C  CG   . PHE B 1 143 ? 30.001 47.238 21.805  1.00 268.59 ? 143 PHE B CG   1 
ATOM   2255 C  CD1  . PHE B 1 143 ? 30.426 47.220 20.486  1.00 279.74 ? 143 PHE B CD1  1 
ATOM   2256 C  CD2  . PHE B 1 143 ? 29.176 48.266 22.220  1.00 279.05 ? 143 PHE B CD2  1 
ATOM   2257 C  CE1  . PHE B 1 143 ? 30.047 48.204 19.607  1.00 283.89 ? 143 PHE B CE1  1 
ATOM   2258 C  CE2  . PHE B 1 143 ? 28.795 49.256 21.345  1.00 285.47 ? 143 PHE B CE2  1 
ATOM   2259 C  CZ   . PHE B 1 143 ? 29.231 49.224 20.035  1.00 284.46 ? 143 PHE B CZ   1 
ATOM   2260 N  N    . GLU B 1 144 ? 29.406 43.740 20.155  1.00 227.14 ? 144 GLU B N    1 
ATOM   2261 C  CA   . GLU B 1 144 ? 28.444 43.554 19.082  1.00 226.76 ? 144 GLU B CA   1 
ATOM   2262 C  C    . GLU B 1 144 ? 26.967 43.535 19.456  1.00 230.63 ? 144 GLU B C    1 
ATOM   2263 O  O    . GLU B 1 144 ? 26.542 42.792 20.343  1.00 229.71 ? 144 GLU B O    1 
ATOM   2264 C  CB   . GLU B 1 144 ? 28.835 42.386 18.183  1.00 227.77 ? 144 GLU B CB   1 
ATOM   2265 C  CG   . GLU B 1 144 ? 29.244 42.847 16.811  1.00 233.97 ? 144 GLU B CG   1 
ATOM   2266 C  CD   . GLU B 1 144 ? 29.112 44.350 16.683  1.00 243.52 ? 144 GLU B CD   1 
ATOM   2267 O  OE1  . GLU B 1 144 ? 27.986 44.826 16.423  1.00 234.65 ? 144 GLU B OE1  1 
ATOM   2268 O  OE2  . GLU B 1 144 ? 30.110 45.058 16.939  1.00 234.39 ? 144 GLU B OE2  1 
ATOM   2269 N  N    . ASN B 1 145 ? 26.202 44.385 18.777  1.00 231.84 ? 145 ASN B N    1 
ATOM   2270 C  CA   . ASN B 1 145 ? 24.767 44.503 19.002  1.00 232.33 ? 145 ASN B CA   1 
ATOM   2271 C  C    . ASN B 1 145 ? 23.996 44.040 17.765  1.00 238.24 ? 145 ASN B C    1 
ATOM   2272 O  O    . ASN B 1 145 ? 23.255 44.813 17.151  1.00 237.82 ? 145 ASN B O    1 
ATOM   2273 C  CB   . ASN B 1 145 ? 24.394 45.948 19.344  1.00 231.60 ? 145 ASN B CB   1 
ATOM   2274 C  CG   . ASN B 1 145 ? 25.602 46.858 19.421  1.00 245.93 ? 145 ASN B CG   1 
ATOM   2275 O  OD1  . ASN B 1 145 ? 25.832 47.512 20.437  1.00 239.00 ? 145 ASN B OD1  1 
ATOM   2276 N  ND2  . ASN B 1 145 ? 26.392 46.894 18.349  1.00 236.55 ? 145 ASN B ND2  1 
ATOM   2277 N  N    . TYR B 1 146 ? 24.186 42.774 17.404  1.00 238.50 ? 146 TYR B N    1 
ATOM   2278 C  CA   . TYR B 1 146 ? 23.509 42.185 16.256  1.00 239.03 ? 146 TYR B CA   1 
ATOM   2279 C  C    . TYR B 1 146 ? 21.999 42.166 16.502  1.00 245.27 ? 146 TYR B C    1 
ATOM   2280 O  O    . TYR B 1 146 ? 21.407 41.098 16.686  1.00 245.07 ? 146 TYR B O    1 
ATOM   2281 C  CB   . TYR B 1 146 ? 24.024 40.762 16.016  1.00 239.70 ? 146 TYR B CB   1 
ATOM   2282 C  CG   . TYR B 1 146 ? 25.257 40.399 16.825  1.00 240.17 ? 146 TYR B CG   1 
ATOM   2283 C  CD1  . TYR B 1 146 ? 26.513 40.334 16.224  1.00 241.79 ? 146 TYR B CD1  1 
ATOM   2284 C  CD2  . TYR B 1 146 ? 25.165 40.106 18.185  1.00 240.49 ? 146 TYR B CD2  1 
ATOM   2285 C  CE1  . TYR B 1 146 ? 27.645 39.978 16.953  1.00 241.89 ? 146 TYR B CE1  1 
ATOM   2286 C  CE2  . TYR B 1 146 ? 26.294 39.765 18.928  1.00 241.07 ? 146 TYR B CE2  1 
ATOM   2287 C  CZ   . TYR B 1 146 ? 27.533 39.703 18.308  1.00 247.06 ? 146 TYR B CZ   1 
ATOM   2288 O  OH   . TYR B 1 146 ? 28.658 39.370 19.039  1.00 247.17 ? 146 TYR B OH   1 
ATOM   2289 N  N    . ILE B 1 147 ? 21.391 43.355 16.512  1.00 242.38 ? 147 ILE B N    1 
ATOM   2290 C  CA   . ILE B 1 147 ? 19.955 43.517 16.757  1.00 242.55 ? 147 ILE B CA   1 
ATOM   2291 C  C    . ILE B 1 147 ? 19.084 43.206 15.534  1.00 243.93 ? 147 ILE B C    1 
ATOM   2292 O  O    . ILE B 1 147 ? 17.914 43.602 15.465  1.00 242.75 ? 147 ILE B O    1 
ATOM   2293 C  CB   . ILE B 1 147 ? 19.636 44.904 17.356  1.00 246.58 ? 147 ILE B CB   1 
ATOM   2294 C  CG1  . ILE B 1 147 ? 20.628 45.239 18.474  1.00 247.35 ? 147 ILE B CG1  1 
ATOM   2295 C  CG2  . ILE B 1 147 ? 18.202 44.946 17.876  1.00 247.63 ? 147 ILE B CG2  1 
ATOM   2296 C  CD1  . ILE B 1 147 ? 21.374 46.538 18.265  1.00 254.94 ? 147 ILE B CD1  1 
ATOM   2297 N  N    . ALA B 1 148 ? 19.656 42.467 14.587  1.00 240.93 ? 148 ALA B N    1 
ATOM   2298 C  CA   . ALA B 1 148 ? 18.951 42.070 13.376  1.00 240.93 ? 148 ALA B CA   1 
ATOM   2299 C  C    . ALA B 1 148 ? 17.595 41.447 13.708  1.00 240.93 ? 148 ALA B C    1 
ATOM   2300 O  O    . ALA B 1 148 ? 17.518 40.394 14.345  1.00 240.93 ? 148 ALA B O    1 
ATOM   2301 C  CB   . ALA B 1 148 ? 19.803 41.098 12.571  1.00 240.93 ? 148 ALA B CB   1 
ATOM   2302 N  N    . MET C 1 1   ? 41.823 62.531 26.071  1.00 174.09 ? 1   MET C N    1 
ATOM   2303 C  CA   . MET C 1 1   ? 42.412 62.502 24.741  1.00 174.09 ? 1   MET C CA   1 
ATOM   2304 C  C    . MET C 1 1   ? 41.665 61.585 23.779  1.00 174.09 ? 1   MET C C    1 
ATOM   2305 O  O    . MET C 1 1   ? 41.288 60.462 24.127  1.00 271.30 ? 1   MET C O    1 
ATOM   2306 C  CB   . MET C 1 1   ? 43.876 62.100 24.809  1.00 174.09 ? 1   MET C CB   1 
ATOM   2307 C  CG   . MET C 1 1   ? 44.814 63.157 24.263  1.00 174.09 ? 1   MET C CG   1 
ATOM   2308 S  SD   . MET C 1 1   ? 45.962 62.488 23.041  1.00 174.09 ? 1   MET C SD   1 
ATOM   2309 C  CE   . MET C 1 1   ? 47.337 61.825 24.105  1.00 174.09 ? 1   MET C CE   1 
ATOM   2310 N  N    . ASP C 1 2   ? 41.473 62.086 22.560  1.00 174.85 ? 2   ASP C N    1 
ATOM   2311 C  CA   . ASP C 1 2   ? 40.756 61.399 21.468  1.00 176.13 ? 2   ASP C CA   1 
ATOM   2312 C  C    . ASP C 1 2   ? 41.249 59.966 21.173  1.00 173.11 ? 2   ASP C C    1 
ATOM   2313 O  O    . ASP C 1 2   ? 42.323 59.774 20.595  1.00 171.29 ? 2   ASP C O    1 
ATOM   2314 C  CB   . ASP C 1 2   ? 40.793 62.277 20.195  1.00 181.86 ? 2   ASP C CB   1 
ATOM   2315 C  CG   . ASP C 1 2   ? 41.175 63.760 20.489  1.00 218.72 ? 2   ASP C CG   1 
ATOM   2316 O  OD1  . ASP C 1 2   ? 41.192 64.182 21.676  1.00 223.05 ? 2   ASP C OD1  1 
ATOM   2317 O  OD2  . ASP C 1 2   ? 41.455 64.510 19.519  1.00 228.42 ? 2   ASP C OD2  1 
ATOM   2318 N  N    . GLN C 1 3   ? 40.453 58.980 21.586  1.00 173.28 ? 3   GLN C N    1 
ATOM   2319 C  CA   . GLN C 1 3   ? 40.781 57.565 21.448  1.00 171.72 ? 3   GLN C CA   1 
ATOM   2320 C  C    . GLN C 1 3   ? 41.499 57.201 20.154  1.00 171.84 ? 3   GLN C C    1 
ATOM   2321 O  O    . GLN C 1 3   ? 42.436 56.395 20.146  1.00 171.08 ? 3   GLN C O    1 
ATOM   2322 C  CB   . GLN C 1 3   ? 39.511 56.728 21.612  1.00 172.65 ? 3   GLN C CB   1 
ATOM   2323 C  CG   . GLN C 1 3   ? 39.615 55.305 21.059  1.00 173.42 ? 3   GLN C CG   1 
ATOM   2324 C  CD   . GLN C 1 3   ? 40.263 54.319 22.039  1.00 178.73 ? 3   GLN C CD   1 
ATOM   2325 O  OE1  . GLN C 1 3   ? 40.592 54.675 23.183  1.00 172.18 ? 3   GLN C OE1  1 
ATOM   2326 N  NE2  . GLN C 1 3   ? 40.458 53.071 21.585  1.00 168.83 ? 3   GLN C NE2  1 
ATOM   2327 N  N    . GLU C 1 4   ? 41.059 57.789 19.053  1.00 172.46 ? 4   GLU C N    1 
ATOM   2328 C  CA   . GLU C 1 4   ? 41.693 57.484 17.782  1.00 171.20 ? 4   GLU C CA   1 
ATOM   2329 C  C    . GLU C 1 4   ? 43.149 57.931 17.814  1.00 158.15 ? 4   GLU C C    1 
ATOM   2330 O  O    . GLU C 1 4   ? 44.057 57.124 17.598  1.00 154.32 ? 4   GLU C O    1 
ATOM   2331 C  CB   . GLU C 1 4   ? 40.941 58.131 16.619  1.00 174.76 ? 4   GLU C CB   1 
ATOM   2332 C  CG   . GLU C 1 4   ? 41.832 58.867 15.638  1.00 195.90 ? 4   GLU C CG   1 
ATOM   2333 C  CD   . GLU C 1 4   ? 41.905 60.359 15.932  1.00 236.99 ? 4   GLU C CD   1 
ATOM   2334 O  OE1  . GLU C 1 4   ? 41.078 60.849 16.739  1.00 236.77 ? 4   GLU C OE1  1 
ATOM   2335 O  OE2  . GLU C 1 4   ? 42.790 61.038 15.360  1.00 236.51 ? 4   GLU C OE2  1 
ATOM   2336 N  N    . THR C 1 5   ? 43.346 59.211 18.134  1.00 156.26 ? 5   THR C N    1 
ATOM   2337 C  CA   . THR C 1 5   ? 44.659 59.860 18.211  1.00 155.06 ? 5   THR C CA   1 
ATOM   2338 C  C    . THR C 1 5   ? 45.641 59.121 19.114  1.00 156.11 ? 5   THR C C    1 
ATOM   2339 O  O    . THR C 1 5   ? 46.775 58.815 18.720  1.00 154.43 ? 5   THR C O    1 
ATOM   2340 C  CB   . THR C 1 5   ? 44.502 61.312 18.700  1.00 166.90 ? 5   THR C CB   1 
ATOM   2341 O  OG1  . THR C 1 5   ? 44.660 61.353 20.123  1.00 167.37 ? 5   THR C OG1  1 
ATOM   2342 C  CG2  . THR C 1 5   ? 43.126 61.842 18.353  1.00 166.40 ? 5   THR C CG2  1 
ATOM   2343 N  N    . VAL C 1 6   ? 45.207 58.903 20.351  1.00 150.26 ? 6   VAL C N    1 
ATOM   2344 C  CA   . VAL C 1 6   ? 46.002 58.201 21.351  1.00 148.47 ? 6   VAL C CA   1 
ATOM   2345 C  C    . VAL C 1 6   ? 46.574 56.940 20.713  1.00 159.38 ? 6   VAL C C    1 
ATOM   2346 O  O    . VAL C 1 6   ? 47.717 56.551 20.970  1.00 160.98 ? 6   VAL C O    1 
ATOM   2347 C  CB   . VAL C 1 6   ? 45.126 57.846 22.579  1.00 145.08 ? 6   VAL C CB   1 
ATOM   2348 C  CG1  . VAL C 1 6   ? 45.947 57.916 23.851  1.00 143.63 ? 6   VAL C CG1  1 
ATOM   2349 C  CG2  . VAL C 1 6   ? 43.898 58.767 22.669  1.00 143.64 ? 6   VAL C CG2  1 
ATOM   2350 N  N    . GLY C 1 7   ? 45.762 56.337 19.849  1.00 155.90 ? 7   GLY C N    1 
ATOM   2351 C  CA   . GLY C 1 7   ? 46.121 55.146 19.114  1.00 154.36 ? 7   GLY C CA   1 
ATOM   2352 C  C    . GLY C 1 7   ? 47.388 55.339 18.299  1.00 154.43 ? 7   GLY C C    1 
ATOM   2353 O  O    . GLY C 1 7   ? 48.325 54.547 18.418  1.00 153.53 ? 7   GLY C O    1 
ATOM   2354 N  N    . ASN C 1 8   ? 47.427 56.390 17.477  1.00 150.41 ? 8   ASN C N    1 
ATOM   2355 C  CA   . ASN C 1 8   ? 48.582 56.648 16.608  1.00 148.98 ? 8   ASN C CA   1 
ATOM   2356 C  C    . ASN C 1 8   ? 49.725 57.400 17.284  1.00 149.18 ? 8   ASN C C    1 
ATOM   2357 O  O    . ASN C 1 8   ? 50.401 58.228 16.659  1.00 148.47 ? 8   ASN C O    1 
ATOM   2358 C  CB   . ASN C 1 8   ? 48.160 57.351 15.314  1.00 149.46 ? 8   ASN C CB   1 
ATOM   2359 C  CG   . ASN C 1 8   ? 46.902 58.179 15.485  1.00 169.81 ? 8   ASN C CG   1 
ATOM   2360 O  OD1  . ASN C 1 8   ? 46.965 59.362 15.825  1.00 163.77 ? 8   ASN C OD1  1 
ATOM   2361 N  ND2  . ASN C 1 8   ? 45.748 57.559 15.257  1.00 161.32 ? 8   ASN C ND2  1 
ATOM   2362 N  N    . VAL C 1 9   ? 49.966 57.067 18.546  1.00 141.67 ? 9   VAL C N    1 
ATOM   2363 C  CA   . VAL C 1 9   ? 51.028 57.703 19.301  1.00 136.33 ? 9   VAL C CA   1 
ATOM   2364 C  C    . VAL C 1 9   ? 51.433 56.810 20.474  1.00 149.59 ? 9   VAL C C    1 
ATOM   2365 O  O    . VAL C 1 9   ? 52.526 56.937 21.044  1.00 151.54 ? 9   VAL C O    1 
ATOM   2366 C  CB   . VAL C 1 9   ? 50.574 59.079 19.767  1.00 127.27 ? 9   VAL C CB   1 
ATOM   2367 C  CG1  . VAL C 1 9   ? 49.232 58.981 20.506  1.00 124.90 ? 9   VAL C CG1  1 
ATOM   2368 C  CG2  . VAL C 1 9   ? 51.658 59.714 20.607  1.00 124.91 ? 9   VAL C CG2  1 
ATOM   2369 N  N    . VAL C 1 10  ? 50.532 55.897 20.807  1.00 142.89 ? 10  VAL C N    1 
ATOM   2370 C  CA   . VAL C 1 10  ? 50.728 54.952 21.884  1.00 144.65 ? 10  VAL C CA   1 
ATOM   2371 C  C    . VAL C 1 10  ? 52.124 54.355 21.885  1.00 139.15 ? 10  VAL C C    1 
ATOM   2372 O  O    . VAL C 1 10  ? 52.669 54.042 22.932  1.00 135.49 ? 10  VAL C O    1 
ATOM   2373 C  CB   . VAL C 1 10  ? 49.687 53.849 21.790  1.00 157.39 ? 10  VAL C CB   1 
ATOM   2374 C  CG1  . VAL C 1 10  ? 50.334 52.501 21.998  1.00 158.70 ? 10  VAL C CG1  1 
ATOM   2375 C  CG2  . VAL C 1 10  ? 48.560 54.094 22.777  1.00 158.71 ? 10  VAL C CG2  1 
ATOM   2376 N  N    . LEU C 1 11  ? 52.700 54.194 20.705  1.00 131.90 ? 11  LEU C N    1 
ATOM   2377 C  CA   . LEU C 1 11  ? 54.028 53.608 20.606  1.00 131.93 ? 11  LEU C CA   1 
ATOM   2378 C  C    . LEU C 1 11  ? 55.111 54.561 21.047  1.00 139.14 ? 11  LEU C C    1 
ATOM   2379 O  O    . LEU C 1 11  ? 56.024 54.176 21.773  1.00 140.96 ? 11  LEU C O    1 
ATOM   2380 C  CB   . LEU C 1 11  ? 54.313 53.169 19.187  1.00 129.69 ? 11  LEU C CB   1 
ATOM   2381 C  CG   . LEU C 1 11  ? 53.502 51.939 18.832  1.00 128.68 ? 11  LEU C CG   1 
ATOM   2382 C  CD1  . LEU C 1 11  ? 52.715 51.510 20.067  1.00 126.88 ? 11  LEU C CD1  1 
ATOM   2383 C  CD2  . LEU C 1 11  ? 52.585 52.318 17.688  1.00 129.17 ? 11  LEU C CD2  1 
ATOM   2384 N  N    . LEU C 1 12  ? 55.035 55.792 20.554  1.00 134.17 ? 12  LEU C N    1 
ATOM   2385 C  CA   . LEU C 1 12  ? 55.998 56.822 20.906  1.00 130.91 ? 12  LEU C CA   1 
ATOM   2386 C  C    . LEU C 1 12  ? 55.898 57.048 22.403  1.00 134.61 ? 12  LEU C C    1 
ATOM   2387 O  O    . LEU C 1 12  ? 56.902 57.284 23.078  1.00 134.20 ? 12  LEU C O    1 
ATOM   2388 C  CB   . LEU C 1 12  ? 55.655 58.123 20.193  1.00 129.32 ? 12  LEU C CB   1 
ATOM   2389 C  CG   . LEU C 1 12  ? 55.335 57.982 18.711  1.00 131.45 ? 12  LEU C CG   1 
ATOM   2390 C  CD1  . LEU C 1 12  ? 54.681 59.262 18.212  1.00 130.81 ? 12  LEU C CD1  1 
ATOM   2391 C  CD2  . LEU C 1 12  ? 56.589 57.628 17.911  1.00 133.12 ? 12  LEU C CD2  1 
ATOM   2392 N  N    . ALA C 1 13  ? 54.673 56.979 22.915  1.00 130.72 ? 13  ALA C N    1 
ATOM   2393 C  CA   . ALA C 1 13  ? 54.439 57.135 24.340  1.00 130.27 ? 13  ALA C CA   1 
ATOM   2394 C  C    . ALA C 1 13  ? 55.157 56.004 25.076  1.00 127.65 ? 13  ALA C C    1 
ATOM   2395 O  O    . ALA C 1 13  ? 55.940 56.238 26.000  1.00 125.43 ? 13  ALA C O    1 
ATOM   2396 C  CB   . ALA C 1 13  ? 52.954 57.081 24.624  1.00 131.66 ? 13  ALA C CB   1 
ATOM   2397 N  N    . ILE C 1 14  ? 54.882 54.774 24.645  1.00 122.30 ? 14  ILE C N    1 
ATOM   2398 C  CA   . ILE C 1 14  ? 55.485 53.581 25.233  1.00 121.18 ? 14  ILE C CA   1 
ATOM   2399 C  C    . ILE C 1 14  ? 56.988 53.695 25.249  1.00 126.79 ? 14  ILE C C    1 
ATOM   2400 O  O    . ILE C 1 14  ? 57.589 53.727 26.309  1.00 126.98 ? 14  ILE C O    1 
ATOM   2401 C  CB   . ILE C 1 14  ? 55.069 52.312 24.491  1.00 122.36 ? 14  ILE C CB   1 
ATOM   2402 C  CG1  . ILE C 1 14  ? 53.945 51.617 25.251  1.00 121.79 ? 14  ILE C CG1  1 
ATOM   2403 C  CG2  . ILE C 1 14  ? 56.254 51.378 24.345  1.00 122.34 ? 14  ILE C CG2  1 
ATOM   2404 C  CD1  . ILE C 1 14  ? 52.571 51.949 24.743  1.00 127.87 ? 14  ILE C CD1  1 
ATOM   2405 N  N    . VAL C 1 15  ? 57.583 53.761 24.061  1.00 123.03 ? 15  VAL C N    1 
ATOM   2406 C  CA   . VAL C 1 15  ? 59.029 53.881 23.918  1.00 121.02 ? 15  VAL C CA   1 
ATOM   2407 C  C    . VAL C 1 15  ? 59.529 55.001 24.817  1.00 127.29 ? 15  VAL C C    1 
ATOM   2408 O  O    . VAL C 1 15  ? 60.526 54.854 25.531  1.00 127.01 ? 15  VAL C O    1 
ATOM   2409 C  CB   . VAL C 1 15  ? 59.438 54.133 22.438  1.00 120.98 ? 15  VAL C CB   1 
ATOM   2410 C  CG1  . VAL C 1 15  ? 59.499 55.627 22.145  1.00 120.13 ? 15  VAL C CG1  1 
ATOM   2411 C  CG2  . VAL C 1 15  ? 60.778 53.451 22.110  1.00 120.13 ? 15  VAL C CG2  1 
ATOM   2412 N  N    . THR C 1 16  ? 58.801 56.107 24.805  1.00 123.62 ? 16  THR C N    1 
ATOM   2413 C  CA   . THR C 1 16  ? 59.155 57.259 25.609  1.00 123.56 ? 16  THR C CA   1 
ATOM   2414 C  C    . THR C 1 16  ? 59.142 56.961 27.118  1.00 127.78 ? 16  THR C C    1 
ATOM   2415 O  O    . THR C 1 16  ? 60.123 57.226 27.824  1.00 127.29 ? 16  THR C O    1 
ATOM   2416 C  CB   . THR C 1 16  ? 58.288 58.436 25.213  1.00 128.96 ? 16  THR C CB   1 
ATOM   2417 O  OG1  . THR C 1 16  ? 58.960 59.184 24.194  1.00 127.93 ? 16  THR C OG1  1 
ATOM   2418 C  CG2  . THR C 1 16  ? 57.986 59.308 26.404  1.00 126.95 ? 16  THR C CG2  1 
ATOM   2419 N  N    . LEU C 1 17  ? 58.052 56.369 27.600  1.00 127.21 ? 17  LEU C N    1 
ATOM   2420 C  CA   . LEU C 1 17  ? 57.934 55.996 29.013  1.00 127.40 ? 17  LEU C CA   1 
ATOM   2421 C  C    . LEU C 1 17  ? 59.028 54.972 29.379  1.00 128.56 ? 17  LEU C C    1 
ATOM   2422 O  O    . LEU C 1 17  ? 59.434 54.854 30.536  1.00 127.05 ? 17  LEU C O    1 
ATOM   2423 C  CB   . LEU C 1 17  ? 56.538 55.410 29.299  1.00 128.41 ? 17  LEU C CB   1 
ATOM   2424 C  CG   . LEU C 1 17  ? 55.272 56.277 29.348  1.00 134.69 ? 17  LEU C CG   1 
ATOM   2425 C  CD1  . LEU C 1 17  ? 55.559 57.732 29.062  1.00 135.34 ? 17  LEU C CD1  1 
ATOM   2426 C  CD2  . LEU C 1 17  ? 54.219 55.743 28.399  1.00 137.64 ? 17  LEU C CD2  1 
ATOM   2427 N  N    . ILE C 1 18  ? 59.476 54.218 28.381  1.00 127.64 ? 18  ILE C N    1 
ATOM   2428 C  CA   . ILE C 1 18  ? 60.521 53.225 28.562  1.00 129.19 ? 18  ILE C CA   1 
ATOM   2429 C  C    . ILE C 1 18  ? 61.767 53.996 28.878  1.00 131.41 ? 18  ILE C C    1 
ATOM   2430 O  O    . ILE C 1 18  ? 62.333 53.891 29.954  1.00 129.70 ? 18  ILE C O    1 
ATOM   2431 C  CB   . ILE C 1 18  ? 60.764 52.470 27.256  1.00 134.72 ? 18  ILE C CB   1 
ATOM   2432 C  CG1  . ILE C 1 18  ? 59.945 51.186 27.209  1.00 136.38 ? 18  ILE C CG1  1 
ATOM   2433 C  CG2  . ILE C 1 18  ? 62.228 52.153 27.098  1.00 136.36 ? 18  ILE C CG2  1 
ATOM   2434 C  CD1  . ILE C 1 18  ? 58.456 51.386 27.317  1.00 145.31 ? 18  ILE C CD1  1 
ATOM   2435 N  N    . SER C 1 19  ? 62.179 54.784 27.902  1.00 130.39 ? 19  SER C N    1 
ATOM   2436 C  CA   . SER C 1 19  ? 63.357 55.616 28.008  1.00 131.76 ? 19  SER C CA   1 
ATOM   2437 C  C    . SER C 1 19  ? 63.314 56.480 29.259  1.00 139.23 ? 19  SER C C    1 
ATOM   2438 O  O    . SER C 1 19  ? 64.355 56.815 29.817  1.00 139.34 ? 19  SER C O    1 
ATOM   2439 C  CB   . SER C 1 19  ? 63.435 56.523 26.785  1.00 135.25 ? 19  SER C CB   1 
ATOM   2440 O  OG   . SER C 1 19  ? 62.285 57.355 26.706  1.00 143.78 ? 19  SER C OG   1 
ATOM   2441 N  N    . VAL C 1 20  ? 62.114 56.881 29.671  1.00 137.18 ? 20  VAL C N    1 
ATOM   2442 C  CA   . VAL C 1 20  ? 61.961 57.717 30.860  1.00 137.01 ? 20  VAL C CA   1 
ATOM   2443 C  C    . VAL C 1 20  ? 62.405 56.925 32.079  1.00 139.50 ? 20  VAL C C    1 
ATOM   2444 O  O    . VAL C 1 20  ? 63.017 57.461 33.003  1.00 138.43 ? 20  VAL C O    1 
ATOM   2445 C  CB   . VAL C 1 20  ? 60.502 58.186 31.039  1.00 141.28 ? 20  VAL C CB   1 
ATOM   2446 C  CG1  . VAL C 1 20  ? 59.830 57.422 32.178  1.00 141.13 ? 20  VAL C CG1  1 
ATOM   2447 C  CG2  . VAL C 1 20  ? 60.457 59.679 31.315  1.00 141.14 ? 20  VAL C CG2  1 
ATOM   2448 N  N    . VAL C 1 21  ? 62.084 55.637 32.059  1.00 137.95 ? 21  VAL C N    1 
ATOM   2449 C  CA   . VAL C 1 21  ? 62.409 54.725 33.140  1.00 139.32 ? 21  VAL C CA   1 
ATOM   2450 C  C    . VAL C 1 21  ? 63.867 54.307 33.119  1.00 141.50 ? 21  VAL C C    1 
ATOM   2451 O  O    . VAL C 1 21  ? 64.505 54.257 34.164  1.00 139.67 ? 21  VAL C O    1 
ATOM   2452 C  CB   . VAL C 1 21  ? 61.497 53.522 33.101  1.00 146.70 ? 21  VAL C CB   1 
ATOM   2453 C  CG1  . VAL C 1 21  ? 62.308 52.247 33.233  1.00 147.09 ? 21  VAL C CG1  1 
ATOM   2454 C  CG2  . VAL C 1 21  ? 60.433 53.654 34.169  1.00 147.10 ? 21  VAL C CG2  1 
ATOM   2455 N  N    . GLN C 1 22  ? 64.392 54.007 31.934  1.00 139.21 ? 22  GLN C N    1 
ATOM   2456 C  CA   . GLN C 1 22  ? 65.801 53.658 31.810  1.00 140.78 ? 22  GLN C CA   1 
ATOM   2457 C  C    . GLN C 1 22  ? 66.605 54.869 32.283  1.00 147.29 ? 22  GLN C C    1 
ATOM   2458 O  O    . GLN C 1 22  ? 67.672 54.735 32.876  1.00 147.07 ? 22  GLN C O    1 
ATOM   2459 C  CB   . GLN C 1 22  ? 66.162 53.365 30.361  1.00 142.23 ? 22  GLN C CB   1 
ATOM   2460 C  CG   . GLN C 1 22  ? 66.724 54.578 29.644  1.00 150.21 ? 22  GLN C CG   1 
ATOM   2461 C  CD   . GLN C 1 22  ? 67.695 54.224 28.538  1.00 162.01 ? 22  GLN C CD   1 
ATOM   2462 O  OE1  . GLN C 1 22  ? 67.877 54.995 27.595  1.00 156.42 ? 22  GLN C OE1  1 
ATOM   2463 N  NE2  . GLN C 1 22  ? 68.338 53.063 28.654  1.00 153.08 ? 22  GLN C NE2  1 
ATOM   2464 N  N    . ASN C 1 23  ? 66.073 56.058 32.025  1.00 147.26 ? 23  ASN C N    1 
ATOM   2465 C  CA   . ASN C 1 23  ? 66.735 57.297 32.425  1.00 147.51 ? 23  ASN C CA   1 
ATOM   2466 C  C    . ASN C 1 23  ? 66.927 57.337 33.931  1.00 153.16 ? 23  ASN C C    1 
ATOM   2467 O  O    . ASN C 1 23  ? 68.033 57.567 34.412  1.00 152.20 ? 23  ASN C O    1 
ATOM   2468 C  CB   . ASN C 1 23  ? 65.910 58.507 31.986  1.00 146.63 ? 23  ASN C CB   1 
ATOM   2469 C  CG   . ASN C 1 23  ? 66.546 59.261 30.837  1.00 160.36 ? 23  ASN C CG   1 
ATOM   2470 O  OD1  . ASN C 1 23  ? 67.268 58.684 30.011  1.00 153.35 ? 23  ASN C OD1  1 
ATOM   2471 N  ND2  . ASN C 1 23  ? 66.269 60.561 30.766  1.00 150.90 ? 23  ASN C ND2  1 
ATOM   2472 N  N    . GLY C 1 24  ? 65.839 57.109 34.661  1.00 152.59 ? 24  GLY C N    1 
ATOM   2473 C  CA   . GLY C 1 24  ? 65.847 57.101 36.109  1.00 153.70 ? 24  GLY C CA   1 
ATOM   2474 C  C    . GLY C 1 24  ? 66.837 56.086 36.636  1.00 160.06 ? 24  GLY C C    1 
ATOM   2475 O  O    . GLY C 1 24  ? 67.259 56.158 37.786  1.00 159.79 ? 24  GLY C O    1 
ATOM   2476 N  N    . PHE C 1 25  ? 67.197 55.127 35.791  1.00 159.34 ? 25  PHE C N    1 
ATOM   2477 C  CA   . PHE C 1 25  ? 68.160 54.096 36.161  1.00 163.35 ? 25  PHE C CA   1 
ATOM   2478 C  C    . PHE C 1 25  ? 69.534 54.720 36.136  1.00 160.02 ? 25  PHE C C    1 
ATOM   2479 O  O    . PHE C 1 25  ? 70.301 54.616 37.091  1.00 156.23 ? 25  PHE C O    1 
ATOM   2480 C  CB   . PHE C 1 25  ? 68.157 52.973 35.125  1.00 172.69 ? 25  PHE C CB   1 
ATOM   2481 C  CG   . PHE C 1 25  ? 69.325 52.037 35.241  1.00 184.40 ? 25  PHE C CG   1 
ATOM   2482 C  CD1  . PHE C 1 25  ? 69.962 51.849 36.446  1.00 194.75 ? 25  PHE C CD1  1 
ATOM   2483 C  CD2  . PHE C 1 25  ? 69.775 51.341 34.140  1.00 194.08 ? 25  PHE C CD2  1 
ATOM   2484 C  CE1  . PHE C 1 25  ? 71.044 51.020 36.544  1.00 198.60 ? 25  PHE C CE1  1 
ATOM   2485 C  CE2  . PHE C 1 25  ? 70.847 50.497 34.237  1.00 200.18 ? 25  PHE C CE2  1 
ATOM   2486 C  CZ   . PHE C 1 25  ? 71.483 50.337 35.441  1.00 199.09 ? 25  PHE C CZ   1 
ATOM   2487 N  N    . PHE C 1 26  ? 69.863 55.297 34.990  1.00 158.46 ? 26  PHE C N    1 
ATOM   2488 C  CA   . PHE C 1 26  ? 71.150 55.941 34.788  1.00 160.16 ? 26  PHE C CA   1 
ATOM   2489 C  C    . PHE C 1 26  ? 71.419 56.874 35.955  1.00 165.65 ? 26  PHE C C    1 
ATOM   2490 O  O    . PHE C 1 26  ? 72.535 56.940 36.475  1.00 165.24 ? 26  PHE C O    1 
ATOM   2491 C  CB   . PHE C 1 26  ? 71.114 56.751 33.486  1.00 161.61 ? 26  PHE C CB   1 
ATOM   2492 C  CG   . PHE C 1 26  ? 71.081 55.902 32.244  1.00 161.74 ? 26  PHE C CG   1 
ATOM   2493 C  CD1  . PHE C 1 26  ? 70.378 54.706 32.222  1.00 163.38 ? 26  PHE C CD1  1 
ATOM   2494 C  CD2  . PHE C 1 26  ? 71.779 56.282 31.106  1.00 162.36 ? 26  PHE C CD2  1 
ATOM   2495 C  CE1  . PHE C 1 26  ? 70.355 53.914 31.081  1.00 163.56 ? 26  PHE C CE1  1 
ATOM   2496 C  CE2  . PHE C 1 26  ? 71.771 55.488 29.966  1.00 164.34 ? 26  PHE C CE2  1 
ATOM   2497 C  CZ   . PHE C 1 26  ? 71.056 54.304 29.955  1.00 162.18 ? 26  PHE C CZ   1 
ATOM   2498 N  N    . ALA C 1 27  ? 70.369 57.581 36.365  1.00 167.40 ? 27  ALA C N    1 
ATOM   2499 C  CA   . ALA C 1 27  ? 70.448 58.542 37.462  1.00 167.83 ? 27  ALA C CA   1 
ATOM   2500 C  C    . ALA C 1 27  ? 70.377 57.883 38.828  1.00 164.06 ? 27  ALA C C    1 
ATOM   2501 O  O    . ALA C 1 27  ? 70.362 58.566 39.851  1.00 160.99 ? 27  ALA C O    1 
ATOM   2502 C  CB   . ALA C 1 27  ? 69.376 59.622 37.328  1.00 169.67 ? 27  ALA C CB   1 
ATOM   2503 N  N    . HIS C 1 28  ? 70.331 56.556 38.837  1.00 168.34 ? 28  HIS C N    1 
ATOM   2504 C  CA   . HIS C 1 28  ? 70.315 55.803 40.083  1.00 172.43 ? 28  HIS C CA   1 
ATOM   2505 C  C    . HIS C 1 28  ? 71.708 55.221 40.295  1.00 165.38 ? 28  HIS C C    1 
ATOM   2506 O  O    . HIS C 1 28  ? 72.253 55.266 41.398  1.00 163.54 ? 28  HIS C O    1 
ATOM   2507 C  CB   . HIS C 1 28  ? 69.244 54.714 40.044  1.00 181.36 ? 28  HIS C CB   1 
ATOM   2508 C  CG   . HIS C 1 28  ? 69.596 53.483 40.816  1.00 192.93 ? 28  HIS C CG   1 
ATOM   2509 N  ND1  . HIS C 1 28  ? 69.116 53.237 42.084  1.00 198.88 ? 28  HIS C ND1  1 
ATOM   2510 C  CD2  . HIS C 1 28  ? 70.345 52.406 40.480  1.00 200.43 ? 28  HIS C CD2  1 
ATOM   2511 C  CE1  . HIS C 1 28  ? 69.565 52.066 42.500  1.00 201.08 ? 28  HIS C CE1  1 
ATOM   2512 N  NE2  . HIS C 1 28  ? 70.309 51.539 41.543  1.00 201.68 ? 28  HIS C NE2  1 
ATOM   2513 N  N    . LYS C 1 29  ? 72.310 54.740 39.212  1.00 168.16 ? 29  LYS C N    1 
ATOM   2514 C  CA   . LYS C 1 29  ? 73.660 54.205 39.274  1.00 167.97 ? 29  LYS C CA   1 
ATOM   2515 C  C    . LYS C 1 29  ? 74.631 55.361 39.532  1.00 171.99 ? 29  LYS C C    1 
ATOM   2516 O  O    . LYS C 1 29  ? 75.821 55.157 39.779  1.00 168.31 ? 29  LYS C O    1 
ATOM   2517 C  CB   . LYS C 1 29  ? 74.004 53.460 37.982  1.00 172.93 ? 29  LYS C CB   1 
ATOM   2518 C  CG   . LYS C 1 29  ? 74.273 51.971 38.173  1.00 216.87 ? 29  LYS C CG   1 
ATOM   2519 C  CD   . LYS C 1 29  ? 73.236 51.314 39.074  1.00 241.94 ? 29  LYS C CD   1 
ATOM   2520 C  CE   . LYS C 1 29  ? 73.542 49.834 39.279  1.00 263.06 ? 29  LYS C CE   1 
ATOM   2521 N  NZ   . LYS C 1 29  ? 72.319 49.045 39.606  1.00 275.04 ? 29  LYS C NZ   1 
ATOM   2522 N  N    . VAL C 1 30  ? 74.107 56.580 39.499  1.00 170.11 ? 30  VAL C N    1 
ATOM   2523 C  CA   . VAL C 1 30  ? 74.925 57.745 39.786  1.00 173.31 ? 30  VAL C CA   1 
ATOM   2524 C  C    . VAL C 1 30  ? 74.762 58.101 41.260  1.00 182.22 ? 30  VAL C C    1 
ATOM   2525 O  O    . VAL C 1 30  ? 75.617 58.765 41.834  1.00 183.02 ? 30  VAL C O    1 
ATOM   2526 C  CB   . VAL C 1 30  ? 74.622 58.935 38.857  1.00 176.05 ? 30  VAL C CB   1 
ATOM   2527 C  CG1  . VAL C 1 30  ? 73.973 60.052 39.641  1.00 175.56 ? 30  VAL C CG1  1 
ATOM   2528 C  CG2  . VAL C 1 30  ? 75.898 59.434 38.191  1.00 175.57 ? 30  VAL C CG2  1 
ATOM   2529 N  N    . GLU C 1 31  ? 73.686 57.628 41.885  1.00 183.27 ? 31  GLU C N    1 
ATOM   2530 C  CA   . GLU C 1 31  ? 73.489 57.879 43.310  1.00 184.03 ? 31  GLU C CA   1 
ATOM   2531 C  C    . GLU C 1 31  ? 74.318 56.905 44.121  1.00 185.94 ? 31  GLU C C    1 
ATOM   2532 O  O    . GLU C 1 31  ? 74.855 57.253 45.165  1.00 182.61 ? 31  GLU C O    1 
ATOM   2533 C  CB   . GLU C 1 31  ? 72.026 57.776 43.712  1.00 186.65 ? 31  GLU C CB   1 
ATOM   2534 C  CG   . GLU C 1 31  ? 71.683 58.638 44.916  1.00 206.70 ? 31  GLU C CG   1 
ATOM   2535 C  CD   . GLU C 1 31  ? 71.962 60.118 44.688  1.00 246.97 ? 31  GLU C CD   1 
ATOM   2536 O  OE1  . GLU C 1 31  ? 72.548 60.472 43.642  1.00 246.60 ? 31  GLU C OE1  1 
ATOM   2537 O  OE2  . GLU C 1 31  ? 71.581 60.931 45.556  1.00 246.34 ? 31  GLU C OE2  1 
ATOM   2538 N  N    . HIS C 1 32  ? 74.449 55.688 43.615  1.00 182.38 ? 32  HIS C N    1 
ATOM   2539 C  CA   . HIS C 1 32  ? 75.262 54.683 44.279  1.00 188.33 ? 32  HIS C CA   1 
ATOM   2540 C  C    . HIS C 1 32  ? 76.702 55.147 44.399  1.00 197.14 ? 32  HIS C C    1 
ATOM   2541 O  O    . HIS C 1 32  ? 77.357 54.912 45.411  1.00 196.98 ? 32  HIS C O    1 
ATOM   2542 C  CB   . HIS C 1 32  ? 75.256 53.393 43.478  1.00 192.87 ? 32  HIS C CB   1 
ATOM   2543 C  CG   . HIS C 1 32  ? 74.569 52.268 44.173  1.00 199.69 ? 32  HIS C CG   1 
ATOM   2544 N  ND1  . HIS C 1 32  ? 75.004 50.963 44.083  1.00 203.07 ? 32  HIS C ND1  1 
ATOM   2545 C  CD2  . HIS C 1 32  ? 73.476 52.250 44.972  1.00 203.56 ? 32  HIS C CD2  1 
ATOM   2546 C  CE1  . HIS C 1 32  ? 74.198 50.187 44.787  1.00 203.43 ? 32  HIS C CE1  1 
ATOM   2547 N  NE2  . HIS C 1 32  ? 73.262 50.943 45.335  1.00 203.84 ? 32  HIS C NE2  1 
ATOM   2548 N  N    . GLU C 1 33  ? 77.197 55.768 43.335  1.00 194.31 ? 33  GLU C N    1 
ATOM   2549 C  CA   . GLU C 1 33  ? 78.573 56.238 43.272  1.00 195.52 ? 33  GLU C CA   1 
ATOM   2550 C  C    . GLU C 1 33  ? 78.839 57.495 44.100  1.00 196.36 ? 33  GLU C C    1 
ATOM   2551 O  O    . GLU C 1 33  ? 79.962 57.725 44.538  1.00 195.62 ? 33  GLU C O    1 
ATOM   2552 C  CB   . GLU C 1 33  ? 78.964 56.483 41.815  1.00 197.52 ? 33  GLU C CB   1 
ATOM   2553 C  CG   . GLU C 1 33  ? 79.611 55.292 41.124  1.00 205.47 ? 33  GLU C CG   1 
ATOM   2554 C  CD   . GLU C 1 33  ? 79.720 54.081 42.019  1.00 216.33 ? 33  GLU C CD   1 
ATOM   2555 O  OE1  . GLU C 1 33  ? 78.720 53.340 42.126  1.00 207.65 ? 33  GLU C OE1  1 
ATOM   2556 O  OE2  . GLU C 1 33  ? 80.805 53.871 42.608  1.00 207.39 ? 33  GLU C OE2  1 
ATOM   2557 N  N    . SER C 1 34  ? 77.822 58.325 44.285  1.00 202.74 ? 34  SER C N    1 
ATOM   2558 C  CA   . SER C 1 34  ? 77.994 59.549 45.054  1.00 201.17 ? 34  SER C CA   1 
ATOM   2559 C  C    . SER C 1 34  ? 77.751 59.240 46.522  1.00 198.75 ? 34  SER C C    1 
ATOM   2560 O  O    . SER C 1 34  ? 77.992 60.069 47.398  1.00 198.42 ? 34  SER C O    1 
ATOM   2561 C  CB   . SER C 1 34  ? 77.039 60.637 44.557  1.00 205.71 ? 34  SER C CB   1 
ATOM   2562 O  OG   . SER C 1 34  ? 76.473 61.358 45.635  1.00 215.60 ? 34  SER C OG   1 
ATOM   2563 N  N    . ARG C 1 35  ? 77.304 58.015 46.777  1.00 203.08 ? 35  ARG C N    1 
ATOM   2564 C  CA   . ARG C 1 35  ? 77.015 57.562 48.128  1.00 203.87 ? 35  ARG C CA   1 
ATOM   2565 C  C    . ARG C 1 35  ? 78.191 56.809 48.748  1.00 215.63 ? 35  ARG C C    1 
ATOM   2566 O  O    . ARG C 1 35  ? 78.604 57.109 49.868  1.00 213.56 ? 35  ARG C O    1 
ATOM   2567 C  CB   . ARG C 1 35  ? 75.746 56.697 48.139  1.00 207.42 ? 35  ARG C CB   1 
ATOM   2568 C  CG   . ARG C 1 35  ? 74.473 57.438 48.572  1.00 230.20 ? 35  ARG C CG   1 
ATOM   2569 C  CD   . ARG C 1 35  ? 74.334 58.802 47.886  1.00 252.62 ? 35  ARG C CD   1 
ATOM   2570 N  NE   . ARG C 1 35  ? 75.325 59.772 48.357  1.00 267.40 ? 35  ARG C NE   1 
ATOM   2571 C  CZ   . ARG C 1 35  ? 75.029 60.959 48.879  1.00 283.07 ? 35  ARG C CZ   1 
ATOM   2572 N  NH1  . ARG C 1 35  ? 73.763 61.336 48.999  1.00 270.56 ? 35  ARG C NH1  1 
ATOM   2573 N  NH2  . ARG C 1 35  ? 75.999 61.771 49.284  1.00 269.98 ? 35  ARG C NH2  1 
ATOM   2574 N  N    . THR C 1 36  ? 78.728 55.830 48.024  1.00 210.46 ? 36  THR C N    1 
ATOM   2575 C  CA   . THR C 1 36  ? 79.857 55.051 48.536  1.00 214.54 ? 36  THR C CA   1 
ATOM   2576 C  C    . THR C 1 36  ? 81.095 55.932 48.618  1.00 223.50 ? 36  THR C C    1 
ATOM   2577 O  O    . THR C 1 36  ? 82.005 55.697 49.424  1.00 223.44 ? 36  THR C O    1 
ATOM   2578 C  CB   . THR C 1 36  ? 80.104 53.765 47.715  1.00 225.95 ? 36  THR C CB   1 
ATOM   2579 O  OG1  . THR C 1 36  ? 80.624 54.105 46.421  1.00 226.07 ? 36  THR C OG1  1 
ATOM   2580 C  CG2  . THR C 1 36  ? 78.812 52.964 47.566  1.00 225.09 ? 36  THR C CG2  1 
ATOM   2581 N  N    . GLN C 1 37  ? 81.115 56.936 47.747  1.00 221.65 ? 37  GLN C N    1 
ATOM   2582 C  CA   . GLN C 1 37  ? 82.185 57.917 47.689  1.00 223.32 ? 37  GLN C CA   1 
ATOM   2583 C  C    . GLN C 1 37  ? 81.894 58.895 48.821  1.00 231.95 ? 37  GLN C C    1 
ATOM   2584 O  O    . GLN C 1 37  ? 81.838 60.108 48.606  1.00 232.11 ? 37  GLN C O    1 
ATOM   2585 C  CB   . GLN C 1 37  ? 82.142 58.646 46.341  1.00 224.92 ? 37  GLN C CB   1 
ATOM   2586 C  CG   . GLN C 1 37  ? 83.013 58.037 45.236  1.00 245.89 ? 37  GLN C CG   1 
ATOM   2587 C  CD   . GLN C 1 37  ? 82.779 56.543 44.986  1.00 270.09 ? 37  GLN C CD   1 
ATOM   2588 O  OE1  . GLN C 1 37  ? 82.252 55.826 45.835  1.00 266.36 ? 37  GLN C OE1  1 
ATOM   2589 N  NE2  . GLN C 1 37  ? 83.218 56.067 43.825  1.00 263.02 ? 37  GLN C NE2  1 
ATOM   2590 N  N    . ASN C 1 38  ? 81.649 58.317 50.002  1.00 230.79 ? 38  ASN C N    1 
ATOM   2591 C  CA   . ASN C 1 38  ? 81.308 59.009 51.253  1.00 232.00 ? 38  ASN C CA   1 
ATOM   2592 C  C    . ASN C 1 38  ? 81.371 60.529 51.226  1.00 239.32 ? 38  ASN C C    1 
ATOM   2593 O  O    . ASN C 1 38  ? 82.155 61.146 51.948  1.00 239.37 ? 38  ASN C O    1 
ATOM   2594 C  CB   . ASN C 1 38  ? 82.137 58.460 52.421  1.00 233.58 ? 38  ASN C CB   1 
ATOM   2595 C  CG   . ASN C 1 38  ? 81.543 57.192 53.015  1.00 256.71 ? 38  ASN C CG   1 
ATOM   2596 O  OD1  . ASN C 1 38  ? 80.519 57.233 53.701  1.00 251.01 ? 38  ASN C OD1  1 
ATOM   2597 N  ND2  . ASN C 1 38  ? 82.181 56.056 52.748  1.00 248.56 ? 38  ASN C ND2  1 
ATOM   2598 N  N    . GLY C 1 39  ? 80.539 61.128 50.383  1.00 236.01 ? 39  GLY C N    1 
ATOM   2599 C  CA   . GLY C 1 39  ? 80.514 62.568 50.236  1.00 233.95 ? 39  GLY C CA   1 
ATOM   2600 C  C    . GLY C 1 39  ? 79.483 63.265 51.101  1.00 229.88 ? 39  GLY C C    1 
ATOM   2601 O  O    . GLY C 1 39  ? 78.444 62.692 51.452  1.00 227.29 ? 39  GLY C O    1 
ATOM   2602 N  N    . ARG C 1 40  ? 79.786 64.516 51.442  1.00 225.36 ? 40  ARG C N    1 
ATOM   2603 C  CA   . ARG C 1 40  ? 78.891 65.353 52.230  1.00 226.18 ? 40  ARG C CA   1 
ATOM   2604 C  C    . ARG C 1 40  ? 77.838 65.884 51.265  1.00 230.91 ? 40  ARG C C    1 
ATOM   2605 O  O    . ARG C 1 40  ? 76.694 65.415 51.239  1.00 230.54 ? 40  ARG C O    1 
ATOM   2606 C  CB   . ARG C 1 40  ? 79.668 66.531 52.832  1.00 229.93 ? 40  ARG C CB   1 
ATOM   2607 C  CG   . ARG C 1 40  ? 80.021 66.362 54.301  1.00 250.14 ? 40  ARG C CG   1 
ATOM   2608 C  CD   . ARG C 1 40  ? 79.266 67.362 55.159  1.00 269.14 ? 40  ARG C CD   1 
ATOM   2609 N  NE   . ARG C 1 40  ? 78.983 66.845 56.495  1.00 280.89 ? 40  ARG C NE   1 
ATOM   2610 C  CZ   . ARG C 1 40  ? 78.143 65.848 56.751  1.00 294.45 ? 40  ARG C CZ   1 
ATOM   2611 N  NH1  . ARG C 1 40  ? 77.504 65.242 55.760  1.00 281.42 ? 40  ARG C NH1  1 
ATOM   2612 N  NH2  . ARG C 1 40  ? 77.944 65.449 58.000  1.00 280.83 ? 40  ARG C NH2  1 
ATOM   2613 N  N    . SER C 1 41  ? 78.261 66.833 50.436  1.00 225.93 ? 41  SER C N    1 
ATOM   2614 C  CA   . SER C 1 41  ? 77.400 67.430 49.427  1.00 227.28 ? 41  SER C CA   1 
ATOM   2615 C  C    . SER C 1 41  ? 77.347 66.518 48.209  1.00 245.80 ? 41  SER C C    1 
ATOM   2616 O  O    . SER C 1 41  ? 76.706 65.469 48.242  1.00 248.76 ? 41  SER C O    1 
ATOM   2617 C  CB   . SER C 1 41  ? 77.953 68.797 49.031  1.00 224.62 ? 41  SER C CB   1 
ATOM   2618 O  OG   . SER C 1 41  ? 79.163 69.063 49.728  1.00 226.64 ? 41  SER C OG   1 
ATOM   2619 N  N    . PHE C 1 42  ? 78.057 66.908 47.153  1.00 240.74 ? 42  PHE C N    1 
ATOM   2620 C  CA   . PHE C 1 42  ? 78.108 66.137 45.912  1.00 240.57 ? 42  PHE C CA   1 
ATOM   2621 C  C    . PHE C 1 42  ? 78.800 66.947 44.815  1.00 238.17 ? 42  PHE C C    1 
ATOM   2622 O  O    . PHE C 1 42  ? 78.251 67.923 44.306  1.00 236.39 ? 42  PHE C O    1 
ATOM   2623 C  CB   . PHE C 1 42  ? 76.689 65.724 45.494  1.00 244.01 ? 42  PHE C CB   1 
ATOM   2624 C  CG   . PHE C 1 42  ? 76.568 65.234 44.072  1.00 247.25 ? 42  PHE C CG   1 
ATOM   2625 C  CD1  . PHE C 1 42  ? 76.445 63.881 43.801  1.00 251.41 ? 42  PHE C CD1  1 
ATOM   2626 C  CD2  . PHE C 1 42  ? 76.445 66.131 43.024  1.00 250.52 ? 42  PHE C CD2  1 
ATOM   2627 C  CE1  . PHE C 1 42  ? 76.277 63.432 42.507  1.00 252.74 ? 42  PHE C CE1  1 
ATOM   2628 C  CE2  . PHE C 1 42  ? 76.279 65.686 41.727  1.00 253.81 ? 42  PHE C CE2  1 
ATOM   2629 C  CZ   . PHE C 1 42  ? 76.196 64.337 41.468  1.00 252.01 ? 42  PHE C CZ   1 
ATOM   2630 N  N    . GLN C 1 43  ? 80.029 66.560 44.490  1.00 234.38 ? 43  GLN C N    1 
ATOM   2631 C  CA   . GLN C 1 43  ? 80.806 67.231 43.451  1.00 232.19 ? 43  GLN C CA   1 
ATOM   2632 C  C    . GLN C 1 43  ? 80.802 66.344 42.220  1.00 232.13 ? 43  GLN C C    1 
ATOM   2633 O  O    . GLN C 1 43  ? 80.419 65.181 42.293  1.00 230.97 ? 43  GLN C O    1 
ATOM   2634 C  CB   . GLN C 1 43  ? 82.255 67.438 43.904  1.00 232.49 ? 43  GLN C CB   1 
ATOM   2635 C  CG   . GLN C 1 43  ? 82.423 68.313 45.143  1.00 217.17 ? 43  GLN C CG   1 
ATOM   2636 C  CD   . GLN C 1 43  ? 83.414 67.728 46.150  1.00 207.59 ? 43  GLN C CD   1 
ATOM   2637 O  OE1  . GLN C 1 43  ? 84.122 66.752 45.859  1.00 198.83 ? 43  GLN C OE1  1 
ATOM   2638 N  NE2  . GLN C 1 43  ? 83.460 68.319 47.346  1.00 195.47 ? 43  GLN C NE2  1 
ATOM   2639 N  N    . ARG C 1 44  ? 81.252 66.885 41.095  1.00 225.51 ? 44  ARG C N    1 
ATOM   2640 C  CA   . ARG C 1 44  ? 81.299 66.119 39.854  1.00 224.87 ? 44  ARG C CA   1 
ATOM   2641 C  C    . ARG C 1 44  ? 82.545 65.227 39.792  1.00 229.66 ? 44  ARG C C    1 
ATOM   2642 O  O    . ARG C 1 44  ? 82.689 64.406 38.885  1.00 229.59 ? 44  ARG C O    1 
ATOM   2643 C  CB   . ARG C 1 44  ? 81.208 67.065 38.646  1.00 222.55 ? 44  ARG C CB   1 
ATOM   2644 C  CG   . ARG C 1 44  ? 82.066 66.694 37.438  1.00 224.98 ? 44  ARG C CG   1 
ATOM   2645 C  CD   . ARG C 1 44  ? 82.475 67.947 36.664  1.00 223.12 ? 44  ARG C CD   1 
ATOM   2646 N  NE   . ARG C 1 44  ? 83.125 67.650 35.386  1.00 219.91 ? 44  ARG C NE   1 
ATOM   2647 C  CZ   . ARG C 1 44  ? 83.670 68.571 34.593  1.00 226.13 ? 44  ARG C CZ   1 
ATOM   2648 N  NH1  . ARG C 1 44  ? 83.650 69.853 34.944  1.00 211.61 ? 44  ARG C NH1  1 
ATOM   2649 N  NH2  . ARG C 1 44  ? 84.235 68.214 33.445  1.00 211.02 ? 44  ARG C NH2  1 
ATOM   2650 N  N    . THR C 1 45  ? 83.415 65.359 40.791  1.00 222.54 ? 45  THR C N    1 
ATOM   2651 C  CA   . THR C 1 45  ? 84.654 64.587 40.831  1.00 220.98 ? 45  THR C CA   1 
ATOM   2652 C  C    . THR C 1 45  ? 84.935 63.936 42.181  1.00 225.38 ? 45  THR C C    1 
ATOM   2653 O  O    . THR C 1 45  ? 84.591 64.484 43.229  1.00 225.30 ? 45  THR C O    1 
ATOM   2654 C  CB   . THR C 1 45  ? 85.850 65.450 40.408  1.00 210.14 ? 45  THR C CB   1 
ATOM   2655 O  OG1  . THR C 1 45  ? 86.067 65.314 38.998  1.00 205.50 ? 45  THR C OG1  1 
ATOM   2656 C  CG2  . THR C 1 45  ? 87.096 65.015 41.155  1.00 204.53 ? 45  THR C CG2  1 
ATOM   2657 N  N    . GLY C 1 46  ? 85.607 62.787 42.146  1.00 218.66 ? 46  GLY C N    1 
ATOM   2658 C  CA   . GLY C 1 46  ? 85.964 62.068 43.353  1.00 215.81 ? 46  GLY C CA   1 
ATOM   2659 C  C    . GLY C 1 46  ? 85.795 60.563 43.276  1.00 210.06 ? 46  GLY C C    1 
ATOM   2660 O  O    . GLY C 1 46  ? 84.917 60.012 43.943  1.00 207.56 ? 46  GLY C O    1 
ATOM   2661 N  N    . THR C 1 47  ? 86.668 59.927 42.491  1.00 205.47 ? 47  THR C N    1 
ATOM   2662 C  CA   . THR C 1 47  ? 86.749 58.472 42.258  1.00 205.81 ? 47  THR C CA   1 
ATOM   2663 C  C    . THR C 1 47  ? 86.827 58.235 40.769  1.00 203.00 ? 47  THR C C    1 
ATOM   2664 O  O    . THR C 1 47  ? 86.656 59.160 39.983  1.00 201.33 ? 47  THR C O    1 
ATOM   2665 C  CB   . THR C 1 47  ? 85.577 57.658 42.858  1.00 246.09 ? 47  THR C CB   1 
ATOM   2666 O  OG1  . THR C 1 47  ? 85.545 57.854 44.272  1.00 252.86 ? 47  THR C OG1  1 
ATOM   2667 C  CG2  . THR C 1 47  ? 85.746 56.165 42.580  1.00 251.88 ? 47  THR C CG2  1 
ATOM   2668 N  N    . LEU C 1 48  ? 87.087 56.997 40.376  1.00 200.33 ? 48  LEU C N    1 
ATOM   2669 C  CA   . LEU C 1 48  ? 87.078 56.665 38.968  1.00 200.74 ? 48  LEU C CA   1 
ATOM   2670 C  C    . LEU C 1 48  ? 85.863 55.790 38.673  1.00 202.23 ? 48  LEU C C    1 
ATOM   2671 O  O    . LEU C 1 48  ? 85.541 55.511 37.515  1.00 201.63 ? 48  LEU C O    1 
ATOM   2672 C  CB   . LEU C 1 48  ? 88.394 56.044 38.508  1.00 202.11 ? 48  LEU C CB   1 
ATOM   2673 C  CG   . LEU C 1 48  ? 89.229 56.995 37.639  1.00 209.29 ? 48  LEU C CG   1 
ATOM   2674 C  CD1  . LEU C 1 48  ? 88.994 56.767 36.140  1.00 210.26 ? 48  LEU C CD1  1 
ATOM   2675 C  CD2  . LEU C 1 48  ? 88.924 58.437 38.016  1.00 212.55 ? 48  LEU C CD2  1 
ATOM   2676 N  N    . ALA C 1 49  ? 85.149 55.422 39.733  1.00 199.37 ? 49  ALA C N    1 
ATOM   2677 C  CA   . ALA C 1 49  ? 83.926 54.637 39.594  1.00 198.17 ? 49  ALA C CA   1 
ATOM   2678 C  C    . ALA C 1 49  ? 82.775 55.611 39.488  1.00 197.21 ? 49  ALA C C    1 
ATOM   2679 O  O    . ALA C 1 49  ? 81.833 55.396 38.729  1.00 196.14 ? 49  ALA C O    1 
ATOM   2680 C  CB   . ALA C 1 49  ? 83.730 53.743 40.809  1.00 199.12 ? 49  ALA C CB   1 
ATOM   2681 N  N    . PHE C 1 50  ? 82.866 56.680 40.274  1.00 195.44 ? 50  PHE C N    1 
ATOM   2682 C  CA   . PHE C 1 50  ? 81.843 57.711 40.305  1.00 191.67 ? 50  PHE C CA   1 
ATOM   2683 C  C    . PHE C 1 50  ? 82.083 58.746 39.234  1.00 197.18 ? 50  PHE C C    1 
ATOM   2684 O  O    . PHE C 1 50  ? 81.165 59.416 38.774  1.00 197.31 ? 50  PHE C O    1 
ATOM   2685 C  CB   . PHE C 1 50  ? 81.822 58.414 41.648  1.00 188.76 ? 50  PHE C CB   1 
ATOM   2686 C  CG   . PHE C 1 50  ? 81.007 59.666 41.639  1.00 183.67 ? 50  PHE C CG   1 
ATOM   2687 C  CD1  . PHE C 1 50  ? 79.678 59.627 41.268  1.00 181.66 ? 50  PHE C CD1  1 
ATOM   2688 C  CD2  . PHE C 1 50  ? 81.581 60.884 41.935  1.00 180.75 ? 50  PHE C CD2  1 
ATOM   2689 C  CE1  . PHE C 1 50  ? 78.922 60.775 41.235  1.00 180.44 ? 50  PHE C CE1  1 
ATOM   2690 C  CE2  . PHE C 1 50  ? 80.828 62.037 41.913  1.00 181.17 ? 50  PHE C CE2  1 
ATOM   2691 C  CZ   . PHE C 1 50  ? 79.494 61.981 41.562  1.00 178.55 ? 50  PHE C CZ   1 
ATOM   2692 N  N    . GLU C 1 51  ? 83.334 58.917 38.865  1.00 198.51 ? 51  GLU C N    1 
ATOM   2693 C  CA   . GLU C 1 51  ? 83.624 59.867 37.825  1.00 196.67 ? 51  GLU C CA   1 
ATOM   2694 C  C    . GLU C 1 51  ? 83.397 59.173 36.492  1.00 182.24 ? 51  GLU C C    1 
ATOM   2695 O  O    . GLU C 1 51  ? 83.178 59.821 35.473  1.00 182.57 ? 51  GLU C O    1 
ATOM   2696 C  CB   . GLU C 1 51  ? 85.046 60.397 37.952  1.00 199.52 ? 51  GLU C CB   1 
ATOM   2697 C  CG   . GLU C 1 51  ? 85.119 61.796 38.548  1.00 213.63 ? 51  GLU C CG   1 
ATOM   2698 C  CD   . GLU C 1 51  ? 86.272 62.605 37.985  1.00 238.94 ? 51  GLU C CD   1 
ATOM   2699 O  OE1  . GLU C 1 51  ? 86.269 62.880 36.763  1.00 234.35 ? 51  GLU C OE1  1 
ATOM   2700 O  OE2  . GLU C 1 51  ? 87.187 62.952 38.763  1.00 234.08 ? 51  GLU C OE2  1 
ATOM   2701 N  N    . ARG C 1 52  ? 83.401 57.846 36.508  1.00 184.74 ? 52  ARG C N    1 
ATOM   2702 C  CA   . ARG C 1 52  ? 83.148 57.100 35.286  1.00 180.23 ? 52  ARG C CA   1 
ATOM   2703 C  C    . ARG C 1 52  ? 81.643 56.956 35.043  1.00 179.93 ? 52  ARG C C    1 
ATOM   2704 O  O    . ARG C 1 52  ? 81.195 56.882 33.903  1.00 173.91 ? 52  ARG C O    1 
ATOM   2705 C  CB   . ARG C 1 52  ? 83.884 55.758 35.289  1.00 187.78 ? 52  ARG C CB   1 
ATOM   2706 C  CG   . ARG C 1 52  ? 85.313 55.866 34.757  1.00 225.54 ? 52  ARG C CG   1 
ATOM   2707 C  CD   . ARG C 1 52  ? 86.028 54.526 34.763  1.00 265.73 ? 52  ARG C CD   1 
ATOM   2708 N  NE   . ARG C 1 52  ? 86.461 54.129 33.425  1.00 292.42 ? 52  ARG C NE   1 
ATOM   2709 C  CZ   . ARG C 1 52  ? 87.412 54.742 32.727  1.00 297.43 ? 52  ARG C CZ   1 
ATOM   2710 N  NH1  . ARG C 1 52  ? 88.049 55.789 33.234  1.00 297.43 ? 52  ARG C NH1  1 
ATOM   2711 N  NH2  . ARG C 1 52  ? 87.728 54.303 31.518  1.00 297.43 ? 52  ARG C NH2  1 
ATOM   2712 N  N    . VAL C 1 53  ? 80.863 57.000 36.119  1.00 167.12 ? 53  VAL C N    1 
ATOM   2713 C  CA   . VAL C 1 53  ? 79.407 56.906 36.031  1.00 173.73 ? 53  VAL C CA   1 
ATOM   2714 C  C    . VAL C 1 53  ? 78.764 58.258 35.743  1.00 181.70 ? 53  VAL C C    1 
ATOM   2715 O  O    . VAL C 1 53  ? 77.953 58.377 34.825  1.00 181.43 ? 53  VAL C O    1 
ATOM   2716 C  CB   . VAL C 1 53  ? 78.800 56.255 37.295  1.00 180.90 ? 53  VAL C CB   1 
ATOM   2717 C  CG1  . VAL C 1 53  ? 77.553 57.006 37.756  1.00 181.15 ? 53  VAL C CG1  1 
ATOM   2718 C  CG2  . VAL C 1 53  ? 78.492 54.789 37.043  1.00 181.14 ? 53  VAL C CG2  1 
ATOM   2719 N  N    . TYR C 1 54  ? 79.103 59.271 36.537  1.00 173.13 ? 54  TYR C N    1 
ATOM   2720 C  CA   . TYR C 1 54  ? 78.523 60.586 36.317  1.00 173.87 ? 54  TYR C CA   1 
ATOM   2721 C  C    . TYR C 1 54  ? 78.841 61.037 34.899  1.00 172.34 ? 54  TYR C C    1 
ATOM   2722 O  O    . TYR C 1 54  ? 78.079 61.794 34.290  1.00 171.85 ? 54  TYR C O    1 
ATOM   2723 C  CB   . TYR C 1 54  ? 79.002 61.619 37.335  1.00 177.69 ? 54  TYR C CB   1 
ATOM   2724 C  CG   . TYR C 1 54  ? 78.360 62.971 37.104  1.00 182.66 ? 54  TYR C CG   1 
ATOM   2725 C  CD1  . TYR C 1 54  ? 77.229 63.361 37.817  1.00 184.99 ? 54  TYR C CD1  1 
ATOM   2726 C  CD2  . TYR C 1 54  ? 78.822 63.820 36.098  1.00 184.15 ? 54  TYR C CD2  1 
ATOM   2727 C  CE1  . TYR C 1 54  ? 76.607 64.594 37.566  1.00 185.78 ? 54  TYR C CE1  1 
ATOM   2728 C  CE2  . TYR C 1 54  ? 78.210 65.047 35.838  1.00 185.19 ? 54  TYR C CE2  1 
ATOM   2729 C  CZ   . TYR C 1 54  ? 77.099 65.426 36.569  1.00 191.83 ? 54  TYR C CZ   1 
ATOM   2730 O  OH   . TYR C 1 54  ? 76.486 66.635 36.308  1.00 192.33 ? 54  TYR C OH   1 
ATOM   2731 N  N    . THR C 1 55  ? 79.950 60.538 34.361  1.00 168.54 ? 55  THR C N    1 
ATOM   2732 C  CA   . THR C 1 55  ? 80.311 60.861 32.988  1.00 167.23 ? 55  THR C CA   1 
ATOM   2733 C  C    . THR C 1 55  ? 79.346 60.147 32.029  1.00 168.44 ? 55  THR C C    1 
ATOM   2734 O  O    . THR C 1 55  ? 78.568 60.808 31.345  1.00 166.67 ? 55  THR C O    1 
ATOM   2735 C  CB   . THR C 1 55  ? 81.830 60.664 32.679  1.00 183.24 ? 55  THR C CB   1 
ATOM   2736 O  OG1  . THR C 1 55  ? 82.243 61.571 31.645  1.00 184.69 ? 55  THR C OG1  1 
ATOM   2737 C  CG2  . THR C 1 55  ? 82.141 59.234 32.264  1.00 183.71 ? 55  THR C CG2  1 
ATOM   2738 N  N    . ALA C 1 56  ? 79.314 58.812 32.071  1.00 161.78 ? 56  ALA C N    1 
ATOM   2739 C  CA   . ALA C 1 56  ? 78.410 58.014 31.226  1.00 162.77 ? 56  ALA C CA   1 
ATOM   2740 C  C    . ALA C 1 56  ? 76.983 58.538 31.246  1.00 166.58 ? 56  ALA C C    1 
ATOM   2741 O  O    . ALA C 1 56  ? 76.308 58.595 30.222  1.00 166.63 ? 56  ALA C O    1 
ATOM   2742 C  CB   . ALA C 1 56  ? 78.423 56.559 31.663  1.00 163.76 ? 56  ALA C CB   1 
ATOM   2743 N  N    . ASN C 1 57  ? 76.523 58.890 32.434  1.00 158.81 ? 57  ASN C N    1 
ATOM   2744 C  CA   . ASN C 1 57  ? 75.187 59.418 32.599  1.00 158.65 ? 57  ASN C CA   1 
ATOM   2745 C  C    . ASN C 1 57  ? 75.074 60.768 31.892  1.00 165.36 ? 57  ASN C C    1 
ATOM   2746 O  O    . ASN C 1 57  ? 74.285 60.923 30.959  1.00 165.15 ? 57  ASN C O    1 
ATOM   2747 C  CB   . ASN C 1 57  ? 74.870 59.559 34.091  1.00 157.66 ? 57  ASN C CB   1 
ATOM   2748 C  CG   . ASN C 1 57  ? 73.498 60.158 34.352  1.00 174.07 ? 57  ASN C CG   1 
ATOM   2749 O  OD1  . ASN C 1 57  ? 73.367 61.127 35.107  1.00 167.49 ? 57  ASN C OD1  1 
ATOM   2750 N  ND2  . ASN C 1 57  ? 72.462 59.554 33.770  1.00 165.05 ? 57  ASN C ND2  1 
ATOM   2751 N  N    . GLN C 1 58  ? 75.877 61.737 32.319  1.00 160.51 ? 58  GLN C N    1 
ATOM   2752 C  CA   . GLN C 1 58  ? 75.828 63.055 31.709  1.00 160.87 ? 58  GLN C CA   1 
ATOM   2753 C  C    . GLN C 1 58  ? 76.292 63.087 30.250  1.00 162.34 ? 58  GLN C C    1 
ATOM   2754 O  O    . GLN C 1 58  ? 76.747 64.115 29.758  1.00 161.79 ? 58  GLN C O    1 
ATOM   2755 C  CB   . GLN C 1 58  ? 76.564 64.085 32.557  1.00 162.54 ? 58  GLN C CB   1 
ATOM   2756 C  CG   . GLN C 1 58  ? 76.309 65.530 32.132  1.00 169.08 ? 58  GLN C CG   1 
ATOM   2757 C  CD   . GLN C 1 58  ? 75.019 66.093 32.704  1.00 179.07 ? 58  GLN C CD   1 
ATOM   2758 O  OE1  . GLN C 1 58  ? 74.397 66.994 32.121  1.00 173.18 ? 58  GLN C OE1  1 
ATOM   2759 N  NE2  . GLN C 1 58  ? 74.608 65.564 33.854  1.00 169.83 ? 58  GLN C NE2  1 
ATOM   2760 N  N    . ASN C 1 59  ? 76.170 61.955 29.563  1.00 160.32 ? 59  ASN C N    1 
ATOM   2761 C  CA   . ASN C 1 59  ? 76.503 61.863 28.135  1.00 158.91 ? 59  ASN C CA   1 
ATOM   2762 C  C    . ASN C 1 59  ? 75.244 61.399 27.461  1.00 160.92 ? 59  ASN C C    1 
ATOM   2763 O  O    . ASN C 1 59  ? 75.071 61.538 26.246  1.00 160.40 ? 59  ASN C O    1 
ATOM   2764 C  CB   . ASN C 1 59  ? 77.545 60.788 27.858  1.00 156.18 ? 59  ASN C CB   1 
ATOM   2765 C  CG   . ASN C 1 59  ? 78.792 60.985 28.646  1.00 162.81 ? 59  ASN C CG   1 
ATOM   2766 O  OD1  . ASN C 1 59  ? 78.908 61.952 29.405  1.00 154.79 ? 59  ASN C OD1  1 
ATOM   2767 N  ND2  . ASN C 1 59  ? 79.709 60.025 28.553  1.00 152.35 ? 59  ASN C ND2  1 
ATOM   2768 N  N    . CYS C 1 60  ? 74.408 60.760 28.269  1.00 158.61 ? 60  CYS C N    1 
ATOM   2769 C  CA   . CYS C 1 60  ? 73.146 60.216 27.818  1.00 158.10 ? 60  CYS C CA   1 
ATOM   2770 C  C    . CYS C 1 60  ? 72.109 61.300 28.038  1.00 160.08 ? 60  CYS C C    1 
ATOM   2771 O  O    . CYS C 1 60  ? 71.113 61.395 27.317  1.00 159.88 ? 60  CYS C O    1 
ATOM   2772 C  CB   . CYS C 1 60  ? 72.806 58.958 28.627  1.00 158.75 ? 60  CYS C CB   1 
ATOM   2773 S  SG   . CYS C 1 60  ? 73.829 57.501 28.221  1.00 162.73 ? 60  CYS C SG   1 
ATOM   2774 N  N    . VAL C 1 61  ? 72.372 62.146 29.024  1.00 157.80 ? 61  VAL C N    1 
ATOM   2775 C  CA   . VAL C 1 61  ? 71.463 63.236 29.315  1.00 157.33 ? 61  VAL C CA   1 
ATOM   2776 C  C    . VAL C 1 61  ? 71.560 64.296 28.234  1.00 159.20 ? 61  VAL C C    1 
ATOM   2777 O  O    . VAL C 1 61  ? 70.635 65.081 28.052  1.00 158.32 ? 61  VAL C O    1 
ATOM   2778 C  CB   . VAL C 1 61  ? 71.683 63.834 30.723  1.00 162.66 ? 61  VAL C CB   1 
ATOM   2779 C  CG1  . VAL C 1 61  ? 71.911 65.346 30.638  1.00 162.73 ? 61  VAL C CG1  1 
ATOM   2780 C  CG2  . VAL C 1 61  ? 70.483 63.536 31.621  1.00 162.74 ? 61  VAL C CG2  1 
ATOM   2781 N  N    . ASP C 1 62  ? 72.678 64.319 27.515  1.00 155.62 ? 62  ASP C N    1 
ATOM   2782 C  CA   . ASP C 1 62  ? 72.865 65.301 26.448  1.00 155.57 ? 62  ASP C CA   1 
ATOM   2783 C  C    . ASP C 1 62  ? 72.127 64.790 25.225  1.00 156.30 ? 62  ASP C C    1 
ATOM   2784 O  O    . ASP C 1 62  ? 71.730 65.559 24.347  1.00 155.01 ? 62  ASP C O    1 
ATOM   2785 C  CB   . ASP C 1 62  ? 74.350 65.427 26.069  1.00 158.47 ? 62  ASP C CB   1 
ATOM   2786 C  CG   . ASP C 1 62  ? 75.220 65.947 27.201  1.00 175.33 ? 62  ASP C CG   1 
ATOM   2787 O  OD1  . ASP C 1 62  ? 74.670 66.295 28.268  1.00 176.79 ? 62  ASP C OD1  1 
ATOM   2788 O  OD2  . ASP C 1 62  ? 76.463 66.007 27.012  1.00 182.17 ? 62  ASP C OD2  1 
ATOM   2789 N  N    . ALA C 1 63  ? 72.010 63.468 25.160  1.00 153.32 ? 63  ALA C N    1 
ATOM   2790 C  CA   . ALA C 1 63  ? 71.409 62.790 24.020  1.00 153.15 ? 63  ALA C CA   1 
ATOM   2791 C  C    . ALA C 1 63  ? 69.893 62.655 24.066  1.00 151.98 ? 63  ALA C C    1 
ATOM   2792 O  O    . ALA C 1 63  ? 69.245 62.600 23.021  1.00 149.81 ? 63  ALA C O    1 
ATOM   2793 C  CB   . ALA C 1 63  ? 72.058 61.427 23.819  1.00 154.47 ? 63  ALA C CB   1 
ATOM   2794 N  N    . TYR C 1 64  ? 69.330 62.574 25.268  1.00 148.15 ? 64  TYR C N    1 
ATOM   2795 C  CA   . TYR C 1 64  ? 67.881 62.434 25.419  1.00 147.48 ? 64  TYR C CA   1 
ATOM   2796 C  C    . TYR C 1 64  ? 67.049 63.423 24.578  1.00 151.73 ? 64  TYR C C    1 
ATOM   2797 O  O    . TYR C 1 64  ? 66.199 63.017 23.780  1.00 151.56 ? 64  TYR C O    1 
ATOM   2798 C  CB   . TYR C 1 64  ? 67.478 62.486 26.894  1.00 146.33 ? 64  TYR C CB   1 
ATOM   2799 C  CG   . TYR C 1 64  ? 66.170 61.784 27.183  1.00 143.06 ? 64  TYR C CG   1 
ATOM   2800 C  CD1  . TYR C 1 64  ? 65.655 60.840 26.298  1.00 144.03 ? 64  TYR C CD1  1 
ATOM   2801 C  CD2  . TYR C 1 64  ? 65.433 62.080 28.324  1.00 142.35 ? 64  TYR C CD2  1 
ATOM   2802 C  CE1  . TYR C 1 64  ? 64.437 60.205 26.544  1.00 143.60 ? 64  TYR C CE1  1 
ATOM   2803 C  CE2  . TYR C 1 64  ? 64.214 61.445 28.582  1.00 142.57 ? 64  TYR C CE2  1 
ATOM   2804 C  CZ   . TYR C 1 64  ? 63.719 60.513 27.687  1.00 148.39 ? 64  TYR C CZ   1 
ATOM   2805 O  OH   . TYR C 1 64  ? 62.513 59.890 27.937  1.00 148.46 ? 64  TYR C OH   1 
ATOM   2806 N  N    . PRO C 1 65  ? 67.284 64.734 24.753  1.00 148.88 ? 65  PRO C N    1 
ATOM   2807 C  CA   . PRO C 1 65  ? 66.546 65.770 24.022  1.00 146.73 ? 65  PRO C CA   1 
ATOM   2808 C  C    . PRO C 1 65  ? 66.630 65.610 22.501  1.00 144.61 ? 65  PRO C C    1 
ATOM   2809 O  O    . PRO C 1 65  ? 65.613 65.453 21.825  1.00 142.29 ? 65  PRO C O    1 
ATOM   2810 C  CB   . PRO C 1 65  ? 67.262 67.055 24.448  1.00 149.32 ? 65  PRO C CB   1 
ATOM   2811 C  CG   . PRO C 1 65  ? 68.668 66.623 24.689  1.00 155.60 ? 65  PRO C CG   1 
ATOM   2812 C  CD   . PRO C 1 65  ? 68.549 65.252 25.309  1.00 150.90 ? 65  PRO C CD   1 
ATOM   2813 N  N    . THR C 1 66  ? 67.853 65.679 21.980  1.00 140.26 ? 66  THR C N    1 
ATOM   2814 C  CA   . THR C 1 66  ? 68.129 65.584 20.546  1.00 140.79 ? 66  THR C CA   1 
ATOM   2815 C  C    . THR C 1 66  ? 67.654 64.278 19.912  1.00 145.08 ? 66  THR C C    1 
ATOM   2816 O  O    . THR C 1 66  ? 67.609 64.148 18.688  1.00 144.95 ? 66  THR C O    1 
ATOM   2817 C  CB   . THR C 1 66  ? 69.623 65.815 20.270  1.00 151.25 ? 66  THR C CB   1 
ATOM   2818 O  OG1  . THR C 1 66  ? 70.342 65.787 21.510  1.00 151.34 ? 66  THR C OG1  1 
ATOM   2819 C  CG2  . THR C 1 66  ? 69.841 67.166 19.588  1.00 150.36 ? 66  THR C CG2  1 
ATOM   2820 N  N    . PHE C 1 67  ? 67.317 63.306 20.749  1.00 138.69 ? 67  PHE C N    1 
ATOM   2821 C  CA   . PHE C 1 67  ? 66.832 62.020 20.264  1.00 137.20 ? 67  PHE C CA   1 
ATOM   2822 C  C    . PHE C 1 67  ? 65.321 62.067 20.287  1.00 145.35 ? 67  PHE C C    1 
ATOM   2823 O  O    . PHE C 1 67  ? 64.667 61.748 19.294  1.00 145.62 ? 67  PHE C O    1 
ATOM   2824 C  CB   . PHE C 1 67  ? 67.325 60.889 21.163  1.00 136.00 ? 67  PHE C CB   1 
ATOM   2825 C  CG   . PHE C 1 67  ? 66.302 59.810 21.405  1.00 132.98 ? 67  PHE C CG   1 
ATOM   2826 C  CD1  . PHE C 1 67  ? 66.105 58.796 20.465  1.00 132.19 ? 67  PHE C CD1  1 
ATOM   2827 C  CD2  . PHE C 1 67  ? 65.569 59.783 22.588  1.00 131.16 ? 67  PHE C CD2  1 
ATOM   2828 C  CE1  . PHE C 1 67  ? 65.191 57.774 20.701  1.00 131.28 ? 67  PHE C CE1  1 
ATOM   2829 C  CE2  . PHE C 1 67  ? 64.645 58.776 22.829  1.00 131.91 ? 67  PHE C CE2  1 
ATOM   2830 C  CZ   . PHE C 1 67  ? 64.455 57.767 21.885  1.00 129.39 ? 67  PHE C CZ   1 
ATOM   2831 N  N    . LEU C 1 68  ? 64.784 62.483 21.432  1.00 137.11 ? 68  LEU C N    1 
ATOM   2832 C  CA   . LEU C 1 68  ? 63.349 62.628 21.613  1.00 135.23 ? 68  LEU C CA   1 
ATOM   2833 C  C    . LEU C 1 68  ? 62.816 63.433 20.447  1.00 144.27 ? 68  LEU C C    1 
ATOM   2834 O  O    . LEU C 1 68  ? 61.725 63.173 19.944  1.00 145.75 ? 68  LEU C O    1 
ATOM   2835 C  CB   . LEU C 1 68  ? 63.067 63.381 22.910  1.00 131.63 ? 68  LEU C CB   1 
ATOM   2836 C  CG   . LEU C 1 68  ? 62.182 62.601 23.869  1.00 128.58 ? 68  LEU C CG   1 
ATOM   2837 C  CD1  . LEU C 1 68  ? 61.872 61.245 23.269  1.00 126.14 ? 68  LEU C CD1  1 
ATOM   2838 C  CD2  . LEU C 1 68  ? 62.879 62.443 25.198  1.00 128.44 ? 68  LEU C CD2  1 
ATOM   2839 N  N    . ALA C 1 69  ? 63.620 64.397 20.011  1.00 140.33 ? 69  ALA C N    1 
ATOM   2840 C  CA   . ALA C 1 69  ? 63.270 65.249 18.887  1.00 138.94 ? 69  ALA C CA   1 
ATOM   2841 C  C    . ALA C 1 69  ? 62.866 64.377 17.709  1.00 141.80 ? 69  ALA C C    1 
ATOM   2842 O  O    . ALA C 1 69  ? 61.674 64.204 17.438  1.00 140.80 ? 69  ALA C O    1 
ATOM   2843 C  CB   . ALA C 1 69  ? 64.446 66.141 18.511  1.00 139.54 ? 69  ALA C CB   1 
ATOM   2844 N  N    . VAL C 1 70  ? 63.854 63.794 17.034  1.00 137.25 ? 70  VAL C N    1 
ATOM   2845 C  CA   . VAL C 1 70  ? 63.582 62.947 15.873  1.00 137.70 ? 70  VAL C CA   1 
ATOM   2846 C  C    . VAL C 1 70  ? 62.721 61.706 16.141  1.00 141.22 ? 70  VAL C C    1 
ATOM   2847 O  O    . VAL C 1 70  ? 62.213 61.088 15.204  1.00 140.48 ? 70  VAL C O    1 
ATOM   2848 C  CB   . VAL C 1 70  ? 64.853 62.604 15.106  1.00 142.43 ? 70  VAL C CB   1 
ATOM   2849 C  CG1  . VAL C 1 70  ? 65.757 63.835 15.008  1.00 142.36 ? 70  VAL C CG1  1 
ATOM   2850 C  CG2  . VAL C 1 70  ? 65.555 61.433 15.776  1.00 142.37 ? 70  VAL C CG2  1 
ATOM   2851 N  N    . LEU C 1 71  ? 62.553 61.340 17.408  1.00 137.56 ? 71  LEU C N    1 
ATOM   2852 C  CA   . LEU C 1 71  ? 61.726 60.185 17.743  1.00 137.26 ? 71  LEU C CA   1 
ATOM   2853 C  C    . LEU C 1 71  ? 60.280 60.499 17.428  1.00 139.32 ? 71  LEU C C    1 
ATOM   2854 O  O    . LEU C 1 71  ? 59.533 59.638 16.980  1.00 139.11 ? 71  LEU C O    1 
ATOM   2855 C  CB   . LEU C 1 71  ? 61.846 59.816 19.223  1.00 137.20 ? 71  LEU C CB   1 
ATOM   2856 C  CG   . LEU C 1 71  ? 61.370 58.421 19.654  1.00 141.10 ? 71  LEU C CG   1 
ATOM   2857 C  CD1  . LEU C 1 71  ? 60.187 58.502 20.597  1.00 140.97 ? 71  LEU C CD1  1 
ATOM   2858 C  CD2  . LEU C 1 71  ? 61.058 57.533 18.469  1.00 143.26 ? 71  LEU C CD2  1 
ATOM   2859 N  N    . TRP C 1 72  ? 59.880 61.738 17.676  1.00 137.48 ? 72  TRP C N    1 
ATOM   2860 C  CA   . TRP C 1 72  ? 58.508 62.134 17.435  1.00 137.43 ? 72  TRP C CA   1 
ATOM   2861 C  C    . TRP C 1 72  ? 58.318 62.762 16.087  1.00 139.66 ? 72  TRP C C    1 
ATOM   2862 O  O    . TRP C 1 72  ? 57.439 62.357 15.344  1.00 138.24 ? 72  TRP C O    1 
ATOM   2863 C  CB   . TRP C 1 72  ? 57.979 62.984 18.580  1.00 137.84 ? 72  TRP C CB   1 
ATOM   2864 C  CG   . TRP C 1 72  ? 57.949 62.166 19.833  1.00 140.56 ? 72  TRP C CG   1 
ATOM   2865 C  CD1  . TRP C 1 72  ? 58.981 61.412 20.329  1.00 143.82 ? 72  TRP C CD1  1 
ATOM   2866 C  CD2  . TRP C 1 72  ? 56.792 61.814 20.611  1.00 140.61 ? 72  TRP C CD2  1 
ATOM   2867 N  NE1  . TRP C 1 72  ? 58.558 60.678 21.412  1.00 143.17 ? 72  TRP C NE1  1 
ATOM   2868 C  CE2  . TRP C 1 72  ? 57.219 60.904 21.607  1.00 144.28 ? 72  TRP C CE2  1 
ATOM   2869 C  CE3  . TRP C 1 72  ? 55.448 62.207 20.590  1.00 141.64 ? 72  TRP C CE3  1 
ATOM   2870 C  CZ2  . TRP C 1 72  ? 56.349 60.384 22.573  1.00 143.21 ? 72  TRP C CZ2  1 
ATOM   2871 C  CZ3  . TRP C 1 72  ? 54.585 61.687 21.553  1.00 142.62 ? 72  TRP C CZ3  1 
ATOM   2872 C  CH2  . TRP C 1 72  ? 55.040 60.782 22.526  1.00 143.11 ? 72  TRP C CH2  1 
ATOM   2873 N  N    . SER C 1 73  ? 59.204 63.678 15.727  1.00 135.66 ? 73  SER C N    1 
ATOM   2874 C  CA   . SER C 1 73  ? 59.130 64.298 14.413  1.00 136.36 ? 73  SER C CA   1 
ATOM   2875 C  C    . SER C 1 73  ? 59.102 63.221 13.320  1.00 140.25 ? 73  SER C C    1 
ATOM   2876 O  O    . SER C 1 73  ? 58.399 63.344 12.315  1.00 139.37 ? 73  SER C O    1 
ATOM   2877 C  CB   . SER C 1 73  ? 60.255 65.325 14.210  1.00 140.97 ? 73  SER C CB   1 
ATOM   2878 O  OG   . SER C 1 73  ? 61.455 64.720 13.769  1.00 150.72 ? 73  SER C OG   1 
ATOM   2879 N  N    . ALA C 1 74  ? 59.786 62.115 13.571  1.00 137.13 ? 74  ALA C N    1 
ATOM   2880 C  CA   . ALA C 1 74  ? 59.770 61.017 12.625  1.00 137.39 ? 74  ALA C CA   1 
ATOM   2881 C  C    . ALA C 1 74  ? 58.644 60.068 12.997  1.00 138.57 ? 74  ALA C C    1 
ATOM   2882 O  O    . ALA C 1 74  ? 58.455 59.045 12.347  1.00 137.24 ? 74  ALA C O    1 
ATOM   2883 C  CB   . ALA C 1 74  ? 61.086 60.297 12.636  1.00 138.53 ? 74  ALA C CB   1 
ATOM   2884 N  N    . GLY C 1 75  ? 57.908 60.405 14.054  1.00 136.15 ? 75  GLY C N    1 
ATOM   2885 C  CA   . GLY C 1 75  ? 56.800 59.592 14.531  1.00 136.56 ? 75  GLY C CA   1 
ATOM   2886 C  C    . GLY C 1 75  ? 55.458 60.123 14.055  1.00 142.35 ? 75  GLY C C    1 
ATOM   2887 O  O    . GLY C 1 75  ? 54.503 59.363 13.849  1.00 141.83 ? 75  GLY C O    1 
ATOM   2888 N  N    . LEU C 1 76  ? 55.382 61.440 13.881  1.00 140.49 ? 76  LEU C N    1 
ATOM   2889 C  CA   . LEU C 1 76  ? 54.165 62.081 13.403  1.00 140.04 ? 76  LEU C CA   1 
ATOM   2890 C  C    . LEU C 1 76  ? 54.335 62.389 11.934  1.00 144.59 ? 76  LEU C C    1 
ATOM   2891 O  O    . LEU C 1 76  ? 53.523 61.996 11.102  1.00 144.74 ? 76  LEU C O    1 
ATOM   2892 C  CB   . LEU C 1 76  ? 53.904 63.372 14.176  1.00 138.79 ? 76  LEU C CB   1 
ATOM   2893 C  CG   . LEU C 1 76  ? 53.808 63.229 15.699  1.00 140.03 ? 76  LEU C CG   1 
ATOM   2894 C  CD1  . LEU C 1 76  ? 53.329 61.832 16.104  1.00 138.98 ? 76  LEU C CD1  1 
ATOM   2895 C  CD2  . LEU C 1 76  ? 55.151 63.546 16.343  1.00 141.28 ? 76  LEU C CD2  1 
ATOM   2896 N  N    . LEU C 1 77  ? 55.436 63.050 11.620  1.00 145.40 ? 77  LEU C N    1 
ATOM   2897 C  CA   . LEU C 1 77  ? 55.729 63.413 10.251  1.00 144.85 ? 77  LEU C CA   1 
ATOM   2898 C  C    . LEU C 1 77  ? 56.003 62.211 9.348   1.00 150.92 ? 77  LEU C C    1 
ATOM   2899 O  O    . LEU C 1 77  ? 56.394 62.373 8.190   1.00 150.21 ? 77  LEU C O    1 
ATOM   2900 C  CB   . LEU C 1 77  ? 56.871 64.416 10.211  1.00 144.76 ? 77  LEU C CB   1 
ATOM   2901 C  CG   . LEU C 1 77  ? 56.414 65.819 10.611  1.00 149.99 ? 77  LEU C CG   1 
ATOM   2902 C  CD1  . LEU C 1 77  ? 55.203 65.782 11.549  1.00 150.39 ? 77  LEU C CD1  1 
ATOM   2903 C  CD2  . LEU C 1 77  ? 57.564 66.597 11.223  1.00 152.70 ? 77  LEU C CD2  1 
ATOM   2904 N  N    . CYS C 1 78  ? 55.749 61.016 9.872   1.00 150.14 ? 78  CYS C N    1 
ATOM   2905 C  CA   . CYS C 1 78  ? 55.943 59.779 9.124   1.00 151.80 ? 78  CYS C CA   1 
ATOM   2906 C  C    . CYS C 1 78  ? 55.959 58.531 10.018  1.00 158.55 ? 78  CYS C C    1 
ATOM   2907 O  O    . CYS C 1 78  ? 56.671 58.472 11.027  1.00 158.72 ? 78  CYS C O    1 
ATOM   2908 C  CB   . CYS C 1 78  ? 57.207 59.843 8.264   1.00 152.56 ? 78  CYS C CB   1 
ATOM   2909 S  SG   . CYS C 1 78  ? 58.063 58.279 8.082   1.00 156.55 ? 78  CYS C SG   1 
ATOM   2910 N  N    . SER C 1 79  ? 55.170 57.535 9.619   1.00 154.87 ? 79  SER C N    1 
ATOM   2911 C  CA   . SER C 1 79  ? 55.033 56.256 10.328  1.00 154.69 ? 79  SER C CA   1 
ATOM   2912 C  C    . SER C 1 79  ? 55.317 56.207 11.821  1.00 158.43 ? 79  SER C C    1 
ATOM   2913 O  O    . SER C 1 79  ? 56.470 56.307 12.245  1.00 156.72 ? 79  SER C O    1 
ATOM   2914 C  CB   . SER C 1 79  ? 55.793 55.134 9.626   1.00 158.81 ? 79  SER C CB   1 
ATOM   2915 O  OG   . SER C 1 79  ? 55.226 53.880 9.973   1.00 168.16 ? 79  SER C OG   1 
ATOM   2916 N  N    . GLN C 1 80  ? 54.267 55.979 12.604  1.00 153.65 ? 80  GLN C N    1 
ATOM   2917 C  CA   . GLN C 1 80  ? 54.401 55.876 14.050  1.00 154.14 ? 80  GLN C CA   1 
ATOM   2918 C  C    . GLN C 1 80  ? 55.009 54.531 14.456  1.00 155.48 ? 80  GLN C C    1 
ATOM   2919 O  O    . GLN C 1 80  ? 55.326 54.308 15.622  1.00 155.37 ? 80  GLN C O    1 
ATOM   2920 C  CB   . GLN C 1 80  ? 53.044 56.069 14.734  1.00 155.51 ? 80  GLN C CB   1 
ATOM   2921 C  CG   . GLN C 1 80  ? 53.120 56.018 16.255  1.00 159.94 ? 80  GLN C CG   1 
ATOM   2922 C  CD   . GLN C 1 80  ? 51.929 55.334 16.882  1.00 168.46 ? 80  GLN C CD   1 
ATOM   2923 O  OE1  . GLN C 1 80  ? 50.919 55.106 16.224  1.00 162.38 ? 80  GLN C OE1  1 
ATOM   2924 N  NE2  . GLN C 1 80  ? 52.035 55.014 18.168  1.00 159.04 ? 80  GLN C NE2  1 
ATOM   2925 N  N    . VAL C 1 81  ? 55.191 53.647 13.484  1.00 151.50 ? 81  VAL C N    1 
ATOM   2926 C  CA   . VAL C 1 81  ? 55.746 52.337 13.751  1.00 148.07 ? 81  VAL C CA   1 
ATOM   2927 C  C    . VAL C 1 81  ? 57.264 52.250 13.694  1.00 155.26 ? 81  VAL C C    1 
ATOM   2928 O  O    . VAL C 1 81  ? 57.912 51.907 14.682  1.00 155.77 ? 81  VAL C O    1 
ATOM   2929 C  CB   . VAL C 1 81  ? 55.110 51.322 12.863  1.00 145.83 ? 81  VAL C CB   1 
ATOM   2930 C  CG1  . VAL C 1 81  ? 56.154 50.382 12.307  1.00 144.60 ? 81  VAL C CG1  1 
ATOM   2931 C  CG2  . VAL C 1 81  ? 54.084 50.588 13.646  1.00 144.61 ? 81  VAL C CG2  1 
ATOM   2932 N  N    . PRO C 1 82  ? 57.854 52.527 12.524  1.00 153.75 ? 82  PRO C N    1 
ATOM   2933 C  CA   . PRO C 1 82  ? 59.310 52.443 12.434  1.00 153.00 ? 82  PRO C CA   1 
ATOM   2934 C  C    . PRO C 1 82  ? 59.925 53.439 13.409  1.00 157.41 ? 82  PRO C C    1 
ATOM   2935 O  O    . PRO C 1 82  ? 60.897 53.136 14.106  1.00 156.70 ? 82  PRO C O    1 
ATOM   2936 C  CB   . PRO C 1 82  ? 59.574 52.903 11.008  1.00 154.40 ? 82  PRO C CB   1 
ATOM   2937 C  CG   . PRO C 1 82  ? 58.482 53.927 10.751  1.00 158.72 ? 82  PRO C CG   1 
ATOM   2938 C  CD   . PRO C 1 82  ? 57.339 53.636 11.708  1.00 154.04 ? 82  PRO C CD   1 
ATOM   2939 N  N    . ALA C 1 83  ? 59.332 54.628 13.451  1.00 157.51 ? 83  ALA C N    1 
ATOM   2940 C  CA   . ALA C 1 83  ? 59.774 55.694 14.339  1.00 157.85 ? 83  ALA C CA   1 
ATOM   2941 C  C    . ALA C 1 83  ? 59.885 55.141 15.746  1.00 155.44 ? 83  ALA C C    1 
ATOM   2942 O  O    . ALA C 1 83  ? 60.905 55.305 16.413  1.00 153.14 ? 83  ALA C O    1 
ATOM   2943 C  CB   . ALA C 1 83  ? 58.770 56.850 14.313  1.00 159.44 ? 83  ALA C CB   1 
ATOM   2944 N  N    . ALA C 1 84  ? 58.826 54.475 16.188  1.00 151.82 ? 84  ALA C N    1 
ATOM   2945 C  CA   . ALA C 1 84  ? 58.799 53.917 17.525  1.00 152.05 ? 84  ALA C CA   1 
ATOM   2946 C  C    . ALA C 1 84  ? 59.740 52.737 17.709  1.00 160.30 ? 84  ALA C C    1 
ATOM   2947 O  O    . ALA C 1 84  ? 60.262 52.530 18.801  1.00 160.03 ? 84  ALA C O    1 
ATOM   2948 C  CB   . ALA C 1 84  ? 57.396 53.563 17.935  1.00 152.41 ? 84  ALA C CB   1 
ATOM   2949 N  N    . PHE C 1 85  ? 59.977 51.960 16.663  1.00 154.07 ? 85  PHE C N    1 
ATOM   2950 C  CA   . PHE C 1 85  ? 60.895 50.857 16.847  1.00 155.66 ? 85  PHE C CA   1 
ATOM   2951 C  C    . PHE C 1 85  ? 62.315 51.382 16.906  1.00 153.65 ? 85  PHE C C    1 
ATOM   2952 O  O    . PHE C 1 85  ? 63.068 51.069 17.827  1.00 153.43 ? 85  PHE C O    1 
ATOM   2953 C  CB   . PHE C 1 85  ? 60.777 49.809 15.759  1.00 160.29 ? 85  PHE C CB   1 
ATOM   2954 C  CG   . PHE C 1 85  ? 61.950 48.871 15.719  1.00 165.28 ? 85  PHE C CG   1 
ATOM   2955 C  CD1  . PHE C 1 85  ? 63.120 49.226 15.056  1.00 170.95 ? 85  PHE C CD1  1 
ATOM   2956 C  CD2  . PHE C 1 85  ? 61.914 47.665 16.405  1.00 170.10 ? 85  PHE C CD2  1 
ATOM   2957 C  CE1  . PHE C 1 85  ? 64.219 48.376 15.041  1.00 173.00 ? 85  PHE C CE1  1 
ATOM   2958 C  CE2  . PHE C 1 85  ? 63.010 46.808 16.398  1.00 174.21 ? 85  PHE C CE2  1 
ATOM   2959 C  CZ   . PHE C 1 85  ? 64.164 47.162 15.709  1.00 172.65 ? 85  PHE C CZ   1 
ATOM   2960 N  N    . ALA C 1 86  ? 62.682 52.158 15.898  1.00 150.17 ? 86  ALA C N    1 
ATOM   2961 C  CA   . ALA C 1 86  ? 64.011 52.744 15.827  1.00 148.27 ? 86  ALA C CA   1 
ATOM   2962 C  C    . ALA C 1 86  ? 64.371 53.377 17.168  1.00 156.88 ? 86  ALA C C    1 
ATOM   2963 O  O    . ALA C 1 86  ? 65.483 53.215 17.673  1.00 158.00 ? 86  ALA C O    1 
ATOM   2964 C  CB   . ALA C 1 86  ? 64.041 53.793 14.736  1.00 148.13 ? 86  ALA C CB   1 
ATOM   2965 N  N    . GLY C 1 87  ? 63.404 54.088 17.740  1.00 153.60 ? 87  GLY C N    1 
ATOM   2966 C  CA   . GLY C 1 87  ? 63.561 54.745 19.023  1.00 153.45 ? 87  GLY C CA   1 
ATOM   2967 C  C    . GLY C 1 87  ? 63.762 53.714 20.112  1.00 158.41 ? 87  GLY C C    1 
ATOM   2968 O  O    . GLY C 1 87  ? 64.351 53.998 21.150  1.00 157.93 ? 87  GLY C O    1 
ATOM   2969 N  N    . LEU C 1 88  ? 63.282 52.504 19.859  1.00 154.30 ? 88  LEU C N    1 
ATOM   2970 C  CA   . LEU C 1 88  ? 63.408 51.416 20.807  1.00 151.72 ? 88  LEU C CA   1 
ATOM   2971 C  C    . LEU C 1 88  ? 64.846 50.900 20.806  1.00 155.68 ? 88  LEU C C    1 
ATOM   2972 O  O    . LEU C 1 88  ? 65.434 50.662 21.851  1.00 155.09 ? 88  LEU C O    1 
ATOM   2973 C  CB   . LEU C 1 88  ? 62.424 50.319 20.432  1.00 148.53 ? 88  LEU C CB   1 
ATOM   2974 C  CG   . LEU C 1 88  ? 62.537 48.994 21.166  1.00 145.41 ? 88  LEU C CG   1 
ATOM   2975 C  CD1  . LEU C 1 88  ? 63.634 48.116 20.552  1.00 142.89 ? 88  LEU C CD1  1 
ATOM   2976 C  CD2  . LEU C 1 88  ? 62.774 49.261 22.639  1.00 145.19 ? 88  LEU C CD2  1 
ATOM   2977 N  N    . MET C 1 89  ? 65.433 50.788 19.628  1.00 154.91 ? 89  MET C N    1 
ATOM   2978 C  CA   . MET C 1 89  ? 66.809 50.342 19.511  1.00 154.91 ? 89  MET C CA   1 
ATOM   2979 C  C    . MET C 1 89  ? 67.696 51.311 20.233  1.00 154.91 ? 89  MET C C    1 
ATOM   2980 O  O    . MET C 1 89  ? 68.660 50.935 20.899  1.00 222.57 ? 89  MET C O    1 
ATOM   2981 C  CB   . MET C 1 89  ? 67.185 50.366 18.049  1.00 154.91 ? 89  MET C CB   1 
ATOM   2982 C  CG   . MET C 1 89  ? 66.161 49.657 17.245  1.00 154.91 ? 89  MET C CG   1 
ATOM   2983 S  SD   . MET C 1 89  ? 65.760 48.241 18.251  1.00 154.91 ? 89  MET C SD   1 
ATOM   2984 C  CE   . MET C 1 89  ? 67.366 47.431 18.230  1.00 154.91 ? 89  MET C CE   1 
ATOM   2985 N  N    . TYR C 1 90  ? 67.370 52.580 20.050  1.00 150.63 ? 90  TYR C N    1 
ATOM   2986 C  CA   . TYR C 1 90  ? 68.127 53.652 20.654  1.00 151.31 ? 90  TYR C CA   1 
ATOM   2987 C  C    . TYR C 1 90  ? 68.225 53.421 22.143  1.00 161.64 ? 90  TYR C C    1 
ATOM   2988 O  O    . TYR C 1 90  ? 69.221 53.767 22.766  1.00 162.17 ? 90  TYR C O    1 
ATOM   2989 C  CB   . TYR C 1 90  ? 67.461 54.995 20.390  1.00 149.81 ? 90  TYR C CB   1 
ATOM   2990 C  CG   . TYR C 1 90  ? 68.282 56.147 20.888  1.00 146.02 ? 90  TYR C CG   1 
ATOM   2991 C  CD1  . TYR C 1 90  ? 69.316 56.671 20.117  1.00 146.87 ? 90  TYR C CD1  1 
ATOM   2992 C  CD2  . TYR C 1 90  ? 68.086 56.658 22.161  1.00 145.07 ? 90  TYR C CD2  1 
ATOM   2993 C  CE1  . TYR C 1 90  ? 70.094 57.729 20.577  1.00 146.16 ? 90  TYR C CE1  1 
ATOM   2994 C  CE2  . TYR C 1 90  ? 68.853 57.716 22.637  1.00 145.13 ? 90  TYR C CE2  1 
ATOM   2995 C  CZ   . TYR C 1 90  ? 69.854 58.253 21.842  1.00 150.49 ? 90  TYR C CZ   1 
ATOM   2996 O  OH   . TYR C 1 90  ? 70.604 59.313 22.318  1.00 150.29 ? 90  TYR C OH   1 
ATOM   2997 N  N    . LEU C 1 91  ? 67.185 52.836 22.720  1.00 158.15 ? 91  LEU C N    1 
ATOM   2998 C  CA   . LEU C 1 91  ? 67.202 52.569 24.150  1.00 157.49 ? 91  LEU C CA   1 
ATOM   2999 C  C    . LEU C 1 91  ? 68.062 51.350 24.448  1.00 162.44 ? 91  LEU C C    1 
ATOM   3000 O  O    . LEU C 1 91  ? 68.467 51.124 25.589  1.00 161.79 ? 91  LEU C O    1 
ATOM   3001 C  CB   . LEU C 1 91  ? 65.787 52.434 24.714  1.00 156.27 ? 91  LEU C CB   1 
ATOM   3002 C  CG   . LEU C 1 91  ? 65.184 53.769 25.169  1.00 157.88 ? 91  LEU C CG   1 
ATOM   3003 C  CD1  . LEU C 1 91  ? 65.750 54.926 24.351  1.00 156.97 ? 91  LEU C CD1  1 
ATOM   3004 C  CD2  . LEU C 1 91  ? 63.672 53.743 25.087  1.00 159.27 ? 91  LEU C CD2  1 
ATOM   3005 N  N    . PHE C 1 92  ? 68.386 50.601 23.396  1.00 163.54 ? 92  PHE C N    1 
ATOM   3006 C  CA   . PHE C 1 92  ? 69.254 49.443 23.533  1.00 165.89 ? 92  PHE C CA   1 
ATOM   3007 C  C    . PHE C 1 92  ? 70.693 49.880 23.412  1.00 157.27 ? 92  PHE C C    1 
ATOM   3008 O  O    . PHE C 1 92  ? 71.545 49.423 24.161  1.00 153.56 ? 92  PHE C O    1 
ATOM   3009 C  CB   . PHE C 1 92  ? 68.924 48.366 22.510  1.00 174.79 ? 92  PHE C CB   1 
ATOM   3010 C  CG   . PHE C 1 92  ? 67.769 47.509 22.913  1.00 186.22 ? 92  PHE C CG   1 
ATOM   3011 C  CD1  . PHE C 1 92  ? 67.056 47.802 24.065  1.00 196.69 ? 92  PHE C CD1  1 
ATOM   3012 C  CD2  . PHE C 1 92  ? 67.381 46.429 22.143  1.00 195.93 ? 92  PHE C CD2  1 
ATOM   3013 C  CE1  . PHE C 1 92  ? 65.979 47.036 24.443  1.00 200.66 ? 92  PHE C CE1  1 
ATOM   3014 C  CE2  . PHE C 1 92  ? 66.296 45.659 22.512  1.00 202.16 ? 92  PHE C CE2  1 
ATOM   3015 C  CZ   . PHE C 1 92  ? 65.596 45.962 23.665  1.00 201.16 ? 92  PHE C CZ   1 
ATOM   3016 N  N    . VAL C 1 93  ? 70.958 50.805 22.501  1.00 157.46 ? 93  VAL C N    1 
ATOM   3017 C  CA   . VAL C 1 93  ? 72.304 51.334 22.364  1.00 159.77 ? 93  VAL C CA   1 
ATOM   3018 C  C    . VAL C 1 93  ? 72.668 52.065 23.640  1.00 159.92 ? 93  VAL C C    1 
ATOM   3019 O  O    . VAL C 1 93  ? 73.801 51.958 24.119  1.00 158.09 ? 93  VAL C O    1 
ATOM   3020 C  CB   . VAL C 1 93  ? 72.402 52.306 21.209  1.00 169.31 ? 93  VAL C CB   1 
ATOM   3021 C  CG1  . VAL C 1 93  ? 73.841 52.387 20.715  1.00 170.06 ? 93  VAL C CG1  1 
ATOM   3022 C  CG2  . VAL C 1 93  ? 71.422 51.925 20.116  1.00 170.07 ? 93  VAL C CG2  1 
ATOM   3023 N  N    . ARG C 1 94  ? 71.709 52.843 24.153  1.00 159.35 ? 94  ARG C N    1 
ATOM   3024 C  CA   . ARG C 1 94  ? 71.887 53.630 25.376  1.00 160.83 ? 94  ARG C CA   1 
ATOM   3025 C  C    . ARG C 1 94  ? 72.250 52.713 26.523  1.00 169.66 ? 94  ARG C C    1 
ATOM   3026 O  O    . ARG C 1 94  ? 73.075 53.050 27.370  1.00 169.57 ? 94  ARG C O    1 
ATOM   3027 C  CB   . ARG C 1 94  ? 70.616 54.392 25.735  1.00 160.71 ? 94  ARG C CB   1 
ATOM   3028 C  CG   . ARG C 1 94  ? 70.563 55.772 25.146  1.00 168.03 ? 94  ARG C CG   1 
ATOM   3029 C  CD   . ARG C 1 94  ? 70.674 56.848 26.201  1.00 170.86 ? 94  ARG C CD   1 
ATOM   3030 N  NE   . ARG C 1 94  ? 69.407 57.043 26.906  1.00 170.89 ? 94  ARG C NE   1 
ATOM   3031 C  CZ   . ARG C 1 94  ? 68.630 58.118 26.791  1.00 178.94 ? 94  ARG C CZ   1 
ATOM   3032 N  NH1  . ARG C 1 94  ? 68.979 59.123 25.994  1.00 164.84 ? 94  ARG C NH1  1 
ATOM   3033 N  NH2  . ARG C 1 94  ? 67.498 58.185 27.482  1.00 164.25 ? 94  ARG C NH2  1 
ATOM   3034 N  N    . GLN C 1 95  ? 71.618 51.547 26.554  1.00 167.79 ? 95  GLN C N    1 
ATOM   3035 C  CA   . GLN C 1 95  ? 71.917 50.565 27.580  1.00 169.72 ? 95  GLN C CA   1 
ATOM   3036 C  C    . GLN C 1 95  ? 73.349 50.062 27.435  1.00 176.54 ? 95  GLN C C    1 
ATOM   3037 O  O    . GLN C 1 95  ? 74.136 50.107 28.379  1.00 175.89 ? 95  GLN C O    1 
ATOM   3038 C  CB   . GLN C 1 95  ? 70.957 49.383 27.481  1.00 171.62 ? 95  GLN C CB   1 
ATOM   3039 C  CG   . GLN C 1 95  ? 70.427 49.011 28.814  1.00 189.30 ? 95  GLN C CG   1 
ATOM   3040 C  CD   . GLN C 1 95  ? 70.737 50.095 29.806  1.00 209.94 ? 95  GLN C CD   1 
ATOM   3041 O  OE1  . GLN C 1 95  ? 69.947 51.022 29.981  1.00 205.66 ? 95  GLN C OE1  1 
ATOM   3042 N  NE2  . GLN C 1 95  ? 71.959 50.084 30.326  1.00 202.31 ? 95  GLN C NE2  1 
ATOM   3043 N  N    . LYS C 1 96  ? 73.673 49.591 26.235  1.00 171.92 ? 96  LYS C N    1 
ATOM   3044 C  CA   . LYS C 1 96  ? 74.983 49.030 25.946  1.00 173.45 ? 96  LYS C CA   1 
ATOM   3045 C  C    . LYS C 1 96  ? 76.114 50.034 25.936  1.00 178.37 ? 96  LYS C C    1 
ATOM   3046 O  O    . LYS C 1 96  ? 77.272 49.656 26.043  1.00 177.55 ? 96  LYS C O    1 
ATOM   3047 C  CB   . LYS C 1 96  ? 74.968 48.202 24.665  1.00 177.51 ? 96  LYS C CB   1 
ATOM   3048 C  CG   . LYS C 1 96  ? 74.621 46.737 24.895  1.00 200.42 ? 96  LYS C CG   1 
ATOM   3049 C  CD   . LYS C 1 96  ? 73.131 46.561 25.191  1.00 214.36 ? 96  LYS C CD   1 
ATOM   3050 C  CE   . LYS C 1 96  ? 72.871 46.188 26.648  1.00 227.70 ? 96  LYS C CE   1 
ATOM   3051 N  NZ   . LYS C 1 96  ? 71.415 46.158 26.977  1.00 237.54 ? 96  LYS C NZ   1 
ATOM   3052 N  N    . TYR C 1 97  ? 75.793 51.313 25.822  1.00 178.91 ? 97  TYR C N    1 
ATOM   3053 C  CA   . TYR C 1 97  ? 76.840 52.319 25.858  1.00 178.24 ? 97  TYR C CA   1 
ATOM   3054 C  C    . TYR C 1 97  ? 77.035 52.768 27.302  1.00 184.40 ? 97  TYR C C    1 
ATOM   3055 O  O    . TYR C 1 97  ? 78.160 52.861 27.784  1.00 183.82 ? 97  TYR C O    1 
ATOM   3056 C  CB   . TYR C 1 97  ? 76.514 53.498 24.942  1.00 176.46 ? 97  TYR C CB   1 
ATOM   3057 C  CG   . TYR C 1 97  ? 77.117 54.824 25.382  1.00 172.41 ? 97  TYR C CG   1 
ATOM   3058 C  CD1  . TYR C 1 97  ? 78.314 55.284 24.840  1.00 173.24 ? 97  TYR C CD1  1 
ATOM   3059 C  CD2  . TYR C 1 97  ? 76.457 55.643 26.297  1.00 171.39 ? 97  TYR C CD2  1 
ATOM   3060 C  CE1  . TYR C 1 97  ? 78.853 56.509 25.221  1.00 172.40 ? 97  TYR C CE1  1 
ATOM   3061 C  CE2  . TYR C 1 97  ? 76.987 56.867 26.684  1.00 171.40 ? 97  TYR C CE2  1 
ATOM   3062 C  CZ   . TYR C 1 97  ? 78.184 57.295 26.145  1.00 176.36 ? 97  TYR C CZ   1 
ATOM   3063 O  OH   . TYR C 1 97  ? 78.708 58.510 26.529  1.00 175.88 ? 97  TYR C OH   1 
ATOM   3064 N  N    . PHE C 1 98  ? 75.929 52.985 28.006  1.00 186.48 ? 98  PHE C N    1 
ATOM   3065 C  CA   . PHE C 1 98  ? 75.975 53.408 29.398  1.00 185.37 ? 98  PHE C CA   1 
ATOM   3066 C  C    . PHE C 1 98  ? 76.512 52.289 30.256  1.00 198.70 ? 98  PHE C C    1 
ATOM   3067 O  O    . PHE C 1 98  ? 76.854 52.494 31.418  1.00 199.56 ? 98  PHE C O    1 
ATOM   3068 C  CB   . PHE C 1 98  ? 74.579 53.766 29.886  1.00 182.19 ? 98  PHE C CB   1 
ATOM   3069 C  CG   . PHE C 1 98  ? 74.510 54.068 31.354  1.00 176.32 ? 98  PHE C CG   1 
ATOM   3070 C  CD1  . PHE C 1 98  ? 75.221 55.132 31.891  1.00 173.45 ? 98  PHE C CD1  1 
ATOM   3071 C  CD2  . PHE C 1 98  ? 73.715 53.303 32.196  1.00 172.23 ? 98  PHE C CD2  1 
ATOM   3072 C  CE1  . PHE C 1 98  ? 75.135 55.431 33.245  1.00 171.62 ? 98  PHE C CE1  1 
ATOM   3073 C  CE2  . PHE C 1 98  ? 73.629 53.587 33.555  1.00 171.97 ? 98  PHE C CE2  1 
ATOM   3074 C  CZ   . PHE C 1 98  ? 74.337 54.654 34.079  1.00 169.20 ? 98  PHE C CZ   1 
ATOM   3075 N  N    . VAL C 1 99  ? 76.553 51.091 29.688  1.00 203.88 ? 99  VAL C N    1 
ATOM   3076 C  CA   . VAL C 1 99  ? 77.063 49.948 30.427  1.00 209.17 ? 99  VAL C CA   1 
ATOM   3077 C  C    . VAL C 1 99  ? 78.563 49.766 30.250  1.00 199.50 ? 99  VAL C C    1 
ATOM   3078 O  O    . VAL C 1 99  ? 79.289 49.648 31.234  1.00 195.65 ? 99  VAL C O    1 
ATOM   3079 C  CB   . VAL C 1 99  ? 76.282 48.658 30.165  1.00 228.31 ? 99  VAL C CB   1 
ATOM   3080 C  CG1  . VAL C 1 99  ? 77.190 47.623 29.509  1.00 230.66 ? 99  VAL C CG1  1 
ATOM   3081 C  CG2  . VAL C 1 99  ? 75.715 48.117 31.476  1.00 230.67 ? 99  VAL C CG2  1 
ATOM   3082 N  N    . GLY C 1 100 ? 79.033 49.760 29.006  1.00 205.09 ? 100 GLY C N    1 
ATOM   3083 C  CA   . GLY C 1 100 ? 80.451 49.608 28.728  1.00 205.38 ? 100 GLY C CA   1 
ATOM   3084 C  C    . GLY C 1 100 ? 81.256 50.780 29.259  1.00 209.86 ? 100 GLY C C    1 
ATOM   3085 O  O    . GLY C 1 100 ? 82.465 50.690 29.470  1.00 208.91 ? 100 GLY C O    1 
ATOM   3086 N  N    . TYR C 1 101 ? 80.569 51.889 29.482  1.00 209.52 ? 101 TYR C N    1 
ATOM   3087 C  CA   . TYR C 1 101 ? 81.212 53.091 29.974  1.00 211.81 ? 101 TYR C CA   1 
ATOM   3088 C  C    . TYR C 1 101 ? 81.469 53.118 31.480  1.00 216.24 ? 101 TYR C C    1 
ATOM   3089 O  O    . TYR C 1 101 ? 80.805 53.856 32.202  1.00 215.29 ? 101 TYR C O    1 
ATOM   3090 C  CB   . TYR C 1 101 ? 80.406 54.322 29.560  1.00 216.33 ? 101 TYR C CB   1 
ATOM   3091 C  CG   . TYR C 1 101 ? 81.245 55.534 29.221  1.00 223.10 ? 101 TYR C CG   1 
ATOM   3092 C  CD1  . TYR C 1 101 ? 82.009 55.571 28.064  1.00 225.82 ? 101 TYR C CD1  1 
ATOM   3093 C  CD2  . TYR C 1 101 ? 81.242 56.658 30.039  1.00 224.72 ? 101 TYR C CD2  1 
ATOM   3094 C  CE1  . TYR C 1 101 ? 82.755 56.686 27.742  1.00 226.45 ? 101 TYR C CE1  1 
ATOM   3095 C  CE2  . TYR C 1 101 ? 81.989 57.769 29.725  1.00 225.63 ? 101 TYR C CE2  1 
ATOM   3096 C  CZ   . TYR C 1 101 ? 82.743 57.776 28.582  1.00 231.34 ? 101 TYR C CZ   1 
ATOM   3097 O  OH   . TYR C 1 101 ? 83.491 58.877 28.273  1.00 231.11 ? 101 TYR C OH   1 
ATOM   3098 N  N    . LEU C 1 102 ? 82.528 52.424 31.903  1.00 217.66 ? 102 LEU C N    1 
ATOM   3099 C  CA   . LEU C 1 102 ? 83.029 52.391 33.293  1.00 221.20 ? 102 LEU C CA   1 
ATOM   3100 C  C    . LEU C 1 102 ? 83.446 51.007 33.753  1.00 226.37 ? 102 LEU C C    1 
ATOM   3101 O  O    . LEU C 1 102 ? 84.515 50.834 34.352  1.00 225.81 ? 102 LEU C O    1 
ATOM   3102 C  CB   . LEU C 1 102 ? 82.099 53.050 34.322  1.00 224.31 ? 102 LEU C CB   1 
ATOM   3103 C  CG   . LEU C 1 102 ? 81.012 52.215 34.993  1.00 235.11 ? 102 LEU C CG   1 
ATOM   3104 C  CD1  . LEU C 1 102 ? 81.003 52.506 36.482  1.00 237.29 ? 102 LEU C CD1  1 
ATOM   3105 C  CD2  . LEU C 1 102 ? 79.659 52.518 34.375  1.00 239.59 ? 102 LEU C CD2  1 
ATOM   3106 N  N    . GLY C 1 103 ? 82.595 50.026 33.468  1.00 228.56 ? 103 GLY C N    1 
ATOM   3107 C  CA   . GLY C 1 103 ? 82.837 48.646 33.843  1.00 228.46 ? 103 GLY C CA   1 
ATOM   3108 C  C    . GLY C 1 103 ? 84.132 48.090 33.284  1.00 231.36 ? 103 GLY C C    1 
ATOM   3109 O  O    . GLY C 1 103 ? 84.984 47.596 34.031  1.00 230.19 ? 103 GLY C O    1 
ATOM   3110 N  N    . GLU C 1 104 ? 84.287 48.176 31.965  1.00 232.38 ? 104 GLU C N    1 
ATOM   3111 C  CA   . GLU C 1 104 ? 85.478 47.652 31.304  1.00 233.78 ? 104 GLU C CA   1 
ATOM   3112 C  C    . GLU C 1 104 ? 86.713 48.562 31.354  1.00 245.46 ? 104 GLU C C    1 
ATOM   3113 O  O    . GLU C 1 104 ? 87.839 48.068 31.497  1.00 246.40 ? 104 GLU C O    1 
ATOM   3114 C  CB   . GLU C 1 104 ? 85.170 47.253 29.854  1.00 234.61 ? 104 GLU C CB   1 
ATOM   3115 C  CG   . GLU C 1 104 ? 85.803 45.925 29.395  1.00 240.67 ? 104 GLU C CG   1 
ATOM   3116 C  CD   . GLU C 1 104 ? 86.967 45.454 30.271  1.00 249.72 ? 104 GLU C CD   1 
ATOM   3117 O  OE1  . GLU C 1 104 ? 88.136 45.647 29.869  1.00 240.67 ? 104 GLU C OE1  1 
ATOM   3118 O  OE2  . GLU C 1 104 ? 86.716 44.825 31.324  1.00 240.42 ? 104 GLU C OE2  1 
ATOM   3119 N  N    . ARG C 1 105 ? 86.504 49.877 31.247  1.00 243.77 ? 105 ARG C N    1 
ATOM   3120 C  CA   . ARG C 1 105 ? 87.609 50.840 31.212  1.00 244.68 ? 105 ARG C CA   1 
ATOM   3121 C  C    . ARG C 1 105 ? 88.672 50.341 30.227  1.00 250.07 ? 105 ARG C C    1 
ATOM   3122 O  O    . ARG C 1 105 ? 89.877 50.463 30.458  1.00 249.77 ? 105 ARG C O    1 
ATOM   3123 C  CB   . ARG C 1 105 ? 88.202 51.091 32.606  1.00 246.11 ? 105 ARG C CB   1 
ATOM   3124 C  CG   . ARG C 1 105 ? 88.135 49.910 33.565  1.00 255.43 ? 105 ARG C CG   1 
ATOM   3125 C  CD   . ARG C 1 105 ? 89.069 50.106 34.745  1.00 259.64 ? 105 ARG C CD   1 
ATOM   3126 N  NE   . ARG C 1 105 ? 90.318 49.363 34.596  1.00 260.77 ? 105 ARG C NE   1 
ATOM   3127 C  CZ   . ARG C 1 105 ? 91.450 49.675 35.219  1.00 269.67 ? 105 ARG C CZ   1 
ATOM   3128 N  NH1  . ARG C 1 105 ? 91.495 50.721 36.032  1.00 255.80 ? 105 ARG C NH1  1 
ATOM   3129 N  NH2  . ARG C 1 105 ? 92.540 48.944 35.029  1.00 255.21 ? 105 ARG C NH2  1 
ATOM   3130 N  N    . THR C 1 106 ? 88.188 49.733 29.145  1.00 247.92 ? 106 THR C N    1 
ATOM   3131 C  CA   . THR C 1 106 ? 89.026 49.164 28.096  1.00 247.90 ? 106 THR C CA   1 
ATOM   3132 C  C    . THR C 1 106 ? 88.913 50.024 26.845  1.00 249.94 ? 106 THR C C    1 
ATOM   3133 O  O    . THR C 1 106 ? 87.808 50.266 26.353  1.00 248.99 ? 106 THR C O    1 
ATOM   3134 C  CB   . THR C 1 106 ? 88.606 47.706 27.793  1.00 263.12 ? 106 THR C CB   1 
ATOM   3135 O  OG1  . THR C 1 106 ? 89.491 46.799 28.461  1.00 264.28 ? 106 THR C OG1  1 
ATOM   3136 C  CG2  . THR C 1 106 ? 88.631 47.434 26.291  1.00 263.31 ? 106 THR C CG2  1 
ATOM   3137 N  N    . GLN C 1 107 ? 90.053 50.481 26.331  1.00 247.30 ? 107 GLN C N    1 
ATOM   3138 C  CA   . GLN C 1 107 ? 90.057 51.328 25.142  1.00 247.57 ? 107 GLN C CA   1 
ATOM   3139 C  C    . GLN C 1 107 ? 89.298 50.725 23.970  1.00 257.61 ? 107 GLN C C    1 
ATOM   3140 O  O    . GLN C 1 107 ? 89.791 49.838 23.264  1.00 258.76 ? 107 GLN C O    1 
ATOM   3141 C  CB   . GLN C 1 107 ? 91.466 51.764 24.735  1.00 247.65 ? 107 GLN C CB   1 
ATOM   3142 C  CG   . GLN C 1 107 ? 91.566 53.251 24.361  1.00 233.71 ? 107 GLN C CG   1 
ATOM   3143 C  CD   . GLN C 1 107 ? 90.253 53.832 23.827  1.00 225.43 ? 107 GLN C CD   1 
ATOM   3144 O  OE1  . GLN C 1 107 ? 89.548 54.570 24.529  1.00 216.85 ? 107 GLN C OE1  1 
ATOM   3145 N  NE2  . GLN C 1 107 ? 89.941 53.528 22.568  1.00 213.50 ? 107 GLN C NE2  1 
ATOM   3146 N  N    . SER C 1 108 ? 88.090 51.241 23.780  1.00 252.35 ? 108 SER C N    1 
ATOM   3147 C  CA   . SER C 1 108 ? 87.177 50.805 22.737  1.00 250.35 ? 108 SER C CA   1 
ATOM   3148 C  C    . SER C 1 108 ? 85.815 51.346 23.151  1.00 245.85 ? 108 SER C C    1 
ATOM   3149 O  O    . SER C 1 108 ? 84.909 51.490 22.330  1.00 243.66 ? 108 SER C O    1 
ATOM   3150 C  CB   . SER C 1 108 ? 87.127 49.272 22.682  1.00 254.92 ? 108 SER C CB   1 
ATOM   3151 O  OG   . SER C 1 108 ? 86.545 48.726 23.859  1.00 264.32 ? 108 SER C OG   1 
ATOM   3152 N  N    . THR C 1 109 ? 85.703 51.668 24.438  1.00 239.66 ? 109 THR C N    1 
ATOM   3153 C  CA   . THR C 1 109 ? 84.459 52.149 25.029  1.00 238.75 ? 109 THR C CA   1 
ATOM   3154 C  C    . THR C 1 109 ? 84.200 53.668 25.010  1.00 233.86 ? 109 THR C C    1 
ATOM   3155 O  O    . THR C 1 109 ? 83.100 54.103 24.655  1.00 231.78 ? 109 THR C O    1 
ATOM   3156 C  CB   . THR C 1 109 ? 84.231 51.532 26.433  1.00 269.54 ? 109 THR C CB   1 
ATOM   3157 O  OG1  . THR C 1 109 ? 84.611 50.147 26.423  1.00 274.15 ? 109 THR C OG1  1 
ATOM   3158 C  CG2  . THR C 1 109 ? 82.770 51.653 26.840  1.00 273.18 ? 109 THR C CG2  1 
ATOM   3159 N  N    . PRO C 1 110 ? 85.193 54.485 25.423  1.00 227.14 ? 110 PRO C N    1 
ATOM   3160 C  CA   . PRO C 1 110 ? 85.060 55.950 25.508  1.00 227.58 ? 110 PRO C CA   1 
ATOM   3161 C  C    . PRO C 1 110 ? 84.238 56.588 24.379  1.00 236.06 ? 110 PRO C C    1 
ATOM   3162 O  O    . PRO C 1 110 ? 84.113 56.011 23.299  1.00 237.14 ? 110 PRO C O    1 
ATOM   3163 C  CB   . PRO C 1 110 ? 86.515 56.433 25.442  1.00 227.99 ? 110 PRO C CB   1 
ATOM   3164 C  CG   . PRO C 1 110 ? 87.303 55.312 26.017  1.00 230.31 ? 110 PRO C CG   1 
ATOM   3165 C  CD   . PRO C 1 110 ? 86.594 54.052 25.590  1.00 225.65 ? 110 PRO C CD   1 
ATOM   3166 N  N    . GLY C 1 111 ? 83.670 57.768 24.631  1.00 228.96 ? 111 GLY C N    1 
ATOM   3167 C  CA   . GLY C 1 111 ? 82.937 58.481 23.597  1.00 226.64 ? 111 GLY C CA   1 
ATOM   3168 C  C    . GLY C 1 111 ? 81.581 59.100 23.888  1.00 223.39 ? 111 GLY C C    1 
ATOM   3169 O  O    . GLY C 1 111 ? 80.687 58.442 24.409  1.00 221.88 ? 111 GLY C O    1 
ATOM   3170 N  N    . TYR C 1 112 ? 81.420 60.360 23.488  1.00 217.62 ? 112 TYR C N    1 
ATOM   3171 C  CA   . TYR C 1 112 ? 80.146 61.071 23.601  1.00 214.93 ? 112 TYR C CA   1 
ATOM   3172 C  C    . TYR C 1 112 ? 79.511 60.984 22.224  1.00 228.87 ? 112 TYR C C    1 
ATOM   3173 O  O    . TYR C 1 112 ? 79.741 61.856 21.389  1.00 231.17 ? 112 TYR C O    1 
ATOM   3174 C  CB   . TYR C 1 112 ? 80.357 62.563 23.885  1.00 207.97 ? 112 TYR C CB   1 
ATOM   3175 C  CG   . TYR C 1 112 ? 80.596 62.920 25.329  1.00 197.18 ? 112 TYR C CG   1 
ATOM   3176 C  CD1  . TYR C 1 112 ? 81.566 62.243 26.074  1.00 197.02 ? 112 TYR C CD1  1 
ATOM   3177 C  CD2  . TYR C 1 112 ? 79.910 63.978 25.938  1.00 194.69 ? 112 TYR C CD2  1 
ATOM   3178 C  CE1  . TYR C 1 112 ? 81.847 62.589 27.412  1.00 195.60 ? 112 TYR C CE1  1 
ATOM   3179 C  CE2  . TYR C 1 112 ? 80.168 64.329 27.288  1.00 194.27 ? 112 TYR C CE2  1 
ATOM   3180 C  CZ   . TYR C 1 112 ? 81.150 63.628 28.021  1.00 199.19 ? 112 TYR C CZ   1 
ATOM   3181 O  OH   . TYR C 1 112 ? 81.445 63.942 29.346  1.00 198.72 ? 112 TYR C OH   1 
ATOM   3182 N  N    . ILE C 1 113 ? 78.720 59.946 21.981  1.00 218.63 ? 113 ILE C N    1 
ATOM   3183 C  CA   . ILE C 1 113 ? 78.091 59.777 20.678  1.00 216.55 ? 113 ILE C CA   1 
ATOM   3184 C  C    . ILE C 1 113 ? 76.875 58.889 20.796  1.00 223.01 ? 113 ILE C C    1 
ATOM   3185 O  O    . ILE C 1 113 ? 75.753 59.347 21.007  1.00 223.85 ? 113 ILE C O    1 
ATOM   3186 C  CB   . ILE C 1 113 ? 79.067 59.115 19.701  1.00 216.78 ? 113 ILE C CB   1 
ATOM   3187 C  CG1  . ILE C 1 113 ? 80.290 59.998 19.459  1.00 215.63 ? 113 ILE C CG1  1 
ATOM   3188 C  CG2  . ILE C 1 113 ? 78.365 58.757 18.405  1.00 216.44 ? 113 ILE C CG2  1 
ATOM   3189 C  CD1  . ILE C 1 113 ? 81.600 59.331 19.840  1.00 220.68 ? 113 ILE C CD1  1 
ATOM   3190 N  N    . PHE C 1 114 ? 77.134 57.605 20.593  1.00 212.78 ? 114 PHE C N    1 
ATOM   3191 C  CA   . PHE C 1 114 ? 76.140 56.554 20.666  1.00 206.93 ? 114 PHE C CA   1 
ATOM   3192 C  C    . PHE C 1 114 ? 74.863 56.659 19.844  1.00 205.80 ? 114 PHE C C    1 
ATOM   3193 O  O    . PHE C 1 114 ? 73.957 57.443 20.138  1.00 204.66 ? 114 PHE C O    1 
ATOM   3194 C  CB   . PHE C 1 114 ? 75.874 56.125 22.105  1.00 203.61 ? 114 PHE C CB   1 
ATOM   3195 C  CG   . PHE C 1 114 ? 74.804 56.915 22.786  1.00 197.69 ? 114 PHE C CG   1 
ATOM   3196 C  CD1  . PHE C 1 114 ? 73.520 56.424 22.863  1.00 195.13 ? 114 PHE C CD1  1 
ATOM   3197 C  CD2  . PHE C 1 114 ? 75.095 58.127 23.392  1.00 193.96 ? 114 PHE C CD2  1 
ATOM   3198 C  CE1  . PHE C 1 114 ? 72.541 57.137 23.499  1.00 193.58 ? 114 PHE C CE1  1 
ATOM   3199 C  CE2  . PHE C 1 114 ? 74.115 58.847 24.026  1.00 194.01 ? 114 PHE C CE2  1 
ATOM   3200 C  CZ   . PHE C 1 114 ? 72.835 58.343 24.090  1.00 191.35 ? 114 PHE C CZ   1 
ATOM   3201 N  N    . GLY C 1 115 ? 74.820 55.821 18.814  1.00 197.00 ? 115 GLY C N    1 
ATOM   3202 C  CA   . GLY C 1 115 ? 73.713 55.619 17.900  1.00 195.31 ? 115 GLY C CA   1 
ATOM   3203 C  C    . GLY C 1 115 ? 73.478 56.629 16.797  1.00 194.97 ? 115 GLY C C    1 
ATOM   3204 O  O    . GLY C 1 115 ? 72.331 56.797 16.377  1.00 194.18 ? 115 GLY C O    1 
ATOM   3205 N  N    . LYS C 1 116 ? 74.536 57.283 16.313  1.00 185.48 ? 116 LYS C N    1 
ATOM   3206 C  CA   . LYS C 1 116 ? 74.376 58.292 15.265  1.00 183.95 ? 116 LYS C CA   1 
ATOM   3207 C  C    . LYS C 1 116 ? 73.500 57.794 14.129  1.00 188.29 ? 116 LYS C C    1 
ATOM   3208 O  O    . LYS C 1 116 ? 72.729 58.560 13.564  1.00 188.49 ? 116 LYS C O    1 
ATOM   3209 C  CB   . LYS C 1 116 ? 75.715 58.808 14.736  1.00 184.15 ? 116 LYS C CB   1 
ATOM   3210 C  CG   . LYS C 1 116 ? 76.579 57.721 14.119  1.00 174.59 ? 116 LYS C CG   1 
ATOM   3211 C  CD   . LYS C 1 116 ? 77.197 58.128 12.768  1.00 170.55 ? 116 LYS C CD   1 
ATOM   3212 C  CE   . LYS C 1 116 ? 77.609 56.885 11.939  1.00 168.31 ? 116 LYS C CE   1 
ATOM   3213 N  NZ   . LYS C 1 116 ? 78.820 57.080 11.070  1.00 173.00 ? 116 LYS C NZ   1 
ATOM   3214 N  N    . ARG C 1 117 ? 73.573 56.498 13.845  1.00 180.63 ? 117 ARG C N    1 
ATOM   3215 C  CA   . ARG C 1 117 ? 72.772 55.899 12.788  1.00 178.94 ? 117 ARG C CA   1 
ATOM   3216 C  C    . ARG C 1 117 ? 71.279 55.986 13.077  1.00 177.19 ? 117 ARG C C    1 
ATOM   3217 O  O    . ARG C 1 117 ? 70.494 56.341 12.203  1.00 176.02 ? 117 ARG C O    1 
ATOM   3218 C  CB   . ARG C 1 117 ? 73.176 54.447 12.594  1.00 180.32 ? 117 ARG C CB   1 
ATOM   3219 C  CG   . ARG C 1 117 ? 72.271 53.476 13.317  1.00 192.59 ? 117 ARG C CG   1 
ATOM   3220 C  CD   . ARG C 1 117 ? 72.779 52.054 13.180  1.00 204.17 ? 117 ARG C CD   1 
ATOM   3221 N  NE   . ARG C 1 117 ? 72.442 51.457 11.887  1.00 213.95 ? 117 ARG C NE   1 
ATOM   3222 C  CZ   . ARG C 1 117 ? 73.151 51.620 10.771  1.00 228.94 ? 117 ARG C CZ   1 
ATOM   3223 N  NH1  . ARG C 1 117 ? 74.240 52.381 10.770  1.00 216.56 ? 117 ARG C NH1  1 
ATOM   3224 N  NH2  . ARG C 1 117 ? 72.766 51.021 9.650   1.00 215.97 ? 117 ARG C NH2  1 
ATOM   3225 N  N    . ILE C 1 118 ? 70.886 55.659 14.301  1.00 170.87 ? 118 ILE C N    1 
ATOM   3226 C  CA   . ILE C 1 118 ? 69.484 55.712 14.680  1.00 167.96 ? 118 ILE C CA   1 
ATOM   3227 C  C    . ILE C 1 118 ? 68.886 57.104 14.498  1.00 166.91 ? 118 ILE C C    1 
ATOM   3228 O  O    . ILE C 1 118 ? 67.961 57.292 13.706  1.00 165.76 ? 118 ILE C O    1 
ATOM   3229 C  CB   . ILE C 1 118 ? 69.282 55.208 16.097  1.00 169.77 ? 118 ILE C CB   1 
ATOM   3230 C  CG1  . ILE C 1 118 ? 69.597 53.720 16.163  1.00 169.51 ? 118 ILE C CG1  1 
ATOM   3231 C  CG2  . ILE C 1 118 ? 67.862 55.480 16.558  1.00 170.00 ? 118 ILE C CG2  1 
ATOM   3232 C  CD1  . ILE C 1 118 ? 69.487 53.150 17.555  1.00 176.05 ? 118 ILE C CD1  1 
ATOM   3233 N  N    . ILE C 1 119 ? 69.414 58.077 15.239  1.00 160.20 ? 119 ILE C N    1 
ATOM   3234 C  CA   . ILE C 1 119 ? 68.936 59.460 15.171  1.00 159.63 ? 119 ILE C CA   1 
ATOM   3235 C  C    . ILE C 1 119 ? 69.013 59.976 13.744  1.00 164.59 ? 119 ILE C C    1 
ATOM   3236 O  O    . ILE C 1 119 ? 68.149 60.719 13.283  1.00 164.33 ? 119 ILE C O    1 
ATOM   3237 C  CB   . ILE C 1 119 ? 69.723 60.378 16.128  1.00 162.48 ? 119 ILE C CB   1 
ATOM   3238 C  CG1  . ILE C 1 119 ? 71.107 59.787 16.410  1.00 162.88 ? 119 ILE C CG1  1 
ATOM   3239 C  CG2  . ILE C 1 119 ? 68.944 60.599 17.426  1.00 163.14 ? 119 ILE C CG2  1 
ATOM   3240 C  CD1  . ILE C 1 119 ? 71.361 59.491 17.884  1.00 170.37 ? 119 ILE C CD1  1 
ATOM   3241 N  N    . LEU C 1 120 ? 70.065 59.587 13.045  1.00 155.42 ? 120 LEU C N    1 
ATOM   3242 C  CA   . LEU C 1 120 ? 70.209 59.991 11.665  1.00 155.11 ? 120 LEU C CA   1 
ATOM   3243 C  C    . LEU C 1 120 ? 68.984 59.490 10.915  1.00 157.11 ? 120 LEU C C    1 
ATOM   3244 O  O    . LEU C 1 120 ? 68.310 60.261 10.240  1.00 157.32 ? 120 LEU C O    1 
ATOM   3245 C  CB   . LEU C 1 120 ? 71.475 59.392 11.072  1.00 154.92 ? 120 LEU C CB   1 
ATOM   3246 C  CG   . LEU C 1 120 ? 71.537 59.506 9.560   1.00 158.30 ? 120 LEU C CG   1 
ATOM   3247 C  CD1  . LEU C 1 120 ? 70.818 58.324 8.927   1.00 157.95 ? 120 LEU C CD1  1 
ATOM   3248 C  CD2  . LEU C 1 120 ? 70.917 60.824 9.151   1.00 160.26 ? 120 LEU C CD2  1 
ATOM   3249 N  N    . PHE C 1 121 ? 68.705 58.196 11.046  1.00 154.22 ? 121 PHE C N    1 
ATOM   3250 C  CA   . PHE C 1 121 ? 67.558 57.576 10.392  1.00 153.73 ? 121 PHE C CA   1 
ATOM   3251 C  C    . PHE C 1 121 ? 66.254 58.250 10.777  1.00 151.12 ? 121 PHE C C    1 
ATOM   3252 O  O    . PHE C 1 121 ? 65.477 58.650 9.905   1.00 148.55 ? 121 PHE C O    1 
ATOM   3253 C  CB   . PHE C 1 121 ? 67.453 56.101 10.759  1.00 158.74 ? 121 PHE C CB   1 
ATOM   3254 C  CG   . PHE C 1 121 ? 66.118 55.501 10.442  1.00 165.19 ? 121 PHE C CG   1 
ATOM   3255 C  CD1  . PHE C 1 121 ? 65.448 55.849 9.289   1.00 171.88 ? 121 PHE C CD1  1 
ATOM   3256 C  CD2  . PHE C 1 121 ? 65.524 54.609 11.308  1.00 171.16 ? 121 PHE C CD2  1 
ATOM   3257 C  CE1  . PHE C 1 121 ? 64.216 55.324 9.012   1.00 174.26 ? 121 PHE C CE1  1 
ATOM   3258 C  CE2  . PHE C 1 121 ? 64.297 54.072 11.028  1.00 175.62 ? 121 PHE C CE2  1 
ATOM   3259 C  CZ   . PHE C 1 121 ? 63.643 54.428 9.879   1.00 174.08 ? 121 PHE C CZ   1 
ATOM   3260 N  N    . LEU C 1 122 ? 65.980 58.288 12.080  1.00 146.30 ? 122 LEU C N    1 
ATOM   3261 C  CA   . LEU C 1 122 ? 64.767 58.912 12.591  1.00 146.38 ? 122 LEU C CA   1 
ATOM   3262 C  C    . LEU C 1 122 ? 64.634 60.293 11.954  1.00 150.39 ? 122 LEU C C    1 
ATOM   3263 O  O    . LEU C 1 122 ? 63.567 60.687 11.484  1.00 150.26 ? 122 LEU C O    1 
ATOM   3264 C  CB   . LEU C 1 122 ? 64.840 59.045 14.115  1.00 145.70 ? 122 LEU C CB   1 
ATOM   3265 C  CG   . LEU C 1 122 ? 63.884 58.188 14.939  1.00 148.18 ? 122 LEU C CG   1 
ATOM   3266 C  CD1  . LEU C 1 122 ? 63.386 56.998 14.138  1.00 147.55 ? 122 LEU C CD1  1 
ATOM   3267 C  CD2  . LEU C 1 122 ? 64.592 57.735 16.196  1.00 149.85 ? 122 LEU C CD2  1 
ATOM   3268 N  N    . PHE C 1 123 ? 65.753 60.998 11.888  1.00 146.02 ? 123 PHE C N    1 
ATOM   3269 C  CA   . PHE C 1 123 ? 65.787 62.323 11.303  1.00 144.47 ? 123 PHE C CA   1 
ATOM   3270 C  C    . PHE C 1 123 ? 65.452 62.290 9.813   1.00 150.82 ? 123 PHE C C    1 
ATOM   3271 O  O    . PHE C 1 123 ? 65.077 63.303 9.232   1.00 150.72 ? 123 PHE C O    1 
ATOM   3272 C  CB   . PHE C 1 123 ? 67.158 62.939 11.541  1.00 143.98 ? 123 PHE C CB   1 
ATOM   3273 C  CG   . PHE C 1 123 ? 67.471 64.082 10.636  1.00 142.10 ? 123 PHE C CG   1 
ATOM   3274 C  CD1  . PHE C 1 123 ? 67.919 63.854 9.344   1.00 142.29 ? 123 PHE C CD1  1 
ATOM   3275 C  CD2  . PHE C 1 123 ? 67.374 65.385 11.095  1.00 141.25 ? 123 PHE C CD2  1 
ATOM   3276 C  CE1  . PHE C 1 123 ? 68.233 64.903 8.517   1.00 141.83 ? 123 PHE C CE1  1 
ATOM   3277 C  CE2  . PHE C 1 123 ? 67.680 66.444 10.271  1.00 142.50 ? 123 PHE C CE2  1 
ATOM   3278 C  CZ   . PHE C 1 123 ? 68.115 66.204 8.979   1.00 140.13 ? 123 PHE C CZ   1 
ATOM   3279 N  N    . LEU C 1 124 ? 65.591 61.124 9.196   1.00 146.17 ? 124 LEU C N    1 
ATOM   3280 C  CA   . LEU C 1 124 ? 65.291 60.989 7.779   1.00 145.04 ? 124 LEU C CA   1 
ATOM   3281 C  C    . LEU C 1 124 ? 63.820 60.736 7.544   1.00 145.20 ? 124 LEU C C    1 
ATOM   3282 O  O    . LEU C 1 124 ? 63.300 61.022 6.472   1.00 144.70 ? 124 LEU C O    1 
ATOM   3283 C  CB   . LEU C 1 124 ? 66.120 59.881 7.151   1.00 144.48 ? 124 LEU C CB   1 
ATOM   3284 C  CG   . LEU C 1 124 ? 67.499 60.400 6.767   1.00 146.96 ? 124 LEU C CG   1 
ATOM   3285 C  CD1  . LEU C 1 124 ? 67.582 61.888 7.071   1.00 146.31 ? 124 LEU C CD1  1 
ATOM   3286 C  CD2  . LEU C 1 124 ? 68.541 59.646 7.550   1.00 148.62 ? 124 LEU C CD2  1 
ATOM   3287 N  N    . MET C 1 125 ? 63.153 60.200 8.554   1.00 143.85 ? 125 MET C N    1 
ATOM   3288 C  CA   . MET C 1 125 ? 61.730 59.955 8.458   1.00 143.85 ? 125 MET C CA   1 
ATOM   3289 C  C    . MET C 1 125 ? 61.032 61.289 8.646   1.00 143.85 ? 125 MET C C    1 
ATOM   3290 O  O    . MET C 1 125 ? 60.051 61.598 7.967   1.00 206.01 ? 125 MET C O    1 
ATOM   3291 C  CB   . MET C 1 125 ? 61.299 58.971 9.535   1.00 143.85 ? 125 MET C CB   1 
ATOM   3292 C  CG   . MET C 1 125 ? 61.849 57.565 9.314   1.00 143.85 ? 125 MET C CG   1 
ATOM   3293 S  SD   . MET C 1 125 ? 61.162 56.317 10.463  1.00 143.85 ? 125 MET C SD   1 
ATOM   3294 C  CE   . MET C 1 125 ? 61.075 57.285 12.032  1.00 143.85 ? 125 MET C CE   1 
ATOM   3295 N  N    . SER C 1 126 ? 61.581 62.098 9.545   1.00 139.85 ? 126 SER C N    1 
ATOM   3296 C  CA   . SER C 1 126 ? 61.047 63.433 9.819   1.00 140.84 ? 126 SER C CA   1 
ATOM   3297 C  C    . SER C 1 126 ? 61.270 64.342 8.616   1.00 145.37 ? 126 SER C C    1 
ATOM   3298 O  O    . SER C 1 126 ? 60.374 65.086 8.216   1.00 144.66 ? 126 SER C O    1 
ATOM   3299 C  CB   . SER C 1 126 ? 61.702 64.041 11.064  1.00 146.11 ? 126 SER C CB   1 
ATOM   3300 O  OG   . SER C 1 126 ? 62.852 63.304 11.456  1.00 156.58 ? 126 SER C OG   1 
ATOM   3301 N  N    . VAL C 1 127 ? 62.467 64.267 8.041   1.00 141.11 ? 127 VAL C N    1 
ATOM   3302 C  CA   . VAL C 1 127 ? 62.791 65.053 6.863   1.00 141.38 ? 127 VAL C CA   1 
ATOM   3303 C  C    . VAL C 1 127 ? 62.051 64.468 5.669   1.00 147.90 ? 127 VAL C C    1 
ATOM   3304 O  O    . VAL C 1 127 ? 61.935 65.106 4.620   1.00 147.90 ? 127 VAL C O    1 
ATOM   3305 C  CB   . VAL C 1 127 ? 64.270 65.040 6.593   1.00 144.40 ? 127 VAL C CB   1 
ATOM   3306 C  CG1  . VAL C 1 127 ? 64.703 63.634 6.197   1.00 144.06 ? 127 VAL C CG1  1 
ATOM   3307 C  CG2  . VAL C 1 127 ? 64.599 66.062 5.513   1.00 144.07 ? 127 VAL C CG2  1 
ATOM   3308 N  N    . ALA C 1 128 ? 61.573 63.238 5.839   1.00 147.25 ? 128 ALA C N    1 
ATOM   3309 C  CA   . ALA C 1 128 ? 60.806 62.545 4.810   1.00 148.10 ? 128 ALA C CA   1 
ATOM   3310 C  C    . ALA C 1 128 ? 59.437 63.189 4.695   1.00 151.96 ? 128 ALA C C    1 
ATOM   3311 O  O    . ALA C 1 128 ? 59.153 63.920 3.747   1.00 150.78 ? 128 ALA C O    1 
ATOM   3312 C  CB   . ALA C 1 128 ? 60.647 61.088 5.180   1.00 149.26 ? 128 ALA C CB   1 
ATOM   3313 N  N    . GLY C 1 129 ? 58.588 62.913 5.675   1.00 151.28 ? 129 GLY C N    1 
ATOM   3314 C  CA   . GLY C 1 129 ? 57.255 63.476 5.698   1.00 152.19 ? 129 GLY C CA   1 
ATOM   3315 C  C    . GLY C 1 129 ? 57.247 64.988 5.530   1.00 158.36 ? 129 GLY C C    1 
ATOM   3316 O  O    . GLY C 1 129 ? 56.394 65.534 4.820   1.00 158.27 ? 129 GLY C O    1 
ATOM   3317 N  N    . ILE C 1 130 ? 58.186 65.670 6.184   1.00 154.93 ? 130 ILE C N    1 
ATOM   3318 C  CA   . ILE C 1 130 ? 58.252 67.129 6.097   1.00 154.97 ? 130 ILE C CA   1 
ATOM   3319 C  C    . ILE C 1 130 ? 58.248 67.598 4.658   1.00 159.11 ? 130 ILE C C    1 
ATOM   3320 O  O    . ILE C 1 130 ? 57.642 68.619 4.334   1.00 160.68 ? 130 ILE C O    1 
ATOM   3321 C  CB   . ILE C 1 130 ? 59.470 67.717 6.802   1.00 157.72 ? 130 ILE C CB   1 
ATOM   3322 C  CG1  . ILE C 1 130 ? 59.027 68.811 7.781   1.00 157.92 ? 130 ILE C CG1  1 
ATOM   3323 C  CG2  . ILE C 1 130 ? 60.414 68.317 5.753   1.00 158.25 ? 130 ILE C CG2  1 
ATOM   3324 C  CD1  . ILE C 1 130 ? 58.383 70.013 7.112   1.00 165.03 ? 130 ILE C CD1  1 
ATOM   3325 N  N    . PHE C 1 131 ? 58.961 66.874 3.804   1.00 158.09 ? 131 PHE C N    1 
ATOM   3326 C  CA   . PHE C 1 131 ? 59.005 67.218 2.395   1.00 157.38 ? 131 PHE C CA   1 
ATOM   3327 C  C    . PHE C 1 131 ? 57.754 66.694 1.693   1.00 158.35 ? 131 PHE C C    1 
ATOM   3328 O  O    . PHE C 1 131 ? 57.008 67.457 1.070   1.00 156.02 ? 131 PHE C O    1 
ATOM   3329 C  CB   . PHE C 1 131 ? 60.259 66.635 1.739   1.00 161.75 ? 131 PHE C CB   1 
ATOM   3330 C  CG   . PHE C 1 131 ? 59.977 65.816 0.509   1.00 167.13 ? 131 PHE C CG   1 
ATOM   3331 C  CD1  . PHE C 1 131 ? 60.205 64.450 0.506   1.00 173.02 ? 131 PHE C CD1  1 
ATOM   3332 C  CD2  . PHE C 1 131 ? 59.486 66.408 -0.644  1.00 172.37 ? 131 PHE C CD2  1 
ATOM   3333 C  CE1  . PHE C 1 131 ? 59.950 63.692 -0.620  1.00 175.23 ? 131 PHE C CE1  1 
ATOM   3334 C  CE2  . PHE C 1 131 ? 59.215 65.653 -1.762  1.00 176.66 ? 131 PHE C CE2  1 
ATOM   3335 C  CZ   . PHE C 1 131 ? 59.459 64.295 -1.755  1.00 175.10 ? 131 PHE C CZ   1 
ATOM   3336 N  N    . ASN C 1 132 ? 57.553 65.383 1.775   1.00 157.16 ? 132 ASN C N    1 
ATOM   3337 C  CA   . ASN C 1 132 ? 56.420 64.740 1.136   1.00 158.25 ? 132 ASN C CA   1 
ATOM   3338 C  C    . ASN C 1 132 ? 55.128 65.491 1.412   1.00 161.83 ? 132 ASN C C    1 
ATOM   3339 O  O    . ASN C 1 132 ? 54.193 65.436 0.624   1.00 159.12 ? 132 ASN C O    1 
ATOM   3340 C  CB   . ASN C 1 132 ? 56.296 63.293 1.594   1.00 164.62 ? 132 ASN C CB   1 
ATOM   3341 C  CG   . ASN C 1 132 ? 54.871 62.794 1.543   1.00 215.04 ? 132 ASN C CG   1 
ATOM   3342 O  OD1  . ASN C 1 132 ? 54.052 63.130 2.404   1.00 213.46 ? 132 ASN C OD1  1 
ATOM   3343 N  ND2  . ASN C 1 132 ? 54.547 62.032 0.500   1.00 211.00 ? 132 ASN C ND2  1 
ATOM   3344 N  N    . TYR C 1 133 ? 55.084 66.204 2.528   1.00 158.29 ? 133 TYR C N    1 
ATOM   3345 C  CA   . TYR C 1 133 ? 53.908 66.979 2.862   1.00 160.13 ? 133 TYR C CA   1 
ATOM   3346 C  C    . TYR C 1 133 ? 53.813 68.147 1.906   1.00 164.80 ? 133 TYR C C    1 
ATOM   3347 O  O    . TYR C 1 133 ? 52.729 68.514 1.462   1.00 164.61 ? 133 TYR C O    1 
ATOM   3348 C  CB   . TYR C 1 133 ? 54.014 67.529 4.273   1.00 160.75 ? 133 TYR C CB   1 
ATOM   3349 C  CG   . TYR C 1 133 ? 53.357 68.885 4.429   1.00 159.72 ? 133 TYR C CG   1 
ATOM   3350 C  CD1  . TYR C 1 133 ? 52.015 69.072 4.116   1.00 161.05 ? 133 TYR C CD1  1 
ATOM   3351 C  CD2  . TYR C 1 133 ? 54.080 69.981 4.872   1.00 159.53 ? 133 TYR C CD2  1 
ATOM   3352 C  CE1  . TYR C 1 133 ? 51.409 70.310 4.260   1.00 160.85 ? 133 TYR C CE1  1 
ATOM   3353 C  CE2  . TYR C 1 133 ? 53.481 71.219 5.021   1.00 159.91 ? 133 TYR C CE2  1 
ATOM   3354 C  CZ   . TYR C 1 133 ? 52.148 71.378 4.717   1.00 165.76 ? 133 TYR C CZ   1 
ATOM   3355 O  OH   . TYR C 1 133 ? 51.561 72.613 4.874   1.00 165.82 ? 133 TYR C OH   1 
ATOM   3356 N  N    . TYR C 1 134 ? 54.952 68.755 1.615   1.00 162.51 ? 134 TYR C N    1 
ATOM   3357 C  CA   . TYR C 1 134 ? 54.973 69.885 0.711   1.00 162.68 ? 134 TYR C CA   1 
ATOM   3358 C  C    . TYR C 1 134 ? 54.430 69.516 -0.663  1.00 165.02 ? 134 TYR C C    1 
ATOM   3359 O  O    . TYR C 1 134 ? 53.900 70.367 -1.375  1.00 163.12 ? 134 TYR C O    1 
ATOM   3360 C  CB   . TYR C 1 134 ? 56.377 70.453 0.610   1.00 166.03 ? 134 TYR C CB   1 
ATOM   3361 C  CG   . TYR C 1 134 ? 56.671 71.429 1.715   1.00 171.72 ? 134 TYR C CG   1 
ATOM   3362 C  CD1  . TYR C 1 134 ? 55.771 71.613 2.749   1.00 174.24 ? 134 TYR C CD1  1 
ATOM   3363 C  CD2  . TYR C 1 134 ? 57.838 72.179 1.717   1.00 173.64 ? 134 TYR C CD2  1 
ATOM   3364 C  CE1  . TYR C 1 134 ? 56.030 72.505 3.758   1.00 175.42 ? 134 TYR C CE1  1 
ATOM   3365 C  CE2  . TYR C 1 134 ? 58.104 73.077 2.724   1.00 174.91 ? 134 TYR C CE2  1 
ATOM   3366 C  CZ   . TYR C 1 134 ? 57.198 73.234 3.745   1.00 182.11 ? 134 TYR C CZ   1 
ATOM   3367 O  OH   . TYR C 1 134 ? 57.462 74.125 4.760   1.00 182.97 ? 134 TYR C OH   1 
ATOM   3368 N  N    . LEU C 1 135 ? 54.522 68.239 -1.015  1.00 162.38 ? 135 LEU C N    1 
ATOM   3369 C  CA   . LEU C 1 135 ? 54.006 67.771 -2.296  1.00 163.35 ? 135 LEU C CA   1 
ATOM   3370 C  C    . LEU C 1 135 ? 52.493 67.682 -2.252  1.00 169.81 ? 135 LEU C C    1 
ATOM   3371 O  O    . LEU C 1 135 ? 51.805 68.258 -3.092  1.00 170.00 ? 135 LEU C O    1 
ATOM   3372 C  CB   . LEU C 1 135 ? 54.589 66.412 -2.637  1.00 162.70 ? 135 LEU C CB   1 
ATOM   3373 C  CG   . LEU C 1 135 ? 56.111 66.400 -2.579  1.00 165.20 ? 135 LEU C CG   1 
ATOM   3374 C  CD1  . LEU C 1 135 ? 56.637 65.561 -3.721  1.00 164.57 ? 135 LEU C CD1  1 
ATOM   3375 C  CD2  . LEU C 1 135 ? 56.688 67.821 -2.625  1.00 166.88 ? 135 LEU C CD2  1 
ATOM   3376 N  N    . ILE C 1 136 ? 51.982 66.968 -1.257  1.00 168.86 ? 136 ILE C N    1 
ATOM   3377 C  CA   . ILE C 1 136 ? 50.544 66.823 -1.066  1.00 168.19 ? 136 ILE C CA   1 
ATOM   3378 C  C    . ILE C 1 136 ? 49.895 68.197 -0.989  1.00 177.77 ? 136 ILE C C    1 
ATOM   3379 O  O    . ILE C 1 136 ? 48.713 68.373 -1.284  1.00 178.07 ? 136 ILE C O    1 
ATOM   3380 C  CB   . ILE C 1 136 ? 50.252 66.045 0.210   1.00 169.17 ? 136 ILE C CB   1 
ATOM   3381 C  CG1  . ILE C 1 136 ? 51.218 64.872 0.360   1.00 168.60 ? 136 ILE C CG1  1 
ATOM   3382 C  CG2  . ILE C 1 136 ? 48.819 65.595 0.227   1.00 169.16 ? 136 ILE C CG2  1 
ATOM   3383 C  CD1  . ILE C 1 136 ? 51.765 64.726 1.771   1.00 174.77 ? 136 ILE C CD1  1 
ATOM   3384 N  N    . PHE C 1 137 ? 50.688 69.165 -0.561  1.00 177.14 ? 137 PHE C N    1 
ATOM   3385 C  CA   . PHE C 1 137 ? 50.246 70.532 -0.427  1.00 180.26 ? 137 PHE C CA   1 
ATOM   3386 C  C    . PHE C 1 137 ? 50.261 71.179 -1.804  1.00 180.94 ? 137 PHE C C    1 
ATOM   3387 O  O    . PHE C 1 137 ? 49.381 71.965 -2.145  1.00 179.35 ? 137 PHE C O    1 
ATOM   3388 C  CB   . PHE C 1 137 ? 51.212 71.252 0.506   1.00 186.72 ? 137 PHE C CB   1 
ATOM   3389 C  CG   . PHE C 1 137 ? 51.009 72.721 0.562   1.00 194.45 ? 137 PHE C CG   1 
ATOM   3390 C  CD1  . PHE C 1 137 ? 49.748 73.260 0.410   1.00 201.94 ? 137 PHE C CD1  1 
ATOM   3391 C  CD2  . PHE C 1 137 ? 52.076 73.564 0.791   1.00 201.07 ? 137 PHE C CD2  1 
ATOM   3392 C  CE1  . PHE C 1 137 ? 49.553 74.619 0.465   1.00 204.58 ? 137 PHE C CE1  1 
ATOM   3393 C  CE2  . PHE C 1 137 ? 51.895 74.928 0.847   1.00 205.81 ? 137 PHE C CE2  1 
ATOM   3394 C  CZ   . PHE C 1 137 ? 50.629 75.457 0.684   1.00 204.40 ? 137 PHE C CZ   1 
ATOM   3395 N  N    . PHE C 1 138 ? 51.243 70.800 -2.614  1.00 177.55 ? 138 PHE C N    1 
ATOM   3396 C  CA   . PHE C 1 138 ? 51.383 71.363 -3.947  1.00 178.17 ? 138 PHE C CA   1 
ATOM   3397 C  C    . PHE C 1 138 ? 50.807 70.524 -5.061  1.00 197.48 ? 138 PHE C C    1 
ATOM   3398 O  O    . PHE C 1 138 ? 50.009 70.995 -5.861  1.00 199.90 ? 138 PHE C O    1 
ATOM   3399 C  CB   . PHE C 1 138 ? 52.850 71.632 -4.252  1.00 175.60 ? 138 PHE C CB   1 
ATOM   3400 C  CG   . PHE C 1 138 ? 53.393 72.843 -3.562  1.00 171.18 ? 138 PHE C CG   1 
ATOM   3401 C  CD1  . PHE C 1 138 ? 52.792 73.323 -2.410  1.00 169.57 ? 138 PHE C CD1  1 
ATOM   3402 C  CD2  . PHE C 1 138 ? 54.507 73.501 -4.063  1.00 168.29 ? 138 PHE C CD2  1 
ATOM   3403 C  CE1  . PHE C 1 138 ? 53.284 74.448 -1.775  1.00 168.27 ? 138 PHE C CE1  1 
ATOM   3404 C  CE2  . PHE C 1 138 ? 55.010 74.621 -3.429  1.00 168.61 ? 138 PHE C CE2  1 
ATOM   3405 C  CZ   . PHE C 1 138 ? 54.394 75.099 -2.282  1.00 166.03 ? 138 PHE C CZ   1 
ATOM   3406 N  N    . PHE C 1 139 ? 51.269 69.294 -5.160  1.00 196.21 ? 139 PHE C N    1 
ATOM   3407 C  CA   . PHE C 1 139 ? 50.857 68.472 -6.268  1.00 198.59 ? 139 PHE C CA   1 
ATOM   3408 C  C    . PHE C 1 139 ? 49.726 67.517 -5.951  1.00 204.59 ? 139 PHE C C    1 
ATOM   3409 O  O    . PHE C 1 139 ? 48.990 67.110 -6.846  1.00 204.04 ? 139 PHE C O    1 
ATOM   3410 C  CB   . PHE C 1 139 ? 52.051 67.739 -6.861  1.00 201.98 ? 139 PHE C CB   1 
ATOM   3411 C  CG   . PHE C 1 139 ? 53.171 68.648 -7.279  1.00 204.95 ? 139 PHE C CG   1 
ATOM   3412 C  CD1  . PHE C 1 139 ? 53.230 69.954 -6.833  1.00 208.55 ? 139 PHE C CD1  1 
ATOM   3413 C  CD2  . PHE C 1 139 ? 54.167 68.194 -8.121  1.00 207.68 ? 139 PHE C CD2  1 
ATOM   3414 C  CE1  . PHE C 1 139 ? 54.263 70.777 -7.200  1.00 209.54 ? 139 PHE C CE1  1 
ATOM   3415 C  CE2  . PHE C 1 139 ? 55.204 69.020 -8.490  1.00 210.57 ? 139 PHE C CE2  1 
ATOM   3416 C  CZ   . PHE C 1 139 ? 55.248 70.312 -8.039  1.00 208.63 ? 139 PHE C CZ   1 
ATOM   3417 N  N    . GLY C 1 140 ? 49.566 67.171 -4.680  1.00 207.45 ? 140 GLY C N    1 
ATOM   3418 C  CA   . GLY C 1 140 ? 48.501 66.266 -4.277  1.00 209.30 ? 140 GLY C CA   1 
ATOM   3419 C  C    . GLY C 1 140 ? 47.130 66.750 -4.722  1.00 219.50 ? 140 GLY C C    1 
ATOM   3420 O  O    . GLY C 1 140 ? 46.240 65.945 -5.024  1.00 219.91 ? 140 GLY C O    1 
ATOM   3421 N  N    . SER C 1 141 ? 46.973 68.072 -4.772  1.00 220.23 ? 141 SER C N    1 
ATOM   3422 C  CA   . SER C 1 141 ? 45.719 68.706 -5.172  1.00 222.50 ? 141 SER C CA   1 
ATOM   3423 C  C    . SER C 1 141 ? 45.490 68.683 -6.686  1.00 233.60 ? 141 SER C C    1 
ATOM   3424 O  O    . SER C 1 141 ? 44.359 68.828 -7.154  1.00 234.27 ? 141 SER C O    1 
ATOM   3425 C  CB   . SER C 1 141 ? 45.679 70.150 -4.662  1.00 226.44 ? 141 SER C CB   1 
ATOM   3426 O  OG   . SER C 1 141 ? 46.971 70.732 -4.681  1.00 235.79 ? 141 SER C OG   1 
ATOM   3427 N  N    . ASP C 1 142 ? 46.566 68.516 -7.449  1.00 233.44 ? 142 ASP C N    1 
ATOM   3428 C  CA   . ASP C 1 142 ? 46.471 68.510 -8.902  1.00 233.27 ? 142 ASP C CA   1 
ATOM   3429 C  C    . ASP C 1 142 ? 45.785 67.290 -9.506  1.00 233.21 ? 142 ASP C C    1 
ATOM   3430 O  O    . ASP C 1 142 ? 45.788 66.195 -8.937  1.00 231.37 ? 142 ASP C O    1 
ATOM   3431 C  CB   . ASP C 1 142 ? 47.837 68.745 -9.544  1.00 235.50 ? 142 ASP C CB   1 
ATOM   3432 C  CG   . ASP C 1 142 ? 48.113 70.212 -9.800  1.00 242.55 ? 142 ASP C CG   1 
ATOM   3433 O  OD1  . ASP C 1 142 ? 47.231 70.894 -10.362 1.00 242.55 ? 142 ASP C OD1  1 
ATOM   3434 O  OD2  . ASP C 1 142 ? 49.204 70.688 -9.427  1.00 247.92 ? 142 ASP C OD2  1 
ATOM   3435 N  N    . PHE C 1 143 ? 45.197 67.503 -10.676 1.00 235.18 ? 143 PHE C N    1 
ATOM   3436 C  CA   . PHE C 1 143 ? 44.491 66.452 -11.387 1.00 231.76 ? 143 PHE C CA   1 
ATOM   3437 C  C    . PHE C 1 143 ? 43.819 66.951 -12.675 1.00 227.60 ? 143 PHE C C    1 
ATOM   3438 O  O    . PHE C 1 143 ? 42.588 66.994 -12.769 1.00 224.70 ? 143 PHE C O    1 
ATOM   3439 C  CB   . PHE C 1 143 ? 43.472 65.789 -10.469 1.00 231.04 ? 143 PHE C CB   1 
ATOM   3440 C  CG   . PHE C 1 143 ? 43.225 64.359 -10.805 1.00 227.67 ? 143 PHE C CG   1 
ATOM   3441 C  CD1  . PHE C 1 143 ? 44.206 63.617 -11.441 1.00 226.55 ? 143 PHE C CD1  1 
ATOM   3442 C  CD2  . PHE C 1 143 ? 42.000 63.773 -10.551 1.00 225.45 ? 143 PHE C CD2  1 
ATOM   3443 C  CE1  . PHE C 1 143 ? 43.987 62.305 -11.788 1.00 225.53 ? 143 PHE C CE1  1 
ATOM   3444 C  CE2  . PHE C 1 143 ? 41.771 62.452 -10.888 1.00 226.09 ? 143 PHE C CE2  1 
ATOM   3445 C  CZ   . PHE C 1 143 ? 42.767 61.718 -11.512 1.00 223.57 ? 143 PHE C CZ   1 
ATOM   3446 N  N    . GLU C 1 144 ? 44.644 67.289 -13.668 1.00 228.28 ? 144 GLU C N    1 
ATOM   3447 C  CA   . GLU C 1 144 ? 44.200 67.810 -14.966 1.00 227.07 ? 144 GLU C CA   1 
ATOM   3448 C  C    . GLU C 1 144 ? 43.039 67.088 -15.655 1.00 229.45 ? 144 GLU C C    1 
ATOM   3449 O  O    . GLU C 1 144 ? 43.157 66.650 -16.802 1.00 228.20 ? 144 GLU C O    1 
ATOM   3450 C  CB   . GLU C 1 144 ? 45.382 67.936 -15.927 1.00 227.86 ? 144 GLU C CB   1 
ATOM   3451 C  CG   . GLU C 1 144 ? 46.689 68.319 -15.254 1.00 233.17 ? 144 GLU C CG   1 
ATOM   3452 C  CD   . GLU C 1 144 ? 46.720 69.772 -14.834 1.00 241.53 ? 144 GLU C CD   1 
ATOM   3453 O  OE1  . GLU C 1 144 ? 45.635 70.347 -14.603 1.00 232.39 ? 144 GLU C OE1  1 
ATOM   3454 O  OE2  . GLU C 1 144 ? 47.829 70.341 -14.746 1.00 232.13 ? 144 GLU C OE2  1 
ATOM   3455 N  N    . ASN C 1 145 ? 41.911 67.006 -14.960 1.00 230.96 ? 145 ASN C N    1 
ATOM   3456 C  CA   . ASN C 1 145 ? 40.693 66.409 -15.496 1.00 231.50 ? 145 ASN C CA   1 
ATOM   3457 C  C    . ASN C 1 145 ? 39.819 67.603 -15.818 1.00 237.66 ? 145 ASN C C    1 
ATOM   3458 O  O    . ASN C 1 145 ? 38.757 67.495 -16.434 1.00 237.26 ? 145 ASN C O    1 
ATOM   3459 C  CB   . ASN C 1 145 ? 40.007 65.571 -14.420 1.00 230.74 ? 145 ASN C CB   1 
ATOM   3460 C  CG   . ASN C 1 145 ? 40.798 64.341 -14.054 1.00 245.07 ? 145 ASN C CG   1 
ATOM   3461 O  OD1  . ASN C 1 145 ? 41.753 63.977 -14.741 1.00 238.14 ? 145 ASN C OD1  1 
ATOM   3462 N  ND2  . ASN C 1 145 ? 40.398 63.682 -12.973 1.00 235.69 ? 145 ASN C ND2  1 
ATOM   3463 N  N    . TYR C 1 146 ? 40.304 68.746 -15.354 1.00 238.40 ? 146 TYR C N    1 
ATOM   3464 C  CA   . TYR C 1 146 ? 39.667 70.037 -15.527 1.00 239.08 ? 146 TYR C CA   1 
ATOM   3465 C  C    . TYR C 1 146 ? 39.789 70.428 -16.993 1.00 245.74 ? 146 TYR C C    1 
ATOM   3466 O  O    . TYR C 1 146 ? 39.150 71.373 -17.461 1.00 245.48 ? 146 TYR C O    1 
ATOM   3467 C  CB   . TYR C 1 146 ? 40.382 71.039 -14.621 1.00 239.78 ? 146 TYR C CB   1 
ATOM   3468 C  CG   . TYR C 1 146 ? 40.961 70.374 -13.376 1.00 240.29 ? 146 TYR C CG   1 
ATOM   3469 C  CD1  . TYR C 1 146 ? 40.217 69.433 -12.660 1.00 241.91 ? 146 TYR C CD1  1 
ATOM   3470 C  CD2  . TYR C 1 146 ? 42.258 70.650 -12.940 1.00 240.61 ? 146 TYR C CD2  1 
ATOM   3471 C  CE1  . TYR C 1 146 ? 40.733 68.805 -11.534 1.00 242.01 ? 146 TYR C CE1  1 
ATOM   3472 C  CE2  . TYR C 1 146 ? 42.779 70.032 -11.803 1.00 241.19 ? 146 TYR C CE2  1 
ATOM   3473 C  CZ   . TYR C 1 146 ? 42.004 69.119 -11.101 1.00 247.18 ? 146 TYR C CZ   1 
ATOM   3474 O  OH   . TYR C 1 146 ? 42.503 68.485 -9.986  1.00 247.29 ? 146 TYR C OH   1 
ATOM   3475 N  N    . ILE C 1 147 ? 40.599 69.661 -17.717 1.00 243.93 ? 147 ILE C N    1 
ATOM   3476 C  CA   . ILE C 1 147 ? 40.766 69.857 -19.148 1.00 244.36 ? 147 ILE C CA   1 
ATOM   3477 C  C    . ILE C 1 147 ? 39.783 68.917 -19.846 1.00 246.24 ? 147 ILE C C    1 
ATOM   3478 O  O    . ILE C 1 147 ? 40.098 68.296 -20.867 1.00 245.03 ? 147 ILE C O    1 
ATOM   3479 C  CB   . ILE C 1 147 ? 42.228 69.638 -19.599 1.00 248.42 ? 147 ILE C CB   1 
ATOM   3480 C  CG1  . ILE C 1 147 ? 43.174 70.552 -18.809 1.00 249.19 ? 147 ILE C CG1  1 
ATOM   3481 C  CG2  . ILE C 1 147 ? 42.371 69.900 -21.097 1.00 249.47 ? 147 ILE C CG2  1 
ATOM   3482 C  CD1  . ILE C 1 147 ? 44.335 71.104 -19.630 1.00 256.79 ? 147 ILE C CD1  1 
ATOM   3483 N  N    . ALA C 1 148 ? 38.592 68.807 -19.257 1.00 243.28 ? 148 ALA C N    1 
ATOM   3484 C  CA   . ALA C 1 148 ? 37.509 67.989 -19.795 1.00 243.28 ? 148 ALA C CA   1 
ATOM   3485 C  C    . ALA C 1 148 ? 36.542 68.897 -20.560 1.00 243.28 ? 148 ALA C C    1 
ATOM   3486 O  O    . ALA C 1 148 ? 35.350 68.970 -20.250 1.00 243.28 ? 148 ALA C O    1 
ATOM   3487 C  CB   . ALA C 1 148 ? 36.783 67.256 -18.669 1.00 243.28 ? 148 ALA C CB   1 
ATOM   3488 N  N    . THR C 1 149 ? 37.088 69.607 -21.546 1.00 239.19 ? 149 THR C N    1 
ATOM   3489 C  CA   . THR C 1 149 ? 36.326 70.528 -22.379 1.00 240.59 ? 149 THR C CA   1 
ATOM   3490 C  C    . THR C 1 149 ? 35.845 69.808 -23.633 1.00 249.70 ? 149 THR C C    1 
ATOM   3491 O  O    . THR C 1 149 ? 36.434 68.809 -24.048 1.00 250.12 ? 149 THR C O    1 
ATOM   3492 C  CB   . THR C 1 149 ? 37.174 71.758 -22.745 1.00 249.02 ? 149 THR C CB   1 
ATOM   3493 O  OG1  . THR C 1 149 ? 37.291 72.618 -21.605 1.00 248.73 ? 149 THR C OG1  1 
ATOM   3494 C  CG2  . THR C 1 149 ? 36.546 72.519 -23.901 1.00 247.75 ? 149 THR C CG2  1 
ATOM   3495 N  N    . MET D 1 1   ? 32.518 53.056 43.622  1.00 176.43 ? 1   MET D N    1 
ATOM   3496 C  CA   . MET D 1 1   ? 32.455 52.521 44.974  1.00 176.43 ? 1   MET D CA   1 
ATOM   3497 C  C    . MET D 1 1   ? 33.323 53.311 45.949  1.00 176.43 ? 1   MET D C    1 
ATOM   3498 O  O    . MET D 1 1   ? 34.438 53.716 45.615  1.00 281.95 ? 1   MET D O    1 
ATOM   3499 C  CB   . MET D 1 1   ? 32.833 51.045 44.990  1.00 176.43 ? 1   MET D CB   1 
ATOM   3500 C  CG   . MET D 1 1   ? 31.811 50.175 45.695  1.00 176.43 ? 1   MET D CG   1 
ATOM   3501 S  SD   . MET D 1 1   ? 32.553 49.190 47.002  1.00 176.43 ? 1   MET D SD   1 
ATOM   3502 C  CE   . MET D 1 1   ? 33.394 47.884 46.045  1.00 176.43 ? 1   MET D CE   1 
ATOM   3503 N  N    . ASP D 1 2   ? 32.794 53.524 47.156  1.00 177.88 ? 2   ASP D N    1 
ATOM   3504 C  CA   . ASP D 1 2   ? 33.471 54.300 48.212  1.00 180.26 ? 2   ASP D CA   1 
ATOM   3505 C  C    . ASP D 1 2   ? 34.895 53.848 48.543  1.00 178.19 ? 2   ASP D C    1 
ATOM   3506 O  O    . ASP D 1 2   ? 35.106 52.791 49.140  1.00 176.37 ? 2   ASP D O    1 
ATOM   3507 C  CB   . ASP D 1 2   ? 32.618 54.410 49.493  1.00 186.19 ? 2   ASP D CB   1 
ATOM   3508 C  CG   . ASP D 1 2   ? 31.330 53.577 49.434  1.00 218.21 ? 2   ASP D CG   1 
ATOM   3509 O  OD1  . ASP D 1 2   ? 30.508 53.770 48.503  1.00 221.76 ? 2   ASP D OD1  1 
ATOM   3510 O  OD2  . ASP D 1 2   ? 31.114 52.768 50.366  1.00 227.13 ? 2   ASP D OD2  1 
ATOM   3511 N  N    . GLN D 1 3   ? 35.860 54.680 48.164  1.00 177.93 ? 3   GLN D N    1 
ATOM   3512 C  CA   . GLN D 1 3   ? 37.275 54.391 48.361  1.00 176.45 ? 3   GLN D CA   1 
ATOM   3513 C  C    . GLN D 1 3   ? 37.603 53.760 49.703  1.00 175.52 ? 3   GLN D C    1 
ATOM   3514 O  O    . GLN D 1 3   ? 38.481 52.905 49.809  1.00 174.90 ? 3   GLN D O    1 
ATOM   3515 C  CB   . GLN D 1 3   ? 38.104 55.659 48.180  1.00 177.55 ? 3   GLN D CB   1 
ATOM   3516 C  CG   . GLN D 1 3   ? 39.462 55.592 48.859  1.00 179.60 ? 3   GLN D CG   1 
ATOM   3517 C  CD   . GLN D 1 3   ? 40.493 54.842 48.034  1.00 186.10 ? 3   GLN D CD   1 
ATOM   3518 O  OE1  . GLN D 1 3   ? 40.247 54.494 46.873  1.00 179.72 ? 3   GLN D OE1  1 
ATOM   3519 N  NE2  . GLN D 1 3   ? 41.663 54.602 48.623  1.00 176.39 ? 3   GLN D NE2  1 
ATOM   3520 N  N    . GLU D 1 4   ? 36.904 54.199 50.736  1.00 176.49 ? 4   GLU D N    1 
ATOM   3521 C  CA   . GLU D 1 4   ? 37.134 53.659 52.066  1.00 175.20 ? 4   GLU D CA   1 
ATOM   3522 C  C    . GLU D 1 4   ? 36.876 52.155 52.032  1.00 163.73 ? 4   GLU D C    1 
ATOM   3523 O  O    . GLU D 1 4   ? 37.781 51.342 52.254  1.00 159.41 ? 4   GLU D O    1 
ATOM   3524 C  CB   . GLU D 1 4   ? 36.174 54.323 53.069  1.00 178.79 ? 4   GLU D CB   1 
ATOM   3525 C  CG   . GLU D 1 4   ? 36.164 53.691 54.469  1.00 202.01 ? 4   GLU D CG   1 
ATOM   3526 C  CD   . GLU D 1 4   ? 34.774 53.232 54.919  1.00 248.03 ? 4   GLU D CD   1 
ATOM   3527 O  OE1  . GLU D 1 4   ? 33.930 52.917 54.048  1.00 249.17 ? 4   GLU D OE1  1 
ATOM   3528 O  OE2  . GLU D 1 4   ? 34.533 53.165 56.147  1.00 248.92 ? 4   GLU D OE2  1 
ATOM   3529 N  N    . THR D 1 5   ? 35.619 51.824 51.742  1.00 160.38 ? 5   THR D N    1 
ATOM   3530 C  CA   . THR D 1 5   ? 35.095 50.465 51.689  1.00 159.66 ? 5   THR D CA   1 
ATOM   3531 C  C    . THR D 1 5   ? 35.922 49.547 50.803  1.00 160.79 ? 5   THR D C    1 
ATOM   3532 O  O    . THR D 1 5   ? 36.305 48.443 51.203  1.00 159.58 ? 5   THR D O    1 
ATOM   3533 C  CB   . THR D 1 5   ? 33.650 50.511 51.201  1.00 168.11 ? 5   THR D CB   1 
ATOM   3534 O  OG1  . THR D 1 5   ? 33.587 51.342 50.037  1.00 167.74 ? 5   THR D OG1  1 
ATOM   3535 C  CG2  . THR D 1 5   ? 32.744 51.105 52.273  1.00 166.76 ? 5   THR D CG2  1 
ATOM   3536 N  N    . VAL D 1 6   ? 36.143 49.998 49.576  1.00 155.40 ? 6   VAL D N    1 
ATOM   3537 C  CA   . VAL D 1 6   ? 36.933 49.258 48.612  1.00 153.51 ? 6   VAL D CA   1 
ATOM   3538 C  C    . VAL D 1 6   ? 38.224 48.812 49.287  1.00 162.68 ? 6   VAL D C    1 
ATOM   3539 O  O    . VAL D 1 6   ? 38.733 47.716 49.035  1.00 163.94 ? 6   VAL D O    1 
ATOM   3540 C  CB   . VAL D 1 6   ? 37.236 50.157 47.417  1.00 151.63 ? 6   VAL D CB   1 
ATOM   3541 C  CG1  . VAL D 1 6   ? 37.547 49.324 46.199  1.00 150.46 ? 6   VAL D CG1  1 
ATOM   3542 C  CG2  . VAL D 1 6   ? 36.076 51.114 47.160  1.00 150.47 ? 6   VAL D CG2  1 
ATOM   3543 N  N    . GLY D 1 7   ? 38.717 49.674 50.173  1.00 158.48 ? 7   GLY D N    1 
ATOM   3544 C  CA   . GLY D 1 7   ? 39.926 49.450 50.938  1.00 157.60 ? 7   GLY D CA   1 
ATOM   3545 C  C    . GLY D 1 7   ? 39.829 48.226 51.828  1.00 160.51 ? 7   GLY D C    1 
ATOM   3546 O  O    . GLY D 1 7   ? 40.752 47.414 51.872  1.00 159.77 ? 7   GLY D O    1 
ATOM   3547 N  N    . ASN D 1 8   ? 38.713 48.082 52.538  1.00 155.56 ? 8   ASN D N    1 
ATOM   3548 C  CA   . ASN D 1 8   ? 38.534 46.942 53.437  1.00 154.58 ? 8   ASN D CA   1 
ATOM   3549 C  C    . ASN D 1 8   ? 37.916 45.701 52.783  1.00 154.08 ? 8   ASN D C    1 
ATOM   3550 O  O    . ASN D 1 8   ? 37.133 44.973 53.406  1.00 152.53 ? 8   ASN D O    1 
ATOM   3551 C  CB   . ASN D 1 8   ? 37.777 47.341 54.709  1.00 157.40 ? 8   ASN D CB   1 
ATOM   3552 C  CG   . ASN D 1 8   ? 37.363 48.802 54.714  1.00 187.31 ? 8   ASN D CG   1 
ATOM   3553 O  OD1  . ASN D 1 8   ? 36.185 49.124 54.544  1.00 182.65 ? 8   ASN D OD1  1 
ATOM   3554 N  ND2  . ASN D 1 8   ? 38.323 49.691 54.957  1.00 180.20 ? 8   ASN D ND2  1 
ATOM   3555 N  N    . VAL D 1 9   ? 38.311 45.438 51.542  1.00 148.06 ? 9   VAL D N    1 
ATOM   3556 C  CA   . VAL D 1 9   ? 37.838 44.262 50.830  1.00 146.57 ? 9   VAL D CA   1 
ATOM   3557 C  C    . VAL D 1 9   ? 38.774 43.932 49.680  1.00 151.46 ? 9   VAL D C    1 
ATOM   3558 O  O    . VAL D 1 9   ? 38.759 42.828 49.139  1.00 151.04 ? 9   VAL D O    1 
ATOM   3559 C  CB   . VAL D 1 9   ? 36.418 44.446 50.360  1.00 147.64 ? 9   VAL D CB   1 
ATOM   3560 C  CG1  . VAL D 1 9   ? 36.284 45.771 49.598  1.00 146.96 ? 9   VAL D CG1  1 
ATOM   3561 C  CG2  . VAL D 1 9   ? 36.006 43.245 49.533  1.00 146.97 ? 9   VAL D CG2  1 
ATOM   3562 N  N    . VAL D 1 10  ? 39.602 44.907 49.337  1.00 145.57 ? 10  VAL D N    1 
ATOM   3563 C  CA   . VAL D 1 10  ? 40.576 44.764 48.284  1.00 145.72 ? 10  VAL D CA   1 
ATOM   3564 C  C    . VAL D 1 10  ? 41.344 43.462 48.384  1.00 145.28 ? 10  VAL D C    1 
ATOM   3565 O  O    . VAL D 1 10  ? 41.844 42.957 47.385  1.00 144.37 ? 10  VAL D O    1 
ATOM   3566 C  CB   . VAL D 1 10  ? 41.527 45.934 48.303  1.00 151.85 ? 10  VAL D CB   1 
ATOM   3567 C  CG1  . VAL D 1 10  ? 42.931 45.475 47.940  1.00 152.00 ? 10  VAL D CG1  1 
ATOM   3568 C  CG2  . VAL D 1 10  ? 41.014 47.026 47.382  1.00 152.01 ? 10  VAL D CG2  1 
ATOM   3569 N  N    . LEU D 1 11  ? 41.434 42.915 49.590  1.00 139.69 ? 11  LEU D N    1 
ATOM   3570 C  CA   . LEU D 1 11  ? 42.154 41.662 49.809  1.00 138.10 ? 11  LEU D CA   1 
ATOM   3571 C  C    . LEU D 1 11  ? 41.355 40.460 49.335  1.00 141.61 ? 11  LEU D C    1 
ATOM   3572 O  O    . LEU D 1 11  ? 41.864 39.575 48.640  1.00 141.54 ? 11  LEU D O    1 
ATOM   3573 C  CB   . LEU D 1 11  ? 42.460 41.497 51.289  1.00 137.17 ? 11  LEU D CB   1 
ATOM   3574 C  CG   . LEU D 1 11  ? 43.689 42.294 51.693  1.00 139.95 ? 11  LEU D CG   1 
ATOM   3575 C  CD1  . LEU D 1 11  ? 44.911 41.582 51.115  1.00 139.49 ? 11  LEU D CD1  1 
ATOM   3576 C  CD2  . LEU D 1 11  ? 43.567 43.712 51.140  1.00 141.79 ? 11  LEU D CD2  1 
ATOM   3577 N  N    . LEU D 1 12  ? 40.101 40.428 49.755  1.00 136.73 ? 12  LEU D N    1 
ATOM   3578 C  CA   . LEU D 1 12  ? 39.196 39.364 49.375  1.00 134.85 ? 12  LEU D CA   1 
ATOM   3579 C  C    . LEU D 1 12  ? 38.965 39.417 47.863  1.00 140.30 ? 12  LEU D C    1 
ATOM   3580 O  O    . LEU D 1 12  ? 38.802 38.384 47.209  1.00 140.84 ? 12  LEU D O    1 
ATOM   3581 C  CB   . LEU D 1 12  ? 37.881 39.527 50.133  1.00 133.00 ? 12  LEU D CB   1 
ATOM   3582 C  CG   . LEU D 1 12  ? 38.030 39.974 51.590  1.00 133.97 ? 12  LEU D CG   1 
ATOM   3583 C  CD1  . LEU D 1 12  ? 36.797 40.791 52.021  1.00 132.91 ? 12  LEU D CD1  1 
ATOM   3584 C  CD2  . LEU D 1 12  ? 38.292 38.773 52.519  1.00 135.21 ? 12  LEU D CD2  1 
ATOM   3585 N  N    . ALA D 1 13  ? 38.965 40.627 47.312  1.00 135.49 ? 13  ALA D N    1 
ATOM   3586 C  CA   . ALA D 1 13  ? 38.813 40.805 45.876  1.00 134.20 ? 13  ALA D CA   1 
ATOM   3587 C  C    . ALA D 1 13  ? 40.039 40.183 45.211  1.00 132.84 ? 13  ALA D C    1 
ATOM   3588 O  O    . ALA D 1 13  ? 39.925 39.326 44.332  1.00 131.34 ? 13  ALA D O    1 
ATOM   3589 C  CB   . ALA D 1 13  ? 38.724 42.293 45.532  1.00 135.25 ? 13  ALA D CB   1 
ATOM   3590 N  N    . ILE D 1 14  ? 41.214 40.607 45.660  1.00 127.76 ? 14  ILE D N    1 
ATOM   3591 C  CA   . ILE D 1 14  ? 42.470 40.111 45.121  1.00 126.80 ? 14  ILE D CA   1 
ATOM   3592 C  C    . ILE D 1 14  ? 42.506 38.596 45.127  1.00 130.63 ? 14  ILE D C    1 
ATOM   3593 O  O    . ILE D 1 14  ? 42.574 37.965 44.073  1.00 129.74 ? 14  ILE D O    1 
ATOM   3594 C  CB   . ILE D 1 14  ? 43.673 40.722 45.856  1.00 129.25 ? 14  ILE D CB   1 
ATOM   3595 C  CG1  . ILE D 1 14  ? 44.390 41.729 44.957  1.00 129.38 ? 14  ILE D CG1  1 
ATOM   3596 C  CG2  . ILE D 1 14  ? 44.623 39.647 46.322  1.00 129.75 ? 14  ILE D CG2  1 
ATOM   3597 C  CD1  . ILE D 1 14  ? 44.650 43.055 45.626  1.00 136.39 ? 14  ILE D CD1  1 
ATOM   3598 N  N    . VAL D 1 15  ? 42.425 38.015 46.316  1.00 125.93 ? 15  VAL D N    1 
ATOM   3599 C  CA   . VAL D 1 15  ? 42.462 36.572 46.437  1.00 124.01 ? 15  VAL D CA   1 
ATOM   3600 C  C    . VAL D 1 15  ? 41.381 35.944 45.553  1.00 132.88 ? 15  VAL D C    1 
ATOM   3601 O  O    . VAL D 1 15  ? 41.615 34.941 44.874  1.00 133.48 ? 15  VAL D O    1 
ATOM   3602 C  CB   . VAL D 1 15  ? 42.401 36.118 47.909  1.00 121.74 ? 15  VAL D CB   1 
ATOM   3603 C  CG1  . VAL D 1 15  ? 40.981 35.743 48.299  1.00 120.48 ? 15  VAL D CG1  1 
ATOM   3604 C  CG2  . VAL D 1 15  ? 43.394 34.971 48.165  1.00 120.49 ? 15  VAL D CG2  1 
ATOM   3605 N  N    . THR D 1 16  ? 40.220 36.582 45.499  1.00 128.66 ? 16  THR D N    1 
ATOM   3606 C  CA   . THR D 1 16  ? 39.131 36.090 44.671  1.00 128.13 ? 16  THR D CA   1 
ATOM   3607 C  C    . THR D 1 16  ? 39.497 36.088 43.185  1.00 132.15 ? 16  THR D C    1 
ATOM   3608 O  O    . THR D 1 16  ? 39.318 35.080 42.504  1.00 131.59 ? 16  THR D O    1 
ATOM   3609 C  CB   . THR D 1 16  ? 37.842 36.864 44.941  1.00 131.75 ? 16  THR D CB   1 
ATOM   3610 O  OG1  . THR D 1 16  ? 37.206 36.325 46.107  1.00 130.34 ? 16  THR D OG1  1 
ATOM   3611 C  CG2  . THR D 1 16  ? 36.912 36.779 43.744  1.00 129.38 ? 16  THR D CG2  1 
ATOM   3612 N  N    . LEU D 1 17  ? 40.020 37.211 42.695  1.00 130.12 ? 17  LEU D N    1 
ATOM   3613 C  CA   . LEU D 1 17  ? 40.420 37.336 41.291  1.00 130.00 ? 17  LEU D CA   1 
ATOM   3614 C  C    . LEU D 1 17  ? 41.522 36.351 40.986  1.00 133.96 ? 17  LEU D C    1 
ATOM   3615 O  O    . LEU D 1 17  ? 41.728 35.950 39.838  1.00 133.36 ? 17  LEU D O    1 
ATOM   3616 C  CB   . LEU D 1 17  ? 40.927 38.740 40.996  1.00 129.93 ? 17  LEU D CB   1 
ATOM   3617 C  CG   . LEU D 1 17  ? 39.882 39.823 41.221  1.00 134.20 ? 17  LEU D CG   1 
ATOM   3618 C  CD1  . LEU D 1 17  ? 39.876 40.816 40.076  1.00 134.21 ? 17  LEU D CD1  1 
ATOM   3619 C  CD2  . LEU D 1 17  ? 38.518 39.172 41.388  1.00 136.51 ? 17  LEU D CD2  1 
ATOM   3620 N  N    . ILE D 1 18  ? 42.259 36.003 42.029  1.00 131.52 ? 18  ILE D N    1 
ATOM   3621 C  CA   . ILE D 1 18  ? 43.338 35.047 41.912  1.00 131.54 ? 18  ILE D CA   1 
ATOM   3622 C  C    . ILE D 1 18  ? 42.685 33.710 41.636  1.00 137.91 ? 18  ILE D C    1 
ATOM   3623 O  O    . ILE D 1 18  ? 42.864 33.124 40.571  1.00 138.12 ? 18  ILE D O    1 
ATOM   3624 C  CB   . ILE D 1 18  ? 44.138 34.988 43.212  1.00 133.97 ? 18  ILE D CB   1 
ATOM   3625 C  CG1  . ILE D 1 18  ? 45.280 35.999 43.181  1.00 134.08 ? 18  ILE D CG1  1 
ATOM   3626 C  CG2  . ILE D 1 18  ? 44.620 33.576 43.481  1.00 134.45 ? 18  ILE D CG2  1 
ATOM   3627 C  CD1  . ILE D 1 18  ? 45.163 37.054 44.238  1.00 141.04 ? 18  ILE D CD1  1 
ATOM   3628 N  N    . SER D 1 19  ? 41.889 33.263 42.601  1.00 136.45 ? 19  SER D N    1 
ATOM   3629 C  CA   . SER D 1 19  ? 41.159 32.009 42.504  1.00 136.51 ? 19  SER D CA   1 
ATOM   3630 C  C    . SER D 1 19  ? 40.364 31.944 41.204  1.00 142.87 ? 19  SER D C    1 
ATOM   3631 O  O    . SER D 1 19  ? 40.180 30.864 40.642  1.00 142.26 ? 19  SER D O    1 
ATOM   3632 C  CB   . SER D 1 19  ? 40.211 31.873 43.696  1.00 139.47 ? 19  SER D CB   1 
ATOM   3633 O  OG   . SER D 1 19  ? 39.488 33.076 43.910  1.00 147.73 ? 19  SER D OG   1 
ATOM   3634 N  N    . VAL D 1 20  ? 39.900 33.102 40.731  1.00 139.62 ? 20  VAL D N    1 
ATOM   3635 C  CA   . VAL D 1 20  ? 39.139 33.178 39.478  1.00 138.65 ? 20  VAL D CA   1 
ATOM   3636 C  C    . VAL D 1 20  ? 40.004 32.787 38.279  1.00 145.93 ? 20  VAL D C    1 
ATOM   3637 O  O    . VAL D 1 20  ? 39.533 32.111 37.355  1.00 146.38 ? 20  VAL D O    1 
ATOM   3638 C  CB   . VAL D 1 20  ? 38.463 34.560 39.276  1.00 138.32 ? 20  VAL D CB   1 
ATOM   3639 C  CG1  . VAL D 1 20  ? 38.669 35.080 37.838  1.00 137.37 ? 20  VAL D CG1  1 
ATOM   3640 C  CG2  . VAL D 1 20  ? 36.981 34.474 39.618  1.00 137.38 ? 20  VAL D CG2  1 
ATOM   3641 N  N    . VAL D 1 21  ? 41.272 33.199 38.303  1.00 141.06 ? 21  VAL D N    1 
ATOM   3642 C  CA   . VAL D 1 21  ? 42.193 32.833 37.235  1.00 139.96 ? 21  VAL D CA   1 
ATOM   3643 C  C    . VAL D 1 21  ? 42.728 31.422 37.392  1.00 148.25 ? 21  VAL D C    1 
ATOM   3644 O  O    . VAL D 1 21  ? 42.917 30.734 36.401  1.00 148.35 ? 21  VAL D O    1 
ATOM   3645 C  CB   . VAL D 1 21  ? 43.340 33.789 37.074  1.00 140.67 ? 21  VAL D CB   1 
ATOM   3646 C  CG1  . VAL D 1 21  ? 44.589 33.176 37.699  1.00 139.95 ? 21  VAL D CG1  1 
ATOM   3647 C  CG2  . VAL D 1 21  ? 43.563 34.019 35.594  1.00 139.97 ? 21  VAL D CG2  1 
ATOM   3648 N  N    . GLN D 1 22  ? 42.997 31.003 38.627  1.00 144.08 ? 22  GLN D N    1 
ATOM   3649 C  CA   . GLN D 1 22  ? 43.452 29.644 38.876  1.00 144.84 ? 22  GLN D CA   1 
ATOM   3650 C  C    . GLN D 1 22  ? 42.359 28.747 38.332  1.00 152.07 ? 22  GLN D C    1 
ATOM   3651 O  O    . GLN D 1 22  ? 42.621 27.682 37.777  1.00 152.25 ? 22  GLN D O    1 
ATOM   3652 C  CB   . GLN D 1 22  ? 43.571 29.379 40.376  1.00 145.80 ? 22  GLN D CB   1 
ATOM   3653 C  CG   . GLN D 1 22  ? 43.670 27.891 40.729  1.00 147.81 ? 22  GLN D CG   1 
ATOM   3654 C  CD   . GLN D 1 22  ? 43.070 27.546 42.085  1.00 154.22 ? 22  GLN D CD   1 
ATOM   3655 O  OE1  . GLN D 1 22  ? 41.973 27.997 42.413  1.00 147.83 ? 22  GLN D OE1  1 
ATOM   3656 N  NE2  . GLN D 1 22  ? 43.777 26.722 42.867  1.00 144.48 ? 22  GLN D NE2  1 
ATOM   3657 N  N    . ASN D 1 23  ? 41.120 29.194 38.502  1.00 153.42 ? 23  ASN D N    1 
ATOM   3658 C  CA   . ASN D 1 23  ? 39.954 28.453 38.033  1.00 153.03 ? 23  ASN D CA   1 
ATOM   3659 C  C    . ASN D 1 23  ? 39.981 28.220 36.536  1.00 157.34 ? 23  ASN D C    1 
ATOM   3660 O  O    . ASN D 1 23  ? 39.841 27.086 36.074  1.00 156.29 ? 23  ASN D O    1 
ATOM   3661 C  CB   . ASN D 1 23  ? 38.670 29.188 38.402  1.00 150.60 ? 23  ASN D CB   1 
ATOM   3662 C  CG   . ASN D 1 23  ? 38.109 28.727 39.727  1.00 156.91 ? 23  ASN D CG   1 
ATOM   3663 O  OD1  . ASN D 1 23  ? 38.846 28.614 40.717  1.00 148.81 ? 23  ASN D OD1  1 
ATOM   3664 N  ND2  . ASN D 1 23  ? 36.818 28.390 39.743  1.00 146.36 ? 23  ASN D ND2  1 
ATOM   3665 N  N    . GLY D 1 24  ? 40.136 29.304 35.784  1.00 159.58 ? 24  GLY D N    1 
ATOM   3666 C  CA   . GLY D 1 24  ? 40.200 29.237 34.338  1.00 159.85 ? 24  GLY D CA   1 
ATOM   3667 C  C    . GLY D 1 24  ? 41.316 28.315 33.879  1.00 163.36 ? 24  GLY D C    1 
ATOM   3668 O  O    . GLY D 1 24  ? 41.311 27.829 32.751  1.00 162.91 ? 24  GLY D O    1 
ATOM   3669 N  N    . PHE D 1 25  ? 42.299 28.101 34.745  1.00 166.18 ? 25  PHE D N    1 
ATOM   3670 C  CA   . PHE D 1 25  ? 43.414 27.230 34.414  1.00 170.17 ? 25  PHE D CA   1 
ATOM   3671 C  C    . PHE D 1 25  ? 42.935 25.795 34.491  1.00 162.36 ? 25  PHE D C    1 
ATOM   3672 O  O    . PHE D 1 25  ? 43.114 25.022 33.556  1.00 158.06 ? 25  PHE D O    1 
ATOM   3673 C  CB   . PHE D 1 25  ? 44.566 27.438 35.390  1.00 181.45 ? 25  PHE D CB   1 
ATOM   3674 C  CG   . PHE D 1 25  ? 45.466 26.254 35.511  1.00 195.97 ? 25  PHE D CG   1 
ATOM   3675 C  CD1  . PHE D 1 25  ? 45.858 25.554 34.390  1.00 208.41 ? 25  PHE D CD1  1 
ATOM   3676 C  CD2  . PHE D 1 25  ? 45.916 25.839 36.742  1.00 207.83 ? 25  PHE D CD2  1 
ATOM   3677 C  CE1  . PHE D 1 25  ? 46.664 24.456 34.498  1.00 213.13 ? 25  PHE D CE1  1 
ATOM   3678 C  CE2  . PHE D 1 25  ? 46.737 24.751 36.855  1.00 214.89 ? 25  PHE D CE2  1 
ATOM   3679 C  CZ   . PHE D 1 25  ? 47.115 24.058 35.731  1.00 214.04 ? 25  PHE D CZ   1 
ATOM   3680 N  N    . PHE D 1 26  ? 42.343 25.441 35.623  1.00 162.71 ? 26  PHE D N    1 
ATOM   3681 C  CA   . PHE D 1 26  ? 41.803 24.104 35.813  1.00 165.92 ? 26  PHE D CA   1 
ATOM   3682 C  C    . PHE D 1 26  ? 40.920 23.749 34.621  1.00 169.63 ? 26  PHE D C    1 
ATOM   3683 O  O    . PHE D 1 26  ? 40.948 22.624 34.121  1.00 167.13 ? 26  PHE D O    1 
ATOM   3684 C  CB   . PHE D 1 26  ? 40.948 24.068 37.078  1.00 171.02 ? 26  PHE D CB   1 
ATOM   3685 C  CG   . PHE D 1 26  ? 41.734 24.217 38.342  1.00 176.96 ? 26  PHE D CG   1 
ATOM   3686 C  CD1  . PHE D 1 26  ? 43.113 24.311 38.304  1.00 183.14 ? 26  PHE D CD1  1 
ATOM   3687 C  CD2  . PHE D 1 26  ? 41.094 24.264 39.570  1.00 182.33 ? 26  PHE D CD2  1 
ATOM   3688 C  CE1  . PHE D 1 26  ? 43.846 24.434 39.471  1.00 185.29 ? 26  PHE D CE1  1 
ATOM   3689 C  CE2  . PHE D 1 26  ? 41.820 24.397 40.742  1.00 186.52 ? 26  PHE D CE2  1 
ATOM   3690 C  CZ   . PHE D 1 26  ? 43.198 24.484 40.694  1.00 184.94 ? 26  PHE D CZ   1 
ATOM   3691 N  N    . ALA D 1 27  ? 40.138 24.730 34.177  1.00 168.53 ? 27  ALA D N    1 
ATOM   3692 C  CA   . ALA D 1 27  ? 39.211 24.556 33.063  1.00 171.72 ? 27  ALA D CA   1 
ATOM   3693 C  C    . ALA D 1 27  ? 39.926 24.585 31.735  1.00 169.97 ? 27  ALA D C    1 
ATOM   3694 O  O    . ALA D 1 27  ? 39.311 24.455 30.681  1.00 166.73 ? 27  ALA D O    1 
ATOM   3695 C  CB   . ALA D 1 27  ? 38.141 25.622 33.093  1.00 174.01 ? 27  ALA D CB   1 
ATOM   3696 N  N    . HIS D 1 28  ? 41.231 24.787 31.793  1.00 169.65 ? 28  HIS D N    1 
ATOM   3697 C  CA   . HIS D 1 28  ? 42.032 24.821 30.589  1.00 173.79 ? 28  HIS D CA   1 
ATOM   3698 C  C    . HIS D 1 28  ? 42.727 23.473 30.429  1.00 173.71 ? 28  HIS D C    1 
ATOM   3699 O  O    . HIS D 1 28  ? 42.787 22.914 29.332  1.00 172.60 ? 28  HIS D O    1 
ATOM   3700 C  CB   . HIS D 1 28  ? 43.054 25.946 30.667  1.00 179.90 ? 28  HIS D CB   1 
ATOM   3701 C  CG   . HIS D 1 28  ? 44.206 25.761 29.739  1.00 188.38 ? 28  HIS D CG   1 
ATOM   3702 N  ND1  . HIS D 1 28  ? 44.205 26.248 28.451  1.00 192.65 ? 28  HIS D ND1  1 
ATOM   3703 C  CD2  . HIS D 1 28  ? 45.371 25.088 29.890  1.00 193.56 ? 28  HIS D CD2  1 
ATOM   3704 C  CE1  . HIS D 1 28  ? 45.334 25.908 27.856  1.00 193.69 ? 28  HIS D CE1  1 
ATOM   3705 N  NE2  . HIS D 1 28  ? 46.060 25.205 28.708  1.00 194.19 ? 28  HIS D NE2  1 
ATOM   3706 N  N    . LYS D 1 29  ? 43.233 22.943 31.537  1.00 173.98 ? 29  LYS D N    1 
ATOM   3707 C  CA   . LYS D 1 29  ? 43.876 21.646 31.519  1.00 173.80 ? 29  LYS D CA   1 
ATOM   3708 C  C    . LYS D 1 29  ? 42.810 20.603 31.237  1.00 175.28 ? 29  LYS D C    1 
ATOM   3709 O  O    . LYS D 1 29  ? 43.115 19.428 31.063  1.00 173.23 ? 29  LYS D O    1 
ATOM   3710 C  CB   . LYS D 1 29  ? 44.556 21.364 32.851  1.00 177.94 ? 29  LYS D CB   1 
ATOM   3711 C  CG   . LYS D 1 29  ? 46.050 21.321 32.741  1.00 205.92 ? 29  LYS D CG   1 
ATOM   3712 C  CD   . LYS D 1 29  ? 46.497 21.949 31.440  1.00 222.25 ? 29  LYS D CD   1 
ATOM   3713 C  CE   . LYS D 1 29  ? 47.961 22.361 31.506  1.00 236.61 ? 29  LYS D CE   1 
ATOM   3714 N  NZ   . LYS D 1 29  ? 48.426 23.036 30.259  1.00 246.54 ? 29  LYS D NZ   1 
ATOM   3715 N  N    . VAL D 1 30  ? 41.554 21.046 31.183  1.00 175.87 ? 30  VAL D N    1 
ATOM   3716 C  CA   . VAL D 1 30  ? 40.427 20.164 30.882  1.00 177.04 ? 30  VAL D CA   1 
ATOM   3717 C  C    . VAL D 1 30  ? 40.154 20.195 29.383  1.00 186.45 ? 30  VAL D C    1 
ATOM   3718 O  O    . VAL D 1 30  ? 39.639 19.236 28.819  1.00 185.66 ? 30  VAL D O    1 
ATOM   3719 C  CB   . VAL D 1 30  ? 39.165 20.545 31.684  1.00 179.77 ? 30  VAL D CB   1 
ATOM   3720 C  CG1  . VAL D 1 30  ? 37.988 19.744 31.207  1.00 179.38 ? 30  VAL D CG1  1 
ATOM   3721 C  CG2  . VAL D 1 30  ? 39.380 20.306 33.163  1.00 179.39 ? 30  VAL D CG2  1 
ATOM   3722 N  N    . GLU D 1 31  ? 40.517 21.294 28.734  1.00 184.98 ? 31  GLU D N    1 
ATOM   3723 C  CA   . GLU D 1 31  ? 40.325 21.401 27.299  1.00 187.81 ? 31  GLU D CA   1 
ATOM   3724 C  C    . GLU D 1 31  ? 41.395 20.618 26.576  1.00 192.73 ? 31  GLU D C    1 
ATOM   3725 O  O    . GLU D 1 31  ? 41.132 19.997 25.553  1.00 192.46 ? 31  GLU D O    1 
ATOM   3726 C  CB   . GLU D 1 31  ? 40.354 22.850 26.839  1.00 190.05 ? 31  GLU D CB   1 
ATOM   3727 C  CG   . GLU D 1 31  ? 39.766 23.047 25.459  1.00 202.88 ? 31  GLU D CG   1 
ATOM   3728 C  CD   . GLU D 1 31  ? 38.315 22.601 25.370  1.00 226.33 ? 31  GLU D CD   1 
ATOM   3729 O  OE1  . GLU D 1 31  ? 37.816 21.972 26.329  1.00 221.27 ? 31  GLU D OE1  1 
ATOM   3730 O  OE2  . GLU D 1 31  ? 37.670 22.889 24.337  1.00 221.01 ? 31  GLU D OE2  1 
ATOM   3731 N  N    . HIS D 1 32  ? 42.603 20.643 27.124  1.00 195.44 ? 32  HIS D N    1 
ATOM   3732 C  CA   . HIS D 1 32  ? 43.724 19.919 26.541  1.00 197.37 ? 32  HIS D CA   1 
ATOM   3733 C  C    . HIS D 1 32  ? 43.427 18.430 26.428  1.00 196.10 ? 32  HIS D C    1 
ATOM   3734 O  O    . HIS D 1 32  ? 43.830 17.787 25.465  1.00 195.17 ? 32  HIS D O    1 
ATOM   3735 C  CB   . HIS D 1 32  ? 44.990 20.113 27.377  1.00 202.34 ? 32  HIS D CB   1 
ATOM   3736 C  CG   . HIS D 1 32  ? 45.959 21.091 26.790  1.00 209.80 ? 32  HIS D CG   1 
ATOM   3737 N  ND1  . HIS D 1 32  ? 47.301 21.087 27.107  1.00 213.51 ? 32  HIS D ND1  1 
ATOM   3738 C  CD2  . HIS D 1 32  ? 45.779 22.117 25.923  1.00 214.07 ? 32  HIS D CD2  1 
ATOM   3739 C  CE1  . HIS D 1 32  ? 47.907 22.067 26.459  1.00 214.04 ? 32  HIS D CE1  1 
ATOM   3740 N  NE2  . HIS D 1 32  ? 47.007 22.705 25.731  1.00 214.46 ? 32  HIS D NE2  1 
ATOM   3741 N  N    . GLU D 1 33  ? 42.747 17.877 27.427  1.00 200.40 ? 33  GLU D N    1 
ATOM   3742 C  CA   . GLU D 1 33  ? 42.439 16.451 27.428  1.00 200.14 ? 33  GLU D CA   1 
ATOM   3743 C  C    . GLU D 1 33  ? 41.190 16.075 26.632  1.00 198.39 ? 33  GLU D C    1 
ATOM   3744 O  O    . GLU D 1 33  ? 41.028 14.920 26.237  1.00 194.23 ? 33  GLU D O    1 
ATOM   3745 C  CB   . GLU D 1 33  ? 42.382 15.895 28.852  1.00 202.81 ? 33  GLU D CB   1 
ATOM   3746 C  CG   . GLU D 1 33  ? 43.594 16.247 29.702  1.00 222.04 ? 33  GLU D CG   1 
ATOM   3747 C  CD   . GLU D 1 33  ? 44.861 15.575 29.224  1.00 259.69 ? 33  GLU D CD   1 
ATOM   3748 O  OE1  . GLU D 1 33  ? 45.722 16.272 28.646  1.00 258.53 ? 33  GLU D OE1  1 
ATOM   3749 O  OE2  . GLU D 1 33  ? 44.999 14.353 29.437  1.00 258.27 ? 33  GLU D OE2  1 
ATOM   3750 N  N    . SER D 1 34  ? 40.321 17.051 26.383  1.00 195.60 ? 34  SER D N    1 
ATOM   3751 C  CA   . SER D 1 34  ? 39.110 16.813 25.602  1.00 199.64 ? 34  SER D CA   1 
ATOM   3752 C  C    . SER D 1 34  ? 39.447 16.985 24.129  1.00 212.61 ? 34  SER D C    1 
ATOM   3753 O  O    . SER D 1 34  ? 38.674 16.593 23.250  1.00 212.68 ? 34  SER D O    1 
ATOM   3754 C  CB   . SER D 1 34  ? 38.006 17.803 25.997  1.00 203.96 ? 34  SER D CB   1 
ATOM   3755 O  OG   . SER D 1 34  ? 36.810 17.590 25.258  1.00 213.38 ? 34  SER D OG   1 
ATOM   3756 N  N    . ARG D 1 35  ? 40.611 17.574 23.868  1.00 208.67 ? 35  ARG D N    1 
ATOM   3757 C  CA   . ARG D 1 35  ? 41.056 17.803 22.497  1.00 211.05 ? 35  ARG D CA   1 
ATOM   3758 C  C    . ARG D 1 35  ? 42.013 16.725 21.957  1.00 219.54 ? 35  ARG D C    1 
ATOM   3759 O  O    . ARG D 1 35  ? 41.892 16.315 20.798  1.00 220.36 ? 35  ARG D O    1 
ATOM   3760 C  CB   . ARG D 1 35  ? 41.588 19.229 22.303  1.00 211.63 ? 35  ARG D CB   1 
ATOM   3761 C  CG   . ARG D 1 35  ? 40.702 20.116 21.412  1.00 219.76 ? 35  ARG D CG   1 
ATOM   3762 C  CD   . ARG D 1 35  ? 39.363 20.488 22.069  1.00 224.75 ? 35  ARG D CD   1 
ATOM   3763 N  NE   . ARG D 1 35  ? 38.282 19.559 21.722  1.00 228.28 ? 35  ARG D NE   1 
ATOM   3764 C  CZ   . ARG D 1 35  ? 36.986 19.869 21.707  1.00 239.36 ? 35  ARG D CZ   1 
ATOM   3765 N  NH1  . ARG D 1 35  ? 36.584 21.098 22.006  1.00 226.07 ? 35  ARG D NH1  1 
ATOM   3766 N  NH2  . ARG D 1 35  ? 36.087 18.947 21.387  1.00 225.48 ? 35  ARG D NH2  1 
ATOM   3767 N  N    . THR D 1 36  ? 42.924 16.237 22.803  1.00 217.37 ? 36  THR D N    1 
ATOM   3768 C  CA   . THR D 1 36  ? 43.840 15.158 22.411  1.00 217.99 ? 36  THR D CA   1 
ATOM   3769 C  C    . THR D 1 36  ? 43.005 13.903 22.149  1.00 227.53 ? 36  THR D C    1 
ATOM   3770 O  O    . THR D 1 36  ? 43.436 12.971 21.461  1.00 227.84 ? 36  THR D O    1 
ATOM   3771 C  CB   . THR D 1 36  ? 44.923 14.884 23.495  1.00 221.08 ? 36  THR D CB   1 
ATOM   3772 O  OG1  . THR D 1 36  ? 44.349 14.174 24.605  1.00 219.63 ? 36  THR D OG1  1 
ATOM   3773 C  CG2  . THR D 1 36  ? 45.554 16.186 23.979  1.00 218.65 ? 36  THR D CG2  1 
ATOM   3774 N  N    . GLN D 1 37  ? 41.798 13.917 22.714  1.00 228.41 ? 37  GLN D N    1 
ATOM   3775 C  CA   . GLN D 1 37  ? 40.823 12.840 22.589  1.00 229.36 ? 37  GLN D CA   1 
ATOM   3776 C  C    . GLN D 1 37  ? 39.907 13.125 21.397  1.00 236.11 ? 37  GLN D C    1 
ATOM   3777 O  O    . GLN D 1 37  ? 38.902 12.442 21.187  1.00 235.84 ? 37  GLN D O    1 
ATOM   3778 C  CB   . GLN D 1 37  ? 39.993 12.752 23.878  1.00 230.30 ? 37  GLN D CB   1 
ATOM   3779 C  CG   . GLN D 1 37  ? 39.311 11.409 24.113  1.00 223.04 ? 37  GLN D CG   1 
ATOM   3780 C  CD   . GLN D 1 37  ? 39.036 11.134 25.583  1.00 220.28 ? 37  GLN D CD   1 
ATOM   3781 O  OE1  . GLN D 1 37  ? 39.953 10.829 26.346  1.00 212.49 ? 37  GLN D OE1  1 
ATOM   3782 N  NE2  . GLN D 1 37  ? 37.768 11.226 25.983  1.00 209.14 ? 37  GLN D NE2  1 
ATOM   3783 N  N    . ASN D 1 38  ? 40.258 14.157 20.634  1.00 235.86 ? 38  ASN D N    1 
ATOM   3784 C  CA   . ASN D 1 38  ? 39.510 14.548 19.442  1.00 235.39 ? 38  ASN D CA   1 
ATOM   3785 C  C    . ASN D 1 38  ? 38.281 15.442 19.678  1.00 235.36 ? 38  ASN D C    1 
ATOM   3786 O  O    . ASN D 1 38  ? 37.624 15.369 20.725  1.00 233.58 ? 38  ASN D O    1 
ATOM   3787 C  CB   . ASN D 1 38  ? 39.181 13.328 18.569  1.00 239.54 ? 38  ASN D CB   1 
ATOM   3788 C  CG   . ASN D 1 38  ? 40.413 12.745 17.892  1.00 274.72 ? 38  ASN D CG   1 
ATOM   3789 O  OD1  . ASN D 1 38  ? 40.516 12.737 16.665  1.00 270.81 ? 38  ASN D OD1  1 
ATOM   3790 N  ND2  . ASN D 1 38  ? 41.361 12.267 18.693  1.00 268.36 ? 38  ASN D ND2  1 
ATOM   3791 N  N    . GLY D 1 39  ? 37.998 16.293 18.690  1.00 234.45 ? 39  GLY D N    1 
ATOM   3792 C  CA   . GLY D 1 39  ? 36.895 17.241 18.709  1.00 233.79 ? 39  GLY D CA   1 
ATOM   3793 C  C    . GLY D 1 39  ? 35.539 16.669 18.330  1.00 234.95 ? 39  GLY D C    1 
ATOM   3794 O  O    . GLY D 1 39  ? 34.869 17.170 17.420  1.00 233.56 ? 39  GLY D O    1 
ATOM   3795 N  N    . ARG D 1 40  ? 35.137 15.615 19.037  1.00 233.31 ? 40  ARG D N    1 
ATOM   3796 C  CA   . ARG D 1 40  ? 33.832 14.983 18.837  1.00 234.28 ? 40  ARG D CA   1 
ATOM   3797 C  C    . ARG D 1 40  ? 32.923 15.578 19.916  1.00 242.23 ? 40  ARG D C    1 
ATOM   3798 O  O    . ARG D 1 40  ? 32.253 14.854 20.661  1.00 242.59 ? 40  ARG D O    1 
ATOM   3799 C  CB   . ARG D 1 40  ? 33.942 13.458 19.010  1.00 234.30 ? 40  ARG D CB   1 
ATOM   3800 C  CG   . ARG D 1 40  ? 35.205 12.837 18.409  1.00 243.73 ? 40  ARG D CG   1 
ATOM   3801 C  CD   . ARG D 1 40  ? 35.316 13.110 16.907  1.00 250.64 ? 40  ARG D CD   1 
ATOM   3802 N  NE   . ARG D 1 40  ? 36.558 13.805 16.557  1.00 254.59 ? 40  ARG D NE   1 
ATOM   3803 C  CZ   . ARG D 1 40  ? 36.923 14.131 15.318  1.00 264.93 ? 40  ARG D CZ   1 
ATOM   3804 N  NH1  . ARG D 1 40  ? 36.143 13.827 14.289  1.00 251.33 ? 40  ARG D NH1  1 
ATOM   3805 N  NH2  . ARG D 1 40  ? 38.071 14.765 15.106  1.00 250.74 ? 40  ARG D NH2  1 
ATOM   3806 N  N    . SER D 1 41  ? 32.949 16.909 20.006  1.00 238.63 ? 41  SER D N    1 
ATOM   3807 C  CA   . SER D 1 41  ? 32.237 17.659 21.038  1.00 239.91 ? 41  SER D CA   1 
ATOM   3808 C  C    . SER D 1 41  ? 33.046 17.452 22.325  1.00 253.55 ? 41  SER D C    1 
ATOM   3809 O  O    . SER D 1 41  ? 34.279 17.526 22.297  1.00 255.40 ? 41  SER D O    1 
ATOM   3810 C  CB   . SER D 1 41  ? 30.796 17.164 21.182  1.00 240.40 ? 41  SER D CB   1 
ATOM   3811 O  OG   . SER D 1 41  ? 29.931 17.873 20.306  1.00 245.91 ? 41  SER D OG   1 
ATOM   3812 N  N    . PHE D 1 42  ? 32.374 17.186 23.443  1.00 250.09 ? 42  PHE D N    1 
ATOM   3813 C  CA   . PHE D 1 42  ? 33.091 16.880 24.682  1.00 249.07 ? 42  PHE D CA   1 
ATOM   3814 C  C    . PHE D 1 42  ? 32.871 15.401 24.921  1.00 246.18 ? 42  PHE D C    1 
ATOM   3815 O  O    . PHE D 1 42  ? 32.241 14.706 24.114  1.00 244.29 ? 42  PHE D O    1 
ATOM   3816 C  CB   . PHE D 1 42  ? 32.580 17.632 25.922  1.00 251.42 ? 42  PHE D CB   1 
ATOM   3817 C  CG   . PHE D 1 42  ? 32.269 19.080 25.695  1.00 252.68 ? 42  PHE D CG   1 
ATOM   3818 C  CD1  . PHE D 1 42  ? 31.474 19.481 24.630  1.00 255.06 ? 42  PHE D CD1  1 
ATOM   3819 C  CD2  . PHE D 1 42  ? 32.658 20.027 26.623  1.00 254.03 ? 42  PHE D CD2  1 
ATOM   3820 C  CE1  . PHE D 1 42  ? 31.135 20.803 24.451  1.00 255.49 ? 42  PHE D CE1  1 
ATOM   3821 C  CE2  . PHE D 1 42  ? 32.305 21.347 26.457  1.00 256.29 ? 42  PHE D CE2  1 
ATOM   3822 C  CZ   . PHE D 1 42  ? 31.543 21.733 25.365  1.00 254.21 ? 42  PHE D CZ   1 
ATOM   3823 N  N    . GLN D 1 43  ? 33.344 14.939 26.067  1.00 240.64 ? 43  GLN D N    1 
ATOM   3824 C  CA   . GLN D 1 43  ? 33.213 13.541 26.423  1.00 239.26 ? 43  GLN D CA   1 
ATOM   3825 C  C    . GLN D 1 43  ? 33.157 13.443 27.949  1.00 247.62 ? 43  GLN D C    1 
ATOM   3826 O  O    . GLN D 1 43  ? 33.588 14.360 28.648  1.00 248.40 ? 43  GLN D O    1 
ATOM   3827 C  CB   . GLN D 1 43  ? 34.396 12.741 25.838  1.00 238.72 ? 43  GLN D CB   1 
ATOM   3828 C  CG   . GLN D 1 43  ? 34.342 12.546 24.296  1.00 224.41 ? 43  GLN D CG   1 
ATOM   3829 C  CD   . GLN D 1 43  ? 35.535 13.158 23.540  1.00 216.93 ? 43  GLN D CD   1 
ATOM   3830 O  OE1  . GLN D 1 43  ? 36.531 13.570 24.143  1.00 208.53 ? 43  GLN D OE1  1 
ATOM   3831 N  NE2  . GLN D 1 43  ? 35.435 13.204 22.210  1.00 205.19 ? 43  GLN D NE2  1 
ATOM   3832 N  N    . ARG D 1 44  ? 32.562 12.368 28.457  1.00 240.25 ? 44  ARG D N    1 
ATOM   3833 C  CA   . ARG D 1 44  ? 32.468 12.156 29.897  1.00 240.71 ? 44  ARG D CA   1 
ATOM   3834 C  C    . ARG D 1 44  ? 33.551 11.145 30.274  1.00 247.36 ? 44  ARG D C    1 
ATOM   3835 O  O    . ARG D 1 44  ? 34.353 11.384 31.181  1.00 247.77 ? 44  ARG D O    1 
ATOM   3836 C  CB   . ARG D 1 44  ? 31.075 11.629 30.284  1.00 240.63 ? 44  ARG D CB   1 
ATOM   3837 C  CG   . ARG D 1 44  ? 30.061 12.709 30.669  1.00 248.32 ? 44  ARG D CG   1 
ATOM   3838 C  CD   . ARG D 1 44  ? 29.018 12.916 29.571  1.00 251.88 ? 44  ARG D CD   1 
ATOM   3839 N  NE   . ARG D 1 44  ? 29.643 13.124 28.263  1.00 252.82 ? 44  ARG D NE   1 
ATOM   3840 C  CZ   . ARG D 1 44  ? 28.987 13.412 27.137  1.00 261.56 ? 44  ARG D CZ   1 
ATOM   3841 N  NH1  . ARG D 1 44  ? 27.667 13.534 27.134  1.00 247.64 ? 44  ARG D NH1  1 
ATOM   3842 N  NH2  . ARG D 1 44  ? 29.655 13.579 26.003  1.00 247.06 ? 44  ARG D NH2  1 
ATOM   3843 N  N    . THR D 1 45  ? 33.592 10.040 29.528  1.00 239.24 ? 45  THR D N    1 
ATOM   3844 C  CA   . THR D 1 45  ? 34.570 8.965  29.738  1.00 238.49 ? 45  THR D CA   1 
ATOM   3845 C  C    . THR D 1 45  ? 35.653 8.965  28.645  1.00 241.15 ? 45  THR D C    1 
ATOM   3846 O  O    . THR D 1 45  ? 35.491 9.586  27.590  1.00 240.73 ? 45  THR D O    1 
ATOM   3847 C  CB   . THR D 1 45  ? 33.871 7.569  29.828  1.00 244.51 ? 45  THR D CB   1 
ATOM   3848 O  OG1  . THR D 1 45  ? 33.016 7.517  30.978  1.00 243.63 ? 45  THR D OG1  1 
ATOM   3849 C  CG2  . THR D 1 45  ? 34.901 6.444  29.919  1.00 242.66 ? 45  THR D CG2  1 
ATOM   3850 N  N    . GLY D 1 46  ? 36.750 8.254  28.900  1.00 230.95 ? 46  GLY D N    1 
ATOM   3851 C  CA   . GLY D 1 46  ? 37.839 8.146  27.945  1.00 229.21 ? 46  GLY D CA   1 
ATOM   3852 C  C    . GLY D 1 46  ? 39.205 8.057  28.593  1.00 227.74 ? 46  GLY D C    1 
ATOM   3853 O  O    . GLY D 1 46  ? 39.356 7.414  29.638  1.00 226.41 ? 46  GLY D O    1 
ATOM   3854 N  N    . THR D 1 47  ? 40.187 8.694  27.949  1.00 218.33 ? 47  THR D N    1 
ATOM   3855 C  CA   . THR D 1 47  ? 41.568 8.731  28.419  1.00 216.50 ? 47  THR D CA   1 
ATOM   3856 C  C    . THR D 1 47  ? 41.589 8.853  29.917  1.00 213.10 ? 47  THR D C    1 
ATOM   3857 O  O    . THR D 1 47  ? 40.861 9.658  30.495  1.00 211.34 ? 47  THR D O    1 
ATOM   3858 C  CB   . THR D 1 47  ? 42.350 9.926  27.841  1.00 231.07 ? 47  THR D CB   1 
ATOM   3859 O  OG1  . THR D 1 47  ? 42.102 10.051 26.441  1.00 232.05 ? 47  THR D OG1  1 
ATOM   3860 C  CG2  . THR D 1 47  ? 43.837 9.753  28.086  1.00 231.08 ? 47  THR D CG2  1 
ATOM   3861 N  N    . LEU D 1 48  ? 42.410 8.032  30.547  1.00 205.25 ? 48  LEU D N    1 
ATOM   3862 C  CA   . LEU D 1 48  ? 42.572 8.086  31.985  1.00 201.38 ? 48  LEU D CA   1 
ATOM   3863 C  C    . LEU D 1 48  ? 43.328 9.368  32.330  1.00 210.19 ? 48  LEU D C    1 
ATOM   3864 O  O    . LEU D 1 48  ? 43.559 9.684  33.499  1.00 211.19 ? 48  LEU D O    1 
ATOM   3865 C  CB   . LEU D 1 48  ? 43.291 6.836  32.468  1.00 196.44 ? 48  LEU D CB   1 
ATOM   3866 C  CG   . LEU D 1 48  ? 42.520 5.650  31.889  1.00 191.00 ? 48  LEU D CG   1 
ATOM   3867 C  CD1  . LEU D 1 48  ? 41.016 6.003  31.838  1.00 187.80 ? 48  LEU D CD1  1 
ATOM   3868 C  CD2  . LEU D 1 48  ? 43.054 5.326  30.487  1.00 190.10 ? 48  LEU D CD2  1 
ATOM   3869 N  N    . ALA D 1 49  ? 43.660 10.129 31.289  1.00 208.96 ? 49  ALA D N    1 
ATOM   3870 C  CA   . ALA D 1 49  ? 44.321 11.417 31.452  1.00 206.58 ? 49  ALA D CA   1 
ATOM   3871 C  C    . ALA D 1 49  ? 43.247 12.493 31.452  1.00 198.74 ? 49  ALA D C    1 
ATOM   3872 O  O    . ALA D 1 49  ? 43.332 13.466 32.198  1.00 196.12 ? 49  ALA D O    1 
ATOM   3873 C  CB   . ALA D 1 49  ? 45.296 11.657 30.316  1.00 207.86 ? 49  ALA D CB   1 
ATOM   3874 N  N    . PHE D 1 50  ? 42.234 12.291 30.613  1.00 201.60 ? 50  PHE D N    1 
ATOM   3875 C  CA   . PHE D 1 50  ? 41.108 13.205 30.486  1.00 199.74 ? 50  PHE D CA   1 
ATOM   3876 C  C    . PHE D 1 50  ? 40.063 12.897 31.549  1.00 197.45 ? 50  PHE D C    1 
ATOM   3877 O  O    . PHE D 1 50  ? 39.336 13.776 31.996  1.00 195.85 ? 50  PHE D O    1 
ATOM   3878 C  CB   . PHE D 1 50  ? 40.506 13.073 29.086  1.00 202.02 ? 50  PHE D CB   1 
ATOM   3879 C  CG   . PHE D 1 50  ? 39.034 13.366 29.016  1.00 204.34 ? 50  PHE D CG   1 
ATOM   3880 C  CD1  . PHE D 1 50  ? 38.583 14.523 28.407  1.00 207.98 ? 50  PHE D CD1  1 
ATOM   3881 C  CD2  . PHE D 1 50  ? 38.101 12.441 29.460  1.00 207.04 ? 50  PHE D CD2  1 
ATOM   3882 C  CE1  . PHE D 1 50  ? 37.240 14.780 28.298  1.00 209.06 ? 50  PHE D CE1  1 
ATOM   3883 C  CE2  . PHE D 1 50  ? 36.757 12.702 29.370  1.00 210.03 ? 50  PHE D CE2  1 
ATOM   3884 C  CZ   . PHE D 1 50  ? 36.326 13.870 28.782  1.00 208.14 ? 50  PHE D CZ   1 
ATOM   3885 N  N    . GLU D 1 51  ? 39.967 11.632 31.924  1.00 193.63 ? 51  GLU D N    1 
ATOM   3886 C  CA   . GLU D 1 51  ? 39.030 11.232 32.955  1.00 193.77 ? 51  GLU D CA   1 
ATOM   3887 C  C    . GLU D 1 51  ? 39.652 11.607 34.304  1.00 195.29 ? 51  GLU D C    1 
ATOM   3888 O  O    . GLU D 1 51  ? 38.946 11.857 35.283  1.00 194.42 ? 51  GLU D O    1 
ATOM   3889 C  CB   . GLU D 1 51  ? 38.755 9.726  32.870  1.00 195.74 ? 51  GLU D CB   1 
ATOM   3890 C  CG   . GLU D 1 51  ? 37.281 9.350  32.952  1.00 207.85 ? 51  GLU D CG   1 
ATOM   3891 C  CD   . GLU D 1 51  ? 36.572 9.980  34.148  1.00 229.40 ? 51  GLU D CD   1 
ATOM   3892 O  OE1  . GLU D 1 51  ? 36.545 9.355  35.237  1.00 223.76 ? 51  GLU D OE1  1 
ATOM   3893 O  OE2  . GLU D 1 51  ? 36.033 11.101 33.992  1.00 223.51 ? 51  GLU D OE2  1 
ATOM   3894 N  N    . ARG D 1 52  ? 40.980 11.683 34.336  1.00 188.43 ? 52  ARG D N    1 
ATOM   3895 C  CA   . ARG D 1 52  ? 41.697 12.042 35.553  1.00 187.39 ? 52  ARG D CA   1 
ATOM   3896 C  C    . ARG D 1 52  ? 41.614 13.543 35.796  1.00 185.63 ? 52  ARG D C    1 
ATOM   3897 O  O    . ARG D 1 52  ? 41.595 13.995 36.940  1.00 184.61 ? 52  ARG D O    1 
ATOM   3898 C  CB   . ARG D 1 52  ? 43.161 11.597 35.473  1.00 190.34 ? 52  ARG D CB   1 
ATOM   3899 C  CG   . ARG D 1 52  ? 43.755 11.183 36.813  1.00 205.74 ? 52  ARG D CG   1 
ATOM   3900 C  CD   . ARG D 1 52  ? 44.375 9.783  36.779  1.00 218.63 ? 52  ARG D CD   1 
ATOM   3901 N  NE   . ARG D 1 52  ? 45.637 9.735  37.521  1.00 226.79 ? 52  ARG D NE   1 
ATOM   3902 C  CZ   . ARG D 1 52  ? 45.923 8.856  38.479  1.00 239.41 ? 52  ARG D CZ   1 
ATOM   3903 N  NH1  . ARG D 1 52  ? 45.041 7.926  38.818  1.00 226.32 ? 52  ARG D NH1  1 
ATOM   3904 N  NH2  . ARG D 1 52  ? 47.096 8.908  39.099  1.00 225.74 ? 52  ARG D NH2  1 
ATOM   3905 N  N    . VAL D 1 53  ? 41.552 14.313 34.717  1.00 181.94 ? 53  VAL D N    1 
ATOM   3906 C  CA   . VAL D 1 53  ? 41.471 15.758 34.841  1.00 177.99 ? 53  VAL D CA   1 
ATOM   3907 C  C    . VAL D 1 53  ? 40.062 16.272 35.025  1.00 179.84 ? 53  VAL D C    1 
ATOM   3908 O  O    . VAL D 1 53  ? 39.834 17.133 35.866  1.00 179.85 ? 53  VAL D O    1 
ATOM   3909 C  CB   . VAL D 1 53  ? 42.156 16.492 33.703  1.00 176.83 ? 53  VAL D CB   1 
ATOM   3910 C  CG1  . VAL D 1 53  ? 41.178 17.463 33.051  1.00 175.77 ? 53  VAL D CG1  1 
ATOM   3911 C  CG2  . VAL D 1 53  ? 43.353 17.239 34.238  1.00 175.78 ? 53  VAL D CG2  1 
ATOM   3912 N  N    . TYR D 1 54  ? 39.123 15.785 34.218  1.00 175.80 ? 54  TYR D N    1 
ATOM   3913 C  CA   . TYR D 1 54  ? 37.740 16.236 34.341  1.00 176.26 ? 54  TYR D CA   1 
ATOM   3914 C  C    . TYR D 1 54  ? 37.297 15.997 35.753  1.00 177.22 ? 54  TYR D C    1 
ATOM   3915 O  O    . TYR D 1 54  ? 36.451 16.709 36.294  1.00 175.33 ? 54  TYR D O    1 
ATOM   3916 C  CB   . TYR D 1 54  ? 36.787 15.431 33.472  1.00 182.34 ? 54  TYR D CB   1 
ATOM   3917 C  CG   . TYR D 1 54  ? 35.379 15.939 33.644  1.00 193.57 ? 54  TYR D CG   1 
ATOM   3918 C  CD1  . TYR D 1 54  ? 35.147 17.305 33.769  1.00 197.04 ? 54  TYR D CD1  1 
ATOM   3919 C  CD2  . TYR D 1 54  ? 34.297 15.075 33.767  1.00 196.91 ? 54  TYR D CD2  1 
ATOM   3920 C  CE1  . TYR D 1 54  ? 33.876 17.813 33.935  1.00 198.87 ? 54  TYR D CE1  1 
ATOM   3921 C  CE2  . TYR D 1 54  ? 33.006 15.576 33.942  1.00 198.62 ? 54  TYR D CE2  1 
ATOM   3922 C  CZ   . TYR D 1 54  ? 32.806 16.952 34.025  1.00 205.69 ? 54  TYR D CZ   1 
ATOM   3923 O  OH   . TYR D 1 54  ? 31.545 17.486 34.203  1.00 206.33 ? 54  TYR D OH   1 
ATOM   3924 N  N    . THR D 1 55  ? 37.839 14.933 36.319  1.00 169.48 ? 55  THR D N    1 
ATOM   3925 C  CA   . THR D 1 55  ? 37.516 14.544 37.671  1.00 170.06 ? 55  THR D CA   1 
ATOM   3926 C  C    . THR D 1 55  ? 38.122 15.543 38.677  1.00 175.50 ? 55  THR D C    1 
ATOM   3927 O  O    . THR D 1 55  ? 37.392 16.198 39.425  1.00 176.02 ? 55  THR D O    1 
ATOM   3928 C  CB   . THR D 1 55  ? 37.899 13.070 37.894  1.00 171.92 ? 55  THR D CB   1 
ATOM   3929 O  OG1  . THR D 1 55  ? 36.755 12.230 37.656  1.00 170.06 ? 55  THR D OG1  1 
ATOM   3930 C  CG2  . THR D 1 55  ? 38.458 12.851 39.286  1.00 169.09 ? 55  THR D CG2  1 
ATOM   3931 N  N    . ALA D 1 56  ? 39.440 15.721 38.631  1.00 170.84 ? 56  ALA D N    1 
ATOM   3932 C  CA   . ALA D 1 56  ? 40.121 16.680 39.498  1.00 169.38 ? 56  ALA D CA   1 
ATOM   3933 C  C    . ALA D 1 56  ? 39.476 18.063 39.420  1.00 169.25 ? 56  ALA D C    1 
ATOM   3934 O  O    . ALA D 1 56  ? 39.294 18.737 40.433  1.00 167.57 ? 56  ALA D O    1 
ATOM   3935 C  CB   . ALA D 1 56  ? 41.600 16.764 39.129  1.00 170.23 ? 56  ALA D CB   1 
ATOM   3936 N  N    . ASN D 1 57  ? 39.147 18.488 38.208  1.00 164.01 ? 57  ASN D N    1 
ATOM   3937 C  CA   . ASN D 1 57  ? 38.530 19.787 38.004  1.00 164.17 ? 57  ASN D CA   1 
ATOM   3938 C  C    . ASN D 1 57  ? 37.149 19.825 38.638  1.00 168.63 ? 57  ASN D C    1 
ATOM   3939 O  O    . ASN D 1 57  ? 36.890 20.625 39.534  1.00 169.31 ? 57  ASN D O    1 
ATOM   3940 C  CB   . ASN D 1 57  ? 38.445 20.107 36.514  1.00 163.32 ? 57  ASN D CB   1 
ATOM   3941 C  CG   . ASN D 1 57  ? 37.596 21.324 36.229  1.00 177.04 ? 57  ASN D CG   1 
ATOM   3942 O  OD1  . ASN D 1 57  ? 36.625 21.251 35.478  1.00 170.04 ? 57  ASN D OD1  1 
ATOM   3943 N  ND2  . ASN D 1 57  ? 37.960 22.454 36.822  1.00 167.58 ? 57  ASN D ND2  1 
ATOM   3944 N  N    . GLN D 1 58  ? 36.264 18.947 38.188  1.00 166.72 ? 58  GLN D N    1 
ATOM   3945 C  CA   . GLN D 1 58  ? 34.921 18.916 38.739  1.00 165.40 ? 58  GLN D CA   1 
ATOM   3946 C  C    . GLN D 1 58  ? 34.897 18.452 40.198  1.00 166.00 ? 58  GLN D C    1 
ATOM   3947 O  O    . GLN D 1 58  ? 33.904 17.908 40.676  1.00 163.78 ? 58  GLN D O    1 
ATOM   3948 C  CB   . GLN D 1 58  ? 33.990 18.085 37.863  1.00 167.08 ? 58  GLN D CB   1 
ATOM   3949 C  CG   . GLN D 1 58  ? 32.522 18.144 38.282  1.00 184.03 ? 58  GLN D CG   1 
ATOM   3950 C  CD   . GLN D 1 58  ? 31.844 19.457 37.916  1.00 203.84 ? 58  GLN D CD   1 
ATOM   3951 O  OE1  . GLN D 1 58  ? 30.940 19.926 38.619  1.00 199.41 ? 58  GLN D OE1  1 
ATOM   3952 N  NE2  . GLN D 1 58  ? 32.261 20.044 36.800  1.00 196.06 ? 58  GLN D NE2  1 
ATOM   3953 N  N    . ASN D 1 59  ? 35.993 18.694 40.911  1.00 162.92 ? 59  ASN D N    1 
ATOM   3954 C  CA   . ASN D 1 59  ? 36.098 18.355 42.333  1.00 163.14 ? 59  ASN D CA   1 
ATOM   3955 C  C    . ASN D 1 59  ? 36.435 19.655 43.032  1.00 166.26 ? 59  ASN D C    1 
ATOM   3956 O  O    . ASN D 1 59  ? 36.191 19.827 44.230  1.00 165.95 ? 59  ASN D O    1 
ATOM   3957 C  CB   . ASN D 1 59  ? 37.238 17.364 42.567  1.00 161.77 ? 59  ASN D CB   1 
ATOM   3958 C  CG   . ASN D 1 59  ? 36.805 15.928 42.396  1.00 171.32 ? 59  ASN D CG   1 
ATOM   3959 O  OD1  . ASN D 1 59  ? 35.837 15.640 41.696  1.00 163.68 ? 59  ASN D OD1  1 
ATOM   3960 N  ND2  . ASN D 1 59  ? 37.516 15.015 43.047  1.00 161.24 ? 59  ASN D ND2  1 
ATOM   3961 N  N    . CYS D 1 60  ? 37.018 20.555 42.247  1.00 162.07 ? 60  CYS D N    1 
ATOM   3962 C  CA   . CYS D 1 60  ? 37.425 21.873 42.700  1.00 162.68 ? 60  CYS D CA   1 
ATOM   3963 C  C    . CYS D 1 60  ? 36.294 22.828 42.398  1.00 165.14 ? 60  CYS D C    1 
ATOM   3964 O  O    . CYS D 1 60  ? 36.164 23.880 43.024  1.00 164.41 ? 60  CYS D O    1 
ATOM   3965 C  CB   . CYS D 1 60  ? 38.679 22.314 41.945  1.00 164.57 ? 60  CYS D CB   1 
ATOM   3966 S  SG   . CYS D 1 60  ? 40.064 21.176 42.139  1.00 169.00 ? 60  CYS D SG   1 
ATOM   3967 N  N    . VAL D 1 61  ? 35.472 22.444 41.428  1.00 160.29 ? 61  VAL D N    1 
ATOM   3968 C  CA   . VAL D 1 61  ? 34.327 23.249 41.023  1.00 158.43 ? 61  VAL D CA   1 
ATOM   3969 C  C    . VAL D 1 61  ? 33.166 23.101 42.009  1.00 166.86 ? 61  VAL D C    1 
ATOM   3970 O  O    . VAL D 1 61  ? 32.236 23.910 42.019  1.00 168.08 ? 61  VAL D O    1 
ATOM   3971 C  CB   . VAL D 1 61  ? 33.903 22.938 39.566  1.00 156.96 ? 61  VAL D CB   1 
ATOM   3972 C  CG1  . VAL D 1 61  ? 32.622 23.699 39.194  1.00 155.84 ? 61  VAL D CG1  1 
ATOM   3973 C  CG2  . VAL D 1 61  ? 35.043 23.271 38.595  1.00 155.85 ? 61  VAL D CG2  1 
ATOM   3974 N  N    . ASP D 1 62  ? 33.232 22.076 42.853  1.00 162.84 ? 62  ASP D N    1 
ATOM   3975 C  CA   . ASP D 1 62  ? 32.203 21.875 43.868  1.00 161.20 ? 62  ASP D CA   1 
ATOM   3976 C  C    . ASP D 1 62  ? 32.632 22.590 45.165  1.00 159.66 ? 62  ASP D C    1 
ATOM   3977 O  O    . ASP D 1 62  ? 31.800 22.961 46.003  1.00 158.44 ? 62  ASP D O    1 
ATOM   3978 C  CB   . ASP D 1 62  ? 31.963 20.375 44.117  1.00 163.41 ? 62  ASP D CB   1 
ATOM   3979 C  CG   . ASP D 1 62  ? 32.412 19.499 42.950  1.00 174.40 ? 62  ASP D CG   1 
ATOM   3980 O  OD1  . ASP D 1 62  ? 32.762 20.055 41.885  1.00 175.01 ? 62  ASP D OD1  1 
ATOM   3981 O  OD2  . ASP D 1 62  ? 32.407 18.254 43.100  1.00 180.38 ? 62  ASP D OD2  1 
ATOM   3982 N  N    . ALA D 1 63  ? 33.938 22.810 45.296  1.00 156.10 ? 63  ALA D N    1 
ATOM   3983 C  CA   . ALA D 1 63  ? 34.500 23.468 46.463  1.00 154.99 ? 63  ALA D CA   1 
ATOM   3984 C  C    . ALA D 1 63  ? 34.522 24.991 46.362  1.00 157.44 ? 63  ALA D C    1 
ATOM   3985 O  O    . ALA D 1 63  ? 34.464 25.669 47.382  1.00 156.52 ? 63  ALA D O    1 
ATOM   3986 C  CB   . ALA D 1 63  ? 35.883 22.929 46.762  1.00 155.64 ? 63  ALA D CB   1 
ATOM   3987 N  N    . TYR D 1 64  ? 34.596 25.532 45.146  1.00 153.12 ? 64  TYR D N    1 
ATOM   3988 C  CA   . TYR D 1 64  ? 34.632 26.991 44.964  1.00 152.01 ? 64  TYR D CA   1 
ATOM   3989 C  C    . TYR D 1 64  ? 33.546 27.751 45.731  1.00 156.24 ? 64  TYR D C    1 
ATOM   3990 O  O    . TYR D 1 64  ? 33.857 28.635 46.542  1.00 156.40 ? 64  TYR D O    1 
ATOM   3991 C  CB   . TYR D 1 64  ? 34.639 27.410 43.486  1.00 150.41 ? 64  TYR D CB   1 
ATOM   3992 C  CG   . TYR D 1 64  ? 35.244 28.786 43.262  1.00 146.41 ? 64  TYR D CG   1 
ATOM   3993 C  CD1  . TYR D 1 64  ? 36.217 29.293 44.121  1.00 147.26 ? 64  TYR D CD1  1 
ATOM   3994 C  CD2  . TYR D 1 64  ? 34.842 29.580 42.198  1.00 145.47 ? 64  TYR D CD2  1 
ATOM   3995 C  CE1  . TYR D 1 64  ? 36.781 30.556 43.917  1.00 146.66 ? 64  TYR D CE1  1 
ATOM   3996 C  CE2  . TYR D 1 64  ? 35.404 30.848 41.984  1.00 145.59 ? 64  TYR D CE2  1 
ATOM   3997 C  CZ   . TYR D 1 64  ? 36.367 31.332 42.846  1.00 151.25 ? 64  TYR D CZ   1 
ATOM   3998 O  OH   . TYR D 1 64  ? 36.915 32.584 42.624  1.00 151.23 ? 64  TYR D OH   1 
ATOM   3999 N  N    . PRO D 1 65  ? 32.259 27.423 45.481  1.00 153.00 ? 65  PRO D N    1 
ATOM   4000 C  CA   . PRO D 1 65  ? 31.161 28.121 46.164  1.00 150.92 ? 65  PRO D CA   1 
ATOM   4001 C  C    . PRO D 1 65  ? 31.265 28.059 47.698  1.00 149.69 ? 65  PRO D C    1 
ATOM   4002 O  O    . PRO D 1 65  ? 31.317 29.096 48.371  1.00 148.50 ? 65  PRO D O    1 
ATOM   4003 C  CB   . PRO D 1 65  ? 29.915 27.377 45.667  1.00 152.95 ? 65  PRO D CB   1 
ATOM   4004 C  CG   . PRO D 1 65  ? 30.389 25.996 45.389  1.00 158.34 ? 65  PRO D CG   1 
ATOM   4005 C  CD   . PRO D 1 65  ? 31.827 26.118 44.940  1.00 153.86 ? 65  PRO D CD   1 
ATOM   4006 N  N    . THR D 1 66  ? 31.300 26.839 48.237  1.00 146.97 ? 66  THR D N    1 
ATOM   4007 C  CA   . THR D 1 66  ? 31.391 26.612 49.680  1.00 146.73 ? 66  THR D CA   1 
ATOM   4008 C  C    . THR D 1 66  ? 32.652 27.219 50.293  1.00 149.03 ? 66  THR D C    1 
ATOM   4009 O  O    . THR D 1 66  ? 32.775 27.304 51.508  1.00 147.87 ? 66  THR D O    1 
ATOM   4010 C  CB   . THR D 1 66  ? 31.306 25.105 50.023  1.00 163.94 ? 66  THR D CB   1 
ATOM   4011 O  OG1  . THR D 1 66  ? 31.127 24.340 48.821  1.00 165.60 ? 66  THR D OG1  1 
ATOM   4012 C  CG2  . THR D 1 66  ? 30.160 24.834 50.999  1.00 164.62 ? 66  THR D CG2  1 
ATOM   4013 N  N    . PHE D 1 67  ? 33.604 27.600 49.453  1.00 144.67 ? 67  PHE D N    1 
ATOM   4014 C  CA   . PHE D 1 67  ? 34.846 28.181 49.935  1.00 144.10 ? 67  PHE D CA   1 
ATOM   4015 C  C    . PHE D 1 67  ? 34.673 29.673 49.900  1.00 148.05 ? 67  PHE D C    1 
ATOM   4016 O  O    . PHE D 1 67  ? 34.940 30.359 50.878  1.00 147.30 ? 67  PHE D O    1 
ATOM   4017 C  CB   . PHE D 1 67  ? 35.989 27.781 49.011  1.00 144.58 ? 67  PHE D CB   1 
ATOM   4018 C  CG   . PHE D 1 67  ? 37.084 28.809 48.898  1.00 143.37 ? 67  PHE D CG   1 
ATOM   4019 C  CD1  . PHE D 1 67  ? 37.929 29.069 49.972  1.00 143.86 ? 67  PHE D CD1  1 
ATOM   4020 C  CD2  . PHE D 1 67  ? 37.334 29.442 47.687  1.00 142.77 ? 67  PHE D CD2  1 
ATOM   4021 C  CE1  . PHE D 1 67  ? 38.984 29.968 49.850  1.00 143.45 ? 67  PHE D CE1  1 
ATOM   4022 C  CE2  . PHE D 1 67  ? 38.382 30.346 47.560  1.00 144.08 ? 67  PHE D CE2  1 
ATOM   4023 C  CZ   . PHE D 1 67  ? 39.205 30.609 48.644  1.00 141.73 ? 67  PHE D CZ   1 
ATOM   4024 N  N    . LEU D 1 68  ? 34.207 30.161 48.758  1.00 142.26 ? 68  LEU D N    1 
ATOM   4025 C  CA   . LEU D 1 68  ? 33.949 31.575 48.573  1.00 142.45 ? 68  LEU D CA   1 
ATOM   4026 C  C    . LEU D 1 68  ? 33.064 32.059 49.709  1.00 147.93 ? 68  LEU D C    1 
ATOM   4027 O  O    . LEU D 1 68  ? 33.205 33.189 50.190  1.00 146.96 ? 68  LEU D O    1 
ATOM   4028 C  CB   . LEU D 1 68  ? 33.230 31.797 47.247  1.00 142.46 ? 68  LEU D CB   1 
ATOM   4029 C  CG   . LEU D 1 68  ? 34.087 32.512 46.211  1.00 147.24 ? 68  LEU D CG   1 
ATOM   4030 C  CD1  . LEU D 1 68  ? 35.536 32.178 46.472  1.00 147.45 ? 68  LEU D CD1  1 
ATOM   4031 C  CD2  . LEU D 1 68  ? 33.689 32.110 44.812  1.00 149.75 ? 68  LEU D CD2  1 
ATOM   4032 N  N    . ALA D 1 69  ? 32.152 31.191 50.140  1.00 144.55 ? 69  ALA D N    1 
ATOM   4033 C  CA   . ALA D 1 69  ? 31.246 31.506 51.243  1.00 145.78 ? 69  ALA D CA   1 
ATOM   4034 C  C    . ALA D 1 69  ? 32.035 32.029 52.443  1.00 145.93 ? 69  ALA D C    1 
ATOM   4035 O  O    . ALA D 1 69  ? 32.107 33.241 52.672  1.00 144.90 ? 69  ALA D O    1 
ATOM   4036 C  CB   . ALA D 1 69  ? 30.442 30.274 51.639  1.00 147.28 ? 69  ALA D CB   1 
ATOM   4037 N  N    . VAL D 1 70  ? 32.658 31.114 53.180  1.00 144.10 ? 70  VAL D N    1 
ATOM   4038 C  CA   . VAL D 1 70  ? 33.452 31.480 54.349  1.00 147.07 ? 70  VAL D CA   1 
ATOM   4039 C  C    . VAL D 1 70  ? 34.604 32.454 54.074  1.00 142.88 ? 70  VAL D C    1 
ATOM   4040 O  O    . VAL D 1 70  ? 35.127 33.075 54.992  1.00 139.47 ? 70  VAL D O    1 
ATOM   4041 C  CB   . VAL D 1 70  ? 33.950 30.242 55.084  1.00 161.39 ? 70  VAL D CB   1 
ATOM   4042 C  CG1  . VAL D 1 70  ? 32.779 29.390 55.530  1.00 162.98 ? 70  VAL D CG1  1 
ATOM   4043 C  CG2  . VAL D 1 70  ? 34.898 29.450 54.197  1.00 163.00 ? 70  VAL D CG2  1 
ATOM   4044 N  N    . LEU D 1 71  ? 35.013 32.570 52.816  1.00 141.45 ? 71  LEU D N    1 
ATOM   4045 C  CA   . LEU D 1 71  ? 36.104 33.471 52.450  1.00 144.01 ? 71  LEU D CA   1 
ATOM   4046 C  C    . LEU D 1 71  ? 35.675 34.890 52.735  1.00 143.43 ? 71  LEU D C    1 
ATOM   4047 O  O    . LEU D 1 71  ? 36.460 35.714 53.192  1.00 141.98 ? 71  LEU D O    1 
ATOM   4048 C  CB   . LEU D 1 71  ? 36.421 33.345 50.959  1.00 146.64 ? 71  LEU D CB   1 
ATOM   4049 C  CG   . LEU D 1 71  ? 37.775 33.848 50.447  1.00 155.41 ? 71  LEU D CG   1 
ATOM   4050 C  CD1  . LEU D 1 71  ? 37.674 34.348 49.008  1.00 156.85 ? 71  LEU D CD1  1 
ATOM   4051 C  CD2  . LEU D 1 71  ? 38.358 34.912 51.356  1.00 159.15 ? 71  LEU D CD2  1 
ATOM   4052 N  N    . TRP D 1 72  ? 34.417 35.174 52.453  1.00 141.22 ? 72  TRP D N    1 
ATOM   4053 C  CA   . TRP D 1 72  ? 33.912 36.500 52.679  1.00 142.56 ? 72  TRP D CA   1 
ATOM   4054 C  C    . TRP D 1 72  ? 33.206 36.664 54.008  1.00 144.23 ? 72  TRP D C    1 
ATOM   4055 O  O    . TRP D 1 72  ? 33.450 37.644 54.709  1.00 142.25 ? 72  TRP D O    1 
ATOM   4056 C  CB   . TRP D 1 72  ? 33.061 36.948 51.517  1.00 144.34 ? 72  TRP D CB   1 
ATOM   4057 C  CG   . TRP D 1 72  ? 33.856 37.010 50.289  1.00 148.31 ? 72  TRP D CG   1 
ATOM   4058 C  CD1  . TRP D 1 72  ? 34.498 35.974 49.695  1.00 151.80 ? 72  TRP D CD1  1 
ATOM   4059 C  CD2  . TRP D 1 72  ? 34.219 38.187 49.553  1.00 148.99 ? 72  TRP D CD2  1 
ATOM   4060 N  NE1  . TRP D 1 72  ? 35.194 36.416 48.591  1.00 151.58 ? 72  TRP D NE1  1 
ATOM   4061 C  CE2  . TRP D 1 72  ? 35.034 37.772 48.477  1.00 153.02 ? 72  TRP D CE2  1 
ATOM   4062 C  CE3  . TRP D 1 72  ? 33.925 39.546 49.691  1.00 150.58 ? 72  TRP D CE3  1 
ATOM   4063 C  CZ2  . TRP D 1 72  ? 35.552 38.669 47.533  1.00 152.31 ? 72  TRP D CZ2  1 
ATOM   4064 C  CZ3  . TRP D 1 72  ? 34.449 40.435 48.763  1.00 152.04 ? 72  TRP D CZ3  1 
ATOM   4065 C  CH2  . TRP D 1 72  ? 35.249 39.991 47.692  1.00 152.61 ? 72  TRP D CH2  1 
ATOM   4066 N  N    . SER D 1 73  ? 32.357 35.706 54.379  1.00 139.87 ? 73  SER D N    1 
ATOM   4067 C  CA   . SER D 1 73  ? 31.664 35.799 55.669  1.00 141.26 ? 73  SER D CA   1 
ATOM   4068 C  C    . SER D 1 73  ? 32.714 35.967 56.769  1.00 145.40 ? 73  SER D C    1 
ATOM   4069 O  O    . SER D 1 73  ? 32.516 36.701 57.744  1.00 144.72 ? 73  SER D O    1 
ATOM   4070 C  CB   . SER D 1 73  ? 30.767 34.581 55.950  1.00 146.53 ? 73  SER D CB   1 
ATOM   4071 O  OG   . SER D 1 73  ? 30.801 33.637 54.896  1.00 156.95 ? 73  SER D OG   1 
ATOM   4072 N  N    . ALA D 1 74  ? 33.864 35.338 56.560  1.00 140.97 ? 74  ALA D N    1 
ATOM   4073 C  CA   . ALA D 1 74  ? 34.967 35.440 57.493  1.00 140.94 ? 74  ALA D CA   1 
ATOM   4074 C  C    . ALA D 1 74  ? 35.817 36.662 57.154  1.00 144.52 ? 74  ALA D C    1 
ATOM   4075 O  O    . ALA D 1 74  ? 36.783 36.970 57.849  1.00 144.01 ? 74  ALA D O    1 
ATOM   4076 C  CB   . ALA D 1 74  ? 35.798 34.193 57.427  1.00 141.73 ? 74  ALA D CB   1 
ATOM   4077 N  N    . GLY D 1 75  ? 35.461 37.346 56.071  1.00 141.98 ? 75  GLY D N    1 
ATOM   4078 C  CA   . GLY D 1 75  ? 36.177 38.525 55.614  1.00 141.93 ? 75  GLY D CA   1 
ATOM   4079 C  C    . GLY D 1 75  ? 35.503 39.809 56.057  1.00 146.27 ? 75  GLY D C    1 
ATOM   4080 O  O    . GLY D 1 75  ? 36.164 40.821 56.308  1.00 146.04 ? 75  GLY D O    1 
ATOM   4081 N  N    . LEU D 1 76  ? 34.177 39.770 56.145  1.00 145.46 ? 76  LEU D N    1 
ATOM   4082 C  CA   . LEU D 1 76  ? 33.408 40.929 56.586  1.00 145.62 ? 76  LEU D CA   1 
ATOM   4083 C  C    . LEU D 1 76  ? 33.117 40.757 58.063  1.00 148.87 ? 76  LEU D C    1 
ATOM   4084 O  O    . LEU D 1 76  ? 33.462 41.614 58.888  1.00 147.35 ? 76  LEU D O    1 
ATOM   4085 C  CB   . LEU D 1 76  ? 32.080 41.038 55.828  1.00 146.30 ? 76  LEU D CB   1 
ATOM   4086 C  CG   . LEU D 1 76  ? 32.160 41.188 54.316  1.00 152.03 ? 76  LEU D CG   1 
ATOM   4087 C  CD1  . LEU D 1 76  ? 33.545 41.651 53.871  1.00 152.51 ? 76  LEU D CD1  1 
ATOM   4088 C  CD2  . LEU D 1 76  ? 31.834 39.856 53.721  1.00 154.80 ? 76  LEU D CD2  1 
ATOM   4089 N  N    . LEU D 1 77  ? 32.480 39.636 58.386  1.00 147.78 ? 77  LEU D N    1 
ATOM   4090 C  CA   . LEU D 1 77  ? 32.125 39.337 59.762  1.00 148.14 ? 77  LEU D CA   1 
ATOM   4091 C  C    . LEU D 1 77  ? 33.331 39.177 60.683  1.00 156.92 ? 77  LEU D C    1 
ATOM   4092 O  O    . LEU D 1 77  ? 33.185 38.817 61.857  1.00 157.71 ? 77  LEU D O    1 
ATOM   4093 C  CB   . LEU D 1 77  ? 31.224 38.115 59.830  1.00 146.57 ? 77  LEU D CB   1 
ATOM   4094 C  CG   . LEU D 1 77  ? 29.768 38.471 59.568  1.00 147.76 ? 77  LEU D CG   1 
ATOM   4095 C  CD1  . LEU D 1 77  ? 29.691 39.435 58.389  1.00 146.75 ? 77  LEU D CD1  1 
ATOM   4096 C  CD2  . LEU D 1 77  ? 28.980 37.199 59.307  1.00 149.06 ? 77  LEU D CD2  1 
ATOM   4097 N  N    . CYS D 1 78  ? 34.513 39.487 60.158  1.00 155.36 ? 78  CYS D N    1 
ATOM   4098 C  CA   . CYS D 1 78  ? 35.736 39.396 60.939  1.00 155.70 ? 78  CYS D CA   1 
ATOM   4099 C  C    . CYS D 1 78  ? 36.995 39.548 60.091  1.00 162.91 ? 78  CYS D C    1 
ATOM   4100 O  O    . CYS D 1 78  ? 37.156 38.867 59.080  1.00 163.57 ? 78  CYS D O    1 
ATOM   4101 C  CB   . CYS D 1 78  ? 35.788 38.064 61.682  1.00 155.76 ? 78  CYS D CB   1 
ATOM   4102 S  SG   . CYS D 1 78  ? 37.330 37.804 62.537  1.00 159.57 ? 78  CYS D SG   1 
ATOM   4103 N  N    . SER D 1 79  ? 37.890 40.425 60.535  1.00 160.74 ? 79  SER D N    1 
ATOM   4104 C  CA   . SER D 1 79  ? 39.190 40.664 59.895  1.00 160.61 ? 79  SER D CA   1 
ATOM   4105 C  C    . SER D 1 79  ? 39.344 40.350 58.405  1.00 162.48 ? 79  SER D C    1 
ATOM   4106 O  O    . SER D 1 79  ? 39.361 39.185 58.002  1.00 159.64 ? 79  SER D O    1 
ATOM   4107 C  CB   . SER D 1 79  ? 40.304 39.970 60.686  1.00 167.15 ? 79  SER D CB   1 
ATOM   4108 O  OG   . SER D 1 79  ? 41.080 40.907 61.419  1.00 179.37 ? 79  SER D OG   1 
ATOM   4109 N  N    . GLN D 1 80  ? 39.538 41.395 57.609  1.00 159.32 ? 80  GLN D N    1 
ATOM   4110 C  CA   . GLN D 1 80  ? 39.717 41.244 56.175  1.00 159.92 ? 80  GLN D CA   1 
ATOM   4111 C  C    . GLN D 1 80  ? 41.094 40.698 55.806  1.00 159.07 ? 80  GLN D C    1 
ATOM   4112 O  O    . GLN D 1 80  ? 41.323 40.320 54.664  1.00 158.49 ? 80  GLN D O    1 
ATOM   4113 C  CB   . GLN D 1 80  ? 39.474 42.577 55.467  1.00 161.43 ? 80  GLN D CB   1 
ATOM   4114 C  CG   . GLN D 1 80  ? 39.615 42.501 53.953  1.00 166.69 ? 80  GLN D CG   1 
ATOM   4115 C  CD   . GLN D 1 80  ? 40.456 43.628 53.376  1.00 176.06 ? 80  GLN D CD   1 
ATOM   4116 O  OE1  . GLN D 1 80  ? 40.770 44.599 54.064  1.00 170.11 ? 80  GLN D OE1  1 
ATOM   4117 N  NE2  . GLN D 1 80  ? 40.799 43.515 52.096  1.00 166.77 ? 80  GLN D NE2  1 
ATOM   4118 N  N    . VAL D 1 81  ? 42.014 40.663 56.759  1.00 156.56 ? 81  VAL D N    1 
ATOM   4119 C  CA   . VAL D 1 81  ? 43.346 40.149 56.468  1.00 154.77 ? 81  VAL D CA   1 
ATOM   4120 C  C    . VAL D 1 81  ? 43.538 38.657 56.661  1.00 158.93 ? 81  VAL D C    1 
ATOM   4121 O  O    . VAL D 1 81  ? 44.021 37.973 55.769  1.00 158.20 ? 81  VAL D O    1 
ATOM   4122 C  CB   . VAL D 1 81  ? 44.431 40.952 57.127  1.00 157.25 ? 81  VAL D CB   1 
ATOM   4123 C  CG1  . VAL D 1 81  ? 44.670 42.206 56.331  1.00 156.84 ? 81  VAL D CG1  1 
ATOM   4124 C  CG2  . VAL D 1 81  ? 44.037 41.281 58.542  1.00 156.84 ? 81  VAL D CG2  1 
ATOM   4125 N  N    . PRO D 1 82  ? 43.182 38.134 57.838  1.00 155.72 ? 82  PRO D N    1 
ATOM   4126 C  CA   . PRO D 1 82  ? 43.326 36.690 58.040  1.00 156.40 ? 82  PRO D CA   1 
ATOM   4127 C  C    . PRO D 1 82  ? 42.466 35.946 57.025  1.00 163.72 ? 82  PRO D C    1 
ATOM   4128 O  O    . PRO D 1 82  ? 42.894 34.966 56.408  1.00 164.51 ? 82  PRO D O    1 
ATOM   4129 C  CB   . PRO D 1 82  ? 42.700 36.496 59.414  1.00 157.27 ? 82  PRO D CB   1 
ATOM   4130 C  CG   . PRO D 1 82  ? 41.575 37.504 59.428  1.00 160.17 ? 82  PRO D CG   1 
ATOM   4131 C  CD   . PRO D 1 82  ? 42.050 38.680 58.609  1.00 155.29 ? 82  PRO D CD   1 
ATOM   4132 N  N    . ALA D 1 83  ? 41.230 36.416 56.897  1.00 161.51 ? 83  ALA D N    1 
ATOM   4133 C  CA   . ALA D 1 83  ? 40.269 35.845 55.971  1.00 160.56 ? 83  ALA D CA   1 
ATOM   4134 C  C    . ALA D 1 83  ? 40.916 35.739 54.612  1.00 160.98 ? 83  ALA D C    1 
ATOM   4135 O  O    . ALA D 1 83  ? 40.881 34.689 53.972  1.00 159.72 ? 83  ALA D O    1 
ATOM   4136 C  CB   . ALA D 1 83  ? 39.042 36.735 55.885  1.00 161.50 ? 83  ALA D CB   1 
ATOM   4137 N  N    . ALA D 1 84  ? 41.512 36.849 54.190  1.00 157.81 ? 84  ALA D N    1 
ATOM   4138 C  CA   . ALA D 1 84  ? 42.175 36.938 52.897  1.00 157.29 ? 84  ALA D CA   1 
ATOM   4139 C  C    . ALA D 1 84  ? 43.423 36.056 52.774  1.00 164.68 ? 84  ALA D C    1 
ATOM   4140 O  O    . ALA D 1 84  ? 43.714 35.524 51.700  1.00 164.77 ? 84  ALA D O    1 
ATOM   4141 C  CB   . ALA D 1 84  ? 42.496 38.393 52.559  1.00 157.49 ? 84  ALA D CB   1 
ATOM   4142 N  N    . PHE D 1 85  ? 44.171 35.891 53.856  1.00 159.73 ? 85  PHE D N    1 
ATOM   4143 C  CA   . PHE D 1 85  ? 45.341 35.043 53.764  1.00 161.17 ? 85  PHE D CA   1 
ATOM   4144 C  C    . PHE D 1 85  ? 44.900 33.594 53.686  1.00 157.33 ? 85  PHE D C    1 
ATOM   4145 O  O    . PHE D 1 85  ? 45.313 32.855 52.794  1.00 155.84 ? 85  PHE D O    1 
ATOM   4146 C  CB   . PHE D 1 85  ? 46.261 35.218 54.961  1.00 167.11 ? 85  PHE D CB   1 
ATOM   4147 C  CG   . PHE D 1 85  ? 47.257 34.106 55.105  1.00 174.35 ? 85  PHE D CG   1 
ATOM   4148 C  CD1  . PHE D 1 85  ? 46.902 32.915 55.718  1.00 181.76 ? 85  PHE D CD1  1 
ATOM   4149 C  CD2  . PHE D 1 85  ? 48.526 34.225 54.568  1.00 181.13 ? 85  PHE D CD2  1 
ATOM   4150 C  CE1  . PHE D 1 85  ? 47.799 31.871 55.810  1.00 184.61 ? 85  PHE D CE1  1 
ATOM   4151 C  CE2  . PHE D 1 85  ? 49.435 33.188 54.666  1.00 186.13 ? 85  PHE D CE2  1 
ATOM   4152 C  CZ   . PHE D 1 85  ? 49.070 32.009 55.290  1.00 184.76 ? 85  PHE D CZ   1 
ATOM   4153 N  N    . ALA D 1 86  ? 44.106 33.185 54.670  1.00 153.21 ? 86  ALA D N    1 
ATOM   4154 C  CA   . ALA D 1 86  ? 43.607 31.820 54.751  1.00 152.47 ? 86  ALA D CA   1 
ATOM   4155 C  C    . ALA D 1 86  ? 43.058 31.428 53.403  1.00 162.41 ? 86  ALA D C    1 
ATOM   4156 O  O    . ALA D 1 86  ? 43.315 30.336 52.907  1.00 163.71 ? 86  ALA D O    1 
ATOM   4157 C  CB   . ALA D 1 86  ? 42.516 31.728 55.794  1.00 152.43 ? 86  ALA D CB   1 
ATOM   4158 N  N    . GLY D 1 87  ? 42.309 32.349 52.809  1.00 159.32 ? 87  GLY D N    1 
ATOM   4159 C  CA   . GLY D 1 87  ? 41.726 32.143 51.504  1.00 158.90 ? 87  GLY D CA   1 
ATOM   4160 C  C    . GLY D 1 87  ? 42.827 31.988 50.481  1.00 162.63 ? 87  GLY D C    1 
ATOM   4161 O  O    . GLY D 1 87  ? 42.631 31.354 49.446  1.00 161.91 ? 87  GLY D O    1 
ATOM   4162 N  N    . LEU D 1 88  ? 43.993 32.556 50.780  1.00 162.84 ? 88  LEU D N    1 
ATOM   4163 C  CA   . LEU D 1 88  ? 45.137 32.475 49.884  1.00 161.59 ? 88  LEU D CA   1 
ATOM   4164 C  C    . LEU D 1 88  ? 45.758 31.079 49.921  1.00 151.59 ? 88  LEU D C    1 
ATOM   4165 O  O    . LEU D 1 88  ? 46.127 30.526 48.885  1.00 160.50 ? 88  LEU D O    1 
ATOM   4166 C  CB   . LEU D 1 88  ? 46.171 33.532 50.249  1.00 161.03 ? 88  LEU D CB   1 
ATOM   4167 C  CG   . LEU D 1 88  ? 47.504 33.363 49.536  1.00 163.71 ? 88  LEU D CG   1 
ATOM   4168 C  CD1  . LEU D 1 88  ? 48.385 32.376 50.284  1.00 163.15 ? 88  LEU D CD1  1 
ATOM   4169 C  CD2  . LEU D 1 88  ? 47.277 32.921 48.103  1.00 165.45 ? 88  LEU D CD2  1 
ATOM   4170 N  N    . MET D 1 89  ? 45.860 30.508 51.116  1.00 156.69 ? 89  MET D N    1 
ATOM   4171 C  CA   . MET D 1 89  ? 46.403 29.162 51.278  1.00 156.69 ? 89  MET D CA   1 
ATOM   4172 C  C    . MET D 1 89  ? 45.539 28.179 50.510  1.00 156.69 ? 89  MET D C    1 
ATOM   4173 O  O    . MET D 1 89  ? 46.037 27.267 49.849  1.00 231.03 ? 89  MET D O    1 
ATOM   4174 C  CB   . MET D 1 89  ? 46.376 28.769 52.751  1.00 156.69 ? 89  MET D CB   1 
ATOM   4175 C  CG   . MET D 1 89  ? 47.167 29.687 53.636  1.00 156.69 ? 89  MET D CG   1 
ATOM   4176 S  SD   . MET D 1 89  ? 48.550 30.342 52.718  1.00 156.69 ? 89  MET D SD   1 
ATOM   4177 C  CE   . MET D 1 89  ? 49.818 29.117 53.094  1.00 156.69 ? 89  MET D CE   1 
ATOM   4178 N  N    . TYR D 1 90  ? 44.232 28.362 50.644  1.00 147.24 ? 90  TYR D N    1 
ATOM   4179 C  CA   . TYR D 1 90  ? 43.262 27.508 49.988  1.00 159.09 ? 90  TYR D CA   1 
ATOM   4180 C  C    . TYR D 1 90  ? 43.552 27.421 48.504  1.00 168.51 ? 90  TYR D C    1 
ATOM   4181 O  O    . TYR D 1 90  ? 43.335 26.388 47.884  1.00 168.76 ? 90  TYR D O    1 
ATOM   4182 C  CB   . TYR D 1 90  ? 41.842 28.025 50.211  1.00 159.27 ? 90  TYR D CB   1 
ATOM   4183 C  CG   . TYR D 1 90  ? 40.785 27.100 49.662  1.00 158.36 ? 90  TYR D CG   1 
ATOM   4184 C  CD1  . TYR D 1 90  ? 40.336 27.228 48.357  1.00 159.71 ? 90  TYR D CD1  1 
ATOM   4185 C  CD2  . TYR D 1 90  ? 40.268 26.064 50.434  1.00 158.09 ? 90  TYR D CD2  1 
ATOM   4186 C  CE1  . TYR D 1 90  ? 39.379 26.362 47.839  1.00 159.40 ? 90  TYR D CE1  1 
ATOM   4187 C  CE2  . TYR D 1 90  ? 39.306 25.194 49.926  1.00 158.39 ? 90  TYR D CE2  1 
ATOM   4188 C  CZ   . TYR D 1 90  ? 38.866 25.350 48.627  1.00 163.96 ? 90  TYR D CZ   1 
ATOM   4189 O  OH   . TYR D 1 90  ? 37.914 24.501 48.107  1.00 163.81 ? 90  TYR D OH   1 
ATOM   4190 N  N    . LEU D 1 91  ? 44.037 28.513 47.928  1.00 161.37 ? 91  LEU D N    1 
ATOM   4191 C  CA   . LEU D 1 91  ? 44.359 28.525 46.508  1.00 160.98 ? 91  LEU D CA   1 
ATOM   4192 C  C    . LEU D 1 91  ? 45.659 27.756 46.272  1.00 168.21 ? 91  LEU D C    1 
ATOM   4193 O  O    . LEU D 1 91  ? 45.955 27.343 45.146  1.00 168.10 ? 91  LEU D O    1 
ATOM   4194 C  CB   . LEU D 1 91  ? 44.459 29.961 45.985  1.00 159.27 ? 91  LEU D CB   1 
ATOM   4195 C  CG   . LEU D 1 91  ? 43.211 30.585 45.350  1.00 159.69 ? 91  LEU D CG   1 
ATOM   4196 C  CD1  . LEU D 1 91  ? 41.940 29.938 45.860  1.00 158.37 ? 91  LEU D CD1  1 
ATOM   4197 C  CD2  . LEU D 1 91  ? 43.180 32.075 45.593  1.00 160.67 ? 91  LEU D CD2  1 
ATOM   4198 N  N    . PHE D 1 92  ? 46.406 27.536 47.355  1.00 167.98 ? 92  PHE D N    1 
ATOM   4199 C  CA   . PHE D 1 92  ? 47.663 26.796 47.308  1.00 169.82 ? 92  PHE D CA   1 
ATOM   4200 C  C    . PHE D 1 92  ? 47.378 25.311 47.400  1.00 162.06 ? 92  PHE D C    1 
ATOM   4201 O  O    . PHE D 1 92  ? 47.944 24.511 46.661  1.00 158.54 ? 92  PHE D O    1 
ATOM   4202 C  CB   . PHE D 1 92  ? 48.580 27.225 48.451  1.00 177.75 ? 92  PHE D CB   1 
ATOM   4203 C  CG   . PHE D 1 92  ? 49.544 28.308 48.068  1.00 187.72 ? 92  PHE D CG   1 
ATOM   4204 C  CD1  . PHE D 1 92  ? 49.351 29.040 46.904  1.00 197.02 ? 92  PHE D CD1  1 
ATOM   4205 C  CD2  . PHE D 1 92  ? 50.644 28.593 48.862  1.00 196.31 ? 92  PHE D CD2  1 
ATOM   4206 C  CE1  . PHE D 1 92  ? 50.230 30.040 46.542  1.00 200.51 ? 92  PHE D CE1  1 
ATOM   4207 C  CE2  . PHE D 1 92  ? 51.531 29.591 48.503  1.00 202.00 ? 92  PHE D CE2  1 
ATOM   4208 C  CZ   . PHE D 1 92  ? 51.323 30.315 47.340  1.00 200.83 ? 92  PHE D CZ   1 
ATOM   4209 N  N    . VAL D 1 93  ? 46.469 24.948 48.291  1.00 159.29 ? 93  VAL D N    1 
ATOM   4210 C  CA   . VAL D 1 93  ? 46.082 23.560 48.421  1.00 160.46 ? 93  VAL D CA   1 
ATOM   4211 C  C    . VAL D 1 93  ? 45.350 23.107 47.159  1.00 167.03 ? 93  VAL D C    1 
ATOM   4212 O  O    . VAL D 1 93  ? 45.578 22.000 46.657  1.00 166.53 ? 93  VAL D O    1 
ATOM   4213 C  CB   . VAL D 1 93  ? 45.248 23.371 49.654  1.00 165.00 ? 93  VAL D CB   1 
ATOM   4214 C  CG1  . VAL D 1 93  ? 45.895 22.333 50.547  1.00 164.92 ? 93  VAL D CG1  1 
ATOM   4215 C  CG2  . VAL D 1 93  ? 45.109 24.705 50.366  1.00 164.93 ? 93  VAL D CG2  1 
ATOM   4216 N  N    . ARG D 1 94  ? 44.496 23.984 46.633  1.00 162.72 ? 94  ARG D N    1 
ATOM   4217 C  CA   . ARG D 1 94  ? 43.757 23.708 45.406  1.00 164.51 ? 94  ARG D CA   1 
ATOM   4218 C  C    . ARG D 1 94  ? 44.734 23.393 44.296  1.00 176.14 ? 94  ARG D C    1 
ATOM   4219 O  O    . ARG D 1 94  ? 44.510 22.496 43.491  1.00 176.84 ? 94  ARG D O    1 
ATOM   4220 C  CB   . ARG D 1 94  ? 42.919 24.911 45.011  1.00 162.16 ? 94  ARG D CB   1 
ATOM   4221 C  CG   . ARG D 1 94  ? 41.499 24.807 45.496  1.00 162.67 ? 94  ARG D CG   1 
ATOM   4222 C  CD   . ARG D 1 94  ? 40.549 24.603 44.339  1.00 157.54 ? 94  ARG D CD   1 
ATOM   4223 N  NE   . ARG D 1 94  ? 40.324 25.845 43.607  1.00 152.01 ? 94  ARG D NE   1 
ATOM   4224 C  CZ   . ARG D 1 94  ? 39.171 26.505 43.593  1.00 157.41 ? 94  ARG D CZ   1 
ATOM   4225 N  NH1  . ARG D 1 94  ? 38.128 26.040 44.272  1.00 142.79 ? 94  ARG D NH1  1 
ATOM   4226 N  NH2  . ARG D 1 94  ? 39.067 27.634 42.907  1.00 142.20 ? 94  ARG D NH2  1 
ATOM   4227 N  N    . GLN D 1 95  ? 45.828 24.138 44.267  1.00 173.65 ? 95  GLN D N    1 
ATOM   4228 C  CA   . GLN D 1 95  ? 46.866 23.902 43.285  1.00 174.70 ? 95  GLN D CA   1 
ATOM   4229 C  C    . GLN D 1 95  ? 47.492 22.531 43.490  1.00 181.07 ? 95  GLN D C    1 
ATOM   4230 O  O    . GLN D 1 95  ? 47.601 21.737 42.556  1.00 180.36 ? 95  GLN D O    1 
ATOM   4231 C  CB   . GLN D 1 95  ? 47.947 24.972 43.399  1.00 176.02 ? 95  GLN D CB   1 
ATOM   4232 C  CG   . GLN D 1 95  ? 48.287 25.567 42.073  1.00 184.31 ? 95  GLN D CG   1 
ATOM   4233 C  CD   . GLN D 1 95  ? 47.303 25.124 41.027  1.00 196.44 ? 95  GLN D CD   1 
ATOM   4234 O  OE1  . GLN D 1 95  ? 46.107 25.413 41.125  1.00 190.90 ? 95  GLN D OE1  1 
ATOM   4235 N  NE2  . GLN D 1 95  ? 47.775 24.334 40.071  1.00 187.54 ? 95  GLN D NE2  1 
ATOM   4236 N  N    . LYS D 1 96  ? 47.905 22.265 44.724  1.00 177.56 ? 96  LYS D N    1 
ATOM   4237 C  CA   . LYS D 1 96  ? 48.580 21.025 45.055  1.00 178.45 ? 96  LYS D CA   1 
ATOM   4238 C  C    . LYS D 1 96  ? 47.678 19.814 45.070  1.00 182.26 ? 96  LYS D C    1 
ATOM   4239 O  O    . LYS D 1 96  ? 48.151 18.682 45.050  1.00 181.13 ? 96  LYS D O    1 
ATOM   4240 C  CB   . LYS D 1 96  ? 49.355 21.164 46.359  1.00 181.85 ? 96  LYS D CB   1 
ATOM   4241 C  CG   . LYS D 1 96  ? 50.667 21.924 46.189  1.00 198.61 ? 96  LYS D CG   1 
ATOM   4242 C  CD   . LYS D 1 96  ? 50.584 22.944 45.041  1.00 209.40 ? 96  LYS D CD   1 
ATOM   4243 C  CE   . LYS D 1 96  ? 51.664 22.722 43.982  1.00 220.42 ? 96  LYS D CE   1 
ATOM   4244 N  NZ   . LYS D 1 96  ? 51.490 23.625 42.807  1.00 229.57 ? 96  LYS D NZ   1 
ATOM   4245 N  N    . TYR D 1 97  ? 46.377 20.048 45.075  1.00 182.81 ? 97  TYR D N    1 
ATOM   4246 C  CA   . TYR D 1 97  ? 45.440 18.946 45.031  1.00 182.11 ? 97  TYR D CA   1 
ATOM   4247 C  C    . TYR D 1 97  ? 45.074 18.671 43.579  1.00 189.45 ? 97  TYR D C    1 
ATOM   4248 O  O    . TYR D 1 97  ? 45.069 17.527 43.141  1.00 188.99 ? 97  TYR D O    1 
ATOM   4249 C  CB   . TYR D 1 97  ? 44.197 19.258 45.851  1.00 179.62 ? 97  TYR D CB   1 
ATOM   4250 C  CG   . TYR D 1 97  ? 42.969 18.468 45.454  1.00 174.39 ? 97  TYR D CG   1 
ATOM   4251 C  CD1  . TYR D 1 97  ? 42.608 17.313 46.138  1.00 175.02 ? 97  TYR D CD1  1 
ATOM   4252 C  CD2  . TYR D 1 97  ? 42.136 18.912 44.436  1.00 173.05 ? 97  TYR D CD2  1 
ATOM   4253 C  CE1  . TYR D 1 97  ? 41.465 16.612 45.798  1.00 174.02 ? 97  TYR D CE1  1 
ATOM   4254 C  CE2  . TYR D 1 97  ? 40.990 18.221 44.093  1.00 172.95 ? 97  TYR D CE2  1 
ATOM   4255 C  CZ   . TYR D 1 97  ? 40.659 17.072 44.776  1.00 177.85 ? 97  TYR D CZ   1 
ATOM   4256 O  OH   . TYR D 1 97  ? 39.518 16.385 44.429  1.00 177.34 ? 97  TYR D OH   1 
ATOM   4257 N  N    . PHE D 1 98  ? 44.804 19.731 42.825  1.00 191.87 ? 98  PHE D N    1 
ATOM   4258 C  CA   . PHE D 1 98  ? 44.461 19.607 41.408  1.00 191.69 ? 98  PHE D CA   1 
ATOM   4259 C  C    . PHE D 1 98  ? 45.684 19.179 40.618  1.00 201.64 ? 98  PHE D C    1 
ATOM   4260 O  O    . PHE D 1 98  ? 45.597 18.870 39.436  1.00 201.67 ? 98  PHE D O    1 
ATOM   4261 C  CB   . PHE D 1 98  ? 43.984 20.957 40.875  1.00 190.56 ? 98  PHE D CB   1 
ATOM   4262 C  CG   . PHE D 1 98  ? 43.597 20.944 39.424  1.00 187.21 ? 98  PHE D CG   1 
ATOM   4263 C  CD1  . PHE D 1 98  ? 42.438 20.314 39.007  1.00 186.05 ? 98  PHE D CD1  1 
ATOM   4264 C  CD2  . PHE D 1 98  ? 44.356 21.619 38.488  1.00 184.74 ? 98  PHE D CD2  1 
ATOM   4265 C  CE1  . PHE D 1 98  ? 42.054 20.341 37.678  1.00 184.82 ? 98  PHE D CE1  1 
ATOM   4266 C  CE2  . PHE D 1 98  ? 43.969 21.659 37.161  1.00 185.12 ? 98  PHE D CE2  1 
ATOM   4267 C  CZ   . PHE D 1 98  ? 42.821 21.012 36.756  1.00 182.54 ? 98  PHE D CZ   1 
ATOM   4268 N  N    . VAL D 1 99  ? 46.831 19.197 41.280  1.00 205.10 ? 99  VAL D N    1 
ATOM   4269 C  CA   . VAL D 1 99  ? 48.090 18.828 40.656  1.00 210.27 ? 99  VAL D CA   1 
ATOM   4270 C  C    . VAL D 1 99  ? 48.333 17.332 40.795  1.00 206.26 ? 99  VAL D C    1 
ATOM   4271 O  O    . VAL D 1 99  ? 48.505 16.622 39.805  1.00 203.53 ? 99  VAL D O    1 
ATOM   4272 C  CB   . VAL D 1 99  ? 49.245 19.607 41.296  1.00 226.56 ? 99  VAL D CB   1 
ATOM   4273 C  CG1  . VAL D 1 99  ? 50.456 18.705 41.481  1.00 228.45 ? 99  VAL D CG1  1 
ATOM   4274 C  CG2  . VAL D 1 99  ? 49.585 20.837 40.471  1.00 228.46 ? 99  VAL D CG2  1 
ATOM   4275 N  N    . GLY D 1 100 ? 48.376 16.867 42.037  1.00 209.32 ? 100 GLY D N    1 
ATOM   4276 C  CA   . GLY D 1 100 ? 48.601 15.466 42.337  1.00 210.01 ? 100 GLY D CA   1 
ATOM   4277 C  C    . GLY D 1 100 ? 47.512 14.585 41.756  1.00 215.62 ? 100 GLY D C    1 
ATOM   4278 O  O    . GLY D 1 100 ? 47.720 13.391 41.526  1.00 214.87 ? 100 GLY D O    1 
ATOM   4279 N  N    . TYR D 1 101 ? 46.348 15.186 41.513  1.00 216.45 ? 101 TYR D N    1 
ATOM   4280 C  CA   . TYR D 1 101 ? 45.206 14.481 40.937  1.00 218.72 ? 101 TYR D CA   1 
ATOM   4281 C  C    . TYR D 1 101 ? 45.410 14.308 39.447  1.00 220.02 ? 101 TYR D C    1 
ATOM   4282 O  O    . TYR D 1 101 ? 44.468 14.436 38.660  1.00 218.22 ? 101 TYR D O    1 
ATOM   4283 C  CB   . TYR D 1 101 ? 43.910 15.256 41.171  1.00 224.75 ? 101 TYR D CB   1 
ATOM   4284 C  CG   . TYR D 1 101 ? 42.746 14.374 41.544  1.00 234.25 ? 101 TYR D CG   1 
ATOM   4285 C  CD1  . TYR D 1 101 ? 42.951 13.162 42.187  1.00 237.49 ? 101 TYR D CD1  1 
ATOM   4286 C  CD2  . TYR D 1 101 ? 41.446 14.759 41.278  1.00 236.70 ? 101 TYR D CD2  1 
ATOM   4287 C  CE1  . TYR D 1 101 ? 41.891 12.360 42.544  1.00 238.84 ? 101 TYR D CE1  1 
ATOM   4288 C  CE2  . TYR D 1 101 ? 40.381 13.968 41.624  1.00 238.00 ? 101 TYR D CE2  1 
ATOM   4289 C  CZ   . TYR D 1 101 ? 40.606 12.769 42.260  1.00 244.66 ? 101 TYR D CZ   1 
ATOM   4290 O  OH   . TYR D 1 101 ? 39.543 11.974 42.617  1.00 244.98 ? 101 TYR D OH   1 
ATOM   4291 N  N    . LEU D 1 102 ? 46.656 14.038 39.071  1.00 224.67 ? 102 LEU D N    1 
ATOM   4292 C  CA   . LEU D 1 102 ? 47.023 13.840 37.677  1.00 230.63 ? 102 LEU D CA   1 
ATOM   4293 C  C    . LEU D 1 102 ? 48.095 12.758 37.566  1.00 224.54 ? 102 LEU D C    1 
ATOM   4294 O  O    . LEU D 1 102 ? 47.884 11.735 36.910  1.00 221.49 ? 102 LEU D O    1 
ATOM   4295 C  CB   . LEU D 1 102 ? 47.524 15.150 37.066  1.00 239.01 ? 102 LEU D CB   1 
ATOM   4296 C  CG   . LEU D 1 102 ? 46.433 16.164 36.730  1.00 259.85 ? 102 LEU D CG   1 
ATOM   4297 C  CD1  . LEU D 1 102 ? 47.058 17.457 36.247  1.00 265.31 ? 102 LEU D CD1  1 
ATOM   4298 C  CD2  . LEU D 1 102 ? 45.474 15.599 35.691  1.00 267.61 ? 102 LEU D CD2  1 
ATOM   4299 N  N    . GLY D 1 103 ? 49.234 12.980 38.220  1.00 228.40 ? 103 GLY D N    1 
ATOM   4300 C  CA   . GLY D 1 103 ? 50.349 12.046 38.206  1.00 228.31 ? 103 GLY D CA   1 
ATOM   4301 C  C    . GLY D 1 103 ? 50.663 11.464 36.835  1.00 231.30 ? 103 GLY D C    1 
ATOM   4302 O  O    . GLY D 1 103 ? 51.537 11.963 36.117  1.00 230.11 ? 103 GLY D O    1 
ATOM   4303 N  N    . GLU D 1 104 ? 49.943 10.402 36.478  1.00 233.50 ? 104 GLU D N    1 
ATOM   4304 C  CA   . GLU D 1 104 ? 50.136 9.698  35.209  1.00 234.99 ? 104 GLU D CA   1 
ATOM   4305 C  C    . GLU D 1 104 ? 49.378 8.370  35.302  1.00 246.68 ? 104 GLU D C    1 
ATOM   4306 O  O    . GLU D 1 104 ? 48.295 8.205  34.730  1.00 247.59 ? 104 GLU D O    1 
ATOM   4307 C  CB   . GLU D 1 104 ? 51.633 9.418  34.999  1.00 235.85 ? 104 GLU D CB   1 
ATOM   4308 C  CG   . GLU D 1 104 ? 52.097 9.333  33.548  1.00 241.94 ? 104 GLU D CG   1 
ATOM   4309 C  CD   . GLU D 1 104 ? 53.599 9.097  33.436  1.00 250.99 ? 104 GLU D CD   1 
ATOM   4310 O  OE1  . GLU D 1 104 ? 54.011 8.216  32.648  1.00 241.95 ? 104 GLU D OE1  1 
ATOM   4311 O  OE2  . GLU D 1 104 ? 54.364 9.784  34.147  1.00 241.69 ? 104 GLU D OE2  1 
ATOM   4312 N  N    . ARG D 1 105 ? 49.954 7.441  36.062  1.00 247.11 ? 105 ARG D N    1 
ATOM   4313 C  CA   . ARG D 1 105 ? 49.377 6.121  36.278  1.00 248.52 ? 105 ARG D CA   1 
ATOM   4314 C  C    . ARG D 1 105 ? 49.780 5.662  37.672  1.00 258.50 ? 105 ARG D C    1 
ATOM   4315 O  O    . ARG D 1 105 ? 49.805 4.468  37.967  1.00 259.28 ? 105 ARG D O    1 
ATOM   4316 C  CB   . ARG D 1 105 ? 49.905 5.140  35.229  1.00 246.63 ? 105 ARG D CB   1 
ATOM   4317 C  CG   . ARG D 1 105 ? 50.414 5.824  33.968  1.00 247.92 ? 105 ARG D CG   1 
ATOM   4318 C  CD   . ARG D 1 105 ? 51.348 4.927  33.171  1.00 244.03 ? 105 ARG D CD   1 
ATOM   4319 N  NE   . ARG D 1 105 ? 50.933 4.830  31.774  1.00 240.31 ? 105 ARG D NE   1 
ATOM   4320 C  CZ   . ARG D 1 105 ? 51.494 4.025  30.876  1.00 247.30 ? 105 ARG D CZ   1 
ATOM   4321 N  NH1  . ARG D 1 105 ? 52.511 3.241  31.222  1.00 233.11 ? 105 ARG D NH1  1 
ATOM   4322 N  NH2  . ARG D 1 105 ? 51.036 4.003  29.627  1.00 232.52 ? 105 ARG D NH2  1 
ATOM   4323 N  N    . THR D 1 106 ? 50.109 6.634  38.518  1.00 255.92 ? 106 THR D N    1 
ATOM   4324 C  CA   . THR D 1 106 ? 50.513 6.372  39.892  1.00 254.83 ? 106 THR D CA   1 
ATOM   4325 C  C    . THR D 1 106 ? 49.507 5.473  40.604  1.00 255.66 ? 106 THR D C    1 
ATOM   4326 O  O    . THR D 1 106 ? 49.859 4.763  41.549  1.00 254.46 ? 106 THR D O    1 
ATOM   4327 C  CB   . THR D 1 106 ? 50.702 7.689  40.673  1.00 259.73 ? 106 THR D CB   1 
ATOM   4328 O  OG1  . THR D 1 106 ? 50.629 8.803  39.773  1.00 258.55 ? 106 THR D OG1  1 
ATOM   4329 C  CG2  . THR D 1 106 ? 52.040 7.698  41.390  1.00 257.58 ? 106 THR D CG2  1 
ATOM   4330 N  N    . GLN D 1 107 ? 48.253 5.533  40.158  1.00 252.68 ? 107 GLN D N    1 
ATOM   4331 C  CA   . GLN D 1 107 ? 47.156 4.764  40.750  1.00 251.02 ? 107 GLN D CA   1 
ATOM   4332 C  C    . GLN D 1 107 ? 46.660 5.397  42.059  1.00 249.19 ? 107 GLN D C    1 
ATOM   4333 O  O    . GLN D 1 107 ? 45.575 5.068  42.547  1.00 247.51 ? 107 GLN D O    1 
ATOM   4334 C  CB   . GLN D 1 107 ? 47.550 3.298  40.970  1.00 252.24 ? 107 GLN D CB   1 
ATOM   4335 C  CG   . GLN D 1 107 ? 48.508 2.726  39.930  1.00 257.02 ? 107 GLN D CG   1 
ATOM   4336 C  CD   . GLN D 1 107 ? 49.775 2.172  40.556  1.00 266.19 ? 107 GLN D CD   1 
ATOM   4337 O  OE1  . GLN D 1 107 ? 49.796 1.824  41.738  1.00 260.23 ? 107 GLN D OE1  1 
ATOM   4338 N  NE2  . GLN D 1 107 ? 50.854 2.140  39.782  1.00 256.88 ? 107 GLN D NE2  1 
ATOM   4339 N  N    . SER D 1 108 ? 47.455 6.318  42.607  1.00 245.07 ? 108 SER D N    1 
ATOM   4340 C  CA   . SER D 1 108 ? 47.119 7.011  43.853  1.00 244.16 ? 108 SER D CA   1 
ATOM   4341 C  C    . SER D 1 108 ? 46.471 8.388  43.629  1.00 247.19 ? 108 SER D C    1 
ATOM   4342 O  O    . SER D 1 108 ? 45.858 8.637  42.585  1.00 246.72 ? 108 SER D O    1 
ATOM   4343 C  CB   . SER D 1 108 ? 48.353 7.130  44.763  1.00 246.60 ? 108 SER D CB   1 
ATOM   4344 O  OG   . SER D 1 108 ? 49.539 7.389  44.025  1.00 254.10 ? 108 SER D OG   1 
ATOM   4345 N  N    . THR D 1 109 ? 46.589 9.261  44.629  1.00 242.03 ? 109 THR D N    1 
ATOM   4346 C  CA   . THR D 1 109 ? 46.030 10.618 44.587  1.00 241.57 ? 109 THR D CA   1 
ATOM   4347 C  C    . THR D 1 109 ? 44.561 10.724 45.004  1.00 238.24 ? 109 THR D C    1 
ATOM   4348 O  O    . THR D 1 109 ? 43.662 10.705 44.159  1.00 236.42 ? 109 THR D O    1 
ATOM   4349 C  CB   . THR D 1 109 ? 46.264 11.312 43.239  1.00 271.85 ? 109 THR D CB   1 
ATOM   4350 O  OG1  . THR D 1 109 ? 47.669 11.381 42.963  1.00 276.34 ? 109 THR D OG1  1 
ATOM   4351 C  CG2  . THR D 1 109 ? 45.693 12.712 43.287  1.00 275.36 ? 109 THR D CG2  1 
ATOM   4352 N  N    . PRO D 1 110 ? 44.304 10.871 46.316  1.00 233.36 ? 110 PRO D N    1 
ATOM   4353 C  CA   . PRO D 1 110 ? 42.917 10.985 46.778  1.00 230.64 ? 110 PRO D CA   1 
ATOM   4354 C  C    . PRO D 1 110 ? 42.359 12.371 46.509  1.00 225.33 ? 110 PRO D C    1 
ATOM   4355 O  O    . PRO D 1 110 ? 43.106 13.343 46.387  1.00 223.20 ? 110 PRO D O    1 
ATOM   4356 C  CB   . PRO D 1 110 ? 43.024 10.739 48.289  1.00 233.53 ? 110 PRO D CB   1 
ATOM   4357 C  CG   . PRO D 1 110 ? 44.295 9.976  48.462  1.00 240.24 ? 110 PRO D CG   1 
ATOM   4358 C  CD   . PRO D 1 110 ? 45.218 10.549 47.425  1.00 235.66 ? 110 PRO D CD   1 
ATOM   4359 N  N    . GLY D 1 111 ? 41.037 12.448 46.411  1.00 219.36 ? 111 GLY D N    1 
ATOM   4360 C  CA   . GLY D 1 111 ? 40.350 13.691 46.128  1.00 218.28 ? 111 GLY D CA   1 
ATOM   4361 C  C    . GLY D 1 111 ? 39.116 13.924 46.976  1.00 219.59 ? 111 GLY D C    1 
ATOM   4362 O  O    . GLY D 1 111 ? 38.974 13.364 48.064  1.00 218.95 ? 111 GLY D O    1 
ATOM   4363 N  N    . TYR D 1 112 ? 38.237 14.791 46.487  1.00 213.38 ? 112 TYR D N    1 
ATOM   4364 C  CA   . TYR D 1 112 ? 37.022 15.165 47.199  1.00 212.10 ? 112 TYR D CA   1 
ATOM   4365 C  C    . TYR D 1 112 ? 37.237 15.681 48.613  1.00 226.79 ? 112 TYR D C    1 
ATOM   4366 O  O    . TYR D 1 112 ? 36.407 16.414 49.154  1.00 229.09 ? 112 TYR D O    1 
ATOM   4367 C  CB   . TYR D 1 112 ? 35.958 14.079 47.145  1.00 206.91 ? 112 TYR D CB   1 
ATOM   4368 C  CG   . TYR D 1 112 ? 34.697 14.606 46.519  1.00 198.79 ? 112 TYR D CG   1 
ATOM   4369 C  CD1  . TYR D 1 112 ? 34.753 15.316 45.323  1.00 199.01 ? 112 TYR D CD1  1 
ATOM   4370 C  CD2  . TYR D 1 112 ? 33.474 14.527 47.177  1.00 196.93 ? 112 TYR D CD2  1 
ATOM   4371 C  CE1  . TYR D 1 112 ? 33.613 15.866 44.751  1.00 197.83 ? 112 TYR D CE1  1 
ATOM   4372 C  CE2  . TYR D 1 112 ? 32.318 15.071 46.612  1.00 196.70 ? 112 TYR D CE2  1 
ATOM   4373 C  CZ   . TYR D 1 112 ? 32.396 15.741 45.395  1.00 201.58 ? 112 TYR D CZ   1 
ATOM   4374 O  OH   . TYR D 1 112 ? 31.271 16.289 44.809  1.00 201.08 ? 112 TYR D OH   1 
ATOM   4375 N  N    . ILE D 1 113 ? 38.367 15.316 49.201  1.00 219.89 ? 113 ILE D N    1 
ATOM   4376 C  CA   . ILE D 1 113 ? 38.710 15.788 50.528  1.00 218.75 ? 113 ILE D CA   1 
ATOM   4377 C  C    . ILE D 1 113 ? 38.895 17.301 50.432  1.00 221.66 ? 113 ILE D C    1 
ATOM   4378 O  O    . ILE D 1 113 ? 37.904 18.031 50.319  1.00 221.49 ? 113 ILE D O    1 
ATOM   4379 C  CB   . ILE D 1 113 ? 39.964 15.062 51.083  1.00 221.06 ? 113 ILE D CB   1 
ATOM   4380 C  CG1  . ILE D 1 113 ? 40.483 15.761 52.341  1.00 220.94 ? 113 ILE D CG1  1 
ATOM   4381 C  CG2  . ILE D 1 113 ? 41.049 14.924 50.010  1.00 221.51 ? 113 ILE D CG2  1 
ATOM   4382 C  CD1  . ILE D 1 113 ? 41.603 15.021 53.021  1.00 227.22 ? 113 ILE D CD1  1 
ATOM   4383 N  N    . PHE D 1 114 ? 40.160 17.731 50.423  1.00 213.64 ? 114 PHE D N    1 
ATOM   4384 C  CA   . PHE D 1 114 ? 40.586 19.132 50.336  1.00 208.69 ? 114 PHE D CA   1 
ATOM   4385 C  C    . PHE D 1 114 ? 41.229 19.705 51.599  1.00 207.47 ? 114 PHE D C    1 
ATOM   4386 O  O    . PHE D 1 114 ? 41.717 18.974 52.464  1.00 206.04 ? 114 PHE D O    1 
ATOM   4387 C  CB   . PHE D 1 114 ? 39.470 20.054 49.873  1.00 206.37 ? 114 PHE D CB   1 
ATOM   4388 C  CG   . PHE D 1 114 ? 39.723 20.664 48.547  1.00 201.80 ? 114 PHE D CG   1 
ATOM   4389 C  CD1  . PHE D 1 114 ? 40.934 21.273 48.282  1.00 200.26 ? 114 PHE D CD1  1 
ATOM   4390 C  CD2  . PHE D 1 114 ? 38.768 20.606 47.555  1.00 198.91 ? 114 PHE D CD2  1 
ATOM   4391 C  CE1  . PHE D 1 114 ? 41.183 21.846 47.055  1.00 199.04 ? 114 PHE D CE1  1 
ATOM   4392 C  CE2  . PHE D 1 114 ? 39.007 21.175 46.324  1.00 199.31 ? 114 PHE D CE2  1 
ATOM   4393 C  CZ   . PHE D 1 114 ? 40.221 21.798 46.073  1.00 196.81 ? 114 PHE D CZ   1 
ATOM   4394 N  N    . GLY D 1 115 ? 41.231 21.033 51.672  1.00 199.66 ? 115 GLY D N    1 
ATOM   4395 C  CA   . GLY D 1 115 ? 41.761 21.818 52.772  1.00 198.67 ? 115 GLY D CA   1 
ATOM   4396 C  C    . GLY D 1 115 ? 40.719 22.063 53.840  1.00 200.32 ? 115 GLY D C    1 
ATOM   4397 O  O    . GLY D 1 115 ? 40.398 23.205 54.178  1.00 199.70 ? 115 GLY D O    1 
ATOM   4398 N  N    . LYS D 1 116 ? 40.191 20.959 54.349  1.00 189.42 ? 116 LYS D N    1 
ATOM   4399 C  CA   . LYS D 1 116 ? 39.219 20.933 55.424  1.00 188.37 ? 116 LYS D CA   1 
ATOM   4400 C  C    . LYS D 1 116 ? 39.434 22.034 56.433  1.00 193.54 ? 116 LYS D C    1 
ATOM   4401 O  O    . LYS D 1 116 ? 38.511 22.761 56.809  1.00 193.77 ? 116 LYS D O    1 
ATOM   4402 C  CB   . LYS D 1 116 ? 39.407 19.627 56.205  1.00 188.61 ? 116 LYS D CB   1 
ATOM   4403 C  CG   . LYS D 1 116 ? 38.688 18.423 55.654  1.00 177.31 ? 116 LYS D CG   1 
ATOM   4404 C  CD   . LYS D 1 116 ? 37.227 18.487 56.030  1.00 172.16 ? 116 LYS D CD   1 
ATOM   4405 C  CE   . LYS D 1 116 ? 36.615 19.736 55.460  1.00 168.92 ? 116 LYS D CE   1 
ATOM   4406 N  NZ   . LYS D 1 116 ? 36.746 20.891 56.392  1.00 173.28 ? 116 LYS D NZ   1 
ATOM   4407 N  N    . ARG D 1 117 ? 40.661 22.090 56.930  1.00 185.80 ? 117 ARG D N    1 
ATOM   4408 C  CA   . ARG D 1 117 ? 40.997 23.045 57.956  1.00 184.06 ? 117 ARG D CA   1 
ATOM   4409 C  C    . ARG D 1 117 ? 40.871 24.498 57.543  1.00 181.68 ? 117 ARG D C    1 
ATOM   4410 O  O    . ARG D 1 117 ? 40.412 25.312 58.331  1.00 180.15 ? 117 ARG D O    1 
ATOM   4411 C  CB   . ARG D 1 117 ? 42.328 22.737 58.623  1.00 185.67 ? 117 ARG D CB   1 
ATOM   4412 C  CG   . ARG D 1 117 ? 43.410 22.266 57.690  1.00 198.72 ? 117 ARG D CG   1 
ATOM   4413 C  CD   . ARG D 1 117 ? 44.745 22.357 58.404  1.00 211.42 ? 117 ARG D CD   1 
ATOM   4414 N  NE   . ARG D 1 117 ? 44.662 21.839 59.770  1.00 222.09 ? 117 ARG D NE   1 
ATOM   4415 C  CZ   . ARG D 1 117 ? 44.933 22.544 60.865  1.00 237.54 ? 117 ARG D CZ   1 
ATOM   4416 N  NH1  . ARG D 1 117 ? 45.301 23.814 60.773  1.00 225.26 ? 117 ARG D NH1  1 
ATOM   4417 N  NH2  . ARG D 1 117 ? 44.834 21.975 62.058  1.00 224.67 ? 117 ARG D NH2  1 
ATOM   4418 N  N    . ILE D 1 118 ? 41.228 24.826 56.305  1.00 175.99 ? 118 ILE D N    1 
ATOM   4419 C  CA   . ILE D 1 118 ? 41.093 26.203 55.838  1.00 174.00 ? 118 ILE D CA   1 
ATOM   4420 C  C    . ILE D 1 118 ? 39.651 26.689 56.001  1.00 171.63 ? 118 ILE D C    1 
ATOM   4421 O  O    . ILE D 1 118 ? 39.376 27.602 56.783  1.00 169.96 ? 118 ILE D O    1 
ATOM   4422 C  CB   . ILE D 1 118 ? 41.536 26.359 54.375  1.00 177.17 ? 118 ILE D CB   1 
ATOM   4423 C  CG1  . ILE D 1 118 ? 43.032 26.623 54.292  1.00 177.60 ? 118 ILE D CG1  1 
ATOM   4424 C  CG2  . ILE D 1 118 ? 40.815 27.529 53.735  1.00 177.89 ? 118 ILE D CG2  1 
ATOM   4425 C  CD1  . ILE D 1 118 ? 43.399 27.573 53.183  1.00 184.98 ? 118 ILE D CD1  1 
ATOM   4426 N  N    . ILE D 1 119 ? 38.739 26.084 55.239  1.00 168.33 ? 119 ILE D N    1 
ATOM   4427 C  CA   . ILE D 1 119 ? 37.317 26.444 55.269  1.00 168.12 ? 119 ILE D CA   1 
ATOM   4428 C  C    . ILE D 1 119 ? 36.784 26.362 56.686  1.00 159.37 ? 119 ILE D C    1 
ATOM   4429 O  O    . ILE D 1 119 ? 35.952 27.170 57.108  1.00 173.37 ? 119 ILE D O    1 
ATOM   4430 C  CB   . ILE D 1 119 ? 36.487 25.517 54.366  1.00 170.98 ? 119 ILE D CB   1 
ATOM   4431 C  CG1  . ILE D 1 119 ? 36.802 24.045 54.680  1.00 171.37 ? 119 ILE D CG1  1 
ATOM   4432 C  CG2  . ILE D 1 119 ? 36.626 25.908 52.895  1.00 171.67 ? 119 ILE D CG2  1 
ATOM   4433 C  CD1  . ILE D 1 119 ? 37.648 23.328 53.637  1.00 178.77 ? 119 ILE D CD1  1 
ATOM   4434 N  N    . LEU D 1 120 ? 37.235 25.344 57.406  1.00 159.20 ? 120 LEU D N    1 
ATOM   4435 C  CA   . LEU D 1 120 ? 36.810 25.167 58.778  1.00 159.20 ? 120 LEU D CA   1 
ATOM   4436 C  C    . LEU D 1 120 ? 37.155 26.433 59.541  1.00 159.20 ? 120 LEU D C    1 
ATOM   4437 O  O    . LEU D 1 120 ? 36.283 27.070 60.125  1.00 159.20 ? 120 LEU D O    1 
ATOM   4438 C  CB   . LEU D 1 120 ? 37.512 23.971 59.400  1.00 159.20 ? 120 LEU D CB   1 
ATOM   4439 C  CG   . LEU D 1 120 ? 36.936 23.680 60.772  1.00 159.20 ? 120 LEU D CG   1 
ATOM   4440 C  CD1  . LEU D 1 120 ? 37.827 24.342 61.803  1.00 159.20 ? 120 LEU D CD1  1 
ATOM   4441 C  CD2  . LEU D 1 120 ? 35.527 24.250 60.813  1.00 159.20 ? 120 LEU D CD2  1 
ATOM   4442 N  N    . PHE D 1 121 ? 38.424 26.819 59.480  1.00 147.89 ? 121 PHE D N    1 
ATOM   4443 C  CA   . PHE D 1 121 ? 38.890 28.023 60.149  1.00 160.86 ? 121 PHE D CA   1 
ATOM   4444 C  C    . PHE D 1 121 ? 38.174 29.270 59.665  1.00 160.62 ? 121 PHE D C    1 
ATOM   4445 O  O    . PHE D 1 121 ? 37.720 30.075 60.473  1.00 160.73 ? 121 PHE D O    1 
ATOM   4446 C  CB   . PHE D 1 121 ? 40.384 28.213 59.960  1.00 161.94 ? 121 PHE D CB   1 
ATOM   4447 C  CG   . PHE D 1 121 ? 40.829 29.618 60.187  1.00 162.29 ? 121 PHE D CG   1 
ATOM   4448 C  CD1  . PHE D 1 121 ? 41.656 30.249 59.279  1.00 164.27 ? 121 PHE D CD1  1 
ATOM   4449 C  CD2  . PHE D 1 121 ? 40.376 30.328 61.286  1.00 163.59 ? 121 PHE D CD2  1 
ATOM   4450 C  CE1  . PHE D 1 121 ? 42.045 31.559 59.473  1.00 164.76 ? 121 PHE D CE1  1 
ATOM   4451 C  CE2  . PHE D 1 121 ? 40.748 31.634 61.483  1.00 165.94 ? 121 PHE D CE2  1 
ATOM   4452 C  CZ   . PHE D 1 121 ? 41.590 32.252 60.578  1.00 163.81 ? 121 PHE D CZ   1 
ATOM   4453 N  N    . LEU D 1 122 ? 38.149 29.466 58.354  1.00 154.66 ? 122 LEU D N    1 
ATOM   4454 C  CA   . LEU D 1 122 ? 37.476 30.619 57.791  1.00 151.89 ? 122 LEU D CA   1 
ATOM   4455 C  C    . LEU D 1 122 ? 36.055 30.640 58.353  1.00 153.96 ? 122 LEU D C    1 
ATOM   4456 O  O    . LEU D 1 122 ? 35.546 31.685 58.768  1.00 152.80 ? 122 LEU D O    1 
ATOM   4457 C  CB   . LEU D 1 122 ? 37.452 30.519 56.267  1.00 151.21 ? 122 LEU D CB   1 
ATOM   4458 C  CG   . LEU D 1 122 ? 38.237 31.582 55.497  1.00 155.09 ? 122 LEU D CG   1 
ATOM   4459 C  CD1  . LEU D 1 122 ? 39.362 32.142 56.342  1.00 155.03 ? 122 LEU D CD1  1 
ATOM   4460 C  CD2  . LEU D 1 122 ? 38.792 30.997 54.217  1.00 157.32 ? 122 LEU D CD2  1 
ATOM   4461 N  N    . PHE D 1 123 ? 35.443 29.464 58.426  1.00 150.33 ? 123 PHE D N    1 
ATOM   4462 C  CA   . PHE D 1 123 ? 34.095 29.351 58.958  1.00 149.32 ? 123 PHE D CA   1 
ATOM   4463 C  C    . PHE D 1 123 ? 34.019 29.759 60.427  1.00 155.52 ? 123 PHE D C    1 
ATOM   4464 O  O    . PHE D 1 123 ? 32.947 30.084 60.933  1.00 155.84 ? 123 PHE D O    1 
ATOM   4465 C  CB   . PHE D 1 123 ? 33.579 27.930 58.793  1.00 148.60 ? 123 PHE D CB   1 
ATOM   4466 C  CG   . PHE D 1 123 ? 32.300 27.671 59.529  1.00 146.02 ? 123 PHE D CG   1 
ATOM   4467 C  CD1  . PHE D 1 123 ? 32.315 27.103 60.794  1.00 145.62 ? 123 PHE D CD1  1 
ATOM   4468 C  CD2  . PHE D 1 123 ? 31.079 28.020 58.965  1.00 144.58 ? 123 PHE D CD2  1 
ATOM   4469 C  CE1  . PHE D 1 123 ? 31.135 26.848 61.461  1.00 144.91 ? 123 PHE D CE1  1 
ATOM   4470 C  CE2  . PHE D 1 123 ? 29.893 27.785 59.634  1.00 145.57 ? 123 PHE D CE2  1 
ATOM   4471 C  CZ   . PHE D 1 123 ? 29.919 27.195 60.879  1.00 143.13 ? 123 PHE D CZ   1 
ATOM   4472 N  N    . LEU D 1 124 ? 35.154 29.725 61.116  1.00 152.16 ? 124 LEU D N    1 
ATOM   4473 C  CA   . LEU D 1 124 ? 35.181 30.091 62.526  1.00 150.95 ? 124 LEU D CA   1 
ATOM   4474 C  C    . LEU D 1 124 ? 35.371 31.581 62.725  1.00 148.73 ? 124 LEU D C    1 
ATOM   4475 O  O    . LEU D 1 124 ? 35.075 32.104 63.792  1.00 146.92 ? 124 LEU D O    1 
ATOM   4476 C  CB   . LEU D 1 124 ? 36.232 29.299 63.290  1.00 151.61 ? 124 LEU D CB   1 
ATOM   4477 C  CG   . LEU D 1 124 ? 35.935 27.805 63.364  1.00 156.88 ? 124 LEU D CG   1 
ATOM   4478 C  CD1  . LEU D 1 124 ? 34.625 27.456 62.660  1.00 157.18 ? 124 LEU D CD1  1 
ATOM   4479 C  CD2  . LEU D 1 124 ? 37.092 27.045 62.760  1.00 159.47 ? 124 LEU D CD2  1 
ATOM   4480 N  N    . MET D 1 125 ? 35.849 32.267 61.694  1.00 146.13 ? 125 MET D N    1 
ATOM   4481 C  CA   . MET D 1 125 ? 35.998 33.710 61.765  1.00 146.13 ? 125 MET D CA   1 
ATOM   4482 C  C    . MET D 1 125 ? 34.610 34.281 61.531  1.00 146.13 ? 125 MET D C    1 
ATOM   4483 O  O    . MET D 1 125 ? 34.198 35.239 62.181  1.00 216.31 ? 125 MET D O    1 
ATOM   4484 C  CB   . MET D 1 125 ? 36.934 34.211 60.671  1.00 146.13 ? 125 MET D CB   1 
ATOM   4485 C  CG   . MET D 1 125 ? 38.326 33.598 60.672  1.00 146.13 ? 125 MET D CG   1 
ATOM   4486 S  SD   . MET D 1 125 ? 39.511 34.614 59.714  1.00 146.13 ? 125 MET D SD   1 
ATOM   4487 C  CE   . MET D 1 125 ? 38.608 34.874 58.192  1.00 146.13 ? 125 MET D CE   1 
ATOM   4488 N  N    . SER D 1 126 ? 33.884 33.666 60.604  1.00 142.33 ? 126 SER D N    1 
ATOM   4489 C  CA   . SER D 1 126 ? 32.523 34.088 60.294  1.00 143.48 ? 126 SER D CA   1 
ATOM   4490 C  C    . SER D 1 126 ? 31.601 33.801 61.481  1.00 150.69 ? 126 SER D C    1 
ATOM   4491 O  O    . SER D 1 126 ? 30.781 34.644 61.857  1.00 151.10 ? 126 SER D O    1 
ATOM   4492 C  CB   . SER D 1 126 ? 32.006 33.391 59.034  1.00 147.67 ? 126 SER D CB   1 
ATOM   4493 O  OG   . SER D 1 126 ? 32.722 32.196 58.790  1.00 156.92 ? 126 SER D OG   1 
ATOM   4494 N  N    . VAL D 1 127 ? 31.748 32.615 62.073  1.00 147.83 ? 127 VAL D N    1 
ATOM   4495 C  CA   . VAL D 1 127 ? 30.959 32.230 63.239  1.00 147.60 ? 127 VAL D CA   1 
ATOM   4496 C  C    . VAL D 1 127 ? 31.397 33.074 64.420  1.00 150.37 ? 127 VAL D C    1 
ATOM   4497 O  O    . VAL D 1 127 ? 30.685 33.183 65.411  1.00 149.21 ? 127 VAL D O    1 
ATOM   4498 C  CB   . VAL D 1 127 ? 31.136 30.752 63.575  1.00 152.22 ? 127 VAL D CB   1 
ATOM   4499 C  CG1  . VAL D 1 127 ? 32.553 30.486 64.037  1.00 152.15 ? 127 VAL D CG1  1 
ATOM   4500 C  CG2  . VAL D 1 127 ? 30.162 30.355 64.646  1.00 152.16 ? 127 VAL D CG2  1 
ATOM   4501 N  N    . ALA D 1 128 ? 32.588 33.652 64.312  1.00 149.09 ? 128 ALA D N    1 
ATOM   4502 C  CA   . ALA D 1 128 ? 33.134 34.492 65.370  1.00 150.05 ? 128 ALA D CA   1 
ATOM   4503 C  C    . ALA D 1 128 ? 32.402 35.817 65.413  1.00 158.11 ? 128 ALA D C    1 
ATOM   4504 O  O    . ALA D 1 128 ? 31.604 36.070 66.313  1.00 158.51 ? 128 ALA D O    1 
ATOM   4505 C  CB   . ALA D 1 128 ? 34.608 34.723 65.157  1.00 150.67 ? 128 ALA D CB   1 
ATOM   4506 N  N    . GLY D 1 129 ? 32.677 36.665 64.431  1.00 156.64 ? 129 GLY D N    1 
ATOM   4507 C  CA   . GLY D 1 129 ? 32.035 37.960 64.349  1.00 157.08 ? 129 GLY D CA   1 
ATOM   4508 C  C    . GLY D 1 129 ? 30.526 37.846 64.451  1.00 162.83 ? 129 GLY D C    1 
ATOM   4509 O  O    . GLY D 1 129 ? 29.879 38.644 65.130  1.00 162.92 ? 129 GLY D O    1 
ATOM   4510 N  N    . ILE D 1 130 ? 29.962 36.849 63.780  1.00 160.30 ? 130 ILE D N    1 
ATOM   4511 C  CA   . ILE D 1 130 ? 28.523 36.662 63.794  1.00 160.55 ? 130 ILE D CA   1 
ATOM   4512 C  C    . ILE D 1 130 ? 27.975 36.633 65.212  1.00 162.68 ? 130 ILE D C    1 
ATOM   4513 O  O    . ILE D 1 130 ? 26.895 37.159 65.488  1.00 164.06 ? 130 ILE D O    1 
ATOM   4514 C  CB   . ILE D 1 130 ? 28.111 35.428 63.010  1.00 164.38 ? 130 ILE D CB   1 
ATOM   4515 C  CG1  . ILE D 1 130 ? 26.955 35.776 62.070  1.00 165.17 ? 130 ILE D CG1  1 
ATOM   4516 C  CG2  . ILE D 1 130 ? 27.724 34.305 63.967  1.00 165.34 ? 130 ILE D CG2  1 
ATOM   4517 C  CD1  . ILE D 1 130 ? 26.035 36.861 62.607  1.00 173.10 ? 130 ILE D CD1  1 
ATOM   4518 N  N    . PHE D 1 131 ? 28.732 36.019 66.111  1.00 161.91 ? 131 PHE D N    1 
ATOM   4519 C  CA   . PHE D 1 131 ? 28.341 35.962 67.510  1.00 162.07 ? 131 PHE D CA   1 
ATOM   4520 C  C    . PHE D 1 131 ? 28.753 37.268 68.174  1.00 164.53 ? 131 PHE D C    1 
ATOM   4521 O  O    . PHE D 1 131 ? 27.913 37.968 68.734  1.00 159.72 ? 131 PHE D O    1 
ATOM   4522 C  CB   . PHE D 1 131 ? 29.012 34.786 68.233  1.00 167.82 ? 131 PHE D CB   1 
ATOM   4523 C  CG   . PHE D 1 131 ? 29.777 35.188 69.476  1.00 175.29 ? 131 PHE D CG   1 
ATOM   4524 C  CD1  . PHE D 1 131 ? 31.164 35.145 69.501  1.00 182.51 ? 131 PHE D CD1  1 
ATOM   4525 C  CD2  . PHE D 1 131 ? 29.112 35.627 70.612  1.00 181.93 ? 131 PHE D CD2  1 
ATOM   4526 C  CE1  . PHE D 1 131 ? 31.867 35.516 70.634  1.00 185.19 ? 131 PHE D CE1  1 
ATOM   4527 C  CE2  . PHE D 1 131 ? 29.814 36.013 71.741  1.00 186.71 ? 131 PHE D CE2  1 
ATOM   4528 C  CZ   . PHE D 1 131 ? 31.190 35.950 71.754  1.00 185.24 ? 131 PHE D CZ   1 
ATOM   4529 N  N    . ASN D 1 132 ? 30.049 37.575 68.122  1.00 161.09 ? 132 ASN D N    1 
ATOM   4530 C  CA   . ASN D 1 132 ? 30.591 38.778 68.741  1.00 164.04 ? 132 ASN D CA   1 
ATOM   4531 C  C    . ASN D 1 132 ? 29.719 39.989 68.476  1.00 166.27 ? 132 ASN D C    1 
ATOM   4532 O  O    . ASN D 1 132 ? 29.686 40.932 69.268  1.00 164.53 ? 132 ASN D O    1 
ATOM   4533 C  CB   . ASN D 1 132 ? 31.986 39.079 68.208  1.00 168.13 ? 132 ASN D CB   1 
ATOM   4534 C  CG   . ASN D 1 132 ? 32.207 40.567 67.984  1.00 198.78 ? 132 ASN D CG   1 
ATOM   4535 O  OD1  . ASN D 1 132 ? 31.771 41.130 66.974  1.00 194.19 ? 132 ASN D OD1  1 
ATOM   4536 N  ND2  . ASN D 1 132 ? 32.830 41.224 68.958  1.00 191.74 ? 132 ASN D ND2  1 
ATOM   4537 N  N    . TYR D 1 133 ? 29.030 39.969 67.343  1.00 164.78 ? 133 TYR D N    1 
ATOM   4538 C  CA   . TYR D 1 133 ? 28.163 41.074 66.980  1.00 164.53 ? 133 TYR D CA   1 
ATOM   4539 C  C    . TYR D 1 133 ? 26.927 41.097 67.859  1.00 167.71 ? 133 TYR D C    1 
ATOM   4540 O  O    . TYR D 1 133 ? 26.450 42.156 68.242  1.00 167.84 ? 133 TYR D O    1 
ATOM   4541 C  CB   . TYR D 1 133 ? 27.741 40.967 65.534  1.00 164.46 ? 133 TYR D CB   1 
ATOM   4542 C  CG   . TYR D 1 133 ? 26.397 41.580 65.287  1.00 163.16 ? 133 TYR D CG   1 
ATOM   4543 C  CD1  . TYR D 1 133 ? 25.235 40.838 65.440  1.00 164.55 ? 133 TYR D CD1  1 
ATOM   4544 C  CD2  . TYR D 1 133 ? 26.288 42.909 64.925  1.00 162.85 ? 133 TYR D CD2  1 
ATOM   4545 C  CE1  . TYR D 1 133 ? 24.008 41.398 65.202  1.00 164.38 ? 133 TYR D CE1  1 
ATOM   4546 C  CE2  . TYR D 1 133 ? 25.068 43.477 64.687  1.00 163.19 ? 133 TYR D CE2  1 
ATOM   4547 C  CZ   . TYR D 1 133 ? 23.931 42.720 64.819  1.00 169.06 ? 133 TYR D CZ   1 
ATOM   4548 O  OH   . TYR D 1 133 ? 22.713 43.304 64.570  1.00 169.06 ? 133 TYR D OH   1 
ATOM   4549 N  N    . TYR D 1 134 ? 26.387 39.925 68.153  1.00 167.61 ? 134 TYR D N    1 
ATOM   4550 C  CA   . TYR D 1 134 ? 25.225 39.858 69.019  1.00 167.68 ? 134 TYR D CA   1 
ATOM   4551 C  C    . TYR D 1 134 ? 25.562 40.418 70.398  1.00 169.29 ? 134 TYR D C    1 
ATOM   4552 O  O    . TYR D 1 134 ? 24.681 40.849 71.135  1.00 167.05 ? 134 TYR D O    1 
ATOM   4553 C  CB   . TYR D 1 134 ? 24.688 38.437 69.101  1.00 172.23 ? 134 TYR D CB   1 
ATOM   4554 C  CG   . TYR D 1 134 ? 23.764 38.141 67.964  1.00 180.37 ? 134 TYR D CG   1 
ATOM   4555 C  CD1  . TYR D 1 134 ? 22.759 39.036 67.629  1.00 183.28 ? 134 TYR D CD1  1 
ATOM   4556 C  CD2  . TYR D 1 134 ? 23.956 37.034 67.162  1.00 182.94 ? 134 TYR D CD2  1 
ATOM   4557 C  CE1  . TYR D 1 134 ? 21.928 38.807 66.571  1.00 184.78 ? 134 TYR D CE1  1 
ATOM   4558 C  CE2  . TYR D 1 134 ? 23.131 36.792 66.095  1.00 184.43 ? 134 TYR D CE2  1 
ATOM   4559 C  CZ   . TYR D 1 134 ? 22.115 37.682 65.800  1.00 191.70 ? 134 TYR D CZ   1 
ATOM   4560 O  OH   . TYR D 1 134 ? 21.285 37.441 64.727  1.00 192.57 ? 134 TYR D OH   1 
ATOM   4561 N  N    . LEU D 1 135 ? 26.855 40.443 70.710  1.00 166.80 ? 135 LEU D N    1 
ATOM   4562 C  CA   . LEU D 1 135 ? 27.384 41.001 71.952  1.00 168.70 ? 135 LEU D CA   1 
ATOM   4563 C  C    . LEU D 1 135 ? 27.207 42.494 71.892  1.00 174.33 ? 135 LEU D C    1 
ATOM   4564 O  O    . LEU D 1 135 ? 26.505 43.092 72.705  1.00 173.87 ? 135 LEU D O    1 
ATOM   4565 C  CB   . LEU D 1 135 ? 28.894 40.787 71.985  1.00 169.13 ? 135 LEU D CB   1 
ATOM   4566 C  CG   . LEU D 1 135 ? 29.412 39.630 72.817  1.00 173.89 ? 135 LEU D CG   1 
ATOM   4567 C  CD1  . LEU D 1 135 ? 30.010 40.182 74.086  1.00 174.02 ? 135 LEU D CD1  1 
ATOM   4568 C  CD2  . LEU D 1 135 ? 28.272 38.677 73.120  1.00 176.33 ? 135 LEU D CD2  1 
ATOM   4569 N  N    . ILE D 1 136 ? 27.918 43.092 70.942  1.00 172.11 ? 136 ILE D N    1 
ATOM   4570 C  CA   . ILE D 1 136 ? 27.887 44.534 70.719  1.00 172.01 ? 136 ILE D CA   1 
ATOM   4571 C  C    . ILE D 1 136 ? 26.453 45.043 70.598  1.00 184.01 ? 136 ILE D C    1 
ATOM   4572 O  O    . ILE D 1 136 ? 26.167 46.210 70.863  1.00 184.53 ? 136 ILE D O    1 
ATOM   4573 C  CB   . ILE D 1 136 ? 28.716 44.927 69.483  1.00 172.48 ? 136 ILE D CB   1 
ATOM   4574 C  CG1  . ILE D 1 136 ? 29.701 43.815 69.116  1.00 171.63 ? 136 ILE D CG1  1 
ATOM   4575 C  CG2  . ILE D 1 136 ? 29.445 46.227 69.725  1.00 172.29 ? 136 ILE D CG2  1 
ATOM   4576 C  CD1  . ILE D 1 136 ? 29.913 43.653 67.614  1.00 177.39 ? 136 ILE D CD1  1 
ATOM   4577 N  N    . PHE D 1 137 ? 25.555 44.153 70.191  1.00 185.26 ? 137 PHE D N    1 
ATOM   4578 C  CA   . PHE D 1 137 ? 24.145 44.489 70.060  1.00 192.26 ? 137 PHE D CA   1 
ATOM   4579 C  C    . PHE D 1 137 ? 23.500 44.573 71.448  1.00 181.68 ? 137 PHE D C    1 
ATOM   4580 O  O    . PHE D 1 137 ? 22.573 45.351 71.658  1.00 177.44 ? 137 PHE D O    1 
ATOM   4581 C  CB   . PHE D 1 137 ? 23.435 43.440 69.206  1.00 206.92 ? 137 PHE D CB   1 
ATOM   4582 C  CG   . PHE D 1 137 ? 21.998 43.754 68.930  1.00 225.66 ? 137 PHE D CG   1 
ATOM   4583 C  CD1  . PHE D 1 137 ? 21.593 45.053 68.696  1.00 241.15 ? 137 PHE D CD1  1 
ATOM   4584 C  CD2  . PHE D 1 137 ? 21.058 42.742 68.884  1.00 240.37 ? 137 PHE D CD2  1 
ATOM   4585 C  CE1  . PHE D 1 137 ? 20.274 45.336 68.436  1.00 246.97 ? 137 PHE D CE1  1 
ATOM   4586 C  CE2  . PHE D 1 137 ? 19.740 43.018 68.623  1.00 248.65 ? 137 PHE D CE2  1 
ATOM   4587 C  CZ   . PHE D 1 137 ? 19.346 44.317 68.399  1.00 248.18 ? 137 PHE D CZ   1 
ATOM   4588 N  N    . PHE D 1 138 ? 24.030 43.821 72.412  1.00 180.76 ? 138 PHE D N    1 
ATOM   4589 C  CA   . PHE D 1 138 ? 23.511 43.859 73.777  1.00 183.77 ? 138 PHE D CA   1 
ATOM   4590 C  C    . PHE D 1 138 ? 24.439 44.607 74.709  1.00 197.85 ? 138 PHE D C    1 
ATOM   4591 O  O    . PHE D 1 138 ? 24.080 45.647 75.249  1.00 198.93 ? 138 PHE D O    1 
ATOM   4592 C  CB   . PHE D 1 138 ? 23.252 42.452 74.294  1.00 185.63 ? 138 PHE D CB   1 
ATOM   4593 C  CG   . PHE D 1 138 ? 22.219 41.719 73.506  1.00 187.10 ? 138 PHE D CG   1 
ATOM   4594 C  CD1  . PHE D 1 138 ? 21.682 42.292 72.372  1.00 189.54 ? 138 PHE D CD1  1 
ATOM   4595 C  CD2  . PHE D 1 138 ? 21.785 40.468 73.892  1.00 188.63 ? 138 PHE D CD2  1 
ATOM   4596 C  CE1  . PHE D 1 138 ? 20.733 41.636 71.634  1.00 189.91 ? 138 PHE D CE1  1 
ATOM   4597 C  CE2  . PHE D 1 138 ? 20.832 39.802 73.159  1.00 190.79 ? 138 PHE D CE2  1 
ATOM   4598 C  CZ   . PHE D 1 138 ? 20.304 40.388 72.024  1.00 188.60 ? 138 PHE D CZ   1 
ATOM   4599 N  N    . PHE D 1 139 ? 25.650 44.097 74.863  1.00 200.07 ? 139 PHE D N    1 
ATOM   4600 C  CA   . PHE D 1 139 ? 26.619 44.736 75.736  1.00 203.78 ? 139 PHE D CA   1 
ATOM   4601 C  C    . PHE D 1 139 ? 27.541 45.673 74.962  1.00 219.68 ? 139 PHE D C    1 
ATOM   4602 O  O    . PHE D 1 139 ? 28.573 46.127 75.471  1.00 221.18 ? 139 PHE D O    1 
ATOM   4603 C  CB   . PHE D 1 139 ? 27.402 43.696 76.528  1.00 205.85 ? 139 PHE D CB   1 
ATOM   4604 C  CG   . PHE D 1 139 ? 26.536 42.658 77.174  1.00 207.73 ? 139 PHE D CG   1 
ATOM   4605 C  CD1  . PHE D 1 139 ? 25.159 42.781 77.163  1.00 210.81 ? 139 PHE D CD1  1 
ATOM   4606 C  CD2  . PHE D 1 139 ? 27.098 41.558 77.798  1.00 209.86 ? 139 PHE D CD2  1 
ATOM   4607 C  CE1  . PHE D 1 139 ? 24.361 41.821 77.738  1.00 211.61 ? 139 PHE D CE1  1 
ATOM   4608 C  CE2  . PHE D 1 139 ? 26.298 40.588 78.378  1.00 212.53 ? 139 PHE D CE2  1 
ATOM   4609 C  CZ   . PHE D 1 139 ? 24.930 40.727 78.358  1.00 210.56 ? 139 PHE D CZ   1 
ATOM   4610 N  N    . GLY D 1 140 ? 27.150 45.975 73.729  1.00 223.18 ? 140 GLY D N    1 
ATOM   4611 C  CA   . GLY D 1 140 ? 27.893 46.914 72.913  1.00 225.33 ? 140 GLY D CA   1 
ATOM   4612 C  C    . GLY D 1 140 ? 27.616 48.241 73.576  1.00 236.02 ? 140 GLY D C    1 
ATOM   4613 O  O    . GLY D 1 140 ? 28.527 49.014 73.866  1.00 236.45 ? 140 GLY D O    1 
ATOM   4614 N  N    . SER D 1 141 ? 26.337 48.461 73.869  1.00 238.81 ? 141 SER D N    1 
ATOM   4615 C  CA   . SER D 1 141 ? 25.882 49.639 74.596  1.00 237.00 ? 141 SER D CA   1 
ATOM   4616 C  C    . SER D 1 141 ? 26.057 49.258 76.061  1.00 228.50 ? 141 SER D C    1 
ATOM   4617 O  O    . SER D 1 141 ? 26.567 48.179 76.355  1.00 224.56 ? 141 SER D O    1 
ATOM   4618 C  CB   . SER D 1 141 ? 24.396 49.887 74.305  1.00 243.44 ? 141 SER D CB   1 
ATOM   4619 O  OG   . SER D 1 141 ? 23.717 48.675 74.000  1.00 254.42 ? 141 SER D OG   1 
ATOM   4620 N  N    . ASP D 1 142 ? 25.645 50.121 76.983  1.00 229.90 ? 142 ASP D N    1 
ATOM   4621 C  CA   . ASP D 1 142 ? 25.749 49.795 78.407  1.00 228.99 ? 142 ASP D CA   1 
ATOM   4622 C  C    . ASP D 1 142 ? 27.189 49.570 78.876  1.00 242.00 ? 142 ASP D C    1 
ATOM   4623 O  O    . ASP D 1 142 ? 27.514 49.775 80.044  1.00 242.96 ? 142 ASP D O    1 
ATOM   4624 C  CB   . ASP D 1 142 ? 24.881 48.573 78.737  1.00 227.24 ? 142 ASP D CB   1 
ATOM   4625 C  CG   . ASP D 1 142 ? 25.706 47.350 79.114  1.00 217.08 ? 142 ASP D CG   1 
ATOM   4626 O  OD1  . ASP D 1 142 ? 26.557 46.928 78.302  1.00 214.76 ? 142 ASP D OD1  1 
ATOM   4627 O  OD2  . ASP D 1 142 ? 25.494 46.798 80.217  1.00 220.12 ? 142 ASP D OD2  1 
ATOM   4628 N  N    . PHE D 1 143 ? 28.043 49.141 77.954  1.00 242.05 ? 143 PHE D N    1 
ATOM   4629 C  CA   . PHE D 1 143 ? 29.464 48.921 78.210  1.00 240.09 ? 143 PHE D CA   1 
ATOM   4630 C  C    . PHE D 1 143 ? 30.083 50.073 79.003  1.00 253.29 ? 143 PHE D C    1 
ATOM   4631 O  O    . PHE D 1 143 ? 31.208 49.958 79.490  1.00 254.22 ? 143 PHE D O    1 
ATOM   4632 C  CB   . PHE D 1 143 ? 30.206 48.773 76.882  1.00 234.52 ? 143 PHE D CB   1 
ATOM   4633 C  CG   . PHE D 1 143 ? 30.067 49.969 75.982  1.00 223.34 ? 143 PHE D CG   1 
ATOM   4634 C  CD1  . PHE D 1 143 ? 28.912 50.750 76.006  1.00 215.65 ? 143 PHE D CD1  1 
ATOM   4635 C  CD2  . PHE D 1 143 ? 31.092 50.330 75.130  1.00 214.34 ? 143 PHE D CD2  1 
ATOM   4636 C  CE1  . PHE D 1 143 ? 28.769 51.849 75.191  1.00 211.70 ? 143 PHE D CE1  1 
ATOM   4637 C  CE2  . PHE D 1 143 ? 30.960 51.438 74.307  1.00 211.70 ? 143 PHE D CE2  1 
ATOM   4638 C  CZ   . PHE D 1 143 ? 29.793 52.197 74.339  1.00 208.29 ? 143 PHE D CZ   1 
ATOM   4639 N  N    . GLU D 1 144 ? 29.361 51.190 79.100  1.00 251.52 ? 144 GLU D N    1 
ATOM   4640 C  CA   . GLU D 1 144 ? 29.820 52.355 79.857  1.00 249.35 ? 144 GLU D CA   1 
ATOM   4641 C  C    . GLU D 1 144 ? 28.892 52.693 81.033  1.00 249.59 ? 144 GLU D C    1 
ATOM   4642 O  O    . GLU D 1 144 ? 28.157 53.688 81.000  1.00 247.83 ? 144 GLU D O    1 
ATOM   4643 C  CB   . GLU D 1 144 ? 30.036 53.574 78.951  1.00 249.94 ? 144 GLU D CB   1 
ATOM   4644 C  CG   . GLU D 1 144 ? 31.435 53.662 78.324  1.00 254.26 ? 144 GLU D CG   1 
ATOM   4645 C  CD   . GLU D 1 144 ? 32.567 53.542 79.340  1.00 261.26 ? 144 GLU D CD   1 
ATOM   4646 O  OE1  . GLU D 1 144 ? 32.285 53.412 80.549  1.00 251.81 ? 144 GLU D OE1  1 
ATOM   4647 O  OE2  . GLU D 1 144 ? 33.746 53.568 78.926  1.00 251.55 ? 144 GLU D OE2  1 
ATOM   4648 N  N    . ASN D 1 145 ? 28.956 51.859 82.073  1.00 246.83 ? 145 ASN D N    1 
ATOM   4649 C  CA   . ASN D 1 145 ? 28.179 52.035 83.303  1.00 247.18 ? 145 ASN D CA   1 
ATOM   4650 C  C    . ASN D 1 145 ? 28.769 53.219 84.065  1.00 252.73 ? 145 ASN D C    1 
ATOM   4651 O  O    . ASN D 1 145 ? 28.546 53.382 85.267  1.00 252.16 ? 145 ASN D O    1 
ATOM   4652 C  CB   . ASN D 1 145 ? 28.268 50.771 84.175  1.00 246.36 ? 145 ASN D CB   1 
ATOM   4653 C  CG   . ASN D 1 145 ? 26.945 50.029 84.281  1.00 260.60 ? 145 ASN D CG   1 
ATOM   4654 O  OD1  . ASN D 1 145 ? 25.872 50.628 84.216  1.00 253.67 ? 145 ASN D OD1  1 
ATOM   4655 N  ND2  . ASN D 1 145 ? 27.021 48.716 84.476  1.00 251.22 ? 145 ASN D ND2  1 
ATOM   4656 N  N    . TYR D 1 146 ? 29.560 54.017 83.355  1.00 249.64 ? 146 TYR D N    1 
ATOM   4657 C  CA   . TYR D 1 146 ? 30.192 55.201 83.913  1.00 250.18 ? 146 TYR D CA   1 
ATOM   4658 C  C    . TYR D 1 146 ? 29.083 56.157 84.345  1.00 256.74 ? 146 TYR D C    1 
ATOM   4659 O  O    . TYR D 1 146 ? 28.878 57.200 83.727  1.00 256.36 ? 146 TYR D O    1 
ATOM   4660 C  CB   . TYR D 1 146 ? 31.052 55.870 82.835  1.00 250.72 ? 146 TYR D CB   1 
ATOM   4661 C  CG   . TYR D 1 146 ? 32.553 55.829 83.076  1.00 251.11 ? 146 TYR D CG   1 
ATOM   4662 C  CD1  . TYR D 1 146 ? 33.100 56.273 84.275  1.00 252.72 ? 146 TYR D CD1  1 
ATOM   4663 C  CD2  . TYR D 1 146 ? 33.427 55.420 82.072  1.00 251.42 ? 146 TYR D CD2  1 
ATOM   4664 C  CE1  . TYR D 1 146 ? 34.476 56.267 84.482  1.00 252.82 ? 146 TYR D CE1  1 
ATOM   4665 C  CE2  . TYR D 1 146 ? 34.800 55.407 82.271  1.00 252.00 ? 146 TYR D CE2  1 
ATOM   4666 C  CZ   . TYR D 1 146 ? 35.319 55.832 83.476  1.00 257.99 ? 146 TYR D CZ   1 
ATOM   4667 O  OH   . TYR D 1 146 ? 36.682 55.825 83.679  1.00 258.10 ? 146 TYR D OH   1 
ATOM   4668 N  N    . ILE D 1 147 ? 28.341 55.774 85.381  1.00 252.92 ? 147 ILE D N    1 
ATOM   4669 C  CA   . ILE D 1 147 ? 27.240 56.593 85.883  1.00 253.45 ? 147 ILE D CA   1 
ATOM   4670 C  C    . ILE D 1 147 ? 27.525 57.090 87.299  1.00 255.43 ? 147 ILE D C    1 
ATOM   4671 O  O    . ILE D 1 147 ? 27.218 58.232 87.644  1.00 254.22 ? 147 ILE D O    1 
ATOM   4672 C  CB   . ILE D 1 147 ? 25.891 55.840 85.817  1.00 257.50 ? 147 ILE D CB   1 
ATOM   4673 C  CG1  . ILE D 1 147 ? 25.629 55.323 84.400  1.00 258.27 ? 147 ILE D CG1  1 
ATOM   4674 C  CG2  . ILE D 1 147 ? 24.757 56.741 86.273  1.00 258.55 ? 147 ILE D CG2  1 
ATOM   4675 C  CD1  . ILE D 1 147 ? 24.875 54.009 84.360  1.00 265.86 ? 147 ILE D CD1  1 
ATOM   4676 N  N    . MET E 1 1   ? 33.446 45.773 60.076  1.00 193.40 ? 1   MET E N    1 
ATOM   4677 C  CA   . MET E 1 1   ? 32.160 46.019 59.433  1.00 193.40 ? 1   MET E CA   1 
ATOM   4678 C  C    . MET E 1 1   ? 31.186 46.815 60.320  1.00 193.40 ? 1   MET E C    1 
ATOM   4679 O  O    . MET E 1 1   ? 31.035 46.518 61.507  1.00 300.00 ? 1   MET E O    1 
ATOM   4680 C  CB   . MET E 1 1   ? 31.540 44.696 59.019  1.00 193.40 ? 1   MET E CB   1 
ATOM   4681 C  CG   . MET E 1 1   ? 31.912 44.275 57.624  1.00 193.40 ? 1   MET E CG   1 
ATOM   4682 S  SD   . MET E 1 1   ? 30.465 44.235 56.568  1.00 193.40 ? 1   MET E SD   1 
ATOM   4683 C  CE   . MET E 1 1   ? 29.333 45.223 57.541  1.00 193.40 ? 1   MET E CE   1 
ATOM   4684 N  N    . ASP E 1 2   ? 30.534 47.828 59.741  1.00 196.10 ? 2   ASP E N    1 
ATOM   4685 C  CA   . ASP E 1 2   ? 29.606 48.695 60.491  1.00 198.77 ? 2   ASP E CA   1 
ATOM   4686 C  C    . ASP E 1 2   ? 28.487 47.945 61.185  1.00 200.35 ? 2   ASP E C    1 
ATOM   4687 O  O    . ASP E 1 2   ? 27.587 47.416 60.530  1.00 199.25 ? 2   ASP E O    1 
ATOM   4688 C  CB   . ASP E 1 2   ? 29.030 49.831 59.635  1.00 204.03 ? 2   ASP E CB   1 
ATOM   4689 C  CG   . ASP E 1 2   ? 29.077 49.534 58.143  1.00 233.29 ? 2   ASP E CG   1 
ATOM   4690 O  OD1  . ASP E 1 2   ? 30.104 49.004 57.660  1.00 236.47 ? 2   ASP E OD1  1 
ATOM   4691 O  OD2  . ASP E 1 2   ? 28.109 49.897 57.441  1.00 241.84 ? 2   ASP E OD2  1 
ATOM   4692 N  N    . GLN E 1 3   ? 28.547 47.916 62.515  1.00 198.07 ? 3   GLN E N    1 
ATOM   4693 C  CA   . GLN E 1 3   ? 27.566 47.195 63.323  1.00 197.35 ? 3   GLN E CA   1 
ATOM   4694 C  C    . GLN E 1 3   ? 26.122 47.329 62.851  1.00 197.06 ? 3   GLN E C    1 
ATOM   4695 O  O    . GLN E 1 3   ? 25.328 46.396 62.981  1.00 196.22 ? 3   GLN E O    1 
ATOM   4696 C  CB   . GLN E 1 3   ? 27.684 47.535 64.812  1.00 198.81 ? 3   GLN E CB   1 
ATOM   4697 C  CG   . GLN E 1 3   ? 26.344 47.539 65.560  1.00 203.41 ? 3   GLN E CG   1 
ATOM   4698 C  CD   . GLN E 1 3   ? 26.221 46.428 66.593  1.00 211.77 ? 3   GLN E CD   1 
ATOM   4699 O  OE1  . GLN E 1 3   ? 27.023 45.493 66.614  1.00 205.65 ? 3   GLN E OE1  1 
ATOM   4700 N  NE2  . GLN E 1 3   ? 25.205 46.522 67.449  1.00 202.31 ? 3   GLN E NE2  1 
ATOM   4701 N  N    . GLU E 1 4   ? 25.782 48.480 62.287  1.00 196.64 ? 4   GLU E N    1 
ATOM   4702 C  CA   . GLU E 1 4   ? 24.431 48.685 61.785  1.00 195.74 ? 4   GLU E CA   1 
ATOM   4703 C  C    . GLU E 1 4   ? 24.154 47.639 60.711  1.00 184.87 ? 4   GLU E C    1 
ATOM   4704 O  O    . GLU E 1 4   ? 23.277 46.780 60.861  1.00 180.16 ? 4   GLU E O    1 
ATOM   4705 C  CB   . GLU E 1 4   ? 24.312 50.081 61.160  1.00 199.37 ? 4   GLU E CB   1 
ATOM   4706 C  CG   . GLU E 1 4   ? 23.068 50.277 60.288  1.00 222.60 ? 4   GLU E CG   1 
ATOM   4707 C  CD   . GLU E 1 4   ? 23.398 50.604 58.834  1.00 268.68 ? 4   GLU E CD   1 
ATOM   4708 O  OE1  . GLU E 1 4   ? 24.597 50.587 58.474  1.00 269.85 ? 4   GLU E OE1  1 
ATOM   4709 O  OE2  . GLU E 1 4   ? 22.457 50.877 58.052  1.00 269.60 ? 4   GLU E OE2  1 
ATOM   4710 N  N    . THR E 1 5   ? 24.932 47.738 59.632  1.00 180.05 ? 5   THR E N    1 
ATOM   4711 C  CA   . THR E 1 5   ? 24.815 46.874 58.459  1.00 179.78 ? 5   THR E CA   1 
ATOM   4712 C  C    . THR E 1 5   ? 24.864 45.411 58.807  1.00 182.73 ? 5   THR E C    1 
ATOM   4713 O  O    . THR E 1 5   ? 24.007 44.648 58.380  1.00 182.61 ? 5   THR E O    1 
ATOM   4714 C  CB   . THR E 1 5   ? 25.882 47.188 57.402  1.00 181.63 ? 5   THR E CB   1 
ATOM   4715 O  OG1  . THR E 1 5   ? 27.186 47.017 57.972  1.00 179.76 ? 5   THR E OG1  1 
ATOM   4716 C  CG2  . THR E 1 5   ? 25.717 48.603 56.863  1.00 178.79 ? 5   THR E CG2  1 
ATOM   4717 N  N    . VAL E 1 6   ? 25.910 45.024 59.525  1.00 177.06 ? 6   VAL E N    1 
ATOM   4718 C  CA   . VAL E 1 6   ? 26.089 43.646 59.946  1.00 173.64 ? 6   VAL E CA   1 
ATOM   4719 C  C    . VAL E 1 6   ? 24.758 43.132 60.477  1.00 184.00 ? 6   VAL E C    1 
ATOM   4720 O  O    . VAL E 1 6   ? 24.384 41.971 60.269  1.00 185.51 ? 6   VAL E O    1 
ATOM   4721 C  CB   . VAL E 1 6   ? 27.193 43.547 61.022  1.00 169.51 ? 6   VAL E CB   1 
ATOM   4722 C  CG1  . VAL E 1 6   ? 26.877 42.450 62.023  1.00 167.97 ? 6   VAL E CG1  1 
ATOM   4723 C  CG2  . VAL E 1 6   ? 28.544 43.306 60.383  1.00 167.99 ? 6   VAL E CG2  1 
ATOM   4724 N  N    . GLY E 1 7   ? 24.016 44.037 61.105  1.00 181.38 ? 7   GLY E N    1 
ATOM   4725 C  CA   . GLY E 1 7   ? 22.714 43.727 61.663  1.00 179.88 ? 7   GLY E CA   1 
ATOM   4726 C  C    . GLY E 1 7   ? 21.720 43.260 60.612  1.00 180.27 ? 7   GLY E C    1 
ATOM   4727 O  O    . GLY E 1 7   ? 21.089 42.207 60.765  1.00 178.95 ? 7   GLY E O    1 
ATOM   4728 N  N    . ASN E 1 8   ? 21.585 44.036 59.538  1.00 176.64 ? 8   ASN E N    1 
ATOM   4729 C  CA   . ASN E 1 8   ? 20.635 43.715 58.474  1.00 175.49 ? 8   ASN E CA   1 
ATOM   4730 C  C    . ASN E 1 8   ? 21.148 42.699 57.458  1.00 174.41 ? 8   ASN E C    1 
ATOM   4731 O  O    . ASN E 1 8   ? 20.872 42.810 56.262  1.00 172.80 ? 8   ASN E O    1 
ATOM   4732 C  CB   . ASN E 1 8   ? 20.137 44.982 57.771  1.00 178.48 ? 8   ASN E CB   1 
ATOM   4733 C  CG   . ASN E 1 8   ? 21.241 45.993 57.542  1.00 209.58 ? 8   ASN E CG   1 
ATOM   4734 O  OD1  . ASN E 1 8   ? 21.381 46.543 56.448  1.00 205.10 ? 8   ASN E OD1  1 
ATOM   4735 N  ND2  . ASN E 1 8   ? 22.041 46.235 58.572  1.00 202.66 ? 8   ASN E ND2  1 
ATOM   4736 N  N    . VAL E 1 9   ? 21.869 41.694 57.937  1.00 167.09 ? 9   VAL E N    1 
ATOM   4737 C  CA   . VAL E 1 9   ? 22.378 40.662 57.056  1.00 164.52 ? 9   VAL E CA   1 
ATOM   4738 C  C    . VAL E 1 9   ? 22.815 39.461 57.872  1.00 174.48 ? 9   VAL E C    1 
ATOM   4739 O  O    . VAL E 1 9   ? 22.968 38.360 57.345  1.00 175.20 ? 9   VAL E O    1 
ATOM   4740 C  CB   . VAL E 1 9   ? 23.467 41.203 56.129  1.00 161.35 ? 9   VAL E CB   1 
ATOM   4741 C  CG1  . VAL E 1 9   ? 24.025 42.484 56.685  1.00 159.96 ? 9   VAL E CG1  1 
ATOM   4742 C  CG2  . VAL E 1 9   ? 24.557 40.181 55.931  1.00 159.97 ? 9   VAL E CG2  1 
ATOM   4743 N  N    . VAL E 1 10  ? 22.933 39.666 59.177  1.00 167.35 ? 10  VAL E N    1 
ATOM   4744 C  CA   . VAL E 1 10  ? 23.297 38.601 60.090  1.00 166.75 ? 10  VAL E CA   1 
ATOM   4745 C  C    . VAL E 1 10  ? 22.474 37.333 59.862  1.00 166.21 ? 10  VAL E C    1 
ATOM   4746 O  O    . VAL E 1 10  ? 22.910 36.227 60.182  1.00 166.33 ? 10  VAL E O    1 
ATOM   4747 C  CB   . VAL E 1 10  ? 23.137 39.071 61.511  1.00 171.31 ? 10  VAL E CB   1 
ATOM   4748 C  CG1  . VAL E 1 10  ? 22.777 37.907 62.403  1.00 171.18 ? 10  VAL E CG1  1 
ATOM   4749 C  CG2  . VAL E 1 10  ? 24.393 39.753 61.969  1.00 171.19 ? 10  VAL E CG2  1 
ATOM   4750 N  N    . LEU E 1 11  ? 21.279 37.501 59.310  1.00 163.90 ? 11  LEU E N    1 
ATOM   4751 C  CA   . LEU E 1 11  ? 20.393 36.377 59.033  1.00 162.46 ? 11  LEU E CA   1 
ATOM   4752 C  C    . LEU E 1 11  ? 20.845 35.601 57.815  1.00 160.26 ? 11  LEU E C    1 
ATOM   4753 O  O    . LEU E 1 11  ? 20.960 34.382 57.854  1.00 157.47 ? 11  LEU E O    1 
ATOM   4754 C  CB   . LEU E 1 11  ? 18.973 36.879 58.829  1.00 164.57 ? 11  LEU E CB   1 
ATOM   4755 C  CG   . LEU E 1 11  ? 18.459 37.294 60.193  1.00 174.15 ? 11  LEU E CG   1 
ATOM   4756 C  CD1  . LEU E 1 11  ? 18.987 36.275 61.191  1.00 175.98 ? 11  LEU E CD1  1 
ATOM   4757 C  CD2  . LEU E 1 11  ? 19.023 38.660 60.515  1.00 178.28 ? 11  LEU E CD2  1 
ATOM   4758 N  N    . LEU E 1 12  ? 21.089 36.322 56.730  1.00 156.21 ? 12  LEU E N    1 
ATOM   4759 C  CA   . LEU E 1 12  ? 21.547 35.713 55.497  1.00 156.94 ? 12  LEU E CA   1 
ATOM   4760 C  C    . LEU E 1 12  ? 22.920 35.093 55.714  1.00 161.00 ? 12  LEU E C    1 
ATOM   4761 O  O    . LEU E 1 12  ? 23.273 34.106 55.070  1.00 160.38 ? 12  LEU E O    1 
ATOM   4762 C  CB   . LEU E 1 12  ? 21.617 36.758 54.389  1.00 156.79 ? 12  LEU E CB   1 
ATOM   4763 C  CG   . LEU E 1 12  ? 20.486 37.782 54.280  1.00 160.36 ? 12  LEU E CG   1 
ATOM   4764 C  CD1  . LEU E 1 12  ? 20.996 38.990 53.492  1.00 160.11 ? 12  LEU E CD1  1 
ATOM   4765 C  CD2  . LEU E 1 12  ? 19.245 37.177 53.615  1.00 162.40 ? 12  LEU E CD2  1 
ATOM   4766 N  N    . ALA E 1 13  ? 23.692 35.673 56.625  1.00 156.55 ? 13  ALA E N    1 
ATOM   4767 C  CA   . ALA E 1 13  ? 25.007 35.138 56.948  1.00 156.43 ? 13  ALA E CA   1 
ATOM   4768 C  C    . ALA E 1 13  ? 24.814 33.830 57.707  1.00 153.55 ? 13  ALA E C    1 
ATOM   4769 O  O    . ALA E 1 13  ? 25.439 32.815 57.397  1.00 151.62 ? 13  ALA E O    1 
ATOM   4770 C  CB   . ALA E 1 13  ? 25.787 36.121 57.794  1.00 157.92 ? 13  ALA E CB   1 
ATOM   4771 N  N    . ILE E 1 14  ? 23.921 33.861 58.689  1.00 150.26 ? 14  ILE E N    1 
ATOM   4772 C  CA   . ILE E 1 14  ? 23.619 32.682 59.488  1.00 149.80 ? 14  ILE E CA   1 
ATOM   4773 C  C    . ILE E 1 14  ? 23.158 31.512 58.616  1.00 150.64 ? 14  ILE E C    1 
ATOM   4774 O  O    . ILE E 1 14  ? 23.794 30.461 58.586  1.00 149.18 ? 14  ILE E O    1 
ATOM   4775 C  CB   . ILE E 1 14  ? 22.594 33.008 60.570  1.00 153.73 ? 14  ILE E CB   1 
ATOM   4776 C  CG1  . ILE E 1 14  ? 23.294 33.304 61.899  1.00 154.57 ? 14  ILE E CG1  1 
ATOM   4777 C  CG2  . ILE E 1 14  ? 21.595 31.876 60.693  1.00 154.79 ? 14  ILE E CG2  1 
ATOM   4778 C  CD1  . ILE E 1 14  ? 22.873 34.615 62.512  1.00 162.42 ? 14  ILE E CD1  1 
ATOM   4779 N  N    . VAL E 1 15  ? 22.050 31.706 57.906  1.00 149.25 ? 15  VAL E N    1 
ATOM   4780 C  CA   . VAL E 1 15  ? 21.523 30.684 57.004  1.00 149.62 ? 15  VAL E CA   1 
ATOM   4781 C  C    . VAL E 1 15  ? 22.635 30.191 56.093  1.00 150.61 ? 15  VAL E C    1 
ATOM   4782 O  O    . VAL E 1 15  ? 22.787 28.991 55.871  1.00 149.15 ? 15  VAL E O    1 
ATOM   4783 C  CB   . VAL E 1 15  ? 20.333 31.216 56.157  1.00 155.50 ? 15  VAL E CB   1 
ATOM   4784 C  CG1  . VAL E 1 15  ? 20.680 32.538 55.489  1.00 155.63 ? 15  VAL E CG1  1 
ATOM   4785 C  CG2  . VAL E 1 15  ? 19.946 30.209 55.096  1.00 155.63 ? 15  VAL E CG2  1 
ATOM   4786 N  N    . THR E 1 16  ? 23.409 31.135 55.569  1.00 147.24 ? 16  THR E N    1 
ATOM   4787 C  CA   . THR E 1 16  ? 24.510 30.824 54.673  1.00 148.23 ? 16  THR E CA   1 
ATOM   4788 C  C    . THR E 1 16  ? 25.557 29.945 55.341  1.00 153.98 ? 16  THR E C    1 
ATOM   4789 O  O    . THR E 1 16  ? 25.924 28.909 54.806  1.00 153.30 ? 16  THR E O    1 
ATOM   4790 C  CB   . THR E 1 16  ? 25.122 32.090 54.062  1.00 163.20 ? 16  THR E CB   1 
ATOM   4791 O  OG1  . THR E 1 16  ? 24.280 32.565 53.003  1.00 164.34 ? 16  THR E OG1  1 
ATOM   4792 C  CG2  . THR E 1 16  ? 26.507 31.795 53.521  1.00 163.37 ? 16  THR E CG2  1 
ATOM   4793 N  N    . LEU E 1 17  ? 26.015 30.337 56.524  1.00 149.79 ? 17  LEU E N    1 
ATOM   4794 C  CA   . LEU E 1 17  ? 27.004 29.544 57.245  1.00 151.12 ? 17  LEU E CA   1 
ATOM   4795 C  C    . LEU E 1 17  ? 26.419 28.191 57.601  1.00 156.33 ? 17  LEU E C    1 
ATOM   4796 O  O    . LEU E 1 17  ? 27.151 27.227 57.821  1.00 155.87 ? 17  LEU E O    1 
ATOM   4797 C  CB   . LEU E 1 17  ? 27.456 30.262 58.508  1.00 151.64 ? 17  LEU E CB   1 
ATOM   4798 C  CG   . LEU E 1 17  ? 28.520 31.332 58.268  1.00 156.73 ? 17  LEU E CG   1 
ATOM   4799 C  CD1  . LEU E 1 17  ? 29.904 30.716 58.363  1.00 156.98 ? 17  LEU E CD1  1 
ATOM   4800 C  CD2  . LEU E 1 17  ? 28.322 32.013 56.919  1.00 159.28 ? 17  LEU E CD2  1 
ATOM   4801 N  N    . ILE E 1 18  ? 25.091 28.134 57.659  1.00 153.70 ? 18  ILE E N    1 
ATOM   4802 C  CA   . ILE E 1 18  ? 24.370 26.895 57.945  1.00 153.54 ? 18  ILE E CA   1 
ATOM   4803 C  C    . ILE E 1 18  ? 24.561 25.997 56.743  1.00 158.54 ? 18  ILE E C    1 
ATOM   4804 O  O    . ILE E 1 18  ? 25.158 24.926 56.830  1.00 158.14 ? 18  ILE E O    1 
ATOM   4805 C  CB   . ILE E 1 18  ? 22.870 27.161 58.112  1.00 156.06 ? 18  ILE E CB   1 
ATOM   4806 C  CG1  . ILE E 1 18  ? 22.540 27.501 59.562  1.00 156.13 ? 18  ILE E CG1  1 
ATOM   4807 C  CG2  . ILE E 1 18  ? 22.079 25.966 57.627  1.00 156.55 ? 18  ILE E CG2  1 
ATOM   4808 C  CD1  . ILE E 1 18  ? 23.648 28.232 60.271  1.00 163.00 ? 18  ILE E CD1  1 
ATOM   4809 N  N    . SER E 1 19  ? 24.037 26.462 55.617  1.00 157.87 ? 19  SER E N    1 
ATOM   4810 C  CA   . SER E 1 19  ? 24.142 25.752 54.355  1.00 158.11 ? 19  SER E CA   1 
ATOM   4811 C  C    . SER E 1 19  ? 25.600 25.423 54.020  1.00 163.69 ? 19  SER E C    1 
ATOM   4812 O  O    . SER E 1 19  ? 25.879 24.443 53.321  1.00 163.14 ? 19  SER E O    1 
ATOM   4813 C  CB   . SER E 1 19  ? 23.514 26.589 53.237  1.00 161.41 ? 19  SER E CB   1 
ATOM   4814 O  OG   . SER E 1 19  ? 24.486 27.382 52.575  1.00 169.92 ? 19  SER E OG   1 
ATOM   4815 N  N    . VAL E 1 20  ? 26.524 26.245 54.517  1.00 162.29 ? 20  VAL E N    1 
ATOM   4816 C  CA   . VAL E 1 20  ? 27.957 26.035 54.291  1.00 162.42 ? 20  VAL E CA   1 
ATOM   4817 C  C    . VAL E 1 20  ? 28.391 24.756 54.966  1.00 165.25 ? 20  VAL E C    1 
ATOM   4818 O  O    . VAL E 1 20  ? 29.228 24.021 54.443  1.00 164.11 ? 20  VAL E O    1 
ATOM   4819 C  CB   . VAL E 1 20  ? 28.804 27.174 54.878  1.00 166.72 ? 20  VAL E CB   1 
ATOM   4820 C  CG1  . VAL E 1 20  ? 29.713 26.625 55.985  1.00 166.58 ? 20  VAL E CG1  1 
ATOM   4821 C  CG2  . VAL E 1 20  ? 29.640 27.818 53.785  1.00 166.58 ? 20  VAL E CG2  1 
ATOM   4822 N  N    . VAL E 1 21  ? 27.867 24.543 56.170  1.00 162.27 ? 21  VAL E N    1 
ATOM   4823 C  CA   . VAL E 1 21  ? 28.197 23.365 56.957  1.00 163.17 ? 21  VAL E CA   1 
ATOM   4824 C  C    . VAL E 1 21  ? 27.404 22.143 56.519  1.00 168.44 ? 21  VAL E C    1 
ATOM   4825 O  O    . VAL E 1 21  ? 27.918 21.026 56.544  1.00 167.49 ? 21  VAL E O    1 
ATOM   4826 C  CB   . VAL E 1 21  ? 28.048 23.616 58.437  1.00 168.05 ? 21  VAL E CB   1 
ATOM   4827 C  CG1  . VAL E 1 21  ? 26.711 23.085 58.908  1.00 168.02 ? 21  VAL E CG1  1 
ATOM   4828 C  CG2  . VAL E 1 21  ? 29.193 22.959 59.171  1.00 168.04 ? 21  VAL E CG2  1 
ATOM   4829 N  N    . GLN E 1 22  ? 26.161 22.356 56.100  1.00 165.77 ? 22  GLN E N    1 
ATOM   4830 C  CA   . GLN E 1 22  ? 25.355 21.264 55.577  1.00 166.96 ? 22  GLN E CA   1 
ATOM   4831 C  C    . GLN E 1 22  ? 26.070 20.771 54.314  1.00 172.66 ? 22  GLN E C    1 
ATOM   4832 O  O    . GLN E 1 22  ? 26.152 19.568 54.054  1.00 172.31 ? 22  GLN E O    1 
ATOM   4833 C  CB   . GLN E 1 22  ? 23.941 21.756 55.241  1.00 168.34 ? 22  GLN E CB   1 
ATOM   4834 C  CG   . GLN E 1 22  ? 23.744 22.221 53.803  1.00 173.76 ? 22  GLN E CG   1 
ATOM   4835 C  CD   . GLN E 1 22  ? 22.404 21.792 53.239  1.00 183.07 ? 22  GLN E CD   1 
ATOM   4836 O  OE1  . GLN E 1 22  ? 22.145 21.928 52.044  1.00 177.10 ? 22  GLN E OE1  1 
ATOM   4837 N  NE2  . GLN E 1 22  ? 21.548 21.254 54.099  1.00 173.76 ? 22  GLN E NE2  1 
ATOM   4838 N  N    . ASN E 1 23  ? 26.633 21.713 53.560  1.00 172.92 ? 23  ASN E N    1 
ATOM   4839 C  CA   . ASN E 1 23  ? 27.358 21.384 52.338  1.00 172.87 ? 23  ASN E CA   1 
ATOM   4840 C  C    . ASN E 1 23  ? 28.539 20.463 52.606  1.00 177.52 ? 23  ASN E C    1 
ATOM   4841 O  O    . ASN E 1 23  ? 28.723 19.471 51.909  1.00 176.63 ? 23  ASN E O    1 
ATOM   4842 C  CB   . ASN E 1 23  ? 27.814 22.646 51.605  1.00 171.68 ? 23  ASN E CB   1 
ATOM   4843 C  CG   . ASN E 1 23  ? 26.816 23.098 50.556  1.00 183.79 ? 23  ASN E CG   1 
ATOM   4844 O  OD1  . ASN E 1 23  ? 25.805 23.716 50.880  1.00 176.55 ? 23  ASN E OD1  1 
ATOM   4845 N  ND2  . ASN E 1 23  ? 27.084 22.771 49.294  1.00 174.09 ? 23  ASN E ND2  1 
ATOM   4846 N  N    . GLY E 1 24  ? 29.331 20.794 53.619  1.00 176.58 ? 24  GLY E N    1 
ATOM   4847 C  CA   . GLY E 1 24  ? 30.485 19.999 53.996  1.00 178.04 ? 24  GLY E CA   1 
ATOM   4848 C  C    . GLY E 1 24  ? 30.063 18.610 54.425  1.00 187.09 ? 24  GLY E C    1 
ATOM   4849 O  O    . GLY E 1 24  ? 30.867 17.676 54.467  1.00 186.62 ? 24  GLY E O    1 
ATOM   4850 N  N    . PHE E 1 25  ? 28.792 18.482 54.776  1.00 184.35 ? 25  PHE E N    1 
ATOM   4851 C  CA   . PHE E 1 25  ? 28.237 17.204 55.184  1.00 188.21 ? 25  PHE E CA   1 
ATOM   4852 C  C    . PHE E 1 25  ? 28.079 16.323 53.958  1.00 186.52 ? 25  PHE E C    1 
ATOM   4853 O  O    . PHE E 1 25  ? 28.581 15.196 53.909  1.00 184.74 ? 25  PHE E O    1 
ATOM   4854 C  CB   . PHE E 1 25  ? 26.851 17.425 55.754  1.00 195.26 ? 25  PHE E CB   1 
ATOM   4855 C  CG   . PHE E 1 25  ? 26.025 16.186 55.785  1.00 203.03 ? 25  PHE E CG   1 
ATOM   4856 C  CD1  . PHE E 1 25  ? 26.274 15.202 56.722  1.00 210.21 ? 25  PHE E CD1  1 
ATOM   4857 C  CD2  . PHE E 1 25  ? 25.060 15.969 54.827  1.00 209.38 ? 25  PHE E CD2  1 
ATOM   4858 C  CE1  . PHE E 1 25  ? 25.537 14.049 56.733  1.00 212.67 ? 25  PHE E CE1  1 
ATOM   4859 C  CE2  . PHE E 1 25  ? 24.319 14.821 54.830  1.00 213.90 ? 25  PHE E CE2  1 
ATOM   4860 C  CZ   . PHE E 1 25  ? 24.555 13.856 55.784  1.00 212.41 ? 25  PHE E CZ   1 
ATOM   4861 N  N    . PHE E 1 26  ? 27.326 16.843 52.991  1.00 186.70 ? 26  PHE E N    1 
ATOM   4862 C  CA   . PHE E 1 26  ? 27.081 16.154 51.732  1.00 186.28 ? 26  PHE E CA   1 
ATOM   4863 C  C    . PHE E 1 26  ? 28.406 15.665 51.184  1.00 188.50 ? 26  PHE E C    1 
ATOM   4864 O  O    . PHE E 1 26  ? 28.512 14.544 50.693  1.00 187.39 ? 26  PHE E O    1 
ATOM   4865 C  CB   . PHE E 1 26  ? 26.504 17.121 50.705  1.00 188.14 ? 26  PHE E CB   1 
ATOM   4866 C  CG   . PHE E 1 26  ? 25.139 17.614 51.039  1.00 189.54 ? 26  PHE E CG   1 
ATOM   4867 C  CD1  . PHE E 1 26  ? 24.642 17.488 52.319  1.00 192.39 ? 26  PHE E CD1  1 
ATOM   4868 C  CD2  . PHE E 1 26  ? 24.357 18.216 50.072  1.00 191.31 ? 26  PHE E CD2  1 
ATOM   4869 C  CE1  . PHE E 1 26  ? 23.382 17.951 52.632  1.00 193.08 ? 26  PHE E CE1  1 
ATOM   4870 C  CE2  . PHE E 1 26  ? 23.097 18.682 50.375  1.00 193.87 ? 26  PHE E CE2  1 
ATOM   4871 C  CZ   . PHE E 1 26  ? 22.607 18.554 51.659  1.00 191.91 ? 26  PHE E CZ   1 
ATOM   4872 N  N    . ALA E 1 27  ? 29.404 16.541 51.236  1.00 187.36 ? 27  ALA E N    1 
ATOM   4873 C  CA   . ALA E 1 27  ? 30.733 16.234 50.732  1.00 187.60 ? 27  ALA E CA   1 
ATOM   4874 C  C    . ALA E 1 27  ? 31.490 15.315 51.674  1.00 192.37 ? 27  ALA E C    1 
ATOM   4875 O  O    . ALA E 1 27  ? 32.642 14.974 51.417  1.00 192.23 ? 27  ALA E O    1 
ATOM   4876 C  CB   . ALA E 1 27  ? 31.519 17.508 50.469  1.00 188.34 ? 27  ALA E CB   1 
ATOM   4877 N  N    . HIS E 1 28  ? 30.847 14.919 52.768  1.00 187.90 ? 28  HIS E N    1 
ATOM   4878 C  CA   . HIS E 1 28  ? 31.469 13.984 53.690  1.00 191.33 ? 28  HIS E CA   1 
ATOM   4879 C  C    . HIS E 1 28  ? 30.889 12.604 53.433  1.00 197.54 ? 28  HIS E C    1 
ATOM   4880 O  O    . HIS E 1 28  ? 31.599 11.595 53.436  1.00 195.50 ? 28  HIS E O    1 
ATOM   4881 C  CB   . HIS E 1 28  ? 31.242 14.370 55.144  1.00 197.02 ? 28  HIS E CB   1 
ATOM   4882 C  CG   . HIS E 1 28  ? 31.911 13.438 56.104  1.00 206.20 ? 28  HIS E CG   1 
ATOM   4883 N  ND1  . HIS E 1 28  ? 33.282 13.306 56.172  1.00 211.09 ? 28  HIS E ND1  1 
ATOM   4884 C  CD2  . HIS E 1 28  ? 31.401 12.522 56.960  1.00 212.24 ? 28  HIS E CD2  1 
ATOM   4885 C  CE1  . HIS E 1 28  ? 33.588 12.388 57.072  1.00 212.60 ? 28  HIS E CE1  1 
ATOM   4886 N  NE2  . HIS E 1 28  ? 32.465 11.897 57.565  1.00 213.13 ? 28  HIS E NE2  1 
ATOM   4887 N  N    . LYS E 1 29  ? 29.587 12.575 53.189  1.00 192.40 ? 29  LYS E N    1 
ATOM   4888 C  CA   . LYS E 1 29  ? 28.902 11.327 52.901  1.00 194.99 ? 29  LYS E CA   1 
ATOM   4889 C  C    . LYS E 1 29  ? 29.374 10.800 51.552  1.00 198.92 ? 29  LYS E C    1 
ATOM   4890 O  O    . LYS E 1 29  ? 29.077 9.668  51.172  1.00 199.84 ? 29  LYS E O    1 
ATOM   4891 C  CB   . LYS E 1 29  ? 27.388 11.540 52.914  1.00 198.27 ? 29  LYS E CB   1 
ATOM   4892 C  CG   . LYS E 1 29  ? 26.810 11.686 54.320  1.00 203.92 ? 29  LYS E CG   1 
ATOM   4893 C  CD   . LYS E 1 29  ? 27.873 12.145 55.329  1.00 207.58 ? 29  LYS E CD   1 
ATOM   4894 C  CE   . LYS E 1 29  ? 28.134 11.094 56.405  1.00 211.68 ? 29  LYS E CE   1 
ATOM   4895 N  NZ   . LYS E 1 29  ? 28.830 11.666 57.591  1.00 218.43 ? 29  LYS E NZ   1 
ATOM   4896 N  N    . VAL E 1 30  ? 30.123 11.627 50.832  1.00 201.10 ? 30  VAL E N    1 
ATOM   4897 C  CA   . VAL E 1 30  ? 30.659 11.209 49.549  1.00 195.60 ? 30  VAL E CA   1 
ATOM   4898 C  C    . VAL E 1 30  ? 32.059 10.669 49.756  1.00 206.36 ? 30  VAL E C    1 
ATOM   4899 O  O    . VAL E 1 30  ? 32.554 9.904  48.942  1.00 206.63 ? 30  VAL E O    1 
ATOM   4900 C  CB   . VAL E 1 30  ? 30.603 12.314 48.478  1.00 189.04 ? 30  VAL E CB   1 
ATOM   4901 C  CG1  . VAL E 1 30  ? 31.728 12.136 47.486  1.00 187.13 ? 30  VAL E CG1  1 
ATOM   4902 C  CG2  . VAL E 1 30  ? 29.271 12.277 47.750  1.00 187.13 ? 30  VAL E CG2  1 
ATOM   4903 N  N    . GLU E 1 31  ? 32.684 11.037 50.868  1.00 209.24 ? 31  GLU E N    1 
ATOM   4904 C  CA   . GLU E 1 31  ? 34.018 10.539 51.170  1.00 210.38 ? 31  GLU E CA   1 
ATOM   4905 C  C    . GLU E 1 31  ? 33.877 9.124  51.694  1.00 211.40 ? 31  GLU E C    1 
ATOM   4906 O  O    . GLU E 1 31  ? 34.690 8.246  51.398  1.00 210.43 ? 31  GLU E O    1 
ATOM   4907 C  CB   . GLU E 1 31  ? 34.713 11.419 52.208  1.00 212.58 ? 31  GLU E CB   1 
ATOM   4908 C  CG   . GLU E 1 31  ? 36.234 11.326 52.173  1.00 225.68 ? 31  GLU E CG   1 
ATOM   4909 C  CD   . GLU E 1 31  ? 36.805 11.460 50.768  1.00 250.03 ? 31  GLU E CD   1 
ATOM   4910 O  OE1  . GLU E 1 31  ? 36.118 12.034 49.897  1.00 245.25 ? 31  GLU E OE1  1 
ATOM   4911 O  OE2  . GLU E 1 31  ? 37.945 11.001 50.538  1.00 244.99 ? 31  GLU E OE2  1 
ATOM   4912 N  N    . HIS E 1 32  ? 32.814 8.895  52.450  1.00 214.95 ? 32  HIS E N    1 
ATOM   4913 C  CA   . HIS E 1 32  ? 32.585 7.574  52.983  1.00 218.15 ? 32  HIS E CA   1 
ATOM   4914 C  C    . HIS E 1 32  ? 32.381 6.515  51.908  1.00 217.81 ? 32  HIS E C    1 
ATOM   4915 O  O    . HIS E 1 32  ? 32.842 5.381  52.049  1.00 214.33 ? 32  HIS E O    1 
ATOM   4916 C  CB   . HIS E 1 32  ? 31.448 7.577  53.981  1.00 225.42 ? 32  HIS E CB   1 
ATOM   4917 C  CG   . HIS E 1 32  ? 31.791 6.865  55.243  1.00 235.68 ? 32  HIS E CG   1 
ATOM   4918 N  ND1  . HIS E 1 32  ? 30.871 6.610  56.236  1.00 240.92 ? 32  HIS E ND1  1 
ATOM   4919 C  CD2  . HIS E 1 32  ? 32.962 6.330  55.663  1.00 242.05 ? 32  HIS E CD2  1 
ATOM   4920 C  CE1  . HIS E 1 32  ? 31.465 5.961  57.222  1.00 242.48 ? 32  HIS E CE1  1 
ATOM   4921 N  NE2  . HIS E 1 32  ? 32.734 5.777  56.898  1.00 242.99 ? 32  HIS E NE2  1 
ATOM   4922 N  N    . GLU E 1 33  ? 31.714 6.894  50.824  1.00 216.15 ? 33  GLU E N    1 
ATOM   4923 C  CA   . GLU E 1 33  ? 31.449 5.964  49.736  1.00 219.35 ? 33  GLU E CA   1 
ATOM   4924 C  C    . GLU E 1 33  ? 32.623 5.760  48.794  1.00 222.99 ? 33  GLU E C    1 
ATOM   4925 O  O    . GLU E 1 33  ? 32.683 4.759  48.089  1.00 223.31 ? 33  GLU E O    1 
ATOM   4926 C  CB   . GLU E 1 33  ? 30.200 6.372  48.965  1.00 221.60 ? 33  GLU E CB   1 
ATOM   4927 C  CG   . GLU E 1 33  ? 28.909 6.049  49.701  1.00 232.26 ? 33  GLU E CG   1 
ATOM   4928 C  CD   . GLU E 1 33  ? 29.133 5.164  50.919  1.00 250.44 ? 33  GLU E CD   1 
ATOM   4929 O  OE1  . GLU E 1 33  ? 29.625 5.679  51.949  1.00 243.91 ? 33  GLU E OE1  1 
ATOM   4930 O  OE2  . GLU E 1 33  ? 28.806 3.957  50.852  1.00 243.65 ? 33  GLU E OE2  1 
ATOM   4931 N  N    . SER E 1 34  ? 33.554 6.707  48.772  1.00 224.84 ? 34  SER E N    1 
ATOM   4932 C  CA   . SER E 1 34  ? 34.727 6.561  47.920  1.00 224.61 ? 34  SER E CA   1 
ATOM   4933 C  C    . SER E 1 34  ? 35.824 5.892  48.724  1.00 228.29 ? 34  SER E C    1 
ATOM   4934 O  O    . SER E 1 34  ? 36.869 5.527  48.184  1.00 227.12 ? 34  SER E O    1 
ATOM   4935 C  CB   . SER E 1 34  ? 35.210 7.901  47.367  1.00 230.24 ? 34  SER E CB   1 
ATOM   4936 O  OG   . SER E 1 34  ? 35.613 7.773  46.009  1.00 242.14 ? 34  SER E OG   1 
ATOM   4937 N  N    . ARG E 1 35  ? 35.558 5.717  50.017  1.00 229.07 ? 35  ARG E N    1 
ATOM   4938 C  CA   . ARG E 1 35  ? 36.492 5.072  50.933  1.00 231.08 ? 35  ARG E CA   1 
ATOM   4939 C  C    . ARG E 1 35  ? 36.209 3.571  51.037  1.00 240.23 ? 35  ARG E C    1 
ATOM   4940 O  O    . ARG E 1 35  ? 37.123 2.745  50.951  1.00 239.87 ? 35  ARG E O    1 
ATOM   4941 C  CB   . ARG E 1 35  ? 36.410 5.727  52.318  1.00 233.07 ? 35  ARG E CB   1 
ATOM   4942 C  CG   . ARG E 1 35  ? 37.621 6.585  52.682  1.00 247.30 ? 35  ARG E CG   1 
ATOM   4943 C  CD   . ARG E 1 35  ? 37.717 7.855  51.825  1.00 259.99 ? 35  ARG E CD   1 
ATOM   4944 N  NE   . ARG E 1 35  ? 38.751 7.762  50.789  1.00 269.01 ? 35  ARG E NE   1 
ATOM   4945 C  CZ   . ARG E 1 35  ? 39.687 8.684  50.561  1.00 282.60 ? 35  ARG E CZ   1 
ATOM   4946 N  NH1  . ARG E 1 35  ? 39.737 9.786  51.299  1.00 269.79 ? 35  ARG E NH1  1 
ATOM   4947 N  NH2  . ARG E 1 35  ? 40.582 8.500  49.597  1.00 269.20 ? 35  ARG E NH2  1 
ATOM   4948 N  N    . THR E 1 36  ? 34.937 3.223  51.209  1.00 236.59 ? 36  THR E N    1 
ATOM   4949 C  CA   . THR E 1 36  ? 34.527 1.822  51.305  1.00 238.89 ? 36  THR E CA   1 
ATOM   4950 C  C    . THR E 1 36  ? 34.837 1.046  50.020  1.00 248.90 ? 36  THR E C    1 
ATOM   4951 O  O    . THR E 1 36  ? 34.846 -0.187 50.010  1.00 249.49 ? 36  THR E O    1 
ATOM   4952 C  CB   . THR E 1 36  ? 33.046 1.686  51.717  1.00 248.23 ? 36  THR E CB   1 
ATOM   4953 O  OG1  . THR E 1 36  ? 32.208 2.315  50.738  1.00 248.10 ? 36  THR E OG1  1 
ATOM   4954 C  CG2  . THR E 1 36  ? 32.811 2.330  53.075  1.00 247.12 ? 36  THR E CG2  1 
ATOM   4955 N  N    . GLN E 1 37  ? 35.114 1.777  48.942  1.00 247.12 ? 37  GLN E N    1 
ATOM   4956 C  CA   . GLN E 1 37  ? 35.473 1.167  47.661  1.00 248.02 ? 37  GLN E CA   1 
ATOM   4957 C  C    . GLN E 1 37  ? 36.906 0.655  47.775  1.00 253.24 ? 37  GLN E C    1 
ATOM   4958 O  O    . GLN E 1 37  ? 37.209 -0.464 47.354  1.00 252.82 ? 37  GLN E O    1 
ATOM   4959 C  CB   . GLN E 1 37  ? 35.360 2.189  46.519  1.00 249.55 ? 37  GLN E CB   1 
ATOM   4960 C  CG   . GLN E 1 37  ? 34.657 1.669  45.266  1.00 259.30 ? 37  GLN E CG   1 
ATOM   4961 C  CD   . GLN E 1 37  ? 33.141 1.679  45.389  1.00 272.45 ? 37  GLN E CD   1 
ATOM   4962 O  OE1  . GLN E 1 37  ? 32.425 1.775  44.390  1.00 267.04 ? 37  GLN E OE1  1 
ATOM   4963 N  NE2  . GLN E 1 37  ? 32.646 1.564  46.615  1.00 263.70 ? 37  GLN E NE2  1 
ATOM   4964 N  N    . ASN E 1 38  ? 37.769 1.478  48.376  1.00 251.24 ? 38  ASN E N    1 
ATOM   4965 C  CA   . ASN E 1 38  ? 39.169 1.131  48.615  1.00 251.06 ? 38  ASN E CA   1 
ATOM   4966 C  C    . ASN E 1 38  ? 40.036 1.240  47.360  1.00 254.09 ? 38  ASN E C    1 
ATOM   4967 O  O    . ASN E 1 38  ? 40.821 0.337  47.065  1.00 253.22 ? 38  ASN E O    1 
ATOM   4968 C  CB   . ASN E 1 38  ? 39.260 -0.285 49.195  1.00 252.11 ? 38  ASN E CB   1 
ATOM   4969 C  CG   . ASN E 1 38  ? 40.452 -0.471 50.103  1.00 274.07 ? 38  ASN E CG   1 
ATOM   4970 O  OD1  . ASN E 1 38  ? 41.547 0.012  49.816  1.00 268.25 ? 38  ASN E OD1  1 
ATOM   4971 N  ND2  . ASN E 1 38  ? 40.258 -1.214 51.187  1.00 265.80 ? 38  ASN E ND2  1 
ATOM   4972 N  N    . GLY E 1 39  ? 39.916 2.348  46.635  1.00 252.04 ? 39  GLY E N    1 
ATOM   4973 C  CA   . GLY E 1 39  ? 40.672 2.524  45.405  1.00 250.01 ? 39  GLY E CA   1 
ATOM   4974 C  C    . GLY E 1 39  ? 41.635 3.697  45.343  1.00 246.26 ? 39  GLY E C    1 
ATOM   4975 O  O    . GLY E 1 39  ? 42.076 4.083  44.257  1.00 243.89 ? 39  GLY E O    1 
ATOM   4976 N  N    . ARG E 1 40  ? 41.970 4.257  46.503  1.00 242.76 ? 40  ARG E N    1 
ATOM   4977 C  CA   . ARG E 1 40  ? 42.894 5.392  46.582  1.00 242.90 ? 40  ARG E CA   1 
ATOM   4978 C  C    . ARG E 1 40  ? 42.459 6.613  45.748  1.00 246.01 ? 40  ARG E C    1 
ATOM   4979 O  O    . ARG E 1 40  ? 42.449 7.742  46.253  1.00 245.37 ? 40  ARG E O    1 
ATOM   4980 C  CB   . ARG E 1 40  ? 44.335 4.960  46.260  1.00 245.77 ? 40  ARG E CB   1 
ATOM   4981 C  CG   . ARG E 1 40  ? 45.326 6.105  46.057  1.00 263.84 ? 40  ARG E CG   1 
ATOM   4982 C  CD   . ARG E 1 40  ? 45.484 6.970  47.304  1.00 280.80 ? 40  ARG E CD   1 
ATOM   4983 N  NE   . ARG E 1 40  ? 46.859 6.971  47.803  1.00 291.42 ? 40  ARG E NE   1 
ATOM   4984 C  CZ   . ARG E 1 40  ? 47.748 7.934  47.572  1.00 300.00 ? 40  ARG E CZ   1 
ATOM   4985 N  NH1  . ARG E 1 40  ? 47.423 8.980  46.832  1.00 291.49 ? 40  ARG E NH1  1 
ATOM   4986 N  NH2  . ARG E 1 40  ? 48.975 7.845  48.071  1.00 290.90 ? 40  ARG E NH2  1 
ATOM   4987 N  N    . SER E 1 41  ? 42.079 6.389  44.489  1.00 241.54 ? 41  SER E N    1 
ATOM   4988 C  CA   . SER E 1 41  ? 41.628 7.474  43.623  1.00 243.11 ? 41  SER E CA   1 
ATOM   4989 C  C    . SER E 1 41  ? 40.114 7.417  43.465  1.00 259.03 ? 41  SER E C    1 
ATOM   4990 O  O    . SER E 1 41  ? 39.517 6.345  43.536  1.00 261.42 ? 41  SER E O    1 
ATOM   4991 C  CB   . SER E 1 41  ? 42.304 7.385  42.257  1.00 242.98 ? 41  SER E CB   1 
ATOM   4992 O  OG   . SER E 1 41  ? 42.532 6.035  41.896  1.00 247.96 ? 41  SER E OG   1 
ATOM   4993 N  N    . PHE E 1 42  ? 39.493 8.574  43.268  1.00 256.89 ? 42  PHE E N    1 
ATOM   4994 C  CA   . PHE E 1 42  ? 38.044 8.640  43.106  1.00 256.27 ? 42  PHE E CA   1 
ATOM   4995 C  C    . PHE E 1 42  ? 37.754 8.699  41.621  1.00 256.46 ? 42  PHE E C    1 
ATOM   4996 O  O    . PHE E 1 42  ? 38.661 8.833  40.803  1.00 255.21 ? 42  PHE E O    1 
ATOM   4997 C  CB   . PHE E 1 42  ? 37.457 9.913  43.735  1.00 258.26 ? 42  PHE E CB   1 
ATOM   4998 C  CG   . PHE E 1 42  ? 37.834 10.133 45.175  1.00 259.30 ? 42  PHE E CG   1 
ATOM   4999 C  CD1  . PHE E 1 42  ? 38.967 9.549  45.727  1.00 261.65 ? 42  PHE E CD1  1 
ATOM   5000 C  CD2  . PHE E 1 42  ? 37.071 10.973 45.970  1.00 260.64 ? 42  PHE E CD2  1 
ATOM   5001 C  CE1  . PHE E 1 42  ? 39.318 9.775  47.048  1.00 262.12 ? 42  PHE E CE1  1 
ATOM   5002 C  CE2  . PHE E 1 42  ? 37.411 11.199 47.295  1.00 262.95 ? 42  PHE E CE2  1 
ATOM   5003 C  CZ   . PHE E 1 42  ? 38.539 10.601 47.834  1.00 260.89 ? 42  PHE E CZ   1 
ATOM   5004 N  N    . GLN E 1 43  ? 36.480 8.609  41.273  1.00 254.37 ? 43  GLN E N    1 
ATOM   5005 C  CA   . GLN E 1 43  ? 36.049 8.720  39.886  1.00 252.07 ? 43  GLN E CA   1 
ATOM   5006 C  C    . GLN E 1 43  ? 34.536 8.668  39.858  1.00 252.87 ? 43  GLN E C    1 
ATOM   5007 O  O    . GLN E 1 43  ? 33.916 7.985  40.672  1.00 251.98 ? 43  GLN E O    1 
ATOM   5008 C  CB   . GLN E 1 43  ? 36.648 7.634  38.985  1.00 252.08 ? 43  GLN E CB   1 
ATOM   5009 C  CG   . GLN E 1 43  ? 37.402 6.531  39.706  1.00 232.51 ? 43  GLN E CG   1 
ATOM   5010 C  CD   . GLN E 1 43  ? 36.582 5.268  39.870  1.00 219.28 ? 43  GLN E CD   1 
ATOM   5011 O  OE1  . GLN E 1 43  ? 35.732 5.173  40.760  1.00 209.98 ? 43  GLN E OE1  1 
ATOM   5012 N  NE2  . GLN E 1 43  ? 36.846 4.280  39.020  1.00 206.63 ? 43  GLN E NE2  1 
ATOM   5013 N  N    . ARG E 1 44  ? 33.945 9.425  38.945  1.00 250.30 ? 44  ARG E N    1 
ATOM   5014 C  CA   . ARG E 1 44  ? 32.498 9.494  38.836  1.00 250.12 ? 44  ARG E CA   1 
ATOM   5015 C  C    . ARG E 1 44  ? 31.895 8.136  38.483  1.00 253.94 ? 44  ARG E C    1 
ATOM   5016 O  O    . ARG E 1 44  ? 31.058 8.037  37.588  1.00 253.71 ? 44  ARG E O    1 
ATOM   5017 C  CB   . ARG E 1 44  ? 32.121 10.538 37.790  1.00 251.35 ? 44  ARG E CB   1 
ATOM   5018 C  CG   . ARG E 1 44  ? 33.303 10.997 36.947  1.00 263.90 ? 44  ARG E CG   1 
ATOM   5019 C  CD   . ARG E 1 44  ? 32.976 12.264 36.182  1.00 273.31 ? 44  ARG E CD   1 
ATOM   5020 N  NE   . ARG E 1 44  ? 32.657 12.010 34.778  1.00 277.74 ? 44  ARG E NE   1 
ATOM   5021 C  CZ   . ARG E 1 44  ? 31.863 11.035 34.339  1.00 287.54 ? 44  ARG E CZ   1 
ATOM   5022 N  NH1  . ARG E 1 44  ? 31.296 10.190 35.188  1.00 273.71 ? 44  ARG E NH1  1 
ATOM   5023 N  NH2  . ARG E 1 44  ? 31.633 10.904 33.040  1.00 273.13 ? 44  ARG E NH2  1 
ATOM   5024 N  N    . THR E 1 45  ? 32.340 7.091  39.179  1.00 252.46 ? 45  THR E N    1 
ATOM   5025 C  CA   . THR E 1 45  ? 31.871 5.725  38.939  1.00 252.27 ? 45  THR E CA   1 
ATOM   5026 C  C    . THR E 1 45  ? 32.063 4.858  40.189  1.00 258.63 ? 45  THR E C    1 
ATOM   5027 O  O    . THR E 1 45  ? 32.888 5.178  41.041  1.00 258.91 ? 45  THR E O    1 
ATOM   5028 C  CB   . THR E 1 45  ? 32.611 5.084  37.736  1.00 253.25 ? 45  THR E CB   1 
ATOM   5029 O  OG1  . THR E 1 45  ? 33.886 4.593  38.166  1.00 251.29 ? 45  THR E OG1  1 
ATOM   5030 C  CG2  . THR E 1 45  ? 32.821 6.089  36.604  1.00 250.32 ? 45  THR E CG2  1 
ATOM   5031 N  N    . GLY E 1 46  ? 31.332 3.749  40.286  1.00 257.79 ? 46  GLY E N    1 
ATOM   5032 C  CA   . GLY E 1 46  ? 31.463 2.848  41.422  1.00 255.66 ? 46  GLY E CA   1 
ATOM   5033 C  C    . GLY E 1 46  ? 30.178 2.163  41.850  1.00 252.21 ? 46  GLY E C    1 
ATOM   5034 O  O    . GLY E 1 46  ? 29.220 2.097  41.082  1.00 250.24 ? 46  GLY E O    1 
ATOM   5035 N  N    . THR E 1 47  ? 30.161 1.647  43.079  1.00 252.38 ? 47  THR E N    1 
ATOM   5036 C  CA   . THR E 1 47  ? 28.986 0.964  43.622  1.00 247.30 ? 47  THR E CA   1 
ATOM   5037 C  C    . THR E 1 47  ? 27.752 1.848  43.522  1.00 222.79 ? 47  THR E C    1 
ATOM   5038 O  O    . THR E 1 47  ? 27.867 3.058  43.344  1.00 219.31 ? 47  THR E O    1 
ATOM   5039 C  CB   . THR E 1 47  ? 29.210 0.535  45.083  1.00 293.95 ? 47  THR E CB   1 
ATOM   5040 O  OG1  . THR E 1 47  ? 27.944 0.355  45.729  1.00 298.83 ? 47  THR E OG1  1 
ATOM   5041 C  CG2  . THR E 1 47  ? 29.986 1.592  45.831  1.00 298.83 ? 47  THR E CG2  1 
ATOM   5042 N  N    . LEU E 1 48  ? 26.573 1.249  43.657  1.00 224.30 ? 48  LEU E N    1 
ATOM   5043 C  CA   . LEU E 1 48  ? 25.328 2.010  43.598  1.00 215.18 ? 48  LEU E CA   1 
ATOM   5044 C  C    . LEU E 1 48  ? 25.059 2.809  44.873  1.00 229.35 ? 48  LEU E C    1 
ATOM   5045 O  O    . LEU E 1 48  ? 24.072 3.540  44.963  1.00 228.92 ? 48  LEU E O    1 
ATOM   5046 C  CB   . LEU E 1 48  ? 24.133 1.127  43.238  1.00 209.14 ? 48  LEU E CB   1 
ATOM   5047 C  CG   . LEU E 1 48  ? 23.029 1.837  42.448  1.00 209.48 ? 48  LEU E CG   1 
ATOM   5048 C  CD1  . LEU E 1 48  ? 21.952 2.404  43.373  1.00 208.83 ? 48  LEU E CD1  1 
ATOM   5049 C  CD2  . LEU E 1 48  ? 23.626 2.930  41.575  1.00 210.40 ? 48  LEU E CD2  1 
ATOM   5050 N  N    . ALA E 1 49  ? 25.948 2.678  45.852  1.00 208.69 ? 49  ALA E N    1 
ATOM   5051 C  CA   . ALA E 1 49  ? 25.827 3.438  47.087  1.00 219.90 ? 49  ALA E CA   1 
ATOM   5052 C  C    . ALA E 1 49  ? 26.666 4.703  46.919  1.00 233.30 ? 49  ALA E C    1 
ATOM   5053 O  O    . ALA E 1 49  ? 26.280 5.781  47.367  1.00 234.99 ? 49  ALA E O    1 
ATOM   5054 C  CB   . ALA E 1 49  ? 26.318 2.613  48.273  1.00 223.95 ? 49  ALA E CB   1 
ATOM   5055 N  N    . PHE E 1 50  ? 27.799 4.553  46.236  1.00 222.73 ? 50  PHE E N    1 
ATOM   5056 C  CA   . PHE E 1 50  ? 28.733 5.644  45.966  1.00 221.00 ? 50  PHE E CA   1 
ATOM   5057 C  C    . PHE E 1 50  ? 28.280 6.398  44.723  1.00 221.01 ? 50  PHE E C    1 
ATOM   5058 O  O    . PHE E 1 50  ? 28.469 7.601  44.602  1.00 220.06 ? 50  PHE E O    1 
ATOM   5059 C  CB   . PHE E 1 50  ? 30.141 5.061  45.773  1.00 222.17 ? 50  PHE E CB   1 
ATOM   5060 C  CG   . PHE E 1 50  ? 31.158 6.036  45.234  1.00 222.34 ? 50  PHE E CG   1 
ATOM   5061 C  CD1  . PHE E 1 50  ? 31.048 7.395  45.466  1.00 224.11 ? 50  PHE E CD1  1 
ATOM   5062 C  CD2  . PHE E 1 50  ? 32.273 5.573  44.544  1.00 223.03 ? 50  PHE E CD2  1 
ATOM   5063 C  CE1  . PHE E 1 50  ? 32.001 8.280  44.969  1.00 224.30 ? 50  PHE E CE1  1 
ATOM   5064 C  CE2  . PHE E 1 50  ? 33.237 6.451  44.055  1.00 225.01 ? 50  PHE E CE2  1 
ATOM   5065 C  CZ   . PHE E 1 50  ? 33.102 7.804  44.269  1.00 222.87 ? 50  PHE E CZ   1 
ATOM   5066 N  N    . GLU E 1 51  ? 27.651 5.686  43.803  1.00 215.50 ? 51  GLU E N    1 
ATOM   5067 C  CA   . GLU E 1 51  ? 27.151 6.320  42.599  1.00 215.22 ? 51  GLU E CA   1 
ATOM   5068 C  C    . GLU E 1 51  ? 25.859 7.026  42.952  1.00 215.79 ? 51  GLU E C    1 
ATOM   5069 O  O    . GLU E 1 51  ? 25.459 7.977  42.294  1.00 212.87 ? 51  GLU E O    1 
ATOM   5070 C  CB   . GLU E 1 51  ? 26.884 5.279  41.509  1.00 217.39 ? 51  GLU E CB   1 
ATOM   5071 C  CG   . GLU E 1 51  ? 27.470 5.634  40.145  1.00 233.60 ? 51  GLU E CG   1 
ATOM   5072 C  CD   . GLU E 1 51  ? 26.453 5.546  39.017  1.00 265.15 ? 51  GLU E CD   1 
ATOM   5073 O  OE1  . GLU E 1 51  ? 25.422 6.252  39.083  1.00 262.35 ? 51  GLU E OE1  1 
ATOM   5074 O  OE2  . GLU E 1 51  ? 26.699 4.790  38.051  1.00 262.09 ? 51  GLU E OE2  1 
ATOM   5075 N  N    . ARG E 1 52  ? 25.206 6.547  44.002  1.00 207.45 ? 52  ARG E N    1 
ATOM   5076 C  CA   . ARG E 1 52  ? 23.947 7.129  44.456  1.00 208.44 ? 52  ARG E CA   1 
ATOM   5077 C  C    . ARG E 1 52  ? 24.207 8.412  45.245  1.00 207.92 ? 52  ARG E C    1 
ATOM   5078 O  O    . ARG E 1 52  ? 23.407 9.354  45.212  1.00 207.89 ? 52  ARG E O    1 
ATOM   5079 C  CB   . ARG E 1 52  ? 23.191 6.124  45.338  1.00 212.03 ? 52  ARG E CB   1 
ATOM   5080 C  CG   . ARG E 1 52  ? 21.676 6.205  45.241  1.00 226.41 ? 52  ARG E CG   1 
ATOM   5081 C  CD   . ARG E 1 52  ? 21.100 5.074  44.401  1.00 237.60 ? 52  ARG E CD   1 
ATOM   5082 N  NE   . ARG E 1 52  ? 19.642 5.086  44.438  1.00 244.78 ? 52  ARG E NE   1 
ATOM   5083 C  CZ   . ARG E 1 52  ? 18.894 6.128  44.086  1.00 257.19 ? 52  ARG E CZ   1 
ATOM   5084 N  NH1  . ARG E 1 52  ? 19.467 7.239  43.643  1.00 244.09 ? 52  ARG E NH1  1 
ATOM   5085 N  NH2  . ARG E 1 52  ? 17.572 6.058  44.171  1.00 243.51 ? 52  ARG E NH2  1 
ATOM   5086 N  N    . VAL E 1 53  ? 25.332 8.433  45.955  1.00 203.92 ? 53  VAL E N    1 
ATOM   5087 C  CA   . VAL E 1 53  ? 25.721 9.570  46.788  1.00 199.93 ? 53  VAL E CA   1 
ATOM   5088 C  C    . VAL E 1 53  ? 26.404 10.690 46.001  1.00 201.32 ? 53  VAL E C    1 
ATOM   5089 O  O    . VAL E 1 53  ? 26.030 11.858 46.129  1.00 200.51 ? 53  VAL E O    1 
ATOM   5090 C  CB   . VAL E 1 53  ? 26.575 9.109  47.987  1.00 200.39 ? 53  VAL E CB   1 
ATOM   5091 C  CG1  . VAL E 1 53  ? 27.229 10.296 48.672  1.00 199.64 ? 53  VAL E CG1  1 
ATOM   5092 C  CG2  . VAL E 1 53  ? 25.730 8.307  48.967  1.00 199.65 ? 53  VAL E CG2  1 
ATOM   5093 N  N    . TYR E 1 54  ? 27.410 10.342 45.201  1.00 198.04 ? 54  TYR E N    1 
ATOM   5094 C  CA   . TYR E 1 54  ? 28.102 11.346 44.406  1.00 198.69 ? 54  TYR E CA   1 
ATOM   5095 C  C    . TYR E 1 54  ? 27.110 12.022 43.459  1.00 197.24 ? 54  TYR E C    1 
ATOM   5096 O  O    . TYR E 1 54  ? 27.311 13.161 43.039  1.00 195.34 ? 54  TYR E O    1 
ATOM   5097 C  CB   . TYR E 1 54  ? 29.266 10.734 43.633  1.00 204.48 ? 54  TYR E CB   1 
ATOM   5098 C  CG   . TYR E 1 54  ? 29.918 11.708 42.685  1.00 214.15 ? 54  TYR E CG   1 
ATOM   5099 C  CD1  . TYR E 1 54  ? 30.895 12.586 43.124  1.00 217.33 ? 54  TYR E CD1  1 
ATOM   5100 C  CD2  . TYR E 1 54  ? 29.523 11.778 41.359  1.00 217.01 ? 54  TYR E CD2  1 
ATOM   5101 C  CE1  . TYR E 1 54  ? 31.477 13.490 42.261  1.00 218.90 ? 54  TYR E CE1  1 
ATOM   5102 C  CE2  . TYR E 1 54  ? 30.102 12.671 40.490  1.00 218.55 ? 54  TYR E CE2  1 
ATOM   5103 C  CZ   . TYR E 1 54  ? 31.073 13.528 40.946  1.00 225.61 ? 54  TYR E CZ   1 
ATOM   5104 O  OH   . TYR E 1 54  ? 31.640 14.425 40.075  1.00 226.31 ? 54  TYR E OH   1 
ATOM   5105 N  N    . THR E 1 55  ? 26.018 11.329 43.156  1.00 191.66 ? 55  THR E N    1 
ATOM   5106 C  CA   . THR E 1 55  ? 24.980 11.887 42.302  1.00 191.72 ? 55  THR E CA   1 
ATOM   5107 C  C    . THR E 1 55  ? 24.171 12.922 43.070  1.00 195.00 ? 55  THR E C    1 
ATOM   5108 O  O    . THR E 1 55  ? 24.147 14.099 42.711  1.00 194.46 ? 55  THR E O    1 
ATOM   5109 C  CB   . THR E 1 55  ? 24.065 10.789 41.766  1.00 201.63 ? 55  THR E CB   1 
ATOM   5110 O  OG1  . THR E 1 55  ? 24.851 9.799  41.096  1.00 201.60 ? 55  THR E OG1  1 
ATOM   5111 C  CG2  . THR E 1 55  ? 23.051 11.372 40.799  1.00 200.62 ? 55  THR E CG2  1 
ATOM   5112 N  N    . ALA E 1 56  ? 23.506 12.473 44.130  1.00 187.90 ? 56  ALA E N    1 
ATOM   5113 C  CA   . ALA E 1 56  ? 22.692 13.358 44.951  1.00 187.93 ? 56  ALA E CA   1 
ATOM   5114 C  C    . ALA E 1 56  ? 23.486 14.587 45.369  1.00 192.81 ? 56  ALA E C    1 
ATOM   5115 O  O    . ALA E 1 56  ? 22.956 15.695 45.387  1.00 192.09 ? 56  ALA E O    1 
ATOM   5116 C  CB   . ALA E 1 56  ? 22.156 12.622 46.161  1.00 188.68 ? 56  ALA E CB   1 
ATOM   5117 N  N    . ASN E 1 57  ? 24.764 14.388 45.672  1.00 184.63 ? 57  ASN E N    1 
ATOM   5118 C  CA   . ASN E 1 57  ? 25.632 15.486 46.064  1.00 185.05 ? 57  ASN E CA   1 
ATOM   5119 C  C    . ASN E 1 57  ? 25.843 16.445 44.894  1.00 190.77 ? 57  ASN E C    1 
ATOM   5120 O  O    . ASN E 1 57  ? 25.506 17.627 44.990  1.00 191.38 ? 57  ASN E O    1 
ATOM   5121 C  CB   . ASN E 1 57  ? 26.965 14.948 46.574  1.00 182.58 ? 57  ASN E CB   1 
ATOM   5122 C  CG   . ASN E 1 57  ? 27.915 16.048 46.970  1.00 187.83 ? 57  ASN E CG   1 
ATOM   5123 O  OD1  . ASN E 1 57  ? 28.337 16.844 46.133  1.00 179.57 ? 57  ASN E OD1  1 
ATOM   5124 N  ND2  . ASN E 1 57  ? 28.245 16.115 48.256  1.00 177.12 ? 57  ASN E ND2  1 
ATOM   5125 N  N    . GLN E 1 58  ? 26.366 15.932 43.780  1.00 188.31 ? 58  GLN E N    1 
ATOM   5126 C  CA   . GLN E 1 58  ? 26.597 16.765 42.595  1.00 186.76 ? 58  GLN E CA   1 
ATOM   5127 C  C    . GLN E 1 58  ? 25.289 17.179 41.941  1.00 186.49 ? 58  GLN E C    1 
ATOM   5128 O  O    . GLN E 1 58  ? 25.225 17.442 40.737  1.00 185.33 ? 58  GLN E O    1 
ATOM   5129 C  CB   . GLN E 1 58  ? 27.515 16.088 41.574  1.00 188.11 ? 58  GLN E CB   1 
ATOM   5130 C  CG   . GLN E 1 58  ? 27.940 17.005 40.423  1.00 197.07 ? 58  GLN E CG   1 
ATOM   5131 C  CD   . GLN E 1 58  ? 29.028 17.986 40.820  1.00 209.85 ? 58  GLN E CD   1 
ATOM   5132 O  OE1  . GLN E 1 58  ? 29.002 19.158 40.432  1.00 204.41 ? 58  GLN E OE1  1 
ATOM   5133 N  NE2  . GLN E 1 58  ? 29.998 17.508 41.590  1.00 201.06 ? 58  GLN E NE2  1 
ATOM   5134 N  N    . ASN E 1 59  ? 24.246 17.235 42.758  1.00 184.62 ? 59  ASN E N    1 
ATOM   5135 C  CA   . ASN E 1 59  ? 22.926 17.656 42.317  1.00 183.91 ? 59  ASN E CA   1 
ATOM   5136 C  C    . ASN E 1 59  ? 22.557 18.861 43.174  1.00 187.66 ? 59  ASN E C    1 
ATOM   5137 O  O    . ASN E 1 59  ? 21.751 19.711 42.785  1.00 187.67 ? 59  ASN E O    1 
ATOM   5138 C  CB   . ASN E 1 59  ? 21.912 16.531 42.547  1.00 181.61 ? 59  ASN E CB   1 
ATOM   5139 C  CG   . ASN E 1 59  ? 21.827 15.567 41.373  1.00 190.25 ? 59  ASN E CG   1 
ATOM   5140 O  OD1  . ASN E 1 59  ? 22.407 15.807 40.306  1.00 182.53 ? 59  ASN E OD1  1 
ATOM   5141 N  ND2  . ASN E 1 59  ? 21.086 14.477 41.561  1.00 180.09 ? 59  ASN E ND2  1 
ATOM   5142 N  N    . CYS E 1 60  ? 23.164 18.911 44.354  1.00 184.40 ? 60  CYS E N    1 
ATOM   5143 C  CA   . CYS E 1 60  ? 22.936 19.987 45.296  1.00 184.43 ? 60  CYS E CA   1 
ATOM   5144 C  C    . CYS E 1 60  ? 24.029 21.015 45.103  1.00 185.69 ? 60  CYS E C    1 
ATOM   5145 O  O    . CYS E 1 60  ? 23.852 22.191 45.404  1.00 184.40 ? 60  CYS E O    1 
ATOM   5146 C  CB   . CYS E 1 60  ? 22.959 19.446 46.725  1.00 186.08 ? 60  CYS E CB   1 
ATOM   5147 S  SG   . CYS E 1 60  ? 21.918 17.980 46.975  1.00 190.41 ? 60  CYS E SG   1 
ATOM   5148 N  N    . VAL E 1 61  ? 25.159 20.570 44.576  1.00 182.10 ? 61  VAL E N    1 
ATOM   5149 C  CA   . VAL E 1 61  ? 26.255 21.483 44.332  1.00 180.44 ? 61  VAL E CA   1 
ATOM   5150 C  C    . VAL E 1 61  ? 25.984 22.295 43.071  1.00 186.11 ? 61  VAL E C    1 
ATOM   5151 O  O    . VAL E 1 61  ? 26.641 23.299 42.810  1.00 186.90 ? 61  VAL E O    1 
ATOM   5152 C  CB   . VAL E 1 61  ? 27.608 20.757 44.334  1.00 180.11 ? 61  VAL E CB   1 
ATOM   5153 C  CG1  . VAL E 1 61  ? 28.696 21.628 43.709  1.00 179.17 ? 61  VAL E CG1  1 
ATOM   5154 C  CG2  . VAL E 1 61  ? 27.978 20.362 45.758  1.00 179.18 ? 61  VAL E CG2  1 
ATOM   5155 N  N    . ASP E 1 62  ? 24.969 21.881 42.325  1.00 182.86 ? 62  ASP E N    1 
ATOM   5156 C  CA   . ASP E 1 62  ? 24.566 22.579 41.120  1.00 181.48 ? 62  ASP E CA   1 
ATOM   5157 C  C    . ASP E 1 62  ? 23.536 23.632 41.513  1.00 181.40 ? 62  ASP E C    1 
ATOM   5158 O  O    . ASP E 1 62  ? 23.372 24.651 40.840  1.00 179.44 ? 62  ASP E O    1 
ATOM   5159 C  CB   . ASP E 1 62  ? 23.965 21.570 40.139  1.00 184.17 ? 62  ASP E CB   1 
ATOM   5160 C  CG   . ASP E 1 62  ? 24.741 20.261 40.108  1.00 201.95 ? 62  ASP E CG   1 
ATOM   5161 O  OD1  . ASP E 1 62  ? 25.845 20.215 40.686  1.00 203.58 ? 62  ASP E OD1  1 
ATOM   5162 O  OD2  . ASP E 1 62  ? 24.258 19.278 39.506  1.00 208.95 ? 62  ASP E OD2  1 
ATOM   5163 N  N    . ALA E 1 63  ? 22.880 23.396 42.646  1.00 181.34 ? 63  ALA E N    1 
ATOM   5164 C  CA   . ALA E 1 63  ? 21.841 24.295 43.153  1.00 181.63 ? 63  ALA E CA   1 
ATOM   5165 C  C    . ALA E 1 63  ? 22.342 25.380 44.101  1.00 174.73 ? 63  ALA E C    1 
ATOM   5166 O  O    . ALA E 1 63  ? 21.725 26.439 44.219  1.00 172.29 ? 63  ALA E O    1 
ATOM   5167 C  CB   . ALA E 1 63  ? 20.720 23.496 43.818  1.00 183.61 ? 63  ALA E CB   1 
ATOM   5168 N  N    . TYR E 1 64  ? 23.443 25.104 44.789  1.00 173.57 ? 64  TYR E N    1 
ATOM   5169 C  CA   . TYR E 1 64  ? 24.005 26.054 45.730  1.00 173.23 ? 64  TYR E CA   1 
ATOM   5170 C  C    . TYR E 1 64  ? 24.089 27.473 45.177  1.00 175.98 ? 64  TYR E C    1 
ATOM   5171 O  O    . TYR E 1 64  ? 23.502 28.397 45.735  1.00 174.05 ? 64  TYR E O    1 
ATOM   5172 C  CB   . TYR E 1 64  ? 25.375 25.589 46.212  1.00 176.00 ? 64  TYR E CB   1 
ATOM   5173 C  CG   . TYR E 1 64  ? 25.756 26.188 47.541  1.00 180.57 ? 64  TYR E CG   1 
ATOM   5174 C  CD1  . TYR E 1 64  ? 24.861 26.991 48.239  1.00 182.95 ? 64  TYR E CD1  1 
ATOM   5175 C  CD2  . TYR E 1 64  ? 27.008 25.964 48.100  1.00 181.93 ? 64  TYR E CD2  1 
ATOM   5176 C  CE1  . TYR E 1 64  ? 25.200 27.553 49.464  1.00 183.75 ? 64  TYR E CE1  1 
ATOM   5177 C  CE2  . TYR E 1 64  ? 27.357 26.529 49.326  1.00 182.92 ? 64  TYR E CE2  1 
ATOM   5178 C  CZ   . TYR E 1 64  ? 26.450 27.327 49.996  1.00 189.57 ? 64  TYR E CZ   1 
ATOM   5179 O  OH   . TYR E 1 64  ? 26.787 27.893 51.202  1.00 190.01 ? 64  TYR E OH   1 
ATOM   5180 N  N    . PRO E 1 65  ? 24.815 27.661 44.062  1.00 169.71 ? 65  PRO E N    1 
ATOM   5181 C  CA   . PRO E 1 65  ? 25.003 28.980 43.438  1.00 170.08 ? 65  PRO E CA   1 
ATOM   5182 C  C    . PRO E 1 65  ? 23.699 29.705 43.117  1.00 173.05 ? 65  PRO E C    1 
ATOM   5183 O  O    . PRO E 1 65  ? 23.442 30.799 43.635  1.00 173.14 ? 65  PRO E O    1 
ATOM   5184 C  CB   . PRO E 1 65  ? 25.761 28.660 42.139  1.00 171.90 ? 65  PRO E CB   1 
ATOM   5185 C  CG   . PRO E 1 65  ? 25.446 27.245 41.844  1.00 176.16 ? 65  PRO E CG   1 
ATOM   5186 C  CD   . PRO E 1 65  ? 25.257 26.565 43.181  1.00 171.09 ? 65  PRO E CD   1 
ATOM   5187 N  N    . THR E 1 66  ? 22.892 29.096 42.244  1.00 167.62 ? 66  THR E N    1 
ATOM   5188 C  CA   . THR E 1 66  ? 21.616 29.681 41.808  1.00 167.12 ? 66  THR E CA   1 
ATOM   5189 C  C    . THR E 1 66  ? 20.639 29.889 42.952  1.00 170.80 ? 66  THR E C    1 
ATOM   5190 O  O    . THR E 1 66  ? 19.594 30.518 42.780  1.00 170.17 ? 66  THR E O    1 
ATOM   5191 C  CB   . THR E 1 66  ? 20.939 28.907 40.633  1.00 179.83 ? 66  THR E CB   1 
ATOM   5192 O  OG1  . THR E 1 66  ? 21.775 27.824 40.199  1.00 180.52 ? 66  THR E OG1  1 
ATOM   5193 C  CG2  . THR E 1 66  ? 20.639 29.852 39.453  1.00 179.54 ? 66  THR E CG2  1 
ATOM   5194 N  N    . PHE E 1 67  ? 20.970 29.350 44.117  1.00 164.99 ? 67  PHE E N    1 
ATOM   5195 C  CA   . PHE E 1 67  ? 20.113 29.514 45.276  1.00 163.67 ? 67  PHE E CA   1 
ATOM   5196 C  C    . PHE E 1 67  ? 20.629 30.686 46.087  1.00 170.00 ? 67  PHE E C    1 
ATOM   5197 O  O    . PHE E 1 67  ? 19.875 31.592 46.448  1.00 169.94 ? 67  PHE E O    1 
ATOM   5198 C  CB   . PHE E 1 67  ? 20.155 28.270 46.138  1.00 162.65 ? 67  PHE E CB   1 
ATOM   5199 C  CG   . PHE E 1 67  ? 19.821 28.535 47.570  1.00 159.63 ? 67  PHE E CG   1 
ATOM   5200 C  CD1  . PHE E 1 67  ? 18.690 29.265 47.895  1.00 158.84 ? 67  PHE E CD1  1 
ATOM   5201 C  CD2  . PHE E 1 67  ? 20.656 28.083 48.591  1.00 157.92 ? 67  PHE E CD2  1 
ATOM   5202 C  CE1  . PHE E 1 67  ? 18.370 29.504 49.212  1.00 158.01 ? 67  PHE E CE1  1 
ATOM   5203 C  CE2  . PHE E 1 67  ? 20.345 28.313 49.915  1.00 158.78 ? 67  PHE E CE2  1 
ATOM   5204 C  CZ   . PHE E 1 67  ? 19.201 29.026 50.230  1.00 156.26 ? 67  PHE E CZ   1 
ATOM   5205 N  N    . LEU E 1 68  ? 21.927 30.648 46.372  1.00 162.60 ? 68  LEU E N    1 
ATOM   5206 C  CA   . LEU E 1 68  ? 22.568 31.702 47.127  1.00 161.28 ? 68  LEU E CA   1 
ATOM   5207 C  C    . LEU E 1 68  ? 22.284 33.009 46.435  1.00 169.36 ? 68  LEU E C    1 
ATOM   5208 O  O    . LEU E 1 68  ? 22.147 34.043 47.078  1.00 170.30 ? 68  LEU E O    1 
ATOM   5209 C  CB   . LEU E 1 68  ? 24.068 31.462 47.232  1.00 158.85 ? 68  LEU E CB   1 
ATOM   5210 C  CG   . LEU E 1 68  ? 24.420 30.914 48.612  1.00 158.54 ? 68  LEU E CG   1 
ATOM   5211 C  CD1  . LEU E 1 68  ? 23.393 29.869 49.009  1.00 157.04 ? 68  LEU E CD1  1 
ATOM   5212 C  CD2  . LEU E 1 68  ? 25.825 30.345 48.656  1.00 159.34 ? 68  LEU E CD2  1 
ATOM   5213 N  N    . ALA E 1 69  ? 22.152 32.945 45.118  1.00 164.67 ? 69  ALA E N    1 
ATOM   5214 C  CA   . ALA E 1 69  ? 21.828 34.124 44.337  1.00 164.00 ? 69  ALA E CA   1 
ATOM   5215 C  C    . ALA E 1 69  ? 20.576 34.778 44.922  1.00 167.72 ? 69  ALA E C    1 
ATOM   5216 O  O    . ALA E 1 69  ? 20.652 35.775 45.644  1.00 167.10 ? 69  ALA E O    1 
ATOM   5217 C  CB   . ALA E 1 69  ? 21.593 33.735 42.884  1.00 164.69 ? 69  ALA E CB   1 
ATOM   5218 N  N    . VAL E 1 70  ? 19.428 34.180 44.632  1.00 161.49 ? 70  VAL E N    1 
ATOM   5219 C  CA   . VAL E 1 70  ? 18.148 34.674 45.106  1.00 161.73 ? 70  VAL E CA   1 
ATOM   5220 C  C    . VAL E 1 70  ? 18.079 34.856 46.625  1.00 167.57 ? 70  VAL E C    1 
ATOM   5221 O  O    . VAL E 1 70  ? 17.266 35.640 47.119  1.00 167.57 ? 70  VAL E O    1 
ATOM   5222 C  CB   . VAL E 1 70  ? 17.044 33.750 44.631  1.00 165.30 ? 70  VAL E CB   1 
ATOM   5223 C  CG1  . VAL E 1 70  ? 17.071 33.652 43.113  1.00 165.06 ? 70  VAL E CG1  1 
ATOM   5224 C  CG2  . VAL E 1 70  ? 17.220 32.379 45.275  1.00 165.07 ? 70  VAL E CG2  1 
ATOM   5225 N  N    . LEU E 1 71  ? 18.902 34.114 47.368  1.00 161.10 ? 71  LEU E N    1 
ATOM   5226 C  CA   . LEU E 1 71  ? 18.898 34.209 48.836  1.00 160.41 ? 71  LEU E CA   1 
ATOM   5227 C  C    . LEU E 1 71  ? 19.266 35.608 49.291  1.00 167.36 ? 71  LEU E C    1 
ATOM   5228 O  O    . LEU E 1 71  ? 18.718 36.130 50.260  1.00 167.56 ? 71  LEU E O    1 
ATOM   5229 C  CB   . LEU E 1 71  ? 19.871 33.206 49.468  1.00 158.89 ? 71  LEU E CB   1 
ATOM   5230 C  CG   . LEU E 1 71  ? 19.726 32.915 50.971  1.00 160.07 ? 71  LEU E CG   1 
ATOM   5231 C  CD1  . LEU E 1 71  ? 21.027 33.125 51.735  1.00 159.02 ? 71  LEU E CD1  1 
ATOM   5232 C  CD2  . LEU E 1 71  ? 18.596 33.701 51.599  1.00 161.33 ? 71  LEU E CD2  1 
ATOM   5233 N  N    . TRP E 1 72  ? 20.219 36.202 48.595  1.00 163.09 ? 72  TRP E N    1 
ATOM   5234 C  CA   . TRP E 1 72  ? 20.662 37.527 48.951  1.00 161.27 ? 72  TRP E CA   1 
ATOM   5235 C  C    . TRP E 1 72  ? 19.961 38.599 48.154  1.00 166.38 ? 72  TRP E C    1 
ATOM   5236 O  O    . TRP E 1 72  ? 19.531 39.599 48.719  1.00 167.09 ? 72  TRP E O    1 
ATOM   5237 C  CB   . TRP E 1 72  ? 22.160 37.646 48.807  1.00 157.07 ? 72  TRP E CB   1 
ATOM   5238 C  CG   . TRP E 1 72  ? 22.880 36.750 49.728  1.00 154.85 ? 72  TRP E CG   1 
ATOM   5239 C  CD1  . TRP E 1 72  ? 23.047 35.400 49.597  1.00 157.03 ? 72  TRP E CD1  1 
ATOM   5240 C  CD2  . TRP E 1 72  ? 23.532 37.123 50.942  1.00 153.43 ? 72  TRP E CD2  1 
ATOM   5241 N  NE1  . TRP E 1 72  ? 23.793 34.912 50.646  1.00 155.41 ? 72  TRP E NE1  1 
ATOM   5242 C  CE2  . TRP E 1 72  ? 24.114 35.952 51.480  1.00 156.30 ? 72  TRP E CE2  1 
ATOM   5243 C  CE3  . TRP E 1 72  ? 23.691 38.334 51.624  1.00 153.88 ? 72  TRP E CE3  1 
ATOM   5244 C  CZ2  . TRP E 1 72  ? 24.839 35.955 52.674  1.00 155.13 ? 72  TRP E CZ2  1 
ATOM   5245 C  CZ3  . TRP E 1 72  ? 24.416 38.338 52.803  1.00 154.66 ? 72  TRP E CZ3  1 
ATOM   5246 C  CH2  . TRP E 1 72  ? 24.982 37.154 53.317  1.00 155.12 ? 72  TRP E CH2  1 
ATOM   5247 N  N    . SER E 1 73  ? 19.844 38.404 46.847  1.00 163.68 ? 73  SER E N    1 
ATOM   5248 C  CA   . SER E 1 73  ? 19.147 39.374 46.014  1.00 162.15 ? 73  SER E CA   1 
ATOM   5249 C  C    . SER E 1 73  ? 17.777 39.645 46.651  1.00 164.78 ? 73  SER E C    1 
ATOM   5250 O  O    . SER E 1 73  ? 17.300 40.784 46.720  1.00 163.71 ? 73  SER E O    1 
ATOM   5251 C  CB   . SER E 1 73  ? 18.970 38.809 44.606  1.00 165.11 ? 73  SER E CB   1 
ATOM   5252 O  OG   . SER E 1 73  ? 18.263 37.578 44.641  1.00 173.42 ? 73  SER E OG   1 
ATOM   5253 N  N    . ALA E 1 74  ? 17.188 38.587 47.190  1.00 163.15 ? 74  ALA E N    1 
ATOM   5254 C  CA   . ALA E 1 74  ? 15.906 38.692 47.857  1.00 163.00 ? 74  ALA E CA   1 
ATOM   5255 C  C    . ALA E 1 74  ? 16.106 39.104 49.314  1.00 164.49 ? 74  ALA E C    1 
ATOM   5256 O  O    . ALA E 1 74  ? 15.146 39.304 50.045  1.00 163.17 ? 74  ALA E O    1 
ATOM   5257 C  CB   . ALA E 1 74  ? 15.164 37.359 47.773  1.00 163.94 ? 74  ALA E CB   1 
ATOM   5258 N  N    . GLY E 1 75  ? 17.354 39.219 49.744  1.00 162.49 ? 75  GLY E N    1 
ATOM   5259 C  CA   . GLY E 1 75  ? 17.643 39.597 51.116  1.00 162.67 ? 75  GLY E CA   1 
ATOM   5260 C  C    . GLY E 1 75  ? 17.975 41.072 51.253  1.00 167.05 ? 75  GLY E C    1 
ATOM   5261 O  O    . GLY E 1 75  ? 17.720 41.689 52.286  1.00 166.81 ? 75  GLY E O    1 
ATOM   5262 N  N    . LEU E 1 76  ? 18.575 41.633 50.212  1.00 165.63 ? 76  LEU E N    1 
ATOM   5263 C  CA   . LEU E 1 76  ? 18.939 43.037 50.222  1.00 165.76 ? 76  LEU E CA   1 
ATOM   5264 C  C    . LEU E 1 76  ? 17.834 43.780 49.510  1.00 170.14 ? 76  LEU E C    1 
ATOM   5265 O  O    . LEU E 1 76  ? 17.224 44.701 50.062  1.00 169.54 ? 76  LEU E O    1 
ATOM   5266 C  CB   . LEU E 1 76  ? 20.252 43.266 49.472  1.00 166.05 ? 76  LEU E CB   1 
ATOM   5267 C  CG   . LEU E 1 76  ? 21.437 42.494 50.030  1.00 171.11 ? 76  LEU E CG   1 
ATOM   5268 C  CD1  . LEU E 1 76  ? 21.111 42.030 51.436  1.00 171.38 ? 76  LEU E CD1  1 
ATOM   5269 C  CD2  . LEU E 1 76  ? 21.731 41.315 49.137  1.00 173.67 ? 76  LEU E CD2  1 
ATOM   5270 N  N    . LEU E 1 77  ? 17.579 43.368 48.274  1.00 168.03 ? 77  LEU E N    1 
ATOM   5271 C  CA   . LEU E 1 77  ? 16.562 44.008 47.459  1.00 168.09 ? 77  LEU E CA   1 
ATOM   5272 C  C    . LEU E 1 77  ? 15.175 43.842 48.045  1.00 178.75 ? 77  LEU E C    1 
ATOM   5273 O  O    . LEU E 1 77  ? 14.188 44.216 47.412  1.00 180.29 ? 77  LEU E O    1 
ATOM   5274 C  CB   . LEU E 1 77  ? 16.588 43.451 46.041  1.00 166.40 ? 77  LEU E CB   1 
ATOM   5275 C  CG   . LEU E 1 77  ? 17.723 44.005 45.182  1.00 168.02 ? 77  LEU E CG   1 
ATOM   5276 C  CD1  . LEU E 1 77  ? 18.742 44.715 46.067  1.00 167.19 ? 77  LEU E CD1  1 
ATOM   5277 C  CD2  . LEU E 1 77  ? 18.385 42.877 44.392  1.00 169.50 ? 77  LEU E CD2  1 
ATOM   5278 N  N    . CYS E 1 78  ? 15.101 43.309 49.261  1.00 175.44 ? 78  CYS E N    1 
ATOM   5279 C  CA   . CYS E 1 78  ? 13.808 43.067 49.877  1.00 174.85 ? 78  CYS E CA   1 
ATOM   5280 C  C    . CYS E 1 78  ? 13.947 42.268 51.183  1.00 185.14 ? 78  CYS E C    1 
ATOM   5281 O  O    . CYS E 1 78  ? 14.577 41.210 51.192  1.00 186.70 ? 78  CYS E O    1 
ATOM   5282 C  CB   . CYS E 1 78  ? 12.969 42.280 48.864  1.00 173.24 ? 78  CYS E CB   1 
ATOM   5283 S  SG   . CYS E 1 78  ? 11.407 41.650 49.435  1.00 176.50 ? 78  CYS E SG   1 
ATOM   5284 N  N    . SER E 1 79  ? 13.354 42.782 52.266  1.00 181.31 ? 79  SER E N    1 
ATOM   5285 C  CA   . SER E 1 79  ? 13.350 42.153 53.604  1.00 180.31 ? 79  SER E CA   1 
ATOM   5286 C  C    . SER E 1 79  ? 14.345 41.033 53.917  1.00 183.91 ? 79  SER E C    1 
ATOM   5287 O  O    . SER E 1 79  ? 14.275 39.931 53.365  1.00 182.53 ? 79  SER E O    1 
ATOM   5288 C  CB   . SER E 1 79  ? 11.944 41.728 54.012  1.00 183.43 ? 79  SER E CB   1 
ATOM   5289 O  OG   . SER E 1 79  ? 11.403 40.837 53.055  1.00 191.70 ? 79  SER E OG   1 
ATOM   5290 N  N    . GLN E 1 80  ? 15.233 41.314 54.862  1.00 181.94 ? 80  GLN E N    1 
ATOM   5291 C  CA   . GLN E 1 80  ? 16.261 40.362 55.260  1.00 181.56 ? 80  GLN E CA   1 
ATOM   5292 C  C    . GLN E 1 80  ? 15.707 39.203 56.069  1.00 179.79 ? 80  GLN E C    1 
ATOM   5293 O  O    . GLN E 1 80  ? 16.426 38.255 56.372  1.00 178.24 ? 80  GLN E O    1 
ATOM   5294 C  CB   . GLN E 1 80  ? 17.359 41.062 56.073  1.00 183.17 ? 80  GLN E CB   1 
ATOM   5295 C  CG   . GLN E 1 80  ? 18.593 40.197 56.331  1.00 190.68 ? 80  GLN E CG   1 
ATOM   5296 C  CD   . GLN E 1 80  ? 18.933 40.075 57.800  1.00 201.87 ? 80  GLN E CD   1 
ATOM   5297 O  OE1  . GLN E 1 80  ? 18.206 40.563 58.656  1.00 196.18 ? 80  GLN E OE1  1 
ATOM   5298 N  NE2  . GLN E 1 80  ? 20.053 39.437 58.095  1.00 192.83 ? 80  GLN E NE2  1 
ATOM   5299 N  N    . VAL E 1 81  ? 14.440 39.286 56.445  1.00 178.92 ? 81  VAL E N    1 
ATOM   5300 C  CA   . VAL E 1 81  ? 13.862 38.243 57.268  1.00 177.58 ? 81  VAL E CA   1 
ATOM   5301 C  C    . VAL E 1 81  ? 13.206 37.120 56.479  1.00 179.29 ? 81  VAL E C    1 
ATOM   5302 O  O    . VAL E 1 81  ? 13.522 35.946 56.671  1.00 177.20 ? 81  VAL E O    1 
ATOM   5303 C  CB   . VAL E 1 81  ? 12.923 38.827 58.288  1.00 181.05 ? 81  VAL E CB   1 
ATOM   5304 C  CG1  . VAL E 1 81  ? 12.286 40.087 57.729  1.00 180.80 ? 81  VAL E CG1  1 
ATOM   5305 C  CG2  . VAL E 1 81  ? 11.883 37.796 58.673  1.00 180.80 ? 81  VAL E CG2  1 
ATOM   5306 N  N    . PRO E 1 82  ? 12.262 37.463 55.598  1.00 177.65 ? 82  PRO E N    1 
ATOM   5307 C  CA   . PRO E 1 82  ? 11.612 36.400 54.823  1.00 178.37 ? 82  PRO E CA   1 
ATOM   5308 C  C    . PRO E 1 82  ? 12.651 35.711 53.946  1.00 183.70 ? 82  PRO E C    1 
ATOM   5309 O  O    . PRO E 1 82  ? 12.674 34.480 53.827  1.00 183.74 ? 82  PRO E O    1 
ATOM   5310 C  CB   . PRO E 1 82  ? 10.605 37.165 53.949  1.00 179.84 ? 82  PRO E CB   1 
ATOM   5311 C  CG   . PRO E 1 82  ? 10.628 38.593 54.446  1.00 183.56 ? 82  PRO E CG   1 
ATOM   5312 C  CD   . PRO E 1 82  ? 11.983 38.790 55.035  1.00 178.49 ? 82  PRO E CD   1 
ATOM   5313 N  N    . ALA E 1 83  ? 13.522 36.526 53.354  1.00 181.44 ? 83  ALA E N    1 
ATOM   5314 C  CA   . ALA E 1 83  ? 14.599 36.028 52.514  1.00 180.90 ? 83  ALA E CA   1 
ATOM   5315 C  C    . ALA E 1 83  ? 15.393 34.986 53.291  1.00 183.43 ? 83  ALA E C    1 
ATOM   5316 O  O    . ALA E 1 83  ? 15.646 33.886 52.790  1.00 182.62 ? 83  ALA E O    1 
ATOM   5317 C  CB   . ALA E 1 83  ? 15.510 37.176 52.077  1.00 181.71 ? 83  ALA E CB   1 
ATOM   5318 N  N    . ALA E 1 84  ? 15.762 35.334 54.525  1.00 181.42 ? 84  ALA E N    1 
ATOM   5319 C  CA   . ALA E 1 84  ? 16.544 34.450 55.392  1.00 180.96 ? 84  ALA E CA   1 
ATOM   5320 C  C    . ALA E 1 84  ? 15.790 33.204 55.825  1.00 182.93 ? 84  ALA E C    1 
ATOM   5321 O  O    . ALA E 1 84  ? 16.392 32.150 56.029  1.00 182.65 ? 84  ALA E O    1 
ATOM   5322 C  CB   . ALA E 1 84  ? 17.066 35.200 56.608  1.00 181.74 ? 84  ALA E CB   1 
ATOM   5323 N  N    . PHE E 1 85  ? 14.477 33.322 55.986  1.00 180.96 ? 85  PHE E N    1 
ATOM   5324 C  CA   . PHE E 1 85  ? 13.704 32.156 56.378  1.00 183.34 ? 85  PHE E CA   1 
ATOM   5325 C  C    . PHE E 1 85  ? 13.536 31.201 55.204  1.00 179.10 ? 85  PHE E C    1 
ATOM   5326 O  O    . PHE E 1 85  ? 13.862 30.013 55.301  1.00 175.38 ? 85  PHE E O    1 
ATOM   5327 C  CB   . PHE E 1 85  ? 12.336 32.518 56.932  1.00 192.19 ? 85  PHE E CB   1 
ATOM   5328 C  CG   . PHE E 1 85  ? 11.509 31.314 57.243  1.00 204.01 ? 85  PHE E CG   1 
ATOM   5329 C  CD1  . PHE E 1 85  ? 10.700 30.750 56.271  1.00 214.76 ? 85  PHE E CD1  1 
ATOM   5330 C  CD2  . PHE E 1 85  ? 11.692 30.634 58.437  1.00 214.09 ? 85  PHE E CD2  1 
ATOM   5331 C  CE1  . PHE E 1 85  ? 9.997  29.594 56.528  1.00 218.85 ? 85  PHE E CE1  1 
ATOM   5332 C  CE2  . PHE E 1 85  ? 10.997 29.475 58.704  1.00 220.46 ? 85  PHE E CE2  1 
ATOM   5333 C  CZ   . PHE E 1 85  ? 10.143 28.954 57.751  1.00 219.46 ? 85  PHE E CZ   1 
ATOM   5334 N  N    . ALA E 1 86  ? 13.001 31.731 54.109  1.00 176.85 ? 86  ALA E N    1 
ATOM   5335 C  CA   . ALA E 1 86  ? 12.801 30.966 52.887  1.00 179.14 ? 86  ALA E CA   1 
ATOM   5336 C  C    . ALA E 1 86  ? 14.076 30.193 52.581  1.00 180.86 ? 86  ALA E C    1 
ATOM   5337 O  O    . ALA E 1 86  ? 14.040 29.010 52.233  1.00 178.93 ? 86  ALA E O    1 
ATOM   5338 C  CB   . ALA E 1 86  ? 12.480 31.908 51.736  1.00 180.74 ? 86  ALA E CB   1 
ATOM   5339 N  N    . GLY E 1 87  ? 15.206 30.875 52.736  1.00 178.34 ? 87  GLY E N    1 
ATOM   5340 C  CA   . GLY E 1 87  ? 16.509 30.285 52.512  1.00 178.96 ? 87  GLY E CA   1 
ATOM   5341 C  C    . GLY E 1 87  ? 16.768 29.188 53.523  1.00 183.64 ? 87  GLY E C    1 
ATOM   5342 O  O    . GLY E 1 87  ? 17.536 28.262 53.269  1.00 183.07 ? 87  GLY E O    1 
ATOM   5343 N  N    . LEU E 1 88  ? 16.110 29.282 54.671  1.00 177.50 ? 88  LEU E N    1 
ATOM   5344 C  CA   . LEU E 1 88  ? 16.276 28.284 55.708  1.00 175.99 ? 88  LEU E CA   1 
ATOM   5345 C  C    . LEU E 1 88  ? 15.535 27.000 55.350  1.00 182.35 ? 88  LEU E C    1 
ATOM   5346 O  O    . LEU E 1 88  ? 16.025 25.897 55.588  1.00 182.48 ? 88  LEU E O    1 
ATOM   5347 C  CB   . LEU E 1 88  ? 15.800 28.835 57.038  1.00 173.63 ? 88  LEU E CB   1 
ATOM   5348 C  CG   . LEU E 1 88  ? 16.142 27.893 58.177  1.00 172.88 ? 88  LEU E CG   1 
ATOM   5349 C  CD1  . LEU E 1 88  ? 15.032 26.855 58.281  1.00 171.19 ? 88  LEU E CD1  1 
ATOM   5350 C  CD2  . LEU E 1 88  ? 17.477 27.231 57.887  1.00 173.49 ? 88  LEU E CD2  1 
ATOM   5351 N  N    . MET E 1 89  ? 14.362 27.157 54.751  1.00 178.34 ? 89  MET E N    1 
ATOM   5352 C  CA   . MET E 1 89  ? 13.551 26.028 54.306  1.00 178.34 ? 89  MET E CA   1 
ATOM   5353 C  C    . MET E 1 89  ? 14.314 25.268 53.248  1.00 178.34 ? 89  MET E C    1 
ATOM   5354 O  O    . MET E 1 89  ? 14.332 24.040 53.222  1.00 261.67 ? 89  MET E O    1 
ATOM   5355 C  CB   . MET E 1 89  ? 12.266 26.556 53.673  1.00 178.34 ? 89  MET E CB   1 
ATOM   5356 C  CG   . MET E 1 89  ? 11.376 27.246 54.668  1.00 178.34 ? 89  MET E CG   1 
ATOM   5357 S  SD   . MET E 1 89  ? 11.414 26.292 56.196  1.00 178.34 ? 89  MET E SD   1 
ATOM   5358 C  CE   . MET E 1 89  ? 10.706 24.712 55.598  1.00 178.34 ? 89  MET E CE   1 
ATOM   5359 N  N    . TYR E 1 90  ? 14.911 26.034 52.346  1.00 181.60 ? 90  TYR E N    1 
ATOM   5360 C  CA   . TYR E 1 90  ? 15.684 25.478 51.261  1.00 182.23 ? 90  TYR E CA   1 
ATOM   5361 C  C    . TYR E 1 90  ? 16.718 24.529 51.840  1.00 174.74 ? 90  TYR E C    1 
ATOM   5362 O  O    . TYR E 1 90  ? 17.056 23.527 51.222  1.00 191.12 ? 90  TYR E O    1 
ATOM   5363 C  CB   . TYR E 1 90  ? 16.369 26.593 50.470  1.00 181.52 ? 90  TYR E CB   1 
ATOM   5364 C  CG   . TYR E 1 90  ? 17.182 26.089 49.304  1.00 178.99 ? 90  TYR E CG   1 
ATOM   5365 C  CD1  . TYR E 1 90  ? 18.312 25.309 49.508  1.00 180.06 ? 90  TYR E CD1  1 
ATOM   5366 C  CD2  . TYR E 1 90  ? 16.815 26.379 47.994  1.00 178.43 ? 90  TYR E CD2  1 
ATOM   5367 C  CE1  . TYR E 1 90  ? 19.045 24.803 48.445  1.00 179.66 ? 90  TYR E CE1  1 
ATOM   5368 C  CE2  . TYR E 1 90  ? 17.554 25.892 46.912  1.00 178.69 ? 90  TYR E CE2  1 
ATOM   5369 C  CZ   . TYR E 1 90  ? 18.670 25.098 47.147  1.00 184.44 ? 90  TYR E CZ   1 
ATOM   5370 O  OH   . TYR E 1 90  ? 19.423 24.603 46.099  1.00 184.47 ? 90  TYR E OH   1 
ATOM   5371 N  N    . LEU E 1 91  ? 17.221 24.846 53.029  1.00 183.44 ? 91  LEU E N    1 
ATOM   5372 C  CA   . LEU E 1 91  ? 18.219 24.000 53.678  1.00 183.44 ? 91  LEU E CA   1 
ATOM   5373 C  C    . LEU E 1 91  ? 17.566 22.743 54.261  1.00 183.44 ? 91  LEU E C    1 
ATOM   5374 O  O    . LEU E 1 91  ? 18.236 21.741 54.545  1.00 183.44 ? 91  LEU E O    1 
ATOM   5375 C  CB   . LEU E 1 91  ? 19.001 24.788 54.737  1.00 183.44 ? 91  LEU E CB   1 
ATOM   5376 C  CG   . LEU E 1 91  ? 20.222 25.557 54.208  1.00 183.44 ? 91  LEU E CG   1 
ATOM   5377 C  CD1  . LEU E 1 91  ? 19.969 26.119 52.808  1.00 183.44 ? 91  LEU E CD1  1 
ATOM   5378 C  CD2  . LEU E 1 91  ? 20.656 26.664 55.155  1.00 183.44 ? 91  LEU E CD2  1 
ATOM   5379 N  N    . PHE E 1 92  ? 16.244 22.791 54.388  1.00 175.95 ? 92  PHE E N    1 
ATOM   5380 C  CA   . PHE E 1 92  ? 15.480 21.651 54.875  1.00 194.23 ? 92  PHE E CA   1 
ATOM   5381 C  C    . PHE E 1 92  ? 15.194 20.717 53.708  1.00 188.62 ? 92  PHE E C    1 
ATOM   5382 O  O    . PHE E 1 92  ? 15.405 19.512 53.798  1.00 185.70 ? 92  PHE E O    1 
ATOM   5383 C  CB   . PHE E 1 92  ? 14.154 22.114 55.473  1.00 201.76 ? 92  PHE E CB   1 
ATOM   5384 C  CG   . PHE E 1 92  ? 14.277 22.690 56.847  1.00 211.03 ? 92  PHE E CG   1 
ATOM   5385 C  CD1  . PHE E 1 92  ? 15.486 23.190 57.294  1.00 219.86 ? 92  PHE E CD1  1 
ATOM   5386 C  CD2  . PHE E 1 92  ? 13.176 22.739 57.687  1.00 219.11 ? 92  PHE E CD2  1 
ATOM   5387 C  CE1  . PHE E 1 92  ? 15.598 23.723 58.554  1.00 223.19 ? 92  PHE E CE1  1 
ATOM   5388 C  CE2  . PHE E 1 92  ? 13.277 23.279 58.949  1.00 224.64 ? 92  PHE E CE2  1 
ATOM   5389 C  CZ   . PHE E 1 92  ? 14.490 23.770 59.384  1.00 223.44 ? 92  PHE E CZ   1 
ATOM   5390 N  N    . VAL E 1 93  ? 14.713 21.284 52.608  1.00 182.54 ? 93  VAL E N    1 
ATOM   5391 C  CA   . VAL E 1 93  ? 14.415 20.492 51.427  1.00 183.53 ? 93  VAL E CA   1 
ATOM   5392 C  C    . VAL E 1 93  ? 15.691 19.822 50.916  1.00 187.75 ? 93  VAL E C    1 
ATOM   5393 O  O    . VAL E 1 93  ? 15.673 18.661 50.505  1.00 186.83 ? 93  VAL E O    1 
ATOM   5394 C  CB   . VAL E 1 93  ? 13.721 21.338 50.361  1.00 189.01 ? 93  VAL E CB   1 
ATOM   5395 C  CG1  . VAL E 1 93  ? 12.662 20.518 49.651  1.00 189.09 ? 93  VAL E CG1  1 
ATOM   5396 C  CG2  . VAL E 1 93  ? 13.108 22.586 51.001  1.00 189.10 ? 93  VAL E CG2  1 
ATOM   5397 N  N    . ARG E 1 94  ? 16.800 20.553 50.986  1.00 185.56 ? 94  ARG E N    1 
ATOM   5398 C  CA   . ARG E 1 94  ? 18.096 20.037 50.569  1.00 186.75 ? 94  ARG E CA   1 
ATOM   5399 C  C    . ARG E 1 94  ? 18.440 18.833 51.412  1.00 195.66 ? 94  ARG E C    1 
ATOM   5400 O  O    . ARG E 1 94  ? 18.963 17.845 50.913  1.00 195.83 ? 94  ARG E O    1 
ATOM   5401 C  CB   . ARG E 1 94  ? 19.167 21.103 50.741  1.00 185.12 ? 94  ARG E CB   1 
ATOM   5402 C  CG   . ARG E 1 94  ? 19.259 22.037 49.562  1.00 187.59 ? 94  ARG E CG   1 
ATOM   5403 C  CD   . ARG E 1 94  ? 20.514 21.764 48.783  1.00 185.03 ? 94  ARG E CD   1 
ATOM   5404 N  NE   . ARG E 1 94  ? 21.680 21.902 49.642  1.00 181.59 ? 94  ARG E NE   1 
ATOM   5405 C  CZ   . ARG E 1 94  ? 22.708 22.693 49.365  1.00 188.13 ? 94  ARG E CZ   1 
ATOM   5406 N  NH1  . ARG E 1 94  ? 22.706 23.403 48.242  1.00 173.75 ? 94  ARG E NH1  1 
ATOM   5407 N  NH2  . ARG E 1 94  ? 23.737 22.767 50.202  1.00 173.16 ? 94  ARG E NH2  1 
ATOM   5408 N  N    . GLN E 1 95  ? 18.134 18.914 52.697  1.00 193.31 ? 95  GLN E N    1 
ATOM   5409 C  CA   . GLN E 1 95  ? 18.387 17.804 53.588  1.00 194.74 ? 95  GLN E CA   1 
ATOM   5410 C  C    . GLN E 1 95  ? 17.502 16.617 53.210  1.00 202.44 ? 95  GLN E C    1 
ATOM   5411 O  O    . GLN E 1 95  ? 17.976 15.486 53.070  1.00 202.40 ? 95  GLN E O    1 
ATOM   5412 C  CB   . GLN E 1 95  ? 18.120 18.230 55.025  1.00 196.18 ? 95  GLN E CB   1 
ATOM   5413 C  CG   . GLN E 1 95  ? 19.230 17.848 55.967  1.00 207.31 ? 95  GLN E CG   1 
ATOM   5414 C  CD   . GLN E 1 95  ? 20.268 16.983 55.292  1.00 222.01 ? 95  GLN E CD   1 
ATOM   5415 O  OE1  . GLN E 1 95  ? 21.000 17.443 54.420  1.00 216.86 ? 95  GLN E OE1  1 
ATOM   5416 N  NE2  . GLN E 1 95  ? 20.329 15.717 55.684  1.00 213.50 ? 95  GLN E NE2  1 
ATOM   5417 N  N    . LYS E 1 96  ? 16.217 16.904 53.016  1.00 199.80 ? 96  LYS E N    1 
ATOM   5418 C  CA   . LYS E 1 96  ? 15.207 15.903 52.669  1.00 200.39 ? 96  LYS E CA   1 
ATOM   5419 C  C    . LYS E 1 96  ? 15.376 15.315 51.271  1.00 203.13 ? 96  LYS E C    1 
ATOM   5420 O  O    . LYS E 1 96  ? 14.889 14.220 50.991  1.00 202.03 ? 96  LYS E O    1 
ATOM   5421 C  CB   . LYS E 1 96  ? 13.808 16.513 52.801  1.00 204.26 ? 96  LYS E CB   1 
ATOM   5422 C  CG   . LYS E 1 96  ? 13.277 16.553 54.231  1.00 227.61 ? 96  LYS E CG   1 
ATOM   5423 C  CD   . LYS E 1 96  ? 14.084 17.501 55.114  1.00 241.93 ? 96  LYS E CD   1 
ATOM   5424 C  CE   . LYS E 1 96  ? 14.336 16.924 56.501  1.00 255.63 ? 96  LYS E CE   1 
ATOM   5425 N  NZ   . LYS E 1 96  ? 15.734 16.428 56.662  1.00 265.58 ? 96  LYS E NZ   1 
ATOM   5426 N  N    . TYR E 1 97  ? 16.040 16.054 50.388  1.00 205.94 ? 97  TYR E N    1 
ATOM   5427 C  CA   . TYR E 1 97  ? 16.265 15.585 49.025  1.00 204.15 ? 97  TYR E CA   1 
ATOM   5428 C  C    . TYR E 1 97  ? 17.542 14.751 48.944  1.00 209.60 ? 97  TYR E C    1 
ATOM   5429 O  O    . TYR E 1 97  ? 17.537 13.653 48.398  1.00 209.02 ? 97  TYR E O    1 
ATOM   5430 C  CB   . TYR E 1 97  ? 16.323 16.757 48.043  1.00 200.72 ? 97  TYR E CB   1 
ATOM   5431 C  CG   . TYR E 1 97  ? 16.957 16.393 46.721  1.00 193.72 ? 97  TYR E CG   1 
ATOM   5432 C  CD1  . TYR E 1 97  ? 16.659 15.192 46.092  1.00 194.10 ? 97  TYR E CD1  1 
ATOM   5433 C  CD2  . TYR E 1 97  ? 17.883 17.229 46.120  1.00 191.89 ? 97  TYR E CD2  1 
ATOM   5434 C  CE1  . TYR E 1 97  ? 17.255 14.846 44.879  1.00 192.91 ? 97  TYR E CE1  1 
ATOM   5435 C  CE2  . TYR E 1 97  ? 18.486 16.893 44.909  1.00 191.62 ? 97  TYR E CE2  1 
ATOM   5436 C  CZ   . TYR E 1 97  ? 18.170 15.701 44.294  1.00 196.51 ? 97  TYR E CZ   1 
ATOM   5437 O  OH   . TYR E 1 97  ? 18.767 15.364 43.096  1.00 195.98 ? 97  TYR E OH   1 
ATOM   5438 N  N    . PHE E 1 98  ? 18.631 15.268 49.500  1.00 212.02 ? 98  PHE E N    1 
ATOM   5439 C  CA   . PHE E 1 98  ? 19.894 14.539 49.498  1.00 209.94 ? 98  PHE E CA   1 
ATOM   5440 C  C    . PHE E 1 98  ? 19.797 13.357 50.451  1.00 223.22 ? 98  PHE E C    1 
ATOM   5441 O  O    . PHE E 1 98  ? 20.691 12.522 50.517  1.00 224.43 ? 98  PHE E O    1 
ATOM   5442 C  CB   . PHE E 1 98  ? 21.065 15.454 49.877  1.00 205.65 ? 98  PHE E CB   1 
ATOM   5443 C  CG   . PHE E 1 98  ? 22.320 14.720 50.294  1.00 198.11 ? 98  PHE E CG   1 
ATOM   5444 C  CD1  . PHE E 1 98  ? 23.259 14.318 49.354  1.00 193.95 ? 98  PHE E CD1  1 
ATOM   5445 C  CD2  . PHE E 1 98  ? 22.583 14.469 51.634  1.00 192.64 ? 98  PHE E CD2  1 
ATOM   5446 C  CE1  . PHE E 1 98  ? 24.428 13.666 49.743  1.00 191.55 ? 98  PHE E CE1  1 
ATOM   5447 C  CE2  . PHE E 1 98  ? 23.753 13.823 52.028  1.00 191.72 ? 98  PHE E CE2  1 
ATOM   5448 C  CZ   . PHE E 1 98  ? 24.673 13.421 51.082  1.00 188.79 ? 98  PHE E CZ   1 
ATOM   5449 N  N    . VAL E 1 99  ? 18.684 13.272 51.165  1.00 222.26 ? 99  VAL E N    1 
ATOM   5450 C  CA   . VAL E 1 99  ? 18.463 12.178 52.092  1.00 222.04 ? 99  VAL E CA   1 
ATOM   5451 C  C    . VAL E 1 99  ? 17.809 11.010 51.363  1.00 231.93 ? 99  VAL E C    1 
ATOM   5452 O  O    . VAL E 1 99  ? 18.331 9.895  51.352  1.00 232.47 ? 99  VAL E O    1 
ATOM   5453 C  CB   . VAL E 1 99  ? 17.603 12.641 53.264  1.00 222.70 ? 99  VAL E CB   1 
ATOM   5454 C  CG1  . VAL E 1 99  ? 16.663 11.539 53.693  1.00 221.96 ? 99  VAL E CG1  1 
ATOM   5455 C  CG2  . VAL E 1 99  ? 18.478 13.096 54.414  1.00 221.97 ? 99  VAL E CG2  1 
ATOM   5456 N  N    . GLY E 1 100 ? 16.667 11.280 50.742  1.00 230.12 ? 100 GLY E N    1 
ATOM   5457 C  CA   . GLY E 1 100 ? 15.923 10.277 50.000  1.00 230.76 ? 100 GLY E CA   1 
ATOM   5458 C  C    . GLY E 1 100 ? 16.676 9.740  48.797  1.00 236.90 ? 100 GLY E C    1 
ATOM   5459 O  O    . GLY E 1 100 ? 16.406 8.642  48.307  1.00 236.62 ? 100 GLY E O    1 
ATOM   5460 N  N    . TYR E 1 101 ? 17.629 10.519 48.309  1.00 234.29 ? 101 TYR E N    1 
ATOM   5461 C  CA   . TYR E 1 101 ? 18.425 10.084 47.177  1.00 233.59 ? 101 TYR E CA   1 
ATOM   5462 C  C    . TYR E 1 101 ? 19.648 9.329  47.676  1.00 244.22 ? 101 TYR E C    1 
ATOM   5463 O  O    . TYR E 1 101 ? 20.694 9.351  47.042  1.00 244.79 ? 101 TYR E O    1 
ATOM   5464 C  CB   . TYR E 1 101 ? 18.877 11.286 46.350  1.00 229.74 ? 101 TYR E CB   1 
ATOM   5465 C  CG   . TYR E 1 101 ? 18.816 11.060 44.860  1.00 222.22 ? 101 TYR E CG   1 
ATOM   5466 C  CD1  . TYR E 1 101 ? 17.663 10.568 44.265  1.00 222.54 ? 101 TYR E CD1  1 
ATOM   5467 C  CD2  . TYR E 1 101 ? 19.903 11.357 44.045  1.00 220.18 ? 101 TYR E CD2  1 
ATOM   5468 C  CE1  . TYR E 1 101 ? 17.597 10.368 42.906  1.00 221.25 ? 101 TYR E CE1  1 
ATOM   5469 C  CE2  . TYR E 1 101 ? 19.844 11.162 42.681  1.00 219.83 ? 101 TYR E CE2  1 
ATOM   5470 C  CZ   . TYR E 1 101 ? 18.688 10.665 42.118  1.00 224.69 ? 101 TYR E CZ   1 
ATOM   5471 O  OH   . TYR E 1 101 ? 18.610 10.455 40.764  1.00 224.14 ? 101 TYR E OH   1 
ATOM   5472 N  N    . LEU E 1 102 ? 19.550 8.727  48.853  1.00 244.84 ? 102 LEU E N    1 
ATOM   5473 C  CA   . LEU E 1 102 ? 20.695 8.021  49.418  1.00 247.77 ? 102 LEU E CA   1 
ATOM   5474 C  C    . LEU E 1 102 ? 20.306 6.712  50.092  1.00 242.16 ? 102 LEU E C    1 
ATOM   5475 O  O    . LEU E 1 102 ? 20.937 5.676  49.856  1.00 239.40 ? 102 LEU E O    1 
ATOM   5476 C  CB   . LEU E 1 102 ? 21.458 8.914  50.394  1.00 253.07 ? 102 LEU E CB   1 
ATOM   5477 C  CG   . LEU E 1 102 ? 22.531 8.197  51.214  1.00 267.57 ? 102 LEU E CG   1 
ATOM   5478 C  CD1  . LEU E 1 102 ? 21.921 7.564  52.454  1.00 270.92 ? 102 LEU E CD1  1 
ATOM   5479 C  CD2  . LEU E 1 102 ? 23.252 7.153  50.370  1.00 273.22 ? 102 LEU E CD2  1 
ATOM   5480 N  N    . GLY E 1 103 ? 19.284 6.767  50.946  1.00 243.08 ? 103 GLY E N    1 
ATOM   5481 C  CA   . GLY E 1 103 ? 18.770 5.583  51.614  1.00 242.79 ? 103 GLY E CA   1 
ATOM   5482 C  C    . GLY E 1 103 ? 18.445 4.609  50.502  1.00 245.69 ? 103 GLY E C    1 
ATOM   5483 O  O    . GLY E 1 103 ? 18.542 3.388  50.653  1.00 244.72 ? 103 GLY E O    1 
ATOM   5484 N  N    . GLU E 1 104 ? 18.095 5.191  49.357  1.00 244.95 ? 104 GLU E N    1 
ATOM   5485 C  CA   . GLU E 1 104 ? 17.828 4.463  48.127  1.00 246.19 ? 104 GLU E CA   1 
ATOM   5486 C  C    . GLU E 1 104 ? 16.606 3.555  48.038  1.00 257.31 ? 104 GLU E C    1 
ATOM   5487 O  O    . GLU E 1 104 ? 16.561 2.459  48.611  1.00 258.37 ? 104 GLU E O    1 
ATOM   5488 C  CB   . GLU E 1 104 ? 19.099 3.800  47.578  1.00 247.06 ? 104 GLU E CB   1 
ATOM   5489 C  CG   . GLU E 1 104 ? 19.171 2.290  47.731  1.00 253.16 ? 104 GLU E CG   1 
ATOM   5490 C  CD   . GLU E 1 104 ? 20.054 1.654  46.681  1.00 262.21 ? 104 GLU E CD   1 
ATOM   5491 O  OE1  . GLU E 1 104 ? 20.982 2.336  46.190  1.00 253.17 ? 104 GLU E OE1  1 
ATOM   5492 O  OE2  . GLU E 1 104 ? 19.807 0.479  46.339  1.00 252.91 ? 104 GLU E OE2  1 
ATOM   5493 N  N    . ARG E 1 105 ? 15.639 4.005  47.244  1.00 255.85 ? 105 ARG E N    1 
ATOM   5494 C  CA   . ARG E 1 105 ? 14.440 3.235  46.959  1.00 256.22 ? 105 ARG E CA   1 
ATOM   5495 C  C    . ARG E 1 105 ? 14.885 2.206  45.926  1.00 259.93 ? 105 ARG E C    1 
ATOM   5496 O  O    . ARG E 1 105 ? 14.089 1.740  45.112  1.00 259.44 ? 105 ARG E O    1 
ATOM   5497 C  CB   . ARG E 1 105 ? 13.384 4.151  46.333  1.00 257.79 ? 105 ARG E CB   1 
ATOM   5498 C  CG   . ARG E 1 105 ? 11.974 3.932  46.842  1.00 267.38 ? 105 ARG E CG   1 
ATOM   5499 C  CD   . ARG E 1 105 ? 11.038 5.027  46.356  1.00 271.82 ? 105 ARG E CD   1 
ATOM   5500 N  NE   . ARG E 1 105 ? 10.161 5.505  47.422  1.00 273.04 ? 105 ARG E NE   1 
ATOM   5501 C  CZ   . ARG E 1 105 ? 8.833  5.498  47.361  1.00 281.98 ? 105 ARG E CZ   1 
ATOM   5502 N  NH1  . ARG E 1 105 ? 8.222  5.042  46.278  1.00 268.11 ? 105 ARG E NH1  1 
ATOM   5503 N  NH2  . ARG E 1 105 ? 8.115  5.949  48.381  1.00 267.52 ? 105 ARG E NH2  1 
ATOM   5504 N  N    . THR E 1 106 ? 16.182 1.900  45.943  1.00 258.96 ? 106 THR E N    1 
ATOM   5505 C  CA   . THR E 1 106 ? 16.796 0.995  44.982  1.00 258.94 ? 106 THR E CA   1 
ATOM   5506 C  C    . THR E 1 106 ? 16.787 1.657  43.602  1.00 260.92 ? 106 THR E C    1 
ATOM   5507 O  O    . THR E 1 106 ? 17.837 1.817  42.974  1.00 260.10 ? 106 THR E O    1 
ATOM   5508 C  CB   . THR E 1 106 ? 16.155 -0.402 45.012  1.00 275.82 ? 106 THR E CB   1 
ATOM   5509 O  OG1  . THR E 1 106 ? 16.547 -1.071 46.218  1.00 277.37 ? 106 THR E OG1  1 
ATOM   5510 C  CG2  . THR E 1 106 ? 16.605 -1.223 43.810  1.00 276.39 ? 106 THR E CG2  1 
ATOM   5511 N  N    . GLN E 1 107 ? 15.611 2.107  43.170  1.00 259.19 ? 107 GLN E N    1 
ATOM   5512 C  CA   . GLN E 1 107 ? 15.475 2.830  41.906  1.00 259.67 ? 107 GLN E CA   1 
ATOM   5513 C  C    . GLN E 1 107 ? 14.489 3.996  42.013  1.00 267.32 ? 107 GLN E C    1 
ATOM   5514 O  O    . GLN E 1 107 ? 13.283 3.799  42.191  1.00 267.98 ? 107 GLN E O    1 
ATOM   5515 C  CB   . GLN E 1 107 ? 15.105 1.902  40.740  1.00 260.49 ? 107 GLN E CB   1 
ATOM   5516 C  CG   . GLN E 1 107 ? 16.247 1.675  39.730  1.00 258.48 ? 107 GLN E CG   1 
ATOM   5517 C  CD   . GLN E 1 107 ? 16.152 2.547  38.472  1.00 260.92 ? 107 GLN E CD   1 
ATOM   5518 O  OE1  . GLN E 1 107 ? 15.503 3.597  38.466  1.00 253.92 ? 107 GLN E OE1  1 
ATOM   5519 N  NE2  . GLN E 1 107 ? 16.832 2.122  37.410  1.00 250.57 ? 107 GLN E NE2  1 
ATOM   5520 N  N    . SER E 1 108 ? 15.024 5.211  41.920  1.00 264.01 ? 108 SER E N    1 
ATOM   5521 C  CA   . SER E 1 108 ? 14.220 6.427  41.986  1.00 262.24 ? 108 SER E CA   1 
ATOM   5522 C  C    . SER E 1 108 ? 14.808 7.531  41.099  1.00 259.32 ? 108 SER E C    1 
ATOM   5523 O  O    . SER E 1 108 ? 16.012 7.547  40.810  1.00 257.69 ? 108 SER E O    1 
ATOM   5524 C  CB   . SER E 1 108 ? 14.064 6.913  43.437  1.00 266.53 ? 108 SER E CB   1 
ATOM   5525 O  OG   . SER E 1 108 ? 15.318 7.086  44.084  1.00 275.69 ? 108 SER E OG   1 
ATOM   5526 N  N    . THR E 1 109 ? 13.945 8.440  40.654  1.00 254.24 ? 109 THR E N    1 
ATOM   5527 C  CA   . THR E 1 109 ? 14.377 9.558  39.825  1.00 251.82 ? 109 THR E CA   1 
ATOM   5528 C  C    . THR E 1 109 ? 13.786 10.909 40.261  1.00 247.57 ? 109 THR E C    1 
ATOM   5529 O  O    . THR E 1 109 ? 12.960 11.506 39.563  1.00 245.74 ? 109 THR E O    1 
ATOM   5530 C  CB   . THR E 1 109 ? 14.267 9.260  38.303  1.00 261.53 ? 109 THR E CB   1 
ATOM   5531 O  OG1  . THR E 1 109 ? 15.268 8.302  37.932  1.00 261.43 ? 109 THR E OG1  1 
ATOM   5532 C  CG2  . THR E 1 109 ? 14.486 10.520 37.485  1.00 260.46 ? 109 THR E CG2  1 
ATOM   5533 N  N    . PRO E 1 110 ? 14.190 11.387 41.454  1.00 241.04 ? 110 PRO E N    1 
ATOM   5534 C  CA   . PRO E 1 110 ? 13.789 12.701 41.957  1.00 241.41 ? 110 PRO E CA   1 
ATOM   5535 C  C    . PRO E 1 110 ? 14.919 13.642 41.561  1.00 251.36 ? 110 PRO E C    1 
ATOM   5536 O  O    . PRO E 1 110 ? 14.748 14.860 41.496  1.00 252.81 ? 110 PRO E O    1 
ATOM   5537 C  CB   . PRO E 1 110 ? 13.784 12.503 43.479  1.00 241.15 ? 110 PRO E CB   1 
ATOM   5538 C  CG   . PRO E 1 110 ? 14.782 11.433 43.719  1.00 242.73 ? 110 PRO E CG   1 
ATOM   5539 C  CD   . PRO E 1 110 ? 14.637 10.500 42.546  1.00 238.44 ? 110 PRO E CD   1 
ATOM   5540 N  N    . GLY E 1 111 ? 16.066 13.031 41.270  1.00 244.49 ? 111 GLY E N    1 
ATOM   5541 C  CA   . GLY E 1 111 ? 17.298 13.685 40.870  1.00 243.89 ? 111 GLY E CA   1 
ATOM   5542 C  C    . GLY E 1 111 ? 17.133 15.013 40.169  1.00 247.37 ? 111 GLY E C    1 
ATOM   5543 O  O    . GLY E 1 111 ? 16.235 15.200 39.346  1.00 247.52 ? 111 GLY E O    1 
ATOM   5544 N  N    . TYR E 1 112 ? 18.005 15.947 40.521  1.00 241.08 ? 112 TYR E N    1 
ATOM   5545 C  CA   . TYR E 1 112 ? 17.976 17.276 39.943  1.00 236.91 ? 112 TYR E CA   1 
ATOM   5546 C  C    . TYR E 1 112 ? 16.691 18.019 40.285  1.00 256.04 ? 112 TYR E C    1 
ATOM   5547 O  O    . TYR E 1 112 ? 15.611 17.433 40.322  1.00 259.69 ? 112 TYR E O    1 
ATOM   5548 C  CB   . TYR E 1 112 ? 18.186 17.211 38.431  1.00 223.94 ? 112 TYR E CB   1 
ATOM   5549 C  CG   . TYR E 1 112 ? 19.411 17.967 37.973  1.00 201.81 ? 112 TYR E CG   1 
ATOM   5550 C  CD1  . TYR E 1 112 ? 20.675 17.660 38.481  1.00 199.63 ? 112 TYR E CD1  1 
ATOM   5551 C  CD2  . TYR E 1 112 ? 19.302 19.028 37.075  1.00 196.24 ? 112 TYR E CD2  1 
ATOM   5552 C  CE1  . TYR E 1 112 ? 21.813 18.375 38.079  1.00 196.41 ? 112 TYR E CE1  1 
ATOM   5553 C  CE2  . TYR E 1 112 ? 20.428 19.746 36.658  1.00 194.69 ? 112 TYR E CE2  1 
ATOM   5554 C  CZ   . TYR E 1 112 ? 21.683 19.422 37.167  1.00 198.59 ? 112 TYR E CZ   1 
ATOM   5555 O  OH   . TYR E 1 112 ? 22.800 20.135 36.751  1.00 197.71 ? 112 TYR E OH   1 
ATOM   5556 N  N    . ILE E 1 113 ? 16.832 19.313 40.549  1.00 246.25 ? 113 ILE E N    1 
ATOM   5557 C  CA   . ILE E 1 113 ? 15.715 20.178 40.904  1.00 239.43 ? 113 ILE E CA   1 
ATOM   5558 C  C    . ILE E 1 113 ? 15.111 19.838 42.250  1.00 240.37 ? 113 ILE E C    1 
ATOM   5559 O  O    . ILE E 1 113 ? 14.624 18.729 42.451  1.00 240.48 ? 113 ILE E O    1 
ATOM   5560 C  CB   . ILE E 1 113 ? 14.620 20.191 39.833  1.00 235.81 ? 113 ILE E CB   1 
ATOM   5561 C  CG1  . ILE E 1 113 ? 14.937 21.229 38.764  1.00 232.53 ? 113 ILE E CG1  1 
ATOM   5562 C  CG2  . ILE E 1 113 ? 13.282 20.504 40.470  1.00 233.92 ? 113 ILE E CG2  1 
ATOM   5563 C  CD1  . ILE E 1 113 ? 15.901 20.735 37.736  1.00 234.75 ? 113 ILE E CD1  1 
ATOM   5564 N  N    . PHE E 1 114 ? 15.120 20.806 43.161  1.00 232.86 ? 114 PHE E N    1 
ATOM   5565 C  CA   . PHE E 1 114 ? 14.476 20.628 44.456  1.00 227.39 ? 114 PHE E CA   1 
ATOM   5566 C  C    . PHE E 1 114 ? 13.312 21.608 44.497  1.00 232.58 ? 114 PHE E C    1 
ATOM   5567 O  O    . PHE E 1 114 ? 12.552 21.790 43.540  1.00 232.83 ? 114 PHE E O    1 
ATOM   5568 C  CB   . PHE E 1 114 ? 15.348 21.026 45.670  1.00 224.49 ? 114 PHE E CB   1 
ATOM   5569 C  CG   . PHE E 1 114 ? 16.793 20.619 45.606  1.00 221.83 ? 114 PHE E CG   1 
ATOM   5570 C  CD1  . PHE E 1 114 ? 17.546 20.780 44.452  1.00 222.59 ? 114 PHE E CD1  1 
ATOM   5571 C  CD2  . PHE E 1 114 ? 17.446 20.266 46.779  1.00 221.59 ? 114 PHE E CD2  1 
ATOM   5572 C  CE1  . PHE E 1 114 ? 18.898 20.476 44.439  1.00 222.61 ? 114 PHE E CE1  1 
ATOM   5573 C  CE2  . PHE E 1 114 ? 18.797 19.980 46.780  1.00 223.40 ? 114 PHE E CE2  1 
ATOM   5574 C  CZ   . PHE E 1 114 ? 19.524 20.076 45.606  1.00 221.21 ? 114 PHE E CZ   1 
ATOM   5575 N  N    . GLY E 1 115 ? 13.275 22.298 45.629  1.00 222.95 ? 115 GLY E N    1 
ATOM   5576 C  CA   . GLY E 1 115 ? 12.309 23.307 45.994  1.00 223.24 ? 115 GLY E CA   1 
ATOM   5577 C  C    . GLY E 1 115 ? 12.206 24.460 45.029  1.00 210.31 ? 115 GLY E C    1 
ATOM   5578 O  O    . GLY E 1 115 ? 12.466 25.608 45.388  1.00 230.54 ? 115 GLY E O    1 
ATOM   5579 N  N    . LYS E 1 116 ? 11.779 24.145 43.812  1.00 210.07 ? 116 LYS E N    1 
ATOM   5580 C  CA   . LYS E 1 116 ? 11.564 25.145 42.779  1.00 210.07 ? 116 LYS E CA   1 
ATOM   5581 C  C    . LYS E 1 116 ? 10.770 26.320 43.342  1.00 210.07 ? 116 LYS E C    1 
ATOM   5582 O  O    . LYS E 1 116 ? 10.975 27.472 42.953  1.00 210.07 ? 116 LYS E O    1 
ATOM   5583 C  CB   . LYS E 1 116 ? 10.794 24.527 41.617  1.00 210.07 ? 116 LYS E CB   1 
ATOM   5584 C  CG   . LYS E 1 116 ? 11.446 24.716 40.264  1.00 210.07 ? 116 LYS E CG   1 
ATOM   5585 C  CD   . LYS E 1 116 ? 10.798 23.822 39.216  1.00 210.07 ? 116 LYS E CD   1 
ATOM   5586 C  CE   . LYS E 1 116 ? 9.784  24.589 38.380  1.00 210.07 ? 116 LYS E CE   1 
ATOM   5587 N  NZ   . LYS E 1 116 ? 9.304  23.801 37.207  1.00 210.07 ? 116 LYS E NZ   1 
ATOM   5588 N  N    . ARG E 1 117 ? 9.876  26.016 44.279  1.00 195.00 ? 117 ARG E N    1 
ATOM   5589 C  CA   . ARG E 1 117 ? 9.046  27.035 44.911  1.00 211.97 ? 117 ARG E CA   1 
ATOM   5590 C  C    . ARG E 1 117 ? 9.879  28.043 45.703  1.00 205.37 ? 117 ARG E C    1 
ATOM   5591 O  O    . ARG E 1 117 ? 9.695  29.253 45.566  1.00 203.30 ? 117 ARG E O    1 
ATOM   5592 C  CB   . ARG E 1 117 ? 7.971  26.405 45.810  1.00 221.10 ? 117 ARG E CB   1 
ATOM   5593 C  CG   . ARG E 1 117 ? 8.370  25.093 46.475  1.00 255.78 ? 117 ARG E CG   1 
ATOM   5594 C  CD   . ARG E 1 117 ? 7.284  24.615 47.430  1.00 292.01 ? 117 ARG E CD   1 
ATOM   5595 N  NE   . ARG E 1 117 ? 6.255  23.836 46.746  1.00 300.00 ? 117 ARG E NE   1 
ATOM   5596 C  CZ   . ARG E 1 117 ? 5.016  23.670 47.200  1.00 300.00 ? 117 ARG E CZ   1 
ATOM   5597 N  NH1  . ARG E 1 117 ? 4.648  24.226 48.345  1.00 300.00 ? 117 ARG E NH1  1 
ATOM   5598 N  NH2  . ARG E 1 117 ? 4.142  22.946 46.511  1.00 300.00 ? 117 ARG E NH2  1 
ATOM   5599 N  N    . ILE E 1 118 ? 10.793 27.541 46.530  1.00 194.21 ? 118 ILE E N    1 
ATOM   5600 C  CA   . ILE E 1 118 ? 11.643 28.405 47.345  1.00 191.45 ? 118 ILE E CA   1 
ATOM   5601 C  C    . ILE E 1 118 ? 12.327 29.464 46.493  1.00 194.80 ? 118 ILE E C    1 
ATOM   5602 O  O    . ILE E 1 118 ? 12.044 30.659 46.603  1.00 194.92 ? 118 ILE E O    1 
ATOM   5603 C  CB   . ILE E 1 118 ? 12.720 27.595 48.108  1.00 192.23 ? 118 ILE E CB   1 
ATOM   5604 C  CG1  . ILE E 1 118 ? 12.102 26.744 49.217  1.00 191.50 ? 118 ILE E CG1  1 
ATOM   5605 C  CG2  . ILE E 1 118 ? 13.746 28.531 48.727  1.00 192.11 ? 118 ILE E CG2  1 
ATOM   5606 C  CD1  . ILE E 1 118 ? 13.022 26.552 50.410  1.00 197.39 ? 118 ILE E CD1  1 
ATOM   5607 N  N    . ILE E 1 119 ? 13.270 29.008 45.675  1.00 185.78 ? 119 ILE E N    1 
ATOM   5608 C  CA   . ILE E 1 119 ? 14.054 29.895 44.825  1.00 183.64 ? 119 ILE E CA   1 
ATOM   5609 C  C    . ILE E 1 119 ? 13.140 30.742 43.969  1.00 190.90 ? 119 ILE E C    1 
ATOM   5610 O  O    . ILE E 1 119 ? 13.426 31.903 43.679  1.00 191.59 ? 119 ILE E O    1 
ATOM   5611 C  CB   . ILE E 1 119 ? 15.067 29.116 43.968  1.00 183.99 ? 119 ILE E CB   1 
ATOM   5612 C  CG1  . ILE E 1 119 ? 14.337 28.357 42.866  1.00 183.13 ? 119 ILE E CG1  1 
ATOM   5613 C  CG2  . ILE E 1 119 ? 15.878 28.151 44.839  1.00 183.72 ? 119 ILE E CG2  1 
ATOM   5614 C  CD1  . ILE E 1 119 ? 13.709 27.093 43.363  1.00 189.01 ? 119 ILE E CD1  1 
ATOM   5615 N  N    . LEU E 1 120 ? 12.032 30.151 43.562  1.00 181.95 ? 120 LEU E N    1 
ATOM   5616 C  CA   . LEU E 1 120 ? 11.082 30.886 42.767  1.00 180.40 ? 120 LEU E CA   1 
ATOM   5617 C  C    . LEU E 1 120 ? 10.648 32.093 43.603  1.00 183.30 ? 120 LEU E C    1 
ATOM   5618 O  O    . LEU E 1 120 ? 10.794 33.246 43.180  1.00 184.42 ? 120 LEU E O    1 
ATOM   5619 C  CB   . LEU E 1 120 ? 9.890  29.995 42.425  1.00 179.08 ? 120 LEU E CB   1 
ATOM   5620 C  CG   . LEU E 1 120 ? 8.776  30.759 41.714  1.00 180.47 ? 120 LEU E CG   1 
ATOM   5621 C  CD1  . LEU E 1 120 ? 7.833  31.348 42.759  1.00 179.49 ? 120 LEU E CD1  1 
ATOM   5622 C  CD2  . LEU E 1 120 ? 9.368  31.872 40.834  1.00 181.80 ? 120 LEU E CD2  1 
ATOM   5623 N  N    . PHE E 1 121 ? 10.184 31.816 44.820  1.00 180.88 ? 121 PHE E N    1 
ATOM   5624 C  CA   . PHE E 1 121 ? 9.733  32.861 45.736  1.00 179.77 ? 121 PHE E CA   1 
ATOM   5625 C  C    . PHE E 1 121 ? 10.827 33.883 46.015  1.00 176.64 ? 121 PHE E C    1 
ATOM   5626 O  O    . PHE E 1 121 ? 10.606 35.092 45.878  1.00 173.30 ? 121 PHE E O    1 
ATOM   5627 C  CB   . PHE E 1 121 ? 9.227  32.250 47.048  1.00 185.14 ? 121 PHE E CB   1 
ATOM   5628 C  CG   . PHE E 1 121 ? 9.443  33.127 48.259  1.00 192.42 ? 121 PHE E CG   1 
ATOM   5629 C  CD1  . PHE E 1 121 ? 9.017  34.449 48.270  1.00 199.86 ? 121 PHE E CD1  1 
ATOM   5630 C  CD2  . PHE E 1 121 ? 10.040 32.614 49.405  1.00 199.00 ? 121 PHE E CD2  1 
ATOM   5631 C  CE1  . PHE E 1 121 ? 9.213  35.246 49.388  1.00 202.52 ? 121 PHE E CE1  1 
ATOM   5632 C  CE2  . PHE E 1 121 ? 10.224 33.405 50.529  1.00 203.77 ? 121 PHE E CE2  1 
ATOM   5633 C  CZ   . PHE E 1 121 ? 9.813  34.718 50.522  1.00 202.37 ? 121 PHE E CZ   1 
ATOM   5634 N  N    . LEU E 1 122 ? 11.983 33.393 46.459  1.00 170.63 ? 122 LEU E N    1 
ATOM   5635 C  CA   . LEU E 1 122 ? 13.112 34.260 46.764  1.00 170.93 ? 122 LEU E CA   1 
ATOM   5636 C  C    . LEU E 1 122 ? 13.352 35.158 45.555  1.00 176.88 ? 122 LEU E C    1 
ATOM   5637 O  O    . LEU E 1 122 ? 13.587 36.360 45.695  1.00 178.04 ? 122 LEU E O    1 
ATOM   5638 C  CB   . LEU E 1 122 ? 14.358 33.423 47.070  1.00 169.14 ? 122 LEU E CB   1 
ATOM   5639 C  CG   . LEU E 1 122 ? 14.912 33.438 48.496  1.00 168.95 ? 122 LEU E CG   1 
ATOM   5640 C  CD1  . LEU E 1 122 ? 13.856 33.856 49.494  1.00 167.42 ? 122 LEU E CD1  1 
ATOM   5641 C  CD2  . LEU E 1 122 ? 15.479 32.082 48.860  1.00 169.72 ? 122 LEU E CD2  1 
ATOM   5642 N  N    . PHE E 1 123 ? 13.240 34.566 44.367  1.00 172.09 ? 123 PHE E N    1 
ATOM   5643 C  CA   . PHE E 1 123 ? 13.420 35.289 43.110  1.00 169.64 ? 123 PHE E CA   1 
ATOM   5644 C  C    . PHE E 1 123 ? 12.401 36.409 42.987  1.00 177.50 ? 123 PHE E C    1 
ATOM   5645 O  O    . PHE E 1 123 ? 12.630 37.415 42.306  1.00 177.75 ? 123 PHE E O    1 
ATOM   5646 C  CB   . PHE E 1 123 ? 13.247 34.350 41.909  1.00 168.77 ? 123 PHE E CB   1 
ATOM   5647 C  CG   . PHE E 1 123 ? 13.305 35.060 40.580  1.00 167.16 ? 123 PHE E CG   1 
ATOM   5648 C  CD1  . PHE E 1 123 ? 12.220 35.789 40.112  1.00 167.88 ? 123 PHE E CD1  1 
ATOM   5649 C  CD2  . PHE E 1 123 ? 14.469 35.042 39.818  1.00 166.87 ? 123 PHE E CD2  1 
ATOM   5650 C  CE1  . PHE E 1 123 ? 12.296 36.486 38.909  1.00 167.74 ? 123 PHE E CE1  1 
ATOM   5651 C  CE2  . PHE E 1 123 ? 14.544 35.719 38.598  1.00 168.50 ? 123 PHE E CE2  1 
ATOM   5652 C  CZ   . PHE E 1 123 ? 13.457 36.443 38.146  1.00 166.26 ? 123 PHE E CZ   1 
ATOM   5653 N  N    . LEU E 1 124 ? 11.247 36.197 43.602  1.00 172.63 ? 124 LEU E N    1 
ATOM   5654 C  CA   . LEU E 1 124 ? 10.180 37.171 43.523  1.00 171.21 ? 124 LEU E CA   1 
ATOM   5655 C  C    . LEU E 1 124 ? 10.338 38.327 44.506  1.00 170.24 ? 124 LEU E C    1 
ATOM   5656 O  O    . LEU E 1 124 ? 9.792  39.408 44.299  1.00 169.21 ? 124 LEU E O    1 
ATOM   5657 C  CB   . LEU E 1 124 ? 8.819  36.490 43.591  1.00 170.45 ? 124 LEU E CB   1 
ATOM   5658 C  CG   . LEU E 1 124 ? 8.488  35.923 42.208  1.00 172.09 ? 124 LEU E CG   1 
ATOM   5659 C  CD1  . LEU E 1 124 ? 9.461  36.464 41.175  1.00 171.11 ? 124 LEU E CD1  1 
ATOM   5660 C  CD2  . LEU E 1 124 ? 8.506  34.413 42.199  1.00 173.41 ? 124 LEU E CD2  1 
ATOM   5661 N  N    . MET E 1 125 ? 11.146 38.117 45.537  1.00 165.89 ? 125 MET E N    1 
ATOM   5662 C  CA   . MET E 1 125 ? 11.435 39.171 46.493  1.00 165.89 ? 125 MET E CA   1 
ATOM   5663 C  C    . MET E 1 125 ? 12.473 40.071 45.834  1.00 165.89 ? 125 MET E C    1 
ATOM   5664 O  O    . MET E 1 125 ? 12.410 41.295 45.925  1.00 242.38 ? 125 MET E O    1 
ATOM   5665 C  CB   . MET E 1 125 ? 12.024 38.563 47.767  1.00 165.89 ? 125 MET E CB   1 
ATOM   5666 C  CG   . MET E 1 125 ? 10.996 38.025 48.764  1.00 165.89 ? 125 MET E CG   1 
ATOM   5667 S  SD   . MET E 1 125 ? 11.639 37.912 50.472  1.00 165.89 ? 125 MET E SD   1 
ATOM   5668 C  CE   . MET E 1 125 ? 12.686 36.471 50.320  1.00 165.89 ? 125 MET E CE   1 
ATOM   5669 N  N    . SER E 1 126 ? 13.423 39.436 45.155  1.00 163.17 ? 126 SER E N    1 
ATOM   5670 C  CA   . SER E 1 126 ? 14.489 40.139 44.454  1.00 164.22 ? 126 SER E CA   1 
ATOM   5671 C  C    . SER E 1 126 ? 13.901 40.912 43.291  1.00 171.39 ? 126 SER E C    1 
ATOM   5672 O  O    . SER E 1 126 ? 14.256 42.065 43.051  1.00 171.77 ? 126 SER E O    1 
ATOM   5673 C  CB   . SER E 1 126 ? 15.523 39.147 43.925  1.00 168.23 ? 126 SER E CB   1 
ATOM   5674 O  OG   . SER E 1 126 ? 15.088 37.813 44.105  1.00 177.22 ? 126 SER E OG   1 
ATOM   5675 N  N    . VAL E 1 127 ? 13.001 40.256 42.569  1.00 167.18 ? 127 VAL E N    1 
ATOM   5676 C  CA   . VAL E 1 127 ? 12.311 40.851 41.433  1.00 166.46 ? 127 VAL E CA   1 
ATOM   5677 C  C    . VAL E 1 127 ? 11.375 41.954 41.951  1.00 173.34 ? 127 VAL E C    1 
ATOM   5678 O  O    . VAL E 1 127 ? 10.976 42.874 41.219  1.00 173.74 ? 127 VAL E O    1 
ATOM   5679 C  CB   . VAL E 1 127 ? 11.550 39.746 40.670  1.00 168.15 ? 127 VAL E CB   1 
ATOM   5680 C  CG1  . VAL E 1 127 ? 10.332 39.292 41.445  1.00 167.61 ? 127 VAL E CG1  1 
ATOM   5681 C  CG2  . VAL E 1 127 ? 11.176 40.205 39.289  1.00 167.61 ? 127 VAL E CG2  1 
ATOM   5682 N  N    . ALA E 1 128 ? 11.067 41.854 43.242  1.00 171.98 ? 128 ALA E N    1 
ATOM   5683 C  CA   . ALA E 1 128 ? 10.194 42.794 43.935  1.00 172.12 ? 128 ALA E CA   1 
ATOM   5684 C  C    . ALA E 1 128 ? 10.872 44.141 44.108  1.00 178.03 ? 128 ALA E C    1 
ATOM   5685 O  O    . ALA E 1 128 ? 10.605 45.092 43.381  1.00 177.68 ? 128 ALA E O    1 
ATOM   5686 C  CB   . ALA E 1 128 ? 9.813  42.230 45.303  1.00 172.81 ? 128 ALA E CB   1 
ATOM   5687 N  N    . GLY E 1 129 ? 11.742 44.215 45.102  1.00 176.87 ? 129 GLY E N    1 
ATOM   5688 C  CA   . GLY E 1 129 ? 12.455 45.440 45.383  1.00 177.83 ? 129 GLY E CA   1 
ATOM   5689 C  C    . GLY E 1 129 ? 13.090 46.010 44.135  1.00 185.65 ? 129 GLY E C    1 
ATOM   5690 O  O    . GLY E 1 129 ? 13.075 47.220 43.921  1.00 184.71 ? 129 GLY E O    1 
ATOM   5691 N  N    . ILE E 1 130 ? 13.638 45.126 43.309  1.00 188.45 ? 130 ILE E N    1 
ATOM   5692 C  CA   . ILE E 1 130 ? 14.307 45.520 42.078  1.00 187.88 ? 130 ILE E CA   1 
ATOM   5693 C  C    . ILE E 1 130 ? 13.445 46.496 41.290  1.00 179.71 ? 130 ILE E C    1 
ATOM   5694 O  O    . ILE E 1 130 ? 13.925 47.510 40.772  1.00 173.02 ? 130 ILE E O    1 
ATOM   5695 C  CB   . ILE E 1 130 ? 14.675 44.282 41.239  1.00 193.85 ? 130 ILE E CB   1 
ATOM   5696 C  CG1  . ILE E 1 130 ? 16.177 44.005 41.320  1.00 195.09 ? 130 ILE E CG1  1 
ATOM   5697 C  CG2  . ILE E 1 130 ? 14.222 44.456 39.804  1.00 195.44 ? 130 ILE E CG2  1 
ATOM   5698 C  CD1  . ILE E 1 130 ? 16.932 44.384 40.069  1.00 202.52 ? 130 ILE E CD1  1 
ATOM   5699 N  N    . PHE E 1 131 ? 12.158 46.204 41.216  1.00 178.82 ? 131 PHE E N    1 
ATOM   5700 C  CA   . PHE E 1 131 ? 11.276 47.089 40.483  1.00 177.70 ? 131 PHE E CA   1 
ATOM   5701 C  C    . PHE E 1 131 ? 10.811 48.225 41.385  1.00 186.45 ? 131 PHE E C    1 
ATOM   5702 O  O    . PHE E 1 131 ? 10.912 49.397 41.014  1.00 189.52 ? 131 PHE E O    1 
ATOM   5703 C  CB   . PHE E 1 131 ? 10.109 46.316 39.844  1.00 174.47 ? 131 PHE E CB   1 
ATOM   5704 C  CG   . PHE E 1 131 ? 8.822  46.439 40.601  1.00 172.43 ? 131 PHE E CG   1 
ATOM   5705 C  CD1  . PHE E 1 131 ? 8.543  45.582 41.665  1.00 173.28 ? 131 PHE E CD1  1 
ATOM   5706 C  CD2  . PHE E 1 131 ? 7.916  47.453 40.296  1.00 172.43 ? 131 PHE E CD2  1 
ATOM   5707 C  CE1  . PHE E 1 131 ? 7.379  45.729 42.429  1.00 173.30 ? 131 PHE E CE1  1 
ATOM   5708 C  CE2  . PHE E 1 131 ? 6.736  47.607 41.043  1.00 174.08 ? 131 PHE E CE2  1 
ATOM   5709 C  CZ   . PHE E 1 131 ? 6.468  46.740 42.116  1.00 171.98 ? 131 PHE E CZ   1 
ATOM   5710 N  N    . ASN E 1 132 ? 10.349 47.867 42.583  1.00 177.12 ? 132 ASN E N    1 
ATOM   5711 C  CA   . ASN E 1 132 ? 9.855  48.842 43.543  1.00 179.16 ? 132 ASN E CA   1 
ATOM   5712 C  C    . ASN E 1 132 ? 10.848 49.971 43.709  1.00 191.75 ? 132 ASN E C    1 
ATOM   5713 O  O    . ASN E 1 132 ? 10.477 51.087 44.076  1.00 194.37 ? 132 ASN E O    1 
ATOM   5714 C  CB   . ASN E 1 132 ? 9.667  48.210 44.907  1.00 187.93 ? 132 ASN E CB   1 
ATOM   5715 C  CG   . ASN E 1 132 ? 10.225 49.085 46.003  1.00 221.47 ? 132 ASN E CG   1 
ATOM   5716 O  OD1  . ASN E 1 132 ? 11.426 49.055 46.276  1.00 216.72 ? 132 ASN E OD1  1 
ATOM   5717 N  ND2  . ASN E 1 132 ? 9.401  50.007 46.495  1.00 214.26 ? 132 ASN E ND2  1 
ATOM   5718 N  N    . TYR E 1 133 ? 12.123 49.657 43.505  1.00 188.00 ? 133 TYR E N    1 
ATOM   5719 C  CA   . TYR E 1 133 ? 13.166 50.664 43.633  1.00 185.64 ? 133 TYR E CA   1 
ATOM   5720 C  C    . TYR E 1 133 ? 13.012 51.648 42.485  1.00 189.57 ? 133 TYR E C    1 
ATOM   5721 O  O    . TYR E 1 133 ? 13.196 52.858 42.646  1.00 188.81 ? 133 TYR E O    1 
ATOM   5722 C  CB   . TYR E 1 133 ? 14.561 50.037 43.544  1.00 185.49 ? 133 TYR E CB   1 
ATOM   5723 C  CG   . TYR E 1 133 ? 15.599 50.981 42.945  1.00 185.93 ? 133 TYR E CG   1 
ATOM   5724 C  CD1  . TYR E 1 133 ? 15.794 51.061 41.564  1.00 187.56 ? 133 TYR E CD1  1 
ATOM   5725 C  CD2  . TYR E 1 133 ? 16.349 51.827 43.759  1.00 186.43 ? 133 TYR E CD2  1 
ATOM   5726 C  CE1  . TYR E 1 133 ? 16.723 51.944 41.019  1.00 187.77 ? 133 TYR E CE1  1 
ATOM   5727 C  CE2  . TYR E 1 133 ? 17.280 52.708 43.220  1.00 187.11 ? 133 TYR E CE2  1 
ATOM   5728 C  CZ   . TYR E 1 133 ? 17.461 52.761 41.854  1.00 193.24 ? 133 TYR E CZ   1 
ATOM   5729 O  OH   . TYR E 1 133 ? 18.395 53.629 41.337  1.00 193.47 ? 133 TYR E OH   1 
ATOM   5730 N  N    . TYR E 1 134 ? 12.710 51.108 41.311  1.00 187.19 ? 134 TYR E N    1 
ATOM   5731 C  CA   . TYR E 1 134 ? 12.559 51.925 40.124  1.00 188.01 ? 134 TYR E CA   1 
ATOM   5732 C  C    . TYR E 1 134 ? 11.471 52.977 40.306  1.00 191.79 ? 134 TYR E C    1 
ATOM   5733 O  O    . TYR E 1 134 ? 11.502 54.047 39.688  1.00 191.11 ? 134 TYR E O    1 
ATOM   5734 C  CB   . TYR E 1 134 ? 12.318 51.028 38.912  1.00 190.44 ? 134 TYR E CB   1 
ATOM   5735 C  CG   . TYR E 1 134 ? 13.615 50.676 38.228  1.00 194.03 ? 134 TYR E CG   1 
ATOM   5736 C  CD1  . TYR E 1 134 ? 14.760 51.413 38.489  1.00 196.17 ? 134 TYR E CD1  1 
ATOM   5737 C  CD2  . TYR E 1 134 ? 13.705 49.619 37.335  1.00 195.31 ? 134 TYR E CD2  1 
ATOM   5738 C  CE1  . TYR E 1 134 ? 15.956 51.123 37.876  1.00 196.96 ? 134 TYR E CE1  1 
ATOM   5739 C  CE2  . TYR E 1 134 ? 14.904 49.325 36.703  1.00 196.33 ? 134 TYR E CE2  1 
ATOM   5740 C  CZ   . TYR E 1 134 ? 16.029 50.082 36.982  1.00 203.20 ? 134 TYR E CZ   1 
ATOM   5741 O  OH   . TYR E 1 134 ? 17.240 49.813 36.378  1.00 203.88 ? 134 TYR E OH   1 
ATOM   5742 N  N    . LEU E 1 135 ? 10.539 52.684 41.205  1.00 190.44 ? 135 LEU E N    1 
ATOM   5743 C  CA   . LEU E 1 135 ? 9.450  53.601 41.504  1.00 190.54 ? 135 LEU E CA   1 
ATOM   5744 C  C    . LEU E 1 135 ? 9.953  54.688 42.445  1.00 194.47 ? 135 LEU E C    1 
ATOM   5745 O  O    . LEU E 1 135 ? 9.818  55.875 42.163  1.00 193.38 ? 135 LEU E O    1 
ATOM   5746 C  CB   . LEU E 1 135 ? 8.270  52.845 42.113  1.00 190.67 ? 135 LEU E CB   1 
ATOM   5747 C  CG   . LEU E 1 135 ? 8.004  51.454 41.524  1.00 195.26 ? 135 LEU E CG   1 
ATOM   5748 C  CD1  . LEU E 1 135 ? 6.545  51.098 41.672  1.00 195.37 ? 135 LEU E CD1  1 
ATOM   5749 C  CD2  . LEU E 1 135 ? 8.430  51.342 40.065  1.00 197.67 ? 135 LEU E CD2  1 
ATOM   5750 N  N    . ILE E 1 136 ? 10.578 54.269 43.539  1.00 193.61 ? 136 ILE E N    1 
ATOM   5751 C  CA   . ILE E 1 136 ? 11.152 55.194 44.505  1.00 193.68 ? 136 ILE E CA   1 
ATOM   5752 C  C    . ILE E 1 136 ? 12.102 56.174 43.809  1.00 204.10 ? 136 ILE E C    1 
ATOM   5753 O  O    . ILE E 1 136 ? 12.289 57.311 44.260  1.00 204.61 ? 136 ILE E O    1 
ATOM   5754 C  CB   . ILE E 1 136 ? 11.861 54.422 45.631  1.00 194.50 ? 136 ILE E CB   1 
ATOM   5755 C  CG1  . ILE E 1 136 ? 10.899 53.411 46.268  1.00 193.76 ? 136 ILE E CG1  1 
ATOM   5756 C  CG2  . ILE E 1 136 ? 12.441 55.384 46.662  1.00 194.38 ? 136 ILE E CG2  1 
ATOM   5757 C  CD1  . ILE E 1 136 ? 11.514 52.041 46.490  1.00 199.65 ? 136 ILE E CD1  1 
ATOM   5758 N  N    . PHE E 1 137 ? 12.702 55.731 42.707  1.00 202.52 ? 137 PHE E N    1 
ATOM   5759 C  CA   . PHE E 1 137 ? 13.601 56.600 41.951  1.00 205.51 ? 137 PHE E CA   1 
ATOM   5760 C  C    . PHE E 1 137 ? 12.779 57.470 41.011  1.00 209.24 ? 137 PHE E C    1 
ATOM   5761 O  O    . PHE E 1 137 ? 13.089 58.645 40.781  1.00 208.47 ? 137 PHE E O    1 
ATOM   5762 C  CB   . PHE E 1 137 ? 14.577 55.800 41.090  1.00 210.88 ? 137 PHE E CB   1 
ATOM   5763 C  CG   . PHE E 1 137 ? 14.885 56.469 39.778  1.00 217.19 ? 137 PHE E CG   1 
ATOM   5764 C  CD1  . PHE E 1 137 ? 15.631 57.641 39.746  1.00 223.65 ? 137 PHE E CD1  1 
ATOM   5765 C  CD2  . PHE E 1 137 ? 14.328 56.004 38.598  1.00 222.77 ? 137 PHE E CD2  1 
ATOM   5766 C  CE1  . PHE E 1 137 ? 15.880 58.293 38.552  1.00 225.86 ? 137 PHE E CE1  1 
ATOM   5767 C  CE2  . PHE E 1 137 ? 14.576 56.650 37.397  1.00 227.03 ? 137 PHE E CE2  1 
ATOM   5768 C  CZ   . PHE E 1 137 ? 15.353 57.797 37.376  1.00 225.49 ? 137 PHE E CZ   1 
ATOM   5769 N  N    . PHE E 1 138 ? 11.762 56.839 40.434  1.00 215.13 ? 138 PHE E N    1 
ATOM   5770 C  CA   . PHE E 1 138 ? 10.882 57.459 39.463  1.00 213.79 ? 138 PHE E CA   1 
ATOM   5771 C  C    . PHE E 1 138 ? 9.870  58.412 40.093  1.00 193.47 ? 138 PHE E C    1 
ATOM   5772 O  O    . PHE E 1 138 ? 9.774  59.575 39.691  1.00 190.03 ? 138 PHE E O    1 
ATOM   5773 C  CB   . PHE E 1 138 ? 10.154 56.364 38.681  1.00 219.86 ? 138 PHE E CB   1 
ATOM   5774 C  CG   . PHE E 1 138 ? 10.338 56.453 37.196  1.00 223.13 ? 138 PHE E CG   1 
ATOM   5775 C  CD1  . PHE E 1 138 ? 11.437 57.096 36.657  1.00 225.88 ? 138 PHE E CD1  1 
ATOM   5776 C  CD2  . PHE E 1 138 ? 9.400  55.901 36.335  1.00 224.61 ? 138 PHE E CD2  1 
ATOM   5777 C  CE1  . PHE E 1 138 ? 11.601 57.189 35.282  1.00 226.09 ? 138 PHE E CE1  1 
ATOM   5778 C  CE2  . PHE E 1 138 ? 9.550  55.993 34.962  1.00 226.59 ? 138 PHE E CE2  1 
ATOM   5779 C  CZ   . PHE E 1 138 ? 10.654 56.635 34.433  1.00 224.45 ? 138 PHE E CZ   1 
ATOM   5780 N  N    . PHE E 1 139 ? 9.103  57.902 41.059  1.00 198.13 ? 139 PHE E N    1 
ATOM   5781 C  CA   . PHE E 1 139 ? 8.047  58.678 41.724  1.00 190.29 ? 139 PHE E CA   1 
ATOM   5782 C  C    . PHE E 1 139 ? 7.936  58.448 43.235  1.00 207.91 ? 139 PHE E C    1 
ATOM   5783 O  O    . PHE E 1 139 ? 7.275  57.506 43.696  1.00 207.63 ? 139 PHE E O    1 
ATOM   5784 C  CB   . PHE E 1 139 ? 6.678  58.443 41.063  1.00 184.01 ? 139 PHE E CB   1 
ATOM   5785 C  CG   . PHE E 1 139 ? 6.714  57.480 39.904  1.00 181.10 ? 139 PHE E CG   1 
ATOM   5786 C  CD1  . PHE E 1 139 ? 6.262  57.870 38.644  1.00 181.85 ? 139 PHE E CD1  1 
ATOM   5787 C  CD2  . PHE E 1 139 ? 7.184  56.178 40.076  1.00 181.00 ? 139 PHE E CD2  1 
ATOM   5788 C  CE1  . PHE E 1 139 ? 6.299  56.985 37.568  1.00 181.87 ? 139 PHE E CE1  1 
ATOM   5789 C  CE2  . PHE E 1 139 ? 7.240  55.289 39.005  1.00 182.65 ? 139 PHE E CE2  1 
ATOM   5790 C  CZ   . PHE E 1 139 ? 6.785  55.689 37.750  1.00 180.55 ? 139 PHE E CZ   1 
ATOM   5791 N  N    . GLY E 1 140 ? 8.544  59.353 43.995  1.00 205.26 ? 140 GLY E N    1 
ATOM   5792 C  CA   . GLY E 1 140 ? 8.531  59.308 45.444  1.00 214.25 ? 140 GLY E CA   1 
ATOM   5793 C  C    . GLY E 1 140 ? 9.467  60.344 46.036  1.00 244.65 ? 140 GLY E C    1 
ATOM   5794 O  O    . GLY E 1 140 ? 9.061  61.467 46.328  1.00 249.48 ? 140 GLY E O    1 
ATOM   5795 N  N    . MET F 1 1   ? 17.384 48.160 52.267  1.00 185.54 ? 1   MET F N    1 
ATOM   5796 C  CA   . MET F 1 1   ? 18.618 48.566 51.606  1.00 185.54 ? 1   MET F CA   1 
ATOM   5797 C  C    . MET F 1 1   ? 18.601 50.026 51.144  1.00 185.54 ? 1   MET F C    1 
ATOM   5798 O  O    . MET F 1 1   ? 17.620 50.492 50.561  1.00 294.13 ? 1   MET F O    1 
ATOM   5799 C  CB   . MET F 1 1   ? 18.914 47.644 50.425  1.00 185.54 ? 1   MET F CB   1 
ATOM   5800 C  CG   . MET F 1 1   ? 20.305 47.014 50.467  1.00 185.54 ? 1   MET F CG   1 
ATOM   5801 S  SD   . MET F 1 1   ? 21.455 47.801 49.295  1.00 185.54 ? 1   MET F SD   1 
ATOM   5802 C  CE   . MET F 1 1   ? 21.397 46.626 47.907  1.00 185.54 ? 1   MET F CE   1 
ATOM   5803 N  N    . ASP F 1 2   ? 19.708 50.726 51.397  1.00 186.35 ? 2   ASP F N    1 
ATOM   5804 C  CA   . ASP F 1 2   ? 19.882 52.142 51.047  1.00 189.82 ? 2   ASP F CA   1 
ATOM   5805 C  C    . ASP F 1 2   ? 19.621 52.449 49.571  1.00 187.89 ? 2   ASP F C    1 
ATOM   5806 O  O    . ASP F 1 2   ? 20.438 52.124 48.713  1.00 186.11 ? 2   ASP F O    1 
ATOM   5807 C  CB   . ASP F 1 2   ? 21.294 52.606 51.433  1.00 197.24 ? 2   ASP F CB   1 
ATOM   5808 C  CG   . ASP F 1 2   ? 22.161 51.471 51.988  1.00 242.59 ? 2   ASP F CG   1 
ATOM   5809 O  OD1  . ASP F 1 2   ? 21.730 50.773 52.936  1.00 248.08 ? 2   ASP F OD1  1 
ATOM   5810 O  OD2  . ASP F 1 2   ? 23.295 51.295 51.492  1.00 253.45 ? 2   ASP F OD2  1 
ATOM   5811 N  N    . GLN F 1 3   ? 18.491 53.091 49.288  1.00 185.50 ? 3   GLN F N    1 
ATOM   5812 C  CA   . GLN F 1 3   ? 18.093 53.420 47.919  1.00 184.67 ? 3   GLN F CA   1 
ATOM   5813 C  C    . GLN F 1 3   ? 19.219 53.900 47.008  1.00 186.37 ? 3   GLN F C    1 
ATOM   5814 O  O    . GLN F 1 3   ? 19.242 53.574 45.820  1.00 185.96 ? 3   GLN F O    1 
ATOM   5815 C  CB   . GLN F 1 3   ? 16.941 54.427 47.905  1.00 185.77 ? 3   GLN F CB   1 
ATOM   5816 C  CG   . GLN F 1 3   ? 16.831 55.243 46.615  1.00 189.01 ? 3   GLN F CG   1 
ATOM   5817 C  CD   . GLN F 1 3   ? 15.871 54.628 45.610  1.00 196.45 ? 3   GLN F CD   1 
ATOM   5818 O  OE1  . GLN F 1 3   ? 15.291 53.563 45.854  1.00 190.21 ? 3   GLN F OE1  1 
ATOM   5819 N  NE2  . GLN F 1 3   ? 15.702 55.293 44.469  1.00 186.86 ? 3   GLN F NE2  1 
ATOM   5820 N  N    . GLU F 1 4   ? 20.148 54.678 47.549  1.00 181.26 ? 4   GLU F N    1 
ATOM   5821 C  CA   . GLU F 1 4   ? 21.252 55.155 46.727  1.00 181.09 ? 4   GLU F CA   1 
ATOM   5822 C  C    . GLU F 1 4   ? 21.976 53.949 46.167  1.00 177.19 ? 4   GLU F C    1 
ATOM   5823 O  O    . GLU F 1 4   ? 22.045 53.751 44.950  1.00 174.56 ? 4   GLU F O    1 
ATOM   5824 C  CB   . GLU F 1 4   ? 22.253 55.955 47.563  1.00 183.98 ? 4   GLU F CB   1 
ATOM   5825 C  CG   . GLU F 1 4   ? 23.674 55.997 46.951  1.00 203.27 ? 4   GLU F CG   1 
ATOM   5826 C  CD   . GLU F 1 4   ? 24.729 55.220 47.758  1.00 240.82 ? 4   GLU F CD   1 
ATOM   5827 O  OE1  . GLU F 1 4   ? 24.455 54.838 48.919  1.00 239.62 ? 4   GLU F OE1  1 
ATOM   5828 O  OE2  . GLU F 1 4   ? 25.847 55.003 47.232  1.00 239.37 ? 4   GLU F OE2  1 
ATOM   5829 N  N    . THR F 1 5   ? 22.514 53.158 47.096  1.00 172.74 ? 5   THR F N    1 
ATOM   5830 C  CA   . THR F 1 5   ? 23.301 51.961 46.806  1.00 170.41 ? 5   THR F CA   1 
ATOM   5831 C  C    . THR F 1 5   ? 22.588 50.965 45.904  1.00 170.21 ? 5   THR F C    1 
ATOM   5832 O  O    . THR F 1 5   ? 23.168 50.482 44.929  1.00 170.21 ? 5   THR F O    1 
ATOM   5833 C  CB   . THR F 1 5   ? 23.826 51.302 48.104  1.00 158.27 ? 5   THR F CB   1 
ATOM   5834 O  OG1  . THR F 1 5   ? 22.771 51.235 49.075  1.00 153.24 ? 5   THR F OG1  1 
ATOM   5835 C  CG2  . THR F 1 5   ? 25.001 52.105 48.678  1.00 152.26 ? 5   THR F CG2  1 
ATOM   5836 N  N    . VAL F 1 6   ? 21.343 50.651 46.252  1.00 169.82 ? 6   VAL F N    1 
ATOM   5837 C  CA   . VAL F 1 6   ? 20.512 49.745 45.469  1.00 165.63 ? 6   VAL F CA   1 
ATOM   5838 C  C    . VAL F 1 6   ? 20.620 50.200 44.027  1.00 169.28 ? 6   VAL F C    1 
ATOM   5839 O  O    . VAL F 1 6   ? 20.642 49.394 43.101  1.00 168.73 ? 6   VAL F O    1 
ATOM   5840 C  CB   . VAL F 1 6   ? 19.031 49.846 45.911  1.00 164.66 ? 6   VAL F CB   1 
ATOM   5841 C  CG1  . VAL F 1 6   ? 18.260 48.581 45.543  1.00 163.68 ? 6   VAL F CG1  1 
ATOM   5842 C  CG2  . VAL F 1 6   ? 18.910 50.178 47.398  1.00 163.70 ? 6   VAL F CG2  1 
ATOM   5843 N  N    . GLY F 1 7   ? 20.698 51.516 43.863  1.00 166.20 ? 7   GLY F N    1 
ATOM   5844 C  CA   . GLY F 1 7   ? 20.802 52.144 42.565  1.00 166.29 ? 7   GLY F CA   1 
ATOM   5845 C  C    . GLY F 1 7   ? 22.021 51.688 41.788  1.00 171.01 ? 7   GLY F C    1 
ATOM   5846 O  O    . GLY F 1 7   ? 21.905 51.311 40.617  1.00 170.83 ? 7   GLY F O    1 
ATOM   5847 N  N    . ASN F 1 8   ? 23.189 51.719 42.435  1.00 165.99 ? 8   ASN F N    1 
ATOM   5848 C  CA   . ASN F 1 8   ? 24.452 51.336 41.786  1.00 164.60 ? 8   ASN F CA   1 
ATOM   5849 C  C    . ASN F 1 8   ? 24.784 49.834 41.840  1.00 163.57 ? 8   ASN F C    1 
ATOM   5850 O  O    . ASN F 1 8   ? 25.944 49.448 41.997  1.00 162.18 ? 8   ASN F O    1 
ATOM   5851 C  CB   . ASN F 1 8   ? 25.625 52.184 42.307  1.00 165.71 ? 8   ASN F CB   1 
ATOM   5852 C  CG   . ASN F 1 8   ? 25.300 52.900 43.610  1.00 186.62 ? 8   ASN F CG   1 
ATOM   5853 O  OD1  . ASN F 1 8   ? 25.833 52.552 44.669  1.00 180.63 ? 8   ASN F OD1  1 
ATOM   5854 N  ND2  . ASN F 1 8   ? 24.426 53.908 43.539  1.00 178.17 ? 8   ASN F ND2  1 
ATOM   5855 N  N    . VAL F 1 9   ? 23.761 48.999 41.668  1.00 157.06 ? 9   VAL F N    1 
ATOM   5856 C  CA   . VAL F 1 9   ? 23.917 47.547 41.701  1.00 152.85 ? 9   VAL F CA   1 
ATOM   5857 C  C    . VAL F 1 9   ? 22.758 46.902 40.954  1.00 162.64 ? 9   VAL F C    1 
ATOM   5858 O  O    . VAL F 1 9   ? 22.849 45.765 40.492  1.00 163.44 ? 9   VAL F O    1 
ATOM   5859 C  CB   . VAL F 1 9   ? 23.916 47.043 43.148  1.00 147.09 ? 9   VAL F CB   1 
ATOM   5860 C  CG1  . VAL F 1 9   ? 22.895 47.817 43.977  1.00 145.27 ? 9   VAL F CG1  1 
ATOM   5861 C  CG2  . VAL F 1 9   ? 23.588 45.575 43.172  1.00 145.26 ? 9   VAL F CG2  1 
ATOM   5862 N  N    . VAL F 1 10  ? 21.653 47.636 40.891  1.00 156.10 ? 10  VAL F N    1 
ATOM   5863 C  CA   . VAL F 1 10  ? 20.426 47.184 40.249  1.00 156.60 ? 10  VAL F CA   1 
ATOM   5864 C  C    . VAL F 1 10  ? 20.685 46.460 38.938  1.00 155.34 ? 10  VAL F C    1 
ATOM   5865 O  O    . VAL F 1 10  ? 19.928 45.572 38.560  1.00 154.05 ? 10  VAL F O    1 
ATOM   5866 C  CB   . VAL F 1 10  ? 19.430 48.359 40.053  1.00 164.13 ? 10  VAL F CB   1 
ATOM   5867 C  CG1  . VAL F 1 10  ? 18.548 48.123 38.835  1.00 164.53 ? 10  VAL F CG1  1 
ATOM   5868 C  CG2  . VAL F 1 10  ? 18.587 48.570 41.311  1.00 164.54 ? 10  VAL F CG2  1 
ATOM   5869 N  N    . LEU F 1 11  ? 21.758 46.837 38.249  1.00 150.72 ? 11  LEU F N    1 
ATOM   5870 C  CA   . LEU F 1 11  ? 22.086 46.226 36.966  1.00 149.44 ? 11  LEU F CA   1 
ATOM   5871 C  C    . LEU F 1 11  ? 22.711 44.857 37.129  1.00 150.71 ? 11  LEU F C    1 
ATOM   5872 O  O    . LEU F 1 11  ? 22.393 43.926 36.387  1.00 150.05 ? 11  LEU F O    1 
ATOM   5873 C  CB   . LEU F 1 11  ? 22.977 47.145 36.142  1.00 149.10 ? 11  LEU F CB   1 
ATOM   5874 C  CG   . LEU F 1 11  ? 22.222 48.444 35.866  1.00 152.70 ? 11  LEU F CG   1 
ATOM   5875 C  CD1  . LEU F 1 11  ? 20.715 48.162 35.846  1.00 152.48 ? 11  LEU F CD1  1 
ATOM   5876 C  CD2  . LEU F 1 11  ? 22.544 49.467 36.942  1.00 154.77 ? 11  LEU F CD2  1 
ATOM   5877 N  N    . LEU F 1 12  ? 23.589 44.744 38.120  1.00 147.06 ? 12  LEU F N    1 
ATOM   5878 C  CA   . LEU F 1 12  ? 24.248 43.486 38.447  1.00 145.99 ? 12  LEU F CA   1 
ATOM   5879 C  C    . LEU F 1 12  ? 23.204 42.499 38.948  1.00 149.16 ? 12  LEU F C    1 
ATOM   5880 O  O    . LEU F 1 12  ? 23.273 41.300 38.670  1.00 148.20 ? 12  LEU F O    1 
ATOM   5881 C  CB   . LEU F 1 12  ? 25.265 43.714 39.568  1.00 145.78 ? 12  LEU F CB   1 
ATOM   5882 C  CG   . LEU F 1 12  ? 26.439 44.627 39.242  1.00 150.16 ? 12  LEU F CG   1 
ATOM   5883 C  CD1  . LEU F 1 12  ? 27.676 44.081 39.918  1.00 150.24 ? 12  LEU F CD1  1 
ATOM   5884 C  CD2  . LEU F 1 12  ? 26.631 44.717 37.728  1.00 152.54 ? 12  LEU F CD2  1 
ATOM   5885 N  N    . ALA F 1 13  ? 22.257 43.003 39.731  1.00 144.52 ? 13  ALA F N    1 
ATOM   5886 C  CA   . ALA F 1 13  ? 21.215 42.145 40.259  1.00 144.67 ? 13  ALA F CA   1 
ATOM   5887 C  C    . ALA F 1 13  ? 20.337 41.694 39.103  1.00 142.23 ? 13  ALA F C    1 
ATOM   5888 O  O    . ALA F 1 13  ? 20.053 40.509 38.962  1.00 140.00 ? 13  ALA F O    1 
ATOM   5889 C  CB   . ALA F 1 13  ? 20.406 42.857 41.315  1.00 146.19 ? 13  ALA F CB   1 
ATOM   5890 N  N    . ILE F 1 14  ? 19.947 42.640 38.253  1.00 136.81 ? 14  ILE F N    1 
ATOM   5891 C  CA   . ILE F 1 14  ? 19.119 42.342 37.082  1.00 135.64 ? 14  ILE F CA   1 
ATOM   5892 C  C    . ILE F 1 14  ? 19.758 41.223 36.293  1.00 141.20 ? 14  ILE F C    1 
ATOM   5893 O  O    . ILE F 1 14  ? 19.192 40.145 36.174  1.00 141.86 ? 14  ILE F O    1 
ATOM   5894 C  CB   . ILE F 1 14  ? 18.906 43.600 36.188  1.00 136.67 ? 14  ILE F CB   1 
ATOM   5895 C  CG1  . ILE F 1 14  ? 17.496 44.167 36.384  1.00 136.01 ? 14  ILE F CG1  1 
ATOM   5896 C  CG2  . ILE F 1 14  ? 19.181 43.297 34.705  1.00 136.57 ? 14  ILE F CG2  1 
ATOM   5897 C  CD1  . ILE F 1 14  ? 17.451 45.424 37.236  1.00 142.01 ? 14  ILE F CD1  1 
ATOM   5898 N  N    . VAL F 1 15  ? 20.950 41.499 35.772  1.00 136.30 ? 15  VAL F N    1 
ATOM   5899 C  CA   . VAL F 1 15  ? 21.716 40.535 34.993  1.00 134.73 ? 15  VAL F CA   1 
ATOM   5900 C  C    . VAL F 1 15  ? 21.793 39.216 35.749  1.00 143.06 ? 15  VAL F C    1 
ATOM   5901 O  O    . VAL F 1 15  ? 21.626 38.138 35.171  1.00 142.91 ? 15  VAL F O    1 
ATOM   5902 C  CB   . VAL F 1 15  ? 23.151 41.066 34.700  1.00 135.42 ? 15  VAL F CB   1 
ATOM   5903 C  CG1  . VAL F 1 15  ? 24.190 40.337 35.579  1.00 134.73 ? 15  VAL F CG1  1 
ATOM   5904 C  CG2  . VAL F 1 15  ? 23.493 40.923 33.206  1.00 134.73 ? 15  VAL F CG2  1 
ATOM   5905 N  N    . THR F 1 16  ? 22.062 39.306 37.045  1.00 138.66 ? 16  THR F N    1 
ATOM   5906 C  CA   . THR F 1 16  ? 22.180 38.110 37.855  1.00 138.45 ? 16  THR F CA   1 
ATOM   5907 C  C    . THR F 1 16  ? 20.867 37.345 37.955  1.00 141.96 ? 16  THR F C    1 
ATOM   5908 O  O    . THR F 1 16  ? 20.832 36.127 37.772  1.00 142.02 ? 16  THR F O    1 
ATOM   5909 C  CB   . THR F 1 16  ? 22.789 38.406 39.220  1.00 138.62 ? 16  THR F CB   1 
ATOM   5910 O  OG1  . THR F 1 16  ? 24.169 38.764 39.053  1.00 136.37 ? 16  THR F OG1  1 
ATOM   5911 C  CG2  . THR F 1 16  ? 22.678 37.175 40.114  1.00 135.40 ? 16  THR F CG2  1 
ATOM   5912 N  N    . LEU F 1 17  ? 19.783 38.066 38.217  1.00 142.92 ? 17  LEU F N    1 
ATOM   5913 C  CA   . LEU F 1 17  ? 18.458 37.451 38.309  1.00 142.62 ? 17  LEU F CA   1 
ATOM   5914 C  C    . LEU F 1 17  ? 18.088 36.822 36.954  1.00 142.68 ? 17  LEU F C    1 
ATOM   5915 O  O    . LEU F 1 17  ? 17.322 35.848 36.869  1.00 140.26 ? 17  LEU F O    1 
ATOM   5916 C  CB   . LEU F 1 17  ? 17.417 38.504 38.735  1.00 144.43 ? 17  LEU F CB   1 
ATOM   5917 C  CG   . LEU F 1 17  ? 17.150 38.689 40.244  1.00 153.06 ? 17  LEU F CG   1 
ATOM   5918 C  CD1  . LEU F 1 17  ? 17.804 37.598 41.106  1.00 154.56 ? 17  LEU F CD1  1 
ATOM   5919 C  CD2  . LEU F 1 17  ? 17.538 40.086 40.739  1.00 156.85 ? 17  LEU F CD2  1 
ATOM   5920 N  N    . ILE F 1 18  ? 18.664 37.399 35.902  1.00 141.15 ? 18  ILE F N    1 
ATOM   5921 C  CA   . ILE F 1 18  ? 18.484 36.942 34.529  1.00 143.02 ? 18  ILE F CA   1 
ATOM   5922 C  C    . ILE F 1 18  ? 19.130 35.571 34.442  1.00 147.86 ? 18  ILE F C    1 
ATOM   5923 O  O    . ILE F 1 18  ? 18.453 34.557 34.270  1.00 147.17 ? 18  ILE F O    1 
ATOM   5924 C  CB   . ILE F 1 18  ? 19.154 37.942 33.542  1.00 147.24 ? 18  ILE F CB   1 
ATOM   5925 C  CG1  . ILE F 1 18  ? 18.118 38.897 32.954  1.00 148.12 ? 18  ILE F CG1  1 
ATOM   5926 C  CG2  . ILE F 1 18  ? 19.960 37.228 32.470  1.00 148.35 ? 18  ILE F CG2  1 
ATOM   5927 C  CD1  . ILE F 1 18  ? 17.345 39.674 34.015  1.00 155.94 ? 18  ILE F CD1  1 
ATOM   5928 N  N    . SER F 1 19  ? 20.444 35.559 34.624  1.00 147.08 ? 19  SER F N    1 
ATOM   5929 C  CA   . SER F 1 19  ? 21.239 34.344 34.586  1.00 147.66 ? 19  SER F CA   1 
ATOM   5930 C  C    . SER F 1 19  ? 20.730 33.293 35.569  1.00 152.52 ? 19  SER F C    1 
ATOM   5931 O  O    . SER F 1 19  ? 20.925 32.095 35.357  1.00 151.57 ? 19  SER F O    1 
ATOM   5932 C  CB   . SER F 1 19  ? 22.692 34.677 34.904  1.00 151.86 ? 19  SER F CB   1 
ATOM   5933 O  OG   . SER F 1 19  ? 22.813 35.137 36.240  1.00 161.30 ? 19  SER F OG   1 
ATOM   5934 N  N    . VAL F 1 20  ? 20.100 33.735 36.653  1.00 151.88 ? 20  VAL F N    1 
ATOM   5935 C  CA   . VAL F 1 20  ? 19.569 32.795 37.625  1.00 152.45 ? 20  VAL F CA   1 
ATOM   5936 C  C    . VAL F 1 20  ? 18.369 32.078 37.020  1.00 153.33 ? 20  VAL F C    1 
ATOM   5937 O  O    . VAL F 1 20  ? 18.153 30.888 37.259  1.00 151.68 ? 20  VAL F O    1 
ATOM   5938 C  CB   . VAL F 1 20  ? 19.182 33.484 38.917  1.00 158.15 ? 20  VAL F CB   1 
ATOM   5939 C  CG1  . VAL F 1 20  ? 17.735 33.937 38.844  1.00 158.22 ? 20  VAL F CG1  1 
ATOM   5940 C  CG2  . VAL F 1 20  ? 19.389 32.533 40.084  1.00 158.24 ? 20  VAL F CG2  1 
ATOM   5941 N  N    . VAL F 1 21  ? 17.609 32.822 36.220  1.00 153.51 ? 21  VAL F N    1 
ATOM   5942 C  CA   . VAL F 1 21  ? 16.429 32.333 35.513  1.00 155.51 ? 21  VAL F CA   1 
ATOM   5943 C  C    . VAL F 1 21  ? 16.808 31.401 34.355  1.00 154.07 ? 21  VAL F C    1 
ATOM   5944 O  O    . VAL F 1 21  ? 16.244 30.320 34.197  1.00 152.49 ? 21  VAL F O    1 
ATOM   5945 C  CB   . VAL F 1 21  ? 15.649 33.540 34.991  1.00 165.17 ? 21  VAL F CB   1 
ATOM   5946 C  CG1  . VAL F 1 21  ? 15.506 33.485 33.471  1.00 165.92 ? 21  VAL F CG1  1 
ATOM   5947 C  CG2  . VAL F 1 21  ? 14.325 33.670 35.713  1.00 165.95 ? 21  VAL F CG2  1 
ATOM   5948 N  N    . GLN F 1 22  ? 17.761 31.842 33.541  1.00 154.84 ? 22  GLN F N    1 
ATOM   5949 C  CA   . GLN F 1 22  ? 18.257 31.042 32.432  1.00 155.49 ? 22  GLN F CA   1 
ATOM   5950 C  C    . GLN F 1 22  ? 18.902 29.778 32.991  1.00 161.22 ? 22  GLN F C    1 
ATOM   5951 O  O    . GLN F 1 22  ? 18.912 28.737 32.343  1.00 159.69 ? 22  GLN F O    1 
ATOM   5952 C  CB   . GLN F 1 22  ? 19.283 31.833 31.629  1.00 157.19 ? 22  GLN F CB   1 
ATOM   5953 C  CG   . GLN F 1 22  ? 20.683 31.260 31.684  1.00 176.08 ? 22  GLN F CG   1 
ATOM   5954 C  CD   . GLN F 1 22  ? 21.459 31.538 30.414  1.00 197.88 ? 22  GLN F CD   1 
ATOM   5955 O  OE1  . GLN F 1 22  ? 22.687 31.486 30.404  1.00 193.77 ? 22  GLN F OE1  1 
ATOM   5956 N  NE2  . GLN F 1 22  ? 20.744 31.860 29.336  1.00 190.42 ? 22  GLN F NE2  1 
ATOM   5957 N  N    . ASN F 1 23  ? 19.419 29.873 34.210  1.00 159.32 ? 23  ASN F N    1 
ATOM   5958 C  CA   . ASN F 1 23  ? 20.024 28.729 34.874  1.00 161.15 ? 23  ASN F CA   1 
ATOM   5959 C  C    . ASN F 1 23  ? 18.996 27.648 35.169  1.00 168.85 ? 23  ASN F C    1 
ATOM   5960 O  O    . ASN F 1 23  ? 19.230 26.472 34.894  1.00 168.12 ? 23  ASN F O    1 
ATOM   5961 C  CB   . ASN F 1 23  ? 20.713 29.156 36.160  1.00 161.88 ? 23  ASN F CB   1 
ATOM   5962 C  CG   . ASN F 1 23  ? 22.176 29.410 35.952  1.00 181.46 ? 23  ASN F CG   1 
ATOM   5963 O  OD1  . ASN F 1 23  ? 22.555 30.459 35.428  1.00 175.28 ? 23  ASN F OD1  1 
ATOM   5964 N  ND2  . ASN F 1 23  ? 22.996 28.386 36.194  1.00 172.83 ? 23  ASN F ND2  1 
ATOM   5965 N  N    . GLY F 1 24  ? 17.856 28.045 35.722  1.00 165.94 ? 24  GLY F N    1 
ATOM   5966 C  CA   . GLY F 1 24  ? 16.790 27.106 36.013  1.00 167.60 ? 24  GLY F CA   1 
ATOM   5967 C  C    . GLY F 1 24  ? 16.269 26.421 34.756  1.00 175.70 ? 24  GLY F C    1 
ATOM   5968 O  O    . GLY F 1 24  ? 15.686 25.335 34.816  1.00 175.49 ? 24  GLY F O    1 
ATOM   5969 N  N    . PHE F 1 25  ? 16.474 27.052 33.606  1.00 173.99 ? 25  PHE F N    1 
ATOM   5970 C  CA   . PHE F 1 25  ? 16.018 26.464 32.357  1.00 177.80 ? 25  PHE F CA   1 
ATOM   5971 C  C    . PHE F 1 25  ? 16.964 25.355 31.932  1.00 174.25 ? 25  PHE F C    1 
ATOM   5972 O  O    . PHE F 1 25  ? 16.530 24.266 31.583  1.00 171.55 ? 25  PHE F O    1 
ATOM   5973 C  CB   . PHE F 1 25  ? 15.881 27.520 31.265  1.00 186.23 ? 25  PHE F CB   1 
ATOM   5974 C  CG   . PHE F 1 25  ? 16.022 26.977 29.877  1.00 196.24 ? 25  PHE F CG   1 
ATOM   5975 C  CD1  . PHE F 1 25  ? 15.416 25.783 29.517  1.00 205.20 ? 25  PHE F CD1  1 
ATOM   5976 C  CD2  . PHE F 1 25  ? 16.757 27.667 28.928  1.00 204.45 ? 25  PHE F CD2  1 
ATOM   5977 C  CE1  . PHE F 1 25  ? 15.577 25.268 28.255  1.00 208.42 ? 25  PHE F CE1  1 
ATOM   5978 C  CE2  . PHE F 1 25  ? 16.907 27.169 27.660  1.00 209.84 ? 25  PHE F CE2  1 
ATOM   5979 C  CZ   . PHE F 1 25  ? 16.316 25.966 27.319  1.00 208.57 ? 25  PHE F CZ   1 
ATOM   5980 N  N    . PHE F 1 26  ? 18.254 25.649 31.929  1.00 173.66 ? 26  PHE F N    1 
ATOM   5981 C  CA   . PHE F 1 26  ? 19.244 24.659 31.563  1.00 174.43 ? 26  PHE F CA   1 
ATOM   5982 C  C    . PHE F 1 26  ? 19.016 23.452 32.458  1.00 177.79 ? 26  PHE F C    1 
ATOM   5983 O  O    . PHE F 1 26  ? 19.139 22.311 32.023  1.00 177.08 ? 26  PHE F O    1 
ATOM   5984 C  CB   . PHE F 1 26  ? 20.652 25.238 31.740  1.00 176.90 ? 26  PHE F CB   1 
ATOM   5985 C  CG   . PHE F 1 26  ? 20.957 26.382 30.806  1.00 179.16 ? 26  PHE F CG   1 
ATOM   5986 C  CD1  . PHE F 1 26  ? 20.137 26.644 29.717  1.00 182.66 ? 26  PHE F CD1  1 
ATOM   5987 C  CD2  . PHE F 1 26  ? 22.060 27.190 31.010  1.00 181.67 ? 26  PHE F CD2  1 
ATOM   5988 C  CE1  . PHE F 1 26  ? 20.416 27.682 28.844  1.00 183.66 ? 26  PHE F CE1  1 
ATOM   5989 C  CE2  . PHE F 1 26  ? 22.343 28.233 30.140  1.00 184.58 ? 26  PHE F CE2  1 
ATOM   5990 C  CZ   . PHE F 1 26  ? 21.519 28.476 29.055  1.00 182.69 ? 26  PHE F CZ   1 
ATOM   5991 N  N    . ALA F 1 27  ? 18.587 23.725 33.686  1.00 175.74 ? 27  ALA F N    1 
ATOM   5992 C  CA   . ALA F 1 27  ? 18.297 22.691 34.677  1.00 176.27 ? 27  ALA F CA   1 
ATOM   5993 C  C    . ALA F 1 27  ? 16.932 22.057 34.423  1.00 183.08 ? 27  ALA F C    1 
ATOM   5994 O  O    . ALA F 1 27  ? 16.552 21.078 35.077  1.00 182.66 ? 27  ALA F O    1 
ATOM   5995 C  CB   . ALA F 1 27  ? 18.348 23.284 36.085  1.00 176.95 ? 27  ALA F CB   1 
ATOM   5996 N  N    . HIS F 1 28  ? 16.192 22.629 33.479  1.00 182.19 ? 28  HIS F N    1 
ATOM   5997 C  CA   . HIS F 1 28  ? 14.881 22.103 33.123  1.00 184.68 ? 28  HIS F CA   1 
ATOM   5998 C  C    . HIS F 1 28  ? 15.033 21.156 31.933  1.00 182.57 ? 28  HIS F C    1 
ATOM   5999 O  O    . HIS F 1 28  ? 14.448 20.066 31.912  1.00 180.65 ? 28  HIS F O    1 
ATOM   6000 C  CB   . HIS F 1 28  ? 13.919 23.240 32.772  1.00 190.01 ? 28  HIS F CB   1 
ATOM   6001 C  CG   . HIS F 1 28  ? 12.910 22.871 31.729  1.00 197.73 ? 28  HIS F CG   1 
ATOM   6002 N  ND1  . HIS F 1 28  ? 11.723 22.238 32.033  1.00 201.60 ? 28  HIS F ND1  1 
ATOM   6003 C  CD2  . HIS F 1 28  ? 12.921 23.023 30.382  1.00 202.34 ? 28  HIS F CD2  1 
ATOM   6004 C  CE1  . HIS F 1 28  ? 11.043 22.024 30.920  1.00 202.35 ? 28  HIS F CE1  1 
ATOM   6005 N  NE2  . HIS F 1 28  ? 11.747 22.491 29.904  1.00 202.81 ? 28  HIS F NE2  1 
ATOM   6006 N  N    . LYS F 1 29  ? 15.843 21.583 30.961  1.00 183.79 ? 29  LYS F N    1 
ATOM   6007 C  CA   . LYS F 1 29  ? 16.123 20.795 29.767  1.00 183.86 ? 29  LYS F CA   1 
ATOM   6008 C  C    . LYS F 1 29  ? 16.896 19.543 30.156  1.00 185.14 ? 29  LYS F C    1 
ATOM   6009 O  O    . LYS F 1 29  ? 17.172 18.683 29.319  1.00 183.20 ? 29  LYS F O    1 
ATOM   6010 C  CB   . LYS F 1 29  ? 16.927 21.616 28.760  1.00 188.06 ? 29  LYS F CB   1 
ATOM   6011 C  CG   . LYS F 1 29  ? 16.135 22.047 27.536  1.00 215.22 ? 29  LYS F CG   1 
ATOM   6012 C  CD   . LYS F 1 29  ? 14.754 21.407 27.512  1.00 231.17 ? 29  LYS F CD   1 
ATOM   6013 C  CE   . LYS F 1 29  ? 14.672 20.287 26.481  1.00 245.39 ? 29  LYS F CE   1 
ATOM   6014 N  NZ   . LYS F 1 29  ? 13.314 19.674 26.415  1.00 255.32 ? 29  LYS F NZ   1 
ATOM   6015 N  N    . VAL F 1 30  ? 17.237 19.462 31.441  1.00 185.82 ? 30  VAL F N    1 
ATOM   6016 C  CA   . VAL F 1 30  ? 17.950 18.321 32.014  1.00 187.10 ? 30  VAL F CA   1 
ATOM   6017 C  C    . VAL F 1 30  ? 16.928 17.356 32.600  1.00 196.02 ? 30  VAL F C    1 
ATOM   6018 O  O    . VAL F 1 30  ? 17.169 16.152 32.696  1.00 194.93 ? 30  VAL F O    1 
ATOM   6019 C  CB   . VAL F 1 30  ? 18.920 18.763 33.126  1.00 190.62 ? 30  VAL F CB   1 
ATOM   6020 C  CG1  . VAL F 1 30  ? 18.633 17.986 34.398  1.00 190.37 ? 30  VAL F CG1  1 
ATOM   6021 C  CG2  . VAL F 1 30  ? 20.365 18.573 32.690  1.00 190.39 ? 30  VAL F CG2  1 
ATOM   6022 N  N    . GLU F 1 31  ? 15.792 17.894 33.024  1.00 195.37 ? 31  GLU F N    1 
ATOM   6023 C  CA   . GLU F 1 31  ? 14.760 17.047 33.585  1.00 198.32 ? 31  GLU F CA   1 
ATOM   6024 C  C    . GLU F 1 31  ? 14.036 16.310 32.481  1.00 201.92 ? 31  GLU F C    1 
ATOM   6025 O  O    . GLU F 1 31  ? 13.721 15.128 32.612  1.00 202.00 ? 31  GLU F O    1 
ATOM   6026 C  CB   . GLU F 1 31  ? 13.784 17.841 34.442  1.00 200.68 ? 31  GLU F CB   1 
ATOM   6027 C  CG   . GLU F 1 31  ? 13.460 17.144 35.760  1.00 213.48 ? 31  GLU F CG   1 
ATOM   6028 C  CD   . GLU F 1 31  ? 14.673 16.446 36.384  1.00 236.73 ? 31  GLU F CD   1 
ATOM   6029 O  OE1  . GLU F 1 31  ? 15.814 16.914 36.164  1.00 231.61 ? 31  GLU F OE1  1 
ATOM   6030 O  OE2  . GLU F 1 31  ? 14.481 15.445 37.116  1.00 231.36 ? 31  GLU F OE2  1 
ATOM   6031 N  N    . HIS F 1 32  ? 13.807 17.003 31.373  1.00 205.65 ? 32  HIS F N    1 
ATOM   6032 C  CA   . HIS F 1 32  ? 13.131 16.391 30.241  1.00 207.96 ? 32  HIS F CA   1 
ATOM   6033 C  C    . HIS F 1 32  ? 13.869 15.165 29.720  1.00 204.99 ? 32  HIS F C    1 
ATOM   6034 O  O    . HIS F 1 32  ? 13.241 14.196 29.309  1.00 202.15 ? 32  HIS F O    1 
ATOM   6035 C  CB   . HIS F 1 32  ? 12.891 17.398 29.119  1.00 215.18 ? 32  HIS F CB   1 
ATOM   6036 C  CG   . HIS F 1 32  ? 11.511 17.973 29.121  1.00 225.36 ? 32  HIS F CG   1 
ATOM   6037 N  ND1  . HIS F 1 32  ? 11.008 18.712 28.072  1.00 230.56 ? 32  HIS F ND1  1 
ATOM   6038 C  CD2  . HIS F 1 32  ? 10.526 17.917 30.049  1.00 231.72 ? 32  HIS F CD2  1 
ATOM   6039 C  CE1  . HIS F 1 32  ? 9.775  19.091 28.356  1.00 232.13 ? 32  HIS F CE1  1 
ATOM   6040 N  NE2  . HIS F 1 32  ? 9.458  18.620 29.549  1.00 232.66 ? 32  HIS F NE2  1 
ATOM   6041 N  N    . GLU F 1 33  ? 15.199 15.202 29.747  1.00 205.94 ? 33  GLU F N    1 
ATOM   6042 C  CA   . GLU F 1 33  ? 15.996 14.078 29.259  1.00 207.89 ? 33  GLU F CA   1 
ATOM   6043 C  C    . GLU F 1 33  ? 16.145 12.967 30.281  1.00 210.57 ? 33  GLU F C    1 
ATOM   6044 O  O    . GLU F 1 33  ? 16.456 11.831 29.926  1.00 208.75 ? 33  GLU F O    1 
ATOM   6045 C  CB   . GLU F 1 33  ? 17.367 14.530 28.760  1.00 210.34 ? 33  GLU F CB   1 
ATOM   6046 C  CG   . GLU F 1 33  ? 17.419 14.745 27.263  1.00 226.48 ? 33  GLU F CG   1 
ATOM   6047 C  CD   . GLU F 1 33  ? 16.047 15.012 26.679  1.00 257.74 ? 33  GLU F CD   1 
ATOM   6048 O  OE1  . GLU F 1 33  ? 15.645 16.193 26.615  1.00 254.87 ? 33  GLU F OE1  1 
ATOM   6049 O  OE2  . GLU F 1 33  ? 15.360 14.035 26.314  1.00 254.61 ? 33  GLU F OE2  1 
ATOM   6050 N  N    . SER F 1 34  ? 15.930 13.295 31.549  1.00 207.36 ? 34  SER F N    1 
ATOM   6051 C  CA   . SER F 1 34  ? 16.017 12.293 32.598  1.00 209.36 ? 34  SER F CA   1 
ATOM   6052 C  C    . SER F 1 34  ? 14.647 11.662 32.779  1.00 221.93 ? 34  SER F C    1 
ATOM   6053 O  O    . SER F 1 34  ? 14.504 10.648 33.467  1.00 223.36 ? 34  SER F O    1 
ATOM   6054 C  CB   . SER F 1 34  ? 16.467 12.919 33.913  1.00 210.77 ? 34  SER F CB   1 
ATOM   6055 O  OG   . SER F 1 34  ? 16.378 11.972 34.966  1.00 217.04 ? 34  SER F OG   1 
ATOM   6056 N  N    . ARG F 1 35  ? 13.645 12.278 32.157  1.00 223.20 ? 35  ARG F N    1 
ATOM   6057 C  CA   . ARG F 1 35  ? 12.263 11.804 32.223  1.00 223.29 ? 35  ARG F CA   1 
ATOM   6058 C  C    . ARG F 1 35  ? 11.926 10.851 31.073  1.00 226.86 ? 35  ARG F C    1 
ATOM   6059 O  O    . ARG F 1 35  ? 11.353 9.781  31.288  1.00 225.42 ? 35  ARG F O    1 
ATOM   6060 C  CB   . ARG F 1 35  ? 11.289 12.988 32.212  1.00 224.78 ? 35  ARG F CB   1 
ATOM   6061 C  CG   . ARG F 1 35  ? 11.347 13.861 33.454  1.00 236.90 ? 35  ARG F CG   1 
ATOM   6062 C  CD   . ARG F 1 35  ? 12.228 13.232 34.518  1.00 246.77 ? 35  ARG F CD   1 
ATOM   6063 N  NE   . ARG F 1 35  ? 11.632 13.316 35.849  1.00 253.72 ? 35  ARG F NE   1 
ATOM   6064 C  CZ   . ARG F 1 35  ? 11.544 12.296 36.700  1.00 266.41 ? 35  ARG F CZ   1 
ATOM   6065 N  NH1  . ARG F 1 35  ? 12.005 11.100 36.358  1.00 253.43 ? 35  ARG F NH1  1 
ATOM   6066 N  NH2  . ARG F 1 35  ? 10.989 12.468 37.895  1.00 252.84 ? 35  ARG F NH2  1 
ATOM   6067 N  N    . THR F 1 36  ? 12.275 11.250 29.851  1.00 230.60 ? 36  THR F N    1 
ATOM   6068 C  CA   . THR F 1 36  ? 12.014 10.429 28.669  1.00 231.45 ? 36  THR F CA   1 
ATOM   6069 C  C    . THR F 1 36  ? 12.808 9.124  28.717  1.00 232.93 ? 36  THR F C    1 
ATOM   6070 O  O    . THR F 1 36  ? 12.419 8.128  28.109  1.00 231.37 ? 36  THR F O    1 
ATOM   6071 C  CB   . THR F 1 36  ? 12.276 11.199 27.351  1.00 253.32 ? 36  THR F CB   1 
ATOM   6072 O  OG1  . THR F 1 36  ? 13.664 11.542 27.252  1.00 255.90 ? 36  THR F OG1  1 
ATOM   6073 C  CG2  . THR F 1 36  ? 11.436 12.462 27.289  1.00 254.93 ? 36  THR F CG2  1 
ATOM   6074 N  N    . GLN F 1 37  ? 13.937 9.153  29.424  1.00 233.16 ? 37  GLN F N    1 
ATOM   6075 C  CA   . GLN F 1 37  ? 14.818 7.996  29.574  1.00 234.24 ? 37  GLN F CA   1 
ATOM   6076 C  C    . GLN F 1 37  ? 15.151 7.830  31.045  1.00 236.11 ? 37  GLN F C    1 
ATOM   6077 O  O    . GLN F 1 37  ? 16.322 7.835  31.436  1.00 234.69 ? 37  GLN F O    1 
ATOM   6078 C  CB   . GLN F 1 37  ? 16.113 8.209  28.789  1.00 236.66 ? 37  GLN F CB   1 
ATOM   6079 C  CG   . GLN F 1 37  ? 15.904 8.531  27.319  1.00 261.87 ? 37  GLN F CG   1 
ATOM   6080 C  CD   . GLN F 1 37  ? 15.036 7.501  26.611  1.00 289.04 ? 37  GLN F CD   1 
ATOM   6081 O  OE1  . GLN F 1 37  ? 14.540 6.558  27.229  1.00 285.70 ? 37  GLN F OE1  1 
ATOM   6082 N  NE2  . GLN F 1 37  ? 14.852 7.678  25.306  1.00 282.36 ? 37  GLN F NE2  1 
ATOM   6083 N  N    . ASN F 1 38  ? 14.104 7.709  31.854  1.00 235.67 ? 38  ASN F N    1 
ATOM   6084 C  CA   . ASN F 1 38  ? 14.238 7.610  33.301  1.00 238.03 ? 38  ASN F CA   1 
ATOM   6085 C  C    . ASN F 1 38  ? 15.283 6.641  33.849  1.00 247.76 ? 38  ASN F C    1 
ATOM   6086 O  O    . ASN F 1 38  ? 15.332 5.463  33.483  1.00 248.38 ? 38  ASN F O    1 
ATOM   6087 C  CB   . ASN F 1 38  ? 12.881 7.434  33.979  1.00 245.34 ? 38  ASN F CB   1 
ATOM   6088 C  CG   . ASN F 1 38  ? 12.396 8.710  34.639  1.00 299.10 ? 38  ASN F CG   1 
ATOM   6089 O  OD1  . ASN F 1 38  ? 12.926 9.127  35.667  1.00 298.98 ? 38  ASN F OD1  1 
ATOM   6090 N  ND2  . ASN F 1 38  ? 11.408 9.354  34.030  1.00 296.53 ? 38  ASN F ND2  1 
ATOM   6091 N  N    . GLY F 1 39  ? 16.104 7.166  34.750  1.00 246.76 ? 39  GLY F N    1 
ATOM   6092 C  CA   . GLY F 1 39  ? 17.185 6.445  35.391  1.00 247.21 ? 39  GLY F CA   1 
ATOM   6093 C  C    . GLY F 1 39  ? 18.358 7.398  35.506  1.00 252.53 ? 39  GLY F C    1 
ATOM   6094 O  O    . GLY F 1 39  ? 18.887 7.843  34.483  1.00 252.22 ? 39  GLY F O    1 
ATOM   6095 N  N    . ARG F 1 40  ? 18.735 7.737  36.744  1.00 250.36 ? 40  ARG F N    1 
ATOM   6096 C  CA   . ARG F 1 40  ? 19.844 8.667  37.033  1.00 250.14 ? 40  ARG F CA   1 
ATOM   6097 C  C    . ARG F 1 40  ? 21.194 8.250  36.421  1.00 253.93 ? 40  ARG F C    1 
ATOM   6098 O  O    . ARG F 1 40  ? 22.255 8.767  36.802  1.00 253.29 ? 40  ARG F O    1 
ATOM   6099 C  CB   . ARG F 1 40  ? 19.987 8.885  38.549  1.00 249.73 ? 40  ARG F CB   1 
ATOM   6100 C  CG   . ARG F 1 40  ? 21.031 9.926  38.954  1.00 257.39 ? 40  ARG F CG   1 
ATOM   6101 C  CD   . ARG F 1 40  ? 20.470 11.325 38.855  1.00 262.36 ? 40  ARG F CD   1 
ATOM   6102 N  NE   . ARG F 1 40  ? 19.020 11.299 38.707  1.00 265.04 ? 40  ARG F NE   1 
ATOM   6103 C  CZ   . ARG F 1 40  ? 18.382 11.572 37.577  1.00 274.80 ? 40  ARG F CZ   1 
ATOM   6104 N  NH1  . ARG F 1 40  ? 19.067 11.908 36.493  1.00 261.08 ? 40  ARG F NH1  1 
ATOM   6105 N  NH2  . ARG F 1 40  ? 17.061 11.516 37.533  1.00 260.50 ? 40  ARG F NH2  1 
ATOM   6106 N  N    . SER F 1 41  ? 21.132 7.323  35.465  1.00 249.86 ? 41  SER F N    1 
ATOM   6107 C  CA   . SER F 1 41  ? 22.305 6.820  34.763  1.00 250.63 ? 41  SER F CA   1 
ATOM   6108 C  C    . SER F 1 41  ? 23.220 7.960  34.320  1.00 260.98 ? 41  SER F C    1 
ATOM   6109 O  O    . SER F 1 41  ? 23.298 8.307  33.139  1.00 262.04 ? 41  SER F O    1 
ATOM   6110 C  CB   . SER F 1 41  ? 21.883 5.965  33.565  1.00 252.03 ? 41  SER F CB   1 
ATOM   6111 O  OG   . SER F 1 41  ? 20.490 5.698  33.597  1.00 258.44 ? 41  SER F OG   1 
ATOM   6112 N  N    . PHE F 1 42  ? 23.896 8.548  35.298  1.00 256.90 ? 42  PHE F N    1 
ATOM   6113 C  CA   . PHE F 1 42  ? 24.841 9.620  35.053  1.00 252.67 ? 42  PHE F CA   1 
ATOM   6114 C  C    . PHE F 1 42  ? 26.194 8.926  34.861  1.00 269.38 ? 42  PHE F C    1 
ATOM   6115 O  O    . PHE F 1 42  ? 26.461 7.924  35.532  1.00 271.68 ? 42  PHE F O    1 
ATOM   6116 C  CB   . PHE F 1 42  ? 24.886 10.542 36.276  1.00 245.12 ? 42  PHE F CB   1 
ATOM   6117 C  CG   . PHE F 1 42  ? 26.119 10.370 37.122  1.00 233.92 ? 42  PHE F CG   1 
ATOM   6118 C  CD1  . PHE F 1 42  ? 27.228 11.181 36.928  1.00 227.80 ? 42  PHE F CD1  1 
ATOM   6119 C  CD2  . PHE F 1 42  ? 26.176 9.392  38.101  1.00 226.68 ? 42  PHE F CD2  1 
ATOM   6120 C  CE1  . PHE F 1 42  ? 28.371 11.019 37.692  1.00 225.05 ? 42  PHE F CE1  1 
ATOM   6121 C  CE2  . PHE F 1 42  ? 27.318 9.227  38.870  1.00 225.44 ? 42  PHE F CE2  1 
ATOM   6122 C  CZ   . PHE F 1 42  ? 28.416 10.044 38.663  1.00 222.48 ? 42  PHE F CZ   1 
ATOM   6123 N  N    . GLN F 1 43  ? 27.005 9.421  33.917  1.00 264.52 ? 43  GLN F N    1 
ATOM   6124 C  CA   . GLN F 1 43  ? 28.342 8.870  33.593  1.00 263.26 ? 43  GLN F CA   1 
ATOM   6125 C  C    . GLN F 1 43  ? 28.385 7.873  32.418  1.00 267.09 ? 43  GLN F C    1 
ATOM   6126 O  O    . GLN F 1 43  ? 27.814 6.781  32.499  1.00 266.74 ? 43  GLN F O    1 
ATOM   6127 C  CB   . GLN F 1 43  ? 29.066 8.307  34.835  1.00 263.45 ? 43  GLN F CB   1 
ATOM   6128 C  CG   . GLN F 1 43  ? 29.823 6.982  34.614  1.00 247.95 ? 43  GLN F CG   1 
ATOM   6129 C  CD   . GLN F 1 43  ? 28.953 5.734  34.807  1.00 238.31 ? 43  GLN F CD   1 
ATOM   6130 O  OE1  . GLN F 1 43  ? 28.902 4.859  33.936  1.00 229.54 ? 43  GLN F OE1  1 
ATOM   6131 N  NE2  . GLN F 1 43  ? 28.279 5.643  35.952  1.00 226.19 ? 43  GLN F NE2  1 
ATOM   6132 N  N    . ARG F 1 44  ? 29.069 8.258  31.337  1.00 258.66 ? 44  ARG F N    1 
ATOM   6133 C  CA   . ARG F 1 44  ? 29.230 7.416  30.140  1.00 256.83 ? 44  ARG F CA   1 
ATOM   6134 C  C    . ARG F 1 44  ? 28.020 6.545  29.756  1.00 261.01 ? 44  ARG F C    1 
ATOM   6135 O  O    . ARG F 1 44  ? 28.142 5.619  28.952  1.00 260.86 ? 44  ARG F O    1 
ATOM   6136 C  CB   . ARG F 1 44  ? 30.499 6.561  30.247  1.00 248.60 ? 44  ARG F CB   1 
ATOM   6137 C  CG   . ARG F 1 44  ? 30.989 5.983  28.923  1.00 232.44 ? 44  ARG F CG   1 
ATOM   6138 C  CD   . ARG F 1 44  ? 30.690 4.482  28.829  1.00 209.44 ? 44  ARG F CD   1 
ATOM   6139 N  NE   . ARG F 1 44  ? 31.565 3.791  27.880  1.00 192.39 ? 44  ARG F NE   1 
ATOM   6140 C  CZ   . ARG F 1 44  ? 31.889 2.499  27.956  1.00 192.70 ? 44  ARG F CZ   1 
ATOM   6141 N  NH1  . ARG F 1 44  ? 31.408 1.745  28.942  1.00 177.10 ? 44  ARG F NH1  1 
ATOM   6142 N  NH2  . ARG F 1 44  ? 32.697 1.957  27.046  1.00 176.53 ? 44  ARG F NH2  1 
ATOM   6143 N  N    . THR F 1 45  ? 26.859 6.849  30.331  1.00 248.47 ? 45  THR F N    1 
ATOM   6144 C  CA   . THR F 1 45  ? 25.640 6.104  30.049  1.00 248.62 ? 45  THR F CA   1 
ATOM   6145 C  C    . THR F 1 45  ? 24.428 7.017  30.019  1.00 250.12 ? 45  THR F C    1 
ATOM   6146 O  O    . THR F 1 45  ? 24.468 8.148  30.502  1.00 249.56 ? 45  THR F O    1 
ATOM   6147 C  CB   . THR F 1 45  ? 25.430 4.945  31.032  1.00 271.76 ? 45  THR F CB   1 
ATOM   6148 O  OG1  . THR F 1 45  ? 24.787 5.434  32.216  1.00 274.73 ? 45  THR F OG1  1 
ATOM   6149 C  CG2  . THR F 1 45  ? 26.761 4.303  31.395  1.00 273.75 ? 45  THR F CG2  1 
ATOM   6150 N  N    . GLY F 1 46  ? 23.338 6.501  29.474  1.00 238.91 ? 46  GLY F N    1 
ATOM   6151 C  CA   . GLY F 1 46  ? 22.121 7.261  29.313  1.00 238.44 ? 46  GLY F CA   1 
ATOM   6152 C  C    . GLY F 1 46  ? 22.127 7.665  27.859  1.00 241.99 ? 46  GLY F C    1 
ATOM   6153 O  O    . GLY F 1 46  ? 23.157 7.542  27.191  1.00 241.94 ? 46  GLY F O    1 
ATOM   6154 N  N    . THR F 1 47  ? 20.992 8.144  27.367  1.00 232.82 ? 47  THR F N    1 
ATOM   6155 C  CA   . THR F 1 47  ? 20.862 8.556  25.972  1.00 231.09 ? 47  THR F CA   1 
ATOM   6156 C  C    . THR F 1 47  ? 22.059 9.342  25.448  1.00 228.21 ? 47  THR F C    1 
ATOM   6157 O  O    . THR F 1 47  ? 23.052 9.560  26.138  1.00 226.65 ? 47  THR F O    1 
ATOM   6158 C  CB   . THR F 1 47  ? 19.577 9.395  25.762  1.00 245.29 ? 47  THR F CB   1 
ATOM   6159 O  OG1  . THR F 1 47  ? 18.715 9.270  26.900  1.00 246.20 ? 47  THR F OG1  1 
ATOM   6160 C  CG2  . THR F 1 47  ? 18.843 8.959  24.509  1.00 245.23 ? 47  THR F CG2  1 
ATOM   6161 N  N    . LEU F 1 48  ? 21.944 9.765  24.203  1.00 220.76 ? 48  LEU F N    1 
ATOM   6162 C  CA   . LEU F 1 48  ? 22.917 10.643 23.595  1.00 218.94 ? 48  LEU F CA   1 
ATOM   6163 C  C    . LEU F 1 48  ? 22.278 12.022 23.659  1.00 213.51 ? 48  LEU F C    1 
ATOM   6164 O  O    . LEU F 1 48  ? 22.925 13.033 23.398  1.00 211.46 ? 48  LEU F O    1 
ATOM   6165 C  CB   . LEU F 1 48  ? 23.150 10.247 22.145  1.00 220.13 ? 48  LEU F CB   1 
ATOM   6166 C  CG   . LEU F 1 48  ? 24.460 9.492  21.996  1.00 227.01 ? 48  LEU F CG   1 
ATOM   6167 C  CD1  . LEU F 1 48  ? 25.510 10.458 21.482  1.00 227.91 ? 48  LEU F CD1  1 
ATOM   6168 C  CD2  . LEU F 1 48  ? 24.851 8.918  23.357  1.00 230.22 ? 48  LEU F CD2  1 
ATOM   6169 N  N    . ALA F 1 49  ? 20.993 12.046 24.013  1.00 212.27 ? 49  ALA F N    1 
ATOM   6170 C  CA   . ALA F 1 49  ? 20.241 13.293 24.142  1.00 210.67 ? 49  ALA F CA   1 
ATOM   6171 C  C    . ALA F 1 49  ? 20.269 13.766 25.592  1.00 212.40 ? 49  ALA F C    1 
ATOM   6172 O  O    . ALA F 1 49  ? 20.360 14.964 25.849  1.00 212.06 ? 49  ALA F O    1 
ATOM   6173 C  CB   . ALA F 1 49  ? 18.804 13.114 23.661  1.00 211.17 ? 49  ALA F CB   1 
ATOM   6174 N  N    . PHE F 1 50  ? 20.203 12.817 26.527  1.00 210.32 ? 50  PHE F N    1 
ATOM   6175 C  CA   . PHE F 1 50  ? 20.252 13.105 27.960  1.00 207.16 ? 50  PHE F CA   1 
ATOM   6176 C  C    . PHE F 1 50  ? 21.711 13.243 28.389  1.00 209.25 ? 50  PHE F C    1 
ATOM   6177 O  O    . PHE F 1 50  ? 22.027 13.963 29.331  1.00 208.69 ? 50  PHE F O    1 
ATOM   6178 C  CB   . PHE F 1 50  ? 19.526 11.992 28.743  1.00 206.09 ? 50  PHE F CB   1 
ATOM   6179 C  CG   . PHE F 1 50  ? 20.179 11.607 30.054  1.00 203.37 ? 50  PHE F CG   1 
ATOM   6180 C  CD1  . PHE F 1 50  ? 19.502 11.792 31.252  1.00 203.22 ? 50  PHE F CD1  1 
ATOM   6181 C  CD2  . PHE F 1 50  ? 21.392 10.926 30.088  1.00 201.93 ? 50  PHE F CD2  1 
ATOM   6182 C  CE1  . PHE F 1 50  ? 20.065 11.396 32.465  1.00 202.63 ? 50  PHE F CE1  1 
ATOM   6183 C  CE2  . PHE F 1 50  ? 21.968 10.544 31.298  1.00 203.07 ? 50  PHE F CE2  1 
ATOM   6184 C  CZ   . PHE F 1 50  ? 21.301 10.776 32.486  1.00 200.77 ? 50  PHE F CZ   1 
ATOM   6185 N  N    . GLU F 1 51  ? 22.594 12.539 27.691  1.00 203.91 ? 51  GLU F N    1 
ATOM   6186 C  CA   . GLU F 1 51  ? 24.017 12.601 27.980  1.00 203.17 ? 51  GLU F CA   1 
ATOM   6187 C  C    . GLU F 1 51  ? 24.606 13.842 27.328  1.00 205.07 ? 51  GLU F C    1 
ATOM   6188 O  O    . GLU F 1 51  ? 25.635 14.357 27.755  1.00 203.92 ? 51  GLU F O    1 
ATOM   6189 C  CB   . GLU F 1 51  ? 24.712 11.364 27.438  1.00 204.68 ? 51  GLU F CB   1 
ATOM   6190 C  CG   . GLU F 1 51  ? 26.174 11.286 27.806  1.00 215.14 ? 51  GLU F CG   1 
ATOM   6191 C  CD   . GLU F 1 51  ? 26.629 9.868  28.075  1.00 234.00 ? 51  GLU F CD   1 
ATOM   6192 O  OE1  . GLU F 1 51  ? 25.947 8.926  27.606  1.00 227.69 ? 51  GLU F OE1  1 
ATOM   6193 O  OE2  . GLU F 1 51  ? 27.673 9.702  28.748  1.00 227.43 ? 51  GLU F OE2  1 
ATOM   6194 N  N    . ARG F 1 52  ? 23.943 14.326 26.289  1.00 197.68 ? 52  ARG F N    1 
ATOM   6195 C  CA   . ARG F 1 52  ? 24.394 15.533 25.616  1.00 196.95 ? 52  ARG F CA   1 
ATOM   6196 C  C    . ARG F 1 52  ? 23.940 16.775 26.384  1.00 195.56 ? 52  ARG F C    1 
ATOM   6197 O  O    . ARG F 1 52  ? 24.625 17.792 26.365  1.00 195.27 ? 52  ARG F O    1 
ATOM   6198 C  CB   . ARG F 1 52  ? 23.884 15.581 24.178  1.00 199.02 ? 52  ARG F CB   1 
ATOM   6199 C  CG   . ARG F 1 52  ? 24.783 16.365 23.239  1.00 211.55 ? 52  ARG F CG   1 
ATOM   6200 C  CD   . ARG F 1 52  ? 24.462 16.056 21.783  1.00 221.46 ? 52  ARG F CD   1 
ATOM   6201 N  NE   . ARG F 1 52  ? 25.652 16.005 20.933  1.00 228.01 ? 52  ARG F NE   1 
ATOM   6202 C  CZ   . ARG F 1 52  ? 26.796 15.409 21.264  1.00 240.19 ? 52  ARG F CZ   1 
ATOM   6203 N  NH1  . ARG F 1 52  ? 26.935 14.813 22.445  1.00 227.06 ? 52  ARG F NH1  1 
ATOM   6204 N  NH2  . ARG F 1 52  ? 27.810 15.415 20.408  1.00 226.47 ? 52  ARG F NH2  1 
ATOM   6205 N  N    . VAL F 1 53  ? 22.800 16.686 27.073  1.00 190.67 ? 53  VAL F N    1 
ATOM   6206 C  CA   . VAL F 1 53  ? 22.282 17.813 27.857  1.00 185.20 ? 53  VAL F CA   1 
ATOM   6207 C  C    . VAL F 1 53  ? 22.877 17.908 29.250  1.00 191.72 ? 53  VAL F C    1 
ATOM   6208 O  O    . VAL F 1 53  ? 23.265 18.990 29.682  1.00 192.09 ? 53  VAL F O    1 
ATOM   6209 C  CB   . VAL F 1 53  ? 20.751 17.850 27.936  1.00 180.28 ? 53  VAL F CB   1 
ATOM   6210 C  CG1  . VAL F 1 53  ? 20.317 18.201 29.351  1.00 178.62 ? 53  VAL F CG1  1 
ATOM   6211 C  CG2  . VAL F 1 53  ? 20.201 18.868 26.962  1.00 178.62 ? 53  VAL F CG2  1 
ATOM   6212 N  N    . TYR F 1 54  ? 22.918 16.797 29.977  1.00 187.99 ? 54  TYR F N    1 
ATOM   6213 C  CA   . TYR F 1 54  ? 23.498 16.852 31.304  1.00 187.32 ? 54  TYR F CA   1 
ATOM   6214 C  C    . TYR F 1 54  ? 24.927 17.332 31.203  1.00 185.10 ? 54  TYR F C    1 
ATOM   6215 O  O    . TYR F 1 54  ? 25.477 17.879 32.156  1.00 184.02 ? 54  TYR F O    1 
ATOM   6216 C  CB   . TYR F 1 54  ? 23.482 15.515 32.019  1.00 190.76 ? 54  TYR F CB   1 
ATOM   6217 C  CG   . TYR F 1 54  ? 23.864 15.695 33.466  1.00 196.05 ? 54  TYR F CG   1 
ATOM   6218 C  CD1  . TYR F 1 54  ? 23.166 16.591 34.261  1.00 198.54 ? 54  TYR F CD1  1 
ATOM   6219 C  CD2  . TYR F 1 54  ? 24.997 15.092 33.999  1.00 197.70 ? 54  TYR F CD2  1 
ATOM   6220 C  CE1  . TYR F 1 54  ? 23.518 16.815 35.578  1.00 199.60 ? 54  TYR F CE1  1 
ATOM   6221 C  CE2  . TYR F 1 54  ? 25.361 15.307 35.327  1.00 198.86 ? 54  TYR F CE2  1 
ATOM   6222 C  CZ   . TYR F 1 54  ? 24.611 16.175 36.112  1.00 205.90 ? 54  TYR F CZ   1 
ATOM   6223 O  OH   . TYR F 1 54  ? 24.937 16.416 37.433  1.00 206.60 ? 54  TYR F OH   1 
ATOM   6224 N  N    . THR F 1 55  ? 25.533 17.122 30.041  1.00 181.85 ? 55  THR F N    1 
ATOM   6225 C  CA   . THR F 1 55  ? 26.896 17.578 29.830  1.00 180.92 ? 55  THR F CA   1 
ATOM   6226 C  C    . THR F 1 55  ? 26.946 19.087 29.578  1.00 182.77 ? 55  THR F C    1 
ATOM   6227 O  O    . THR F 1 55  ? 27.652 19.806 30.283  1.00 181.83 ? 55  THR F O    1 
ATOM   6228 C  CB   . THR F 1 55  ? 27.618 16.771 28.761  1.00 193.48 ? 55  THR F CB   1 
ATOM   6229 O  OG1  . THR F 1 55  ? 27.935 15.474 29.288  1.00 194.12 ? 55  THR F OG1  1 
ATOM   6230 C  CG2  . THR F 1 55  ? 28.899 17.478 28.372  1.00 193.14 ? 55  THR F CG2  1 
ATOM   6231 N  N    . ALA F 1 56  ? 26.163 19.569 28.610  1.00 175.37 ? 56  ALA F N    1 
ATOM   6232 C  CA   . ALA F 1 56  ? 26.085 21.006 28.309  1.00 175.31 ? 56  ALA F CA   1 
ATOM   6233 C  C    . ALA F 1 56  ? 25.760 21.783 29.573  1.00 182.30 ? 56  ALA F C    1 
ATOM   6234 O  O    . ALA F 1 56  ? 26.329 22.841 29.835  1.00 183.19 ? 56  ALA F O    1 
ATOM   6235 C  CB   . ALA F 1 56  ? 25.012 21.277 27.259  1.00 175.69 ? 56  ALA F CB   1 
ATOM   6236 N  N    . ASN F 1 57  ? 24.811 21.251 30.333  1.00 175.43 ? 57  ASN F N    1 
ATOM   6237 C  CA   . ASN F 1 57  ? 24.393 21.840 31.594  1.00 174.64 ? 57  ASN F CA   1 
ATOM   6238 C  C    . ASN F 1 57  ? 25.569 21.871 32.581  1.00 178.28 ? 57  ASN F C    1 
ATOM   6239 O  O    . ASN F 1 57  ? 26.052 22.943 32.956  1.00 178.45 ? 57  ASN F O    1 
ATOM   6240 C  CB   . ASN F 1 57  ? 23.233 21.025 32.175  1.00 173.54 ? 57  ASN F CB   1 
ATOM   6241 C  CG   . ASN F 1 57  ? 22.445 21.784 33.226  1.00 187.84 ? 57  ASN F CG   1 
ATOM   6242 O  OD1  . ASN F 1 57  ? 22.033 21.213 34.235  1.00 180.94 ? 57  ASN F OD1  1 
ATOM   6243 N  ND2  . ASN F 1 57  ? 22.207 23.070 32.980  1.00 178.49 ? 57  ASN F ND2  1 
ATOM   6244 N  N    . GLN F 1 58  ? 26.042 20.697 32.991  1.00 176.68 ? 58  GLN F N    1 
ATOM   6245 C  CA   . GLN F 1 58  ? 27.160 20.625 33.926  1.00 175.63 ? 58  GLN F CA   1 
ATOM   6246 C  C    . GLN F 1 58  ? 28.467 21.169 33.345  1.00 175.59 ? 58  GLN F C    1 
ATOM   6247 O  O    . GLN F 1 58  ? 29.557 20.781 33.770  1.00 174.20 ? 58  GLN F O    1 
ATOM   6248 C  CB   . GLN F 1 58  ? 27.354 19.204 34.437  1.00 177.34 ? 58  GLN F CB   1 
ATOM   6249 C  CG   . GLN F 1 58  ? 28.110 19.132 35.753  1.00 192.80 ? 58  GLN F CG   1 
ATOM   6250 C  CD   . GLN F 1 58  ? 27.355 19.796 36.896  1.00 211.32 ? 58  GLN F CD   1 
ATOM   6251 O  OE1  . GLN F 1 58  ? 27.935 20.119 37.941  1.00 206.72 ? 58  GLN F OE1  1 
ATOM   6252 N  NE2  . GLN F 1 58  ? 26.052 20.000 36.704  1.00 203.37 ? 58  GLN F NE2  1 
ATOM   6253 N  N    . ASN F 1 59  ? 28.339 22.067 32.371  1.00 173.80 ? 59  ASN F N    1 
ATOM   6254 C  CA   . ASN F 1 59  ? 29.475 22.712 31.719  1.00 173.19 ? 59  ASN F CA   1 
ATOM   6255 C  C    . ASN F 1 59  ? 29.257 24.200 31.930  1.00 175.97 ? 59  ASN F C    1 
ATOM   6256 O  O    . ASN F 1 59  ? 30.188 25.004 31.884  1.00 174.96 ? 59  ASN F O    1 
ATOM   6257 C  CB   . ASN F 1 59  ? 29.475 22.400 30.216  1.00 172.94 ? 59  ASN F CB   1 
ATOM   6258 C  CG   . ASN F 1 59  ? 30.152 21.074 29.889  1.00 190.17 ? 59  ASN F CG   1 
ATOM   6259 O  OD1  . ASN F 1 59  ? 30.724 20.412 30.761  1.00 183.68 ? 59  ASN F OD1  1 
ATOM   6260 N  ND2  . ASN F 1 59  ? 30.093 20.685 28.624  1.00 181.24 ? 59  ASN F ND2  1 
ATOM   6261 N  N    . CYS F 1 60  ? 27.995 24.538 32.165  1.00 174.81 ? 60  CYS F N    1 
ATOM   6262 C  CA   . CYS F 1 60  ? 27.557 25.904 32.409  1.00 178.50 ? 60  CYS F CA   1 
ATOM   6263 C  C    . CYS F 1 60  ? 27.566 26.143 33.906  1.00 171.93 ? 60  CYS F C    1 
ATOM   6264 O  O    . CYS F 1 60  ? 27.728 27.275 34.366  1.00 168.47 ? 60  CYS F O    1 
ATOM   6265 C  CB   . CYS F 1 60  ? 26.120 26.086 31.909  1.00 185.54 ? 60  CYS F CB   1 
ATOM   6266 S  SG   . CYS F 1 60  ? 25.945 26.589 30.185  1.00 191.62 ? 60  CYS F SG   1 
ATOM   6267 N  N    . VAL F 1 61  ? 27.341 25.085 34.674  1.00 170.25 ? 61  VAL F N    1 
ATOM   6268 C  CA   . VAL F 1 61  ? 27.328 25.266 36.108  1.00 171.90 ? 61  VAL F CA   1 
ATOM   6269 C  C    . VAL F 1 61  ? 28.702 25.298 36.741  1.00 174.37 ? 61  VAL F C    1 
ATOM   6270 O  O    . VAL F 1 61  ? 28.847 25.649 37.909  1.00 173.11 ? 61  VAL F O    1 
ATOM   6271 C  CB   . VAL F 1 61  ? 26.263 24.466 36.855  1.00 178.83 ? 61  VAL F CB   1 
ATOM   6272 C  CG1  . VAL F 1 61  ? 26.895 23.677 38.003  1.00 179.14 ? 61  VAL F CG1  1 
ATOM   6273 C  CG2  . VAL F 1 61  ? 25.183 25.424 37.377  1.00 179.15 ? 61  VAL F CG2  1 
ATOM   6274 N  N    . ASP F 1 62  ? 29.722 25.028 35.936  1.00 170.24 ? 62  ASP F N    1 
ATOM   6275 C  CA   . ASP F 1 62  ? 31.091 25.133 36.411  1.00 170.37 ? 62  ASP F CA   1 
ATOM   6276 C  C    . ASP F 1 62  ? 31.555 26.554 36.105  1.00 169.70 ? 62  ASP F C    1 
ATOM   6277 O  O    . ASP F 1 62  ? 32.476 27.072 36.732  1.00 168.54 ? 62  ASP F O    1 
ATOM   6278 C  CB   . ASP F 1 62  ? 31.983 24.115 35.706  1.00 173.29 ? 62  ASP F CB   1 
ATOM   6279 C  CG   . ASP F 1 62  ? 31.231 22.863 35.315  1.00 187.77 ? 62  ASP F CG   1 
ATOM   6280 O  OD1  . ASP F 1 62  ? 30.015 22.793 35.590  1.00 188.87 ? 62  ASP F OD1  1 
ATOM   6281 O  OD2  . ASP F 1 62  ? 31.853 21.954 34.728  1.00 194.24 ? 62  ASP F OD2  1 
ATOM   6282 N  N    . ALA F 1 63  ? 30.869 27.187 35.158  1.00 165.83 ? 63  ALA F N    1 
ATOM   6283 C  CA   . ALA F 1 63  ? 31.185 28.546 34.734  1.00 164.79 ? 63  ALA F CA   1 
ATOM   6284 C  C    . ALA F 1 63  ? 30.454 29.628 35.523  1.00 167.13 ? 63  ALA F C    1 
ATOM   6285 O  O    . ALA F 1 63  ? 30.960 30.740 35.654  1.00 167.40 ? 63  ALA F O    1 
ATOM   6286 C  CB   . ALA F 1 63  ? 30.931 28.715 33.239  1.00 165.40 ? 63  ALA F CB   1 
ATOM   6287 N  N    . TYR F 1 64  ? 29.268 29.318 36.038  1.00 163.26 ? 64  TYR F N    1 
ATOM   6288 C  CA   . TYR F 1 64  ? 28.500 30.304 36.800  1.00 161.76 ? 64  TYR F CA   1 
ATOM   6289 C  C    . TYR F 1 64  ? 29.324 31.036 37.855  1.00 165.23 ? 64  TYR F C    1 
ATOM   6290 O  O    . TYR F 1 64  ? 29.455 32.263 37.822  1.00 164.35 ? 64  TYR F O    1 
ATOM   6291 C  CB   . TYR F 1 64  ? 27.274 29.678 37.463  1.00 162.36 ? 64  TYR F CB   1 
ATOM   6292 C  CG   . TYR F 1 64  ? 26.181 30.691 37.741  1.00 163.36 ? 64  TYR F CG   1 
ATOM   6293 C  CD1  . TYR F 1 64  ? 26.145 31.914 37.066  1.00 165.08 ? 64  TYR F CD1  1 
ATOM   6294 C  CD2  . TYR F 1 64  ? 25.189 30.435 38.677  1.00 163.88 ? 64  TYR F CD2  1 
ATOM   6295 C  CE1  . TYR F 1 64  ? 25.142 32.848 37.311  1.00 165.30 ? 64  TYR F CE1  1 
ATOM   6296 C  CE2  . TYR F 1 64  ? 24.179 31.365 38.924  1.00 164.55 ? 64  TYR F CE2  1 
ATOM   6297 C  CZ   . TYR F 1 64  ? 24.160 32.565 38.238  1.00 170.64 ? 64  TYR F CZ   1 
ATOM   6298 O  OH   . TYR F 1 64  ? 23.154 33.472 38.486  1.00 170.83 ? 64  TYR F OH   1 
ATOM   6299 N  N    . PRO F 1 65  ? 29.877 30.287 38.818  1.00 159.20 ? 65  PRO F N    1 
ATOM   6300 C  CA   . PRO F 1 65  ? 30.669 30.887 39.897  1.00 158.80 ? 65  PRO F CA   1 
ATOM   6301 C  C    . PRO F 1 65  ? 31.775 31.822 39.404  1.00 161.76 ? 65  PRO F C    1 
ATOM   6302 O  O    . PRO F 1 65  ? 31.763 33.022 39.691  1.00 160.89 ? 65  PRO F O    1 
ATOM   6303 C  CB   . PRO F 1 65  ? 31.271 29.669 40.607  1.00 160.44 ? 65  PRO F CB   1 
ATOM   6304 C  CG   . PRO F 1 65  ? 31.275 28.588 39.567  1.00 164.71 ? 65  PRO F CG   1 
ATOM   6305 C  CD   . PRO F 1 65  ? 30.033 28.823 38.762  1.00 159.90 ? 65  PRO F CD   1 
ATOM   6306 N  N    . THR F 1 66  ? 32.740 31.260 38.683  1.00 156.74 ? 66  THR F N    1 
ATOM   6307 C  CA   . THR F 1 66  ? 33.876 32.030 38.193  1.00 156.18 ? 66  THR F CA   1 
ATOM   6308 C  C    . THR F 1 66  ? 33.479 33.163 37.261  1.00 158.20 ? 66  THR F C    1 
ATOM   6309 O  O    . THR F 1 66  ? 34.312 33.971 36.866  1.00 157.62 ? 66  THR F O    1 
ATOM   6310 C  CB   . THR F 1 66  ? 34.983 31.137 37.601  1.00 163.29 ? 66  THR F CB   1 
ATOM   6311 O  OG1  . THR F 1 66  ? 34.795 29.790 38.043  1.00 162.61 ? 66  THR F OG1  1 
ATOM   6312 C  CG2  . THR F 1 66  ? 36.349 31.618 38.052  1.00 161.65 ? 66  THR F CG2  1 
ATOM   6313 N  N    . PHE F 1 67  ? 32.203 33.234 36.920  1.00 153.91 ? 67  PHE F N    1 
ATOM   6314 C  CA   . PHE F 1 67  ? 31.733 34.297 36.056  1.00 152.13 ? 67  PHE F CA   1 
ATOM   6315 C  C    . PHE F 1 67  ? 31.134 35.338 36.962  1.00 158.19 ? 67  PHE F C    1 
ATOM   6316 O  O    . PHE F 1 67  ? 31.451 36.518 36.864  1.00 158.56 ? 67  PHE F O    1 
ATOM   6317 C  CB   . PHE F 1 67  ? 30.669 33.765 35.106  1.00 151.32 ? 67  PHE F CB   1 
ATOM   6318 C  CG   . PHE F 1 67  ? 29.509 34.704 34.894  1.00 148.94 ? 67  PHE F CG   1 
ATOM   6319 C  CD1  . PHE F 1 67  ? 29.433 35.485 33.746  1.00 148.83 ? 67  PHE F CD1  1 
ATOM   6320 C  CD2  . PHE F 1 67  ? 28.453 34.747 35.793  1.00 147.67 ? 67  PHE F CD2  1 
ATOM   6321 C  CE1  . PHE F 1 67  ? 28.342 36.323 33.516  1.00 148.22 ? 67  PHE F CE1  1 
ATOM   6322 C  CE2  . PHE F 1 67  ? 27.363 35.589 35.575  1.00 148.76 ? 67  PHE F CE2  1 
ATOM   6323 C  CZ   . PHE F 1 67  ? 27.307 36.374 34.433  1.00 146.39 ? 67  PHE F CZ   1 
ATOM   6324 N  N    . LEU F 1 68  ? 30.281 34.876 37.867  1.00 152.17 ? 68  LEU F N    1 
ATOM   6325 C  CA   . LEU F 1 68  ? 29.629 35.756 38.813  1.00 151.38 ? 68  LEU F CA   1 
ATOM   6326 C  C    . LEU F 1 68  ? 30.700 36.540 39.532  1.00 157.60 ? 68  LEU F C    1 
ATOM   6327 O  O    . LEU F 1 68  ? 30.521 37.716 39.836  1.00 157.07 ? 68  LEU F O    1 
ATOM   6328 C  CB   . LEU F 1 68  ? 28.805 34.955 39.813  1.00 150.60 ? 68  LEU F CB   1 
ATOM   6329 C  CG   . LEU F 1 68  ? 27.395 35.512 39.988  1.00 153.93 ? 68  LEU F CG   1 
ATOM   6330 C  CD1  . LEU F 1 68  ? 27.216 36.723 39.088  1.00 153.66 ? 68  LEU F CD1  1 
ATOM   6331 C  CD2  . LEU F 1 68  ? 26.354 34.456 39.672  1.00 155.95 ? 68  LEU F CD2  1 
ATOM   6332 N  N    . ALA F 1 69  ? 31.831 35.889 39.775  1.00 153.83 ? 69  ALA F N    1 
ATOM   6333 C  CA   . ALA F 1 69  ? 32.940 36.556 40.436  1.00 154.58 ? 69  ALA F CA   1 
ATOM   6334 C  C    . ALA F 1 69  ? 33.263 37.858 39.704  1.00 155.74 ? 69  ALA F C    1 
ATOM   6335 O  O    . ALA F 1 69  ? 32.892 38.945 40.146  1.00 154.03 ? 69  ALA F O    1 
ATOM   6336 C  CB   . ALA F 1 69  ? 34.150 35.651 40.474  1.00 155.87 ? 69  ALA F CB   1 
ATOM   6337 N  N    . VAL F 1 70  ? 33.899 37.732 38.549  1.00 151.78 ? 70  VAL F N    1 
ATOM   6338 C  CA   . VAL F 1 70  ? 34.266 38.880 37.745  1.00 152.58 ? 70  VAL F CA   1 
ATOM   6339 C  C    . VAL F 1 70  ? 33.098 39.809 37.449  1.00 154.57 ? 70  VAL F C    1 
ATOM   6340 O  O    . VAL F 1 70  ? 33.296 40.993 37.191  1.00 154.08 ? 70  VAL F O    1 
ATOM   6341 C  CB   . VAL F 1 70  ? 34.920 38.414 36.457  1.00 158.18 ? 70  VAL F CB   1 
ATOM   6342 C  CG1  . VAL F 1 70  ? 35.828 37.236 36.752  1.00 158.25 ? 70  VAL F CG1  1 
ATOM   6343 C  CG2  . VAL F 1 70  ? 33.857 38.027 35.446  1.00 158.26 ? 70  VAL F CG2  1 
ATOM   6344 N  N    . LEU F 1 71  ? 31.883 39.275 37.450  1.00 152.50 ? 71  LEU F N    1 
ATOM   6345 C  CA   . LEU F 1 71  ? 30.711 40.097 37.141  1.00 152.99 ? 71  LEU F CA   1 
ATOM   6346 C  C    . LEU F 1 71  ? 30.556 41.213 38.144  1.00 153.42 ? 71  LEU F C    1 
ATOM   6347 O  O    . LEU F 1 71  ? 30.205 42.333 37.794  1.00 151.66 ? 71  LEU F O    1 
ATOM   6348 C  CB   . LEU F 1 71  ? 29.424 39.265 37.110  1.00 155.13 ? 71  LEU F CB   1 
ATOM   6349 C  CG   . LEU F 1 71  ? 28.194 39.886 36.419  1.00 164.15 ? 71  LEU F CG   1 
ATOM   6350 C  CD1  . LEU F 1 71  ? 26.930 39.768 37.276  1.00 165.76 ? 71  LEU F CD1  1 
ATOM   6351 C  CD2  . LEU F 1 71  ? 28.419 41.329 35.944  1.00 168.05 ? 71  LEU F CD2  1 
ATOM   6352 N  N    . TRP F 1 72  ? 30.791 40.898 39.403  1.00 149.61 ? 72  TRP F N    1 
ATOM   6353 C  CA   . TRP F 1 72  ? 30.623 41.891 40.428  1.00 150.83 ? 72  TRP F CA   1 
ATOM   6354 C  C    . TRP F 1 72  ? 31.907 42.615 40.700  1.00 154.57 ? 72  TRP F C    1 
ATOM   6355 O  O    . TRP F 1 72  ? 31.925 43.834 40.790  1.00 153.97 ? 72  TRP F O    1 
ATOM   6356 C  CB   . TRP F 1 72  ? 30.081 41.247 41.682  1.00 150.66 ? 72  TRP F CB   1 
ATOM   6357 C  CG   . TRP F 1 72  ? 28.729 40.682 41.459  1.00 152.34 ? 72  TRP F CG   1 
ATOM   6358 C  CD1  . TRP F 1 72  ? 28.430 39.509 40.842  1.00 155.36 ? 72  TRP F CD1  1 
ATOM   6359 C  CD2  . TRP F 1 72  ? 27.475 41.301 41.774  1.00 152.05 ? 72  TRP F CD2  1 
ATOM   6360 N  NE1  . TRP F 1 72  ? 27.067 39.330 40.796  1.00 154.51 ? 72  TRP F NE1  1 
ATOM   6361 C  CE2  . TRP F 1 72  ? 26.459 40.413 41.373  1.00 155.60 ? 72  TRP F CE2  1 
ATOM   6362 C  CE3  . TRP F 1 72  ? 27.113 42.505 42.381  1.00 152.95 ? 72  TRP F CE3  1 
ATOM   6363 C  CZ2  . TRP F 1 72  ? 25.108 40.695 41.550  1.00 154.54 ? 72  TRP F CZ2  1 
ATOM   6364 C  CZ3  . TRP F 1 72  ? 25.775 42.783 42.556  1.00 153.93 ? 72  TRP F CZ3  1 
ATOM   6365 C  CH2  . TRP F 1 72  ? 24.787 41.882 42.145  1.00 154.43 ? 72  TRP F CH2  1 
ATOM   6366 N  N    . SER F 1 73  ? 32.984 41.860 40.824  1.00 150.10 ? 73  SER F N    1 
ATOM   6367 C  CA   . SER F 1 73  ? 34.275 42.457 41.087  1.00 150.20 ? 73  SER F CA   1 
ATOM   6368 C  C    . SER F 1 73  ? 34.517 43.560 40.080  1.00 154.53 ? 73  SER F C    1 
ATOM   6369 O  O    . SER F 1 73  ? 35.055 44.613 40.411  1.00 154.19 ? 73  SER F O    1 
ATOM   6370 C  CB   . SER F 1 73  ? 35.365 41.402 40.996  1.00 153.92 ? 73  SER F CB   1 
ATOM   6371 O  OG   . SER F 1 73  ? 35.239 40.486 42.069  1.00 162.86 ? 73  SER F OG   1 
ATOM   6372 N  N    . ALA F 1 74  ? 34.049 43.336 38.859  1.00 150.84 ? 74  ALA F N    1 
ATOM   6373 C  CA   . ALA F 1 74  ? 34.187 44.327 37.800  1.00 150.53 ? 74  ALA F CA   1 
ATOM   6374 C  C    . ALA F 1 74  ? 32.982 45.243 37.813  1.00 153.73 ? 74  ALA F C    1 
ATOM   6375 O  O    . ALA F 1 74  ? 32.871 46.141 36.985  1.00 153.03 ? 74  ALA F O    1 
ATOM   6376 C  CB   . ALA F 1 74  ? 34.307 43.656 36.453  1.00 151.29 ? 74  ALA F CB   1 
ATOM   6377 N  N    . GLY F 1 75  ? 32.069 44.993 38.744  1.00 151.14 ? 75  GLY F N    1 
ATOM   6378 C  CA   . GLY F 1 75  ? 30.859 45.783 38.875  1.00 151.22 ? 75  GLY F CA   1 
ATOM   6379 C  C    . GLY F 1 75  ? 30.959 46.820 39.976  1.00 155.96 ? 75  GLY F C    1 
ATOM   6380 O  O    . GLY F 1 75  ? 30.352 47.888 39.896  1.00 155.26 ? 75  GLY F O    1 
ATOM   6381 N  N    . LEU F 1 76  ? 31.722 46.497 41.016  1.00 153.42 ? 76  LEU F N    1 
ATOM   6382 C  CA   . LEU F 1 76  ? 31.937 47.423 42.121  1.00 153.26 ? 76  LEU F CA   1 
ATOM   6383 C  C    . LEU F 1 76  ? 33.303 48.079 41.973  1.00 159.64 ? 76  LEU F C    1 
ATOM   6384 O  O    . LEU F 1 76  ? 33.416 49.309 41.944  1.00 159.67 ? 76  LEU F O    1 
ATOM   6385 C  CB   . LEU F 1 76  ? 31.828 46.710 43.462  1.00 152.02 ? 76  LEU F CB   1 
ATOM   6386 C  CG   . LEU F 1 76  ? 30.442 46.110 43.592  1.00 153.48 ? 76  LEU F CG   1 
ATOM   6387 C  CD1  . LEU F 1 76  ? 29.475 46.977 42.821  1.00 152.52 ? 76  LEU F CD1  1 
ATOM   6388 C  CD2  . LEU F 1 76  ? 30.484 44.732 43.004  1.00 154.82 ? 76  LEU F CD2  1 
ATOM   6389 N  N    . LEU F 1 77  ? 34.335 47.254 41.839  1.00 158.27 ? 77  LEU F N    1 
ATOM   6390 C  CA   . LEU F 1 77  ? 35.681 47.769 41.660  1.00 157.12 ? 77  LEU F CA   1 
ATOM   6391 C  C    . LEU F 1 77  ? 35.842 48.525 40.340  1.00 166.33 ? 77  LEU F C    1 
ATOM   6392 O  O    . LEU F 1 77  ? 36.957 48.899 39.975  1.00 167.51 ? 77  LEU F O    1 
ATOM   6393 C  CB   . LEU F 1 77  ? 36.701 46.636 41.750  1.00 154.70 ? 77  LEU F CB   1 
ATOM   6394 C  CG   . LEU F 1 77  ? 36.996 46.159 43.167  1.00 154.69 ? 77  LEU F CG   1 
ATOM   6395 C  CD1  . LEU F 1 77  ? 35.686 45.919 43.896  1.00 153.32 ? 77  LEU F CD1  1 
ATOM   6396 C  CD2  . LEU F 1 77  ? 37.878 44.913 43.161  1.00 155.62 ? 77  LEU F CD2  1 
ATOM   6397 N  N    . CYS F 1 78  ? 34.732 48.776 39.644  1.00 166.55 ? 78  CYS F N    1 
ATOM   6398 C  CA   . CYS F 1 78  ? 34.787 49.457 38.353  1.00 167.52 ? 78  CYS F CA   1 
ATOM   6399 C  C    . CYS F 1 78  ? 33.433 49.451 37.637  1.00 171.18 ? 78  CYS F C    1 
ATOM   6400 O  O    . CYS F 1 78  ? 32.858 48.384 37.415  1.00 170.32 ? 78  CYS F O    1 
ATOM   6401 C  CB   . CYS F 1 78  ? 35.814 48.741 37.476  1.00 169.51 ? 78  CYS F CB   1 
ATOM   6402 S  SG   . CYS F 1 78  ? 36.035 49.447 35.857  1.00 173.95 ? 78  CYS F SG   1 
ATOM   6403 N  N    . SER F 1 79  ? 32.961 50.637 37.246  1.00 169.87 ? 79  SER F N    1 
ATOM   6404 C  CA   . SER F 1 79  ? 31.679 50.824 36.535  1.00 169.74 ? 79  SER F CA   1 
ATOM   6405 C  C    . SER F 1 79  ? 30.629 49.697 36.522  1.00 171.32 ? 79  SER F C    1 
ATOM   6406 O  O    . SER F 1 79  ? 30.841 48.618 35.954  1.00 171.94 ? 79  SER F O    1 
ATOM   6407 C  CB   . SER F 1 79  ? 31.889 51.391 35.134  1.00 173.49 ? 79  SER F CB   1 
ATOM   6408 O  OG   . SER F 1 79  ? 32.547 50.447 34.315  1.00 182.16 ? 79  SER F OG   1 
ATOM   6409 N  N    . GLN F 1 80  ? 29.479 49.983 37.125  1.00 171.07 ? 80  GLN F N    1 
ATOM   6410 C  CA   . GLN F 1 80  ? 28.386 49.020 37.222  1.00 169.21 ? 80  GLN F CA   1 
ATOM   6411 C  C    . GLN F 1 80  ? 27.643 48.850 35.894  1.00 168.83 ? 80  GLN F C    1 
ATOM   6412 O  O    . GLN F 1 80  ? 26.774 47.986 35.758  1.00 165.09 ? 80  GLN F O    1 
ATOM   6413 C  CB   . GLN F 1 80  ? 27.416 49.446 38.333  1.00 171.25 ? 80  GLN F CB   1 
ATOM   6414 C  CG   . GLN F 1 80  ? 26.114 48.669 38.377  1.00 195.01 ? 80  GLN F CG   1 
ATOM   6415 C  CD   . GLN F 1 80  ? 24.933 49.549 38.711  1.00 220.98 ? 80  GLN F CD   1 
ATOM   6416 O  OE1  . GLN F 1 80  ? 24.941 50.750 38.443  1.00 217.47 ? 80  GLN F OE1  1 
ATOM   6417 N  NE2  . GLN F 1 80  ? 23.903 48.952 39.291  1.00 214.14 ? 80  GLN F NE2  1 
ATOM   6418 N  N    . VAL F 1 81  ? 28.003 49.667 34.912  1.00 164.24 ? 81  VAL F N    1 
ATOM   6419 C  CA   . VAL F 1 81  ? 27.357 49.638 33.610  1.00 164.98 ? 81  VAL F CA   1 
ATOM   6420 C  C    . VAL F 1 81  ? 27.993 48.620 32.671  1.00 170.98 ? 81  VAL F C    1 
ATOM   6421 O  O    . VAL F 1 81  ? 27.352 47.667 32.233  1.00 170.20 ? 81  VAL F O    1 
ATOM   6422 C  CB   . VAL F 1 81  ? 27.359 51.048 32.992  1.00 166.48 ? 81  VAL F CB   1 
ATOM   6423 C  CG1  . VAL F 1 81  ? 28.306 51.961 33.775  1.00 165.84 ? 81  VAL F CG1  1 
ATOM   6424 C  CG2  . VAL F 1 81  ? 27.742 51.001 31.517  1.00 165.84 ? 81  VAL F CG2  1 
ATOM   6425 N  N    . PRO F 1 82  ? 29.267 48.826 32.333  1.00 169.90 ? 82  PRO F N    1 
ATOM   6426 C  CA   . PRO F 1 82  ? 29.944 47.907 31.420  1.00 169.18 ? 82  PRO F CA   1 
ATOM   6427 C  C    . PRO F 1 82  ? 29.926 46.522 32.010  1.00 170.33 ? 82  PRO F C    1 
ATOM   6428 O  O    . PRO F 1 82  ? 29.622 45.543 31.329  1.00 168.53 ? 82  PRO F O    1 
ATOM   6429 C  CB   . PRO F 1 82  ? 31.383 48.427 31.409  1.00 171.55 ? 82  PRO F CB   1 
ATOM   6430 C  CG   . PRO F 1 82  ? 31.294 49.823 31.932  1.00 177.13 ? 82  PRO F CG   1 
ATOM   6431 C  CD   . PRO F 1 82  ? 30.203 49.781 32.939  1.00 172.11 ? 82  PRO F CD   1 
ATOM   6432 N  N    . ALA F 1 83  ? 30.253 46.458 33.294  1.00 169.60 ? 83  ALA F N    1 
ATOM   6433 C  CA   . ALA F 1 83  ? 30.280 45.197 34.017  1.00 170.63 ? 83  ALA F CA   1 
ATOM   6434 C  C    . ALA F 1 83  ? 28.951 44.460 33.844  1.00 171.58 ? 83  ALA F C    1 
ATOM   6435 O  O    . ALA F 1 83  ? 28.928 43.257 33.574  1.00 170.18 ? 83  ALA F O    1 
ATOM   6436 C  CB   . ALA F 1 83  ? 30.574 45.444 35.495  1.00 172.02 ? 83  ALA F CB   1 
ATOM   6437 N  N    . ALA F 1 84  ? 27.850 45.194 33.988  1.00 168.78 ? 84  ALA F N    1 
ATOM   6438 C  CA   . ALA F 1 84  ? 26.520 44.616 33.845  1.00 168.67 ? 84  ALA F CA   1 
ATOM   6439 C  C    . ALA F 1 84  ? 26.190 44.256 32.392  1.00 172.99 ? 84  ALA F C    1 
ATOM   6440 O  O    . ALA F 1 84  ? 25.468 43.290 32.141  1.00 172.32 ? 84  ALA F O    1 
ATOM   6441 C  CB   . ALA F 1 84  ? 25.454 45.537 34.445  1.00 169.34 ? 84  ALA F CB   1 
ATOM   6442 N  N    . PHE F 1 85  ? 26.722 45.011 31.433  1.00 169.33 ? 85  PHE F N    1 
ATOM   6443 C  CA   . PHE F 1 85  ? 26.459 44.688 30.038  1.00 171.33 ? 85  PHE F CA   1 
ATOM   6444 C  C    . PHE F 1 85  ? 27.236 43.446 29.669  1.00 167.75 ? 85  PHE F C    1 
ATOM   6445 O  O    . PHE F 1 85  ? 26.675 42.486 29.150  1.00 165.29 ? 85  PHE F O    1 
ATOM   6446 C  CB   . PHE F 1 85  ? 26.854 45.821 29.094  1.00 178.10 ? 85  PHE F CB   1 
ATOM   6447 C  CG   . PHE F 1 85  ? 26.674 45.483 27.627  1.00 186.53 ? 85  PHE F CG   1 
ATOM   6448 C  CD1  . PHE F 1 85  ? 27.445 44.498 27.011  1.00 194.77 ? 85  PHE F CD1  1 
ATOM   6449 C  CD2  . PHE F 1 85  ? 25.745 46.162 26.854  1.00 194.10 ? 85  PHE F CD2  1 
ATOM   6450 C  CE1  . PHE F 1 85  ? 27.269 44.177 25.674  1.00 197.90 ? 85  PHE F CE1  1 
ATOM   6451 C  CE2  . PHE F 1 85  ? 25.585 45.860 25.503  1.00 199.41 ? 85  PHE F CE2  1 
ATOM   6452 C  CZ   . PHE F 1 85  ? 26.346 44.865 24.917  1.00 198.13 ? 85  PHE F CZ   1 
ATOM   6453 N  N    . ALA F 1 86  ? 28.549 43.512 29.847  1.00 165.77 ? 86  ALA F N    1 
ATOM   6454 C  CA   . ALA F 1 86  ? 29.421 42.393 29.517  1.00 166.37 ? 86  ALA F CA   1 
ATOM   6455 C  C    . ALA F 1 86  ? 28.831 41.116 30.093  1.00 169.70 ? 86  ALA F C    1 
ATOM   6456 O  O    . ALA F 1 86  ? 28.800 40.077 29.433  1.00 168.56 ? 86  ALA F O    1 
ATOM   6457 C  CB   . ALA F 1 86  ? 30.809 42.631 30.083  1.00 167.41 ? 86  ALA F CB   1 
ATOM   6458 N  N    . GLY F 1 87  ? 28.322 41.221 31.317  1.00 167.50 ? 87  GLY F N    1 
ATOM   6459 C  CA   . GLY F 1 87  ? 27.693 40.112 32.008  1.00 167.88 ? 87  GLY F CA   1 
ATOM   6460 C  C    . GLY F 1 87  ? 26.422 39.690 31.299  1.00 172.55 ? 87  GLY F C    1 
ATOM   6461 O  O    . GLY F 1 87  ? 25.979 38.547 31.429  1.00 172.21 ? 87  GLY F O    1 
ATOM   6462 N  N    . LEU F 1 88  ? 25.848 40.618 30.535  1.00 169.26 ? 88  LEU F N    1 
ATOM   6463 C  CA   . LEU F 1 88  ? 24.639 40.357 29.753  1.00 168.66 ? 88  LEU F CA   1 
ATOM   6464 C  C    . LEU F 1 88  ? 24.962 39.484 28.538  1.00 169.01 ? 88  LEU F C    1 
ATOM   6465 O  O    . LEU F 1 88  ? 24.234 38.539 28.232  1.00 167.64 ? 88  LEU F O    1 
ATOM   6466 C  CB   . LEU F 1 88  ? 24.017 41.672 29.264  1.00 169.10 ? 88  LEU F CB   1 
ATOM   6467 C  CG   . LEU F 1 88  ? 23.304 41.672 27.903  1.00 174.25 ? 88  LEU F CG   1 
ATOM   6468 C  CD1  . LEU F 1 88  ? 24.235 41.654 26.668  1.00 174.54 ? 88  LEU F CD1  1 
ATOM   6469 C  CD2  . LEU F 1 88  ? 22.290 40.549 27.854  1.00 176.85 ? 88  LEU F CD2  1 
ATOM   6470 N  N    . MET F 1 89  ? 26.017 39.838 27.808  1.00 166.78 ? 89  MET F N    1 
ATOM   6471 C  CA   . MET F 1 89  ? 26.374 39.070 26.631  1.00 166.78 ? 89  MET F CA   1 
ATOM   6472 C  C    . MET F 1 89  ? 26.805 37.670 27.027  1.00 166.78 ? 89  MET F C    1 
ATOM   6473 O  O    . MET F 1 89  ? 26.518 36.704 26.324  1.00 247.30 ? 89  MET F O    1 
ATOM   6474 C  CB   . MET F 1 89  ? 27.420 39.790 25.792  1.00 166.78 ? 89  MET F CB   1 
ATOM   6475 C  CG   . MET F 1 89  ? 26.872 41.033 25.078  1.00 166.78 ? 89  MET F CG   1 
ATOM   6476 S  SD   . MET F 1 89  ? 27.072 41.081 23.236  1.00 166.78 ? 89  MET F SD   1 
ATOM   6477 C  CE   . MET F 1 89  ? 28.769 40.324 22.954  1.00 166.78 ? 89  MET F CE   1 
ATOM   6478 N  N    . TYR F 1 90  ? 27.427 37.554 28.193  1.00 165.07 ? 90  TYR F N    1 
ATOM   6479 C  CA   . TYR F 1 90  ? 27.827 36.253 28.704  1.00 165.34 ? 90  TYR F CA   1 
ATOM   6480 C  C    . TYR F 1 90  ? 26.597 35.360 28.806  1.00 175.63 ? 90  TYR F C    1 
ATOM   6481 O  O    . TYR F 1 90  ? 26.680 34.144 28.639  1.00 176.37 ? 90  TYR F O    1 
ATOM   6482 C  CB   . TYR F 1 90  ? 28.476 36.386 30.077  1.00 162.61 ? 90  TYR F CB   1 
ATOM   6483 C  CG   . TYR F 1 90  ? 28.991 35.071 30.623  1.00 155.75 ? 90  TYR F CG   1 
ATOM   6484 C  CD1  . TYR F 1 90  ? 28.146 34.196 31.304  1.00 156.07 ? 90  TYR F CD1  1 
ATOM   6485 C  CD2  . TYR F 1 90  ? 30.318 34.690 30.434  1.00 153.83 ? 90  TYR F CD2  1 
ATOM   6486 C  CE1  . TYR F 1 90  ? 28.621 32.980 31.807  1.00 154.84 ? 90  TYR F CE1  1 
ATOM   6487 C  CE2  . TYR F 1 90  ? 30.808 33.482 30.937  1.00 153.53 ? 90  TYR F CE2  1 
ATOM   6488 C  CZ   . TYR F 1 90  ? 29.956 32.631 31.623  1.00 158.62 ? 90  TYR F CZ   1 
ATOM   6489 O  OH   . TYR F 1 90  ? 30.442 31.434 32.118  1.00 158.26 ? 90  TYR F OH   1 
ATOM   6490 N  N    . LEU F 1 91  ? 25.454 35.978 29.085  1.00 173.72 ? 91  LEU F N    1 
ATOM   6491 C  CA   . LEU F 1 91  ? 24.188 35.258 29.199  1.00 173.04 ? 91  LEU F CA   1 
ATOM   6492 C  C    . LEU F 1 91  ? 23.701 34.872 27.793  1.00 175.61 ? 91  LEU F C    1 
ATOM   6493 O  O    . LEU F 1 91  ? 22.843 33.996 27.624  1.00 174.53 ? 91  LEU F O    1 
ATOM   6494 C  CB   . LEU F 1 91  ? 23.144 36.127 29.924  1.00 172.83 ? 91  LEU F CB   1 
ATOM   6495 C  CG   . LEU F 1 91  ? 22.987 36.020 31.450  1.00 176.94 ? 91  LEU F CG   1 
ATOM   6496 C  CD1  . LEU F 1 91  ? 23.735 34.833 32.030  1.00 176.90 ? 91  LEU F CD1  1 
ATOM   6497 C  CD2  . LEU F 1 91  ? 23.383 37.310 32.150  1.00 179.21 ? 91  LEU F CD2  1 
ATOM   6498 N  N    . PHE F 1 92  ? 24.281 35.518 26.786  1.00 175.35 ? 92  PHE F N    1 
ATOM   6499 C  CA   . PHE F 1 92  ? 23.938 35.234 25.402  1.00 177.68 ? 92  PHE F CA   1 
ATOM   6500 C  C    . PHE F 1 92  ? 24.795 34.107 24.875  1.00 173.62 ? 92  PHE F C    1 
ATOM   6501 O  O    . PHE F 1 92  ? 24.314 33.211 24.189  1.00 171.18 ? 92  PHE F O    1 
ATOM   6502 C  CB   . PHE F 1 92  ? 24.115 36.479 24.556  1.00 185.01 ? 92  PHE F CB   1 
ATOM   6503 C  CG   . PHE F 1 92  ? 22.975 37.428 24.678  1.00 194.15 ? 92  PHE F CG   1 
ATOM   6504 C  CD1  . PHE F 1 92  ? 21.857 37.071 25.423  1.00 202.95 ? 92  PHE F CD1  1 
ATOM   6505 C  CD2  . PHE F 1 92  ? 23.012 38.666 24.063  1.00 202.03 ? 92  PHE F CD2  1 
ATOM   6506 C  CE1  . PHE F 1 92  ? 20.790 37.926 25.549  1.00 206.21 ? 92  PHE F CE1  1 
ATOM   6507 C  CE2  . PHE F 1 92  ? 21.946 39.535 24.177  1.00 207.48 ? 92  PHE F CE2  1 
ATOM   6508 C  CZ   . PHE F 1 92  ? 20.827 39.163 24.922  1.00 206.31 ? 92  PHE F CZ   1 
ATOM   6509 N  N    . VAL F 1 93  ? 26.070 34.150 25.223  1.00 171.04 ? 93  VAL F N    1 
ATOM   6510 C  CA   . VAL F 1 93  ? 26.988 33.103 24.842  1.00 170.77 ? 93  VAL F CA   1 
ATOM   6511 C  C    . VAL F 1 93  ? 26.510 31.821 25.491  1.00 176.20 ? 93  VAL F C    1 
ATOM   6512 O  O    . VAL F 1 93  ? 26.483 30.767 24.860  1.00 175.80 ? 93  VAL F O    1 
ATOM   6513 C  CB   . VAL F 1 93  ? 28.372 33.423 25.352  1.00 173.49 ? 93  VAL F CB   1 
ATOM   6514 C  CG1  . VAL F 1 93  ? 29.385 32.440 24.795  1.00 173.08 ? 93  VAL F CG1  1 
ATOM   6515 C  CG2  . VAL F 1 93  ? 28.720 34.858 25.024  1.00 173.09 ? 93  VAL F CG2  1 
ATOM   6516 N  N    . ARG F 1 94  ? 26.158 31.922 26.771  1.00 174.79 ? 94  ARG F N    1 
ATOM   6517 C  CA   . ARG F 1 94  ? 25.675 30.780 27.540  1.00 175.58 ? 94  ARG F CA   1 
ATOM   6518 C  C    . ARG F 1 94  ? 24.522 30.123 26.815  1.00 183.67 ? 94  ARG F C    1 
ATOM   6519 O  O    . ARG F 1 94  ? 24.429 28.895 26.740  1.00 183.73 ? 94  ARG F O    1 
ATOM   6520 C  CB   . ARG F 1 94  ? 25.199 31.229 28.918  1.00 174.39 ? 94  ARG F CB   1 
ATOM   6521 C  CG   . ARG F 1 94  ? 26.316 31.503 29.904  1.00 180.04 ? 94  ARG F CG   1 
ATOM   6522 C  CD   . ARG F 1 94  ? 26.250 30.557 31.094  1.00 181.76 ? 94  ARG F CD   1 
ATOM   6523 N  NE   . ARG F 1 94  ? 24.925 30.558 31.704  1.00 181.23 ? 94  ARG F NE   1 
ATOM   6524 C  CZ   . ARG F 1 94  ? 24.631 29.983 32.865  1.00 188.99 ? 94  ARG F CZ   1 
ATOM   6525 N  NH1  . ARG F 1 94  ? 25.576 29.352 33.550  1.00 174.82 ? 94  ARG F NH1  1 
ATOM   6526 N  NH2  . ARG F 1 94  ? 23.390 30.041 33.338  1.00 174.23 ? 94  ARG F NH2  1 
ATOM   6527 N  N    . GLN F 1 95  ? 23.635 30.958 26.287  1.00 184.20 ? 95  GLN F N    1 
ATOM   6528 C  CA   . GLN F 1 95  ? 22.479 30.478 25.544  1.00 185.67 ? 95  GLN F CA   1 
ATOM   6529 C  C    . GLN F 1 95  ? 22.913 29.777 24.260  1.00 190.25 ? 95  GLN F C    1 
ATOM   6530 O  O    . GLN F 1 95  ? 22.503 28.648 23.990  1.00 189.45 ? 95  GLN F O    1 
ATOM   6531 C  CB   . GLN F 1 95  ? 21.530 31.634 25.212  1.00 187.75 ? 95  GLN F CB   1 
ATOM   6532 C  CG   . GLN F 1 95  ? 20.067 31.222 25.108  1.00 206.22 ? 95  GLN F CG   1 
ATOM   6533 C  CD   . GLN F 1 95  ? 19.816 29.807 25.608  1.00 227.23 ? 95  GLN F CD   1 
ATOM   6534 O  OE1  . GLN F 1 95  ? 19.906 29.530 26.806  1.00 222.99 ? 95  GLN F OE1  1 
ATOM   6535 N  NE2  . GLN F 1 95  ? 19.477 28.910 24.690  1.00 219.63 ? 95  GLN F NE2  1 
ATOM   6536 N  N    . LYS F 1 96  ? 23.751 30.448 23.476  1.00 189.96 ? 96  LYS F N    1 
ATOM   6537 C  CA   . LYS F 1 96  ? 24.214 29.899 22.207  1.00 190.30 ? 96  LYS F CA   1 
ATOM   6538 C  C    . LYS F 1 96  ? 25.222 28.765 22.331  1.00 189.57 ? 96  LYS F C    1 
ATOM   6539 O  O    . LYS F 1 96  ? 25.491 28.063 21.362  1.00 187.59 ? 96  LYS F O    1 
ATOM   6540 C  CB   . LYS F 1 96  ? 24.724 31.002 21.285  1.00 195.50 ? 96  LYS F CB   1 
ATOM   6541 C  CG   . LYS F 1 96  ? 23.611 31.829 20.651  1.00 230.95 ? 96  LYS F CG   1 
ATOM   6542 C  CD   . LYS F 1 96  ? 22.465 32.069 21.627  1.00 251.63 ? 96  LYS F CD   1 
ATOM   6543 C  CE   . LYS F 1 96  ? 21.247 31.237 21.271  1.00 270.13 ? 96  LYS F CE   1 
ATOM   6544 N  NZ   . LYS F 1 96  ? 19.986 31.924 21.655  1.00 281.51 ? 96  LYS F NZ   1 
ATOM   6545 N  N    . TYR F 1 97  ? 25.762 28.575 23.528  1.00 191.64 ? 97  TYR F N    1 
ATOM   6546 C  CA   . TYR F 1 97  ? 26.691 27.483 23.764  1.00 190.93 ? 97  TYR F CA   1 
ATOM   6547 C  C    . TYR F 1 97  ? 25.887 26.305 24.256  1.00 199.38 ? 97  TYR F C    1 
ATOM   6548 O  O    . TYR F 1 97  ? 26.049 25.186 23.779  1.00 199.48 ? 97  TYR F O    1 
ATOM   6549 C  CB   . TYR F 1 97  ? 27.706 27.854 24.834  1.00 188.27 ? 97  TYR F CB   1 
ATOM   6550 C  CG   . TYR F 1 97  ? 28.414 26.661 25.453  1.00 183.04 ? 97  TYR F CG   1 
ATOM   6551 C  CD1  . TYR F 1 97  ? 28.945 25.644 24.664  1.00 183.65 ? 97  TYR F CD1  1 
ATOM   6552 C  CD2  . TYR F 1 97  ? 28.590 26.574 26.826  1.00 181.83 ? 97  TYR F CD2  1 
ATOM   6553 C  CE1  . TYR F 1 97  ? 29.624 24.564 25.235  1.00 182.75 ? 97  TYR F CE1  1 
ATOM   6554 C  CE2  . TYR F 1 97  ? 29.262 25.501 27.404  1.00 181.81 ? 97  TYR F CE2  1 
ATOM   6555 C  CZ   . TYR F 1 97  ? 29.775 24.504 26.609  1.00 186.86 ? 97  TYR F CZ   1 
ATOM   6556 O  OH   . TYR F 1 97  ? 30.426 23.451 27.213  1.00 186.48 ? 97  TYR F OH   1 
ATOM   6557 N  N    . PHE F 1 98  ? 25.013 26.567 25.218  1.00 199.36 ? 98  PHE F N    1 
ATOM   6558 C  CA   . PHE F 1 98  ? 24.169 25.525 25.774  1.00 197.59 ? 98  PHE F CA   1 
ATOM   6559 C  C    . PHE F 1 98  ? 23.149 25.038 24.756  1.00 213.27 ? 98  PHE F C    1 
ATOM   6560 O  O    . PHE F 1 98  ? 22.465 24.035 24.967  1.00 215.06 ? 98  PHE F O    1 
ATOM   6561 C  CB   . PHE F 1 98  ? 23.426 26.046 26.990  1.00 192.66 ? 98  PHE F CB   1 
ATOM   6562 C  CG   . PHE F 1 98  ? 22.522 25.028 27.604  1.00 183.86 ? 98  PHE F CG   1 
ATOM   6563 C  CD1  . PHE F 1 98  ? 23.053 23.972 28.335  1.00 178.45 ? 98  PHE F CD1  1 
ATOM   6564 C  CD2  . PHE F 1 98  ? 21.157 25.070 27.377  1.00 177.24 ? 98  PHE F CD2  1 
ATOM   6565 C  CE1  . PHE F 1 98  ? 22.235 23.010 28.888  1.00 175.48 ? 98  PHE F CE1  1 
ATOM   6566 C  CE2  . PHE F 1 98  ? 20.327 24.110 27.924  1.00 175.69 ? 98  PHE F CE2  1 
ATOM   6567 C  CZ   . PHE F 1 98  ? 20.865 23.078 28.681  1.00 172.53 ? 98  PHE F CZ   1 
ATOM   6568 N  N    . VAL F 1 99  ? 23.028 25.776 23.662  1.00 209.42 ? 99  VAL F N    1 
ATOM   6569 C  CA   . VAL F 1 99  ? 22.084 25.421 22.618  1.00 205.97 ? 99  VAL F CA   1 
ATOM   6570 C  C    . VAL F 1 99  ? 22.734 24.525 21.570  1.00 223.30 ? 99  VAL F C    1 
ATOM   6571 O  O    . VAL F 1 99  ? 22.234 23.438 21.287  1.00 225.36 ? 99  VAL F O    1 
ATOM   6572 C  CB   . VAL F 1 99  ? 21.435 26.667 22.003  1.00 197.37 ? 99  VAL F CB   1 
ATOM   6573 C  CG1  . VAL F 1 99  ? 21.875 26.849 20.561  1.00 195.06 ? 99  VAL F CG1  1 
ATOM   6574 C  CG2  . VAL F 1 99  ? 19.923 26.585 22.114  1.00 195.07 ? 99  VAL F CG2  1 
ATOM   6575 N  N    . GLY F 1 100 ? 23.863 24.970 21.025  1.00 218.35 ? 100 GLY F N    1 
ATOM   6576 C  CA   . GLY F 1 100 ? 24.599 24.222 20.024  1.00 219.12 ? 100 GLY F CA   1 
ATOM   6577 C  C    . GLY F 1 100 ? 25.117 22.915 20.583  1.00 225.72 ? 100 GLY F C    1 
ATOM   6578 O  O    . GLY F 1 100 ? 25.406 21.971 19.852  1.00 225.58 ? 100 GLY F O    1 
ATOM   6579 N  N    . TYR F 1 101 ? 25.234 22.860 21.899  1.00 219.91 ? 101 TYR F N    1 
ATOM   6580 C  CA   . TYR F 1 101 ? 25.702 21.654 22.544  1.00 219.81 ? 101 TYR F CA   1 
ATOM   6581 C  C    . TYR F 1 101 ? 24.539 20.687 22.747  1.00 236.29 ? 101 TYR F C    1 
ATOM   6582 O  O    . TYR F 1 101 ? 24.386 20.069 23.800  1.00 238.23 ? 101 TYR F O    1 
ATOM   6583 C  CB   . TYR F 1 101 ? 26.416 21.982 23.848  1.00 214.54 ? 101 TYR F CB   1 
ATOM   6584 C  CG   . TYR F 1 101 ? 27.239 20.833 24.331  1.00 205.25 ? 101 TYR F CG   1 
ATOM   6585 C  CD1  . TYR F 1 101 ? 27.794 19.941 23.429  1.00 205.27 ? 101 TYR F CD1  1 
ATOM   6586 C  CD2  . TYR F 1 101 ? 27.389 20.582 25.684  1.00 202.82 ? 101 TYR F CD2  1 
ATOM   6587 C  CE1  . TYR F 1 101 ? 28.505 18.846 23.862  1.00 203.73 ? 101 TYR F CE1  1 
ATOM   6588 C  CE2  . TYR F 1 101 ? 28.087 19.485 26.136  1.00 202.33 ? 101 TYR F CE2  1 
ATOM   6589 C  CZ   . TYR F 1 101 ? 28.644 18.615 25.220  1.00 206.99 ? 101 TYR F CZ   1 
ATOM   6590 O  OH   . TYR F 1 101 ? 29.351 17.514 25.650  1.00 206.36 ? 101 TYR F OH   1 
ATOM   6591 N  N    . LEU F 1 102 ? 23.721 20.574 21.707  1.00 237.58 ? 102 LEU F N    1 
ATOM   6592 C  CA   . LEU F 1 102 ? 22.568 19.686 21.705  1.00 240.54 ? 102 LEU F CA   1 
ATOM   6593 C  C    . LEU F 1 102 ? 22.120 19.479 20.261  1.00 239.34 ? 102 LEU F C    1 
ATOM   6594 O  O    . LEU F 1 102 ? 20.978 19.767 19.895  1.00 237.55 ? 102 LEU F O    1 
ATOM   6595 C  CB   . LEU F 1 102 ? 21.437 20.266 22.552  1.00 244.57 ? 102 LEU F CB   1 
ATOM   6596 C  CG   . LEU F 1 102 ? 21.129 19.492 23.835  1.00 256.34 ? 102 LEU F CG   1 
ATOM   6597 C  CD1  . LEU F 1 102 ? 19.644 19.545 24.123  1.00 258.76 ? 102 LEU F CD1  1 
ATOM   6598 C  CD2  . LEU F 1 102 ? 21.604 18.047 23.733  1.00 261.06 ? 102 LEU F CD2  1 
ATOM   6599 N  N    . GLY F 1 103 ? 23.055 19.012 19.441  1.00 240.97 ? 103 GLY F N    1 
ATOM   6600 C  CA   . GLY F 1 103 ? 22.837 18.749 18.032  1.00 240.02 ? 103 GLY F CA   1 
ATOM   6601 C  C    . GLY F 1 103 ? 23.801 17.666 17.594  1.00 240.34 ? 103 GLY F C    1 
ATOM   6602 O  O    . GLY F 1 103 ? 24.070 16.736 18.356  1.00 238.75 ? 103 GLY F O    1 
ATOM   6603 N  N    . GLU F 1 104 ? 24.350 17.795 16.390  1.00 241.40 ? 104 GLU F N    1 
ATOM   6604 C  CA   . GLU F 1 104 ? 25.294 16.799 15.889  1.00 242.47 ? 104 GLU F CA   1 
ATOM   6605 C  C    . GLU F 1 104 ? 26.727 17.317 15.773  1.00 253.40 ? 104 GLU F C    1 
ATOM   6606 O  O    . GLU F 1 104 ? 27.460 16.908 14.869  1.00 254.44 ? 104 GLU F O    1 
ATOM   6607 C  CB   . GLU F 1 104 ? 24.824 16.223 14.550  1.00 243.29 ? 104 GLU F CB   1 
ATOM   6608 C  CG   . GLU F 1 104 ? 25.444 14.871 14.205  1.00 249.33 ? 104 GLU F CG   1 
ATOM   6609 C  CD   . GLU F 1 104 ? 25.201 13.816 15.278  1.00 258.36 ? 104 GLU F CD   1 
ATOM   6610 O  OE1  . GLU F 1 104 ? 26.027 13.704 16.211  1.00 249.32 ? 104 GLU F OE1  1 
ATOM   6611 O  OE2  . GLU F 1 104 ? 24.190 13.090 15.180  1.00 249.06 ? 104 GLU F OE2  1 
ATOM   6612 N  N    . ARG F 1 105 ? 27.125 18.176 16.714  1.00 253.89 ? 105 ARG F N    1 
ATOM   6613 C  CA   . ARG F 1 105 ? 28.462 18.782 16.741  1.00 253.85 ? 105 ARG F CA   1 
ATOM   6614 C  C    . ARG F 1 105 ? 28.958 19.114 15.342  1.00 255.64 ? 105 ARG F C    1 
ATOM   6615 O  O    . ARG F 1 105 ? 30.119 18.866 15.008  1.00 254.64 ? 105 ARG F O    1 
ATOM   6616 C  CB   . ARG F 1 105 ? 29.472 17.893 17.470  1.00 255.83 ? 105 ARG F CB   1 
ATOM   6617 C  CG   . ARG F 1 105 ? 29.617 16.509 16.877  1.00 266.06 ? 105 ARG F CG   1 
ATOM   6618 C  CD   . ARG F 1 105 ? 28.706 15.520 17.592  1.00 270.95 ? 105 ARG F CD   1 
ATOM   6619 N  NE   . ARG F 1 105 ? 29.051 14.133 17.298  1.00 272.36 ? 105 ARG F NE   1 
ATOM   6620 C  CZ   . ARG F 1 105 ? 30.291 13.654 17.286  1.00 281.34 ? 105 ARG F CZ   1 
ATOM   6621 N  NH1  . ARG F 1 105 ? 31.321 14.449 17.550  1.00 267.48 ? 105 ARG F NH1  1 
ATOM   6622 N  NH2  . ARG F 1 105 ? 30.503 12.375 17.008  1.00 266.89 ? 105 ARG F NH2  1 
ATOM   6623 N  N    . THR F 1 106 ? 28.045 19.627 14.519  1.00 255.53 ? 106 THR F N    1 
ATOM   6624 C  CA   . THR F 1 106 ? 28.353 19.994 13.140  1.00 254.59 ? 106 THR F CA   1 
ATOM   6625 C  C    . THR F 1 106 ? 29.111 21.316 13.080  1.00 257.60 ? 106 THR F C    1 
ATOM   6626 O  O    . THR F 1 106 ? 29.039 22.133 14.004  1.00 256.92 ? 106 THR F O    1 
ATOM   6627 C  CB   . THR F 1 106 ? 27.091 20.015 12.251  1.00 255.54 ? 106 THR F CB   1 
ATOM   6628 O  OG1  . THR F 1 106 ? 26.133 19.072 12.754  1.00 253.52 ? 106 THR F OG1  1 
ATOM   6629 C  CG2  . THR F 1 106 ? 27.451 19.660 10.807  1.00 252.55 ? 106 THR F CG2  1 
ATOM   6630 N  N    . GLN F 1 107 ? 29.849 21.513 11.992  1.00 256.09 ? 107 GLN F N    1 
ATOM   6631 C  CA   . GLN F 1 107 ? 30.656 22.715 11.834  1.00 256.97 ? 107 GLN F CA   1 
ATOM   6632 C  C    . GLN F 1 107 ? 31.626 22.779 13.014  1.00 265.22 ? 107 GLN F C    1 
ATOM   6633 O  O    . GLN F 1 107 ? 31.695 23.781 13.732  1.00 266.06 ? 107 GLN F O    1 
ATOM   6634 C  CB   . GLN F 1 107 ? 29.768 23.961 11.755  1.00 257.99 ? 107 GLN F CB   1 
ATOM   6635 C  CG   . GLN F 1 107 ? 29.401 24.375 10.322  1.00 259.88 ? 107 GLN F CG   1 
ATOM   6636 C  CD   . GLN F 1 107 ? 28.454 23.396 9.636   1.00 265.80 ? 107 GLN F CD   1 
ATOM   6637 O  OE1  . GLN F 1 107 ? 28.858 22.638 8.749   1.00 259.31 ? 107 GLN F OE1  1 
ATOM   6638 N  NE2  . GLN F 1 107 ? 27.181 23.437 10.020  1.00 255.97 ? 107 GLN F NE2  1 
ATOM   6639 N  N    . SER F 1 108 ? 32.326 21.659 13.215  1.00 262.23 ? 108 SER F N    1 
ATOM   6640 C  CA   . SER F 1 108 ? 33.325 21.462 14.272  1.00 261.29 ? 108 SER F CA   1 
ATOM   6641 C  C    . SER F 1 108 ? 32.910 20.658 15.521  1.00 263.96 ? 108 SER F C    1 
ATOM   6642 O  O    . SER F 1 108 ? 32.676 19.444 15.440  1.00 263.52 ? 108 SER F O    1 
ATOM   6643 C  CB   . SER F 1 108 ? 34.091 22.745 14.612  1.00 264.09 ? 108 SER F CB   1 
ATOM   6644 O  OG   . SER F 1 108 ? 35.240 22.880 13.787  1.00 271.89 ? 108 SER F OG   1 
ATOM   6645 N  N    . THR F 1 109 ? 32.867 21.322 16.676  1.00 259.35 ? 109 THR F N    1 
ATOM   6646 C  CA   . THR F 1 109 ? 32.539 20.651 17.937  1.00 258.52 ? 109 THR F CA   1 
ATOM   6647 C  C    . THR F 1 109 ? 32.374 21.653 19.098  1.00 259.84 ? 109 THR F C    1 
ATOM   6648 O  O    . THR F 1 109 ? 33.049 22.688 19.132  1.00 259.04 ? 109 THR F O    1 
ATOM   6649 C  CB   . THR F 1 109 ? 33.617 19.580 18.267  1.00 269.23 ? 109 THR F CB   1 
ATOM   6650 O  OG1  . THR F 1 109 ? 33.825 19.514 19.683  1.00 269.41 ? 109 THR F OG1  1 
ATOM   6651 C  CG2  . THR F 1 109 ? 34.943 19.930 17.591  1.00 268.43 ? 109 THR F CG2  1 
ATOM   6652 N  N    . PRO F 1 110 ? 31.475 21.355 20.064  1.00 252.89 ? 110 PRO F N    1 
ATOM   6653 C  CA   . PRO F 1 110 ? 31.349 22.290 21.194  1.00 253.27 ? 110 PRO F CA   1 
ATOM   6654 C  C    . PRO F 1 110 ? 32.527 22.132 22.161  1.00 260.42 ? 110 PRO F C    1 
ATOM   6655 O  O    . PRO F 1 110 ? 33.006 21.021 22.391  1.00 261.03 ? 110 PRO F O    1 
ATOM   6656 C  CB   . PRO F 1 110 ? 30.026 21.880 21.866  1.00 253.44 ? 110 PRO F CB   1 
ATOM   6657 C  CG   . PRO F 1 110 ? 29.550 20.656 21.147  1.00 255.06 ? 110 PRO F CG   1 
ATOM   6658 C  CD   . PRO F 1 110 ? 30.222 20.620 19.820  1.00 250.61 ? 110 PRO F CD   1 
ATOM   6659 N  N    . GLY F 1 111 ? 33.017 23.244 22.701  1.00 253.20 ? 111 GLY F N    1 
ATOM   6660 C  CA   . GLY F 1 111 ? 34.158 23.212 23.599  1.00 245.03 ? 111 GLY F CA   1 
ATOM   6661 C  C    . GLY F 1 111 ? 33.852 23.498 25.059  1.00 220.56 ? 111 GLY F C    1 
ATOM   6662 O  O    . GLY F 1 111 ? 32.904 24.223 25.380  1.00 217.44 ? 111 GLY F O    1 
ATOM   6663 N  N    . TYR F 1 112 ? 34.641 22.893 25.946  1.00 212.51 ? 112 TYR F N    1 
ATOM   6664 C  CA   . TYR F 1 112 ? 34.492 23.082 27.391  1.00 202.69 ? 112 TYR F CA   1 
ATOM   6665 C  C    . TYR F 1 112 ? 34.493 24.581 27.739  1.00 217.07 ? 112 TYR F C    1 
ATOM   6666 O  O    . TYR F 1 112 ? 33.841 25.018 28.693  1.00 216.56 ? 112 TYR F O    1 
ATOM   6667 C  CB   . TYR F 1 112 ? 35.612 22.332 28.132  1.00 192.22 ? 112 TYR F CB   1 
ATOM   6668 C  CG   . TYR F 1 112 ? 35.358 22.116 29.609  1.00 187.19 ? 112 TYR F CG   1 
ATOM   6669 C  CD1  . TYR F 1 112 ? 34.080 21.841 30.084  1.00 188.03 ? 112 TYR F CD1  1 
ATOM   6670 C  CD2  . TYR F 1 112 ? 36.398 22.186 30.530  1.00 187.18 ? 112 TYR F CD2  1 
ATOM   6671 C  CE1  . TYR F 1 112 ? 33.842 21.652 31.440  1.00 187.19 ? 112 TYR F CE1  1 
ATOM   6672 C  CE2  . TYR F 1 112 ? 36.169 22.003 31.888  1.00 187.39 ? 112 TYR F CE2  1 
ATOM   6673 C  CZ   . TYR F 1 112 ? 34.887 21.738 32.338  1.00 190.56 ? 112 TYR F CZ   1 
ATOM   6674 O  OH   . TYR F 1 112 ? 34.646 21.552 33.683  1.00 189.17 ? 112 TYR F OH   1 
ATOM   6675 N  N    . ILE F 1 113 ? 35.182 25.367 26.914  1.00 206.49 ? 113 ILE F N    1 
ATOM   6676 C  CA   . ILE F 1 113 ? 35.288 26.811 27.090  1.00 217.55 ? 113 ILE F CA   1 
ATOM   6677 C  C    . ILE F 1 113 ? 33.972 27.508 27.382  1.00 225.95 ? 113 ILE F C    1 
ATOM   6678 O  O    . ILE F 1 113 ? 32.966 26.879 27.699  1.00 226.55 ? 113 ILE F O    1 
ATOM   6679 C  CB   . ILE F 1 113 ? 35.937 27.476 25.873  1.00 228.44 ? 113 ILE F CB   1 
ATOM   6680 C  CG1  . ILE F 1 113 ? 36.831 26.491 25.113  1.00 231.10 ? 113 ILE F CG1  1 
ATOM   6681 C  CG2  . ILE F 1 113 ? 36.688 28.712 26.295  1.00 231.44 ? 113 ILE F CG2  1 
ATOM   6682 C  CD1  . ILE F 1 113 ? 36.754 26.626 23.595  1.00 238.79 ? 113 ILE F CD1  1 
ATOM   6683 N  N    . PHE F 1 114 ? 33.991 28.824 27.213  1.00 216.37 ? 114 PHE F N    1 
ATOM   6684 C  CA   . PHE F 1 114 ? 32.821 29.642 27.458  1.00 214.16 ? 114 PHE F CA   1 
ATOM   6685 C  C    . PHE F 1 114 ? 33.181 31.124 27.517  1.00 220.01 ? 114 PHE F C    1 
ATOM   6686 O  O    . PHE F 1 114 ? 33.604 31.612 28.566  1.00 220.70 ? 114 PHE F O    1 
ATOM   6687 C  CB   . PHE F 1 114 ? 32.193 29.242 28.786  1.00 213.37 ? 114 PHE F CB   1 
ATOM   6688 C  CG   . PHE F 1 114 ? 30.705 29.257 28.769  1.00 211.42 ? 114 PHE F CG   1 
ATOM   6689 C  CD1  . PHE F 1 114 ? 29.987 28.632 29.768  1.00 211.69 ? 114 PHE F CD1  1 
ATOM   6690 C  CD2  . PHE F 1 114 ? 30.023 29.908 27.756  1.00 210.62 ? 114 PHE F CD2  1 
ATOM   6691 C  CE1  . PHE F 1 114 ? 28.611 28.653 29.761  1.00 211.23 ? 114 PHE F CE1  1 
ATOM   6692 C  CE2  . PHE F 1 114 ? 28.647 29.936 27.742  1.00 211.88 ? 114 PHE F CE2  1 
ATOM   6693 C  CZ   . PHE F 1 114 ? 27.940 29.297 28.743  1.00 209.50 ? 114 PHE F CZ   1 
ATOM   6694 N  N    . GLY F 1 115 ? 32.979 31.839 26.409  1.00 210.74 ? 115 GLY F N    1 
ATOM   6695 C  CA   . GLY F 1 115 ? 33.238 33.270 26.308  1.00 209.27 ? 115 GLY F CA   1 
ATOM   6696 C  C    . GLY F 1 115 ? 34.428 33.795 27.091  1.00 209.94 ? 115 GLY F C    1 
ATOM   6697 O  O    . GLY F 1 115 ? 34.303 34.804 27.789  1.00 209.49 ? 115 GLY F O    1 
ATOM   6698 N  N    . LYS F 1 116 ? 35.574 33.122 26.970  1.00 202.96 ? 116 LYS F N    1 
ATOM   6699 C  CA   . LYS F 1 116 ? 36.776 33.524 27.692  1.00 199.80 ? 116 LYS F CA   1 
ATOM   6700 C  C    . LYS F 1 116 ? 36.990 35.004 27.568  1.00 199.62 ? 116 LYS F C    1 
ATOM   6701 O  O    . LYS F 1 116 ? 37.462 35.641 28.495  1.00 198.75 ? 116 LYS F O    1 
ATOM   6702 C  CB   . LYS F 1 116 ? 38.027 32.824 27.198  1.00 199.18 ? 116 LYS F CB   1 
ATOM   6703 C  CG   . LYS F 1 116 ? 37.829 31.412 26.789  1.00 180.28 ? 116 LYS F CG   1 
ATOM   6704 C  CD   . LYS F 1 116 ? 38.705 31.085 25.581  1.00 171.34 ? 116 LYS F CD   1 
ATOM   6705 C  CE   . LYS F 1 116 ? 40.167 31.508 25.788  1.00 165.43 ? 116 LYS F CE   1 
ATOM   6706 N  NZ   . LYS F 1 116 ? 41.146 30.623 25.068  1.00 169.02 ? 116 LYS F NZ   1 
ATOM   6707 N  N    . ARG F 1 117 ? 36.615 35.548 26.420  1.00 192.61 ? 117 ARG F N    1 
ATOM   6708 C  CA   . ARG F 1 117 ? 36.748 36.971 26.166  1.00 191.11 ? 117 ARG F CA   1 
ATOM   6709 C  C    . ARG F 1 117 ? 35.995 37.778 27.219  1.00 192.70 ? 117 ARG F C    1 
ATOM   6710 O  O    . ARG F 1 117 ? 36.554 38.679 27.847  1.00 192.33 ? 117 ARG F O    1 
ATOM   6711 C  CB   . ARG F 1 117 ? 36.222 37.298 24.762  1.00 189.52 ? 117 ARG F CB   1 
ATOM   6712 C  CG   . ARG F 1 117 ? 35.975 38.778 24.496  1.00 195.02 ? 117 ARG F CG   1 
ATOM   6713 C  CD   . ARG F 1 117 ? 36.216 39.142 23.032  1.00 199.88 ? 117 ARG F CD   1 
ATOM   6714 N  NE   . ARG F 1 117 ? 37.625 39.038 22.660  1.00 205.46 ? 117 ARG F NE   1 
ATOM   6715 C  CZ   . ARG F 1 117 ? 38.304 39.991 22.027  1.00 218.59 ? 117 ARG F CZ   1 
ATOM   6716 N  NH1  . ARG F 1 117 ? 37.698 41.124 21.693  1.00 205.85 ? 117 ARG F NH1  1 
ATOM   6717 N  NH2  . ARG F 1 117 ? 39.587 39.813 21.727  1.00 205.26 ? 117 ARG F NH2  1 
ATOM   6718 N  N    . ILE F 1 118 ? 34.729 37.446 27.430  1.00 183.88 ? 118 ILE F N    1 
ATOM   6719 C  CA   . ILE F 1 118 ? 33.944 38.179 28.405  1.00 181.43 ? 118 ILE F CA   1 
ATOM   6720 C  C    . ILE F 1 118 ? 34.544 38.202 29.811  1.00 183.08 ? 118 ILE F C    1 
ATOM   6721 O  O    . ILE F 1 118 ? 34.931 39.264 30.304  1.00 182.61 ? 118 ILE F O    1 
ATOM   6722 C  CB   . ILE F 1 118 ? 32.477 37.783 28.379  1.00 182.94 ? 118 ILE F CB   1 
ATOM   6723 C  CG1  . ILE F 1 118 ? 31.776 38.512 27.234  1.00 182.54 ? 118 ILE F CG1  1 
ATOM   6724 C  CG2  . ILE F 1 118 ? 31.813 38.122 29.705  1.00 183.09 ? 118 ILE F CG2  1 
ATOM   6725 C  CD1  . ILE F 1 118 ? 30.318 38.823 27.503  1.00 188.81 ? 118 ILE F CD1  1 
ATOM   6726 N  N    . ILE F 1 119 ? 34.631 37.043 30.461  1.00 177.04 ? 119 ILE F N    1 
ATOM   6727 C  CA   . ILE F 1 119 ? 35.195 36.996 31.811  1.00 173.75 ? 119 ILE F CA   1 
ATOM   6728 C  C    . ILE F 1 119 ? 36.583 37.596 31.806  1.00 177.59 ? 119 ILE F C    1 
ATOM   6729 O  O    . ILE F 1 119 ? 36.986 38.228 32.774  1.00 177.74 ? 119 ILE F O    1 
ATOM   6730 C  CB   . ILE F 1 119 ? 35.197 35.594 32.447  1.00 173.42 ? 119 ILE F CB   1 
ATOM   6731 C  CG1  . ILE F 1 119 ? 36.054 34.636 31.631  1.00 172.10 ? 119 ILE F CG1  1 
ATOM   6732 C  CG2  . ILE F 1 119 ? 33.783 35.084 32.695  1.00 172.82 ? 119 ILE F CG2  1 
ATOM   6733 C  CD1  . ILE F 1 119 ? 35.576 34.447 30.227  1.00 177.30 ? 119 ILE F CD1  1 
ATOM   6734 N  N    . LEU F 1 120 ? 37.310 37.406 30.712  1.00 169.88 ? 120 LEU F N    1 
ATOM   6735 C  CA   . LEU F 1 120 ? 38.636 37.982 30.602  1.00 169.20 ? 120 LEU F CA   1 
ATOM   6736 C  C    . LEU F 1 120 ? 38.482 39.475 30.795  1.00 171.20 ? 120 LEU F C    1 
ATOM   6737 O  O    . LEU F 1 120 ? 39.134 40.072 31.647  1.00 169.44 ? 120 LEU F O    1 
ATOM   6738 C  CB   . LEU F 1 120 ? 39.224 37.729 29.221  1.00 170.08 ? 120 LEU F CB   1 
ATOM   6739 C  CG   . LEU F 1 120 ? 40.652 38.234 29.085  1.00 176.87 ? 120 LEU F CG   1 
ATOM   6740 C  CD1  . LEU F 1 120 ? 40.645 39.703 28.797  1.00 177.76 ? 120 LEU F CD1  1 
ATOM   6741 C  CD2  . LEU F 1 120 ? 41.393 37.961 30.368  1.00 180.07 ? 120 LEU F CD2  1 
ATOM   6742 N  N    . PHE F 1 121 ? 37.604 40.070 29.999  1.00 164.94 ? 121 PHE F N    1 
ATOM   6743 C  CA   . PHE F 1 121 ? 37.351 41.502 30.063  1.00 165.73 ? 121 PHE F CA   1 
ATOM   6744 C  C    . PHE F 1 121 ? 36.854 41.953 31.432  1.00 168.06 ? 121 PHE F C    1 
ATOM   6745 O  O    . PHE F 1 121 ? 37.396 42.891 32.020  1.00 168.90 ? 121 PHE F O    1 
ATOM   6746 C  CB   . PHE F 1 121 ? 36.351 41.915 28.988  1.00 167.68 ? 121 PHE F CB   1 
ATOM   6747 C  CG   . PHE F 1 121 ? 35.657 43.207 29.282  1.00 168.60 ? 121 PHE F CG   1 
ATOM   6748 C  CD1  . PHE F 1 121 ? 36.380 44.319 29.656  1.00 170.74 ? 121 PHE F CD1  1 
ATOM   6749 C  CD2  . PHE F 1 121 ? 34.279 43.305 29.204  1.00 170.17 ? 121 PHE F CD2  1 
ATOM   6750 C  CE1  . PHE F 1 121 ? 35.744 45.510 29.934  1.00 171.29 ? 121 PHE F CE1  1 
ATOM   6751 C  CE2  . PHE F 1 121 ? 33.635 44.497 29.480  1.00 172.58 ? 121 PHE F CE2  1 
ATOM   6752 C  CZ   . PHE F 1 121 ? 34.368 45.600 29.843  1.00 170.42 ? 121 PHE F CZ   1 
ATOM   6753 N  N    . LEU F 1 122 ? 35.810 41.301 31.928  1.00 164.73 ? 122 LEU F N    1 
ATOM   6754 C  CA   . LEU F 1 122 ? 35.273 41.654 33.230  1.00 161.60 ? 122 LEU F CA   1 
ATOM   6755 C  C    . LEU F 1 122 ? 36.378 41.589 34.280  1.00 163.18 ? 122 LEU F C    1 
ATOM   6756 O  O    . LEU F 1 122 ? 36.478 42.447 35.155  1.00 162.07 ? 122 LEU F O    1 
ATOM   6757 C  CB   . LEU F 1 122 ? 34.101 40.748 33.602  1.00 160.77 ? 122 LEU F CB   1 
ATOM   6758 C  CG   . LEU F 1 122 ? 32.730 41.422 33.492  1.00 164.33 ? 122 LEU F CG   1 
ATOM   6759 C  CD1  . LEU F 1 122 ? 32.840 42.747 32.757  1.00 164.17 ? 122 LEU F CD1  1 
ATOM   6760 C  CD2  . LEU F 1 122 ? 31.738 40.513 32.796  1.00 166.46 ? 122 LEU F CD2  1 
ATOM   6761 N  N    . PHE F 1 123 ? 37.237 40.587 34.162  1.00 161.18 ? 123 PHE F N    1 
ATOM   6762 C  CA   . PHE F 1 123 ? 38.347 40.432 35.087  1.00 159.92 ? 123 PHE F CA   1 
ATOM   6763 C  C    . PHE F 1 123 ? 39.316 41.592 34.965  1.00 163.74 ? 123 PHE F C    1 
ATOM   6764 O  O    . PHE F 1 123 ? 40.097 41.847 35.871  1.00 163.16 ? 123 PHE F O    1 
ATOM   6765 C  CB   . PHE F 1 123 ? 39.075 39.125 34.812  1.00 159.92 ? 123 PHE F CB   1 
ATOM   6766 C  CG   . PHE F 1 123 ? 40.390 39.010 35.508  1.00 158.43 ? 123 PHE F CG   1 
ATOM   6767 C  CD1  . PHE F 1 123 ? 41.518 39.619 34.987  1.00 159.03 ? 123 PHE F CD1  1 
ATOM   6768 C  CD2  . PHE F 1 123 ? 40.502 38.258 36.665  1.00 157.90 ? 123 PHE F CD2  1 
ATOM   6769 C  CE1  . PHE F 1 123 ? 42.728 39.505 35.620  1.00 158.78 ? 123 PHE F CE1  1 
ATOM   6770 C  CE2  . PHE F 1 123 ? 41.711 38.133 37.308  1.00 159.40 ? 123 PHE F CE2  1 
ATOM   6771 C  CZ   . PHE F 1 123 ? 42.828 38.760 36.787  1.00 157.16 ? 123 PHE F CZ   1 
ATOM   6772 N  N    . LEU F 1 124 ? 39.283 42.278 33.829  1.00 160.96 ? 124 LEU F N    1 
ATOM   6773 C  CA   . LEU F 1 124 ? 40.169 43.409 33.613  1.00 160.85 ? 124 LEU F CA   1 
ATOM   6774 C  C    . LEU F 1 124 ? 39.616 44.708 34.190  1.00 158.35 ? 124 LEU F C    1 
ATOM   6775 O  O    . LEU F 1 124 ? 40.373 45.625 34.490  1.00 156.11 ? 124 LEU F O    1 
ATOM   6776 C  CB   . LEU F 1 124 ? 40.564 43.541 32.147  1.00 162.56 ? 124 LEU F CB   1 
ATOM   6777 C  CG   . LEU F 1 124 ? 41.793 42.690 31.833  1.00 170.00 ? 124 LEU F CG   1 
ATOM   6778 C  CD1  . LEU F 1 124 ? 41.714 41.359 32.562  1.00 171.03 ? 124 LEU F CD1  1 
ATOM   6779 C  CD2  . LEU F 1 124 ? 41.966 42.484 30.346  1.00 173.33 ? 124 LEU F CD2  1 
ATOM   6780 N  N    . MET F 1 125 ? 38.305 44.764 34.404  1.00 155.46 ? 125 MET F N    1 
ATOM   6781 C  CA   . MET F 1 125 ? 37.698 45.926 35.041  1.00 155.46 ? 125 MET F CA   1 
ATOM   6782 C  C    . MET F 1 125 ? 37.959 45.773 36.524  1.00 155.46 ? 125 MET F C    1 
ATOM   6783 O  O    . MET F 1 125 ? 38.214 46.747 37.226  1.00 229.84 ? 125 MET F O    1 
ATOM   6784 C  CB   . MET F 1 125 ? 36.196 45.940 34.821  1.00 155.46 ? 125 MET F CB   1 
ATOM   6785 C  CG   . MET F 1 125 ? 35.800 45.947 33.367  1.00 155.46 ? 125 MET F CG   1 
ATOM   6786 S  SD   . MET F 1 125 ? 34.403 47.058 33.046  1.00 155.46 ? 125 MET F SD   1 
ATOM   6787 C  CE   . MET F 1 125 ? 33.084 46.332 34.143  1.00 155.46 ? 125 MET F CE   1 
ATOM   6788 N  N    . SER F 1 126 ? 37.898 44.524 36.980  1.00 153.42 ? 126 SER F N    1 
ATOM   6789 C  CA   . SER F 1 126 ? 38.158 44.166 38.371  1.00 154.61 ? 126 SER F CA   1 
ATOM   6790 C  C    . SER F 1 126 ? 39.609 44.487 38.717  1.00 159.51 ? 126 SER F C    1 
ATOM   6791 O  O    . SER F 1 126 ? 39.891 45.088 39.754  1.00 158.89 ? 126 SER F O    1 
ATOM   6792 C  CB   . SER F 1 126 ? 37.928 42.667 38.585  1.00 160.70 ? 126 SER F CB   1 
ATOM   6793 O  OG   . SER F 1 126 ? 36.552 42.354 38.649  1.00 172.18 ? 126 SER F OG   1 
ATOM   6794 N  N    . VAL F 1 127 ? 40.529 44.061 37.855  1.00 156.74 ? 127 VAL F N    1 
ATOM   6795 C  CA   . VAL F 1 127 ? 41.945 44.307 38.079  1.00 157.42 ? 127 VAL F CA   1 
ATOM   6796 C  C    . VAL F 1 127 ? 42.247 45.756 37.806  1.00 159.94 ? 127 VAL F C    1 
ATOM   6797 O  O    . VAL F 1 127 ? 43.299 46.257 38.169  1.00 158.46 ? 127 VAL F O    1 
ATOM   6798 C  CB   . VAL F 1 127 ? 42.811 43.433 37.212  1.00 163.14 ? 127 VAL F CB   1 
ATOM   6799 C  CG1  . VAL F 1 127 ? 42.464 43.659 35.770  1.00 163.24 ? 127 VAL F CG1  1 
ATOM   6800 C  CG2  . VAL F 1 127 ? 44.261 43.741 37.468  1.00 163.25 ? 127 VAL F CG2  1 
ATOM   6801 N  N    . ALA F 1 128 ? 41.310 46.429 37.158  1.00 159.05 ? 128 ALA F N    1 
ATOM   6802 C  CA   . ALA F 1 128 ? 41.465 47.839 36.860  1.00 160.54 ? 128 ALA F CA   1 
ATOM   6803 C  C    . ALA F 1 128 ? 41.327 48.631 38.145  1.00 167.05 ? 128 ALA F C    1 
ATOM   6804 O  O    . ALA F 1 128 ? 42.315 49.111 38.692  1.00 166.98 ? 128 ALA F O    1 
ATOM   6805 C  CB   . ALA F 1 128 ? 40.424 48.278 35.873  1.00 161.49 ? 128 ALA F CB   1 
ATOM   6806 N  N    . GLY F 1 129 ? 40.094 48.757 38.626  1.00 165.57 ? 129 GLY F N    1 
ATOM   6807 C  CA   . GLY F 1 129 ? 39.798 49.478 39.853  1.00 166.26 ? 129 GLY F CA   1 
ATOM   6808 C  C    . GLY F 1 129 ? 40.633 49.012 41.033  1.00 172.83 ? 129 GLY F C    1 
ATOM   6809 O  O    . GLY F 1 129 ? 41.060 49.810 41.862  1.00 173.10 ? 129 GLY F O    1 
ATOM   6810 N  N    . ILE F 1 130 ? 40.865 47.708 41.112  1.00 170.13 ? 130 ILE F N    1 
ATOM   6811 C  CA   . ILE F 1 130 ? 41.655 47.142 42.194  1.00 170.23 ? 130 ILE F CA   1 
ATOM   6812 C  C    . ILE F 1 130 ? 42.994 47.847 42.281  1.00 172.37 ? 130 ILE F C    1 
ATOM   6813 O  O    . ILE F 1 130 ? 43.509 48.080 43.370  1.00 173.74 ? 130 ILE F O    1 
ATOM   6814 C  CB   . ILE F 1 130 ? 41.887 45.654 41.984  1.00 173.80 ? 130 ILE F CB   1 
ATOM   6815 C  CG1  . ILE F 1 130 ? 41.588 44.888 43.267  1.00 174.41 ? 130 ILE F CG1  1 
ATOM   6816 C  CG2  . ILE F 1 130 ? 43.336 45.422 41.582  1.00 174.68 ? 130 ILE F CG2  1 
ATOM   6817 C  CD1  . ILE F 1 130 ? 42.752 44.898 44.226  1.00 181.95 ? 130 ILE F CD1  1 
ATOM   6818 N  N    . PHE F 1 131 ? 43.568 48.155 41.123  1.00 171.89 ? 131 PHE F N    1 
ATOM   6819 C  CA   . PHE F 1 131 ? 44.842 48.854 41.077  1.00 171.69 ? 131 PHE F CA   1 
ATOM   6820 C  C    . PHE F 1 131 ? 44.618 50.349 41.236  1.00 173.71 ? 131 PHE F C    1 
ATOM   6821 O  O    . PHE F 1 131 ? 45.207 50.974 42.113  1.00 168.88 ? 131 PHE F O    1 
ATOM   6822 C  CB   . PHE F 1 131 ? 45.554 48.624 39.748  1.00 177.32 ? 131 PHE F CB   1 
ATOM   6823 C  CG   . PHE F 1 131 ? 46.146 49.885 39.153  1.00 184.92 ? 131 PHE F CG   1 
ATOM   6824 C  CD1  . PHE F 1 131 ? 45.444 50.633 38.219  1.00 192.59 ? 131 PHE F CD1  1 
ATOM   6825 C  CD2  . PHE F 1 131 ? 47.409 50.316 39.524  1.00 191.89 ? 131 PHE F CD2  1 
ATOM   6826 C  CE1  . PHE F 1 131 ? 45.982 51.786 37.687  1.00 195.51 ? 131 PHE F CE1  1 
ATOM   6827 C  CE2  . PHE F 1 131 ? 47.957 51.460 38.976  1.00 196.97 ? 131 PHE F CE2  1 
ATOM   6828 C  CZ   . PHE F 1 131 ? 47.246 52.191 38.057  1.00 195.65 ? 131 PHE F CZ   1 
ATOM   6829 N  N    . ASN F 1 132 ? 43.797 50.922 40.360  1.00 170.35 ? 132 ASN F N    1 
ATOM   6830 C  CA   . ASN F 1 132 ? 43.518 52.350 40.386  1.00 173.40 ? 132 ASN F CA   1 
ATOM   6831 C  C    . ASN F 1 132 ? 43.197 52.817 41.795  1.00 175.79 ? 132 ASN F C    1 
ATOM   6832 O  O    . ASN F 1 132 ? 43.379 53.983 42.115  1.00 174.98 ? 132 ASN F O    1 
ATOM   6833 C  CB   . ASN F 1 132 ? 42.318 52.675 39.517  1.00 177.58 ? 132 ASN F CB   1 
ATOM   6834 C  CG   . ASN F 1 132 ? 41.175 53.260 40.328  1.00 208.65 ? 132 ASN F CG   1 
ATOM   6835 O  OD1  . ASN F 1 132 ? 40.413 52.534 40.977  1.00 204.12 ? 132 ASN F OD1  1 
ATOM   6836 N  ND2  . ASN F 1 132 ? 41.121 54.581 40.388  1.00 201.67 ? 132 ASN F ND2  1 
ATOM   6837 N  N    . TYR F 1 133 ? 42.684 51.909 42.623  1.00 174.66 ? 133 TYR F N    1 
ATOM   6838 C  CA   . TYR F 1 133 ? 42.351 52.227 44.010  1.00 174.24 ? 133 TYR F CA   1 
ATOM   6839 C  C    . TYR F 1 133 ? 43.628 52.462 44.802  1.00 177.83 ? 133 TYR F C    1 
ATOM   6840 O  O    . TYR F 1 133 ? 43.716 53.385 45.604  1.00 176.29 ? 133 TYR F O    1 
ATOM   6841 C  CB   . TYR F 1 133 ? 41.577 51.088 44.656  1.00 175.75 ? 133 TYR F CB   1 
ATOM   6842 C  CG   . TYR F 1 133 ? 41.802 51.006 46.142  1.00 178.15 ? 133 TYR F CG   1 
ATOM   6843 C  CD1  . TYR F 1 133 ? 40.965 51.668 47.023  1.00 180.13 ? 133 TYR F CD1  1 
ATOM   6844 C  CD2  . TYR F 1 133 ? 42.861 50.293 46.661  1.00 178.97 ? 133 TYR F CD2  1 
ATOM   6845 C  CE1  . TYR F 1 133 ? 41.163 51.597 48.387  1.00 180.54 ? 133 TYR F CE1  1 
ATOM   6846 C  CE2  . TYR F 1 133 ? 43.087 50.230 48.016  1.00 179.74 ? 133 TYR F CE2  1 
ATOM   6847 C  CZ   . TYR F 1 133 ? 42.222 50.877 48.881  1.00 185.94 ? 133 TYR F CZ   1 
ATOM   6848 O  OH   . TYR F 1 133 ? 42.406 50.816 50.246  1.00 186.15 ? 133 TYR F OH   1 
ATOM   6849 N  N    . TYR F 1 134 ? 44.608 51.593 44.591  1.00 175.71 ? 134 TYR F N    1 
ATOM   6850 C  CA   . TYR F 1 134 ? 45.896 51.724 45.247  1.00 176.99 ? 134 TYR F CA   1 
ATOM   6851 C  C    . TYR F 1 134 ? 46.511 53.081 44.980  1.00 179.76 ? 134 TYR F C    1 
ATOM   6852 O  O    . TYR F 1 134 ? 47.307 53.576 45.768  1.00 179.22 ? 134 TYR F O    1 
ATOM   6853 C  CB   . TYR F 1 134 ? 46.838 50.630 44.782  1.00 179.57 ? 134 TYR F CB   1 
ATOM   6854 C  CG   . TYR F 1 134 ? 46.622 49.412 45.591  1.00 182.86 ? 134 TYR F CG   1 
ATOM   6855 C  CD1  . TYR F 1 134 ? 45.452 49.267 46.292  1.00 184.89 ? 134 TYR F CD1  1 
ATOM   6856 C  CD2  . TYR F 1 134 ? 47.609 48.462 45.746  1.00 184.12 ? 134 TYR F CD2  1 
ATOM   6857 C  CE1  . TYR F 1 134 ? 45.220 48.189 47.079  1.00 185.62 ? 134 TYR F CE1  1 
ATOM   6858 C  CE2  . TYR F 1 134 ? 47.401 47.365 46.548  1.00 185.13 ? 134 TYR F CE2  1 
ATOM   6859 C  CZ   . TYR F 1 134 ? 46.197 47.232 47.215  1.00 191.94 ? 134 TYR F CZ   1 
ATOM   6860 O  OH   . TYR F 1 134 ? 45.970 46.139 48.023  1.00 192.62 ? 134 TYR F OH   1 
ATOM   6861 N  N    . LEU F 1 135 ? 46.143 53.681 43.858  1.00 181.21 ? 135 LEU F N    1 
ATOM   6862 C  CA   . LEU F 1 135 ? 46.654 54.994 43.514  1.00 181.84 ? 135 LEU F CA   1 
ATOM   6863 C  C    . LEU F 1 135 ? 45.936 56.022 44.364  1.00 181.47 ? 135 LEU F C    1 
ATOM   6864 O  O    . LEU F 1 135 ? 46.571 56.783 45.085  1.00 178.58 ? 135 LEU F O    1 
ATOM   6865 C  CB   . LEU F 1 135 ? 46.451 55.285 42.028  1.00 184.24 ? 135 LEU F CB   1 
ATOM   6866 C  CG   . LEU F 1 135 ? 47.163 54.323 41.070  1.00 193.61 ? 135 LEU F CG   1 
ATOM   6867 C  CD1  . LEU F 1 135 ? 47.782 55.071 39.895  1.00 195.31 ? 135 LEU F CD1  1 
ATOM   6868 C  CD2  . LEU F 1 135 ? 48.213 53.489 41.808  1.00 197.61 ? 135 LEU F CD2  1 
ATOM   6869 N  N    . ILE F 1 136 ? 44.608 56.014 44.305  1.00 181.30 ? 136 ILE F N    1 
ATOM   6870 C  CA   . ILE F 1 136 ? 43.797 56.938 45.088  1.00 183.47 ? 136 ILE F CA   1 
ATOM   6871 C  C    . ILE F 1 136 ? 44.227 56.903 46.538  1.00 192.15 ? 136 ILE F C    1 
ATOM   6872 O  O    . ILE F 1 136 ? 44.109 57.885 47.261  1.00 192.04 ? 136 ILE F O    1 
ATOM   6873 C  CB   . ILE F 1 136 ? 42.304 56.583 45.013  1.00 186.62 ? 136 ILE F CB   1 
ATOM   6874 C  CG1  . ILE F 1 136 ? 42.028 55.589 43.885  1.00 187.01 ? 136 ILE F CG1  1 
ATOM   6875 C  CG2  . ILE F 1 136 ? 41.460 57.835 44.885  1.00 187.34 ? 136 ILE F CG2  1 
ATOM   6876 C  CD1  . ILE F 1 136 ? 40.763 54.757 44.082  1.00 194.29 ? 136 ILE F CD1  1 
ATOM   6877 N  N    . PHE F 1 137 ? 44.696 55.746 46.971  1.00 189.76 ? 137 PHE F N    1 
ATOM   6878 C  CA   . PHE F 1 137 ? 45.103 55.591 48.350  1.00 194.88 ? 137 PHE F CA   1 
ATOM   6879 C  C    . PHE F 1 137 ? 46.552 55.993 48.568  1.00 196.15 ? 137 PHE F C    1 
ATOM   6880 O  O    . PHE F 1 137 ? 46.859 56.728 49.502  1.00 194.67 ? 137 PHE F O    1 
ATOM   6881 C  CB   . PHE F 1 137 ? 44.840 54.162 48.815  1.00 203.67 ? 137 PHE F CB   1 
ATOM   6882 C  CG   . PHE F 1 137 ? 45.711 53.716 49.950  1.00 214.79 ? 137 PHE F CG   1 
ATOM   6883 C  CD1  . PHE F 1 137 ? 45.915 54.522 51.049  1.00 224.78 ? 137 PHE F CD1  1 
ATOM   6884 C  CD2  . PHE F 1 137 ? 46.276 52.455 49.942  1.00 224.02 ? 137 PHE F CD2  1 
ATOM   6885 C  CE1  . PHE F 1 137 ? 46.708 54.096 52.096  1.00 228.46 ? 137 PHE F CE1  1 
ATOM   6886 C  CE2  . PHE F 1 137 ? 47.047 52.015 50.995  1.00 229.92 ? 137 PHE F CE2  1 
ATOM   6887 C  CZ   . PHE F 1 137 ? 47.275 52.838 52.067  1.00 228.80 ? 137 PHE F CZ   1 
ATOM   6888 N  N    . PHE F 1 138 ? 47.441 55.481 47.725  1.00 194.36 ? 138 PHE F N    1 
ATOM   6889 C  CA   . PHE F 1 138 ? 48.871 55.753 47.845  1.00 194.36 ? 138 PHE F CA   1 
ATOM   6890 C  C    . PHE F 1 138 ? 49.305 57.165 47.494  1.00 194.36 ? 138 PHE F C    1 
ATOM   6891 O  O    . PHE F 1 138 ? 50.316 57.659 47.988  1.00 194.36 ? 138 PHE F O    1 
ATOM   6892 C  CB   . PHE F 1 138 ? 49.668 54.757 47.028  1.00 194.36 ? 138 PHE F CB   1 
ATOM   6893 C  CG   . PHE F 1 138 ? 50.022 53.533 47.787  1.00 194.36 ? 138 PHE F CG   1 
ATOM   6894 C  CD1  . PHE F 1 138 ? 49.370 53.242 48.969  1.00 194.36 ? 138 PHE F CD1  1 
ATOM   6895 C  CD2  . PHE F 1 138 ? 51.015 52.688 47.340  1.00 194.36 ? 138 PHE F CD2  1 
ATOM   6896 C  CE1  . PHE F 1 138 ? 49.693 52.122 49.686  1.00 194.36 ? 138 PHE F CE1  1 
ATOM   6897 C  CE2  . PHE F 1 138 ? 51.343 51.559 48.050  1.00 194.36 ? 138 PHE F CE2  1 
ATOM   6898 C  CZ   . PHE F 1 138 ? 50.677 51.272 49.226  1.00 194.36 ? 138 PHE F CZ   1 
ATOM   6899 N  N    . PHE F 1 139 ? 48.562 57.802 46.608  1.00 194.91 ? 139 PHE F N    1 
ATOM   6900 C  CA   . PHE F 1 139 ? 48.886 59.158 46.241  1.00 202.93 ? 139 PHE F CA   1 
ATOM   6901 C  C    . PHE F 1 139 ? 47.782 60.091 46.725  1.00 198.12 ? 139 PHE F C    1 
ATOM   6902 O  O    . PHE F 1 139 ? 47.203 60.876 45.973  1.00 195.22 ? 139 PHE F O    1 
ATOM   6903 C  CB   . PHE F 1 139 ? 49.215 59.265 44.756  1.00 217.41 ? 139 PHE F CB   1 
ATOM   6904 C  CG   . PHE F 1 139 ? 50.470 58.532 44.375  1.00 236.54 ? 139 PHE F CG   1 
ATOM   6905 C  CD1  . PHE F 1 139 ? 51.248 57.935 45.347  1.00 252.45 ? 139 PHE F CD1  1 
ATOM   6906 C  CD2  . PHE F 1 139 ? 50.870 58.437 43.059  1.00 251.74 ? 139 PHE F CD2  1 
ATOM   6907 C  CE1  . PHE F 1 139 ? 52.398 57.261 45.011  1.00 258.48 ? 139 PHE F CE1  1 
ATOM   6908 C  CE2  . PHE F 1 139 ? 52.017 57.754 42.720  1.00 260.24 ? 139 PHE F CE2  1 
ATOM   6909 C  CZ   . PHE F 1 139 ? 52.784 57.173 43.697  1.00 259.81 ? 139 PHE F CZ   1 
ATOM   6910 N  N    . GLY F 1 140 ? 47.488 59.946 48.013  1.00 203.83 ? 140 GLY F N    1 
ATOM   6911 C  CA   . GLY F 1 140 ? 46.536 60.762 48.734  1.00 205.02 ? 140 GLY F CA   1 
ATOM   6912 C  C    . GLY F 1 140 ? 47.358 61.699 49.604  1.00 212.30 ? 140 GLY F C    1 
ATOM   6913 O  O    . GLY F 1 140 ? 46.815 62.479 50.393  1.00 211.90 ? 140 GLY F O    1 
ATOM   6914 N  N    . SER F 1 141 ? 48.683 61.630 49.435  1.00 217.83 ? 141 SER F N    1 
ATOM   6915 C  CA   . SER F 1 141 ? 49.631 62.473 50.169  1.00 218.69 ? 141 SER F CA   1 
ATOM   6916 C  C    . SER F 1 141 ? 49.454 63.925 49.761  1.00 223.53 ? 141 SER F C    1 
ATOM   6917 O  O    . SER F 1 141 ? 50.282 64.775 50.079  1.00 222.61 ? 141 SER F O    1 
ATOM   6918 C  CB   . SER F 1 141 ? 51.079 62.029 49.906  1.00 223.16 ? 141 SER F CB   1 
ATOM   6919 O  OG   . SER F 1 141 ? 51.607 62.621 48.732  1.00 232.88 ? 141 SER F OG   1 
ATOM   6920 N  N    . ASP F 1 142 ? 48.363 64.191 49.049  1.00 230.00 ? 142 ASP F N    1 
ATOM   6921 C  CA   . ASP F 1 142 ? 48.036 65.524 48.570  1.00 230.79 ? 142 ASP F CA   1 
ATOM   6922 C  C    . ASP F 1 142 ? 47.606 66.457 49.702  1.00 237.07 ? 142 ASP F C    1 
ATOM   6923 O  O    . ASP F 1 142 ? 46.674 67.251 49.554  1.00 236.58 ? 142 ASP F O    1 
ATOM   6924 C  CB   . ASP F 1 142 ? 46.955 65.447 47.487  1.00 231.86 ? 142 ASP F CB   1 
ATOM   6925 C  CG   . ASP F 1 142 ? 45.562 65.312 48.063  1.00 229.19 ? 142 ASP F CG   1 
ATOM   6926 O  OD1  . ASP F 1 142 ? 45.370 64.463 48.958  1.00 227.75 ? 142 ASP F OD1  1 
ATOM   6927 O  OD2  . ASP F 1 142 ? 44.701 66.146 47.717  1.00 233.12 ? 142 ASP F OD2  1 
ATOM   6928 N  N    . PHE F 1 143 ? 48.309 66.387 50.826  1.00 243.03 ? 143 PHE F N    1 
ATOM   6929 C  CA   . PHE F 1 143 ? 48.004 67.269 51.943  1.00 241.55 ? 143 PHE F CA   1 
ATOM   6930 C  C    . PHE F 1 143 ? 48.184 68.740 51.520  1.00 234.42 ? 143 PHE F C    1 
ATOM   6931 O  O    . PHE F 1 143 ? 47.565 69.644 52.095  1.00 230.90 ? 143 PHE F O    1 
ATOM   6932 C  CB   . PHE F 1 143 ? 48.880 66.930 53.153  1.00 244.25 ? 143 PHE F CB   1 
ATOM   6933 C  CG   . PHE F 1 143 ? 50.352 66.879 52.849  1.00 245.84 ? 143 PHE F CG   1 
ATOM   6934 C  CD1  . PHE F 1 143 ? 50.885 67.568 51.772  1.00 248.60 ? 143 PHE F CD1  1 
ATOM   6935 C  CD2  . PHE F 1 143 ? 51.207 66.158 53.655  1.00 247.59 ? 143 PHE F CD2  1 
ATOM   6936 C  CE1  . PHE F 1 143 ? 52.227 67.541 51.497  1.00 249.27 ? 143 PHE F CE1  1 
ATOM   6937 C  CE2  . PHE F 1 143 ? 52.560 66.122 53.386  1.00 250.13 ? 143 PHE F CE2  1 
ATOM   6938 C  CZ   . PHE F 1 143 ? 53.071 66.816 52.305  1.00 248.14 ? 143 PHE F CZ   1 
ATOM   6939 N  N    . GLU F 1 144 ? 49.007 68.955 50.489  1.00 238.76 ? 144 GLU F N    1 
ATOM   6940 C  CA   . GLU F 1 144 ? 49.318 70.285 49.971  1.00 237.66 ? 144 GLU F CA   1 
ATOM   6941 C  C    . GLU F 1 144 ? 49.538 71.315 51.087  1.00 240.22 ? 144 GLU F C    1 
ATOM   6942 O  O    . GLU F 1 144 ? 48.586 71.741 51.756  1.00 239.00 ? 144 GLU F O    1 
ATOM   6943 C  CB   . GLU F 1 144 ? 48.246 70.755 48.983  1.00 238.48 ? 144 GLU F CB   1 
ATOM   6944 C  CG   . GLU F 1 144 ? 46.928 71.178 49.625  1.00 243.86 ? 144 GLU F CG   1 
ATOM   6945 C  CD   . GLU F 1 144 ? 45.721 70.617 48.905  1.00 252.28 ? 144 GLU F CD   1 
ATOM   6946 O  OE1  . GLU F 1 144 ? 44.710 70.334 49.579  1.00 243.16 ? 144 GLU F OE1  1 
ATOM   6947 O  OE2  . GLU F 1 144 ? 45.786 70.440 47.670  1.00 242.90 ? 144 GLU F OE2  1 
ATOM   6948 N  N    . ASN F 1 145 ? 50.795 71.704 51.291  1.00 245.01 ? 145 ASN F N    1 
ATOM   6949 C  CA   . ASN F 1 145 ? 51.132 72.685 52.323  1.00 245.56 ? 145 ASN F CA   1 
ATOM   6950 C  C    . ASN F 1 145 ? 50.317 73.968 52.193  1.00 251.71 ? 145 ASN F C    1 
ATOM   6951 O  O    . ASN F 1 145 ? 50.395 74.683 51.189  1.00 251.35 ? 145 ASN F O    1 
ATOM   6952 C  CB   . ASN F 1 145 ? 52.628 73.027 52.312  1.00 244.83 ? 145 ASN F CB   1 
ATOM   6953 C  CG   . ASN F 1 145 ? 52.899 74.500 52.633  1.00 259.17 ? 145 ASN F CG   1 
ATOM   6954 O  OD1  . ASN F 1 145 ? 52.829 74.921 53.791  1.00 252.24 ? 145 ASN F OD1  1 
ATOM   6955 N  ND2  . ASN F 1 145 ? 53.216 75.284 51.604  1.00 249.79 ? 145 ASN F ND2  1 
ATOM   6956 N  N    . TYR F 1 146 ? 49.560 74.269 53.238  1.00 254.36 ? 146 TYR F N    1 
ATOM   6957 C  CA   . TYR F 1 146 ? 48.764 75.483 53.284  1.00 254.97 ? 146 TYR F CA   1 
ATOM   6958 C  C    . TYR F 1 146 ? 49.651 76.623 53.799  1.00 261.38 ? 146 TYR F C    1 
ATOM   6959 O  O    . TYR F 1 146 ? 50.387 76.460 54.776  1.00 260.99 ? 146 TYR F O    1 
ATOM   6960 C  CB   . TYR F 1 146 ? 47.605 75.285 54.265  1.00 255.73 ? 146 TYR F CB   1 
ATOM   6961 C  CG   . TYR F 1 146 ? 48.072 75.232 55.705  1.00 256.33 ? 146 TYR F CG   1 
ATOM   6962 C  CD1  . TYR F 1 146 ? 48.108 76.385 56.485  1.00 257.96 ? 146 TYR F CD1  1 
ATOM   6963 C  CD2  . TYR F 1 146 ? 48.584 74.055 56.247  1.00 256.66 ? 146 TYR F CD2  1 
ATOM   6964 C  CE1  . TYR F 1 146 ? 48.583 76.355 57.787  1.00 258.07 ? 146 TYR F CE1  1 
ATOM   6965 C  CE2  . TYR F 1 146 ? 49.061 74.015 57.549  1.00 257.24 ? 146 TYR F CE2  1 
ATOM   6966 C  CZ   . TYR F 1 146 ? 49.058 75.168 58.314  1.00 263.24 ? 146 TYR F CZ   1 
ATOM   6967 O  OH   . TYR F 1 146 ? 49.533 75.132 59.608  1.00 263.35 ? 146 TYR F OH   1 
ATOM   6968 N  N    . ILE F 1 147 ? 49.586 77.775 53.145  1.00 261.42 ? 147 ILE F N    1 
ATOM   6969 C  CA   . ILE F 1 147 ? 50.331 78.935 53.616  1.00 262.70 ? 147 ILE F CA   1 
ATOM   6970 C  C    . ILE F 1 147 ? 49.290 79.959 54.040  1.00 268.40 ? 147 ILE F C    1 
ATOM   6971 O  O    . ILE F 1 147 ? 49.611 81.083 54.434  1.00 267.99 ? 147 ILE F O    1 
ATOM   6972 C  CB   . ILE F 1 147 ? 51.317 79.473 52.571  1.00 266.55 ? 147 ILE F CB   1 
ATOM   6973 C  CG1  . ILE F 1 147 ? 52.690 79.690 53.215  1.00 267.28 ? 147 ILE F CG1  1 
ATOM   6974 C  CG2  . ILE F 1 147 ? 50.789 80.753 51.941  1.00 267.57 ? 147 ILE F CG2  1 
ATOM   6975 C  CD1  . ILE F 1 147 ? 53.106 78.581 54.164  1.00 274.84 ? 147 ILE F CD1  1 
ATOM   6976 N  N    . ALA F 1 148 ? 48.033 79.521 53.983  1.00 269.21 ? 148 ALA F N    1 
ATOM   6977 C  CA   . ALA F 1 148 ? 46.879 80.322 54.374  1.00 269.21 ? 148 ALA F CA   1 
ATOM   6978 C  C    . ALA F 1 148 ? 46.950 81.764 53.891  1.00 269.21 ? 148 ALA F C    1 
ATOM   6979 O  O    . ALA F 1 148 ? 47.583 82.063 52.874  1.00 269.21 ? 148 ALA F O    1 
ATOM   6980 C  CB   . ALA F 1 148 ? 46.674 80.265 55.885  1.00 269.21 ? 148 ALA F CB   1 
ATOM   6981 N  N    . THR F 1 149 ? 46.283 82.650 54.626  1.00 268.84 ? 149 THR F N    1 
ATOM   6982 C  CA   . THR F 1 149 ? 46.246 84.070 54.288  1.00 218.94 ? 149 THR F CA   1 
ATOM   6983 C  C    . THR F 1 149 ? 45.900 84.941 55.508  1.00 233.95 ? 149 THR F C    1 
ATOM   6984 O  O    . THR F 1 149 ? 45.637 84.440 56.611  1.00 193.36 ? 149 THR F O    1 
ATOM   6985 C  CB   . THR F 1 149 ? 45.288 84.344 53.093  1.00 215.67 ? 149 THR F CB   1 
ATOM   6986 O  OG1  . THR F 1 149 ? 45.398 83.290 52.124  1.00 213.46 ? 149 THR F OG1  1 
ATOM   6987 C  CG2  . THR F 1 149 ? 45.618 85.683 52.432  1.00 212.59 ? 149 THR F CG2  1 
HETATM 6988 C  C1   . 2CS G 2 .   ? 78.047 64.251 9.468   1.00 201.44 ? 502 2CS A C1   1 
HETATM 6989 C  C2   . 2CS G 2 .   ? 77.464 63.511 10.694  1.00 201.47 ? 502 2CS A C2   1 
HETATM 6990 C  C3   . 2CS G 2 .   ? 77.067 62.141 10.449  1.00 201.41 ? 502 2CS A C3   1 
HETATM 6991 O  O4   . 2CS G 2 .   ? 77.472 61.451 9.522   1.00 201.40 ? 502 2CS A O4   1 
HETATM 6992 O  O5   . 2CS G 2 .   ? 76.341 61.522 11.218  1.00 201.39 ? 502 2CS A O5   1 
HETATM 6993 C  C7   . 2CS G 2 .   ? 76.248 64.314 11.250  1.00 201.63 ? 502 2CS A C7   1 
HETATM 6994 C  C8   . 2CS G 2 .   ? 75.842 63.932 12.613  1.00 201.83 ? 502 2CS A C8   1 
HETATM 6995 C  C10  . 2CS G 2 .   ? 77.670 65.040 13.895  1.00 201.81 ? 502 2CS A C10  1 
HETATM 6996 C  C11  . 2CS G 2 .   ? 77.627 66.191 13.027  1.00 201.73 ? 502 2CS A C11  1 
HETATM 6997 C  C12  . 2CS G 2 .   ? 78.515 66.184 11.932  1.00 201.73 ? 502 2CS A C12  1 
HETATM 6998 C  C13  . 2CS G 2 .   ? 78.476 67.251 11.044  1.00 201.75 ? 502 2CS A C13  1 
HETATM 6999 C  C14  . 2CS G 2 .   ? 76.678 67.204 13.304  1.00 201.70 ? 502 2CS A C14  1 
HETATM 7000 C  C15  . 2CS G 2 .   ? 76.629 68.292 12.435  1.00 201.73 ? 502 2CS A C15  1 
HETATM 7001 C  C16  . 2CS G 2 .   ? 77.539 68.272 11.345  1.00 201.81 ? 502 2CS A C16  1 
HETATM 7002 C  C19  . 2CS G 2 .   ? 76.144 63.735 16.178  1.00 202.23 ? 502 2CS A C19  1 
HETATM 7003 C  C20  . 2CS G 2 .   ? 75.311 63.052 17.057  1.00 202.36 ? 502 2CS A C20  1 
HETATM 7004 C  C21  . 2CS G 2 .   ? 74.761 62.963 14.264  1.00 202.15 ? 502 2CS A C21  1 
HETATM 7005 C  C22  . 2CS G 2 .   ? 73.912 62.254 15.133  1.00 202.35 ? 502 2CS A C22  1 
HETATM 7006 C  C27  . 2CS G 2 .   ? 73.744 62.144 20.343  1.00 203.51 ? 502 2CS A C27  1 
HETATM 7007 C  C30  . 2CS G 2 .   ? 73.841 64.954 20.356  1.00 203.72 ? 502 2CS A C30  1 
HETATM 7008 C  C31  . 2CS G 2 .   ? 73.869 66.363 20.339  1.00 203.83 ? 502 2CS A C31  1 
HETATM 7009 C  C32  . 2CS G 2 .   ? 74.427 66.997 21.483  1.00 203.95 ? 502 2CS A C32  1 
HETATM 7010 C  C33  . 2CS G 2 .   ? 74.935 66.258 22.587  1.00 204.02 ? 502 2CS A C33  1 
HETATM 7011 C  C34  . 2CS G 2 .   ? 74.896 64.837 22.589  1.00 203.98 ? 502 2CS A C34  1 
HETATM 7012 C  C28  . 2CS G 2 .   ? 74.299 62.773 21.455  1.00 203.69 ? 502 2CS A C28  1 
HETATM 7013 C  C29  . 2CS G 2 .   ? 74.343 64.181 21.462  1.00 203.83 ? 502 2CS A C29  1 
HETATM 7014 N  N35  . 2CS G 2 .   ? 73.329 64.312 19.313  1.00 203.52 ? 502 2CS A N35  1 
HETATM 7015 C  C26  . 2CS G 2 .   ? 73.271 62.970 19.305  1.00 203.36 ? 502 2CS A C26  1 
HETATM 7016 C  C25  . 2CS G 2 .   ? 72.678 62.314 18.175  1.00 203.07 ? 502 2CS A C25  1 
HETATM 7017 O  O24  . 2CS G 2 .   ? 73.508 61.723 17.324  1.00 202.79 ? 502 2CS A O24  1 
HETATM 7018 C  C23  . 2CS G 2 .   ? 74.232 62.333 16.519  1.00 202.50 ? 502 2CS A C23  1 
HETATM 7019 C  C18  . 2CS G 2 .   ? 75.839 63.667 14.788  1.00 202.09 ? 502 2CS A C18  1 
HETATM 7020 C  C36  . 2CS G 2 .   ? 74.746 63.137 12.886  1.00 201.97 ? 502 2CS A C36  1 
HETATM 7021 S  S37  . 2CS G 2 .   ? 73.566 62.533 11.757  1.00 201.91 ? 502 2CS A S37  1 
HETATM 7022 C  C38  . 2CS G 2 .   ? 72.160 63.678 12.091  1.00 201.87 ? 502 2CS A C38  1 
HETATM 7023 C  C41  . 2CS G 2 .   ? 72.377 64.846 13.067  1.00 201.84 ? 502 2CS A C41  1 
HETATM 7024 C  C39  . 2CS G 2 .   ? 71.978 64.395 10.775  1.00 201.90 ? 502 2CS A C39  1 
HETATM 7025 C  C40  . 2CS G 2 .   ? 70.823 63.005 12.443  1.00 201.86 ? 502 2CS A C40  1 
HETATM 7026 C  C6   . 2CS G 2 .   ? 78.625 63.267 11.688  1.00 201.45 ? 502 2CS A C6   1 
HETATM 7027 N  N9   . 2CS G 2 .   ? 76.482 64.235 13.755  1.00 201.90 ? 502 2CS A N9   1 
HETATM 7028 CL CL17 . 2CS G 2 .   ? 77.517 69.559 10.298  1.00 201.96 ? 502 2CS A CL17 1 
HETATM 7029 C  C1   . 2CS H 2 .   ? 65.848 88.424 31.980  1.00 204.27 ? 503 2CS A C1   1 
HETATM 7030 C  C2   . 2CS H 2 .   ? 64.588 88.075 32.744  1.00 204.29 ? 503 2CS A C2   1 
HETATM 7031 C  C3   . 2CS H 2 .   ? 64.802 87.946 34.177  1.00 204.40 ? 503 2CS A C3   1 
HETATM 7032 O  O4   . 2CS H 2 .   ? 65.808 88.370 34.726  1.00 204.46 ? 503 2CS A O4   1 
HETATM 7033 O  O5   . 2CS H 2 .   ? 64.065 87.312 34.944  1.00 204.42 ? 503 2CS A O5   1 
HETATM 7034 C  C7   . 2CS H 2 .   ? 64.086 86.715 32.259  1.00 204.19 ? 503 2CS A C7   1 
HETATM 7035 C  C8   . 2CS H 2 .   ? 65.023 85.761 31.662  1.00 204.11 ? 503 2CS A C8   1 
HETATM 7036 C  C10  . 2CS H 2 .   ? 66.855 85.819 33.289  1.00 204.18 ? 503 2CS A C10  1 
HETATM 7037 C  C11  . 2CS H 2 .   ? 66.158 85.321 34.432  1.00 204.28 ? 503 2CS A C11  1 
HETATM 7038 C  C12  . 2CS H 2 .   ? 66.575 85.841 35.664  1.00 204.37 ? 503 2CS A C12  1 
HETATM 7039 C  C13  . 2CS H 2 .   ? 65.908 85.381 36.804  1.00 204.42 ? 503 2CS A C13  1 
HETATM 7040 C  C14  . 2CS H 2 .   ? 65.116 84.383 34.239  1.00 204.28 ? 503 2CS A C14  1 
HETATM 7041 C  C15  . 2CS H 2 .   ? 64.442 83.930 35.373  1.00 204.36 ? 503 2CS A C15  1 
HETATM 7042 C  C16  . 2CS H 2 .   ? 64.865 84.441 36.633  1.00 204.46 ? 503 2CS A C16  1 
HETATM 7043 C  C19  . 2CS H 2 .   ? 67.956 83.832 31.415  1.00 203.99 ? 503 2CS A C19  1 
HETATM 7044 C  C20  . 2CS H 2 .   ? 68.296 82.945 30.406  1.00 203.90 ? 503 2CS A C20  1 
HETATM 7045 C  C21  . 2CS H 2 .   ? 65.800 84.284 30.228  1.00 203.98 ? 503 2CS A C21  1 
HETATM 7046 C  C22  . 2CS H 2 .   ? 66.137 83.369 29.191  1.00 203.87 ? 503 2CS A C22  1 
HETATM 7047 C  C27  . 2CS H 2 .   ? 69.696 79.364 28.388  1.00 202.84 ? 503 2CS A C27  1 
HETATM 7048 C  C30  . 2CS H 2 .   ? 68.916 78.098 30.841  1.00 202.62 ? 503 2CS A C30  1 
HETATM 7049 C  C31  . 2CS H 2 .   ? 68.488 77.489 32.051  1.00 202.49 ? 503 2CS A C31  1 
HETATM 7050 C  C32  . 2CS H 2 .   ? 69.394 76.545 32.608  1.00 202.42 ? 503 2CS A C32  1 
HETATM 7051 C  C33  . 2CS H 2 .   ? 70.647 76.216 31.998  1.00 202.41 ? 503 2CS A C33  1 
HETATM 7052 C  C34  . 2CS H 2 .   ? 71.075 76.820 30.778  1.00 202.48 ? 503 2CS A C34  1 
HETATM 7053 C  C28  . 2CS H 2 .   ? 70.570 78.413 28.975  1.00 202.74 ? 503 2CS A C28  1 
HETATM 7054 C  C29  . 2CS H 2 .   ? 70.192 77.777 30.195  1.00 202.61 ? 503 2CS A C29  1 
HETATM 7055 N  N35  . 2CS H 2 .   ? 68.112 79.015 30.243  1.00 202.78 ? 503 2CS A N35  1 
HETATM 7056 C  C26  . 2CS H 2 .   ? 68.471 79.631 29.060  1.00 202.95 ? 503 2CS A C26  1 
HETATM 7057 C  C25  . 2CS H 2 .   ? 67.571 80.585 28.425  1.00 203.23 ? 503 2CS A C25  1 
HETATM 7058 O  O24  . 2CS H 2 .   ? 67.865 81.885 28.498  1.00 203.49 ? 503 2CS A O24  1 
HETATM 7059 C  C23  . 2CS H 2 .   ? 67.417 82.711 29.338  1.00 203.76 ? 503 2CS A C23  1 
HETATM 7060 C  C18  . 2CS H 2 .   ? 66.713 84.478 31.285  1.00 204.01 ? 503 2CS A C18  1 
HETATM 7061 C  C36  . 2CS H 2 .   ? 64.695 85.122 30.514  1.00 204.10 ? 503 2CS A C36  1 
HETATM 7062 S  S37  . 2CS H 2 .   ? 63.116 85.462 29.821  1.00 204.19 ? 503 2CS A S37  1 
HETATM 7063 C  C38  . 2CS H 2 .   ? 61.903 84.907 31.141  1.00 204.14 ? 503 2CS A C38  1 
HETATM 7064 C  C41  . 2CS H 2 .   ? 62.492 84.184 32.372  1.00 204.12 ? 503 2CS A C41  1 
HETATM 7065 C  C39  . 2CS H 2 .   ? 61.214 86.136 31.722  1.00 204.11 ? 503 2CS A C39  1 
HETATM 7066 C  C40  . 2CS H 2 .   ? 60.726 84.074 30.629  1.00 204.13 ? 503 2CS A C40  1 
HETATM 7067 C  C6   . 2CS H 2 .   ? 63.709 89.252 32.319  1.00 204.29 ? 503 2CS A C6   1 
HETATM 7068 N  N9   . 2CS H 2 .   ? 66.206 85.372 32.116  1.00 204.09 ? 503 2CS A N9   1 
HETATM 7069 CL CL17 . 2CS H 2 .   ? 64.104 83.919 38.034  1.00 204.61 ? 503 2CS A CL17 1 
HETATM 7070 C  C1   . 2CS I 2 .   ? 60.871 52.311 42.525  1.00 193.59 ? 501 2CS C C1   1 
HETATM 7071 C  C2   . 2CS I 2 .   ? 62.085 53.143 42.048  1.00 193.59 ? 501 2CS C C2   1 
HETATM 7072 C  C3   . 2CS I 2 .   ? 62.408 54.113 43.119  1.00 193.69 ? 501 2CS C C3   1 
HETATM 7073 O  O4   . 2CS I 2 .   ? 61.828 55.212 43.238  1.00 193.70 ? 501 2CS C O4   1 
HETATM 7074 O  O5   . 2CS I 2 .   ? 63.261 53.931 44.016  1.00 193.78 ? 501 2CS C O5   1 
HETATM 7075 C  C7   . 2CS I 2 .   ? 61.756 53.776 40.649  1.00 193.52 ? 501 2CS C C7   1 
HETATM 7076 C  C8   . 2CS I 2 .   ? 62.175 55.152 40.320  1.00 193.56 ? 501 2CS C C8   1 
HETATM 7077 C  C10  . 2CS I 2 .   ? 64.425 54.936 41.068  1.00 193.64 ? 501 2CS C C10  1 
HETATM 7078 C  C11  . 2CS I 2 .   ? 64.874 54.209 39.938  1.00 193.65 ? 501 2CS C C11  1 
HETATM 7079 C  C12  . 2CS I 2 .   ? 64.589 54.664 38.628  1.00 193.62 ? 501 2CS C C12  1 
HETATM 7080 C  C13  . 2CS I 2 .   ? 65.042 53.900 37.565  1.00 193.64 ? 501 2CS C C13  1 
HETATM 7081 C  C14  . 2CS I 2 .   ? 65.568 53.076 40.283  1.00 193.70 ? 501 2CS C C14  1 
HETATM 7082 C  C15  . 2CS I 2 .   ? 66.021 52.317 39.243  1.00 193.73 ? 501 2CS C C15  1 
HETATM 7083 C  C16  . 2CS I 2 .   ? 65.757 52.747 37.947  1.00 193.75 ? 501 2CS C C16  1 
HETATM 7084 C  C19  . 2CS I 2 .   ? 64.628 57.794 40.202  1.00 193.45 ? 501 2CS C C19  1 
HETATM 7085 C  C20  . 2CS I 2 .   ? 64.475 59.098 39.730  1.00 193.37 ? 501 2CS C C20  1 
HETATM 7086 C  C21  . 2CS I 2 .   ? 62.224 57.277 39.644  1.00 193.48 ? 501 2CS C C21  1 
HETATM 7087 C  C22  . 2CS I 2 .   ? 62.074 58.613 39.152  1.00 193.36 ? 501 2CS C C22  1 
HETATM 7088 C  C27  . 2CS I 2 .   ? 65.663 63.226 38.310  1.00 192.79 ? 501 2CS C C27  1 
HETATM 7089 C  C30  . 2CS I 2 .   ? 66.543 61.411 36.347  1.00 192.67 ? 501 2CS C C30  1 
HETATM 7090 C  C31  . 2CS I 2 .   ? 66.978 60.484 35.354  1.00 192.65 ? 501 2CS C C31  1 
HETATM 7091 C  C32  . 2CS I 2 .   ? 68.111 60.844 34.556  1.00 192.61 ? 501 2CS C C32  1 
HETATM 7092 C  C33  . 2CS I 2 .   ? 68.775 62.088 34.747  1.00 192.57 ? 501 2CS C C33  1 
HETATM 7093 C  C34  . 2CS I 2 .   ? 68.345 63.024 35.733  1.00 192.57 ? 501 2CS C C34  1 
HETATM 7094 C  C28  . 2CS I 2 .   ? 66.778 63.563 37.509  1.00 192.73 ? 501 2CS C C28  1 
HETATM 7095 C  C29  . 2CS I 2 .   ? 67.226 62.669 36.530  1.00 192.65 ? 501 2CS C C29  1 
HETATM 7096 N  N35  . 2CS I 2 .   ? 65.462 61.122 37.144  1.00 192.73 ? 501 2CS C N35  1 
HETATM 7097 C  C26  . 2CS I 2 .   ? 65.022 61.988 38.106  1.00 192.83 ? 501 2CS C C26  1 
HETATM 7098 C  C25  . 2CS I 2 .   ? 63.892 61.733 39.007  1.00 192.98 ? 501 2CS C C25  1 
HETATM 7099 O  O24  . 2CS I 2 .   ? 63.106 60.668 38.767  1.00 193.13 ? 501 2CS C O24  1 
HETATM 7100 C  C23  . 2CS I 2 .   ? 63.223 59.490 39.213  1.00 193.28 ? 501 2CS C C23  1 
HETATM 7101 C  C18  . 2CS I 2 .   ? 63.482 56.935 40.148  1.00 193.52 ? 501 2CS C C18  1 
HETATM 7102 C  C36  . 2CS I 2 .   ? 61.372 56.117 39.754  1.00 193.56 ? 501 2CS C C36  1 
HETATM 7103 S  S37  . 2CS I 2 .   ? 59.704 55.815 39.276  1.00 193.58 ? 501 2CS C S37  1 
HETATM 7104 C  C38  . 2CS I 2 .   ? 60.002 55.479 37.453  1.00 193.55 ? 501 2CS C C38  1 
HETATM 7105 C  C41  . 2CS I 2 .   ? 59.229 54.272 36.939  1.00 193.55 ? 501 2CS C C41  1 
HETATM 7106 C  C39  . 2CS I 2 .   ? 59.548 56.685 36.606  1.00 193.54 ? 501 2CS C C39  1 
HETATM 7107 C  C40  . 2CS I 2 .   ? 61.455 55.253 36.998  1.00 193.51 ? 501 2CS C C40  1 
HETATM 7108 C  C6   . 2CS I 2 .   ? 63.243 52.132 41.919  1.00 193.60 ? 501 2CS C C6   1 
HETATM 7109 N  N9   . 2CS I 2 .   ? 63.378 55.657 40.530  1.00 193.60 ? 501 2CS C N9   1 
HETATM 7110 CL CL17 . 2CS I 2 .   ? 66.399 51.695 36.844  1.00 193.92 ? 501 2CS C CL17 1 
HETATM 7111 C  C1   . 2CS J 2 .   ? 42.105 32.994 27.530  1.00 194.85 ? 504 2CS D C1   1 
HETATM 7112 C  C2   . 2CS J 2 .   ? 43.271 33.104 28.517  1.00 194.89 ? 504 2CS D C2   1 
HETATM 7113 C  C3   . 2CS J 2 .   ? 44.297 32.110 28.242  1.00 194.94 ? 504 2CS D C3   1 
HETATM 7114 O  O4   . 2CS J 2 .   ? 44.315 31.390 27.240  1.00 194.92 ? 504 2CS D O4   1 
HETATM 7115 O  O5   . 2CS J 2 .   ? 45.224 31.857 29.007  1.00 194.99 ? 504 2CS D O5   1 
HETATM 7116 C  C7   . 2CS J 2 .   ? 42.754 32.871 29.957  1.00 194.95 ? 504 2CS D C7   1 
HETATM 7117 C  C8   . 2CS J 2 .   ? 41.430 32.263 30.258  1.00 195.00 ? 504 2CS D C8   1 
HETATM 7118 C  C10  . 2CS J 2 .   ? 41.832 29.842 29.874  1.00 194.91 ? 504 2CS D C10  1 
HETATM 7119 C  C11  . 2CS J 2 .   ? 42.937 29.899 30.793  1.00 194.82 ? 504 2CS D C11  1 
HETATM 7120 C  C12  . 2CS J 2 .   ? 44.250 29.613 30.343  1.00 194.78 ? 504 2CS D C12  1 
HETATM 7121 C  C13  . 2CS J 2 .   ? 45.283 29.721 31.288  1.00 194.83 ? 504 2CS D C13  1 
HETATM 7122 C  C14  . 2CS J 2 .   ? 42.575 30.282 32.097  1.00 194.84 ? 504 2CS D C14  1 
HETATM 7123 C  C15  . 2CS J 2 .   ? 43.579 30.385 33.039  1.00 194.87 ? 504 2CS D C15  1 
HETATM 7124 C  C16  . 2CS J 2 .   ? 44.900 30.101 32.603  1.00 194.91 ? 504 2CS D C16  1 
HETATM 7125 C  C19  . 2CS J 2 .   ? 38.906 29.723 30.736  1.00 195.18 ? 504 2CS D C19  1 
HETATM 7126 C  C20  . 2CS J 2 .   ? 37.581 29.906 31.156  1.00 195.19 ? 504 2CS D C20  1 
HETATM 7127 C  C21  . 2CS J 2 .   ? 39.313 32.173 30.885  1.00 195.15 ? 504 2CS D C21  1 
HETATM 7128 C  C22  . 2CS J 2 .   ? 37.976 32.360 31.301  1.00 195.23 ? 504 2CS D C22  1 
HETATM 7129 C  C27  . 2CS J 2 .   ? 33.974 28.402 32.523  1.00 194.70 ? 504 2CS D C27  1 
HETATM 7130 C  C30  . 2CS J 2 .   ? 36.134 27.860 34.259  1.00 194.47 ? 504 2CS D C30  1 
HETATM 7131 C  C31  . 2CS J 2 .   ? 37.215 27.580 35.146  1.00 194.36 ? 504 2CS D C31  1 
HETATM 7132 C  C32  . 2CS J 2 .   ? 37.174 26.309 35.819  1.00 194.32 ? 504 2CS D C32  1 
HETATM 7133 C  C33  . 2CS J 2 .   ? 36.123 25.353 35.606  1.00 194.33 ? 504 2CS D C33  1 
HETATM 7134 C  C34  . 2CS J 2 .   ? 35.035 25.623 34.726  1.00 194.38 ? 504 2CS D C34  1 
HETATM 7135 C  C28  . 2CS J 2 .   ? 33.983 27.167 33.193  1.00 194.58 ? 504 2CS D C28  1 
HETATM 7136 C  C29  . 2CS J 2 .   ? 35.051 26.885 34.058  1.00 194.46 ? 504 2CS D C29  1 
HETATM 7137 N  N35  . 2CS J 2 .   ? 36.089 29.050 33.584  1.00 194.65 ? 504 2CS D N35  1 
HETATM 7138 C  C26  . 2CS J 2 .   ? 35.039 29.319 32.736  1.00 194.81 ? 504 2CS D C26  1 
HETATM 7139 C  C25  . 2CS J 2 .   ? 34.898 30.560 31.964  1.00 195.05 ? 504 2CS D C25  1 
HETATM 7140 O  O24  . 2CS J 2 .   ? 35.938 31.410 31.838  1.00 195.22 ? 504 2CS D O24  1 
HETATM 7141 C  C23  . 2CS J 2 .   ? 37.131 31.208 31.438  1.00 195.24 ? 504 2CS D C23  1 
HETATM 7142 C  C18  . 2CS J 2 .   ? 39.736 30.874 30.612  1.00 195.15 ? 504 2CS D C18  1 
HETATM 7143 C  C36  . 2CS J 2 .   ? 40.406 33.061 30.673  1.00 194.98 ? 504 2CS D C36  1 
HETATM 7144 S  S37  . 2CS J 2 .   ? 40.640 34.801 30.868  1.00 194.74 ? 504 2CS D S37  1 
HETATM 7145 C  C38  . 2CS J 2 .   ? 41.820 34.932 32.245  1.00 194.47 ? 504 2CS D C38  1 
HETATM 7146 C  C41  . 2CS J 2 .   ? 42.175 33.617 32.952  1.00 194.39 ? 504 2CS D C41  1 
HETATM 7147 C  C39  . 2CS J 2 .   ? 43.119 35.358 31.590  1.00 194.36 ? 504 2CS D C39  1 
HETATM 7148 C  C40  . 2CS J 2 .   ? 41.418 35.988 33.279  1.00 194.47 ? 504 2CS D C40  1 
HETATM 7149 C  C6   . 2CS J 2 .   ? 43.806 34.516 28.272  1.00 194.86 ? 504 2CS D C6   1 
HETATM 7150 N  N9   . 2CS J 2 .   ? 41.020 30.965 30.229  1.00 195.04 ? 504 2CS D N9   1 
HETATM 7151 CL CL17 . 2CS J 2 .   ? 46.121 30.220 33.747  1.00 195.03 ? 504 2CS D CL17 1 
HETATM 7152 C  C1   . 2CS K 2 .   ? 34.701 18.452 61.724  1.00 196.26 ? 505 2CS E C1   1 
HETATM 7153 C  C2   . 2CS K 2 .   ? 34.347 18.118 60.268  1.00 196.22 ? 505 2CS E C2   1 
HETATM 7154 C  C3   . 2CS K 2 .   ? 35.533 18.262 59.484  1.00 196.26 ? 505 2CS E C3   1 
HETATM 7155 O  O4   . 2CS K 2 .   ? 36.067 17.347 58.855  1.00 196.33 ? 505 2CS E O4   1 
HETATM 7156 O  O5   . 2CS K 2 .   ? 36.114 19.330 59.399  1.00 196.23 ? 505 2CS E O5   1 
HETATM 7157 C  C7   . 2CS K 2 .   ? 33.346 19.146 59.737  1.00 196.22 ? 505 2CS E C7   1 
HETATM 7158 C  C8   . 2CS K 2 .   ? 33.576 19.526 58.353  1.00 196.28 ? 505 2CS E C8   1 
HETATM 7159 C  C10  . 2CS K 2 .   ? 33.237 17.303 57.321  1.00 196.34 ? 505 2CS E C10  1 
HETATM 7160 C  C11  . 2CS K 2 .   ? 31.827 17.304 57.580  1.00 196.37 ? 505 2CS E C11  1 
HETATM 7161 C  C12  . 2CS K 2 .   ? 31.103 18.449 57.170  1.00 196.36 ? 505 2CS E C12  1 
HETATM 7162 C  C13  . 2CS K 2 .   ? 29.729 18.505 57.410  1.00 196.42 ? 505 2CS E C13  1 
HETATM 7163 C  C14  . 2CS K 2 .   ? 31.267 16.197 58.240  1.00 196.45 ? 505 2CS E C14  1 
HETATM 7164 C  C15  . 2CS K 2 .   ? 29.892 16.227 58.488  1.00 196.52 ? 505 2CS E C15  1 
HETATM 7165 C  C16  . 2CS K 2 .   ? 29.180 17.373 58.071  1.00 196.56 ? 505 2CS E C16  1 
HETATM 7166 C  C19  . 2CS K 2 .   ? 33.810 18.730 54.899  1.00 196.36 ? 505 2CS E C19  1 
HETATM 7167 C  C20  . 2CS K 2 .   ? 34.113 19.600 53.844  1.00 196.38 ? 505 2CS E C20  1 
HETATM 7168 C  C21  . 2CS K 2 .   ? 33.999 20.649 56.525  1.00 196.37 ? 505 2CS E C21  1 
HETATM 7169 C  C22  . 2CS K 2 .   ? 34.286 21.547 55.443  1.00 196.40 ? 505 2CS E C22  1 
HETATM 7170 C  C27  . 2CS K 2 .   ? 34.984 21.171 50.351  1.00 196.00 ? 505 2CS E C27  1 
HETATM 7171 C  C30  . 2CS K 2 .   ? 32.301 20.651 49.508  1.00 195.88 ? 505 2CS E C30  1 
HETATM 7172 C  C31  . 2CS K 2 .   ? 30.930 20.427 49.177  1.00 195.82 ? 505 2CS E C31  1 
HETATM 7173 C  C32  . 2CS K 2 .   ? 30.707 19.781 47.949  1.00 195.81 ? 505 2CS E C32  1 
HETATM 7174 C  C33  . 2CS K 2 .   ? 31.823 19.397 47.134  1.00 195.83 ? 505 2CS E C33  1 
HETATM 7175 C  C34  . 2CS K 2 .   ? 33.208 19.637 47.473  1.00 195.86 ? 505 2CS E C34  1 
HETATM 7176 C  C28  . 2CS K 2 .   ? 34.808 20.534 49.110  1.00 195.92 ? 505 2CS E C28  1 
HETATM 7177 C  C29  . 2CS K 2 .   ? 33.462 20.280 48.702  1.00 195.88 ? 505 2CS E C29  1 
HETATM 7178 N  N35  . 2CS K 2 .   ? 32.540 21.251 50.654  1.00 195.98 ? 505 2CS E N35  1 
HETATM 7179 C  C26  . 2CS K 2 .   ? 33.791 21.505 51.058  1.00 196.09 ? 505 2CS E C26  1 
HETATM 7180 C  C25  . 2CS K 2 .   ? 33.860 22.188 52.309  1.00 196.25 ? 505 2CS E C25  1 
HETATM 7181 O  O24  . 2CS K 2 .   ? 34.691 21.678 53.175  1.00 196.36 ? 505 2CS E O24  1 
HETATM 7182 C  C23  . 2CS K 2 .   ? 34.356 20.963 54.124  1.00 196.39 ? 505 2CS E C23  1 
HETATM 7183 C  C18  . 2CS K 2 .   ? 33.779 19.298 56.198  1.00 196.35 ? 505 2CS E C18  1 
HETATM 7184 C  C36  . 2CS K 2 .   ? 33.883 20.801 57.930  1.00 196.30 ? 505 2CS E C36  1 
HETATM 7185 S  S37  . 2CS K 2 .   ? 34.063 22.226 58.934  1.00 196.17 ? 505 2CS E S37  1 
HETATM 7186 C  C38  . 2CS K 2 .   ? 33.022 23.559 58.173  1.00 196.08 ? 505 2CS E C38  1 
HETATM 7187 C  C41  . 2CS K 2 .   ? 32.746 24.654 59.164  1.00 196.09 ? 505 2CS E C41  1 
HETATM 7188 C  C39  . 2CS K 2 .   ? 33.858 24.326 57.152  1.00 196.06 ? 505 2CS E C39  1 
HETATM 7189 C  C40  . 2CS K 2 .   ? 31.665 23.231 57.509  1.00 196.03 ? 505 2CS E C40  1 
HETATM 7190 C  C6   . 2CS K 2 .   ? 33.841 16.669 60.168  1.00 196.19 ? 505 2CS E C6   1 
HETATM 7191 N  N9   . 2CS K 2 .   ? 33.541 18.672 57.316  1.00 196.32 ? 505 2CS E N9   1 
HETATM 7192 CL CL17 . 2CS K 2 .   ? 27.556 17.329 58.417  1.00 196.74 ? 505 2CS E CL17 1 
HETATM 7193 C  C1   . 2CS L 2 .   ? 8.575  28.407 38.126  1.00 243.49 ? 506 2CS E C1   1 
HETATM 7194 C  C2   . 2CS L 2 .   ? 9.362  28.582 36.810  1.00 243.49 ? 506 2CS E C2   1 
HETATM 7195 C  C3   . 2CS L 2 .   ? 9.163  27.444 35.919  1.00 243.56 ? 506 2CS E C3   1 
HETATM 7196 O  O4   . 2CS L 2 .   ? 9.088  26.267 36.285  1.00 243.59 ? 506 2CS E O4   1 
HETATM 7197 O  O5   . 2CS L 2 .   ? 9.029  27.562 34.705  1.00 243.60 ? 506 2CS E O5   1 
HETATM 7198 C  C7   . 2CS L 2 .   ? 10.824 28.804 37.235  1.00 243.41 ? 506 2CS E C7   1 
HETATM 7199 C  C8   . 2CS L 2 .   ? 11.748 27.831 37.843  1.00 243.35 ? 506 2CS E C8   1 
HETATM 7200 C  C10  . 2CS L 2 .   ? 11.882 26.139 36.035  1.00 243.35 ? 506 2CS E C10  1 
HETATM 7201 C  C11  . 2CS L 2 .   ? 12.320 26.834 34.834  1.00 243.38 ? 506 2CS E C11  1 
HETATM 7202 C  C12  . 2CS L 2 .   ? 13.495 27.653 34.808  1.00 243.40 ? 506 2CS E C12  1 
HETATM 7203 C  C13  . 2CS L 2 .   ? 13.845 28.285 33.575  1.00 243.42 ? 506 2CS E C13  1 
HETATM 7204 C  C14  . 2CS L 2 .   ? 11.486 26.612 33.712  1.00 243.39 ? 506 2CS E C14  1 
HETATM 7205 C  C15  . 2CS L 2 .   ? 11.829 27.239 32.496  1.00 243.43 ? 506 2CS E C15  1 
HETATM 7206 C  C16  . 2CS L 2 .   ? 12.991 28.053 32.440  1.00 243.46 ? 506 2CS E C16  1 
HETATM 7207 C  C19  . 2CS L 2 .   ? 13.815 24.923 38.008  1.00 243.25 ? 506 2CS E C19  1 
HETATM 7208 C  C20  . 2CS L 2 .   ? 14.655 24.565 39.087  1.00 243.17 ? 506 2CS E C20  1 
HETATM 7209 C  C21  . 2CS L 2 .   ? 13.134 26.963 39.308  1.00 243.25 ? 506 2CS E C21  1 
HETATM 7210 C  C22  . 2CS L 2 .   ? 13.977 26.623 40.404  1.00 243.16 ? 506 2CS E C22  1 
HETATM 7211 C  C27  . 2CS L 2 .   ? 18.491 23.673 41.251  1.00 242.24 ? 506 2CS E C27  1 
HETATM 7212 C  C30  . 2CS L 2 .   ? 19.216 24.975 38.843  1.00 242.13 ? 506 2CS E C30  1 
HETATM 7213 C  C31  . 2CS L 2 .   ? 19.543 25.671 37.651  1.00 242.06 ? 506 2CS E C31  1 
HETATM 7214 C  C32  . 2CS L 2 .   ? 20.609 25.105 36.909  1.00 242.01 ? 506 2CS E C32  1 
HETATM 7215 C  C33  . 2CS L 2 .   ? 21.290 23.913 37.333  1.00 241.99 ? 506 2CS E C33  1 
HETATM 7216 C  C34  . 2CS L 2 .   ? 20.962 23.217 38.537  1.00 242.02 ? 506 2CS E C34  1 
HETATM 7217 C  C28  . 2CS L 2 .   ? 19.543 23.118 40.496  1.00 242.15 ? 506 2CS E C28  1 
HETATM 7218 C  C29  . 2CS L 2 .   ? 19.904 23.766 39.298  1.00 242.09 ? 506 2CS E C29  1 
HETATM 7219 N  N35  . 2CS L 2 .   ? 18.222 25.457 39.595  1.00 242.25 ? 506 2CS E N35  1 
HETATM 7220 C  C26  . 2CS L 2 .   ? 17.861 24.845 40.754  1.00 242.37 ? 506 2CS E C26  1 
HETATM 7221 C  C25  . 2CS L 2 .   ? 16.772 25.410 41.543  1.00 242.63 ? 506 2CS E C25  1 
HETATM 7222 O  O24  . 2CS L 2 .   ? 15.516 25.000 41.229  1.00 242.87 ? 506 2CS E O24  1 
HETATM 7223 C  C23  . 2CS L 2 .   ? 14.744 25.394 40.266  1.00 243.08 ? 506 2CS E C23  1 
HETATM 7224 C  C18  . 2CS L 2 .   ? 13.074 26.135 38.164  1.00 243.28 ? 506 2CS E C18  1 
HETATM 7225 C  C36  . 2CS L 2 .   ? 12.286 28.034 39.099  1.00 243.31 ? 506 2CS E C36  1 
HETATM 7226 S  S37  . 2CS L 2 .   ? 11.976 29.386 40.140  1.00 243.32 ? 506 2CS E S37  1 
HETATM 7227 C  C38  . 2CS L 2 .   ? 12.316 30.893 39.123  1.00 243.25 ? 506 2CS E C38  1 
HETATM 7228 C  C41  . 2CS L 2 .   ? 11.112 31.526 38.426  1.00 243.19 ? 506 2CS E C41  1 
HETATM 7229 C  C39  . 2CS L 2 .   ? 12.786 31.956 40.126  1.00 243.25 ? 506 2CS E C39  1 
HETATM 7230 C  C40  . 2CS L 2 .   ? 13.396 30.759 38.032  1.00 243.23 ? 506 2CS E C40  1 
HETATM 7231 C  C6   . 2CS L 2 .   ? 8.834  29.824 36.045  1.00 243.49 ? 506 2CS E C6   1 
HETATM 7232 N  N9   . 2CS L 2 .   ? 12.222 26.700 37.305  1.00 243.33 ? 506 2CS E N9   1 
HETATM 7233 CL CL17 . 2CS L 2 .   ? 13.341 28.766 30.941  1.00 243.55 ? 506 2CS E CL17 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  HIS 32  32  32  HIS HIS A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  CYS 78  78  78  CYS CYS A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 PHE 138 138 138 PHE PHE A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 GLY 140 140 ?   ?   ?   A . n 
A 1 141 SER 141 141 ?   ?   ?   A . n 
A 1 142 ASP 142 142 ?   ?   ?   A . n 
A 1 143 PHE 143 143 ?   ?   ?   A . n 
A 1 144 GLU 144 144 ?   ?   ?   A . n 
A 1 145 ASN 145 145 ?   ?   ?   A . n 
A 1 146 TYR 146 146 ?   ?   ?   A . n 
A 1 147 ILE 147 147 ?   ?   ?   A . n 
A 1 148 ALA 148 148 ?   ?   ?   A . n 
A 1 149 THR 149 149 ?   ?   ?   A . n 
A 1 150 ILE 150 150 ?   ?   ?   A . n 
A 1 151 SER 151 151 ?   ?   ?   A . n 
A 1 152 THR 152 152 ?   ?   ?   A . n 
A 1 153 THR 153 153 ?   ?   ?   A . n 
A 1 154 ILE 154 154 ?   ?   ?   A . n 
A 1 155 SER 155 155 ?   ?   ?   A . n 
A 1 156 PRO 156 156 ?   ?   ?   A . n 
A 1 157 LEU 157 157 ?   ?   ?   A . n 
A 1 158 LEU 158 158 ?   ?   ?   A . n 
A 1 159 LEU 159 159 ?   ?   ?   A . n 
A 1 160 ILE 160 160 ?   ?   ?   A . n 
A 1 161 PRO 161 161 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   GLN 3   3   3   GLN GLN B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   THR 5   5   5   THR THR B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  ILE 14  14  14  ILE ILE B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  THR 16  16  16  THR THR B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  GLN 22  22  22  GLN GLN B . n 
B 1 23  ASN 23  23  23  ASN ASN B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  PHE 25  25  25  PHE PHE B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  ALA 27  27  27  ALA ALA B . n 
B 1 28  HIS 28  28  28  HIS HIS B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  HIS 32  32  32  HIS HIS B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  SER 34  34  34  SER SER B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  GLN 37  37  37  GLN GLN B . n 
B 1 38  ASN 38  38  38  ASN ASN B . n 
B 1 39  GLY 39  39  39  GLY GLY B . n 
B 1 40  ARG 40  40  40  ARG ARG B . n 
B 1 41  SER 41  41  41  SER SER B . n 
B 1 42  PHE 42  42  42  PHE PHE B . n 
B 1 43  GLN 43  43  43  GLN GLN B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  ARG 52  52  52  ARG ARG B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  TYR 54  54  54  TYR TYR B . n 
B 1 55  THR 55  55  55  THR THR B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  GLN 58  58  58  GLN GLN B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  CYS 60  60  60  CYS CYS B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  TYR 64  64  64  TYR TYR B . n 
B 1 65  PRO 65  65  65  PRO PRO B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  PHE 67  67  67  PHE PHE B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  TRP 72  72  72  TRP TRP B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  ALA 74  74  74  ALA ALA B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  CYS 78  78  78  CYS CYS B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  GLN 80  80  80  GLN GLN B . n 
B 1 81  VAL 81  81  81  VAL VAL B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  PHE 85  85  85  PHE PHE B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  MET 89  89  89  MET MET B . n 
B 1 90  TYR 90  90  90  TYR TYR B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  PHE 92  92  92  PHE PHE B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  ARG 94  94  94  ARG ARG B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  PHE 98  98  98  PHE PHE B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 THR 109 109 109 THR THR B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 TYR 112 112 112 TYR TYR B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 PHE 114 114 114 PHE PHE B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 LYS 116 116 116 LYS LYS B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 PHE 121 121 121 PHE PHE B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 MET 125 125 125 MET MET B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 GLY 129 129 129 GLY GLY B . n 
B 1 130 ILE 130 130 130 ILE ILE B . n 
B 1 131 PHE 131 131 131 PHE PHE B . n 
B 1 132 ASN 132 132 132 ASN ASN B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 PHE 138 138 138 PHE PHE B . n 
B 1 139 PHE 139 139 139 PHE PHE B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 ASP 142 142 142 ASP ASP B . n 
B 1 143 PHE 143 143 143 PHE PHE B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 TYR 146 146 146 TYR TYR B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 THR 149 149 ?   ?   ?   B . n 
B 1 150 ILE 150 150 ?   ?   ?   B . n 
B 1 151 SER 151 151 ?   ?   ?   B . n 
B 1 152 THR 152 152 ?   ?   ?   B . n 
B 1 153 THR 153 153 ?   ?   ?   B . n 
B 1 154 ILE 154 154 ?   ?   ?   B . n 
B 1 155 SER 155 155 ?   ?   ?   B . n 
B 1 156 PRO 156 156 ?   ?   ?   B . n 
B 1 157 LEU 157 157 ?   ?   ?   B . n 
B 1 158 LEU 158 158 ?   ?   ?   B . n 
B 1 159 LEU 159 159 ?   ?   ?   B . n 
B 1 160 ILE 160 160 ?   ?   ?   B . n 
B 1 161 PRO 161 161 ?   ?   ?   B . n 
C 1 1   MET 1   1   1   MET MET C . n 
C 1 2   ASP 2   2   2   ASP ASP C . n 
C 1 3   GLN 3   3   3   GLN GLN C . n 
C 1 4   GLU 4   4   4   GLU GLU C . n 
C 1 5   THR 5   5   5   THR THR C . n 
C 1 6   VAL 6   6   6   VAL VAL C . n 
C 1 7   GLY 7   7   7   GLY GLY C . n 
C 1 8   ASN 8   8   8   ASN ASN C . n 
C 1 9   VAL 9   9   9   VAL VAL C . n 
C 1 10  VAL 10  10  10  VAL VAL C . n 
C 1 11  LEU 11  11  11  LEU LEU C . n 
C 1 12  LEU 12  12  12  LEU LEU C . n 
C 1 13  ALA 13  13  13  ALA ALA C . n 
C 1 14  ILE 14  14  14  ILE ILE C . n 
C 1 15  VAL 15  15  15  VAL VAL C . n 
C 1 16  THR 16  16  16  THR THR C . n 
C 1 17  LEU 17  17  17  LEU LEU C . n 
C 1 18  ILE 18  18  18  ILE ILE C . n 
C 1 19  SER 19  19  19  SER SER C . n 
C 1 20  VAL 20  20  20  VAL VAL C . n 
C 1 21  VAL 21  21  21  VAL VAL C . n 
C 1 22  GLN 22  22  22  GLN GLN C . n 
C 1 23  ASN 23  23  23  ASN ASN C . n 
C 1 24  GLY 24  24  24  GLY GLY C . n 
C 1 25  PHE 25  25  25  PHE PHE C . n 
C 1 26  PHE 26  26  26  PHE PHE C . n 
C 1 27  ALA 27  27  27  ALA ALA C . n 
C 1 28  HIS 28  28  28  HIS HIS C . n 
C 1 29  LYS 29  29  29  LYS LYS C . n 
C 1 30  VAL 30  30  30  VAL VAL C . n 
C 1 31  GLU 31  31  31  GLU GLU C . n 
C 1 32  HIS 32  32  32  HIS HIS C . n 
C 1 33  GLU 33  33  33  GLU GLU C . n 
C 1 34  SER 34  34  34  SER SER C . n 
C 1 35  ARG 35  35  35  ARG ARG C . n 
C 1 36  THR 36  36  36  THR THR C . n 
C 1 37  GLN 37  37  37  GLN GLN C . n 
C 1 38  ASN 38  38  38  ASN ASN C . n 
C 1 39  GLY 39  39  39  GLY GLY C . n 
C 1 40  ARG 40  40  40  ARG ARG C . n 
C 1 41  SER 41  41  41  SER SER C . n 
C 1 42  PHE 42  42  42  PHE PHE C . n 
C 1 43  GLN 43  43  43  GLN GLN C . n 
C 1 44  ARG 44  44  44  ARG ARG C . n 
C 1 45  THR 45  45  45  THR THR C . n 
C 1 46  GLY 46  46  46  GLY GLY C . n 
C 1 47  THR 47  47  47  THR THR C . n 
C 1 48  LEU 48  48  48  LEU LEU C . n 
C 1 49  ALA 49  49  49  ALA ALA C . n 
C 1 50  PHE 50  50  50  PHE PHE C . n 
C 1 51  GLU 51  51  51  GLU GLU C . n 
C 1 52  ARG 52  52  52  ARG ARG C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  TYR 54  54  54  TYR TYR C . n 
C 1 55  THR 55  55  55  THR THR C . n 
C 1 56  ALA 56  56  56  ALA ALA C . n 
C 1 57  ASN 57  57  57  ASN ASN C . n 
C 1 58  GLN 58  58  58  GLN GLN C . n 
C 1 59  ASN 59  59  59  ASN ASN C . n 
C 1 60  CYS 60  60  60  CYS CYS C . n 
C 1 61  VAL 61  61  61  VAL VAL C . n 
C 1 62  ASP 62  62  62  ASP ASP C . n 
C 1 63  ALA 63  63  63  ALA ALA C . n 
C 1 64  TYR 64  64  64  TYR TYR C . n 
C 1 65  PRO 65  65  65  PRO PRO C . n 
C 1 66  THR 66  66  66  THR THR C . n 
C 1 67  PHE 67  67  67  PHE PHE C . n 
C 1 68  LEU 68  68  68  LEU LEU C . n 
C 1 69  ALA 69  69  69  ALA ALA C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  TRP 72  72  72  TRP TRP C . n 
C 1 73  SER 73  73  73  SER SER C . n 
C 1 74  ALA 74  74  74  ALA ALA C . n 
C 1 75  GLY 75  75  75  GLY GLY C . n 
C 1 76  LEU 76  76  76  LEU LEU C . n 
C 1 77  LEU 77  77  77  LEU LEU C . n 
C 1 78  CYS 78  78  78  CYS CYS C . n 
C 1 79  SER 79  79  79  SER SER C . n 
C 1 80  GLN 80  80  80  GLN GLN C . n 
C 1 81  VAL 81  81  81  VAL VAL C . n 
C 1 82  PRO 82  82  82  PRO PRO C . n 
C 1 83  ALA 83  83  83  ALA ALA C . n 
C 1 84  ALA 84  84  84  ALA ALA C . n 
C 1 85  PHE 85  85  85  PHE PHE C . n 
C 1 86  ALA 86  86  86  ALA ALA C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  MET 89  89  89  MET MET C . n 
C 1 90  TYR 90  90  90  TYR TYR C . n 
C 1 91  LEU 91  91  91  LEU LEU C . n 
C 1 92  PHE 92  92  92  PHE PHE C . n 
C 1 93  VAL 93  93  93  VAL VAL C . n 
C 1 94  ARG 94  94  94  ARG ARG C . n 
C 1 95  GLN 95  95  95  GLN GLN C . n 
C 1 96  LYS 96  96  96  LYS LYS C . n 
C 1 97  TYR 97  97  97  TYR TYR C . n 
C 1 98  PHE 98  98  98  PHE PHE C . n 
C 1 99  VAL 99  99  99  VAL VAL C . n 
C 1 100 GLY 100 100 100 GLY GLY C . n 
C 1 101 TYR 101 101 101 TYR TYR C . n 
C 1 102 LEU 102 102 102 LEU LEU C . n 
C 1 103 GLY 103 103 103 GLY GLY C . n 
C 1 104 GLU 104 104 104 GLU GLU C . n 
C 1 105 ARG 105 105 105 ARG ARG C . n 
C 1 106 THR 106 106 106 THR THR C . n 
C 1 107 GLN 107 107 107 GLN GLN C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 THR 109 109 109 THR THR C . n 
C 1 110 PRO 110 110 110 PRO PRO C . n 
C 1 111 GLY 111 111 111 GLY GLY C . n 
C 1 112 TYR 112 112 112 TYR TYR C . n 
C 1 113 ILE 113 113 113 ILE ILE C . n 
C 1 114 PHE 114 114 114 PHE PHE C . n 
C 1 115 GLY 115 115 115 GLY GLY C . n 
C 1 116 LYS 116 116 116 LYS LYS C . n 
C 1 117 ARG 117 117 117 ARG ARG C . n 
C 1 118 ILE 118 118 118 ILE ILE C . n 
C 1 119 ILE 119 119 119 ILE ILE C . n 
C 1 120 LEU 120 120 120 LEU LEU C . n 
C 1 121 PHE 121 121 121 PHE PHE C . n 
C 1 122 LEU 122 122 122 LEU LEU C . n 
C 1 123 PHE 123 123 123 PHE PHE C . n 
C 1 124 LEU 124 124 124 LEU LEU C . n 
C 1 125 MET 125 125 125 MET MET C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 VAL 127 127 127 VAL VAL C . n 
C 1 128 ALA 128 128 128 ALA ALA C . n 
C 1 129 GLY 129 129 129 GLY GLY C . n 
C 1 130 ILE 130 130 130 ILE ILE C . n 
C 1 131 PHE 131 131 131 PHE PHE C . n 
C 1 132 ASN 132 132 132 ASN ASN C . n 
C 1 133 TYR 133 133 133 TYR TYR C . n 
C 1 134 TYR 134 134 134 TYR TYR C . n 
C 1 135 LEU 135 135 135 LEU LEU C . n 
C 1 136 ILE 136 136 136 ILE ILE C . n 
C 1 137 PHE 137 137 137 PHE PHE C . n 
C 1 138 PHE 138 138 138 PHE PHE C . n 
C 1 139 PHE 139 139 139 PHE PHE C . n 
C 1 140 GLY 140 140 140 GLY GLY C . n 
C 1 141 SER 141 141 141 SER SER C . n 
C 1 142 ASP 142 142 142 ASP ASP C . n 
C 1 143 PHE 143 143 143 PHE PHE C . n 
C 1 144 GLU 144 144 144 GLU GLU C . n 
C 1 145 ASN 145 145 145 ASN ASN C . n 
C 1 146 TYR 146 146 146 TYR TYR C . n 
C 1 147 ILE 147 147 147 ILE ILE C . n 
C 1 148 ALA 148 148 148 ALA ALA C . n 
C 1 149 THR 149 149 149 THR THR C . n 
C 1 150 ILE 150 150 ?   ?   ?   C . n 
C 1 151 SER 151 151 ?   ?   ?   C . n 
C 1 152 THR 152 152 ?   ?   ?   C . n 
C 1 153 THR 153 153 ?   ?   ?   C . n 
C 1 154 ILE 154 154 ?   ?   ?   C . n 
C 1 155 SER 155 155 ?   ?   ?   C . n 
C 1 156 PRO 156 156 ?   ?   ?   C . n 
C 1 157 LEU 157 157 ?   ?   ?   C . n 
C 1 158 LEU 158 158 ?   ?   ?   C . n 
C 1 159 LEU 159 159 ?   ?   ?   C . n 
C 1 160 ILE 160 160 ?   ?   ?   C . n 
C 1 161 PRO 161 161 ?   ?   ?   C . n 
D 1 1   MET 1   1   1   MET MET D . n 
D 1 2   ASP 2   2   2   ASP ASP D . n 
D 1 3   GLN 3   3   3   GLN GLN D . n 
D 1 4   GLU 4   4   4   GLU GLU D . n 
D 1 5   THR 5   5   5   THR THR D . n 
D 1 6   VAL 6   6   6   VAL VAL D . n 
D 1 7   GLY 7   7   7   GLY GLY D . n 
D 1 8   ASN 8   8   8   ASN ASN D . n 
D 1 9   VAL 9   9   9   VAL VAL D . n 
D 1 10  VAL 10  10  10  VAL VAL D . n 
D 1 11  LEU 11  11  11  LEU LEU D . n 
D 1 12  LEU 12  12  12  LEU LEU D . n 
D 1 13  ALA 13  13  13  ALA ALA D . n 
D 1 14  ILE 14  14  14  ILE ILE D . n 
D 1 15  VAL 15  15  15  VAL VAL D . n 
D 1 16  THR 16  16  16  THR THR D . n 
D 1 17  LEU 17  17  17  LEU LEU D . n 
D 1 18  ILE 18  18  18  ILE ILE D . n 
D 1 19  SER 19  19  19  SER SER D . n 
D 1 20  VAL 20  20  20  VAL VAL D . n 
D 1 21  VAL 21  21  21  VAL VAL D . n 
D 1 22  GLN 22  22  22  GLN GLN D . n 
D 1 23  ASN 23  23  23  ASN ASN D . n 
D 1 24  GLY 24  24  24  GLY GLY D . n 
D 1 25  PHE 25  25  25  PHE PHE D . n 
D 1 26  PHE 26  26  26  PHE PHE D . n 
D 1 27  ALA 27  27  27  ALA ALA D . n 
D 1 28  HIS 28  28  28  HIS HIS D . n 
D 1 29  LYS 29  29  29  LYS LYS D . n 
D 1 30  VAL 30  30  30  VAL VAL D . n 
D 1 31  GLU 31  31  31  GLU GLU D . n 
D 1 32  HIS 32  32  32  HIS HIS D . n 
D 1 33  GLU 33  33  33  GLU GLU D . n 
D 1 34  SER 34  34  34  SER SER D . n 
D 1 35  ARG 35  35  35  ARG ARG D . n 
D 1 36  THR 36  36  36  THR THR D . n 
D 1 37  GLN 37  37  37  GLN GLN D . n 
D 1 38  ASN 38  38  38  ASN ASN D . n 
D 1 39  GLY 39  39  39  GLY GLY D . n 
D 1 40  ARG 40  40  40  ARG ARG D . n 
D 1 41  SER 41  41  41  SER SER D . n 
D 1 42  PHE 42  42  42  PHE PHE D . n 
D 1 43  GLN 43  43  43  GLN GLN D . n 
D 1 44  ARG 44  44  44  ARG ARG D . n 
D 1 45  THR 45  45  45  THR THR D . n 
D 1 46  GLY 46  46  46  GLY GLY D . n 
D 1 47  THR 47  47  47  THR THR D . n 
D 1 48  LEU 48  48  48  LEU LEU D . n 
D 1 49  ALA 49  49  49  ALA ALA D . n 
D 1 50  PHE 50  50  50  PHE PHE D . n 
D 1 51  GLU 51  51  51  GLU GLU D . n 
D 1 52  ARG 52  52  52  ARG ARG D . n 
D 1 53  VAL 53  53  53  VAL VAL D . n 
D 1 54  TYR 54  54  54  TYR TYR D . n 
D 1 55  THR 55  55  55  THR THR D . n 
D 1 56  ALA 56  56  56  ALA ALA D . n 
D 1 57  ASN 57  57  57  ASN ASN D . n 
D 1 58  GLN 58  58  58  GLN GLN D . n 
D 1 59  ASN 59  59  59  ASN ASN D . n 
D 1 60  CYS 60  60  60  CYS CYS D . n 
D 1 61  VAL 61  61  61  VAL VAL D . n 
D 1 62  ASP 62  62  62  ASP ASP D . n 
D 1 63  ALA 63  63  63  ALA ALA D . n 
D 1 64  TYR 64  64  64  TYR TYR D . n 
D 1 65  PRO 65  65  65  PRO PRO D . n 
D 1 66  THR 66  66  66  THR THR D . n 
D 1 67  PHE 67  67  67  PHE PHE D . n 
D 1 68  LEU 68  68  68  LEU LEU D . n 
D 1 69  ALA 69  69  69  ALA ALA D . n 
D 1 70  VAL 70  70  70  VAL VAL D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  TRP 72  72  72  TRP TRP D . n 
D 1 73  SER 73  73  73  SER SER D . n 
D 1 74  ALA 74  74  74  ALA ALA D . n 
D 1 75  GLY 75  75  75  GLY GLY D . n 
D 1 76  LEU 76  76  76  LEU LEU D . n 
D 1 77  LEU 77  77  77  LEU LEU D . n 
D 1 78  CYS 78  78  78  CYS CYS D . n 
D 1 79  SER 79  79  79  SER SER D . n 
D 1 80  GLN 80  80  80  GLN GLN D . n 
D 1 81  VAL 81  81  81  VAL VAL D . n 
D 1 82  PRO 82  82  82  PRO PRO D . n 
D 1 83  ALA 83  83  83  ALA ALA D . n 
D 1 84  ALA 84  84  84  ALA ALA D . n 
D 1 85  PHE 85  85  85  PHE PHE D . n 
D 1 86  ALA 86  86  86  ALA ALA D . n 
D 1 87  GLY 87  87  87  GLY GLY D . n 
D 1 88  LEU 88  88  88  LEU LEU D . n 
D 1 89  MET 89  89  89  MET MET D . n 
D 1 90  TYR 90  90  90  TYR TYR D . n 
D 1 91  LEU 91  91  91  LEU LEU D . n 
D 1 92  PHE 92  92  92  PHE PHE D . n 
D 1 93  VAL 93  93  93  VAL VAL D . n 
D 1 94  ARG 94  94  94  ARG ARG D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  LYS 96  96  96  LYS LYS D . n 
D 1 97  TYR 97  97  97  TYR TYR D . n 
D 1 98  PHE 98  98  98  PHE PHE D . n 
D 1 99  VAL 99  99  99  VAL VAL D . n 
D 1 100 GLY 100 100 100 GLY GLY D . n 
D 1 101 TYR 101 101 101 TYR TYR D . n 
D 1 102 LEU 102 102 102 LEU LEU D . n 
D 1 103 GLY 103 103 103 GLY GLY D . n 
D 1 104 GLU 104 104 104 GLU GLU D . n 
D 1 105 ARG 105 105 105 ARG ARG D . n 
D 1 106 THR 106 106 106 THR THR D . n 
D 1 107 GLN 107 107 107 GLN GLN D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 THR 109 109 109 THR THR D . n 
D 1 110 PRO 110 110 110 PRO PRO D . n 
D 1 111 GLY 111 111 111 GLY GLY D . n 
D 1 112 TYR 112 112 112 TYR TYR D . n 
D 1 113 ILE 113 113 113 ILE ILE D . n 
D 1 114 PHE 114 114 114 PHE PHE D . n 
D 1 115 GLY 115 115 115 GLY GLY D . n 
D 1 116 LYS 116 116 116 LYS LYS D . n 
D 1 117 ARG 117 117 117 ARG ARG D . n 
D 1 118 ILE 118 118 118 ILE ILE D . n 
D 1 119 ILE 119 119 119 ILE ILE D . n 
D 1 120 LEU 120 120 120 LEU LEU D . n 
D 1 121 PHE 121 121 121 PHE PHE D . n 
D 1 122 LEU 122 122 122 LEU LEU D . n 
D 1 123 PHE 123 123 123 PHE PHE D . n 
D 1 124 LEU 124 124 124 LEU LEU D . n 
D 1 125 MET 125 125 125 MET MET D . n 
D 1 126 SER 126 126 126 SER SER D . n 
D 1 127 VAL 127 127 127 VAL VAL D . n 
D 1 128 ALA 128 128 128 ALA ALA D . n 
D 1 129 GLY 129 129 129 GLY GLY D . n 
D 1 130 ILE 130 130 130 ILE ILE D . n 
D 1 131 PHE 131 131 131 PHE PHE D . n 
D 1 132 ASN 132 132 132 ASN ASN D . n 
D 1 133 TYR 133 133 133 TYR TYR D . n 
D 1 134 TYR 134 134 134 TYR TYR D . n 
D 1 135 LEU 135 135 135 LEU LEU D . n 
D 1 136 ILE 136 136 136 ILE ILE D . n 
D 1 137 PHE 137 137 137 PHE PHE D . n 
D 1 138 PHE 138 138 138 PHE PHE D . n 
D 1 139 PHE 139 139 139 PHE PHE D . n 
D 1 140 GLY 140 140 140 GLY GLY D . n 
D 1 141 SER 141 141 141 SER SER D . n 
D 1 142 ASP 142 142 142 ASP ASP D . n 
D 1 143 PHE 143 143 143 PHE PHE D . n 
D 1 144 GLU 144 144 144 GLU GLU D . n 
D 1 145 ASN 145 145 145 ASN ASN D . n 
D 1 146 TYR 146 146 146 TYR TYR D . n 
D 1 147 ILE 147 147 147 ILE ILE D . n 
D 1 148 ALA 148 148 ?   ?   ?   D . n 
D 1 149 THR 149 149 ?   ?   ?   D . n 
D 1 150 ILE 150 150 ?   ?   ?   D . n 
D 1 151 SER 151 151 ?   ?   ?   D . n 
D 1 152 THR 152 152 ?   ?   ?   D . n 
D 1 153 THR 153 153 ?   ?   ?   D . n 
D 1 154 ILE 154 154 ?   ?   ?   D . n 
D 1 155 SER 155 155 ?   ?   ?   D . n 
D 1 156 PRO 156 156 ?   ?   ?   D . n 
D 1 157 LEU 157 157 ?   ?   ?   D . n 
D 1 158 LEU 158 158 ?   ?   ?   D . n 
D 1 159 LEU 159 159 ?   ?   ?   D . n 
D 1 160 ILE 160 160 ?   ?   ?   D . n 
D 1 161 PRO 161 161 ?   ?   ?   D . n 
E 1 1   MET 1   1   1   MET MET E . n 
E 1 2   ASP 2   2   2   ASP ASP E . n 
E 1 3   GLN 3   3   3   GLN GLN E . n 
E 1 4   GLU 4   4   4   GLU GLU E . n 
E 1 5   THR 5   5   5   THR THR E . n 
E 1 6   VAL 6   6   6   VAL VAL E . n 
E 1 7   GLY 7   7   7   GLY GLY E . n 
E 1 8   ASN 8   8   8   ASN ASN E . n 
E 1 9   VAL 9   9   9   VAL VAL E . n 
E 1 10  VAL 10  10  10  VAL VAL E . n 
E 1 11  LEU 11  11  11  LEU LEU E . n 
E 1 12  LEU 12  12  12  LEU LEU E . n 
E 1 13  ALA 13  13  13  ALA ALA E . n 
E 1 14  ILE 14  14  14  ILE ILE E . n 
E 1 15  VAL 15  15  15  VAL VAL E . n 
E 1 16  THR 16  16  16  THR THR E . n 
E 1 17  LEU 17  17  17  LEU LEU E . n 
E 1 18  ILE 18  18  18  ILE ILE E . n 
E 1 19  SER 19  19  19  SER SER E . n 
E 1 20  VAL 20  20  20  VAL VAL E . n 
E 1 21  VAL 21  21  21  VAL VAL E . n 
E 1 22  GLN 22  22  22  GLN GLN E . n 
E 1 23  ASN 23  23  23  ASN ASN E . n 
E 1 24  GLY 24  24  24  GLY GLY E . n 
E 1 25  PHE 25  25  25  PHE PHE E . n 
E 1 26  PHE 26  26  26  PHE PHE E . n 
E 1 27  ALA 27  27  27  ALA ALA E . n 
E 1 28  HIS 28  28  28  HIS HIS E . n 
E 1 29  LYS 29  29  29  LYS LYS E . n 
E 1 30  VAL 30  30  30  VAL VAL E . n 
E 1 31  GLU 31  31  31  GLU GLU E . n 
E 1 32  HIS 32  32  32  HIS HIS E . n 
E 1 33  GLU 33  33  33  GLU GLU E . n 
E 1 34  SER 34  34  34  SER SER E . n 
E 1 35  ARG 35  35  35  ARG ARG E . n 
E 1 36  THR 36  36  36  THR THR E . n 
E 1 37  GLN 37  37  37  GLN GLN E . n 
E 1 38  ASN 38  38  38  ASN ASN E . n 
E 1 39  GLY 39  39  39  GLY GLY E . n 
E 1 40  ARG 40  40  40  ARG ARG E . n 
E 1 41  SER 41  41  41  SER SER E . n 
E 1 42  PHE 42  42  42  PHE PHE E . n 
E 1 43  GLN 43  43  43  GLN GLN E . n 
E 1 44  ARG 44  44  44  ARG ARG E . n 
E 1 45  THR 45  45  45  THR THR E . n 
E 1 46  GLY 46  46  46  GLY GLY E . n 
E 1 47  THR 47  47  47  THR THR E . n 
E 1 48  LEU 48  48  48  LEU LEU E . n 
E 1 49  ALA 49  49  49  ALA ALA E . n 
E 1 50  PHE 50  50  50  PHE PHE E . n 
E 1 51  GLU 51  51  51  GLU GLU E . n 
E 1 52  ARG 52  52  52  ARG ARG E . n 
E 1 53  VAL 53  53  53  VAL VAL E . n 
E 1 54  TYR 54  54  54  TYR TYR E . n 
E 1 55  THR 55  55  55  THR THR E . n 
E 1 56  ALA 56  56  56  ALA ALA E . n 
E 1 57  ASN 57  57  57  ASN ASN E . n 
E 1 58  GLN 58  58  58  GLN GLN E . n 
E 1 59  ASN 59  59  59  ASN ASN E . n 
E 1 60  CYS 60  60  60  CYS CYS E . n 
E 1 61  VAL 61  61  61  VAL VAL E . n 
E 1 62  ASP 62  62  62  ASP ASP E . n 
E 1 63  ALA 63  63  63  ALA ALA E . n 
E 1 64  TYR 64  64  64  TYR TYR E . n 
E 1 65  PRO 65  65  65  PRO PRO E . n 
E 1 66  THR 66  66  66  THR THR E . n 
E 1 67  PHE 67  67  67  PHE PHE E . n 
E 1 68  LEU 68  68  68  LEU LEU E . n 
E 1 69  ALA 69  69  69  ALA ALA E . n 
E 1 70  VAL 70  70  70  VAL VAL E . n 
E 1 71  LEU 71  71  71  LEU LEU E . n 
E 1 72  TRP 72  72  72  TRP TRP E . n 
E 1 73  SER 73  73  73  SER SER E . n 
E 1 74  ALA 74  74  74  ALA ALA E . n 
E 1 75  GLY 75  75  75  GLY GLY E . n 
E 1 76  LEU 76  76  76  LEU LEU E . n 
E 1 77  LEU 77  77  77  LEU LEU E . n 
E 1 78  CYS 78  78  78  CYS CYS E . n 
E 1 79  SER 79  79  79  SER SER E . n 
E 1 80  GLN 80  80  80  GLN GLN E . n 
E 1 81  VAL 81  81  81  VAL VAL E . n 
E 1 82  PRO 82  82  82  PRO PRO E . n 
E 1 83  ALA 83  83  83  ALA ALA E . n 
E 1 84  ALA 84  84  84  ALA ALA E . n 
E 1 85  PHE 85  85  85  PHE PHE E . n 
E 1 86  ALA 86  86  86  ALA ALA E . n 
E 1 87  GLY 87  87  87  GLY GLY E . n 
E 1 88  LEU 88  88  88  LEU LEU E . n 
E 1 89  MET 89  89  89  MET MET E . n 
E 1 90  TYR 90  90  90  TYR TYR E . n 
E 1 91  LEU 91  91  91  LEU LEU E . n 
E 1 92  PHE 92  92  92  PHE PHE E . n 
E 1 93  VAL 93  93  93  VAL VAL E . n 
E 1 94  ARG 94  94  94  ARG ARG E . n 
E 1 95  GLN 95  95  95  GLN GLN E . n 
E 1 96  LYS 96  96  96  LYS LYS E . n 
E 1 97  TYR 97  97  97  TYR TYR E . n 
E 1 98  PHE 98  98  98  PHE PHE E . n 
E 1 99  VAL 99  99  99  VAL VAL E . n 
E 1 100 GLY 100 100 100 GLY GLY E . n 
E 1 101 TYR 101 101 101 TYR TYR E . n 
E 1 102 LEU 102 102 102 LEU LEU E . n 
E 1 103 GLY 103 103 103 GLY GLY E . n 
E 1 104 GLU 104 104 104 GLU GLU E . n 
E 1 105 ARG 105 105 105 ARG ARG E . n 
E 1 106 THR 106 106 106 THR THR E . n 
E 1 107 GLN 107 107 107 GLN GLN E . n 
E 1 108 SER 108 108 108 SER SER E . n 
E 1 109 THR 109 109 109 THR THR E . n 
E 1 110 PRO 110 110 110 PRO PRO E . n 
E 1 111 GLY 111 111 111 GLY GLY E . n 
E 1 112 TYR 112 112 112 TYR TYR E . n 
E 1 113 ILE 113 113 113 ILE ILE E . n 
E 1 114 PHE 114 114 114 PHE PHE E . n 
E 1 115 GLY 115 115 115 GLY GLY E . n 
E 1 116 LYS 116 116 116 LYS LYS E . n 
E 1 117 ARG 117 117 117 ARG ARG E . n 
E 1 118 ILE 118 118 118 ILE ILE E . n 
E 1 119 ILE 119 119 119 ILE ILE E . n 
E 1 120 LEU 120 120 120 LEU LEU E . n 
E 1 121 PHE 121 121 121 PHE PHE E . n 
E 1 122 LEU 122 122 122 LEU LEU E . n 
E 1 123 PHE 123 123 123 PHE PHE E . n 
E 1 124 LEU 124 124 124 LEU LEU E . n 
E 1 125 MET 125 125 125 MET MET E . n 
E 1 126 SER 126 126 126 SER SER E . n 
E 1 127 VAL 127 127 127 VAL VAL E . n 
E 1 128 ALA 128 128 128 ALA ALA E . n 
E 1 129 GLY 129 129 129 GLY GLY E . n 
E 1 130 ILE 130 130 130 ILE ILE E . n 
E 1 131 PHE 131 131 131 PHE PHE E . n 
E 1 132 ASN 132 132 132 ASN ASN E . n 
E 1 133 TYR 133 133 133 TYR TYR E . n 
E 1 134 TYR 134 134 134 TYR TYR E . n 
E 1 135 LEU 135 135 135 LEU LEU E . n 
E 1 136 ILE 136 136 136 ILE ILE E . n 
E 1 137 PHE 137 137 137 PHE PHE E . n 
E 1 138 PHE 138 138 138 PHE PHE E . n 
E 1 139 PHE 139 139 139 PHE PHE E . n 
E 1 140 GLY 140 140 140 GLY GLY E . n 
E 1 141 SER 141 141 ?   ?   ?   E . n 
E 1 142 ASP 142 142 ?   ?   ?   E . n 
E 1 143 PHE 143 143 ?   ?   ?   E . n 
E 1 144 GLU 144 144 ?   ?   ?   E . n 
E 1 145 ASN 145 145 ?   ?   ?   E . n 
E 1 146 TYR 146 146 ?   ?   ?   E . n 
E 1 147 ILE 147 147 ?   ?   ?   E . n 
E 1 148 ALA 148 148 ?   ?   ?   E . n 
E 1 149 THR 149 149 ?   ?   ?   E . n 
E 1 150 ILE 150 150 ?   ?   ?   E . n 
E 1 151 SER 151 151 ?   ?   ?   E . n 
E 1 152 THR 152 152 ?   ?   ?   E . n 
E 1 153 THR 153 153 ?   ?   ?   E . n 
E 1 154 ILE 154 154 ?   ?   ?   E . n 
E 1 155 SER 155 155 ?   ?   ?   E . n 
E 1 156 PRO 156 156 ?   ?   ?   E . n 
E 1 157 LEU 157 157 ?   ?   ?   E . n 
E 1 158 LEU 158 158 ?   ?   ?   E . n 
E 1 159 LEU 159 159 ?   ?   ?   E . n 
E 1 160 ILE 160 160 ?   ?   ?   E . n 
E 1 161 PRO 161 161 ?   ?   ?   E . n 
F 1 1   MET 1   1   1   MET MET F . n 
F 1 2   ASP 2   2   2   ASP ASP F . n 
F 1 3   GLN 3   3   3   GLN GLN F . n 
F 1 4   GLU 4   4   4   GLU GLU F . n 
F 1 5   THR 5   5   5   THR THR F . n 
F 1 6   VAL 6   6   6   VAL VAL F . n 
F 1 7   GLY 7   7   7   GLY GLY F . n 
F 1 8   ASN 8   8   8   ASN ASN F . n 
F 1 9   VAL 9   9   9   VAL VAL F . n 
F 1 10  VAL 10  10  10  VAL VAL F . n 
F 1 11  LEU 11  11  11  LEU LEU F . n 
F 1 12  LEU 12  12  12  LEU LEU F . n 
F 1 13  ALA 13  13  13  ALA ALA F . n 
F 1 14  ILE 14  14  14  ILE ILE F . n 
F 1 15  VAL 15  15  15  VAL VAL F . n 
F 1 16  THR 16  16  16  THR THR F . n 
F 1 17  LEU 17  17  17  LEU LEU F . n 
F 1 18  ILE 18  18  18  ILE ILE F . n 
F 1 19  SER 19  19  19  SER SER F . n 
F 1 20  VAL 20  20  20  VAL VAL F . n 
F 1 21  VAL 21  21  21  VAL VAL F . n 
F 1 22  GLN 22  22  22  GLN GLN F . n 
F 1 23  ASN 23  23  23  ASN ASN F . n 
F 1 24  GLY 24  24  24  GLY GLY F . n 
F 1 25  PHE 25  25  25  PHE PHE F . n 
F 1 26  PHE 26  26  26  PHE PHE F . n 
F 1 27  ALA 27  27  27  ALA ALA F . n 
F 1 28  HIS 28  28  28  HIS HIS F . n 
F 1 29  LYS 29  29  29  LYS LYS F . n 
F 1 30  VAL 30  30  30  VAL VAL F . n 
F 1 31  GLU 31  31  31  GLU GLU F . n 
F 1 32  HIS 32  32  32  HIS HIS F . n 
F 1 33  GLU 33  33  33  GLU GLU F . n 
F 1 34  SER 34  34  34  SER SER F . n 
F 1 35  ARG 35  35  35  ARG ARG F . n 
F 1 36  THR 36  36  36  THR THR F . n 
F 1 37  GLN 37  37  37  GLN GLN F . n 
F 1 38  ASN 38  38  38  ASN ASN F . n 
F 1 39  GLY 39  39  39  GLY GLY F . n 
F 1 40  ARG 40  40  40  ARG ARG F . n 
F 1 41  SER 41  41  41  SER SER F . n 
F 1 42  PHE 42  42  42  PHE PHE F . n 
F 1 43  GLN 43  43  43  GLN GLN F . n 
F 1 44  ARG 44  44  44  ARG ARG F . n 
F 1 45  THR 45  45  45  THR THR F . n 
F 1 46  GLY 46  46  46  GLY GLY F . n 
F 1 47  THR 47  47  47  THR THR F . n 
F 1 48  LEU 48  48  48  LEU LEU F . n 
F 1 49  ALA 49  49  49  ALA ALA F . n 
F 1 50  PHE 50  50  50  PHE PHE F . n 
F 1 51  GLU 51  51  51  GLU GLU F . n 
F 1 52  ARG 52  52  52  ARG ARG F . n 
F 1 53  VAL 53  53  53  VAL VAL F . n 
F 1 54  TYR 54  54  54  TYR TYR F . n 
F 1 55  THR 55  55  55  THR THR F . n 
F 1 56  ALA 56  56  56  ALA ALA F . n 
F 1 57  ASN 57  57  57  ASN ASN F . n 
F 1 58  GLN 58  58  58  GLN GLN F . n 
F 1 59  ASN 59  59  59  ASN ASN F . n 
F 1 60  CYS 60  60  60  CYS CYS F . n 
F 1 61  VAL 61  61  61  VAL VAL F . n 
F 1 62  ASP 62  62  62  ASP ASP F . n 
F 1 63  ALA 63  63  63  ALA ALA F . n 
F 1 64  TYR 64  64  64  TYR TYR F . n 
F 1 65  PRO 65  65  65  PRO PRO F . n 
F 1 66  THR 66  66  66  THR THR F . n 
F 1 67  PHE 67  67  67  PHE PHE F . n 
F 1 68  LEU 68  68  68  LEU LEU F . n 
F 1 69  ALA 69  69  69  ALA ALA F . n 
F 1 70  VAL 70  70  70  VAL VAL F . n 
F 1 71  LEU 71  71  71  LEU LEU F . n 
F 1 72  TRP 72  72  72  TRP TRP F . n 
F 1 73  SER 73  73  73  SER SER F . n 
F 1 74  ALA 74  74  74  ALA ALA F . n 
F 1 75  GLY 75  75  75  GLY GLY F . n 
F 1 76  LEU 76  76  76  LEU LEU F . n 
F 1 77  LEU 77  77  77  LEU LEU F . n 
F 1 78  CYS 78  78  78  CYS CYS F . n 
F 1 79  SER 79  79  79  SER SER F . n 
F 1 80  GLN 80  80  80  GLN GLN F . n 
F 1 81  VAL 81  81  81  VAL VAL F . n 
F 1 82  PRO 82  82  82  PRO PRO F . n 
F 1 83  ALA 83  83  83  ALA ALA F . n 
F 1 84  ALA 84  84  84  ALA ALA F . n 
F 1 85  PHE 85  85  85  PHE PHE F . n 
F 1 86  ALA 86  86  86  ALA ALA F . n 
F 1 87  GLY 87  87  87  GLY GLY F . n 
F 1 88  LEU 88  88  88  LEU LEU F . n 
F 1 89  MET 89  89  89  MET MET F . n 
F 1 90  TYR 90  90  90  TYR TYR F . n 
F 1 91  LEU 91  91  91  LEU LEU F . n 
F 1 92  PHE 92  92  92  PHE PHE F . n 
F 1 93  VAL 93  93  93  VAL VAL F . n 
F 1 94  ARG 94  94  94  ARG ARG F . n 
F 1 95  GLN 95  95  95  GLN GLN F . n 
F 1 96  LYS 96  96  96  LYS LYS F . n 
F 1 97  TYR 97  97  97  TYR TYR F . n 
F 1 98  PHE 98  98  98  PHE PHE F . n 
F 1 99  VAL 99  99  99  VAL VAL F . n 
F 1 100 GLY 100 100 100 GLY GLY F . n 
F 1 101 TYR 101 101 101 TYR TYR F . n 
F 1 102 LEU 102 102 102 LEU LEU F . n 
F 1 103 GLY 103 103 103 GLY GLY F . n 
F 1 104 GLU 104 104 104 GLU GLU F . n 
F 1 105 ARG 105 105 105 ARG ARG F . n 
F 1 106 THR 106 106 106 THR THR F . n 
F 1 107 GLN 107 107 107 GLN GLN F . n 
F 1 108 SER 108 108 108 SER SER F . n 
F 1 109 THR 109 109 109 THR THR F . n 
F 1 110 PRO 110 110 110 PRO PRO F . n 
F 1 111 GLY 111 111 111 GLY GLY F . n 
F 1 112 TYR 112 112 112 TYR TYR F . n 
F 1 113 ILE 113 113 113 ILE ILE F . n 
F 1 114 PHE 114 114 114 PHE PHE F . n 
F 1 115 GLY 115 115 115 GLY GLY F . n 
F 1 116 LYS 116 116 116 LYS LYS F . n 
F 1 117 ARG 117 117 117 ARG ARG F . n 
F 1 118 ILE 118 118 118 ILE ILE F . n 
F 1 119 ILE 119 119 119 ILE ILE F . n 
F 1 120 LEU 120 120 120 LEU LEU F . n 
F 1 121 PHE 121 121 121 PHE PHE F . n 
F 1 122 LEU 122 122 122 LEU LEU F . n 
F 1 123 PHE 123 123 123 PHE PHE F . n 
F 1 124 LEU 124 124 124 LEU LEU F . n 
F 1 125 MET 125 125 125 MET MET F . n 
F 1 126 SER 126 126 126 SER SER F . n 
F 1 127 VAL 127 127 127 VAL VAL F . n 
F 1 128 ALA 128 128 128 ALA ALA F . n 
F 1 129 GLY 129 129 129 GLY GLY F . n 
F 1 130 ILE 130 130 130 ILE ILE F . n 
F 1 131 PHE 131 131 131 PHE PHE F . n 
F 1 132 ASN 132 132 132 ASN ASN F . n 
F 1 133 TYR 133 133 133 TYR TYR F . n 
F 1 134 TYR 134 134 134 TYR TYR F . n 
F 1 135 LEU 135 135 135 LEU LEU F . n 
F 1 136 ILE 136 136 136 ILE ILE F . n 
F 1 137 PHE 137 137 137 PHE PHE F . n 
F 1 138 PHE 138 138 138 PHE PHE F . n 
F 1 139 PHE 139 139 139 PHE PHE F . n 
F 1 140 GLY 140 140 140 GLY GLY F . n 
F 1 141 SER 141 141 141 SER SER F . n 
F 1 142 ASP 142 142 142 ASP ASP F . n 
F 1 143 PHE 143 143 143 PHE PHE F . n 
F 1 144 GLU 144 144 144 GLU GLU F . n 
F 1 145 ASN 145 145 145 ASN ASN F . n 
F 1 146 TYR 146 146 146 TYR TYR F . n 
F 1 147 ILE 147 147 147 ILE ILE F . n 
F 1 148 ALA 148 148 148 ALA ALA F . n 
F 1 149 THR 149 149 149 THR THR F . n 
F 1 150 ILE 150 150 ?   ?   ?   F . n 
F 1 151 SER 151 151 ?   ?   ?   F . n 
F 1 152 THR 152 152 ?   ?   ?   F . n 
F 1 153 THR 153 153 ?   ?   ?   F . n 
F 1 154 ILE 154 154 ?   ?   ?   F . n 
F 1 155 SER 155 155 ?   ?   ?   F . n 
F 1 156 PRO 156 156 ?   ?   ?   F . n 
F 1 157 LEU 157 157 ?   ?   ?   F . n 
F 1 158 LEU 158 158 ?   ?   ?   F . n 
F 1 159 LEU 159 159 ?   ?   ?   F . n 
F 1 160 ILE 160 160 ?   ?   ?   F . n 
F 1 161 PRO 161 161 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 2 2CS 1 502 502 2CS 2CS A . 
H 2 2CS 1 503 503 2CS 2CS A . 
I 2 2CS 1 501 501 2CS 2CS C . 
J 2 2CS 1 504 504 2CS 2CS D . 
K 2 2CS 1 505 505 2CS 2CS E . 
L 2 2CS 1 506 506 2CS 2CS E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I 
2 1 D,E,F,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8710 ? 
2 'ABSA (A^2)' 8850 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER-TNT refinement        1.9.3 ? 1 
HKL-2000   'data collection' .     ? 2 
HKL-2000   'data reduction'  .     ? 3 
HKL-2000   'data scaling'    .     ? 4 
BUSTER-TNT phasing           1.9.3 ? 5 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;HELIX                                                                
DETERMINATION METHOD: AUTHOR DETERMINED 
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             THR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              109 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              110 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              110 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                104.76 
_pdbx_validate_rmsd_angle.angle_target_value         128.40 
_pdbx_validate_rmsd_angle.angle_deviation            -23.64 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.10 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 2   ? ? -53.80  107.82  
2   1 ASN A 8   ? ? -82.82  33.35   
3   1 VAL A 9   ? ? -158.62 -17.29  
4   1 ASN A 38  ? ? -42.36  167.38  
5   1 PHE A 42  ? ? -113.66 74.31   
6   1 THR A 45  ? ? -39.43  101.17  
7   1 THR A 47  ? ? -37.78  135.24  
8   1 GLN A 58  ? ? -66.75  25.91   
9   1 ALA A 69  ? ? -53.46  -73.93  
10  1 LEU A 77  ? ? -61.98  5.23    
11  1 CYS A 78  ? ? 170.61  128.59  
12  1 SER A 79  ? ? 23.65   113.03  
13  1 TYR A 101 ? ? -83.12  33.02   
14  1 LEU A 102 ? ? -137.23 -91.69  
15  1 GLU A 104 ? ? 167.01  125.36  
16  1 ARG A 105 ? ? 58.47   -38.24  
17  1 GLN A 107 ? ? -59.89  75.10   
18  1 ALA A 128 ? ? -69.86  -78.27  
19  1 ASP B 2   ? ? -56.45  106.48  
20  1 GLN B 3   ? ? -38.54  -33.87  
21  1 ASN B 8   ? ? -82.69  33.54   
22  1 VAL B 9   ? ? -153.26 -23.14  
23  1 VAL B 10  ? ? -38.82  -36.16  
24  1 THR B 36  ? ? -49.96  6.49    
25  1 GLN B 37  ? ? -166.12 -145.21 
26  1 ASN B 38  ? ? -73.98  26.18   
27  1 SER B 41  ? ? 137.25  9.74    
28  1 THR B 45  ? ? 177.06  57.64   
29  1 THR B 47  ? ? 113.43  142.04  
30  1 LEU B 48  ? ? 30.47   -54.08  
31  1 GLN B 58  ? ? -65.83  21.32   
32  1 ALA B 69  ? ? -49.98  -75.68  
33  1 LEU B 77  ? ? -64.67  9.61    
34  1 CYS B 78  ? ? 171.14  130.33  
35  1 SER B 79  ? ? 13.80   116.25  
36  1 TYR B 101 ? ? -81.85  30.36   
37  1 ARG B 105 ? ? 81.65   -144.19 
38  1 THR B 106 ? ? 40.31   -172.36 
39  1 SER B 108 ? ? -57.09  83.52   
40  1 PRO B 110 ? ? -56.79  37.55   
41  1 PHE B 114 ? ? -143.55 -108.47 
42  1 ALA B 128 ? ? -69.80  -74.77  
43  1 PHE B 138 ? ? -98.58  -86.78  
44  1 PHE B 139 ? ? -61.01  3.22    
45  1 SER B 141 ? ? -81.04  -108.59 
46  1 ASP B 142 ? ? 26.65   -95.60  
47  1 PHE B 143 ? ? 24.97   24.55   
48  1 ASN B 145 ? ? -114.08 60.88   
49  1 TYR B 146 ? ? -63.79  69.06   
50  1 ASP C 2   ? ? -51.91  105.80  
51  1 ASN C 8   ? ? -84.04  38.36   
52  1 VAL C 9   ? ? -158.54 -19.09  
53  1 GLN C 37  ? ? -79.38  49.48   
54  1 ASN C 38  ? ? -6.20   62.09   
55  1 ARG C 40  ? ? -79.74  -73.81  
56  1 SER C 41  ? ? -81.55  -104.32 
57  1 PHE C 42  ? ? 170.36  106.66  
58  1 THR C 47  ? ? 131.17  171.15  
59  1 GLN C 58  ? ? -66.44  25.88   
60  1 ALA C 69  ? ? -51.55  -77.05  
61  1 LEU C 77  ? ? -66.69  9.43    
62  1 CYS C 78  ? ? 164.38  130.63  
63  1 SER C 79  ? ? 25.52   112.08  
64  1 LEU C 102 ? ? 138.22  -46.00  
65  1 GLN C 107 ? ? -53.28  102.21  
66  1 SER C 108 ? ? 163.43  -19.59  
67  1 PRO C 110 ? ? -37.70  155.96  
68  1 ILE C 113 ? ? -158.14 -91.77  
69  1 PHE C 114 ? ? 53.42   107.63  
70  1 ALA C 128 ? ? -71.45  -74.53  
71  1 PHE C 143 ? ? 176.48  69.63   
72  1 GLU C 144 ? ? -45.90  57.46   
73  1 ILE C 147 ? ? -94.03  39.08   
74  1 ALA C 148 ? ? -98.67  56.99   
75  1 ASP D 2   ? ? -53.01  109.70  
76  1 ASN D 8   ? ? -88.74  38.41   
77  1 VAL D 9   ? ? -160.10 -16.00  
78  1 ASN D 38  ? ? 83.50   148.97  
79  1 ARG D 40  ? ? -97.29  49.29   
80  1 SER D 41  ? ? 74.56   -135.90 
81  1 THR D 47  ? ? -38.16  133.13  
82  1 GLN D 58  ? ? -67.57  27.89   
83  1 ALA D 69  ? ? -50.58  -78.12  
84  1 LEU D 77  ? ? -63.23  7.85    
85  1 CYS D 78  ? ? 169.58  130.17  
86  1 SER D 79  ? ? 24.90   113.05  
87  1 TYR D 101 ? ? -77.53  38.25   
88  1 LEU D 102 ? ? -143.63 -59.18  
89  1 GLU D 104 ? ? 166.94  -74.59  
90  1 ARG D 105 ? ? -148.67 22.41   
91  1 GLN D 107 ? ? 77.78   -14.71  
92  1 SER D 108 ? ? -96.94  -156.05 
93  1 THR D 109 ? ? 84.91   86.68   
94  1 TYR D 112 ? ? 54.48   -22.56  
95  1 ILE D 113 ? ? -64.67  -103.10 
96  1 PHE D 114 ? ? 110.94  -160.05 
97  1 ALA D 128 ? ? -72.75  -73.34  
98  1 PHE D 138 ? ? -105.94 -62.05  
99  1 ASP D 142 ? ? 61.55   -27.33  
100 1 PHE D 143 ? ? -44.90  -13.36  
101 1 GLU D 144 ? ? -117.70 73.02   
102 1 TYR D 146 ? ? -62.31  68.49   
103 1 ASN E 8   ? ? -82.48  38.94   
104 1 VAL E 9   ? ? -164.19 -13.98  
105 1 ASN E 38  ? ? 77.03   47.63   
106 1 ARG E 40  ? ? 56.67   -47.70  
107 1 GLN E 43  ? ? -176.15 144.49  
108 1 ARG E 44  ? ? -62.54  46.50   
109 1 GLN E 58  ? ? -69.94  26.71   
110 1 ALA E 69  ? ? -52.95  -76.74  
111 1 LEU E 77  ? ? -64.08  8.23    
112 1 CYS E 78  ? ? 171.85  127.81  
113 1 SER E 79  ? ? 16.01   115.78  
114 1 LEU E 102 ? ? -139.68 -48.70  
115 1 GLU E 104 ? ? 67.61   109.47  
116 1 ARG E 105 ? ? -77.95  25.13   
117 1 THR E 106 ? ? 68.33   -52.82  
118 1 TYR E 112 ? ? 63.71   141.03  
119 1 ILE E 113 ? ? 67.39   120.72  
120 1 PHE E 114 ? ? -114.14 -132.53 
121 1 ILE E 118 ? ? -51.88  -70.14  
122 1 ALA E 128 ? ? -70.71  -79.44  
123 1 ASP F 2   ? ? -54.14  106.69  
124 1 ASN F 8   ? ? -86.85  39.55   
125 1 VAL F 9   ? ? -157.81 -24.60  
126 1 ARG F 40  ? ? -56.80  15.83   
127 1 SER F 41  ? ? -46.23  72.63   
128 1 GLN F 43  ? ? 95.52   114.85  
129 1 ARG F 44  ? ? 36.21   15.03   
130 1 THR F 47  ? ? -42.28  -177.76 
131 1 GLN F 58  ? ? -65.35  25.44   
132 1 ALA F 69  ? ? -52.37  -74.92  
133 1 LEU F 77  ? ? -65.27  9.26    
134 1 CYS F 78  ? ? 171.32  126.35  
135 1 SER F 79  ? ? 16.09   116.13  
136 1 TYR F 101 ? ? -84.20  43.31   
137 1 LEU F 102 ? ? -162.82 56.26   
138 1 ARG F 105 ? ? 37.64   40.79   
139 1 SER F 108 ? ? 101.72  -114.23 
140 1 THR F 109 ? ? -172.64 147.18  
141 1 ILE F 113 ? ? -46.54  -163.89 
142 1 PHE F 114 ? ? 166.46  98.28   
143 1 ALA F 128 ? ? -71.72  -74.69  
144 1 PHE F 139 ? ? -113.37 51.97   
145 1 SER F 141 ? ? -66.23  11.95   
146 1 ASP F 142 ? ? -71.22  42.02   
147 1 GLU F 144 ? ? 41.60   107.05  
148 1 ALA F 148 ? ? 42.50   -153.24 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 140 ? A GLY 140 
2  1 Y 1 A SER 141 ? A SER 141 
3  1 Y 1 A ASP 142 ? A ASP 142 
4  1 Y 1 A PHE 143 ? A PHE 143 
5  1 Y 1 A GLU 144 ? A GLU 144 
6  1 Y 1 A ASN 145 ? A ASN 145 
7  1 Y 1 A TYR 146 ? A TYR 146 
8  1 Y 1 A ILE 147 ? A ILE 147 
9  1 Y 1 A ALA 148 ? A ALA 148 
10 1 Y 1 A THR 149 ? A THR 149 
11 1 Y 1 A ILE 150 ? A ILE 150 
12 1 Y 1 A SER 151 ? A SER 151 
13 1 Y 1 A THR 152 ? A THR 152 
14 1 Y 1 A THR 153 ? A THR 153 
15 1 Y 1 A ILE 154 ? A ILE 154 
16 1 Y 1 A SER 155 ? A SER 155 
17 1 Y 1 A PRO 156 ? A PRO 156 
18 1 Y 1 A LEU 157 ? A LEU 157 
19 1 Y 1 A LEU 158 ? A LEU 158 
20 1 Y 1 A LEU 159 ? A LEU 159 
21 1 Y 1 A ILE 160 ? A ILE 160 
22 1 Y 1 A PRO 161 ? A PRO 161 
23 1 Y 1 B THR 149 ? B THR 149 
24 1 Y 1 B ILE 150 ? B ILE 150 
25 1 Y 1 B SER 151 ? B SER 151 
26 1 Y 1 B THR 152 ? B THR 152 
27 1 Y 1 B THR 153 ? B THR 153 
28 1 Y 1 B ILE 154 ? B ILE 154 
29 1 Y 1 B SER 155 ? B SER 155 
30 1 Y 1 B PRO 156 ? B PRO 156 
31 1 Y 1 B LEU 157 ? B LEU 157 
32 1 Y 1 B LEU 158 ? B LEU 158 
33 1 Y 1 B LEU 159 ? B LEU 159 
34 1 Y 1 B ILE 160 ? B ILE 160 
35 1 Y 1 B PRO 161 ? B PRO 161 
36 1 Y 1 C ILE 150 ? C ILE 150 
37 1 Y 1 C SER 151 ? C SER 151 
38 1 Y 1 C THR 152 ? C THR 152 
39 1 Y 1 C THR 153 ? C THR 153 
40 1 Y 1 C ILE 154 ? C ILE 154 
41 1 Y 1 C SER 155 ? C SER 155 
42 1 Y 1 C PRO 156 ? C PRO 156 
43 1 Y 1 C LEU 157 ? C LEU 157 
44 1 Y 1 C LEU 158 ? C LEU 158 
45 1 Y 1 C LEU 159 ? C LEU 159 
46 1 Y 1 C ILE 160 ? C ILE 160 
47 1 Y 1 C PRO 161 ? C PRO 161 
48 1 Y 1 D ALA 148 ? D ALA 148 
49 1 Y 1 D THR 149 ? D THR 149 
50 1 Y 1 D ILE 150 ? D ILE 150 
51 1 Y 1 D SER 151 ? D SER 151 
52 1 Y 1 D THR 152 ? D THR 152 
53 1 Y 1 D THR 153 ? D THR 153 
54 1 Y 1 D ILE 154 ? D ILE 154 
55 1 Y 1 D SER 155 ? D SER 155 
56 1 Y 1 D PRO 156 ? D PRO 156 
57 1 Y 1 D LEU 157 ? D LEU 157 
58 1 Y 1 D LEU 158 ? D LEU 158 
59 1 Y 1 D LEU 159 ? D LEU 159 
60 1 Y 1 D ILE 160 ? D ILE 160 
61 1 Y 1 D PRO 161 ? D PRO 161 
62 1 Y 1 E SER 141 ? E SER 141 
63 1 Y 1 E ASP 142 ? E ASP 142 
64 1 Y 1 E PHE 143 ? E PHE 143 
65 1 Y 1 E GLU 144 ? E GLU 144 
66 1 Y 1 E ASN 145 ? E ASN 145 
67 1 Y 1 E TYR 146 ? E TYR 146 
68 1 Y 1 E ILE 147 ? E ILE 147 
69 1 Y 1 E ALA 148 ? E ALA 148 
70 1 Y 1 E THR 149 ? E THR 149 
71 1 Y 1 E ILE 150 ? E ILE 150 
72 1 Y 1 E SER 151 ? E SER 151 
73 1 Y 1 E THR 152 ? E THR 152 
74 1 Y 1 E THR 153 ? E THR 153 
75 1 Y 1 E ILE 154 ? E ILE 154 
76 1 Y 1 E SER 155 ? E SER 155 
77 1 Y 1 E PRO 156 ? E PRO 156 
78 1 Y 1 E LEU 157 ? E LEU 157 
79 1 Y 1 E LEU 158 ? E LEU 158 
80 1 Y 1 E LEU 159 ? E LEU 159 
81 1 Y 1 E ILE 160 ? E ILE 160 
82 1 Y 1 E PRO 161 ? E PRO 161 
83 1 Y 1 F ILE 150 ? F ILE 150 
84 1 Y 1 F SER 151 ? F SER 151 
85 1 Y 1 F THR 152 ? F THR 152 
86 1 Y 1 F THR 153 ? F THR 153 
87 1 Y 1 F ILE 154 ? F ILE 154 
88 1 Y 1 F SER 155 ? F SER 155 
89 1 Y 1 F PRO 156 ? F PRO 156 
90 1 Y 1 F LEU 157 ? F LEU 157 
91 1 Y 1 F LEU 158 ? F LEU 158 
92 1 Y 1 F LEU 159 ? F LEU 159 
93 1 Y 1 F ILE 160 ? F ILE 160 
94 1 Y 1 F PRO 161 ? F PRO 161 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        
'3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID' 
_pdbx_entity_nonpoly.comp_id     2CS 
#