data_2QBX
# 
_entry.id   2QBX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QBX         
RCSB  RCSB043405   
WWPDB D_1000043405 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NUK 'Apo ligand binding domain of the EphB2 receptor' unspecified 
PDB 1KGY 'EphB2/ephrinB2 complex structure'                unspecified 
PDB 2BBA 'EphB4/Antagonistic TNYL-RAW complex structure'   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2QBX 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chrencik, J.E.'                                                    1 
'Brooun, A.'                                                        2 
'Recht, M.I.'                                                       3 
'Nicola, G.'                                                        4 
'Pasquale, E.B.'                                                    5 
'Kuhn, P.'                                                          6 
'Accelerated Technologies Center for Gene to 3D Structure (ATCG3D)' 7 
# 
_citation.id                        primary 
_citation.title                     
'Three-dimensional structure of the EphB2 receptor in complex with an antagonistic peptide reveals a novel mode of inhibition.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                36505 
_citation.page_last                 36513 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17897949 
_citation.pdbx_database_id_DOI      10.1074/jbc.M706340200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chrencik, J.E.' 1 
primary 'Brooun, A.'     2 
primary 'Recht, M.I.'    3 
primary 'Nicola, G.'     4 
primary 'Davis, L.K.'    5 
primary 'Abagyan, R.'    6 
primary 'Widmer, H.'     7 
primary 'Pasquale, E.B.' 8 
primary 'Kuhn, P.'       9 
# 
_cell.entry_id           2QBX 
_cell.length_a           40.183 
_cell.length_b           40.183 
_cell.length_c           235.025 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QBX 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ephrin type-B receptor 2' 23664.738 2   2.7.10.1 ? EphB2 ? 
2 polymer     syn 'antagonistic peptide'     1506.663  2   ?        ? ?     ? 
3 non-polymer syn 'SULFATE ION'              96.063    12  ?        ? ?     ? 
4 water       nat water                      18.015    174 ?        ? ?     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Tyrosine-protein kinase receptor EPH-3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MVSAIVLYVLLAAAAHSAFAAMVHHHHHHSAEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESS
QNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFS
QVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRK
;
;MVSAIVLYVLLAAAAHSAFAAMVHHHHHHSAEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESS
QNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFS
QVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRK
;
A,B ? 
2 'polypeptide(L)' no no SNEWIQPRLPQH SNEWIQPRLPQH D,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   SER n 
1 4   ALA n 
1 5   ILE n 
1 6   VAL n 
1 7   LEU n 
1 8   TYR n 
1 9   VAL n 
1 10  LEU n 
1 11  LEU n 
1 12  ALA n 
1 13  ALA n 
1 14  ALA n 
1 15  ALA n 
1 16  HIS n 
1 17  SER n 
1 18  ALA n 
1 19  PHE n 
1 20  ALA n 
1 21  ALA n 
1 22  MET n 
1 23  VAL n 
1 24  HIS n 
1 25  HIS n 
1 26  HIS n 
1 27  HIS n 
1 28  HIS n 
1 29  HIS n 
1 30  SER n 
1 31  ALA n 
1 32  GLU n 
1 33  GLU n 
1 34  THR n 
1 35  LEU n 
1 36  MET n 
1 37  ASP n 
1 38  SER n 
1 39  THR n 
1 40  THR n 
1 41  ALA n 
1 42  THR n 
1 43  ALA n 
1 44  GLU n 
1 45  LEU n 
1 46  GLY n 
1 47  TRP n 
1 48  MET n 
1 49  VAL n 
1 50  HIS n 
1 51  PRO n 
1 52  PRO n 
1 53  SER n 
1 54  GLY n 
1 55  TRP n 
1 56  GLU n 
1 57  GLU n 
1 58  VAL n 
1 59  SER n 
1 60  GLY n 
1 61  TYR n 
1 62  ASP n 
1 63  GLU n 
1 64  ASN n 
1 65  MET n 
1 66  ASN n 
1 67  THR n 
1 68  ILE n 
1 69  ARG n 
1 70  THR n 
1 71  TYR n 
1 72  GLN n 
1 73  VAL n 
1 74  CYS n 
1 75  ASN n 
1 76  VAL n 
1 77  PHE n 
1 78  GLU n 
1 79  SER n 
1 80  SER n 
1 81  GLN n 
1 82  ASN n 
1 83  ASN n 
1 84  TRP n 
1 85  LEU n 
1 86  ARG n 
1 87  THR n 
1 88  LYS n 
1 89  PHE n 
1 90  ILE n 
1 91  ARG n 
1 92  ARG n 
1 93  ARG n 
1 94  GLY n 
1 95  ALA n 
1 96  HIS n 
1 97  ARG n 
1 98  ILE n 
1 99  HIS n 
1 100 VAL n 
1 101 GLU n 
1 102 MET n 
1 103 LYS n 
1 104 PHE n 
1 105 SER n 
1 106 VAL n 
1 107 ARG n 
1 108 ASP n 
1 109 CYS n 
1 110 SER n 
1 111 SER n 
1 112 ILE n 
1 113 PRO n 
1 114 SER n 
1 115 VAL n 
1 116 PRO n 
1 117 GLY n 
1 118 SER n 
1 119 CYS n 
1 120 LYS n 
1 121 GLU n 
1 122 THR n 
1 123 PHE n 
1 124 ASN n 
1 125 LEU n 
1 126 TYR n 
1 127 TYR n 
1 128 TYR n 
1 129 GLU n 
1 130 ALA n 
1 131 ASP n 
1 132 PHE n 
1 133 ASP n 
1 134 SER n 
1 135 ALA n 
1 136 THR n 
1 137 LYS n 
1 138 THR n 
1 139 PHE n 
1 140 PRO n 
1 141 ASN n 
1 142 TRP n 
1 143 MET n 
1 144 GLU n 
1 145 ASN n 
1 146 PRO n 
1 147 TRP n 
1 148 VAL n 
1 149 LYS n 
1 150 VAL n 
1 151 ASP n 
1 152 THR n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 GLU n 
1 158 SER n 
1 159 PHE n 
1 160 SER n 
1 161 GLN n 
1 162 VAL n 
1 163 ASP n 
1 164 LEU n 
1 165 GLY n 
1 166 GLY n 
1 167 ARG n 
1 168 VAL n 
1 169 MET n 
1 170 LYS n 
1 171 ILE n 
1 172 ASN n 
1 173 THR n 
1 174 GLU n 
1 175 VAL n 
1 176 ARG n 
1 177 SER n 
1 178 PHE n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 SER n 
1 183 ARG n 
1 184 SER n 
1 185 GLY n 
1 186 PHE n 
1 187 TYR n 
1 188 LEU n 
1 189 ALA n 
1 190 PHE n 
1 191 GLN n 
1 192 ASP n 
1 193 TYR n 
1 194 GLY n 
1 195 GLY n 
1 196 CYS n 
1 197 MET n 
1 198 SER n 
1 199 LEU n 
1 200 ILE n 
1 201 ALA n 
1 202 VAL n 
1 203 ARG n 
1 204 VAL n 
1 205 PHE n 
1 206 TYR n 
1 207 ARG n 
1 208 LYS n 
2 1   SER n 
2 2   ASN n 
2 3   GLU n 
2 4   TRP n 
2 5   ILE n 
2 6   GLN n 
2 7   PRO n 
2 8   ARG n 
2 9   LEU n 
2 10  PRO n 
2 11  GLN n 
2 12  HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'EPHB2, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               HI-5 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Pfastbac1 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pBac6 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Antagonistic Peptide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP EPHB2_HUMAN P29323 1 
;EETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSS
IPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQ
DYGGCMSLIAVRVFYRK
;
20 ? 
2 PDB 2QBX        2QBX   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2QBX A 32 ? 208 ? P29323 20 ? 196 ? 28 204 
2 1 2QBX B 32 ? 208 ? P29323 20 ? 196 ? 28 204 
3 2 2QBX D 1  ? 12  ? 2QBX   1  ? 12  ? 1  12  
4 2 2QBX P 1  ? 12  ? 2QBX   1  ? 12  ? 1  12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2QBX MET A 1  ? UNP P29323 ? ? 'EXPRESSION TAG' -3 1  
1 2QBX VAL A 2  ? UNP P29323 ? ? 'EXPRESSION TAG' -2 2  
1 2QBX SER A 3  ? UNP P29323 ? ? 'EXPRESSION TAG' -1 3  
1 2QBX ALA A 4  ? UNP P29323 ? ? 'EXPRESSION TAG' 0  4  
1 2QBX ILE A 5  ? UNP P29323 ? ? 'EXPRESSION TAG' 1  5  
1 2QBX VAL A 6  ? UNP P29323 ? ? 'EXPRESSION TAG' 2  6  
1 2QBX LEU A 7  ? UNP P29323 ? ? 'EXPRESSION TAG' 3  7  
1 2QBX TYR A 8  ? UNP P29323 ? ? 'EXPRESSION TAG' 4  8  
1 2QBX VAL A 9  ? UNP P29323 ? ? 'EXPRESSION TAG' 5  9  
1 2QBX LEU A 10 ? UNP P29323 ? ? 'EXPRESSION TAG' 6  10 
1 2QBX LEU A 11 ? UNP P29323 ? ? 'EXPRESSION TAG' 7  11 
1 2QBX ALA A 12 ? UNP P29323 ? ? 'EXPRESSION TAG' 8  12 
1 2QBX ALA A 13 ? UNP P29323 ? ? 'EXPRESSION TAG' 9  13 
1 2QBX ALA A 14 ? UNP P29323 ? ? 'EXPRESSION TAG' 10 14 
1 2QBX ALA A 15 ? UNP P29323 ? ? 'EXPRESSION TAG' 11 15 
1 2QBX HIS A 16 ? UNP P29323 ? ? 'EXPRESSION TAG' 12 16 
1 2QBX SER A 17 ? UNP P29323 ? ? 'EXPRESSION TAG' 13 17 
1 2QBX ALA A 18 ? UNP P29323 ? ? 'EXPRESSION TAG' 14 18 
1 2QBX PHE A 19 ? UNP P29323 ? ? 'EXPRESSION TAG' 15 19 
1 2QBX ALA A 20 ? UNP P29323 ? ? 'EXPRESSION TAG' 16 20 
1 2QBX ALA A 21 ? UNP P29323 ? ? 'EXPRESSION TAG' 17 21 
1 2QBX MET A 22 ? UNP P29323 ? ? 'EXPRESSION TAG' 18 22 
1 2QBX VAL A 23 ? UNP P29323 ? ? 'EXPRESSION TAG' 19 23 
1 2QBX HIS A 24 ? UNP P29323 ? ? 'EXPRESSION TAG' 20 24 
1 2QBX HIS A 25 ? UNP P29323 ? ? 'EXPRESSION TAG' 21 25 
1 2QBX HIS A 26 ? UNP P29323 ? ? 'EXPRESSION TAG' 22 26 
1 2QBX HIS A 27 ? UNP P29323 ? ? 'EXPRESSION TAG' 23 27 
1 2QBX HIS A 28 ? UNP P29323 ? ? 'EXPRESSION TAG' 24 28 
1 2QBX HIS A 29 ? UNP P29323 ? ? 'EXPRESSION TAG' 25 29 
1 2QBX SER A 30 ? UNP P29323 ? ? 'EXPRESSION TAG' 26 30 
1 2QBX ALA A 31 ? UNP P29323 ? ? 'EXPRESSION TAG' 27 31 
2 2QBX MET B 1  ? UNP P29323 ? ? 'EXPRESSION TAG' -3 32 
2 2QBX VAL B 2  ? UNP P29323 ? ? 'EXPRESSION TAG' -2 33 
2 2QBX SER B 3  ? UNP P29323 ? ? 'EXPRESSION TAG' -1 34 
2 2QBX ALA B 4  ? UNP P29323 ? ? 'EXPRESSION TAG' 0  35 
2 2QBX ILE B 5  ? UNP P29323 ? ? 'EXPRESSION TAG' 1  36 
2 2QBX VAL B 6  ? UNP P29323 ? ? 'EXPRESSION TAG' 2  37 
2 2QBX LEU B 7  ? UNP P29323 ? ? 'EXPRESSION TAG' 3  38 
2 2QBX TYR B 8  ? UNP P29323 ? ? 'EXPRESSION TAG' 4  39 
2 2QBX VAL B 9  ? UNP P29323 ? ? 'EXPRESSION TAG' 5  40 
2 2QBX LEU B 10 ? UNP P29323 ? ? 'EXPRESSION TAG' 6  41 
2 2QBX LEU B 11 ? UNP P29323 ? ? 'EXPRESSION TAG' 7  42 
2 2QBX ALA B 12 ? UNP P29323 ? ? 'EXPRESSION TAG' 8  43 
2 2QBX ALA B 13 ? UNP P29323 ? ? 'EXPRESSION TAG' 9  44 
2 2QBX ALA B 14 ? UNP P29323 ? ? 'EXPRESSION TAG' 10 45 
2 2QBX ALA B 15 ? UNP P29323 ? ? 'EXPRESSION TAG' 11 46 
2 2QBX HIS B 16 ? UNP P29323 ? ? 'EXPRESSION TAG' 12 47 
2 2QBX SER B 17 ? UNP P29323 ? ? 'EXPRESSION TAG' 13 48 
2 2QBX ALA B 18 ? UNP P29323 ? ? 'EXPRESSION TAG' 14 49 
2 2QBX PHE B 19 ? UNP P29323 ? ? 'EXPRESSION TAG' 15 50 
2 2QBX ALA B 20 ? UNP P29323 ? ? 'EXPRESSION TAG' 16 51 
2 2QBX ALA B 21 ? UNP P29323 ? ? 'EXPRESSION TAG' 17 52 
2 2QBX MET B 22 ? UNP P29323 ? ? 'EXPRESSION TAG' 18 53 
2 2QBX VAL B 23 ? UNP P29323 ? ? 'EXPRESSION TAG' 19 54 
2 2QBX HIS B 24 ? UNP P29323 ? ? 'EXPRESSION TAG' 20 55 
2 2QBX HIS B 25 ? UNP P29323 ? ? 'EXPRESSION TAG' 21 56 
2 2QBX HIS B 26 ? UNP P29323 ? ? 'EXPRESSION TAG' 22 57 
2 2QBX HIS B 27 ? UNP P29323 ? ? 'EXPRESSION TAG' 23 58 
2 2QBX HIS B 28 ? UNP P29323 ? ? 'EXPRESSION TAG' 24 59 
2 2QBX HIS B 29 ? UNP P29323 ? ? 'EXPRESSION TAG' 25 60 
2 2QBX SER B 30 ? UNP P29323 ? ? 'EXPRESSION TAG' 26 61 
2 2QBX ALA B 31 ? UNP P29323 ? ? 'EXPRESSION TAG' 27 62 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2QBX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    
'100 mM Hepes, pH 7.2, 100 mM ammonium sulfate, and 20% PEG-3350, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-10-10 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2QBX 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            2.299 
_reflns.d_resolution_low             34.79 
_reflns.number_all                   17391 
_reflns.number_obs                   17391 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.299 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   87.06 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2QBX 
_refine.ls_number_reflns_obs                     17391 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.79 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    97.03 
_refine.ls_R_factor_obs                          0.19793 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19424 
_refine.ls_R_factor_R_free                       0.2695 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  942 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.896 
_refine.B_iso_mean                               33.547 
_refine.aniso_B[1][1]                            0.23 
_refine.aniso_B[2][2]                            0.23 
_refine.aniso_B[3][3]                            -0.35 
_refine.aniso_B[1][2]                            0.12 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1NUK 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.395 
_refine.pdbx_overall_ESU_R_Free                  0.275 
_refine.overall_SU_ML                            0.206 
_refine.overall_SU_B                             10.396 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2988 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             174 
_refine_hist.number_atoms_total               3222 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        34.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017  0.022  ? 3130 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020  ? 2651 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.106  1.942  ? 4261 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.295  3.000  ? 6150 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   19.432 5.000  ? 373  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.724 23.467 ? 150  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.254 15.000 ? 488  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.122 15.000 ? 21   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.217  0.200  ? 439  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.007  0.020  ? 3442 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 683  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.199  0.200  ? 523  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.207  0.200  ? 2765 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.195  0.200  ? 1455 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.097  0.200  ? 1828 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.200  0.200  ? 176  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.068  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.100  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.263  0.200  ? 69   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.338  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.939  1.500  ? 2003 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.178  1.500  ? 760  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.416  2.000  ? 3012 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.834  3.000  ? 1437 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.663  4.500  ? 1246 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.3 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             1174 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.percent_reflns_obs               87.06 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             71 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2QBX 
_struct.title                     'EphB2/SNEW Antagonistic Peptide Complex' 
_struct.pdbx_descriptor           'Ephrin type-B receptor 2 (E.C.2.7.10.1), antagonistic peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QBX 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;Receptor tyrosine kinase, bi-directional signaling, tumorigenesis, angiogenesis, SIGNALING PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'the biological unit is a dimer.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 39  ? ALA A 41  ? THR A 35  ALA A 37  5 ? 3 
HELX_P HELX_P2 2 ASP A 108 ? ILE A 112 ? ASP A 104 ILE A 108 5 ? 5 
HELX_P HELX_P3 3 THR B 39  ? ALA B 41  ? THR B 35  ALA B 37  5 ? 3 
HELX_P HELX_P4 4 ASP B 108 ? ILE B 112 ? ASP B 104 ILE B 108 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 74  SG ? ? ? 1_555 A CYS 196 SG ? ? A CYS 70  A CYS 192 1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf2 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 105 A CYS 115 1_555 ? ? ? ? ? ? ? 1.680 ? 
disulf3 disulf ? ? B CYS 74  SG ? ? ? 1_555 B CYS 196 SG ? ? B CYS 70  B CYS 192 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf4 disulf ? ? B CYS 109 SG ? ? ? 1_555 B CYS 119 SG ? ? B CYS 105 B CYS 115 1_555 ? ? ? ? ? ? ? 2.059 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 50  A . ? HIS 46  A PRO 51  A ? PRO 47  A 1 2.27  
2 PHE 139 A . ? PHE 135 A PRO 140 A ? PRO 136 A 1 -7.66 
3 GLY 165 A . ? GLY 161 A GLY 166 A ? GLY 162 A 1 -3.11 
4 GLY 179 A . ? GLY 175 A PRO 180 A ? PRO 176 A 1 -2.17 
5 HIS 50  B . ? HIS 46  B PRO 51  B ? PRO 47  B 1 -2.27 
6 PHE 139 B . ? PHE 135 B PRO 140 B ? PRO 136 B 1 -8.23 
7 GLY 179 B . ? GLY 175 B PRO 180 B ? PRO 176 B 1 2.07  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 5 ? 
E ? 4 ? 
F ? 5 ? 
G ? 4 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 33  ? ASP A 37  ? GLU A 29  ASP A 33  
A 2 MET A 197 ? TYR A 206 ? MET A 193 TYR A 202 
A 3 THR A 67  ? VAL A 73  ? THR A 63  VAL A 69  
A 4 GLU A 56  ? TYR A 61  ? GLU A 52  TYR A 57  
B 1 GLU A 33  ? ASP A 37  ? GLU A 29  ASP A 33  
B 2 MET A 197 ? TYR A 206 ? MET A 193 TYR A 202 
B 3 ILE A 98  ? VAL A 106 ? ILE A 94  VAL A 102 
B 4 ARG A 167 ? PHE A 178 ? ARG A 163 PHE A 174 
B 5 SER A 160 ? LEU A 164 ? SER A 156 LEU A 160 
C 1 MET A 48  ? HIS A 50  ? MET A 44  HIS A 46  
C 2 ASN A 83  ? ARG A 86  ? ASN A 79  ARG A 82  
C 3 GLY A 185 ? ASP A 192 ? GLY A 181 ASP A 188 
C 4 ILE A 90  ? ARG A 91  ? ILE A 86  ARG A 87  
D 1 MET A 48  ? HIS A 50  ? MET A 44  HIS A 46  
D 2 ASN A 83  ? ARG A 86  ? ASN A 79  ARG A 82  
D 3 GLY A 185 ? ASP A 192 ? GLY A 181 ASP A 188 
D 4 PHE A 123 ? ALA A 130 ? PHE A 119 ALA A 126 
D 5 VAL A 148 ? ILE A 153 ? VAL A 144 ILE A 149 
E 1 GLU B 33  ? ASP B 37  ? GLU B 29  ASP B 33  
E 2 CYS B 196 ? TYR B 206 ? CYS B 192 TYR B 202 
E 3 THR B 67  ? CYS B 74  ? THR B 63  CYS B 70  
E 4 GLU B 56  ? TYR B 61  ? GLU B 52  TYR B 57  
F 1 GLU B 33  ? ASP B 37  ? GLU B 29  ASP B 33  
F 2 CYS B 196 ? TYR B 206 ? CYS B 192 TYR B 202 
F 3 ILE B 98  ? VAL B 106 ? ILE B 94  VAL B 102 
F 4 VAL B 168 ? PHE B 178 ? VAL B 164 PHE B 174 
F 5 SER B 160 ? ASP B 163 ? SER B 156 ASP B 159 
G 1 MET B 48  ? HIS B 50  ? MET B 44  HIS B 46  
G 2 ASN B 83  ? ARG B 86  ? ASN B 79  ARG B 82  
G 3 GLY B 185 ? ASP B 192 ? GLY B 181 ASP B 188 
G 4 ILE B 90  ? ARG B 91  ? ILE B 86  ARG B 87  
H 1 MET B 48  ? HIS B 50  ? MET B 44  HIS B 46  
H 2 ASN B 83  ? ARG B 86  ? ASN B 79  ARG B 82  
H 3 GLY B 185 ? ASP B 192 ? GLY B 181 ASP B 188 
H 4 THR B 122 ? ALA B 130 ? THR B 118 ALA B 126 
H 5 VAL B 148 ? ALA B 154 ? VAL B 144 ALA B 150 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 36  ? N MET A 32  O VAL A 204 ? O VAL A 200 
A 2 3 O LEU A 199 ? O LEU A 195 N TYR A 71  ? N TYR A 67  
A 3 4 O ILE A 68  ? O ILE A 64  N GLY A 60  ? N GLY A 56  
B 1 2 N MET A 36  ? N MET A 32  O VAL A 204 ? O VAL A 200 
B 2 3 O PHE A 205 ? O PHE A 201 N HIS A 99  ? N HIS A 95  
B 3 4 N VAL A 100 ? N VAL A 96  O ARG A 176 ? O ARG A 172 
B 4 5 O ARG A 167 ? O ARG A 163 N LEU A 164 ? N LEU A 160 
C 1 2 N HIS A 50  ? N HIS A 46  O TRP A 84  ? O TRP A 80  
C 2 3 N ASN A 83  ? N ASN A 79  O ASP A 192 ? O ASP A 188 
C 3 4 O PHE A 186 ? O PHE A 182 N ILE A 90  ? N ILE A 86  
D 1 2 N HIS A 50  ? N HIS A 46  O TRP A 84  ? O TRP A 80  
D 2 3 N ASN A 83  ? N ASN A 79  O ASP A 192 ? O ASP A 188 
D 3 4 O TYR A 187 ? O TYR A 183 N TYR A 128 ? N TYR A 124 
D 4 5 N PHE A 123 ? N PHE A 119 O ILE A 153 ? O ILE A 149 
E 1 2 N LEU B 35  ? N LEU B 31  O VAL B 204 ? O VAL B 200 
E 2 3 O LEU B 199 ? O LEU B 195 N TYR B 71  ? N TYR B 67  
E 3 4 O THR B 70  ? O THR B 66  N VAL B 58  ? N VAL B 54  
F 1 2 N LEU B 35  ? N LEU B 31  O VAL B 204 ? O VAL B 200 
F 2 3 O PHE B 205 ? O PHE B 201 N HIS B 99  ? N HIS B 95  
F 3 4 N VAL B 100 ? N VAL B 96  O ARG B 176 ? O ARG B 172 
F 4 5 O MET B 169 ? O MET B 165 N VAL B 162 ? N VAL B 158 
G 1 2 N HIS B 50  ? N HIS B 46  O TRP B 84  ? O TRP B 80  
G 2 3 N ASN B 83  ? N ASN B 79  O ASP B 192 ? O ASP B 188 
G 3 4 O PHE B 186 ? O PHE B 182 N ILE B 90  ? N ILE B 86  
H 1 2 N HIS B 50  ? N HIS B 46  O TRP B 84  ? O TRP B 80  
H 2 3 N ASN B 83  ? N ASN B 79  O ASP B 192 ? O ASP B 188 
H 3 4 O GLY B 185 ? O GLY B 181 N ALA B 130 ? N ALA B 126 
H 4 5 N PHE B 123 ? N PHE B 119 O ILE B 153 ? O ILE B 149 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 401' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 402' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 403' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 404' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 405' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 406' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 D 407' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 408' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 409' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 410' 
BC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 411' 
BC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 412' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 HIS B 99  ? HIS B 95  . ? 1_555 ? 
2  AC1 2 ARG B 207 ? ARG B 203 . ? 1_555 ? 
3  AC2 3 ARG B 92  ? ARG B 88  . ? 1_555 ? 
4  AC2 3 GLY B 94  ? GLY B 90  . ? 1_555 ? 
5  AC2 3 HIS B 96  ? HIS B 92  . ? 1_555 ? 
6  AC3 4 MET B 36  ? MET B 32  . ? 1_555 ? 
7  AC3 4 ASP B 37  ? ASP B 33  . ? 1_555 ? 
8  AC3 4 LEU B 45  ? LEU B 41  . ? 1_555 ? 
9  AC3 4 HOH R .   ? HOH B 470 . ? 1_555 ? 
10 AC4 5 PHE A 139 ? PHE A 135 . ? 1_555 ? 
11 AC4 5 PRO A 140 ? PRO A 136 . ? 1_555 ? 
12 AC4 5 ASN A 141 ? ASN A 137 . ? 1_555 ? 
13 AC4 5 PRO A 146 ? PRO A 142 . ? 1_555 ? 
14 AC4 5 HOH Q .   ? HOH A 481 . ? 1_555 ? 
15 AC5 3 ARG A 183 ? ARG A 179 . ? 1_555 ? 
16 AC5 3 HOH Q .   ? HOH A 480 . ? 1_555 ? 
17 AC5 3 ARG B 183 ? ARG B 179 . ? 1_555 ? 
18 AC6 2 SER A 59  ? SER A 55  . ? 1_555 ? 
19 AC6 2 ARG A 69  ? ARG A 65  . ? 1_555 ? 
20 AC7 5 PRO A 113 ? PRO A 109 . ? 2_654 ? 
21 AC7 5 SER A 114 ? SER A 110 . ? 2_654 ? 
22 AC7 5 HOH R .   ? HOH B 441 . ? 1_555 ? 
23 AC7 5 GLN C 6   ? GLN D 6   . ? 1_555 ? 
24 AC7 5 HOH S .   ? HOH D 285 . ? 1_555 ? 
25 AC8 3 ARG A 92  ? ARG A 88  . ? 1_555 ? 
26 AC8 3 GLY A 94  ? GLY A 90  . ? 1_555 ? 
27 AC8 3 HIS A 96  ? HIS A 92  . ? 1_555 ? 
28 AC9 4 THR B 40  ? THR B 36  . ? 1_455 ? 
29 AC9 4 SER B 79  ? SER B 75  . ? 1_555 ? 
30 AC9 4 SER B 80  ? SER B 76  . ? 1_555 ? 
31 AC9 4 SER B 118 ? SER B 114 . ? 1_555 ? 
32 BC1 4 PRO B 113 ? PRO B 109 . ? 1_555 ? 
33 BC1 4 SER B 114 ? SER B 110 . ? 1_555 ? 
34 BC1 4 GLN D 6   ? GLN P 6   . ? 2_554 ? 
35 BC1 4 HOH T .   ? HOH P 14  . ? 2_554 ? 
36 BC2 7 TRP B 84  ? TRP B 80  . ? 1_555 ? 
37 BC2 7 TYR B 126 ? TYR B 122 . ? 1_555 ? 
38 BC2 7 MET B 143 ? MET B 139 . ? 1_555 ? 
39 BC2 7 GLU B 144 ? GLU B 140 . ? 1_555 ? 
40 BC2 7 GLN B 191 ? GLN B 187 . ? 1_555 ? 
41 BC2 7 HOH R .   ? HOH B 453 . ? 1_555 ? 
42 BC2 7 HOH R .   ? HOH B 491 . ? 1_555 ? 
43 BC3 2 SER B 59  ? SER B 55  . ? 1_555 ? 
44 BC3 2 ARG B 69  ? ARG B 65  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2QBX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2QBX 
_atom_sites.fract_transf_matrix[1][1]   0.024886 
_atom_sites.fract_transf_matrix[1][2]   0.014368 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028736 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004255 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 32  ? -8.161  8.308  42.647  1.00 52.39  ? 28  GLU A N   1 
ATOM   2    C CA  . GLU A 1 32  ? -8.587  6.880  42.553  1.00 52.88  ? 28  GLU A CA  1 
ATOM   3    C C   . GLU A 1 32  ? -7.453  5.932  42.162  1.00 52.89  ? 28  GLU A C   1 
ATOM   4    O O   . GLU A 1 32  ? -6.882  5.292  43.066  1.00 54.28  ? 28  GLU A O   1 
ATOM   5    C CB  . GLU A 1 32  ? -9.835  6.701  41.664  1.00 53.10  ? 28  GLU A CB  1 
ATOM   6    C CG  . GLU A 1 32  ? -11.126 7.130  42.421  1.00 54.18  ? 28  GLU A CG  1 
ATOM   7    C CD  . GLU A 1 32  ? -12.352 7.296  41.522  1.00 54.90  ? 28  GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 32  ? -13.117 6.304  41.419  1.00 56.96  ? 28  GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 32  ? -12.555 8.406  40.942  1.00 54.68  ? 28  GLU A OE2 1 
ATOM   10   N N   . GLU A 1 33  ? -7.090  5.848  40.877  1.00 51.99  ? 29  GLU A N   1 
ATOM   11   C CA  . GLU A 1 33  ? -6.133  4.811  40.441  1.00 51.27  ? 29  GLU A CA  1 
ATOM   12   C C   . GLU A 1 33  ? -4.631  5.193  40.463  1.00 50.37  ? 29  GLU A C   1 
ATOM   13   O O   . GLU A 1 33  ? -4.192  6.045  39.708  1.00 49.54  ? 29  GLU A O   1 
ATOM   14   C CB  . GLU A 1 33  ? -6.504  4.310  39.060  1.00 51.36  ? 29  GLU A CB  1 
ATOM   15   C CG  . GLU A 1 33  ? -6.054  2.883  38.806  1.00 53.91  ? 29  GLU A CG  1 
ATOM   16   C CD  . GLU A 1 33  ? -6.740  1.888  39.751  1.00 56.93  ? 29  GLU A CD  1 
ATOM   17   O OE1 . GLU A 1 33  ? -7.977  2.015  39.947  1.00 56.36  ? 29  GLU A OE1 1 
ATOM   18   O OE2 . GLU A 1 33  ? -6.037  0.987  40.293  1.00 58.93  ? 29  GLU A OE2 1 
ATOM   19   N N   . THR A 1 34  ? -3.848  4.501  41.292  1.00 49.38  ? 30  THR A N   1 
ATOM   20   C CA  . THR A 1 34  ? -2.415  4.789  41.466  1.00 48.89  ? 30  THR A CA  1 
ATOM   21   C C   . THR A 1 34  ? -1.512  4.236  40.355  1.00 47.23  ? 30  THR A C   1 
ATOM   22   O O   . THR A 1 34  ? -1.492  3.049  40.084  1.00 47.13  ? 30  THR A O   1 
ATOM   23   C CB  . THR A 1 34  ? -1.897  4.274  42.844  1.00 48.72  ? 30  THR A CB  1 
ATOM   24   O OG1 . THR A 1 34  ? -2.331  5.167  43.865  1.00 49.75  ? 30  THR A OG1 1 
ATOM   25   C CG2 . THR A 1 34  ? -0.373  4.205  42.912  1.00 48.86  ? 30  THR A CG2 1 
ATOM   26   N N   . LEU A 1 35  ? -0.716  5.122  39.775  1.00 45.84  ? 31  LEU A N   1 
ATOM   27   C CA  . LEU A 1 35  ? 0.310   4.758  38.803  1.00 44.64  ? 31  LEU A CA  1 
ATOM   28   C C   . LEU A 1 35  ? 1.699   4.617  39.464  1.00 43.99  ? 31  LEU A C   1 
ATOM   29   O O   . LEU A 1 35  ? 2.518   3.784  39.048  1.00 43.41  ? 31  LEU A O   1 
ATOM   30   C CB  . LEU A 1 35  ? 0.321   5.810  37.691  1.00 44.25  ? 31  LEU A CB  1 
ATOM   31   C CG  . LEU A 1 35  ? -1.036  5.854  36.965  1.00 44.77  ? 31  LEU A CG  1 
ATOM   32   C CD1 . LEU A 1 35  ? -1.157  7.019  35.998  1.00 44.53  ? 31  LEU A CD1 1 
ATOM   33   C CD2 . LEU A 1 35  ? -1.297  4.530  36.261  1.00 44.53  ? 31  LEU A CD2 1 
ATOM   34   N N   . MET A 1 36  ? 1.943   5.418  40.503  1.00 42.82  ? 32  MET A N   1 
ATOM   35   C CA  . MET A 1 36  ? 3.181   5.327  41.301  1.00 42.58  ? 32  MET A CA  1 
ATOM   36   C C   . MET A 1 36  ? 2.942   5.928  42.703  1.00 42.43  ? 32  MET A C   1 
ATOM   37   O O   . MET A 1 36  ? 2.278   6.990  42.851  1.00 41.39  ? 32  MET A O   1 
ATOM   38   C CB  . MET A 1 36  ? 4.343   6.051  40.599  1.00 41.58  ? 32  MET A CB  1 
ATOM   39   C CG  . MET A 1 36  ? 5.707   5.939  41.280  1.00 40.68  ? 32  MET A CG  1 
ATOM   40   S SD  . MET A 1 36  ? 6.098   7.162  42.550  1.00 34.83  ? 32  MET A SD  1 
ATOM   41   C CE  . MET A 1 36  ? 6.674   8.549  41.607  1.00 34.78  ? 32  MET A CE  1 
ATOM   42   N N   . ASP A 1 37  ? 3.501   5.251  43.712  1.00 42.12  ? 33  ASP A N   1 
ATOM   43   C CA  . ASP A 1 37  ? 3.476   5.739  45.076  1.00 42.17  ? 33  ASP A CA  1 
ATOM   44   C C   . ASP A 1 37  ? 4.813   5.433  45.729  1.00 41.48  ? 33  ASP A C   1 
ATOM   45   O O   . ASP A 1 37  ? 5.090   4.290  46.038  1.00 41.67  ? 33  ASP A O   1 
ATOM   46   C CB  . ASP A 1 37  ? 2.314   5.081  45.842  1.00 42.18  ? 33  ASP A CB  1 
ATOM   47   C CG  . ASP A 1 37  ? 1.905   5.867  47.108  1.00 43.23  ? 33  ASP A CG  1 
ATOM   48   O OD1 . ASP A 1 37  ? 2.763   6.454  47.800  1.00 38.87  ? 33  ASP A OD1 1 
ATOM   49   O OD2 . ASP A 1 37  ? 0.692   5.886  47.399  1.00 46.93  ? 33  ASP A OD2 1 
ATOM   50   N N   . SER A 1 38  ? 5.629   6.469  45.917  1.00 41.00  ? 34  SER A N   1 
ATOM   51   C CA  . SER A 1 38  ? 6.947   6.357  46.516  1.00 41.04  ? 34  SER A CA  1 
ATOM   52   C C   . SER A 1 38  ? 6.926   5.756  47.957  1.00 42.49  ? 34  SER A C   1 
ATOM   53   O O   . SER A 1 38  ? 7.931   5.216  48.436  1.00 43.10  ? 34  SER A O   1 
ATOM   54   C CB  . SER A 1 38  ? 7.576   7.732  46.568  1.00 39.99  ? 34  SER A CB  1 
ATOM   55   O OG  . SER A 1 38  ? 6.964   8.534  47.570  1.00 36.10  ? 34  SER A OG  1 
ATOM   56   N N   . THR A 1 39  ? 5.778   5.910  48.613  1.00 42.87  ? 35  THR A N   1 
ATOM   57   C CA  . THR A 1 39  ? 5.463   5.477  49.994  1.00 43.67  ? 35  THR A CA  1 
ATOM   58   C C   . THR A 1 39  ? 5.369   3.935  50.153  1.00 44.52  ? 35  THR A C   1 
ATOM   59   O O   . THR A 1 39  ? 5.376   3.386  51.245  1.00 44.62  ? 35  THR A O   1 
ATOM   60   C CB  . THR A 1 39  ? 4.091   6.179  50.372  1.00 43.48  ? 35  THR A CB  1 
ATOM   61   O OG1 . THR A 1 39  ? 4.344   7.473  50.964  1.00 42.86  ? 35  THR A OG1 1 
ATOM   62   C CG2 . THR A 1 39  ? 3.171   5.309  51.205  1.00 44.78  ? 35  THR A CG2 1 
ATOM   63   N N   . THR A 1 40  ? 5.323   3.260  49.018  1.00 45.46  ? 36  THR A N   1 
ATOM   64   C CA  . THR A 1 40  ? 5.103   1.833  48.912  1.00 45.49  ? 36  THR A CA  1 
ATOM   65   C C   . THR A 1 40  ? 6.386   1.106  48.507  1.00 45.02  ? 36  THR A C   1 
ATOM   66   O O   . THR A 1 40  ? 6.435   -0.120 48.466  1.00 45.42  ? 36  THR A O   1 
ATOM   67   C CB  . THR A 1 40  ? 3.953   1.656  47.915  1.00 46.31  ? 36  THR A CB  1 
ATOM   68   O OG1 . THR A 1 40  ? 2.743   1.523  48.661  1.00 46.66  ? 36  THR A OG1 1 
ATOM   69   C CG2 . THR A 1 40  ? 4.141   0.471  46.958  1.00 48.38  ? 36  THR A CG2 1 
ATOM   70   N N   . ALA A 1 41  ? 7.452   1.852  48.258  1.00 44.75  ? 37  ALA A N   1 
ATOM   71   C CA  . ALA A 1 41  ? 8.684   1.234  47.836  1.00 45.25  ? 37  ALA A CA  1 
ATOM   72   C C   . ALA A 1 41  ? 9.141   0.175  48.867  1.00 45.86  ? 37  ALA A C   1 
ATOM   73   O O   . ALA A 1 41  ? 9.219   0.457  50.085  1.00 45.57  ? 37  ALA A O   1 
ATOM   74   C CB  . ALA A 1 41  ? 9.747   2.256  47.609  1.00 45.11  ? 37  ALA A CB  1 
ATOM   75   N N   . THR A 1 42  ? 9.380   -1.042 48.360  1.00 45.47  ? 38  THR A N   1 
ATOM   76   C CA  . THR A 1 42  ? 9.866   -2.154 49.173  1.00 45.06  ? 38  THR A CA  1 
ATOM   77   C C   . THR A 1 42  ? 11.399  -2.145 49.272  1.00 45.31  ? 38  THR A C   1 
ATOM   78   O O   . THR A 1 42  ? 11.963  -2.940 50.003  1.00 44.93  ? 38  THR A O   1 
ATOM   79   C CB  . THR A 1 42  ? 9.288   -3.520 48.697  1.00 45.16  ? 38  THR A CB  1 
ATOM   80   O OG1 . THR A 1 42  ? 9.618   -3.785 47.319  1.00 43.25  ? 38  THR A OG1 1 
ATOM   81   C CG2 . THR A 1 42  ? 7.769   -3.509 48.886  1.00 43.50  ? 38  THR A CG2 1 
ATOM   82   N N   . ALA A 1 43  ? 12.049  -1.179 48.605  1.00 45.28  ? 39  ALA A N   1 
ATOM   83   C CA  . ALA A 1 43  ? 13.485  -0.964 48.748  1.00 45.42  ? 39  ALA A CA  1 
ATOM   84   C C   . ALA A 1 43  ? 13.794  0.483  48.425  1.00 45.30  ? 39  ALA A C   1 
ATOM   85   O O   . ALA A 1 43  ? 12.871  1.254  48.167  1.00 46.98  ? 39  ALA A O   1 
ATOM   86   C CB  . ALA A 1 43  ? 14.250  -1.899 47.793  1.00 45.90  ? 39  ALA A CB  1 
ATOM   87   N N   . GLU A 1 44  ? 15.070  0.860  48.393  1.00 44.03  ? 40  GLU A N   1 
ATOM   88   C CA  . GLU A 1 44  ? 15.465  2.195  47.892  1.00 43.47  ? 40  GLU A CA  1 
ATOM   89   C C   . GLU A 1 44  ? 14.617  2.713  46.714  1.00 41.88  ? 40  GLU A C   1 
ATOM   90   O O   . GLU A 1 44  ? 14.195  1.957  45.846  1.00 41.21  ? 40  GLU A O   1 
ATOM   91   C CB  . GLU A 1 44  ? 16.930  2.180  47.441  1.00 43.98  ? 40  GLU A CB  1 
ATOM   92   C CG  . GLU A 1 44  ? 17.944  1.917  48.557  1.00 45.14  ? 40  GLU A CG  1 
ATOM   93   N N   . LEU A 1 45  ? 14.329  4.004  46.712  1.00 40.96  ? 41  LEU A N   1 
ATOM   94   C CA  . LEU A 1 45  ? 13.775  4.654  45.496  1.00 40.00  ? 41  LEU A CA  1 
ATOM   95   C C   . LEU A 1 45  ? 14.428  4.320  44.096  1.00 39.37  ? 41  LEU A C   1 
ATOM   96   O O   . LEU A 1 45  ? 13.815  3.722  43.169  1.00 38.62  ? 41  LEU A O   1 
ATOM   97   C CB  . LEU A 1 45  ? 13.131  6.044  45.692  1.00 39.74  ? 41  LEU A CB  1 
ATOM   98   C CG  . LEU A 1 45  ? 11.745  6.213  46.338  1.00 39.38  ? 41  LEU A CG  1 
ATOM   99   C CD1 . LEU A 1 45  ? 11.084  4.904  46.693  1.00 40.57  ? 41  LEU A CD1 1 
ATOM   100  C CD2 . LEU A 1 45  ? 11.794  7.155  47.528  1.00 39.78  ? 41  LEU A CD2 1 
ATOM   101  N N   . GLY A 1 46  ? 15.687  4.757  44.018  1.00 37.89  ? 42  GLY A N   1 
ATOM   102  C CA  . GLY A 1 46  ? 16.554  4.497  42.929  1.00 37.65  ? 42  GLY A CA  1 
ATOM   103  C C   . GLY A 1 46  ? 16.454  5.614  41.941  1.00 37.29  ? 42  GLY A C   1 
ATOM   104  O O   . GLY A 1 46  ? 16.699  5.396  40.767  1.00 37.44  ? 42  GLY A O   1 
ATOM   105  N N   . TRP A 1 47  ? 16.108  6.818  42.410  1.00 36.18  ? 43  TRP A N   1 
ATOM   106  C CA  . TRP A 1 47  ? 15.753  7.894  41.506  1.00 34.56  ? 43  TRP A CA  1 
ATOM   107  C C   . TRP A 1 47  ? 17.025  8.598  41.132  1.00 34.99  ? 43  TRP A C   1 
ATOM   108  O O   . TRP A 1 47  ? 17.949  8.685  41.922  1.00 36.24  ? 43  TRP A O   1 
ATOM   109  C CB  . TRP A 1 47  ? 14.742  8.859  42.164  1.00 32.92  ? 43  TRP A CB  1 
ATOM   110  C CG  . TRP A 1 47  ? 13.364  8.283  42.376  1.00 30.55  ? 43  TRP A CG  1 
ATOM   111  C CD1 . TRP A 1 47  ? 12.964  7.007  42.141  1.00 31.25  ? 43  TRP A CD1 1 
ATOM   112  C CD2 . TRP A 1 47  ? 12.212  8.969  42.905  1.00 29.64  ? 43  TRP A CD2 1 
ATOM   113  N NE1 . TRP A 1 47  ? 11.634  6.850  42.471  1.00 29.98  ? 43  TRP A NE1 1 
ATOM   114  C CE2 . TRP A 1 47  ? 11.153  8.044  42.944  1.00 28.36  ? 43  TRP A CE2 1 
ATOM   115  C CE3 . TRP A 1 47  ? 11.975  10.288 43.332  1.00 29.15  ? 43  TRP A CE3 1 
ATOM   116  C CZ2 . TRP A 1 47  ? 9.881   8.374  43.415  1.00 29.25  ? 43  TRP A CZ2 1 
ATOM   117  C CZ3 . TRP A 1 47  ? 10.701  10.614 43.812  1.00 31.43  ? 43  TRP A CZ3 1 
ATOM   118  C CH2 . TRP A 1 47  ? 9.667   9.663  43.832  1.00 29.97  ? 43  TRP A CH2 1 
ATOM   119  N N   . MET A 1 48  ? 17.102  9.100  39.916  1.00 35.25  ? 44  MET A N   1 
ATOM   120  C CA  . MET A 1 48  ? 18.324  9.699  39.448  1.00 35.43  ? 44  MET A CA  1 
ATOM   121  C C   . MET A 1 48  ? 18.429  11.073 40.030  1.00 35.40  ? 44  MET A C   1 
ATOM   122  O O   . MET A 1 48  ? 17.476  11.827 39.961  1.00 34.79  ? 44  MET A O   1 
ATOM   123  C CB  . MET A 1 48  ? 18.298  9.837  37.935  1.00 36.47  ? 44  MET A CB  1 
ATOM   124  C CG  . MET A 1 48  ? 19.494  10.590 37.369  1.00 39.33  ? 44  MET A CG  1 
ATOM   125  S SD  . MET A 1 48  ? 20.897  9.495  37.477  1.00 44.82  ? 44  MET A SD  1 
ATOM   126  C CE  . MET A 1 48  ? 20.486  8.360  36.149  1.00 45.97  ? 44  MET A CE  1 
ATOM   127  N N   . VAL A 1 49  ? 19.604  11.409 40.555  1.00 35.43  ? 45  VAL A N   1 
ATOM   128  C CA  . VAL A 1 49  ? 19.871  12.743 41.023  1.00 35.63  ? 45  VAL A CA  1 
ATOM   129  C C   . VAL A 1 49  ? 21.032  13.347 40.242  1.00 35.81  ? 45  VAL A C   1 
ATOM   130  O O   . VAL A 1 49  ? 22.024  12.679 39.975  1.00 37.53  ? 45  VAL A O   1 
ATOM   131  C CB  . VAL A 1 49  ? 20.120  12.784 42.549  1.00 36.05  ? 45  VAL A CB  1 
ATOM   132  C CG1 . VAL A 1 49  ? 19.007  12.062 43.296  1.00 35.41  ? 45  VAL A CG1 1 
ATOM   133  C CG2 . VAL A 1 49  ? 21.451  12.162 42.896  1.00 37.12  ? 45  VAL A CG2 1 
ATOM   134  N N   . HIS A 1 50  ? 20.909  14.625 39.933  1.00 35.43  ? 46  HIS A N   1 
ATOM   135  C CA  . HIS A 1 50  ? 21.822  15.339 39.090  1.00 36.11  ? 46  HIS A CA  1 
ATOM   136  C C   . HIS A 1 50  ? 21.902  16.801 39.551  1.00 35.47  ? 46  HIS A C   1 
ATOM   137  O O   . HIS A 1 50  ? 21.011  17.579 39.270  1.00 35.90  ? 46  HIS A O   1 
ATOM   138  C CB  . HIS A 1 50  ? 21.303  15.269 37.634  1.00 36.08  ? 46  HIS A CB  1 
ATOM   139  C CG  . HIS A 1 50  ? 22.075  16.107 36.667  1.00 36.98  ? 46  HIS A CG  1 
ATOM   140  N ND1 . HIS A 1 50  ? 21.890  17.471 36.533  1.00 37.28  ? 46  HIS A ND1 1 
ATOM   141  C CD2 . HIS A 1 50  ? 23.044  15.769 35.778  1.00 38.22  ? 46  HIS A CD2 1 
ATOM   142  C CE1 . HIS A 1 50  ? 22.706  17.931 35.601  1.00 36.23  ? 46  HIS A CE1 1 
ATOM   143  N NE2 . HIS A 1 50  ? 23.408  16.916 35.121  1.00 36.51  ? 46  HIS A NE2 1 
ATOM   144  N N   . PRO A 1 51  ? 22.991  17.192 40.225  1.00 35.94  ? 47  PRO A N   1 
ATOM   145  C CA  . PRO A 1 51  ? 24.194  16.407 40.567  1.00 35.70  ? 47  PRO A CA  1 
ATOM   146  C C   . PRO A 1 51  ? 24.002  15.570 41.797  1.00 35.03  ? 47  PRO A C   1 
ATOM   147  O O   . PRO A 1 51  ? 23.060  15.813 42.568  1.00 36.24  ? 47  PRO A O   1 
ATOM   148  C CB  . PRO A 1 51  ? 25.267  17.469 40.785  1.00 35.51  ? 47  PRO A CB  1 
ATOM   149  C CG  . PRO A 1 51  ? 24.504  18.691 41.242  1.00 36.26  ? 47  PRO A CG  1 
ATOM   150  C CD  . PRO A 1 51  ? 23.082  18.579 40.711  1.00 36.23  ? 47  PRO A CD  1 
ATOM   151  N N   . PRO A 1 52  ? 24.855  14.550 41.976  1.00 34.34  ? 48  PRO A N   1 
ATOM   152  C CA  . PRO A 1 52  ? 24.812  13.697 43.180  1.00 33.51  ? 48  PRO A CA  1 
ATOM   153  C C   . PRO A 1 52  ? 25.004  14.450 44.504  1.00 32.28  ? 48  PRO A C   1 
ATOM   154  O O   . PRO A 1 52  ? 24.631  13.933 45.581  1.00 30.34  ? 48  PRO A O   1 
ATOM   155  C CB  . PRO A 1 52  ? 25.964  12.693 42.937  1.00 33.91  ? 48  PRO A CB  1 
ATOM   156  C CG  . PRO A 1 52  ? 26.135  12.716 41.403  1.00 33.33  ? 48  PRO A CG  1 
ATOM   157  C CD  . PRO A 1 52  ? 25.917  14.114 41.038  1.00 33.93  ? 48  PRO A CD  1 
ATOM   158  N N   . SER A 1 53  ? 25.581  15.646 44.413  1.00 31.12  ? 49  SER A N   1 
ATOM   159  C CA  . SER A 1 53  ? 25.681  16.528 45.555  1.00 31.67  ? 49  SER A CA  1 
ATOM   160  C C   . SER A 1 53  ? 24.338  17.201 45.979  1.00 31.92  ? 49  SER A C   1 
ATOM   161  O O   . SER A 1 53  ? 24.256  17.730 47.063  1.00 32.45  ? 49  SER A O   1 
ATOM   162  C CB  . SER A 1 53  ? 26.752  17.603 45.303  1.00 31.52  ? 49  SER A CB  1 
ATOM   163  O OG  . SER A 1 53  ? 26.512  18.314 44.103  1.00 32.43  ? 49  SER A OG  1 
ATOM   164  N N   . GLY A 1 54  ? 23.294  17.184 45.151  1.00 32.11  ? 50  GLY A N   1 
ATOM   165  C CA  . GLY A 1 54  ? 22.036  17.907 45.494  1.00 31.71  ? 50  GLY A CA  1 
ATOM   166  C C   . GLY A 1 54  ? 21.089  17.045 46.305  1.00 31.48  ? 50  GLY A C   1 
ATOM   167  O O   . GLY A 1 54  ? 21.340  16.781 47.495  1.00 32.03  ? 50  GLY A O   1 
ATOM   168  N N   . TRP A 1 55  ? 20.053  16.519 45.653  1.00 30.23  ? 51  TRP A N   1 
ATOM   169  C CA  . TRP A 1 55  ? 19.103  15.644 46.342  1.00 30.73  ? 51  TRP A CA  1 
ATOM   170  C C   . TRP A 1 55  ? 19.782  14.389 46.866  1.00 31.11  ? 51  TRP A C   1 
ATOM   171  O O   . TRP A 1 55  ? 20.696  13.924 46.247  1.00 32.73  ? 51  TRP A O   1 
ATOM   172  C CB  . TRP A 1 55  ? 17.894  15.238 45.455  1.00 29.24  ? 51  TRP A CB  1 
ATOM   173  C CG  . TRP A 1 55  ? 16.995  16.361 45.008  1.00 29.85  ? 51  TRP A CG  1 
ATOM   174  C CD1 . TRP A 1 55  ? 17.132  17.129 43.879  1.00 28.49  ? 51  TRP A CD1 1 
ATOM   175  C CD2 . TRP A 1 55  ? 15.784  16.830 45.662  1.00 29.20  ? 51  TRP A CD2 1 
ATOM   176  N NE1 . TRP A 1 55  ? 16.094  18.035 43.799  1.00 29.00  ? 51  TRP A NE1 1 
ATOM   177  C CE2 . TRP A 1 55  ? 15.258  17.869 44.871  1.00 28.97  ? 51  TRP A CE2 1 
ATOM   178  C CE3 . TRP A 1 55  ? 15.108  16.467 46.828  1.00 28.08  ? 51  TRP A CE3 1 
ATOM   179  C CZ2 . TRP A 1 55  ? 14.084  18.561 45.220  1.00 31.31  ? 51  TRP A CZ2 1 
ATOM   180  C CZ3 . TRP A 1 55  ? 13.914  17.133 47.161  1.00 28.98  ? 51  TRP A CZ3 1 
ATOM   181  C CH2 . TRP A 1 55  ? 13.425  18.176 46.366  1.00 28.54  ? 51  TRP A CH2 1 
ATOM   182  N N   . GLU A 1 56  ? 19.250  13.807 47.952  1.00 31.57  ? 52  GLU A N   1 
ATOM   183  C CA  . GLU A 1 56  ? 19.778  12.586 48.563  1.00 31.68  ? 52  GLU A CA  1 
ATOM   184  C C   . GLU A 1 56  ? 18.694  11.729 49.143  1.00 29.92  ? 52  GLU A C   1 
ATOM   185  O O   . GLU A 1 56  ? 17.857  12.219 49.878  1.00 30.37  ? 52  GLU A O   1 
ATOM   186  C CB  . GLU A 1 56  ? 20.734  12.925 49.689  1.00 31.50  ? 52  GLU A CB  1 
ATOM   187  C CG  . GLU A 1 56  ? 21.096  11.676 50.557  1.00 35.25  ? 52  GLU A CG  1 
ATOM   188  C CD  . GLU A 1 56  ? 22.100  12.011 51.669  1.00 37.09  ? 52  GLU A CD  1 
ATOM   189  O OE1 . GLU A 1 56  ? 22.129  13.194 52.137  1.00 44.02  ? 52  GLU A OE1 1 
ATOM   190  O OE2 . GLU A 1 56  ? 22.852  11.081 52.064  1.00 44.69  ? 52  GLU A OE2 1 
ATOM   191  N N   . GLU A 1 57  ? 18.682  10.450 48.837  1.00 29.49  ? 53  GLU A N   1 
ATOM   192  C CA  . GLU A 1 57  ? 17.682  9.595  49.448  1.00 30.05  ? 53  GLU A CA  1 
ATOM   193  C C   . GLU A 1 57  ? 18.002  9.408  50.936  1.00 31.31  ? 53  GLU A C   1 
ATOM   194  O O   . GLU A 1 57  ? 19.146  9.123  51.270  1.00 32.88  ? 53  GLU A O   1 
ATOM   195  C CB  . GLU A 1 57  ? 17.545  8.278  48.723  1.00 28.91  ? 53  GLU A CB  1 
ATOM   196  C CG  . GLU A 1 57  ? 16.369  7.509  49.167  1.00 27.33  ? 53  GLU A CG  1 
ATOM   197  C CD  . GLU A 1 57  ? 16.140  6.284  48.364  1.00 28.30  ? 53  GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 57  ? 16.689  6.174  47.245  1.00 31.55  ? 53  GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 57  ? 15.346  5.426  48.805  1.00 29.44  ? 53  GLU A OE2 1 
ATOM   200  N N   . VAL A 1 58  ? 17.009  9.627  51.811  1.00 31.85  ? 54  VAL A N   1 
ATOM   201  C CA  . VAL A 1 58  ? 17.163  9.609  53.301  1.00 32.13  ? 54  VAL A CA  1 
ATOM   202  C C   . VAL A 1 58  ? 15.929  8.927  53.849  1.00 31.68  ? 54  VAL A C   1 
ATOM   203  O O   . VAL A 1 58  ? 14.874  9.062  53.241  1.00 31.45  ? 54  VAL A O   1 
ATOM   204  C CB  . VAL A 1 58  ? 17.247  11.058 53.879  1.00 32.88  ? 54  VAL A CB  1 
ATOM   205  C CG1 . VAL A 1 58  ? 17.355  11.041 55.372  1.00 35.13  ? 54  VAL A CG1 1 
ATOM   206  C CG2 . VAL A 1 58  ? 18.479  11.757 53.363  1.00 34.21  ? 54  VAL A CG2 1 
ATOM   207  N N   . SER A 1 59  ? 16.016  8.155  54.937  1.00 31.43  ? 55  SER A N   1 
ATOM   208  C CA  . SER A 1 59  ? 14.765  7.646  55.556  1.00 31.46  ? 55  SER A CA  1 
ATOM   209  C C   . SER A 1 59  ? 14.088  8.841  56.264  1.00 30.88  ? 55  SER A C   1 
ATOM   210  O O   . SER A 1 59  ? 14.756  9.784  56.688  1.00 29.95  ? 55  SER A O   1 
ATOM   211  C CB  . SER A 1 59  ? 15.004  6.510  56.558  1.00 31.76  ? 55  SER A CB  1 
ATOM   212  O OG  . SER A 1 59  ? 16.029  6.882  57.462  1.00 31.96  ? 55  SER A OG  1 
ATOM   213  N N   . GLY A 1 60  ? 12.769  8.827  56.355  1.00 30.28  ? 56  GLY A N   1 
ATOM   214  C CA  . GLY A 1 60  ? 12.074  9.956  56.959  1.00 30.47  ? 56  GLY A CA  1 
ATOM   215  C C   . GLY A 1 60  ? 10.664  9.631  57.319  1.00 30.31  ? 56  GLY A C   1 
ATOM   216  O O   . GLY A 1 60  ? 10.144  8.573  56.956  1.00 30.83  ? 56  GLY A O   1 
ATOM   217  N N   . TYR A 1 61  ? 10.034  10.560 58.025  1.00 30.39  ? 57  TYR A N   1 
ATOM   218  C CA  . TYR A 1 61  ? 8.694   10.353 58.529  1.00 30.10  ? 57  TYR A CA  1 
ATOM   219  C C   . TYR A 1 61  ? 7.603   10.780 57.575  1.00 31.35  ? 57  TYR A C   1 
ATOM   220  O O   . TYR A 1 61  ? 7.674   11.809 56.905  1.00 29.66  ? 57  TYR A O   1 
ATOM   221  C CB  . TYR A 1 61  ? 8.474   11.087 59.868  1.00 28.95  ? 57  TYR A CB  1 
ATOM   222  C CG  . TYR A 1 61  ? 9.412   10.641 60.954  1.00 28.71  ? 57  TYR A CG  1 
ATOM   223  C CD1 . TYR A 1 61  ? 9.469   9.292  61.367  1.00 26.73  ? 57  TYR A CD1 1 
ATOM   224  C CD2 . TYR A 1 61  ? 10.245  11.558 61.587  1.00 24.95  ? 57  TYR A CD2 1 
ATOM   225  C CE1 . TYR A 1 61  ? 10.362  8.884  62.393  1.00 26.48  ? 57  TYR A CE1 1 
ATOM   226  C CE2 . TYR A 1 61  ? 11.151  11.150 62.576  1.00 27.24  ? 57  TYR A CE2 1 
ATOM   227  C CZ  . TYR A 1 61  ? 11.187  9.827  62.979  1.00 26.18  ? 57  TYR A CZ  1 
ATOM   228  O OH  . TYR A 1 61  ? 12.103  9.492  63.912  1.00 28.72  ? 57  TYR A OH  1 
ATOM   229  N N   . ASP A 1 62  ? 6.608   9.901  57.526  1.00 34.36  ? 58  ASP A N   1 
ATOM   230  C CA  . ASP A 1 62  ? 5.193   10.216 57.332  1.00 36.07  ? 58  ASP A CA  1 
ATOM   231  C C   . ASP A 1 62  ? 4.636   11.264 58.262  1.00 37.28  ? 58  ASP A C   1 
ATOM   232  O O   . ASP A 1 62  ? 5.230   11.542 59.327  1.00 34.99  ? 58  ASP A O   1 
ATOM   233  C CB  . ASP A 1 62  ? 4.405   9.000  57.822  1.00 36.94  ? 58  ASP A CB  1 
ATOM   234  C CG  . ASP A 1 62  ? 3.774   8.307  56.767  1.00 38.65  ? 58  ASP A CG  1 
ATOM   235  O OD1 . ASP A 1 62  ? 4.002   8.732  55.652  1.00 46.55  ? 58  ASP A OD1 1 
ATOM   236  O OD2 . ASP A 1 62  ? 3.073   7.337  57.033  1.00 41.77  ? 58  ASP A OD2 1 
ATOM   237  N N   . GLU A 1 63  ? 3.428   11.734 57.879  1.00 38.39  ? 59  GLU A N   1 
ATOM   238  C CA  . GLU A 1 63  ? 2.415   12.304 58.791  1.00 39.70  ? 59  GLU A CA  1 
ATOM   239  C C   . GLU A 1 63  ? 2.000   11.402 59.972  1.00 39.39  ? 59  GLU A C   1 
ATOM   240  O O   . GLU A 1 63  ? 1.700   11.904 61.041  1.00 40.66  ? 59  GLU A O   1 
ATOM   241  C CB  . GLU A 1 63  ? 1.138   12.657 58.001  1.00 40.06  ? 59  GLU A CB  1 
ATOM   242  C CG  . GLU A 1 63  ? 1.247   14.022 57.307  1.00 42.89  ? 59  GLU A CG  1 
ATOM   243  C CD  . GLU A 1 63  ? 0.160   14.249 56.270  1.00 42.89  ? 59  GLU A CD  1 
ATOM   244  O OE1 . GLU A 1 63  ? -0.030  13.371 55.388  1.00 42.86  ? 59  GLU A OE1 1 
ATOM   245  O OE2 . GLU A 1 63  ? -0.492  15.312 56.369  1.00 45.15  ? 59  GLU A OE2 1 
ATOM   246  N N   . ASN A 1 64  ? 1.903   10.094 59.757  1.00 38.73  ? 60  ASN A N   1 
ATOM   247  C CA  . ASN A 1 64  ? 1.683   9.124  60.843  1.00 38.15  ? 60  ASN A CA  1 
ATOM   248  C C   . ASN A 1 64  ? 2.964   8.630  61.559  1.00 36.87  ? 60  ASN A C   1 
ATOM   249  O O   . ASN A 1 64  ? 2.910   7.685  62.312  1.00 36.31  ? 60  ASN A O   1 
ATOM   250  C CB  . ASN A 1 64  ? 0.955   7.903  60.295  1.00 38.29  ? 60  ASN A CB  1 
ATOM   251  C CG  . ASN A 1 64  ? -0.289  8.264  59.551  1.00 41.20  ? 60  ASN A CG  1 
ATOM   252  O OD1 . ASN A 1 64  ? -1.145  8.952  60.083  1.00 44.59  ? 60  ASN A OD1 1 
ATOM   253  N ND2 . ASN A 1 64  ? -0.396  7.817  58.297  1.00 44.62  ? 60  ASN A ND2 1 
ATOM   254  N N   . MET A 1 65  ? 4.105   9.250  61.300  1.00 36.38  ? 61  MET A N   1 
ATOM   255  C CA  . MET A 1 65  ? 5.396   8.841  61.872  1.00 36.30  ? 61  MET A CA  1 
ATOM   256  C C   . MET A 1 65  ? 5.848   7.444  61.448  1.00 35.39  ? 61  MET A C   1 
ATOM   257  O O   . MET A 1 65  ? 6.659   6.843  62.136  1.00 35.43  ? 61  MET A O   1 
ATOM   258  C CB  . MET A 1 65  ? 5.402   8.934  63.428  1.00 36.27  ? 61  MET A CB  1 
ATOM   259  C CG  . MET A 1 65  ? 5.156   10.314 64.007  1.00 35.45  ? 61  MET A CG  1 
ATOM   260  S SD  . MET A 1 65  ? 6.280   11.524 63.374  1.00 34.79  ? 61  MET A SD  1 
ATOM   261  C CE  . MET A 1 65  ? 7.791   11.194 64.275  1.00 32.75  ? 61  MET A CE  1 
ATOM   262  N N   . ASN A 1 66  ? 5.301   6.911  60.361  1.00 35.06  ? 62  ASN A N   1 
ATOM   263  C CA  . ASN A 1 66  ? 5.875   5.724  59.722  1.00 34.97  ? 62  ASN A CA  1 
ATOM   264  C C   . ASN A 1 66  ? 7.124   6.175  58.992  1.00 34.23  ? 62  ASN A C   1 
ATOM   265  O O   . ASN A 1 66  ? 7.214   7.316  58.553  1.00 35.63  ? 62  ASN A O   1 
ATOM   266  C CB  . ASN A 1 66  ? 4.942   5.066  58.721  1.00 35.11  ? 62  ASN A CB  1 
ATOM   267  C CG  . ASN A 1 66  ? 3.598   4.732  59.307  1.00 37.11  ? 62  ASN A CG  1 
ATOM   268  O OD1 . ASN A 1 66  ? 3.492   3.926  60.232  1.00 37.75  ? 62  ASN A OD1 1 
ATOM   269  N ND2 . ASN A 1 66  ? 2.550   5.363  58.773  1.00 37.25  ? 62  ASN A ND2 1 
ATOM   270  N N   . THR A 1 67  ? 8.098   5.289  58.885  1.00 33.35  ? 63  THR A N   1 
ATOM   271  C CA  . THR A 1 67  ? 9.386   5.661  58.344  1.00 32.45  ? 63  THR A CA  1 
ATOM   272  C C   . THR A 1 67  ? 9.430   5.185  56.919  1.00 31.50  ? 63  THR A C   1 
ATOM   273  O O   . THR A 1 67  ? 9.220   4.016  56.666  1.00 31.33  ? 63  THR A O   1 
ATOM   274  C CB  . THR A 1 67  ? 10.547  5.081  59.204  1.00 32.18  ? 63  THR A CB  1 
ATOM   275  O OG1 . THR A 1 67  ? 10.680  5.876  60.388  1.00 30.42  ? 63  THR A OG1 1 
ATOM   276  C CG2 . THR A 1 67  ? 11.876  5.093  58.444  1.00 31.83  ? 63  THR A CG2 1 
ATOM   277  N N   . ILE A 1 68  ? 9.719   6.110  56.004  1.00 31.50  ? 64  ILE A N   1 
ATOM   278  C CA  . ILE A 1 68  ? 9.668   5.871  54.545  1.00 31.79  ? 64  ILE A CA  1 
ATOM   279  C C   . ILE A 1 68  ? 10.933  6.416  53.860  1.00 31.65  ? 64  ILE A C   1 
ATOM   280  O O   . ILE A 1 68  ? 11.791  7.024  54.511  1.00 30.41  ? 64  ILE A O   1 
ATOM   281  C CB  . ILE A 1 68  ? 8.406   6.553  53.924  1.00 31.41  ? 64  ILE A CB  1 
ATOM   282  C CG1 . ILE A 1 68  ? 8.318   8.018  54.371  1.00 32.51  ? 64  ILE A CG1 1 
ATOM   283  C CG2 . ILE A 1 68  ? 7.164   5.796  54.333  1.00 31.80  ? 64  ILE A CG2 1 
ATOM   284  C CD1 . ILE A 1 68  ? 7.218   8.821  53.668  1.00 33.59  ? 64  ILE A CD1 1 
ATOM   285  N N   . ARG A 1 69  ? 11.051  6.177  52.545  1.00 31.56  ? 65  ARG A N   1 
ATOM   286  C CA  . ARG A 1 69  ? 12.139  6.746  51.768  1.00 31.28  ? 65  ARG A CA  1 
ATOM   287  C C   . ARG A 1 69  ? 11.712  8.142  51.302  1.00 30.00  ? 65  ARG A C   1 
ATOM   288  O O   . ARG A 1 69  ? 10.591  8.319  50.823  1.00 29.56  ? 65  ARG A O   1 
ATOM   289  C CB  . ARG A 1 69  ? 12.498  5.883  50.539  1.00 31.81  ? 65  ARG A CB  1 
ATOM   290  C CG  . ARG A 1 69  ? 12.832  4.372  50.781  1.00 34.65  ? 65  ARG A CG  1 
ATOM   291  C CD  . ARG A 1 69  ? 13.929  4.156  51.823  1.00 36.71  ? 65  ARG A CD  1 
ATOM   292  N NE  . ARG A 1 69  ? 15.247  4.736  51.480  1.00 36.97  ? 65  ARG A NE  1 
ATOM   293  C CZ  . ARG A 1 69  ? 16.157  5.071  52.403  1.00 38.80  ? 65  ARG A CZ  1 
ATOM   294  N NH1 . ARG A 1 69  ? 15.914  4.889  53.690  1.00 41.52  ? 65  ARG A NH1 1 
ATOM   295  N NH2 . ARG A 1 69  ? 17.319  5.575  52.065  1.00 38.81  ? 65  ARG A NH2 1 
ATOM   296  N N   . THR A 1 70  ? 12.625  9.096  51.417  1.00 28.21  ? 66  THR A N   1 
ATOM   297  C CA  . THR A 1 70  ? 12.393  10.428 51.013  1.00 28.64  ? 66  THR A CA  1 
ATOM   298  C C   . THR A 1 70  ? 13.656  10.957 50.312  1.00 29.24  ? 66  THR A C   1 
ATOM   299  O O   . THR A 1 70  ? 14.681  10.307 50.357  1.00 27.85  ? 66  THR A O   1 
ATOM   300  C CB  . THR A 1 70  ? 12.135  11.351 52.235  1.00 28.26  ? 66  THR A CB  1 
ATOM   301  O OG1 . THR A 1 70  ? 13.337  11.451 52.961  1.00 28.12  ? 66  THR A OG1 1 
ATOM   302  C CG2 . THR A 1 70  ? 11.042  10.836 53.149  1.00 26.64  ? 66  THR A CG2 1 
ATOM   303  N N   . TYR A 1 71  ? 13.555  12.152 49.701  1.00 28.94  ? 67  TYR A N   1 
ATOM   304  C CA  . TYR A 1 71  ? 14.689  12.860 49.121  1.00 28.79  ? 67  TYR A CA  1 
ATOM   305  C C   . TYR A 1 71  ? 14.782  14.222 49.726  1.00 29.06  ? 67  TYR A C   1 
ATOM   306  O O   . TYR A 1 71  ? 13.812  14.892 49.869  1.00 30.07  ? 67  TYR A O   1 
ATOM   307  C CB  . TYR A 1 71  ? 14.604  12.965 47.585  1.00 29.13  ? 67  TYR A CB  1 
ATOM   308  C CG  . TYR A 1 71  ? 14.999  11.670 46.884  1.00 27.97  ? 67  TYR A CG  1 
ATOM   309  C CD1 . TYR A 1 71  ? 16.340  11.388 46.586  1.00 28.43  ? 67  TYR A CD1 1 
ATOM   310  C CD2 . TYR A 1 71  ? 14.053  10.726 46.573  1.00 27.67  ? 67  TYR A CD2 1 
ATOM   311  C CE1 . TYR A 1 71  ? 16.713  10.209 45.952  1.00 27.58  ? 67  TYR A CE1 1 
ATOM   312  C CE2 . TYR A 1 71  ? 14.408  9.520  45.983  1.00 30.92  ? 67  TYR A CE2 1 
ATOM   313  C CZ  . TYR A 1 71  ? 15.748  9.265  45.693  1.00 29.85  ? 67  TYR A CZ  1 
ATOM   314  O OH  . TYR A 1 71  ? 16.086  8.091  45.090  1.00 30.94  ? 67  TYR A OH  1 
ATOM   315  N N   . GLN A 1 72  ? 15.993  14.622 50.056  1.00 30.10  ? 68  GLN A N   1 
ATOM   316  C CA  . GLN A 1 72  ? 16.275  15.812 50.790  1.00 30.97  ? 68  GLN A CA  1 
ATOM   317  C C   . GLN A 1 72  ? 17.384  16.548 50.057  1.00 30.23  ? 68  GLN A C   1 
ATOM   318  O O   . GLN A 1 72  ? 18.285  15.922 49.435  1.00 31.25  ? 68  GLN A O   1 
ATOM   319  C CB  . GLN A 1 72  ? 16.733  15.347 52.173  1.00 31.55  ? 68  GLN A CB  1 
ATOM   320  C CG  . GLN A 1 72  ? 16.684  16.333 53.263  1.00 33.07  ? 68  GLN A CG  1 
ATOM   321  C CD  . GLN A 1 72  ? 17.041  15.680 54.624  1.00 33.94  ? 68  GLN A CD  1 
ATOM   322  O OE1 . GLN A 1 72  ? 18.171  15.827 55.094  1.00 39.21  ? 68  GLN A OE1 1 
ATOM   323  N NE2 . GLN A 1 72  ? 16.098  14.950 55.231  1.00 32.02  ? 68  GLN A NE2 1 
ATOM   324  N N   . VAL A 1 73  ? 17.319  17.862 50.111  1.00 28.80  ? 69  VAL A N   1 
ATOM   325  C CA  . VAL A 1 73  ? 18.319  18.720 49.553  1.00 28.26  ? 69  VAL A CA  1 
ATOM   326  C C   . VAL A 1 73  ? 18.359  19.961 50.443  1.00 29.04  ? 69  VAL A C   1 
ATOM   327  O O   . VAL A 1 73  ? 17.302  20.452 50.858  1.00 29.00  ? 69  VAL A O   1 
ATOM   328  C CB  . VAL A 1 73  ? 17.986  19.114 48.085  1.00 28.29  ? 69  VAL A CB  1 
ATOM   329  C CG1 . VAL A 1 73  ? 16.797  20.081 47.991  1.00 26.45  ? 69  VAL A CG1 1 
ATOM   330  C CG2 . VAL A 1 73  ? 19.187  19.709 47.411  1.00 28.39  ? 69  VAL A CG2 1 
ATOM   331  N N   . CYS A 1 74  ? 19.559  20.455 50.754  1.00 29.04  ? 70  CYS A N   1 
ATOM   332  C CA  . CYS A 1 74  ? 19.690  21.632 51.558  1.00 29.11  ? 70  CYS A CA  1 
ATOM   333  C C   . CYS A 1 74  ? 21.023  22.311 51.375  1.00 29.13  ? 70  CYS A C   1 
ATOM   334  O O   . CYS A 1 74  ? 21.780  22.512 52.336  1.00 30.40  ? 70  CYS A O   1 
ATOM   335  C CB  . CYS A 1 74  ? 19.457  21.305 53.050  1.00 29.37  ? 70  CYS A CB  1 
ATOM   336  S SG  . CYS A 1 74  ? 19.465  22.829 54.102  1.00 29.54  ? 70  CYS A SG  1 
ATOM   337  N N   . ASN A 1 75  ? 21.316  22.721 50.155  1.00 29.30  ? 71  ASN A N   1 
ATOM   338  C CA  . ASN A 1 75  ? 22.646  23.267 49.860  1.00 29.54  ? 71  ASN A CA  1 
ATOM   339  C C   . ASN A 1 75  ? 22.574  24.776 49.963  1.00 29.22  ? 71  ASN A C   1 
ATOM   340  O O   . ASN A 1 75  ? 22.979  25.487 49.069  1.00 28.93  ? 71  ASN A O   1 
ATOM   341  C CB  . ASN A 1 75  ? 23.190  22.812 48.482  1.00 29.43  ? 71  ASN A CB  1 
ATOM   342  C CG  . ASN A 1 75  ? 23.390  21.295 48.377  1.00 30.49  ? 71  ASN A CG  1 
ATOM   343  O OD1 . ASN A 1 75  ? 23.273  20.573 49.352  1.00 31.19  ? 71  ASN A OD1 1 
ATOM   344  N ND2 . ASN A 1 75  ? 23.621  20.801 47.149  1.00 32.04  ? 71  ASN A ND2 1 
ATOM   345  N N   . VAL A 1 76  ? 22.114  25.253 51.111  1.00 29.51  ? 72  VAL A N   1 
ATOM   346  C CA  . VAL A 1 76  ? 21.895  26.673 51.313  1.00 29.90  ? 72  VAL A CA  1 
ATOM   347  C C   . VAL A 1 76  ? 23.179  27.486 51.459  1.00 30.74  ? 72  VAL A C   1 
ATOM   348  O O   . VAL A 1 76  ? 23.164  28.700 51.373  1.00 31.27  ? 72  VAL A O   1 
ATOM   349  C CB  . VAL A 1 76  ? 20.918  26.939 52.494  1.00 29.99  ? 72  VAL A CB  1 
ATOM   350  C CG1 . VAL A 1 76  ? 19.544  26.421 52.135  1.00 28.36  ? 72  VAL A CG1 1 
ATOM   351  C CG2 . VAL A 1 76  ? 21.431  26.316 53.838  1.00 30.29  ? 72  VAL A CG2 1 
ATOM   352  N N   . PHE A 1 77  ? 24.303  26.823 51.643  1.00 32.40  ? 73  PHE A N   1 
ATOM   353  C CA  . PHE A 1 77  ? 25.581  27.534 51.776  1.00 33.95  ? 73  PHE A CA  1 
ATOM   354  C C   . PHE A 1 77  ? 26.442  27.591 50.473  1.00 35.17  ? 73  PHE A C   1 
ATOM   355  O O   . PHE A 1 77  ? 27.583  28.078 50.492  1.00 35.43  ? 73  PHE A O   1 
ATOM   356  C CB  . PHE A 1 77  ? 26.322  26.988 52.978  1.00 32.31  ? 73  PHE A CB  1 
ATOM   357  C CG  . PHE A 1 77  ? 25.657  27.334 54.285  1.00 30.10  ? 73  PHE A CG  1 
ATOM   358  C CD1 . PHE A 1 77  ? 25.670  28.624 54.752  1.00 28.46  ? 73  PHE A CD1 1 
ATOM   359  C CD2 . PHE A 1 77  ? 25.005  26.381 55.024  1.00 28.97  ? 73  PHE A CD2 1 
ATOM   360  C CE1 . PHE A 1 77  ? 25.052  28.947 55.981  1.00 30.11  ? 73  PHE A CE1 1 
ATOM   361  C CE2 . PHE A 1 77  ? 24.383  26.697 56.251  1.00 31.27  ? 73  PHE A CE2 1 
ATOM   362  C CZ  . PHE A 1 77  ? 24.416  27.979 56.716  1.00 29.38  ? 73  PHE A CZ  1 
ATOM   363  N N   . GLU A 1 78  ? 25.814  27.212 49.351  1.00 36.75  ? 74  GLU A N   1 
ATOM   364  C CA  . GLU A 1 78  ? 26.444  27.076 48.020  1.00 38.17  ? 74  GLU A CA  1 
ATOM   365  C C   . GLU A 1 78  ? 25.706  27.898 46.987  1.00 39.80  ? 74  GLU A C   1 
ATOM   366  O O   . GLU A 1 78  ? 24.465  27.838 46.910  1.00 41.86  ? 74  GLU A O   1 
ATOM   367  C CB  . GLU A 1 78  ? 26.387  25.611 47.584  1.00 39.08  ? 74  GLU A CB  1 
ATOM   368  C CG  . GLU A 1 78  ? 27.505  24.745 48.154  1.00 41.39  ? 74  GLU A CG  1 
ATOM   369  C CD  . GLU A 1 78  ? 28.678  24.676 47.182  1.00 46.67  ? 74  GLU A CD  1 
ATOM   370  O OE1 . GLU A 1 78  ? 28.970  25.737 46.544  1.00 47.45  ? 74  GLU A OE1 1 
ATOM   371  O OE2 . GLU A 1 78  ? 29.282  23.573 47.043  1.00 46.86  ? 74  GLU A OE2 1 
ATOM   372  N N   . SER A 1 79  ? 26.453  28.676 46.209  1.00 40.39  ? 75  SER A N   1 
ATOM   373  C CA  . SER A 1 79  ? 25.918  29.396 45.067  1.00 40.93  ? 75  SER A CA  1 
ATOM   374  C C   . SER A 1 79  ? 25.615  28.470 43.854  1.00 41.03  ? 75  SER A C   1 
ATOM   375  O O   . SER A 1 79  ? 26.121  27.349 43.741  1.00 41.14  ? 75  SER A O   1 
ATOM   376  C CB  . SER A 1 79  ? 26.952  30.412 44.646  1.00 41.40  ? 75  SER A CB  1 
ATOM   377  O OG  . SER A 1 79  ? 28.146  29.701 44.331  1.00 42.52  ? 75  SER A OG  1 
ATOM   378  N N   . SER A 1 80  ? 24.787  28.968 42.949  1.00 41.04  ? 76  SER A N   1 
ATOM   379  C CA  . SER A 1 80  ? 24.552  28.347 41.649  1.00 41.03  ? 76  SER A CA  1 
ATOM   380  C C   . SER A 1 80  ? 23.886  26.999 41.770  1.00 40.28  ? 76  SER A C   1 
ATOM   381  O O   . SER A 1 80  ? 24.229  26.060 41.025  1.00 41.47  ? 76  SER A O   1 
ATOM   382  C CB  . SER A 1 80  ? 25.875  28.233 40.850  1.00 41.54  ? 76  SER A CB  1 
ATOM   383  O OG  . SER A 1 80  ? 26.469  29.530 40.690  1.00 44.30  ? 76  SER A OG  1 
ATOM   384  N N   . GLN A 1 81  ? 22.920  26.874 42.676  1.00 38.51  ? 77  GLN A N   1 
ATOM   385  C CA  . GLN A 1 81  ? 22.319  25.562 42.905  1.00 37.00  ? 77  GLN A CA  1 
ATOM   386  C C   . GLN A 1 81  ? 21.267  25.285 41.839  1.00 36.55  ? 77  GLN A C   1 
ATOM   387  O O   . GLN A 1 81  ? 20.388  26.110 41.594  1.00 35.85  ? 77  GLN A O   1 
ATOM   388  C CB  . GLN A 1 81  ? 21.722  25.451 44.306  1.00 36.61  ? 77  GLN A CB  1 
ATOM   389  C CG  . GLN A 1 81  ? 22.767  25.259 45.417  1.00 35.17  ? 77  GLN A CG  1 
ATOM   390  C CD  . GLN A 1 81  ? 23.710  24.077 45.170  1.00 34.91  ? 77  GLN A CD  1 
ATOM   391  O OE1 . GLN A 1 81  ? 23.305  22.901 45.220  1.00 34.07  ? 77  GLN A OE1 1 
ATOM   392  N NE2 . GLN A 1 81  ? 24.980  24.392 44.893  1.00 32.41  ? 77  GLN A NE2 1 
ATOM   393  N N   . ASN A 1 82  ? 21.400  24.142 41.177  1.00 35.44  ? 78  ASN A N   1 
ATOM   394  C CA  . ASN A 1 82  ? 20.382  23.678 40.237  1.00 34.80  ? 78  ASN A CA  1 
ATOM   395  C C   . ASN A 1 82  ? 20.277  22.157 40.289  1.00 33.25  ? 78  ASN A C   1 
ATOM   396  O O   . ASN A 1 82  ? 20.803  21.505 39.420  1.00 33.28  ? 78  ASN A O   1 
ATOM   397  C CB  . ASN A 1 82  ? 20.738  24.144 38.812  1.00 35.16  ? 78  ASN A CB  1 
ATOM   398  C CG  . ASN A 1 82  ? 19.643  23.869 37.809  1.00 34.75  ? 78  ASN A CG  1 
ATOM   399  O OD1 . ASN A 1 82  ? 18.686  23.138 38.066  1.00 30.35  ? 78  ASN A OD1 1 
ATOM   400  N ND2 . ASN A 1 82  ? 19.792  24.462 36.637  1.00 39.49  ? 78  ASN A ND2 1 
ATOM   401  N N   . ASN A 1 83  ? 19.543  21.633 41.270  1.00 31.93  ? 79  ASN A N   1 
ATOM   402  C CA  . ASN A 1 83  ? 19.595  20.240 41.642  1.00 32.24  ? 79  ASN A CA  1 
ATOM   403  C C   . ASN A 1 83  ? 18.337  19.494 41.223  1.00 31.57  ? 79  ASN A C   1 
ATOM   404  O O   . ASN A 1 83  ? 17.226  19.812 41.666  1.00 30.76  ? 79  ASN A O   1 
ATOM   405  C CB  . ASN A 1 83  ? 19.827  20.100 43.195  1.00 32.95  ? 79  ASN A CB  1 
ATOM   406  C CG  . ASN A 1 83  ? 21.060  20.872 43.681  1.00 32.74  ? 79  ASN A CG  1 
ATOM   407  O OD1 . ASN A 1 83  ? 22.177  20.508 43.370  1.00 35.64  ? 79  ASN A OD1 1 
ATOM   408  N ND2 . ASN A 1 83  ? 20.857  21.944 44.419  1.00 33.99  ? 79  ASN A ND2 1 
ATOM   409  N N   . TRP A 1 84  ? 18.526  18.475 40.379  1.00 30.96  ? 80  TRP A N   1 
ATOM   410  C CA  . TRP A 1 84  ? 17.427  17.710 39.824  1.00 29.90  ? 80  TRP A CA  1 
ATOM   411  C C   . TRP A 1 84  ? 17.332  16.334 40.422  1.00 29.54  ? 80  TRP A C   1 
ATOM   412  O O   . TRP A 1 84  ? 18.320  15.743 40.788  1.00 30.68  ? 80  TRP A O   1 
ATOM   413  C CB  . TRP A 1 84  ? 17.561  17.586 38.305  1.00 28.90  ? 80  TRP A CB  1 
ATOM   414  C CG  . TRP A 1 84  ? 17.237  18.855 37.558  1.00 27.90  ? 80  TRP A CG  1 
ATOM   415  C CD1 . TRP A 1 84  ? 17.929  20.023 37.580  1.00 27.09  ? 80  TRP A CD1 1 
ATOM   416  C CD2 . TRP A 1 84  ? 16.151  19.044 36.635  1.00 26.88  ? 80  TRP A CD2 1 
ATOM   417  N NE1 . TRP A 1 84  ? 17.332  20.947 36.730  1.00 28.27  ? 80  TRP A NE1 1 
ATOM   418  C CE2 . TRP A 1 84  ? 16.227  20.363 36.157  1.00 27.48  ? 80  TRP A CE2 1 
ATOM   419  C CE3 . TRP A 1 84  ? 15.108  18.227 36.185  1.00 27.49  ? 80  TRP A CE3 1 
ATOM   420  C CZ2 . TRP A 1 84  ? 15.299  20.882 35.234  1.00 29.10  ? 80  TRP A CZ2 1 
ATOM   421  C CZ3 . TRP A 1 84  ? 14.162  18.757 35.273  1.00 27.92  ? 80  TRP A CZ3 1 
ATOM   422  C CH2 . TRP A 1 84  ? 14.271  20.068 34.817  1.00 27.66  ? 80  TRP A CH2 1 
ATOM   423  N N   . LEU A 1 85  ? 16.109  15.846 40.476  1.00 29.45  ? 81  LEU A N   1 
ATOM   424  C CA  . LEU A 1 85  ? 15.725  14.538 40.951  1.00 29.18  ? 81  LEU A CA  1 
ATOM   425  C C   . LEU A 1 85  ? 14.666  14.040 39.993  1.00 29.43  ? 81  LEU A C   1 
ATOM   426  O O   . LEU A 1 85  ? 13.743  14.811 39.631  1.00 29.70  ? 81  LEU A O   1 
ATOM   427  C CB  . LEU A 1 85  ? 15.058  14.692 42.325  1.00 29.43  ? 81  LEU A CB  1 
ATOM   428  C CG  . LEU A 1 85  ? 14.330  13.483 42.922  1.00 27.76  ? 81  LEU A CG  1 
ATOM   429  C CD1 . LEU A 1 85  ? 15.384  12.452 43.279  1.00 29.72  ? 81  LEU A CD1 1 
ATOM   430  C CD2 . LEU A 1 85  ? 13.528  13.882 44.173  1.00 28.84  ? 81  LEU A CD2 1 
ATOM   431  N N   . ARG A 1 86  ? 14.733  12.774 39.629  1.00 29.64  ? 82  ARG A N   1 
ATOM   432  C CA  . ARG A 1 86  ? 13.848  12.230 38.614  1.00 30.46  ? 82  ARG A CA  1 
ATOM   433  C C   . ARG A 1 86  ? 13.397  10.845 39.025  1.00 31.23  ? 82  ARG A C   1 
ATOM   434  O O   . ARG A 1 86  ? 14.236  10.002 39.318  1.00 31.57  ? 82  ARG A O   1 
ATOM   435  C CB  . ARG A 1 86  ? 14.627  12.119 37.292  1.00 31.01  ? 82  ARG A CB  1 
ATOM   436  C CG  . ARG A 1 86  ? 13.847  11.590 36.097  1.00 31.08  ? 82  ARG A CG  1 
ATOM   437  C CD  . ARG A 1 86  ? 14.744  11.556 34.869  1.00 32.20  ? 82  ARG A CD  1 
ATOM   438  N NE  . ARG A 1 86  ? 15.638  10.386 34.903  1.00 33.94  ? 82  ARG A NE  1 
ATOM   439  C CZ  . ARG A 1 86  ? 16.797  10.293 34.235  1.00 36.17  ? 82  ARG A CZ  1 
ATOM   440  N NH1 . ARG A 1 86  ? 17.234  11.291 33.470  1.00 36.15  ? 82  ARG A NH1 1 
ATOM   441  N NH2 . ARG A 1 86  ? 17.514  9.175  34.315  1.00 34.58  ? 82  ARG A NH2 1 
ATOM   442  N N   . THR A 1 87  ? 12.086  10.608 38.984  1.00 31.72  ? 83  THR A N   1 
ATOM   443  C CA  . THR A 1 87  ? 11.496  9.344  39.281  1.00 32.52  ? 83  THR A CA  1 
ATOM   444  C C   . THR A 1 87  ? 11.890  8.270  38.296  1.00 34.00  ? 83  THR A C   1 
ATOM   445  O O   . THR A 1 87  ? 12.498  8.525  37.269  1.00 33.83  ? 83  THR A O   1 
ATOM   446  C CB  . THR A 1 87  ? 9.955   9.414  39.186  1.00 33.32  ? 83  THR A CB  1 
ATOM   447  O OG1 . THR A 1 87  ? 9.547   9.513  37.805  1.00 33.23  ? 83  THR A OG1 1 
ATOM   448  C CG2 . THR A 1 87  ? 9.385   10.575 40.016  1.00 32.72  ? 83  THR A CG2 1 
ATOM   449  N N   . LYS A 1 88  ? 11.490  7.047  38.592  1.00 35.61  ? 84  LYS A N   1 
ATOM   450  C CA  . LYS A 1 88  ? 11.612  5.996  37.607  1.00 36.75  ? 84  LYS A CA  1 
ATOM   451  C C   . LYS A 1 88  ? 10.458  6.148  36.579  1.00 37.36  ? 84  LYS A C   1 
ATOM   452  O O   . LYS A 1 88  ? 9.504   6.908  36.773  1.00 37.94  ? 84  LYS A O   1 
ATOM   453  C CB  . LYS A 1 88  ? 11.662  4.629  38.289  1.00 36.84  ? 84  LYS A CB  1 
ATOM   454  C CG  . LYS A 1 88  ? 13.123  4.233  38.606  1.00 40.62  ? 84  LYS A CG  1 
ATOM   455  C CD  . LYS A 1 88  ? 13.274  3.416  39.870  1.00 43.43  ? 84  LYS A CD  1 
ATOM   456  C CE  . LYS A 1 88  ? 13.387  1.903  39.646  1.00 44.45  ? 84  LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 88  ? 13.953  1.231  40.888  1.00 44.65  ? 84  LYS A NZ  1 
ATOM   458  N N   . PHE A 1 89  ? 10.592  5.463  35.467  1.00 37.51  ? 85  PHE A N   1 
ATOM   459  C CA  . PHE A 1 89  ? 9.591   5.483  34.422  1.00 37.73  ? 85  PHE A CA  1 
ATOM   460  C C   . PHE A 1 89  ? 8.290   4.998  35.019  1.00 36.84  ? 85  PHE A C   1 
ATOM   461  O O   . PHE A 1 89  ? 8.270   3.986  35.666  1.00 36.98  ? 85  PHE A O   1 
ATOM   462  C CB  . PHE A 1 89  ? 10.080  4.537  33.327  1.00 38.18  ? 85  PHE A CB  1 
ATOM   463  C CG  . PHE A 1 89  ? 9.190   4.439  32.118  1.00 38.40  ? 85  PHE A CG  1 
ATOM   464  C CD1 . PHE A 1 89  ? 9.165   5.449  31.178  1.00 38.47  ? 85  PHE A CD1 1 
ATOM   465  C CD2 . PHE A 1 89  ? 8.465   3.290  31.884  1.00 38.09  ? 85  PHE A CD2 1 
ATOM   466  C CE1 . PHE A 1 89  ? 8.406   5.334  30.055  1.00 38.54  ? 85  PHE A CE1 1 
ATOM   467  C CE2 . PHE A 1 89  ? 7.716   3.154  30.744  1.00 40.50  ? 85  PHE A CE2 1 
ATOM   468  C CZ  . PHE A 1 89  ? 7.678   4.192  29.833  1.00 39.76  ? 85  PHE A CZ  1 
ATOM   469  N N   . ILE A 1 90  ? 7.218   5.743  34.810  1.00 36.80  ? 86  ILE A N   1 
ATOM   470  C CA  . ILE A 1 90  ? 5.883   5.396  35.302  1.00 36.74  ? 86  ILE A CA  1 
ATOM   471  C C   . ILE A 1 90  ? 5.029   5.081  34.075  1.00 37.53  ? 86  ILE A C   1 
ATOM   472  O O   . ILE A 1 90  ? 4.946   5.926  33.185  1.00 37.62  ? 86  ILE A O   1 
ATOM   473  C CB  . ILE A 1 90  ? 5.247   6.600  36.043  1.00 36.06  ? 86  ILE A CB  1 
ATOM   474  C CG1 . ILE A 1 90  ? 6.139   7.064  37.186  1.00 35.95  ? 86  ILE A CG1 1 
ATOM   475  C CG2 . ILE A 1 90  ? 3.907   6.239  36.549  1.00 35.84  ? 86  ILE A CG2 1 
ATOM   476  C CD1 . ILE A 1 90  ? 5.927   8.456  37.644  1.00 36.67  ? 86  ILE A CD1 1 
ATOM   477  N N   . ARG A 1 91  ? 4.408   3.900  34.018  1.00 38.05  ? 87  ARG A N   1 
ATOM   478  C CA  . ARG A 1 91  ? 3.530   3.551  32.900  1.00 39.49  ? 87  ARG A CA  1 
ATOM   479  C C   . ARG A 1 91  ? 2.220   4.325  32.997  1.00 40.14  ? 87  ARG A C   1 
ATOM   480  O O   . ARG A 1 91  ? 1.783   4.673  34.088  1.00 40.91  ? 87  ARG A O   1 
ATOM   481  C CB  . ARG A 1 91  ? 3.262   2.036  32.821  1.00 39.31  ? 87  ARG A CB  1 
ATOM   482  C CG  . ARG A 1 91  ? 4.475   1.193  32.410  1.00 40.91  ? 87  ARG A CG  1 
ATOM   483  C CD  . ARG A 1 91  ? 4.091   -0.286 32.168  1.00 40.61  ? 87  ARG A CD  1 
ATOM   484  N N   . ARG A 1 92  ? 1.598   4.592  31.849  1.00 41.04  ? 88  ARG A N   1 
ATOM   485  C CA  . ARG A 1 92  ? 0.380   5.416  31.773  1.00 41.67  ? 88  ARG A CA  1 
ATOM   486  C C   . ARG A 1 92  ? -0.898  4.600  32.065  1.00 42.30  ? 88  ARG A C   1 
ATOM   487  O O   . ARG A 1 92  ? -1.871  5.116  32.629  1.00 42.10  ? 88  ARG A O   1 
ATOM   488  C CB  . ARG A 1 92  ? 0.317   6.057  30.388  1.00 41.07  ? 88  ARG A CB  1 
ATOM   489  C CG  . ARG A 1 92  ? -0.752  7.135  30.190  1.00 41.37  ? 88  ARG A CG  1 
ATOM   490  C CD  . ARG A 1 92  ? -0.628  7.752  28.787  1.00 41.24  ? 88  ARG A CD  1 
ATOM   491  N NE  . ARG A 1 92  ? -0.727  6.756  27.725  1.00 40.78  ? 88  ARG A NE  1 
ATOM   492  C CZ  . ARG A 1 92  ? -1.869  6.299  27.208  1.00 43.12  ? 88  ARG A CZ  1 
ATOM   493  N NH1 . ARG A 1 92  ? -3.044  6.746  27.644  1.00 42.71  ? 88  ARG A NH1 1 
ATOM   494  N NH2 . ARG A 1 92  ? -1.842  5.370  26.252  1.00 42.81  ? 88  ARG A NH2 1 
ATOM   495  N N   . ARG A 1 93  ? -0.882  3.333  31.663  1.00 43.28  ? 89  ARG A N   1 
ATOM   496  C CA  . ARG A 1 93  ? -1.996  2.383  31.883  1.00 44.07  ? 89  ARG A CA  1 
ATOM   497  C C   . ARG A 1 93  ? -3.348  2.956  31.502  1.00 44.78  ? 89  ARG A C   1 
ATOM   498  O O   . ARG A 1 93  ? -4.309  2.878  32.282  1.00 45.36  ? 89  ARG A O   1 
ATOM   499  C CB  . ARG A 1 93  ? -2.021  1.907  33.344  1.00 44.43  ? 89  ARG A CB  1 
ATOM   500  C CG  . ARG A 1 93  ? -0.835  1.049  33.775  1.00 44.68  ? 89  ARG A CG  1 
ATOM   501  C CD  . ARG A 1 93  ? -0.775  0.932  35.304  1.00 45.18  ? 89  ARG A CD  1 
ATOM   502  N N   . GLY A 1 94  ? -3.426  3.567  30.320  1.00 45.21  ? 90  GLY A N   1 
ATOM   503  C CA  . GLY A 1 94  ? -4.710  4.100  29.820  1.00 45.26  ? 90  GLY A CA  1 
ATOM   504  C C   . GLY A 1 94  ? -5.107  5.518  30.241  1.00 45.66  ? 90  GLY A C   1 
ATOM   505  O O   . GLY A 1 94  ? -5.993  6.097  29.624  1.00 46.84  ? 90  GLY A O   1 
ATOM   506  N N   . ALA A 1 95  ? -4.482  6.068  31.285  1.00 45.15  ? 91  ALA A N   1 
ATOM   507  C CA  . ALA A 1 95  ? -4.736  7.436  31.758  1.00 44.59  ? 91  ALA A CA  1 
ATOM   508  C C   . ALA A 1 95  ? -4.499  8.508  30.717  1.00 44.45  ? 91  ALA A C   1 
ATOM   509  O O   . ALA A 1 95  ? -3.632  8.377  29.887  1.00 43.58  ? 91  ALA A O   1 
ATOM   510  C CB  . ALA A 1 95  ? -3.828  7.738  32.950  1.00 44.87  ? 91  ALA A CB  1 
ATOM   511  N N   . HIS A 1 96  ? -5.242  9.605  30.813  1.00 44.99  ? 92  HIS A N   1 
ATOM   512  C CA  . HIS A 1 96  ? -4.980  10.789 30.002  1.00 45.68  ? 92  HIS A CA  1 
ATOM   513  C C   . HIS A 1 96  ? -4.648  12.004 30.868  1.00 44.97  ? 92  HIS A C   1 
ATOM   514  O O   . HIS A 1 96  ? -3.767  12.785 30.527  1.00 45.61  ? 92  HIS A O   1 
ATOM   515  C CB  . HIS A 1 96  ? -6.176  11.072 29.092  1.00 46.56  ? 92  HIS A CB  1 
ATOM   516  C CG  . HIS A 1 96  ? -6.619  9.867  28.327  1.00 48.74  ? 92  HIS A CG  1 
ATOM   517  N ND1 . HIS A 1 96  ? -7.635  9.041  28.762  1.00 51.00  ? 92  HIS A ND1 1 
ATOM   518  C CD2 . HIS A 1 96  ? -6.132  9.302  27.200  1.00 50.78  ? 92  HIS A CD2 1 
ATOM   519  C CE1 . HIS A 1 96  ? -7.773  8.034  27.921  1.00 51.47  ? 92  HIS A CE1 1 
ATOM   520  N NE2 . HIS A 1 96  ? -6.877  8.170  26.962  1.00 52.79  ? 92  HIS A NE2 1 
ATOM   521  N N   . ARG A 1 97  ? -5.353  12.182 31.973  1.00 44.06  ? 93  ARG A N   1 
ATOM   522  C CA  . ARG A 1 97  ? -4.994  13.237 32.895  1.00 43.97  ? 93  ARG A CA  1 
ATOM   523  C C   . ARG A 1 97  ? -4.313  12.634 34.105  1.00 42.49  ? 93  ARG A C   1 
ATOM   524  O O   . ARG A 1 97  ? -4.805  11.668 34.693  1.00 43.11  ? 93  ARG A O   1 
ATOM   525  C CB  . ARG A 1 97  ? -6.198  14.053 33.321  1.00 44.41  ? 93  ARG A CB  1 
ATOM   526  C CG  . ARG A 1 97  ? -5.784  15.311 34.083  1.00 47.96  ? 93  ARG A CG  1 
ATOM   527  C CD  . ARG A 1 97  ? -6.573  16.544 33.667  1.00 53.00  ? 93  ARG A CD  1 
ATOM   528  N NE  . ARG A 1 97  ? -5.824  17.800 33.874  1.00 55.95  ? 93  ARG A NE  1 
ATOM   529  C CZ  . ARG A 1 97  ? -5.134  18.457 32.936  1.00 57.69  ? 93  ARG A CZ  1 
ATOM   530  N NH1 . ARG A 1 97  ? -5.045  18.005 31.679  1.00 60.85  ? 93  ARG A NH1 1 
ATOM   531  N NH2 . ARG A 1 97  ? -4.530  19.585 33.261  1.00 56.18  ? 93  ARG A NH2 1 
ATOM   532  N N   . ILE A 1 98  ? -3.176  13.199 34.463  1.00 40.65  ? 94  ILE A N   1 
ATOM   533  C CA  . ILE A 1 98  ? -2.348  12.667 35.546  1.00 39.34  ? 94  ILE A CA  1 
ATOM   534  C C   . ILE A 1 98  ? -2.407  13.596 36.743  1.00 38.06  ? 94  ILE A C   1 
ATOM   535  O O   . ILE A 1 98  ? -2.163  14.800 36.625  1.00 37.07  ? 94  ILE A O   1 
ATOM   536  C CB  . ILE A 1 98  ? -0.869  12.545 35.110  1.00 39.11  ? 94  ILE A CB  1 
ATOM   537  C CG1 . ILE A 1 98  ? -0.749  11.652 33.880  1.00 38.07  ? 94  ILE A CG1 1 
ATOM   538  C CG2 . ILE A 1 98  ? -0.020  11.975 36.246  1.00 39.46  ? 94  ILE A CG2 1 
ATOM   539  C CD1 . ILE A 1 98  ? -1.294  10.245 34.121  1.00 38.76  ? 94  ILE A CD1 1 
ATOM   540  N N   . HIS A 1 99  ? -2.686  13.022 37.901  1.00 37.34  ? 95  HIS A N   1 
ATOM   541  C CA  . HIS A 1 99  ? -2.626  13.777 39.140  1.00 37.11  ? 95  HIS A CA  1 
ATOM   542  C C   . HIS A 1 99  ? -1.397  13.381 39.973  1.00 35.89  ? 95  HIS A C   1 
ATOM   543  O O   . HIS A 1 99  ? -1.119  12.185 40.173  1.00 35.68  ? 95  HIS A O   1 
ATOM   544  C CB  . HIS A 1 99  ? -3.927  13.579 39.893  1.00 37.76  ? 95  HIS A CB  1 
ATOM   545  C CG  . HIS A 1 99  ? -5.116  14.064 39.120  1.00 40.81  ? 95  HIS A CG  1 
ATOM   546  N ND1 . HIS A 1 99  ? -5.431  15.404 39.015  1.00 43.55  ? 95  HIS A ND1 1 
ATOM   547  C CD2 . HIS A 1 99  ? -6.012  13.400 38.351  1.00 41.43  ? 95  HIS A CD2 1 
ATOM   548  C CE1 . HIS A 1 99  ? -6.492  15.536 38.238  1.00 44.11  ? 95  HIS A CE1 1 
ATOM   549  N NE2 . HIS A 1 99  ? -6.860  14.336 37.823  1.00 41.84  ? 95  HIS A NE2 1 
ATOM   550  N N   . VAL A 1 100 ? -0.672  14.403 40.426  1.00 34.24  ? 96  VAL A N   1 
ATOM   551  C CA  . VAL A 1 100 ? 0.505   14.230 41.257  1.00 33.16  ? 96  VAL A CA  1 
ATOM   552  C C   . VAL A 1 100 ? 0.339   14.826 42.672  1.00 32.70  ? 96  VAL A C   1 
ATOM   553  O O   . VAL A 1 100 ? 0.372   16.036 42.842  1.00 30.62  ? 96  VAL A O   1 
ATOM   554  C CB  . VAL A 1 100 ? 1.760   14.901 40.654  1.00 32.59  ? 96  VAL A CB  1 
ATOM   555  C CG1 . VAL A 1 100 ? 2.980   14.406 41.395  1.00 32.36  ? 96  VAL A CG1 1 
ATOM   556  C CG2 . VAL A 1 100 ? 1.890   14.604 39.195  1.00 31.92  ? 96  VAL A CG2 1 
ATOM   557  N N   . GLU A 1 101 ? 0.260   13.945 43.672  1.00 32.37  ? 97  GLU A N   1 
ATOM   558  C CA  . GLU A 1 101 ? 0.167   14.349 45.075  1.00 32.35  ? 97  GLU A CA  1 
ATOM   559  C C   . GLU A 1 101 ? 1.546   14.322 45.729  1.00 30.60  ? 97  GLU A C   1 
ATOM   560  O O   . GLU A 1 101 ? 2.146   13.263 45.871  1.00 31.22  ? 97  GLU A O   1 
ATOM   561  C CB  . GLU A 1 101 ? -0.792  13.397 45.846  1.00 32.14  ? 97  GLU A CB  1 
ATOM   562  C CG  . GLU A 1 101 ? -1.104  13.844 47.290  1.00 33.42  ? 97  GLU A CG  1 
ATOM   563  C CD  . GLU A 1 101 ? -1.967  12.846 48.065  1.00 36.26  ? 97  GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 101 ? -1.697  11.623 48.038  1.00 42.08  ? 97  GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 101 ? -2.938  13.289 48.720  1.00 44.30  ? 97  GLU A OE2 1 
ATOM   566  N N   . MET A 1 102 ? 2.015   15.476 46.168  1.00 29.60  ? 98  MET A N   1 
ATOM   567  C CA  . MET A 1 102 ? 3.296   15.620 46.820  1.00 28.78  ? 98  MET A CA  1 
ATOM   568  C C   . MET A 1 102 ? 3.118   15.929 48.306  1.00 28.68  ? 98  MET A C   1 
ATOM   569  O O   . MET A 1 102 ? 2.487   16.905 48.628  1.00 27.98  ? 98  MET A O   1 
ATOM   570  C CB  . MET A 1 102 ? 4.090   16.772 46.165  1.00 27.82  ? 98  MET A CB  1 
ATOM   571  C CG  . MET A 1 102 ? 4.422   16.529 44.726  1.00 28.30  ? 98  MET A CG  1 
ATOM   572  S SD  . MET A 1 102 ? 4.619   18.032 43.731  1.00 25.98  ? 98  MET A SD  1 
ATOM   573  C CE  . MET A 1 102 ? 2.879   18.389 43.386  1.00 26.65  ? 98  MET A CE  1 
ATOM   574  N N   . LYS A 1 103 ? 3.697   15.103 49.191  1.00 29.00  ? 99  LYS A N   1 
ATOM   575  C CA  . LYS A 1 103 ? 3.924   15.472 50.611  1.00 28.33  ? 99  LYS A CA  1 
ATOM   576  C C   . LYS A 1 103 ? 5.372   15.932 50.768  1.00 27.85  ? 99  LYS A C   1 
ATOM   577  O O   . LYS A 1 103 ? 6.289   15.251 50.295  1.00 27.89  ? 99  LYS A O   1 
ATOM   578  C CB  . LYS A 1 103 ? 3.709   14.277 51.545  1.00 29.38  ? 99  LYS A CB  1 
ATOM   579  C CG  . LYS A 1 103 ? 2.418   13.490 51.338  1.00 30.16  ? 99  LYS A CG  1 
ATOM   580  C CD  . LYS A 1 103 ? 1.220   14.289 51.633  1.00 32.64  ? 99  LYS A CD  1 
ATOM   581  C CE  . LYS A 1 103 ? -0.045  13.420 51.865  1.00 33.06  ? 99  LYS A CE  1 
ATOM   582  N NZ  . LYS A 1 103 ? -1.011  14.258 52.654  1.00 35.09  ? 99  LYS A NZ  1 
ATOM   583  N N   . PHE A 1 104 ? 5.602   17.041 51.449  1.00 26.99  ? 100 PHE A N   1 
ATOM   584  C CA  . PHE A 1 104 ? 6.940   17.579 51.576  1.00 27.11  ? 100 PHE A CA  1 
ATOM   585  C C   . PHE A 1 104 ? 7.088   18.565 52.736  1.00 27.39  ? 100 PHE A C   1 
ATOM   586  O O   . PHE A 1 104 ? 6.100   19.175 53.187  1.00 27.77  ? 100 PHE A O   1 
ATOM   587  C CB  . PHE A 1 104 ? 7.311   18.286 50.286  1.00 27.28  ? 100 PHE A CB  1 
ATOM   588  C CG  . PHE A 1 104 ? 6.418   19.459 49.966  1.00 27.36  ? 100 PHE A CG  1 
ATOM   589  C CD1 . PHE A 1 104 ? 5.187   19.258 49.357  1.00 29.75  ? 100 PHE A CD1 1 
ATOM   590  C CD2 . PHE A 1 104 ? 6.788   20.743 50.287  1.00 28.13  ? 100 PHE A CD2 1 
ATOM   591  C CE1 . PHE A 1 104 ? 4.357   20.321 49.073  1.00 29.78  ? 100 PHE A CE1 1 
ATOM   592  C CE2 . PHE A 1 104 ? 5.960   21.820 49.990  1.00 28.65  ? 100 PHE A CE2 1 
ATOM   593  C CZ  . PHE A 1 104 ? 4.749   21.595 49.371  1.00 28.28  ? 100 PHE A CZ  1 
ATOM   594  N N   . SER A 1 105 ? 8.335   18.764 53.182  1.00 27.02  ? 101 SER A N   1 
ATOM   595  C CA  . SER A 1 105 ? 8.650   19.738 54.232  1.00 25.74  ? 101 SER A CA  1 
ATOM   596  C C   . SER A 1 105 ? 9.656   20.733 53.780  1.00 27.11  ? 101 SER A C   1 
ATOM   597  O O   . SER A 1 105 ? 10.746  20.362 53.337  1.00 27.87  ? 101 SER A O   1 
ATOM   598  C CB  . SER A 1 105 ? 9.212   19.057 55.455  1.00 25.24  ? 101 SER A CB  1 
ATOM   599  O OG  . SER A 1 105 ? 8.290   18.122 55.951  1.00 21.44  ? 101 SER A OG  1 
ATOM   600  N N   . VAL A 1 106 ? 9.311   22.012 53.883  1.00 28.25  ? 102 VAL A N   1 
ATOM   601  C CA  . VAL A 1 106 ? 10.262  23.086 53.624  1.00 28.67  ? 102 VAL A CA  1 
ATOM   602  C C   . VAL A 1 106 ? 10.786  23.685 54.925  1.00 29.99  ? 102 VAL A C   1 
ATOM   603  O O   . VAL A 1 106 ? 10.015  23.976 55.840  1.00 30.15  ? 102 VAL A O   1 
ATOM   604  C CB  . VAL A 1 106 ? 9.634   24.204 52.772  1.00 28.42  ? 102 VAL A CB  1 
ATOM   605  C CG1 . VAL A 1 106 ? 10.584  25.387 52.665  1.00 27.34  ? 102 VAL A CG1 1 
ATOM   606  C CG2 . VAL A 1 106 ? 9.270   23.678 51.392  1.00 30.71  ? 102 VAL A CG2 1 
ATOM   607  N N   . ARG A 1 107 ? 12.100  23.865 55.001  1.00 32.05  ? 103 ARG A N   1 
ATOM   608  C CA  . ARG A 1 107 ? 12.700  24.702 56.033  1.00 32.84  ? 103 ARG A CA  1 
ATOM   609  C C   . ARG A 1 107 ? 12.964  26.112 55.516  1.00 34.45  ? 103 ARG A C   1 
ATOM   610  O O   . ARG A 1 107 ? 14.055  26.412 55.031  1.00 34.30  ? 103 ARG A O   1 
ATOM   611  C CB  . ARG A 1 107 ? 14.001  24.077 56.541  1.00 32.42  ? 103 ARG A CB  1 
ATOM   612  C CG  . ARG A 1 107 ? 14.603  24.787 57.742  1.00 32.23  ? 103 ARG A CG  1 
ATOM   613  C CD  . ARG A 1 107 ? 15.965  24.213 58.098  1.00 32.36  ? 103 ARG A CD  1 
ATOM   614  N NE  . ARG A 1 107 ? 16.440  24.694 59.392  1.00 31.37  ? 103 ARG A NE  1 
ATOM   615  C CZ  . ARG A 1 107 ? 17.485  24.188 60.039  1.00 30.56  ? 103 ARG A CZ  1 
ATOM   616  N NH1 . ARG A 1 107 ? 18.168  23.180 59.514  1.00 30.46  ? 103 ARG A NH1 1 
ATOM   617  N NH2 . ARG A 1 107 ? 17.847  24.689 61.212  1.00 31.69  ? 103 ARG A NH2 1 
ATOM   618  N N   . ASP A 1 108 ? 11.958  26.974 55.623  1.00 36.26  ? 104 ASP A N   1 
ATOM   619  C CA  . ASP A 1 108 ? 12.032  28.132 56.506  1.00 36.87  ? 104 ASP A CA  1 
ATOM   620  C C   . ASP A 1 108 ? 13.380  28.837 56.611  1.00 36.21  ? 104 ASP A C   1 
ATOM   621  O O   . ASP A 1 108 ? 14.053  28.760 57.639  1.00 35.61  ? 104 ASP A O   1 
ATOM   622  C CB  . ASP A 1 108 ? 11.597  27.753 57.923  1.00 38.68  ? 104 ASP A CB  1 
ATOM   623  C CG  . ASP A 1 108 ? 10.564  28.707 58.490  1.00 39.05  ? 104 ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 108 ? 10.961  29.729 59.089  1.00 45.75  ? 104 ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 108 ? 9.354   28.436 58.337  1.00 44.77  ? 104 ASP A OD2 1 
ATOM   626  N N   . CYS A 1 109 ? 13.769  29.522 55.541  1.00 35.87  ? 105 CYS A N   1 
ATOM   627  C CA  . CYS A 1 109 ? 15.001  30.301 55.536  1.00 36.40  ? 105 CYS A CA  1 
ATOM   628  C C   . CYS A 1 109 ? 15.237  31.112 56.805  1.00 36.48  ? 105 CYS A C   1 
ATOM   629  O O   . CYS A 1 109 ? 16.351  31.157 57.327  1.00 36.21  ? 105 CYS A O   1 
ATOM   630  C CB  . CYS A 1 109 ? 15.075  31.211 54.309  1.00 36.80  ? 105 CYS A CB  1 
ATOM   631  S SG  . CYS A 1 109 ? 15.339  30.340 52.747  1.00 37.79  ? 105 CYS A SG  1 
ATOM   632  N N   . SER A 1 110 ? 14.181  31.752 57.297  1.00 37.00  ? 106 SER A N   1 
ATOM   633  C CA  . SER A 1 110 ? 14.221  32.423 58.628  1.00 37.11  ? 106 SER A CA  1 
ATOM   634  C C   . SER A 1 110 ? 14.708  31.499 59.732  1.00 35.97  ? 106 SER A C   1 
ATOM   635  O O   . SER A 1 110 ? 15.273  31.952 60.692  1.00 36.86  ? 106 SER A O   1 
ATOM   636  C CB  . SER A 1 110 ? 12.813  32.869 59.070  1.00 37.05  ? 106 SER A CB  1 
ATOM   637  O OG  . SER A 1 110 ? 12.296  33.828 58.189  1.00 39.43  ? 106 SER A OG  1 
ATOM   638  N N   . SER A 1 111 ? 14.436  30.219 59.597  1.00 35.27  ? 107 SER A N   1 
ATOM   639  C CA  . SER A 1 111 ? 14.775  29.263 60.607  1.00 35.16  ? 107 SER A CA  1 
ATOM   640  C C   . SER A 1 111 ? 16.086  28.479 60.315  1.00 34.70  ? 107 SER A C   1 
ATOM   641  O O   . SER A 1 111 ? 16.264  27.372 60.788  1.00 34.93  ? 107 SER A O   1 
ATOM   642  C CB  . SER A 1 111 ? 13.591  28.329 60.782  1.00 34.81  ? 107 SER A CB  1 
ATOM   643  O OG  . SER A 1 111 ? 13.830  27.091 60.121  1.00 38.98  ? 107 SER A OG  1 
ATOM   644  N N   . ILE A 1 112 ? 17.000  29.044 59.532  1.00 34.14  ? 108 ILE A N   1 
ATOM   645  C CA  . ILE A 1 112 ? 18.274  28.354 59.251  1.00 33.65  ? 108 ILE A CA  1 
ATOM   646  C C   . ILE A 1 112 ? 19.378  29.264 59.729  1.00 32.07  ? 108 ILE A C   1 
ATOM   647  O O   . ILE A 1 112 ? 19.603  30.299 59.126  1.00 30.98  ? 108 ILE A O   1 
ATOM   648  C CB  . ILE A 1 112 ? 18.478  28.047 57.727  1.00 33.79  ? 108 ILE A CB  1 
ATOM   649  C CG1 . ILE A 1 112 ? 17.348  27.155 57.195  1.00 33.84  ? 108 ILE A CG1 1 
ATOM   650  C CG2 . ILE A 1 112 ? 19.816  27.354 57.499  1.00 33.75  ? 108 ILE A CG2 1 
ATOM   651  C CD1 . ILE A 1 112 ? 17.233  27.118 55.665  1.00 32.80  ? 108 ILE A CD1 1 
ATOM   652  N N   . PRO A 1 113 ? 20.065  28.894 60.829  1.00 31.59  ? 109 PRO A N   1 
ATOM   653  C CA  . PRO A 1 113 ? 21.050  29.842 61.330  1.00 31.37  ? 109 PRO A CA  1 
ATOM   654  C C   . PRO A 1 113 ? 22.111  30.167 60.295  1.00 31.85  ? 109 PRO A C   1 
ATOM   655  O O   . PRO A 1 113 ? 22.555  29.271 59.543  1.00 31.55  ? 109 PRO A O   1 
ATOM   656  C CB  . PRO A 1 113 ? 21.630  29.136 62.553  1.00 31.57  ? 109 PRO A CB  1 
ATOM   657  C CG  . PRO A 1 113 ? 20.560  28.123 62.952  1.00 31.88  ? 109 PRO A CG  1 
ATOM   658  C CD  . PRO A 1 113 ? 19.997  27.678 61.660  1.00 31.88  ? 109 PRO A CD  1 
ATOM   659  N N   . SER A 1 114 ? 22.460  31.447 60.239  1.00 32.88  ? 110 SER A N   1 
ATOM   660  C CA  . SER A 1 114 ? 23.566  31.991 59.412  1.00 34.88  ? 110 SER A CA  1 
ATOM   661  C C   . SER A 1 114 ? 23.378  31.865 57.868  1.00 35.29  ? 110 SER A C   1 
ATOM   662  O O   . SER A 1 114 ? 24.305  32.138 57.085  1.00 35.11  ? 110 SER A O   1 
ATOM   663  C CB  . SER A 1 114 ? 24.920  31.387 59.875  1.00 35.02  ? 110 SER A CB  1 
ATOM   664  O OG  . SER A 1 114 ? 25.122  31.578 61.291  1.00 35.49  ? 110 SER A OG  1 
ATOM   665  N N   . VAL A 1 115 ? 22.158  31.531 57.436  1.00 35.75  ? 111 VAL A N   1 
ATOM   666  C CA  . VAL A 1 115 ? 21.865  31.337 56.017  1.00 35.66  ? 111 VAL A CA  1 
ATOM   667  C C   . VAL A 1 115 ? 22.035  32.624 55.192  1.00 35.65  ? 111 VAL A C   1 
ATOM   668  O O   . VAL A 1 115 ? 21.698  33.714 55.654  1.00 35.86  ? 111 VAL A O   1 
ATOM   669  C CB  . VAL A 1 115 ? 20.480  30.688 55.818  1.00 35.46  ? 111 VAL A CB  1 
ATOM   670  C CG1 . VAL A 1 115 ? 19.365  31.730 55.759  1.00 34.67  ? 111 VAL A CG1 1 
ATOM   671  C CG2 . VAL A 1 115 ? 20.484  29.803 54.582  1.00 35.10  ? 111 VAL A CG2 1 
ATOM   672  N N   . PRO A 1 116 ? 22.669  32.518 54.007  1.00 36.44  ? 112 PRO A N   1 
ATOM   673  C CA  . PRO A 1 116 ? 22.713  33.657 53.063  1.00 36.44  ? 112 PRO A CA  1 
ATOM   674  C C   . PRO A 1 116 ? 21.345  34.059 52.482  1.00 37.30  ? 112 PRO A C   1 
ATOM   675  O O   . PRO A 1 116 ? 20.396  33.263 52.493  1.00 37.21  ? 112 PRO A O   1 
ATOM   676  C CB  . PRO A 1 116 ? 23.674  33.172 51.972  1.00 36.25  ? 112 PRO A CB  1 
ATOM   677  C CG  . PRO A 1 116 ? 24.535  32.107 52.693  1.00 36.12  ? 112 PRO A CG  1 
ATOM   678  C CD  . PRO A 1 116 ? 23.537  31.407 53.563  1.00 36.14  ? 112 PRO A CD  1 
ATOM   679  N N   . GLY A 1 117 ? 21.259  35.289 51.982  1.00 37.94  ? 113 GLY A N   1 
ATOM   680  C CA  . GLY A 1 117 ? 19.979  35.870 51.566  1.00 39.05  ? 113 GLY A CA  1 
ATOM   681  C C   . GLY A 1 117 ? 19.385  35.297 50.284  1.00 39.46  ? 113 GLY A C   1 
ATOM   682  O O   . GLY A 1 117 ? 18.281  35.682 49.860  1.00 39.76  ? 113 GLY A O   1 
ATOM   683  N N   . SER A 1 118 ? 20.103  34.378 49.653  1.00 39.35  ? 114 SER A N   1 
ATOM   684  C CA  . SER A 1 118 ? 19.656  33.853 48.395  1.00 39.15  ? 114 SER A CA  1 
ATOM   685  C C   . SER A 1 118 ? 18.825  32.633 48.643  1.00 38.30  ? 114 SER A C   1 
ATOM   686  O O   . SER A 1 118 ? 18.315  32.061 47.688  1.00 39.05  ? 114 SER A O   1 
ATOM   687  C CB  . SER A 1 118 ? 20.848  33.554 47.475  1.00 39.70  ? 114 SER A CB  1 
ATOM   688  O OG  . SER A 1 118 ? 22.003  33.207 48.211  1.00 42.33  ? 114 SER A OG  1 
ATOM   689  N N   . CYS A 1 119 ? 18.656  32.249 49.917  1.00 36.71  ? 115 CYS A N   1 
ATOM   690  C CA  . CYS A 1 119 ? 17.873  31.072 50.298  1.00 35.21  ? 115 CYS A CA  1 
ATOM   691  C C   . CYS A 1 119 ? 16.465  31.072 49.673  1.00 34.96  ? 115 CYS A C   1 
ATOM   692  O O   . CYS A 1 119 ? 15.873  32.132 49.491  1.00 33.91  ? 115 CYS A O   1 
ATOM   693  C CB  . CYS A 1 119 ? 17.796  30.988 51.831  1.00 35.35  ? 115 CYS A CB  1 
ATOM   694  S SG  . CYS A 1 119 ? 16.827  29.595 52.517  1.00 36.37  ? 115 CYS A SG  1 
ATOM   695  N N   . LYS A 1 120 ? 15.952  29.878 49.341  1.00 34.51  ? 116 LYS A N   1 
ATOM   696  C CA  . LYS A 1 120 ? 14.705  29.712 48.581  1.00 34.52  ? 116 LYS A CA  1 
ATOM   697  C C   . LYS A 1 120 ? 13.821  28.759 49.337  1.00 33.84  ? 116 LYS A C   1 
ATOM   698  O O   . LYS A 1 120 ? 14.309  27.985 50.190  1.00 32.87  ? 116 LYS A O   1 
ATOM   699  C CB  . LYS A 1 120 ? 14.987  29.110 47.190  1.00 35.20  ? 116 LYS A CB  1 
ATOM   700  C CG  . LYS A 1 120 ? 15.037  30.074 46.050  1.00 37.74  ? 116 LYS A CG  1 
ATOM   701  C CD  . LYS A 1 120 ? 16.055  31.166 46.285  1.00 40.36  ? 116 LYS A CD  1 
ATOM   702  C CE  . LYS A 1 120 ? 16.257  32.024 45.066  1.00 42.29  ? 116 LYS A CE  1 
ATOM   703  N NZ  . LYS A 1 120 ? 17.620  32.682 45.099  1.00 45.05  ? 116 LYS A NZ  1 
ATOM   704  N N   . GLU A 1 121 ? 12.526  28.805 49.023  1.00 33.33  ? 117 GLU A N   1 
ATOM   705  C CA  . GLU A 1 121 ? 11.544  28.032 49.753  1.00 33.15  ? 117 GLU A CA  1 
ATOM   706  C C   . GLU A 1 121 ? 10.561  27.331 48.851  1.00 33.25  ? 117 GLU A C   1 
ATOM   707  O O   . GLU A 1 121 ? 9.523   26.861 49.306  1.00 33.67  ? 117 GLU A O   1 
ATOM   708  C CB  . GLU A 1 121 ? 10.835  28.910 50.780  1.00 33.30  ? 117 GLU A CB  1 
ATOM   709  C CG  . GLU A 1 121 ? 11.781  29.544 51.843  1.00 33.09  ? 117 GLU A CG  1 
ATOM   710  C CD  . GLU A 1 121 ? 11.017  30.227 53.011  1.00 34.28  ? 117 GLU A CD  1 
ATOM   711  O OE1 . GLU A 1 121 ? 9.796   29.992 53.179  1.00 36.66  ? 117 GLU A OE1 1 
ATOM   712  O OE2 . GLU A 1 121 ? 11.648  30.982 53.775  1.00 35.43  ? 117 GLU A OE2 1 
ATOM   713  N N   . THR A 1 122 ? 10.924  27.164 47.578  1.00 33.85  ? 118 THR A N   1 
ATOM   714  C CA  . THR A 1 122 ? 10.074  26.450 46.607  1.00 33.10  ? 118 THR A CA  1 
ATOM   715  C C   . THR A 1 122 ? 10.895  25.473 45.755  1.00 32.99  ? 118 THR A C   1 
ATOM   716  O O   . THR A 1 122 ? 12.114  25.571 45.684  1.00 32.64  ? 118 THR A O   1 
ATOM   717  C CB  . THR A 1 122 ? 9.367   27.454 45.683  1.00 32.87  ? 118 THR A CB  1 
ATOM   718  O OG1 . THR A 1 122 ? 10.337  28.155 44.903  1.00 31.24  ? 118 THR A OG1 1 
ATOM   719  C CG2 . THR A 1 122 ? 8.574   28.484 46.515  1.00 33.33  ? 118 THR A CG2 1 
ATOM   720  N N   . PHE A 1 123 ? 10.193  24.533 45.129  1.00 32.52  ? 119 PHE A N   1 
ATOM   721  C CA  . PHE A 1 123 ? 10.729  23.739 44.062  1.00 31.61  ? 119 PHE A CA  1 
ATOM   722  C C   . PHE A 1 123 ? 9.793   23.690 42.842  1.00 31.56  ? 119 PHE A C   1 
ATOM   723  O O   . PHE A 1 123 ? 8.555   23.871 42.947  1.00 29.81  ? 119 PHE A O   1 
ATOM   724  C CB  . PHE A 1 123 ? 11.021  22.331 44.547  1.00 31.62  ? 119 PHE A CB  1 
ATOM   725  C CG  . PHE A 1 123 ? 9.826   21.591 45.011  1.00 31.38  ? 119 PHE A CG  1 
ATOM   726  C CD1 . PHE A 1 123 ? 9.219   20.668 44.204  1.00 29.74  ? 119 PHE A CD1 1 
ATOM   727  C CD2 . PHE A 1 123 ? 9.326   21.791 46.297  1.00 32.30  ? 119 PHE A CD2 1 
ATOM   728  C CE1 . PHE A 1 123 ? 8.117   19.983 44.651  1.00 31.58  ? 119 PHE A CE1 1 
ATOM   729  C CE2 . PHE A 1 123 ? 8.217   21.094 46.740  1.00 31.95  ? 119 PHE A CE2 1 
ATOM   730  C CZ  . PHE A 1 123 ? 7.626   20.190 45.930  1.00 31.91  ? 119 PHE A CZ  1 
ATOM   731  N N   . ASN A 1 124 ? 10.406  23.442 41.675  1.00 30.68  ? 120 ASN A N   1 
ATOM   732  C CA  . ASN A 1 124 ? 9.641   23.139 40.476  1.00 29.84  ? 120 ASN A CA  1 
ATOM   733  C C   . ASN A 1 124 ? 9.404   21.663 40.274  1.00 29.67  ? 120 ASN A C   1 
ATOM   734  O O   . ASN A 1 124 ? 10.243  20.820 40.627  1.00 28.79  ? 120 ASN A O   1 
ATOM   735  C CB  . ASN A 1 124 ? 10.343  23.636 39.236  1.00 29.92  ? 120 ASN A CB  1 
ATOM   736  C CG  . ASN A 1 124 ? 10.420  25.104 39.167  1.00 28.35  ? 120 ASN A CG  1 
ATOM   737  O OD1 . ASN A 1 124 ? 9.530   25.819 39.624  1.00 30.29  ? 120 ASN A OD1 1 
ATOM   738  N ND2 . ASN A 1 124 ? 11.495  25.587 38.583  1.00 30.51  ? 120 ASN A ND2 1 
ATOM   739  N N   . LEU A 1 125 ? 8.257   21.392 39.642  1.00 29.40  ? 121 LEU A N   1 
ATOM   740  C CA  . LEU A 1 125 ? 7.848   20.080 39.166  1.00 28.78  ? 121 LEU A CA  1 
ATOM   741  C C   . LEU A 1 125 ? 7.732   20.114 37.629  1.00 28.85  ? 121 LEU A C   1 
ATOM   742  O O   . LEU A 1 125 ? 7.210   21.089 37.071  1.00 28.37  ? 121 LEU A O   1 
ATOM   743  C CB  . LEU A 1 125 ? 6.496   19.758 39.760  1.00 28.78  ? 121 LEU A CB  1 
ATOM   744  C CG  . LEU A 1 125 ? 5.785   18.536 39.235  1.00 28.83  ? 121 LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 125 ? 6.567   17.328 39.612  1.00 28.28  ? 121 LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 125 ? 4.354   18.495 39.796  1.00 29.07  ? 121 LEU A CD2 1 
ATOM   747  N N   . TYR A 1 126 ? 8.212   19.036 36.983  1.00 29.02  ? 122 TYR A N   1 
ATOM   748  C CA  . TYR A 1 126 ? 8.212   18.843 35.533  1.00 29.10  ? 122 TYR A CA  1 
ATOM   749  C C   . TYR A 1 126 ? 7.777   17.410 35.200  1.00 30.31  ? 122 TYR A C   1 
ATOM   750  O O   . TYR A 1 126 ? 7.937   16.504 36.008  1.00 29.33  ? 122 TYR A O   1 
ATOM   751  C CB  . TYR A 1 126 ? 9.611   19.016 34.936  1.00 28.74  ? 122 TYR A CB  1 
ATOM   752  C CG  . TYR A 1 126 ? 10.267  20.342 35.174  1.00 28.81  ? 122 TYR A CG  1 
ATOM   753  C CD1 . TYR A 1 126 ? 10.172  21.369 34.243  1.00 29.46  ? 122 TYR A CD1 1 
ATOM   754  C CD2 . TYR A 1 126 ? 11.020  20.568 36.334  1.00 27.98  ? 122 TYR A CD2 1 
ATOM   755  C CE1 . TYR A 1 126 ? 10.818  22.609 34.477  1.00 31.17  ? 122 TYR A CE1 1 
ATOM   756  C CE2 . TYR A 1 126 ? 11.633  21.767 36.570  1.00 28.77  ? 122 TYR A CE2 1 
ATOM   757  C CZ  . TYR A 1 126 ? 11.520  22.787 35.652  1.00 29.12  ? 122 TYR A CZ  1 
ATOM   758  O OH  . TYR A 1 126 ? 12.149  23.965 35.908  1.00 30.58  ? 122 TYR A OH  1 
ATOM   759  N N   . TYR A 1 127 ? 7.227   17.200 34.007  1.00 31.61  ? 123 TYR A N   1 
ATOM   760  C CA  . TYR A 1 127 ? 7.159   15.819 33.475  1.00 33.02  ? 123 TYR A CA  1 
ATOM   761  C C   . TYR A 1 127 ? 7.790   15.719 32.079  1.00 32.55  ? 123 TYR A C   1 
ATOM   762  O O   . TYR A 1 127 ? 8.108   16.710 31.424  1.00 31.88  ? 123 TYR A O   1 
ATOM   763  C CB  . TYR A 1 127 ? 5.740   15.259 33.451  1.00 33.60  ? 123 TYR A CB  1 
ATOM   764  C CG  . TYR A 1 127 ? 4.871   15.929 32.406  1.00 36.48  ? 123 TYR A CG  1 
ATOM   765  C CD1 . TYR A 1 127 ? 4.662   15.332 31.162  1.00 37.24  ? 123 TYR A CD1 1 
ATOM   766  C CD2 . TYR A 1 127 ? 4.275   17.185 32.656  1.00 36.04  ? 123 TYR A CD2 1 
ATOM   767  C CE1 . TYR A 1 127 ? 3.886   15.959 30.190  1.00 37.20  ? 123 TYR A CE1 1 
ATOM   768  C CE2 . TYR A 1 127 ? 3.487   17.810 31.705  1.00 36.66  ? 123 TYR A CE2 1 
ATOM   769  C CZ  . TYR A 1 127 ? 3.299   17.186 30.470  1.00 37.27  ? 123 TYR A CZ  1 
ATOM   770  O OH  . TYR A 1 127 ? 2.541   17.792 29.507  1.00 37.88  ? 123 TYR A OH  1 
ATOM   771  N N   . TYR A 1 128 ? 8.010   14.485 31.670  1.00 33.23  ? 124 TYR A N   1 
ATOM   772  C CA  . TYR A 1 128 ? 8.500   14.185 30.343  1.00 33.37  ? 124 TYR A CA  1 
ATOM   773  C C   . TYR A 1 128 ? 7.922   12.826 29.978  1.00 33.45  ? 124 TYR A C   1 
ATOM   774  O O   . TYR A 1 128 ? 8.096   11.861 30.747  1.00 34.46  ? 124 TYR A O   1 
ATOM   775  C CB  . TYR A 1 128 ? 10.012  14.127 30.362  1.00 33.87  ? 124 TYR A CB  1 
ATOM   776  C CG  . TYR A 1 128 ? 10.591  13.566 29.081  1.00 34.97  ? 124 TYR A CG  1 
ATOM   777  C CD1 . TYR A 1 128 ? 10.637  14.336 27.910  1.00 34.40  ? 124 TYR A CD1 1 
ATOM   778  C CD2 . TYR A 1 128 ? 11.085  12.276 29.037  1.00 35.30  ? 124 TYR A CD2 1 
ATOM   779  C CE1 . TYR A 1 128 ? 11.163  13.829 26.733  1.00 34.46  ? 124 TYR A CE1 1 
ATOM   780  C CE2 . TYR A 1 128 ? 11.630  11.762 27.874  1.00 37.13  ? 124 TYR A CE2 1 
ATOM   781  C CZ  . TYR A 1 128 ? 11.646  12.535 26.709  1.00 35.28  ? 124 TYR A CZ  1 
ATOM   782  O OH  . TYR A 1 128 ? 12.191  11.996 25.569  1.00 35.54  ? 124 TYR A OH  1 
ATOM   783  N N   . GLU A 1 129 ? 7.218   12.732 28.843  1.00 32.76  ? 125 GLU A N   1 
ATOM   784  C CA  . GLU A 1 129 ? 6.690   11.429 28.403  1.00 32.42  ? 125 GLU A CA  1 
ATOM   785  C C   . GLU A 1 129 ? 7.635   10.742 27.437  1.00 32.28  ? 125 GLU A C   1 
ATOM   786  O O   . GLU A 1 129 ? 8.462   11.384 26.820  1.00 30.43  ? 125 GLU A O   1 
ATOM   787  C CB  . GLU A 1 129 ? 5.354   11.550 27.692  1.00 32.67  ? 125 GLU A CB  1 
ATOM   788  C CG  . GLU A 1 129 ? 4.347   12.492 28.249  1.00 32.58  ? 125 GLU A CG  1 
ATOM   789  C CD  . GLU A 1 129 ? 3.135   12.522 27.348  1.00 32.71  ? 125 GLU A CD  1 
ATOM   790  O OE1 . GLU A 1 129 ? 2.508   11.451 27.257  1.00 31.05  ? 125 GLU A OE1 1 
ATOM   791  O OE2 . GLU A 1 129 ? 2.837   13.587 26.729  1.00 32.88  ? 125 GLU A OE2 1 
ATOM   792  N N   . ALA A 1 130 ? 7.479   9.425  27.304  1.00 33.00  ? 126 ALA A N   1 
ATOM   793  C CA  . ALA A 1 130 ? 8.406   8.618  26.522  1.00 33.88  ? 126 ALA A CA  1 
ATOM   794  C C   . ALA A 1 130 ? 7.707   7.336  26.128  1.00 34.13  ? 126 ALA A C   1 
ATOM   795  O O   . ALA A 1 130 ? 6.764   6.963  26.748  1.00 34.33  ? 126 ALA A O   1 
ATOM   796  C CB  . ALA A 1 130 ? 9.685   8.305  27.325  1.00 33.97  ? 126 ALA A CB  1 
ATOM   797  N N   . ASP A 1 131 ? 8.213   6.682  25.092  1.00 34.69  ? 127 ASP A N   1 
ATOM   798  C CA  . ASP A 1 131 ? 7.594   5.507  24.496  1.00 34.60  ? 127 ASP A CA  1 
ATOM   799  C C   . ASP A 1 131 ? 8.121   4.239  25.165  1.00 35.48  ? 127 ASP A C   1 
ATOM   800  O O   . ASP A 1 131 ? 7.528   3.180  25.067  1.00 34.95  ? 127 ASP A O   1 
ATOM   801  C CB  . ASP A 1 131 ? 7.890   5.473  22.996  1.00 34.32  ? 127 ASP A CB  1 
ATOM   802  C CG  . ASP A 1 131 ? 7.275   6.646  22.244  1.00 32.80  ? 127 ASP A CG  1 
ATOM   803  O OD1 . ASP A 1 131 ? 6.506   7.416  22.844  1.00 34.85  ? 127 ASP A OD1 1 
ATOM   804  O OD2 . ASP A 1 131 ? 7.565   6.800  21.041  1.00 31.22  ? 127 ASP A OD2 1 
ATOM   805  N N   . PHE A 1 132 ? 9.242   4.388  25.852  1.00 35.98  ? 128 PHE A N   1 
ATOM   806  C CA  . PHE A 1 132 ? 9.821   3.356  26.642  1.00 36.23  ? 128 PHE A CA  1 
ATOM   807  C C   . PHE A 1 132 ? 10.752  4.033  27.667  1.00 36.61  ? 128 PHE A C   1 
ATOM   808  O O   . PHE A 1 132 ? 10.931  5.261  27.672  1.00 35.64  ? 128 PHE A O   1 
ATOM   809  C CB  . PHE A 1 132 ? 10.608  2.414  25.732  1.00 36.43  ? 128 PHE A CB  1 
ATOM   810  C CG  . PHE A 1 132 ? 11.871  3.023  25.152  1.00 35.69  ? 128 PHE A CG  1 
ATOM   811  C CD1 . PHE A 1 132 ? 11.804  3.962  24.145  1.00 35.61  ? 128 PHE A CD1 1 
ATOM   812  C CD2 . PHE A 1 132 ? 13.118  2.609  25.585  1.00 35.99  ? 128 PHE A CD2 1 
ATOM   813  C CE1 . PHE A 1 132 ? 12.929  4.511  23.616  1.00 36.06  ? 128 PHE A CE1 1 
ATOM   814  C CE2 . PHE A 1 132 ? 14.265  3.144  25.055  1.00 36.25  ? 128 PHE A CE2 1 
ATOM   815  C CZ  . PHE A 1 132 ? 14.177  4.094  24.059  1.00 37.84  ? 128 PHE A CZ  1 
ATOM   816  N N   . ASP A 1 133 ? 11.337  3.202  28.521  1.00 37.19  ? 129 ASP A N   1 
ATOM   817  C CA  . ASP A 1 133 ? 12.225  3.640  29.570  1.00 37.63  ? 129 ASP A CA  1 
ATOM   818  C C   . ASP A 1 133 ? 13.527  4.069  28.957  1.00 38.16  ? 129 ASP A C   1 
ATOM   819  O O   . ASP A 1 133 ? 14.501  3.331  28.952  1.00 39.23  ? 129 ASP A O   1 
ATOM   820  C CB  . ASP A 1 133 ? 12.403  2.503  30.585  1.00 37.53  ? 129 ASP A CB  1 
ATOM   821  C CG  . ASP A 1 133 ? 13.123  2.947  31.861  1.00 39.01  ? 129 ASP A CG  1 
ATOM   822  O OD1 . ASP A 1 133 ? 13.487  4.150  32.029  1.00 38.76  ? 129 ASP A OD1 1 
ATOM   823  O OD2 . ASP A 1 133 ? 13.313  2.057  32.713  1.00 40.81  ? 129 ASP A OD2 1 
ATOM   824  N N   . SER A 1 134 ? 13.540  5.289  28.445  1.00 38.70  ? 130 SER A N   1 
ATOM   825  C CA  . SER A 1 134 ? 14.652  5.805  27.679  1.00 39.09  ? 130 SER A CA  1 
ATOM   826  C C   . SER A 1 134 ? 15.671  6.595  28.511  1.00 39.17  ? 130 SER A C   1 
ATOM   827  O O   . SER A 1 134 ? 16.808  6.867  28.071  1.00 38.55  ? 130 SER A O   1 
ATOM   828  C CB  . SER A 1 134 ? 14.072  6.696  26.589  1.00 39.50  ? 130 SER A CB  1 
ATOM   829  O OG  . SER A 1 134 ? 13.280  7.707  27.173  1.00 40.73  ? 130 SER A OG  1 
ATOM   830  N N   . ALA A 1 135 ? 15.283  6.972  29.724  1.00 39.21  ? 131 ALA A N   1 
ATOM   831  C CA  . ALA A 1 135 ? 16.192  7.756  30.580  1.00 39.39  ? 131 ALA A CA  1 
ATOM   832  C C   . ALA A 1 135 ? 17.540  7.081  30.869  1.00 38.92  ? 131 ALA A C   1 
ATOM   833  O O   . ALA A 1 135 ? 17.621  5.880  31.095  1.00 38.47  ? 131 ALA A O   1 
ATOM   834  C CB  . ALA A 1 135 ? 15.509  8.112  31.918  1.00 39.45  ? 131 ALA A CB  1 
ATOM   835  N N   . THR A 1 136 ? 18.575  7.905  30.886  1.00 38.99  ? 132 THR A N   1 
ATOM   836  C CA  . THR A 1 136 ? 19.932  7.516  31.187  1.00 39.69  ? 132 THR A CA  1 
ATOM   837  C C   . THR A 1 136 ? 20.477  8.634  32.091  1.00 40.91  ? 132 THR A C   1 
ATOM   838  O O   . THR A 1 136 ? 19.717  9.512  32.543  1.00 41.29  ? 132 THR A O   1 
ATOM   839  C CB  . THR A 1 136 ? 20.806  7.480  29.915  1.00 39.77  ? 132 THR A CB  1 
ATOM   840  O OG1 . THR A 1 136 ? 20.963  8.813  29.410  1.00 39.46  ? 132 THR A OG1 1 
ATOM   841  C CG2 . THR A 1 136 ? 20.219  6.587  28.836  1.00 39.52  ? 132 THR A CG2 1 
ATOM   842  N N   . LYS A 1 137 ? 21.783  8.645  32.329  1.00 41.06  ? 133 LYS A N   1 
ATOM   843  C CA  . LYS A 1 137 ? 22.350  9.624  33.245  1.00 40.94  ? 133 LYS A CA  1 
ATOM   844  C C   . LYS A 1 137 ? 22.325  11.014 32.646  1.00 40.71  ? 133 LYS A C   1 
ATOM   845  O O   . LYS A 1 137 ? 22.165  11.968 33.367  1.00 41.04  ? 133 LYS A O   1 
ATOM   846  C CB  . LYS A 1 137 ? 23.774  9.216  33.683  1.00 40.91  ? 133 LYS A CB  1 
ATOM   847  N N   . THR A 1 138 ? 22.470  11.111 31.326  1.00 41.16  ? 134 THR A N   1 
ATOM   848  C CA  . THR A 1 138 ? 22.575  12.393 30.575  1.00 40.82  ? 134 THR A CA  1 
ATOM   849  C C   . THR A 1 138 ? 21.350  12.728 29.701  1.00 39.63  ? 134 THR A C   1 
ATOM   850  O O   . THR A 1 138 ? 21.193  13.855 29.216  1.00 38.66  ? 134 THR A O   1 
ATOM   851  C CB  . THR A 1 138 ? 23.854  12.385 29.644  1.00 41.31  ? 134 THR A CB  1 
ATOM   852  O OG1 . THR A 1 138 ? 23.992  11.103 29.021  1.00 42.22  ? 134 THR A OG1 1 
ATOM   853  C CG2 . THR A 1 138 ? 25.103  12.644 30.460  1.00 41.73  ? 134 THR A CG2 1 
ATOM   854  N N   . PHE A 1 139 ? 20.477  11.760 29.499  1.00 39.14  ? 135 PHE A N   1 
ATOM   855  C CA  . PHE A 1 139 ? 19.247  12.029 28.750  1.00 39.06  ? 135 PHE A CA  1 
ATOM   856  C C   . PHE A 1 139 ? 18.020  11.638 29.569  1.00 37.99  ? 135 PHE A C   1 
ATOM   857  O O   . PHE A 1 139 ? 18.033  10.603 30.239  1.00 36.73  ? 135 PHE A O   1 
ATOM   858  C CB  . PHE A 1 139 ? 19.252  11.260 27.402  1.00 38.85  ? 135 PHE A CB  1 
ATOM   859  C CG  . PHE A 1 139 ? 17.929  11.311 26.670  1.00 38.23  ? 135 PHE A CG  1 
ATOM   860  C CD1 . PHE A 1 139 ? 17.664  12.315 25.773  1.00 38.22  ? 135 PHE A CD1 1 
ATOM   861  C CD2 . PHE A 1 139 ? 16.958  10.352 26.895  1.00 36.93  ? 135 PHE A CD2 1 
ATOM   862  C CE1 . PHE A 1 139 ? 16.456  12.382 25.120  1.00 35.90  ? 135 PHE A CE1 1 
ATOM   863  C CE2 . PHE A 1 139 ? 15.754  10.409 26.241  1.00 38.21  ? 135 PHE A CE2 1 
ATOM   864  C CZ  . PHE A 1 139 ? 15.513  11.434 25.340  1.00 38.81  ? 135 PHE A CZ  1 
ATOM   865  N N   . PRO A 1 140 ? 16.949  12.452 29.504  1.00 38.24  ? 136 PRO A N   1 
ATOM   866  C CA  . PRO A 1 140 ? 16.866  13.758 28.859  1.00 38.25  ? 136 PRO A CA  1 
ATOM   867  C C   . PRO A 1 140 ? 17.700  14.881 29.497  1.00 38.72  ? 136 PRO A C   1 
ATOM   868  O O   . PRO A 1 140 ? 18.038  14.826 30.663  1.00 38.66  ? 136 PRO A O   1 
ATOM   869  C CB  . PRO A 1 140 ? 15.362  14.113 28.928  1.00 38.89  ? 136 PRO A CB  1 
ATOM   870  C CG  . PRO A 1 140 ? 14.660  12.985 29.509  1.00 38.43  ? 136 PRO A CG  1 
ATOM   871  C CD  . PRO A 1 140 ? 15.655  12.032 30.090  1.00 38.10  ? 136 PRO A CD  1 
ATOM   872  N N   . ASN A 1 141 ? 18.026  15.903 28.716  1.00 38.98  ? 137 ASN A N   1 
ATOM   873  C CA  . ASN A 1 141 ? 18.711  17.049 29.248  1.00 40.01  ? 137 ASN A CA  1 
ATOM   874  C C   . ASN A 1 141 ? 18.017  17.481 30.546  1.00 39.85  ? 137 ASN A C   1 
ATOM   875  O O   . ASN A 1 141 ? 16.774  17.445 30.675  1.00 40.04  ? 137 ASN A O   1 
ATOM   876  C CB  . ASN A 1 141 ? 18.708  18.219 28.255  1.00 40.79  ? 137 ASN A CB  1 
ATOM   877  C CG  . ASN A 1 141 ? 19.688  18.030 27.079  1.00 42.97  ? 137 ASN A CG  1 
ATOM   878  O OD1 . ASN A 1 141 ? 20.559  17.151 27.093  1.00 44.09  ? 137 ASN A OD1 1 
ATOM   879  N ND2 . ASN A 1 141 ? 19.532  18.876 26.050  1.00 43.24  ? 137 ASN A ND2 1 
ATOM   880  N N   . TRP A 1 142 ? 18.851  17.883 31.489  1.00 39.13  ? 138 TRP A N   1 
ATOM   881  C CA  . TRP A 1 142 ? 18.452  18.304 32.834  1.00 38.28  ? 138 TRP A CA  1 
ATOM   882  C C   . TRP A 1 142 ? 18.072  19.773 32.831  1.00 38.64  ? 138 TRP A C   1 
ATOM   883  O O   . TRP A 1 142 ? 18.794  20.613 33.363  1.00 38.14  ? 138 TRP A O   1 
ATOM   884  C CB  . TRP A 1 142 ? 19.640  18.050 33.774  1.00 36.74  ? 138 TRP A CB  1 
ATOM   885  C CG  . TRP A 1 142 ? 19.897  16.612 33.889  1.00 34.57  ? 138 TRP A CG  1 
ATOM   886  C CD1 . TRP A 1 142 ? 20.831  15.898 33.238  1.00 34.11  ? 138 TRP A CD1 1 
ATOM   887  C CD2 . TRP A 1 142 ? 19.132  15.680 34.649  1.00 34.76  ? 138 TRP A CD2 1 
ATOM   888  N NE1 . TRP A 1 142 ? 20.740  14.569 33.573  1.00 33.98  ? 138 TRP A NE1 1 
ATOM   889  C CE2 . TRP A 1 142 ? 19.703  14.410 34.448  1.00 32.92  ? 138 TRP A CE2 1 
ATOM   890  C CE3 . TRP A 1 142 ? 18.037  15.800 35.511  1.00 33.10  ? 138 TRP A CE3 1 
ATOM   891  C CZ2 . TRP A 1 142 ? 19.219  13.273 35.067  1.00 33.13  ? 138 TRP A CZ2 1 
ATOM   892  C CZ3 . TRP A 1 142 ? 17.555  14.654 36.123  1.00 33.06  ? 138 TRP A CZ3 1 
ATOM   893  C CH2 . TRP A 1 142 ? 18.142  13.416 35.896  1.00 33.10  ? 138 TRP A CH2 1 
ATOM   894  N N   . MET A 1 143 ? 16.954  20.067 32.184  1.00 40.01  ? 139 MET A N   1 
ATOM   895  C CA  . MET A 1 143 ? 16.490  21.436 31.998  1.00 42.04  ? 139 MET A CA  1 
ATOM   896  C C   . MET A 1 143 ? 15.101  21.476 31.377  1.00 40.88  ? 139 MET A C   1 
ATOM   897  O O   . MET A 1 143 ? 14.732  20.556 30.643  1.00 40.81  ? 139 MET A O   1 
ATOM   898  C CB  . MET A 1 143 ? 17.438  22.180 31.075  1.00 41.72  ? 139 MET A CB  1 
ATOM   899  C CG  . MET A 1 143 ? 17.597  21.479 29.717  1.00 45.37  ? 139 MET A CG  1 
ATOM   900  S SD  . MET A 1 143 ? 18.673  22.379 28.587  1.00 47.76  ? 139 MET A SD  1 
ATOM   901  C CE  . MET A 1 143 ? 17.645  23.834 28.299  1.00 47.29  ? 139 MET A CE  1 
ATOM   902  N N   . GLU A 1 144 ? 14.358  22.540 31.641  1.00 40.40  ? 140 GLU A N   1 
ATOM   903  C CA  . GLU A 1 144 ? 13.085  22.767 30.981  1.00 40.31  ? 140 GLU A CA  1 
ATOM   904  C C   . GLU A 1 144 ? 13.287  22.663 29.480  1.00 40.19  ? 140 GLU A C   1 
ATOM   905  O O   . GLU A 1 144 ? 14.188  23.256 28.966  1.00 40.01  ? 140 GLU A O   1 
ATOM   906  C CB  . GLU A 1 144 ? 12.450  24.120 31.370  1.00 39.42  ? 140 GLU A CB  1 
ATOM   907  C CG  . GLU A 1 144 ? 10.959  24.215 31.072  1.00 40.24  ? 140 GLU A CG  1 
ATOM   908  C CD  . GLU A 1 144 ? 10.285  25.546 31.409  1.00 42.17  ? 140 GLU A CD  1 
ATOM   909  O OE1 . GLU A 1 144 ? 10.867  26.396 32.052  1.00 44.54  ? 140 GLU A OE1 1 
ATOM   910  O OE2 . GLU A 1 144 ? 9.139   25.752 31.038  1.00 43.33  ? 140 GLU A OE2 1 
ATOM   911  N N   . ASN A 1 145 ? 12.431  21.901 28.807  1.00 39.78  ? 141 ASN A N   1 
ATOM   912  C CA  . ASN A 1 145 ? 12.641  21.569 27.403  1.00 39.43  ? 141 ASN A CA  1 
ATOM   913  C C   . ASN A 1 145 ? 13.842  20.652 27.201  1.00 38.34  ? 141 ASN A C   1 
ATOM   914  O O   . ASN A 1 145 ? 14.903  21.091 26.756  1.00 38.54  ? 141 ASN A O   1 
ATOM   915  C CB  . ASN A 1 145 ? 12.805  22.842 26.570  1.00 39.40  ? 141 ASN A CB  1 
ATOM   916  C CG  . ASN A 1 145 ? 12.513  22.618 25.099  1.00 40.25  ? 141 ASN A CG  1 
ATOM   917  O OD1 . ASN A 1 145 ? 12.294  21.488 24.663  1.00 39.41  ? 141 ASN A OD1 1 
ATOM   918  N ND2 . ASN A 1 145 ? 12.508  23.697 24.326  1.00 43.22  ? 141 ASN A ND2 1 
ATOM   919  N N   . PRO A 1 146 ? 13.669  19.376 27.530  1.00 37.69  ? 142 PRO A N   1 
ATOM   920  C CA  . PRO A 1 146 ? 12.530  18.600 27.030  1.00 36.65  ? 142 PRO A CA  1 
ATOM   921  C C   . PRO A 1 146 ? 11.479  18.374 28.112  1.00 36.42  ? 142 PRO A C   1 
ATOM   922  O O   . PRO A 1 146 ? 10.328  18.071 27.800  1.00 36.41  ? 142 PRO A O   1 
ATOM   923  C CB  . PRO A 1 146 ? 13.168  17.268 26.632  1.00 37.36  ? 142 PRO A CB  1 
ATOM   924  C CG  . PRO A 1 146 ? 14.354  17.146 27.521  1.00 37.63  ? 142 PRO A CG  1 
ATOM   925  C CD  . PRO A 1 146 ? 14.871  18.544 27.711  1.00 37.01  ? 142 PRO A CD  1 
ATOM   926  N N   . TRP A 1 147 ? 11.878  18.523 29.371  1.00 34.75  ? 143 TRP A N   1 
ATOM   927  C CA  . TRP A 1 147 ? 10.930  18.542 30.478  1.00 33.62  ? 143 TRP A CA  1 
ATOM   928  C C   . TRP A 1 147 ? 9.891   19.643 30.296  1.00 33.59  ? 143 TRP A C   1 
ATOM   929  O O   . TRP A 1 147 ? 10.207  20.737 29.827  1.00 34.25  ? 143 TRP A O   1 
ATOM   930  C CB  . TRP A 1 147 ? 11.663  18.726 31.809  1.00 31.01  ? 143 TRP A CB  1 
ATOM   931  C CG  . TRP A 1 147 ? 12.551  17.574 32.168  1.00 30.04  ? 143 TRP A CG  1 
ATOM   932  C CD1 . TRP A 1 147 ? 13.893  17.474 31.947  1.00 28.32  ? 143 TRP A CD1 1 
ATOM   933  C CD2 . TRP A 1 147 ? 12.159  16.357 32.814  1.00 27.44  ? 143 TRP A CD2 1 
ATOM   934  N NE1 . TRP A 1 147 ? 14.362  16.270 32.414  1.00 27.02  ? 143 TRP A NE1 1 
ATOM   935  C CE2 . TRP A 1 147 ? 13.317  15.566 32.952  1.00 25.71  ? 143 TRP A CE2 1 
ATOM   936  C CE3 . TRP A 1 147 ? 10.942  15.859 33.290  1.00 25.71  ? 143 TRP A CE3 1 
ATOM   937  C CZ2 . TRP A 1 147 ? 13.294  14.305 33.544  1.00 26.14  ? 143 TRP A CZ2 1 
ATOM   938  C CZ3 . TRP A 1 147 ? 10.921  14.607 33.878  1.00 28.68  ? 143 TRP A CZ3 1 
ATOM   939  C CH2 . TRP A 1 147 ? 12.089  13.845 34.000  1.00 28.91  ? 143 TRP A CH2 1 
ATOM   940  N N   . VAL A 1 148 ? 8.650   19.347 30.669  1.00 33.97  ? 144 VAL A N   1 
ATOM   941  C CA  . VAL A 1 148 ? 7.591   20.356 30.686  1.00 34.66  ? 144 VAL A CA  1 
ATOM   942  C C   . VAL A 1 148 ? 7.210   20.645 32.145  1.00 34.48  ? 144 VAL A C   1 
ATOM   943  O O   . VAL A 1 148 ? 6.858   19.744 32.902  1.00 32.59  ? 144 VAL A O   1 
ATOM   944  C CB  . VAL A 1 148 ? 6.388   20.041 29.693  1.00 35.31  ? 144 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 148 ? 6.323   18.598 29.353  1.00 37.54  ? 144 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 148 ? 5.033   20.561 30.195  1.00 34.01  ? 144 VAL A CG2 1 
ATOM   947  N N   . LYS A 1 149 ? 7.380   21.915 32.507  1.00 35.63  ? 145 LYS A N   1 
ATOM   948  C CA  . LYS A 1 149 ? 7.051   22.468 33.841  1.00 36.80  ? 145 LYS A CA  1 
ATOM   949  C C   . LYS A 1 149 ? 5.590   22.339 34.110  1.00 35.93  ? 145 LYS A C   1 
ATOM   950  O O   . LYS A 1 149 ? 4.799   22.707 33.268  1.00 35.65  ? 145 LYS A O   1 
ATOM   951  C CB  . LYS A 1 149 ? 7.420   23.961 33.926  1.00 36.74  ? 145 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 149 ? 7.351   24.560 35.344  1.00 37.15  ? 145 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 149 ? 8.284   25.779 35.425  1.00 38.89  ? 145 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 149 ? 8.129   26.621 36.694  1.00 41.38  ? 145 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 149 ? 9.486   27.266 37.030  1.00 45.96  ? 145 LYS A NZ  1 
ATOM   956  N N   . VAL A 1 150 ? 5.248   21.772 35.263  1.00 36.09  ? 146 VAL A N   1 
ATOM   957  C CA  . VAL A 1 150 ? 3.863   21.703 35.727  1.00 36.21  ? 146 VAL A CA  1 
ATOM   958  C C   . VAL A 1 150 ? 3.610   22.962 36.560  1.00 35.72  ? 146 VAL A C   1 
ATOM   959  O O   . VAL A 1 150 ? 2.757   23.748 36.225  1.00 35.85  ? 146 VAL A O   1 
ATOM   960  C CB  . VAL A 1 150 ? 3.573   20.417 36.530  1.00 36.68  ? 146 VAL A CB  1 
ATOM   961  C CG1 . VAL A 1 150 ? 2.156   20.449 37.135  1.00 37.31  ? 146 VAL A CG1 1 
ATOM   962  C CG2 . VAL A 1 150 ? 3.782   19.151 35.644  1.00 36.35  ? 146 VAL A CG2 1 
ATOM   963  N N   . ASP A 1 151 ? 4.393   23.186 37.605  1.00 35.36  ? 147 ASP A N   1 
ATOM   964  C CA  . ASP A 1 151 ? 4.251   24.383 38.411  1.00 35.09  ? 147 ASP A CA  1 
ATOM   965  C C   . ASP A 1 151 ? 5.417   24.547 39.377  1.00 35.08  ? 147 ASP A C   1 
ATOM   966  O O   . ASP A 1 151 ? 6.147   23.600 39.651  1.00 35.21  ? 147 ASP A O   1 
ATOM   967  C CB  . ASP A 1 151 ? 2.921   24.317 39.183  1.00 34.91  ? 147 ASP A CB  1 
ATOM   968  C CG  . ASP A 1 151 ? 2.441   25.685 39.696  1.00 35.58  ? 147 ASP A CG  1 
ATOM   969  O OD1 . ASP A 1 151 ? 3.018   26.720 39.286  1.00 32.40  ? 147 ASP A OD1 1 
ATOM   970  O OD2 . ASP A 1 151 ? 1.492   25.716 40.536  1.00 35.16  ? 147 ASP A OD2 1 
ATOM   971  N N   . THR A 1 152 ? 5.606   25.772 39.861  1.00 35.38  ? 148 THR A N   1 
ATOM   972  C CA  . THR A 1 152 ? 6.438   26.033 41.043  1.00 35.60  ? 148 THR A CA  1 
ATOM   973  C C   . THR A 1 152 ? 5.638   25.731 42.298  1.00 35.88  ? 148 THR A C   1 
ATOM   974  O O   . THR A 1 152 ? 4.556   26.303 42.467  1.00 36.92  ? 148 THR A O   1 
ATOM   975  C CB  . THR A 1 152 ? 6.902   27.464 41.081  1.00 35.00  ? 148 THR A CB  1 
ATOM   976  O OG1 . THR A 1 152 ? 7.811   27.665 40.005  1.00 35.22  ? 148 THR A OG1 1 
ATOM   977  C CG2 . THR A 1 152 ? 7.638   27.780 42.381  1.00 35.84  ? 148 THR A CG2 1 
ATOM   978  N N   . ILE A 1 153 ? 6.169   24.849 43.157  1.00 35.46  ? 149 ILE A N   1 
ATOM   979  C CA  . ILE A 1 153 ? 5.461   24.317 44.325  1.00 34.87  ? 149 ILE A CA  1 
ATOM   980  C C   . ILE A 1 153 ? 6.001   25.022 45.560  1.00 35.78  ? 149 ILE A C   1 
ATOM   981  O O   . ILE A 1 153 ? 7.212   25.229 45.697  1.00 35.45  ? 149 ILE A O   1 
ATOM   982  C CB  . ILE A 1 153 ? 5.604   22.772 44.444  1.00 34.98  ? 149 ILE A CB  1 
ATOM   983  C CG1 . ILE A 1 153 ? 5.275   22.072 43.114  1.00 33.44  ? 149 ILE A CG1 1 
ATOM   984  C CG2 . ILE A 1 153 ? 4.717   22.193 45.556  1.00 35.06  ? 149 ILE A CG2 1 
ATOM   985  C CD1 . ILE A 1 153 ? 3.818   22.083 42.743  1.00 32.37  ? 149 ILE A CD1 1 
ATOM   986  N N   . ALA A 1 154 ? 5.067   25.444 46.414  1.00 36.66  ? 150 ALA A N   1 
ATOM   987  C CA  . ALA A 1 154 ? 5.326   26.143 47.674  1.00 37.47  ? 150 ALA A CA  1 
ATOM   988  C C   . ALA A 1 154 ? 4.484   25.579 48.782  1.00 38.06  ? 150 ALA A C   1 
ATOM   989  O O   . ALA A 1 154 ? 3.493   24.928 48.551  1.00 37.58  ? 150 ALA A O   1 
ATOM   990  C CB  . ALA A 1 154 ? 5.033   27.611 47.545  1.00 37.51  ? 150 ALA A CB  1 
ATOM   991  N N   . ALA A 1 155 ? 4.892   25.838 50.011  1.00 40.23  ? 151 ALA A N   1 
ATOM   992  C CA  . ALA A 1 155 ? 4.145   25.363 51.174  1.00 41.53  ? 151 ALA A CA  1 
ATOM   993  C C   . ALA A 1 155 ? 2.882   26.227 51.399  1.00 41.93  ? 151 ALA A C   1 
ATOM   994  O O   . ALA A 1 155 ? 3.006   27.439 51.512  1.00 41.55  ? 151 ALA A O   1 
ATOM   995  C CB  . ALA A 1 155 ? 5.054   25.367 52.421  1.00 41.36  ? 151 ALA A CB  1 
ATOM   996  N N   . ASP A 1 156 ? 1.689   25.595 51.449  1.00 42.95  ? 152 ASP A N   1 
ATOM   997  C CA  . ASP A 1 156 ? 0.424   26.296 51.831  1.00 43.26  ? 152 ASP A CA  1 
ATOM   998  C C   . ASP A 1 156 ? 0.281   26.477 53.351  1.00 44.02  ? 152 ASP A C   1 
ATOM   999  O O   . ASP A 1 156 ? 1.191   26.105 54.141  1.00 44.17  ? 152 ASP A O   1 
ATOM   1000 C CB  . ASP A 1 156 ? -0.846  25.705 51.157  1.00 43.15  ? 152 ASP A CB  1 
ATOM   1001 C CG  . ASP A 1 156 ? -1.212  24.256 51.604  1.00 46.07  ? 152 ASP A CG  1 
ATOM   1002 O OD1 . ASP A 1 156 ? -0.661  23.697 52.585  1.00 48.97  ? 152 ASP A OD1 1 
ATOM   1003 O OD2 . ASP A 1 156 ? -2.106  23.653 50.937  1.00 47.50  ? 152 ASP A OD2 1 
ATOM   1004 N N   . GLU A 1 157 ? -0.822  27.110 53.764  1.00 44.57  ? 153 GLU A N   1 
ATOM   1005 C CA  . GLU A 1 157 ? -1.027  27.425 55.176  1.00 44.55  ? 153 GLU A CA  1 
ATOM   1006 C C   . GLU A 1 157 ? -1.999  26.456 55.762  1.00 43.63  ? 153 GLU A C   1 
ATOM   1007 O O   . GLU A 1 157 ? -2.534  26.700 56.808  1.00 43.50  ? 153 GLU A O   1 
ATOM   1008 C CB  . GLU A 1 157 ? -1.435  28.891 55.380  1.00 45.16  ? 153 GLU A CB  1 
ATOM   1009 C CG  . GLU A 1 157 ? -0.219  29.888 55.392  1.00 47.04  ? 153 GLU A CG  1 
ATOM   1010 C CD  . GLU A 1 157 ? 0.592   29.891 56.734  1.00 51.03  ? 153 GLU A CD  1 
ATOM   1011 O OE1 . GLU A 1 157 ? 0.056   30.374 57.753  1.00 53.30  ? 153 GLU A OE1 1 
ATOM   1012 O OE2 . GLU A 1 157 ? 1.772   29.442 56.789  1.00 52.27  ? 153 GLU A OE2 1 
ATOM   1013 N N   . SER A 1 158 ? -2.232  25.346 55.068  1.00 43.56  ? 154 SER A N   1 
ATOM   1014 C CA  . SER A 1 158 ? -2.870  24.169 55.671  1.00 44.28  ? 154 SER A CA  1 
ATOM   1015 C C   . SER A 1 158 ? -1.733  23.213 55.928  1.00 44.08  ? 154 SER A C   1 
ATOM   1016 O O   . SER A 1 158 ? -0.837  23.107 55.089  1.00 45.89  ? 154 SER A O   1 
ATOM   1017 C CB  . SER A 1 158 ? -3.872  23.487 54.744  1.00 44.03  ? 154 SER A CB  1 
ATOM   1018 O OG  . SER A 1 158 ? -5.133  24.108 54.792  1.00 45.73  ? 154 SER A OG  1 
ATOM   1019 N N   . PHE A 1 159 ? -1.744  22.548 57.074  1.00 42.91  ? 155 PHE A N   1 
ATOM   1020 C CA  . PHE A 1 159 ? -0.641  21.666 57.456  1.00 41.39  ? 155 PHE A CA  1 
ATOM   1021 C C   . PHE A 1 159 ? -0.916  20.994 58.786  1.00 41.38  ? 155 PHE A C   1 
ATOM   1022 O O   . PHE A 1 159 ? -1.948  21.217 59.430  1.00 40.19  ? 155 PHE A O   1 
ATOM   1023 C CB  . PHE A 1 159 ? 0.749   22.294 57.226  1.00 40.66  ? 155 PHE A CB  1 
ATOM   1024 C CG  . PHE A 1 159 ? 1.024   23.584 57.988  1.00 39.52  ? 155 PHE A CG  1 
ATOM   1025 C CD1 . PHE A 1 159 ? 1.354   23.560 59.354  1.00 36.41  ? 155 PHE A CD1 1 
ATOM   1026 C CD2 . PHE A 1 159 ? 1.028   24.805 57.336  1.00 38.78  ? 155 PHE A CD2 1 
ATOM   1027 C CE1 . PHE A 1 159 ? 1.632   24.722 60.042  1.00 35.26  ? 155 PHE A CE1 1 
ATOM   1028 C CE2 . PHE A 1 159 ? 1.338   25.992 58.033  1.00 36.80  ? 155 PHE A CE2 1 
ATOM   1029 C CZ  . PHE A 1 159 ? 1.621   25.943 59.387  1.00 36.71  ? 155 PHE A CZ  1 
ATOM   1030 N N   . SER A 1 160 ? -0.009  20.075 59.108  1.00 41.84  ? 156 SER A N   1 
ATOM   1031 C CA  . SER A 1 160 ? 0.091   19.444 60.421  1.00 41.02  ? 156 SER A CA  1 
ATOM   1032 C C   . SER A 1 160 ? 1.517   19.797 60.827  1.00 39.65  ? 156 SER A C   1 
ATOM   1033 O O   . SER A 1 160 ? 2.423   19.845 59.999  1.00 39.62  ? 156 SER A O   1 
ATOM   1034 C CB  . SER A 1 160 ? -0.061  17.920 60.379  1.00 42.11  ? 156 SER A CB  1 
ATOM   1035 N N   . GLN A 1 161 ? 1.692   20.099 62.101  1.00 38.14  ? 157 GLN A N   1 
ATOM   1036 C CA  . GLN A 1 161 ? 3.001   20.406 62.638  1.00 35.99  ? 157 GLN A CA  1 
ATOM   1037 C C   . GLN A 1 161 ? 3.148   19.654 63.961  1.00 35.44  ? 157 GLN A C   1 
ATOM   1038 O O   . GLN A 1 161 ? 2.284   19.702 64.810  1.00 34.89  ? 157 GLN A O   1 
ATOM   1039 C CB  . GLN A 1 161 ? 3.117   21.899 62.851  1.00 35.35  ? 157 GLN A CB  1 
ATOM   1040 C CG  . GLN A 1 161 ? 4.420   22.312 63.387  1.00 35.15  ? 157 GLN A CG  1 
ATOM   1041 C CD  . GLN A 1 161 ? 4.632   23.808 63.363  1.00 33.30  ? 157 GLN A CD  1 
ATOM   1042 O OE1 . GLN A 1 161 ? 4.836   24.422 64.404  1.00 29.72  ? 157 GLN A OE1 1 
ATOM   1043 N NE2 . GLN A 1 161 ? 4.593   24.398 62.177  1.00 30.28  ? 157 GLN A NE2 1 
ATOM   1044 N N   . VAL A 1 162 ? 4.238   18.943 64.133  1.00 34.91  ? 158 VAL A N   1 
ATOM   1045 C CA  . VAL A 1 162 ? 4.503   18.340 65.437  1.00 34.84  ? 158 VAL A CA  1 
ATOM   1046 C C   . VAL A 1 162 ? 5.907   18.688 65.924  1.00 34.52  ? 158 VAL A C   1 
ATOM   1047 O O   . VAL A 1 162 ? 6.761   19.081 65.145  1.00 33.98  ? 158 VAL A O   1 
ATOM   1048 C CB  . VAL A 1 162 ? 4.293   16.801 65.396  1.00 34.64  ? 158 VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 162 ? 2.836   16.511 65.228  1.00 35.40  ? 158 VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 162 ? 5.083   16.163 64.250  1.00 33.74  ? 158 VAL A CG2 1 
ATOM   1051 N N   . ASP A 1 163 ? 6.115   18.515 67.219  1.00 35.36  ? 159 ASP A N   1 
ATOM   1052 C CA  . ASP A 1 163 ? 7.347   18.887 67.942  1.00 36.39  ? 159 ASP A CA  1 
ATOM   1053 C C   . ASP A 1 163 ? 8.149   17.604 68.127  1.00 36.08  ? 159 ASP A C   1 
ATOM   1054 O O   . ASP A 1 163 ? 7.739   16.748 68.904  1.00 37.14  ? 159 ASP A O   1 
ATOM   1055 C CB  . ASP A 1 163 ? 6.936   19.435 69.308  1.00 37.60  ? 159 ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 163 ? 8.095   20.005 70.119  1.00 41.14  ? 159 ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 163 ? 8.817   20.894 69.558  1.00 40.54  ? 159 ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 163 ? 8.213   19.593 71.339  1.00 43.72  ? 159 ASP A OD2 1 
ATOM   1059 N N   . LEU A 1 164 ? 9.225   17.429 67.350  1.00 35.13  ? 160 LEU A N   1 
ATOM   1060 C CA  . LEU A 1 164 ? 10.139  16.260 67.481  1.00 35.14  ? 160 LEU A CA  1 
ATOM   1061 C C   . LEU A 1 164 ? 11.232  16.736 68.420  1.00 34.96  ? 160 LEU A C   1 
ATOM   1062 O O   . LEU A 1 164 ? 12.335  17.033 68.005  1.00 35.04  ? 160 LEU A O   1 
ATOM   1063 C CB  . LEU A 1 164 ? 10.716  15.917 66.117  1.00 34.61  ? 160 LEU A CB  1 
ATOM   1064 C CG  . LEU A 1 164 ? 9.742   15.472 65.037  1.00 34.91  ? 160 LEU A CG  1 
ATOM   1065 C CD1 . LEU A 1 164 ? 10.513  15.002 63.785  1.00 34.56  ? 160 LEU A CD1 1 
ATOM   1066 C CD2 . LEU A 1 164 ? 8.855   14.364 65.567  1.00 35.28  ? 160 LEU A CD2 1 
ATOM   1067 N N   . GLY A 1 165 ? 10.886  16.840 69.691  1.00 35.50  ? 161 GLY A N   1 
ATOM   1068 C CA  . GLY A 1 165 ? 11.093  18.109 70.393  1.00 36.62  ? 161 GLY A CA  1 
ATOM   1069 C C   . GLY A 1 165 ? 12.503  18.495 70.650  1.00 36.57  ? 161 GLY A C   1 
ATOM   1070 O O   . GLY A 1 165 ? 13.275  17.641 70.990  1.00 38.56  ? 161 GLY A O   1 
ATOM   1071 N N   . GLY A 1 166 ? 12.883  19.749 70.491  1.00 36.92  ? 162 GLY A N   1 
ATOM   1072 C CA  . GLY A 1 166 ? 12.053  20.851 70.009  1.00 36.32  ? 162 GLY A CA  1 
ATOM   1073 C C   . GLY A 1 166 ? 12.491  21.268 68.612  1.00 36.60  ? 162 GLY A C   1 
ATOM   1074 O O   . GLY A 1 166 ? 12.908  22.388 68.400  1.00 36.02  ? 162 GLY A O   1 
ATOM   1075 N N   . ARG A 1 167 ? 12.409  20.334 67.653  1.00 36.23  ? 163 ARG A N   1 
ATOM   1076 C CA  . ARG A 1 167 ? 12.454  20.679 66.228  1.00 35.98  ? 163 ARG A CA  1 
ATOM   1077 C C   . ARG A 1 167 ? 11.067  20.376 65.676  1.00 33.45  ? 163 ARG A C   1 
ATOM   1078 O O   . ARG A 1 167 ? 10.523  19.328 65.979  1.00 33.12  ? 163 ARG A O   1 
ATOM   1079 C CB  . ARG A 1 167 ? 13.534  19.873 65.507  1.00 35.44  ? 163 ARG A CB  1 
ATOM   1080 C CG  . ARG A 1 167 ? 14.911  20.452 65.703  1.00 38.49  ? 163 ARG A CG  1 
ATOM   1081 C CD  . ARG A 1 167 ? 16.034  19.430 65.549  1.00 40.12  ? 163 ARG A CD  1 
ATOM   1082 N NE  . ARG A 1 167 ? 17.040  19.687 66.571  1.00 45.31  ? 163 ARG A NE  1 
ATOM   1083 C CZ  . ARG A 1 167 ? 16.931  19.292 67.847  1.00 47.25  ? 163 ARG A CZ  1 
ATOM   1084 N NH1 . ARG A 1 167 ? 15.898  18.548 68.266  1.00 49.16  ? 163 ARG A NH1 1 
ATOM   1085 N NH2 . ARG A 1 167 ? 17.883  19.604 68.713  1.00 45.76  ? 163 ARG A NH2 1 
ATOM   1086 N N   . VAL A 1 168 ? 10.474  21.298 64.914  1.00 32.47  ? 164 VAL A N   1 
ATOM   1087 C CA  . VAL A 1 168 ? 9.086   21.070 64.433  1.00 32.74  ? 164 VAL A CA  1 
ATOM   1088 C C   . VAL A 1 168 ? 9.103   20.382 63.078  1.00 31.92  ? 164 VAL A C   1 
ATOM   1089 O O   . VAL A 1 168 ? 9.825   20.768 62.206  1.00 31.94  ? 164 VAL A O   1 
ATOM   1090 C CB  . VAL A 1 168 ? 8.169   22.346 64.372  1.00 31.84  ? 164 VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 168 ? 8.267   23.142 65.617  1.00 32.75  ? 164 VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 168 ? 8.496   23.191 63.224  1.00 33.07  ? 164 VAL A CG2 1 
ATOM   1093 N N   . MET A 1 169 ? 8.330   19.333 62.940  1.00 32.50  ? 165 MET A N   1 
ATOM   1094 C CA  . MET A 1 169 ? 8.128   18.751 61.656  1.00 33.13  ? 165 MET A CA  1 
ATOM   1095 C C   . MET A 1 169 ? 6.794   19.180 61.080  1.00 33.38  ? 165 MET A C   1 
ATOM   1096 O O   . MET A 1 169 ? 5.718   18.806 61.579  1.00 33.26  ? 165 MET A O   1 
ATOM   1097 C CB  . MET A 1 169 ? 8.185   17.232 61.690  1.00 33.30  ? 165 MET A CB  1 
ATOM   1098 C CG  . MET A 1 169 ? 8.236   16.696 60.242  1.00 34.05  ? 165 MET A CG  1 
ATOM   1099 S SD  . MET A 1 169 ? 8.407   14.960 60.182  1.00 33.26  ? 165 MET A SD  1 
ATOM   1100 C CE  . MET A 1 169 ? 6.932   14.420 61.064  1.00 34.59  ? 165 MET A CE  1 
ATOM   1101 N N   . LYS A 1 170 ? 6.894   19.923 59.990  1.00 33.80  ? 166 LYS A N   1 
ATOM   1102 C CA  . LYS A 1 170 ? 5.735   20.435 59.265  1.00 34.05  ? 166 LYS A CA  1 
ATOM   1103 C C   . LYS A 1 170 ? 5.722   19.858 57.832  1.00 34.20  ? 166 LYS A C   1 
ATOM   1104 O O   . LYS A 1 170 ? 6.645   20.153 57.022  1.00 33.76  ? 166 LYS A O   1 
ATOM   1105 C CB  . LYS A 1 170 ? 5.831   21.957 59.210  1.00 33.67  ? 166 LYS A CB  1 
ATOM   1106 C CG  . LYS A 1 170 ? 4.540   22.594 58.794  1.00 33.32  ? 166 LYS A CG  1 
ATOM   1107 C CD  . LYS A 1 170 ? 4.733   23.650 57.775  1.00 31.92  ? 166 LYS A CD  1 
ATOM   1108 C CE  . LYS A 1 170 ? 5.342   24.852 58.330  1.00 29.33  ? 166 LYS A CE  1 
ATOM   1109 N NZ  . LYS A 1 170 ? 4.807   25.995 57.572  1.00 32.26  ? 166 LYS A NZ  1 
ATOM   1110 N N   . ILE A 1 171 ? 4.684   19.048 57.572  1.00 34.11  ? 167 ILE A N   1 
ATOM   1111 C CA  . ILE A 1 171 ? 4.407   18.412 56.281  1.00 33.90  ? 167 ILE A CA  1 
ATOM   1112 C C   . ILE A 1 171 ? 3.243   19.083 55.519  1.00 34.05  ? 167 ILE A C   1 
ATOM   1113 O O   . ILE A 1 171 ? 2.113   19.019 55.947  1.00 33.70  ? 167 ILE A O   1 
ATOM   1114 C CB  . ILE A 1 171 ? 4.069   16.936 56.448  1.00 32.94  ? 167 ILE A CB  1 
ATOM   1115 C CG1 . ILE A 1 171 ? 5.236   16.177 57.111  1.00 33.54  ? 167 ILE A CG1 1 
ATOM   1116 C CG2 . ILE A 1 171 ? 3.763   16.320 55.095  1.00 32.75  ? 167 ILE A CG2 1 
ATOM   1117 C CD1 . ILE A 1 171 ? 4.928   14.725 57.405  1.00 34.79  ? 167 ILE A CD1 1 
ATOM   1118 N N   . ASN A 1 172 ? 3.541   19.699 54.373  1.00 34.33  ? 168 ASN A N   1 
ATOM   1119 C CA  . ASN A 1 172 ? 2.522   20.177 53.461  1.00 34.87  ? 168 ASN A CA  1 
ATOM   1120 C C   . ASN A 1 172 ? 2.141   19.202 52.386  1.00 34.64  ? 168 ASN A C   1 
ATOM   1121 O O   . ASN A 1 172 ? 2.931   18.368 52.016  1.00 35.99  ? 168 ASN A O   1 
ATOM   1122 C CB  . ASN A 1 172 ? 2.996   21.442 52.813  1.00 35.26  ? 168 ASN A CB  1 
ATOM   1123 C CG  . ASN A 1 172 ? 3.123   22.542 53.797  1.00 36.85  ? 168 ASN A CG  1 
ATOM   1124 O OD1 . ASN A 1 172 ? 4.230   22.860 54.274  1.00 36.70  ? 168 ASN A OD1 1 
ATOM   1125 N ND2 . ASN A 1 172 ? 1.974   23.106 54.175  1.00 40.47  ? 168 ASN A ND2 1 
ATOM   1126 N N   . THR A 1 173 ? 0.917   19.328 51.891  1.00 34.47  ? 169 THR A N   1 
ATOM   1127 C CA  . THR A 1 173 ? 0.395   18.539 50.787  1.00 33.73  ? 169 THR A CA  1 
ATOM   1128 C C   . THR A 1 173 ? -0.106  19.476 49.679  1.00 34.37  ? 169 THR A C   1 
ATOM   1129 O O   . THR A 1 173 ? -0.812  20.469 49.937  1.00 32.88  ? 169 THR A O   1 
ATOM   1130 C CB  . THR A 1 173 ? -0.760  17.665 51.236  1.00 34.12  ? 169 THR A CB  1 
ATOM   1131 O OG1 . THR A 1 173 ? -0.351  16.867 52.370  1.00 33.32  ? 169 THR A OG1 1 
ATOM   1132 C CG2 . THR A 1 173 ? -1.255  16.733 50.078  1.00 33.19  ? 169 THR A CG2 1 
ATOM   1133 N N   . GLU A 1 174 ? 0.312   19.150 48.454  1.00 34.22  ? 170 GLU A N   1 
ATOM   1134 C CA  . GLU A 1 174 ? -0.043  19.858 47.264  1.00 34.11  ? 170 GLU A CA  1 
ATOM   1135 C C   . GLU A 1 174 ? -0.341  18.825 46.202  1.00 34.56  ? 170 GLU A C   1 
ATOM   1136 O O   . GLU A 1 174 ? 0.353   17.790 46.086  1.00 33.94  ? 170 GLU A O   1 
ATOM   1137 C CB  . GLU A 1 174 ? 1.106   20.762 46.809  1.00 34.33  ? 170 GLU A CB  1 
ATOM   1138 C CG  . GLU A 1 174 ? 1.261   22.028 47.638  1.00 35.08  ? 170 GLU A CG  1 
ATOM   1139 C CD  . GLU A 1 174 ? 0.093   23.006 47.426  1.00 36.76  ? 170 GLU A CD  1 
ATOM   1140 O OE1 . GLU A 1 174 ? -0.429  23.562 48.417  1.00 35.00  ? 170 GLU A OE1 1 
ATOM   1141 O OE2 . GLU A 1 174 ? -0.297  23.223 46.261  1.00 33.92  ? 170 GLU A OE2 1 
ATOM   1142 N N   . VAL A 1 175 ? -1.391  19.092 45.435  1.00 34.47  ? 171 VAL A N   1 
ATOM   1143 C CA  . VAL A 1 175 ? -1.695  18.313 44.251  1.00 34.28  ? 171 VAL A CA  1 
ATOM   1144 C C   . VAL A 1 175 ? -1.620  19.226 43.020  1.00 35.30  ? 171 VAL A C   1 
ATOM   1145 O O   . VAL A 1 175 ? -2.032  20.384 43.064  1.00 33.96  ? 171 VAL A O   1 
ATOM   1146 C CB  . VAL A 1 175 ? -3.062  17.614 44.379  1.00 33.77  ? 171 VAL A CB  1 
ATOM   1147 C CG1 . VAL A 1 175 ? -3.341  16.746 43.156  1.00 34.59  ? 171 VAL A CG1 1 
ATOM   1148 C CG2 . VAL A 1 175 ? -3.066  16.711 45.628  1.00 34.19  ? 171 VAL A CG2 1 
ATOM   1149 N N   . ARG A 1 176 ? -1.025  18.712 41.943  1.00 36.35  ? 172 ARG A N   1 
ATOM   1150 C CA  . ARG A 1 176 ? -1.065  19.353 40.636  1.00 36.95  ? 172 ARG A CA  1 
ATOM   1151 C C   . ARG A 1 176 ? -1.336  18.278 39.616  1.00 38.38  ? 172 ARG A C   1 
ATOM   1152 O O   . ARG A 1 176 ? -1.065  17.071 39.831  1.00 39.10  ? 172 ARG A O   1 
ATOM   1153 C CB  . ARG A 1 176 ? 0.272   19.981 40.284  1.00 37.31  ? 172 ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 176 ? 0.703   21.094 41.188  1.00 35.58  ? 172 ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 176 ? -0.030  22.368 40.879  1.00 32.71  ? 172 ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 176 ? 0.525   23.451 41.671  1.00 32.94  ? 172 ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 176 ? 0.322   23.573 42.986  1.00 33.54  ? 172 ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 176 ? -0.442  22.690 43.636  1.00 32.49  ? 172 ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 176 ? 0.872   24.585 43.644  1.00 32.20  ? 172 ARG A NH2 1 
ATOM   1160 N N   . SER A 1 177 ? -1.842  18.711 38.477  1.00 38.91  ? 173 SER A N   1 
ATOM   1161 C CA  . SER A 1 177 ? -2.250  17.762 37.481  1.00 39.52  ? 173 SER A CA  1 
ATOM   1162 C C   . SER A 1 177 ? -1.825  18.253 36.112  1.00 39.46  ? 173 SER A C   1 
ATOM   1163 O O   . SER A 1 177 ? -1.560  19.433 35.922  1.00 39.64  ? 173 SER A O   1 
ATOM   1164 C CB  . SER A 1 177 ? -3.753  17.472 37.610  1.00 39.59  ? 173 SER A CB  1 
ATOM   1165 O OG  . SER A 1 177 ? -4.534  18.590 37.272  1.00 41.13  ? 173 SER A OG  1 
ATOM   1166 N N   . PHE A 1 178 ? -1.683  17.317 35.193  1.00 39.50  ? 174 PHE A N   1 
ATOM   1167 C CA  . PHE A 1 178 ? -1.293  17.639 33.829  1.00 39.74  ? 174 PHE A CA  1 
ATOM   1168 C C   . PHE A 1 178 ? -1.831  16.606 32.862  1.00 39.80  ? 174 PHE A C   1 
ATOM   1169 O O   . PHE A 1 178 ? -2.272  15.524 33.243  1.00 39.23  ? 174 PHE A O   1 
ATOM   1170 C CB  . PHE A 1 178 ? 0.243   17.756 33.691  1.00 40.01  ? 174 PHE A CB  1 
ATOM   1171 C CG  . PHE A 1 178 ? 0.996   16.495 34.023  1.00 38.15  ? 174 PHE A CG  1 
ATOM   1172 C CD1 . PHE A 1 178 ? 1.347   16.213 35.327  1.00 38.39  ? 174 PHE A CD1 1 
ATOM   1173 C CD2 . PHE A 1 178 ? 1.373   15.612 33.028  1.00 39.11  ? 174 PHE A CD2 1 
ATOM   1174 C CE1 . PHE A 1 178 ? 2.051   15.059 35.632  1.00 38.70  ? 174 PHE A CE1 1 
ATOM   1175 C CE2 . PHE A 1 178 ? 2.070   14.453 33.323  1.00 37.53  ? 174 PHE A CE2 1 
ATOM   1176 C CZ  . PHE A 1 178 ? 2.400   14.177 34.634  1.00 39.65  ? 174 PHE A CZ  1 
ATOM   1177 N N   . GLY A 1 179 ? -1.787  16.974 31.599  1.00 40.47  ? 175 GLY A N   1 
ATOM   1178 C CA  . GLY A 1 179 ? -2.361  16.159 30.527  1.00 41.31  ? 175 GLY A CA  1 
ATOM   1179 C C   . GLY A 1 179 ? -2.693  17.009 29.297  1.00 41.19  ? 175 GLY A C   1 
ATOM   1180 O O   . GLY A 1 179 ? -2.462  18.224 29.306  1.00 41.19  ? 175 GLY A O   1 
ATOM   1181 N N   . PRO A 1 180 ? -3.241  16.381 28.238  1.00 41.10  ? 176 PRO A N   1 
ATOM   1182 C CA  . PRO A 1 180 ? -3.487  14.958 28.185  1.00 41.19  ? 176 PRO A CA  1 
ATOM   1183 C C   . PRO A 1 180 ? -2.176  14.225 27.916  1.00 41.46  ? 176 PRO A C   1 
ATOM   1184 O O   . PRO A 1 180 ? -1.271  14.762 27.246  1.00 41.04  ? 176 PRO A O   1 
ATOM   1185 C CB  . PRO A 1 180 ? -4.471  14.801 27.000  1.00 41.32  ? 176 PRO A CB  1 
ATOM   1186 C CG  . PRO A 1 180 ? -4.815  16.231 26.548  1.00 41.07  ? 176 PRO A CG  1 
ATOM   1187 C CD  . PRO A 1 180 ? -3.671  17.048 26.988  1.00 41.54  ? 176 PRO A CD  1 
ATOM   1188 N N   . VAL A 1 181 ? -2.084  13.015 28.445  1.00 41.05  ? 177 VAL A N   1 
ATOM   1189 C CA  . VAL A 1 181 ? -0.876  12.221 28.351  1.00 41.13  ? 177 VAL A CA  1 
ATOM   1190 C C   . VAL A 1 181 ? -1.150  11.051 27.381  1.00 40.59  ? 177 VAL A C   1 
ATOM   1191 O O   . VAL A 1 181 ? -2.204  10.417 27.432  1.00 40.81  ? 177 VAL A O   1 
ATOM   1192 C CB  . VAL A 1 181 ? -0.377  11.817 29.803  1.00 40.75  ? 177 VAL A CB  1 
ATOM   1193 C CG1 . VAL A 1 181 ? -1.253  10.758 30.463  1.00 41.76  ? 177 VAL A CG1 1 
ATOM   1194 C CG2 . VAL A 1 181 ? 1.009   11.350 29.779  1.00 41.12  ? 177 VAL A CG2 1 
ATOM   1195 N N   . SER A 1 182 ? -0.218  10.778 26.476  1.00 40.45  ? 178 SER A N   1 
ATOM   1196 C CA  . SER A 1 182 ? -0.520  9.881  25.356  1.00 40.43  ? 178 SER A CA  1 
ATOM   1197 C C   . SER A 1 182 ? 0.466   8.739  25.122  1.00 40.42  ? 178 SER A C   1 
ATOM   1198 O O   . SER A 1 182 ? 0.136   7.786  24.385  1.00 40.28  ? 178 SER A O   1 
ATOM   1199 C CB  . SER A 1 182 ? -0.680  10.707 24.061  1.00 40.51  ? 178 SER A CB  1 
ATOM   1200 O OG  . SER A 1 182 ? 0.393   11.654 23.872  1.00 40.90  ? 178 SER A OG  1 
ATOM   1201 N N   . ARG A 1 183 ? 1.655   8.785  25.732  1.00 39.50  ? 179 ARG A N   1 
ATOM   1202 C CA  . ARG A 1 183 ? 2.684   7.768  25.393  1.00 37.74  ? 179 ARG A CA  1 
ATOM   1203 C C   . ARG A 1 183 ? 2.754   6.602  26.369  1.00 37.09  ? 179 ARG A C   1 
ATOM   1204 O O   . ARG A 1 183 ? 1.985   6.545  27.337  1.00 36.33  ? 179 ARG A O   1 
ATOM   1205 C CB  . ARG A 1 183 ? 4.018   8.438  25.185  1.00 37.54  ? 179 ARG A CB  1 
ATOM   1206 C CG  . ARG A 1 183 ? 3.947   9.395  23.999  1.00 36.96  ? 179 ARG A CG  1 
ATOM   1207 C CD  . ARG A 1 183 ? 5.205   10.142 23.812  1.00 36.83  ? 179 ARG A CD  1 
ATOM   1208 N NE  . ARG A 1 183 ? 5.128   11.024 22.665  1.00 36.69  ? 179 ARG A NE  1 
ATOM   1209 C CZ  . ARG A 1 183 ? 5.240   10.645 21.397  1.00 36.95  ? 179 ARG A CZ  1 
ATOM   1210 N NH1 . ARG A 1 183 ? 5.453   9.371  21.070  1.00 36.83  ? 179 ARG A NH1 1 
ATOM   1211 N NH2 . ARG A 1 183 ? 5.146   11.564 20.453  1.00 36.52  ? 179 ARG A NH2 1 
ATOM   1212 N N   . SER A 1 184 ? 3.650   5.647  26.113  1.00 36.28  ? 180 SER A N   1 
ATOM   1213 C CA  A SER A 1 184 ? 3.663   4.427  26.912  0.50 36.30  ? 180 SER A CA  1 
ATOM   1214 C CA  B SER A 1 184 ? 3.710   4.421  26.914  0.50 36.00  ? 180 SER A CA  1 
ATOM   1215 C C   . SER A 1 184 ? 3.757   4.761  28.406  1.00 35.84  ? 180 SER A C   1 
ATOM   1216 O O   . SER A 1 184 ? 3.192   4.044  29.234  1.00 36.35  ? 180 SER A O   1 
ATOM   1217 C CB  A SER A 1 184 ? 4.815   3.510  26.502  0.50 36.50  ? 180 SER A CB  1 
ATOM   1218 C CB  B SER A 1 184 ? 4.940   3.573  26.548  0.50 36.17  ? 180 SER A CB  1 
ATOM   1219 O OG  A SER A 1 184 ? 6.022   3.952  27.093  0.50 36.64  ? 180 SER A OG  1 
ATOM   1220 O OG  B SER A 1 184 ? 4.953   3.169  25.187  0.50 34.34  ? 180 SER A OG  1 
ATOM   1221 N N   . GLY A 1 185 ? 4.465   5.845  28.729  1.00 34.77  ? 181 GLY A N   1 
ATOM   1222 C CA  . GLY A 1 185 ? 4.620   6.299  30.104  1.00 34.22  ? 181 GLY A CA  1 
ATOM   1223 C C   . GLY A 1 185 ? 5.287   7.664  30.219  1.00 33.36  ? 181 GLY A C   1 
ATOM   1224 O O   . GLY A 1 185 ? 5.444   8.376  29.231  1.00 33.08  ? 181 GLY A O   1 
ATOM   1225 N N   . PHE A 1 186 ? 5.658   8.029  31.444  1.00 32.48  ? 182 PHE A N   1 
ATOM   1226 C CA  . PHE A 1 186 ? 6.317   9.308  31.723  1.00 31.59  ? 182 PHE A CA  1 
ATOM   1227 C C   . PHE A 1 186 ? 7.216   9.229  32.962  1.00 31.26  ? 182 PHE A C   1 
ATOM   1228 O O   . PHE A 1 186 ? 7.190   8.232  33.720  1.00 31.02  ? 182 PHE A O   1 
ATOM   1229 C CB  . PHE A 1 186 ? 5.275   10.416 31.908  1.00 31.05  ? 182 PHE A CB  1 
ATOM   1230 C CG  . PHE A 1 186 ? 4.254   10.093 32.945  1.00 29.77  ? 182 PHE A CG  1 
ATOM   1231 C CD1 . PHE A 1 186 ? 4.407   10.538 34.257  1.00 30.82  ? 182 PHE A CD1 1 
ATOM   1232 C CD2 . PHE A 1 186 ? 3.173   9.331  32.632  1.00 30.86  ? 182 PHE A CD2 1 
ATOM   1233 C CE1 . PHE A 1 186 ? 3.511   10.198 35.231  1.00 31.50  ? 182 PHE A CE1 1 
ATOM   1234 C CE2 . PHE A 1 186 ? 2.233   8.988  33.607  1.00 31.62  ? 182 PHE A CE2 1 
ATOM   1235 C CZ  . PHE A 1 186 ? 2.401   9.436  34.907  1.00 30.59  ? 182 PHE A CZ  1 
ATOM   1236 N N   . TYR A 1 187 ? 7.999   10.301 33.124  1.00 31.53  ? 183 TYR A N   1 
ATOM   1237 C CA  . TYR A 1 187 ? 8.836   10.596 34.296  1.00 31.36  ? 183 TYR A CA  1 
ATOM   1238 C C   . TYR A 1 187 ? 8.398   11.912 34.914  1.00 30.79  ? 183 TYR A C   1 
ATOM   1239 O O   . TYR A 1 187 ? 7.957   12.808 34.176  1.00 29.83  ? 183 TYR A O   1 
ATOM   1240 C CB  . TYR A 1 187 ? 10.287  10.835 33.876  1.00 32.31  ? 183 TYR A CB  1 
ATOM   1241 C CG  . TYR A 1 187 ? 10.988  9.668  33.187  1.00 34.72  ? 183 TYR A CG  1 
ATOM   1242 C CD1 . TYR A 1 187 ? 11.684  8.706  33.932  1.00 33.66  ? 183 TYR A CD1 1 
ATOM   1243 C CD2 . TYR A 1 187 ? 10.991  9.562  31.781  1.00 33.96  ? 183 TYR A CD2 1 
ATOM   1244 C CE1 . TYR A 1 187 ? 12.321  7.649  33.310  1.00 35.24  ? 183 TYR A CE1 1 
ATOM   1245 C CE2 . TYR A 1 187 ? 11.644  8.518  31.139  1.00 35.54  ? 183 TYR A CE2 1 
ATOM   1246 C CZ  . TYR A 1 187 ? 12.313  7.561  31.901  1.00 35.76  ? 183 TYR A CZ  1 
ATOM   1247 O OH  . TYR A 1 187 ? 12.956  6.516  31.268  1.00 36.06  ? 183 TYR A OH  1 
ATOM   1248 N N   . LEU A 1 188 ? 8.596   12.052 36.244  1.00 29.97  ? 184 LEU A N   1 
ATOM   1249 C CA  . LEU A 1 188 ? 8.541   13.367 36.923  1.00 28.96  ? 184 LEU A CA  1 
ATOM   1250 C C   . LEU A 1 188 ? 9.950   13.838 37.256  1.00 28.55  ? 184 LEU A C   1 
ATOM   1251 O O   . LEU A 1 188 ? 10.863  13.040 37.404  1.00 27.75  ? 184 LEU A O   1 
ATOM   1252 C CB  . LEU A 1 188 ? 7.663   13.341 38.210  1.00 28.64  ? 184 LEU A CB  1 
ATOM   1253 C CG  . LEU A 1 188 ? 6.282   12.684 38.041  1.00 30.24  ? 184 LEU A CG  1 
ATOM   1254 C CD1 . LEU A 1 188 ? 5.378   12.839 39.278  1.00 31.52  ? 184 LEU A CD1 1 
ATOM   1255 C CD2 . LEU A 1 188 ? 5.564   13.250 36.833  1.00 30.93  ? 184 LEU A CD2 1 
ATOM   1256 N N   . ALA A 1 189 ? 10.118  15.146 37.349  1.00 28.16  ? 185 ALA A N   1 
ATOM   1257 C CA  . ALA A 1 189 ? 11.313  15.726 37.899  1.00 28.66  ? 185 ALA A CA  1 
ATOM   1258 C C   . ALA A 1 189 ? 10.975  16.819 38.899  1.00 28.90  ? 185 ALA A C   1 
ATOM   1259 O O   . ALA A 1 189 ? 10.001  17.566 38.743  1.00 29.85  ? 185 ALA A O   1 
ATOM   1260 C CB  . ALA A 1 189 ? 12.229  16.310 36.809  1.00 28.41  ? 185 ALA A CB  1 
ATOM   1261 N N   . PHE A 1 190 ? 11.840  16.903 39.891  1.00 28.79  ? 186 PHE A N   1 
ATOM   1262 C CA  . PHE A 1 190 ? 11.814  17.876 40.937  1.00 28.50  ? 186 PHE A CA  1 
ATOM   1263 C C   . PHE A 1 190 ? 13.137  18.632 40.902  1.00 28.61  ? 186 PHE A C   1 
ATOM   1264 O O   . PHE A 1 190 ? 14.179  18.030 40.951  1.00 30.25  ? 186 PHE A O   1 
ATOM   1265 C CB  . PHE A 1 190 ? 11.609  17.118 42.237  1.00 28.11  ? 186 PHE A CB  1 
ATOM   1266 C CG  . PHE A 1 190 ? 10.437  16.214 42.198  1.00 27.84  ? 186 PHE A CG  1 
ATOM   1267 C CD1 . PHE A 1 190 ? 10.569  14.908 41.838  1.00 29.25  ? 186 PHE A CD1 1 
ATOM   1268 C CD2 . PHE A 1 190 ? 9.158   16.698 42.491  1.00 30.53  ? 186 PHE A CD2 1 
ATOM   1269 C CE1 . PHE A 1 190 ? 9.470   14.096 41.780  1.00 28.99  ? 186 PHE A CE1 1 
ATOM   1270 C CE2 . PHE A 1 190 ? 8.066   15.890 42.432  1.00 27.85  ? 186 PHE A CE2 1 
ATOM   1271 C CZ  . PHE A 1 190 ? 8.222   14.592 42.077  1.00 29.00  ? 186 PHE A CZ  1 
ATOM   1272 N N   . GLN A 1 191 ? 13.080  19.948 40.786  1.00 29.46  ? 187 GLN A N   1 
ATOM   1273 C CA  . GLN A 1 191 ? 14.229  20.807 40.687  1.00 29.71  ? 187 GLN A CA  1 
ATOM   1274 C C   . GLN A 1 191 ? 14.301  21.776 41.880  1.00 30.59  ? 187 GLN A C   1 
ATOM   1275 O O   . GLN A 1 191 ? 13.350  22.513 42.118  1.00 31.64  ? 187 GLN A O   1 
ATOM   1276 C CB  . GLN A 1 191 ? 14.108  21.619 39.414  1.00 28.85  ? 187 GLN A CB  1 
ATOM   1277 C CG  . GLN A 1 191 ? 15.236  22.620 39.180  1.00 29.24  ? 187 GLN A CG  1 
ATOM   1278 C CD  . GLN A 1 191 ? 14.920  23.646 38.094  1.00 30.06  ? 187 GLN A CD  1 
ATOM   1279 O OE1 . GLN A 1 191 ? 13.759  23.944 37.833  1.00 33.27  ? 187 GLN A OE1 1 
ATOM   1280 N NE2 . GLN A 1 191 ? 15.953  24.171 37.446  1.00 31.14  ? 187 GLN A NE2 1 
ATOM   1281 N N   . ASP A 1 192 ? 15.438  21.795 42.584  1.00 31.05  ? 188 ASP A N   1 
ATOM   1282 C CA  . ASP A 1 192 ? 15.745  22.768 43.653  1.00 31.20  ? 188 ASP A CA  1 
ATOM   1283 C C   . ASP A 1 192 ? 16.757  23.799 43.142  1.00 31.82  ? 188 ASP A C   1 
ATOM   1284 O O   . ASP A 1 192 ? 17.598  23.520 42.302  1.00 31.96  ? 188 ASP A O   1 
ATOM   1285 C CB  . ASP A 1 192 ? 16.287  22.060 44.942  1.00 31.73  ? 188 ASP A CB  1 
ATOM   1286 C CG  . ASP A 1 192 ? 17.170  22.992 45.828  1.00 32.36  ? 188 ASP A CG  1 
ATOM   1287 O OD1 . ASP A 1 192 ? 16.626  23.801 46.641  1.00 34.78  ? 188 ASP A OD1 1 
ATOM   1288 O OD2 . ASP A 1 192 ? 18.420  22.948 45.687  1.00 29.84  ? 188 ASP A OD2 1 
ATOM   1289 N N   . TYR A 1 193 ? 16.689  25.009 43.659  1.00 32.81  ? 189 TYR A N   1 
ATOM   1290 C CA  . TYR A 1 193 ? 17.609  26.035 43.233  1.00 33.58  ? 189 TYR A CA  1 
ATOM   1291 C C   . TYR A 1 193 ? 18.064  26.880 44.446  1.00 32.84  ? 189 TYR A C   1 
ATOM   1292 O O   . TYR A 1 193 ? 18.156  28.064 44.376  1.00 33.15  ? 189 TYR A O   1 
ATOM   1293 C CB  . TYR A 1 193 ? 16.987  26.843 42.075  1.00 34.53  ? 189 TYR A CB  1 
ATOM   1294 C CG  . TYR A 1 193 ? 15.497  26.935 42.200  1.00 36.28  ? 189 TYR A CG  1 
ATOM   1295 C CD1 . TYR A 1 193 ? 14.901  27.775 43.144  1.00 38.55  ? 189 TYR A CD1 1 
ATOM   1296 C CD2 . TYR A 1 193 ? 14.677  26.146 41.427  1.00 36.51  ? 189 TYR A CD2 1 
ATOM   1297 C CE1 . TYR A 1 193 ? 13.497  27.836 43.287  1.00 38.33  ? 189 TYR A CE1 1 
ATOM   1298 C CE2 . TYR A 1 193 ? 13.304  26.190 41.557  1.00 38.09  ? 189 TYR A CE2 1 
ATOM   1299 C CZ  . TYR A 1 193 ? 12.707  27.031 42.479  1.00 38.34  ? 189 TYR A CZ  1 
ATOM   1300 O OH  . TYR A 1 193 ? 11.321  27.031 42.547  1.00 38.47  ? 189 TYR A OH  1 
ATOM   1301 N N   . GLY A 1 194 ? 18.372  26.213 45.552  1.00 33.28  ? 190 GLY A N   1 
ATOM   1302 C CA  . GLY A 1 194 ? 18.970  26.857 46.733  1.00 33.42  ? 190 GLY A CA  1 
ATOM   1303 C C   . GLY A 1 194 ? 18.100  26.903 47.987  1.00 33.18  ? 190 GLY A C   1 
ATOM   1304 O O   . GLY A 1 194 ? 18.237  27.795 48.800  1.00 34.90  ? 190 GLY A O   1 
ATOM   1305 N N   . GLY A 1 195 ? 17.214  25.946 48.162  1.00 32.95  ? 191 GLY A N   1 
ATOM   1306 C CA  . GLY A 1 195 ? 16.464  25.864 49.393  1.00 32.90  ? 191 GLY A CA  1 
ATOM   1307 C C   . GLY A 1 195 ? 16.826  24.665 50.224  1.00 32.45  ? 191 GLY A C   1 
ATOM   1308 O O   . GLY A 1 195 ? 17.851  24.013 50.015  1.00 32.64  ? 191 GLY A O   1 
ATOM   1309 N N   . CYS A 1 196 ? 15.948  24.359 51.169  1.00 31.80  ? 192 CYS A N   1 
ATOM   1310 C CA  . CYS A 1 196 ? 16.237  23.387 52.200  1.00 31.08  ? 192 CYS A CA  1 
ATOM   1311 C C   . CYS A 1 196 ? 14.949  22.679 52.454  1.00 30.70  ? 192 CYS A C   1 
ATOM   1312 O O   . CYS A 1 196 ? 14.050  23.267 53.053  1.00 31.57  ? 192 CYS A O   1 
ATOM   1313 C CB  . CYS A 1 196 ? 16.759  24.102 53.457  1.00 31.69  ? 192 CYS A CB  1 
ATOM   1314 S SG  . CYS A 1 196 ? 17.494  23.013 54.713  1.00 30.43  ? 192 CYS A SG  1 
ATOM   1315 N N   . MET A 1 197 ? 14.842  21.432 51.988  1.00 29.86  ? 193 MET A N   1 
ATOM   1316 C CA  . MET A 1 197 ? 13.595  20.747 51.984  1.00 30.26  ? 193 MET A CA  1 
ATOM   1317 C C   . MET A 1 197 ? 13.716  19.285 51.821  1.00 29.69  ? 193 MET A C   1 
ATOM   1318 O O   . MET A 1 197 ? 14.765  18.752 51.433  1.00 30.90  ? 193 MET A O   1 
ATOM   1319 C CB  . MET A 1 197 ? 12.703  21.258 50.844  1.00 30.68  ? 193 MET A CB  1 
ATOM   1320 C CG  . MET A 1 197 ? 13.044  20.773 49.439  1.00 31.68  ? 193 MET A CG  1 
ATOM   1321 S SD  . MET A 1 197 ? 12.423  21.873 48.147  1.00 34.63  ? 193 MET A SD  1 
ATOM   1322 C CE  . MET A 1 197 ? 13.409  23.338 48.350  1.00 33.51  ? 193 MET A CE  1 
ATOM   1323 N N   . SER A 1 198 ? 12.593  18.631 52.079  1.00 28.75  ? 194 SER A N   1 
ATOM   1324 C CA  . SER A 1 198 ? 12.481  17.225 51.913  1.00 28.17  ? 194 SER A CA  1 
ATOM   1325 C C   . SER A 1 198 ? 11.180  16.897 51.195  1.00 28.81  ? 194 SER A C   1 
ATOM   1326 O O   . SER A 1 198 ? 10.088  17.336 51.603  1.00 27.34  ? 194 SER A O   1 
ATOM   1327 C CB  . SER A 1 198 ? 12.563  16.523 53.273  1.00 28.64  ? 194 SER A CB  1 
ATOM   1328 O OG  . SER A 1 198 ? 12.057  15.234 53.138  1.00 25.27  ? 194 SER A OG  1 
ATOM   1329 N N   . LEU A 1 199 ? 11.324  16.134 50.105  1.00 29.11  ? 195 LEU A N   1 
ATOM   1330 C CA  . LEU A 1 199 ? 10.207  15.536 49.403  1.00 29.11  ? 195 LEU A CA  1 
ATOM   1331 C C   . LEU A 1 199 ? 9.908   14.147 50.025  1.00 28.77  ? 195 LEU A C   1 
ATOM   1332 O O   . LEU A 1 199 ? 10.643  13.188 49.845  1.00 29.56  ? 195 LEU A O   1 
ATOM   1333 C CB  . LEU A 1 199 ? 10.484  15.479 47.887  1.00 28.89  ? 195 LEU A CB  1 
ATOM   1334 C CG  . LEU A 1 199 ? 9.362   14.971 46.973  1.00 29.44  ? 195 LEU A CG  1 
ATOM   1335 C CD1 . LEU A 1 199 ? 8.206   15.965 46.855  1.00 30.58  ? 195 LEU A CD1 1 
ATOM   1336 C CD2 . LEU A 1 199 ? 9.862   14.695 45.612  1.00 29.86  ? 195 LEU A CD2 1 
ATOM   1337 N N   . ILE A 1 200 ? 8.805   14.080 50.767  1.00 28.04  ? 196 ILE A N   1 
ATOM   1338 C CA  . ILE A 1 200 ? 8.446   12.978 51.632  1.00 26.95  ? 196 ILE A CA  1 
ATOM   1339 C C   . ILE A 1 200 ? 7.662   11.919 50.892  1.00 27.62  ? 196 ILE A C   1 
ATOM   1340 O O   . ILE A 1 200 ? 7.782   10.724 51.157  1.00 27.95  ? 196 ILE A O   1 
ATOM   1341 C CB  . ILE A 1 200 ? 7.659   13.556 52.862  1.00 26.47  ? 196 ILE A CB  1 
ATOM   1342 C CG1 . ILE A 1 200 ? 8.626   14.306 53.755  1.00 26.96  ? 196 ILE A CG1 1 
ATOM   1343 C CG2 . ILE A 1 200 ? 6.990   12.492 53.678  1.00 24.72  ? 196 ILE A CG2 1 
ATOM   1344 C CD1 . ILE A 1 200 ? 7.980   15.270 54.673  1.00 29.17  ? 196 ILE A CD1 1 
ATOM   1345 N N   . ALA A 1 201 ? 6.848   12.348 49.946  1.00 28.40  ? 197 ALA A N   1 
ATOM   1346 C CA  . ALA A 1 201 ? 6.045   11.410 49.194  1.00 28.92  ? 197 ALA A CA  1 
ATOM   1347 C C   . ALA A 1 201 ? 5.536   11.996 47.896  1.00 28.86  ? 197 ALA A C   1 
ATOM   1348 O O   . ALA A 1 201 ? 5.248   13.182 47.785  1.00 30.02  ? 197 ALA A O   1 
ATOM   1349 C CB  . ALA A 1 201 ? 4.873   10.903 50.026  1.00 29.45  ? 197 ALA A CB  1 
ATOM   1350 N N   . VAL A 1 202 ? 5.446   11.109 46.924  1.00 29.11  ? 198 VAL A N   1 
ATOM   1351 C CA  . VAL A 1 202 ? 4.938   11.385 45.635  1.00 29.39  ? 198 VAL A CA  1 
ATOM   1352 C C   . VAL A 1 202 ? 3.972   10.252 45.343  1.00 29.77  ? 198 VAL A C   1 
ATOM   1353 O O   . VAL A 1 202 ? 4.320   9.103  45.399  1.00 28.42  ? 198 VAL A O   1 
ATOM   1354 C CB  . VAL A 1 202 ? 6.065   11.479 44.590  1.00 29.09  ? 198 VAL A CB  1 
ATOM   1355 C CG1 . VAL A 1 202 ? 5.513   12.012 43.299  1.00 30.50  ? 198 VAL A CG1 1 
ATOM   1356 C CG2 . VAL A 1 202 ? 7.125   12.420 45.067  1.00 28.90  ? 198 VAL A CG2 1 
ATOM   1357 N N   . ARG A 1 203 ? 2.721   10.612 45.105  1.00 31.90  ? 199 ARG A N   1 
ATOM   1358 C CA  . ARG A 1 203 ? 1.709   9.690  44.684  1.00 33.67  ? 199 ARG A CA  1 
ATOM   1359 C C   . ARG A 1 203 ? 1.163   10.189 43.355  1.00 34.63  ? 199 ARG A C   1 
ATOM   1360 O O   . ARG A 1 203 ? 0.706   11.335 43.239  1.00 35.28  ? 199 ARG A O   1 
ATOM   1361 C CB  . ARG A 1 203 ? 0.611   9.623  45.717  1.00 33.93  ? 199 ARG A CB  1 
ATOM   1362 C CG  . ARG A 1 203 ? -0.507  8.696  45.339  1.00 35.65  ? 199 ARG A CG  1 
ATOM   1363 C CD  . ARG A 1 203 ? -1.515  8.498  46.457  1.00 37.48  ? 199 ARG A CD  1 
ATOM   1364 N NE  . ARG A 1 203 ? -2.733  8.075  45.799  1.00 42.29  ? 199 ARG A NE  1 
ATOM   1365 C CZ  . ARG A 1 203 ? -3.855  8.790  45.726  1.00 42.47  ? 199 ARG A CZ  1 
ATOM   1366 N NH1 . ARG A 1 203 ? -3.995  9.949  46.368  1.00 41.31  ? 199 ARG A NH1 1 
ATOM   1367 N NH2 . ARG A 1 203 ? -4.864  8.299  45.018  1.00 43.83  ? 199 ARG A NH2 1 
ATOM   1368 N N   . VAL A 1 204 ? 1.231   9.333  42.348  1.00 35.90  ? 200 VAL A N   1 
ATOM   1369 C CA  . VAL A 1 204 ? 0.800   9.683  41.006  1.00 37.09  ? 200 VAL A CA  1 
ATOM   1370 C C   . VAL A 1 204 ? -0.440  8.835  40.716  1.00 38.32  ? 200 VAL A C   1 
ATOM   1371 O O   . VAL A 1 204 ? -0.429  7.606  40.861  1.00 37.05  ? 200 VAL A O   1 
ATOM   1372 C CB  . VAL A 1 204 ? 1.931   9.398  39.958  1.00 37.41  ? 200 VAL A CB  1 
ATOM   1373 C CG1 . VAL A 1 204 ? 1.546   9.908  38.546  1.00 37.02  ? 200 VAL A CG1 1 
ATOM   1374 C CG2 . VAL A 1 204 ? 3.282   9.989  40.436  1.00 35.47  ? 200 VAL A CG2 1 
ATOM   1375 N N   . PHE A 1 205 ? -1.520  9.493  40.335  1.00 39.99  ? 201 PHE A N   1 
ATOM   1376 C CA  . PHE A 1 205 ? -2.764  8.760  40.073  1.00 42.54  ? 201 PHE A CA  1 
ATOM   1377 C C   . PHE A 1 205 ? -3.601  9.376  38.919  1.00 43.38  ? 201 PHE A C   1 
ATOM   1378 O O   . PHE A 1 205 ? -3.276  10.459 38.407  1.00 42.65  ? 201 PHE A O   1 
ATOM   1379 C CB  . PHE A 1 205 ? -3.587  8.646  41.373  1.00 41.30  ? 201 PHE A CB  1 
ATOM   1380 C CG  . PHE A 1 205 ? -4.070  9.974  41.911  1.00 41.53  ? 201 PHE A CG  1 
ATOM   1381 C CD1 . PHE A 1 205 ? -3.234  10.786 42.663  1.00 40.60  ? 201 PHE A CD1 1 
ATOM   1382 C CD2 . PHE A 1 205 ? -5.359  10.413 41.649  1.00 41.04  ? 201 PHE A CD2 1 
ATOM   1383 C CE1 . PHE A 1 205 ? -3.669  12.012 43.146  1.00 39.66  ? 201 PHE A CE1 1 
ATOM   1384 C CE2 . PHE A 1 205 ? -5.796  11.620 42.136  1.00 41.13  ? 201 PHE A CE2 1 
ATOM   1385 C CZ  . PHE A 1 205 ? -4.942  12.430 42.885  1.00 40.00  ? 201 PHE A CZ  1 
ATOM   1386 N N   . TYR A 1 206 ? -4.634  8.637  38.499  1.00 45.96  ? 202 TYR A N   1 
ATOM   1387 C CA  . TYR A 1 206 ? -5.625  9.121  37.536  1.00 48.20  ? 202 TYR A CA  1 
ATOM   1388 C C   . TYR A 1 206 ? -7.094  8.783  37.907  1.00 49.88  ? 202 TYR A C   1 
ATOM   1389 O O   . TYR A 1 206 ? -7.370  7.924  38.764  1.00 49.56  ? 202 TYR A O   1 
ATOM   1390 C CB  . TYR A 1 206 ? -5.284  8.628  36.112  1.00 48.97  ? 202 TYR A CB  1 
ATOM   1391 C CG  . TYR A 1 206 ? -5.553  7.175  35.877  1.00 49.51  ? 202 TYR A CG  1 
ATOM   1392 C CD1 . TYR A 1 206 ? -4.686  6.218  36.342  1.00 51.29  ? 202 TYR A CD1 1 
ATOM   1393 C CD2 . TYR A 1 206 ? -6.675  6.752  35.163  1.00 51.78  ? 202 TYR A CD2 1 
ATOM   1394 C CE1 . TYR A 1 206 ? -4.929  4.865  36.125  1.00 51.13  ? 202 TYR A CE1 1 
ATOM   1395 C CE2 . TYR A 1 206 ? -6.927  5.400  34.942  1.00 50.53  ? 202 TYR A CE2 1 
ATOM   1396 C CZ  . TYR A 1 206 ? -6.061  4.471  35.435  1.00 50.42  ? 202 TYR A CZ  1 
ATOM   1397 O OH  . TYR A 1 206 ? -6.295  3.140  35.242  1.00 49.82  ? 202 TYR A OH  1 
ATOM   1398 N N   . ARG A 1 207 ? -8.004  9.529  37.261  1.00 51.85  ? 203 ARG A N   1 
ATOM   1399 C CA  . ARG A 1 207 ? -9.480  9.353  37.297  1.00 52.89  ? 203 ARG A CA  1 
ATOM   1400 C C   . ARG A 1 207 ? -10.115 9.567  38.683  1.00 53.67  ? 203 ARG A C   1 
ATOM   1401 O O   . ARG A 1 207 ? -10.333 10.724 39.122  1.00 54.51  ? 203 ARG A O   1 
ATOM   1402 C CB  . ARG A 1 207 ? -9.922  8.014  36.638  1.00 53.47  ? 203 ARG A CB  1 
ATOM   1403 C CG  . ARG A 1 207 ? -9.726  6.728  37.494  1.00 55.41  ? 203 ARG A CG  1 
ATOM   1404 C CD  . ARG A 1 207 ? -10.581 5.511  37.057  1.00 56.23  ? 203 ARG A CD  1 
ATOM   1405 N NE  . ARG A 1 207 ? -11.834 5.892  36.399  1.00 60.27  ? 203 ARG A NE  1 
ATOM   1406 C CZ  . ARG A 1 207 ? -12.831 6.583  36.964  1.00 62.23  ? 203 ARG A CZ  1 
ATOM   1407 N NH1 . ARG A 1 207 ? -12.764 7.001  38.232  1.00 64.12  ? 203 ARG A NH1 1 
ATOM   1408 N NH2 . ARG A 1 207 ? -13.916 6.869  36.245  1.00 62.71  ? 203 ARG A NH2 1 
ATOM   1409 N N   . GLU B 1 32  ? 19.584  23.690 2.717   1.00 54.81  ? 28  GLU B N   1 
ATOM   1410 C CA  . GLU B 1 32  ? 18.556  22.762 3.295   1.00 54.68  ? 28  GLU B CA  1 
ATOM   1411 C C   . GLU B 1 32  ? 18.928  21.308 3.116   1.00 54.18  ? 28  GLU B C   1 
ATOM   1412 O O   . GLU B 1 32  ? 19.322  20.891 2.018   1.00 54.89  ? 28  GLU B O   1 
ATOM   1413 C CB  . GLU B 1 32  ? 17.153  23.018 2.713   1.00 54.44  ? 28  GLU B CB  1 
ATOM   1414 C CG  . GLU B 1 32  ? 17.002  22.733 1.250   1.00 54.54  ? 28  GLU B CG  1 
ATOM   1415 C CD  . GLU B 1 32  ? 15.718  23.307 0.649   1.00 55.81  ? 28  GLU B CD  1 
ATOM   1416 O OE1 . GLU B 1 32  ? 15.193  24.338 1.127   1.00 57.67  ? 28  GLU B OE1 1 
ATOM   1417 O OE2 . GLU B 1 32  ? 15.226  22.716 -0.327  1.00 56.48  ? 28  GLU B OE2 1 
ATOM   1418 N N   . GLU B 1 33  ? 18.659  20.540 4.166   1.00 53.21  ? 29  GLU B N   1 
ATOM   1419 C CA  . GLU B 1 33  ? 19.124  19.184 4.307   1.00 52.37  ? 29  GLU B CA  1 
ATOM   1420 C C   . GLU B 1 33  ? 18.072  18.087 4.428   1.00 50.52  ? 29  GLU B C   1 
ATOM   1421 O O   . GLU B 1 33  ? 17.125  18.201 5.143   1.00 49.31  ? 29  GLU B O   1 
ATOM   1422 C CB  . GLU B 1 33  ? 20.130  19.089 5.425   1.00 52.17  ? 29  GLU B CB  1 
ATOM   1423 C CG  . GLU B 1 33  ? 21.374  18.412 4.980   1.00 54.09  ? 29  GLU B CG  1 
ATOM   1424 C CD  . GLU B 1 33  ? 22.112  17.725 6.085   1.00 54.77  ? 29  GLU B CD  1 
ATOM   1425 O OE1 . GLU B 1 33  ? 23.330  17.942 6.153   1.00 58.90  ? 29  GLU B OE1 1 
ATOM   1426 O OE2 . GLU B 1 33  ? 21.498  16.992 6.878   1.00 55.89  ? 29  GLU B OE2 1 
ATOM   1427 N N   . THR B 1 34  ? 18.284  17.004 3.687   1.00 48.99  ? 30  THR B N   1 
ATOM   1428 C CA  . THR B 1 34  ? 17.217  16.053 3.398   1.00 48.32  ? 30  THR B CA  1 
ATOM   1429 C C   . THR B 1 34  ? 17.141  14.969 4.468   1.00 47.07  ? 30  THR B C   1 
ATOM   1430 O O   . THR B 1 34  ? 18.147  14.344 4.805   1.00 46.68  ? 30  THR B O   1 
ATOM   1431 C CB  . THR B 1 34  ? 17.409  15.390 2.021   1.00 48.27  ? 30  THR B CB  1 
ATOM   1432 O OG1 . THR B 1 34  ? 17.245  16.371 0.989   1.00 48.75  ? 30  THR B OG1 1 
ATOM   1433 C CG2 . THR B 1 34  ? 16.395  14.275 1.821   1.00 49.04  ? 30  THR B CG2 1 
ATOM   1434 N N   . LEU B 1 35  ? 15.942  14.750 4.998   1.00 46.01  ? 31  LEU B N   1 
ATOM   1435 C CA  . LEU B 1 35  ? 15.738  13.758 6.047   1.00 44.93  ? 31  LEU B CA  1 
ATOM   1436 C C   . LEU B 1 35  ? 15.217  12.446 5.471   1.00 43.80  ? 31  LEU B C   1 
ATOM   1437 O O   . LEU B 1 35  ? 15.735  11.372 5.780   1.00 43.23  ? 31  LEU B O   1 
ATOM   1438 C CB  . LEU B 1 35  ? 14.768  14.289 7.104   1.00 44.80  ? 31  LEU B CB  1 
ATOM   1439 C CG  . LEU B 1 35  ? 15.399  14.875 8.369   1.00 45.17  ? 31  LEU B CG  1 
ATOM   1440 C CD1 . LEU B 1 35  ? 16.870  15.189 8.141   1.00 45.61  ? 31  LEU B CD1 1 
ATOM   1441 C CD2 . LEU B 1 35  ? 14.645  16.117 8.821   1.00 44.19  ? 31  LEU B CD2 1 
ATOM   1442 N N   . MET B 1 36  ? 14.191  12.539 4.632   1.00 42.44  ? 32  MET B N   1 
ATOM   1443 C CA  . MET B 1 36  ? 13.896  11.492 3.661   1.00 41.63  ? 32  MET B CA  1 
ATOM   1444 C C   . MET B 1 36  ? 13.727  12.070 2.261   1.00 40.60  ? 32  MET B C   1 
ATOM   1445 O O   . MET B 1 36  ? 13.490  13.267 2.097   1.00 40.23  ? 32  MET B O   1 
ATOM   1446 C CB  . MET B 1 36  ? 12.638  10.722 4.069   1.00 41.06  ? 32  MET B CB  1 
ATOM   1447 C CG  . MET B 1 36  ? 11.897  10.084 2.905   1.00 41.62  ? 32  MET B CG  1 
ATOM   1448 S SD  . MET B 1 36  ? 10.223  9.575  3.341   1.00 43.80  ? 32  MET B SD  1 
ATOM   1449 C CE  . MET B 1 36  ? 9.360   11.142 3.254   1.00 46.69  ? 32  MET B CE  1 
ATOM   1450 N N   . ASP B 1 37  ? 13.850  11.212 1.253   1.00 39.85  ? 33  ASP B N   1 
ATOM   1451 C CA  . ASP B 1 37  ? 13.353  11.522 -0.082  1.00 39.54  ? 33  ASP B CA  1 
ATOM   1452 C C   . ASP B 1 37  ? 12.929  10.257 -0.821  1.00 38.69  ? 33  ASP B C   1 
ATOM   1453 O O   . ASP B 1 37  ? 13.741  9.361  -1.052  1.00 39.33  ? 33  ASP B O   1 
ATOM   1454 C CB  . ASP B 1 37  ? 14.415  12.271 -0.889  1.00 39.22  ? 33  ASP B CB  1 
ATOM   1455 C CG  . ASP B 1 37  ? 13.899  12.747 -2.232  1.00 40.02  ? 33  ASP B CG  1 
ATOM   1456 O OD1 . ASP B 1 37  ? 13.162  11.984 -2.892  1.00 39.24  ? 33  ASP B OD1 1 
ATOM   1457 O OD2 . ASP B 1 37  ? 14.229  13.885 -2.629  1.00 40.63  ? 33  ASP B OD2 1 
ATOM   1458 N N   . SER B 1 38  ? 11.654  10.191 -1.188  1.00 38.36  ? 34  SER B N   1 
ATOM   1459 C CA  . SER B 1 38  ? 11.063  8.955  -1.688  1.00 37.78  ? 34  SER B CA  1 
ATOM   1460 C C   . SER B 1 38  ? 11.594  8.612  -3.076  1.00 39.18  ? 34  SER B C   1 
ATOM   1461 O O   . SER B 1 38  ? 11.611  7.447  -3.474  1.00 39.05  ? 34  SER B O   1 
ATOM   1462 C CB  . SER B 1 38  ? 9.538   9.065  -1.720  1.00 37.06  ? 34  SER B CB  1 
ATOM   1463 O OG  . SER B 1 38  ? 9.110   9.932  -2.757  1.00 33.36  ? 34  SER B OG  1 
ATOM   1464 N N   . THR B 1 39  ? 12.025  9.634  -3.808  1.00 39.62  ? 35  THR B N   1 
ATOM   1465 C CA  . THR B 1 39  ? 12.474  9.455  -5.184  1.00 40.72  ? 35  THR B CA  1 
ATOM   1466 C C   . THR B 1 39  ? 13.920  8.971  -5.233  1.00 42.15  ? 35  THR B C   1 
ATOM   1467 O O   . THR B 1 39  ? 14.512  8.865  -6.307  1.00 42.72  ? 35  THR B O   1 
ATOM   1468 C CB  . THR B 1 39  ? 12.352  10.761 -5.991  1.00 40.25  ? 35  THR B CB  1 
ATOM   1469 O OG1 . THR B 1 39  ? 13.469  11.611 -5.704  1.00 37.46  ? 35  THR B OG1 1 
ATOM   1470 C CG2 . THR B 1 39  ? 11.063  11.487 -5.638  1.00 41.11  ? 35  THR B CG2 1 
ATOM   1471 N N   . THR B 1 40  ? 14.481  8.680  -4.064  1.00 43.64  ? 36  THR B N   1 
ATOM   1472 C CA  . THR B 1 40  ? 15.852  8.191  -3.974  1.00 44.49  ? 36  THR B CA  1 
ATOM   1473 C C   . THR B 1 40  ? 15.888  6.728  -3.546  1.00 45.00  ? 36  THR B C   1 
ATOM   1474 O O   . THR B 1 40  ? 16.960  6.141  -3.395  1.00 45.80  ? 36  THR B O   1 
ATOM   1475 C CB  . THR B 1 40  ? 16.685  9.026  -2.984  1.00 44.83  ? 36  THR B CB  1 
ATOM   1476 O OG1 . THR B 1 40  ? 17.627  9.829  -3.706  1.00 46.51  ? 36  THR B OG1 1 
ATOM   1477 C CG2 . THR B 1 40  ? 17.432  8.119  -2.019  1.00 45.69  ? 36  THR B CG2 1 
ATOM   1478 N N   . ALA B 1 41  ? 14.710  6.144  -3.351  1.00 45.29  ? 37  ALA B N   1 
ATOM   1479 C CA  . ALA B 1 41  ? 14.603  4.733  -3.000  1.00 45.81  ? 37  ALA B CA  1 
ATOM   1480 C C   . ALA B 1 41  ? 15.399  3.862  -3.966  1.00 46.57  ? 37  ALA B C   1 
ATOM   1481 O O   . ALA B 1 41  ? 15.279  4.000  -5.183  1.00 46.33  ? 37  ALA B O   1 
ATOM   1482 C CB  . ALA B 1 41  ? 13.145  4.303  -2.972  1.00 45.73  ? 37  ALA B CB  1 
ATOM   1483 N N   . THR B 1 42  ? 16.210  2.975  -3.437  1.00 47.11  ? 38  THR B N   1 
ATOM   1484 C CA  . THR B 1 42  ? 16.860  1.981  -4.240  1.00 47.62  ? 38  THR B CA  1 
ATOM   1485 C C   . THR B 1 42  ? 16.105  0.680  -4.169  1.00 48.47  ? 38  THR B C   1 
ATOM   1486 O O   . THR B 1 42  ? 16.677  -0.330 -4.327  1.00 49.31  ? 38  THR B O   1 
ATOM   1487 C CB  . THR B 1 42  ? 18.306  1.791  -3.818  1.00 47.26  ? 38  THR B CB  1 
ATOM   1488 O OG1 . THR B 1 42  ? 18.378  1.296  -2.486  1.00 45.60  ? 38  THR B OG1 1 
ATOM   1489 C CG2 . THR B 1 42  ? 19.021  3.068  -3.872  1.00 47.00  ? 38  THR B CG2 1 
ATOM   1490 N N   . ALA B 1 43  ? 14.806  0.719  -3.930  1.00 49.28  ? 39  ALA B N   1 
ATOM   1491 C CA  . ALA B 1 43  ? 14.125  -0.401 -3.339  1.00 48.96  ? 39  ALA B CA  1 
ATOM   1492 C C   . ALA B 1 43  ? 12.659  -0.475 -3.679  1.00 49.22  ? 39  ALA B C   1 
ATOM   1493 O O   . ALA B 1 43  ? 12.241  0.065  -4.638  1.00 49.31  ? 39  ALA B O   1 
ATOM   1494 C CB  . ALA B 1 43  ? 14.802  -1.624 -3.715  1.00 49.50  ? 39  ALA B CB  1 
ATOM   1495 N N   . GLU B 1 44  ? 11.846  -1.117 -2.880  1.00 20.00  ? 40  GLU B N   1 
ATOM   1496 C CA  . GLU B 1 44  ? 10.512  -0.593 -2.674  1.00 20.00  ? 40  GLU B CA  1 
ATOM   1497 C C   . GLU B 1 44  ? 10.536  0.396  -1.551  1.00 20.00  ? 40  GLU B C   1 
ATOM   1498 O O   . GLU B 1 44  ? 11.461  0.456  -0.791  1.00 20.00  ? 40  GLU B O   1 
ATOM   1499 C CB  . GLU B 1 44  ? 9.529   -1.710 -2.424  1.00 20.00  ? 40  GLU B CB  1 
ATOM   1500 C CG  . GLU B 1 44  ? 9.709   -2.804 -3.416  1.00 20.00  ? 40  GLU B CG  1 
ATOM   1501 N N   . LEU B 1 45  ? 9.538   1.222  -1.491  1.00 36.65  ? 41  LEU B N   1 
ATOM   1502 C CA  . LEU B 1 45  ? 9.418   2.114  -0.381  1.00 38.00  ? 41  LEU B CA  1 
ATOM   1503 C C   . LEU B 1 45  ? 9.098   1.289  0.849   1.00 37.67  ? 41  LEU B C   1 
ATOM   1504 O O   . LEU B 1 45  ? 9.770   1.375  1.857   1.00 37.57  ? 41  LEU B O   1 
ATOM   1505 C CB  . LEU B 1 45  ? 8.364   3.153  -0.689  1.00 37.97  ? 41  LEU B CB  1 
ATOM   1506 C CG  . LEU B 1 45  ? 8.952   4.144  -1.675  1.00 39.37  ? 41  LEU B CG  1 
ATOM   1507 C CD1 . LEU B 1 45  ? 8.065   5.261  -2.007  1.00 40.35  ? 41  LEU B CD1 1 
ATOM   1508 C CD2 . LEU B 1 45  ? 10.252  4.638  -1.265  1.00 39.05  ? 41  LEU B CD2 1 
ATOM   1509 N N   . GLY B 1 46  ? 8.100   0.441  0.693   1.00 36.16  ? 42  GLY B N   1 
ATOM   1510 C CA  . GLY B 1 46  ? 7.685   -0.488 1.692   1.00 35.80  ? 42  GLY B CA  1 
ATOM   1511 C C   . GLY B 1 46  ? 6.916   0.180  2.792   1.00 35.39  ? 42  GLY B C   1 
ATOM   1512 O O   . GLY B 1 46  ? 6.994   -0.214 3.907   1.00 35.40  ? 42  GLY B O   1 
ATOM   1513 N N   . TRP B 1 47  ? 6.173   1.210  2.453   1.00 33.80  ? 43  TRP B N   1 
ATOM   1514 C CA  . TRP B 1 47  ? 5.414   1.983  3.418   1.00 32.34  ? 43  TRP B CA  1 
ATOM   1515 C C   . TRP B 1 47  ? 4.210   1.157  3.747   1.00 32.60  ? 43  TRP B C   1 
ATOM   1516 O O   . TRP B 1 47  ? 3.801   0.352  2.936   1.00 33.15  ? 43  TRP B O   1 
ATOM   1517 C CB  . TRP B 1 47  ? 4.984   3.359  2.836   1.00 30.66  ? 43  TRP B CB  1 
ATOM   1518 C CG  . TRP B 1 47  ? 6.133   4.250  2.542   1.00 28.52  ? 43  TRP B CG  1 
ATOM   1519 C CD1 . TRP B 1 47  ? 7.428   3.980  2.768   1.00 26.58  ? 43  TRP B CD1 1 
ATOM   1520 C CD2 . TRP B 1 47  ? 6.083   5.592  2.015   1.00 28.56  ? 43  TRP B CD2 1 
ATOM   1521 N NE1 . TRP B 1 47  ? 8.194   5.050  2.446   1.00 26.79  ? 43  TRP B NE1 1 
ATOM   1522 C CE2 . TRP B 1 47  ? 7.400   6.046  1.940   1.00 26.09  ? 43  TRP B CE2 1 
ATOM   1523 C CE3 . TRP B 1 47  ? 5.042   6.445  1.590   1.00 26.85  ? 43  TRP B CE3 1 
ATOM   1524 C CZ2 . TRP B 1 47  ? 7.737   7.310  1.435   1.00 26.80  ? 43  TRP B CZ2 1 
ATOM   1525 C CZ3 . TRP B 1 47  ? 5.379   7.712  1.097   1.00 27.60  ? 43  TRP B CZ3 1 
ATOM   1526 C CH2 . TRP B 1 47  ? 6.718   8.131  1.039   1.00 27.23  ? 43  TRP B CH2 1 
ATOM   1527 N N   . MET B 1 48  ? 3.643   1.370  4.933   1.00 32.68  ? 44  MET B N   1 
ATOM   1528 C CA  . MET B 1 48  ? 2.494   0.646  5.376   1.00 33.10  ? 44  MET B CA  1 
ATOM   1529 C C   . MET B 1 48  ? 1.225   1.240  4.828   1.00 33.17  ? 44  MET B C   1 
ATOM   1530 O O   . MET B 1 48  ? 0.995   2.429  4.937   1.00 32.95  ? 44  MET B O   1 
ATOM   1531 C CB  . MET B 1 48  ? 2.366   0.699  6.883   1.00 33.86  ? 44  MET B CB  1 
ATOM   1532 C CG  . MET B 1 48  ? 1.102   0.013  7.436   1.00 36.64  ? 44  MET B CG  1 
ATOM   1533 S SD  . MET B 1 48  ? 1.163   -1.779 7.341   1.00 41.39  ? 44  MET B SD  1 
ATOM   1534 C CE  . MET B 1 48  ? 2.914   -2.065 7.616   1.00 42.70  ? 44  MET B CE  1 
ATOM   1535 N N   . VAL B 1 49  ? 0.359   0.353  4.372   1.00 32.98  ? 45  VAL B N   1 
ATOM   1536 C CA  . VAL B 1 49  ? -0.892  0.685  3.781   1.00 33.51  ? 45  VAL B CA  1 
ATOM   1537 C C   . VAL B 1 49  ? -1.950  0.022  4.626   1.00 33.64  ? 45  VAL B C   1 
ATOM   1538 O O   . VAL B 1 49  ? -1.817  -1.144 4.978   1.00 35.19  ? 45  VAL B O   1 
ATOM   1539 C CB  . VAL B 1 49  ? -0.888  0.225  2.325   1.00 33.94  ? 45  VAL B CB  1 
ATOM   1540 C CG1 . VAL B 1 49  ? -2.282  0.123  1.758   1.00 36.50  ? 45  VAL B CG1 1 
ATOM   1541 C CG2 . VAL B 1 49  ? -0.046  1.228  1.498   1.00 33.97  ? 45  VAL B CG2 1 
ATOM   1542 N N   . HIS B 1 50  ? -2.968  0.792  4.987   1.00 33.37  ? 46  HIS B N   1 
ATOM   1543 C CA  . HIS B 1 50  ? -4.034  0.358  5.857   1.00 33.93  ? 46  HIS B CA  1 
ATOM   1544 C C   . HIS B 1 50  ? -5.317  1.029  5.380   1.00 33.61  ? 46  HIS B C   1 
ATOM   1545 O O   . HIS B 1 50  ? -5.474  2.204  5.573   1.00 33.46  ? 46  HIS B O   1 
ATOM   1546 C CB  . HIS B 1 50  ? -3.751  0.761  7.320   1.00 33.85  ? 46  HIS B CB  1 
ATOM   1547 C CG  . HIS B 1 50  ? -4.936  0.622  8.228   1.00 34.47  ? 46  HIS B CG  1 
ATOM   1548 N ND1 . HIS B 1 50  ? -5.987  1.520  8.232   1.00 35.50  ? 46  HIS B ND1 1 
ATOM   1549 C CD2 . HIS B 1 50  ? -5.220  -0.292 9.191   1.00 36.39  ? 46  HIS B CD2 1 
ATOM   1550 C CE1 . HIS B 1 50  ? -6.876  1.145  9.137   1.00 35.92  ? 46  HIS B CE1 1 
ATOM   1551 N NE2 . HIS B 1 50  ? -6.437  0.044  9.730   1.00 36.21  ? 46  HIS B NE2 1 
ATOM   1552 N N   . PRO B 1 51  ? -6.228  0.284  4.746   1.00 34.66  ? 47  PRO B N   1 
ATOM   1553 C CA  . PRO B 1 51  ? -6.172  -1.147 4.376   1.00 35.14  ? 47  PRO B CA  1 
ATOM   1554 C C   . PRO B 1 51  ? -5.389  -1.364 3.106   1.00 35.88  ? 47  PRO B C   1 
ATOM   1555 O O   . PRO B 1 51  ? -5.256  -0.420 2.299   1.00 37.41  ? 47  PRO B O   1 
ATOM   1556 C CB  . PRO B 1 51  ? -7.638  -1.517 4.189   1.00 35.63  ? 47  PRO B CB  1 
ATOM   1557 C CG  . PRO B 1 51  ? -8.349  -0.182 3.873   1.00 34.68  ? 47  PRO B CG  1 
ATOM   1558 C CD  . PRO B 1 51  ? -7.490  0.929  4.344   1.00 34.84  ? 47  PRO B CD  1 
ATOM   1559 N N   . PRO B 1 52  ? -4.874  -2.595 2.895   1.00 36.14  ? 48  PRO B N   1 
ATOM   1560 C CA  . PRO B 1 52  ? -4.010  -2.903 1.721   1.00 35.54  ? 48  PRO B CA  1 
ATOM   1561 C C   . PRO B 1 52  ? -4.767  -2.779 0.406   1.00 34.69  ? 48  PRO B C   1 
ATOM   1562 O O   . PRO B 1 52  ? -4.191  -2.737 -0.688  1.00 34.45  ? 48  PRO B O   1 
ATOM   1563 C CB  . PRO B 1 52  ? -3.571  -4.357 1.971   1.00 35.95  ? 48  PRO B CB  1 
ATOM   1564 C CG  . PRO B 1 52  ? -4.001  -4.666 3.381   1.00 35.79  ? 48  PRO B CG  1 
ATOM   1565 C CD  . PRO B 1 52  ? -5.107  -3.790 3.737   1.00 35.52  ? 48  PRO B CD  1 
ATOM   1566 N N   . SER B 1 53  ? -6.068  -2.800 0.585   1.00 33.72  ? 49  SER B N   1 
ATOM   1567 C CA  . SER B 1 53  ? -7.128  -2.359 -0.308  1.00 33.74  ? 49  SER B CA  1 
ATOM   1568 C C   . SER B 1 53  ? -7.057  -0.904 -0.882  1.00 33.85  ? 49  SER B C   1 
ATOM   1569 O O   . SER B 1 53  ? -7.662  -0.585 -1.930  1.00 33.52  ? 49  SER B O   1 
ATOM   1570 C CB  . SER B 1 53  ? -8.342  -2.439 0.610   1.00 33.88  ? 49  SER B CB  1 
ATOM   1571 O OG  . SER B 1 53  ? -9.532  -2.115 0.015   1.00 35.64  ? 49  SER B OG  1 
ATOM   1572 N N   . GLY B 1 54  ? -6.356  -0.014 -0.183  1.00 33.48  ? 50  GLY B N   1 
ATOM   1573 C CA  . GLY B 1 54  ? -6.438  1.441  -0.480  1.00 33.09  ? 50  GLY B CA  1 
ATOM   1574 C C   . GLY B 1 54  ? -5.279  1.888  -1.329  1.00 32.41  ? 50  GLY B C   1 
ATOM   1575 O O   . GLY B 1 54  ? -5.272  1.642  -2.542  1.00 33.02  ? 50  GLY B O   1 
ATOM   1576 N N   . TRP B 1 55  ? -4.272  2.491  -0.702  1.00 31.67  ? 51  TRP B N   1 
ATOM   1577 C CA  . TRP B 1 55  ? -3.052  2.918  -1.413  1.00 32.27  ? 51  TRP B CA  1 
ATOM   1578 C C   . TRP B 1 55  ? -2.326  1.723  -2.001  1.00 32.38  ? 51  TRP B C   1 
ATOM   1579 O O   . TRP B 1 55  ? -2.475  0.654  -1.480  1.00 33.75  ? 51  TRP B O   1 
ATOM   1580 C CB  . TRP B 1 55  ? -2.089  3.712  -0.489  1.00 31.70  ? 51  TRP B CB  1 
ATOM   1581 C CG  . TRP B 1 55  ? -2.627  5.086  -0.059  1.00 32.36  ? 51  TRP B CG  1 
ATOM   1582 C CD1 . TRP B 1 55  ? -3.377  5.367  1.040   1.00 31.85  ? 51  TRP B CD1 1 
ATOM   1583 C CD2 . TRP B 1 55  ? -2.432  6.341  -0.739  1.00 31.93  ? 51  TRP B CD2 1 
ATOM   1584 N NE1 . TRP B 1 55  ? -3.657  6.707  1.087   1.00 32.97  ? 51  TRP B NE1 1 
ATOM   1585 C CE2 . TRP B 1 55  ? -3.089  7.327  0.011   1.00 32.03  ? 51  TRP B CE2 1 
ATOM   1586 C CE3 . TRP B 1 55  ? -1.768  6.716  -1.916  1.00 32.03  ? 51  TRP B CE3 1 
ATOM   1587 C CZ2 . TRP B 1 55  ? -3.102  8.684  -0.366  1.00 33.47  ? 51  TRP B CZ2 1 
ATOM   1588 C CZ3 . TRP B 1 55  ? -1.758  8.065  -2.287  1.00 32.39  ? 51  TRP B CZ3 1 
ATOM   1589 C CH2 . TRP B 1 55  ? -2.436  9.034  -1.514  1.00 31.09  ? 51  TRP B CH2 1 
ATOM   1590 N N   . GLU B 1 56  ? -1.490  1.912  -3.030  1.00 32.61  ? 52  GLU B N   1 
ATOM   1591 C CA  . GLU B 1 56  ? -0.727  0.795  -3.642  1.00 31.93  ? 52  GLU B CA  1 
ATOM   1592 C C   . GLU B 1 56  ? 0.527   1.271  -4.296  1.00 31.52  ? 52  GLU B C   1 
ATOM   1593 O O   . GLU B 1 56  ? 0.483   2.211  -5.067  1.00 32.54  ? 52  GLU B O   1 
ATOM   1594 C CB  . GLU B 1 56  ? -1.558  0.098  -4.725  1.00 32.14  ? 52  GLU B CB  1 
ATOM   1595 C CG  . GLU B 1 56  ? -0.781  -1.054 -5.439  1.00 33.65  ? 52  GLU B CG  1 
ATOM   1596 N N   . GLU B 1 57  ? 1.656   0.643  -4.021  1.00 31.07  ? 53  GLU B N   1 
ATOM   1597 C CA  . GLU B 1 57  ? 2.895   1.109  -4.592  1.00 31.35  ? 53  GLU B CA  1 
ATOM   1598 C C   . GLU B 1 57  ? 2.923   0.740  -6.072  1.00 32.59  ? 53  GLU B C   1 
ATOM   1599 O O   . GLU B 1 57  ? 2.640   -0.399 -6.417  1.00 33.89  ? 53  GLU B O   1 
ATOM   1600 C CB  . GLU B 1 57  ? 4.074   0.549  -3.846  1.00 30.71  ? 53  GLU B CB  1 
ATOM   1601 C CG  . GLU B 1 57  ? 5.363   1.187  -4.186  1.00 31.01  ? 53  GLU B CG  1 
ATOM   1602 C CD  . GLU B 1 57  ? 6.469   0.727  -3.307  1.00 35.07  ? 53  GLU B CD  1 
ATOM   1603 O OE1 . GLU B 1 57  ? 6.168   0.161  -2.213  1.00 38.94  ? 53  GLU B OE1 1 
ATOM   1604 O OE2 . GLU B 1 57  ? 7.645   0.955  -3.673  1.00 34.51  ? 53  GLU B OE2 1 
ATOM   1605 N N   . VAL B 1 58  ? 3.189   1.712  -6.948  1.00 33.16  ? 54  VAL B N   1 
ATOM   1606 C CA  . VAL B 1 58  ? 3.127   1.515  -8.414  1.00 33.16  ? 54  VAL B CA  1 
ATOM   1607 C C   . VAL B 1 58  ? 4.306   2.293  -8.924  1.00 33.65  ? 54  VAL B C   1 
ATOM   1608 O O   . VAL B 1 58  ? 4.707   3.261  -8.273  1.00 34.17  ? 54  VAL B O   1 
ATOM   1609 C CB  . VAL B 1 58  ? 1.793   2.028  -8.989  1.00 33.62  ? 54  VAL B CB  1 
ATOM   1610 C CG1 . VAL B 1 58  ? 1.754   1.947  -10.521 1.00 35.20  ? 54  VAL B CG1 1 
ATOM   1611 C CG2 . VAL B 1 58  ? 0.673   1.203  -8.460  1.00 32.84  ? 54  VAL B CG2 1 
ATOM   1612 N N   . SER B 1 59  ? 4.953   1.848  -10.002 1.00 33.35  ? 55  SER B N   1 
ATOM   1613 C CA  . SER B 1 59  ? 6.026   2.677  -10.582 1.00 32.79  ? 55  SER B CA  1 
ATOM   1614 C C   . SER B 1 59  ? 5.344   3.874  -11.330 1.00 31.62  ? 55  SER B C   1 
ATOM   1615 O O   . SER B 1 59  ? 4.193   3.811  -11.751 1.00 30.08  ? 55  SER B O   1 
ATOM   1616 C CB  . SER B 1 59  ? 6.962   1.886  -11.510 1.00 32.48  ? 55  SER B CB  1 
ATOM   1617 O OG  . SER B 1 59  ? 6.224   1.283  -12.554 1.00 32.95  ? 55  SER B OG  1 
ATOM   1618 N N   . GLY B 1 60  ? 6.038   4.987  -11.440 1.00 30.51  ? 56  GLY B N   1 
ATOM   1619 C CA  . GLY B 1 60  ? 5.410   6.132  -12.089 1.00 30.33  ? 56  GLY B CA  1 
ATOM   1620 C C   . GLY B 1 60  ? 6.427   7.153  -12.465 1.00 29.73  ? 56  GLY B C   1 
ATOM   1621 O O   . GLY B 1 60  ? 7.616   7.030  -12.116 1.00 29.91  ? 56  GLY B O   1 
ATOM   1622 N N   . TYR B 1 61  ? 5.957   8.167  -13.170 1.00 29.22  ? 57  TYR B N   1 
ATOM   1623 C CA  . TYR B 1 61  ? 6.817   9.255  -13.581 1.00 28.98  ? 57  TYR B CA  1 
ATOM   1624 C C   . TYR B 1 61  ? 6.855   10.407 -12.582 1.00 29.57  ? 57  TYR B C   1 
ATOM   1625 O O   . TYR B 1 61  ? 5.869   10.801 -11.987 1.00 27.61  ? 57  TYR B O   1 
ATOM   1626 C CB  . TYR B 1 61  ? 6.337   9.795  -14.914 1.00 28.96  ? 57  TYR B CB  1 
ATOM   1627 C CG  . TYR B 1 61  ? 6.225   8.744  -15.999 1.00 28.31  ? 57  TYR B CG  1 
ATOM   1628 C CD1 . TYR B 1 61  ? 7.336   8.026  -16.418 1.00 27.62  ? 57  TYR B CD1 1 
ATOM   1629 C CD2 . TYR B 1 61  ? 5.004   8.488  -16.618 1.00 25.98  ? 57  TYR B CD2 1 
ATOM   1630 C CE1 . TYR B 1 61  ? 7.234   7.047  -17.431 1.00 28.01  ? 57  TYR B CE1 1 
ATOM   1631 C CE2 . TYR B 1 61  ? 4.901   7.530  -17.595 1.00 28.53  ? 57  TYR B CE2 1 
ATOM   1632 C CZ  . TYR B 1 61  ? 6.023   6.833  -18.011 1.00 27.93  ? 57  TYR B CZ  1 
ATOM   1633 O OH  . TYR B 1 61  ? 5.857   5.893  -18.964 1.00 30.00  ? 57  TYR B OH  1 
ATOM   1634 N N   . ASP B 1 62  ? 8.027   10.984 -12.450 1.00 31.52  ? 58  ASP B N   1 
ATOM   1635 C CA  . ASP B 1 62  ? 8.158   12.343 -11.938 1.00 32.81  ? 58  ASP B CA  1 
ATOM   1636 C C   . ASP B 1 62  ? 8.268   13.155 -13.203 1.00 34.34  ? 58  ASP B C   1 
ATOM   1637 O O   . ASP B 1 62  ? 7.647   12.784 -14.230 1.00 33.69  ? 58  ASP B O   1 
ATOM   1638 C CB  . ASP B 1 62  ? 9.480   12.415 -11.189 1.00 32.19  ? 58  ASP B CB  1 
ATOM   1639 C CG  . ASP B 1 62  ? 10.668  12.359 -12.102 1.00 33.83  ? 58  ASP B CG  1 
ATOM   1640 O OD1 . ASP B 1 62  ? 10.491  12.172 -13.342 1.00 35.11  ? 58  ASP B OD1 1 
ATOM   1641 O OD2 . ASP B 1 62  ? 11.789  12.519 -11.591 1.00 34.80  ? 58  ASP B OD2 1 
ATOM   1642 N N   . GLU B 1 63  ? 8.832   14.343 -13.056 1.00 36.20  ? 59  GLU B N   1 
ATOM   1643 C CA  . GLU B 1 63  ? 8.318   15.543 -13.693 1.00 36.69  ? 59  GLU B CA  1 
ATOM   1644 C C   . GLU B 1 63  ? 9.061   15.566 -14.978 1.00 36.64  ? 59  GLU B C   1 
ATOM   1645 O O   . GLU B 1 63  ? 8.604   16.060 -15.962 1.00 37.13  ? 59  GLU B O   1 
ATOM   1646 C CB  . GLU B 1 63  ? 8.721   16.785 -12.896 1.00 36.67  ? 59  GLU B CB  1 
ATOM   1647 C CG  . GLU B 1 63  ? 7.866   17.077 -11.690 1.00 39.16  ? 59  GLU B CG  1 
ATOM   1648 C CD  . GLU B 1 63  ? 8.201   18.353 -11.002 1.00 38.08  ? 59  GLU B CD  1 
ATOM   1649 O OE1 . GLU B 1 63  ? 9.368   18.662 -10.889 1.00 44.93  ? 59  GLU B OE1 1 
ATOM   1650 O OE2 . GLU B 1 63  ? 7.303   19.071 -10.601 1.00 42.12  ? 59  GLU B OE2 1 
ATOM   1651 N N   . ASN B 1 64  ? 10.234  14.955 -14.916 1.00 20.00  ? 60  ASN B N   1 
ATOM   1652 C CA  . ASN B 1 64  ? 11.135  14.712 -16.024 1.00 20.00  ? 60  ASN B CA  1 
ATOM   1653 C C   . ASN B 1 64  ? 10.999  13.329 -16.609 1.00 20.00  ? 60  ASN B C   1 
ATOM   1654 O O   . ASN B 1 64  ? 11.912  12.854 -17.190 1.00 33.52  ? 60  ASN B O   1 
ATOM   1655 C CB  . ASN B 1 64  ? 12.574  14.794 -15.550 1.00 20.00  ? 60  ASN B CB  1 
ATOM   1656 C CG  . ASN B 1 64  ? 12.870  16.038 -14.838 1.00 20.00  ? 60  ASN B CG  1 
ATOM   1657 O OD1 . ASN B 1 64  ? 12.804  17.080 -15.399 1.00 20.00  ? 60  ASN B OD1 1 
ATOM   1658 N ND2 . ASN B 1 64  ? 13.200  15.938 -13.589 1.00 20.00  ? 60  ASN B ND2 1 
ATOM   1659 N N   . MET B 1 65  ? 9.888   12.666 -16.386 1.00 34.52  ? 61  MET B N   1 
ATOM   1660 C CA  . MET B 1 65  ? 9.681   11.331 -16.948 1.00 34.72  ? 61  MET B CA  1 
ATOM   1661 C C   . MET B 1 65  ? 10.736  10.278 -16.533 1.00 34.57  ? 61  MET B C   1 
ATOM   1662 O O   . MET B 1 65  ? 10.961  9.304  -17.268 1.00 34.26  ? 61  MET B O   1 
ATOM   1663 C CB  . MET B 1 65  ? 9.627   11.408 -18.502 1.00 34.60  ? 61  MET B CB  1 
ATOM   1664 C CG  . MET B 1 65  ? 8.539   12.290 -19.044 1.00 33.52  ? 61  MET B CG  1 
ATOM   1665 S SD  . MET B 1 65  ? 6.933   11.921 -18.400 1.00 32.75  ? 61  MET B SD  1 
ATOM   1666 C CE  . MET B 1 65  ? 6.428   10.463 -19.352 1.00 32.97  ? 61  MET B CE  1 
ATOM   1667 N N   . ASN B 1 66  ? 11.405  10.473 -15.398 1.00 34.39  ? 62  ASN B N   1 
ATOM   1668 C CA  . ASN B 1 66  ? 12.179  9.391  -14.825 1.00 34.78  ? 62  ASN B CA  1 
ATOM   1669 C C   . ASN B 1 66  ? 11.183  8.542  -14.089 1.00 34.17  ? 62  ASN B C   1 
ATOM   1670 O O   . ASN B 1 66  ? 10.224  9.038  -13.560 1.00 34.27  ? 62  ASN B O   1 
ATOM   1671 C CB  . ASN B 1 66  ? 13.209  9.842  -13.806 1.00 35.17  ? 62  ASN B CB  1 
ATOM   1672 C CG  . ASN B 1 66  ? 14.128  10.872 -14.327 1.00 37.07  ? 62  ASN B CG  1 
ATOM   1673 O OD1 . ASN B 1 66  ? 14.980  10.604 -15.178 1.00 40.00  ? 62  ASN B OD1 1 
ATOM   1674 N ND2 . ASN B 1 66  ? 13.979  12.089 -13.809 1.00 40.20  ? 62  ASN B ND2 1 
ATOM   1675 N N   . THR B 1 67  ? 11.434  7.256  -14.000 1.00 34.29  ? 63  THR B N   1 
ATOM   1676 C CA  . THR B 1 67  ? 10.485  6.383  -13.326 1.00 33.83  ? 63  THR B CA  1 
ATOM   1677 C C   . THR B 1 67  ? 10.877  5.869  -11.933 1.00 33.56  ? 63  THR B C   1 
ATOM   1678 O O   . THR B 1 67  ? 12.032  5.529  -11.732 1.00 33.72  ? 63  THR B O   1 
ATOM   1679 C CB  . THR B 1 67  ? 10.337  5.041  -14.200 1.00 33.40  ? 63  THR B CB  1 
ATOM   1680 O OG1 . THR B 1 67  ? 9.554   5.257  -15.380 1.00 31.08  ? 63  THR B OG1 1 
ATOM   1681 C CG2 . THR B 1 67  ? 9.725   3.903  -13.416 1.00 33.63  ? 63  THR B CG2 1 
ATOM   1682 N N   . ILE B 1 68  ? 9.961   5.848  -10.951 1.00 33.40  ? 64  ILE B N   1 
ATOM   1683 C CA  . ILE B 1 68  ? 10.171  6.160  -9.510  1.00 32.91  ? 64  ILE B CA  1 
ATOM   1684 C C   . ILE B 1 68  ? 9.032   5.377  -8.786  1.00 32.11  ? 64  ILE B C   1 
ATOM   1685 O O   . ILE B 1 68  ? 8.038   4.972  -9.410  1.00 31.20  ? 64  ILE B O   1 
ATOM   1686 C CB  . ILE B 1 68  ? 10.387  7.646  -8.981  1.00 32.40  ? 64  ILE B CB  1 
ATOM   1687 C CG1 . ILE B 1 68  ? 9.227   8.573  -9.291  1.00 33.91  ? 64  ILE B CG1 1 
ATOM   1688 C CG2 . ILE B 1 68  ? 11.761  8.178  -9.394  1.00 33.94  ? 64  ILE B CG2 1 
ATOM   1689 C CD1 . ILE B 1 68  ? 9.357   9.873  -8.501  1.00 34.15  ? 64  ILE B CD1 1 
ATOM   1690 N N   . ARG B 1 69  ? 9.205   5.115  -7.492  1.00 31.90  ? 65  ARG B N   1 
ATOM   1691 C CA  . ARG B 1 69  ? 8.143   4.509  -6.687  1.00 31.72  ? 65  ARG B CA  1 
ATOM   1692 C C   . ARG B 1 69  ? 7.116   5.566  -6.249  1.00 30.18  ? 65  ARG B C   1 
ATOM   1693 O O   . ARG B 1 69  ? 7.473   6.616  -5.733  1.00 30.56  ? 65  ARG B O   1 
ATOM   1694 C CB  . ARG B 1 69  ? 8.725   3.774  -5.447  1.00 32.63  ? 65  ARG B CB  1 
ATOM   1695 C CG  . ARG B 1 69  ? 9.835   2.716  -5.748  1.00 35.85  ? 65  ARG B CG  1 
ATOM   1696 C CD  . ARG B 1 69  ? 9.410   1.766  -6.892  1.00 38.37  ? 65  ARG B CD  1 
ATOM   1697 N NE  . ARG B 1 69  ? 8.306   0.880  -6.504  1.00 40.32  ? 65  ARG B NE  1 
ATOM   1698 C CZ  . ARG B 1 69  ? 7.604   0.136  -7.357  1.00 40.70  ? 65  ARG B CZ  1 
ATOM   1699 N NH1 . ARG B 1 69  ? 7.858   0.161  -8.644  1.00 42.78  ? 65  ARG B NH1 1 
ATOM   1700 N NH2 . ARG B 1 69  ? 6.648   -0.650 -6.922  1.00 41.86  ? 65  ARG B NH2 1 
ATOM   1701 N N   . THR B 1 70  ? 5.849   5.258  -6.442  1.00 27.95  ? 66  THR B N   1 
ATOM   1702 C CA  . THR B 1 70  ? 4.792   6.133  -6.127  1.00 27.92  ? 66  THR B CA  1 
ATOM   1703 C C   . THR B 1 70  ? 3.686   5.288  -5.454  1.00 28.38  ? 66  THR B C   1 
ATOM   1704 O O   . THR B 1 70  ? 3.759   4.074  -5.480  1.00 28.11  ? 66  THR B O   1 
ATOM   1705 C CB  . THR B 1 70  ? 4.196   6.774  -7.398  1.00 27.90  ? 66  THR B CB  1 
ATOM   1706 O OG1 . THR B 1 70  ? 3.562   5.758  -8.141  1.00 27.64  ? 66  THR B OG1 1 
ATOM   1707 C CG2 . THR B 1 70  ? 5.241   7.446  -8.289  1.00 26.61  ? 66  THR B CG2 1 
ATOM   1708 N N   . TYR B 1 71  ? 2.680   5.953  -4.867  1.00 27.71  ? 67  TYR B N   1 
ATOM   1709 C CA  . TYR B 1 71  ? 1.548   5.314  -4.256  1.00 27.51  ? 67  TYR B CA  1 
ATOM   1710 C C   . TYR B 1 71  ? 0.335   5.910  -4.869  1.00 27.74  ? 67  TYR B C   1 
ATOM   1711 O O   . TYR B 1 71  ? 0.250   7.099  -4.888  1.00 28.05  ? 67  TYR B O   1 
ATOM   1712 C CB  . TYR B 1 71  ? 1.557   5.517  -2.722  1.00 27.62  ? 67  TYR B CB  1 
ATOM   1713 C CG  . TYR B 1 71  ? 2.475   4.538  -2.004  1.00 26.77  ? 67  TYR B CG  1 
ATOM   1714 C CD1 . TYR B 1 71  ? 2.034   3.236  -1.711  1.00 27.04  ? 67  TYR B CD1 1 
ATOM   1715 C CD2 . TYR B 1 71  ? 3.774   4.877  -1.671  1.00 25.77  ? 67  TYR B CD2 1 
ATOM   1716 C CE1 . TYR B 1 71  ? 2.829   2.312  -1.045  1.00 23.76  ? 67  TYR B CE1 1 
ATOM   1717 C CE2 . TYR B 1 71  ? 4.608   3.939  -1.008  1.00 29.21  ? 67  TYR B CE2 1 
ATOM   1718 C CZ  . TYR B 1 71  ? 4.107   2.645  -0.730  1.00 27.46  ? 67  TYR B CZ  1 
ATOM   1719 O OH  . TYR B 1 71  ? 4.884   1.699  -0.112  1.00 29.55  ? 67  TYR B OH  1 
ATOM   1720 N N   . GLN B 1 72  ? -0.577  5.077  -5.394  1.00 28.49  ? 68  GLN B N   1 
ATOM   1721 C CA  . GLN B 1 72  ? -1.882  5.499  -5.854  1.00 29.73  ? 68  GLN B CA  1 
ATOM   1722 C C   . GLN B 1 72  ? -3.019  4.889  -5.069  1.00 29.51  ? 68  GLN B C   1 
ATOM   1723 O O   . GLN B 1 72  ? -2.879  3.833  -4.417  1.00 31.38  ? 68  GLN B O   1 
ATOM   1724 C CB  . GLN B 1 72  ? -2.135  5.070  -7.307  1.00 30.02  ? 68  GLN B CB  1 
ATOM   1725 C CG  . GLN B 1 72  ? -0.960  5.227  -8.217  1.00 32.34  ? 68  GLN B CG  1 
ATOM   1726 C CD  . GLN B 1 72  ? -1.325  4.985  -9.688  1.00 31.68  ? 68  GLN B CD  1 
ATOM   1727 O OE1 . GLN B 1 72  ? -0.509  5.220  -10.560 1.00 34.03  ? 68  GLN B OE1 1 
ATOM   1728 N NE2 . GLN B 1 72  ? -2.539  4.510  -9.954  1.00 33.30  ? 68  GLN B NE2 1 
ATOM   1729 N N   . VAL B 1 73  ? -4.172  5.510  -5.231  1.00 28.34  ? 69  VAL B N   1 
ATOM   1730 C CA  . VAL B 1 73  ? -5.378  5.113  -4.568  1.00 28.17  ? 69  VAL B CA  1 
ATOM   1731 C C   . VAL B 1 73  ? -6.452  5.712  -5.430  1.00 28.59  ? 69  VAL B C   1 
ATOM   1732 O O   . VAL B 1 73  ? -6.381  6.899  -5.800  1.00 28.99  ? 69  VAL B O   1 
ATOM   1733 C CB  . VAL B 1 73  ? -5.493  5.628  -3.094  1.00 28.17  ? 69  VAL B CB  1 
ATOM   1734 C CG1 . VAL B 1 73  ? -5.651  7.132  -3.010  1.00 26.95  ? 69  VAL B CG1 1 
ATOM   1735 C CG2 . VAL B 1 73  ? -6.658  4.989  -2.400  1.00 28.90  ? 69  VAL B CG2 1 
ATOM   1736 N N   . CYS B 1 74  ? -7.422  4.891  -5.818  1.00 28.46  ? 70  CYS B N   1 
ATOM   1737 C CA  . CYS B 1 74  ? -8.496  5.383  -6.624  1.00 28.27  ? 70  CYS B CA  1 
ATOM   1738 C C   . CYS B 1 74  ? -9.698  4.519  -6.462  1.00 28.45  ? 70  CYS B C   1 
ATOM   1739 O O   . CYS B 1 74  ? -10.127 3.856  -7.413  1.00 29.38  ? 70  CYS B O   1 
ATOM   1740 C CB  . CYS B 1 74  ? -8.088  5.456  -8.094  1.00 28.57  ? 70  CYS B CB  1 
ATOM   1741 S SG  . CYS B 1 74  ? -9.453  6.229  -9.088  1.00 27.87  ? 70  CYS B SG  1 
ATOM   1742 N N   . ASN B 1 75  ? -10.241 4.529  -5.255  1.00 28.59  ? 71  ASN B N   1 
ATOM   1743 C CA  . ASN B 1 75  ? -11.398 3.688  -4.905  1.00 29.09  ? 71  ASN B CA  1 
ATOM   1744 C C   . ASN B 1 75  ? -12.697 4.471  -4.978  1.00 28.84  ? 71  ASN B C   1 
ATOM   1745 O O   . ASN B 1 75  ? -13.528 4.450  -4.073  1.00 27.61  ? 71  ASN B O   1 
ATOM   1746 C CB  . ASN B 1 75  ? -11.252 3.057  -3.517  1.00 28.89  ? 71  ASN B CB  1 
ATOM   1747 C CG  . ASN B 1 75  ? -10.106 2.061  -3.418  1.00 29.94  ? 71  ASN B CG  1 
ATOM   1748 O OD1 . ASN B 1 75  ? -9.460  1.704  -4.405  1.00 31.53  ? 71  ASN B OD1 1 
ATOM   1749 N ND2 . ASN B 1 75  ? -9.812  1.645  -2.187  1.00 27.13  ? 71  ASN B ND2 1 
ATOM   1750 N N   . VAL B 1 76  ? -12.912 5.105  -6.114  1.00 29.94  ? 72  VAL B N   1 
ATOM   1751 C CA  . VAL B 1 76  ? -14.087 5.967  -6.282  1.00 30.76  ? 72  VAL B CA  1 
ATOM   1752 C C   . VAL B 1 76  ? -15.399 5.236  -6.514  1.00 32.21  ? 72  VAL B C   1 
ATOM   1753 O O   . VAL B 1 76  ? -16.458 5.844  -6.552  1.00 33.53  ? 72  VAL B O   1 
ATOM   1754 C CB  . VAL B 1 76  ? -13.889 6.948  -7.417  1.00 30.94  ? 72  VAL B CB  1 
ATOM   1755 C CG1 . VAL B 1 76  ? -12.683 7.845  -7.152  1.00 28.52  ? 72  VAL B CG1 1 
ATOM   1756 C CG2 . VAL B 1 76  ? -13.768 6.175  -8.794  1.00 32.76  ? 72  VAL B CG2 1 
ATOM   1757 N N   . PHE B 1 77  ? -15.388 3.929  -6.657  1.00 34.47  ? 73  PHE B N   1 
ATOM   1758 C CA  . PHE B 1 77  ? -16.688 3.231  -6.839  1.00 35.48  ? 73  PHE B CA  1 
ATOM   1759 C C   . PHE B 1 77  ? -17.092 2.432  -5.613  1.00 36.77  ? 73  PHE B C   1 
ATOM   1760 O O   . PHE B 1 77  ? -17.949 1.582  -5.694  1.00 37.19  ? 73  PHE B O   1 
ATOM   1761 C CB  . PHE B 1 77  ? -16.646 2.353  -8.051  1.00 34.40  ? 73  PHE B CB  1 
ATOM   1762 C CG  . PHE B 1 77  ? -16.566 3.105  -9.342  1.00 33.56  ? 73  PHE B CG  1 
ATOM   1763 C CD1 . PHE B 1 77  ? -17.668 3.747  -9.854  1.00 31.66  ? 73  PHE B CD1 1 
ATOM   1764 C CD2 . PHE B 1 77  ? -15.402 3.121  -10.075 1.00 32.40  ? 73  PHE B CD2 1 
ATOM   1765 C CE1 . PHE B 1 77  ? -17.599 4.401  -11.070 1.00 31.91  ? 73  PHE B CE1 1 
ATOM   1766 C CE2 . PHE B 1 77  ? -15.350 3.788  -11.306 1.00 33.62  ? 73  PHE B CE2 1 
ATOM   1767 C CZ  . PHE B 1 77  ? -16.463 4.411  -11.786 1.00 30.94  ? 73  PHE B CZ  1 
ATOM   1768 N N   . GLU B 1 78  ? -16.497 2.787  -4.476  1.00 38.69  ? 74  GLU B N   1 
ATOM   1769 C CA  . GLU B 1 78  ? -16.573 2.029  -3.232  1.00 40.35  ? 74  GLU B CA  1 
ATOM   1770 C C   . GLU B 1 78  ? -16.741 3.044  -2.116  1.00 41.17  ? 74  GLU B C   1 
ATOM   1771 O O   . GLU B 1 78  ? -15.888 3.925  -1.962  1.00 42.91  ? 74  GLU B O   1 
ATOM   1772 C CB  . GLU B 1 78  ? -15.279 1.210  -3.045  1.00 40.22  ? 74  GLU B CB  1 
ATOM   1773 C CG  . GLU B 1 78  ? -15.499 -0.176 -2.490  1.00 41.92  ? 74  GLU B CG  1 
ATOM   1774 N N   . SER B 1 79  ? -17.825 2.941  -1.344  1.00 41.76  ? 75  SER B N   1 
ATOM   1775 C CA  . SER B 1 79  ? -18.077 3.886  -0.251  1.00 42.05  ? 75  SER B CA  1 
ATOM   1776 C C   . SER B 1 79  ? -17.223 3.640  1.029   1.00 42.19  ? 75  SER B C   1 
ATOM   1777 O O   . SER B 1 79  ? -16.453 2.662  1.136   1.00 42.91  ? 75  SER B O   1 
ATOM   1778 C CB  . SER B 1 79  ? -19.544 3.862  0.095   1.00 41.80  ? 75  SER B CB  1 
ATOM   1779 O OG  . SER B 1 79  ? -19.862 2.571  0.534   1.00 43.04  ? 75  SER B OG  1 
ATOM   1780 N N   . SER B 1 80  ? -17.354 4.568  1.972   1.00 41.77  ? 76  SER B N   1 
ATOM   1781 C CA  . SER B 1 80  ? -16.699 4.510  3.274   1.00 41.37  ? 76  SER B CA  1 
ATOM   1782 C C   . SER B 1 80  ? -15.202 4.437  3.140   1.00 40.55  ? 76  SER B C   1 
ATOM   1783 O O   . SER B 1 80  ? -14.551 3.664  3.855   1.00 41.83  ? 76  SER B O   1 
ATOM   1784 C CB  . SER B 1 80  ? -17.221 3.311  4.107   1.00 41.66  ? 76  SER B CB  1 
ATOM   1785 O OG  . SER B 1 80  ? -18.630 3.391  4.297   1.00 43.24  ? 76  SER B OG  1 
ATOM   1786 N N   . GLN B 1 81  ? -14.628 5.222  2.236   1.00 39.10  ? 77  GLN B N   1 
ATOM   1787 C CA  . GLN B 1 81  ? -13.208 5.082  1.960   1.00 37.66  ? 77  GLN B CA  1 
ATOM   1788 C C   . GLN B 1 81  ? -12.441 5.820  3.040   1.00 36.96  ? 77  GLN B C   1 
ATOM   1789 O O   . GLN B 1 81  ? -12.753 6.978  3.338   1.00 36.57  ? 77  GLN B O   1 
ATOM   1790 C CB  . GLN B 1 81  ? -12.849 5.602  0.565   1.00 37.59  ? 77  GLN B CB  1 
ATOM   1791 C CG  . GLN B 1 81  ? -13.151 4.606  -0.561  1.00 37.14  ? 77  GLN B CG  1 
ATOM   1792 C CD  . GLN B 1 81  ? -12.653 3.169  -0.261  1.00 35.10  ? 77  GLN B CD  1 
ATOM   1793 O OE1 . GLN B 1 81  ? -11.465 2.874  -0.405  1.00 35.38  ? 77  GLN B OE1 1 
ATOM   1794 N NE2 . GLN B 1 81  ? -13.558 2.290  0.100   1.00 32.85  ? 77  GLN B NE2 1 
ATOM   1795 N N   . ASN B 1 82  ? -11.483 5.128  3.660   1.00 35.50  ? 78  ASN B N   1 
ATOM   1796 C CA  . ASN B 1 82  ? -10.599 5.745  4.657   1.00 35.12  ? 78  ASN B CA  1 
ATOM   1797 C C   . ASN B 1 82  ? -9.230  5.120  4.579   1.00 34.08  ? 78  ASN B C   1 
ATOM   1798 O O   . ASN B 1 82  ? -8.895  4.274  5.400   1.00 34.19  ? 78  ASN B O   1 
ATOM   1799 C CB  . ASN B 1 82  ? -11.180 5.603  6.084   1.00 34.96  ? 78  ASN B CB  1 
ATOM   1800 C CG  . ASN B 1 82  ? -10.415 6.415  7.137   1.00 33.93  ? 78  ASN B CG  1 
ATOM   1801 O OD1 . ASN B 1 82  ? -9.412  7.078  6.863   1.00 29.25  ? 78  ASN B OD1 1 
ATOM   1802 N ND2 . ASN B 1 82  ? -10.886 6.331  8.363   1.00 32.49  ? 78  ASN B ND2 1 
ATOM   1803 N N   . ASN B 1 83  ? -8.423  5.579  3.614   1.00 33.31  ? 79  ASN B N   1 
ATOM   1804 C CA  . ASN B 1 83  ? -7.223  4.856  3.231   1.00 32.75  ? 79  ASN B CA  1 
ATOM   1805 C C   . ASN B 1 83  ? -5.957  5.557  3.690   1.00 31.91  ? 79  ASN B C   1 
ATOM   1806 O O   . ASN B 1 83  ? -5.704  6.693  3.308   1.00 32.00  ? 79  ASN B O   1 
ATOM   1807 C CB  . ASN B 1 83  ? -7.219  4.603  1.697   1.00 32.87  ? 79  ASN B CB  1 
ATOM   1808 C CG  . ASN B 1 83  ? -8.496  3.895  1.206   1.00 32.77  ? 79  ASN B CG  1 
ATOM   1809 O OD1 . ASN B 1 83  ? -8.830  2.806  1.667   1.00 31.02  ? 79  ASN B OD1 1 
ATOM   1810 N ND2 . ASN B 1 83  ? -9.183  4.496  0.255   1.00 31.19  ? 79  ASN B ND2 1 
ATOM   1811 N N   . TRP B 1 84  ? -5.158  4.859  4.503   1.00 31.20  ? 80  TRP B N   1 
ATOM   1812 C CA  . TRP B 1 84  ? -3.898  5.385  5.052   1.00 30.06  ? 80  TRP B CA  1 
ATOM   1813 C C   . TRP B 1 84  ? -2.695  4.734  4.427   1.00 29.65  ? 80  TRP B C   1 
ATOM   1814 O O   . TRP B 1 84  ? -2.717  3.555  4.047   1.00 29.72  ? 80  TRP B O   1 
ATOM   1815 C CB  . TRP B 1 84  ? -3.813  5.180  6.567   1.00 29.53  ? 80  TRP B CB  1 
ATOM   1816 C CG  . TRP B 1 84  ? -4.765  6.048  7.323   1.00 28.90  ? 80  TRP B CG  1 
ATOM   1817 C CD1 . TRP B 1 84  ? -6.097  6.051  7.220   1.00 27.15  ? 80  TRP B CD1 1 
ATOM   1818 C CD2 . TRP B 1 84  ? -4.420  7.080  8.283   1.00 28.51  ? 80  TRP B CD2 1 
ATOM   1819 N NE1 . TRP B 1 84  ? -6.629  7.019  8.040   1.00 28.81  ? 80  TRP B NE1 1 
ATOM   1820 C CE2 . TRP B 1 84  ? -5.616  7.662  8.707   1.00 27.70  ? 80  TRP B CE2 1 
ATOM   1821 C CE3 . TRP B 1 84  ? -3.210  7.560  8.812   1.00 27.75  ? 80  TRP B CE3 1 
ATOM   1822 C CZ2 . TRP B 1 84  ? -5.657  8.711  9.673   1.00 29.84  ? 80  TRP B CZ2 1 
ATOM   1823 C CZ3 . TRP B 1 84  ? -3.244  8.610  9.756   1.00 28.17  ? 80  TRP B CZ3 1 
ATOM   1824 C CH2 . TRP B 1 84  ? -4.463  9.169  10.175  1.00 27.86  ? 80  TRP B CH2 1 
ATOM   1825 N N   . LEU B 1 85  ? -1.659  5.557  4.340   1.00 29.07  ? 81  LEU B N   1 
ATOM   1826 C CA  . LEU B 1 85  ? -0.350  5.227  3.890   1.00 29.02  ? 81  LEU B CA  1 
ATOM   1827 C C   . LEU B 1 85  ? 0.620   5.867  4.879   1.00 29.93  ? 81  LEU B C   1 
ATOM   1828 O O   . LEU B 1 85  ? 0.441   7.068  5.209   1.00 30.71  ? 81  LEU B O   1 
ATOM   1829 C CB  . LEU B 1 85  ? -0.153  5.878  2.542   1.00 28.87  ? 81  LEU B CB  1 
ATOM   1830 C CG  . LEU B 1 85  ? 1.258   5.953  2.017   1.00 27.61  ? 81  LEU B CG  1 
ATOM   1831 C CD1 . LEU B 1 85  ? 1.751   4.541  1.712   1.00 27.70  ? 81  LEU B CD1 1 
ATOM   1832 C CD2 . LEU B 1 85  ? 1.239   6.851  0.765   1.00 28.56  ? 81  LEU B CD2 1 
ATOM   1833 N N   . ARG B 1 86  ? 1.644   5.124  5.311   1.00 29.69  ? 82  ARG B N   1 
ATOM   1834 C CA  . ARG B 1 86  ? 2.560   5.592  6.352   1.00 30.14  ? 82  ARG B CA  1 
ATOM   1835 C C   . ARG B 1 86  ? 4.009   5.327  5.974   1.00 30.53  ? 82  ARG B C   1 
ATOM   1836 O O   . ARG B 1 86  ? 4.388   4.176  5.688   1.00 30.77  ? 82  ARG B O   1 
ATOM   1837 C CB  . ARG B 1 86  ? 2.261   4.876  7.687   1.00 30.22  ? 82  ARG B CB  1 
ATOM   1838 C CG  . ARG B 1 86  ? 3.180   5.247  8.848   1.00 29.95  ? 82  ARG B CG  1 
ATOM   1839 C CD  . ARG B 1 86  ? 2.811   4.417  10.057  1.00 31.66  ? 82  ARG B CD  1 
ATOM   1840 N NE  . ARG B 1 86  ? 3.466   3.092  10.007  1.00 34.31  ? 82  ARG B NE  1 
ATOM   1841 C CZ  . ARG B 1 86  ? 3.020   1.980  10.605  1.00 34.25  ? 82  ARG B CZ  1 
ATOM   1842 N NH1 . ARG B 1 86  ? 1.891   1.977  11.307  1.00 35.43  ? 82  ARG B NH1 1 
ATOM   1843 N NH2 . ARG B 1 86  ? 3.724   0.861  10.503  1.00 34.05  ? 82  ARG B NH2 1 
ATOM   1844 N N   . THR B 1 87  ? 4.810   6.386  5.985   1.00 30.54  ? 83  THR B N   1 
ATOM   1845 C CA  . THR B 1 87  ? 6.202   6.314  5.633   1.00 31.74  ? 83  THR B CA  1 
ATOM   1846 C C   . THR B 1 87  ? 6.975   5.450  6.595   1.00 32.70  ? 83  THR B C   1 
ATOM   1847 O O   . THR B 1 87  ? 6.481   5.019  7.621   1.00 32.98  ? 83  THR B O   1 
ATOM   1848 C CB  . THR B 1 87  ? 6.867   7.702  5.687   1.00 31.89  ? 83  THR B CB  1 
ATOM   1849 O OG1 . THR B 1 87  ? 6.906   8.156  7.040   1.00 32.63  ? 83  THR B OG1 1 
ATOM   1850 C CG2 . THR B 1 87  ? 6.126   8.726  4.824   1.00 31.49  ? 83  THR B CG2 1 
ATOM   1851 N N   . LYS B 1 88  ? 8.229   5.215  6.287   1.00 34.17  ? 84  LYS B N   1 
ATOM   1852 C CA  . LYS B 1 88  ? 9.084   4.608  7.288   1.00 35.89  ? 84  LYS B CA  1 
ATOM   1853 C C   . LYS B 1 88  ? 9.407   5.691  8.339   1.00 36.04  ? 84  LYS B C   1 
ATOM   1854 O O   . LYS B 1 88  ? 8.945   6.836  8.236   1.00 36.25  ? 84  LYS B O   1 
ATOM   1855 C CB  . LYS B 1 88  ? 10.334  3.972  6.646   1.00 35.71  ? 84  LYS B CB  1 
ATOM   1856 C CG  . LYS B 1 88  ? 9.960   2.647  5.927   1.00 37.88  ? 84  LYS B CG  1 
ATOM   1857 C CD  . LYS B 1 88  ? 11.187  1.934  5.423   1.00 38.33  ? 84  LYS B CD  1 
ATOM   1858 C CE  . LYS B 1 88  ? 10.840  0.601  4.792   1.00 39.92  ? 84  LYS B CE  1 
ATOM   1859 N NZ  . LYS B 1 88  ? 11.973  0.144  3.905   1.00 42.50  ? 84  LYS B NZ  1 
ATOM   1860 N N   . PHE B 1 89  ? 10.155  5.287  9.354   1.00 36.20  ? 85  PHE B N   1 
ATOM   1861 C CA  . PHE B 1 89  ? 10.553  6.127  10.437  1.00 36.39  ? 85  PHE B CA  1 
ATOM   1862 C C   . PHE B 1 89  ? 11.638  7.003  9.884   1.00 35.94  ? 85  PHE B C   1 
ATOM   1863 O O   . PHE B 1 89  ? 12.568  6.500  9.291   1.00 36.07  ? 85  PHE B O   1 
ATOM   1864 C CB  . PHE B 1 89  ? 11.087  5.237  11.559  1.00 36.82  ? 85  PHE B CB  1 
ATOM   1865 C CG  . PHE B 1 89  ? 11.640  5.970  12.757  1.00 35.88  ? 85  PHE B CG  1 
ATOM   1866 C CD1 . PHE B 1 89  ? 10.788  6.564  13.680  1.00 38.27  ? 85  PHE B CD1 1 
ATOM   1867 C CD2 . PHE B 1 89  ? 12.999  5.938  13.028  1.00 36.73  ? 85  PHE B CD2 1 
ATOM   1868 C CE1 . PHE B 1 89  ? 11.285  7.179  14.833  1.00 38.15  ? 85  PHE B CE1 1 
ATOM   1869 C CE2 . PHE B 1 89  ? 13.527  6.542  14.184  1.00 39.77  ? 85  PHE B CE2 1 
ATOM   1870 C CZ  . PHE B 1 89  ? 12.658  7.174  15.087  1.00 38.54  ? 85  PHE B CZ  1 
ATOM   1871 N N   . ILE B 1 90  ? 11.494  8.307  10.089  1.00 35.87  ? 86  ILE B N   1 
ATOM   1872 C CA  . ILE B 1 90  ? 12.434  9.326  9.651   1.00 35.84  ? 86  ILE B CA  1 
ATOM   1873 C C   . ILE B 1 90  ? 13.188  9.883  10.869  1.00 36.75  ? 86  ILE B C   1 
ATOM   1874 O O   . ILE B 1 90  ? 12.580  10.433 11.764  1.00 37.95  ? 86  ILE B O   1 
ATOM   1875 C CB  . ILE B 1 90  ? 11.648  10.459 8.955   1.00 35.25  ? 86  ILE B CB  1 
ATOM   1876 C CG1 . ILE B 1 90  ? 10.749  9.875  7.869   1.00 35.08  ? 86  ILE B CG1 1 
ATOM   1877 C CG2 . ILE B 1 90  ? 12.566  11.462 8.352   1.00 35.10  ? 86  ILE B CG2 1 
ATOM   1878 C CD1 . ILE B 1 90  ? 9.960   10.905 7.087   1.00 35.60  ? 86  ILE B CD1 1 
ATOM   1879 N N   . ARG B 1 91  ? 14.501  9.740  10.904  1.00 37.93  ? 87  ARG B N   1 
ATOM   1880 C CA  . ARG B 1 91  ? 15.298  10.307 11.980  1.00 39.57  ? 87  ARG B CA  1 
ATOM   1881 C C   . ARG B 1 91  ? 15.306  11.827 11.912  1.00 40.33  ? 87  ARG B C   1 
ATOM   1882 O O   . ARG B 1 91  ? 15.347  12.401 10.843  1.00 40.70  ? 87  ARG B O   1 
ATOM   1883 C CB  . ARG B 1 91  ? 16.741  9.752  11.973  1.00 39.16  ? 87  ARG B CB  1 
ATOM   1884 C CG  . ARG B 1 91  ? 16.833  8.296  12.465  1.00 40.97  ? 87  ARG B CG  1 
ATOM   1885 C CD  . ARG B 1 91  ? 18.281  7.725  12.432  1.00 40.85  ? 87  ARG B CD  1 
ATOM   1886 N N   . ARG B 1 92  ? 15.292  12.469 13.077  1.00 41.62  ? 88  ARG B N   1 
ATOM   1887 C CA  . ARG B 1 92  ? 15.129  13.920 13.169  1.00 42.23  ? 88  ARG B CA  1 
ATOM   1888 C C   . ARG B 1 92  ? 16.462  14.618 12.908  1.00 43.07  ? 88  ARG B C   1 
ATOM   1889 O O   . ARG B 1 92  ? 16.502  15.771 12.458  1.00 42.61  ? 88  ARG B O   1 
ATOM   1890 C CB  . ARG B 1 92  ? 14.565  14.289 14.550  1.00 41.65  ? 88  ARG B CB  1 
ATOM   1891 C CG  . ARG B 1 92  ? 14.333  15.776 14.773  1.00 42.38  ? 88  ARG B CG  1 
ATOM   1892 C CD  . ARG B 1 92  ? 13.737  16.050 16.150  1.00 41.45  ? 88  ARG B CD  1 
ATOM   1893 N NE  . ARG B 1 92  ? 14.624  15.679 17.248  1.00 39.95  ? 88  ARG B NE  1 
ATOM   1894 C CZ  . ARG B 1 92  ? 15.557  16.470 17.805  1.00 42.59  ? 88  ARG B CZ  1 
ATOM   1895 N NH1 . ARG B 1 92  ? 15.780  17.707 17.366  1.00 41.37  ? 88  ARG B NH1 1 
ATOM   1896 N NH2 . ARG B 1 92  ? 16.298  16.009 18.817  1.00 41.83  ? 88  ARG B NH2 1 
ATOM   1897 N N   . ARG B 1 93  ? 17.537  13.897 13.211  1.00 44.52  ? 89  ARG B N   1 
ATOM   1898 C CA  . ARG B 1 93  ? 18.928  14.378 13.104  1.00 45.69  ? 89  ARG B CA  1 
ATOM   1899 C C   . ARG B 1 93  ? 19.080  15.841 13.515  1.00 46.25  ? 89  ARG B C   1 
ATOM   1900 O O   . ARG B 1 93  ? 19.696  16.655 12.795  1.00 47.81  ? 89  ARG B O   1 
ATOM   1901 C CB  . ARG B 1 93  ? 19.479  14.120 11.685  1.00 45.74  ? 89  ARG B CB  1 
ATOM   1902 C CG  . ARG B 1 93  ? 19.331  12.667 11.218  1.00 45.47  ? 89  ARG B CG  1 
ATOM   1903 N N   . GLY B 1 94  ? 18.503  16.194 14.654  1.00 45.96  ? 90  GLY B N   1 
ATOM   1904 C CA  . GLY B 1 94  ? 18.722  17.549 15.205  1.00 46.38  ? 90  GLY B CA  1 
ATOM   1905 C C   . GLY B 1 94  ? 17.860  18.696 14.682  1.00 46.06  ? 90  GLY B C   1 
ATOM   1906 O O   . GLY B 1 94  ? 18.022  19.828 15.122  1.00 46.68  ? 90  GLY B O   1 
ATOM   1907 N N   . ALA B 1 95  ? 16.938  18.406 13.769  1.00 45.60  ? 91  ALA B N   1 
ATOM   1908 C CA  . ALA B 1 95  ? 16.053  19.399 13.195  1.00 45.28  ? 91  ALA B CA  1 
ATOM   1909 C C   . ALA B 1 95  ? 14.965  19.811 14.169  1.00 45.20  ? 91  ALA B C   1 
ATOM   1910 O O   . ALA B 1 95  ? 14.541  19.026 14.993  1.00 44.35  ? 91  ALA B O   1 
ATOM   1911 C CB  . ALA B 1 95  ? 15.406  18.829 11.923  1.00 45.84  ? 91  ALA B CB  1 
ATOM   1912 N N   . HIS B 1 96  ? 14.484  21.037 14.041  1.00 45.43  ? 92  HIS B N   1 
ATOM   1913 C CA  . HIS B 1 96  ? 13.357  21.480 14.843  1.00 46.22  ? 92  HIS B CA  1 
ATOM   1914 C C   . HIS B 1 96  ? 12.132  21.803 13.983  1.00 45.69  ? 92  HIS B C   1 
ATOM   1915 O O   . HIS B 1 96  ? 11.034  21.459 14.357  1.00 46.79  ? 92  HIS B O   1 
ATOM   1916 C CB  . HIS B 1 96  ? 13.782  22.659 15.731  1.00 47.17  ? 92  HIS B CB  1 
ATOM   1917 C CG  . HIS B 1 96  ? 15.042  22.380 16.488  1.00 48.69  ? 92  HIS B CG  1 
ATOM   1918 N ND1 . HIS B 1 96  ? 16.227  23.043 16.237  1.00 50.27  ? 92  HIS B ND1 1 
ATOM   1919 C CD2 . HIS B 1 96  ? 15.332  21.416 17.393  1.00 49.98  ? 92  HIS B CD2 1 
ATOM   1920 C CE1 . HIS B 1 96  ? 17.182  22.530 16.993  1.00 51.39  ? 92  HIS B CE1 1 
ATOM   1921 N NE2 . HIS B 1 96  ? 16.664  21.542 17.704  1.00 52.21  ? 92  HIS B NE2 1 
ATOM   1922 N N   . ARG B 1 97  ? 12.296  22.460 12.843  1.00 44.69  ? 93  ARG B N   1 
ATOM   1923 C CA  . ARG B 1 97  ? 11.148  22.654 11.969  1.00 43.61  ? 93  ARG B CA  1 
ATOM   1924 C C   . ARG B 1 97  ? 11.291  21.729 10.759  1.00 41.71  ? 93  ARG B C   1 
ATOM   1925 O O   . ARG B 1 97  ? 12.340  21.663 10.120  1.00 41.06  ? 93  ARG B O   1 
ATOM   1926 C CB  . ARG B 1 97  ? 10.942  24.120 11.576  1.00 44.01  ? 93  ARG B CB  1 
ATOM   1927 C CG  . ARG B 1 97  ? 9.573   24.364 10.894  1.00 45.42  ? 93  ARG B CG  1 
ATOM   1928 C CD  . ARG B 1 97  ? 8.765   25.480 11.547  1.00 48.73  ? 93  ARG B CD  1 
ATOM   1929 N NE  . ARG B 1 97  ? 7.483   25.791 10.877  1.00 49.88  ? 93  ARG B NE  1 
ATOM   1930 C CZ  . ARG B 1 97  ? 6.247   25.583 11.375  1.00 51.73  ? 93  ARG B CZ  1 
ATOM   1931 N NH1 . ARG B 1 97  ? 6.028   25.037 12.573  1.00 52.45  ? 93  ARG B NH1 1 
ATOM   1932 N NH2 . ARG B 1 97  ? 5.194   25.940 10.652  1.00 52.32  ? 93  ARG B NH2 1 
ATOM   1933 N N   . ILE B 1 98  ? 10.238  20.966 10.496  1.00 39.55  ? 94  ILE B N   1 
ATOM   1934 C CA  . ILE B 1 98  ? 10.281  19.983 9.424   1.00 37.97  ? 94  ILE B CA  1 
ATOM   1935 C C   . ILE B 1 98  ? 9.528   20.495 8.236   1.00 36.21  ? 94  ILE B C   1 
ATOM   1936 O O   . ILE B 1 98  ? 8.396   20.962 8.378   1.00 35.53  ? 94  ILE B O   1 
ATOM   1937 C CB  . ILE B 1 98  ? 9.679   18.637 9.863   1.00 37.61  ? 94  ILE B CB  1 
ATOM   1938 C CG1 . ILE B 1 98  ? 10.492  18.069 11.028  1.00 35.90  ? 94  ILE B CG1 1 
ATOM   1939 C CG2 . ILE B 1 98  ? 9.642   17.646 8.667   1.00 37.57  ? 94  ILE B CG2 1 
ATOM   1940 C CD1 . ILE B 1 98  ? 11.940  17.901 10.734  1.00 35.52  ? 94  ILE B CD1 1 
ATOM   1941 N N   . HIS B 1 99  ? 10.128  20.367 7.061   1.00 35.44  ? 95  HIS B N   1 
ATOM   1942 C CA  . HIS B 1 99  ? 9.439   20.754 5.819   1.00 35.00  ? 95  HIS B CA  1 
ATOM   1943 C C   . HIS B 1 99  ? 9.166   19.521 4.942   1.00 34.01  ? 95  HIS B C   1 
ATOM   1944 O O   . HIS B 1 99  ? 10.058  18.695 4.701   1.00 35.02  ? 95  HIS B O   1 
ATOM   1945 C CB  . HIS B 1 99  ? 10.278  21.792 5.071   1.00 35.44  ? 95  HIS B CB  1 
ATOM   1946 C CG  . HIS B 1 99  ? 10.587  23.010 5.876   1.00 35.54  ? 95  HIS B CG  1 
ATOM   1947 N ND1 . HIS B 1 99  ? 9.672   24.014 6.077   1.00 38.92  ? 95  HIS B ND1 1 
ATOM   1948 C CD2 . HIS B 1 99  ? 11.710  23.391 6.530   1.00 39.45  ? 95  HIS B CD2 1 
ATOM   1949 C CE1 . HIS B 1 99  ? 10.213  24.961 6.823   1.00 39.33  ? 95  HIS B CE1 1 
ATOM   1950 N NE2 . HIS B 1 99  ? 11.448  24.603 7.119   1.00 38.44  ? 95  HIS B NE2 1 
ATOM   1951 N N   . VAL B 1 100 ? 7.937   19.392 4.478   1.00 32.82  ? 96  VAL B N   1 
ATOM   1952 C CA  . VAL B 1 100 ? 7.555   18.251 3.674   1.00 31.94  ? 96  VAL B CA  1 
ATOM   1953 C C   . VAL B 1 100 ? 7.152   18.713 2.285   1.00 31.67  ? 96  VAL B C   1 
ATOM   1954 O O   . VAL B 1 100 ? 6.079   19.265 2.117   1.00 30.58  ? 96  VAL B O   1 
ATOM   1955 C CB  . VAL B 1 100 ? 6.344   17.462 4.257   1.00 31.47  ? 96  VAL B CB  1 
ATOM   1956 C CG1 . VAL B 1 100 ? 6.140   16.186 3.458   1.00 30.10  ? 96  VAL B CG1 1 
ATOM   1957 C CG2 . VAL B 1 100 ? 6.544   17.139 5.728   1.00 31.58  ? 96  VAL B CG2 1 
ATOM   1958 N N   . GLU B 1 101 ? 7.995   18.413 1.298   1.00 31.56  ? 97  GLU B N   1 
ATOM   1959 C CA  . GLU B 1 101 ? 7.652   18.623 -0.117  1.00 31.88  ? 97  GLU B CA  1 
ATOM   1960 C C   . GLU B 1 101 ? 6.940   17.423 -0.729  1.00 30.65  ? 97  GLU B C   1 
ATOM   1961 O O   . GLU B 1 101 ? 7.504   16.340 -0.787  1.00 30.56  ? 97  GLU B O   1 
ATOM   1962 C CB  . GLU B 1 101 ? 8.904   18.883 -0.957  1.00 31.54  ? 97  GLU B CB  1 
ATOM   1963 C CG  . GLU B 1 101 ? 8.538   19.503 -2.304  1.00 34.17  ? 97  GLU B CG  1 
ATOM   1964 C CD  . GLU B 1 101 ? 9.716   19.691 -3.220  1.00 35.10  ? 97  GLU B CD  1 
ATOM   1965 O OE1 . GLU B 1 101 ? 9.496   20.194 -4.341  1.00 43.08  ? 97  GLU B OE1 1 
ATOM   1966 O OE2 . GLU B 1 101 ? 10.841  19.331 -2.859  1.00 38.04  ? 97  GLU B OE2 1 
ATOM   1967 N N   . MET B 1 102 ? 5.742   17.653 -1.249  1.00 29.28  ? 98  MET B N   1 
ATOM   1968 C CA  . MET B 1 102 ? 4.987   16.646 -1.900  1.00 28.66  ? 98  MET B CA  1 
ATOM   1969 C C   . MET B 1 102 ? 4.831   16.916 -3.401  1.00 28.92  ? 98  MET B C   1 
ATOM   1970 O O   . MET B 1 102 ? 4.447   18.000 -3.796  1.00 29.23  ? 98  MET B O   1 
ATOM   1971 C CB  . MET B 1 102 ? 3.606   16.551 -1.238  1.00 28.03  ? 98  MET B CB  1 
ATOM   1972 C CG  . MET B 1 102 ? 3.649   15.999 0.189   1.00 28.32  ? 98  MET B CG  1 
ATOM   1973 S SD  . MET B 1 102 ? 2.240   16.519 1.223   1.00 27.79  ? 98  MET B SD  1 
ATOM   1974 C CE  . MET B 1 102 ? 2.614   18.288 1.419   1.00 26.40  ? 98  MET B CE  1 
ATOM   1975 N N   . LYS B 1 103 ? 5.112   15.912 -4.237  1.00 29.00  ? 99  LYS B N   1 
ATOM   1976 C CA  . LYS B 1 103 ? 4.640   15.907 -5.629  1.00 28.89  ? 99  LYS B CA  1 
ATOM   1977 C C   . LYS B 1 103 ? 3.542   14.895 -5.811  1.00 28.18  ? 99  LYS B C   1 
ATOM   1978 O O   . LYS B 1 103 ? 3.678   13.766 -5.340  1.00 28.93  ? 99  LYS B O   1 
ATOM   1979 C CB  . LYS B 1 103 ? 5.814   15.649 -6.563  1.00 29.97  ? 99  LYS B CB  1 
ATOM   1980 C CG  . LYS B 1 103 ? 6.760   16.862 -6.465  1.00 31.15  ? 99  LYS B CG  1 
ATOM   1981 C CD  . LYS B 1 103 ? 8.102   16.709 -7.049  1.00 33.19  ? 99  LYS B CD  1 
ATOM   1982 C CE  . LYS B 1 103 ? 8.854   18.073 -6.898  1.00 35.10  ? 99  LYS B CE  1 
ATOM   1983 N NZ  . LYS B 1 103 ? 8.062   19.180 -7.581  1.00 37.33  ? 99  LYS B NZ  1 
ATOM   1984 N N   . PHE B 1 104 ? 2.470   15.282 -6.485  1.00 26.84  ? 100 PHE B N   1 
ATOM   1985 C CA  . PHE B 1 104 ? 1.307   14.430 -6.649  1.00 26.61  ? 100 PHE B CA  1 
ATOM   1986 C C   . PHE B 1 104 ? 0.456   14.785 -7.862  1.00 27.60  ? 100 PHE B C   1 
ATOM   1987 O O   . PHE B 1 104 ? 0.617   15.853 -8.455  1.00 28.97  ? 100 PHE B O   1 
ATOM   1988 C CB  . PHE B 1 104 ? 0.436   14.482 -5.394  1.00 26.92  ? 100 PHE B CB  1 
ATOM   1989 C CG  . PHE B 1 104 ? -0.108  15.862 -5.054  1.00 24.85  ? 100 PHE B CG  1 
ATOM   1990 C CD1 . PHE B 1 104 ? 0.710   16.830 -4.505  1.00 26.32  ? 100 PHE B CD1 1 
ATOM   1991 C CD2 . PHE B 1 104 ? -1.416  16.169 -5.273  1.00 25.49  ? 100 PHE B CD2 1 
ATOM   1992 C CE1 . PHE B 1 104 ? 0.233   18.076 -4.190  1.00 25.46  ? 100 PHE B CE1 1 
ATOM   1993 C CE2 . PHE B 1 104 ? -1.901  17.409 -4.965  1.00 25.31  ? 100 PHE B CE2 1 
ATOM   1994 C CZ  . PHE B 1 104 ? -1.057  18.364 -4.409  1.00 25.90  ? 100 PHE B CZ  1 
ATOM   1995 N N   . SER B 1 105 ? -0.467  13.888 -8.211  1.00 27.63  ? 101 SER B N   1 
ATOM   1996 C CA  . SER B 1 105 ? -1.360  14.039 -9.351  1.00 26.66  ? 101 SER B CA  1 
ATOM   1997 C C   . SER B 1 105 ? -2.726  13.680 -8.882  1.00 27.38  ? 101 SER B C   1 
ATOM   1998 O O   . SER B 1 105 ? -2.927  12.603 -8.367  1.00 28.71  ? 101 SER B O   1 
ATOM   1999 C CB  . SER B 1 105 ? -0.969  13.104 -10.493 1.00 26.74  ? 101 SER B CB  1 
ATOM   2000 O OG  . SER B 1 105 ? 0.301   13.436 -11.044 1.00 24.78  ? 101 SER B OG  1 
ATOM   2001 N N   . VAL B 1 106 ? -3.682  14.582 -9.023  1.00 28.54  ? 102 VAL B N   1 
ATOM   2002 C CA  . VAL B 1 106 ? -5.055  14.289 -8.672  1.00 29.28  ? 102 VAL B CA  1 
ATOM   2003 C C   . VAL B 1 106 ? -5.768  14.147 -9.998  1.00 30.88  ? 102 VAL B C   1 
ATOM   2004 O O   . VAL B 1 106 ? -5.580  14.969 -10.904 1.00 31.71  ? 102 VAL B O   1 
ATOM   2005 C CB  . VAL B 1 106 ? -5.725  15.424 -7.866  1.00 29.08  ? 102 VAL B CB  1 
ATOM   2006 C CG1 . VAL B 1 106 ? -7.239  15.234 -7.799  1.00 27.04  ? 102 VAL B CG1 1 
ATOM   2007 C CG2 . VAL B 1 106 ? -5.126  15.505 -6.446  1.00 29.68  ? 102 VAL B CG2 1 
ATOM   2008 N N   . ARG B 1 107 ? -6.556  13.085 -10.122 1.00 31.86  ? 103 ARG B N   1 
ATOM   2009 C CA  . ARG B 1 107 ? -7.494  12.964 -11.209 1.00 32.35  ? 103 ARG B CA  1 
ATOM   2010 C C   . ARG B 1 107 ? -8.781  13.597 -10.752 1.00 32.98  ? 103 ARG B C   1 
ATOM   2011 O O   . ARG B 1 107 ? -9.399  13.174 -9.768  1.00 33.38  ? 103 ARG B O   1 
ATOM   2012 C CB  . ARG B 1 107 ? -7.700  11.511 -11.588 1.00 32.22  ? 103 ARG B CB  1 
ATOM   2013 C CG  . ARG B 1 107 ? -8.511  11.310 -12.854 1.00 33.56  ? 103 ARG B CG  1 
ATOM   2014 C CD  . ARG B 1 107 ? -8.673  9.853  -13.214 1.00 31.53  ? 103 ARG B CD  1 
ATOM   2015 N NE  . ARG B 1 107 ? -9.584  9.689  -14.328 1.00 30.09  ? 103 ARG B NE  1 
ATOM   2016 C CZ  . ARG B 1 107 ? -9.674  8.602  -15.103 1.00 31.88  ? 103 ARG B CZ  1 
ATOM   2017 N NH1 . ARG B 1 107 ? -8.900  7.546  -14.906 1.00 29.74  ? 103 ARG B NH1 1 
ATOM   2018 N NH2 . ARG B 1 107 ? -10.552 8.574  -16.112 1.00 31.74  ? 103 ARG B NH2 1 
ATOM   2019 N N   . ASP B 1 108 ? -9.180  14.639 -11.465 1.00 33.77  ? 104 ASP B N   1 
ATOM   2020 C CA  . ASP B 1 108 ? -10.399 15.352 -11.125 1.00 33.97  ? 104 ASP B CA  1 
ATOM   2021 C C   . ASP B 1 108 ? -11.571 14.478 -11.370 1.00 34.00  ? 104 ASP B C   1 
ATOM   2022 O O   . ASP B 1 108 ? -11.604 13.727 -12.342 1.00 33.44  ? 104 ASP B O   1 
ATOM   2023 C CB  . ASP B 1 108 ? -10.562 16.709 -11.873 1.00 34.70  ? 104 ASP B CB  1 
ATOM   2024 C CG  . ASP B 1 108 ? -10.012 16.685 -13.240 1.00 33.77  ? 104 ASP B CG  1 
ATOM   2025 O OD1 . ASP B 1 108 ? -8.842  17.023 -13.417 1.00 41.04  ? 104 ASP B OD1 1 
ATOM   2026 O OD2 . ASP B 1 108 ? -10.721 16.313 -14.146 1.00 35.58  ? 104 ASP B OD2 1 
ATOM   2027 N N   . CYS B 1 109 ? -12.549 14.591 -10.479 1.00 34.50  ? 105 CYS B N   1 
ATOM   2028 C CA  . CYS B 1 109 ? -13.694 13.736 -10.515 1.00 35.60  ? 105 CYS B CA  1 
ATOM   2029 C C   . CYS B 1 109 ? -14.438 13.920 -11.825 1.00 35.88  ? 105 CYS B C   1 
ATOM   2030 O O   . CYS B 1 109 ? -15.117 13.010 -12.283 1.00 36.43  ? 105 CYS B O   1 
ATOM   2031 C CB  . CYS B 1 109 ? -14.597 14.090 -9.353  1.00 36.31  ? 105 CYS B CB  1 
ATOM   2032 S SG  . CYS B 1 109 ? -13.778 13.850 -7.784  1.00 39.22  ? 105 CYS B SG  1 
ATOM   2033 N N   . SER B 1 110 ? -14.350 15.137 -12.376 1.00 35.84  ? 106 SER B N   1 
ATOM   2034 C CA  . SER B 1 110 ? -14.942 15.495 -13.692 1.00 36.09  ? 106 SER B CA  1 
ATOM   2035 C C   . SER B 1 110 ? -14.444 14.608 -14.798 1.00 34.54  ? 106 SER B C   1 
ATOM   2036 O O   . SER B 1 110 ? -15.160 14.342 -15.714 1.00 34.62  ? 106 SER B O   1 
ATOM   2037 C CB  . SER B 1 110 ? -14.557 16.927 -14.103 1.00 35.65  ? 106 SER B CB  1 
ATOM   2038 O OG  . SER B 1 110 ? -15.459 17.822 -13.532 1.00 38.91  ? 106 SER B OG  1 
ATOM   2039 N N   . SER B 1 111 ? -13.181 14.226 -14.717 1.00 34.24  ? 107 SER B N   1 
ATOM   2040 C CA  A SER B 1 111 ? -12.560 13.382 -15.722 0.50 34.26  ? 107 SER B CA  1 
ATOM   2041 C CA  B SER B 1 111 ? -12.573 13.386 -15.729 0.50 33.97  ? 107 SER B CA  1 
ATOM   2042 C C   . SER B 1 111 ? -12.630 11.891 -15.400 1.00 34.02  ? 107 SER B C   1 
ATOM   2043 O O   . SER B 1 111 ? -11.818 11.142 -15.876 1.00 35.41  ? 107 SER B O   1 
ATOM   2044 C CB  A SER B 1 111 ? -11.092 13.763 -15.866 0.50 34.20  ? 107 SER B CB  1 
ATOM   2045 C CB  B SER B 1 111 ? -11.122 13.811 -15.917 0.50 33.81  ? 107 SER B CB  1 
ATOM   2046 O OG  A SER B 1 111 ? -10.300 13.094 -14.889 0.50 35.28  ? 107 SER B OG  1 
ATOM   2047 O OG  B SER B 1 111 ? -11.021 15.208 -16.082 0.50 32.91  ? 107 SER B OG  1 
ATOM   2048 N N   . ILE B 1 112 ? -13.565 11.443 -14.567 1.00 33.71  ? 108 ILE B N   1 
ATOM   2049 C CA  . ILE B 1 112 ? -13.663 9.987  -14.275 1.00 33.21  ? 108 ILE B CA  1 
ATOM   2050 C C   . ILE B 1 112 ? -15.023 9.512  -14.797 1.00 32.71  ? 108 ILE B C   1 
ATOM   2051 O O   . ILE B 1 112 ? -16.065 9.940  -14.284 1.00 31.16  ? 108 ILE B O   1 
ATOM   2052 C CB  . ILE B 1 112 ? -13.496 9.636  -12.751 1.00 33.33  ? 108 ILE B CB  1 
ATOM   2053 C CG1 . ILE B 1 112 ? -12.156 10.181 -12.210 1.00 34.22  ? 108 ILE B CG1 1 
ATOM   2054 C CG2 . ILE B 1 112 ? -13.543 8.104  -12.550 1.00 33.00  ? 108 ILE B CG2 1 
ATOM   2055 C CD1 . ILE B 1 112 ? -11.932 10.114 -10.717 1.00 32.19  ? 108 ILE B CD1 1 
ATOM   2056 N N   . PRO B 1 113 ? -15.025 8.687  -15.866 1.00 32.78  ? 109 PRO B N   1 
ATOM   2057 C CA  . PRO B 1 113 ? -16.313 8.249  -16.385 1.00 33.16  ? 109 PRO B CA  1 
ATOM   2058 C C   . PRO B 1 113 ? -17.140 7.564  -15.328 1.00 34.16  ? 109 PRO B C   1 
ATOM   2059 O O   . PRO B 1 113 ? -16.623 6.743  -14.553 1.00 34.42  ? 109 PRO B O   1 
ATOM   2060 C CB  . PRO B 1 113 ? -15.942 7.297  -17.531 1.00 33.18  ? 109 PRO B CB  1 
ATOM   2061 C CG  . PRO B 1 113 ? -14.573 7.737  -17.955 1.00 33.80  ? 109 PRO B CG  1 
ATOM   2062 C CD  . PRO B 1 113 ? -13.908 8.204  -16.692 1.00 33.13  ? 109 PRO B CD  1 
ATOM   2063 N N   . SER B 1 114 ? -18.413 7.931  -15.283 1.00 35.26  ? 110 SER B N   1 
ATOM   2064 C CA  . SER B 1 114 ? -19.379 7.262  -14.435 1.00 36.83  ? 110 SER B CA  1 
ATOM   2065 C C   . SER B 1 114 ? -19.118 7.385  -12.908 1.00 37.05  ? 110 SER B C   1 
ATOM   2066 O O   . SER B 1 114 ? -19.744 6.659  -12.144 1.00 36.95  ? 110 SER B O   1 
ATOM   2067 C CB  . SER B 1 114 ? -19.488 5.767  -14.856 1.00 36.89  ? 110 SER B CB  1 
ATOM   2068 O OG  . SER B 1 114 ? -19.831 5.614  -16.237 1.00 37.79  ? 110 SER B OG  1 
ATOM   2069 N N   . VAL B 1 115 ? -18.263 8.311  -12.443 1.00 38.18  ? 111 VAL B N   1 
ATOM   2070 C CA  . VAL B 1 115 ? -18.063 8.420  -10.977 1.00 38.60  ? 111 VAL B CA  1 
ATOM   2071 C C   . VAL B 1 115 ? -19.303 8.906  -10.290 1.00 38.43  ? 111 VAL B C   1 
ATOM   2072 O O   . VAL B 1 115 ? -19.965 9.806  -10.816 1.00 38.49  ? 111 VAL B O   1 
ATOM   2073 C CB  . VAL B 1 115 ? -16.950 9.412  -10.418 1.00 39.16  ? 111 VAL B CB  1 
ATOM   2074 C CG1 . VAL B 1 115 ? -15.633 8.684  -10.148 1.00 39.61  ? 111 VAL B CG1 1 
ATOM   2075 C CG2 . VAL B 1 115 ? -16.836 10.694 -11.227 1.00 39.28  ? 111 VAL B CG2 1 
ATOM   2076 N N   . PRO B 1 116 ? -19.560 8.358  -9.074  1.00 38.18  ? 112 PRO B N   1 
ATOM   2077 C CA  . PRO B 1 116 ? -20.531 8.874  -8.105  1.00 38.30  ? 112 PRO B CA  1 
ATOM   2078 C C   . PRO B 1 116 ? -20.146 10.272 -7.581  1.00 38.38  ? 112 PRO B C   1 
ATOM   2079 O O   . PRO B 1 116 ? -18.968 10.629 -7.582  1.00 37.82  ? 112 PRO B O   1 
ATOM   2080 C CB  . PRO B 1 116 ? -20.495 7.833  -6.970  1.00 38.45  ? 112 PRO B CB  1 
ATOM   2081 C CG  . PRO B 1 116 ? -19.869 6.589  -7.616  1.00 38.61  ? 112 PRO B CG  1 
ATOM   2082 C CD  . PRO B 1 116 ? -18.904 7.127  -8.591  1.00 38.27  ? 112 PRO B CD  1 
ATOM   2083 N N   . GLY B 1 117 ? -21.140 11.027 -7.113  1.00 38.43  ? 113 GLY B N   1 
ATOM   2084 C CA  . GLY B 1 117 ? -20.927 12.406 -6.664  1.00 39.23  ? 113 GLY B CA  1 
ATOM   2085 C C   . GLY B 1 117 ? -20.085 12.557 -5.390  1.00 39.29  ? 113 GLY B C   1 
ATOM   2086 O O   . GLY B 1 117 ? -19.691 13.665 -5.007  1.00 39.24  ? 113 GLY B O   1 
ATOM   2087 N N   . SER B 1 118 ? -19.782 11.438 -4.742  1.00 38.91  ? 114 SER B N   1 
ATOM   2088 C CA  . SER B 1 118 ? -19.074 11.480 -3.489  1.00 38.58  ? 114 SER B CA  1 
ATOM   2089 C C   . SER B 1 118 ? -17.596 11.498 -3.752  1.00 37.72  ? 114 SER B C   1 
ATOM   2090 O O   . SER B 1 118 ? -16.825 11.511 -2.815  1.00 38.40  ? 114 SER B O   1 
ATOM   2091 C CB  . SER B 1 118 ? -19.470 10.290 -2.622  1.00 38.25  ? 114 SER B CB  1 
ATOM   2092 O OG  . SER B 1 118 ? -18.947 9.106  -3.172  1.00 41.82  ? 114 SER B OG  1 
ATOM   2093 N N   . CYS B 1 119 ? -17.200 11.513 -5.029  1.00 36.82  ? 115 CYS B N   1 
ATOM   2094 C CA  . CYS B 1 119 ? -15.801 11.611 -5.420  1.00 35.84  ? 115 CYS B CA  1 
ATOM   2095 C C   . CYS B 1 119 ? -15.090 12.817 -4.783  1.00 35.67  ? 115 CYS B C   1 
ATOM   2096 O O   . CYS B 1 119 ? -15.689 13.889 -4.637  1.00 35.83  ? 115 CYS B O   1 
ATOM   2097 C CB  . CYS B 1 119 ? -15.703 11.700 -6.944  1.00 35.35  ? 115 CYS B CB  1 
ATOM   2098 S SG  . CYS B 1 119 ? -14.013 11.818 -7.547  1.00 36.72  ? 115 CYS B SG  1 
ATOM   2099 N N   . LYS B 1 120 ? -13.807 12.635 -4.438  1.00 35.05  ? 116 LYS B N   1 
ATOM   2100 C CA  . LYS B 1 120 ? -13.025 13.641 -3.754  1.00 34.18  ? 116 LYS B CA  1 
ATOM   2101 C C   . LYS B 1 120 ? -11.773 13.932 -4.519  1.00 33.72  ? 116 LYS B C   1 
ATOM   2102 O O   . LYS B 1 120 ? -11.340 13.133 -5.391  1.00 31.82  ? 116 LYS B O   1 
ATOM   2103 C CB  . LYS B 1 120 ? -12.601 13.148 -2.372  1.00 34.96  ? 116 LYS B CB  1 
ATOM   2104 C CG  . LYS B 1 120 ? -13.732 12.872 -1.459  1.00 37.36  ? 116 LYS B CG  1 
ATOM   2105 C CD  . LYS B 1 120 ? -14.420 14.157 -0.993  1.00 41.78  ? 116 LYS B CD  1 
ATOM   2106 C CE  . LYS B 1 120 ? -15.918 13.936 -0.943  1.00 42.90  ? 116 LYS B CE  1 
ATOM   2107 N NZ  . LYS B 1 120 ? -16.258 12.662 -0.225  1.00 45.66  ? 116 LYS B NZ  1 
ATOM   2108 N N   . GLU B 1 121 ? -11.163 15.067 -4.158  1.00 32.93  ? 117 GLU B N   1 
ATOM   2109 C CA  . GLU B 1 121 ? -9.999  15.562 -4.864  1.00 32.74  ? 117 GLU B CA  1 
ATOM   2110 C C   . GLU B 1 121 ? -8.885  16.047 -3.967  1.00 32.75  ? 117 GLU B C   1 
ATOM   2111 O O   . GLU B 1 121 ? -7.898  16.596 -4.461  1.00 33.59  ? 117 GLU B O   1 
ATOM   2112 C CB  . GLU B 1 121 ? -10.420 16.649 -5.853  1.00 32.65  ? 117 GLU B CB  1 
ATOM   2113 C CG  . GLU B 1 121 ? -11.380 16.127 -6.946  1.00 33.27  ? 117 GLU B CG  1 
ATOM   2114 C CD  . GLU B 1 121 ? -11.694 17.138 -8.061  1.00 33.43  ? 117 GLU B CD  1 
ATOM   2115 O OE1 . GLU B 1 121 ? -10.859 18.002 -8.332  1.00 33.20  ? 117 GLU B OE1 1 
ATOM   2116 O OE2 . GLU B 1 121 ? -12.769 17.034 -8.679  1.00 33.26  ? 117 GLU B OE2 1 
ATOM   2117 N N   . THR B 1 122 ? -8.995  15.799 -2.658  1.00 32.98  ? 118 THR B N   1 
ATOM   2118 C CA  . THR B 1 122 ? -7.934  16.165 -1.691  1.00 32.41  ? 118 THR B CA  1 
ATOM   2119 C C   . THR B 1 122 ? -7.429  14.955 -0.917  1.00 31.45  ? 118 THR B C   1 
ATOM   2120 O O   . THR B 1 122 ? -8.084  13.931 -0.917  1.00 32.27  ? 118 THR B O   1 
ATOM   2121 C CB  . THR B 1 122 ? -8.461  17.196 -0.711  1.00 32.50  ? 118 THR B CB  1 
ATOM   2122 O OG1 . THR B 1 122 ? -9.569  16.651 0.039   1.00 32.05  ? 118 THR B OG1 1 
ATOM   2123 C CG2 . THR B 1 122 ? -8.960  18.435 -1.514  1.00 33.50  ? 118 THR B CG2 1 
ATOM   2124 N N   . PHE B 1 123 ? -6.251  15.082 -0.302  1.00 30.10  ? 119 PHE B N   1 
ATOM   2125 C CA  . PHE B 1 123 ? -5.837  14.218 0.784   1.00 29.08  ? 119 PHE B CA  1 
ATOM   2126 C C   . PHE B 1 123 ? -5.350  14.975 2.043   1.00 28.82  ? 119 PHE B C   1 
ATOM   2127 O O   . PHE B 1 123 ? -5.003  16.168 1.985   1.00 28.02  ? 119 PHE B O   1 
ATOM   2128 C CB  . PHE B 1 123 ? -4.775  13.237 0.305   1.00 28.82  ? 119 PHE B CB  1 
ATOM   2129 C CG  . PHE B 1 123 ? -3.464  13.870 -0.046  1.00 27.52  ? 119 PHE B CG  1 
ATOM   2130 C CD1 . PHE B 1 123 ? -2.406  13.791 0.815   1.00 23.91  ? 119 PHE B CD1 1 
ATOM   2131 C CD2 . PHE B 1 123 ? -3.291  14.521 -1.279  1.00 28.84  ? 119 PHE B CD2 1 
ATOM   2132 C CE1 . PHE B 1 123 ? -1.190  14.363 0.494   1.00 27.33  ? 119 PHE B CE1 1 
ATOM   2133 C CE2 . PHE B 1 123 ? -2.070  15.103 -1.616  1.00 27.78  ? 119 PHE B CE2 1 
ATOM   2134 C CZ  . PHE B 1 123 ? -1.013  15.005 -0.744  1.00 28.94  ? 119 PHE B CZ  1 
ATOM   2135 N N   . ASN B 1 124 ? -5.321  14.271 3.181   1.00 28.32  ? 120 ASN B N   1 
ATOM   2136 C CA  . ASN B 1 124 ? -4.660  14.791 4.393   1.00 27.97  ? 120 ASN B CA  1 
ATOM   2137 C C   . ASN B 1 124 ? -3.285  14.258 4.631   1.00 27.60  ? 120 ASN B C   1 
ATOM   2138 O O   . ASN B 1 124 ? -3.005  13.070 4.371   1.00 27.45  ? 120 ASN B O   1 
ATOM   2139 C CB  . ASN B 1 124 ? -5.459  14.483 5.657   1.00 28.68  ? 120 ASN B CB  1 
ATOM   2140 C CG  . ASN B 1 124 ? -6.793  15.149 5.677   1.00 27.58  ? 120 ASN B CG  1 
ATOM   2141 O OD1 . ASN B 1 124 ? -6.924  16.302 5.313   1.00 31.20  ? 120 ASN B OD1 1 
ATOM   2142 N ND2 . ASN B 1 124 ? -7.789  14.425 6.081   1.00 28.00  ? 120 ASN B ND2 1 
ATOM   2143 N N   . LEU B 1 125 ? -2.452  15.146 5.194   1.00 27.59  ? 121 LEU B N   1 
ATOM   2144 C CA  . LEU B 1 125 ? -1.114  14.867 5.690   1.00 27.66  ? 121 LEU B CA  1 
ATOM   2145 C C   . LEU B 1 125 ? -1.065  14.988 7.223   1.00 28.60  ? 121 LEU B C   1 
ATOM   2146 O O   . LEU B 1 125 ? -1.603  15.953 7.786   1.00 27.75  ? 121 LEU B O   1 
ATOM   2147 C CB  . LEU B 1 125 ? -0.140  15.877 5.100   1.00 27.61  ? 121 LEU B CB  1 
ATOM   2148 C CG  . LEU B 1 125 ? 1.274   15.840 5.668   1.00 27.62  ? 121 LEU B CG  1 
ATOM   2149 C CD1 . LEU B 1 125 ? 1.945   14.590 5.249   1.00 27.57  ? 121 LEU B CD1 1 
ATOM   2150 C CD2 . LEU B 1 125 ? 2.084   17.044 5.208   1.00 28.36  ? 121 LEU B CD2 1 
ATOM   2151 N N   . TYR B 1 126 ? -0.383  14.021 7.866   1.00 29.22  ? 122 TYR B N   1 
ATOM   2152 C CA  . TYR B 1 126 ? -0.283  13.905 9.326   1.00 28.91  ? 122 TYR B CA  1 
ATOM   2153 C C   . TYR B 1 126 ? 1.151   13.526 9.667   1.00 30.58  ? 122 TYR B C   1 
ATOM   2154 O O   . TYR B 1 126 ? 1.851   12.878 8.853   1.00 29.75  ? 122 TYR B O   1 
ATOM   2155 C CB  . TYR B 1 126 ? -1.143  12.783 9.894   1.00 28.81  ? 122 TYR B CB  1 
ATOM   2156 C CG  . TYR B 1 126 ? -2.627  12.858 9.697   1.00 29.32  ? 122 TYR B CG  1 
ATOM   2157 C CD1 . TYR B 1 126 ? -3.440  13.412 10.659  1.00 29.24  ? 122 TYR B CD1 1 
ATOM   2158 C CD2 . TYR B 1 126 ? -3.241  12.286 8.561   1.00 30.24  ? 122 TYR B CD2 1 
ATOM   2159 C CE1 . TYR B 1 126 ? -4.821  13.464 10.481  1.00 30.89  ? 122 TYR B CE1 1 
ATOM   2160 C CE2 . TYR B 1 126 ? -4.593  12.341 8.379   1.00 28.18  ? 122 TYR B CE2 1 
ATOM   2161 C CZ  . TYR B 1 126 ? -5.390  12.933 9.341   1.00 29.36  ? 122 TYR B CZ  1 
ATOM   2162 O OH  . TYR B 1 126 ? -6.766  12.966 9.207   1.00 30.26  ? 122 TYR B OH  1 
ATOM   2163 N N   . TYR B 1 127 ? 1.602   13.917 10.864  1.00 31.37  ? 123 TYR B N   1 
ATOM   2164 C CA  . TYR B 1 127 ? 2.811   13.300 11.437  1.00 31.93  ? 123 TYR B CA  1 
ATOM   2165 C C   . TYR B 1 127 ? 2.544   12.750 12.833  1.00 31.73  ? 123 TYR B C   1 
ATOM   2166 O O   . TYR B 1 127 ? 1.505   13.014 13.442  1.00 30.59  ? 123 TYR B O   1 
ATOM   2167 C CB  . TYR B 1 127 ? 3.957   14.256 11.477  1.00 32.43  ? 123 TYR B CB  1 
ATOM   2168 C CG  . TYR B 1 127 ? 3.820   15.334 12.526  1.00 35.32  ? 123 TYR B CG  1 
ATOM   2169 C CD1 . TYR B 1 127 ? 3.047   16.469 12.286  1.00 34.88  ? 123 TYR B CD1 1 
ATOM   2170 C CD2 . TYR B 1 127 ? 4.515   15.247 13.741  1.00 35.80  ? 123 TYR B CD2 1 
ATOM   2171 C CE1 . TYR B 1 127 ? 2.942   17.447 13.222  1.00 36.12  ? 123 TYR B CE1 1 
ATOM   2172 C CE2 . TYR B 1 127 ? 4.409   16.226 14.686  1.00 34.75  ? 123 TYR B CE2 1 
ATOM   2173 C CZ  . TYR B 1 127 ? 3.639   17.324 14.423  1.00 35.71  ? 123 TYR B CZ  1 
ATOM   2174 O OH  . TYR B 1 127 ? 3.534   18.306 15.363  1.00 35.77  ? 123 TYR B OH  1 
ATOM   2175 N N   . TYR B 1 128 ? 3.482   11.926 13.286  1.00 32.00  ? 124 TYR B N   1 
ATOM   2176 C CA  . TYR B 1 128 ? 3.530   11.429 14.656  1.00 32.19  ? 124 TYR B CA  1 
ATOM   2177 C C   . TYR B 1 128 ? 5.013   11.270 15.027  1.00 32.16  ? 124 TYR B C   1 
ATOM   2178 O O   . TYR B 1 128 ? 5.769   10.655 14.269  1.00 32.01  ? 124 TYR B O   1 
ATOM   2179 C CB  . TYR B 1 128 ? 2.781   10.088 14.725  1.00 33.22  ? 124 TYR B CB  1 
ATOM   2180 C CG  . TYR B 1 128 ? 3.040   9.291  16.000  1.00 34.35  ? 124 TYR B CG  1 
ATOM   2181 C CD1 . TYR B 1 128 ? 2.305   9.540  17.165  1.00 34.83  ? 124 TYR B CD1 1 
ATOM   2182 C CD2 . TYR B 1 128 ? 4.016   8.306  16.038  1.00 34.37  ? 124 TYR B CD2 1 
ATOM   2183 C CE1 . TYR B 1 128 ? 2.528   8.800  18.339  1.00 33.61  ? 124 TYR B CE1 1 
ATOM   2184 C CE2 . TYR B 1 128 ? 4.253   7.564  17.198  1.00 36.17  ? 124 TYR B CE2 1 
ATOM   2185 C CZ  . TYR B 1 128 ? 3.506   7.818  18.350  1.00 34.26  ? 124 TYR B CZ  1 
ATOM   2186 O OH  . TYR B 1 128 ? 3.764   7.098  19.494  1.00 34.70  ? 124 TYR B OH  1 
ATOM   2187 N N   . GLU B 1 129 ? 5.447   11.822 16.164  1.00 32.42  ? 125 GLU B N   1 
ATOM   2188 C CA  . GLU B 1 129 ? 6.837   11.656 16.595  1.00 32.64  ? 125 GLU B CA  1 
ATOM   2189 C C   . GLU B 1 129 ? 7.011   10.431 17.479  1.00 32.72  ? 125 GLU B C   1 
ATOM   2190 O O   . GLU B 1 129 ? 6.099   10.042 18.177  1.00 31.86  ? 125 GLU B O   1 
ATOM   2191 C CB  . GLU B 1 129 ? 7.333   12.859 17.377  1.00 33.15  ? 125 GLU B CB  1 
ATOM   2192 C CG  . GLU B 1 129 ? 7.034   14.217 16.806  1.00 33.53  ? 125 GLU B CG  1 
ATOM   2193 C CD  . GLU B 1 129 ? 7.713   15.273 17.641  1.00 33.44  ? 125 GLU B CD  1 
ATOM   2194 O OE1 . GLU B 1 129 ? 8.957   15.209 17.724  1.00 34.25  ? 125 GLU B OE1 1 
ATOM   2195 O OE2 . GLU B 1 129 ? 7.009   16.137 18.219  1.00 34.28  ? 125 GLU B OE2 1 
ATOM   2196 N N   . ALA B 1 130 ? 8.193   9.827  17.446  1.00 33.19  ? 126 ALA B N   1 
ATOM   2197 C CA  . ALA B 1 130 ? 8.435   8.633  18.227  1.00 34.15  ? 126 ALA B CA  1 
ATOM   2198 C C   . ALA B 1 130 ? 9.893   8.587  18.666  1.00 34.64  ? 126 ALA B C   1 
ATOM   2199 O O   . ALA B 1 130 ? 10.742  9.171  18.023  1.00 35.58  ? 126 ALA B O   1 
ATOM   2200 C CB  . ALA B 1 130 ? 8.056   7.384  17.442  1.00 34.00  ? 126 ALA B CB  1 
ATOM   2201 N N   . ASP B 1 131 ? 10.140  7.903  19.784  1.00 35.17  ? 127 ASP B N   1 
ATOM   2202 C CA  . ASP B 1 131 ? 11.458  7.780  20.411  1.00 35.19  ? 127 ASP B CA  1 
ATOM   2203 C C   . ASP B 1 131 ? 12.291  6.672  19.765  1.00 36.05  ? 127 ASP B C   1 
ATOM   2204 O O   . ASP B 1 131 ? 13.522  6.644  19.871  1.00 35.94  ? 127 ASP B O   1 
ATOM   2205 C CB  . ASP B 1 131 ? 11.280  7.463  21.895  1.00 35.15  ? 127 ASP B CB  1 
ATOM   2206 C CG  . ASP B 1 131 ? 10.699  8.621  22.674  1.00 34.21  ? 127 ASP B CG  1 
ATOM   2207 O OD1 . ASP B 1 131 ? 10.822  9.766  22.218  1.00 33.01  ? 127 ASP B OD1 1 
ATOM   2208 O OD2 . ASP B 1 131 ? 10.134  8.387  23.754  1.00 31.94  ? 127 ASP B OD2 1 
ATOM   2209 N N   . PHE B 1 132 ? 11.595  5.765  19.095  1.00 36.72  ? 128 PHE B N   1 
ATOM   2210 C CA  . PHE B 1 132 ? 12.209  4.725  18.335  1.00 37.12  ? 128 PHE B CA  1 
ATOM   2211 C C   . PHE B 1 132 ? 11.229  4.300  17.251  1.00 37.29  ? 128 PHE B C   1 
ATOM   2212 O O   . PHE B 1 132 ? 10.067  4.741  17.226  1.00 36.74  ? 128 PHE B O   1 
ATOM   2213 C CB  . PHE B 1 132 ? 12.583  3.539  19.264  1.00 37.64  ? 128 PHE B CB  1 
ATOM   2214 C CG  . PHE B 1 132 ? 11.390  2.782  19.850  1.00 37.57  ? 128 PHE B CG  1 
ATOM   2215 C CD1 . PHE B 1 132 ? 10.633  3.330  20.876  1.00 36.67  ? 128 PHE B CD1 1 
ATOM   2216 C CD2 . PHE B 1 132 ? 11.088  1.493  19.414  1.00 37.50  ? 128 PHE B CD2 1 
ATOM   2217 C CE1 . PHE B 1 132 ? 9.568   2.637  21.422  1.00 38.43  ? 128 PHE B CE1 1 
ATOM   2218 C CE2 . PHE B 1 132 ? 10.013  0.783  19.947  1.00 37.26  ? 128 PHE B CE2 1 
ATOM   2219 C CZ  . PHE B 1 132 ? 9.249   1.349  20.955  1.00 38.25  ? 128 PHE B CZ  1 
ATOM   2220 N N   . ASP B 1 133 ? 11.704  3.428  16.374  1.00 37.12  ? 129 ASP B N   1 
ATOM   2221 C CA  . ASP B 1 133 ? 10.881  2.873  15.328  1.00 37.38  ? 129 ASP B CA  1 
ATOM   2222 C C   . ASP B 1 133 ? 9.918   1.910  15.954  1.00 37.79  ? 129 ASP B C   1 
ATOM   2223 O O   . ASP B 1 133 ? 10.178  0.707  16.017  1.00 39.04  ? 129 ASP B O   1 
ATOM   2224 C CB  . ASP B 1 133 ? 11.743  2.187  14.253  1.00 37.10  ? 129 ASP B CB  1 
ATOM   2225 C CG  . ASP B 1 133 ? 10.905  1.639  13.075  1.00 36.96  ? 129 ASP B CG  1 
ATOM   2226 O OD1 . ASP B 1 133 ? 9.672   1.870  12.976  1.00 36.85  ? 129 ASP B OD1 1 
ATOM   2227 O OD2 . ASP B 1 133 ? 11.505  0.969  12.234  1.00 35.31  ? 129 ASP B OD2 1 
ATOM   2228 N N   . SER B 1 134 ? 8.788   2.446  16.394  1.00 37.93  ? 130 SER B N   1 
ATOM   2229 C CA  . SER B 1 134 ? 7.838   1.715  17.192  1.00 37.95  ? 130 SER B CA  1 
ATOM   2230 C C   . SER B 1 134 ? 6.593   1.226  16.417  1.00 38.65  ? 130 SER B C   1 
ATOM   2231 O O   . SER B 1 134 ? 5.765   0.437  16.933  1.00 38.02  ? 130 SER B O   1 
ATOM   2232 C CB  . SER B 1 134 ? 7.430   2.649  18.330  1.00 38.52  ? 130 SER B CB  1 
ATOM   2233 O OG  . SER B 1 134 ? 6.685   3.727  17.812  1.00 38.08  ? 130 SER B OG  1 
ATOM   2234 N N   . ALA B 1 135 ? 6.436   1.679  15.175  1.00 38.72  ? 131 ALA B N   1 
ATOM   2235 C CA  . ALA B 1 135 ? 5.205   1.388  14.467  1.00 39.20  ? 131 ALA B CA  1 
ATOM   2236 C C   . ALA B 1 135 ? 5.103   -0.100 14.074  1.00 39.25  ? 131 ALA B C   1 
ATOM   2237 O O   . ALA B 1 135 ? 6.100   -0.778 13.865  1.00 38.46  ? 131 ALA B O   1 
ATOM   2238 C CB  . ALA B 1 135 ? 5.062   2.298  13.221  1.00 39.63  ? 131 ALA B CB  1 
ATOM   2239 N N   . THR B 1 136 ? 3.864   -0.560 13.992  1.00 39.12  ? 132 THR B N   1 
ATOM   2240 C CA  . THR B 1 136 ? 3.493   -1.921 13.664  1.00 39.78  ? 132 THR B CA  1 
ATOM   2241 C C   . THR B 1 136 ? 2.242   -1.792 12.772  1.00 40.66  ? 132 THR B C   1 
ATOM   2242 O O   . THR B 1 136 ? 1.856   -0.678 12.394  1.00 40.35  ? 132 THR B O   1 
ATOM   2243 C CB  . THR B 1 136 ? 3.078   -2.685 14.931  1.00 39.77  ? 132 THR B CB  1 
ATOM   2244 O OG1 . THR B 1 136 ? 1.932   -2.039 15.526  1.00 39.75  ? 132 THR B OG1 1 
ATOM   2245 C CG2 . THR B 1 136 ? 4.219   -2.756 15.936  1.00 39.30  ? 132 THR B CG2 1 
ATOM   2246 N N   . LYS B 1 137 ? 1.566   -2.902 12.488  1.00 41.57  ? 133 LYS B N   1 
ATOM   2247 C CA  . LYS B 1 137 ? 0.377   -2.852 11.639  1.00 41.45  ? 133 LYS B CA  1 
ATOM   2248 C C   . LYS B 1 137 ? -0.751  -2.085 12.277  1.00 41.73  ? 133 LYS B C   1 
ATOM   2249 O O   . LYS B 1 137 ? -1.451  -1.400 11.592  1.00 42.10  ? 133 LYS B O   1 
ATOM   2250 C CB  . LYS B 1 137 ? -0.106  -4.252 11.289  1.00 41.93  ? 133 LYS B CB  1 
ATOM   2251 N N   . THR B 1 138 ? -0.908  -2.223 13.593  1.00 42.61  ? 134 THR B N   1 
ATOM   2252 C CA  . THR B 1 138 ? -2.035  -1.696 14.379  1.00 42.14  ? 134 THR B CA  1 
ATOM   2253 C C   . THR B 1 138 ? -1.676  -0.436 15.201  1.00 41.11  ? 134 THR B C   1 
ATOM   2254 O O   . THR B 1 138 ? -2.549  0.272  15.709  1.00 40.86  ? 134 THR B O   1 
ATOM   2255 C CB  . THR B 1 138 ? -2.553  -2.825 15.364  1.00 43.01  ? 134 THR B CB  1 
ATOM   2256 O OG1 . THR B 1 138 ? -1.432  -3.500 15.976  1.00 43.19  ? 134 THR B OG1 1 
ATOM   2257 C CG2 . THR B 1 138 ? -3.398  -3.865 14.608  1.00 42.96  ? 134 THR B CG2 1 
ATOM   2258 N N   . PHE B 1 139 ? -0.392  -0.173 15.364  1.00 39.97  ? 135 PHE B N   1 
ATOM   2259 C CA  . PHE B 1 139 ? 0.028   0.980  16.143  1.00 39.89  ? 135 PHE B CA  1 
ATOM   2260 C C   . PHE B 1 139 ? 0.989   1.853  15.346  1.00 38.43  ? 135 PHE B C   1 
ATOM   2261 O O   . PHE B 1 139 ? 1.880   1.325  14.680  1.00 37.11  ? 135 PHE B O   1 
ATOM   2262 C CB  . PHE B 1 139 ? 0.699   0.564  17.471  1.00 39.95  ? 135 PHE B CB  1 
ATOM   2263 C CG  . PHE B 1 139 ? 1.355   1.728  18.208  1.00 40.04  ? 135 PHE B CG  1 
ATOM   2264 C CD1 . PHE B 1 139 ? 0.611   2.536  19.054  1.00 41.35  ? 135 PHE B CD1 1 
ATOM   2265 C CD2 . PHE B 1 139 ? 2.699   2.007  18.039  1.00 39.03  ? 135 PHE B CD2 1 
ATOM   2266 C CE1 . PHE B 1 139 ? 1.190   3.614  19.726  1.00 41.57  ? 135 PHE B CE1 1 
ATOM   2267 C CE2 . PHE B 1 139 ? 3.296   3.088  18.694  1.00 41.18  ? 135 PHE B CE2 1 
ATOM   2268 C CZ  . PHE B 1 139 ? 2.528   3.900  19.549  1.00 41.69  ? 135 PHE B CZ  1 
ATOM   2269 N N   . PRO B 1 140 ? 0.828   3.190  15.438  1.00 38.37  ? 136 PRO B N   1 
ATOM   2270 C CA  . PRO B 1 140 ? -0.267  3.901  16.085  1.00 38.38  ? 136 PRO B CA  1 
ATOM   2271 C C   . PRO B 1 140 ? -1.632  3.780  15.392  1.00 38.75  ? 136 PRO B C   1 
ATOM   2272 O O   . PRO B 1 140 ? -1.703  3.513  14.186  1.00 38.40  ? 136 PRO B O   1 
ATOM   2273 C CB  . PRO B 1 140 ? 0.215   5.365  16.102  1.00 38.61  ? 136 PRO B CB  1 
ATOM   2274 C CG  . PRO B 1 140 ? 1.294   5.458  15.131  1.00 38.82  ? 136 PRO B CG  1 
ATOM   2275 C CD  . PRO B 1 140 ? 1.871   4.112  14.940  1.00 38.41  ? 136 PRO B CD  1 
ATOM   2276 N N   . ASN B 1 141 ? -2.703  3.998  16.152  1.00 38.81  ? 137 ASN B N   1 
ATOM   2277 C CA  . ASN B 1 141 ? -4.036  3.938  15.587  1.00 40.29  ? 137 ASN B CA  1 
ATOM   2278 C C   . ASN B 1 141 ? -4.136  4.813  14.331  1.00 40.03  ? 137 ASN B C   1 
ATOM   2279 O O   . ASN B 1 141 ? -3.667  5.965  14.277  1.00 40.03  ? 137 ASN B O   1 
ATOM   2280 C CB  . ASN B 1 141 ? -5.130  4.407  16.547  1.00 41.05  ? 137 ASN B CB  1 
ATOM   2281 C CG  . ASN B 1 141 ? -5.067  3.732  17.894  1.00 44.81  ? 137 ASN B CG  1 
ATOM   2282 O OD1 . ASN B 1 141 ? -5.087  4.412  18.929  1.00 49.54  ? 137 ASN B OD1 1 
ATOM   2283 N ND2 . ASN B 1 141 ? -4.978  2.401  17.901  1.00 46.22  ? 137 ASN B ND2 1 
ATOM   2284 N N   . TRP B 1 142 ? -4.804  4.238  13.349  1.00 39.50  ? 138 TRP B N   1 
ATOM   2285 C CA  . TRP B 1 142 ? -5.016  4.834  12.048  1.00 38.75  ? 138 TRP B CA  1 
ATOM   2286 C C   . TRP B 1 142 ? -6.090  5.883  12.147  1.00 39.03  ? 138 TRP B C   1 
ATOM   2287 O O   . TRP B 1 142 ? -7.169  5.727  11.592  1.00 38.70  ? 138 TRP B O   1 
ATOM   2288 C CB  . TRP B 1 142 ? -5.390  3.706  11.086  1.00 37.42  ? 138 TRP B CB  1 
ATOM   2289 C CG  . TRP B 1 142 ? -4.258  2.733  10.999  1.00 35.69  ? 138 TRP B CG  1 
ATOM   2290 C CD1 . TRP B 1 142 ? -4.133  1.574  11.669  1.00 34.88  ? 138 TRP B CD1 1 
ATOM   2291 C CD2 . TRP B 1 142 ? -3.051  2.894  10.244  1.00 35.62  ? 138 TRP B CD2 1 
ATOM   2292 N NE1 . TRP B 1 142 ? -2.932  0.983  11.379  1.00 34.70  ? 138 TRP B NE1 1 
ATOM   2293 C CE2 . TRP B 1 142 ? -2.258  1.765  10.484  1.00 34.53  ? 138 TRP B CE2 1 
ATOM   2294 C CE3 . TRP B 1 142 ? -2.578  3.873  9.365   1.00 34.58  ? 138 TRP B CE3 1 
ATOM   2295 C CZ2 . TRP B 1 142 ? -1.023  1.581  9.873   1.00 35.57  ? 138 TRP B CZ2 1 
ATOM   2296 C CZ3 . TRP B 1 142 ? -1.342  3.682  8.768   1.00 34.26  ? 138 TRP B CZ3 1 
ATOM   2297 C CH2 . TRP B 1 142 ? -0.586  2.557  9.028   1.00 34.00  ? 138 TRP B CH2 1 
ATOM   2298 N N   . MET B 1 143 ? -5.808  6.918  12.928  1.00 40.18  ? 139 MET B N   1 
ATOM   2299 C CA  . MET B 1 143 ? -6.716  8.051  13.061  1.00 41.69  ? 139 MET B CA  1 
ATOM   2300 C C   . MET B 1 143 ? -6.068  9.272  13.661  1.00 40.81  ? 139 MET B C   1 
ATOM   2301 O O   . MET B 1 143 ? -5.070  9.162  14.373  1.00 40.40  ? 139 MET B O   1 
ATOM   2302 C CB  . MET B 1 143 ? -7.904  7.695  13.930  1.00 41.58  ? 139 MET B CB  1 
ATOM   2303 C CG  . MET B 1 143 ? -7.507  7.456  15.390  1.00 45.11  ? 139 MET B CG  1 
ATOM   2304 S SD  . MET B 1 143 ? -8.845  6.735  16.331  1.00 45.10  ? 139 MET B SD  1 
ATOM   2305 C CE  . MET B 1 143 ? -9.707  8.228  16.856  1.00 47.78  ? 139 MET B CE  1 
ATOM   2306 N N   . GLU B 1 144 ? -6.632  10.441 13.377  1.00 40.89  ? 140 GLU B N   1 
ATOM   2307 C CA  . GLU B 1 144 ? -6.204  11.676 14.024  1.00 41.08  ? 140 GLU B CA  1 
ATOM   2308 C C   . GLU B 1 144 ? -6.238  11.543 15.542  1.00 40.74  ? 140 GLU B C   1 
ATOM   2309 O O   . GLU B 1 144 ? -7.262  11.179 16.121  1.00 40.49  ? 140 GLU B O   1 
ATOM   2310 C CB  . GLU B 1 144 ? -7.083  12.847 13.579  1.00 40.61  ? 140 GLU B CB  1 
ATOM   2311 C CG  . GLU B 1 144 ? -6.479  14.214 13.853  1.00 41.31  ? 140 GLU B CG  1 
ATOM   2312 C CD  . GLU B 1 144 ? -7.361  15.348 13.367  1.00 42.66  ? 140 GLU B CD  1 
ATOM   2313 O OE1 . GLU B 1 144 ? -8.216  15.105 12.489  1.00 45.35  ? 140 GLU B OE1 1 
ATOM   2314 O OE2 . GLU B 1 144 ? -7.200  16.483 13.863  1.00 44.62  ? 140 GLU B OE2 1 
ATOM   2315 N N   . ASN B 1 145 ? -5.112  11.840 16.183  1.00 39.77  ? 141 ASN B N   1 
ATOM   2316 C CA  . ASN B 1 145 ? -4.916  11.500 17.587  1.00 39.13  ? 141 ASN B CA  1 
ATOM   2317 C C   . ASN B 1 145 ? -4.791  9.995  17.803  1.00 38.18  ? 141 ASN B C   1 
ATOM   2318 O O   . ASN B 1 145 ? -5.731  9.344  18.260  1.00 39.09  ? 141 ASN B O   1 
ATOM   2319 C CB  . ASN B 1 145 ? -6.057  12.061 18.438  1.00 39.36  ? 141 ASN B CB  1 
ATOM   2320 C CG  . ASN B 1 145 ? -5.796  11.924 19.925  1.00 39.54  ? 141 ASN B CG  1 
ATOM   2321 O OD1 . ASN B 1 145 ? -4.647  11.862 20.362  1.00 38.16  ? 141 ASN B OD1 1 
ATOM   2322 N ND2 . ASN B 1 145 ? -6.865  11.875 20.712  1.00 41.81  ? 141 ASN B ND2 1 
ATOM   2323 N N   . PRO B 1 146 ? -3.625  9.450  17.473  1.00 36.50  ? 142 PRO B N   1 
ATOM   2324 C CA  . PRO B 1 146 ? -2.352  10.027 17.914  1.00 35.60  ? 142 PRO B CA  1 
ATOM   2325 C C   . PRO B 1 146 ? -1.665  10.805 16.796  1.00 35.18  ? 142 PRO B C   1 
ATOM   2326 O O   . PRO B 1 146 ? -0.666  11.482 17.040  1.00 35.07  ? 142 PRO B O   1 
ATOM   2327 C CB  . PRO B 1 146 ? -1.524  8.795  18.283  1.00 36.38  ? 142 PRO B CB  1 
ATOM   2328 C CG  . PRO B 1 146 ? -2.071  7.711  17.424  1.00 36.16  ? 142 PRO B CG  1 
ATOM   2329 C CD  . PRO B 1 146 ? -3.542  7.989  17.299  1.00 36.56  ? 142 PRO B CD  1 
ATOM   2330 N N   . TRP B 1 147 ? -2.201  10.705 15.584  1.00 33.70  ? 143 TRP B N   1 
ATOM   2331 C CA  . TRP B 1 147 ? -1.655  11.431 14.443  1.00 33.08  ? 143 TRP B CA  1 
ATOM   2332 C C   . TRP B 1 147 ? -1.996  12.915 14.521  1.00 32.17  ? 143 TRP B C   1 
ATOM   2333 O O   . TRP B 1 147 ? -3.120  13.288 14.858  1.00 32.57  ? 143 TRP B O   1 
ATOM   2334 C CB  . TRP B 1 147 ? -2.178  10.840 13.132  1.00 31.09  ? 143 TRP B CB  1 
ATOM   2335 C CG  . TRP B 1 147 ? -1.568  9.516  12.786  1.00 30.97  ? 143 TRP B CG  1 
ATOM   2336 C CD1 . TRP B 1 147 ? -2.106  8.282  13.008  1.00 29.15  ? 143 TRP B CD1 1 
ATOM   2337 C CD2 . TRP B 1 147 ? -0.301  9.293  12.154  1.00 28.59  ? 143 TRP B CD2 1 
ATOM   2338 N NE1 . TRP B 1 147 ? -1.254  7.305  12.554  1.00 29.40  ? 143 TRP B NE1 1 
ATOM   2339 C CE2 . TRP B 1 147 ? -0.138  7.900  12.026  1.00 27.66  ? 143 TRP B CE2 1 
ATOM   2340 C CE3 . TRP B 1 147 ? 0.711   10.137 11.685  1.00 27.32  ? 143 TRP B CE3 1 
ATOM   2341 C CZ2 . TRP B 1 147 ? 0.995   7.331  11.448  1.00 27.34  ? 143 TRP B CZ2 1 
ATOM   2342 C CZ3 . TRP B 1 147 ? 1.835   9.570  11.112  1.00 29.03  ? 143 TRP B CZ3 1 
ATOM   2343 C CH2 . TRP B 1 147 ? 1.967   8.181  10.998  1.00 28.77  ? 143 TRP B CH2 1 
ATOM   2344 N N   . VAL B 1 148 ? -1.018  13.759 14.207  1.00 32.24  ? 144 VAL B N   1 
ATOM   2345 C CA  . VAL B 1 148 ? -1.213  15.211 14.242  1.00 32.55  ? 144 VAL B CA  1 
ATOM   2346 C C   . VAL B 1 148 ? -1.413  15.673 12.795  1.00 32.09  ? 144 VAL B C   1 
ATOM   2347 O O   . VAL B 1 148 ? -0.536  15.512 11.999  1.00 30.76  ? 144 VAL B O   1 
ATOM   2348 C CB  . VAL B 1 148 ? -0.007  15.968 14.930  1.00 32.40  ? 144 VAL B CB  1 
ATOM   2349 C CG1 . VAL B 1 148 ? -0.252  17.500 15.014  1.00 30.84  ? 144 VAL B CG1 1 
ATOM   2350 C CG2 . VAL B 1 148 ? 0.260   15.407 16.314  1.00 33.24  ? 144 VAL B CG2 1 
ATOM   2351 N N   . LYS B 1 149 ? -2.581  16.224 12.488  1.00 33.47  ? 145 LYS B N   1 
ATOM   2352 C CA  . LYS B 1 149 ? -2.900  16.750 11.149  1.00 34.50  ? 145 LYS B CA  1 
ATOM   2353 C C   . LYS B 1 149 ? -2.033  17.935 10.831  1.00 34.99  ? 145 LYS B C   1 
ATOM   2354 O O   . LYS B 1 149 ? -1.943  18.872 11.625  1.00 35.34  ? 145 LYS B O   1 
ATOM   2355 C CB  . LYS B 1 149 ? -4.365  17.184 11.070  1.00 34.37  ? 145 LYS B CB  1 
ATOM   2356 C CG  . LYS B 1 149 ? -4.906  17.372 9.648   1.00 35.01  ? 145 LYS B CG  1 
ATOM   2357 C CD  . LYS B 1 149 ? -6.440  17.555 9.715   1.00 35.97  ? 145 LYS B CD  1 
ATOM   2358 C CE  . LYS B 1 149 ? -7.063  17.860 8.343   1.00 38.62  ? 145 LYS B CE  1 
ATOM   2359 N NZ  . LYS B 1 149 ? -8.512  17.307 8.234   1.00 40.83  ? 145 LYS B NZ  1 
ATOM   2360 N N   . VAL B 1 150 ? -1.344  17.868 9.698   1.00 35.73  ? 146 VAL B N   1 
ATOM   2361 C CA  . VAL B 1 150 ? -0.574  19.006 9.197   1.00 35.78  ? 146 VAL B CA  1 
ATOM   2362 C C   . VAL B 1 150 ? -1.531  19.890 8.390   1.00 35.51  ? 146 VAL B C   1 
ATOM   2363 O O   . VAL B 1 150 ? -1.738  21.052 8.725   1.00 35.77  ? 146 VAL B O   1 
ATOM   2364 C CB  . VAL B 1 150 ? 0.654   18.573 8.377   1.00 36.15  ? 146 VAL B CB  1 
ATOM   2365 C CG1 . VAL B 1 150 ? 1.276   19.772 7.638   1.00 35.83  ? 146 VAL B CG1 1 
ATOM   2366 C CG2 . VAL B 1 150 ? 1.696   17.881 9.290   1.00 35.49  ? 146 VAL B CG2 1 
ATOM   2367 N N   . ASP B 1 151 ? -2.157  19.327 7.367   1.00 34.87  ? 147 ASP B N   1 
ATOM   2368 C CA  . ASP B 1 151 ? -3.065  20.083 6.532   1.00 34.76  ? 147 ASP B CA  1 
ATOM   2369 C C   . ASP B 1 151 ? -3.778  19.145 5.590   1.00 34.47  ? 147 ASP B C   1 
ATOM   2370 O O   . ASP B 1 151 ? -3.310  18.033 5.345   1.00 34.16  ? 147 ASP B O   1 
ATOM   2371 C CB  . ASP B 1 151 ? -2.268  21.130 5.725   1.00 34.47  ? 147 ASP B CB  1 
ATOM   2372 C CG  . ASP B 1 151 ? -3.140  22.299 5.210   1.00 36.64  ? 147 ASP B CG  1 
ATOM   2373 O OD1 . ASP B 1 151 ? -4.319  22.379 5.608   1.00 36.51  ? 147 ASP B OD1 1 
ATOM   2374 O OD2 . ASP B 1 151 ? -2.644  23.132 4.387   1.00 36.57  ? 147 ASP B OD2 1 
ATOM   2375 N N   . THR B 1 152 ? -4.912  19.608 5.074   1.00 34.96  ? 148 THR B N   1 
ATOM   2376 C CA  . THR B 1 152 ? -5.578  19.024 3.899   1.00 34.80  ? 148 THR B CA  1 
ATOM   2377 C C   . THR B 1 152 ? -4.932  19.557 2.634   1.00 35.34  ? 148 THR B C   1 
ATOM   2378 O O   . THR B 1 152 ? -4.800  20.762 2.497   1.00 36.31  ? 148 THR B O   1 
ATOM   2379 C CB  . THR B 1 152 ? -7.009  19.393 3.874   1.00 33.87  ? 148 THR B CB  1 
ATOM   2380 O OG1 . THR B 1 152 ? -7.627  18.856 5.032   1.00 34.07  ? 148 THR B OG1 1 
ATOM   2381 C CG2 . THR B 1 152 ? -7.723  18.816 2.642   1.00 34.86  ? 148 THR B CG2 1 
ATOM   2382 N N   . ILE B 1 153 ? -4.525  18.669 1.726   1.00 35.56  ? 149 ILE B N   1 
ATOM   2383 C CA  . ILE B 1 153 ? -3.751  19.045 0.544   1.00 35.26  ? 149 ILE B CA  1 
ATOM   2384 C C   . ILE B 1 153 ? -4.634  18.895 -0.687  1.00 35.72  ? 149 ILE B C   1 
ATOM   2385 O O   . ILE B 1 153 ? -5.427  17.964 -0.804  1.00 35.49  ? 149 ILE B O   1 
ATOM   2386 C CB  . ILE B 1 153 ? -2.440  18.216 0.383   1.00 35.51  ? 149 ILE B CB  1 
ATOM   2387 C CG1 . ILE B 1 153 ? -1.677  18.071 1.721   1.00 34.63  ? 149 ILE B CG1 1 
ATOM   2388 C CG2 . ILE B 1 153 ? -1.563  18.806 -0.707  1.00 35.15  ? 149 ILE B CG2 1 
ATOM   2389 C CD1 . ILE B 1 153 ? -0.909  19.273 2.156   1.00 33.93  ? 149 ILE B CD1 1 
ATOM   2390 N N   . ALA B 1 154 ? -4.521  19.878 -1.574  1.00 36.57  ? 150 ALA B N   1 
ATOM   2391 C CA  . ALA B 1 154 ? -5.269  19.935 -2.807  1.00 37.09  ? 150 ALA B CA  1 
ATOM   2392 C C   . ALA B 1 154 ? -4.411  20.512 -3.882  1.00 37.24  ? 150 ALA B C   1 
ATOM   2393 O O   . ALA B 1 154 ? -3.516  21.284 -3.623  1.00 36.57  ? 150 ALA B O   1 
ATOM   2394 C CB  . ALA B 1 154 ? -6.537  20.776 -2.656  1.00 37.36  ? 150 ALA B CB  1 
ATOM   2395 N N   . ALA B 1 155 ? -4.689  20.083 -5.100  1.00 38.78  ? 151 ALA B N   1 
ATOM   2396 C CA  . ALA B 1 155 ? -4.120  20.667 -6.283  1.00 39.81  ? 151 ALA B CA  1 
ATOM   2397 C C   . ALA B 1 155 ? -4.606  22.103 -6.480  1.00 40.63  ? 151 ALA B C   1 
ATOM   2398 O O   . ALA B 1 155 ? -5.811  22.366 -6.553  1.00 41.13  ? 151 ALA B O   1 
ATOM   2399 C CB  . ALA B 1 155 ? -4.499  19.828 -7.478  1.00 40.46  ? 151 ALA B CB  1 
ATOM   2400 N N   . ASP B 1 156 ? -3.659  23.024 -6.578  1.00 42.21  ? 152 ASP B N   1 
ATOM   2401 C CA  . ASP B 1 156 ? -3.931  24.380 -7.083  1.00 43.65  ? 152 ASP B CA  1 
ATOM   2402 C C   . ASP B 1 156 ? -3.309  24.629 -8.494  1.00 44.63  ? 152 ASP B C   1 
ATOM   2403 O O   . ASP B 1 156 ? -2.917  23.684 -9.249  1.00 44.56  ? 152 ASP B O   1 
ATOM   2404 C CB  . ASP B 1 156 ? -3.287  25.422 -6.149  1.00 44.17  ? 152 ASP B CB  1 
ATOM   2405 C CG  . ASP B 1 156 ? -1.764  25.399 -6.218  1.00 43.73  ? 152 ASP B CG  1 
ATOM   2406 O OD1 . ASP B 1 156 ? -1.232  24.694 -7.085  1.00 42.97  ? 152 ASP B OD1 1 
ATOM   2407 O OD2 . ASP B 1 156 ? -1.103  26.095 -5.420  1.00 47.06  ? 152 ASP B OD2 1 
ATOM   2408 N N   . GLU B 1 157 ? -3.189  25.918 -8.824  1.00 44.96  ? 153 GLU B N   1 
ATOM   2409 C CA  . GLU B 1 157 ? -3.151  26.346 -10.199 1.00 44.91  ? 153 GLU B CA  1 
ATOM   2410 C C   . GLU B 1 157 ? -1.796  26.529 -10.762 1.00 43.97  ? 153 GLU B C   1 
ATOM   2411 O O   . GLU B 1 157 ? -1.682  27.073 -11.837 1.00 43.56  ? 153 GLU B O   1 
ATOM   2412 C CB  . GLU B 1 157 ? -3.902  27.654 -10.214 1.00 45.53  ? 153 GLU B CB  1 
ATOM   2413 C CG  . GLU B 1 157 ? -5.323  27.489 -9.750  1.00 48.58  ? 153 GLU B CG  1 
ATOM   2414 C CD  . GLU B 1 157 ? -6.220  26.866 -10.794 1.00 54.90  ? 153 GLU B CD  1 
ATOM   2415 O OE1 . GLU B 1 157 ? -7.460  26.864 -10.538 1.00 59.25  ? 153 GLU B OE1 1 
ATOM   2416 O OE2 . GLU B 1 157 ? -5.703  26.386 -11.854 1.00 57.40  ? 153 GLU B OE2 1 
ATOM   2417 N N   . SER B 1 158 ? -0.768  26.072 -10.054 1.00 43.49  ? 154 SER B N   1 
ATOM   2418 C CA  . SER B 1 158 ? 0.570   26.094 -10.606 1.00 44.25  ? 154 SER B CA  1 
ATOM   2419 C C   . SER B 1 158 ? 0.989   24.675 -10.866 1.00 43.97  ? 154 SER B C   1 
ATOM   2420 O O   . SER B 1 158 ? 1.049   23.864 -9.946  1.00 45.89  ? 154 SER B O   1 
ATOM   2421 C CB  . SER B 1 158 ? 1.573   26.792 -9.675  1.00 44.30  ? 154 SER B CB  1 
ATOM   2422 O OG  . SER B 1 158 ? 1.241   28.163 -9.561  1.00 44.42  ? 154 SER B OG  1 
ATOM   2423 N N   . PHE B 1 159 ? 1.261   24.362 -12.121 1.00 43.01  ? 155 PHE B N   1 
ATOM   2424 C CA  . PHE B 1 159 ? 1.630   22.999 -12.470 1.00 41.09  ? 155 PHE B CA  1 
ATOM   2425 C C   . PHE B 1 159 ? 2.186   22.873 -13.873 1.00 40.76  ? 155 PHE B C   1 
ATOM   2426 O O   . PHE B 1 159 ? 2.129   23.800 -14.696 1.00 39.86  ? 155 PHE B O   1 
ATOM   2427 C CB  . PHE B 1 159 ? 0.428   22.081 -12.287 1.00 39.97  ? 155 PHE B CB  1 
ATOM   2428 C CG  . PHE B 1 159 ? -0.817  22.525 -13.031 1.00 38.38  ? 155 PHE B CG  1 
ATOM   2429 C CD1 . PHE B 1 159 ? -1.861  23.136 -12.364 1.00 35.37  ? 155 PHE B CD1 1 
ATOM   2430 C CD2 . PHE B 1 159 ? -0.955  22.292 -14.405 1.00 36.00  ? 155 PHE B CD2 1 
ATOM   2431 C CE1 . PHE B 1 159 ? -3.042  23.511 -13.049 1.00 34.06  ? 155 PHE B CE1 1 
ATOM   2432 C CE2 . PHE B 1 159 ? -2.119  22.690 -15.089 1.00 35.65  ? 155 PHE B CE2 1 
ATOM   2433 C CZ  . PHE B 1 159 ? -3.157  23.301 -14.404 1.00 34.89  ? 155 PHE B CZ  1 
ATOM   2434 N N   . SER B 1 160 ? 2.770   21.701 -14.097 1.00 41.56  ? 156 SER B N   1 
ATOM   2435 C CA  . SER B 1 160 ? 3.221   21.225 -15.415 1.00 40.86  ? 156 SER B CA  1 
ATOM   2436 C C   . SER B 1 160 ? 2.263   20.133 -15.858 1.00 39.14  ? 156 SER B C   1 
ATOM   2437 O O   . SER B 1 160 ? 1.832   19.322 -15.063 1.00 38.85  ? 156 SER B O   1 
ATOM   2438 C CB  . SER B 1 160 ? 4.636   20.625 -15.319 1.00 41.86  ? 156 SER B CB  1 
ATOM   2439 N N   . GLN B 1 161 ? 1.908   20.145 -17.127 1.00 37.96  ? 157 GLN B N   1 
ATOM   2440 C CA  . GLN B 1 161 ? 0.970   19.169 -17.664 1.00 36.53  ? 157 GLN B CA  1 
ATOM   2441 C C   . GLN B 1 161 ? 1.487   18.693 -19.004 1.00 35.45  ? 157 GLN B C   1 
ATOM   2442 O O   . GLN B 1 161 ? 1.771   19.485 -19.873 1.00 34.94  ? 157 GLN B O   1 
ATOM   2443 C CB  . GLN B 1 161 ? -0.384  19.799 -17.849 1.00 35.94  ? 157 GLN B CB  1 
ATOM   2444 C CG  . GLN B 1 161 ? -1.386  18.866 -18.441 1.00 35.54  ? 157 GLN B CG  1 
ATOM   2445 C CD  . GLN B 1 161 ? -2.781  19.424 -18.369 1.00 32.16  ? 157 GLN B CD  1 
ATOM   2446 O OE1 . GLN B 1 161 ? -3.286  19.691 -17.276 1.00 33.78  ? 157 GLN B OE1 1 
ATOM   2447 N NE2 . GLN B 1 161 ? -3.411  19.597 -19.518 1.00 25.28  ? 157 GLN B NE2 1 
ATOM   2448 N N   . VAL B 1 162 ? 1.578   17.395 -19.190 1.00 34.73  ? 158 VAL B N   1 
ATOM   2449 C CA  . VAL B 1 162 ? 2.006   16.891 -20.504 1.00 34.91  ? 158 VAL B CA  1 
ATOM   2450 C C   . VAL B 1 162 ? 1.003   15.903 -20.997 1.00 34.47  ? 158 VAL B C   1 
ATOM   2451 O O   . VAL B 1 162 ? 0.195   15.424 -20.246 1.00 34.80  ? 158 VAL B O   1 
ATOM   2452 C CB  . VAL B 1 162 ? 3.404   16.227 -20.443 1.00 34.81  ? 158 VAL B CB  1 
ATOM   2453 C CG1 . VAL B 1 162 ? 4.441   17.271 -20.072 1.00 34.74  ? 158 VAL B CG1 1 
ATOM   2454 C CG2 . VAL B 1 162 ? 3.413   15.079 -19.443 1.00 33.35  ? 158 VAL B CG2 1 
ATOM   2455 N N   . ASP B 1 163 ? 1.066   15.580 -22.261 1.00 35.67  ? 159 ASP B N   1 
ATOM   2456 C CA  . ASP B 1 163 ? 0.050   14.717 -22.855 1.00 36.72  ? 159 ASP B CA  1 
ATOM   2457 C C   . ASP B 1 163 ? 0.687   13.363 -23.098 1.00 36.48  ? 159 ASP B C   1 
ATOM   2458 O O   . ASP B 1 163 ? 1.586   13.266 -23.931 1.00 37.69  ? 159 ASP B O   1 
ATOM   2459 C CB  . ASP B 1 163 ? -0.419  15.330 -24.154 1.00 37.72  ? 159 ASP B CB  1 
ATOM   2460 C CG  . ASP B 1 163 ? -1.334  14.438 -24.910 1.00 41.02  ? 159 ASP B CG  1 
ATOM   2461 O OD1 . ASP B 1 163 ? -2.538  14.347 -24.518 1.00 38.75  ? 159 ASP B OD1 1 
ATOM   2462 O OD2 . ASP B 1 163 ? -0.821  13.864 -25.919 1.00 48.06  ? 159 ASP B OD2 1 
ATOM   2463 N N   . LEU B 1 164 ? 0.230   12.339 -22.385 1.00 35.18  ? 160 LEU B N   1 
ATOM   2464 C CA  . LEU B 1 164 ? 0.736   10.985 -22.577 1.00 35.01  ? 160 LEU B CA  1 
ATOM   2465 C C   . LEU B 1 164 ? -0.167  10.187 -23.511 1.00 34.98  ? 160 LEU B C   1 
ATOM   2466 O O   . LEU B 1 164 ? -0.832  9.240  -23.088 1.00 33.75  ? 160 LEU B O   1 
ATOM   2467 C CB  . LEU B 1 164 ? 0.869   10.267 -21.232 1.00 34.60  ? 160 LEU B CB  1 
ATOM   2468 C CG  . LEU B 1 164 ? 1.754   10.946 -20.186 1.00 34.98  ? 160 LEU B CG  1 
ATOM   2469 C CD1 . LEU B 1 164 ? 1.992   10.021 -19.002 1.00 35.25  ? 160 LEU B CD1 1 
ATOM   2470 C CD2 . LEU B 1 164 ? 3.074   11.386 -20.801 1.00 35.23  ? 160 LEU B CD2 1 
ATOM   2471 N N   . GLY B 1 165 ? -0.186  10.574 -24.782 1.00 35.93  ? 161 GLY B N   1 
ATOM   2472 C CA  . GLY B 1 165 ? -0.937  9.848  -25.789 1.00 36.36  ? 161 GLY B CA  1 
ATOM   2473 C C   . GLY B 1 165 ? -2.432  10.065 -25.666 1.00 36.34  ? 161 GLY B C   1 
ATOM   2474 O O   . GLY B 1 165 ? -3.225  9.169  -25.955 1.00 38.16  ? 161 GLY B O   1 
ATOM   2475 N N   . GLY B 1 166 ? -2.818  11.262 -25.235 1.00 36.39  ? 162 GLY B N   1 
ATOM   2476 C CA  . GLY B 1 166 ? -4.221  11.601 -25.083 1.00 36.34  ? 162 GLY B CA  1 
ATOM   2477 C C   . GLY B 1 166 ? -4.693  11.485 -23.647 1.00 36.34  ? 162 GLY B C   1 
ATOM   2478 O O   . GLY B 1 166 ? -5.885  11.603 -23.364 1.00 36.82  ? 162 GLY B O   1 
ATOM   2479 N N   . ARG B 1 167 ? -3.753  11.252 -22.737 1.00 36.32  ? 163 ARG B N   1 
ATOM   2480 C CA  . ARG B 1 167 ? -4.020  11.381 -21.309 1.00 35.55  ? 163 ARG B CA  1 
ATOM   2481 C C   . ARG B 1 167 ? -3.004  12.301 -20.639 1.00 33.81  ? 163 ARG B C   1 
ATOM   2482 O O   . ARG B 1 167 ? -1.796  12.144 -20.820 1.00 32.05  ? 163 ARG B O   1 
ATOM   2483 C CB  . ARG B 1 167 ? -4.010  10.008 -20.636 1.00 36.25  ? 163 ARG B CB  1 
ATOM   2484 C CG  . ARG B 1 167 ? -4.879  8.971  -21.328 1.00 39.37  ? 163 ARG B CG  1 
ATOM   2485 C CD  . ARG B 1 167 ? -5.336  7.895  -20.356 1.00 43.95  ? 163 ARG B CD  1 
ATOM   2486 N NE  . ARG B 1 167 ? -5.298  6.564  -20.955 1.00 46.26  ? 163 ARG B NE  1 
ATOM   2487 C CZ  . ARG B 1 167 ? -4.182  5.880  -21.183 1.00 50.92  ? 163 ARG B CZ  1 
ATOM   2488 N NH1 . ARG B 1 167 ? -3.005  6.400  -20.862 1.00 53.58  ? 163 ARG B NH1 1 
ATOM   2489 N NH2 . ARG B 1 167 ? -4.242  4.674  -21.732 1.00 51.62  ? 163 ARG B NH2 1 
ATOM   2490 N N   . VAL B 1 168 ? -3.502  13.260 -19.866 1.00 32.76  ? 164 VAL B N   1 
ATOM   2491 C CA  . VAL B 1 168 ? -2.660  14.238 -19.242 1.00 33.51  ? 164 VAL B CA  1 
ATOM   2492 C C   . VAL B 1 168 ? -2.328  13.778 -17.847 1.00 33.56  ? 164 VAL B C   1 
ATOM   2493 O O   . VAL B 1 168 ? -3.196  13.591 -17.061 1.00 34.53  ? 164 VAL B O   1 
ATOM   2494 C CB  . VAL B 1 168 ? -3.225  15.703 -19.310 1.00 32.21  ? 164 VAL B CB  1 
ATOM   2495 C CG1 . VAL B 1 168 ? -3.765  16.032 -20.598 1.00 32.46  ? 164 VAL B CG1 1 
ATOM   2496 C CG2 . VAL B 1 168 ? -4.211  15.948 -18.325 1.00 32.83  ? 164 VAL B CG2 1 
ATOM   2497 N N   . MET B 1 169 ? -1.045  13.542 -17.704 1.00 20.00  ? 165 MET B N   1 
ATOM   2498 C CA  . MET B 1 169 ? -0.192  13.972 -16.643 1.00 20.00  ? 165 MET B CA  1 
ATOM   2499 C C   . MET B 1 169 ? -0.071  15.419 -16.262 1.00 20.00  ? 165 MET B C   1 
ATOM   2500 O O   . MET B 1 169 ? 0.535   16.213 -16.934 1.00 20.00  ? 165 MET B O   1 
ATOM   2501 C CB  . MET B 1 169 ? 1.070   13.177 -16.605 1.00 20.00  ? 165 MET B CB  1 
ATOM   2502 C CG  . MET B 1 169 ? 1.461   12.907 -15.207 1.00 20.00  ? 165 MET B CG  1 
ATOM   2503 S SD  . MET B 1 169 ? 2.823   11.902 -15.120 1.00 20.00  ? 165 MET B SD  1 
ATOM   2504 C CE  . MET B 1 169 ? 4.000   12.869 -15.981 1.00 20.00  ? 165 MET B CE  1 
ATOM   2505 N N   . LYS B 1 170 ? -0.584  15.695 -15.088 1.00 34.67  ? 166 LYS B N   1 
ATOM   2506 C CA  . LYS B 1 170 ? -0.393  16.925 -14.385 1.00 35.34  ? 166 LYS B CA  1 
ATOM   2507 C C   . LYS B 1 170 ? 0.180   16.715 -12.972 1.00 35.30  ? 166 LYS B C   1 
ATOM   2508 O O   . LYS B 1 170 ? -0.419  16.065 -12.173 1.00 35.24  ? 166 LYS B O   1 
ATOM   2509 C CB  . LYS B 1 170 ? -1.729  17.635 -14.340 1.00 34.63  ? 166 LYS B CB  1 
ATOM   2510 C CG  . LYS B 1 170 ? -1.827  18.620 -13.272 1.00 34.59  ? 166 LYS B CG  1 
ATOM   2511 C CD  . LYS B 1 170 ? -2.784  19.631 -13.615 1.00 34.61  ? 166 LYS B CD  1 
ATOM   2512 C CE  . LYS B 1 170 ? -4.052  19.414 -12.975 1.00 35.12  ? 166 LYS B CE  1 
ATOM   2513 N NZ  . LYS B 1 170 ? -5.032  20.263 -13.583 1.00 38.76  ? 166 LYS B NZ  1 
ATOM   2514 N N   . ILE B 1 171 ? 1.338   17.276 -12.680 1.00 35.30  ? 167 ILE B N   1 
ATOM   2515 C CA  . ILE B 1 171 ? 1.961   17.144 -11.368 1.00 35.55  ? 167 ILE B CA  1 
ATOM   2516 C C   . ILE B 1 171 ? 2.004   18.431 -10.520 1.00 36.04  ? 167 ILE B C   1 
ATOM   2517 O O   . ILE B 1 171 ? 2.750   19.329 -10.832 1.00 35.31  ? 167 ILE B O   1 
ATOM   2518 C CB  . ILE B 1 171 ? 3.367   16.611 -11.491 1.00 34.85  ? 167 ILE B CB  1 
ATOM   2519 C CG1 . ILE B 1 171 ? 3.377   15.227 -12.090 1.00 34.85  ? 167 ILE B CG1 1 
ATOM   2520 C CG2 . ILE B 1 171 ? 4.032   16.593 -10.198 1.00 35.51  ? 167 ILE B CG2 1 
ATOM   2521 C CD1 . ILE B 1 171 ? 4.697   14.735 -12.291 1.00 36.02  ? 167 ILE B CD1 1 
ATOM   2522 N N   . ASN B 1 172 ? 1.246   18.485 -9.423  1.00 36.66  ? 168 ASN B N   1 
ATOM   2523 C CA  . ASN B 1 172 ? 1.362   19.607 -8.476  1.00 36.71  ? 168 ASN B CA  1 
ATOM   2524 C C   . ASN B 1 172 ? 2.471   19.380 -7.450  1.00 36.40  ? 168 ASN B C   1 
ATOM   2525 O O   . ASN B 1 172 ? 2.785   18.255 -7.113  1.00 37.14  ? 168 ASN B O   1 
ATOM   2526 C CB  . ASN B 1 172 ? 0.068   19.871 -7.738  1.00 37.06  ? 168 ASN B CB  1 
ATOM   2527 C CG  . ASN B 1 172 ? -1.115  20.081 -8.663  1.00 39.45  ? 168 ASN B CG  1 
ATOM   2528 O OD1 . ASN B 1 172 ? -1.581  19.140 -9.296  1.00 41.25  ? 168 ASN B OD1 1 
ATOM   2529 N ND2 . ASN B 1 172 ? -1.661  21.306 -8.676  1.00 42.31  ? 168 ASN B ND2 1 
ATOM   2530 N N   . THR B 1 173 ? 3.066   20.474 -6.991  1.00 35.63  ? 169 THR B N   1 
ATOM   2531 C CA  . THR B 1 173 ? 3.992   20.500 -5.877  1.00 34.79  ? 169 THR B CA  1 
ATOM   2532 C C   . THR B 1 173 ? 3.445   21.404 -4.757  1.00 35.29  ? 169 THR B C   1 
ATOM   2533 O O   . THR B 1 173 ? 2.959   22.516 -4.991  1.00 35.34  ? 169 THR B O   1 
ATOM   2534 C CB  . THR B 1 173 ? 5.329   21.036 -6.321  1.00 34.10  ? 169 THR B CB  1 
ATOM   2535 O OG1 . THR B 1 173 ? 5.771   20.277 -7.448  1.00 32.81  ? 169 THR B OG1 1 
ATOM   2536 C CG2 . THR B 1 173 ? 6.387   20.943 -5.201  1.00 32.52  ? 169 THR B CG2 1 
ATOM   2537 N N   . GLU B 1 174 ? 3.569   20.935 -3.532  1.00 35.06  ? 170 GLU B N   1 
ATOM   2538 C CA  . GLU B 1 174 ? 2.925   21.567 -2.419  1.00 35.80  ? 170 GLU B CA  1 
ATOM   2539 C C   . GLU B 1 174 ? 3.895   21.287 -1.292  1.00 35.91  ? 170 GLU B C   1 
ATOM   2540 O O   . GLU B 1 174 ? 4.344   20.152 -1.141  1.00 36.54  ? 170 GLU B O   1 
ATOM   2541 C CB  . GLU B 1 174 ? 1.565   20.880 -2.244  1.00 36.22  ? 170 GLU B CB  1 
ATOM   2542 C CG  . GLU B 1 174 ? 0.386   21.669 -1.781  1.00 38.71  ? 170 GLU B CG  1 
ATOM   2543 C CD  . GLU B 1 174 ? 0.252   23.054 -2.379  1.00 41.70  ? 170 GLU B CD  1 
ATOM   2544 O OE1 . GLU B 1 174 ? -0.250  23.209 -3.517  1.00 43.85  ? 170 GLU B OE1 1 
ATOM   2545 O OE2 . GLU B 1 174 ? 0.596   23.997 -1.658  1.00 43.01  ? 170 GLU B OE2 1 
ATOM   2546 N N   . VAL B 1 175 ? 4.300   22.321 -0.557  1.00 35.34  ? 171 VAL B N   1 
ATOM   2547 C CA  . VAL B 1 175 ? 5.112   22.146 0.622   1.00 34.64  ? 171 VAL B CA  1 
ATOM   2548 C C   . VAL B 1 175 ? 4.284   22.540 1.831   1.00 35.80  ? 171 VAL B C   1 
ATOM   2549 O O   . VAL B 1 175 ? 3.396   23.417 1.754   1.00 33.31  ? 171 VAL B O   1 
ATOM   2550 C CB  . VAL B 1 175 ? 6.442   22.960 0.575   1.00 34.60  ? 171 VAL B CB  1 
ATOM   2551 C CG1 . VAL B 1 175 ? 7.282   22.677 1.810   1.00 35.39  ? 171 VAL B CG1 1 
ATOM   2552 C CG2 . VAL B 1 175 ? 7.269   22.586 -0.628  1.00 33.81  ? 171 VAL B CG2 1 
ATOM   2553 N N   . ARG B 1 176 ? 4.526   21.812 2.928   1.00 36.83  ? 172 ARG B N   1 
ATOM   2554 C CA  . ARG B 1 176 ? 3.963   22.126 4.238   1.00 37.56  ? 172 ARG B CA  1 
ATOM   2555 C C   . ARG B 1 176 ? 5.032   21.917 5.298   1.00 38.52  ? 172 ARG B C   1 
ATOM   2556 O O   . ARG B 1 176 ? 5.946   21.057 5.164   1.00 38.01  ? 172 ARG B O   1 
ATOM   2557 C CB  . ARG B 1 176 ? 2.807   21.200 4.579   1.00 37.65  ? 172 ARG B CB  1 
ATOM   2558 C CG  . ARG B 1 176 ? 1.608   21.367 3.700   1.00 37.37  ? 172 ARG B CG  1 
ATOM   2559 C CD  . ARG B 1 176 ? 0.847   22.666 4.007   1.00 36.55  ? 172 ARG B CD  1 
ATOM   2560 N NE  . ARG B 1 176 ? -0.366  22.721 3.187   1.00 34.72  ? 172 ARG B NE  1 
ATOM   2561 C CZ  . ARG B 1 176 ? -0.369  23.046 1.899   1.00 34.07  ? 172 ARG B CZ  1 
ATOM   2562 N NH1 . ARG B 1 176 ? 0.748   23.378 1.274   1.00 33.74  ? 172 ARG B NH1 1 
ATOM   2563 N NH2 . ARG B 1 176 ? -1.505  23.055 1.236   1.00 38.05  ? 172 ARG B NH2 1 
ATOM   2564 N N   . SER B 1 177 ? 4.883   22.676 6.376   1.00 39.16  ? 173 SER B N   1 
ATOM   2565 C CA  A SER B 1 177 ? 5.824   22.608 7.475   0.50 39.83  ? 173 SER B CA  1 
ATOM   2566 C CA  B SER B 1 177 ? 5.820   22.618 7.474   0.50 39.54  ? 173 SER B CA  1 
ATOM   2567 C C   . SER B 1 177 ? 5.113   22.301 8.785   1.00 40.12  ? 173 SER B C   1 
ATOM   2568 O O   . SER B 1 177 ? 3.900   22.489 8.930   1.00 40.40  ? 173 SER B O   1 
ATOM   2569 C CB  A SER B 1 177 ? 6.664   23.893 7.567   0.50 39.72  ? 173 SER B CB  1 
ATOM   2570 C CB  B SER B 1 177 ? 6.598   23.931 7.554   0.50 39.38  ? 173 SER B CB  1 
ATOM   2571 O OG  A SER B 1 177 ? 5.867   25.063 7.566   0.50 40.57  ? 173 SER B OG  1 
ATOM   2572 O OG  B SER B 1 177 ? 7.249   24.180 6.319   0.50 38.51  ? 173 SER B OG  1 
ATOM   2573 N N   . PHE B 1 178 ? 5.867   21.782 9.731   1.00 40.88  ? 174 PHE B N   1 
ATOM   2574 C CA  . PHE B 1 178 ? 5.299   21.501 11.025  1.00 41.80  ? 174 PHE B CA  1 
ATOM   2575 C C   . PHE B 1 178 ? 6.391   21.476 12.047  1.00 42.15  ? 174 PHE B C   1 
ATOM   2576 O O   . PHE B 1 178 ? 7.561   21.260 11.741  1.00 42.76  ? 174 PHE B O   1 
ATOM   2577 C CB  . PHE B 1 178 ? 4.486   20.175 11.037  1.00 42.28  ? 174 PHE B CB  1 
ATOM   2578 C CG  . PHE B 1 178 ? 5.306   18.922 10.812  1.00 41.57  ? 174 PHE B CG  1 
ATOM   2579 C CD1 . PHE B 1 178 ? 5.370   18.343 9.569   1.00 41.51  ? 174 PHE B CD1 1 
ATOM   2580 C CD2 . PHE B 1 178 ? 5.981   18.317 11.849  1.00 42.67  ? 174 PHE B CD2 1 
ATOM   2581 C CE1 . PHE B 1 178 ? 6.086   17.203 9.360   1.00 42.21  ? 174 PHE B CE1 1 
ATOM   2582 C CE2 . PHE B 1 178 ? 6.710   17.155 11.638  1.00 42.83  ? 174 PHE B CE2 1 
ATOM   2583 C CZ  . PHE B 1 178 ? 6.760   16.609 10.392  1.00 42.78  ? 174 PHE B CZ  1 
ATOM   2584 N N   . GLY B 1 179 ? 5.997   21.709 13.275  1.00 43.03  ? 175 GLY B N   1 
ATOM   2585 C CA  . GLY B 1 179 ? 6.919   21.552 14.370  1.00 43.69  ? 175 GLY B CA  1 
ATOM   2586 C C   . GLY B 1 179 ? 6.624   22.438 15.564  1.00 44.33  ? 175 GLY B C   1 
ATOM   2587 O O   . GLY B 1 179 ? 5.564   23.072 15.644  1.00 43.53  ? 175 GLY B O   1 
ATOM   2588 N N   . PRO B 1 180 ? 7.585   22.486 16.494  1.00 44.98  ? 176 PRO B N   1 
ATOM   2589 C CA  . PRO B 1 180 ? 8.836   21.751 16.298  1.00 45.59  ? 176 PRO B CA  1 
ATOM   2590 C C   . PRO B 1 180 ? 8.855   20.452 17.075  1.00 45.42  ? 176 PRO B C   1 
ATOM   2591 O O   . PRO B 1 180 ? 7.813   20.075 17.643  1.00 45.11  ? 176 PRO B O   1 
ATOM   2592 C CB  . PRO B 1 180 ? 9.855   22.685 16.978  1.00 46.46  ? 176 PRO B CB  1 
ATOM   2593 C CG  . PRO B 1 180 ? 9.028   23.443 18.111  1.00 46.22  ? 176 PRO B CG  1 
ATOM   2594 C CD  . PRO B 1 180 ? 7.553   23.193 17.795  1.00 45.74  ? 176 PRO B CD  1 
ATOM   2595 N N   . VAL B 1 181 ? 9.906   19.690 16.823  1.00 44.77  ? 177 VAL B N   1 
ATOM   2596 C CA  . VAL B 1 181 ? 9.953   18.243 16.972  1.00 44.00  ? 177 VAL B CA  1 
ATOM   2597 C C   . VAL B 1 181 ? 11.133  17.972 17.887  1.00 43.00  ? 177 VAL B C   1 
ATOM   2598 O O   . VAL B 1 181 ? 12.172  18.547 17.695  1.00 42.23  ? 177 VAL B O   1 
ATOM   2599 C CB  . VAL B 1 181 ? 10.140  17.460 15.569  1.00 43.76  ? 177 VAL B CB  1 
ATOM   2600 C CG1 . VAL B 1 181 ? 8.878   17.330 14.826  1.00 43.52  ? 177 VAL B CG1 1 
ATOM   2601 C CG2 . VAL B 1 181 ? 11.168  18.073 14.688  1.00 44.66  ? 177 VAL B CG2 1 
ATOM   2602 N N   . SER B 1 182 ? 10.974  17.107 18.881  1.00 42.59  ? 178 SER B N   1 
ATOM   2603 C CA  . SER B 1 182 ? 11.971  16.981 19.937  1.00 42.00  ? 178 SER B CA  1 
ATOM   2604 C C   . SER B 1 182 ? 12.591  15.587 19.947  1.00 41.98  ? 178 SER B C   1 
ATOM   2605 O O   . SER B 1 182 ? 13.659  15.377 20.522  1.00 42.10  ? 178 SER B O   1 
ATOM   2606 C CB  . SER B 1 182 ? 11.349  17.290 21.301  1.00 42.13  ? 178 SER B CB  1 
ATOM   2607 O OG  . SER B 1 182 ? 9.949   17.073 21.284  1.00 41.07  ? 178 SER B OG  1 
ATOM   2608 N N   . ARG B 1 183 ? 11.913  14.640 19.307  1.00 41.29  ? 179 ARG B N   1 
ATOM   2609 C CA  . ARG B 1 183 ? 12.107  13.226 19.606  1.00 39.41  ? 179 ARG B CA  1 
ATOM   2610 C C   . ARG B 1 183 ? 12.952  12.546 18.533  1.00 39.54  ? 179 ARG B C   1 
ATOM   2611 O O   . ARG B 1 183 ? 13.264  13.145 17.503  1.00 38.73  ? 179 ARG B O   1 
ATOM   2612 C CB  . ARG B 1 183 ? 10.758  12.517 19.740  1.00 39.04  ? 179 ARG B CB  1 
ATOM   2613 C CG  . ARG B 1 183 ? 9.811   13.168 20.734  1.00 37.54  ? 179 ARG B CG  1 
ATOM   2614 C CD  . ARG B 1 183 ? 8.746   12.190 21.205  1.00 36.33  ? 179 ARG B CD  1 
ATOM   2615 N NE  . ARG B 1 183 ? 7.968   12.724 22.319  1.00 35.38  ? 179 ARG B NE  1 
ATOM   2616 C CZ  . ARG B 1 183 ? 8.179   12.413 23.594  1.00 33.63  ? 179 ARG B CZ  1 
ATOM   2617 N NH1 . ARG B 1 183 ? 9.149   11.570 23.921  1.00 33.78  ? 179 ARG B NH1 1 
ATOM   2618 N NH2 . ARG B 1 183 ? 7.422   12.947 24.543  1.00 33.63  ? 179 ARG B NH2 1 
ATOM   2619 N N   . SER B 1 184 ? 13.318  11.293 18.781  1.00 39.35  ? 180 SER B N   1 
ATOM   2620 C CA  . SER B 1 184 ? 14.330  10.618 17.978  1.00 39.59  ? 180 SER B CA  1 
ATOM   2621 C C   . SER B 1 184 ? 13.972  10.652 16.496  1.00 38.82  ? 180 SER B C   1 
ATOM   2622 O O   . SER B 1 184 ? 14.850  10.736 15.637  1.00 38.99  ? 180 SER B O   1 
ATOM   2623 C CB  . SER B 1 184 ? 14.505  9.171  18.443  1.00 40.01  ? 180 SER B CB  1 
ATOM   2624 O OG  . SER B 1 184 ? 14.636  8.292  17.339  1.00 43.00  ? 180 SER B OG  1 
ATOM   2625 N N   . GLY B 1 185 ? 12.677  10.587 16.204  1.00 37.64  ? 181 GLY B N   1 
ATOM   2626 C CA  . GLY B 1 185 ? 12.194  10.712 14.837  1.00 36.95  ? 181 GLY B CA  1 
ATOM   2627 C C   . GLY B 1 185 ? 10.685  10.819 14.735  1.00 36.29  ? 181 GLY B C   1 
ATOM   2628 O O   . GLY B 1 185 ? 9.986   11.022 15.727  1.00 35.75  ? 181 GLY B O   1 
ATOM   2629 N N   . PHE B 1 186 ? 10.187  10.682 13.509  1.00 35.37  ? 182 PHE B N   1 
ATOM   2630 C CA  . PHE B 1 186 ? 8.752   10.772 13.227  1.00 34.06  ? 182 PHE B CA  1 
ATOM   2631 C C   . PHE B 1 186 ? 8.383   9.992  11.951  1.00 33.88  ? 182 PHE B C   1 
ATOM   2632 O O   . PHE B 1 186 ? 9.264   9.525  11.181  1.00 33.47  ? 182 PHE B O   1 
ATOM   2633 C CB  . PHE B 1 186 ? 8.340   12.231 13.064  1.00 33.41  ? 182 PHE B CB  1 
ATOM   2634 C CG  . PHE B 1 186 ? 9.108   12.946 11.979  1.00 33.71  ? 182 PHE B CG  1 
ATOM   2635 C CD1 . PHE B 1 186 ? 8.596   13.047 10.684  1.00 32.80  ? 182 PHE B CD1 1 
ATOM   2636 C CD2 . PHE B 1 186 ? 10.337  13.485 12.238  1.00 33.03  ? 182 PHE B CD2 1 
ATOM   2637 C CE1 . PHE B 1 186 ? 9.307   13.657 9.701   1.00 33.51  ? 182 PHE B CE1 1 
ATOM   2638 C CE2 . PHE B 1 186 ? 11.052  14.123 11.242  1.00 34.00  ? 182 PHE B CE2 1 
ATOM   2639 C CZ  . PHE B 1 186 ? 10.527  14.218 9.978   1.00 33.07  ? 182 PHE B CZ  1 
ATOM   2640 N N   . TYR B 1 187 ? 7.072   9.869  11.747  1.00 33.35  ? 183 TYR B N   1 
ATOM   2641 C CA  . TYR B 1 187 ? 6.491   9.234  10.573  1.00 32.53  ? 183 TYR B CA  1 
ATOM   2642 C C   . TYR B 1 187 ? 5.610   10.268 9.953   1.00 31.55  ? 183 TYR B C   1 
ATOM   2643 O O   . TYR B 1 187 ? 5.085   11.121 10.696  1.00 30.80  ? 183 TYR B O   1 
ATOM   2644 C CB  . TYR B 1 187 ? 5.577   8.078  10.979  1.00 32.99  ? 183 TYR B CB  1 
ATOM   2645 C CG  . TYR B 1 187 ? 6.258   6.952  11.713  1.00 33.70  ? 183 TYR B CG  1 
ATOM   2646 C CD1 . TYR B 1 187 ? 6.767   5.842  11.014  1.00 34.77  ? 183 TYR B CD1 1 
ATOM   2647 C CD2 . TYR B 1 187 ? 6.373   6.977  13.094  1.00 31.85  ? 183 TYR B CD2 1 
ATOM   2648 C CE1 . TYR B 1 187 ? 7.381   4.814  11.668  1.00 33.65  ? 183 TYR B CE1 1 
ATOM   2649 C CE2 . TYR B 1 187 ? 6.974   5.949  13.774  1.00 34.85  ? 183 TYR B CE2 1 
ATOM   2650 C CZ  . TYR B 1 187 ? 7.479   4.861  13.069  1.00 35.81  ? 183 TYR B CZ  1 
ATOM   2651 O OH  . TYR B 1 187 ? 8.095   3.839  13.761  1.00 34.44  ? 183 TYR B OH  1 
ATOM   2652 N N   . LEU B 1 188 ? 5.420   10.190 8.620   1.00 29.80  ? 184 LEU B N   1 
ATOM   2653 C CA  . LEU B 1 188 ? 4.282   10.868 7.977   1.00 28.80  ? 184 LEU B CA  1 
ATOM   2654 C C   . LEU B 1 188 ? 3.162   9.888  7.597   1.00 28.58  ? 184 LEU B C   1 
ATOM   2655 O O   . LEU B 1 188 ? 3.412   8.709  7.352   1.00 27.48  ? 184 LEU B O   1 
ATOM   2656 C CB  . LEU B 1 188 ? 4.731   11.700 6.754   1.00 28.63  ? 184 LEU B CB  1 
ATOM   2657 C CG  . LEU B 1 188 ? 5.940   12.616 7.037   1.00 29.70  ? 184 LEU B CG  1 
ATOM   2658 C CD1 . LEU B 1 188 ? 6.337   13.422 5.807   1.00 29.64  ? 184 LEU B CD1 1 
ATOM   2659 C CD2 . LEU B 1 188 ? 5.621   13.559 8.219   1.00 30.26  ? 184 LEU B CD2 1 
ATOM   2660 N N   . ALA B 1 189 ? 1.929   10.398 7.545   1.00 28.85  ? 185 ALA B N   1 
ATOM   2661 C CA  . ALA B 1 189 ? 0.794   9.662  7.050   1.00 29.57  ? 185 ALA B CA  1 
ATOM   2662 C C   . ALA B 1 189 ? -0.084  10.447 6.060   1.00 30.72  ? 185 ALA B C   1 
ATOM   2663 O O   . ALA B 1 189 ? -0.484  11.609 6.278   1.00 32.20  ? 185 ALA B O   1 
ATOM   2664 C CB  . ALA B 1 189 ? -0.074  9.164  8.199   1.00 29.15  ? 185 ALA B CB  1 
ATOM   2665 N N   . PHE B 1 190 ? -0.461  9.753  5.011   1.00 30.73  ? 186 PHE B N   1 
ATOM   2666 C CA  . PHE B 1 190 ? -1.296  10.314 3.992   1.00 30.38  ? 186 PHE B CA  1 
ATOM   2667 C C   . PHE B 1 190 ? -2.631  9.594  4.062   1.00 29.96  ? 186 PHE B C   1 
ATOM   2668 O O   . PHE B 1 190 ? -2.654  8.407  4.077   1.00 31.60  ? 186 PHE B O   1 
ATOM   2669 C CB  . PHE B 1 190 ? -0.567  10.139 2.682   1.00 29.42  ? 186 PHE B CB  1 
ATOM   2670 C CG  . PHE B 1 190 ? 0.812   10.681 2.728   1.00 28.28  ? 186 PHE B CG  1 
ATOM   2671 C CD1 . PHE B 1 190 ? 1.871   9.884  3.059   1.00 29.17  ? 186 PHE B CD1 1 
ATOM   2672 C CD2 . PHE B 1 190 ? 1.043   12.024 2.475   1.00 29.94  ? 186 PHE B CD2 1 
ATOM   2673 C CE1 . PHE B 1 190 ? 3.149   10.401 3.128   1.00 28.97  ? 186 PHE B CE1 1 
ATOM   2674 C CE2 . PHE B 1 190 ? 2.316   12.546 2.542   1.00 28.96  ? 186 PHE B CE2 1 
ATOM   2675 C CZ  . PHE B 1 190 ? 3.367   11.723 2.864   1.00 29.31  ? 186 PHE B CZ  1 
ATOM   2676 N N   . GLN B 1 191 ? -3.733  10.324 4.153   1.00 30.44  ? 187 GLN B N   1 
ATOM   2677 C CA  . GLN B 1 191 ? -5.063  9.731  4.238   1.00 30.50  ? 187 GLN B CA  1 
ATOM   2678 C C   . GLN B 1 191 ? -5.906  10.153 3.060   1.00 31.44  ? 187 GLN B C   1 
ATOM   2679 O O   . GLN B 1 191 ? -6.036  11.344 2.805   1.00 32.05  ? 187 GLN B O   1 
ATOM   2680 C CB  . GLN B 1 191 ? -5.760  10.180 5.522   1.00 30.04  ? 187 GLN B CB  1 
ATOM   2681 C CG  . GLN B 1 191 ? -7.193  9.653  5.729   1.00 29.77  ? 187 GLN B CG  1 
ATOM   2682 C CD  . GLN B 1 191 ? -7.937  10.424 6.801   1.00 29.10  ? 187 GLN B CD  1 
ATOM   2683 O OE1 . GLN B 1 191 ? -7.659  11.596 6.990   1.00 31.93  ? 187 GLN B OE1 1 
ATOM   2684 N NE2 . GLN B 1 191 ? -8.892  9.783  7.500   1.00 26.30  ? 187 GLN B NE2 1 
ATOM   2685 N N   . ASP B 1 192 ? -6.504  9.170  2.381   1.00 32.51  ? 188 ASP B N   1 
ATOM   2686 C CA  . ASP B 1 192 ? -7.493  9.378  1.292   1.00 32.78  ? 188 ASP B CA  1 
ATOM   2687 C C   . ASP B 1 192 ? -8.864  8.958  1.785   1.00 32.59  ? 188 ASP B C   1 
ATOM   2688 O O   . ASP B 1 192 ? -9.012  8.090  2.633   1.00 33.01  ? 188 ASP B O   1 
ATOM   2689 C CB  . ASP B 1 192 ? -7.105  8.600  -0.002  1.00 33.03  ? 188 ASP B CB  1 
ATOM   2690 C CG  . ASP B 1 192 ? -8.310  8.288  -0.913  1.00 34.16  ? 188 ASP B CG  1 
ATOM   2691 O OD1 . ASP B 1 192 ? -8.731  9.153  -1.732  1.00 36.53  ? 188 ASP B OD1 1 
ATOM   2692 O OD2 . ASP B 1 192 ? -8.858  7.164  -0.805  1.00 38.02  ? 188 ASP B OD2 1 
ATOM   2693 N N   . TYR B 1 193 ? -9.877  9.600  1.249   1.00 33.14  ? 189 TYR B N   1 
ATOM   2694 C CA  . TYR B 1 193 ? -11.240 9.374  1.686   1.00 33.13  ? 189 TYR B CA  1 
ATOM   2695 C C   . TYR B 1 193 ? -12.174 9.363  0.454   1.00 32.29  ? 189 TYR B C   1 
ATOM   2696 O O   . TYR B 1 193 ? -13.278 9.865  0.478   1.00 32.25  ? 189 TYR B O   1 
ATOM   2697 C CB  . TYR B 1 193 ? -11.622 10.387 2.785   1.00 33.78  ? 189 TYR B CB  1 
ATOM   2698 C CG  . TYR B 1 193 ? -10.919 11.722 2.650   1.00 35.26  ? 189 TYR B CG  1 
ATOM   2699 C CD1 . TYR B 1 193 ? -11.315 12.663 1.704   1.00 35.75  ? 189 TYR B CD1 1 
ATOM   2700 C CD2 . TYR B 1 193 ? -9.858  12.036 3.452   1.00 35.46  ? 189 TYR B CD2 1 
ATOM   2701 C CE1 . TYR B 1 193 ? -10.660 13.899 1.576   1.00 35.05  ? 189 TYR B CE1 1 
ATOM   2702 C CE2 . TYR B 1 193 ? -9.185  13.239 3.319   1.00 37.44  ? 189 TYR B CE2 1 
ATOM   2703 C CZ  . TYR B 1 193 ? -9.585  14.185 2.396   1.00 35.88  ? 189 TYR B CZ  1 
ATOM   2704 O OH  . TYR B 1 193 ? -8.873  15.387 2.329   1.00 35.21  ? 189 TYR B OH  1 
ATOM   2705 N N   . GLY B 1 194 ? -11.715 8.728  -0.621  1.00 31.90  ? 190 GLY B N   1 
ATOM   2706 C CA  . GLY B 1 194 ? -12.585 8.434  -1.766  1.00 31.61  ? 190 GLY B CA  1 
ATOM   2707 C C   . GLY B 1 194 ? -12.356 9.264  -3.017  1.00 31.20  ? 190 GLY B C   1 
ATOM   2708 O O   . GLY B 1 194 ? -13.309 9.580  -3.747  1.00 32.37  ? 190 GLY B O   1 
ATOM   2709 N N   . GLY B 1 195 ? -11.101 9.602  -3.266  1.00 30.67  ? 191 GLY B N   1 
ATOM   2710 C CA  . GLY B 1 195 ? -10.693 10.179 -4.528  1.00 30.76  ? 191 GLY B CA  1 
ATOM   2711 C C   . GLY B 1 195 ? -9.757  9.293  -5.317  1.00 30.65  ? 191 GLY B C   1 
ATOM   2712 O O   . GLY B 1 195 ? -9.636  8.094  -5.077  1.00 30.47  ? 191 GLY B O   1 
ATOM   2713 N N   . CYS B 1 196 ? -9.038  9.925  -6.231  1.00 30.55  ? 192 CYS B N   1 
ATOM   2714 C CA  . CYS B 1 196 ? -8.310  9.231  -7.255  1.00 30.29  ? 192 CYS B CA  1 
ATOM   2715 C C   . CYS B 1 196 ? -7.086  10.033 -7.536  1.00 30.10  ? 192 CYS B C   1 
ATOM   2716 O O   . CYS B 1 196 ? -7.196  11.068 -8.185  1.00 31.12  ? 192 CYS B O   1 
ATOM   2717 C CB  . CYS B 1 196 ? -9.185  9.131  -8.514  1.00 30.58  ? 192 CYS B CB  1 
ATOM   2718 S SG  . CYS B 1 196 ? -8.577  7.954  -9.764  1.00 30.68  ? 192 CYS B SG  1 
ATOM   2719 N N   . MET B 1 197 ? -5.932  9.558  -7.065  1.00 29.52  ? 193 MET B N   1 
ATOM   2720 C CA  . MET B 1 197 ? -4.733  10.321 -7.081  1.00 30.06  ? 193 MET B CA  1 
ATOM   2721 C C   . MET B 1 197 ? -3.529  9.442  -6.956  1.00 29.09  ? 193 MET B C   1 
ATOM   2722 O O   . MET B 1 197 ? -3.618  8.289  -6.612  1.00 29.88  ? 193 MET B O   1 
ATOM   2723 C CB  . MET B 1 197 ? -4.728  11.304 -5.909  1.00 31.04  ? 193 MET B CB  1 
ATOM   2724 C CG  . MET B 1 197 ? -4.588  10.661 -4.518  1.00 32.14  ? 193 MET B CG  1 
ATOM   2725 S SD  . MET B 1 197 ? -5.059  11.739 -3.126  1.00 33.94  ? 193 MET B SD  1 
ATOM   2726 C CE  . MET B 1 197 ? -6.822  11.867 -3.429  1.00 33.43  ? 193 MET B CE  1 
ATOM   2727 N N   . SER B 1 198 ? -2.387  10.033 -7.209  1.00 27.85  ? 194 SER B N   1 
ATOM   2728 C CA  . SER B 1 198 ? -1.133  9.388  -7.034  1.00 27.69  ? 194 SER B CA  1 
ATOM   2729 C C   . SER B 1 198 ? -0.175  10.355 -6.343  1.00 28.29  ? 194 SER B C   1 
ATOM   2730 O O   . SER B 1 198 ? 0.013   11.522 -6.771  1.00 27.14  ? 194 SER B O   1 
ATOM   2731 C CB  . SER B 1 198 ? -0.557  8.922  -8.377  1.00 28.15  ? 194 SER B CB  1 
ATOM   2732 O OG  . SER B 1 198 ? 0.820   8.764  -8.224  1.00 25.46  ? 194 SER B OG  1 
ATOM   2733 N N   . LEU B 1 199 ? 0.383   9.862  -5.239  1.00 28.13  ? 195 LEU B N   1 
ATOM   2734 C CA  . LEU B 1 199 ? 1.445   10.520 -4.540  1.00 28.43  ? 195 LEU B CA  1 
ATOM   2735 C C   . LEU B 1 199 ? 2.755   10.053 -5.147  1.00 28.69  ? 195 LEU B C   1 
ATOM   2736 O O   . LEU B 1 199 ? 3.124   8.877  -5.009  1.00 28.34  ? 195 LEU B O   1 
ATOM   2737 C CB  . LEU B 1 199 ? 1.354   10.192 -3.048  1.00 28.16  ? 195 LEU B CB  1 
ATOM   2738 C CG  . LEU B 1 199 ? 2.347   10.821 -2.090  1.00 28.88  ? 195 LEU B CG  1 
ATOM   2739 C CD1 . LEU B 1 199 ? 2.196   12.333 -2.040  1.00 30.15  ? 195 LEU B CD1 1 
ATOM   2740 C CD2 . LEU B 1 199 ? 2.091   10.241 -0.721  1.00 29.47  ? 195 LEU B CD2 1 
ATOM   2741 N N   . ILE B 1 200 ? 3.452   10.997 -5.805  1.00 28.84  ? 196 ILE B N   1 
ATOM   2742 C CA  . ILE B 1 200 ? 4.605   10.763 -6.662  1.00 28.37  ? 196 ILE B CA  1 
ATOM   2743 C C   . ILE B 1 200 ? 5.946   10.899 -5.944  1.00 29.42  ? 196 ILE B C   1 
ATOM   2744 O O   . ILE B 1 200 ? 6.899   10.147 -6.212  1.00 30.04  ? 196 ILE B O   1 
ATOM   2745 C CB  . ILE B 1 200 ? 4.544   11.738 -7.881  1.00 28.18  ? 196 ILE B CB  1 
ATOM   2746 C CG1 . ILE B 1 200 ? 3.406   11.368 -8.817  1.00 28.39  ? 196 ILE B CG1 1 
ATOM   2747 C CG2 . ILE B 1 200 ? 5.809   11.690 -8.695  1.00 28.55  ? 196 ILE B CG2 1 
ATOM   2748 C CD1 . ILE B 1 200 ? 3.054   12.404 -9.774  1.00 29.62  ? 196 ILE B CD1 1 
ATOM   2749 N N   . ALA B 1 201 ? 6.040   11.869 -5.049  1.00 30.20  ? 197 ALA B N   1 
ATOM   2750 C CA  . ALA B 1 201 ? 7.264   12.104 -4.303  1.00 31.21  ? 197 ALA B CA  1 
ATOM   2751 C C   . ALA B 1 201 ? 7.000   12.809 -2.966  1.00 31.46  ? 197 ALA B C   1 
ATOM   2752 O O   . ALA B 1 201 ? 6.033   13.560 -2.814  1.00 31.89  ? 197 ALA B O   1 
ATOM   2753 C CB  . ALA B 1 201 ? 8.254   12.946 -5.132  1.00 32.12  ? 197 ALA B CB  1 
ATOM   2754 N N   . VAL B 1 202 ? 7.889   12.539 -2.012  1.00 31.76  ? 198 VAL B N   1 
ATOM   2755 C CA  . VAL B 1 202 ? 7.865   13.112 -0.680  1.00 31.51  ? 198 VAL B CA  1 
ATOM   2756 C C   . VAL B 1 202 ? 9.337   13.302 -0.392  1.00 32.29  ? 198 VAL B C   1 
ATOM   2757 O O   . VAL B 1 202 ? 10.092  12.325 -0.338  1.00 30.92  ? 198 VAL B O   1 
ATOM   2758 C CB  . VAL B 1 202 ? 7.209   12.167 0.378   1.00 31.55  ? 198 VAL B CB  1 
ATOM   2759 C CG1 . VAL B 1 202 ? 6.959   12.904 1.668   1.00 31.81  ? 198 VAL B CG1 1 
ATOM   2760 C CG2 . VAL B 1 202 ? 5.885   11.644 -0.135  1.00 30.67  ? 198 VAL B CG2 1 
ATOM   2761 N N   . ARG B 1 203 ? 9.755   14.570 -0.331  1.00 33.23  ? 199 ARG B N   1 
ATOM   2762 C CA  . ARG B 1 203 ? 11.026  14.943 0.242   1.00 34.43  ? 199 ARG B CA  1 
ATOM   2763 C C   . ARG B 1 203 ? 10.772  15.650 1.569   1.00 34.53  ? 199 ARG B C   1 
ATOM   2764 O O   . ARG B 1 203 ? 9.940   16.552 1.677   1.00 32.57  ? 199 ARG B O   1 
ATOM   2765 C CB  . ARG B 1 203 ? 11.833  15.843 -0.682  1.00 34.45  ? 199 ARG B CB  1 
ATOM   2766 C CG  . ARG B 1 203 ? 13.251  16.045 -0.175  1.00 36.74  ? 199 ARG B CG  1 
ATOM   2767 C CD  . ARG B 1 203 ? 14.119  16.730 -1.203  1.00 37.55  ? 199 ARG B CD  1 
ATOM   2768 N NE  . ARG B 1 203 ? 13.585  18.051 -1.487  1.00 39.61  ? 199 ARG B NE  1 
ATOM   2769 C CZ  . ARG B 1 203 ? 14.008  19.161 -0.885  1.00 41.85  ? 199 ARG B CZ  1 
ATOM   2770 N NH1 . ARG B 1 203 ? 14.986  19.116 0.052   1.00 42.43  ? 199 ARG B NH1 1 
ATOM   2771 N NH2 . ARG B 1 203 ? 13.466  20.322 -1.234  1.00 39.72  ? 199 ARG B NH2 1 
ATOM   2772 N N   . VAL B 1 204 ? 11.490  15.192 2.580   1.00 35.86  ? 200 VAL B N   1 
ATOM   2773 C CA  . VAL B 1 204 ? 11.367  15.730 3.934   1.00 37.24  ? 200 VAL B CA  1 
ATOM   2774 C C   . VAL B 1 204 ? 12.687  16.414 4.250   1.00 38.17  ? 200 VAL B C   1 
ATOM   2775 O O   . VAL B 1 204 ? 13.742  15.816 4.096   1.00 36.43  ? 200 VAL B O   1 
ATOM   2776 C CB  . VAL B 1 204 ? 11.070  14.607 4.962   1.00 36.94  ? 200 VAL B CB  1 
ATOM   2777 C CG1 . VAL B 1 204 ? 11.019  15.150 6.392   1.00 37.17  ? 200 VAL B CG1 1 
ATOM   2778 C CG2 . VAL B 1 204 ? 9.781   13.934 4.597   1.00 37.07  ? 200 VAL B CG2 1 
ATOM   2779 N N   . PHE B 1 205 ? 12.617  17.675 4.650   1.00 40.27  ? 201 PHE B N   1 
ATOM   2780 C CA  . PHE B 1 205 ? 13.838  18.431 4.955   1.00 42.77  ? 201 PHE B CA  1 
ATOM   2781 C C   . PHE B 1 205 ? 13.712  19.535 6.052   1.00 43.36  ? 201 PHE B C   1 
ATOM   2782 O O   . PHE B 1 205 ? 12.637  19.820 6.546   1.00 42.80  ? 201 PHE B O   1 
ATOM   2783 C CB  . PHE B 1 205 ? 14.374  19.032 3.646   1.00 41.78  ? 201 PHE B CB  1 
ATOM   2784 C CG  . PHE B 1 205 ? 13.533  20.164 3.098   1.00 42.66  ? 201 PHE B CG  1 
ATOM   2785 C CD1 . PHE B 1 205 ? 12.432  19.908 2.294   1.00 41.16  ? 201 PHE B CD1 1 
ATOM   2786 C CD2 . PHE B 1 205 ? 13.861  21.492 3.382   1.00 41.34  ? 201 PHE B CD2 1 
ATOM   2787 C CE1 . PHE B 1 205 ? 11.673  20.950 1.775   1.00 41.99  ? 201 PHE B CE1 1 
ATOM   2788 C CE2 . PHE B 1 205 ? 13.115  22.523 2.869   1.00 41.66  ? 201 PHE B CE2 1 
ATOM   2789 C CZ  . PHE B 1 205 ? 12.002  22.252 2.070   1.00 41.66  ? 201 PHE B CZ  1 
ATOM   2790 N N   . TYR B 1 206 ? 14.850  19.970 6.514   1.00 46.46  ? 202 TYR B N   1 
ATOM   2791 C CA  . TYR B 1 206 ? 15.037  21.258 7.104   1.00 48.45  ? 202 TYR B CA  1 
ATOM   2792 C C   . TYR B 1 206 ? 16.352  21.747 6.580   1.00 51.41  ? 202 TYR B C   1 
ATOM   2793 O O   . TYR B 1 206 ? 16.836  21.286 5.594   1.00 52.20  ? 202 TYR B O   1 
ATOM   2794 C CB  . TYR B 1 206 ? 15.170  21.070 8.598   1.00 49.76  ? 202 TYR B CB  1 
ATOM   2795 C CG  . TYR B 1 206 ? 16.479  20.453 8.967   1.00 49.97  ? 202 TYR B CG  1 
ATOM   2796 C CD1 . TYR B 1 206 ? 16.723  19.146 8.730   1.00 49.04  ? 202 TYR B CD1 1 
ATOM   2797 C CD2 . TYR B 1 206 ? 17.481  21.211 9.523   1.00 51.01  ? 202 TYR B CD2 1 
ATOM   2798 C CE1 . TYR B 1 206 ? 17.900  18.596 9.048   1.00 50.28  ? 202 TYR B CE1 1 
ATOM   2799 C CE2 . TYR B 1 206 ? 18.661  20.672 9.837   1.00 51.84  ? 202 TYR B CE2 1 
ATOM   2800 C CZ  . TYR B 1 206 ? 18.874  19.364 9.604   1.00 51.22  ? 202 TYR B CZ  1 
ATOM   2801 O OH  . TYR B 1 206 ? 20.068  18.821 9.924   1.00 50.97  ? 202 TYR B OH  1 
ATOM   2802 N N   . ARG B 1 207 ? 16.969  22.632 7.320   1.00 55.07  ? 203 ARG B N   1 
ATOM   2803 C CA  . ARG B 1 207 ? 17.283  23.970 6.885   1.00 57.21  ? 203 ARG B CA  1 
ATOM   2804 C C   . ARG B 1 207 ? 18.249  24.458 7.912   1.00 58.47  ? 203 ARG B C   1 
ATOM   2805 O O   . ARG B 1 207 ? 17.921  24.411 9.076   1.00 58.86  ? 203 ARG B O   1 
ATOM   2806 C CB  . ARG B 1 207 ? 16.048  24.825 6.975   1.00 57.77  ? 203 ARG B CB  1 
ATOM   2807 C CG  . ARG B 1 207 ? 15.892  25.766 5.859   1.00 59.99  ? 203 ARG B CG  1 
ATOM   2808 C CD  . ARG B 1 207 ? 14.490  26.219 5.833   1.00 62.42  ? 203 ARG B CD  1 
ATOM   2809 N NE  . ARG B 1 207 ? 14.073  26.585 4.508   1.00 63.21  ? 203 ARG B NE  1 
ATOM   2810 C CZ  . ARG B 1 207 ? 13.205  27.540 4.249   1.00 63.94  ? 203 ARG B CZ  1 
ATOM   2811 N NH1 . ARG B 1 207 ? 12.668  28.238 5.223   1.00 63.10  ? 203 ARG B NH1 1 
ATOM   2812 N NH2 . ARG B 1 207 ? 12.889  27.796 3.005   1.00 66.26  ? 203 ARG B NH2 1 
ATOM   2813 N N   . SER C 2 1   ? -8.091  15.939 -16.013 1.00 32.44  ? 1   SER D N   1 
ATOM   2814 C CA  . SER C 2 1   ? -6.643  15.609 -16.181 1.00 32.51  ? 1   SER D CA  1 
ATOM   2815 C C   . SER C 2 1   ? -6.279  14.346 -15.401 1.00 32.03  ? 1   SER D C   1 
ATOM   2816 O O   . SER C 2 1   ? -7.083  13.816 -14.641 1.00 32.23  ? 1   SER D O   1 
ATOM   2817 C CB  . SER C 2 1   ? -5.739  16.801 -15.787 1.00 33.44  ? 1   SER D CB  1 
ATOM   2818 O OG  . SER C 2 1   ? -5.996  17.245 -14.464 1.00 36.50  ? 1   SER D OG  1 
ATOM   2819 N N   . ASN C 2 2   ? -5.089  13.828 -15.646 1.00 31.69  ? 2   ASN D N   1 
ATOM   2820 C CA  . ASN C 2 2   ? -4.645  12.621 -14.986 1.00 31.61  ? 2   ASN D CA  1 
ATOM   2821 C C   . ASN C 2 2   ? -5.539  11.370 -15.209 1.00 31.76  ? 2   ASN D C   1 
ATOM   2822 O O   . ASN C 2 2   ? -5.798  10.618 -14.254 1.00 32.99  ? 2   ASN D O   1 
ATOM   2823 C CB  . ASN C 2 2   ? -4.428  12.932 -13.503 1.00 31.38  ? 2   ASN D CB  1 
ATOM   2824 C CG  . ASN C 2 2   ? -3.245  13.820 -13.297 1.00 29.90  ? 2   ASN D CG  1 
ATOM   2825 O OD1 . ASN C 2 2   ? -2.213  13.577 -13.883 1.00 25.60  ? 2   ASN D OD1 1 
ATOM   2826 N ND2 . ASN C 2 2   ? -3.374  14.841 -12.452 1.00 29.19  ? 2   ASN D ND2 1 
ATOM   2827 N N   . GLU C 2 3   ? -5.948  11.126 -16.465 1.00 30.51  ? 3   GLU D N   1 
ATOM   2828 C CA  . GLU C 2 3   ? -6.822  10.007 -16.816 1.00 30.19  ? 3   GLU D CA  1 
ATOM   2829 C C   . GLU C 2 3   ? -6.056  8.695  -16.918 1.00 29.59  ? 3   GLU D C   1 
ATOM   2830 O O   . GLU C 2 3   ? -6.615  7.654  -17.238 1.00 30.76  ? 3   GLU D O   1 
ATOM   2831 C CB  . GLU C 2 3   ? -7.557  10.258 -18.150 1.00 30.10  ? 3   GLU D CB  1 
ATOM   2832 C CG  . GLU C 2 3   ? -8.502  11.448 -18.141 1.00 31.37  ? 3   GLU D CG  1 
ATOM   2833 C CD  . GLU C 2 3   ? -7.783  12.820 -18.164 1.00 32.31  ? 3   GLU D CD  1 
ATOM   2834 O OE1 . GLU C 2 3   ? -6.561  12.901 -18.457 1.00 33.01  ? 3   GLU D OE1 1 
ATOM   2835 O OE2 . GLU C 2 3   ? -8.458  13.834 -17.904 1.00 35.16  ? 3   GLU D OE2 1 
ATOM   2836 N N   . TRP C 2 4   ? -4.767  8.753  -16.690 1.00 29.60  ? 4   TRP D N   1 
ATOM   2837 C CA  . TRP C 2 4   ? -3.921  7.563  -16.608 1.00 30.09  ? 4   TRP D CA  1 
ATOM   2838 C C   . TRP C 2 4   ? -3.991  6.828  -15.243 1.00 30.18  ? 4   TRP D C   1 
ATOM   2839 O O   . TRP C 2 4   ? -3.402  5.750  -15.112 1.00 30.71  ? 4   TRP D O   1 
ATOM   2840 C CB  . TRP C 2 4   ? -2.464  7.947  -16.897 1.00 29.69  ? 4   TRP D CB  1 
ATOM   2841 C CG  . TRP C 2 4   ? -1.929  8.954  -15.890 1.00 30.32  ? 4   TRP D CG  1 
ATOM   2842 C CD1 . TRP C 2 4   ? -1.996  10.303 -15.997 1.00 30.82  ? 4   TRP D CD1 1 
ATOM   2843 C CD2 . TRP C 2 4   ? -1.301  8.689  -14.626 1.00 30.46  ? 4   TRP D CD2 1 
ATOM   2844 N NE1 . TRP C 2 4   ? -1.422  10.898 -14.900 1.00 30.09  ? 4   TRP D NE1 1 
ATOM   2845 C CE2 . TRP C 2 4   ? -0.992  9.938  -14.042 1.00 30.15  ? 4   TRP D CE2 1 
ATOM   2846 C CE3 . TRP C 2 4   ? -0.947  7.528  -13.939 1.00 28.81  ? 4   TRP D CE3 1 
ATOM   2847 C CZ2 . TRP C 2 4   ? -0.375  10.055 -12.787 1.00 30.63  ? 4   TRP D CZ2 1 
ATOM   2848 C CZ3 . TRP C 2 4   ? -0.306  7.642  -12.728 1.00 27.22  ? 4   TRP D CZ3 1 
ATOM   2849 C CH2 . TRP C 2 4   ? -0.027  8.900  -12.158 1.00 29.99  ? 4   TRP D CH2 1 
ATOM   2850 N N   . ILE C 2 5   ? -4.656  7.422  -14.246 1.00 29.61  ? 5   ILE D N   1 
ATOM   2851 C CA  . ILE C 2 5   ? -4.827  6.792  -12.938 1.00 28.87  ? 5   ILE D CA  1 
ATOM   2852 C C   . ILE C 2 5   ? -6.117  5.981  -12.972 1.00 28.74  ? 5   ILE D C   1 
ATOM   2853 O O   . ILE C 2 5   ? -7.214  6.536  -13.044 1.00 26.65  ? 5   ILE D O   1 
ATOM   2854 C CB  . ILE C 2 5   ? -4.960  7.809  -11.752 1.00 29.41  ? 5   ILE D CB  1 
ATOM   2855 C CG1 . ILE C 2 5   ? -3.799  8.795  -11.699 1.00 28.05  ? 5   ILE D CG1 1 
ATOM   2856 C CG2 . ILE C 2 5   ? -5.041  7.041  -10.405 1.00 29.47  ? 5   ILE D CG2 1 
ATOM   2857 C CD1 . ILE C 2 5   ? -3.960  9.846  -10.674 1.00 27.57  ? 5   ILE D CD1 1 
ATOM   2858 N N   . GLN C 2 6   ? -6.001  4.670  -12.875 1.00 28.83  ? 6   GLN D N   1 
ATOM   2859 C CA  . GLN C 2 6   ? -7.166  3.818  -13.116 1.00 30.29  ? 6   GLN D CA  1 
ATOM   2860 C C   . GLN C 2 6   ? -7.984  3.620  -11.866 1.00 30.35  ? 6   GLN D C   1 
ATOM   2861 O O   . GLN C 2 6   ? -7.420  3.359  -10.805 1.00 30.09  ? 6   GLN D O   1 
ATOM   2862 C CB  . GLN C 2 6   ? -6.708  2.454  -13.633 1.00 30.91  ? 6   GLN D CB  1 
ATOM   2863 C CG  . GLN C 2 6   ? -5.752  2.607  -14.790 1.00 34.17  ? 6   GLN D CG  1 
ATOM   2864 C CD  . GLN C 2 6   ? -4.336  2.294  -14.402 1.00 38.14  ? 6   GLN D CD  1 
ATOM   2865 O OE1 . GLN C 2 6   ? -3.761  2.804  -13.369 1.00 34.92  ? 6   GLN D OE1 1 
ATOM   2866 N NE2 . GLN C 2 6   ? -3.725  1.450  -15.238 1.00 39.37  ? 6   GLN D NE2 1 
ATOM   2867 N N   . PRO C 2 7   ? -9.311  3.716  -11.983 1.00 31.56  ? 7   PRO D N   1 
ATOM   2868 C CA  . PRO C 2 7   ? -10.119 3.344  -10.838 1.00 32.94  ? 7   PRO D CA  1 
ATOM   2869 C C   . PRO C 2 7   ? -9.840  1.906  -10.420 1.00 34.57  ? 7   PRO D C   1 
ATOM   2870 O O   . PRO C 2 7   ? -9.711  1.058  -11.275 1.00 33.88  ? 7   PRO D O   1 
ATOM   2871 C CB  . PRO C 2 7   ? -11.537 3.485  -11.360 1.00 32.35  ? 7   PRO D CB  1 
ATOM   2872 C CG  . PRO C 2 7   ? -11.406 4.482  -12.476 1.00 32.27  ? 7   PRO D CG  1 
ATOM   2873 C CD  . PRO C 2 7   ? -10.143 4.127  -13.123 1.00 31.04  ? 7   PRO D CD  1 
ATOM   2874 N N   . ARG C 2 8   ? -9.680  1.669  -9.125  1.00 37.26  ? 8   ARG D N   1 
ATOM   2875 C CA  . ARG C 2 8   ? -9.772  0.313  -8.592  1.00 40.07  ? 8   ARG D CA  1 
ATOM   2876 C C   . ARG C 2 8   ? -11.213 -0.043 -8.477  1.00 42.23  ? 8   ARG D C   1 
ATOM   2877 O O   . ARG C 2 8   ? -12.073 0.778  -8.101  1.00 42.82  ? 8   ARG D O   1 
ATOM   2878 C CB  . ARG C 2 8   ? -9.190  0.137  -7.201  1.00 39.87  ? 8   ARG D CB  1 
ATOM   2879 C CG  . ARG C 2 8   ? -7.736  0.006  -7.165  1.00 42.89  ? 8   ARG D CG  1 
ATOM   2880 C CD  . ARG C 2 8   ? -7.106  1.401  -7.060  1.00 46.70  ? 8   ARG D CD  1 
ATOM   2881 N NE  . ARG C 2 8   ? -5.736  1.422  -7.573  1.00 48.10  ? 8   ARG D NE  1 
ATOM   2882 C CZ  . ARG C 2 8   ? -4.639  1.509  -6.830  1.00 47.14  ? 8   ARG D CZ  1 
ATOM   2883 N NH1 . ARG C 2 8   ? -4.725  1.587  -5.504  1.00 42.81  ? 8   ARG D NH1 1 
ATOM   2884 N NH2 . ARG C 2 8   ? -3.441  1.529  -7.445  1.00 49.31  ? 8   ARG D NH2 1 
ATOM   2885 N N   . LEU C 2 9   ? -11.468 -1.313 -8.680  1.00 45.01  ? 9   LEU D N   1 
ATOM   2886 C CA  . LEU C 2 9   ? -12.794 -1.847 -8.806  1.00 47.61  ? 9   LEU D CA  1 
ATOM   2887 C C   . LEU C 2 9   ? -13.133 -2.648 -7.570  1.00 48.55  ? 9   LEU D C   1 
ATOM   2888 O O   . LEU C 2 9   ? -12.267 -3.329 -7.061  1.00 47.96  ? 9   LEU D O   1 
ATOM   2889 C CB  . LEU C 2 9   ? -12.732 -2.784 -9.957  1.00 48.06  ? 9   LEU D CB  1 
ATOM   2890 C CG  . LEU C 2 9   ? -13.810 -2.839 -10.973 1.00 48.98  ? 9   LEU D CG  1 
ATOM   2891 C CD1 . LEU C 2 9   ? -13.316 -1.993 -12.045 1.00 48.59  ? 9   LEU D CD1 1 
ATOM   2892 C CD2 . LEU C 2 9   ? -13.852 -4.289 -11.392 1.00 50.60  ? 9   LEU D CD2 1 
ATOM   2893 N N   . PRO C 2 10  ? -14.394 -2.594 -7.118  1.00 50.35  ? 10  PRO D N   1 
ATOM   2894 C CA  . PRO C 2 10  ? -14.785 -3.144 -5.801  1.00 50.63  ? 10  PRO D CA  1 
ATOM   2895 C C   . PRO C 2 10  ? -14.466 -4.632 -5.619  1.00 52.35  ? 10  PRO D C   1 
ATOM   2896 O O   . PRO C 2 10  ? -14.680 -5.458 -6.545  1.00 51.89  ? 10  PRO D O   1 
ATOM   2897 C CB  . PRO C 2 10  ? -16.294 -2.864 -5.716  1.00 51.26  ? 10  PRO D CB  1 
ATOM   2898 C CG  . PRO C 2 10  ? -16.518 -1.733 -6.658  1.00 51.34  ? 10  PRO D CG  1 
ATOM   2899 C CD  . PRO C 2 10  ? -15.558 -1.985 -7.792  1.00 50.56  ? 10  PRO D CD  1 
ATOM   2900 N N   . GLN C 2 11  ? -14.023 -4.941 -4.390  1.00 53.68  ? 11  GLN D N   1 
ATOM   2901 C CA  . GLN C 2 11  ? -12.910 -5.868 -4.141  1.00 54.92  ? 11  GLN D CA  1 
ATOM   2902 C C   . GLN C 2 11  ? -13.217 -7.070 -3.193  1.00 55.30  ? 11  GLN D C   1 
ATOM   2903 O O   . GLN C 2 11  ? -13.825 -6.930 -2.108  1.00 55.08  ? 11  GLN D O   1 
ATOM   2904 C CB  . GLN C 2 11  ? -11.744 -5.012 -3.594  1.00 55.41  ? 11  GLN D CB  1 
ATOM   2905 C CG  . GLN C 2 11  ? -11.038 -4.175 -4.663  1.00 56.69  ? 11  GLN D CG  1 
ATOM   2906 C CD  . GLN C 2 11  ? -10.797 -2.696 -4.300  1.00 58.52  ? 11  GLN D CD  1 
ATOM   2907 O OE1 . GLN C 2 11  ? -11.750 -1.904 -4.234  1.00 61.78  ? 11  GLN D OE1 1 
ATOM   2908 N NE2 . GLN C 2 11  ? -9.541  -2.334 -4.021  1.00 57.58  ? 11  GLN D NE2 1 
ATOM   2909 N N   . SER D 2 1   ? 8.262   24.840 60.502  1.00 35.55  ? 1   SER P N   1 
ATOM   2910 C CA  . SER D 2 1   ? 9.708   25.244 60.401  1.00 34.32  ? 1   SER P CA  1 
ATOM   2911 C C   . SER D 2 1   ? 10.805  24.203 60.147  1.00 32.74  ? 1   SER P C   1 
ATOM   2912 O O   . SER D 2 1   ? 11.843  24.581 59.649  1.00 31.97  ? 1   SER P O   1 
ATOM   2913 C CB  . SER D 2 1   ? 10.100  26.030 61.593  1.00 34.66  ? 1   SER P CB  1 
ATOM   2914 O OG  . SER D 2 1   ? 11.095  26.957 61.216  1.00 38.10  ? 1   SER P OG  1 
ATOM   2915 N N   . ASN D 2 2   ? 10.617  22.933 60.489  1.00 31.60  ? 2   ASN P N   1 
ATOM   2916 C CA  . ASN D 2 2   ? 11.471  21.886 59.890  1.00 31.46  ? 2   ASN P CA  1 
ATOM   2917 C C   . ASN D 2 2   ? 12.988  21.984 60.111  1.00 31.49  ? 2   ASN P C   1 
ATOM   2918 O O   . ASN D 2 2   ? 13.776  21.710 59.187  1.00 32.13  ? 2   ASN P O   1 
ATOM   2919 C CB  . ASN D 2 2   ? 11.176  21.820 58.396  1.00 30.79  ? 2   ASN P CB  1 
ATOM   2920 C CG  . ASN D 2 2   ? 9.812   21.360 58.148  1.00 29.79  ? 2   ASN P CG  1 
ATOM   2921 O OD1 . ASN D 2 2   ? 9.416   20.369 58.732  1.00 26.86  ? 2   ASN P OD1 1 
ATOM   2922 N ND2 . ASN D 2 2   ? 9.042   22.088 57.325  1.00 28.88  ? 2   ASN P ND2 1 
ATOM   2923 N N   . GLU D 2 3   ? 13.369  22.320 61.347  1.00 31.07  ? 3   GLU P N   1 
ATOM   2924 C CA  . GLU D 2 3   ? 14.749  22.502 61.770  1.00 30.58  ? 3   GLU P CA  1 
ATOM   2925 C C   . GLU D 2 3   ? 15.566  21.217 61.852  1.00 30.07  ? 3   GLU P C   1 
ATOM   2926 O O   . GLU D 2 3   ? 16.751  21.231 62.158  1.00 30.27  ? 3   GLU P O   1 
ATOM   2927 C CB  . GLU D 2 3   ? 14.781  23.225 63.126  1.00 30.46  ? 3   GLU P CB  1 
ATOM   2928 C CG  . GLU D 2 3   ? 14.444  24.728 63.029  1.00 31.07  ? 3   GLU P CG  1 
ATOM   2929 C CD  . GLU D 2 3   ? 12.927  25.041 63.071  1.00 30.70  ? 3   GLU P CD  1 
ATOM   2930 O OE1 . GLU D 2 3   ? 12.093  24.142 63.245  1.00 26.20  ? 3   GLU P OE1 1 
ATOM   2931 O OE2 . GLU D 2 3   ? 12.583  26.227 62.942  1.00 33.09  ? 3   GLU P OE2 1 
ATOM   2932 N N   . TRP D 2 4   ? 14.924  20.115 61.555  1.00 30.63  ? 4   TRP P N   1 
ATOM   2933 C CA  . TRP D 2 4   ? 15.571  18.812 61.479  1.00 31.49  ? 4   TRP P CA  1 
ATOM   2934 C C   . TRP D 2 4   ? 16.244  18.556 60.132  1.00 31.52  ? 4   TRP P C   1 
ATOM   2935 O O   . TRP D 2 4   ? 16.887  17.519 59.980  1.00 30.63  ? 4   TRP P O   1 
ATOM   2936 C CB  . TRP D 2 4   ? 14.556  17.708 61.735  1.00 31.59  ? 4   TRP P CB  1 
ATOM   2937 C CG  . TRP D 2 4   ? 13.386  17.764 60.784  1.00 32.91  ? 4   TRP P CG  1 
ATOM   2938 C CD1 . TRP D 2 4   ? 12.247  18.498 60.940  1.00 33.63  ? 4   TRP P CD1 1 
ATOM   2939 C CD2 . TRP D 2 4   ? 13.247  17.070 59.536  1.00 33.72  ? 4   TRP P CD2 1 
ATOM   2940 N NE1 . TRP D 2 4   ? 11.404  18.292 59.880  1.00 33.50  ? 4   TRP P NE1 1 
ATOM   2941 C CE2 . TRP D 2 4   ? 11.984  17.430 59.000  1.00 33.12  ? 4   TRP P CE2 1 
ATOM   2942 C CE3 . TRP D 2 4   ? 14.054  16.161 58.830  1.00 31.47  ? 4   TRP P CE3 1 
ATOM   2943 C CZ2 . TRP D 2 4   ? 11.509  16.932 57.780  1.00 32.64  ? 4   TRP P CZ2 1 
ATOM   2944 C CZ3 . TRP D 2 4   ? 13.592  15.652 57.643  1.00 31.48  ? 4   TRP P CZ3 1 
ATOM   2945 C CH2 . TRP D 2 4   ? 12.320  16.054 57.108  1.00 33.36  ? 4   TRP P CH2 1 
ATOM   2946 N N   . ILE D 2 5   ? 16.100  19.482 59.176  1.00 31.33  ? 5   ILE P N   1 
ATOM   2947 C CA  . ILE D 2 5   ? 16.650  19.286 57.831  1.00 31.56  ? 5   ILE P CA  1 
ATOM   2948 C C   . ILE D 2 5   ? 18.007  19.959 57.820  1.00 31.50  ? 5   ILE P C   1 
ATOM   2949 O O   . ILE D 2 5   ? 18.132  21.188 57.807  1.00 29.67  ? 5   ILE P O   1 
ATOM   2950 C CB  . ILE D 2 5   ? 15.754  19.917 56.705  1.00 31.90  ? 5   ILE P CB  1 
ATOM   2951 C CG1 . ILE D 2 5   ? 14.363  19.313 56.691  1.00 31.98  ? 5   ILE P CG1 1 
ATOM   2952 C CG2 . ILE D 2 5   ? 16.353  19.691 55.315  1.00 32.34  ? 5   ILE P CG2 1 
ATOM   2953 C CD1 . ILE D 2 5   ? 13.451  19.987 55.695  1.00 31.36  ? 5   ILE P CD1 1 
ATOM   2954 N N   . GLN D 2 6   ? 19.042  19.154 57.836  1.00 31.90  ? 6   GLN P N   1 
ATOM   2955 C CA  . GLN D 2 6   ? 20.368  19.701 58.055  1.00 32.95  ? 6   GLN P CA  1 
ATOM   2956 C C   . GLN D 2 6   ? 20.947  20.265 56.783  1.00 32.77  ? 6   GLN P C   1 
ATOM   2957 O O   . GLN D 2 6   ? 20.902  19.605 55.738  1.00 33.00  ? 6   GLN P O   1 
ATOM   2958 C CB  . GLN D 2 6   ? 21.271  18.596 58.605  1.00 33.52  ? 6   GLN P CB  1 
ATOM   2959 C CG  . GLN D 2 6   ? 20.721  18.047 59.922  1.00 36.37  ? 6   GLN P CG  1 
ATOM   2960 C CD  . GLN D 2 6   ? 20.958  16.560 60.053  1.00 40.92  ? 6   GLN P CD  1 
ATOM   2961 O OE1 . GLN D 2 6   ? 22.115  16.112 60.117  1.00 45.57  ? 6   GLN P OE1 1 
ATOM   2962 N NE2 . GLN D 2 6   ? 19.874  15.784 60.105  1.00 42.24  ? 6   GLN P NE2 1 
ATOM   2963 N N   . PRO D 2 7   ? 21.487  21.462 56.846  1.00 33.78  ? 7   PRO P N   1 
ATOM   2964 C CA  . PRO D 2 7   ? 22.321  21.957 55.759  1.00 35.14  ? 7   PRO P CA  1 
ATOM   2965 C C   . PRO D 2 7   ? 23.480  21.059 55.416  1.00 35.69  ? 7   PRO P C   1 
ATOM   2966 O O   . PRO D 2 7   ? 24.019  20.425 56.259  1.00 34.95  ? 7   PRO P O   1 
ATOM   2967 C CB  . PRO D 2 7   ? 22.801  23.298 56.265  1.00 33.94  ? 7   PRO P CB  1 
ATOM   2968 C CG  . PRO D 2 7   ? 21.924  23.645 57.333  1.00 33.13  ? 7   PRO P CG  1 
ATOM   2969 C CD  . PRO D 2 7   ? 21.445  22.416 57.952  1.00 33.49  ? 7   PRO P CD  1 
ATOM   2970 N N   . ARG D 2 8   ? 23.808  21.000 54.145  1.00 20.00  ? 8   ARG P N   1 
ATOM   2971 C CA  . ARG D 2 8   ? 25.148  20.731 53.670  1.00 20.00  ? 8   ARG P CA  1 
ATOM   2972 C C   . ARG D 2 8   ? 25.941  21.955 53.294  1.00 20.00  ? 8   ARG P C   1 
ATOM   2973 O O   . ARG D 2 8   ? 25.604  22.684 52.366  1.00 42.29  ? 8   ARG P O   1 
ATOM   2974 C CB  . ARG D 2 8   ? 25.090  19.830 52.479  1.00 20.00  ? 8   ARG P CB  1 
ATOM   2975 C CG  . ARG D 2 8   ? 23.756  19.339 52.214  1.00 20.00  ? 8   ARG P CG  1 
ATOM   2976 C CD  . ARG D 2 8   ? 23.825  17.914 52.203  1.00 20.00  ? 8   ARG P CD  1 
ATOM   2977 N NE  . ARG D 2 8   ? 22.557  17.253 51.914  1.00 20.00  ? 8   ARG P NE  1 
ATOM   2978 C CZ  . ARG D 2 8   ? 21.771  17.492 50.875  1.00 20.00  ? 8   ARG P CZ  1 
ATOM   2979 N NH1 . ARG D 2 8   ? 22.043  18.452 49.994  1.00 20.00  ? 8   ARG P NH1 1 
ATOM   2980 N NH2 . ARG D 2 8   ? 20.700  16.762 50.740  1.00 20.00  ? 8   ARG P NH2 1 
ATOM   2981 N N   . LEU D 2 9   ? 27.018  22.168 54.028  1.00 45.06  ? 9   LEU P N   1 
ATOM   2982 C CA  . LEU D 2 9   ? 28.339  21.732 53.632  1.00 45.60  ? 9   LEU P CA  1 
ATOM   2983 C C   . LEU D 2 9   ? 28.262  20.641 52.595  1.00 46.22  ? 9   LEU P C   1 
ATOM   2984 O O   . LEU D 2 9   ? 29.048  20.607 51.687  1.00 47.27  ? 9   LEU P O   1 
ATOM   2985 C CB  . LEU D 2 9   ? 29.130  21.255 54.839  1.00 45.95  ? 9   LEU P CB  1 
ATOM   2986 C CG  . LEU D 2 9   ? 28.757  21.769 56.213  1.00 46.46  ? 9   LEU P CG  1 
ATOM   2987 C CD1 . LEU D 2 9   ? 29.545  21.109 57.250  1.00 47.77  ? 9   LEU P CD1 1 
ATOM   2988 C CD2 . LEU D 2 9   ? 28.891  23.211 56.306  1.00 47.75  ? 9   LEU P CD2 1 
HETATM 2989 S S   . SO4 E 3 .   ? 17.275  15.979 25.039  1.00 103.80 ? 404 SO4 A S   1 
HETATM 2990 O O1  . SO4 E 3 .   ? 18.430  15.432 24.320  1.00 104.08 ? 404 SO4 A O1  1 
HETATM 2991 O O2  . SO4 E 3 .   ? 17.160  15.329 26.330  1.00 103.58 ? 404 SO4 A O2  1 
HETATM 2992 O O3  . SO4 E 3 .   ? 16.034  15.780 24.280  1.00 104.07 ? 404 SO4 A O3  1 
HETATM 2993 O O4  . SO4 E 3 .   ? 17.469  17.406 25.251  1.00 104.58 ? 404 SO4 A O4  1 
HETATM 2994 S S   . SO4 F 3 .   ? 4.763   14.887 22.669  1.00 86.06  ? 405 SO4 A S   1 
HETATM 2995 O O1  . SO4 F 3 .   ? 4.016   13.631 22.820  1.00 82.81  ? 405 SO4 A O1  1 
HETATM 2996 O O2  . SO4 F 3 .   ? 5.388   15.237 23.949  1.00 85.85  ? 405 SO4 A O2  1 
HETATM 2997 O O3  . SO4 F 3 .   ? 3.816   15.949 22.307  1.00 86.34  ? 405 SO4 A O3  1 
HETATM 2998 O O4  . SO4 F 3 .   ? 5.790   14.830 21.630  1.00 83.85  ? 405 SO4 A O4  1 
HETATM 2999 S S   . SO4 G 3 .   ? 19.089  6.144  55.550  1.00 60.07  ? 406 SO4 A S   1 
HETATM 3000 O O1  . SO4 G 3 .   ? 19.346  6.451  54.207  1.00 59.92  ? 406 SO4 A O1  1 
HETATM 3001 O O2  . SO4 G 3 .   ? 20.255  5.535  56.011  1.00 62.37  ? 406 SO4 A O2  1 
HETATM 3002 O O3  . SO4 G 3 .   ? 18.087  5.169  55.733  1.00 57.55  ? 406 SO4 A O3  1 
HETATM 3003 O O4  . SO4 G 3 .   ? 18.879  7.332  56.274  1.00 57.19  ? 406 SO4 A O4  1 
HETATM 3004 S S   . SO4 H 3 .   ? -5.788  5.386  25.291  1.00 75.33  ? 408 SO4 A S   1 
HETATM 3005 O O1  . SO4 H 3 .   ? -7.066  5.719  24.639  1.00 75.08  ? 408 SO4 A O1  1 
HETATM 3006 O O2  . SO4 H 3 .   ? -5.105  4.333  24.537  1.00 74.52  ? 408 SO4 A O2  1 
HETATM 3007 O O3  . SO4 H 3 .   ? -6.045  4.875  26.638  1.00 75.38  ? 408 SO4 A O3  1 
HETATM 3008 O O4  . SO4 H 3 .   ? -4.958  6.596  25.360  1.00 73.51  ? 408 SO4 A O4  1 
HETATM 3009 S S   . SO4 I 3 .   ? 13.309  26.848 9.209   1.00 78.36  ? 401 SO4 B S   1 
HETATM 3010 O O1  . SO4 I 3 .   ? 13.409  25.537 8.583   1.00 80.21  ? 401 SO4 B O1  1 
HETATM 3011 O O2  . SO4 I 3 .   ? 13.927  26.728 10.528  1.00 79.31  ? 401 SO4 B O2  1 
HETATM 3012 O O3  . SO4 I 3 .   ? 11.906  27.252 9.339   1.00 77.40  ? 401 SO4 B O3  1 
HETATM 3013 O O4  . SO4 I 3 .   ? 14.042  27.807 8.402   1.00 78.29  ? 401 SO4 B O4  1 
HETATM 3014 S S   . SO4 J 3 .   ? 18.308  19.128 19.698  1.00 77.14  ? 402 SO4 B S   1 
HETATM 3015 O O1  . SO4 J 3 .   ? 18.463  19.405 18.270  1.00 76.45  ? 402 SO4 B O1  1 
HETATM 3016 O O2  . SO4 J 3 .   ? 19.135  17.976 20.065  1.00 76.26  ? 402 SO4 B O2  1 
HETATM 3017 O O3  . SO4 J 3 .   ? 16.912  18.849 20.023  1.00 75.59  ? 402 SO4 B O3  1 
HETATM 3018 O O4  . SO4 J 3 .   ? 18.740  20.325 20.427  1.00 77.06  ? 402 SO4 B O4  1 
HETATM 3019 S S   . SO4 K 3 .   ? 12.540  5.736  2.014   1.00 86.54  ? 403 SO4 B S   1 
HETATM 3020 O O1  . SO4 K 3 .   ? 11.911  4.413  1.931   1.00 86.29  ? 403 SO4 B O1  1 
HETATM 3021 O O2  . SO4 K 3 .   ? 13.967  5.616  2.333   1.00 85.46  ? 403 SO4 B O2  1 
HETATM 3022 O O3  . SO4 K 3 .   ? 11.815  6.450  3.069   1.00 86.36  ? 403 SO4 B O3  1 
HETATM 3023 O O4  . SO4 K 3 .   ? 12.481  6.481  0.748   1.00 85.72  ? 403 SO4 B O4  1 
HETATM 3024 S S   . SO4 L 3 .   ? -19.048 7.647  0.958   1.00 94.93  ? 409 SO4 B S   1 
HETATM 3025 O O1  . SO4 L 3 .   ? -18.650 7.063  -0.323  1.00 95.32  ? 409 SO4 B O1  1 
HETATM 3026 O O2  . SO4 L 3 .   ? -19.005 6.627  2.010   1.00 93.61  ? 409 SO4 B O2  1 
HETATM 3027 O O3  . SO4 L 3 .   ? -20.413 8.156  0.814   1.00 95.01  ? 409 SO4 B O3  1 
HETATM 3028 O O4  . SO4 L 3 .   ? -18.153 8.762  1.288   1.00 94.53  ? 409 SO4 B O4  1 
HETATM 3029 S S   . SO4 M 3 .   ? -19.867 10.394 -17.646 1.00 65.14  ? 410 SO4 B S   1 
HETATM 3030 O O1  . SO4 M 3 .   ? -21.027 9.881  -18.361 1.00 63.42  ? 410 SO4 B O1  1 
HETATM 3031 O O2  . SO4 M 3 .   ? -18.661 9.677  -18.056 1.00 63.30  ? 410 SO4 B O2  1 
HETATM 3032 O O3  . SO4 M 3 .   ? -20.110 10.241 -16.204 1.00 65.41  ? 410 SO4 B O3  1 
HETATM 3033 O O4  . SO4 M 3 .   ? -19.705 11.824 -17.928 1.00 65.55  ? 410 SO4 B O4  1 
HETATM 3034 S S   . SO4 N 3 .   ? -9.484  10.440 11.383  1.00 82.81  ? 411 SO4 B S   1 
HETATM 3035 O O1  . SO4 N 3 .   ? -8.378  9.596  10.957  1.00 81.73  ? 411 SO4 B O1  1 
HETATM 3036 O O2  . SO4 N 3 .   ? -9.436  10.659 12.821  1.00 84.11  ? 411 SO4 B O2  1 
HETATM 3037 O O3  . SO4 N 3 .   ? -10.761 9.790  11.098  1.00 84.44  ? 411 SO4 B O3  1 
HETATM 3038 O O4  . SO4 N 3 .   ? -9.400  11.713 10.670  1.00 83.55  ? 411 SO4 B O4  1 
HETATM 3039 S S   . SO4 O 3 .   ? 5.275   -1.828 -10.528 1.00 61.29  ? 412 SO4 B S   1 
HETATM 3040 O O1  . SO4 O 3 .   ? 4.186   -1.032 -11.138 1.00 58.78  ? 412 SO4 B O1  1 
HETATM 3041 O O2  . SO4 O 3 .   ? 5.292   -3.190 -11.062 1.00 64.52  ? 412 SO4 B O2  1 
HETATM 3042 O O3  . SO4 O 3 .   ? 5.096   -1.964 -9.081  1.00 60.41  ? 412 SO4 B O3  1 
HETATM 3043 O O4  . SO4 O 3 .   ? 6.586   -1.281 -10.870 1.00 60.79  ? 412 SO4 B O4  1 
HETATM 3044 S S   . SO4 P 3 .   ? 0.164   1.380  -15.711 1.00 80.18  ? 407 SO4 D S   1 
HETATM 3045 O O1  . SO4 P 3 .   ? -0.280  1.714  -17.063 1.00 82.13  ? 407 SO4 D O1  1 
HETATM 3046 O O2  . SO4 P 3 .   ? 0.194   -0.077 -15.595 1.00 80.81  ? 407 SO4 D O2  1 
HETATM 3047 O O3  . SO4 P 3 .   ? -0.801  1.964  -14.775 1.00 80.30  ? 407 SO4 D O3  1 
HETATM 3048 O O4  . SO4 P 3 .   ? 1.498   1.895  -15.442 1.00 78.64  ? 407 SO4 D O4  1 
HETATM 3049 O O   . HOH Q 4 .   ? 21.580  18.399 30.819  1.00 37.17  ? 409 HOH A O   1 
HETATM 3050 O O   . HOH Q 4 .   ? 19.316  7.827  44.324  1.00 43.52  ? 410 HOH A O   1 
HETATM 3051 O O   . HOH Q 4 .   ? 4.727   1.747  36.203  1.00 38.54  ? 411 HOH A O   1 
HETATM 3052 O O   . HOH Q 4 .   ? 0.767   3.821  24.511  1.00 47.43  ? 412 HOH A O   1 
HETATM 3053 O O   . HOH Q 4 .   ? 7.341   3.843  38.660  1.00 39.37  ? 413 HOH A O   1 
HETATM 3054 O O   . HOH Q 4 .   ? 29.885  29.162 40.453  1.00 74.13  ? 414 HOH A O   1 
HETATM 3055 O O   . HOH Q 4 .   ? -3.595  26.623 52.130  1.00 36.80  ? 415 HOH A O   1 
HETATM 3056 O O   . HOH Q 4 .   ? 3.922   28.800 44.123  1.00 53.59  ? 416 HOH A O   1 
HETATM 3057 O O   . HOH Q 4 .   ? 0.692   10.221 49.798  1.00 58.60  ? 417 HOH A O   1 
HETATM 3058 O O   . HOH Q 4 .   ? 24.383  15.765 32.371  1.00 45.65  ? 418 HOH A O   1 
HETATM 3059 O O   . HOH Q 4 .   ? 20.275  16.598 42.727  1.00 22.72  ? 419 HOH A O   1 
HETATM 3060 O O   . HOH Q 4 .   ? -6.597  16.944 29.888  1.00 55.86  ? 420 HOH A O   1 
HETATM 3061 O O   . HOH Q 4 .   ? 9.079   5.893  39.993  1.00 35.29  ? 421 HOH A O   1 
HETATM 3062 O O   . HOH Q 4 .   ? 22.733  15.582 29.697  1.00 45.01  ? 422 HOH A O   1 
HETATM 3063 O O   . HOH Q 4 .   ? 6.039   5.532  19.629  1.00 24.68  ? 423 HOH A O   1 
HETATM 3064 O O   . HOH Q 4 .   ? 23.131  22.481 41.823  1.00 44.41  ? 424 HOH A O   1 
HETATM 3065 O O   . HOH Q 4 .   ? 2.135   9.926  53.319  1.00 44.78  ? 425 HOH A O   1 
HETATM 3066 O O   . HOH Q 4 .   ? -4.378  22.244 33.570  1.00 46.05  ? 426 HOH A O   1 
HETATM 3067 O O   . HOH Q 4 .   ? 22.605  10.879 55.252  1.00 51.29  ? 427 HOH A O   1 
HETATM 3068 O O   . HOH Q 4 .   ? 19.971  17.223 54.565  1.00 26.70  ? 428 HOH A O   1 
HETATM 3069 O O   . HOH Q 4 .   ? 19.478  23.546 48.009  1.00 19.02  ? 429 HOH A O   1 
HETATM 3070 O O   . HOH Q 4 .   ? 16.820  13.740 32.801  1.00 30.06  ? 430 HOH A O   1 
HETATM 3071 O O   . HOH Q 4 .   ? -1.047  21.062 53.170  1.00 31.91  ? 431 HOH A O   1 
HETATM 3072 O O   . HOH Q 4 .   ? 20.922  29.945 50.714  1.00 39.07  ? 432 HOH A O   1 
HETATM 3073 O O   . HOH Q 4 .   ? 22.893  12.232 46.463  1.00 28.47  ? 433 HOH A O   1 
HETATM 3074 O O   . HOH Q 4 .   ? -0.551  26.559 47.571  1.00 56.63  ? 434 HOH A O   1 
HETATM 3075 O O   . HOH Q 4 .   ? 7.633   24.111 30.161  1.00 34.72  ? 435 HOH A O   1 
HETATM 3076 O O   . HOH Q 4 .   ? 16.563  28.126 63.507  1.00 46.00  ? 436 HOH A O   1 
HETATM 3077 O O   . HOH Q 4 .   ? 20.530  28.982 41.723  1.00 53.25  ? 437 HOH A O   1 
HETATM 3078 O O   . HOH Q 4 .   ? 15.842  33.570 62.657  1.00 57.31  ? 438 HOH A O   1 
HETATM 3079 O O   . HOH Q 4 .   ? 6.854   22.805 54.982  1.00 29.64  ? 439 HOH A O   1 
HETATM 3080 O O   . HOH Q 4 .   ? 2.124   25.452 46.067  1.00 31.69  ? 440 HOH A O   1 
HETATM 3081 O O   . HOH Q 4 .   ? 10.098  28.874 32.755  1.00 39.09  ? 441 HOH A O   1 
HETATM 3082 O O   . HOH Q 4 .   ? -8.330  2.385  42.482  1.00 54.89  ? 442 HOH A O   1 
HETATM 3083 O O   . HOH Q 4 .   ? 21.941  20.288 36.972  1.00 44.06  ? 443 HOH A O   1 
HETATM 3084 O O   . HOH Q 4 .   ? 14.756  25.311 45.644  1.00 26.98  ? 444 HOH A O   1 
HETATM 3085 O O   . HOH Q 4 .   ? 15.983  24.733 33.545  1.00 36.04  ? 445 HOH A O   1 
HETATM 3086 O O   . HOH Q 4 .   ? -3.262  21.470 38.773  1.00 45.52  ? 446 HOH A O   1 
HETATM 3087 O O   . HOH Q 4 .   ? 19.838  21.280 61.172  1.00 26.21  ? 447 HOH A O   1 
HETATM 3088 O O   . HOH Q 4 .   ? -4.798  19.419 40.714  1.00 42.52  ? 448 HOH A O   1 
HETATM 3089 O O   . HOH Q 4 .   ? 7.044   26.861 50.808  1.00 47.41  ? 449 HOH A O   1 
HETATM 3090 O O   . HOH Q 4 .   ? 2.173   2.512  36.216  1.00 43.60  ? 450 HOH A O   1 
HETATM 3091 O O   . HOH Q 4 .   ? 10.573  0.198  28.450  1.00 40.95  ? 451 HOH A O   1 
HETATM 3092 O O   . HOH Q 4 .   ? 8.686   16.403 26.180  1.00 30.36  ? 452 HOH A O   1 
HETATM 3093 O O   . HOH Q 4 .   ? 25.587  15.904 49.466  1.00 49.88  ? 453 HOH A O   1 
HETATM 3094 O O   . HOH Q 4 .   ? -4.588  1.583  43.003  1.00 45.50  ? 454 HOH A O   1 
HETATM 3095 O O   . HOH Q 4 .   ? 11.514  32.487 55.898  1.00 30.89  ? 455 HOH A O   1 
HETATM 3096 O O   . HOH Q 4 .   ? 13.873  26.287 51.994  1.00 25.79  ? 456 HOH A O   1 
HETATM 3097 O O   . HOH Q 4 .   ? -3.783  20.690 45.794  1.00 33.44  ? 457 HOH A O   1 
HETATM 3098 O O   . HOH Q 4 .   ? 12.215  9.118  25.276  1.00 30.18  ? 458 HOH A O   1 
HETATM 3099 O O   . HOH Q 4 .   ? -7.361  18.353 36.506  1.00 55.21  ? 459 HOH A O   1 
HETATM 3100 O O   . HOH Q 4 .   ? 20.136  14.637 53.093  1.00 42.64  ? 460 HOH A O   1 
HETATM 3101 O O   . HOH Q 4 .   ? 21.478  21.306 34.655  1.00 43.99  ? 461 HOH A O   1 
HETATM 3102 O O   . HOH Q 4 .   ? 8.929   4.510  51.011  1.00 39.46  ? 462 HOH A O   1 
HETATM 3103 O O   . HOH Q 4 .   ? 8.142   2.421  52.123  1.00 47.33  ? 463 HOH A O   1 
HETATM 3104 O O   . HOH Q 4 .   ? 3.058   27.379 55.372  1.00 50.61  ? 464 HOH A O   1 
HETATM 3105 O O   . HOH Q 4 .   ? 12.950  3.752  35.211  1.00 31.93  ? 465 HOH A O   1 
HETATM 3106 O O   . HOH Q 4 .   ? 17.319  3.102  29.987  1.00 45.63  ? 466 HOH A O   1 
HETATM 3107 O O   . HOH Q 4 .   ? 9.317   22.355 71.922  1.00 45.94  ? 467 HOH A O   1 
HETATM 3108 O O   . HOH Q 4 .   ? -3.573  10.907 59.859  1.00 46.74  ? 468 HOH A O   1 
HETATM 3109 O O   . HOH Q 4 .   ? 14.380  16.508 66.302  1.00 42.45  ? 469 HOH A O   1 
HETATM 3110 O O   . HOH Q 4 .   ? 8.056   8.358  49.959  1.00 27.58  ? 470 HOH A O   1 
HETATM 3111 O O   . HOH Q 4 .   ? 15.151  8.326  37.009  1.00 34.67  ? 471 HOH A O   1 
HETATM 3112 O O   . HOH Q 4 .   ? 9.208   -1.210 45.055  1.00 37.64  ? 472 HOH A O   1 
HETATM 3113 O O   . HOH Q 4 .   ? 18.065  23.126 34.426  1.00 39.11  ? 473 HOH A O   1 
HETATM 3114 O O   . HOH Q 4 .   ? 24.459  20.414 44.396  1.00 34.80  ? 474 HOH A O   1 
HETATM 3115 O O   . HOH Q 4 .   ? 18.848  5.298  46.303  1.00 44.36  ? 475 HOH A O   1 
HETATM 3116 O O   . HOH Q 4 .   ? 9.502   32.391 57.478  1.00 54.14  ? 476 HOH A O   1 
HETATM 3117 O O   . HOH Q 4 .   ? 11.708  31.430 47.375  1.00 38.43  ? 477 HOH A O   1 
HETATM 3118 O O   . HOH Q 4 .   ? 29.826  14.421 39.964  1.00 46.36  ? 478 HOH A O   1 
HETATM 3119 O O   . HOH Q 4 .   ? -10.232 1.040  38.841  1.00 51.22  ? 479 HOH A O   1 
HETATM 3120 O O   . HOH Q 4 .   ? 4.459   15.519 26.621  1.00 45.62  ? 480 HOH A O   1 
HETATM 3121 O O   . HOH Q 4 .   ? 20.291  14.110 22.829  1.00 53.95  ? 481 HOH A O   1 
HETATM 3122 O O   . HOH Q 4 .   ? 16.307  4.502  32.694  1.00 38.29  ? 482 HOH A O   1 
HETATM 3123 O O   . HOH Q 4 .   ? 1.396   23.343 50.668  1.00 38.30  ? 483 HOH A O   1 
HETATM 3124 O O   . HOH Q 4 .   ? 23.939  31.661 43.487  1.00 53.68  ? 484 HOH A O   1 
HETATM 3125 O O   . HOH Q 4 .   ? -3.510  19.456 53.078  1.00 52.83  ? 485 HOH A O   1 
HETATM 3126 O O   . HOH Q 4 .   ? 20.981  9.221  47.373  1.00 39.48  ? 486 HOH A O   1 
HETATM 3127 O O   . HOH Q 4 .   ? -1.915  20.208 31.328  1.00 46.71  ? 487 HOH A O   1 
HETATM 3128 O O   . HOH R 4 .   ? -12.814 17.118 -2.121  1.00 41.48  ? 413 HOH B O   1 
HETATM 3129 O O   . HOH R 4 .   ? -5.909  22.774 -10.857 1.00 46.14  ? 414 HOH B O   1 
HETATM 3130 O O   . HOH R 4 .   ? 13.474  0.328  22.415  1.00 42.12  ? 415 HOH B O   1 
HETATM 3131 O O   . HOH R 4 .   ? -2.233  4.610  19.213  1.00 30.54  ? 416 HOH B O   1 
HETATM 3132 O O   . HOH R 4 .   ? 10.998  16.125 -5.038  1.00 47.83  ? 417 HOH B O   1 
HETATM 3133 O O   . HOH R 4 .   ? 3.703   -1.126 0.431   1.00 32.73  ? 418 HOH B O   1 
HETATM 3134 O O   . HOH R 4 .   ? -19.423 -0.900 -5.027  1.00 46.24  ? 419 HOH B O   1 
HETATM 3135 O O   . HOH R 4 .   ? -2.903  22.602 -1.224  1.00 40.54  ? 420 HOH B O   1 
HETATM 3136 O O   . HOH R 4 .   ? -8.494  2.648  7.728   1.00 41.38  ? 421 HOH B O   1 
HETATM 3137 O O   . HOH R 4 .   ? -20.791 1.037  4.309   1.00 44.21  ? 422 HOH B O   1 
HETATM 3138 O O   . HOH R 4 .   ? 5.509   25.602 4.610   1.00 44.40  ? 423 HOH B O   1 
HETATM 3139 O O   . HOH R 4 .   ? 8.468   25.301 15.064  1.00 61.77  ? 424 HOH B O   1 
HETATM 3140 O O   . HOH R 4 .   ? 17.618  11.562 15.299  1.00 38.02  ? 425 HOH B O   1 
HETATM 3141 O O   . HOH R 4 .   ? 5.619   17.268 -16.013 1.00 48.04  ? 426 HOH B O   1 
HETATM 3142 O O   . HOH R 4 .   ? 7.937   17.321 20.146  1.00 33.83  ? 427 HOH B O   1 
HETATM 3143 O O   . HOH R 4 .   ? -5.635  17.860 -10.745 1.00 38.77  ? 428 HOH B O   1 
HETATM 3144 O O   . HOH R 4 .   ? -7.187  19.138 -5.846  1.00 46.53  ? 429 HOH B O   1 
HETATM 3145 O O   . HOH R 4 .   ? -9.647  12.560 -7.081  1.00 24.49  ? 430 HOH B O   1 
HETATM 3146 O O   . HOH R 4 .   ? -15.564 8.755  -3.856  1.00 49.35  ? 431 HOH B O   1 
HETATM 3147 O O   . HOH R 4 .   ? -0.335  3.891  12.152  1.00 32.16  ? 432 HOH B O   1 
HETATM 3148 O O   . HOH R 4 .   ? 4.803   -2.846 3.995   1.00 54.45  ? 433 HOH B O   1 
HETATM 3149 O O   . HOH R 4 .   ? -13.677 17.756 -10.902 1.00 33.18  ? 434 HOH B O   1 
HETATM 3150 O O   . HOH R 4 .   ? 2.154   22.960 -8.098  1.00 34.86  ? 435 HOH B O   1 
HETATM 3151 O O   . HOH R 4 .   ? 0.920   12.355 -28.243 1.00 39.57  ? 436 HOH B O   1 
HETATM 3152 O O   . HOH R 4 .   ? -10.148 6.534  -3.137  1.00 23.21  ? 437 HOH B O   1 
HETATM 3153 O O   . HOH R 4 .   ? -4.444  2.335  2.323   1.00 28.78  ? 438 HOH B O   1 
HETATM 3154 O O   . HOH R 4 .   ? 8.761   -3.447 -9.458  1.00 53.88  ? 439 HOH B O   1 
HETATM 3155 O O   . HOH R 4 .   ? -17.609 11.864 -14.621 1.00 47.73  ? 440 HOH B O   1 
HETATM 3156 O O   . HOH R 4 .   ? -1.179  4.292  -12.998 1.00 35.52  ? 441 HOH B O   1 
HETATM 3157 O O   . HOH R 4 .   ? 2.012   20.885 14.487  1.00 42.79  ? 442 HOH B O   1 
HETATM 3158 O O   . HOH R 4 .   ? 14.197  8.822  23.102  1.00 38.72  ? 443 HOH B O   1 
HETATM 3159 O O   . HOH R 4 .   ? -9.204  11.675 -0.639  1.00 33.57  ? 444 HOH B O   1 
HETATM 3160 O O   . HOH R 4 .   ? -9.861  0.576  0.545   1.00 34.52  ? 445 HOH B O   1 
HETATM 3161 O O   . HOH R 4 .   ? -2.192  -2.202 -1.531  1.00 28.52  ? 446 HOH B O   1 
HETATM 3162 O O   . HOH R 4 .   ? 5.913   -1.016 19.071  1.00 48.59  ? 447 HOH B O   1 
HETATM 3163 O O   . HOH R 4 .   ? -10.609 2.514  3.067   1.00 34.85  ? 448 HOH B O   1 
HETATM 3164 O O   . HOH R 4 .   ? -4.639  7.601  21.125  1.00 40.35  ? 449 HOH B O   1 
HETATM 3165 O O   . HOH R 4 .   ? 16.297  10.656 -10.238 1.00 43.36  ? 450 HOH B O   1 
HETATM 3166 O O   . HOH R 4 .   ? -4.828  0.009  15.191  1.00 45.83  ? 451 HOH B O   1 
HETATM 3167 O O   . HOH R 4 .   ? -6.587  23.959 -13.232 1.00 43.80  ? 452 HOH B O   1 
HETATM 3168 O O   . HOH R 4 .   ? -8.952  7.289  10.626  1.00 35.34  ? 453 HOH B O   1 
HETATM 3169 O O   . HOH R 4 .   ? -15.957 20.135 -15.051 1.00 48.55  ? 454 HOH B O   1 
HETATM 3170 O O   . HOH R 4 .   ? 15.569  23.150 12.169  1.00 37.75  ? 455 HOH B O   1 
HETATM 3171 O O   . HOH R 4 .   ? 16.312  13.212 20.505  1.00 47.70  ? 456 HOH B O   1 
HETATM 3172 O O   . HOH R 4 .   ? 14.687  2.650  16.358  1.00 36.39  ? 457 HOH B O   1 
HETATM 3173 O O   . HOH R 4 .   ? -10.734 16.287 7.744   1.00 47.20  ? 458 HOH B O   1 
HETATM 3174 O O   . HOH R 4 .   ? -6.624  1.884  14.193  1.00 35.44  ? 459 HOH B O   1 
HETATM 3175 O O   . HOH R 4 .   ? 12.700  6.986  6.380   1.00 30.38  ? 460 HOH B O   1 
HETATM 3176 O O   . HOH R 4 .   ? -12.150 16.010 -18.347 1.00 44.13  ? 461 HOH B O   1 
HETATM 3177 O O   . HOH R 4 .   ? 13.325  19.982 -13.813 1.00 49.02  ? 462 HOH B O   1 
HETATM 3178 O O   . HOH R 4 .   ? -6.994  24.451 -4.121  1.00 54.30  ? 463 HOH B O   1 
HETATM 3179 O O   . HOH R 4 .   ? 15.604  26.803 0.443   1.00 40.48  ? 464 HOH B O   1 
HETATM 3180 O O   . HOH R 4 .   ? -3.760  14.294 -27.262 1.00 48.86  ? 465 HOH B O   1 
HETATM 3181 O O   . HOH R 4 .   ? -4.598  17.203 14.613  1.00 29.95  ? 466 HOH B O   1 
HETATM 3182 O O   . HOH R 4 .   ? -5.199  15.083 -24.191 1.00 48.48  ? 467 HOH B O   1 
HETATM 3183 O O   . HOH R 4 .   ? 8.852   8.783  -5.093  1.00 31.54  ? 468 HOH B O   1 
HETATM 3184 O O   . HOH R 4 .   ? -20.049 13.026 -10.029 1.00 42.01  ? 469 HOH B O   1 
HETATM 3185 O O   . HOH R 4 .   ? 10.186  6.773  4.822   1.00 46.65  ? 470 HOH B O   1 
HETATM 3186 O O   . HOH R 4 .   ? 19.914  6.484  -3.082  1.00 41.36  ? 471 HOH B O   1 
HETATM 3187 O O   . HOH R 4 .   ? 16.773  11.180 8.759   1.00 40.66  ? 472 HOH B O   1 
HETATM 3188 O O   . HOH R 4 .   ? 13.845  17.247 -17.853 1.00 50.77  ? 473 HOH B O   1 
HETATM 3189 O O   . HOH R 4 .   ? 13.076  10.652 21.709  1.00 25.65  ? 474 HOH B O   1 
HETATM 3190 O O   . HOH R 4 .   ? -3.070  17.095 -10.139 1.00 26.31  ? 475 HOH B O   1 
HETATM 3191 O O   . HOH R 4 .   ? 11.523  6.124  -6.045  1.00 39.01  ? 476 HOH B O   1 
HETATM 3192 O O   . HOH R 4 .   ? 5.443   -2.193 -1.317  1.00 50.48  ? 477 HOH B O   1 
HETATM 3193 O O   . HOH R 4 .   ? 8.105   -2.102 14.915  1.00 51.96  ? 478 HOH B O   1 
HETATM 3194 O O   . HOH R 4 .   ? -4.152  4.081  -18.447 1.00 40.37  ? 479 HOH B O   1 
HETATM 3195 O O   . HOH R 4 .   ? -8.417  4.959  -16.317 1.00 29.49  ? 480 HOH B O   1 
HETATM 3196 O O   . HOH R 4 .   ? 15.130  19.891 -15.324 1.00 43.90  ? 481 HOH B O   1 
HETATM 3197 O O   . HOH R 4 .   ? 3.420   13.070 17.840  1.00 26.77  ? 482 HOH B O   1 
HETATM 3198 O O   . HOH R 4 .   ? 13.830  5.716  -7.010  1.00 29.51  ? 483 HOH B O   1 
HETATM 3199 O O   . HOH R 4 .   ? 15.937  8.179  8.601   1.00 44.93  ? 484 HOH B O   1 
HETATM 3200 O O   . HOH R 4 .   ? -2.014  28.162 -7.305  1.00 43.52  ? 485 HOH B O   1 
HETATM 3201 O O   . HOH R 4 .   ? -16.048 10.104 -0.648  1.00 41.53  ? 486 HOH B O   1 
HETATM 3202 O O   . HOH R 4 .   ? 1.476   12.072 18.757  1.00 32.41  ? 487 HOH B O   1 
HETATM 3203 O O   . HOH R 4 .   ? 1.240   -1.969 -2.282  1.00 41.10  ? 488 HOH B O   1 
HETATM 3204 O O   . HOH R 4 .   ? -14.893 16.757 -4.001  1.00 49.58  ? 489 HOH B O   1 
HETATM 3205 O O   . HOH R 4 .   ? -15.332 11.810 -17.880 1.00 44.56  ? 490 HOH B O   1 
HETATM 3206 O O   . HOH R 4 .   ? -8.888  14.380 10.298  1.00 38.72  ? 491 HOH B O   1 
HETATM 3207 O O   . HOH R 4 .   ? 1.940   24.446 6.703   1.00 45.06  ? 492 HOH B O   1 
HETATM 3208 O O   . HOH S 4 .   ? -13.513 1.763  -6.382  1.00 28.34  ? 27  HOH D O   1 
HETATM 3209 O O   . HOH S 4 .   ? -9.186  -3.140 -9.301  1.00 33.56  ? 89  HOH D O   1 
HETATM 3210 O O   . HOH S 4 .   ? -6.398  5.073  -17.711 1.00 28.72  ? 208 HOH D O   1 
HETATM 3211 O O   . HOH S 4 .   ? -7.554  15.804 -20.169 1.00 44.48  ? 234 HOH D O   1 
HETATM 3212 O O   . HOH S 4 .   ? -6.649  -2.759 -4.421  1.00 47.75  ? 273 HOH D O   1 
HETATM 3213 O O   . HOH S 4 .   ? -16.004 -7.451 -4.665  1.00 41.89  ? 274 HOH D O   1 
HETATM 3214 O O   . HOH S 4 .   ? -12.711 -7.352 -8.500  1.00 57.26  ? 278 HOH D O   1 
HETATM 3215 O O   . HOH S 4 .   ? -1.995  4.122  -16.673 1.00 39.62  ? 285 HOH D O   1 
HETATM 3216 O O   . HOH S 4 .   ? -7.793  -0.948 -11.688 1.00 42.85  ? 287 HOH D O   1 
HETATM 3217 O O   . HOH S 4 .   ? -10.919 13.668 -19.369 1.00 44.12  ? 307 HOH D O   1 
HETATM 3218 O O   . HOH S 4 .   ? -8.096  18.616 -17.541 1.00 53.95  ? 312 HOH D O   1 
HETATM 3219 O O   . HOH T 4 .   ? 18.789  19.785 62.669  1.00 25.57  ? 13  HOH P O   1 
HETATM 3220 O O   . HOH T 4 .   ? 17.458  15.068 61.397  1.00 32.18  ? 14  HOH P O   1 
HETATM 3221 O O   . HOH T 4 .   ? 29.989  23.393 50.925  1.00 44.66  ? 15  HOH P O   1 
HETATM 3222 O O   . HOH T 4 .   ? 13.992  28.043 64.367  1.00 44.99  ? 16  HOH P O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'Chirality error at CA in Ala39 Chain B' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -3  ?   ?   ?   A . n 
A 1 2   VAL 2   -2  ?   ?   ?   A . n 
A 1 3   SER 3   -1  ?   ?   ?   A . n 
A 1 4   ALA 4   0   ?   ?   ?   A . n 
A 1 5   ILE 5   1   ?   ?   ?   A . n 
A 1 6   VAL 6   2   ?   ?   ?   A . n 
A 1 7   LEU 7   3   ?   ?   ?   A . n 
A 1 8   TYR 8   4   ?   ?   ?   A . n 
A 1 9   VAL 9   5   ?   ?   ?   A . n 
A 1 10  LEU 10  6   ?   ?   ?   A . n 
A 1 11  LEU 11  7   ?   ?   ?   A . n 
A 1 12  ALA 12  8   ?   ?   ?   A . n 
A 1 13  ALA 13  9   ?   ?   ?   A . n 
A 1 14  ALA 14  10  ?   ?   ?   A . n 
A 1 15  ALA 15  11  ?   ?   ?   A . n 
A 1 16  HIS 16  12  ?   ?   ?   A . n 
A 1 17  SER 17  13  ?   ?   ?   A . n 
A 1 18  ALA 18  14  ?   ?   ?   A . n 
A 1 19  PHE 19  15  ?   ?   ?   A . n 
A 1 20  ALA 20  16  ?   ?   ?   A . n 
A 1 21  ALA 21  17  ?   ?   ?   A . n 
A 1 22  MET 22  18  ?   ?   ?   A . n 
A 1 23  VAL 23  19  ?   ?   ?   A . n 
A 1 24  HIS 24  20  ?   ?   ?   A . n 
A 1 25  HIS 25  21  ?   ?   ?   A . n 
A 1 26  HIS 26  22  ?   ?   ?   A . n 
A 1 27  HIS 27  23  ?   ?   ?   A . n 
A 1 28  HIS 28  24  ?   ?   ?   A . n 
A 1 29  HIS 29  25  ?   ?   ?   A . n 
A 1 30  SER 30  26  ?   ?   ?   A . n 
A 1 31  ALA 31  27  ?   ?   ?   A . n 
A 1 32  GLU 32  28  28  GLU GLU A . n 
A 1 33  GLU 33  29  29  GLU GLU A . n 
A 1 34  THR 34  30  30  THR THR A . n 
A 1 35  LEU 35  31  31  LEU LEU A . n 
A 1 36  MET 36  32  32  MET MET A . n 
A 1 37  ASP 37  33  33  ASP ASP A . n 
A 1 38  SER 38  34  34  SER SER A . n 
A 1 39  THR 39  35  35  THR THR A . n 
A 1 40  THR 40  36  36  THR THR A . n 
A 1 41  ALA 41  37  37  ALA ALA A . n 
A 1 42  THR 42  38  38  THR THR A . n 
A 1 43  ALA 43  39  39  ALA ALA A . n 
A 1 44  GLU 44  40  40  GLU GLU A . n 
A 1 45  LEU 45  41  41  LEU LEU A . n 
A 1 46  GLY 46  42  42  GLY GLY A . n 
A 1 47  TRP 47  43  43  TRP TRP A . n 
A 1 48  MET 48  44  44  MET MET A . n 
A 1 49  VAL 49  45  45  VAL VAL A . n 
A 1 50  HIS 50  46  46  HIS HIS A . n 
A 1 51  PRO 51  47  47  PRO PRO A . n 
A 1 52  PRO 52  48  48  PRO PRO A . n 
A 1 53  SER 53  49  49  SER SER A . n 
A 1 54  GLY 54  50  50  GLY GLY A . n 
A 1 55  TRP 55  51  51  TRP TRP A . n 
A 1 56  GLU 56  52  52  GLU GLU A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  VAL 58  54  54  VAL VAL A . n 
A 1 59  SER 59  55  55  SER SER A . n 
A 1 60  GLY 60  56  56  GLY GLY A . n 
A 1 61  TYR 61  57  57  TYR TYR A . n 
A 1 62  ASP 62  58  58  ASP ASP A . n 
A 1 63  GLU 63  59  59  GLU GLU A . n 
A 1 64  ASN 64  60  60  ASN ASN A . n 
A 1 65  MET 65  61  61  MET MET A . n 
A 1 66  ASN 66  62  62  ASN ASN A . n 
A 1 67  THR 67  63  63  THR THR A . n 
A 1 68  ILE 68  64  64  ILE ILE A . n 
A 1 69  ARG 69  65  65  ARG ARG A . n 
A 1 70  THR 70  66  66  THR THR A . n 
A 1 71  TYR 71  67  67  TYR TYR A . n 
A 1 72  GLN 72  68  68  GLN GLN A . n 
A 1 73  VAL 73  69  69  VAL VAL A . n 
A 1 74  CYS 74  70  70  CYS CYS A . n 
A 1 75  ASN 75  71  71  ASN ASN A . n 
A 1 76  VAL 76  72  72  VAL VAL A . n 
A 1 77  PHE 77  73  73  PHE PHE A . n 
A 1 78  GLU 78  74  74  GLU GLU A . n 
A 1 79  SER 79  75  75  SER SER A . n 
A 1 80  SER 80  76  76  SER SER A . n 
A 1 81  GLN 81  77  77  GLN GLN A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  ASN 83  79  79  ASN ASN A . n 
A 1 84  TRP 84  80  80  TRP TRP A . n 
A 1 85  LEU 85  81  81  LEU LEU A . n 
A 1 86  ARG 86  82  82  ARG ARG A . n 
A 1 87  THR 87  83  83  THR THR A . n 
A 1 88  LYS 88  84  84  LYS LYS A . n 
A 1 89  PHE 89  85  85  PHE PHE A . n 
A 1 90  ILE 90  86  86  ILE ILE A . n 
A 1 91  ARG 91  87  87  ARG ARG A . n 
A 1 92  ARG 92  88  88  ARG ARG A . n 
A 1 93  ARG 93  89  89  ARG ARG A . n 
A 1 94  GLY 94  90  90  GLY GLY A . n 
A 1 95  ALA 95  91  91  ALA ALA A . n 
A 1 96  HIS 96  92  92  HIS HIS A . n 
A 1 97  ARG 97  93  93  ARG ARG A . n 
A 1 98  ILE 98  94  94  ILE ILE A . n 
A 1 99  HIS 99  95  95  HIS HIS A . n 
A 1 100 VAL 100 96  96  VAL VAL A . n 
A 1 101 GLU 101 97  97  GLU GLU A . n 
A 1 102 MET 102 98  98  MET MET A . n 
A 1 103 LYS 103 99  99  LYS LYS A . n 
A 1 104 PHE 104 100 100 PHE PHE A . n 
A 1 105 SER 105 101 101 SER SER A . n 
A 1 106 VAL 106 102 102 VAL VAL A . n 
A 1 107 ARG 107 103 103 ARG ARG A . n 
A 1 108 ASP 108 104 104 ASP ASP A . n 
A 1 109 CYS 109 105 105 CYS CYS A . n 
A 1 110 SER 110 106 106 SER SER A . n 
A 1 111 SER 111 107 107 SER SER A . n 
A 1 112 ILE 112 108 108 ILE ILE A . n 
A 1 113 PRO 113 109 109 PRO PRO A . n 
A 1 114 SER 114 110 110 SER SER A . n 
A 1 115 VAL 115 111 111 VAL VAL A . n 
A 1 116 PRO 116 112 112 PRO PRO A . n 
A 1 117 GLY 117 113 113 GLY GLY A . n 
A 1 118 SER 118 114 114 SER SER A . n 
A 1 119 CYS 119 115 115 CYS CYS A . n 
A 1 120 LYS 120 116 116 LYS LYS A . n 
A 1 121 GLU 121 117 117 GLU GLU A . n 
A 1 122 THR 122 118 118 THR THR A . n 
A 1 123 PHE 123 119 119 PHE PHE A . n 
A 1 124 ASN 124 120 120 ASN ASN A . n 
A 1 125 LEU 125 121 121 LEU LEU A . n 
A 1 126 TYR 126 122 122 TYR TYR A . n 
A 1 127 TYR 127 123 123 TYR TYR A . n 
A 1 128 TYR 128 124 124 TYR TYR A . n 
A 1 129 GLU 129 125 125 GLU GLU A . n 
A 1 130 ALA 130 126 126 ALA ALA A . n 
A 1 131 ASP 131 127 127 ASP ASP A . n 
A 1 132 PHE 132 128 128 PHE PHE A . n 
A 1 133 ASP 133 129 129 ASP ASP A . n 
A 1 134 SER 134 130 130 SER SER A . n 
A 1 135 ALA 135 131 131 ALA ALA A . n 
A 1 136 THR 136 132 132 THR THR A . n 
A 1 137 LYS 137 133 133 LYS LYS A . n 
A 1 138 THR 138 134 134 THR THR A . n 
A 1 139 PHE 139 135 135 PHE PHE A . n 
A 1 140 PRO 140 136 136 PRO PRO A . n 
A 1 141 ASN 141 137 137 ASN ASN A . n 
A 1 142 TRP 142 138 138 TRP TRP A . n 
A 1 143 MET 143 139 139 MET MET A . n 
A 1 144 GLU 144 140 140 GLU GLU A . n 
A 1 145 ASN 145 141 141 ASN ASN A . n 
A 1 146 PRO 146 142 142 PRO PRO A . n 
A 1 147 TRP 147 143 143 TRP TRP A . n 
A 1 148 VAL 148 144 144 VAL VAL A . n 
A 1 149 LYS 149 145 145 LYS LYS A . n 
A 1 150 VAL 150 146 146 VAL VAL A . n 
A 1 151 ASP 151 147 147 ASP ASP A . n 
A 1 152 THR 152 148 148 THR THR A . n 
A 1 153 ILE 153 149 149 ILE ILE A . n 
A 1 154 ALA 154 150 150 ALA ALA A . n 
A 1 155 ALA 155 151 151 ALA ALA A . n 
A 1 156 ASP 156 152 152 ASP ASP A . n 
A 1 157 GLU 157 153 153 GLU GLU A . n 
A 1 158 SER 158 154 154 SER SER A . n 
A 1 159 PHE 159 155 155 PHE PHE A . n 
A 1 160 SER 160 156 156 SER SER A . n 
A 1 161 GLN 161 157 157 GLN GLN A . n 
A 1 162 VAL 162 158 158 VAL VAL A . n 
A 1 163 ASP 163 159 159 ASP ASP A . n 
A 1 164 LEU 164 160 160 LEU LEU A . n 
A 1 165 GLY 165 161 161 GLY GLY A . n 
A 1 166 GLY 166 162 162 GLY GLY A . n 
A 1 167 ARG 167 163 163 ARG ARG A . n 
A 1 168 VAL 168 164 164 VAL VAL A . n 
A 1 169 MET 169 165 165 MET MET A . n 
A 1 170 LYS 170 166 166 LYS LYS A . n 
A 1 171 ILE 171 167 167 ILE ILE A . n 
A 1 172 ASN 172 168 168 ASN ASN A . n 
A 1 173 THR 173 169 169 THR THR A . n 
A 1 174 GLU 174 170 170 GLU GLU A . n 
A 1 175 VAL 175 171 171 VAL VAL A . n 
A 1 176 ARG 176 172 172 ARG ARG A . n 
A 1 177 SER 177 173 173 SER SER A . n 
A 1 178 PHE 178 174 174 PHE PHE A . n 
A 1 179 GLY 179 175 175 GLY GLY A . n 
A 1 180 PRO 180 176 176 PRO PRO A . n 
A 1 181 VAL 181 177 177 VAL VAL A . n 
A 1 182 SER 182 178 178 SER SER A . n 
A 1 183 ARG 183 179 179 ARG ARG A . n 
A 1 184 SER 184 180 180 SER SER A . n 
A 1 185 GLY 185 181 181 GLY GLY A . n 
A 1 186 PHE 186 182 182 PHE PHE A . n 
A 1 187 TYR 187 183 183 TYR TYR A . n 
A 1 188 LEU 188 184 184 LEU LEU A . n 
A 1 189 ALA 189 185 185 ALA ALA A . n 
A 1 190 PHE 190 186 186 PHE PHE A . n 
A 1 191 GLN 191 187 187 GLN GLN A . n 
A 1 192 ASP 192 188 188 ASP ASP A . n 
A 1 193 TYR 193 189 189 TYR TYR A . n 
A 1 194 GLY 194 190 190 GLY GLY A . n 
A 1 195 GLY 195 191 191 GLY GLY A . n 
A 1 196 CYS 196 192 192 CYS CYS A . n 
A 1 197 MET 197 193 193 MET MET A . n 
A 1 198 SER 198 194 194 SER SER A . n 
A 1 199 LEU 199 195 195 LEU LEU A . n 
A 1 200 ILE 200 196 196 ILE ILE A . n 
A 1 201 ALA 201 197 197 ALA ALA A . n 
A 1 202 VAL 202 198 198 VAL VAL A . n 
A 1 203 ARG 203 199 199 ARG ARG A . n 
A 1 204 VAL 204 200 200 VAL VAL A . n 
A 1 205 PHE 205 201 201 PHE PHE A . n 
A 1 206 TYR 206 202 202 TYR TYR A . n 
A 1 207 ARG 207 203 203 ARG ARG A . n 
A 1 208 LYS 208 204 ?   ?   ?   A . n 
B 1 1   MET 1   -3  ?   ?   ?   B . n 
B 1 2   VAL 2   -2  ?   ?   ?   B . n 
B 1 3   SER 3   -1  ?   ?   ?   B . n 
B 1 4   ALA 4   0   ?   ?   ?   B . n 
B 1 5   ILE 5   1   ?   ?   ?   B . n 
B 1 6   VAL 6   2   ?   ?   ?   B . n 
B 1 7   LEU 7   3   ?   ?   ?   B . n 
B 1 8   TYR 8   4   ?   ?   ?   B . n 
B 1 9   VAL 9   5   ?   ?   ?   B . n 
B 1 10  LEU 10  6   ?   ?   ?   B . n 
B 1 11  LEU 11  7   ?   ?   ?   B . n 
B 1 12  ALA 12  8   ?   ?   ?   B . n 
B 1 13  ALA 13  9   ?   ?   ?   B . n 
B 1 14  ALA 14  10  ?   ?   ?   B . n 
B 1 15  ALA 15  11  ?   ?   ?   B . n 
B 1 16  HIS 16  12  ?   ?   ?   B . n 
B 1 17  SER 17  13  ?   ?   ?   B . n 
B 1 18  ALA 18  14  ?   ?   ?   B . n 
B 1 19  PHE 19  15  ?   ?   ?   B . n 
B 1 20  ALA 20  16  ?   ?   ?   B . n 
B 1 21  ALA 21  17  ?   ?   ?   B . n 
B 1 22  MET 22  18  ?   ?   ?   B . n 
B 1 23  VAL 23  19  ?   ?   ?   B . n 
B 1 24  HIS 24  20  ?   ?   ?   B . n 
B 1 25  HIS 25  21  ?   ?   ?   B . n 
B 1 26  HIS 26  22  ?   ?   ?   B . n 
B 1 27  HIS 27  23  ?   ?   ?   B . n 
B 1 28  HIS 28  24  ?   ?   ?   B . n 
B 1 29  HIS 29  25  ?   ?   ?   B . n 
B 1 30  SER 30  26  ?   ?   ?   B . n 
B 1 31  ALA 31  27  ?   ?   ?   B . n 
B 1 32  GLU 32  28  28  GLU GLU B . n 
B 1 33  GLU 33  29  29  GLU GLU B . n 
B 1 34  THR 34  30  30  THR THR B . n 
B 1 35  LEU 35  31  31  LEU LEU B . n 
B 1 36  MET 36  32  32  MET MET B . n 
B 1 37  ASP 37  33  33  ASP ASP B . n 
B 1 38  SER 38  34  34  SER SER B . n 
B 1 39  THR 39  35  35  THR THR B . n 
B 1 40  THR 40  36  36  THR THR B . n 
B 1 41  ALA 41  37  37  ALA ALA B . n 
B 1 42  THR 42  38  38  THR THR B . n 
B 1 43  ALA 43  39  39  ALA ALA B . n 
B 1 44  GLU 44  40  40  GLU GLU B . n 
B 1 45  LEU 45  41  41  LEU LEU B . n 
B 1 46  GLY 46  42  42  GLY GLY B . n 
B 1 47  TRP 47  43  43  TRP TRP B . n 
B 1 48  MET 48  44  44  MET MET B . n 
B 1 49  VAL 49  45  45  VAL VAL B . n 
B 1 50  HIS 50  46  46  HIS HIS B . n 
B 1 51  PRO 51  47  47  PRO PRO B . n 
B 1 52  PRO 52  48  48  PRO PRO B . n 
B 1 53  SER 53  49  49  SER SER B . n 
B 1 54  GLY 54  50  50  GLY GLY B . n 
B 1 55  TRP 55  51  51  TRP TRP B . n 
B 1 56  GLU 56  52  52  GLU GLU B . n 
B 1 57  GLU 57  53  53  GLU GLU B . n 
B 1 58  VAL 58  54  54  VAL VAL B . n 
B 1 59  SER 59  55  55  SER SER B . n 
B 1 60  GLY 60  56  56  GLY GLY B . n 
B 1 61  TYR 61  57  57  TYR TYR B . n 
B 1 62  ASP 62  58  58  ASP ASP B . n 
B 1 63  GLU 63  59  59  GLU GLU B . n 
B 1 64  ASN 64  60  60  ASN ASP B . n 
B 1 65  MET 65  61  61  MET MET B . n 
B 1 66  ASN 66  62  62  ASN ASN B . n 
B 1 67  THR 67  63  63  THR THR B . n 
B 1 68  ILE 68  64  64  ILE ILE B . n 
B 1 69  ARG 69  65  65  ARG ARG B . n 
B 1 70  THR 70  66  66  THR THR B . n 
B 1 71  TYR 71  67  67  TYR TYR B . n 
B 1 72  GLN 72  68  68  GLN GLN B . n 
B 1 73  VAL 73  69  69  VAL VAL B . n 
B 1 74  CYS 74  70  70  CYS CYS B . n 
B 1 75  ASN 75  71  71  ASN ASN B . n 
B 1 76  VAL 76  72  72  VAL VAL B . n 
B 1 77  PHE 77  73  73  PHE PHE B . n 
B 1 78  GLU 78  74  74  GLU GLU B . n 
B 1 79  SER 79  75  75  SER SER B . n 
B 1 80  SER 80  76  76  SER SER B . n 
B 1 81  GLN 81  77  77  GLN GLN B . n 
B 1 82  ASN 82  78  78  ASN ASN B . n 
B 1 83  ASN 83  79  79  ASN ASN B . n 
B 1 84  TRP 84  80  80  TRP TRP B . n 
B 1 85  LEU 85  81  81  LEU LEU B . n 
B 1 86  ARG 86  82  82  ARG ARG B . n 
B 1 87  THR 87  83  83  THR THR B . n 
B 1 88  LYS 88  84  84  LYS LYS B . n 
B 1 89  PHE 89  85  85  PHE PHE B . n 
B 1 90  ILE 90  86  86  ILE ILE B . n 
B 1 91  ARG 91  87  87  ARG ARG B . n 
B 1 92  ARG 92  88  88  ARG ARG B . n 
B 1 93  ARG 93  89  89  ARG ARG B . n 
B 1 94  GLY 94  90  90  GLY GLY B . n 
B 1 95  ALA 95  91  91  ALA ALA B . n 
B 1 96  HIS 96  92  92  HIS HIS B . n 
B 1 97  ARG 97  93  93  ARG ARG B . n 
B 1 98  ILE 98  94  94  ILE ILE B . n 
B 1 99  HIS 99  95  95  HIS HIS B . n 
B 1 100 VAL 100 96  96  VAL VAL B . n 
B 1 101 GLU 101 97  97  GLU GLU B . n 
B 1 102 MET 102 98  98  MET MET B . n 
B 1 103 LYS 103 99  99  LYS LYS B . n 
B 1 104 PHE 104 100 100 PHE PHE B . n 
B 1 105 SER 105 101 101 SER SER B . n 
B 1 106 VAL 106 102 102 VAL VAL B . n 
B 1 107 ARG 107 103 103 ARG ARG B . n 
B 1 108 ASP 108 104 104 ASP ASP B . n 
B 1 109 CYS 109 105 105 CYS CYS B . n 
B 1 110 SER 110 106 106 SER SER B . n 
B 1 111 SER 111 107 107 SER SER B . n 
B 1 112 ILE 112 108 108 ILE ILE B . n 
B 1 113 PRO 113 109 109 PRO PRO B . n 
B 1 114 SER 114 110 110 SER SER B . n 
B 1 115 VAL 115 111 111 VAL VAL B . n 
B 1 116 PRO 116 112 112 PRO PRO B . n 
B 1 117 GLY 117 113 113 GLY GLY B . n 
B 1 118 SER 118 114 114 SER SER B . n 
B 1 119 CYS 119 115 115 CYS CYS B . n 
B 1 120 LYS 120 116 116 LYS LYS B . n 
B 1 121 GLU 121 117 117 GLU GLU B . n 
B 1 122 THR 122 118 118 THR THR B . n 
B 1 123 PHE 123 119 119 PHE PHE B . n 
B 1 124 ASN 124 120 120 ASN ASN B . n 
B 1 125 LEU 125 121 121 LEU LEU B . n 
B 1 126 TYR 126 122 122 TYR TYR B . n 
B 1 127 TYR 127 123 123 TYR TYR B . n 
B 1 128 TYR 128 124 124 TYR TYR B . n 
B 1 129 GLU 129 125 125 GLU GLU B . n 
B 1 130 ALA 130 126 126 ALA ALA B . n 
B 1 131 ASP 131 127 127 ASP ASP B . n 
B 1 132 PHE 132 128 128 PHE PHE B . n 
B 1 133 ASP 133 129 129 ASP ASP B . n 
B 1 134 SER 134 130 130 SER SER B . n 
B 1 135 ALA 135 131 131 ALA ALA B . n 
B 1 136 THR 136 132 132 THR THR B . n 
B 1 137 LYS 137 133 133 LYS LYS B . n 
B 1 138 THR 138 134 134 THR THR B . n 
B 1 139 PHE 139 135 135 PHE PHE B . n 
B 1 140 PRO 140 136 136 PRO PRO B . n 
B 1 141 ASN 141 137 137 ASN ASN B . n 
B 1 142 TRP 142 138 138 TRP TRP B . n 
B 1 143 MET 143 139 139 MET MET B . n 
B 1 144 GLU 144 140 140 GLU GLU B . n 
B 1 145 ASN 145 141 141 ASN ASN B . n 
B 1 146 PRO 146 142 142 PRO PRO B . n 
B 1 147 TRP 147 143 143 TRP TRP B . n 
B 1 148 VAL 148 144 144 VAL VAL B . n 
B 1 149 LYS 149 145 145 LYS LYS B . n 
B 1 150 VAL 150 146 146 VAL VAL B . n 
B 1 151 ASP 151 147 147 ASP ASP B . n 
B 1 152 THR 152 148 148 THR THR B . n 
B 1 153 ILE 153 149 149 ILE ILE B . n 
B 1 154 ALA 154 150 150 ALA ALA B . n 
B 1 155 ALA 155 151 151 ALA ALA B . n 
B 1 156 ASP 156 152 152 ASP ASP B . n 
B 1 157 GLU 157 153 153 GLU GLU B . n 
B 1 158 SER 158 154 154 SER SER B . n 
B 1 159 PHE 159 155 155 PHE PHE B . n 
B 1 160 SER 160 156 156 SER SER B . n 
B 1 161 GLN 161 157 157 GLN GLN B . n 
B 1 162 VAL 162 158 158 VAL VAL B . n 
B 1 163 ASP 163 159 159 ASP ASP B . n 
B 1 164 LEU 164 160 160 LEU LEU B . n 
B 1 165 GLY 165 161 161 GLY GLY B . n 
B 1 166 GLY 166 162 162 GLY GLY B . n 
B 1 167 ARG 167 163 163 ARG ARG B . n 
B 1 168 VAL 168 164 164 VAL VAL B . n 
B 1 169 MET 169 165 165 MET MET B . n 
B 1 170 LYS 170 166 166 LYS LYS B . n 
B 1 171 ILE 171 167 167 ILE ILE B . n 
B 1 172 ASN 172 168 168 ASN ASN B . n 
B 1 173 THR 173 169 169 THR THR B . n 
B 1 174 GLU 174 170 170 GLU GLU B . n 
B 1 175 VAL 175 171 171 VAL VAL B . n 
B 1 176 ARG 176 172 172 ARG ARG B . n 
B 1 177 SER 177 173 173 SER SER B . n 
B 1 178 PHE 178 174 174 PHE PHE B . n 
B 1 179 GLY 179 175 175 GLY GLY B . n 
B 1 180 PRO 180 176 176 PRO PRO B . n 
B 1 181 VAL 181 177 177 VAL VAL B . n 
B 1 182 SER 182 178 178 SER SER B . n 
B 1 183 ARG 183 179 179 ARG ARG B . n 
B 1 184 SER 184 180 180 SER SER B . n 
B 1 185 GLY 185 181 181 GLY GLY B . n 
B 1 186 PHE 186 182 182 PHE PHE B . n 
B 1 187 TYR 187 183 183 TYR TYR B . n 
B 1 188 LEU 188 184 184 LEU LEU B . n 
B 1 189 ALA 189 185 185 ALA ALA B . n 
B 1 190 PHE 190 186 186 PHE PHE B . n 
B 1 191 GLN 191 187 187 GLN GLN B . n 
B 1 192 ASP 192 188 188 ASP ASP B . n 
B 1 193 TYR 193 189 189 TYR TYR B . n 
B 1 194 GLY 194 190 190 GLY GLY B . n 
B 1 195 GLY 195 191 191 GLY GLY B . n 
B 1 196 CYS 196 192 192 CYS CYS B . n 
B 1 197 MET 197 193 193 MET MET B . n 
B 1 198 SER 198 194 194 SER SER B . n 
B 1 199 LEU 199 195 195 LEU LEU B . n 
B 1 200 ILE 200 196 196 ILE ILE B . n 
B 1 201 ALA 201 197 197 ALA ALA B . n 
B 1 202 VAL 202 198 198 VAL VAL B . n 
B 1 203 ARG 203 199 199 ARG ARG B . n 
B 1 204 VAL 204 200 200 VAL VAL B . n 
B 1 205 PHE 205 201 201 PHE PHE B . n 
B 1 206 TYR 206 202 202 TYR TYR B . n 
B 1 207 ARG 207 203 203 ARG ARG B . n 
B 1 208 LYS 208 204 ?   ?   ?   B . n 
C 2 1   SER 1   1   1   SER SER D . n 
C 2 2   ASN 2   2   2   ASN ASN D . n 
C 2 3   GLU 3   3   3   GLU GLU D . n 
C 2 4   TRP 4   4   4   TRP TRP D . n 
C 2 5   ILE 5   5   5   ILE ILE D . n 
C 2 6   GLN 6   6   6   GLN GLN D . n 
C 2 7   PRO 7   7   7   PRO PRO D . n 
C 2 8   ARG 8   8   8   ARG ARG D . n 
C 2 9   LEU 9   9   9   LEU LEU D . n 
C 2 10  PRO 10  10  10  PRO PRO D . n 
C 2 11  GLN 11  11  11  GLN GLN D . n 
C 2 12  HIS 12  12  ?   ?   ?   D . n 
D 2 1   SER 1   1   1   SER SER P . n 
D 2 2   ASN 2   2   2   ASN ASN P . n 
D 2 3   GLU 3   3   3   GLU GLU P . n 
D 2 4   TRP 4   4   4   TRP TRP P . n 
D 2 5   ILE 5   5   5   ILE ILE P . n 
D 2 6   GLN 6   6   6   GLN GLN P . n 
D 2 7   PRO 7   7   7   PRO PRO P . n 
D 2 8   ARG 8   8   8   ARG ARG P . n 
D 2 9   LEU 9   9   9   LEU LEU P . n 
D 2 10  PRO 10  10  ?   ?   ?   P . n 
D 2 11  GLN 11  11  ?   ?   ?   P . n 
D 2 12  HIS 12  12  ?   ?   ?   P . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Accelerated Technologies Center for Gene to 3D Structure' 
_pdbx_SG_project.initial_of_center     ATCG3D 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SO4 1  404 4   SO4 SO4 A . 
F 3 SO4 1  405 5   SO4 SO4 A . 
G 3 SO4 1  406 6   SO4 SO4 A . 
H 3 SO4 1  408 8   SO4 SO4 A . 
I 3 SO4 1  401 2   SO4 SO4 B . 
J 3 SO4 1  402 1   SO4 SO4 B . 
K 3 SO4 1  403 3   SO4 SO4 B . 
L 3 SO4 1  409 9   SO4 SO4 B . 
M 3 SO4 1  410 12  SO4 SO4 B . 
N 3 SO4 1  411 15  SO4 SO4 B . 
O 3 SO4 1  412 2   SO4 SO4 B . 
P 3 SO4 1  407 7   SO4 SO4 D . 
Q 4 HOH 1  409 19  HOH HOH A . 
Q 4 HOH 2  410 20  HOH HOH A . 
Q 4 HOH 3  411 22  HOH HOH A . 
Q 4 HOH 4  412 25  HOH HOH A . 
Q 4 HOH 5  413 31  HOH HOH A . 
Q 4 HOH 6  414 38  HOH HOH A . 
Q 4 HOH 7  415 41  HOH HOH A . 
Q 4 HOH 8  416 43  HOH HOH A . 
Q 4 HOH 9  417 46  HOH HOH A . 
Q 4 HOH 10 418 47  HOH HOH A . 
Q 4 HOH 11 419 51  HOH HOH A . 
Q 4 HOH 12 420 52  HOH HOH A . 
Q 4 HOH 13 421 56  HOH HOH A . 
Q 4 HOH 14 422 62  HOH HOH A . 
Q 4 HOH 15 423 65  HOH HOH A . 
Q 4 HOH 16 424 66  HOH HOH A . 
Q 4 HOH 17 425 68  HOH HOH A . 
Q 4 HOH 18 426 73  HOH HOH A . 
Q 4 HOH 19 427 76  HOH HOH A . 
Q 4 HOH 20 428 81  HOH HOH A . 
Q 4 HOH 21 429 84  HOH HOH A . 
Q 4 HOH 22 430 88  HOH HOH A . 
Q 4 HOH 23 431 93  HOH HOH A . 
Q 4 HOH 24 432 95  HOH HOH A . 
Q 4 HOH 25 433 97  HOH HOH A . 
Q 4 HOH 26 434 99  HOH HOH A . 
Q 4 HOH 27 435 101 HOH HOH A . 
Q 4 HOH 28 436 105 HOH HOH A . 
Q 4 HOH 29 437 107 HOH HOH A . 
Q 4 HOH 30 438 110 HOH HOH A . 
Q 4 HOH 31 439 113 HOH HOH A . 
Q 4 HOH 32 440 117 HOH HOH A . 
Q 4 HOH 33 441 118 HOH HOH A . 
Q 4 HOH 34 442 120 HOH HOH A . 
Q 4 HOH 35 443 122 HOH HOH A . 
Q 4 HOH 36 444 128 HOH HOH A . 
Q 4 HOH 37 445 129 HOH HOH A . 
Q 4 HOH 38 446 135 HOH HOH A . 
Q 4 HOH 39 447 136 HOH HOH A . 
Q 4 HOH 40 448 137 HOH HOH A . 
Q 4 HOH 41 449 138 HOH HOH A . 
Q 4 HOH 42 450 145 HOH HOH A . 
Q 4 HOH 43 451 146 HOH HOH A . 
Q 4 HOH 44 452 203 HOH HOH A . 
Q 4 HOH 45 453 206 HOH HOH A . 
Q 4 HOH 46 454 212 HOH HOH A . 
Q 4 HOH 47 455 216 HOH HOH A . 
Q 4 HOH 48 456 217 HOH HOH A . 
Q 4 HOH 49 457 218 HOH HOH A . 
Q 4 HOH 50 458 224 HOH HOH A . 
Q 4 HOH 51 459 228 HOH HOH A . 
Q 4 HOH 52 460 230 HOH HOH A . 
Q 4 HOH 53 461 232 HOH HOH A . 
Q 4 HOH 54 462 233 HOH HOH A . 
Q 4 HOH 55 463 237 HOH HOH A . 
Q 4 HOH 56 464 240 HOH HOH A . 
Q 4 HOH 57 465 243 HOH HOH A . 
Q 4 HOH 58 466 246 HOH HOH A . 
Q 4 HOH 59 467 247 HOH HOH A . 
Q 4 HOH 60 468 249 HOH HOH A . 
Q 4 HOH 61 469 250 HOH HOH A . 
Q 4 HOH 62 470 252 HOH HOH A . 
Q 4 HOH 63 471 254 HOH HOH A . 
Q 4 HOH 64 472 256 HOH HOH A . 
Q 4 HOH 65 473 257 HOH HOH A . 
Q 4 HOH 66 474 258 HOH HOH A . 
Q 4 HOH 67 475 259 HOH HOH A . 
Q 4 HOH 68 476 270 HOH HOH A . 
Q 4 HOH 69 477 272 HOH HOH A . 
Q 4 HOH 70 478 277 HOH HOH A . 
Q 4 HOH 71 479 280 HOH HOH A . 
Q 4 HOH 72 480 281 HOH HOH A . 
Q 4 HOH 73 481 282 HOH HOH A . 
Q 4 HOH 74 482 294 HOH HOH A . 
Q 4 HOH 75 483 300 HOH HOH A . 
Q 4 HOH 76 484 302 HOH HOH A . 
Q 4 HOH 77 485 303 HOH HOH A . 
Q 4 HOH 78 486 304 HOH HOH A . 
Q 4 HOH 79 487 306 HOH HOH A . 
R 4 HOH 1  413 12  HOH HOH B . 
R 4 HOH 2  414 14  HOH HOH B . 
R 4 HOH 3  415 15  HOH HOH B . 
R 4 HOH 4  416 16  HOH HOH B . 
R 4 HOH 5  417 23  HOH HOH B . 
R 4 HOH 6  418 24  HOH HOH B . 
R 4 HOH 7  419 28  HOH HOH B . 
R 4 HOH 8  420 29  HOH HOH B . 
R 4 HOH 9  421 32  HOH HOH B . 
R 4 HOH 10 422 33  HOH HOH B . 
R 4 HOH 11 423 34  HOH HOH B . 
R 4 HOH 12 424 36  HOH HOH B . 
R 4 HOH 13 425 37  HOH HOH B . 
R 4 HOH 14 426 39  HOH HOH B . 
R 4 HOH 15 427 40  HOH HOH B . 
R 4 HOH 16 428 42  HOH HOH B . 
R 4 HOH 17 429 44  HOH HOH B . 
R 4 HOH 18 430 48  HOH HOH B . 
R 4 HOH 19 431 50  HOH HOH B . 
R 4 HOH 20 432 53  HOH HOH B . 
R 4 HOH 21 433 58  HOH HOH B . 
R 4 HOH 22 434 59  HOH HOH B . 
R 4 HOH 23 435 60  HOH HOH B . 
R 4 HOH 24 436 63  HOH HOH B . 
R 4 HOH 25 437 67  HOH HOH B . 
R 4 HOH 26 438 70  HOH HOH B . 
R 4 HOH 27 439 71  HOH HOH B . 
R 4 HOH 28 440 74  HOH HOH B . 
R 4 HOH 29 441 75  HOH HOH B . 
R 4 HOH 30 442 85  HOH HOH B . 
R 4 HOH 31 443 86  HOH HOH B . 
R 4 HOH 32 444 87  HOH HOH B . 
R 4 HOH 33 445 91  HOH HOH B . 
R 4 HOH 34 446 92  HOH HOH B . 
R 4 HOH 35 447 96  HOH HOH B . 
R 4 HOH 36 448 98  HOH HOH B . 
R 4 HOH 37 449 109 HOH HOH B . 
R 4 HOH 38 450 121 HOH HOH B . 
R 4 HOH 39 451 134 HOH HOH B . 
R 4 HOH 40 452 140 HOH HOH B . 
R 4 HOH 41 453 141 HOH HOH B . 
R 4 HOH 42 454 142 HOH HOH B . 
R 4 HOH 43 455 204 HOH HOH B . 
R 4 HOH 44 456 205 HOH HOH B . 
R 4 HOH 45 457 207 HOH HOH B . 
R 4 HOH 46 458 209 HOH HOH B . 
R 4 HOH 47 459 210 HOH HOH B . 
R 4 HOH 48 460 211 HOH HOH B . 
R 4 HOH 49 461 213 HOH HOH B . 
R 4 HOH 50 462 214 HOH HOH B . 
R 4 HOH 51 463 215 HOH HOH B . 
R 4 HOH 52 464 219 HOH HOH B . 
R 4 HOH 53 465 220 HOH HOH B . 
R 4 HOH 54 466 221 HOH HOH B . 
R 4 HOH 55 467 223 HOH HOH B . 
R 4 HOH 56 468 227 HOH HOH B . 
R 4 HOH 57 469 229 HOH HOH B . 
R 4 HOH 58 470 231 HOH HOH B . 
R 4 HOH 59 471 236 HOH HOH B . 
R 4 HOH 60 472 241 HOH HOH B . 
R 4 HOH 61 473 244 HOH HOH B . 
R 4 HOH 62 474 245 HOH HOH B . 
R 4 HOH 63 475 255 HOH HOH B . 
R 4 HOH 64 476 261 HOH HOH B . 
R 4 HOH 65 477 262 HOH HOH B . 
R 4 HOH 66 478 264 HOH HOH B . 
R 4 HOH 67 479 266 HOH HOH B . 
R 4 HOH 68 480 267 HOH HOH B . 
R 4 HOH 69 481 268 HOH HOH B . 
R 4 HOH 70 482 271 HOH HOH B . 
R 4 HOH 71 483 276 HOH HOH B . 
R 4 HOH 72 484 283 HOH HOH B . 
R 4 HOH 73 485 286 HOH HOH B . 
R 4 HOH 74 486 288 HOH HOH B . 
R 4 HOH 75 487 296 HOH HOH B . 
R 4 HOH 76 488 305 HOH HOH B . 
R 4 HOH 77 489 310 HOH HOH B . 
R 4 HOH 78 490 313 HOH HOH B . 
R 4 HOH 79 491 314 HOH HOH B . 
R 4 HOH 80 492 315 HOH HOH B . 
S 4 HOH 1  27  27  HOH HOH D . 
S 4 HOH 2  89  89  HOH HOH D . 
S 4 HOH 3  208 208 HOH HOH D . 
S 4 HOH 4  234 234 HOH HOH D . 
S 4 HOH 5  273 273 HOH HOH D . 
S 4 HOH 6  274 274 HOH HOH D . 
S 4 HOH 7  278 278 HOH HOH D . 
S 4 HOH 8  285 285 HOH HOH D . 
S 4 HOH 9  287 287 HOH HOH D . 
S 4 HOH 10 307 307 HOH HOH D . 
S 4 HOH 11 312 312 HOH HOH D . 
T 4 HOH 1  13  8   HOH HOH P . 
T 4 HOH 2  14  279 HOH HOH P . 
T 4 HOH 3  15  309 HOH HOH P . 
T 4 HOH 4  16  311 HOH HOH P . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    dimeric    2 
2 author_defined_assembly   ?    dimeric    2 
3 software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,F,G,H,Q,T                         
2 1 B,C,I,J,K,L,M,N,O,P,R,S                 
3 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
_pdbx_struct_assembly_prop.biol_id   3 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     5510 
_pdbx_struct_assembly_prop.details   ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-06 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0005 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
AMoRE    phasing           .        ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_1              49 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_2              49 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_3              49 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                101.23 
_pdbx_validate_rmsd_angle.angle_target_value         110.50 
_pdbx_validate_rmsd_angle.angle_deviation            -9.27 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 40  ? ? -35.89  141.55  
2  1 CYS A 70  ? ? -158.53 59.80   
3  1 ASN A 71  ? ? -95.48  54.97   
4  1 ASP A 104 ? ? 37.43   70.73   
5  1 ASN A 141 ? ? 68.08   75.66   
6  1 ALA B 39  ? ? -154.20 -156.16 
7  1 ASP B 58  ? ? -97.27  -158.44 
8  1 CYS B 70  ? ? -156.16 65.63   
9  1 ASN B 71  ? ? -98.42  52.79   
10 1 ARG B 89  ? ? 38.00   47.60   
11 1 ASN B 141 ? ? 69.07   76.63   
12 1 ASP B 152 ? ? -109.28 -161.66 
13 1 TYR B 202 ? ? -139.11 -155.51 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 TYR A 57  ? ? ASP A 58  ? ? 146.03  
2  1 ARG A 103 ? ? ASP A 104 ? ? 113.62  
3  1 ASN A 141 ? ? PRO A 142 ? ? 50.99   
4  1 LEU A 160 ? ? GLY A 161 ? ? -125.65 
5  1 ALA B 39  ? ? GLU B 40  ? ? 143.04  
6  1 ASP B 58  ? ? GLU B 59  ? ? -137.16 
7  1 THR B 63  ? ? ILE B 64  ? ? -141.89 
8  1 ASN B 141 ? ? PRO B 142 ? ? 48.39   
9  1 VAL B 164 ? ? MET B 165 ? ? 132.99  
10 1 TYR B 202 ? ? ARG B 203 ? ? -118.46 
11 1 PRO D 10  ? ? GLN D 11  ? ? -138.11 
12 1 ARG P 8   ? ? LEU P 9   ? ? 95.64   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    ALA 
_pdbx_validate_chiral.auth_seq_id     39 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 40  ? CD  ? A GLU 44  CD  
2  1 Y 1 A GLU 40  ? OE1 ? A GLU 44  OE1 
3  1 Y 1 A GLU 40  ? OE2 ? A GLU 44  OE2 
4  1 Y 1 A ARG 87  ? NE  ? A ARG 91  NE  
5  1 Y 1 A ARG 87  ? CZ  ? A ARG 91  CZ  
6  1 Y 1 A ARG 87  ? NH1 ? A ARG 91  NH1 
7  1 Y 1 A ARG 87  ? NH2 ? A ARG 91  NH2 
8  1 Y 1 A ARG 89  ? NE  ? A ARG 93  NE  
9  1 Y 1 A ARG 89  ? CZ  ? A ARG 93  CZ  
10 1 Y 1 A ARG 89  ? NH1 ? A ARG 93  NH1 
11 1 Y 1 A ARG 89  ? NH2 ? A ARG 93  NH2 
12 1 Y 1 A LYS 133 ? CG  ? A LYS 137 CG  
13 1 Y 1 A LYS 133 ? CD  ? A LYS 137 CD  
14 1 Y 1 A LYS 133 ? CE  ? A LYS 137 CE  
15 1 Y 1 A LYS 133 ? NZ  ? A LYS 137 NZ  
16 1 Y 1 A SER 156 ? OG  ? A SER 160 OG  
17 1 Y 1 B GLU 40  ? CD  ? B GLU 44  CD  
18 1 Y 1 B GLU 40  ? OE1 ? B GLU 44  OE1 
19 1 Y 1 B GLU 40  ? OE2 ? B GLU 44  OE2 
20 1 Y 1 B GLU 52  ? CD  ? B GLU 56  CD  
21 1 Y 1 B GLU 52  ? OE1 ? B GLU 56  OE1 
22 1 Y 1 B GLU 52  ? OE2 ? B GLU 56  OE2 
23 1 Y 1 B GLU 74  ? CD  ? B GLU 78  CD  
24 1 Y 1 B GLU 74  ? OE1 ? B GLU 78  OE1 
25 1 Y 1 B GLU 74  ? OE2 ? B GLU 78  OE2 
26 1 Y 1 B ARG 87  ? NE  ? B ARG 91  NE  
27 1 Y 1 B ARG 87  ? CZ  ? B ARG 91  CZ  
28 1 Y 1 B ARG 87  ? NH1 ? B ARG 91  NH1 
29 1 Y 1 B ARG 87  ? NH2 ? B ARG 91  NH2 
30 1 Y 1 B ARG 89  ? CD  ? B ARG 93  CD  
31 1 Y 1 B ARG 89  ? NE  ? B ARG 93  NE  
32 1 Y 1 B ARG 89  ? CZ  ? B ARG 93  CZ  
33 1 Y 1 B ARG 89  ? NH1 ? B ARG 93  NH1 
34 1 Y 1 B ARG 89  ? NH2 ? B ARG 93  NH2 
35 1 Y 1 B LYS 133 ? CG  ? B LYS 137 CG  
36 1 Y 1 B LYS 133 ? CD  ? B LYS 137 CD  
37 1 Y 1 B LYS 133 ? CE  ? B LYS 137 CE  
38 1 Y 1 B LYS 133 ? NZ  ? B LYS 137 NZ  
39 1 Y 1 B SER 156 ? OG  ? B SER 160 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -3  ? A MET 1   
2  1 Y 1 A VAL -2  ? A VAL 2   
3  1 Y 1 A SER -1  ? A SER 3   
4  1 Y 1 A ALA 0   ? A ALA 4   
5  1 Y 1 A ILE 1   ? A ILE 5   
6  1 Y 1 A VAL 2   ? A VAL 6   
7  1 Y 1 A LEU 3   ? A LEU 7   
8  1 Y 1 A TYR 4   ? A TYR 8   
9  1 Y 1 A VAL 5   ? A VAL 9   
10 1 Y 1 A LEU 6   ? A LEU 10  
11 1 Y 1 A LEU 7   ? A LEU 11  
12 1 Y 1 A ALA 8   ? A ALA 12  
13 1 Y 1 A ALA 9   ? A ALA 13  
14 1 Y 1 A ALA 10  ? A ALA 14  
15 1 Y 1 A ALA 11  ? A ALA 15  
16 1 Y 1 A HIS 12  ? A HIS 16  
17 1 Y 1 A SER 13  ? A SER 17  
18 1 Y 1 A ALA 14  ? A ALA 18  
19 1 Y 1 A PHE 15  ? A PHE 19  
20 1 Y 1 A ALA 16  ? A ALA 20  
21 1 Y 1 A ALA 17  ? A ALA 21  
22 1 Y 1 A MET 18  ? A MET 22  
23 1 Y 1 A VAL 19  ? A VAL 23  
24 1 Y 1 A HIS 20  ? A HIS 24  
25 1 Y 1 A HIS 21  ? A HIS 25  
26 1 Y 1 A HIS 22  ? A HIS 26  
27 1 Y 1 A HIS 23  ? A HIS 27  
28 1 Y 1 A HIS 24  ? A HIS 28  
29 1 Y 1 A HIS 25  ? A HIS 29  
30 1 Y 1 A SER 26  ? A SER 30  
31 1 Y 1 A ALA 27  ? A ALA 31  
32 1 Y 1 A LYS 204 ? A LYS 208 
33 1 Y 1 B MET -3  ? B MET 1   
34 1 Y 1 B VAL -2  ? B VAL 2   
35 1 Y 1 B SER -1  ? B SER 3   
36 1 Y 1 B ALA 0   ? B ALA 4   
37 1 Y 1 B ILE 1   ? B ILE 5   
38 1 Y 1 B VAL 2   ? B VAL 6   
39 1 Y 1 B LEU 3   ? B LEU 7   
40 1 Y 1 B TYR 4   ? B TYR 8   
41 1 Y 1 B VAL 5   ? B VAL 9   
42 1 Y 1 B LEU 6   ? B LEU 10  
43 1 Y 1 B LEU 7   ? B LEU 11  
44 1 Y 1 B ALA 8   ? B ALA 12  
45 1 Y 1 B ALA 9   ? B ALA 13  
46 1 Y 1 B ALA 10  ? B ALA 14  
47 1 Y 1 B ALA 11  ? B ALA 15  
48 1 Y 1 B HIS 12  ? B HIS 16  
49 1 Y 1 B SER 13  ? B SER 17  
50 1 Y 1 B ALA 14  ? B ALA 18  
51 1 Y 1 B PHE 15  ? B PHE 19  
52 1 Y 1 B ALA 16  ? B ALA 20  
53 1 Y 1 B ALA 17  ? B ALA 21  
54 1 Y 1 B MET 18  ? B MET 22  
55 1 Y 1 B VAL 19  ? B VAL 23  
56 1 Y 1 B HIS 20  ? B HIS 24  
57 1 Y 1 B HIS 21  ? B HIS 25  
58 1 Y 1 B HIS 22  ? B HIS 26  
59 1 Y 1 B HIS 23  ? B HIS 27  
60 1 Y 1 B HIS 24  ? B HIS 28  
61 1 Y 1 B HIS 25  ? B HIS 29  
62 1 Y 1 B SER 26  ? B SER 30  
63 1 Y 1 B ALA 27  ? B ALA 31  
64 1 Y 1 B LYS 204 ? B LYS 208 
65 1 Y 1 D HIS 12  ? C HIS 12  
66 1 Y 1 P PRO 10  ? D PRO 10  
67 1 Y 1 P GLN 11  ? D GLN 11  
68 1 Y 1 P HIS 12  ? D HIS 12  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#