data_2QC8
# 
_entry.id   2QC8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QC8         
RCSB  RCSB043416   
WWPDB D_1000043416 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2OJW 
_pdbx_database_related.details        'Crystal structure of human glutamine synthetase in complex with ADP and phosphate' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2QC8 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karlberg, T.'                         1  
'Lehtio, L.'                           2  
'Arrowsmith, C.H.'                     3  
'Berglund, H.'                         4  
'Busam, R.D.'                          5  
'Collins, R.'                          6  
'Dahlgren, L.G.'                       7  
'Edwards, A.'                          8  
'Flodin, S.'                           9  
'Flores, A.'                           10 
'Graslund, S.'                         11 
'Hammarstrom, M.'                      12 
'Hogbom, M.'                           13 
'Johansson, I.'                        14 
'Kallas, A.'                           15 
'Kotenyova, T.'                        16 
'Moche, M.'                            17 
'Nordlund, P.'                         18 
'Nyman, T.'                            19 
'Persson, C.'                          20 
'Sagemark, J.'                         21 
'Sundstrom, M.'                        22 
'Thorsell, A.G.'                       23 
'Van Den Berg, S.'                     24 
'Weigelt, J.'                          25 
'Holmberg-Schiavone, L.'               26 
'Structural Genomics Consortium (SGC)' 27 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            375 
_citation.page_first                217 
_citation.page_last                 228 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18005987 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.10.029 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Krajewski, W.W.'        1 
primary 'Collins, R.'            2 
primary 'Holmberg-Schiavone, L.' 3 
primary 'Jones, T.A.'            4 
primary 'Karlberg, T.'           5 
primary 'Mowbray, S.L.'          6 
# 
_cell.entry_id           2QC8 
_cell.length_a           181.210 
_cell.length_b           126.080 
_cell.length_c           188.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.14 
_cell.angle_gamma        90.00 
_cell.Z_PDB              40 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QC8 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glutamine synthetase'                 43364.773 10  6.3.1.2 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'                   54.938    30  ?       ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                         35.453    10  ?       ? ? ? 
4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"             427.201   10  ?       ? ? ? 
5 non-polymer syn 'L-METHIONINE-S-SULFOXIMINE PHOSPHATE' 260.205   10  ?       ? ? ? 
6 water       nat water                                  18.015    231 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glutamate-ammonia ligase, GS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWN
FDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMG
TDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVA
RFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLT
GFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWN
FDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMG
TDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVA
RFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLT
GFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  ALA n 
1 25  SER n 
1 26  SER n 
1 27  HIS n 
1 28  LEU n 
1 29  ASN n 
1 30  LYS n 
1 31  GLY n 
1 32  ILE n 
1 33  LYS n 
1 34  GLN n 
1 35  VAL n 
1 36  TYR n 
1 37  MET n 
1 38  SER n 
1 39  LEU n 
1 40  PRO n 
1 41  GLN n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  VAL n 
1 46  GLN n 
1 47  ALA n 
1 48  MET n 
1 49  TYR n 
1 50  ILE n 
1 51  TRP n 
1 52  ILE n 
1 53  ASP n 
1 54  GLY n 
1 55  THR n 
1 56  GLY n 
1 57  GLU n 
1 58  GLY n 
1 59  LEU n 
1 60  ARG n 
1 61  CYS n 
1 62  LYS n 
1 63  THR n 
1 64  ARG n 
1 65  THR n 
1 66  LEU n 
1 67  ASP n 
1 68  SER n 
1 69  GLU n 
1 70  PRO n 
1 71  LYS n 
1 72  CYS n 
1 73  VAL n 
1 74  GLU n 
1 75  GLU n 
1 76  LEU n 
1 77  PRO n 
1 78  GLU n 
1 79  TRP n 
1 80  ASN n 
1 81  PHE n 
1 82  ASP n 
1 83  GLY n 
1 84  SER n 
1 85  SER n 
1 86  THR n 
1 87  LEU n 
1 88  GLN n 
1 89  SER n 
1 90  GLU n 
1 91  GLY n 
1 92  SER n 
1 93  ASN n 
1 94  SER n 
1 95  ASP n 
1 96  MET n 
1 97  TYR n 
1 98  LEU n 
1 99  VAL n 
1 100 PRO n 
1 101 ALA n 
1 102 ALA n 
1 103 MET n 
1 104 PHE n 
1 105 ARG n 
1 106 ASP n 
1 107 PRO n 
1 108 PHE n 
1 109 ARG n 
1 110 LYS n 
1 111 ASP n 
1 112 PRO n 
1 113 ASN n 
1 114 LYS n 
1 115 LEU n 
1 116 VAL n 
1 117 LEU n 
1 118 CYS n 
1 119 GLU n 
1 120 VAL n 
1 121 PHE n 
1 122 LYS n 
1 123 TYR n 
1 124 ASN n 
1 125 ARG n 
1 126 ARG n 
1 127 PRO n 
1 128 ALA n 
1 129 GLU n 
1 130 THR n 
1 131 ASN n 
1 132 LEU n 
1 133 ARG n 
1 134 HIS n 
1 135 THR n 
1 136 CYS n 
1 137 LYS n 
1 138 ARG n 
1 139 ILE n 
1 140 MET n 
1 141 ASP n 
1 142 MET n 
1 143 VAL n 
1 144 SER n 
1 145 ASN n 
1 146 GLN n 
1 147 HIS n 
1 148 PRO n 
1 149 TRP n 
1 150 PHE n 
1 151 GLY n 
1 152 MET n 
1 153 GLU n 
1 154 GLN n 
1 155 GLU n 
1 156 TYR n 
1 157 THR n 
1 158 LEU n 
1 159 MET n 
1 160 GLY n 
1 161 THR n 
1 162 ASP n 
1 163 GLY n 
1 164 HIS n 
1 165 PRO n 
1 166 PHE n 
1 167 GLY n 
1 168 TRP n 
1 169 PRO n 
1 170 SER n 
1 171 ASN n 
1 172 GLY n 
1 173 PHE n 
1 174 PRO n 
1 175 GLY n 
1 176 PRO n 
1 177 GLN n 
1 178 GLY n 
1 179 PRO n 
1 180 TYR n 
1 181 TYR n 
1 182 CYS n 
1 183 GLY n 
1 184 VAL n 
1 185 GLY n 
1 186 ALA n 
1 187 ASP n 
1 188 ARG n 
1 189 ALA n 
1 190 TYR n 
1 191 GLY n 
1 192 ARG n 
1 193 ASP n 
1 194 ILE n 
1 195 VAL n 
1 196 GLU n 
1 197 ALA n 
1 198 HIS n 
1 199 TYR n 
1 200 ARG n 
1 201 ALA n 
1 202 CYS n 
1 203 LEU n 
1 204 TYR n 
1 205 ALA n 
1 206 GLY n 
1 207 VAL n 
1 208 LYS n 
1 209 ILE n 
1 210 ALA n 
1 211 GLY n 
1 212 THR n 
1 213 ASN n 
1 214 ALA n 
1 215 GLU n 
1 216 VAL n 
1 217 MET n 
1 218 PRO n 
1 219 ALA n 
1 220 GLN n 
1 221 TRP n 
1 222 GLU n 
1 223 PHE n 
1 224 GLN n 
1 225 ILE n 
1 226 GLY n 
1 227 PRO n 
1 228 CYS n 
1 229 GLU n 
1 230 GLY n 
1 231 ILE n 
1 232 SER n 
1 233 MET n 
1 234 GLY n 
1 235 ASP n 
1 236 HIS n 
1 237 LEU n 
1 238 TRP n 
1 239 VAL n 
1 240 ALA n 
1 241 ARG n 
1 242 PHE n 
1 243 ILE n 
1 244 LEU n 
1 245 HIS n 
1 246 ARG n 
1 247 VAL n 
1 248 CYS n 
1 249 GLU n 
1 250 ASP n 
1 251 PHE n 
1 252 GLY n 
1 253 VAL n 
1 254 ILE n 
1 255 ALA n 
1 256 THR n 
1 257 PHE n 
1 258 ASP n 
1 259 PRO n 
1 260 LYS n 
1 261 PRO n 
1 262 ILE n 
1 263 PRO n 
1 264 GLY n 
1 265 ASN n 
1 266 TRP n 
1 267 ASN n 
1 268 GLY n 
1 269 ALA n 
1 270 GLY n 
1 271 CYS n 
1 272 HIS n 
1 273 THR n 
1 274 ASN n 
1 275 PHE n 
1 276 SER n 
1 277 THR n 
1 278 LYS n 
1 279 ALA n 
1 280 MET n 
1 281 ARG n 
1 282 GLU n 
1 283 GLU n 
1 284 ASN n 
1 285 GLY n 
1 286 LEU n 
1 287 LYS n 
1 288 TYR n 
1 289 ILE n 
1 290 GLU n 
1 291 GLU n 
1 292 ALA n 
1 293 ILE n 
1 294 GLU n 
1 295 LYS n 
1 296 LEU n 
1 297 SER n 
1 298 LYS n 
1 299 ARG n 
1 300 HIS n 
1 301 GLN n 
1 302 TYR n 
1 303 HIS n 
1 304 ILE n 
1 305 ARG n 
1 306 ALA n 
1 307 TYR n 
1 308 ASP n 
1 309 PRO n 
1 310 LYS n 
1 311 GLY n 
1 312 GLY n 
1 313 LEU n 
1 314 ASP n 
1 315 ASN n 
1 316 ALA n 
1 317 ARG n 
1 318 ARG n 
1 319 LEU n 
1 320 THR n 
1 321 GLY n 
1 322 PHE n 
1 323 HIS n 
1 324 GLU n 
1 325 THR n 
1 326 SER n 
1 327 ASN n 
1 328 ILE n 
1 329 ASN n 
1 330 ASP n 
1 331 PHE n 
1 332 SER n 
1 333 ALA n 
1 334 GLY n 
1 335 VAL n 
1 336 ALA n 
1 337 ASN n 
1 338 ARG n 
1 339 SER n 
1 340 ALA n 
1 341 SER n 
1 342 ILE n 
1 343 ARG n 
1 344 ILE n 
1 345 PRO n 
1 346 ARG n 
1 347 THR n 
1 348 VAL n 
1 349 GLY n 
1 350 GLN n 
1 351 GLU n 
1 352 LYS n 
1 353 LYS n 
1 354 GLY n 
1 355 TYR n 
1 356 PHE n 
1 357 GLU n 
1 358 ASP n 
1 359 ARG n 
1 360 ARG n 
1 361 PRO n 
1 362 SER n 
1 363 ALA n 
1 364 ASN n 
1 365 CYS n 
1 366 ASP n 
1 367 PRO n 
1 368 PHE n 
1 369 SER n 
1 370 VAL n 
1 371 THR n 
1 372 GLU n 
1 373 ALA n 
1 374 LEU n 
1 375 ILE n 
1 376 ARG n 
1 377 THR n 
1 378 CYS n 
1 379 LEU n 
1 380 LEU n 
1 381 ASN n 
1 382 GLU n 
1 383 THR n 
1 384 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'GLUL, GLNS' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)gold pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLNA_HUMAN 
_struct_ref.pdbx_db_accession          P15104 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAM
FRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCG
VGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIP
GNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIR
IPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2QC8 A 24 ? 384 ? P15104 5 ? 365 ? 5 365 
2  1 2QC8 B 24 ? 384 ? P15104 5 ? 365 ? 5 365 
3  1 2QC8 C 24 ? 384 ? P15104 5 ? 365 ? 5 365 
4  1 2QC8 D 24 ? 384 ? P15104 5 ? 365 ? 5 365 
5  1 2QC8 E 24 ? 384 ? P15104 5 ? 365 ? 5 365 
6  1 2QC8 F 24 ? 384 ? P15104 5 ? 365 ? 5 365 
7  1 2QC8 G 24 ? 384 ? P15104 5 ? 365 ? 5 365 
8  1 2QC8 H 24 ? 384 ? P15104 5 ? 365 ? 5 365 
9  1 2QC8 I 24 ? 384 ? P15104 5 ? 365 ? 5 365 
10 1 2QC8 J 24 ? 384 ? P15104 5 ? 365 ? 5 365 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2QC8 MET A 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 1   
1  2QC8 HIS A 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 2   
1  2QC8 HIS A 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 3   
1  2QC8 HIS A 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 4   
1  2QC8 HIS A 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 5   
1  2QC8 HIS A 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 6   
1  2QC8 HIS A 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 7   
1  2QC8 SER A 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 8   
1  2QC8 SER A 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 9   
1  2QC8 GLY A 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  10  
1  2QC8 VAL A 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  11  
1  2QC8 ASP A 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  12  
1  2QC8 LEU A 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  13  
1  2QC8 GLY A 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  14  
1  2QC8 THR A 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  15  
1  2QC8 GLU A 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  16  
1  2QC8 ASN A 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  17  
1  2QC8 LEU A 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  18  
1  2QC8 TYR A 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   19  
1  2QC8 PHE A 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   20  
1  2QC8 GLN A 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   21  
1  2QC8 SER A 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   22  
1  2QC8 MET A 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   23  
2  2QC8 MET B 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 24  
2  2QC8 HIS B 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 25  
2  2QC8 HIS B 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 26  
2  2QC8 HIS B 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 27  
2  2QC8 HIS B 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 28  
2  2QC8 HIS B 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 29  
2  2QC8 HIS B 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 30  
2  2QC8 SER B 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 31  
2  2QC8 SER B 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 32  
2  2QC8 GLY B 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  33  
2  2QC8 VAL B 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  34  
2  2QC8 ASP B 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  35  
2  2QC8 LEU B 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  36  
2  2QC8 GLY B 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  37  
2  2QC8 THR B 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  38  
2  2QC8 GLU B 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  39  
2  2QC8 ASN B 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  40  
2  2QC8 LEU B 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  41  
2  2QC8 TYR B 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   42  
2  2QC8 PHE B 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   43  
2  2QC8 GLN B 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   44  
2  2QC8 SER B 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   45  
2  2QC8 MET B 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   46  
3  2QC8 MET C 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 47  
3  2QC8 HIS C 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 48  
3  2QC8 HIS C 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 49  
3  2QC8 HIS C 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 50  
3  2QC8 HIS C 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 51  
3  2QC8 HIS C 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 52  
3  2QC8 HIS C 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 53  
3  2QC8 SER C 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 54  
3  2QC8 SER C 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 55  
3  2QC8 GLY C 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  56  
3  2QC8 VAL C 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  57  
3  2QC8 ASP C 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  58  
3  2QC8 LEU C 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  59  
3  2QC8 GLY C 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  60  
3  2QC8 THR C 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  61  
3  2QC8 GLU C 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  62  
3  2QC8 ASN C 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  63  
3  2QC8 LEU C 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  64  
3  2QC8 TYR C 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   65  
3  2QC8 PHE C 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   66  
3  2QC8 GLN C 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   67  
3  2QC8 SER C 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   68  
3  2QC8 MET C 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   69  
4  2QC8 MET D 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 70  
4  2QC8 HIS D 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 71  
4  2QC8 HIS D 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 72  
4  2QC8 HIS D 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 73  
4  2QC8 HIS D 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 74  
4  2QC8 HIS D 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 75  
4  2QC8 HIS D 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 76  
4  2QC8 SER D 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 77  
4  2QC8 SER D 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 78  
4  2QC8 GLY D 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  79  
4  2QC8 VAL D 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  80  
4  2QC8 ASP D 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  81  
4  2QC8 LEU D 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  82  
4  2QC8 GLY D 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  83  
4  2QC8 THR D 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  84  
4  2QC8 GLU D 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  85  
4  2QC8 ASN D 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  86  
4  2QC8 LEU D 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  87  
4  2QC8 TYR D 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   88  
4  2QC8 PHE D 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   89  
4  2QC8 GLN D 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   90  
4  2QC8 SER D 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   91  
4  2QC8 MET D 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   92  
5  2QC8 MET E 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 93  
5  2QC8 HIS E 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 94  
5  2QC8 HIS E 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 95  
5  2QC8 HIS E 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 96  
5  2QC8 HIS E 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 97  
5  2QC8 HIS E 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 98  
5  2QC8 HIS E 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 99  
5  2QC8 SER E 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 100 
5  2QC8 SER E 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 101 
5  2QC8 GLY E 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  102 
5  2QC8 VAL E 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  103 
5  2QC8 ASP E 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  104 
5  2QC8 LEU E 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  105 
5  2QC8 GLY E 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  106 
5  2QC8 THR E 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  107 
5  2QC8 GLU E 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  108 
5  2QC8 ASN E 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  109 
5  2QC8 LEU E 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  110 
5  2QC8 TYR E 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   111 
5  2QC8 PHE E 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   112 
5  2QC8 GLN E 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   113 
5  2QC8 SER E 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   114 
5  2QC8 MET E 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   115 
6  2QC8 MET F 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 116 
6  2QC8 HIS F 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 117 
6  2QC8 HIS F 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 118 
6  2QC8 HIS F 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 119 
6  2QC8 HIS F 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 120 
6  2QC8 HIS F 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 121 
6  2QC8 HIS F 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 122 
6  2QC8 SER F 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 123 
6  2QC8 SER F 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 124 
6  2QC8 GLY F 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  125 
6  2QC8 VAL F 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  126 
6  2QC8 ASP F 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  127 
6  2QC8 LEU F 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  128 
6  2QC8 GLY F 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  129 
6  2QC8 THR F 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  130 
6  2QC8 GLU F 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  131 
6  2QC8 ASN F 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  132 
6  2QC8 LEU F 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  133 
6  2QC8 TYR F 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   134 
6  2QC8 PHE F 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   135 
6  2QC8 GLN F 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   136 
6  2QC8 SER F 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   137 
6  2QC8 MET F 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   138 
7  2QC8 MET G 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 139 
7  2QC8 HIS G 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 140 
7  2QC8 HIS G 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 141 
7  2QC8 HIS G 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 142 
7  2QC8 HIS G 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 143 
7  2QC8 HIS G 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 144 
7  2QC8 HIS G 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 145 
7  2QC8 SER G 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 146 
7  2QC8 SER G 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 147 
7  2QC8 GLY G 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  148 
7  2QC8 VAL G 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  149 
7  2QC8 ASP G 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  150 
7  2QC8 LEU G 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  151 
7  2QC8 GLY G 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  152 
7  2QC8 THR G 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  153 
7  2QC8 GLU G 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  154 
7  2QC8 ASN G 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  155 
7  2QC8 LEU G 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  156 
7  2QC8 TYR G 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   157 
7  2QC8 PHE G 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   158 
7  2QC8 GLN G 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   159 
7  2QC8 SER G 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   160 
7  2QC8 MET G 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   161 
8  2QC8 MET H 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 162 
8  2QC8 HIS H 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 163 
8  2QC8 HIS H 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 164 
8  2QC8 HIS H 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 165 
8  2QC8 HIS H 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 166 
8  2QC8 HIS H 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 167 
8  2QC8 HIS H 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 168 
8  2QC8 SER H 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 169 
8  2QC8 SER H 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 170 
8  2QC8 GLY H 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  171 
8  2QC8 VAL H 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  172 
8  2QC8 ASP H 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  173 
8  2QC8 LEU H 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  174 
8  2QC8 GLY H 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  175 
8  2QC8 THR H 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  176 
8  2QC8 GLU H 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  177 
8  2QC8 ASN H 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  178 
8  2QC8 LEU H 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  179 
8  2QC8 TYR H 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   180 
8  2QC8 PHE H 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   181 
8  2QC8 GLN H 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   182 
8  2QC8 SER H 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   183 
8  2QC8 MET H 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   184 
9  2QC8 MET I 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 185 
9  2QC8 HIS I 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 186 
9  2QC8 HIS I 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 187 
9  2QC8 HIS I 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 188 
9  2QC8 HIS I 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 189 
9  2QC8 HIS I 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 190 
9  2QC8 HIS I 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 191 
9  2QC8 SER I 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 192 
9  2QC8 SER I 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 193 
9  2QC8 GLY I 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  194 
9  2QC8 VAL I 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  195 
9  2QC8 ASP I 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  196 
9  2QC8 LEU I 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  197 
9  2QC8 GLY I 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  198 
9  2QC8 THR I 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  199 
9  2QC8 GLU I 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  200 
9  2QC8 ASN I 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  201 
9  2QC8 LEU I 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  202 
9  2QC8 TYR I 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   203 
9  2QC8 PHE I 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   204 
9  2QC8 GLN I 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   205 
9  2QC8 SER I 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   206 
9  2QC8 MET I 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   207 
10 2QC8 MET J 1  ? UNP P15104 ? ? 'EXPRESSION TAG' -18 208 
10 2QC8 HIS J 2  ? UNP P15104 ? ? 'EXPRESSION TAG' -17 209 
10 2QC8 HIS J 3  ? UNP P15104 ? ? 'EXPRESSION TAG' -16 210 
10 2QC8 HIS J 4  ? UNP P15104 ? ? 'EXPRESSION TAG' -15 211 
10 2QC8 HIS J 5  ? UNP P15104 ? ? 'EXPRESSION TAG' -14 212 
10 2QC8 HIS J 6  ? UNP P15104 ? ? 'EXPRESSION TAG' -13 213 
10 2QC8 HIS J 7  ? UNP P15104 ? ? 'EXPRESSION TAG' -12 214 
10 2QC8 SER J 8  ? UNP P15104 ? ? 'EXPRESSION TAG' -11 215 
10 2QC8 SER J 9  ? UNP P15104 ? ? 'EXPRESSION TAG' -10 216 
10 2QC8 GLY J 10 ? UNP P15104 ? ? 'EXPRESSION TAG' -9  217 
10 2QC8 VAL J 11 ? UNP P15104 ? ? 'EXPRESSION TAG' -8  218 
10 2QC8 ASP J 12 ? UNP P15104 ? ? 'EXPRESSION TAG' -7  219 
10 2QC8 LEU J 13 ? UNP P15104 ? ? 'EXPRESSION TAG' -6  220 
10 2QC8 GLY J 14 ? UNP P15104 ? ? 'EXPRESSION TAG' -5  221 
10 2QC8 THR J 15 ? UNP P15104 ? ? 'EXPRESSION TAG' -4  222 
10 2QC8 GLU J 16 ? UNP P15104 ? ? 'EXPRESSION TAG' -3  223 
10 2QC8 ASN J 17 ? UNP P15104 ? ? 'EXPRESSION TAG' -2  224 
10 2QC8 LEU J 18 ? UNP P15104 ? ? 'EXPRESSION TAG' -1  225 
10 2QC8 TYR J 19 ? UNP P15104 ? ? 'EXPRESSION TAG' 0   226 
10 2QC8 PHE J 20 ? UNP P15104 ? ? 'EXPRESSION TAG' 1   227 
10 2QC8 GLN J 21 ? UNP P15104 ? ? 'EXPRESSION TAG' 2   228 
10 2QC8 SER J 22 ? UNP P15104 ? ? 'EXPRESSION TAG' 3   229 
10 2QC8 MET J 23 ? UNP P15104 ? ? 'EXPRESSION TAG' 4   230 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"             ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                         ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                   ? 'Mn 2'              54.938  
P3S non-polymer         . 'L-METHIONINE-S-SULFOXIMINE PHOSPHATE' ? 'C5 H13 N2 O6 P S'  260.205 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2QC8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_details    
'1.1M Sodium malonate, 0.5% Jeffamine ED-2001, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 7.00' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-02-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00595 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             1.00595 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2QC8 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   129787 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.12000 
_reflns.pdbx_Rsym_value              0.09200 
_reflns.pdbx_netI_over_sigmaI        15.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.500 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.52600 
_reflns_shell.pdbx_Rsym_value        0.32400 
_reflns_shell.meanI_over_sigI_obs    4.100 
_reflns_shell.pdbx_redundancy        7.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2QC8 
_refine.ls_number_reflns_obs                     123433 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.94 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.168 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.166 
_refine.ls_R_factor_R_free                       0.217 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  6497 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.916 
_refine.B_iso_mean                               37.49 
_refine.aniso_B[1][1]                            0.00000 
_refine.aniso_B[2][2]                            0.00000 
_refine.aniso_B[3][3]                            0.00000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2OJW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.827 
_refine.pdbx_overall_ESU_R_Free                  0.277 
_refine.overall_SU_ML                            0.187 
_refine.overall_SU_B                             17.298 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28146 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         460 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               28837 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        39.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.022  ? 29330 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 20417 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.592  1.959  ? 39745 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.943  3.000  ? 49193 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       11.089 5.000  ? 3549  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.616 23.403 ? 1440  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.998 15.000 ? 4740  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.467 15.000 ? 240   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.100  0.200  ? 4020  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 32893 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 6259  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.213  0.200  ? 6220  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.202  0.200  ? 21699 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.186  0.200  ? 14173 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.086  0.200  ? 15102 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.141  0.200  ? 874   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.438  0.200  ? 32    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.293  0.200  ? 42    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.087  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.720  1.500  ? 22600 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.133  1.500  ? 7237  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.893  2.000  ? 28445 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.491  3.000  ? 13824 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.178  4.500  ? 11300 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  A 1732 0.13 0.05  'tight positional'  1 'X-RAY DIFFRACTION' 1  ? ? ? 
2  B 1732 0.13 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 2  ? ? ? 
3  C 1732 0.11 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 3  ? ? ? 
4  D 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 4  ? ? ? 
5  E 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 5  ? ? ? 
6  F 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 6  ? ? ? 
7  G 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 7  ? ? ? 
8  H 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 8  ? ? ? 
9  I 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 9  ? ? ? 
10 J 1732 0.12 0.00  'tight positional'  1 'X-RAY DIFFRACTION' 10 ? ? ? 
1  A 713  0.16 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 11 ? ? ? 
2  B 713  0.18 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 12 ? ? ? 
3  C 713  0.15 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 13 ? ? ? 
4  D 713  0.14 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 14 ? ? ? 
5  E 713  0.14 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 15 ? ? ? 
6  F 713  0.15 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 16 ? ? ? 
7  G 713  0.17 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 17 ? ? ? 
8  H 713  0.17 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 18 ? ? ? 
9  I 713  0.14 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 19 ? ? ? 
10 J 713  0.15 0.00  'medium positional' 1 'X-RAY DIFFRACTION' 20 ? ? ? 
1  A 2309 0.19 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 21 ? ? ? 
2  B 2309 0.24 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 22 ? ? ? 
3  C 2309 0.18 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 23 ? ? ? 
4  D 2309 0.18 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 24 ? ? ? 
5  E 2309 0.19 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 25 ? ? ? 
6  F 2309 0.20 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 26 ? ? ? 
7  G 2309 0.19 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 27 ? ? ? 
8  H 2309 0.18 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 28 ? ? ? 
9  I 2309 0.24 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 29 ? ? ? 
10 J 2309 0.21 0.00  'loose positional'  1 'X-RAY DIFFRACTION' 30 ? ? ? 
1  A 1732 0.42 0.50  'tight thermal'     1 'X-RAY DIFFRACTION' 31 ? ? ? 
2  B 1732 0.47 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 32 ? ? ? 
3  C 1732 0.48 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 33 ? ? ? 
4  D 1732 0.42 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 34 ? ? ? 
5  E 1732 0.42 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 35 ? ? ? 
6  F 1732 0.33 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 36 ? ? ? 
7  G 1732 0.31 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 37 ? ? ? 
8  H 1732 0.35 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 38 ? ? ? 
9  I 1732 0.35 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 39 ? ? ? 
10 J 1732 0.30 0.00  'tight thermal'     1 'X-RAY DIFFRACTION' 40 ? ? ? 
1  A 713  0.46 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 41 ? ? ? 
2  B 713  0.53 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 42 ? ? ? 
3  C 713  0.55 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 43 ? ? ? 
4  D 713  0.48 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 44 ? ? ? 
5  E 713  0.48 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 45 ? ? ? 
6  F 713  0.31 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 46 ? ? ? 
7  G 713  0.34 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 47 ? ? ? 
8  H 713  0.35 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 48 ? ? ? 
9  I 713  0.35 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 49 ? ? ? 
10 J 713  0.40 0.00  'medium thermal'    1 'X-RAY DIFFRACTION' 50 ? ? ? 
1  A 2309 0.59 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 51 ? ? ? 
2  B 2309 0.65 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 52 ? ? ? 
3  C 2309 0.68 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 53 ? ? ? 
4  D 2309 0.61 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 54 ? ? ? 
5  E 2309 0.62 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 55 ? ? ? 
6  F 2309 0.47 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 56 ? ? ? 
7  G 2309 0.46 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 57 ? ? ? 
8  H 2309 0.48 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 58 ? ? ? 
9  I 2309 0.48 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 59 ? ? ? 
10 J 2309 0.47 0.00  'loose thermal'     1 'X-RAY DIFFRACTION' 60 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.67 
_refine_ls_shell.number_reflns_R_work             9094 
_refine_ls_shell.R_factor_R_work                  0.2390 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.3000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             479 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  C 
1 4  D 
1 5  E 
1 6  F 
1 7  G 
1 8  H 
1 9  I 
1 10 J 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  A 10  A 54  1 3 A ASN 29  ? A VAL 73  ? 1 ? 
2  B 10  B 54  1 3 B ASN 29  ? B VAL 73  ? 1 ? 
3  C 10  C 54  1 3 C ASN 29  ? C VAL 73  ? 1 ? 
4  D 10  D 54  1 3 D ASN 29  ? D VAL 73  ? 1 ? 
5  E 10  E 54  1 3 E ASN 29  ? E VAL 73  ? 1 ? 
6  F 10  F 54  1 3 F ASN 29  ? F VAL 73  ? 1 ? 
7  G 10  G 54  1 3 G ASN 29  ? G VAL 73  ? 1 ? 
8  H 10  H 54  1 3 H ASN 29  ? H VAL 73  ? 1 ? 
9  I 10  I 54  1 3 I ASN 29  ? I VAL 73  ? 1 ? 
10 J 10  J 54  1 3 J ASN 29  ? J VAL 73  ? 1 ? 
1  A 56  A 106 2 3 A GLU 75  ? A ARG 125 ? 1 ? 
2  B 56  B 106 2 3 B GLU 75  ? B ARG 125 ? 1 ? 
3  C 56  C 106 2 3 C GLU 75  ? C ARG 125 ? 1 ? 
4  D 56  D 106 2 3 D GLU 75  ? D ARG 125 ? 1 ? 
5  E 56  E 106 2 3 E GLU 75  ? E ARG 125 ? 1 ? 
6  F 56  F 106 2 3 F GLU 75  ? F ARG 125 ? 1 ? 
7  G 56  G 106 2 3 G GLU 75  ? G ARG 125 ? 1 ? 
8  H 56  H 106 2 3 H GLU 75  ? H ARG 125 ? 1 ? 
9  I 56  I 106 2 3 I GLU 75  ? I ARG 125 ? 1 ? 
10 J 56  J 106 2 3 J GLU 75  ? J ARG 125 ? 1 ? 
1  A 108 A 122 3 3 A PRO 127 ? A ASP 141 ? 1 ? 
2  B 108 B 122 3 3 B PRO 127 ? B ASP 141 ? 1 ? 
3  C 108 C 122 3 3 C PRO 127 ? C ASP 141 ? 1 ? 
4  D 108 D 122 3 3 D PRO 127 ? D ASP 141 ? 1 ? 
5  E 108 E 122 3 3 E PRO 127 ? E ASP 141 ? 1 ? 
6  F 108 F 122 3 3 F PRO 127 ? F ASP 141 ? 1 ? 
7  G 108 G 122 3 3 G PRO 127 ? G ASP 141 ? 1 ? 
8  H 108 H 122 3 3 H PRO 127 ? H ASP 141 ? 1 ? 
9  I 108 I 122 3 3 I PRO 127 ? I ASP 141 ? 1 ? 
10 J 108 J 122 3 3 J PRO 127 ? J ASP 141 ? 1 ? 
1  A 124 A 281 4 3 A VAL 143 ? A HIS 300 ? 1 ? 
2  B 124 B 281 4 3 B VAL 143 ? B HIS 300 ? 1 ? 
3  C 124 C 281 4 3 C VAL 143 ? C HIS 300 ? 1 ? 
4  D 124 D 281 4 3 D VAL 143 ? D HIS 300 ? 1 ? 
5  E 124 E 281 4 3 E VAL 143 ? E HIS 300 ? 1 ? 
6  F 124 F 281 4 3 F VAL 143 ? F HIS 300 ? 1 ? 
7  G 124 G 281 4 3 G VAL 143 ? G HIS 300 ? 1 ? 
8  H 124 H 281 4 3 H VAL 143 ? H HIS 300 ? 1 ? 
9  I 124 I 281 4 3 I VAL 143 ? I HIS 300 ? 1 ? 
10 J 124 J 281 4 3 J VAL 143 ? J HIS 300 ? 1 ? 
1  A 283 A 310 5 3 A TYR 302 ? A ASN 329 ? 1 ? 
2  B 283 B 310 5 3 B TYR 302 ? B ASN 329 ? 1 ? 
3  C 283 C 310 5 3 C TYR 302 ? C ASN 329 ? 1 ? 
4  D 283 D 310 5 3 D TYR 302 ? D ASN 329 ? 1 ? 
5  E 283 E 310 5 3 E TYR 302 ? E ASN 329 ? 1 ? 
6  F 283 F 310 5 3 F TYR 302 ? F ASN 329 ? 1 ? 
7  G 283 G 310 5 3 G TYR 302 ? G ASN 329 ? 1 ? 
8  H 283 H 310 5 3 H TYR 302 ? H ASN 329 ? 1 ? 
9  I 283 I 310 5 3 I TYR 302 ? I ASN 329 ? 1 ? 
10 J 283 J 310 5 3 J TYR 302 ? J ASN 329 ? 1 ? 
1  A 312 A 365 6 4 A PHE 331 ? A GLY 384 ? 1 ? 
2  B 312 B 365 6 4 B PHE 331 ? B GLY 384 ? 1 ? 
3  C 312 C 365 6 4 C PHE 331 ? C GLY 384 ? 1 ? 
4  D 312 D 365 6 4 D PHE 331 ? D GLY 384 ? 1 ? 
5  E 312 E 364 6 4 E PHE 331 ? E THR 383 ? 1 ? 
6  F 312 F 365 6 4 F PHE 331 ? F GLY 384 ? 1 ? 
7  G 312 G 365 6 4 G PHE 331 ? G GLY 384 ? 1 ? 
8  H 312 H 365 6 4 H PHE 331 ? H GLY 384 ? 1 ? 
9  I 312 I 365 6 4 I PHE 331 ? I GLY 384 ? 1 ? 
10 J 312 J 365 6 4 J PHE 331 ? J GLY 384 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2QC8 
_struct.title                     
'Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate' 
_struct.pdbx_descriptor           'Glutamine synthetase (E.C.6.3.1.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QC8 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
'Amino-acid biosynthesis, Ligase, Synthetase, Structural Genomics, Structural Genomics Consortium, SGC' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 5 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 3 ? 
HA N N 4 ? 
IA N N 5 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 4 ? 
NA N N 5 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 3 ? 
SA N N 4 ? 
TA N N 5 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 4 ? 
AB N N 5 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 4 ? 
FB N N 5 ? 
GB N N 2 ? 
HB N N 2 ? 
IB N N 2 ? 
JB N N 3 ? 
KB N N 4 ? 
LB N N 5 ? 
MB N N 2 ? 
NB N N 2 ? 
OB N N 2 ? 
PB N N 3 ? 
QB N N 4 ? 
RB N N 5 ? 
SB N N 6 ? 
TB N N 6 ? 
UB N N 6 ? 
VB N N 6 ? 
WB N N 6 ? 
XB N N 6 ? 
YB N N 6 ? 
ZB N N 6 ? 
AC N N 6 ? 
BC N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASN A 29  ? SER A 38  ? ASN A 10  SER A 19  1 ? 10 
HELX_P HELX_P2   2   CYS A 72  ? LEU A 76  ? CYS A 53  LEU A 57  5 ? 5  
HELX_P HELX_P3   3   SER A 84  ? THR A 86  ? SER A 65  THR A 67  5 ? 3  
HELX_P HELX_P4   4   GLU A 90  ? ASN A 93  ? GLU A 71  ASN A 74  5 ? 4  
HELX_P HELX_P5   5   LEU A 132 ? MET A 142 ? LEU A 113 MET A 123 1 ? 11 
HELX_P HELX_P6   6   VAL A 143 ? HIS A 147 ? VAL A 124 HIS A 128 5 ? 5  
HELX_P HELX_P7   7   GLY A 191 ? GLY A 206 ? GLY A 172 GLY A 187 1 ? 16 
HELX_P HELX_P8   8   ILE A 231 ? PHE A 251 ? ILE A 212 PHE A 232 1 ? 21 
HELX_P HELX_P9   9   THR A 277 ? GLU A 282 ? THR A 258 GLU A 263 1 ? 6  
HELX_P HELX_P10  10  GLY A 285 ? LYS A 298 ? GLY A 266 LYS A 279 1 ? 14 
HELX_P HELX_P11  11  ARG A 299 ? TYR A 307 ? ARG A 280 TYR A 288 1 ? 9  
HELX_P HELX_P12  12  ASP A 314 ? ARG A 318 ? ASP A 295 ARG A 299 5 ? 5  
HELX_P HELX_P13  13  PRO A 345 ? LYS A 352 ? PRO A 326 LYS A 333 1 ? 8  
HELX_P HELX_P14  14  ASP A 366 ? LEU A 379 ? ASP A 347 LEU A 360 1 ? 14 
HELX_P HELX_P15  15  ASN B 29  ? LEU B 39  ? ASN B 10  LEU B 20  1 ? 11 
HELX_P HELX_P16  16  CYS B 72  ? LEU B 76  ? CYS B 53  LEU B 57  5 ? 5  
HELX_P HELX_P17  17  GLU B 90  ? ASN B 93  ? GLU B 71  ASN B 74  5 ? 4  
HELX_P HELX_P18  18  LEU B 132 ? VAL B 143 ? LEU B 113 VAL B 124 1 ? 12 
HELX_P HELX_P19  19  SER B 144 ? HIS B 147 ? SER B 125 HIS B 128 5 ? 4  
HELX_P HELX_P20  20  GLY B 191 ? GLY B 206 ? GLY B 172 GLY B 187 1 ? 16 
HELX_P HELX_P21  21  ILE B 231 ? PHE B 251 ? ILE B 212 PHE B 232 1 ? 21 
HELX_P HELX_P22  22  THR B 277 ? GLU B 282 ? THR B 258 GLU B 263 1 ? 6  
HELX_P HELX_P23  23  GLY B 285 ? LYS B 298 ? GLY B 266 LYS B 279 1 ? 14 
HELX_P HELX_P24  24  ARG B 299 ? TYR B 307 ? ARG B 280 TYR B 288 1 ? 9  
HELX_P HELX_P25  25  ASP B 314 ? ARG B 318 ? ASP B 295 ARG B 299 5 ? 5  
HELX_P HELX_P26  26  PRO B 345 ? LYS B 352 ? PRO B 326 LYS B 333 1 ? 8  
HELX_P HELX_P27  27  ASP B 366 ? LEU B 379 ? ASP B 347 LEU B 360 1 ? 14 
HELX_P HELX_P28  28  ASN C 29  ? SER C 38  ? ASN C 10  SER C 19  1 ? 10 
HELX_P HELX_P29  29  CYS C 72  ? LEU C 76  ? CYS C 53  LEU C 57  5 ? 5  
HELX_P HELX_P30  30  GLU C 90  ? ASN C 93  ? GLU C 71  ASN C 74  5 ? 4  
HELX_P HELX_P31  31  LEU C 132 ? MET C 142 ? LEU C 113 MET C 123 1 ? 11 
HELX_P HELX_P32  32  VAL C 143 ? HIS C 147 ? VAL C 124 HIS C 128 5 ? 5  
HELX_P HELX_P33  33  GLY C 191 ? GLY C 206 ? GLY C 172 GLY C 187 1 ? 16 
HELX_P HELX_P34  34  ILE C 231 ? GLY C 252 ? ILE C 212 GLY C 233 1 ? 22 
HELX_P HELX_P35  35  THR C 277 ? GLU C 282 ? THR C 258 GLU C 263 1 ? 6  
HELX_P HELX_P36  36  GLY C 285 ? LYS C 298 ? GLY C 266 LYS C 279 1 ? 14 
HELX_P HELX_P37  37  ARG C 299 ? TYR C 307 ? ARG C 280 TYR C 288 1 ? 9  
HELX_P HELX_P38  38  ASP C 314 ? ARG C 318 ? ASP C 295 ARG C 299 5 ? 5  
HELX_P HELX_P39  39  PRO C 345 ? LYS C 352 ? PRO C 326 LYS C 333 1 ? 8  
HELX_P HELX_P40  40  ASP C 366 ? LEU C 379 ? ASP C 347 LEU C 360 1 ? 14 
HELX_P HELX_P41  41  ASN D 29  ? MET D 37  ? ASN D 10  MET D 18  1 ? 9  
HELX_P HELX_P42  42  CYS D 72  ? LEU D 76  ? CYS D 53  LEU D 57  5 ? 5  
HELX_P HELX_P43  43  GLU D 90  ? ASN D 93  ? GLU D 71  ASN D 74  5 ? 4  
HELX_P HELX_P44  44  LEU D 132 ? VAL D 143 ? LEU D 113 VAL D 124 1 ? 12 
HELX_P HELX_P45  45  SER D 144 ? HIS D 147 ? SER D 125 HIS D 128 5 ? 4  
HELX_P HELX_P46  46  GLY D 191 ? GLY D 206 ? GLY D 172 GLY D 187 1 ? 16 
HELX_P HELX_P47  47  ILE D 231 ? PHE D 251 ? ILE D 212 PHE D 232 1 ? 21 
HELX_P HELX_P48  48  THR D 277 ? GLU D 282 ? THR D 258 GLU D 263 1 ? 6  
HELX_P HELX_P49  49  GLY D 285 ? LYS D 298 ? GLY D 266 LYS D 279 1 ? 14 
HELX_P HELX_P50  50  ARG D 299 ? TYR D 307 ? ARG D 280 TYR D 288 1 ? 9  
HELX_P HELX_P51  51  ASP D 314 ? ARG D 318 ? ASP D 295 ARG D 299 5 ? 5  
HELX_P HELX_P52  52  PRO D 345 ? LYS D 352 ? PRO D 326 LYS D 333 1 ? 8  
HELX_P HELX_P53  53  ASP D 366 ? LEU D 379 ? ASP D 347 LEU D 360 1 ? 14 
HELX_P HELX_P54  54  ASN E 29  ? SER E 38  ? ASN E 10  SER E 19  1 ? 10 
HELX_P HELX_P55  55  CYS E 72  ? LEU E 76  ? CYS E 53  LEU E 57  5 ? 5  
HELX_P HELX_P56  56  GLU E 90  ? ASN E 93  ? GLU E 71  ASN E 74  5 ? 4  
HELX_P HELX_P57  57  LEU E 132 ? VAL E 143 ? LEU E 113 VAL E 124 1 ? 12 
HELX_P HELX_P58  58  SER E 144 ? HIS E 147 ? SER E 125 HIS E 128 5 ? 4  
HELX_P HELX_P59  59  GLY E 191 ? GLY E 206 ? GLY E 172 GLY E 187 1 ? 16 
HELX_P HELX_P60  60  ILE E 231 ? PHE E 251 ? ILE E 212 PHE E 232 1 ? 21 
HELX_P HELX_P61  61  THR E 277 ? GLU E 282 ? THR E 258 GLU E 263 1 ? 6  
HELX_P HELX_P62  62  GLY E 285 ? SER E 297 ? GLY E 266 SER E 278 1 ? 13 
HELX_P HELX_P63  63  ARG E 299 ? TYR E 307 ? ARG E 280 TYR E 288 1 ? 9  
HELX_P HELX_P64  64  ASP E 314 ? ARG E 318 ? ASP E 295 ARG E 299 5 ? 5  
HELX_P HELX_P65  65  PRO E 345 ? LYS E 352 ? PRO E 326 LYS E 333 1 ? 8  
HELX_P HELX_P66  66  ASP E 366 ? LEU E 379 ? ASP E 347 LEU E 360 1 ? 14 
HELX_P HELX_P67  67  ASN F 29  ? SER F 38  ? ASN F 10  SER F 19  1 ? 10 
HELX_P HELX_P68  68  CYS F 72  ? LEU F 76  ? CYS F 53  LEU F 57  5 ? 5  
HELX_P HELX_P69  69  SER F 84  ? THR F 86  ? SER F 65  THR F 67  5 ? 3  
HELX_P HELX_P70  70  GLU F 90  ? ASN F 93  ? GLU F 71  ASN F 74  5 ? 4  
HELX_P HELX_P71  71  LEU F 132 ? MET F 142 ? LEU F 113 MET F 123 1 ? 11 
HELX_P HELX_P72  72  VAL F 143 ? HIS F 147 ? VAL F 124 HIS F 128 5 ? 5  
HELX_P HELX_P73  73  GLY F 191 ? GLY F 206 ? GLY F 172 GLY F 187 1 ? 16 
HELX_P HELX_P74  74  ILE F 231 ? GLY F 252 ? ILE F 212 GLY F 233 1 ? 22 
HELX_P HELX_P75  75  THR F 277 ? GLU F 282 ? THR F 258 GLU F 263 1 ? 6  
HELX_P HELX_P76  76  GLY F 285 ? LYS F 298 ? GLY F 266 LYS F 279 1 ? 14 
HELX_P HELX_P77  77  ARG F 299 ? TYR F 307 ? ARG F 280 TYR F 288 1 ? 9  
HELX_P HELX_P78  78  GLY F 312 ? ARG F 317 ? GLY F 293 ARG F 298 1 ? 6  
HELX_P HELX_P79  79  PRO F 345 ? LYS F 352 ? PRO F 326 LYS F 333 1 ? 8  
HELX_P HELX_P80  80  ASP F 366 ? LEU F 379 ? ASP F 347 LEU F 360 1 ? 14 
HELX_P HELX_P81  81  ASN G 29  ? SER G 38  ? ASN G 10  SER G 19  1 ? 10 
HELX_P HELX_P82  82  CYS G 72  ? LEU G 76  ? CYS G 53  LEU G 57  5 ? 5  
HELX_P HELX_P83  83  GLU G 90  ? ASN G 93  ? GLU G 71  ASN G 74  5 ? 4  
HELX_P HELX_P84  84  LEU G 132 ? VAL G 143 ? LEU G 113 VAL G 124 1 ? 12 
HELX_P HELX_P85  85  SER G 144 ? HIS G 147 ? SER G 125 HIS G 128 5 ? 4  
HELX_P HELX_P86  86  GLY G 191 ? GLY G 206 ? GLY G 172 GLY G 187 1 ? 16 
HELX_P HELX_P87  87  ILE G 231 ? GLY G 252 ? ILE G 212 GLY G 233 1 ? 22 
HELX_P HELX_P88  88  THR G 277 ? GLU G 282 ? THR G 258 GLU G 263 1 ? 6  
HELX_P HELX_P89  89  GLY G 285 ? LYS G 298 ? GLY G 266 LYS G 279 1 ? 14 
HELX_P HELX_P90  90  ARG G 299 ? TYR G 307 ? ARG G 280 TYR G 288 1 ? 9  
HELX_P HELX_P91  91  ASP G 314 ? ARG G 318 ? ASP G 295 ARG G 299 5 ? 5  
HELX_P HELX_P92  92  PRO G 345 ? LYS G 352 ? PRO G 326 LYS G 333 1 ? 8  
HELX_P HELX_P93  93  ASP G 366 ? LEU G 379 ? ASP G 347 LEU G 360 1 ? 14 
HELX_P HELX_P94  94  ASN H 29  ? SER H 38  ? ASN H 10  SER H 19  1 ? 10 
HELX_P HELX_P95  95  CYS H 72  ? LEU H 76  ? CYS H 53  LEU H 57  5 ? 5  
HELX_P HELX_P96  96  GLU H 90  ? ASN H 93  ? GLU H 71  ASN H 74  5 ? 4  
HELX_P HELX_P97  97  LEU H 132 ? VAL H 143 ? LEU H 113 VAL H 124 1 ? 12 
HELX_P HELX_P98  98  SER H 144 ? HIS H 147 ? SER H 125 HIS H 128 5 ? 4  
HELX_P HELX_P99  99  GLY H 191 ? GLY H 206 ? GLY H 172 GLY H 187 1 ? 16 
HELX_P HELX_P100 100 ILE H 231 ? PHE H 251 ? ILE H 212 PHE H 232 1 ? 21 
HELX_P HELX_P101 101 THR H 277 ? GLU H 282 ? THR H 258 GLU H 263 1 ? 6  
HELX_P HELX_P102 102 GLY H 285 ? LYS H 298 ? GLY H 266 LYS H 279 1 ? 14 
HELX_P HELX_P103 103 ARG H 299 ? TYR H 307 ? ARG H 280 TYR H 288 1 ? 9  
HELX_P HELX_P104 104 ASP H 314 ? ARG H 318 ? ASP H 295 ARG H 299 5 ? 5  
HELX_P HELX_P105 105 PRO H 345 ? GLU H 351 ? PRO H 326 GLU H 332 1 ? 7  
HELX_P HELX_P106 106 ASP H 366 ? LEU H 379 ? ASP H 347 LEU H 360 1 ? 14 
HELX_P HELX_P107 107 ASN I 29  ? SER I 38  ? ASN I 10  SER I 19  1 ? 10 
HELX_P HELX_P108 108 CYS I 72  ? LEU I 76  ? CYS I 53  LEU I 57  5 ? 5  
HELX_P HELX_P109 109 GLU I 90  ? ASN I 93  ? GLU I 71  ASN I 74  5 ? 4  
HELX_P HELX_P110 110 LEU I 132 ? MET I 142 ? LEU I 113 MET I 123 1 ? 11 
HELX_P HELX_P111 111 VAL I 143 ? HIS I 147 ? VAL I 124 HIS I 128 5 ? 5  
HELX_P HELX_P112 112 GLY I 191 ? GLY I 206 ? GLY I 172 GLY I 187 1 ? 16 
HELX_P HELX_P113 113 ILE I 231 ? GLY I 252 ? ILE I 212 GLY I 233 1 ? 22 
HELX_P HELX_P114 114 THR I 277 ? GLU I 282 ? THR I 258 GLU I 263 1 ? 6  
HELX_P HELX_P115 115 GLY I 285 ? LYS I 298 ? GLY I 266 LYS I 279 1 ? 14 
HELX_P HELX_P116 116 ARG I 299 ? TYR I 307 ? ARG I 280 TYR I 288 1 ? 9  
HELX_P HELX_P117 117 ASP I 314 ? ARG I 318 ? ASP I 295 ARG I 299 5 ? 5  
HELX_P HELX_P118 118 PRO I 345 ? LYS I 352 ? PRO I 326 LYS I 333 1 ? 8  
HELX_P HELX_P119 119 ASP I 366 ? LEU I 379 ? ASP I 347 LEU I 360 1 ? 14 
HELX_P HELX_P120 120 ASN J 29  ? SER J 38  ? ASN J 10  SER J 19  1 ? 10 
HELX_P HELX_P121 121 CYS J 72  ? LEU J 76  ? CYS J 53  LEU J 57  5 ? 5  
HELX_P HELX_P122 122 SER J 84  ? THR J 86  ? SER J 65  THR J 67  5 ? 3  
HELX_P HELX_P123 123 GLU J 90  ? ASN J 93  ? GLU J 71  ASN J 74  5 ? 4  
HELX_P HELX_P124 124 LEU J 132 ? MET J 142 ? LEU J 113 MET J 123 1 ? 11 
HELX_P HELX_P125 125 VAL J 143 ? HIS J 147 ? VAL J 124 HIS J 128 5 ? 5  
HELX_P HELX_P126 126 GLY J 191 ? GLY J 206 ? GLY J 172 GLY J 187 1 ? 16 
HELX_P HELX_P127 127 ILE J 231 ? PHE J 251 ? ILE J 212 PHE J 232 1 ? 21 
HELX_P HELX_P128 128 THR J 277 ? GLU J 282 ? THR J 258 GLU J 263 1 ? 6  
HELX_P HELX_P129 129 GLY J 285 ? LYS J 298 ? GLY J 266 LYS J 279 1 ? 14 
HELX_P HELX_P130 130 ARG J 299 ? TYR J 307 ? ARG J 280 TYR J 288 1 ? 9  
HELX_P HELX_P131 131 GLY J 312 ? ARG J 317 ? GLY J 293 ARG J 298 1 ? 6  
HELX_P HELX_P132 132 PRO J 345 ? LYS J 352 ? PRO J 326 LYS J 333 1 ? 8  
HELX_P HELX_P133 133 ASP J 366 ? LEU J 379 ? ASP J 347 LEU J 360 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? A  CYS 72  SG  ? ? ? 1_555 C  CYS 72  SG  ? ? A CYS 53  C CYS 53  4_455 ? ? ? ? ? ? ? 1.993 ? 
disulf2   disulf ? ? F  CYS 72  SG  ? ? ? 1_555 H  CYS 72  SG  ? ? F CYS 53  H CYS 53  4_454 ? ? ? ? ? ? ? 2.019 ? 
metalc1   metalc ? ? A  GLU 153 OE1 ? ? ? 1_555 M  MN  .   MN  ? ? A GLU 134 A MN  403 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc2   metalc ? ? A  GLU 153 OE1 ? ? ? 1_555 L  MN  .   MN  ? ? A GLU 134 A MN  402 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc3   metalc ? ? A  GLU 153 OE2 ? ? ? 1_555 L  MN  .   MN  ? ? A GLU 134 A MN  402 1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc4   metalc ? ? A  GLU 155 OE2 ? ? ? 1_555 K  MN  .   MN  ? ? A GLU 136 A MN  401 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc5   metalc ? ? A  GLU 215 OE1 ? ? ? 1_555 K  MN  .   MN  ? ? A GLU 196 A MN  401 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc6   metalc ? ? A  GLU 222 OE1 ? ? ? 1_555 K  MN  .   MN  ? ? A GLU 203 A MN  401 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc7   metalc ? ? A  GLU 222 OE2 ? ? ? 1_555 M  MN  .   MN  ? ? A GLU 203 A MN  403 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc8   metalc ? ? A  GLU 357 OE2 ? ? ? 1_555 L  MN  .   MN  ? ? A GLU 338 A MN  402 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc9   metalc ? ? B  GLU 153 OE1 ? ? ? 1_555 S  MN  .   MN  ? ? B GLU 134 B MN  403 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc10  metalc ? ? B  GLU 153 OE1 ? ? ? 1_555 R  MN  .   MN  ? ? B GLU 134 B MN  402 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc11  metalc ? ? B  GLU 153 OE2 ? ? ? 1_555 R  MN  .   MN  ? ? B GLU 134 B MN  402 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc12  metalc ? ? B  GLU 155 OE2 ? ? ? 1_555 Q  MN  .   MN  ? ? B GLU 136 B MN  401 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc13  metalc ? ? B  GLU 215 OE1 ? ? ? 1_555 Q  MN  .   MN  ? ? B GLU 196 B MN  401 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc14  metalc ? ? B  GLU 222 OE1 ? ? ? 1_555 Q  MN  .   MN  ? ? B GLU 203 B MN  401 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc15  metalc ? ? B  GLU 222 OE2 ? ? ? 1_555 S  MN  .   MN  ? ? B GLU 203 B MN  403 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc16  metalc ? ? B  GLU 357 OE2 ? ? ? 1_555 R  MN  .   MN  ? ? B GLU 338 B MN  402 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc17  metalc ? ? C  GLU 153 OE1 ? ? ? 1_555 Y  MN  .   MN  ? ? C GLU 134 C MN  402 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc18  metalc ? ? C  GLU 153 OE1 ? ? ? 1_555 Z  MN  .   MN  ? ? C GLU 134 C MN  403 1_555 ? ? ? ? ? ? ? 1.964 ? 
metalc19  metalc ? ? C  GLU 153 OE2 ? ? ? 1_555 Y  MN  .   MN  ? ? C GLU 134 C MN  402 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc20  metalc ? ? C  GLU 155 OE2 ? ? ? 1_555 X  MN  .   MN  ? ? C GLU 136 C MN  401 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc21  metalc ? ? C  GLU 215 OE1 ? ? ? 1_555 X  MN  .   MN  ? ? C GLU 196 C MN  401 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc22  metalc ? ? C  GLU 222 OE1 ? ? ? 1_555 X  MN  .   MN  ? ? C GLU 203 C MN  401 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc23  metalc ? ? C  GLU 222 OE2 ? ? ? 1_555 Z  MN  .   MN  ? ? C GLU 203 C MN  403 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc24  metalc ? ? C  GLU 357 OE2 ? ? ? 1_555 Y  MN  .   MN  ? ? C GLU 338 C MN  402 1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc25  metalc ? ? D  GLU 153 OE1 ? ? ? 1_555 EA MN  .   MN  ? ? D GLU 134 D MN  402 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc26  metalc ? ? D  GLU 153 OE1 ? ? ? 1_555 FA MN  .   MN  ? ? D GLU 134 D MN  403 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc27  metalc ? ? D  GLU 153 OE2 ? ? ? 1_555 EA MN  .   MN  ? ? D GLU 134 D MN  402 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc28  metalc ? ? D  GLU 155 OE2 ? ? ? 1_555 DA MN  .   MN  ? ? D GLU 136 D MN  401 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc29  metalc ? ? D  GLU 215 OE1 ? ? ? 1_555 DA MN  .   MN  ? ? D GLU 196 D MN  401 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc30  metalc ? ? D  GLU 222 OE1 ? ? ? 1_555 DA MN  .   MN  ? ? D GLU 203 D MN  401 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc31  metalc ? ? D  GLU 222 OE2 ? ? ? 1_555 FA MN  .   MN  ? ? D GLU 203 D MN  403 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc32  metalc ? ? D  GLU 357 OE2 ? ? ? 1_555 EA MN  .   MN  ? ? D GLU 338 D MN  402 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc33  metalc ? ? E  GLU 153 OE1 ? ? ? 1_555 KA MN  .   MN  ? ? E GLU 134 E MN  402 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc34  metalc ? ? E  GLU 153 OE1 ? ? ? 1_555 LA MN  .   MN  ? ? E GLU 134 E MN  403 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc35  metalc ? ? E  GLU 153 OE2 ? ? ? 1_555 KA MN  .   MN  ? ? E GLU 134 E MN  402 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc36  metalc ? ? E  GLU 155 OE2 ? ? ? 1_555 JA MN  .   MN  ? ? E GLU 136 E MN  401 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc37  metalc ? ? E  GLU 215 OE1 ? ? ? 1_555 JA MN  .   MN  ? ? E GLU 196 E MN  401 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc38  metalc ? ? E  GLU 222 OE1 ? ? ? 1_555 JA MN  .   MN  ? ? E GLU 203 E MN  401 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc39  metalc ? ? E  GLU 222 OE2 ? ? ? 1_555 LA MN  .   MN  ? ? E GLU 203 E MN  403 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc40  metalc ? ? E  GLU 357 OE2 ? ? ? 1_555 KA MN  .   MN  ? ? E GLU 338 E MN  402 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc41  metalc ? ? F  GLU 153 OE1 ? ? ? 1_555 QA MN  .   MN  ? ? F GLU 134 F MN  403 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc42  metalc ? ? F  GLU 153 OE1 ? ? ? 1_555 PA MN  .   MN  ? ? F GLU 134 F MN  402 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc43  metalc ? ? F  GLU 153 OE2 ? ? ? 1_555 PA MN  .   MN  ? ? F GLU 134 F MN  402 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc44  metalc ? ? F  GLU 155 OE2 ? ? ? 1_555 OA MN  .   MN  ? ? F GLU 136 F MN  401 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc45  metalc ? ? F  GLU 215 OE1 ? ? ? 1_555 OA MN  .   MN  ? ? F GLU 196 F MN  401 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc46  metalc ? ? F  GLU 222 OE1 ? ? ? 1_555 OA MN  .   MN  ? ? F GLU 203 F MN  401 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc47  metalc ? ? F  GLU 222 OE2 ? ? ? 1_555 QA MN  .   MN  ? ? F GLU 203 F MN  403 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc48  metalc ? ? F  GLU 357 OE2 ? ? ? 1_555 PA MN  .   MN  ? ? F GLU 338 F MN  402 1_555 ? ? ? ? ? ? ? 1.848 ? 
metalc49  metalc ? ? G  GLU 153 OE1 ? ? ? 1_555 VA MN  .   MN  ? ? G GLU 134 G MN  402 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc50  metalc ? ? G  GLU 153 OE1 ? ? ? 1_555 WA MN  .   MN  ? ? G GLU 134 G MN  403 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc51  metalc ? ? G  GLU 153 OE2 ? ? ? 1_555 VA MN  .   MN  ? ? G GLU 134 G MN  402 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc52  metalc ? ? G  GLU 155 OE2 ? ? ? 1_555 UA MN  .   MN  ? ? G GLU 136 G MN  401 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc53  metalc ? ? G  GLU 215 OE1 ? ? ? 1_555 UA MN  .   MN  ? ? G GLU 196 G MN  401 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc54  metalc ? ? G  GLU 222 OE1 ? ? ? 1_555 UA MN  .   MN  ? ? G GLU 203 G MN  401 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc55  metalc ? ? G  GLU 222 OE2 ? ? ? 1_555 WA MN  .   MN  ? ? G GLU 203 G MN  403 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc56  metalc ? ? G  GLU 357 OE2 ? ? ? 1_555 VA MN  .   MN  ? ? G GLU 338 G MN  402 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc57  metalc ? ? H  GLU 153 OE1 ? ? ? 1_555 CB MN  .   MN  ? ? H GLU 134 H MN  402 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc58  metalc ? ? H  GLU 153 OE1 ? ? ? 1_555 DB MN  .   MN  ? ? H GLU 134 H MN  403 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc59  metalc ? ? H  GLU 153 OE2 ? ? ? 1_555 CB MN  .   MN  ? ? H GLU 134 H MN  402 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc60  metalc ? ? H  GLU 155 OE2 ? ? ? 1_555 BB MN  .   MN  ? ? H GLU 136 H MN  401 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc61  metalc ? ? H  GLU 215 OE1 ? ? ? 1_555 BB MN  .   MN  ? ? H GLU 196 H MN  401 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc62  metalc ? ? H  GLU 222 OE1 ? ? ? 1_555 BB MN  .   MN  ? ? H GLU 203 H MN  401 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc63  metalc ? ? H  GLU 222 OE2 ? ? ? 1_555 DB MN  .   MN  ? ? H GLU 203 H MN  403 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc64  metalc ? ? H  GLU 357 OE2 ? ? ? 1_555 CB MN  .   MN  ? ? H GLU 338 H MN  402 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc65  metalc ? ? I  GLU 153 OE1 ? ? ? 1_555 HB MN  .   MN  ? ? I GLU 134 I MN  402 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc66  metalc ? ? I  GLU 153 OE1 ? ? ? 1_555 IB MN  .   MN  ? ? I GLU 134 I MN  403 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc67  metalc ? ? I  GLU 153 OE2 ? ? ? 1_555 HB MN  .   MN  ? ? I GLU 134 I MN  402 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc68  metalc ? ? I  GLU 155 OE2 ? ? ? 1_555 GB MN  .   MN  ? ? I GLU 136 I MN  401 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc69  metalc ? ? I  GLU 215 OE1 ? ? ? 1_555 GB MN  .   MN  ? ? I GLU 196 I MN  401 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc70  metalc ? ? I  GLU 222 OE1 ? ? ? 1_555 GB MN  .   MN  ? ? I GLU 203 I MN  401 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc71  metalc ? ? I  GLU 222 OE2 ? ? ? 1_555 IB MN  .   MN  ? ? I GLU 203 I MN  403 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc72  metalc ? ? I  GLU 357 OE2 ? ? ? 1_555 HB MN  .   MN  ? ? I GLU 338 I MN  402 1_555 ? ? ? ? ? ? ? 1.946 ? 
metalc73  metalc ? ? J  GLU 153 OE1 ? ? ? 1_555 OB MN  .   MN  ? ? J GLU 134 J MN  403 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc74  metalc ? ? J  GLU 153 OE2 ? ? ? 1_555 NB MN  .   MN  ? ? J GLU 134 J MN  402 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc75  metalc ? ? J  GLU 155 OE2 ? ? ? 1_555 MB MN  .   MN  ? ? J GLU 136 J MN  401 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc76  metalc ? ? J  GLU 215 OE1 ? ? ? 1_555 MB MN  .   MN  ? ? J GLU 196 J MN  401 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc77  metalc ? ? J  GLU 222 OE1 ? ? ? 1_555 MB MN  .   MN  ? ? J GLU 203 J MN  401 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc78  metalc ? ? J  GLU 222 OE2 ? ? ? 1_555 OB MN  .   MN  ? ? J GLU 203 J MN  403 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc79  metalc ? ? J  GLU 357 OE2 ? ? ? 1_555 NB MN  .   MN  ? ? J GLU 338 J MN  402 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc80  metalc ? ? K  MN  .   MN  ? ? ? 1_555 P  P3S .   O3A ? ? A MN  401 A P3S 601 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc81  metalc ? ? K  MN  .   MN  ? ? ? 1_555 SB HOH .   O   ? ? A MN  401 A HOH 704 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc82  metalc ? ? L  MN  .   MN  ? ? ? 1_555 O  ADP .   O3B ? ? A MN  402 A ADP 501 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc83  metalc ? ? L  MN  .   MN  ? ? ? 1_555 P  P3S .   O2A ? ? A MN  402 A P3S 601 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc84  metalc ? ? M  MN  .   MN  ? ? ? 1_555 SB HOH .   O   ? ? A MN  403 A HOH 729 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc85  metalc ? ? M  MN  .   MN  ? ? ? 1_555 O  ADP .   O1B ? ? A MN  403 A ADP 501 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc86  metalc ? ? M  MN  .   MN  ? ? ? 1_555 P  P3S .   O3A ? ? A MN  403 A P3S 601 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc87  metalc ? ? M  MN  .   MN  ? ? ? 1_555 O  ADP .   O2A ? ? A MN  403 A ADP 501 1_555 ? ? ? ? ? ? ? 2.024 ? 
metalc88  metalc ? ? Q  MN  .   MN  ? ? ? 1_555 W  P3S .   O3A ? ? B MN  401 B P3S 601 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc89  metalc ? ? Q  MN  .   MN  ? ? ? 1_555 TB HOH .   O   ? ? B MN  401 B HOH 744 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc90  metalc ? ? R  MN  .   MN  ? ? ? 1_555 W  P3S .   O2A ? ? B MN  402 B P3S 601 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc91  metalc ? ? R  MN  .   MN  ? ? ? 1_555 V  ADP .   O2B ? ? B MN  402 B ADP 501 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc92  metalc ? ? S  MN  .   MN  ? ? ? 1_555 W  P3S .   O3A ? ? B MN  403 B P3S 601 1_555 ? ? ? ? ? ? ? 1.942 ? 
metalc93  metalc ? ? S  MN  .   MN  ? ? ? 1_555 V  ADP .   O2A ? ? B MN  403 B ADP 501 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc94  metalc ? ? S  MN  .   MN  ? ? ? 1_555 TB HOH .   O   ? ? B MN  403 B HOH 741 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc95  metalc ? ? S  MN  .   MN  ? ? ? 1_555 V  ADP .   O3B ? ? B MN  403 B ADP 501 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc96  metalc ? ? X  MN  .   MN  ? ? ? 1_555 UB HOH .   O   ? ? C MN  401 C HOH 740 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc97  metalc ? ? X  MN  .   MN  ? ? ? 1_555 CA P3S .   O3A ? ? C MN  401 C P3S 601 1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc98  metalc ? ? Y  MN  .   MN  ? ? ? 1_555 BA ADP .   O2B ? ? C MN  402 C ADP 501 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc99  metalc ? ? Y  MN  .   MN  ? ? ? 1_555 CA P3S .   O2A ? ? C MN  402 C P3S 601 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc100 metalc ? ? Z  MN  .   MN  ? ? ? 1_555 BA ADP .   O3B ? ? C MN  403 C ADP 501 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc101 metalc ? ? Z  MN  .   MN  ? ? ? 1_555 CA P3S .   O3A ? ? C MN  403 C P3S 601 1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc102 metalc ? ? Z  MN  .   MN  ? ? ? 1_555 UB HOH .   O   ? ? C MN  403 C HOH 738 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc103 metalc ? ? Z  MN  .   MN  ? ? ? 1_555 BA ADP .   O2A ? ? C MN  403 C ADP 501 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc104 metalc ? ? DA MN  .   MN  ? ? ? 1_555 IA P3S .   O3A ? ? D MN  401 D P3S 601 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc105 metalc ? ? EA MN  .   MN  ? ? ? 1_555 IA P3S .   O2A ? ? D MN  402 D P3S 601 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc106 metalc ? ? EA MN  .   MN  ? ? ? 1_555 HA ADP .   O2B ? ? D MN  402 D ADP 501 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc107 metalc ? ? FA MN  .   MN  ? ? ? 1_555 IA P3S .   O3A ? ? D MN  403 D P3S 601 1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc108 metalc ? ? FA MN  .   MN  ? ? ? 1_555 HA ADP .   O2A ? ? D MN  403 D ADP 501 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc109 metalc ? ? FA MN  .   MN  ? ? ? 1_555 HA ADP .   O3B ? ? D MN  403 D ADP 501 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc110 metalc ? ? FA MN  .   MN  ? ? ? 1_555 VB HOH .   O   ? ? D MN  403 D HOH 747 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc111 metalc ? ? JA MN  .   MN  ? ? ? 1_555 NA P3S .   O3A ? ? E MN  401 E P3S 601 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc112 metalc ? ? JA MN  .   MN  ? ? ? 1_555 WB HOH .   O   ? ? E MN  401 E HOH 629 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc113 metalc ? ? KA MN  .   MN  ? ? ? 1_555 NA P3S .   O2A ? ? E MN  402 E P3S 601 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc114 metalc ? ? KA MN  .   MN  ? ? ? 1_555 MA ADP .   O2B ? ? E MN  402 E ADP 501 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc115 metalc ? ? LA MN  .   MN  ? ? ? 1_555 NA P3S .   O3A ? ? E MN  403 E P3S 601 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc116 metalc ? ? LA MN  .   MN  ? ? ? 1_555 MA ADP .   O3B ? ? E MN  403 E ADP 501 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc117 metalc ? ? LA MN  .   MN  ? ? ? 1_555 WB HOH .   O   ? ? E MN  403 E HOH 627 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc118 metalc ? ? LA MN  .   MN  ? ? ? 1_555 MA ADP .   O2A ? ? E MN  403 E ADP 501 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc119 metalc ? ? PA MN  .   MN  ? ? ? 1_555 SA ADP .   O2B ? ? F MN  402 F ADP 501 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc120 metalc ? ? PA MN  .   MN  ? ? ? 1_555 TA P3S .   O2A ? ? F MN  402 F P3S 601 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc121 metalc ? ? QA MN  .   MN  ? ? ? 1_555 XB HOH .   O   ? ? F MN  403 F HOH 717 1_555 ? ? ? ? ? ? ? 1.878 ? 
metalc122 metalc ? ? QA MN  .   MN  ? ? ? 1_555 SA ADP .   O2A ? ? F MN  403 F ADP 501 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc123 metalc ? ? QA MN  .   MN  ? ? ? 1_555 SA ADP .   O3B ? ? F MN  403 F ADP 501 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc124 metalc ? ? QA MN  .   MN  ? ? ? 1_555 TA P3S .   O3A ? ? F MN  403 F P3S 601 1_555 ? ? ? ? ? ? ? 1.867 ? 
metalc125 metalc ? ? VA MN  .   MN  ? ? ? 1_555 ZA ADP .   O2B ? ? G MN  402 G ADP 501 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc126 metalc ? ? VA MN  .   MN  ? ? ? 1_555 AB P3S .   O2A ? ? G MN  402 G P3S 601 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc127 metalc ? ? WA MN  .   MN  ? ? ? 1_555 ZA ADP .   O2A ? ? G MN  403 G ADP 501 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc128 metalc ? ? WA MN  .   MN  ? ? ? 1_555 ZA ADP .   O3B ? ? G MN  403 G ADP 501 1_555 ? ? ? ? ? ? ? 1.922 ? 
metalc129 metalc ? ? WA MN  .   MN  ? ? ? 1_555 AB P3S .   O3A ? ? G MN  403 G P3S 601 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc130 metalc ? ? BB MN  .   MN  ? ? ? 1_555 ZB HOH .   O   ? ? H MN  401 H HOH 609 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc131 metalc ? ? BB MN  .   MN  ? ? ? 1_555 FB P3S .   O3A ? ? H MN  401 H P3S 601 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc132 metalc ? ? CB MN  .   MN  ? ? ? 1_555 EB ADP .   O2B ? ? H MN  402 H ADP 501 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc133 metalc ? ? CB MN  .   MN  ? ? ? 1_555 FB P3S .   O2A ? ? H MN  402 H P3S 601 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc134 metalc ? ? DB MN  .   MN  ? ? ? 1_555 EB ADP .   O3B ? ? H MN  403 H ADP 501 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc135 metalc ? ? DB MN  .   MN  ? ? ? 1_555 EB ADP .   O2A ? ? H MN  403 H ADP 501 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc136 metalc ? ? DB MN  .   MN  ? ? ? 1_555 ZB HOH .   O   ? ? H MN  403 H HOH 608 1_555 ? ? ? ? ? ? ? 1.896 ? 
metalc137 metalc ? ? DB MN  .   MN  ? ? ? 1_555 FB P3S .   O3A ? ? H MN  403 H P3S 601 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc138 metalc ? ? GB MN  .   MN  ? ? ? 1_555 LB P3S .   O3A ? ? I MN  401 I P3S 601 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc139 metalc ? ? HB MN  .   MN  ? ? ? 1_555 KB ADP .   O2B ? ? I MN  402 I ADP 501 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc140 metalc ? ? HB MN  .   MN  ? ? ? 1_555 LB P3S .   O2A ? ? I MN  402 I P3S 601 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc141 metalc ? ? IB MN  .   MN  ? ? ? 1_555 AC HOH .   O   ? ? I MN  403 I HOH 718 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc142 metalc ? ? IB MN  .   MN  ? ? ? 1_555 KB ADP .   O2A ? ? I MN  403 I ADP 501 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc143 metalc ? ? IB MN  .   MN  ? ? ? 1_555 KB ADP .   O3B ? ? I MN  403 I ADP 501 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc144 metalc ? ? IB MN  .   MN  ? ? ? 1_555 LB P3S .   O3A ? ? I MN  403 I P3S 601 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc145 metalc ? ? MB MN  .   MN  ? ? ? 1_555 RB P3S .   O3A ? ? J MN  401 J P3S 601 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc146 metalc ? ? MB MN  .   MN  ? ? ? 1_555 BC HOH .   O   ? ? J MN  401 J HOH 718 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc147 metalc ? ? NB MN  .   MN  ? ? ? 1_555 RB P3S .   O2A ? ? J MN  402 J P3S 601 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc148 metalc ? ? NB MN  .   MN  ? ? ? 1_555 QB ADP .   O3B ? ? J MN  402 J ADP 501 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc149 metalc ? ? OB MN  .   MN  ? ? ? 1_555 BC HOH .   O   ? ? J MN  403 J HOH 717 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc150 metalc ? ? OB MN  .   MN  ? ? ? 1_555 QB ADP .   O2A ? ? J MN  403 J ADP 501 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc151 metalc ? ? OB MN  .   MN  ? ? ? 1_555 QB ADP .   O1B ? ? J MN  403 J ADP 501 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc152 metalc ? ? OB MN  .   MN  ? ? ? 1_555 RB P3S .   O3A ? ? J MN  403 J P3S 601 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc153 metalc ? ? K  MN  .   MN  ? ? ? 1_555 P  P3S .   NE  ? ? A MN  401 A P3S 601 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc154 metalc ? ? L  MN  .   MN  ? ? ? 1_555 A  HIS 272 ND1 ? ? A MN  402 A HIS 253 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc155 metalc ? ? Q  MN  .   MN  ? ? ? 1_555 W  P3S .   NE  ? ? B MN  401 B P3S 601 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc156 metalc ? ? R  MN  .   MN  ? ? ? 1_555 B  HIS 272 ND1 ? ? B MN  402 B HIS 253 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc157 metalc ? ? X  MN  .   MN  ? ? ? 1_555 CA P3S .   NE  ? ? C MN  401 C P3S 601 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc158 metalc ? ? Y  MN  .   MN  ? ? ? 1_555 C  HIS 272 ND1 ? ? C MN  402 C HIS 253 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc159 metalc ? ? DA MN  .   MN  ? ? ? 1_555 IA P3S .   NE  ? ? D MN  401 D P3S 601 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc160 metalc ? ? EA MN  .   MN  ? ? ? 1_555 D  HIS 272 ND1 ? ? D MN  402 D HIS 253 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc161 metalc ? ? JA MN  .   MN  ? ? ? 1_555 NA P3S .   NE  ? ? E MN  401 E P3S 601 1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc162 metalc ? ? KA MN  .   MN  ? ? ? 1_555 E  HIS 272 ND1 ? ? E MN  402 E HIS 253 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc163 metalc ? ? OA MN  .   MN  ? ? ? 1_555 TA P3S .   NE  ? ? F MN  401 F P3S 601 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc164 metalc ? ? OA MN  .   MN  ? ? ? 1_555 TA P3S .   O3A ? ? F MN  401 F P3S 601 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc165 metalc ? ? PA MN  .   MN  ? ? ? 1_555 F  HIS 272 ND1 ? ? F MN  402 F HIS 253 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc166 metalc ? ? UA MN  .   MN  ? ? ? 1_555 AB P3S .   NE  ? ? G MN  401 G P3S 601 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc167 metalc ? ? UA MN  .   MN  ? ? ? 1_555 AB P3S .   O3A ? ? G MN  401 G P3S 601 1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc168 metalc ? ? VA MN  .   MN  ? ? ? 1_555 G  HIS 272 ND1 ? ? G MN  402 G HIS 253 1_555 ? ? ? ? ? ? ? 2.525 ? 
metalc169 metalc ? ? BB MN  .   MN  ? ? ? 1_555 FB P3S .   NE  ? ? H MN  401 H P3S 601 1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc170 metalc ? ? CB MN  .   MN  ? ? ? 1_555 H  HIS 272 ND1 ? ? H MN  402 H HIS 253 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc171 metalc ? ? GB MN  .   MN  ? ? ? 1_555 LB P3S .   NE  ? ? I MN  401 I P3S 601 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc172 metalc ? ? HB MN  .   MN  ? ? ? 1_555 I  HIS 272 ND1 ? ? I MN  402 I HIS 253 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc173 metalc ? ? MB MN  .   MN  ? ? ? 1_555 RB P3S .   NE  ? ? J MN  401 J P3S 601 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc174 metalc ? ? NB MN  .   MN  ? ? ? 1_555 J  HIS 272 ND1 ? ? J MN  402 J HIS 253 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc175 metalc ? ? NB MN  .   MN  ? ? ? 1_555 J  GLU 153 OE1 ? ? J MN  402 J GLU 134 1_555 ? ? ? ? ? ? ? 2.568 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 111 A . ? ASP 92  A PRO 112 A ? PRO 93  A 1 16.56  
2  GLY 226 A . ? GLY 207 A PRO 227 A ? PRO 208 A 1 -1.59  
3  ASP 111 B . ? ASP 92  B PRO 112 B ? PRO 93  B 1 13.15  
4  GLY 226 B . ? GLY 207 B PRO 227 B ? PRO 208 B 1 -3.46  
5  ASP 111 C . ? ASP 92  C PRO 112 C ? PRO 93  C 1 15.89  
6  GLY 226 C . ? GLY 207 C PRO 227 C ? PRO 208 C 1 -3.97  
7  ASP 111 D . ? ASP 92  D PRO 112 D ? PRO 93  D 1 16.78  
8  GLY 226 D . ? GLY 207 D PRO 227 D ? PRO 208 D 1 -10.47 
9  ASP 111 E . ? ASP 92  E PRO 112 E ? PRO 93  E 1 22.04  
10 GLY 226 E . ? GLY 207 E PRO 227 E ? PRO 208 E 1 -6.74  
11 ASP 111 F . ? ASP 92  F PRO 112 F ? PRO 93  F 1 14.75  
12 GLY 226 F . ? GLY 207 F PRO 227 F ? PRO 208 F 1 -4.04  
13 ASP 111 G . ? ASP 92  G PRO 112 G ? PRO 93  G 1 15.58  
14 GLY 226 G . ? GLY 207 G PRO 227 G ? PRO 208 G 1 -2.75  
15 ASP 111 H . ? ASP 92  H PRO 112 H ? PRO 93  H 1 22.67  
16 GLY 226 H . ? GLY 207 H PRO 227 H ? PRO 208 H 1 -1.96  
17 ASP 111 I . ? ASP 92  I PRO 112 I ? PRO 93  I 1 21.59  
18 GLY 226 I . ? GLY 207 I PRO 227 I ? PRO 208 I 1 -5.35  
19 ASP 111 J . ? ASP 92  J PRO 112 J ? PRO 93  J 1 20.72  
20 GLY 226 J . ? GLY 207 J PRO 227 J ? PRO 208 J 1 -3.20  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9  ? 
B ? 12 ? 
C ? 6  ? 
D ? 9  ? 
E ? 9  ? 
F ? 12 ? 
G ? 9  ? 
H ? 12 ? 
I ? 9  ? 
J ? 12 ? 
K ? 9  ? 
L ? 12 ? 
M ? 6  ? 
N ? 9  ? 
O ? 9  ? 
P ? 12 ? 
Q ? 9  ? 
R ? 12 ? 
S ? 9  ? 
T ? 12 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? parallel      
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? parallel      
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? parallel      
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? parallel      
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? anti-parallel 
E 8  9  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? parallel      
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
F 6  7  ? anti-parallel 
F 7  8  ? anti-parallel 
F 8  9  ? anti-parallel 
F 9  10 ? anti-parallel 
F 10 11 ? anti-parallel 
F 11 12 ? parallel      
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? parallel      
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? parallel      
H 4  5  ? anti-parallel 
H 5  6  ? anti-parallel 
H 6  7  ? anti-parallel 
H 7  8  ? anti-parallel 
H 8  9  ? anti-parallel 
H 9  10 ? anti-parallel 
H 10 11 ? anti-parallel 
H 11 12 ? parallel      
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? parallel      
I 4  5  ? anti-parallel 
I 5  6  ? anti-parallel 
I 6  7  ? anti-parallel 
I 7  8  ? anti-parallel 
I 8  9  ? anti-parallel 
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? parallel      
J 4  5  ? anti-parallel 
J 5  6  ? anti-parallel 
J 6  7  ? anti-parallel 
J 7  8  ? anti-parallel 
J 8  9  ? anti-parallel 
J 9  10 ? anti-parallel 
J 10 11 ? anti-parallel 
J 11 12 ? parallel      
K 1  2  ? anti-parallel 
K 2  3  ? anti-parallel 
K 3  4  ? parallel      
K 4  5  ? anti-parallel 
K 5  6  ? anti-parallel 
K 6  7  ? anti-parallel 
K 7  8  ? anti-parallel 
K 8  9  ? anti-parallel 
L 1  2  ? anti-parallel 
L 2  3  ? anti-parallel 
L 3  4  ? parallel      
L 4  5  ? anti-parallel 
L 5  6  ? anti-parallel 
L 6  7  ? anti-parallel 
L 7  8  ? anti-parallel 
L 8  9  ? anti-parallel 
L 9  10 ? anti-parallel 
L 10 11 ? anti-parallel 
L 11 12 ? parallel      
M 1  2  ? anti-parallel 
M 2  3  ? anti-parallel 
M 3  4  ? anti-parallel 
M 4  5  ? anti-parallel 
M 5  6  ? parallel      
N 1  2  ? anti-parallel 
N 2  3  ? anti-parallel 
N 3  4  ? anti-parallel 
N 4  5  ? anti-parallel 
N 5  6  ? anti-parallel 
N 6  7  ? parallel      
N 7  8  ? anti-parallel 
N 8  9  ? anti-parallel 
O 1  2  ? anti-parallel 
O 2  3  ? anti-parallel 
O 3  4  ? parallel      
O 4  5  ? anti-parallel 
O 5  6  ? anti-parallel 
O 6  7  ? anti-parallel 
O 7  8  ? anti-parallel 
O 8  9  ? anti-parallel 
P 1  2  ? anti-parallel 
P 2  3  ? anti-parallel 
P 3  4  ? parallel      
P 4  5  ? anti-parallel 
P 5  6  ? anti-parallel 
P 6  7  ? anti-parallel 
P 7  8  ? anti-parallel 
P 8  9  ? anti-parallel 
P 9  10 ? anti-parallel 
P 10 11 ? anti-parallel 
P 11 12 ? parallel      
Q 1  2  ? anti-parallel 
Q 2  3  ? anti-parallel 
Q 3  4  ? parallel      
Q 4  5  ? anti-parallel 
Q 5  6  ? anti-parallel 
Q 6  7  ? anti-parallel 
Q 7  8  ? anti-parallel 
Q 8  9  ? anti-parallel 
R 1  2  ? anti-parallel 
R 2  3  ? anti-parallel 
R 3  4  ? parallel      
R 4  5  ? anti-parallel 
R 5  6  ? anti-parallel 
R 6  7  ? anti-parallel 
R 7  8  ? anti-parallel 
R 8  9  ? anti-parallel 
R 9  10 ? anti-parallel 
R 10 11 ? anti-parallel 
R 11 12 ? parallel      
S 1  2  ? anti-parallel 
S 2  3  ? anti-parallel 
S 3  4  ? parallel      
S 4  5  ? anti-parallel 
S 5  6  ? anti-parallel 
S 6  7  ? anti-parallel 
S 7  8  ? anti-parallel 
S 8  9  ? anti-parallel 
T 1  2  ? anti-parallel 
T 2  3  ? anti-parallel 
T 3  4  ? parallel      
T 4  5  ? anti-parallel 
T 5  6  ? anti-parallel 
T 6  7  ? anti-parallel 
T 7  8  ? anti-parallel 
T 8  9  ? anti-parallel 
T 9  10 ? anti-parallel 
T 10 11 ? anti-parallel 
T 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  TRP A 79  ? ASP A 82  ? TRP A 60  ASP A 63  
A 2  ASP A 95  ? ARG A 105 ? ASP A 76  ARG A 86  
A 3  LYS A 114 ? PHE A 121 ? LYS A 95  PHE A 102 
A 4  VAL A 45  ? ILE A 52  ? VAL A 26  ILE A 33  
A 5  LEU A 59  ? LEU A 66  ? LEU A 40  LEU A 47  
A 6  ILE B 209 ? ALA B 214 ? ILE B 190 ALA B 195 
A 7  GLN B 220 ? GLU B 229 ? GLN B 201 GLU B 210 
A 8  TRP B 149 ? MET B 159 ? TRP B 130 MET B 140 
A 9  ILE B 254 ? THR B 256 ? ILE B 235 THR B 237 
B 1  TRP A 79  ? ASP A 82  ? TRP A 60  ASP A 63  
B 2  ASP A 95  ? ARG A 105 ? ASP A 76  ARG A 86  
B 3  LYS A 114 ? PHE A 121 ? LYS A 95  PHE A 102 
B 4  VAL A 45  ? ILE A 52  ? VAL A 26  ILE A 33  
B 5  LEU A 59  ? LEU A 66  ? LEU A 40  LEU A 47  
B 6  ILE B 209 ? ALA B 214 ? ILE B 190 ALA B 195 
B 7  GLN B 220 ? GLU B 229 ? GLN B 201 GLU B 210 
B 8  TRP B 149 ? MET B 159 ? TRP B 130 MET B 140 
B 9  CYS B 271 ? SER B 276 ? CYS B 252 SER B 257 
B 10 PHE B 356 ? ASP B 358 ? PHE B 337 ASP B 339 
B 11 ILE B 342 ? ILE B 344 ? ILE B 323 ILE B 325 
B 12 ALA B 333 ? VAL B 335 ? ALA B 314 VAL B 316 
C 1  ILE A 254 ? THR A 256 ? ILE A 235 THR A 237 
C 2  TRP A 149 ? MET A 159 ? TRP A 130 MET A 140 
C 3  CYS A 271 ? SER A 276 ? CYS A 252 SER A 257 
C 4  PHE A 356 ? ASP A 358 ? PHE A 337 ASP A 339 
C 5  ILE A 342 ? ILE A 344 ? ILE A 323 ILE A 325 
C 6  ALA A 333 ? VAL A 335 ? ALA A 314 VAL A 316 
D 1  ILE A 254 ? THR A 256 ? ILE A 235 THR A 237 
D 2  TRP A 149 ? MET A 159 ? TRP A 130 MET A 140 
D 3  GLN A 220 ? GLU A 229 ? GLN A 201 GLU A 210 
D 4  ILE A 209 ? ALA A 214 ? ILE A 190 ALA A 195 
D 5  LEU E 59  ? LEU E 66  ? LEU E 40  LEU E 47  
D 6  VAL E 45  ? ILE E 52  ? VAL E 26  ILE E 33  
D 7  LYS E 114 ? PHE E 121 ? LYS E 95  PHE E 102 
D 8  ASP E 95  ? ARG E 105 ? ASP E 76  ARG E 86  
D 9  TRP E 79  ? ASP E 82  ? TRP E 60  ASP E 63  
E 1  TRP B 79  ? ASP B 82  ? TRP B 60  ASP B 63  
E 2  ASP B 95  ? ARG B 105 ? ASP B 76  ARG B 86  
E 3  LYS B 114 ? PHE B 121 ? LYS B 95  PHE B 102 
E 4  VAL B 45  ? ILE B 52  ? VAL B 26  ILE B 33  
E 5  LEU B 59  ? LEU B 66  ? LEU B 40  LEU B 47  
E 6  ILE C 209 ? ALA C 214 ? ILE C 190 ALA C 195 
E 7  GLN C 220 ? GLU C 229 ? GLN C 201 GLU C 210 
E 8  TRP C 149 ? MET C 159 ? TRP C 130 MET C 140 
E 9  ILE C 254 ? THR C 256 ? ILE C 235 THR C 237 
F 1  TRP B 79  ? ASP B 82  ? TRP B 60  ASP B 63  
F 2  ASP B 95  ? ARG B 105 ? ASP B 76  ARG B 86  
F 3  LYS B 114 ? PHE B 121 ? LYS B 95  PHE B 102 
F 4  VAL B 45  ? ILE B 52  ? VAL B 26  ILE B 33  
F 5  LEU B 59  ? LEU B 66  ? LEU B 40  LEU B 47  
F 6  ILE C 209 ? ALA C 214 ? ILE C 190 ALA C 195 
F 7  GLN C 220 ? GLU C 229 ? GLN C 201 GLU C 210 
F 8  TRP C 149 ? MET C 159 ? TRP C 130 MET C 140 
F 9  CYS C 271 ? SER C 276 ? CYS C 252 SER C 257 
F 10 PHE C 356 ? ASP C 358 ? PHE C 337 ASP C 339 
F 11 ILE C 342 ? ILE C 344 ? ILE C 323 ILE C 325 
F 12 ALA C 333 ? VAL C 335 ? ALA C 314 VAL C 316 
G 1  TRP C 79  ? ASP C 82  ? TRP C 60  ASP C 63  
G 2  ASP C 95  ? ARG C 105 ? ASP C 76  ARG C 86  
G 3  LYS C 114 ? PHE C 121 ? LYS C 95  PHE C 102 
G 4  VAL C 45  ? ILE C 52  ? VAL C 26  ILE C 33  
G 5  LEU C 59  ? LEU C 66  ? LEU C 40  LEU C 47  
G 6  ILE D 209 ? ALA D 214 ? ILE D 190 ALA D 195 
G 7  GLN D 220 ? GLU D 229 ? GLN D 201 GLU D 210 
G 8  TRP D 149 ? MET D 159 ? TRP D 130 MET D 140 
G 9  ILE D 254 ? THR D 256 ? ILE D 235 THR D 237 
H 1  TRP C 79  ? ASP C 82  ? TRP C 60  ASP C 63  
H 2  ASP C 95  ? ARG C 105 ? ASP C 76  ARG C 86  
H 3  LYS C 114 ? PHE C 121 ? LYS C 95  PHE C 102 
H 4  VAL C 45  ? ILE C 52  ? VAL C 26  ILE C 33  
H 5  LEU C 59  ? LEU C 66  ? LEU C 40  LEU C 47  
H 6  ILE D 209 ? ALA D 214 ? ILE D 190 ALA D 195 
H 7  GLN D 220 ? GLU D 229 ? GLN D 201 GLU D 210 
H 8  TRP D 149 ? MET D 159 ? TRP D 130 MET D 140 
H 9  CYS D 271 ? SER D 276 ? CYS D 252 SER D 257 
H 10 PHE D 356 ? ASP D 358 ? PHE D 337 ASP D 339 
H 11 ILE D 342 ? ILE D 344 ? ILE D 323 ILE D 325 
H 12 ALA D 333 ? VAL D 335 ? ALA D 314 VAL D 316 
I 1  TRP D 79  ? ASP D 82  ? TRP D 60  ASP D 63  
I 2  ASP D 95  ? ARG D 105 ? ASP D 76  ARG D 86  
I 3  LYS D 114 ? PHE D 121 ? LYS D 95  PHE D 102 
I 4  VAL D 45  ? ILE D 52  ? VAL D 26  ILE D 33  
I 5  LEU D 59  ? LEU D 66  ? LEU D 40  LEU D 47  
I 6  ILE E 209 ? ALA E 214 ? ILE E 190 ALA E 195 
I 7  GLN E 220 ? GLU E 229 ? GLN E 201 GLU E 210 
I 8  TRP E 149 ? MET E 159 ? TRP E 130 MET E 140 
I 9  ILE E 254 ? THR E 256 ? ILE E 235 THR E 237 
J 1  TRP D 79  ? ASP D 82  ? TRP D 60  ASP D 63  
J 2  ASP D 95  ? ARG D 105 ? ASP D 76  ARG D 86  
J 3  LYS D 114 ? PHE D 121 ? LYS D 95  PHE D 102 
J 4  VAL D 45  ? ILE D 52  ? VAL D 26  ILE D 33  
J 5  LEU D 59  ? LEU D 66  ? LEU D 40  LEU D 47  
J 6  ILE E 209 ? ALA E 214 ? ILE E 190 ALA E 195 
J 7  GLN E 220 ? GLU E 229 ? GLN E 201 GLU E 210 
J 8  TRP E 149 ? MET E 159 ? TRP E 130 MET E 140 
J 9  THR E 273 ? SER E 276 ? THR E 254 SER E 257 
J 10 PHE E 356 ? ASP E 358 ? PHE E 337 ASP E 339 
J 11 ILE E 342 ? ILE E 344 ? ILE E 323 ILE E 325 
J 12 ALA E 333 ? VAL E 335 ? ALA E 314 VAL E 316 
K 1  TRP F 79  ? ASP F 82  ? TRP F 60  ASP F 63  
K 2  ASP F 95  ? ARG F 105 ? ASP F 76  ARG F 86  
K 3  LYS F 114 ? PHE F 121 ? LYS F 95  PHE F 102 
K 4  VAL F 45  ? ILE F 52  ? VAL F 26  ILE F 33  
K 5  LEU F 59  ? LEU F 66  ? LEU F 40  LEU F 47  
K 6  ILE G 209 ? ALA G 214 ? ILE G 190 ALA G 195 
K 7  GLN G 220 ? GLU G 229 ? GLN G 201 GLU G 210 
K 8  TRP G 149 ? GLY G 160 ? TRP G 130 GLY G 141 
K 9  VAL G 253 ? THR G 256 ? VAL G 234 THR G 237 
L 1  TRP F 79  ? ASP F 82  ? TRP F 60  ASP F 63  
L 2  ASP F 95  ? ARG F 105 ? ASP F 76  ARG F 86  
L 3  LYS F 114 ? PHE F 121 ? LYS F 95  PHE F 102 
L 4  VAL F 45  ? ILE F 52  ? VAL F 26  ILE F 33  
L 5  LEU F 59  ? LEU F 66  ? LEU F 40  LEU F 47  
L 6  ILE G 209 ? ALA G 214 ? ILE G 190 ALA G 195 
L 7  GLN G 220 ? GLU G 229 ? GLN G 201 GLU G 210 
L 8  TRP G 149 ? GLY G 160 ? TRP G 130 GLY G 141 
L 9  CYS G 271 ? SER G 276 ? CYS G 252 SER G 257 
L 10 PHE G 356 ? ASP G 358 ? PHE G 337 ASP G 339 
L 11 ILE G 342 ? ILE G 344 ? ILE G 323 ILE G 325 
L 12 ALA G 333 ? VAL G 335 ? ALA G 314 VAL G 316 
M 1  ILE F 254 ? THR F 256 ? ILE F 235 THR F 237 
M 2  TRP F 149 ? MET F 159 ? TRP F 130 MET F 140 
M 3  CYS F 271 ? SER F 276 ? CYS F 252 SER F 257 
M 4  PHE F 356 ? ASP F 358 ? PHE F 337 ASP F 339 
M 5  ILE F 342 ? ILE F 344 ? ILE F 323 ILE F 325 
M 6  ALA F 333 ? VAL F 335 ? ALA F 314 VAL F 316 
N 1  ILE F 254 ? THR F 256 ? ILE F 235 THR F 237 
N 2  TRP F 149 ? MET F 159 ? TRP F 130 MET F 140 
N 3  GLN F 220 ? GLU F 229 ? GLN F 201 GLU F 210 
N 4  ILE F 209 ? ALA F 214 ? ILE F 190 ALA F 195 
N 5  LEU J 59  ? LEU J 66  ? LEU J 40  LEU J 47  
N 6  VAL J 45  ? ILE J 52  ? VAL J 26  ILE J 33  
N 7  LYS J 114 ? PHE J 121 ? LYS J 95  PHE J 102 
N 8  ASP J 95  ? ARG J 105 ? ASP J 76  ARG J 86  
N 9  TRP J 79  ? ASP J 82  ? TRP J 60  ASP J 63  
O 1  TRP G 79  ? ASP G 82  ? TRP G 60  ASP G 63  
O 2  ASP G 95  ? ARG G 105 ? ASP G 76  ARG G 86  
O 3  LYS G 114 ? PHE G 121 ? LYS G 95  PHE G 102 
O 4  VAL G 45  ? ILE G 52  ? VAL G 26  ILE G 33  
O 5  LEU G 59  ? LEU G 66  ? LEU G 40  LEU G 47  
O 6  ILE H 209 ? ALA H 214 ? ILE H 190 ALA H 195 
O 7  GLN H 220 ? GLU H 229 ? GLN H 201 GLU H 210 
O 8  TRP H 149 ? MET H 159 ? TRP H 130 MET H 140 
O 9  ILE H 254 ? THR H 256 ? ILE H 235 THR H 237 
P 1  TRP G 79  ? ASP G 82  ? TRP G 60  ASP G 63  
P 2  ASP G 95  ? ARG G 105 ? ASP G 76  ARG G 86  
P 3  LYS G 114 ? PHE G 121 ? LYS G 95  PHE G 102 
P 4  VAL G 45  ? ILE G 52  ? VAL G 26  ILE G 33  
P 5  LEU G 59  ? LEU G 66  ? LEU G 40  LEU G 47  
P 6  ILE H 209 ? ALA H 214 ? ILE H 190 ALA H 195 
P 7  GLN H 220 ? GLU H 229 ? GLN H 201 GLU H 210 
P 8  TRP H 149 ? MET H 159 ? TRP H 130 MET H 140 
P 9  CYS H 271 ? SER H 276 ? CYS H 252 SER H 257 
P 10 PHE H 356 ? ASP H 358 ? PHE H 337 ASP H 339 
P 11 ILE H 342 ? ILE H 344 ? ILE H 323 ILE H 325 
P 12 ALA H 333 ? VAL H 335 ? ALA H 314 VAL H 316 
Q 1  TRP H 79  ? ASP H 82  ? TRP H 60  ASP H 63  
Q 2  ASP H 95  ? ARG H 105 ? ASP H 76  ARG H 86  
Q 3  LYS H 114 ? PHE H 121 ? LYS H 95  PHE H 102 
Q 4  VAL H 45  ? ILE H 52  ? VAL H 26  ILE H 33  
Q 5  LEU H 59  ? LEU H 66  ? LEU H 40  LEU H 47  
Q 6  ILE I 209 ? ALA I 214 ? ILE I 190 ALA I 195 
Q 7  GLN I 220 ? GLU I 229 ? GLN I 201 GLU I 210 
Q 8  TRP I 149 ? MET I 159 ? TRP I 130 MET I 140 
Q 9  ILE I 254 ? THR I 256 ? ILE I 235 THR I 237 
R 1  TRP H 79  ? ASP H 82  ? TRP H 60  ASP H 63  
R 2  ASP H 95  ? ARG H 105 ? ASP H 76  ARG H 86  
R 3  LYS H 114 ? PHE H 121 ? LYS H 95  PHE H 102 
R 4  VAL H 45  ? ILE H 52  ? VAL H 26  ILE H 33  
R 5  LEU H 59  ? LEU H 66  ? LEU H 40  LEU H 47  
R 6  ILE I 209 ? ALA I 214 ? ILE I 190 ALA I 195 
R 7  GLN I 220 ? GLU I 229 ? GLN I 201 GLU I 210 
R 8  TRP I 149 ? MET I 159 ? TRP I 130 MET I 140 
R 9  CYS I 271 ? SER I 276 ? CYS I 252 SER I 257 
R 10 PHE I 356 ? ASP I 358 ? PHE I 337 ASP I 339 
R 11 ILE I 342 ? ILE I 344 ? ILE I 323 ILE I 325 
R 12 ALA I 333 ? VAL I 335 ? ALA I 314 VAL I 316 
S 1  TRP I 79  ? ASP I 82  ? TRP I 60  ASP I 63  
S 2  ASP I 95  ? ARG I 105 ? ASP I 76  ARG I 86  
S 3  LYS I 114 ? PHE I 121 ? LYS I 95  PHE I 102 
S 4  VAL I 45  ? ILE I 52  ? VAL I 26  ILE I 33  
S 5  LEU I 59  ? LEU I 66  ? LEU I 40  LEU I 47  
S 6  ILE J 209 ? ALA J 214 ? ILE J 190 ALA J 195 
S 7  GLN J 220 ? GLU J 229 ? GLN J 201 GLU J 210 
S 8  TRP J 149 ? GLY J 160 ? TRP J 130 GLY J 141 
S 9  VAL J 253 ? THR J 256 ? VAL J 234 THR J 237 
T 1  TRP I 79  ? ASP I 82  ? TRP I 60  ASP I 63  
T 2  ASP I 95  ? ARG I 105 ? ASP I 76  ARG I 86  
T 3  LYS I 114 ? PHE I 121 ? LYS I 95  PHE I 102 
T 4  VAL I 45  ? ILE I 52  ? VAL I 26  ILE I 33  
T 5  LEU I 59  ? LEU I 66  ? LEU I 40  LEU I 47  
T 6  ILE J 209 ? ALA J 214 ? ILE J 190 ALA J 195 
T 7  GLN J 220 ? GLU J 229 ? GLN J 201 GLU J 210 
T 8  TRP J 149 ? GLY J 160 ? TRP J 130 GLY J 141 
T 9  THR J 273 ? SER J 276 ? THR J 254 SER J 257 
T 10 PHE J 356 ? ASP J 358 ? PHE J 337 ASP J 339 
T 11 ILE J 342 ? ILE J 344 ? ILE J 323 ILE J 325 
T 12 ALA J 333 ? VAL J 335 ? ALA J 314 VAL J 316 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N TRP A 79  ? N TRP A 60  O LEU A 98  ? O LEU A 79  
A 2  3  N PHE A 104 ? N PHE A 85  O LEU A 115 ? O LEU A 96  
A 3  4  O VAL A 116 ? O VAL A 97  N ILE A 50  ? N ILE A 31  
A 4  5  N VAL A 45  ? N VAL A 26  O LEU A 66  ? O LEU A 47  
A 5  6  N THR A 65  ? N THR A 46  O ALA B 210 ? O ALA B 191 
A 6  7  N GLY B 211 ? N GLY B 192 O GLN B 224 ? O GLN B 205 
A 7  8  O ILE B 225 ? O ILE B 206 N MET B 152 ? N MET B 133 
A 8  9  N MET B 159 ? N MET B 140 O ILE B 254 ? O ILE B 235 
B 1  2  N TRP A 79  ? N TRP A 60  O LEU A 98  ? O LEU A 79  
B 2  3  N PHE A 104 ? N PHE A 85  O LEU A 115 ? O LEU A 96  
B 3  4  O VAL A 116 ? O VAL A 97  N ILE A 50  ? N ILE A 31  
B 4  5  N VAL A 45  ? N VAL A 26  O LEU A 66  ? O LEU A 47  
B 5  6  N THR A 65  ? N THR A 46  O ALA B 210 ? O ALA B 191 
B 6  7  N GLY B 211 ? N GLY B 192 O GLN B 224 ? O GLN B 205 
B 7  8  O ILE B 225 ? O ILE B 206 N MET B 152 ? N MET B 133 
B 8  9  N GLY B 151 ? N GLY B 132 O ASN B 274 ? O ASN B 255 
B 9  10 N THR B 273 ? N THR B 254 O ASP B 358 ? O ASP B 339 
B 10 11 O GLU B 357 ? O GLU B 338 N ARG B 343 ? N ARG B 324 
B 11 12 O ILE B 344 ? O ILE B 325 N GLY B 334 ? N GLY B 315 
C 1  2  O ILE A 254 ? O ILE A 235 N MET A 159 ? N MET A 140 
C 2  3  N GLY A 151 ? N GLY A 132 O ASN A 274 ? O ASN A 255 
C 3  4  N THR A 273 ? N THR A 254 O ASP A 358 ? O ASP A 339 
C 4  5  O GLU A 357 ? O GLU A 338 N ARG A 343 ? N ARG A 324 
C 5  6  O ILE A 344 ? O ILE A 325 N GLY A 334 ? N GLY A 315 
D 1  2  O ILE A 254 ? O ILE A 235 N MET A 159 ? N MET A 140 
D 2  3  N TYR A 156 ? N TYR A 137 O TRP A 221 ? O TRP A 202 
D 3  4  O GLN A 224 ? O GLN A 205 N ALA A 210 ? N ALA A 191 
D 4  5  N ALA A 210 ? N ALA A 191 O THR E 65  ? O THR E 46  
D 5  6  O ARG E 60  ? O ARG E 41  N TRP E 51  ? N TRP E 32  
D 6  7  N ILE E 50  ? N ILE E 31  O VAL E 116 ? O VAL E 97  
D 7  8  O LEU E 115 ? O LEU E 96  N PHE E 104 ? N PHE E 85  
D 8  9  O LEU E 98  ? O LEU E 79  N TRP E 79  ? N TRP E 60  
E 1  2  N TRP B 79  ? N TRP B 60  O LEU B 98  ? O LEU B 79  
E 2  3  N PHE B 104 ? N PHE B 85  O LEU B 115 ? O LEU B 96  
E 3  4  O VAL B 116 ? O VAL B 97  N ILE B 50  ? N ILE B 31  
E 4  5  N TYR B 49  ? N TYR B 30  O LYS B 62  ? O LYS B 43  
E 5  6  N THR B 65  ? N THR B 46  O ALA C 210 ? O ALA C 191 
E 6  7  N ALA C 210 ? N ALA C 191 O GLN C 224 ? O GLN C 205 
E 7  8  O TRP C 221 ? O TRP C 202 N TYR C 156 ? N TYR C 137 
E 8  9  N MET C 159 ? N MET C 140 O ILE C 254 ? O ILE C 235 
F 1  2  N TRP B 79  ? N TRP B 60  O LEU B 98  ? O LEU B 79  
F 2  3  N PHE B 104 ? N PHE B 85  O LEU B 115 ? O LEU B 96  
F 3  4  O VAL B 116 ? O VAL B 97  N ILE B 50  ? N ILE B 31  
F 4  5  N TYR B 49  ? N TYR B 30  O LYS B 62  ? O LYS B 43  
F 5  6  N THR B 65  ? N THR B 46  O ALA C 210 ? O ALA C 191 
F 6  7  N ALA C 210 ? N ALA C 191 O GLN C 224 ? O GLN C 205 
F 7  8  O TRP C 221 ? O TRP C 202 N TYR C 156 ? N TYR C 137 
F 8  9  N GLY C 151 ? N GLY C 132 O ASN C 274 ? O ASN C 255 
F 9  10 N THR C 273 ? N THR C 254 O ASP C 358 ? O ASP C 339 
F 10 11 O GLU C 357 ? O GLU C 338 N ARG C 343 ? N ARG C 324 
F 11 12 O ILE C 344 ? O ILE C 325 N GLY C 334 ? N GLY C 315 
G 1  2  N TRP C 79  ? N TRP C 60  O LEU C 98  ? O LEU C 79  
G 2  3  N ALA C 101 ? N ALA C 82  O LEU C 117 ? O LEU C 98  
G 3  4  O CYS C 118 ? O CYS C 99  N ILE C 50  ? N ILE C 31  
G 4  5  N TYR C 49  ? N TYR C 30  O LYS C 62  ? O LYS C 43  
G 5  6  N THR C 65  ? N THR C 46  O ALA D 210 ? O ALA D 191 
G 6  7  N GLY D 211 ? N GLY D 192 O GLN D 224 ? O GLN D 205 
G 7  8  O CYS D 228 ? O CYS D 209 N PHE D 150 ? N PHE D 131 
G 8  9  N MET D 159 ? N MET D 140 O ILE D 254 ? O ILE D 235 
H 1  2  N TRP C 79  ? N TRP C 60  O LEU C 98  ? O LEU C 79  
H 2  3  N ALA C 101 ? N ALA C 82  O LEU C 117 ? O LEU C 98  
H 3  4  O CYS C 118 ? O CYS C 99  N ILE C 50  ? N ILE C 31  
H 4  5  N TYR C 49  ? N TYR C 30  O LYS C 62  ? O LYS C 43  
H 5  6  N THR C 65  ? N THR C 46  O ALA D 210 ? O ALA D 191 
H 6  7  N GLY D 211 ? N GLY D 192 O GLN D 224 ? O GLN D 205 
H 7  8  O CYS D 228 ? O CYS D 209 N PHE D 150 ? N PHE D 131 
H 8  9  N GLY D 151 ? N GLY D 132 O ASN D 274 ? O ASN D 255 
H 9  10 N THR D 273 ? N THR D 254 O ASP D 358 ? O ASP D 339 
H 10 11 O GLU D 357 ? O GLU D 338 N ARG D 343 ? N ARG D 324 
H 11 12 O ILE D 342 ? O ILE D 323 N GLY D 334 ? N GLY D 315 
I 1  2  N TRP D 79  ? N TRP D 60  O LEU D 98  ? O LEU D 79  
I 2  3  N ALA D 101 ? N ALA D 82  O LEU D 117 ? O LEU D 98  
I 3  4  O LYS D 114 ? O LYS D 95  N MET D 48  ? N MET D 29  
I 4  5  N TYR D 49  ? N TYR D 30  O LYS D 62  ? O LYS D 43  
I 5  6  N THR D 65  ? N THR D 46  O ALA E 210 ? O ALA E 191 
I 6  7  N ALA E 210 ? N ALA E 191 O GLN E 224 ? O GLN E 205 
I 7  8  O CYS E 228 ? O CYS E 209 N PHE E 150 ? N PHE E 131 
I 8  9  N MET E 159 ? N MET E 140 O ILE E 254 ? O ILE E 235 
J 1  2  N TRP D 79  ? N TRP D 60  O LEU D 98  ? O LEU D 79  
J 2  3  N ALA D 101 ? N ALA D 82  O LEU D 117 ? O LEU D 98  
J 3  4  O LYS D 114 ? O LYS D 95  N MET D 48  ? N MET D 29  
J 4  5  N TYR D 49  ? N TYR D 30  O LYS D 62  ? O LYS D 43  
J 5  6  N THR D 65  ? N THR D 46  O ALA E 210 ? O ALA E 191 
J 6  7  N ALA E 210 ? N ALA E 191 O GLN E 224 ? O GLN E 205 
J 7  8  O CYS E 228 ? O CYS E 209 N PHE E 150 ? N PHE E 131 
J 8  9  N GLY E 151 ? N GLY E 132 O ASN E 274 ? O ASN E 255 
J 9  10 N THR E 273 ? N THR E 254 O ASP E 358 ? O ASP E 339 
J 10 11 O GLU E 357 ? O GLU E 338 N ARG E 343 ? N ARG E 324 
J 11 12 O ILE E 344 ? O ILE E 325 N GLY E 334 ? N GLY E 315 
K 1  2  N TRP F 79  ? N TRP F 60  O LEU F 98  ? O LEU F 79  
K 2  3  N ALA F 102 ? N ALA F 83  O LEU F 117 ? O LEU F 98  
K 3  4  O VAL F 116 ? O VAL F 97  N ILE F 50  ? N ILE F 31  
K 4  5  N TYR F 49  ? N TYR F 30  O LYS F 62  ? O LYS F 43  
K 5  6  N THR F 65  ? N THR F 46  O ALA G 210 ? O ALA G 191 
K 6  7  N GLY G 211 ? N GLY G 192 O GLN G 224 ? O GLN G 205 
K 7  8  O TRP G 221 ? O TRP G 202 N TYR G 156 ? N TYR G 137 
K 8  9  N MET G 159 ? N MET G 140 O ILE G 254 ? O ILE G 235 
L 1  2  N TRP F 79  ? N TRP F 60  O LEU F 98  ? O LEU F 79  
L 2  3  N ALA F 102 ? N ALA F 83  O LEU F 117 ? O LEU F 98  
L 3  4  O VAL F 116 ? O VAL F 97  N ILE F 50  ? N ILE F 31  
L 4  5  N TYR F 49  ? N TYR F 30  O LYS F 62  ? O LYS F 43  
L 5  6  N THR F 65  ? N THR F 46  O ALA G 210 ? O ALA G 191 
L 6  7  N GLY G 211 ? N GLY G 192 O GLN G 224 ? O GLN G 205 
L 7  8  O TRP G 221 ? O TRP G 202 N TYR G 156 ? N TYR G 137 
L 8  9  N TRP G 149 ? N TRP G 130 O SER G 276 ? O SER G 257 
L 9  10 N THR G 273 ? N THR G 254 O ASP G 358 ? O ASP G 339 
L 10 11 O GLU G 357 ? O GLU G 338 N ARG G 343 ? N ARG G 324 
L 11 12 O ILE G 344 ? O ILE G 325 N GLY G 334 ? N GLY G 315 
M 1  2  O THR F 256 ? O THR F 237 N THR F 157 ? N THR F 138 
M 2  3  N GLY F 151 ? N GLY F 132 O ASN F 274 ? O ASN F 255 
M 3  4  N THR F 273 ? N THR F 254 O ASP F 358 ? O ASP F 339 
M 4  5  O GLU F 357 ? O GLU F 338 N ARG F 343 ? N ARG F 324 
M 5  6  O ILE F 344 ? O ILE F 325 N GLY F 334 ? N GLY F 315 
N 1  2  O THR F 256 ? O THR F 237 N THR F 157 ? N THR F 138 
N 2  3  N PHE F 150 ? N PHE F 131 O CYS F 228 ? O CYS F 209 
N 3  4  O GLN F 224 ? O GLN F 205 N ALA F 210 ? N ALA F 191 
N 4  5  N ALA F 210 ? N ALA F 191 O THR J 65  ? O THR J 46  
N 5  6  O LEU J 66  ? O LEU J 47  N VAL J 45  ? N VAL J 26  
N 6  7  N ILE J 50  ? N ILE J 31  O VAL J 116 ? O VAL J 97  
N 7  8  O LEU J 115 ? O LEU J 96  N PHE J 104 ? N PHE J 85  
N 8  9  O LEU J 98  ? O LEU J 79  N TRP J 79  ? N TRP J 60  
O 1  2  N PHE G 81  ? N PHE G 62  O MET G 96  ? O MET G 77  
O 2  3  N ALA G 102 ? N ALA G 83  O LEU G 117 ? O LEU G 98  
O 3  4  O VAL G 116 ? O VAL G 97  N ILE G 50  ? N ILE G 31  
O 4  5  N VAL G 45  ? N VAL G 26  O LEU G 66  ? O LEU G 47  
O 5  6  N THR G 65  ? N THR G 46  O ALA H 210 ? O ALA H 191 
O 6  7  N GLY H 211 ? N GLY H 192 O GLN H 224 ? O GLN H 205 
O 7  8  O CYS H 228 ? O CYS H 209 N PHE H 150 ? N PHE H 131 
O 8  9  N MET H 159 ? N MET H 140 O ILE H 254 ? O ILE H 235 
P 1  2  N PHE G 81  ? N PHE G 62  O MET G 96  ? O MET G 77  
P 2  3  N ALA G 102 ? N ALA G 83  O LEU G 117 ? O LEU G 98  
P 3  4  O VAL G 116 ? O VAL G 97  N ILE G 50  ? N ILE G 31  
P 4  5  N VAL G 45  ? N VAL G 26  O LEU G 66  ? O LEU G 47  
P 5  6  N THR G 65  ? N THR G 46  O ALA H 210 ? O ALA H 191 
P 6  7  N GLY H 211 ? N GLY H 192 O GLN H 224 ? O GLN H 205 
P 7  8  O CYS H 228 ? O CYS H 209 N PHE H 150 ? N PHE H 131 
P 8  9  N GLY H 151 ? N GLY H 132 O ASN H 274 ? O ASN H 255 
P 9  10 N THR H 273 ? N THR H 254 O ASP H 358 ? O ASP H 339 
P 10 11 O GLU H 357 ? O GLU H 338 N ARG H 343 ? N ARG H 324 
P 11 12 O ILE H 344 ? O ILE H 325 N GLY H 334 ? N GLY H 315 
Q 1  2  N TRP H 79  ? N TRP H 60  O LEU H 98  ? O LEU H 79  
Q 2  3  N ALA H 102 ? N ALA H 83  O LEU H 117 ? O LEU H 98  
Q 3  4  O VAL H 116 ? O VAL H 97  N ILE H 50  ? N ILE H 31  
Q 4  5  N VAL H 45  ? N VAL H 26  O LEU H 66  ? O LEU H 47  
Q 5  6  N THR H 65  ? N THR H 46  O ALA I 210 ? O ALA I 191 
Q 6  7  N ALA I 210 ? N ALA I 191 O GLN I 224 ? O GLN I 205 
Q 7  8  O CYS I 228 ? O CYS I 209 N PHE I 150 ? N PHE I 131 
Q 8  9  N THR I 157 ? N THR I 138 O THR I 256 ? O THR I 237 
R 1  2  N TRP H 79  ? N TRP H 60  O LEU H 98  ? O LEU H 79  
R 2  3  N ALA H 102 ? N ALA H 83  O LEU H 117 ? O LEU H 98  
R 3  4  O VAL H 116 ? O VAL H 97  N ILE H 50  ? N ILE H 31  
R 4  5  N VAL H 45  ? N VAL H 26  O LEU H 66  ? O LEU H 47  
R 5  6  N THR H 65  ? N THR H 46  O ALA I 210 ? O ALA I 191 
R 6  7  N ALA I 210 ? N ALA I 191 O GLN I 224 ? O GLN I 205 
R 7  8  O CYS I 228 ? O CYS I 209 N PHE I 150 ? N PHE I 131 
R 8  9  N GLY I 151 ? N GLY I 132 O ASN I 274 ? O ASN I 255 
R 9  10 N THR I 273 ? N THR I 254 O ASP I 358 ? O ASP I 339 
R 10 11 O GLU I 357 ? O GLU I 338 N ARG I 343 ? N ARG I 324 
R 11 12 O ILE I 344 ? O ILE I 325 N GLY I 334 ? N GLY I 315 
S 1  2  N TRP I 79  ? N TRP I 60  O LEU I 98  ? O LEU I 79  
S 2  3  N ALA I 102 ? N ALA I 83  O LEU I 117 ? O LEU I 98  
S 3  4  O VAL I 116 ? O VAL I 97  N ILE I 50  ? N ILE I 31  
S 4  5  N TYR I 49  ? N TYR I 30  O LYS I 62  ? O LYS I 43  
S 5  6  N THR I 63  ? N THR I 44  O THR J 212 ? O THR J 193 
S 6  7  N ALA J 210 ? N ALA J 191 O GLN J 224 ? O GLN J 205 
S 7  8  O CYS J 228 ? O CYS J 209 N PHE J 150 ? N PHE J 131 
S 8  9  N MET J 159 ? N MET J 140 O ILE J 254 ? O ILE J 235 
T 1  2  N TRP I 79  ? N TRP I 60  O LEU I 98  ? O LEU I 79  
T 2  3  N ALA I 102 ? N ALA I 83  O LEU I 117 ? O LEU I 98  
T 3  4  O VAL I 116 ? O VAL I 97  N ILE I 50  ? N ILE I 31  
T 4  5  N TYR I 49  ? N TYR I 30  O LYS I 62  ? O LYS I 43  
T 5  6  N THR I 63  ? N THR I 44  O THR J 212 ? O THR J 193 
T 6  7  N ALA J 210 ? N ALA J 191 O GLN J 224 ? O GLN J 205 
T 7  8  O CYS J 228 ? O CYS J 209 N PHE J 150 ? N PHE J 131 
T 8  9  N GLY J 151 ? N GLY J 132 O ASN J 274 ? O ASN J 255 
T 9  10 N THR J 273 ? N THR J 254 O ASP J 358 ? O ASP J 339 
T 10 11 O GLU J 357 ? O GLU J 338 N ARG J 343 ? N ARG J 324 
T 11 12 O ILE J 344 ? O ILE J 325 N GLY J 334 ? N GLY J 315 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 401'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 402'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 403'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 401'  
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN B 402'  
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN B 403'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 401'  
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 402'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 403'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN D 401'  
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN D 402'  
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN D 403'  
BC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN E 401'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN E 402'  
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN E 403'  
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN F 401'  
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN F 402'  
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN F 403'  
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN G 401'  
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN G 402'  
CC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN G 403'  
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN H 401'  
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN H 402'  
CC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN H 403'  
CC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN I 401'  
CC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN I 402'  
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN I 403'  
DC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN J 401'  
DC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN J 402'  
DC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN J 403'  
DC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL B 701'  
DC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL C 702'  
DC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 703'  
DC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL D 704'  
DC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL B 705'  
DC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL F 706'  
EC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL G 707'  
EC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL G 708'  
EC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL I 709'  
EC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL J 710'  
EC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADP A 501' 
EC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE P3S A 601' 
EC7 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE ADP B 501' 
EC8 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE P3S B 601' 
EC9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE ADP C 501' 
FC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE P3S C 601' 
FC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ADP D 501' 
FC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE P3S D 601' 
FC4 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADP E 501' 
FC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE P3S E 601' 
FC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADP F 501' 
FC7 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE P3S F 601' 
FC8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ADP G 501' 
FC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE P3S G 601' 
GC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ADP H 501' 
GC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE P3S H 601' 
GC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE ADP I 501' 
GC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE P3S I 601' 
GC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ADP J 501' 
GC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE P3S J 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  GLU A  155 ? GLU A 136 . ? 1_555 ? 
2   AC1 6  GLU A  215 ? GLU A 196 . ? 1_555 ? 
3   AC1 6  GLU A  222 ? GLU A 203 . ? 1_555 ? 
4   AC1 6  MN  M  .   ? MN  A 403 . ? 1_555 ? 
5   AC1 6  P3S P  .   ? P3S A 601 . ? 1_555 ? 
6   AC1 6  HOH SB .   ? HOH A 704 . ? 1_555 ? 
7   AC2 6  GLU A  153 ? GLU A 134 . ? 1_555 ? 
8   AC2 6  HIS A  272 ? HIS A 253 . ? 1_555 ? 
9   AC2 6  GLU A  357 ? GLU A 338 . ? 1_555 ? 
10  AC2 6  ARG A  359 ? ARG A 340 . ? 1_555 ? 
11  AC2 6  ADP O  .   ? ADP A 501 . ? 1_555 ? 
12  AC2 6  P3S P  .   ? P3S A 601 . ? 1_555 ? 
13  AC3 6  GLU A  153 ? GLU A 134 . ? 1_555 ? 
14  AC3 6  GLU A  222 ? GLU A 203 . ? 1_555 ? 
15  AC3 6  MN  K  .   ? MN  A 401 . ? 1_555 ? 
16  AC3 6  ADP O  .   ? ADP A 501 . ? 1_555 ? 
17  AC3 6  P3S P  .   ? P3S A 601 . ? 1_555 ? 
18  AC3 6  HOH SB .   ? HOH A 729 . ? 1_555 ? 
19  AC4 6  GLU B  155 ? GLU B 136 . ? 1_555 ? 
20  AC4 6  GLU B  215 ? GLU B 196 . ? 1_555 ? 
21  AC4 6  GLU B  222 ? GLU B 203 . ? 1_555 ? 
22  AC4 6  MN  S  .   ? MN  B 403 . ? 1_555 ? 
23  AC4 6  P3S W  .   ? P3S B 601 . ? 1_555 ? 
24  AC4 6  HOH TB .   ? HOH B 744 . ? 1_555 ? 
25  AC5 7  GLU B  153 ? GLU B 134 . ? 1_555 ? 
26  AC5 7  HIS B  272 ? HIS B 253 . ? 1_555 ? 
27  AC5 7  GLU B  357 ? GLU B 338 . ? 1_555 ? 
28  AC5 7  ARG B  359 ? ARG B 340 . ? 1_555 ? 
29  AC5 7  MN  S  .   ? MN  B 403 . ? 1_555 ? 
30  AC5 7  ADP V  .   ? ADP B 501 . ? 1_555 ? 
31  AC5 7  P3S W  .   ? P3S B 601 . ? 1_555 ? 
32  AC6 7  GLU B  153 ? GLU B 134 . ? 1_555 ? 
33  AC6 7  GLU B  222 ? GLU B 203 . ? 1_555 ? 
34  AC6 7  MN  Q  .   ? MN  B 401 . ? 1_555 ? 
35  AC6 7  MN  R  .   ? MN  B 402 . ? 1_555 ? 
36  AC6 7  ADP V  .   ? ADP B 501 . ? 1_555 ? 
37  AC6 7  P3S W  .   ? P3S B 601 . ? 1_555 ? 
38  AC6 7  HOH TB .   ? HOH B 741 . ? 1_555 ? 
39  AC7 6  GLU C  155 ? GLU C 136 . ? 1_555 ? 
40  AC7 6  GLU C  215 ? GLU C 196 . ? 1_555 ? 
41  AC7 6  GLU C  222 ? GLU C 203 . ? 1_555 ? 
42  AC7 6  MN  Z  .   ? MN  C 403 . ? 1_555 ? 
43  AC7 6  P3S CA .   ? P3S C 601 . ? 1_555 ? 
44  AC7 6  HOH UB .   ? HOH C 740 . ? 1_555 ? 
45  AC8 6  GLU C  153 ? GLU C 134 . ? 1_555 ? 
46  AC8 6  HIS C  272 ? HIS C 253 . ? 1_555 ? 
47  AC8 6  GLU C  357 ? GLU C 338 . ? 1_555 ? 
48  AC8 6  ARG C  359 ? ARG C 340 . ? 1_555 ? 
49  AC8 6  ADP BA .   ? ADP C 501 . ? 1_555 ? 
50  AC8 6  P3S CA .   ? P3S C 601 . ? 1_555 ? 
51  AC9 6  GLU C  153 ? GLU C 134 . ? 1_555 ? 
52  AC9 6  GLU C  222 ? GLU C 203 . ? 1_555 ? 
53  AC9 6  MN  X  .   ? MN  C 401 . ? 1_555 ? 
54  AC9 6  ADP BA .   ? ADP C 501 . ? 1_555 ? 
55  AC9 6  P3S CA .   ? P3S C 601 . ? 1_555 ? 
56  AC9 6  HOH UB .   ? HOH C 738 . ? 1_555 ? 
57  BC1 5  GLU D  155 ? GLU D 136 . ? 1_555 ? 
58  BC1 5  GLU D  215 ? GLU D 196 . ? 1_555 ? 
59  BC1 5  GLU D  222 ? GLU D 203 . ? 1_555 ? 
60  BC1 5  MN  FA .   ? MN  D 403 . ? 1_555 ? 
61  BC1 5  P3S IA .   ? P3S D 601 . ? 1_555 ? 
62  BC2 5  GLU D  153 ? GLU D 134 . ? 1_555 ? 
63  BC2 5  HIS D  272 ? HIS D 253 . ? 1_555 ? 
64  BC2 5  GLU D  357 ? GLU D 338 . ? 1_555 ? 
65  BC2 5  ADP HA .   ? ADP D 501 . ? 1_555 ? 
66  BC2 5  P3S IA .   ? P3S D 601 . ? 1_555 ? 
67  BC3 6  GLU D  153 ? GLU D 134 . ? 1_555 ? 
68  BC3 6  GLU D  222 ? GLU D 203 . ? 1_555 ? 
69  BC3 6  MN  DA .   ? MN  D 401 . ? 1_555 ? 
70  BC3 6  ADP HA .   ? ADP D 501 . ? 1_555 ? 
71  BC3 6  P3S IA .   ? P3S D 601 . ? 1_555 ? 
72  BC3 6  HOH VB .   ? HOH D 747 . ? 1_555 ? 
73  BC4 5  GLU E  155 ? GLU E 136 . ? 1_555 ? 
74  BC4 5  GLU E  215 ? GLU E 196 . ? 1_555 ? 
75  BC4 5  GLU E  222 ? GLU E 203 . ? 1_555 ? 
76  BC4 5  P3S NA .   ? P3S E 601 . ? 1_555 ? 
77  BC4 5  HOH WB .   ? HOH E 629 . ? 1_555 ? 
78  BC5 6  GLU E  153 ? GLU E 134 . ? 1_555 ? 
79  BC5 6  HIS E  272 ? HIS E 253 . ? 1_555 ? 
80  BC5 6  GLU E  357 ? GLU E 338 . ? 1_555 ? 
81  BC5 6  ARG E  359 ? ARG E 340 . ? 1_555 ? 
82  BC5 6  ADP MA .   ? ADP E 501 . ? 1_555 ? 
83  BC5 6  P3S NA .   ? P3S E 601 . ? 1_555 ? 
84  BC6 5  GLU E  153 ? GLU E 134 . ? 1_555 ? 
85  BC6 5  GLU E  222 ? GLU E 203 . ? 1_555 ? 
86  BC6 5  ADP MA .   ? ADP E 501 . ? 1_555 ? 
87  BC6 5  P3S NA .   ? P3S E 601 . ? 1_555 ? 
88  BC6 5  HOH WB .   ? HOH E 627 . ? 1_555 ? 
89  BC7 5  GLU F  155 ? GLU F 136 . ? 1_555 ? 
90  BC7 5  GLU F  215 ? GLU F 196 . ? 1_555 ? 
91  BC7 5  GLU F  222 ? GLU F 203 . ? 1_555 ? 
92  BC7 5  MN  QA .   ? MN  F 403 . ? 1_555 ? 
93  BC7 5  P3S TA .   ? P3S F 601 . ? 1_555 ? 
94  BC8 6  GLU F  153 ? GLU F 134 . ? 1_555 ? 
95  BC8 6  HIS F  272 ? HIS F 253 . ? 1_555 ? 
96  BC8 6  GLU F  357 ? GLU F 338 . ? 1_555 ? 
97  BC8 6  ARG F  359 ? ARG F 340 . ? 1_555 ? 
98  BC8 6  ADP SA .   ? ADP F 501 . ? 1_555 ? 
99  BC8 6  P3S TA .   ? P3S F 601 . ? 1_555 ? 
100 BC9 6  GLU F  153 ? GLU F 134 . ? 1_555 ? 
101 BC9 6  GLU F  222 ? GLU F 203 . ? 1_555 ? 
102 BC9 6  MN  OA .   ? MN  F 401 . ? 1_555 ? 
103 BC9 6  ADP SA .   ? ADP F 501 . ? 1_555 ? 
104 BC9 6  P3S TA .   ? P3S F 601 . ? 1_555 ? 
105 BC9 6  HOH XB .   ? HOH F 717 . ? 1_555 ? 
106 CC1 5  GLU G  155 ? GLU G 136 . ? 1_555 ? 
107 CC1 5  GLU G  215 ? GLU G 196 . ? 1_555 ? 
108 CC1 5  GLU G  222 ? GLU G 203 . ? 1_555 ? 
109 CC1 5  MN  WA .   ? MN  G 403 . ? 1_555 ? 
110 CC1 5  P3S AB .   ? P3S G 601 . ? 1_555 ? 
111 CC2 5  GLU G  153 ? GLU G 134 . ? 1_555 ? 
112 CC2 5  HIS G  272 ? HIS G 253 . ? 1_555 ? 
113 CC2 5  GLU G  357 ? GLU G 338 . ? 1_555 ? 
114 CC2 5  ADP ZA .   ? ADP G 501 . ? 1_555 ? 
115 CC2 5  P3S AB .   ? P3S G 601 . ? 1_555 ? 
116 CC3 5  GLU G  153 ? GLU G 134 . ? 1_555 ? 
117 CC3 5  GLU G  222 ? GLU G 203 . ? 1_555 ? 
118 CC3 5  MN  UA .   ? MN  G 401 . ? 1_555 ? 
119 CC3 5  ADP ZA .   ? ADP G 501 . ? 1_555 ? 
120 CC3 5  P3S AB .   ? P3S G 601 . ? 1_555 ? 
121 CC4 6  GLU H  155 ? GLU H 136 . ? 1_555 ? 
122 CC4 6  GLU H  215 ? GLU H 196 . ? 1_555 ? 
123 CC4 6  GLU H  222 ? GLU H 203 . ? 1_555 ? 
124 CC4 6  MN  DB .   ? MN  H 403 . ? 1_555 ? 
125 CC4 6  P3S FB .   ? P3S H 601 . ? 1_555 ? 
126 CC4 6  HOH ZB .   ? HOH H 609 . ? 1_555 ? 
127 CC5 6  GLU H  153 ? GLU H 134 . ? 1_555 ? 
128 CC5 6  HIS H  272 ? HIS H 253 . ? 1_555 ? 
129 CC5 6  GLU H  357 ? GLU H 338 . ? 1_555 ? 
130 CC5 6  MN  DB .   ? MN  H 403 . ? 1_555 ? 
131 CC5 6  ADP EB .   ? ADP H 501 . ? 1_555 ? 
132 CC5 6  P3S FB .   ? P3S H 601 . ? 1_555 ? 
133 CC6 7  GLU H  153 ? GLU H 134 . ? 1_555 ? 
134 CC6 7  GLU H  222 ? GLU H 203 . ? 1_555 ? 
135 CC6 7  MN  BB .   ? MN  H 401 . ? 1_555 ? 
136 CC6 7  MN  CB .   ? MN  H 402 . ? 1_555 ? 
137 CC6 7  ADP EB .   ? ADP H 501 . ? 1_555 ? 
138 CC6 7  P3S FB .   ? P3S H 601 . ? 1_555 ? 
139 CC6 7  HOH ZB .   ? HOH H 608 . ? 1_555 ? 
140 CC7 5  GLU I  155 ? GLU I 136 . ? 1_555 ? 
141 CC7 5  GLU I  215 ? GLU I 196 . ? 1_555 ? 
142 CC7 5  GLU I  222 ? GLU I 203 . ? 1_555 ? 
143 CC7 5  MN  IB .   ? MN  I 403 . ? 1_555 ? 
144 CC7 5  P3S LB .   ? P3S I 601 . ? 1_555 ? 
145 CC8 6  GLU I  153 ? GLU I 134 . ? 1_555 ? 
146 CC8 6  HIS I  272 ? HIS I 253 . ? 1_555 ? 
147 CC8 6  GLU I  357 ? GLU I 338 . ? 1_555 ? 
148 CC8 6  ARG I  359 ? ARG I 340 . ? 1_555 ? 
149 CC8 6  ADP KB .   ? ADP I 501 . ? 1_555 ? 
150 CC8 6  P3S LB .   ? P3S I 601 . ? 1_555 ? 
151 CC9 6  GLU I  153 ? GLU I 134 . ? 1_555 ? 
152 CC9 6  GLU I  222 ? GLU I 203 . ? 1_555 ? 
153 CC9 6  MN  GB .   ? MN  I 401 . ? 1_555 ? 
154 CC9 6  ADP KB .   ? ADP I 501 . ? 1_555 ? 
155 CC9 6  P3S LB .   ? P3S I 601 . ? 1_555 ? 
156 CC9 6  HOH AC .   ? HOH I 718 . ? 1_555 ? 
157 DC1 6  GLU J  155 ? GLU J 136 . ? 1_555 ? 
158 DC1 6  GLU J  215 ? GLU J 196 . ? 1_555 ? 
159 DC1 6  GLU J  222 ? GLU J 203 . ? 1_555 ? 
160 DC1 6  MN  OB .   ? MN  J 403 . ? 1_555 ? 
161 DC1 6  P3S RB .   ? P3S J 601 . ? 1_555 ? 
162 DC1 6  HOH BC .   ? HOH J 718 . ? 1_555 ? 
163 DC2 5  GLU J  153 ? GLU J 134 . ? 1_555 ? 
164 DC2 5  HIS J  272 ? HIS J 253 . ? 1_555 ? 
165 DC2 5  GLU J  357 ? GLU J 338 . ? 1_555 ? 
166 DC2 5  ADP QB .   ? ADP J 501 . ? 1_555 ? 
167 DC2 5  P3S RB .   ? P3S J 601 . ? 1_555 ? 
168 DC3 6  GLU J  153 ? GLU J 134 . ? 1_555 ? 
169 DC3 6  GLU J  222 ? GLU J 203 . ? 1_555 ? 
170 DC3 6  MN  MB .   ? MN  J 401 . ? 1_555 ? 
171 DC3 6  ADP QB .   ? ADP J 501 . ? 1_555 ? 
172 DC3 6  P3S RB .   ? P3S J 601 . ? 1_555 ? 
173 DC3 6  HOH BC .   ? HOH J 717 . ? 1_555 ? 
174 DC4 3  MET B  48  ? MET B 29  . ? 1_555 ? 
175 DC4 3  THR B  63  ? THR B 44  . ? 1_555 ? 
176 DC4 3  THR C  212 ? THR C 193 . ? 1_555 ? 
177 DC5 4  MET C  48  ? MET C 29  . ? 1_555 ? 
178 DC5 4  THR C  63  ? THR C 44  . ? 1_555 ? 
179 DC5 4  THR D  212 ? THR D 193 . ? 1_555 ? 
180 DC5 4  HOH VB .   ? HOH D 731 . ? 1_555 ? 
181 DC6 3  THR A  212 ? THR A 193 . ? 1_555 ? 
182 DC6 3  MET E  48  ? MET E 29  . ? 1_555 ? 
183 DC6 3  THR E  63  ? THR E 44  . ? 1_555 ? 
184 DC7 2  THR D  63  ? THR D 44  . ? 1_555 ? 
185 DC7 2  THR E  212 ? THR E 193 . ? 1_555 ? 
186 DC8 3  MET A  48  ? MET A 29  . ? 1_555 ? 
187 DC8 3  THR A  63  ? THR A 44  . ? 1_555 ? 
188 DC8 3  THR B  212 ? THR B 193 . ? 1_555 ? 
189 DC9 2  THR F  212 ? THR F 193 . ? 1_555 ? 
190 DC9 2  THR J  63  ? THR J 44  . ? 1_555 ? 
191 EC1 2  THR F  63  ? THR F 44  . ? 1_555 ? 
192 EC1 2  THR G  212 ? THR G 193 . ? 1_555 ? 
193 EC2 4  MET G  48  ? MET G 29  . ? 1_555 ? 
194 EC2 4  LYS G  62  ? LYS G 43  . ? 1_555 ? 
195 EC2 4  THR G  63  ? THR G 44  . ? 1_555 ? 
196 EC2 4  THR H  212 ? THR H 193 . ? 1_555 ? 
197 EC3 2  THR H  63  ? THR H 44  . ? 1_555 ? 
198 EC3 2  THR I  212 ? THR I 193 . ? 1_555 ? 
199 EC4 2  THR I  63  ? THR I 44  . ? 1_555 ? 
200 EC4 2  THR J  212 ? THR J 193 . ? 1_555 ? 
201 EC5 20 TRP A  149 ? TRP A 130 . ? 1_555 ? 
202 EC5 20 GLY A  151 ? GLY A 132 . ? 1_555 ? 
203 EC5 20 GLU A  153 ? GLU A 134 . ? 1_555 ? 
204 EC5 20 GLU A  222 ? GLU A 203 . ? 1_555 ? 
205 EC5 20 GLN A  224 ? GLN A 205 . ? 1_555 ? 
206 EC5 20 GLY A  226 ? GLY A 207 . ? 1_555 ? 
207 EC5 20 PRO A  227 ? PRO A 208 . ? 1_555 ? 
208 EC5 20 ASN A  274 ? ASN A 255 . ? 1_555 ? 
209 EC5 20 SER A  276 ? SER A 257 . ? 1_555 ? 
210 EC5 20 ARG A  281 ? ARG A 262 . ? 1_555 ? 
211 EC5 20 ARG A  338 ? ARG A 319 . ? 1_555 ? 
212 EC5 20 ARG A  343 ? ARG A 324 . ? 1_555 ? 
213 EC5 20 TYR A  355 ? TYR A 336 . ? 1_555 ? 
214 EC5 20 GLU A  357 ? GLU A 338 . ? 1_555 ? 
215 EC5 20 MN  L  .   ? MN  A 402 . ? 1_555 ? 
216 EC5 20 MN  M  .   ? MN  A 403 . ? 1_555 ? 
217 EC5 20 P3S P  .   ? P3S A 601 . ? 1_555 ? 
218 EC5 20 HOH SB .   ? HOH A 729 . ? 1_555 ? 
219 EC5 20 HOH SB .   ? HOH A 730 . ? 1_555 ? 
220 EC5 20 HOH SB .   ? HOH A 731 . ? 1_555 ? 
221 EC6 20 GLU A  153 ? GLU A 134 . ? 1_555 ? 
222 EC6 20 GLU A  155 ? GLU A 136 . ? 1_555 ? 
223 EC6 20 GLU A  215 ? GLU A 196 . ? 1_555 ? 
224 EC6 20 GLU A  222 ? GLU A 203 . ? 1_555 ? 
225 EC6 20 GLY A  268 ? GLY A 249 . ? 1_555 ? 
226 EC6 20 HIS A  272 ? HIS A 253 . ? 1_555 ? 
227 EC6 20 ARG A  318 ? ARG A 299 . ? 1_555 ? 
228 EC6 20 GLU A  324 ? GLU A 305 . ? 1_555 ? 
229 EC6 20 THR A  325 ? THR A 306 . ? 1_555 ? 
230 EC6 20 ARG A  338 ? ARG A 319 . ? 1_555 ? 
231 EC6 20 GLU A  357 ? GLU A 338 . ? 1_555 ? 
232 EC6 20 ARG A  359 ? ARG A 340 . ? 1_555 ? 
233 EC6 20 MN  K  .   ? MN  A 401 . ? 1_555 ? 
234 EC6 20 MN  L  .   ? MN  A 402 . ? 1_555 ? 
235 EC6 20 MN  M  .   ? MN  A 403 . ? 1_555 ? 
236 EC6 20 ADP O  .   ? ADP A 501 . ? 1_555 ? 
237 EC6 20 HOH SB .   ? HOH A 704 . ? 1_555 ? 
238 EC6 20 HOH SB .   ? HOH A 729 . ? 1_555 ? 
239 EC6 20 HOH SB .   ? HOH A 733 . ? 1_555 ? 
240 EC6 20 ASP E  82  ? ASP E 63  . ? 1_555 ? 
241 EC7 19 HOH SB .   ? HOH A 732 . ? 1_555 ? 
242 EC7 19 TRP B  149 ? TRP B 130 . ? 1_555 ? 
243 EC7 19 GLY B  151 ? GLY B 132 . ? 1_555 ? 
244 EC7 19 GLU B  153 ? GLU B 134 . ? 1_555 ? 
245 EC7 19 GLU B  222 ? GLU B 203 . ? 1_555 ? 
246 EC7 19 GLN B  224 ? GLN B 205 . ? 1_555 ? 
247 EC7 19 ILE B  225 ? ILE B 206 . ? 1_555 ? 
248 EC7 19 GLY B  226 ? GLY B 207 . ? 1_555 ? 
249 EC7 19 PRO B  227 ? PRO B 208 . ? 1_555 ? 
250 EC7 19 ASN B  274 ? ASN B 255 . ? 1_555 ? 
251 EC7 19 SER B  276 ? SER B 257 . ? 1_555 ? 
252 EC7 19 ARG B  338 ? ARG B 319 . ? 1_555 ? 
253 EC7 19 ARG B  343 ? ARG B 324 . ? 1_555 ? 
254 EC7 19 TYR B  355 ? TYR B 336 . ? 1_555 ? 
255 EC7 19 GLU B  357 ? GLU B 338 . ? 1_555 ? 
256 EC7 19 MN  R  .   ? MN  B 402 . ? 1_555 ? 
257 EC7 19 MN  S  .   ? MN  B 403 . ? 1_555 ? 
258 EC7 19 P3S W  .   ? P3S B 601 . ? 1_555 ? 
259 EC7 19 HOH TB .   ? HOH B 742 . ? 1_555 ? 
260 EC8 20 ASP A  82  ? ASP A 63  . ? 1_555 ? 
261 EC8 20 GLU B  153 ? GLU B 134 . ? 1_555 ? 
262 EC8 20 GLU B  155 ? GLU B 136 . ? 1_555 ? 
263 EC8 20 TYR B  181 ? TYR B 162 . ? 1_555 ? 
264 EC8 20 GLU B  215 ? GLU B 196 . ? 1_555 ? 
265 EC8 20 GLU B  222 ? GLU B 203 . ? 1_555 ? 
266 EC8 20 GLY B  268 ? GLY B 249 . ? 1_555 ? 
267 EC8 20 HIS B  272 ? HIS B 253 . ? 1_555 ? 
268 EC8 20 ARG B  318 ? ARG B 299 . ? 1_555 ? 
269 EC8 20 GLU B  324 ? GLU B 305 . ? 1_555 ? 
270 EC8 20 THR B  325 ? THR B 306 . ? 1_555 ? 
271 EC8 20 ARG B  338 ? ARG B 319 . ? 1_555 ? 
272 EC8 20 GLU B  357 ? GLU B 338 . ? 1_555 ? 
273 EC8 20 ARG B  359 ? ARG B 340 . ? 1_555 ? 
274 EC8 20 MN  Q  .   ? MN  B 401 . ? 1_555 ? 
275 EC8 20 MN  R  .   ? MN  B 402 . ? 1_555 ? 
276 EC8 20 MN  S  .   ? MN  B 403 . ? 1_555 ? 
277 EC8 20 ADP V  .   ? ADP B 501 . ? 1_555 ? 
278 EC8 20 HOH TB .   ? HOH B 718 . ? 1_555 ? 
279 EC8 20 HOH TB .   ? HOH B 744 . ? 1_555 ? 
280 EC9 19 TRP C  149 ? TRP C 130 . ? 1_555 ? 
281 EC9 19 GLY C  151 ? GLY C 132 . ? 1_555 ? 
282 EC9 19 GLU C  153 ? GLU C 134 . ? 1_555 ? 
283 EC9 19 GLU C  222 ? GLU C 203 . ? 1_555 ? 
284 EC9 19 GLN C  224 ? GLN C 205 . ? 1_555 ? 
285 EC9 19 GLY C  226 ? GLY C 207 . ? 1_555 ? 
286 EC9 19 PRO C  227 ? PRO C 208 . ? 1_555 ? 
287 EC9 19 ASN C  274 ? ASN C 255 . ? 1_555 ? 
288 EC9 19 SER C  276 ? SER C 257 . ? 1_555 ? 
289 EC9 19 ARG C  343 ? ARG C 324 . ? 1_555 ? 
290 EC9 19 TYR C  355 ? TYR C 336 . ? 1_555 ? 
291 EC9 19 GLU C  357 ? GLU C 338 . ? 1_555 ? 
292 EC9 19 MN  Y  .   ? MN  C 402 . ? 1_555 ? 
293 EC9 19 MN  Z  .   ? MN  C 403 . ? 1_555 ? 
294 EC9 19 P3S CA .   ? P3S C 601 . ? 1_555 ? 
295 EC9 19 HOH UB .   ? HOH C 709 . ? 1_555 ? 
296 EC9 19 HOH UB .   ? HOH C 736 . ? 1_555 ? 
297 EC9 19 HOH UB .   ? HOH C 738 . ? 1_555 ? 
298 EC9 19 HOH UB .   ? HOH C 739 . ? 1_555 ? 
299 FC1 21 ASP B  82  ? ASP B 63  . ? 1_555 ? 
300 FC1 21 GLU C  153 ? GLU C 134 . ? 1_555 ? 
301 FC1 21 GLU C  155 ? GLU C 136 . ? 1_555 ? 
302 FC1 21 TYR C  181 ? TYR C 162 . ? 1_555 ? 
303 FC1 21 GLU C  215 ? GLU C 196 . ? 1_555 ? 
304 FC1 21 GLU C  222 ? GLU C 203 . ? 1_555 ? 
305 FC1 21 GLY C  268 ? GLY C 249 . ? 1_555 ? 
306 FC1 21 HIS C  272 ? HIS C 253 . ? 1_555 ? 
307 FC1 21 ARG C  318 ? ARG C 299 . ? 1_555 ? 
308 FC1 21 GLU C  324 ? GLU C 305 . ? 1_555 ? 
309 FC1 21 THR C  325 ? THR C 306 . ? 1_555 ? 
310 FC1 21 ARG C  338 ? ARG C 319 . ? 1_555 ? 
311 FC1 21 GLU C  357 ? GLU C 338 . ? 1_555 ? 
312 FC1 21 ARG C  359 ? ARG C 340 . ? 1_555 ? 
313 FC1 21 MN  X  .   ? MN  C 401 . ? 1_555 ? 
314 FC1 21 MN  Y  .   ? MN  C 402 . ? 1_555 ? 
315 FC1 21 MN  Z  .   ? MN  C 403 . ? 1_555 ? 
316 FC1 21 ADP BA .   ? ADP C 501 . ? 1_555 ? 
317 FC1 21 HOH UB .   ? HOH C 704 . ? 1_555 ? 
318 FC1 21 HOH UB .   ? HOH C 730 . ? 1_555 ? 
319 FC1 21 HOH UB .   ? HOH C 740 . ? 1_555 ? 
320 FC2 18 HOH UB .   ? HOH C 707 . ? 1_555 ? 
321 FC2 18 TRP D  149 ? TRP D 130 . ? 1_555 ? 
322 FC2 18 GLY D  151 ? GLY D 132 . ? 1_555 ? 
323 FC2 18 GLU D  153 ? GLU D 134 . ? 1_555 ? 
324 FC2 18 GLU D  222 ? GLU D 203 . ? 1_555 ? 
325 FC2 18 GLN D  224 ? GLN D 205 . ? 1_555 ? 
326 FC2 18 GLY D  226 ? GLY D 207 . ? 1_555 ? 
327 FC2 18 PRO D  227 ? PRO D 208 . ? 1_555 ? 
328 FC2 18 ASN D  274 ? ASN D 255 . ? 1_555 ? 
329 FC2 18 SER D  276 ? SER D 257 . ? 1_555 ? 
330 FC2 18 ARG D  338 ? ARG D 319 . ? 1_555 ? 
331 FC2 18 ARG D  343 ? ARG D 324 . ? 1_555 ? 
332 FC2 18 TYR D  355 ? TYR D 336 . ? 1_555 ? 
333 FC2 18 GLU D  357 ? GLU D 338 . ? 1_555 ? 
334 FC2 18 MN  EA .   ? MN  D 402 . ? 1_555 ? 
335 FC2 18 MN  FA .   ? MN  D 403 . ? 1_555 ? 
336 FC2 18 P3S IA .   ? P3S D 601 . ? 1_555 ? 
337 FC2 18 HOH VB .   ? HOH D 747 . ? 1_555 ? 
338 FC3 18 ASP C  82  ? ASP C 63  . ? 1_555 ? 
339 FC3 18 GLU D  153 ? GLU D 134 . ? 1_555 ? 
340 FC3 18 GLU D  155 ? GLU D 136 . ? 1_555 ? 
341 FC3 18 GLU D  215 ? GLU D 196 . ? 1_555 ? 
342 FC3 18 GLU D  222 ? GLU D 203 . ? 1_555 ? 
343 FC3 18 GLY D  268 ? GLY D 249 . ? 1_555 ? 
344 FC3 18 HIS D  272 ? HIS D 253 . ? 1_555 ? 
345 FC3 18 ARG D  318 ? ARG D 299 . ? 1_555 ? 
346 FC3 18 GLU D  324 ? GLU D 305 . ? 1_555 ? 
347 FC3 18 THR D  325 ? THR D 306 . ? 1_555 ? 
348 FC3 18 ARG D  338 ? ARG D 319 . ? 1_555 ? 
349 FC3 18 GLU D  357 ? GLU D 338 . ? 1_555 ? 
350 FC3 18 ARG D  359 ? ARG D 340 . ? 1_555 ? 
351 FC3 18 MN  DA .   ? MN  D 401 . ? 1_555 ? 
352 FC3 18 MN  EA .   ? MN  D 402 . ? 1_555 ? 
353 FC3 18 MN  FA .   ? MN  D 403 . ? 1_555 ? 
354 FC3 18 ADP HA .   ? ADP D 501 . ? 1_555 ? 
355 FC3 18 HOH VB .   ? HOH D 711 . ? 1_555 ? 
356 FC4 20 HOH VB .   ? HOH D 749 . ? 1_555 ? 
357 FC4 20 TRP E  149 ? TRP E 130 . ? 1_555 ? 
358 FC4 20 GLY E  151 ? GLY E 132 . ? 1_555 ? 
359 FC4 20 GLU E  153 ? GLU E 134 . ? 1_555 ? 
360 FC4 20 GLU E  222 ? GLU E 203 . ? 1_555 ? 
361 FC4 20 GLN E  224 ? GLN E 205 . ? 1_555 ? 
362 FC4 20 GLY E  226 ? GLY E 207 . ? 1_555 ? 
363 FC4 20 PRO E  227 ? PRO E 208 . ? 1_555 ? 
364 FC4 20 ASN E  274 ? ASN E 255 . ? 1_555 ? 
365 FC4 20 SER E  276 ? SER E 257 . ? 1_555 ? 
366 FC4 20 ARG E  338 ? ARG E 319 . ? 1_555 ? 
367 FC4 20 ARG E  343 ? ARG E 324 . ? 1_555 ? 
368 FC4 20 TYR E  355 ? TYR E 336 . ? 1_555 ? 
369 FC4 20 GLU E  357 ? GLU E 338 . ? 1_555 ? 
370 FC4 20 MN  KA .   ? MN  E 402 . ? 1_555 ? 
371 FC4 20 MN  LA .   ? MN  E 403 . ? 1_555 ? 
372 FC4 20 P3S NA .   ? P3S E 601 . ? 1_555 ? 
373 FC4 20 HOH WB .   ? HOH E 624 . ? 1_555 ? 
374 FC4 20 HOH WB .   ? HOH E 627 . ? 1_555 ? 
375 FC4 20 HOH WB .   ? HOH E 628 . ? 1_555 ? 
376 FC5 18 ASP D  82  ? ASP D 63  . ? 1_555 ? 
377 FC5 18 GLU E  153 ? GLU E 134 . ? 1_555 ? 
378 FC5 18 GLU E  155 ? GLU E 136 . ? 1_555 ? 
379 FC5 18 GLU E  215 ? GLU E 196 . ? 1_555 ? 
380 FC5 18 GLU E  222 ? GLU E 203 . ? 1_555 ? 
381 FC5 18 GLY E  268 ? GLY E 249 . ? 1_555 ? 
382 FC5 18 HIS E  272 ? HIS E 253 . ? 1_555 ? 
383 FC5 18 ARG E  318 ? ARG E 299 . ? 1_555 ? 
384 FC5 18 GLU E  324 ? GLU E 305 . ? 1_555 ? 
385 FC5 18 THR E  325 ? THR E 306 . ? 1_555 ? 
386 FC5 18 ARG E  338 ? ARG E 319 . ? 1_555 ? 
387 FC5 18 GLU E  357 ? GLU E 338 . ? 1_555 ? 
388 FC5 18 ARG E  359 ? ARG E 340 . ? 1_555 ? 
389 FC5 18 MN  JA .   ? MN  E 401 . ? 1_555 ? 
390 FC5 18 MN  KA .   ? MN  E 402 . ? 1_555 ? 
391 FC5 18 MN  LA .   ? MN  E 403 . ? 1_555 ? 
392 FC5 18 ADP MA .   ? ADP E 501 . ? 1_555 ? 
393 FC5 18 HOH WB .   ? HOH E 629 . ? 1_555 ? 
394 FC6 20 TRP F  149 ? TRP F 130 . ? 1_555 ? 
395 FC6 20 GLY F  151 ? GLY F 132 . ? 1_555 ? 
396 FC6 20 GLU F  153 ? GLU F 134 . ? 1_555 ? 
397 FC6 20 ALA F  210 ? ALA F 191 . ? 1_555 ? 
398 FC6 20 GLU F  222 ? GLU F 203 . ? 1_555 ? 
399 FC6 20 GLN F  224 ? GLN F 205 . ? 1_555 ? 
400 FC6 20 ILE F  225 ? ILE F 206 . ? 1_555 ? 
401 FC6 20 GLY F  226 ? GLY F 207 . ? 1_555 ? 
402 FC6 20 PRO F  227 ? PRO F 208 . ? 1_555 ? 
403 FC6 20 ASN F  274 ? ASN F 255 . ? 1_555 ? 
404 FC6 20 SER F  276 ? SER F 257 . ? 1_555 ? 
405 FC6 20 ARG F  338 ? ARG F 319 . ? 1_555 ? 
406 FC6 20 ARG F  343 ? ARG F 324 . ? 1_555 ? 
407 FC6 20 TYR F  355 ? TYR F 336 . ? 1_555 ? 
408 FC6 20 GLU F  357 ? GLU F 338 . ? 1_555 ? 
409 FC6 20 MN  PA .   ? MN  F 402 . ? 1_555 ? 
410 FC6 20 MN  QA .   ? MN  F 403 . ? 1_555 ? 
411 FC6 20 P3S TA .   ? P3S F 601 . ? 1_555 ? 
412 FC6 20 HOH XB .   ? HOH F 717 . ? 1_555 ? 
413 FC6 20 HOH XB .   ? HOH F 718 . ? 1_555 ? 
414 FC7 18 GLU F  153 ? GLU F 134 . ? 1_555 ? 
415 FC7 18 GLU F  155 ? GLU F 136 . ? 1_555 ? 
416 FC7 18 GLU F  215 ? GLU F 196 . ? 1_555 ? 
417 FC7 18 GLU F  222 ? GLU F 203 . ? 1_555 ? 
418 FC7 18 GLY F  268 ? GLY F 249 . ? 1_555 ? 
419 FC7 18 HIS F  272 ? HIS F 253 . ? 1_555 ? 
420 FC7 18 ARG F  318 ? ARG F 299 . ? 1_555 ? 
421 FC7 18 GLU F  324 ? GLU F 305 . ? 1_555 ? 
422 FC7 18 THR F  325 ? THR F 306 . ? 1_555 ? 
423 FC7 18 ARG F  338 ? ARG F 319 . ? 1_555 ? 
424 FC7 18 ARG F  359 ? ARG F 340 . ? 1_555 ? 
425 FC7 18 MN  OA .   ? MN  F 401 . ? 1_555 ? 
426 FC7 18 MN  PA .   ? MN  F 402 . ? 1_555 ? 
427 FC7 18 MN  QA .   ? MN  F 403 . ? 1_555 ? 
428 FC7 18 ADP SA .   ? ADP F 501 . ? 1_555 ? 
429 FC7 18 HOH XB .   ? HOH F 712 . ? 1_555 ? 
430 FC7 18 HOH XB .   ? HOH F 717 . ? 1_555 ? 
431 FC7 18 ASP J  82  ? ASP J 63  . ? 1_555 ? 
432 FC8 18 TRP G  149 ? TRP G 130 . ? 1_555 ? 
433 FC8 18 GLY G  151 ? GLY G 132 . ? 1_555 ? 
434 FC8 18 GLU G  153 ? GLU G 134 . ? 1_555 ? 
435 FC8 18 ALA G  210 ? ALA G 191 . ? 1_555 ? 
436 FC8 18 GLU G  222 ? GLU G 203 . ? 1_555 ? 
437 FC8 18 GLN G  224 ? GLN G 205 . ? 1_555 ? 
438 FC8 18 ILE G  225 ? ILE G 206 . ? 1_555 ? 
439 FC8 18 GLY G  226 ? GLY G 207 . ? 1_555 ? 
440 FC8 18 PRO G  227 ? PRO G 208 . ? 1_555 ? 
441 FC8 18 ASN G  274 ? ASN G 255 . ? 1_555 ? 
442 FC8 18 SER G  276 ? SER G 257 . ? 1_555 ? 
443 FC8 18 ARG G  338 ? ARG G 319 . ? 1_555 ? 
444 FC8 18 ARG G  343 ? ARG G 324 . ? 1_555 ? 
445 FC8 18 TYR G  355 ? TYR G 336 . ? 1_555 ? 
446 FC8 18 GLU G  357 ? GLU G 338 . ? 1_555 ? 
447 FC8 18 MN  VA .   ? MN  G 402 . ? 1_555 ? 
448 FC8 18 MN  WA .   ? MN  G 403 . ? 1_555 ? 
449 FC8 18 P3S AB .   ? P3S G 601 . ? 1_555 ? 
450 FC9 18 ASP F  82  ? ASP F 63  . ? 1_555 ? 
451 FC9 18 GLU G  153 ? GLU G 134 . ? 1_555 ? 
452 FC9 18 GLU G  155 ? GLU G 136 . ? 1_555 ? 
453 FC9 18 GLU G  215 ? GLU G 196 . ? 1_555 ? 
454 FC9 18 GLU G  222 ? GLU G 203 . ? 1_555 ? 
455 FC9 18 ASN G  267 ? ASN G 248 . ? 1_555 ? 
456 FC9 18 GLY G  268 ? GLY G 249 . ? 1_555 ? 
457 FC9 18 HIS G  272 ? HIS G 253 . ? 1_555 ? 
458 FC9 18 ARG G  318 ? ARG G 299 . ? 1_555 ? 
459 FC9 18 GLU G  324 ? GLU G 305 . ? 1_555 ? 
460 FC9 18 THR G  325 ? THR G 306 . ? 1_555 ? 
461 FC9 18 ARG G  338 ? ARG G 319 . ? 1_555 ? 
462 FC9 18 GLU G  357 ? GLU G 338 . ? 1_555 ? 
463 FC9 18 ARG G  359 ? ARG G 340 . ? 1_555 ? 
464 FC9 18 MN  UA .   ? MN  G 401 . ? 1_555 ? 
465 FC9 18 MN  VA .   ? MN  G 402 . ? 1_555 ? 
466 FC9 18 MN  WA .   ? MN  G 403 . ? 1_555 ? 
467 FC9 18 ADP ZA .   ? ADP G 501 . ? 1_555 ? 
468 GC1 17 GLY H  151 ? GLY H 132 . ? 1_555 ? 
469 GC1 17 GLU H  153 ? GLU H 134 . ? 1_555 ? 
470 GC1 17 ALA H  210 ? ALA H 191 . ? 1_555 ? 
471 GC1 17 GLU H  222 ? GLU H 203 . ? 1_555 ? 
472 GC1 17 GLN H  224 ? GLN H 205 . ? 1_555 ? 
473 GC1 17 GLY H  226 ? GLY H 207 . ? 1_555 ? 
474 GC1 17 PRO H  227 ? PRO H 208 . ? 1_555 ? 
475 GC1 17 ASN H  274 ? ASN H 255 . ? 1_555 ? 
476 GC1 17 SER H  276 ? SER H 257 . ? 1_555 ? 
477 GC1 17 ARG H  338 ? ARG H 319 . ? 1_555 ? 
478 GC1 17 ARG H  343 ? ARG H 324 . ? 1_555 ? 
479 GC1 17 TYR H  355 ? TYR H 336 . ? 1_555 ? 
480 GC1 17 GLU H  357 ? GLU H 338 . ? 1_555 ? 
481 GC1 17 MN  CB .   ? MN  H 402 . ? 1_555 ? 
482 GC1 17 MN  DB .   ? MN  H 403 . ? 1_555 ? 
483 GC1 17 P3S FB .   ? P3S H 601 . ? 1_555 ? 
484 GC1 17 HOH ZB .   ? HOH H 608 . ? 1_555 ? 
485 GC2 18 ASP G  82  ? ASP G 63  . ? 1_555 ? 
486 GC2 18 GLU H  153 ? GLU H 134 . ? 1_555 ? 
487 GC2 18 GLU H  155 ? GLU H 136 . ? 1_555 ? 
488 GC2 18 TYR H  181 ? TYR H 162 . ? 1_555 ? 
489 GC2 18 GLU H  215 ? GLU H 196 . ? 1_555 ? 
490 GC2 18 GLU H  222 ? GLU H 203 . ? 1_555 ? 
491 GC2 18 GLY H  268 ? GLY H 249 . ? 1_555 ? 
492 GC2 18 HIS H  272 ? HIS H 253 . ? 1_555 ? 
493 GC2 18 ARG H  318 ? ARG H 299 . ? 1_555 ? 
494 GC2 18 GLU H  324 ? GLU H 305 . ? 1_555 ? 
495 GC2 18 ARG H  338 ? ARG H 319 . ? 1_555 ? 
496 GC2 18 GLU H  357 ? GLU H 338 . ? 1_555 ? 
497 GC2 18 ARG H  359 ? ARG H 340 . ? 1_555 ? 
498 GC2 18 MN  BB .   ? MN  H 401 . ? 1_555 ? 
499 GC2 18 MN  CB .   ? MN  H 402 . ? 1_555 ? 
500 GC2 18 MN  DB .   ? MN  H 403 . ? 1_555 ? 
501 GC2 18 ADP EB .   ? ADP H 501 . ? 1_555 ? 
502 GC2 18 HOH ZB .   ? HOH H 608 . ? 1_555 ? 
503 GC3 19 TRP I  149 ? TRP I 130 . ? 1_555 ? 
504 GC3 19 GLY I  151 ? GLY I 132 . ? 1_555 ? 
505 GC3 19 GLU I  153 ? GLU I 134 . ? 1_555 ? 
506 GC3 19 GLU I  222 ? GLU I 203 . ? 1_555 ? 
507 GC3 19 GLN I  224 ? GLN I 205 . ? 1_555 ? 
508 GC3 19 ILE I  225 ? ILE I 206 . ? 1_555 ? 
509 GC3 19 GLY I  226 ? GLY I 207 . ? 1_555 ? 
510 GC3 19 PRO I  227 ? PRO I 208 . ? 1_555 ? 
511 GC3 19 ASN I  274 ? ASN I 255 . ? 1_555 ? 
512 GC3 19 SER I  276 ? SER I 257 . ? 1_555 ? 
513 GC3 19 ARG I  338 ? ARG I 319 . ? 1_555 ? 
514 GC3 19 ARG I  343 ? ARG I 324 . ? 1_555 ? 
515 GC3 19 TYR I  355 ? TYR I 336 . ? 1_555 ? 
516 GC3 19 GLU I  357 ? GLU I 338 . ? 1_555 ? 
517 GC3 19 MN  HB .   ? MN  I 402 . ? 1_555 ? 
518 GC3 19 MN  IB .   ? MN  I 403 . ? 1_555 ? 
519 GC3 19 P3S LB .   ? P3S I 601 . ? 1_555 ? 
520 GC3 19 HOH AC .   ? HOH I 718 . ? 1_555 ? 
521 GC3 19 HOH AC .   ? HOH I 719 . ? 1_555 ? 
522 GC4 19 ASP H  82  ? ASP H 63  . ? 1_555 ? 
523 GC4 19 GLU I  153 ? GLU I 134 . ? 1_555 ? 
524 GC4 19 GLU I  155 ? GLU I 136 . ? 1_555 ? 
525 GC4 19 GLU I  215 ? GLU I 196 . ? 1_555 ? 
526 GC4 19 GLU I  222 ? GLU I 203 . ? 1_555 ? 
527 GC4 19 ASN I  267 ? ASN I 248 . ? 1_555 ? 
528 GC4 19 GLY I  268 ? GLY I 249 . ? 1_555 ? 
529 GC4 19 GLY I  270 ? GLY I 251 . ? 1_555 ? 
530 GC4 19 HIS I  272 ? HIS I 253 . ? 1_555 ? 
531 GC4 19 ARG I  318 ? ARG I 299 . ? 1_555 ? 
532 GC4 19 GLU I  324 ? GLU I 305 . ? 1_555 ? 
533 GC4 19 ARG I  338 ? ARG I 319 . ? 1_555 ? 
534 GC4 19 ARG I  343 ? ARG I 324 . ? 1_555 ? 
535 GC4 19 GLU I  357 ? GLU I 338 . ? 1_555 ? 
536 GC4 19 ARG I  359 ? ARG I 340 . ? 1_555 ? 
537 GC4 19 MN  GB .   ? MN  I 401 . ? 1_555 ? 
538 GC4 19 MN  HB .   ? MN  I 402 . ? 1_555 ? 
539 GC4 19 MN  IB .   ? MN  I 403 . ? 1_555 ? 
540 GC4 19 ADP KB .   ? ADP I 501 . ? 1_555 ? 
541 GC5 18 TRP J  149 ? TRP J 130 . ? 1_555 ? 
542 GC5 18 GLY J  151 ? GLY J 132 . ? 1_555 ? 
543 GC5 18 GLU J  153 ? GLU J 134 . ? 1_555 ? 
544 GC5 18 ALA J  210 ? ALA J 191 . ? 1_555 ? 
545 GC5 18 GLU J  222 ? GLU J 203 . ? 1_555 ? 
546 GC5 18 GLN J  224 ? GLN J 205 . ? 1_555 ? 
547 GC5 18 GLY J  226 ? GLY J 207 . ? 1_555 ? 
548 GC5 18 PRO J  227 ? PRO J 208 . ? 1_555 ? 
549 GC5 18 ASN J  274 ? ASN J 255 . ? 1_555 ? 
550 GC5 18 SER J  276 ? SER J 257 . ? 1_555 ? 
551 GC5 18 ARG J  338 ? ARG J 319 . ? 1_555 ? 
552 GC5 18 ARG J  343 ? ARG J 324 . ? 1_555 ? 
553 GC5 18 TYR J  355 ? TYR J 336 . ? 1_555 ? 
554 GC5 18 GLU J  357 ? GLU J 338 . ? 1_555 ? 
555 GC5 18 MN  NB .   ? MN  J 402 . ? 1_555 ? 
556 GC5 18 MN  OB .   ? MN  J 403 . ? 1_555 ? 
557 GC5 18 P3S RB .   ? P3S J 601 . ? 1_555 ? 
558 GC5 18 HOH BC .   ? HOH J 717 . ? 1_555 ? 
559 GC6 20 ASP I  82  ? ASP I 63  . ? 1_555 ? 
560 GC6 20 GLU J  153 ? GLU J 134 . ? 1_555 ? 
561 GC6 20 GLU J  155 ? GLU J 136 . ? 1_555 ? 
562 GC6 20 TYR J  181 ? TYR J 162 . ? 1_555 ? 
563 GC6 20 GLU J  215 ? GLU J 196 . ? 1_555 ? 
564 GC6 20 GLU J  222 ? GLU J 203 . ? 1_555 ? 
565 GC6 20 GLY J  268 ? GLY J 249 . ? 1_555 ? 
566 GC6 20 HIS J  272 ? HIS J 253 . ? 1_555 ? 
567 GC6 20 ARG J  318 ? ARG J 299 . ? 1_555 ? 
568 GC6 20 GLU J  324 ? GLU J 305 . ? 1_555 ? 
569 GC6 20 THR J  325 ? THR J 306 . ? 1_555 ? 
570 GC6 20 ARG J  338 ? ARG J 319 . ? 1_555 ? 
571 GC6 20 GLU J  357 ? GLU J 338 . ? 1_555 ? 
572 GC6 20 ARG J  359 ? ARG J 340 . ? 1_555 ? 
573 GC6 20 MN  MB .   ? MN  J 401 . ? 1_555 ? 
574 GC6 20 MN  NB .   ? MN  J 402 . ? 1_555 ? 
575 GC6 20 MN  OB .   ? MN  J 403 . ? 1_555 ? 
576 GC6 20 ADP QB .   ? ADP J 501 . ? 1_555 ? 
577 GC6 20 HOH BC .   ? HOH J 714 . ? 1_555 ? 
578 GC6 20 HOH BC .   ? HOH J 718 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2QC8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2QC8 
_atom_sites.fract_transf_matrix[1][1]   0.005518 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000206 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007931 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005318 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A  1 29  ? -39.594  5.908   -27.056  1.00 62.79 ? 10  ASN A N     1 
ATOM   2     C  CA    . ASN A  1 29  ? -41.033  5.459   -26.914  1.00 62.46 ? 10  ASN A CA    1 
ATOM   3     C  C     . ASN A  1 29  ? -41.582  5.659   -25.484  1.00 62.62 ? 10  ASN A C     1 
ATOM   4     O  O     . ASN A  1 29  ? -40.918  5.328   -24.480  1.00 63.46 ? 10  ASN A O     1 
ATOM   5     C  CB    . ASN A  1 29  ? -41.166  3.983   -27.312  1.00 63.15 ? 10  ASN A CB    1 
ATOM   6     C  CG    . ASN A  1 29  ? -42.625  3.522   -27.489  1.00 64.03 ? 10  ASN A CG    1 
ATOM   7     O  OD1   . ASN A  1 29  ? -42.998  2.445   -26.981  1.00 66.20 ? 10  ASN A OD1   1 
ATOM   8     N  ND2   . ASN A  1 29  ? -43.449  4.316   -28.225  1.00 65.49 ? 10  ASN A ND2   1 
ATOM   9     N  N     . LYS A  1 30  ? -42.817  6.145   -25.389  1.00 61.48 ? 11  LYS A N     1 
ATOM   10    C  CA    . LYS A  1 30  ? -43.270  6.794   -24.163  1.00 60.07 ? 11  LYS A CA    1 
ATOM   11    C  C     . LYS A  1 30  ? -43.660  5.807   -23.075  1.00 58.63 ? 11  LYS A C     1 
ATOM   12    O  O     . LYS A  1 30  ? -43.566  6.118   -21.876  1.00 58.65 ? 11  LYS A O     1 
ATOM   13    C  CB    . LYS A  1 30  ? -44.411  7.777   -24.468  1.00 60.57 ? 11  LYS A CB    1 
ATOM   14    C  CG    . LYS A  1 30  ? -44.110  8.729   -25.645  1.00 61.64 ? 11  LYS A CG    1 
ATOM   15    C  CD    . LYS A  1 30  ? -43.251  9.936   -25.278  1.00 61.92 ? 11  LYS A CD    1 
ATOM   16    C  CE    . LYS A  1 30  ? -42.445  10.371  -26.504  1.00 61.24 ? 11  LYS A CE    1 
ATOM   17    N  NZ    . LYS A  1 30  ? -41.578  11.534  -26.170  1.00 62.05 ? 11  LYS A NZ    1 
ATOM   18    N  N     . GLY A  1 31  ? -44.079  4.619   -23.487  1.00 56.76 ? 12  GLY A N     1 
ATOM   19    C  CA    . GLY A  1 31  ? -44.362  3.544   -22.545  1.00 55.53 ? 12  GLY A CA    1 
ATOM   20    C  C     . GLY A  1 31  ? -43.119  3.176   -21.735  1.00 54.39 ? 12  GLY A C     1 
ATOM   21    O  O     . GLY A  1 31  ? -43.201  2.925   -20.522  1.00 54.58 ? 12  GLY A O     1 
ATOM   22    N  N     . ILE A  1 32  ? -41.964  3.147   -22.399  1.00 52.33 ? 13  ILE A N     1 
ATOM   23    C  CA    . ILE A  1 32  ? -40.705  2.896   -21.716  1.00 51.37 ? 13  ILE A CA    1 
ATOM   24    C  C     . ILE A  1 32  ? -40.472  4.010   -20.686  1.00 49.81 ? 13  ILE A C     1 
ATOM   25    O  O     . ILE A  1 32  ? -40.182  3.733   -19.506  1.00 49.36 ? 13  ILE A O     1 
ATOM   26    C  CB    . ILE A  1 32  ? -39.474  2.814   -22.685  1.00 51.40 ? 13  ILE A CB    1 
ATOM   27    C  CG1   . ILE A  1 32  ? -39.764  1.899   -23.899  1.00 52.81 ? 13  ILE A CG1   1 
ATOM   28    C  CG2   . ILE A  1 32  ? -38.292  2.263   -21.922  1.00 51.15 ? 13  ILE A CG2   1 
ATOM   29    C  CD1   . ILE A  1 32  ? -38.808  2.034   -25.139  1.00 52.13 ? 13  ILE A CD1   1 
ATOM   30    N  N     . LYS A  1 33  ? -40.622  5.257   -21.121  1.00 47.59 ? 14  LYS A N     1 
ATOM   31    C  CA    . LYS A  1 33  ? -40.344  6.370   -20.233  1.00 46.82 ? 14  LYS A CA    1 
ATOM   32    C  C     . LYS A  1 33  ? -41.205  6.281   -18.975  1.00 46.16 ? 14  LYS A C     1 
ATOM   33    O  O     . LYS A  1 33  ? -40.743  6.599   -17.867  1.00 45.27 ? 14  LYS A O     1 
ATOM   34    C  CB    . LYS A  1 33  ? -40.617  7.685   -20.939  1.00 46.53 ? 14  LYS A CB    1 
ATOM   35    C  CG    . LYS A  1 33  ? -40.271  8.875   -20.153  1.00 45.12 ? 14  LYS A CG    1 
ATOM   36    C  CD    . LYS A  1 33  ? -40.944  10.094  -20.679  1.00 44.77 ? 14  LYS A CD    1 
ATOM   37    C  CE    . LYS A  1 33  ? -40.778  11.203  -19.693  1.00 43.13 ? 14  LYS A CE    1 
ATOM   38    N  NZ    . LYS A  1 33  ? -41.194  12.469  -20.251  1.00 42.43 ? 14  LYS A NZ    1 
ATOM   39    N  N     . GLN A  1 34  ? -42.452  5.836   -19.153  1.00 45.64 ? 15  GLN A N     1 
ATOM   40    C  CA    . GLN A  1 34  ? -43.423  5.886   -18.084  1.00 45.10 ? 15  GLN A CA    1 
ATOM   41    C  C     . GLN A  1 34  ? -43.051  4.966   -16.956  1.00 44.12 ? 15  GLN A C     1 
ATOM   42    O  O     . GLN A  1 34  ? -43.258  5.292   -15.768  1.00 43.80 ? 15  GLN A O     1 
ATOM   43    C  CB    . GLN A  1 34  ? -44.823  5.561   -18.591  1.00 45.80 ? 15  GLN A CB    1 
ATOM   44    C  CG    . GLN A  1 34  ? -45.935  6.146   -17.709  1.00 47.33 ? 15  GLN A CG    1 
ATOM   45    C  CD    . GLN A  1 34  ? -45.581  7.593   -17.301  1.00 53.28 ? 15  GLN A CD    1 
ATOM   46    O  OE1   . GLN A  1 34  ? -45.093  8.418   -18.141  1.00 54.46 ? 15  GLN A OE1   1 
ATOM   47    N  NE2   . GLN A  1 34  ? -45.746  7.889   -15.989  1.00 55.30 ? 15  GLN A NE2   1 
ATOM   48    N  N     . VAL A  1 35  ? -42.460  3.836   -17.328  1.00 42.89 ? 16  VAL A N     1 
ATOM   49    C  CA    . VAL A  1 35  ? -41.945  2.915   -16.351  1.00 42.37 ? 16  VAL A CA    1 
ATOM   50    C  C     . VAL A  1 35  ? -40.894  3.571   -15.478  1.00 42.18 ? 16  VAL A C     1 
ATOM   51    O  O     . VAL A  1 35  ? -40.946  3.418   -14.266  1.00 42.78 ? 16  VAL A O     1 
ATOM   52    C  CB    . VAL A  1 35  ? -41.356  1.613   -16.991  1.00 42.95 ? 16  VAL A CB    1 
ATOM   53    C  CG1   . VAL A  1 35  ? -40.807  0.648   -15.894  1.00 39.17 ? 16  VAL A CG1   1 
ATOM   54    C  CG2   . VAL A  1 35  ? -42.450  0.931   -17.829  1.00 42.52 ? 16  VAL A CG2   1 
ATOM   55    N  N     . TYR A  1 36  ? -39.948  4.283   -16.081  1.00 41.29 ? 17  TYR A N     1 
ATOM   56    C  CA    . TYR A  1 36  ? -38.931  4.969   -15.287  1.00 41.07 ? 17  TYR A CA    1 
ATOM   57    C  C     . TYR A  1 36  ? -39.583  6.086   -14.468  1.00 40.85 ? 17  TYR A C     1 
ATOM   58    O  O     . TYR A  1 36  ? -39.214  6.320   -13.320  1.00 41.01 ? 17  TYR A O     1 
ATOM   59    C  CB    . TYR A  1 36  ? -37.801  5.552   -16.170  1.00 40.04 ? 17  TYR A CB    1 
ATOM   60    C  CG    . TYR A  1 36  ? -36.847  4.529   -16.737  1.00 38.90 ? 17  TYR A CG    1 
ATOM   61    C  CD1   . TYR A  1 36  ? -35.726  4.144   -16.042  1.00 37.11 ? 17  TYR A CD1   1 
ATOM   62    C  CD2   . TYR A  1 36  ? -37.073  3.961   -17.974  1.00 38.25 ? 17  TYR A CD2   1 
ATOM   63    C  CE1   . TYR A  1 36  ? -34.881  3.198   -16.551  1.00 39.15 ? 17  TYR A CE1   1 
ATOM   64    C  CE2   . TYR A  1 36  ? -36.211  3.024   -18.500  1.00 38.17 ? 17  TYR A CE2   1 
ATOM   65    C  CZ    . TYR A  1 36  ? -35.126  2.635   -17.787  1.00 38.74 ? 17  TYR A CZ    1 
ATOM   66    O  OH    . TYR A  1 36  ? -34.265  1.711   -18.325  1.00 36.91 ? 17  TYR A OH    1 
ATOM   67    N  N     . MET A  1 37  ? -40.553  6.778   -15.049  1.00 40.78 ? 18  MET A N     1 
ATOM   68    C  CA    . MET A  1 37  ? -41.195  7.862   -14.307  1.00 41.00 ? 18  MET A CA    1 
ATOM   69    C  C     . MET A  1 37  ? -42.088  7.366   -13.137  1.00 41.26 ? 18  MET A C     1 
ATOM   70    O  O     . MET A  1 37  ? -42.444  8.165   -12.288  1.00 41.11 ? 18  MET A O     1 
ATOM   71    C  CB    . MET A  1 37  ? -41.967  8.773   -15.233  1.00 40.56 ? 18  MET A CB    1 
ATOM   72    C  CG    . MET A  1 37  ? -41.106  9.447   -16.302  1.00 41.74 ? 18  MET A CG    1 
ATOM   73    S  SD    . MET A  1 37  ? -39.851  10.627  -15.759  1.00 45.25 ? 18  MET A SD    1 
ATOM   74    C  CE    . MET A  1 37  ? -40.721  11.883  -14.849  1.00 36.53 ? 18  MET A CE    1 
ATOM   75    N  N     . SER A  1 38  ? -42.417  6.067   -13.071  1.00 41.38 ? 19  SER A N     1 
ATOM   76    C  CA    . SER A  1 38  ? -43.050  5.478   -11.877  1.00 41.37 ? 19  SER A CA    1 
ATOM   77    C  C     . SER A  1 38  ? -42.126  5.233   -10.720  1.00 41.63 ? 19  SER A C     1 
ATOM   78    O  O     . SER A  1 38  ? -42.604  4.944   -9.650   1.00 42.01 ? 19  SER A O     1 
ATOM   79    C  CB    . SER A  1 38  ? -43.577  4.095   -12.191  1.00 41.74 ? 19  SER A CB    1 
ATOM   80    O  OG    . SER A  1 38  ? -44.312  4.145   -13.379  1.00 45.08 ? 19  SER A OG    1 
ATOM   81    N  N     . LEU A  1 39  ? -40.811  5.230   -10.930  1.00 41.61 ? 20  LEU A N     1 
ATOM   82    C  CA    . LEU A  1 39  ? -39.877  4.989   -9.828   1.00 41.26 ? 20  LEU A CA    1 
ATOM   83    C  C     . LEU A  1 39  ? -39.991  6.113   -8.794   1.00 40.95 ? 20  LEU A C     1 
ATOM   84    O  O     . LEU A  1 39  ? -39.923  7.269   -9.146   1.00 40.44 ? 20  LEU A O     1 
ATOM   85    C  CB    . LEU A  1 39  ? -38.427  4.912   -10.342  1.00 40.79 ? 20  LEU A CB    1 
ATOM   86    C  CG    . LEU A  1 39  ? -38.047  3.737   -11.250  1.00 39.06 ? 20  LEU A CG    1 
ATOM   87    C  CD1   . LEU A  1 39  ? -36.621  3.968   -11.793  1.00 39.22 ? 20  LEU A CD1   1 
ATOM   88    C  CD2   . LEU A  1 39  ? -38.094  2.457   -10.516  1.00 34.17 ? 20  LEU A CD2   1 
ATOM   89    N  N     . PRO A  1 40  ? -40.190  5.774   -7.520   1.00 41.63 ? 21  PRO A N     1 
ATOM   90    C  CA    . PRO A  1 40  ? -40.146  6.810   -6.494   1.00 41.96 ? 21  PRO A CA    1 
ATOM   91    C  C     . PRO A  1 40  ? -38.792  7.477   -6.479   1.00 43.09 ? 21  PRO A C     1 
ATOM   92    O  O     . PRO A  1 40  ? -37.746  6.784   -6.582   1.00 43.83 ? 21  PRO A O     1 
ATOM   93    C  CB    . PRO A  1 40  ? -40.380  6.056   -5.204   1.00 41.58 ? 21  PRO A CB    1 
ATOM   94    C  CG    . PRO A  1 40  ? -40.135  4.628   -5.528   1.00 42.88 ? 21  PRO A CG    1 
ATOM   95    C  CD    . PRO A  1 40  ? -40.471  4.441   -6.961   1.00 42.01 ? 21  PRO A CD    1 
ATOM   96    N  N     . GLN A  1 41  ? -38.784  8.808   -6.379   1.00 43.64 ? 22  GLN A N     1 
ATOM   97    C  CA    . GLN A  1 41  ? -37.536  9.550   -6.573   1.00 43.65 ? 22  GLN A CA    1 
ATOM   98    C  C     . GLN A  1 41  ? -36.721  9.771   -5.312   1.00 44.48 ? 22  GLN A C     1 
ATOM   99    O  O     . GLN A  1 41  ? -35.512  10.008  -5.426   1.00 45.59 ? 22  GLN A O     1 
ATOM   100   C  CB    . GLN A  1 41  ? -37.762  10.888  -7.308   1.00 43.97 ? 22  GLN A CB    1 
ATOM   101   C  CG    . GLN A  1 41  ? -38.358  12.021  -6.536   1.00 43.20 ? 22  GLN A CG    1 
ATOM   102   C  CD    . GLN A  1 41  ? -38.620  13.241  -7.421   1.00 43.30 ? 22  GLN A CD    1 
ATOM   103   O  OE1   . GLN A  1 41  ? -39.518  13.220  -8.263   1.00 41.57 ? 22  GLN A OE1   1 
ATOM   104   N  NE2   . GLN A  1 41  ? -37.812  14.301  -7.246   1.00 41.78 ? 22  GLN A NE2   1 
ATOM   105   N  N     . GLY A  1 42  ? -37.351  9.708   -4.134   1.00 44.07 ? 23  GLY A N     1 
ATOM   106   C  CA    . GLY A  1 42  ? -36.645  9.913   -2.887   1.00 43.57 ? 23  GLY A CA    1 
ATOM   107   C  C     . GLY A  1 42  ? -36.704  11.339  -2.356   1.00 43.67 ? 23  GLY A C     1 
ATOM   108   O  O     . GLY A  1 42  ? -37.674  12.039  -2.591   1.00 43.02 ? 23  GLY A O     1 
ATOM   109   N  N     . GLU A  1 43  ? -35.654  11.763  -1.630   1.00 43.75 ? 24  GLU A N     1 
ATOM   110   C  CA    . GLU A  1 43  ? -35.638  13.078  -0.926   1.00 43.57 ? 24  GLU A CA    1 
ATOM   111   C  C     . GLU A  1 43  ? -35.411  14.276  -1.862   1.00 42.74 ? 24  GLU A C     1 
ATOM   112   O  O     . GLU A  1 43  ? -35.884  15.376  -1.584   1.00 42.73 ? 24  GLU A O     1 
ATOM   113   C  CB    . GLU A  1 43  ? -34.574  13.107  0.208    1.00 44.27 ? 24  GLU A CB    1 
ATOM   114   C  CG    . GLU A  1 43  ? -34.977  12.399  1.544    1.00 46.21 ? 24  GLU A CG    1 
ATOM   115   N  N     . LYS A  1 44  ? -34.721  14.043  -2.973   1.00 42.12 ? 25  LYS A N     1 
ATOM   116   C  CA    . LYS A  1 44  ? -34.240  15.117  -3.845   1.00 42.39 ? 25  LYS A CA    1 
ATOM   117   C  C     . LYS A  1 44  ? -35.351  15.662  -4.778   1.00 41.86 ? 25  LYS A C     1 
ATOM   118   O  O     . LYS A  1 44  ? -36.320  14.972  -5.038   1.00 42.16 ? 25  LYS A O     1 
ATOM   119   C  CB    . LYS A  1 44  ? -33.035  14.651  -4.674   1.00 42.57 ? 25  LYS A CB    1 
ATOM   120   C  CG    . LYS A  1 44  ? -31.907  14.007  -3.876   1.00 42.92 ? 25  LYS A CG    1 
ATOM   121   C  CD    . LYS A  1 44  ? -31.229  15.033  -3.001   1.00 43.75 ? 25  LYS A CD    1 
ATOM   122   C  CE    . LYS A  1 44  ? -29.933  14.518  -2.445   1.00 42.42 ? 25  LYS A CE    1 
ATOM   123   N  NZ    . LYS A  1 44  ? -29.505  15.476  -1.463   1.00 43.91 ? 25  LYS A NZ    1 
ATOM   124   N  N     . VAL A  1 45  ? -35.195  16.897  -5.271   1.00 41.16 ? 26  VAL A N     1 
ATOM   125   C  CA    . VAL A  1 45  ? -36.286  17.604  -5.984   1.00 40.26 ? 26  VAL A CA    1 
ATOM   126   C  C     . VAL A  1 45  ? -35.668  18.184  -7.260   1.00 40.16 ? 26  VAL A C     1 
ATOM   127   O  O     . VAL A  1 45  ? -34.496  18.598  -7.252   1.00 40.31 ? 26  VAL A O     1 
ATOM   128   C  CB    . VAL A  1 45  ? -36.909  18.721  -5.077   1.00 40.29 ? 26  VAL A CB    1 
ATOM   129   C  CG1   . VAL A  1 45  ? -37.992  19.514  -5.803   1.00 37.89 ? 26  VAL A CG1   1 
ATOM   130   C  CG2   . VAL A  1 45  ? -37.427  18.124  -3.739   1.00 37.65 ? 26  VAL A CG2   1 
ATOM   131   N  N     . GLN A  1 46  ? -36.417  18.146  -8.363   1.00 39.53 ? 27  GLN A N     1 
ATOM   132   C  CA    . GLN A  1 46  ? -35.959  18.719  -9.630   1.00 38.74 ? 27  GLN A CA    1 
ATOM   133   C  C     . GLN A  1 46  ? -36.593  20.074  -9.814   1.00 38.43 ? 27  GLN A C     1 
ATOM   134   O  O     . GLN A  1 46  ? -37.809  20.221  -9.656   1.00 37.27 ? 27  GLN A O     1 
ATOM   135   C  CB    . GLN A  1 46  ? -36.350  17.850  -10.804  1.00 38.55 ? 27  GLN A CB    1 
ATOM   136   C  CG    . GLN A  1 46  ? -35.694  16.511  -10.780  1.00 39.26 ? 27  GLN A CG    1 
ATOM   137   C  CD    . GLN A  1 46  ? -36.378  15.499  -11.648  1.00 38.64 ? 27  GLN A CD    1 
ATOM   138   O  OE1   . GLN A  1 46  ? -37.475  14.997  -11.335  1.00 40.26 ? 27  GLN A OE1   1 
ATOM   139   N  NE2   . GLN A  1 46  ? -35.723  15.160  -12.729  1.00 37.41 ? 27  GLN A NE2   1 
ATOM   140   N  N     . ALA A  1 47  ? -35.762  21.067  -10.128  1.00 37.96 ? 28  ALA A N     1 
ATOM   141   C  CA    . ALA A  1 47  ? -36.259  22.397  -10.435  1.00 38.11 ? 28  ALA A CA    1 
ATOM   142   C  C     . ALA A  1 47  ? -35.850  22.730  -11.868  1.00 38.09 ? 28  ALA A C     1 
ATOM   143   O  O     . ALA A  1 47  ? -34.660  22.775  -12.210  1.00 38.12 ? 28  ALA A O     1 
ATOM   144   C  CB    . ALA A  1 47  ? -35.733  23.448  -9.410   1.00 37.07 ? 28  ALA A CB    1 
ATOM   145   N  N     . MET A  1 48  ? -36.843  22.923  -12.727  1.00 38.14 ? 29  MET A N     1 
ATOM   146   C  CA    . MET A  1 48  ? -36.563  23.263  -14.135  1.00 37.94 ? 29  MET A CA    1 
ATOM   147   C  C     . MET A  1 48  ? -36.711  24.774  -14.300  1.00 37.91 ? 29  MET A C     1 
ATOM   148   O  O     . MET A  1 48  ? -37.817  25.350  -14.144  1.00 37.97 ? 29  MET A O     1 
ATOM   149   C  CB    . MET A  1 48  ? -37.461  22.472  -15.119  1.00 37.01 ? 29  MET A CB    1 
ATOM   150   C  CG    . MET A  1 48  ? -37.263  22.889  -16.578  1.00 37.31 ? 29  MET A CG    1 
ATOM   151   S  SD    . MET A  1 48  ? -37.970  21.857  -17.869  1.00 36.90 ? 29  MET A SD    1 
ATOM   152   C  CE    . MET A  1 48  ? -36.831  20.475  -18.124  1.00 30.17 ? 29  MET A CE    1 
ATOM   153   N  N     . TYR A  1 49  ? -35.583  25.414  -14.574  1.00 38.27 ? 30  TYR A N     1 
ATOM   154   C  CA    . TYR A  1 49  ? -35.550  26.873  -14.781  1.00 38.59 ? 30  TYR A CA    1 
ATOM   155   C  C     . TYR A  1 49  ? -35.792  27.171  -16.248  1.00 38.91 ? 30  TYR A C     1 
ATOM   156   O  O     . TYR A  1 49  ? -35.170  26.556  -17.124  1.00 39.06 ? 30  TYR A O     1 
ATOM   157   C  CB    . TYR A  1 49  ? -34.201  27.446  -14.389  1.00 38.88 ? 30  TYR A CB    1 
ATOM   158   C  CG    . TYR A  1 49  ? -33.923  27.562  -12.900  1.00 38.93 ? 30  TYR A CG    1 
ATOM   159   C  CD1   . TYR A  1 49  ? -34.156  26.501  -12.032  1.00 38.83 ? 30  TYR A CD1   1 
ATOM   160   C  CD2   . TYR A  1 49  ? -33.351  28.726  -12.379  1.00 38.61 ? 30  TYR A CD2   1 
ATOM   161   C  CE1   . TYR A  1 49  ? -33.871  26.614  -10.672  1.00 39.10 ? 30  TYR A CE1   1 
ATOM   162   C  CE2   . TYR A  1 49  ? -33.063  28.837  -11.042  1.00 39.11 ? 30  TYR A CE2   1 
ATOM   163   C  CZ    . TYR A  1 49  ? -33.330  27.777  -10.197  1.00 38.98 ? 30  TYR A CZ    1 
ATOM   164   O  OH    . TYR A  1 49  ? -33.024  27.897  -8.876   1.00 40.01 ? 30  TYR A OH    1 
ATOM   165   N  N     . ILE A  1 50  ? -36.681  28.126  -16.496  1.00 39.08 ? 31  ILE A N     1 
ATOM   166   C  CA    . ILE A  1 50  ? -37.156  28.496  -17.839  1.00 38.79 ? 31  ILE A CA    1 
ATOM   167   C  C     . ILE A  1 50  ? -36.847  29.955  -18.111  1.00 38.48 ? 31  ILE A C     1 
ATOM   168   O  O     . ILE A  1 50  ? -37.123  30.838  -17.271  1.00 38.34 ? 31  ILE A O     1 
ATOM   169   C  CB    . ILE A  1 50  ? -38.723  28.394  -17.906  1.00 38.95 ? 31  ILE A CB    1 
ATOM   170   C  CG1   . ILE A  1 50  ? -39.192  26.958  -17.644  1.00 38.54 ? 31  ILE A CG1   1 
ATOM   171   C  CG2   . ILE A  1 50  ? -39.260  28.924  -19.266  1.00 38.02 ? 31  ILE A CG2   1 
ATOM   172   C  CD1   . ILE A  1 50  ? -40.589  26.866  -17.068  1.00 38.65 ? 31  ILE A CD1   1 
ATOM   173   N  N     . TRP A  1 51  ? -36.347  30.254  -19.292  1.00 38.16 ? 32  TRP A N     1 
ATOM   174   C  CA    . TRP A  1 51  ? -36.133  31.648  -19.609  1.00 37.99 ? 32  TRP A CA    1 
ATOM   175   C  C     . TRP A  1 51  ? -36.304  31.971  -21.078  1.00 38.31 ? 32  TRP A C     1 
ATOM   176   O  O     . TRP A  1 51  ? -36.295  31.069  -21.943  1.00 38.17 ? 32  TRP A O     1 
ATOM   177   C  CB    . TRP A  1 51  ? -34.751  32.106  -19.093  1.00 38.17 ? 32  TRP A CB    1 
ATOM   178   C  CG    . TRP A  1 51  ? -33.562  31.516  -19.819  1.00 39.01 ? 32  TRP A CG    1 
ATOM   179   C  CD1   . TRP A  1 51  ? -32.846  32.092  -20.838  1.00 39.18 ? 32  TRP A CD1   1 
ATOM   180   C  CD2   . TRP A  1 51  ? -32.946  30.242  -19.571  1.00 38.67 ? 32  TRP A CD2   1 
ATOM   181   N  NE1   . TRP A  1 51  ? -31.842  31.258  -21.233  1.00 38.46 ? 32  TRP A NE1   1 
ATOM   182   C  CE2   . TRP A  1 51  ? -31.879  30.116  -20.481  1.00 38.54 ? 32  TRP A CE2   1 
ATOM   183   C  CE3   . TRP A  1 51  ? -33.194  29.201  -18.659  1.00 38.41 ? 32  TRP A CE3   1 
ATOM   184   C  CZ2   . TRP A  1 51  ? -31.055  28.979  -20.519  1.00 39.58 ? 32  TRP A CZ2   1 
ATOM   185   C  CZ3   . TRP A  1 51  ? -32.405  28.079  -18.693  1.00 38.48 ? 32  TRP A CZ3   1 
ATOM   186   C  CH2   . TRP A  1 51  ? -31.342  27.963  -19.627  1.00 39.49 ? 32  TRP A CH2   1 
ATOM   187   N  N     . ILE A  1 52  ? -36.425  33.281  -21.343  1.00 38.52 ? 33  ILE A N     1 
ATOM   188   C  CA    . ILE A  1 52  ? -36.587  33.812  -22.678  1.00 38.67 ? 33  ILE A CA    1 
ATOM   189   C  C     . ILE A  1 52  ? -35.211  34.127  -23.268  1.00 39.33 ? 33  ILE A C     1 
ATOM   190   O  O     . ILE A  1 52  ? -34.384  34.754  -22.621  1.00 39.48 ? 33  ILE A O     1 
ATOM   191   C  CB    . ILE A  1 52  ? -37.447  35.068  -22.674  1.00 38.35 ? 33  ILE A CB    1 
ATOM   192   C  CG1   . ILE A  1 52  ? -38.880  34.713  -22.273  1.00 39.08 ? 33  ILE A CG1   1 
ATOM   193   C  CG2   . ILE A  1 52  ? -37.417  35.709  -24.048  1.00 38.04 ? 33  ILE A CG2   1 
ATOM   194   C  CD1   . ILE A  1 52  ? -39.694  35.902  -21.778  1.00 39.11 ? 33  ILE A CD1   1 
ATOM   195   N  N     . ASP A  1 53  ? -34.981  33.685  -24.514  1.00 40.30 ? 34  ASP A N     1 
ATOM   196   C  CA    . ASP A  1 53  ? -33.660  33.750  -25.153  1.00 40.11 ? 34  ASP A CA    1 
ATOM   197   C  C     . ASP A  1 53  ? -33.477  35.039  -25.915  1.00 40.39 ? 34  ASP A C     1 
ATOM   198   O  O     . ASP A  1 53  ? -34.251  35.955  -25.757  1.00 41.12 ? 34  ASP A O     1 
ATOM   199   C  CB    . ASP A  1 53  ? -33.382  32.499  -26.023  1.00 40.13 ? 34  ASP A CB    1 
ATOM   200   C  CG    . ASP A  1 53  ? -34.221  32.427  -27.317  1.00 41.15 ? 34  ASP A CG    1 
ATOM   201   O  OD1   . ASP A  1 53  ? -34.711  33.471  -27.856  1.00 39.57 ? 34  ASP A OD1   1 
ATOM   202   O  OD2   . ASP A  1 53  ? -34.330  31.267  -27.812  1.00 39.99 ? 34  ASP A OD2   1 
ATOM   203   N  N     . GLY A  1 54  ? -32.409  35.112  -26.701  1.00 40.84 ? 35  GLY A N     1 
ATOM   204   C  CA    . GLY A  1 54  ? -32.015  36.340  -27.364  1.00 40.34 ? 35  GLY A CA    1 
ATOM   205   C  C     . GLY A  1 54  ? -32.970  36.713  -28.470  1.00 40.87 ? 35  GLY A C     1 
ATOM   206   O  O     . GLY A  1 54  ? -32.885  37.827  -28.960  1.00 41.67 ? 35  GLY A O     1 
ATOM   207   N  N     . THR A  1 55  ? -33.867  35.801  -28.874  1.00 40.13 ? 36  THR A N     1 
ATOM   208   C  CA    . THR A  1 55  ? -34.833  36.111  -29.911  1.00 39.85 ? 36  THR A CA    1 
ATOM   209   C  C     . THR A  1 55  ? -36.105  36.792  -29.398  1.00 40.31 ? 36  THR A C     1 
ATOM   210   O  O     . THR A  1 55  ? -36.936  37.207  -30.217  1.00 40.31 ? 36  THR A O     1 
ATOM   211   C  CB    . THR A  1 55  ? -35.363  34.826  -30.663  1.00 40.06 ? 36  THR A CB    1 
ATOM   212   O  OG1   . THR A  1 55  ? -36.360  34.139  -29.856  1.00 38.90 ? 36  THR A OG1   1 
ATOM   213   C  CG2   . THR A  1 55  ? -34.239  33.937  -31.106  1.00 36.95 ? 36  THR A CG2   1 
ATOM   214   N  N     . GLY A  1 56  ? -36.306  36.820  -28.072  1.00 40.35 ? 37  GLY A N     1 
ATOM   215   C  CA    . GLY A  1 56  ? -37.524  37.333  -27.465  1.00 40.38 ? 37  GLY A CA    1 
ATOM   216   C  C     . GLY A  1 56  ? -38.734  36.425  -27.647  1.00 41.18 ? 37  GLY A C     1 
ATOM   217   O  O     . GLY A  1 56  ? -39.818  36.721  -27.164  1.00 40.65 ? 37  GLY A O     1 
ATOM   218   N  N     . GLU A  1 57  ? -38.556  35.301  -28.342  1.00 42.01 ? 38  GLU A N     1 
ATOM   219   C  CA    . GLU A  1 57  ? -39.651  34.361  -28.586  1.00 41.76 ? 38  GLU A CA    1 
ATOM   220   C  C     . GLU A  1 57  ? -39.327  32.981  -28.069  1.00 41.64 ? 38  GLU A C     1 
ATOM   221   O  O     . GLU A  1 57  ? -40.204  32.283  -27.581  1.00 42.04 ? 38  GLU A O     1 
ATOM   222   C  CB    . GLU A  1 57  ? -39.923  34.260  -30.072  1.00 41.74 ? 38  GLU A CB    1 
ATOM   223   C  CG    . GLU A  1 57  ? -40.516  35.493  -30.641  1.00 42.21 ? 38  GLU A CG    1 
ATOM   224   C  CD    . GLU A  1 57  ? -40.922  35.287  -32.066  1.00 43.39 ? 38  GLU A CD    1 
ATOM   225   O  OE1   . GLU A  1 57  ? -42.003  34.698  -32.336  1.00 46.60 ? 38  GLU A OE1   1 
ATOM   226   O  OE2   . GLU A  1 57  ? -40.153  35.731  -32.918  1.00 46.45 ? 38  GLU A OE2   1 
ATOM   227   N  N     . GLY A  1 58  ? -38.068  32.583  -28.177  1.00 41.52 ? 39  GLY A N     1 
ATOM   228   C  CA    . GLY A  1 58  ? -37.701  31.226  -27.832  1.00 41.30 ? 39  GLY A CA    1 
ATOM   229   C  C     . GLY A  1 58  ? -37.597  31.075  -26.333  1.00 40.96 ? 39  GLY A C     1 
ATOM   230   O  O     . GLY A  1 58  ? -37.128  31.960  -25.650  1.00 42.46 ? 39  GLY A O     1 
ATOM   231   N  N     . LEU A  1 59  ? -38.054  29.951  -25.829  1.00 40.20 ? 40  LEU A N     1 
ATOM   232   C  CA    . LEU A  1 59  ? -37.905  29.602  -24.466  1.00 38.94 ? 40  LEU A CA    1 
ATOM   233   C  C     . LEU A  1 59  ? -36.776  28.566  -24.361  1.00 39.00 ? 40  LEU A C     1 
ATOM   234   O  O     . LEU A  1 59  ? -36.593  27.678  -25.233  1.00 38.50 ? 40  LEU A O     1 
ATOM   235   C  CB    . LEU A  1 59  ? -39.217  29.014  -23.977  1.00 39.35 ? 40  LEU A CB    1 
ATOM   236   C  CG    . LEU A  1 59  ? -40.387  29.997  -23.736  1.00 40.07 ? 40  LEU A CG    1 
ATOM   237   C  CD1   . LEU A  1 59  ? -41.772  29.267  -23.712  1.00 36.76 ? 40  LEU A CD1   1 
ATOM   238   C  CD2   . LEU A  1 59  ? -40.112  30.793  -22.437  1.00 36.27 ? 40  LEU A CD2   1 
ATOM   239   N  N     . ARG A  1 60  ? -36.016  28.678  -23.278  1.00 38.15 ? 41  ARG A N     1 
ATOM   240   C  CA    . ARG A  1 60  ? -34.971  27.706  -22.990  1.00 37.71 ? 41  ARG A CA    1 
ATOM   241   C  C     . ARG A  1 60  ? -35.215  27.230  -21.608  1.00 37.42 ? 41  ARG A C     1 
ATOM   242   O  O     . ARG A  1 60  ? -35.920  27.900  -20.830  1.00 37.47 ? 41  ARG A O     1 
ATOM   243   C  CB    . ARG A  1 60  ? -33.583  28.331  -23.026  1.00 37.20 ? 41  ARG A CB    1 
ATOM   244   C  CG    . ARG A  1 60  ? -33.298  29.144  -24.278  1.00 37.54 ? 41  ARG A CG    1 
ATOM   245   C  CD    . ARG A  1 60  ? -32.905  28.293  -25.453  1.00 36.96 ? 41  ARG A CD    1 
ATOM   246   N  NE    . ARG A  1 60  ? -32.676  29.111  -26.631  1.00 36.50 ? 41  ARG A NE    1 
ATOM   247   C  CZ    . ARG A  1 60  ? -31.772  28.856  -27.570  1.00 36.91 ? 41  ARG A CZ    1 
ATOM   248   N  NH1   . ARG A  1 60  ? -30.981  27.809  -27.487  1.00 38.36 ? 41  ARG A NH1   1 
ATOM   249   N  NH2   . ARG A  1 60  ? -31.679  29.645  -28.609  1.00 36.75 ? 41  ARG A NH2   1 
ATOM   250   N  N     . CYS A  1 61  ? -34.614  26.094  -21.279  1.00 37.11 ? 42  CYS A N     1 
ATOM   251   C  CA    . CYS A  1 61  ? -34.697  25.598  -19.934  1.00 36.72 ? 42  CYS A CA    1 
ATOM   252   C  C     . CYS A  1 61  ? -33.612  24.591  -19.535  1.00 36.22 ? 42  CYS A C     1 
ATOM   253   O  O     . CYS A  1 61  ? -33.009  23.937  -20.378  1.00 35.15 ? 42  CYS A O     1 
ATOM   254   C  CB    . CYS A  1 61  ? -36.060  24.956  -19.759  1.00 36.89 ? 42  CYS A CB    1 
ATOM   255   S  SG    . CYS A  1 61  ? -36.082  23.390  -20.585  1.00 38.54 ? 42  CYS A SG    1 
ATOM   256   N  N     . LYS A  1 62  ? -33.388  24.462  -18.225  1.00 36.20 ? 43  LYS A N     1 
ATOM   257   C  CA    . LYS A  1 62  ? -32.550  23.394  -17.717  1.00 36.41 ? 43  LYS A CA    1 
ATOM   258   C  C     . LYS A  1 62  ? -32.870  23.100  -16.260  1.00 36.67 ? 43  LYS A C     1 
ATOM   259   O  O     . LYS A  1 62  ? -33.533  23.888  -15.596  1.00 36.22 ? 43  LYS A O     1 
ATOM   260   C  CB    . LYS A  1 62  ? -31.062  23.705  -17.908  1.00 36.42 ? 43  LYS A CB    1 
ATOM   261   C  CG    . LYS A  1 62  ? -30.555  24.899  -17.121  1.00 36.21 ? 43  LYS A CG    1 
ATOM   262   C  CD    . LYS A  1 62  ? -29.025  24.939  -17.032  1.00 36.25 ? 43  LYS A CD    1 
ATOM   263   C  CE    . LYS A  1 62  ? -28.558  26.229  -16.364  1.00 36.76 ? 43  LYS A CE    1 
ATOM   264   N  NZ    . LYS A  1 62  ? -27.086  26.190  -16.145  1.00 36.73 ? 43  LYS A NZ    1 
ATOM   265   N  N     . THR A  1 63  ? -32.375  21.963  -15.765  1.00 37.14 ? 44  THR A N     1 
ATOM   266   C  CA    . THR A  1 63  ? -32.822  21.424  -14.473  1.00 37.39 ? 44  THR A CA    1 
ATOM   267   C  C     . THR A  1 63  ? -31.698  21.239  -13.457  1.00 37.50 ? 44  THR A C     1 
ATOM   268   O  O     . THR A  1 63  ? -30.582  20.842  -13.810  1.00 36.04 ? 44  THR A O     1 
ATOM   269   C  CB    . THR A  1 63  ? -33.468  20.068  -14.662  1.00 37.63 ? 44  THR A CB    1 
ATOM   270   O  OG1   . THR A  1 63  ? -34.530  20.179  -15.617  1.00 37.96 ? 44  THR A OG1   1 
ATOM   271   C  CG2   . THR A  1 63  ? -33.983  19.534  -13.328  1.00 37.27 ? 44  THR A CG2   1 
ATOM   272   N  N     . ARG A  1 64  ? -32.004  21.522  -12.187  1.00 37.97 ? 45  ARG A N     1 
ATOM   273   C  CA    . ARG A  1 64  ? -31.030  21.266  -11.119  1.00 38.61 ? 45  ARG A CA    1 
ATOM   274   C  C     . ARG A  1 64  ? -31.694  20.484  -10.062  1.00 37.69 ? 45  ARG A C     1 
ATOM   275   O  O     . ARG A  1 64  ? -32.901  20.604  -9.897   1.00 38.21 ? 45  ARG A O     1 
ATOM   276   C  CB    . ARG A  1 64  ? -30.429  22.535  -10.552  1.00 38.43 ? 45  ARG A CB    1 
ATOM   277   C  CG    . ARG A  1 64  ? -31.425  23.403  -9.817   1.00 40.79 ? 45  ARG A CG    1 
ATOM   278   C  CD    . ARG A  1 64  ? -30.799  24.746  -9.565   1.00 41.56 ? 45  ARG A CD    1 
ATOM   279   N  NE    . ARG A  1 64  ? -29.708  24.679  -8.591   1.00 44.58 ? 45  ARG A NE    1 
ATOM   280   C  CZ    . ARG A  1 64  ? -28.963  25.732  -8.256   1.00 46.17 ? 45  ARG A CZ    1 
ATOM   281   N  NH1   . ARG A  1 64  ? -29.189  26.915  -8.834   1.00 48.77 ? 45  ARG A NH1   1 
ATOM   282   N  NH2   . ARG A  1 64  ? -27.983  25.612  -7.367   1.00 45.05 ? 45  ARG A NH2   1 
ATOM   283   N  N     . THR A  1 65  ? -30.913  19.666  -9.372   1.00 37.05 ? 46  THR A N     1 
ATOM   284   C  CA    . THR A  1 65  ? -31.418  18.909  -8.238   1.00 38.03 ? 46  THR A CA    1 
ATOM   285   C  C     . THR A  1 65  ? -31.354  19.762  -6.964   1.00 38.40 ? 46  THR A C     1 
ATOM   286   O  O     . THR A  1 65  ? -30.386  20.415  -6.721   1.00 38.11 ? 46  THR A O     1 
ATOM   287   C  CB    . THR A  1 65  ? -30.588  17.669  -8.071   1.00 38.08 ? 46  THR A CB    1 
ATOM   288   O  OG1   . THR A  1 65  ? -30.488  17.036  -9.359   1.00 39.42 ? 46  THR A OG1   1 
ATOM   289   C  CG2   . THR A  1 65  ? -31.167  16.710  -6.992   1.00 35.76 ? 46  THR A CG2   1 
ATOM   290   N  N     . LEU A  1 66  ? -32.412  19.803  -6.176   1.00 39.01 ? 47  LEU A N     1 
ATOM   291   C  CA    . LEU A  1 66  ? -32.348  20.476  -4.895   1.00 39.14 ? 47  LEU A CA    1 
ATOM   292   C  C     . LEU A  1 66  ? -32.514  19.438  -3.802   1.00 39.25 ? 47  LEU A C     1 
ATOM   293   O  O     . LEU A  1 66  ? -33.095  18.359  -4.030   1.00 38.45 ? 47  LEU A O     1 
ATOM   294   C  CB    . LEU A  1 66  ? -33.477  21.520  -4.765   1.00 39.33 ? 47  LEU A CB    1 
ATOM   295   C  CG    . LEU A  1 66  ? -33.585  22.654  -5.788   1.00 39.24 ? 47  LEU A CG    1 
ATOM   296   C  CD1   . LEU A  1 66  ? -35.068  23.312  -5.771   1.00 36.19 ? 47  LEU A CD1   1 
ATOM   297   C  CD2   . LEU A  1 66  ? -32.449  23.674  -5.610   1.00 35.18 ? 47  LEU A CD2   1 
ATOM   298   N  N     . ASP A  1 67  ? -32.059  19.812  -2.604   1.00 39.92 ? 48  ASP A N     1 
ATOM   299   C  CA    . ASP A  1 67  ? -32.080  18.929  -1.423   1.00 40.78 ? 48  ASP A CA    1 
ATOM   300   C  C     . ASP A  1 67  ? -33.396  18.804  -0.757   1.00 40.47 ? 48  ASP A C     1 
ATOM   301   O  O     . ASP A  1 67  ? -33.589  17.866  -0.018   1.00 40.83 ? 48  ASP A O     1 
ATOM   302   C  CB    . ASP A  1 67  ? -31.074  19.356  -0.367   1.00 41.34 ? 48  ASP A CB    1 
ATOM   303   C  CG    . ASP A  1 67  ? -29.623  19.235  -0.852   1.00 45.37 ? 48  ASP A CG    1 
ATOM   304   O  OD1   . ASP A  1 67  ? -29.332  18.402  -1.755   1.00 49.99 ? 48  ASP A OD1   1 
ATOM   305   O  OD2   . ASP A  1 67  ? -28.765  19.989  -0.339   1.00 49.43 ? 48  ASP A OD2   1 
ATOM   306   N  N     . SER A  1 68  ? -34.302  19.741  -0.998   1.00 40.89 ? 49  SER A N     1 
ATOM   307   C  CA    . SER A  1 68  ? -35.653  19.648  -0.440   1.00 41.02 ? 49  SER A CA    1 
ATOM   308   C  C     . SER A  1 68  ? -36.626  20.462  -1.283   1.00 41.30 ? 49  SER A C     1 
ATOM   309   O  O     . SER A  1 68  ? -36.198  21.164  -2.178   1.00 41.81 ? 49  SER A O     1 
ATOM   310   C  CB    . SER A  1 68  ? -35.667  20.088  1.021    1.00 40.55 ? 49  SER A CB    1 
ATOM   311   O  OG    . SER A  1 68  ? -35.229  21.405  1.133    1.00 40.32 ? 49  SER A OG    1 
ATOM   312   N  N     . GLU A  1 69  ? -37.926  20.320  -1.047   1.00 41.45 ? 50  GLU A N     1 
ATOM   313   C  CA    . GLU A  1 69  ? -38.907  21.046  -1.831   1.00 41.96 ? 50  GLU A CA    1 
ATOM   314   C  C     . GLU A  1 69  ? -39.035  22.538  -1.449   1.00 41.57 ? 50  GLU A C     1 
ATOM   315   O  O     . GLU A  1 69  ? -39.237  22.883  -0.303   1.00 40.97 ? 50  GLU A O     1 
ATOM   316   C  CB    . GLU A  1 69  ? -40.254  20.349  -1.709   1.00 41.79 ? 50  GLU A CB    1 
ATOM   317   C  CG    . GLU A  1 69  ? -41.332  20.928  -2.597   1.00 42.40 ? 50  GLU A CG    1 
ATOM   318   C  CD    . GLU A  1 69  ? -42.683  20.323  -2.296   1.00 43.73 ? 50  GLU A CD    1 
ATOM   319   O  OE1   . GLU A  1 69  ? -42.710  19.357  -1.504   1.00 45.79 ? 50  GLU A OE1   1 
ATOM   320   O  OE2   . GLU A  1 69  ? -43.701  20.793  -2.861   1.00 44.26 ? 50  GLU A OE2   1 
ATOM   321   N  N     . PRO A  1 70  ? -38.898  23.428  -2.419   1.00 42.21 ? 51  PRO A N     1 
ATOM   322   C  CA    . PRO A  1 70  ? -39.152  24.822  -2.105   1.00 42.99 ? 51  PRO A CA    1 
ATOM   323   C  C     . PRO A  1 70  ? -40.649  25.147  -2.013   1.00 44.25 ? 51  PRO A C     1 
ATOM   324   O  O     . PRO A  1 70  ? -41.503  24.688  -2.813   1.00 43.67 ? 51  PRO A O     1 
ATOM   325   C  CB    . PRO A  1 70  ? -38.498  25.569  -3.256   1.00 42.83 ? 51  PRO A CB    1 
ATOM   326   C  CG    . PRO A  1 70  ? -38.520  24.591  -4.392   1.00 42.60 ? 51  PRO A CG    1 
ATOM   327   C  CD    . PRO A  1 70  ? -38.487  23.227  -3.816   1.00 42.30 ? 51  PRO A CD    1 
ATOM   328   N  N     . LYS A  1 71  ? -40.968  25.957  -1.027   1.00 45.10 ? 52  LYS A N     1 
ATOM   329   C  CA    . LYS A  1 71  ? -42.342  26.232  -0.769   1.00 45.68 ? 52  LYS A CA    1 
ATOM   330   C  C     . LYS A  1 71  ? -42.811  27.566  -1.275   1.00 45.30 ? 52  LYS A C     1 
ATOM   331   O  O     . LYS A  1 71  ? -43.990  27.753  -1.354   1.00 45.86 ? 52  LYS A O     1 
ATOM   332   C  CB    . LYS A  1 71  ? -42.580  26.091  0.709    1.00 46.72 ? 52  LYS A CB    1 
ATOM   333   C  CG    . LYS A  1 71  ? -43.238  24.796  1.011    1.00 49.63 ? 52  LYS A CG    1 
ATOM   334   C  CD    . LYS A  1 71  ? -42.333  23.597  1.023    1.00 52.33 ? 52  LYS A CD    1 
ATOM   335   C  CE    . LYS A  1 71  ? -43.217  22.337  1.178    1.00 53.70 ? 52  LYS A CE    1 
ATOM   336   N  NZ    . LYS A  1 71  ? -42.756  21.337  2.194    1.00 56.55 ? 52  LYS A NZ    1 
ATOM   337   N  N     . CYS A  1 72  ? -41.894  28.490  -1.572   1.00 45.04 ? 53  CYS A N     1 
ATOM   338   C  CA    . CYS A  1 72  ? -42.173  29.796  -2.213   1.00 44.00 ? 53  CYS A CA    1 
ATOM   339   C  C     . CYS A  1 72  ? -41.091  29.922  -3.261   1.00 44.05 ? 53  CYS A C     1 
ATOM   340   O  O     . CYS A  1 72  ? -40.056  29.278  -3.125   1.00 43.29 ? 53  CYS A O     1 
ATOM   341   C  CB    . CYS A  1 72  ? -42.077  30.992  -1.239   1.00 43.30 ? 53  CYS A CB    1 
ATOM   342   S  SG    . CYS A  1 72  ? -40.946  30.801  0.125    1.00 37.08 ? 53  CYS A SG    1 
ATOM   343   N  N     . VAL A  1 73  ? -41.328  30.746  -4.285   1.00 44.07 ? 54  VAL A N     1 
ATOM   344   C  CA    . VAL A  1 73  ? -40.372  30.978  -5.367   1.00 44.16 ? 54  VAL A CA    1 
ATOM   345   C  C     . VAL A  1 73  ? -39.031  31.563  -4.876   1.00 44.45 ? 54  VAL A C     1 
ATOM   346   O  O     . VAL A  1 73  ? -37.991  31.255  -5.414   1.00 44.15 ? 54  VAL A O     1 
ATOM   347   C  CB    . VAL A  1 73  ? -40.975  31.879  -6.507   1.00 44.62 ? 54  VAL A CB    1 
ATOM   348   C  CG1   . VAL A  1 73  ? -41.327  33.316  -6.005   1.00 38.97 ? 54  VAL A CG1   1 
ATOM   349   C  CG2   . VAL A  1 73  ? -40.005  31.882  -7.751   1.00 44.76 ? 54  VAL A CG2   1 
ATOM   350   N  N     . GLU A  1 74  ? -39.101  32.372  -3.820   1.00 45.14 ? 55  GLU A N     1 
ATOM   351   C  CA    . GLU A  1 74  ? -37.964  33.024  -3.169   1.00 45.27 ? 55  GLU A CA    1 
ATOM   352   C  C     . GLU A  1 74  ? -36.963  32.027  -2.594   1.00 44.79 ? 55  GLU A C     1 
ATOM   353   O  O     . GLU A  1 74  ? -35.820  32.341  -2.377   1.00 43.79 ? 55  GLU A O     1 
ATOM   354   C  CB    . GLU A  1 74  ? -38.470  33.926  -2.042   1.00 46.30 ? 55  GLU A CB    1 
ATOM   355   C  CG    . GLU A  1 74  ? -39.336  35.099  -2.493   1.00 50.56 ? 55  GLU A CG    1 
ATOM   356   C  CD    . GLU A  1 74  ? -38.495  36.182  -3.135   1.00 58.80 ? 55  GLU A CD    1 
ATOM   357   O  OE1   . GLU A  1 74  ? -37.727  36.925  -2.427   1.00 60.97 ? 55  GLU A OE1   1 
ATOM   358   O  OE2   . GLU A  1 74  ? -38.594  36.270  -4.380   1.00 63.87 ? 55  GLU A OE2   1 
ATOM   359   N  N     . GLU A  1 75  ? -37.403  30.818  -2.330   1.00 45.13 ? 56  GLU A N     1 
ATOM   360   C  CA    . GLU A  1 75  ? -36.498  29.803  -1.843   1.00 45.13 ? 56  GLU A CA    1 
ATOM   361   C  C     . GLU A  1 75  ? -35.573  29.267  -2.929   1.00 45.00 ? 56  GLU A C     1 
ATOM   362   O  O     . GLU A  1 75  ? -34.606  28.619  -2.613   1.00 45.18 ? 56  GLU A O     1 
ATOM   363   C  CB    . GLU A  1 75  ? -37.299  28.665  -1.202   1.00 45.19 ? 56  GLU A CB    1 
ATOM   364   C  CG    . GLU A  1 75  ? -37.881  29.065  0.112    1.00 44.70 ? 56  GLU A CG    1 
ATOM   365   C  CD    . GLU A  1 75  ? -39.050  28.190  0.553    1.00 45.32 ? 56  GLU A CD    1 
ATOM   366   O  OE1   . GLU A  1 75  ? -38.821  26.964  0.741    1.00 43.71 ? 56  GLU A OE1   1 
ATOM   367   O  OE2   . GLU A  1 75  ? -40.178  28.767  0.724    1.00 42.00 ? 56  GLU A OE2   1 
ATOM   368   N  N     . LEU A  1 76  ? -35.853  29.519  -4.204   1.00 44.59 ? 57  LEU A N     1 
ATOM   369   C  CA    . LEU A  1 76  ? -35.015  28.961  -5.249   1.00 44.34 ? 57  LEU A CA    1 
ATOM   370   C  C     . LEU A  1 76  ? -33.711  29.751  -5.431   1.00 44.49 ? 57  LEU A C     1 
ATOM   371   O  O     . LEU A  1 76  ? -33.694  30.992  -5.474   1.00 45.18 ? 57  LEU A O     1 
ATOM   372   C  CB    . LEU A  1 76  ? -35.788  28.881  -6.551   1.00 44.25 ? 57  LEU A CB    1 
ATOM   373   C  CG    . LEU A  1 76  ? -36.934  27.854  -6.547   1.00 45.27 ? 57  LEU A CG    1 
ATOM   374   C  CD1   . LEU A  1 76  ? -38.095  28.261  -7.514   1.00 44.10 ? 57  LEU A CD1   1 
ATOM   375   C  CD2   . LEU A  1 76  ? -36.380  26.460  -6.858   1.00 41.49 ? 57  LEU A CD2   1 
ATOM   376   N  N     . PRO A  1 77  ? -32.588  29.050  -5.536   1.00 44.06 ? 58  PRO A N     1 
ATOM   377   C  CA    . PRO A  1 77  ? -31.380  29.855  -5.660   1.00 43.57 ? 58  PRO A CA    1 
ATOM   378   C  C     . PRO A  1 77  ? -31.293  30.512  -7.031   1.00 43.77 ? 58  PRO A C     1 
ATOM   379   O  O     . PRO A  1 77  ? -31.920  30.045  -7.979   1.00 44.56 ? 58  PRO A O     1 
ATOM   380   C  CB    . PRO A  1 77  ? -30.271  28.854  -5.462   1.00 42.92 ? 58  PRO A CB    1 
ATOM   381   C  CG    . PRO A  1 77  ? -30.878  27.526  -5.572   1.00 43.93 ? 58  PRO A CG    1 
ATOM   382   C  CD    . PRO A  1 77  ? -32.328  27.608  -5.526   1.00 43.69 ? 58  PRO A CD    1 
ATOM   383   N  N     . GLU A  1 78  ? -30.563  31.619  -7.111   1.00 43.41 ? 59  GLU A N     1 
ATOM   384   C  CA    . GLU A  1 78  ? -30.166  32.206  -8.372   1.00 43.37 ? 59  GLU A CA    1 
ATOM   385   C  C     . GLU A  1 78  ? -29.352  31.227  -9.136   1.00 42.39 ? 59  GLU A C     1 
ATOM   386   O  O     . GLU A  1 78  ? -28.617  30.448  -8.542   1.00 43.21 ? 59  GLU A O     1 
ATOM   387   C  CB    . GLU A  1 78  ? -29.246  33.394  -8.146   1.00 43.12 ? 59  GLU A CB    1 
ATOM   388   C  CG    . GLU A  1 78  ? -29.999  34.628  -7.959   1.00 45.13 ? 59  GLU A CG    1 
ATOM   389   C  CD    . GLU A  1 78  ? -29.177  35.874  -8.027   1.00 45.80 ? 59  GLU A CD    1 
ATOM   390   O  OE1   . GLU A  1 78  ? -28.033  35.851  -8.575   1.00 43.27 ? 59  GLU A OE1   1 
ATOM   391   O  OE2   . GLU A  1 78  ? -29.772  36.886  -7.520   1.00 50.52 ? 59  GLU A OE2   1 
ATOM   392   N  N     . TRP A  1 79  ? -29.403  31.304  -10.451  1.00 40.74 ? 60  TRP A N     1 
ATOM   393   C  CA    . TRP A  1 79  ? -28.588  30.401  -11.215  1.00 39.60 ? 60  TRP A CA    1 
ATOM   394   C  C     . TRP A  1 79  ? -28.029  31.150  -12.409  1.00 39.07 ? 60  TRP A C     1 
ATOM   395   O  O     . TRP A  1 79  ? -28.018  32.386  -12.417  1.00 39.28 ? 60  TRP A O     1 
ATOM   396   C  CB    . TRP A  1 79  ? -29.411  29.166  -11.585  1.00 39.43 ? 60  TRP A CB    1 
ATOM   397   C  CG    . TRP A  1 79  ? -28.610  27.962  -11.914  1.00 39.18 ? 60  TRP A CG    1 
ATOM   398   C  CD1   . TRP A  1 79  ? -27.267  27.775  -11.714  1.00 38.65 ? 60  TRP A CD1   1 
ATOM   399   C  CD2   . TRP A  1 79  ? -29.102  26.756  -12.498  1.00 37.96 ? 60  TRP A CD2   1 
ATOM   400   N  NE1   . TRP A  1 79  ? -26.900  26.528  -12.141  1.00 38.40 ? 60  TRP A NE1   1 
ATOM   401   C  CE2   . TRP A  1 79  ? -28.005  25.879  -12.631  1.00 38.56 ? 60  TRP A CE2   1 
ATOM   402   C  CE3   . TRP A  1 79  ? -30.364  26.326  -12.905  1.00 38.69 ? 60  TRP A CE3   1 
ATOM   403   C  CZ2   . TRP A  1 79  ? -28.129  24.591  -13.175  1.00 37.76 ? 60  TRP A CZ2   1 
ATOM   404   C  CZ3   . TRP A  1 79  ? -30.489  25.038  -13.436  1.00 39.51 ? 60  TRP A CZ3   1 
ATOM   405   C  CH2   . TRP A  1 79  ? -29.369  24.194  -13.572  1.00 38.52 ? 60  TRP A CH2   1 
ATOM   406   N  N     . ASN A  1 80  ? -27.528  30.428  -13.394  1.00 38.00 ? 61  ASN A N     1 
ATOM   407   C  CA    . ASN A  1 80  ? -26.916  31.059  -14.543  1.00 38.07 ? 61  ASN A CA    1 
ATOM   408   C  C     . ASN A  1 80  ? -26.826  30.042  -15.684  1.00 37.08 ? 61  ASN A C     1 
ATOM   409   O  O     . ASN A  1 80  ? -26.889  28.833  -15.464  1.00 36.34 ? 61  ASN A O     1 
ATOM   410   C  CB    . ASN A  1 80  ? -25.507  31.587  -14.183  1.00 37.54 ? 61  ASN A CB    1 
ATOM   411   C  CG    . ASN A  1 80  ? -24.589  30.474  -13.729  1.00 38.21 ? 61  ASN A CG    1 
ATOM   412   O  OD1   . ASN A  1 80  ? -24.524  30.156  -12.548  1.00 39.20 ? 61  ASN A OD1   1 
ATOM   413   N  ND2   . ASN A  1 80  ? -23.953  29.810  -14.675  1.00 38.21 ? 61  ASN A ND2   1 
ATOM   414   N  N     . PHE A  1 81  ? -26.629  30.555  -16.883  1.00 36.91 ? 62  PHE A N     1 
ATOM   415   C  CA    . PHE A  1 81  ? -26.450  29.726  -18.054  1.00 38.00 ? 62  PHE A CA    1 
ATOM   416   C  C     . PHE A  1 81  ? -25.404  30.330  -18.956  1.00 38.35 ? 62  PHE A C     1 
ATOM   417   O  O     . PHE A  1 81  ? -24.888  31.415  -18.675  1.00 38.71 ? 62  PHE A O     1 
ATOM   418   C  CB    . PHE A  1 81  ? -27.767  29.610  -18.809  1.00 38.47 ? 62  PHE A CB    1 
ATOM   419   C  CG    . PHE A  1 81  ? -28.287  30.929  -19.380  1.00 38.07 ? 62  PHE A CG    1 
ATOM   420   C  CD1   . PHE A  1 81  ? -28.189  31.195  -20.756  1.00 38.55 ? 62  PHE A CD1   1 
ATOM   421   C  CD2   . PHE A  1 81  ? -28.892  31.852  -18.563  1.00 37.42 ? 62  PHE A CD2   1 
ATOM   422   C  CE1   . PHE A  1 81  ? -28.690  32.354  -21.312  1.00 37.94 ? 62  PHE A CE1   1 
ATOM   423   C  CE2   . PHE A  1 81  ? -29.384  33.031  -19.087  1.00 39.51 ? 62  PHE A CE2   1 
ATOM   424   C  CZ    . PHE A  1 81  ? -29.286  33.288  -20.483  1.00 40.00 ? 62  PHE A CZ    1 
ATOM   425   N  N     . ASP A  1 82  ? -25.121  29.630  -20.046  1.00 38.69 ? 63  ASP A N     1 
ATOM   426   C  CA    . ASP A  1 82  ? -24.237  30.133  -21.084  1.00 39.15 ? 63  ASP A CA    1 
ATOM   427   C  C     . ASP A  1 82  ? -24.919  31.039  -22.102  1.00 39.19 ? 63  ASP A C     1 
ATOM   428   O  O     . ASP A  1 82  ? -25.361  30.555  -23.139  1.00 39.58 ? 63  ASP A O     1 
ATOM   429   C  CB    . ASP A  1 82  ? -23.692  28.941  -21.865  1.00 39.83 ? 63  ASP A CB    1 
ATOM   430   C  CG    . ASP A  1 82  ? -22.844  29.348  -23.060  1.00 39.67 ? 63  ASP A CG    1 
ATOM   431   O  OD1   . ASP A  1 82  ? -22.403  30.528  -23.152  1.00 38.65 ? 63  ASP A OD1   1 
ATOM   432   O  OD2   . ASP A  1 82  ? -22.615  28.444  -23.889  1.00 40.74 ? 63  ASP A OD2   1 
ATOM   433   N  N     . GLY A  1 83  ? -24.941  32.342  -21.861  1.00 39.11 ? 64  GLY A N     1 
ATOM   434   C  CA    . GLY A  1 83  ? -25.521  33.282  -22.828  1.00 39.63 ? 64  GLY A CA    1 
ATOM   435   C  C     . GLY A  1 83  ? -24.957  33.200  -24.255  1.00 40.35 ? 64  GLY A C     1 
ATOM   436   O  O     . GLY A  1 83  ? -25.646  33.552  -25.209  1.00 40.22 ? 64  GLY A O     1 
ATOM   437   N  N     . SER A  1 84  ? -23.703  32.747  -24.413  1.00 40.92 ? 65  SER A N     1 
ATOM   438   C  CA    . SER A  1 84  ? -23.114  32.624  -25.746  1.00 40.73 ? 65  SER A CA    1 
ATOM   439   C  C     . SER A  1 84  ? -23.787  31.546  -26.597  1.00 41.23 ? 65  SER A C     1 
ATOM   440   O  O     . SER A  1 84  ? -23.683  31.597  -27.824  1.00 41.55 ? 65  SER A O     1 
ATOM   441   C  CB    . SER A  1 84  ? -21.599  32.411  -25.698  1.00 40.48 ? 65  SER A CB    1 
ATOM   442   O  OG    . SER A  1 84  ? -21.241  31.064  -25.467  1.00 38.92 ? 65  SER A OG    1 
ATOM   443   N  N     . SER A  1 85  ? -24.483  30.599  -25.966  1.00 41.55 ? 66  SER A N     1 
ATOM   444   C  CA    . SER A  1 85  ? -25.227  29.566  -26.714  1.00 41.79 ? 66  SER A CA    1 
ATOM   445   C  C     . SER A  1 85  ? -26.702  29.871  -26.909  1.00 42.14 ? 66  SER A C     1 
ATOM   446   O  O     . SER A  1 85  ? -27.426  29.027  -27.465  1.00 42.19 ? 66  SER A O     1 
ATOM   447   C  CB    . SER A  1 85  ? -25.080  28.223  -26.024  1.00 41.21 ? 66  SER A CB    1 
ATOM   448   O  OG    . SER A  1 85  ? -23.724  27.841  -26.057  1.00 41.81 ? 66  SER A OG    1 
ATOM   449   N  N     . THR A  1 86  ? -27.153  31.041  -26.442  1.00 42.51 ? 67  THR A N     1 
ATOM   450   C  CA    . THR A  1 86  ? -28.544  31.473  -26.651  1.00 43.18 ? 67  THR A CA    1 
ATOM   451   C  C     . THR A  1 86  ? -28.628  32.862  -27.268  1.00 43.82 ? 67  THR A C     1 
ATOM   452   O  O     . THR A  1 86  ? -29.684  33.520  -27.177  1.00 44.28 ? 67  THR A O     1 
ATOM   453   C  CB    . THR A  1 86  ? -29.371  31.491  -25.344  1.00 42.71 ? 67  THR A CB    1 
ATOM   454   O  OG1   . THR A  1 86  ? -28.939  32.576  -24.522  1.00 42.28 ? 67  THR A OG1   1 
ATOM   455   C  CG2   . THR A  1 86  ? -29.213  30.190  -24.596  1.00 43.26 ? 67  THR A CG2   1 
ATOM   456   N  N     . LEU A  1 87  ? -27.538  33.292  -27.900  1.00 44.26 ? 68  LEU A N     1 
ATOM   457   C  CA    . LEU A  1 87  ? -27.507  34.554  -28.631  1.00 45.10 ? 68  LEU A CA    1 
ATOM   458   C  C     . LEU A  1 87  ? -27.645  35.800  -27.724  1.00 45.30 ? 68  LEU A C     1 
ATOM   459   O  O     . LEU A  1 87  ? -28.268  36.803  -28.092  1.00 45.50 ? 68  LEU A O     1 
ATOM   460   C  CB    . LEU A  1 87  ? -28.598  34.551  -29.745  1.00 46.05 ? 68  LEU A CB    1 
ATOM   461   C  CG    . LEU A  1 87  ? -28.152  34.503  -31.229  1.00 48.06 ? 68  LEU A CG    1 
ATOM   462   C  CD1   . LEU A  1 87  ? -29.273  35.194  -32.093  1.00 49.48 ? 68  LEU A CD1   1 
ATOM   463   C  CD2   . LEU A  1 87  ? -26.754  35.148  -31.486  1.00 46.12 ? 68  LEU A CD2   1 
ATOM   464   N  N     . GLN A  1 88  ? -27.081  35.745  -26.528  1.00 45.20 ? 69  GLN A N     1 
ATOM   465   C  CA    . GLN A  1 88  ? -27.248  36.857  -25.609  1.00 45.04 ? 69  GLN A CA    1 
ATOM   466   C  C     . GLN A  1 88  ? -25.956  37.412  -25.038  1.00 44.87 ? 69  GLN A C     1 
ATOM   467   O  O     . GLN A  1 88  ? -26.022  38.442  -24.395  1.00 45.10 ? 69  GLN A O     1 
ATOM   468   C  CB    . GLN A  1 88  ? -28.230  36.472  -24.505  1.00 44.77 ? 69  GLN A CB    1 
ATOM   469   C  CG    . GLN A  1 88  ? -29.658  36.298  -25.041  1.00 45.04 ? 69  GLN A CG    1 
ATOM   470   C  CD    . GLN A  1 88  ? -30.612  35.637  -24.055  1.00 45.58 ? 69  GLN A CD    1 
ATOM   471   O  OE1   . GLN A  1 88  ? -31.541  36.281  -23.558  1.00 46.85 ? 69  GLN A OE1   1 
ATOM   472   N  NE2   . GLN A  1 88  ? -30.397  34.347  -23.775  1.00 45.38 ? 69  GLN A NE2   1 
ATOM   473   N  N     . SER A  1 89  ? -24.810  36.748  -25.265  1.00 44.88 ? 70  SER A N     1 
ATOM   474   C  CA    . SER A  1 89  ? -23.495  37.198  -24.764  1.00 45.10 ? 70  SER A CA    1 
ATOM   475   C  C     . SER A  1 89  ? -22.349  36.513  -25.547  1.00 45.44 ? 70  SER A C     1 
ATOM   476   O  O     . SER A  1 89  ? -22.605  35.752  -26.452  1.00 45.72 ? 70  SER A O     1 
ATOM   477   C  CB    . SER A  1 89  ? -23.382  36.972  -23.239  1.00 45.12 ? 70  SER A CB    1 
ATOM   478   O  OG    . SER A  1 89  ? -23.183  35.610  -22.891  1.00 45.04 ? 70  SER A OG    1 
ATOM   479   N  N     . GLU A  1 90  ? -21.090  36.807  -25.227  1.00 46.40 ? 71  GLU A N     1 
ATOM   480   C  CA    . GLU A  1 90  ? -19.916  36.225  -25.931  1.00 46.22 ? 71  GLU A CA    1 
ATOM   481   C  C     . GLU A  1 90  ? -19.340  35.093  -25.108  1.00 45.78 ? 71  GLU A C     1 
ATOM   482   O  O     . GLU A  1 90  ? -19.345  35.164  -23.874  1.00 45.12 ? 71  GLU A O     1 
ATOM   483   C  CB    . GLU A  1 90  ? -18.784  37.228  -26.074  1.00 47.09 ? 71  GLU A CB    1 
ATOM   484   C  CG    . GLU A  1 90  ? -19.181  38.646  -26.433  1.00 51.56 ? 71  GLU A CG    1 
ATOM   485   C  CD    . GLU A  1 90  ? -19.047  38.911  -27.903  1.00 58.03 ? 71  GLU A CD    1 
ATOM   486   O  OE1   . GLU A  1 90  ? -19.719  38.161  -28.680  1.00 61.57 ? 71  GLU A OE1   1 
ATOM   487   O  OE2   . GLU A  1 90  ? -18.272  39.851  -28.259  1.00 60.65 ? 71  GLU A OE2   1 
ATOM   488   N  N     . GLY A  1 91  ? -18.802  34.081  -25.801  1.00 45.57 ? 72  GLY A N     1 
ATOM   489   C  CA    . GLY A  1 91  ? -18.206  32.883  -25.185  1.00 45.28 ? 72  GLY A CA    1 
ATOM   490   C  C     . GLY A  1 91  ? -17.173  33.183  -24.112  1.00 45.28 ? 72  GLY A C     1 
ATOM   491   O  O     . GLY A  1 91  ? -17.110  32.496  -23.089  1.00 45.62 ? 72  GLY A O     1 
ATOM   492   N  N     . SER A  1 92  ? -16.392  34.239  -24.318  1.00 44.86 ? 73  SER A N     1 
ATOM   493   C  CA    . SER A  1 92  ? -15.236  34.541  -23.460  1.00 44.76 ? 73  SER A CA    1 
ATOM   494   C  C     . SER A  1 92  ? -15.634  35.191  -22.134  1.00 44.56 ? 73  SER A C     1 
ATOM   495   O  O     . SER A  1 92  ? -14.824  35.233  -21.207  1.00 44.44 ? 73  SER A O     1 
ATOM   496   C  CB    . SER A  1 92  ? -14.238  35.435  -24.194  1.00 44.42 ? 73  SER A CB    1 
ATOM   497   O  OG    . SER A  1 92  ? -14.876  36.661  -24.544  1.00 45.10 ? 73  SER A OG    1 
ATOM   498   N  N     . ASN A  1 93  ? -16.874  35.679  -22.062  1.00 43.89 ? 74  ASN A N     1 
ATOM   499   C  CA    . ASN A  1 93  ? -17.456  36.272  -20.849  1.00 43.73 ? 74  ASN A CA    1 
ATOM   500   C  C     . ASN A  1 93  ? -18.942  35.907  -20.844  1.00 43.65 ? 74  ASN A C     1 
ATOM   501   O  O     . ASN A  1 93  ? -19.798  36.765  -21.001  1.00 44.26 ? 74  ASN A O     1 
ATOM   502   C  CB    . ASN A  1 93  ? -17.263  37.794  -20.844  1.00 43.26 ? 74  ASN A CB    1 
ATOM   503   C  CG    . ASN A  1 93  ? -17.610  38.435  -19.525  1.00 43.24 ? 74  ASN A CG    1 
ATOM   504   O  OD1   . ASN A  1 93  ? -17.954  37.756  -18.548  1.00 41.57 ? 74  ASN A OD1   1 
ATOM   505   N  ND2   . ASN A  1 93  ? -17.518  39.762  -19.482  1.00 40.16 ? 74  ASN A ND2   1 
ATOM   506   N  N     . SER A  1 94  ? -19.227  34.620  -20.650  1.00 43.33 ? 75  SER A N     1 
ATOM   507   C  CA    . SER A  1 94  ? -20.461  34.020  -21.137  1.00 42.41 ? 75  SER A CA    1 
ATOM   508   C  C     . SER A  1 94  ? -21.575  33.884  -20.112  1.00 42.53 ? 75  SER A C     1 
ATOM   509   O  O     . SER A  1 94  ? -22.725  34.066  -20.471  1.00 42.91 ? 75  SER A O     1 
ATOM   510   C  CB    . SER A  1 94  ? -20.166  32.685  -21.829  1.00 41.99 ? 75  SER A CB    1 
ATOM   511   O  OG    . SER A  1 94  ? -19.123  31.981  -21.221  1.00 39.23 ? 75  SER A OG    1 
ATOM   512   N  N     . ASP A  1 95  ? -21.253  33.590  -18.852  1.00 42.48 ? 76  ASP A N     1 
ATOM   513   C  CA    . ASP A  1 95  ? -22.266  33.396  -17.811  1.00 42.09 ? 76  ASP A CA    1 
ATOM   514   C  C     . ASP A  1 95  ? -23.274  34.560  -17.809  1.00 42.60 ? 76  ASP A C     1 
ATOM   515   O  O     . ASP A  1 95  ? -22.871  35.745  -17.910  1.00 42.43 ? 76  ASP A O     1 
ATOM   516   C  CB    . ASP A  1 95  ? -21.649  33.279  -16.408  1.00 41.64 ? 76  ASP A CB    1 
ATOM   517   C  CG    . ASP A  1 95  ? -20.533  32.211  -16.297  1.00 42.75 ? 76  ASP A CG    1 
ATOM   518   O  OD1   . ASP A  1 95  ? -20.202  31.840  -15.156  1.00 42.19 ? 76  ASP A OD1   1 
ATOM   519   O  OD2   . ASP A  1 95  ? -19.943  31.761  -17.317  1.00 43.67 ? 76  ASP A OD2   1 
ATOM   520   N  N     . MET A  1 96  ? -24.578  34.224  -17.719  1.00 42.53 ? 77  MET A N     1 
ATOM   521   C  CA    . MET A  1 96  ? -25.650  35.237  -17.525  1.00 42.29 ? 77  MET A CA    1 
ATOM   522   C  C     . MET A  1 96  ? -26.483  34.778  -16.389  1.00 41.73 ? 77  MET A C     1 
ATOM   523   O  O     . MET A  1 96  ? -26.531  33.608  -16.154  1.00 42.36 ? 77  MET A O     1 
ATOM   524   C  CB    . MET A  1 96  ? -26.518  35.418  -18.760  1.00 42.11 ? 77  MET A CB    1 
ATOM   525   C  CG    . MET A  1 96  ? -25.757  36.003  -19.928  1.00 41.91 ? 77  MET A CG    1 
ATOM   526   S  SD    . MET A  1 96  ? -26.836  36.393  -21.326  1.00 43.83 ? 77  MET A SD    1 
ATOM   527   C  CE    . MET A  1 96  ? -27.407  38.052  -20.863  1.00 38.00 ? 77  MET A CE    1 
ATOM   528   N  N     . TYR A  1 97  ? -27.111  35.692  -15.666  1.00 41.50 ? 78  TYR A N     1 
ATOM   529   C  CA    . TYR A  1 97  ? -27.833  35.327  -14.450  1.00 41.55 ? 78  TYR A CA    1 
ATOM   530   C  C     . TYR A  1 97  ? -29.269  34.889  -14.734  1.00 40.59 ? 78  TYR A C     1 
ATOM   531   O  O     . TYR A  1 97  ? -29.948  35.519  -15.555  1.00 39.87 ? 78  TYR A O     1 
ATOM   532   C  CB    . TYR A  1 97  ? -27.925  36.525  -13.520  1.00 42.36 ? 78  TYR A CB    1 
ATOM   533   C  CG    . TYR A  1 97  ? -26.605  36.940  -12.985  1.00 43.46 ? 78  TYR A CG    1 
ATOM   534   C  CD1   . TYR A  1 97  ? -26.159  36.453  -11.767  1.00 43.28 ? 78  TYR A CD1   1 
ATOM   535   C  CD2   . TYR A  1 97  ? -25.809  37.856  -13.668  1.00 43.78 ? 78  TYR A CD2   1 
ATOM   536   C  CE1   . TYR A  1 97  ? -24.952  36.847  -11.249  1.00 44.10 ? 78  TYR A CE1   1 
ATOM   537   C  CE2   . TYR A  1 97  ? -24.599  38.274  -13.145  1.00 44.15 ? 78  TYR A CE2   1 
ATOM   538   C  CZ    . TYR A  1 97  ? -24.160  37.747  -11.934  1.00 44.39 ? 78  TYR A CZ    1 
ATOM   539   O  OH    . TYR A  1 97  ? -22.926  38.095  -11.399  1.00 44.89 ? 78  TYR A OH    1 
ATOM   540   N  N     . LEU A  1 98  ? -29.727  33.860  -14.019  1.00 39.53 ? 79  LEU A N     1 
ATOM   541   C  CA    . LEU A  1 98  ? -31.164  33.529  -13.930  1.00 39.79 ? 79  LEU A CA    1 
ATOM   542   C  C     . LEU A  1 98  ? -31.675  33.861  -12.522  1.00 39.73 ? 79  LEU A C     1 
ATOM   543   O  O     . LEU A  1 98  ? -31.127  33.349  -11.522  1.00 40.59 ? 79  LEU A O     1 
ATOM   544   C  CB    . LEU A  1 98  ? -31.430  32.048  -14.241  1.00 39.43 ? 79  LEU A CB    1 
ATOM   545   C  CG    . LEU A  1 98  ? -31.132  31.591  -15.687  1.00 39.45 ? 79  LEU A CG    1 
ATOM   546   C  CD1   . LEU A  1 98  ? -31.034  30.089  -15.739  1.00 36.79 ? 79  LEU A CD1   1 
ATOM   547   C  CD2   . LEU A  1 98  ? -32.151  32.121  -16.720  1.00 36.31 ? 79  LEU A CD2   1 
ATOM   548   N  N     . VAL A  1 99  ? -32.699  34.713  -12.435  1.00 38.91 ? 80  VAL A N     1 
ATOM   549   C  CA    . VAL A  1 99  ? -33.313  35.045  -11.149  1.00 38.51 ? 80  VAL A CA    1 
ATOM   550   C  C     . VAL A  1 99  ? -34.741  34.520  -11.178  1.00 39.23 ? 80  VAL A C     1 
ATOM   551   O  O     . VAL A  1 99  ? -35.542  34.945  -12.036  1.00 38.98 ? 80  VAL A O     1 
ATOM   552   C  CB    . VAL A  1 99  ? -33.341  36.568  -10.896  1.00 38.50 ? 80  VAL A CB    1 
ATOM   553   C  CG1   . VAL A  1 99  ? -34.075  36.882  -9.612   1.00 33.91 ? 80  VAL A CG1   1 
ATOM   554   C  CG2   . VAL A  1 99  ? -31.899  37.135  -10.907  1.00 36.04 ? 80  VAL A CG2   1 
ATOM   555   N  N     . PRO A  1 100 ? -35.066  33.569  -10.272  1.00 39.14 ? 81  PRO A N     1 
ATOM   556   C  CA    . PRO A  1 100 ? -36.439  33.087  -10.144  1.00 38.59 ? 81  PRO A CA    1 
ATOM   557   C  C     . PRO A  1 100 ? -37.456  34.210  -10.014  1.00 38.43 ? 81  PRO A C     1 
ATOM   558   O  O     . PRO A  1 100 ? -37.261  35.157  -9.233   1.00 37.36 ? 81  PRO A O     1 
ATOM   559   C  CB    . PRO A  1 100 ? -36.394  32.201  -8.894   1.00 38.66 ? 81  PRO A CB    1 
ATOM   560   C  CG    . PRO A  1 100 ? -34.963  31.660  -8.883   1.00 38.81 ? 81  PRO A CG    1 
ATOM   561   C  CD    . PRO A  1 100 ? -34.140  32.834  -9.387   1.00 39.47 ? 81  PRO A CD    1 
ATOM   562   N  N     . ALA A  1 101 ? -38.509  34.091  -10.831  1.00 38.43 ? 82  ALA A N     1 
ATOM   563   C  CA    . ALA A  1 101 ? -39.589  35.056  -10.896  1.00 38.51 ? 82  ALA A CA    1 
ATOM   564   C  C     . ALA A  1 101 ? -40.930  34.440  -10.447  1.00 38.67 ? 82  ALA A C     1 
ATOM   565   O  O     . ALA A  1 101 ? -41.565  35.021  -9.568   1.00 38.78 ? 82  ALA A O     1 
ATOM   566   C  CB    . ALA A  1 101 ? -39.691  35.675  -12.291  1.00 37.82 ? 82  ALA A CB    1 
ATOM   567   N  N     . ALA A  1 102 ? -41.330  33.293  -11.024  1.00 38.28 ? 83  ALA A N     1 
ATOM   568   C  CA    . ALA A  1 102 ? -42.651  32.656  -10.752  1.00 38.46 ? 83  ALA A CA    1 
ATOM   569   C  C     . ALA A  1 102 ? -42.505  31.127  -10.732  1.00 38.91 ? 83  ALA A C     1 
ATOM   570   O  O     . ALA A  1 102 ? -41.965  30.539  -11.683  1.00 39.22 ? 83  ALA A O     1 
ATOM   571   C  CB    . ALA A  1 102 ? -43.693  33.063  -11.803  1.00 37.45 ? 83  ALA A CB    1 
ATOM   572   N  N     . MET A  1 103 ? -42.965  30.482  -9.657   1.00 38.99 ? 84  MET A N     1 
ATOM   573   C  CA    . MET A  1 103 ? -42.830  29.029  -9.519   1.00 38.97 ? 84  MET A CA    1 
ATOM   574   C  C     . MET A  1 103 ? -44.138  28.323  -9.742   1.00 38.61 ? 84  MET A C     1 
ATOM   575   O  O     . MET A  1 103 ? -45.166  28.780  -9.272   1.00 38.79 ? 84  MET A O     1 
ATOM   576   C  CB    . MET A  1 103 ? -42.351  28.672  -8.118   1.00 39.12 ? 84  MET A CB    1 
ATOM   577   C  CG    . MET A  1 103 ? -42.114  27.199  -7.905   1.00 38.66 ? 84  MET A CG    1 
ATOM   578   S  SD    . MET A  1 103 ? -41.231  26.953  -6.362   1.00 41.00 ? 84  MET A SD    1 
ATOM   579   C  CE    . MET A  1 103 ? -42.614  26.928  -5.197   1.00 35.11 ? 84  MET A CE    1 
ATOM   580   N  N     . PHE A  1 104 ? -44.091  27.177  -10.406  1.00 38.48 ? 85  PHE A N     1 
ATOM   581   C  CA    . PHE A  1 104 ? -45.287  26.367  -10.614  1.00 38.52 ? 85  PHE A CA    1 
ATOM   582   C  C     . PHE A  1 104 ? -44.965  24.923  -10.374  1.00 38.10 ? 85  PHE A C     1 
ATOM   583   O  O     . PHE A  1 104 ? -43.791  24.545  -10.317  1.00 38.23 ? 85  PHE A O     1 
ATOM   584   C  CB    . PHE A  1 104 ? -45.770  26.518  -12.045  1.00 39.12 ? 85  PHE A CB    1 
ATOM   585   C  CG    . PHE A  1 104 ? -46.221  27.887  -12.374  1.00 38.98 ? 85  PHE A CG    1 
ATOM   586   C  CD1   . PHE A  1 104 ? -47.549  28.234  -12.205  1.00 39.98 ? 85  PHE A CD1   1 
ATOM   587   C  CD2   . PHE A  1 104 ? -45.324  28.821  -12.854  1.00 38.63 ? 85  PHE A CD2   1 
ATOM   588   C  CE1   . PHE A  1 104 ? -47.983  29.514  -12.516  1.00 40.64 ? 85  PHE A CE1   1 
ATOM   589   C  CE2   . PHE A  1 104 ? -45.712  30.083  -13.138  1.00 39.41 ? 85  PHE A CE2   1 
ATOM   590   C  CZ    . PHE A  1 104 ? -47.052  30.450  -12.968  1.00 41.11 ? 85  PHE A CZ    1 
ATOM   591   N  N     . ARG A  1 105 ? -45.997  24.107  -10.258  1.00 37.90 ? 86  ARG A N     1 
ATOM   592   C  CA    . ARG A  1 105 ? -45.796  22.650  -10.138  1.00 38.21 ? 86  ARG A CA    1 
ATOM   593   C  C     . ARG A  1 105 ? -45.422  22.055  -11.506  1.00 38.17 ? 86  ARG A C     1 
ATOM   594   O  O     . ARG A  1 105 ? -45.841  22.557  -12.555  1.00 38.71 ? 86  ARG A O     1 
ATOM   595   C  CB    . ARG A  1 105 ? -47.039  21.973  -9.558   1.00 38.15 ? 86  ARG A CB    1 
ATOM   596   C  CG    . ARG A  1 105 ? -47.399  22.416  -8.139   1.00 37.71 ? 86  ARG A CG    1 
ATOM   597   C  CD    . ARG A  1 105 ? -48.880  22.111  -7.791   1.00 37.79 ? 86  ARG A CD    1 
ATOM   598   N  NE    . ARG A  1 105 ? -49.072  20.721  -7.356   1.00 39.19 ? 86  ARG A NE    1 
ATOM   599   C  CZ    . ARG A  1 105 ? -50.173  19.977  -7.558   1.00 39.42 ? 86  ARG A CZ    1 
ATOM   600   N  NH1   . ARG A  1 105 ? -51.233  20.424  -8.246   1.00 36.66 ? 86  ARG A NH1   1 
ATOM   601   N  NH2   . ARG A  1 105 ? -50.198  18.735  -7.078   1.00 37.30 ? 86  ARG A NH2   1 
ATOM   602   N  N     . ASP A  1 106 ? -44.594  21.019  -11.507  1.00 37.91 ? 87  ASP A N     1 
ATOM   603   C  CA    . ASP A  1 106 ? -44.121  20.462  -12.767  1.00 37.70 ? 87  ASP A CA    1 
ATOM   604   C  C     . ASP A  1 106 ? -45.002  19.290  -13.115  1.00 37.46 ? 87  ASP A C     1 
ATOM   605   O  O     . ASP A  1 106 ? -44.919  18.268  -12.465  1.00 37.37 ? 87  ASP A O     1 
ATOM   606   C  CB    . ASP A  1 106 ? -42.671  20.022  -12.658  1.00 37.81 ? 87  ASP A CB    1 
ATOM   607   C  CG    . ASP A  1 106 ? -42.116  19.489  -13.964  1.00 38.27 ? 87  ASP A CG    1 
ATOM   608   O  OD1   . ASP A  1 106 ? -42.880  18.864  -14.743  1.00 38.76 ? 87  ASP A OD1   1 
ATOM   609   O  OD2   . ASP A  1 106 ? -40.895  19.711  -14.214  1.00 40.56 ? 87  ASP A OD2   1 
ATOM   610   N  N     . PRO A  1 107 ? -45.833  19.434  -14.159  1.00 37.81 ? 88  PRO A N     1 
ATOM   611   C  CA    . PRO A  1 107 ? -46.806  18.433  -14.580  1.00 38.00 ? 88  PRO A CA    1 
ATOM   612   C  C     . PRO A  1 107 ? -46.197  17.321  -15.448  1.00 38.26 ? 88  PRO A C     1 
ATOM   613   O  O     . PRO A  1 107 ? -46.883  16.340  -15.760  1.00 38.94 ? 88  PRO A O     1 
ATOM   614   C  CB    . PRO A  1 107 ? -47.797  19.251  -15.409  1.00 37.42 ? 88  PRO A CB    1 
ATOM   615   C  CG    . PRO A  1 107 ? -46.940  20.230  -16.078  1.00 38.28 ? 88  PRO A CG    1 
ATOM   616   C  CD    . PRO A  1 107 ? -45.869  20.604  -15.063  1.00 38.25 ? 88  PRO A CD    1 
ATOM   617   N  N     . PHE A  1 108 ? -44.931  17.493  -15.822  1.00 38.22 ? 89  PHE A N     1 
ATOM   618   C  CA    . PHE A  1 108 ? -44.163  16.494  -16.570  1.00 38.22 ? 89  PHE A CA    1 
ATOM   619   C  C     . PHE A  1 108 ? -43.499  15.536  -15.615  1.00 38.18 ? 89  PHE A C     1 
ATOM   620   O  O     . PHE A  1 108 ? -43.390  14.352  -15.898  1.00 38.22 ? 89  PHE A O     1 
ATOM   621   C  CB    . PHE A  1 108 ? -43.148  17.186  -17.470  1.00 37.73 ? 89  PHE A CB    1 
ATOM   622   C  CG    . PHE A  1 108 ? -43.782  18.255  -18.318  1.00 38.22 ? 89  PHE A CG    1 
ATOM   623   C  CD1   . PHE A  1 108 ? -44.714  17.913  -19.293  1.00 38.56 ? 89  PHE A CD1   1 
ATOM   624   C  CD2   . PHE A  1 108 ? -43.541  19.588  -18.080  1.00 37.36 ? 89  PHE A CD2   1 
ATOM   625   C  CE1   . PHE A  1 108 ? -45.345  18.904  -20.066  1.00 38.85 ? 89  PHE A CE1   1 
ATOM   626   C  CE2   . PHE A  1 108 ? -44.160  20.568  -18.838  1.00 38.15 ? 89  PHE A CE2   1 
ATOM   627   C  CZ    . PHE A  1 108 ? -45.071  20.223  -19.832  1.00 38.61 ? 89  PHE A CZ    1 
ATOM   628   N  N     . ARG A  1 109 ? -43.127  16.029  -14.447  1.00 38.24 ? 90  ARG A N     1 
ATOM   629   C  CA    . ARG A  1 109 ? -42.412  15.194  -13.486  1.00 38.40 ? 90  ARG A CA    1 
ATOM   630   C  C     . ARG A  1 109 ? -43.179  15.040  -12.167  1.00 38.44 ? 90  ARG A C     1 
ATOM   631   O  O     . ARG A  1 109 ? -42.796  14.220  -11.340  1.00 37.03 ? 90  ARG A O     1 
ATOM   632   C  CB    . ARG A  1 109 ? -41.007  15.777  -13.226  1.00 38.50 ? 90  ARG A CB    1 
ATOM   633   C  CG    . ARG A  1 109 ? -40.162  15.966  -14.481  1.00 37.49 ? 90  ARG A CG    1 
ATOM   634   C  CD    . ARG A  1 109 ? -38.952  16.773  -14.158  1.00 38.11 ? 90  ARG A CD    1 
ATOM   635   N  NE    . ARG A  1 109 ? -37.903  16.744  -15.190  1.00 36.43 ? 90  ARG A NE    1 
ATOM   636   C  CZ    . ARG A  1 109 ? -37.000  17.701  -15.319  1.00 35.86 ? 90  ARG A CZ    1 
ATOM   637   N  NH1   . ARG A  1 109 ? -37.002  18.754  -14.505  1.00 37.83 ? 90  ARG A NH1   1 
ATOM   638   N  NH2   . ARG A  1 109 ? -36.102  17.638  -16.268  1.00 36.33 ? 90  ARG A NH2   1 
ATOM   639   N  N     . LYS A  1 110 ? -44.222  15.830  -11.995  1.00 38.70 ? 91  LYS A N     1 
ATOM   640   C  CA    . LYS A  1 110 ? -45.047  15.795  -10.815  1.00 39.20 ? 91  LYS A CA    1 
ATOM   641   C  C     . LYS A  1 110 ? -44.397  16.314  -9.561   1.00 38.74 ? 91  LYS A C     1 
ATOM   642   O  O     . LYS A  1 110 ? -43.246  16.551  -9.526   1.00 37.53 ? 91  LYS A O     1 
ATOM   643   C  CB    . LYS A  1 110 ? -45.620  14.408  -10.586  1.00 38.96 ? 91  LYS A CB    1 
ATOM   644   C  CG    . LYS A  1 110 ? -46.488  13.913  -11.670  1.00 41.17 ? 91  LYS A CG    1 
ATOM   645   C  CD    . LYS A  1 110 ? -46.858  12.503  -11.456  1.00 41.45 ? 91  LYS A CD    1 
ATOM   646   C  CE    . LYS A  1 110 ? -47.532  12.340  -10.143  1.00 47.11 ? 91  LYS A CE    1 
ATOM   647   N  NZ    . LYS A  1 110 ? -48.902  11.782  -10.176  1.00 47.77 ? 91  LYS A NZ    1 
ATOM   648   N  N     . ASP A  1 111 ? -45.188  16.472  -8.526   1.00 39.61 ? 92  ASP A N     1 
ATOM   649   C  CA    . ASP A  1 111 ? -44.717  16.834  -7.213   1.00 39.55 ? 92  ASP A CA    1 
ATOM   650   C  C     . ASP A  1 111 ? -43.628  15.898  -6.807   1.00 39.37 ? 92  ASP A C     1 
ATOM   651   O  O     . ASP A  1 111 ? -43.714  14.731  -7.030   1.00 39.81 ? 92  ASP A O     1 
ATOM   652   C  CB    . ASP A  1 111 ? -45.843  16.748  -6.214   1.00 38.55 ? 92  ASP A CB    1 
ATOM   653   C  CG    . ASP A  1 111 ? -46.810  17.866  -6.326   1.00 39.63 ? 92  ASP A CG    1 
ATOM   654   O  OD1   . ASP A  1 111 ? -46.505  18.893  -6.899   1.00 37.58 ? 92  ASP A OD1   1 
ATOM   655   O  OD2   . ASP A  1 111 ? -47.896  17.723  -5.807   1.00 37.91 ? 92  ASP A OD2   1 
ATOM   656   N  N     . PRO A  1 112 ? -42.560  16.405  -6.245   1.00 39.25 ? 93  PRO A N     1 
ATOM   657   C  CA    . PRO A  1 112 ? -42.457  17.726  -5.673   1.00 39.24 ? 93  PRO A CA    1 
ATOM   658   C  C     . PRO A  1 112 ? -41.675  18.668  -6.537   1.00 39.42 ? 93  PRO A C     1 
ATOM   659   O  O     . PRO A  1 112 ? -41.114  19.625  -6.074   1.00 40.08 ? 93  PRO A O     1 
ATOM   660   C  CB    . PRO A  1 112 ? -41.682  17.442  -4.426   1.00 39.29 ? 93  PRO A CB    1 
ATOM   661   C  CG    . PRO A  1 112 ? -40.875  16.341  -4.778   1.00 39.37 ? 93  PRO A CG    1 
ATOM   662   C  CD    . PRO A  1 112 ? -41.606  15.490  -5.653   1.00 39.13 ? 93  PRO A CD    1 
ATOM   663   N  N     . ASN A  1 113 ? -41.661  18.361  -7.812   1.00 39.32 ? 94  ASN A N     1 
ATOM   664   C  CA    . ASN A  1 113 ? -40.838  19.007  -8.782   1.00 38.83 ? 94  ASN A CA    1 
ATOM   665   C  C     . ASN A  1 113 ? -41.459  20.252  -9.290   1.00 38.23 ? 94  ASN A C     1 
ATOM   666   O  O     . ASN A  1 113 ? -42.633  20.446  -9.198   1.00 38.71 ? 94  ASN A O     1 
ATOM   667   C  CB    . ASN A  1 113 ? -40.509  18.035  -9.889   1.00 38.48 ? 94  ASN A CB    1 
ATOM   668   C  CG    . ASN A  1 113 ? -39.899  16.789  -9.376   1.00 37.79 ? 94  ASN A CG    1 
ATOM   669   O  OD1   . ASN A  1 113 ? -39.029  16.819  -8.570   1.00 39.47 ? 94  ASN A OD1   1 
ATOM   670   N  ND2   . ASN A  1 113 ? -40.356  15.694  -9.839   1.00 35.00 ? 94  ASN A ND2   1 
ATOM   671   N  N     . LYS A  1 114 ? -40.633  21.122  -9.804   1.00 38.10 ? 95  LYS A N     1 
ATOM   672   C  CA    . LYS A  1 114 ? -41.026  22.507  -10.008  1.00 38.42 ? 95  LYS A CA    1 
ATOM   673   C  C     . LYS A  1 114 ? -40.648  23.041  -11.361  1.00 38.74 ? 95  LYS A C     1 
ATOM   674   O  O     . LYS A  1 114 ? -39.639  22.641  -11.937  1.00 39.37 ? 95  LYS A O     1 
ATOM   675   C  CB    . LYS A  1 114 ? -40.351  23.408  -8.982   1.00 37.96 ? 95  LYS A CB    1 
ATOM   676   C  CG    . LYS A  1 114 ? -40.631  23.092  -7.527   1.00 38.24 ? 95  LYS A CG    1 
ATOM   677   C  CD    . LYS A  1 114 ? -42.103  23.154  -7.166   1.00 37.24 ? 95  LYS A CD    1 
ATOM   678   C  CE    . LYS A  1 114 ? -42.270  22.839  -5.705   1.00 36.91 ? 95  LYS A CE    1 
ATOM   679   N  NZ    . LYS A  1 114 ? -43.627  22.293  -5.369   1.00 35.23 ? 95  LYS A NZ    1 
ATOM   680   N  N     . LEU A  1 115 ? -41.452  23.973  -11.856  1.00 38.95 ? 96  LEU A N     1 
ATOM   681   C  CA    . LEU A  1 115 ? -41.044  24.814  -12.980  1.00 39.13 ? 96  LEU A CA    1 
ATOM   682   C  C     . LEU A  1 115 ? -40.817  26.210  -12.403  1.00 39.19 ? 96  LEU A C     1 
ATOM   683   O  O     . LEU A  1 115 ? -41.592  26.646  -11.539  1.00 38.54 ? 96  LEU A O     1 
ATOM   684   C  CB    . LEU A  1 115 ? -42.126  24.859  -14.083  1.00 38.92 ? 96  LEU A CB    1 
ATOM   685   C  CG    . LEU A  1 115 ? -42.617  23.541  -14.680  1.00 38.90 ? 96  LEU A CG    1 
ATOM   686   C  CD1   . LEU A  1 115 ? -43.839  23.769  -15.630  1.00 37.41 ? 96  LEU A CD1   1 
ATOM   687   C  CD2   . LEU A  1 115 ? -41.488  22.770  -15.381  1.00 35.79 ? 96  LEU A CD2   1 
ATOM   688   N  N     . VAL A  1 116 ? -39.766  26.883  -12.885  1.00 39.23 ? 97  VAL A N     1 
ATOM   689   C  CA    . VAL A  1 116 ? -39.382  28.216  -12.418  1.00 39.64 ? 97  VAL A CA    1 
ATOM   690   C  C     . VAL A  1 116 ? -39.153  29.140  -13.616  1.00 40.00 ? 97  VAL A C     1 
ATOM   691   O  O     . VAL A  1 116 ? -38.157  28.997  -14.352  1.00 40.43 ? 97  VAL A O     1 
ATOM   692   C  CB    . VAL A  1 116 ? -38.066  28.162  -11.593  1.00 39.88 ? 97  VAL A CB    1 
ATOM   693   C  CG1   . VAL A  1 116 ? -37.847  29.459  -10.822  1.00 39.41 ? 97  VAL A CG1   1 
ATOM   694   C  CG2   . VAL A  1 116 ? -38.091  27.002  -10.640  1.00 40.87 ? 97  VAL A CG2   1 
ATOM   695   N  N     . LEU A  1 117 ? -40.056  30.087  -13.830  1.00 40.00 ? 98  LEU A N     1 
ATOM   696   C  CA    . LEU A  1 117 ? -39.832  31.076  -14.862  1.00 39.80 ? 98  LEU A CA    1 
ATOM   697   C  C     . LEU A  1 117 ? -38.854  32.058  -14.225  1.00 40.11 ? 98  LEU A C     1 
ATOM   698   O  O     . LEU A  1 117 ? -39.030  32.462  -13.080  1.00 40.18 ? 98  LEU A O     1 
ATOM   699   C  CB    . LEU A  1 117 ? -41.134  31.765  -15.353  1.00 39.75 ? 98  LEU A CB    1 
ATOM   700   C  CG    . LEU A  1 117 ? -40.888  32.910  -16.388  1.00 39.88 ? 98  LEU A CG    1 
ATOM   701   C  CD1   . LEU A  1 117 ? -40.424  32.344  -17.753  1.00 37.38 ? 98  LEU A CD1   1 
ATOM   702   C  CD2   . LEU A  1 117 ? -42.092  33.869  -16.550  1.00 37.68 ? 98  LEU A CD2   1 
ATOM   703   N  N     . CYS A  1 118 ? -37.825  32.413  -14.983  1.00 40.73 ? 99  CYS A N     1 
ATOM   704   C  CA    . CYS A  1 118 ? -36.768  33.291  -14.534  1.00 41.25 ? 99  CYS A CA    1 
ATOM   705   C  C     . CYS A  1 118 ? -36.678  34.582  -15.359  1.00 41.74 ? 99  CYS A C     1 
ATOM   706   O  O     . CYS A  1 118 ? -37.078  34.637  -16.516  1.00 42.66 ? 99  CYS A O     1 
ATOM   707   C  CB    . CYS A  1 118 ? -35.444  32.544  -14.616  1.00 40.92 ? 99  CYS A CB    1 
ATOM   708   S  SG    . CYS A  1 118 ? -35.334  31.201  -13.415  1.00 42.72 ? 99  CYS A SG    1 
ATOM   709   N  N     . GLU A  1 119 ? -36.153  35.630  -14.732  1.00 42.24 ? 100 GLU A N     1 
ATOM   710   C  CA    . GLU A  1 119 ? -35.633  36.788  -15.439  1.00 42.04 ? 100 GLU A CA    1 
ATOM   711   C  C     . GLU A  1 119 ? -34.124  36.599  -15.726  1.00 42.35 ? 100 GLU A C     1 
ATOM   712   O  O     . GLU A  1 119 ? -33.353  36.022  -14.909  1.00 42.13 ? 100 GLU A O     1 
ATOM   713   C  CB    . GLU A  1 119 ? -35.849  38.063  -14.628  1.00 42.41 ? 100 GLU A CB    1 
ATOM   714   C  CG    . GLU A  1 119 ? -37.246  38.673  -14.710  1.00 42.15 ? 100 GLU A CG    1 
ATOM   715   C  CD    . GLU A  1 119 ? -37.292  40.064  -14.106  1.00 42.93 ? 100 GLU A CD    1 
ATOM   716   O  OE1   . GLU A  1 119 ? -36.290  40.818  -14.239  1.00 46.08 ? 100 GLU A OE1   1 
ATOM   717   O  OE2   . GLU A  1 119 ? -38.314  40.416  -13.490  1.00 41.15 ? 100 GLU A OE2   1 
ATOM   718   N  N     . VAL A  1 120 ? -33.720  37.093  -16.894  1.00 42.30 ? 101 VAL A N     1 
ATOM   719   C  CA    . VAL A  1 120 ? -32.337  37.049  -17.330  1.00 42.37 ? 101 VAL A CA    1 
ATOM   720   C  C     . VAL A  1 120 ? -31.668  38.427  -17.103  1.00 42.97 ? 101 VAL A C     1 
ATOM   721   O  O     . VAL A  1 120 ? -32.262  39.485  -17.346  1.00 42.73 ? 101 VAL A O     1 
ATOM   722   C  CB    . VAL A  1 120 ? -32.248  36.596  -18.816  1.00 41.92 ? 101 VAL A CB    1 
ATOM   723   C  CG1   . VAL A  1 120 ? -30.814  36.615  -19.303  1.00 40.79 ? 101 VAL A CG1   1 
ATOM   724   C  CG2   . VAL A  1 120 ? -32.901  35.212  -18.974  1.00 39.33 ? 101 VAL A CG2   1 
ATOM   725   N  N     . PHE A  1 121 ? -30.435  38.382  -16.591  1.00 43.68 ? 102 PHE A N     1 
ATOM   726   C  CA    . PHE A  1 121 ? -29.579  39.551  -16.460  1.00 44.07 ? 102 PHE A CA    1 
ATOM   727   C  C     . PHE A  1 121 ? -28.199  39.288  -17.014  1.00 44.71 ? 102 PHE A C     1 
ATOM   728   O  O     . PHE A  1 121 ? -27.741  38.145  -17.041  1.00 44.12 ? 102 PHE A O     1 
ATOM   729   C  CB    . PHE A  1 121 ? -29.444  39.952  -15.012  1.00 43.61 ? 102 PHE A CB    1 
ATOM   730   C  CG    . PHE A  1 121 ? -30.736  40.302  -14.373  1.00 43.29 ? 102 PHE A CG    1 
ATOM   731   C  CD1   . PHE A  1 121 ? -31.108  41.635  -14.212  1.00 43.41 ? 102 PHE A CD1   1 
ATOM   732   C  CD2   . PHE A  1 121 ? -31.579  39.311  -13.921  1.00 42.56 ? 102 PHE A CD2   1 
ATOM   733   C  CE1   . PHE A  1 121 ? -32.291  41.969  -13.607  1.00 42.65 ? 102 PHE A CE1   1 
ATOM   734   C  CE2   . PHE A  1 121 ? -32.759  39.639  -13.312  1.00 43.40 ? 102 PHE A CE2   1 
ATOM   735   C  CZ    . PHE A  1 121 ? -33.112  40.973  -13.147  1.00 42.94 ? 102 PHE A CZ    1 
ATOM   736   N  N     . LYS A  1 122 ? -27.540  40.378  -17.407  1.00 45.92 ? 103 LYS A N     1 
ATOM   737   C  CA    . LYS A  1 122 ? -26.251  40.334  -18.069  1.00 47.33 ? 103 LYS A CA    1 
ATOM   738   C  C     . LYS A  1 122 ? -25.065  40.259  -17.088  1.00 47.89 ? 103 LYS A C     1 
ATOM   739   O  O     . LYS A  1 122 ? -25.255  40.285  -15.872  1.00 47.76 ? 103 LYS A O     1 
ATOM   740   C  CB    . LYS A  1 122 ? -26.119  41.551  -19.002  1.00 48.09 ? 103 LYS A CB    1 
ATOM   741   C  CG    . LYS A  1 122 ? -27.278  41.664  -20.040  1.00 48.85 ? 103 LYS A CG    1 
ATOM   742   C  CD    . LYS A  1 122 ? -27.370  43.061  -20.634  1.00 48.52 ? 103 LYS A CD    1 
ATOM   743   C  CE    . LYS A  1 122 ? -26.195  43.336  -21.492  1.00 52.04 ? 103 LYS A CE    1 
ATOM   744   N  NZ    . LYS A  1 122 ? -26.512  44.367  -22.520  1.00 53.54 ? 103 LYS A NZ    1 
ATOM   745   N  N     . TYR A  1 123 ? -23.851  40.145  -17.644  1.00 48.93 ? 104 TYR A N     1 
ATOM   746   C  CA    . TYR A  1 123 ? -22.603  40.018  -16.865  1.00 49.41 ? 104 TYR A CA    1 
ATOM   747   C  C     . TYR A  1 123 ? -22.516  41.121  -15.799  1.00 49.54 ? 104 TYR A C     1 
ATOM   748   O  O     . TYR A  1 123 ? -22.087  40.859  -14.685  1.00 49.79 ? 104 TYR A O     1 
ATOM   749   C  CB    . TYR A  1 123 ? -21.333  39.983  -17.780  1.00 50.41 ? 104 TYR A CB    1 
ATOM   750   C  CG    . TYR A  1 123 ? -21.038  41.323  -18.395  1.00 51.30 ? 104 TYR A CG    1 
ATOM   751   C  CD1   . TYR A  1 123 ? -20.063  42.179  -17.860  1.00 51.93 ? 104 TYR A CD1   1 
ATOM   752   C  CD2   . TYR A  1 123 ? -21.805  41.781  -19.458  1.00 52.36 ? 104 TYR A CD2   1 
ATOM   753   C  CE1   . TYR A  1 123 ? -19.850  43.431  -18.406  1.00 51.24 ? 104 TYR A CE1   1 
ATOM   754   C  CE2   . TYR A  1 123 ? -21.616  43.016  -20.004  1.00 52.40 ? 104 TYR A CE2   1 
ATOM   755   C  CZ    . TYR A  1 123 ? -20.641  43.847  -19.486  1.00 53.29 ? 104 TYR A CZ    1 
ATOM   756   O  OH    . TYR A  1 123 ? -20.510  45.097  -20.080  1.00 54.42 ? 104 TYR A OH    1 
ATOM   757   N  N     . ASN A  1 124 ? -22.980  42.324  -16.131  1.00 49.71 ? 105 ASN A N     1 
ATOM   758   C  CA    . ASN A  1 124 ? -22.939  43.501  -15.229  1.00 50.00 ? 105 ASN A CA    1 
ATOM   759   C  C     . ASN A  1 124 ? -24.178  43.713  -14.346  1.00 50.43 ? 105 ASN A C     1 
ATOM   760   O  O     . ASN A  1 124 ? -24.403  44.826  -13.828  1.00 50.08 ? 105 ASN A O     1 
ATOM   761   C  CB    . ASN A  1 124 ? -22.722  44.764  -16.069  1.00 49.87 ? 105 ASN A CB    1 
ATOM   762   C  CG    . ASN A  1 124 ? -23.856  45.022  -17.049  1.00 49.51 ? 105 ASN A CG    1 
ATOM   763   O  OD1   . ASN A  1 124 ? -24.818  44.277  -17.125  1.00 52.00 ? 105 ASN A OD1   1 
ATOM   764   N  ND2   . ASN A  1 124 ? -23.738  46.068  -17.803  1.00 48.69 ? 105 ASN A ND2   1 
ATOM   765   N  N     . ARG A  1 125 ? -24.991  42.657  -14.224  1.00 50.99 ? 106 ARG A N     1 
ATOM   766   C  CA    . ARG A  1 125 ? -26.260  42.653  -13.477  1.00 51.52 ? 106 ARG A CA    1 
ATOM   767   C  C     . ARG A  1 125 ? -27.402  43.545  -14.032  1.00 50.95 ? 106 ARG A C     1 
ATOM   768   O  O     . ARG A  1 125 ? -28.481  43.621  -13.441  1.00 50.99 ? 106 ARG A O     1 
ATOM   769   C  CB    . ARG A  1 125 ? -26.017  42.907  -11.984  1.00 51.65 ? 106 ARG A CB    1 
ATOM   770   C  CG    . ARG A  1 125 ? -25.284  41.767  -11.312  1.00 53.57 ? 106 ARG A CG    1 
ATOM   771   C  CD    . ARG A  1 125 ? -25.318  41.842  -9.753   1.00 55.42 ? 106 ARG A CD    1 
ATOM   772   N  NE    . ARG A  1 125 ? -25.476  40.504  -9.139   1.00 57.67 ? 106 ARG A NE    1 
ATOM   773   C  CZ    . ARG A  1 125 ? -26.595  39.756  -9.186   1.00 59.33 ? 106 ARG A CZ    1 
ATOM   774   N  NH1   . ARG A  1 125 ? -27.714  40.172  -9.822   1.00 58.06 ? 106 ARG A NH1   1 
ATOM   775   N  NH2   . ARG A  1 125 ? -26.591  38.560  -8.588   1.00 59.69 ? 106 ARG A NH2   1 
ATOM   776   N  N     . ARG A  1 126 ? -27.204  44.188  -15.172  1.00 50.50 ? 107 ARG A N     1 
ATOM   777   C  CA    . ARG A  1 126 ? -28.327  44.860  -15.809  1.00 50.71 ? 107 ARG A CA    1 
ATOM   778   C  C     . ARG A  1 126 ? -29.245  43.847  -16.554  1.00 49.02 ? 107 ARG A C     1 
ATOM   779   O  O     . ARG A  1 126 ? -28.816  42.768  -16.968  1.00 47.29 ? 107 ARG A O     1 
ATOM   780   C  CB    . ARG A  1 126 ? -27.849  46.015  -16.717  1.00 51.01 ? 107 ARG A CB    1 
ATOM   781   C  CG    . ARG A  1 126 ? -27.017  47.156  -15.975  1.00 53.06 ? 107 ARG A CG    1 
ATOM   782   C  CD    . ARG A  1 126 ? -27.629  48.620  -16.200  1.00 55.94 ? 107 ARG A CD    1 
ATOM   783   N  NE    . ARG A  1 126 ? -28.901  48.844  -15.449  1.00 60.63 ? 107 ARG A NE    1 
ATOM   784   C  CZ    . ARG A  1 126 ? -30.136  49.059  -15.958  1.00 61.28 ? 107 ARG A CZ    1 
ATOM   785   N  NH1   . ARG A  1 126 ? -31.166  49.216  -15.131  1.00 61.73 ? 107 ARG A NH1   1 
ATOM   786   N  NH2   . ARG A  1 126 ? -30.381  49.128  -17.268  1.00 62.32 ? 107 ARG A NH2   1 
ATOM   787   N  N     . PRO A  1 127 ? -30.525  44.206  -16.732  1.00 48.01 ? 108 PRO A N     1 
ATOM   788   C  CA    . PRO A  1 127 ? -31.435  43.303  -17.421  1.00 47.70 ? 108 PRO A CA    1 
ATOM   789   C  C     . PRO A  1 127 ? -31.005  42.970  -18.842  1.00 46.69 ? 108 PRO A C     1 
ATOM   790   O  O     . PRO A  1 127 ? -30.469  43.824  -19.556  1.00 46.06 ? 108 PRO A O     1 
ATOM   791   C  CB    . PRO A  1 127 ? -32.750  44.080  -17.442  1.00 47.96 ? 108 PRO A CB    1 
ATOM   792   C  CG    . PRO A  1 127 ? -32.609  45.089  -16.361  1.00 48.22 ? 108 PRO A CG    1 
ATOM   793   C  CD    . PRO A  1 127 ? -31.190  45.452  -16.330  1.00 47.66 ? 108 PRO A CD    1 
ATOM   794   N  N     . ALA A  1 128 ? -31.242  41.726  -19.238  1.00 46.13 ? 109 ALA A N     1 
ATOM   795   C  CA    . ALA A  1 128 ? -31.011  41.310  -20.622  1.00 45.86 ? 109 ALA A CA    1 
ATOM   796   C  C     . ALA A  1 128 ? -31.929  42.155  -21.518  1.00 45.30 ? 109 ALA A C     1 
ATOM   797   O  O     . ALA A  1 128 ? -32.995  42.637  -21.067  1.00 43.84 ? 109 ALA A O     1 
ATOM   798   C  CB    . ALA A  1 128 ? -31.305  39.816  -20.803  1.00 45.16 ? 109 ALA A CB    1 
ATOM   799   N  N     . GLU A  1 129 ? -31.493  42.339  -22.771  1.00 44.74 ? 110 GLU A N     1 
ATOM   800   C  CA    . GLU A  1 129 ? -32.258  43.069  -23.790  1.00 44.49 ? 110 GLU A CA    1 
ATOM   801   C  C     . GLU A  1 129 ? -33.680  42.505  -23.978  1.00 43.89 ? 110 GLU A C     1 
ATOM   802   O  O     . GLU A  1 129 ? -34.625  43.255  -24.143  1.00 44.64 ? 110 GLU A O     1 
ATOM   803   C  CB    . GLU A  1 129 ? -31.495  43.067  -25.109  1.00 45.15 ? 110 GLU A CB    1 
ATOM   804   C  CG    . GLU A  1 129 ? -30.246  43.990  -25.112  1.00 47.91 ? 110 GLU A CG    1 
ATOM   805   C  CD    . GLU A  1 129 ? -28.972  43.393  -24.398  1.00 52.85 ? 110 GLU A CD    1 
ATOM   806   O  OE1   . GLU A  1 129 ? -29.016  42.280  -23.770  1.00 54.52 ? 110 GLU A OE1   1 
ATOM   807   O  OE2   . GLU A  1 129 ? -27.898  44.070  -24.462  1.00 53.13 ? 110 GLU A OE2   1 
ATOM   808   N  N     . THR A  1 130 ? -33.811  41.181  -23.934  1.00 42.94 ? 111 THR A N     1 
ATOM   809   C  CA    . THR A  1 130 ? -35.083  40.496  -24.051  1.00 41.69 ? 111 THR A CA    1 
ATOM   810   C  C     . THR A  1 130 ? -35.795  40.227  -22.674  1.00 41.34 ? 111 THR A C     1 
ATOM   811   O  O     . THR A  1 130 ? -36.827  39.559  -22.636  1.00 41.00 ? 111 THR A O     1 
ATOM   812   C  CB    . THR A  1 130 ? -34.958  39.178  -24.898  1.00 41.17 ? 111 THR A CB    1 
ATOM   813   O  OG1   . THR A  1 130 ? -34.227  38.197  -24.184  1.00 41.05 ? 111 THR A OG1   1 
ATOM   814   C  CG2   . THR A  1 130 ? -34.257  39.418  -26.232  1.00 39.57 ? 111 THR A CG2   1 
ATOM   815   N  N     . ASN A  1 131 ? -35.298  40.799  -21.574  1.00 40.32 ? 112 ASN A N     1 
ATOM   816   C  CA    . ASN A  1 131 ? -36.026  40.832  -20.300  1.00 39.67 ? 112 ASN A CA    1 
ATOM   817   C  C     . ASN A  1 131 ? -36.979  42.010  -20.293  1.00 39.81 ? 112 ASN A C     1 
ATOM   818   O  O     . ASN A  1 131 ? -36.586  43.110  -19.951  1.00 40.01 ? 112 ASN A O     1 
ATOM   819   C  CB    . ASN A  1 131 ? -35.036  40.964  -19.130  1.00 39.08 ? 112 ASN A CB    1 
ATOM   820   C  CG    . ASN A  1 131 ? -35.720  40.998  -17.755  1.00 39.39 ? 112 ASN A CG    1 
ATOM   821   O  OD1   . ASN A  1 131 ? -36.940  41.261  -17.627  1.00 39.50 ? 112 ASN A OD1   1 
ATOM   822   N  ND2   . ASN A  1 131 ? -34.935  40.727  -16.713  1.00 35.59 ? 112 ASN A ND2   1 
ATOM   823   N  N     . LEU A  1 132 ? -38.239  41.787  -20.667  1.00 40.08 ? 113 LEU A N     1 
ATOM   824   C  CA    . LEU A  1 132 ? -39.226  42.859  -20.743  1.00 39.76 ? 113 LEU A CA    1 
ATOM   825   C  C     . LEU A  1 132 ? -40.033  42.858  -19.458  1.00 40.40 ? 113 LEU A C     1 
ATOM   826   O  O     . LEU A  1 132 ? -40.873  43.745  -19.199  1.00 40.08 ? 113 LEU A O     1 
ATOM   827   C  CB    . LEU A  1 132 ? -40.101  42.679  -21.979  1.00 39.57 ? 113 LEU A CB    1 
ATOM   828   C  CG    . LEU A  1 132 ? -39.359  42.785  -23.335  1.00 38.97 ? 113 LEU A CG    1 
ATOM   829   C  CD1   . LEU A  1 132 ? -40.241  42.671  -24.556  1.00 33.65 ? 113 LEU A CD1   1 
ATOM   830   C  CD2   . LEU A  1 132 ? -38.571  44.107  -23.402  1.00 37.13 ? 113 LEU A CD2   1 
ATOM   831   N  N     . ARG A  1 133 ? -39.723  41.884  -18.604  1.00 41.13 ? 114 ARG A N     1 
ATOM   832   C  CA    . ARG A  1 133 ? -40.495  41.686  -17.380  1.00 41.44 ? 114 ARG A CA    1 
ATOM   833   C  C     . ARG A  1 133 ? -40.111  42.759  -16.371  1.00 41.92 ? 114 ARG A C     1 
ATOM   834   O  O     . ARG A  1 133 ? -40.936  43.278  -15.655  1.00 41.42 ? 114 ARG A O     1 
ATOM   835   C  CB    . ARG A  1 133 ? -40.262  40.278  -16.806  1.00 40.91 ? 114 ARG A CB    1 
ATOM   836   C  CG    . ARG A  1 133 ? -40.960  40.043  -15.489  1.00 40.61 ? 114 ARG A CG    1 
ATOM   837   C  CD    . ARG A  1 133 ? -40.883  38.606  -15.080  1.00 40.87 ? 114 ARG A CD    1 
ATOM   838   N  NE    . ARG A  1 133 ? -41.940  38.277  -14.112  1.00 42.09 ? 114 ARG A NE    1 
ATOM   839   C  CZ    . ARG A  1 133 ? -41.889  38.562  -12.809  1.00 39.73 ? 114 ARG A CZ    1 
ATOM   840   N  NH1   . ARG A  1 133 ? -40.851  39.201  -12.291  1.00 38.17 ? 114 ARG A NH1   1 
ATOM   841   N  NH2   . ARG A  1 133 ? -42.880  38.200  -12.026  1.00 37.74 ? 114 ARG A NH2   1 
ATOM   842   N  N     . HIS A  1 134 ? -38.831  43.058  -16.335  1.00 43.36 ? 115 HIS A N     1 
ATOM   843   C  CA    . HIS A  1 134 ? -38.301  43.955  -15.351  1.00 44.62 ? 115 HIS A CA    1 
ATOM   844   C  C     . HIS A  1 134 ? -39.035  45.291  -15.318  1.00 44.39 ? 115 HIS A C     1 
ATOM   845   O  O     . HIS A  1 134 ? -39.542  45.681  -14.269  1.00 43.82 ? 115 HIS A O     1 
ATOM   846   C  CB    . HIS A  1 134 ? -36.801  44.158  -15.544  1.00 44.97 ? 115 HIS A CB    1 
ATOM   847   C  CG    . HIS A  1 134 ? -36.133  44.694  -14.322  1.00 47.44 ? 115 HIS A CG    1 
ATOM   848   N  ND1   . HIS A  1 134 ? -35.914  43.910  -13.198  1.00 48.53 ? 115 HIS A ND1   1 
ATOM   849   C  CD2   . HIS A  1 134 ? -35.687  45.942  -14.022  1.00 48.00 ? 115 HIS A CD2   1 
ATOM   850   C  CE1   . HIS A  1 134 ? -35.344  44.657  -12.265  1.00 50.57 ? 115 HIS A CE1   1 
ATOM   851   N  NE2   . HIS A  1 134 ? -35.194  45.890  -12.739  1.00 50.34 ? 115 HIS A NE2   1 
ATOM   852   N  N     . THR A  1 135 ? -39.103  45.969  -16.459  1.00 44.93 ? 116 THR A N     1 
ATOM   853   C  CA    . THR A  1 135 ? -39.866  47.226  -16.555  1.00 45.44 ? 116 THR A CA    1 
ATOM   854   C  C     . THR A  1 135 ? -41.361  46.952  -16.341  1.00 45.84 ? 116 THR A C     1 
ATOM   855   O  O     . THR A  1 135 ? -42.014  47.599  -15.527  1.00 46.64 ? 116 THR A O     1 
ATOM   856   C  CB    . THR A  1 135 ? -39.611  47.951  -17.888  1.00 45.00 ? 116 THR A CB    1 
ATOM   857   O  OG1   . THR A  1 135 ? -38.217  48.270  -17.981  1.00 45.00 ? 116 THR A OG1   1 
ATOM   858   C  CG2   . THR A  1 135 ? -40.356  49.221  -17.962  1.00 44.73 ? 116 THR A CG2   1 
ATOM   859   N  N     . CYS A  1 136 ? -41.904  45.974  -17.029  1.00 46.12 ? 117 CYS A N     1 
ATOM   860   C  CA    . CYS A  1 136 ? -43.319  45.705  -16.892  1.00 46.78 ? 117 CYS A CA    1 
ATOM   861   C  C     . CYS A  1 136 ? -43.728  45.525  -15.412  1.00 47.78 ? 117 CYS A C     1 
ATOM   862   O  O     . CYS A  1 136 ? -44.827  45.965  -15.007  1.00 48.06 ? 117 CYS A O     1 
ATOM   863   C  CB    . CYS A  1 136 ? -43.704  44.497  -17.733  1.00 46.57 ? 117 CYS A CB    1 
ATOM   864   S  SG    . CYS A  1 136 ? -45.406  44.012  -17.573  1.00 45.09 ? 117 CYS A SG    1 
ATOM   865   N  N     . LYS A  1 137 ? -42.863  44.917  -14.599  1.00 48.59 ? 118 LYS A N     1 
ATOM   866   C  CA    . LYS A  1 137 ? -43.185  44.718  -13.182  1.00 49.14 ? 118 LYS A CA    1 
ATOM   867   C  C     . LYS A  1 137 ? -43.244  46.030  -12.423  1.00 49.76 ? 118 LYS A C     1 
ATOM   868   O  O     . LYS A  1 137 ? -44.158  46.264  -11.638  1.00 49.35 ? 118 LYS A O     1 
ATOM   869   C  CB    . LYS A  1 137 ? -42.180  43.815  -12.485  1.00 49.33 ? 118 LYS A CB    1 
ATOM   870   C  CG    . LYS A  1 137 ? -42.769  43.205  -11.240  1.00 49.67 ? 118 LYS A CG    1 
ATOM   871   C  CD    . LYS A  1 137 ? -41.792  43.092  -10.136  1.00 51.42 ? 118 LYS A CD    1 
ATOM   872   C  CE    . LYS A  1 137 ? -42.470  42.780  -8.827   1.00 52.07 ? 118 LYS A CE    1 
ATOM   873   N  NZ    . LYS A  1 137 ? -41.815  43.647  -7.801   1.00 55.63 ? 118 LYS A NZ    1 
ATOM   874   N  N     . ARG A  1 138 ? -42.265  46.893  -12.655  1.00 50.58 ? 119 ARG A N     1 
ATOM   875   C  CA    . ARG A  1 138 ? -42.319  48.229  -12.087  1.00 51.52 ? 119 ARG A CA    1 
ATOM   876   C  C     . ARG A  1 138 ? -43.603  48.943  -12.499  1.00 50.50 ? 119 ARG A C     1 
ATOM   877   O  O     . ARG A  1 138 ? -44.304  49.511  -11.647  1.00 50.25 ? 119 ARG A O     1 
ATOM   878   C  CB    . ARG A  1 138 ? -41.122  49.061  -12.522  1.00 52.61 ? 119 ARG A CB    1 
ATOM   879   C  CG    . ARG A  1 138 ? -39.773  48.512  -12.062  1.00 55.03 ? 119 ARG A CG    1 
ATOM   880   C  CD    . ARG A  1 138 ? -38.622  49.464  -12.521  1.00 57.69 ? 119 ARG A CD    1 
ATOM   881   N  NE    . ARG A  1 138 ? -37.275  48.969  -12.158  1.00 61.79 ? 119 ARG A NE    1 
ATOM   882   C  CZ    . ARG A  1 138 ? -36.233  49.750  -11.810  1.00 66.59 ? 119 ARG A CZ    1 
ATOM   883   N  NH1   . ARG A  1 138 ? -36.358  51.091  -11.754  1.00 67.91 ? 119 ARG A NH1   1 
ATOM   884   N  NH2   . ARG A  1 138 ? -35.046  49.197  -11.497  1.00 66.62 ? 119 ARG A NH2   1 
ATOM   885   N  N     . ILE A  1 139 ? -43.922  48.901  -13.794  1.00 49.27 ? 120 ILE A N     1 
ATOM   886   C  CA    . ILE A  1 139 ? -45.120  49.594  -14.293  1.00 49.25 ? 120 ILE A CA    1 
ATOM   887   C  C     . ILE A  1 139 ? -46.380  49.074  -13.583  1.00 48.93 ? 120 ILE A C     1 
ATOM   888   O  O     . ILE A  1 139 ? -47.203  49.877  -13.131  1.00 48.79 ? 120 ILE A O     1 
ATOM   889   C  CB    . ILE A  1 139 ? -45.233  49.517  -15.836  1.00 48.82 ? 120 ILE A CB    1 
ATOM   890   C  CG1   . ILE A  1 139 ? -44.082  50.304  -16.471  1.00 48.56 ? 120 ILE A CG1   1 
ATOM   891   C  CG2   . ILE A  1 139 ? -46.565  50.041  -16.337  1.00 48.05 ? 120 ILE A CG2   1 
ATOM   892   C  CD1   . ILE A  1 139 ? -44.159  51.763  -16.259  1.00 45.78 ? 120 ILE A CD1   1 
ATOM   893   N  N     . MET A  1 140 ? -46.496  47.751  -13.428  1.00 48.55 ? 121 MET A N     1 
ATOM   894   C  CA    . MET A  1 140 ? -47.627  47.184  -12.684  1.00 48.64 ? 121 MET A CA    1 
ATOM   895   C  C     . MET A  1 140 ? -47.643  47.602  -11.220  1.00 48.90 ? 121 MET A C     1 
ATOM   896   O  O     . MET A  1 140 ? -48.718  47.859  -10.667  1.00 49.77 ? 121 MET A O     1 
ATOM   897   C  CB    . MET A  1 140 ? -47.688  45.665  -12.760  1.00 48.25 ? 121 MET A CB    1 
ATOM   898   C  CG    . MET A  1 140 ? -47.700  45.090  -14.160  1.00 47.77 ? 121 MET A CG    1 
ATOM   899   S  SD    . MET A  1 140 ? -49.151  45.562  -15.027  1.00 47.59 ? 121 MET A SD    1 
ATOM   900   C  CE    . MET A  1 140 ? -48.813  45.049  -16.730  1.00 46.97 ? 121 MET A CE    1 
ATOM   901   N  N     . ASP A  1 141 ? -46.478  47.705  -10.584  1.00 49.24 ? 122 ASP A N     1 
ATOM   902   C  CA    . ASP A  1 141 ? -46.433  48.164  -9.169   1.00 48.92 ? 122 ASP A CA    1 
ATOM   903   C  C     . ASP A  1 141 ? -46.956  49.577  -8.986   1.00 48.89 ? 122 ASP A C     1 
ATOM   904   O  O     . ASP A  1 141 ? -47.591  49.863  -7.973   1.00 49.50 ? 122 ASP A O     1 
ATOM   905   C  CB    . ASP A  1 141 ? -45.038  48.043  -8.559   1.00 48.68 ? 122 ASP A CB    1 
ATOM   906   C  CG    . ASP A  1 141 ? -44.670  46.611  -8.230   1.00 48.96 ? 122 ASP A CG    1 
ATOM   907   O  OD1   . ASP A  1 141 ? -45.590  45.771  -8.090   1.00 46.75 ? 122 ASP A OD1   1 
ATOM   908   O  OD2   . ASP A  1 141 ? -43.449  46.333  -8.114   1.00 51.59 ? 122 ASP A OD2   1 
ATOM   909   N  N     . MET A  1 142 ? -46.740  50.440  -9.973   1.00 48.41 ? 123 MET A N     1 
ATOM   910   C  CA    . MET A  1 142 ? -47.256  51.810  -9.900   1.00 48.49 ? 123 MET A CA    1 
ATOM   911   C  C     . MET A  1 142 ? -48.781  51.954  -9.908   1.00 47.58 ? 123 MET A C     1 
ATOM   912   O  O     . MET A  1 142 ? -49.292  53.029  -9.659   1.00 47.24 ? 123 MET A O     1 
ATOM   913   C  CB    . MET A  1 142 ? -46.722  52.621  -11.071  1.00 48.33 ? 123 MET A CB    1 
ATOM   914   C  CG    . MET A  1 142 ? -45.241  52.849  -11.028  1.00 48.54 ? 123 MET A CG    1 
ATOM   915   S  SD    . MET A  1 142 ? -44.835  53.776  -12.503  1.00 51.69 ? 123 MET A SD    1 
ATOM   916   C  CE    . MET A  1 142 ? -45.575  55.404  -12.148  1.00 50.77 ? 123 MET A CE    1 
ATOM   917   N  N     . VAL A  1 143 ? -49.495  50.892  -10.233  1.00 47.35 ? 124 VAL A N     1 
ATOM   918   C  CA    . VAL A  1 143 ? -50.939  50.969  -10.366  1.00 47.41 ? 124 VAL A CA    1 
ATOM   919   C  C     . VAL A  1 143 ? -51.645  49.819  -9.644   1.00 47.53 ? 124 VAL A C     1 
ATOM   920   O  O     . VAL A  1 143 ? -52.810  49.551  -9.938   1.00 47.81 ? 124 VAL A O     1 
ATOM   921   C  CB    . VAL A  1 143 ? -51.383  50.974  -11.860  1.00 47.44 ? 124 VAL A CB    1 
ATOM   922   C  CG1   . VAL A  1 143 ? -50.999  52.293  -12.548  1.00 46.28 ? 124 VAL A CG1   1 
ATOM   923   C  CG2   . VAL A  1 143 ? -50.798  49.734  -12.611  1.00 47.71 ? 124 VAL A CG2   1 
ATOM   924   N  N     . SER A  1 144 ? -50.971  49.175  -8.686   1.00 47.28 ? 125 SER A N     1 
ATOM   925   C  CA    . SER A  1 144 ? -51.567  48.092  -7.895   1.00 47.41 ? 125 SER A CA    1 
ATOM   926   C  C     . SER A  1 144 ? -52.982  48.376  -7.417   1.00 47.91 ? 125 SER A C     1 
ATOM   927   O  O     . SER A  1 144 ? -53.825  47.460  -7.412   1.00 49.31 ? 125 SER A O     1 
ATOM   928   C  CB    . SER A  1 144 ? -50.718  47.787  -6.663   1.00 47.31 ? 125 SER A CB    1 
ATOM   929   O  OG    . SER A  1 144 ? -49.420  48.321  -6.815   1.00 48.63 ? 125 SER A OG    1 
ATOM   930   N  N     . ASN A  1 145 ? -53.240  49.622  -7.001   1.00 47.69 ? 126 ASN A N     1 
ATOM   931   C  CA    . ASN A  1 145 ? -54.535  50.009  -6.448   1.00 47.42 ? 126 ASN A CA    1 
ATOM   932   C  C     . ASN A  1 145 ? -55.662  49.894  -7.412   1.00 47.38 ? 126 ASN A C     1 
ATOM   933   O  O     . ASN A  1 145 ? -56.819  49.758  -7.012   1.00 47.48 ? 126 ASN A O     1 
ATOM   934   C  CB    . ASN A  1 145 ? -54.506  51.451  -5.989   1.00 47.39 ? 126 ASN A CB    1 
ATOM   935   C  CG    . ASN A  1 145 ? -54.015  51.568  -4.616   1.00 48.70 ? 126 ASN A CG    1 
ATOM   936   O  OD1   . ASN A  1 145 ? -53.896  50.564  -3.916   1.00 50.36 ? 126 ASN A OD1   1 
ATOM   937   N  ND2   . ASN A  1 145 ? -53.735  52.790  -4.183   1.00 49.70 ? 126 ASN A ND2   1 
ATOM   938   N  N     . GLN A  1 146 ? -55.343  50.022  -8.688   1.00 46.86 ? 127 GLN A N     1 
ATOM   939   C  CA    . GLN A  1 146 ? -56.366  49.938  -9.706   1.00 46.37 ? 127 GLN A CA    1 
ATOM   940   C  C     . GLN A  1 146 ? -56.584  48.501  -10.131  1.00 46.00 ? 127 GLN A C     1 
ATOM   941   O  O     . GLN A  1 146 ? -57.490  48.235  -10.916  1.00 45.73 ? 127 GLN A O     1 
ATOM   942   C  CB    . GLN A  1 146 ? -56.009  50.823  -10.879  1.00 46.30 ? 127 GLN A CB    1 
ATOM   943   C  CG    . GLN A  1 146 ? -56.131  52.303  -10.530  1.00 46.44 ? 127 GLN A CG    1 
ATOM   944   C  CD    . GLN A  1 146 ? -55.548  53.170  -11.618  1.00 47.05 ? 127 GLN A CD    1 
ATOM   945   O  OE1   . GLN A  1 146 ? -56.206  53.416  -12.626  1.00 49.02 ? 127 GLN A OE1   1 
ATOM   946   N  NE2   . GLN A  1 146 ? -54.299  53.610  -11.439  1.00 45.84 ? 127 GLN A NE2   1 
ATOM   947   N  N     . HIS A  1 147 ? -55.754  47.592  -9.607   1.00 45.16 ? 128 HIS A N     1 
ATOM   948   C  CA    . HIS A  1 147 ? -55.979  46.167  -9.738   1.00 45.01 ? 128 HIS A CA    1 
ATOM   949   C  C     . HIS A  1 147 ? -56.278  45.706  -11.146  1.00 44.44 ? 128 HIS A C     1 
ATOM   950   O  O     . HIS A  1 147 ? -57.338  45.124  -11.399  1.00 44.35 ? 128 HIS A O     1 
ATOM   951   C  CB    . HIS A  1 147 ? -57.116  45.751  -8.820   1.00 44.62 ? 128 HIS A CB    1 
ATOM   952   C  CG    . HIS A  1 147 ? -56.718  45.771  -7.400   1.00 44.95 ? 128 HIS A CG    1 
ATOM   953   N  ND1   . HIS A  1 147 ? -55.801  44.881  -6.890   1.00 44.92 ? 128 HIS A ND1   1 
ATOM   954   C  CD2   . HIS A  1 147 ? -57.039  46.614  -6.395   1.00 45.85 ? 128 HIS A CD2   1 
ATOM   955   C  CE1   . HIS A  1 147 ? -55.607  45.150  -5.614   1.00 45.50 ? 128 HIS A CE1   1 
ATOM   956   N  NE2   . HIS A  1 147 ? -56.347  46.196  -5.290   1.00 46.08 ? 128 HIS A NE2   1 
ATOM   957   N  N     . PRO A  1 148 ? -55.345  45.959  -12.062  1.00 43.65 ? 129 PRO A N     1 
ATOM   958   C  CA    . PRO A  1 148 ? -55.566  45.639  -13.464  1.00 43.54 ? 129 PRO A CA    1 
ATOM   959   C  C     . PRO A  1 148 ? -55.593  44.136  -13.674  1.00 43.01 ? 129 PRO A C     1 
ATOM   960   O  O     . PRO A  1 148 ? -54.670  43.465  -13.241  1.00 43.15 ? 129 PRO A O     1 
ATOM   961   C  CB    . PRO A  1 148 ? -54.361  46.270  -14.160  1.00 43.50 ? 129 PRO A CB    1 
ATOM   962   C  CG    . PRO A  1 148 ? -53.308  46.276  -13.121  1.00 43.50 ? 129 PRO A CG    1 
ATOM   963   C  CD    . PRO A  1 148 ? -54.023  46.549  -11.830  1.00 43.72 ? 129 PRO A CD    1 
ATOM   964   N  N     . TRP A  1 149 ? -56.655  43.624  -14.293  1.00 42.44 ? 130 TRP A N     1 
ATOM   965   C  CA    . TRP A  1 149 ? -56.730  42.206  -14.656  1.00 42.45 ? 130 TRP A CA    1 
ATOM   966   C  C     . TRP A  1 149 ? -56.635  41.984  -16.164  1.00 42.30 ? 130 TRP A C     1 
ATOM   967   O  O     . TRP A  1 149 ? -57.212  42.736  -16.954  1.00 42.58 ? 130 TRP A O     1 
ATOM   968   C  CB    . TRP A  1 149 ? -58.037  41.564  -14.216  1.00 42.39 ? 130 TRP A CB    1 
ATOM   969   C  CG    . TRP A  1 149 ? -58.255  41.413  -12.772  1.00 41.97 ? 130 TRP A CG    1 
ATOM   970   C  CD1   . TRP A  1 149 ? -57.372  41.680  -11.752  1.00 41.66 ? 130 TRP A CD1   1 
ATOM   971   C  CD2   . TRP A  1 149 ? -59.455  40.925  -12.165  1.00 41.36 ? 130 TRP A CD2   1 
ATOM   972   N  NE1   . TRP A  1 149 ? -57.978  41.407  -10.532  1.00 41.75 ? 130 TRP A NE1   1 
ATOM   973   C  CE2   . TRP A  1 149 ? -59.252  40.939  -10.760  1.00 41.69 ? 130 TRP A CE2   1 
ATOM   974   C  CE3   . TRP A  1 149 ? -60.695  40.495  -12.672  1.00 42.23 ? 130 TRP A CE3   1 
ATOM   975   C  CZ2   . TRP A  1 149 ? -60.244  40.532  -9.853   1.00 40.88 ? 130 TRP A CZ2   1 
ATOM   976   C  CZ3   . TRP A  1 149 ? -61.689  40.086  -11.767  1.00 41.78 ? 130 TRP A CZ3   1 
ATOM   977   C  CH2   . TRP A  1 149 ? -61.447  40.110  -10.369  1.00 41.51 ? 130 TRP A CH2   1 
ATOM   978   N  N     . PHE A  1 150 ? -55.932  40.925  -16.548  1.00 41.67 ? 131 PHE A N     1 
ATOM   979   C  CA    . PHE A  1 150 ? -55.803  40.567  -17.934  1.00 41.46 ? 131 PHE A CA    1 
ATOM   980   C  C     . PHE A  1 150 ? -56.280  39.134  -18.205  1.00 41.06 ? 131 PHE A C     1 
ATOM   981   O  O     . PHE A  1 150 ? -56.191  38.229  -17.359  1.00 39.67 ? 131 PHE A O     1 
ATOM   982   C  CB    . PHE A  1 150 ? -54.356  40.685  -18.378  1.00 41.48 ? 131 PHE A CB    1 
ATOM   983   C  CG    . PHE A  1 150 ? -53.777  42.046  -18.219  1.00 42.14 ? 131 PHE A CG    1 
ATOM   984   C  CD1   . PHE A  1 150 ? -53.900  42.990  -19.228  1.00 42.41 ? 131 PHE A CD1   1 
ATOM   985   C  CD2   . PHE A  1 150 ? -53.063  42.380  -17.066  1.00 42.95 ? 131 PHE A CD2   1 
ATOM   986   C  CE1   . PHE A  1 150 ? -53.355  44.246  -19.079  1.00 42.01 ? 131 PHE A CE1   1 
ATOM   987   C  CE2   . PHE A  1 150 ? -52.517  43.643  -16.910  1.00 41.38 ? 131 PHE A CE2   1 
ATOM   988   C  CZ    . PHE A  1 150 ? -52.667  44.571  -17.920  1.00 41.93 ? 131 PHE A CZ    1 
ATOM   989   N  N     . GLY A  1 151 ? -56.780  38.954  -19.422  1.00 40.95 ? 132 GLY A N     1 
ATOM   990   C  CA    . GLY A  1 151 ? -57.161  37.654  -19.912  1.00 41.12 ? 132 GLY A CA    1 
ATOM   991   C  C     . GLY A  1 151 ? -56.663  37.580  -21.327  1.00 41.77 ? 132 GLY A C     1 
ATOM   992   O  O     . GLY A  1 151 ? -57.027  38.443  -22.164  1.00 43.01 ? 132 GLY A O     1 
ATOM   993   N  N     . MET A  1 152 ? -55.803  36.596  -21.612  1.00 41.17 ? 133 MET A N     1 
ATOM   994   C  CA    . MET A  1 152 ? -55.206  36.501  -22.935  1.00 40.68 ? 133 MET A CA    1 
ATOM   995   C  C     . MET A  1 152 ? -55.577  35.197  -23.621  1.00 40.16 ? 133 MET A C     1 
ATOM   996   O  O     . MET A  1 152 ? -55.602  34.141  -22.984  1.00 39.54 ? 133 MET A O     1 
ATOM   997   C  CB    . MET A  1 152 ? -53.703  36.719  -22.843  1.00 40.76 ? 133 MET A CB    1 
ATOM   998   C  CG    . MET A  1 152 ? -53.368  38.171  -22.447  1.00 41.08 ? 133 MET A CG    1 
ATOM   999   S  SD    . MET A  1 152 ? -51.620  38.538  -22.227  1.00 42.21 ? 133 MET A SD    1 
ATOM   1000  C  CE    . MET A  1 152 ? -51.017  38.527  -23.900  1.00 40.75 ? 133 MET A CE    1 
ATOM   1001  N  N     . GLU A  1 153 ? -55.913  35.319  -24.909  1.00 39.63 ? 134 GLU A N     1 
ATOM   1002  C  CA    . GLU A  1 153 ? -56.419  34.231  -25.720  1.00 39.74 ? 134 GLU A CA    1 
ATOM   1003  C  C     . GLU A  1 153 ? -55.316  33.744  -26.688  1.00 39.10 ? 134 GLU A C     1 
ATOM   1004  O  O     . GLU A  1 153 ? -55.165  34.226  -27.834  1.00 39.68 ? 134 GLU A O     1 
ATOM   1005  C  CB    . GLU A  1 153 ? -57.667  34.687  -26.502  1.00 39.94 ? 134 GLU A CB    1 
ATOM   1006  C  CG    . GLU A  1 153 ? -58.872  35.229  -25.656  1.00 41.51 ? 134 GLU A CG    1 
ATOM   1007  C  CD    . GLU A  1 153 ? -60.023  35.779  -26.532  1.00 40.83 ? 134 GLU A CD    1 
ATOM   1008  O  OE1   . GLU A  1 153 ? -60.437  35.059  -27.484  1.00 41.52 ? 134 GLU A OE1   1 
ATOM   1009  O  OE2   . GLU A  1 153 ? -60.485  36.939  -26.290  1.00 40.34 ? 134 GLU A OE2   1 
ATOM   1010  N  N     . GLN A  1 154 ? -54.550  32.768  -26.247  1.00 38.57 ? 135 GLN A N     1 
ATOM   1011  C  CA    . GLN A  1 154 ? -53.397  32.324  -27.026  1.00 38.66 ? 135 GLN A CA    1 
ATOM   1012  C  C     . GLN A  1 154 ? -53.879  31.417  -28.141  1.00 38.59 ? 135 GLN A C     1 
ATOM   1013  O  O     . GLN A  1 154 ? -54.194  30.269  -27.880  1.00 38.76 ? 135 GLN A O     1 
ATOM   1014  C  CB    . GLN A  1 154 ? -52.408  31.563  -26.150  1.00 38.21 ? 135 GLN A CB    1 
ATOM   1015  C  CG    . GLN A  1 154 ? -51.192  31.080  -26.906  1.00 38.40 ? 135 GLN A CG    1 
ATOM   1016  C  CD    . GLN A  1 154 ? -50.397  32.227  -27.434  1.00 37.31 ? 135 GLN A CD    1 
ATOM   1017  O  OE1   . GLN A  1 154 ? -49.738  32.929  -26.671  1.00 35.74 ? 135 GLN A OE1   1 
ATOM   1018  N  NE2   . GLN A  1 154 ? -50.471  32.454  -28.740  1.00 37.72 ? 135 GLN A NE2   1 
ATOM   1019  N  N     . GLU A  1 155 ? -53.963  31.935  -29.360  1.00 38.16 ? 136 GLU A N     1 
ATOM   1020  C  CA    . GLU A  1 155 ? -54.256  31.097  -30.516  1.00 38.42 ? 136 GLU A CA    1 
ATOM   1021  C  C     . GLU A  1 155 ? -52.928  30.544  -31.049  1.00 38.49 ? 136 GLU A C     1 
ATOM   1022  O  O     . GLU A  1 155 ? -51.867  31.178  -30.931  1.00 39.17 ? 136 GLU A O     1 
ATOM   1023  C  CB    . GLU A  1 155 ? -55.014  31.881  -31.603  1.00 38.31 ? 136 GLU A CB    1 
ATOM   1024  C  CG    . GLU A  1 155 ? -56.470  32.195  -31.227  1.00 38.55 ? 136 GLU A CG    1 
ATOM   1025  C  CD    . GLU A  1 155 ? -57.261  33.022  -32.280  1.00 39.59 ? 136 GLU A CD    1 
ATOM   1026  O  OE1   . GLU A  1 155 ? -56.673  33.846  -33.013  1.00 38.80 ? 136 GLU A OE1   1 
ATOM   1027  O  OE2   . GLU A  1 155 ? -58.517  32.863  -32.347  1.00 42.68 ? 136 GLU A OE2   1 
ATOM   1028  N  N     . TYR A  1 156 ? -52.966  29.349  -31.619  1.00 38.32 ? 137 TYR A N     1 
ATOM   1029  C  CA    . TYR A  1 156 ? -51.728  28.720  -32.130  1.00 38.04 ? 137 TYR A CA    1 
ATOM   1030  C  C     . TYR A  1 156 ? -52.082  27.627  -33.101  1.00 37.68 ? 137 TYR A C     1 
ATOM   1031  O  O     . TYR A  1 156 ? -53.237  27.234  -33.170  1.00 37.93 ? 137 TYR A O     1 
ATOM   1032  C  CB    . TYR A  1 156 ? -50.938  28.135  -30.972  1.00 37.65 ? 137 TYR A CB    1 
ATOM   1033  C  CG    . TYR A  1 156 ? -51.634  27.037  -30.262  1.00 37.31 ? 137 TYR A CG    1 
ATOM   1034  C  CD1   . TYR A  1 156 ? -51.363  25.711  -30.579  1.00 37.55 ? 137 TYR A CD1   1 
ATOM   1035  C  CD2   . TYR A  1 156 ? -52.587  27.308  -29.266  1.00 38.13 ? 137 TYR A CD2   1 
ATOM   1036  C  CE1   . TYR A  1 156 ? -52.020  24.663  -29.903  1.00 38.08 ? 137 TYR A CE1   1 
ATOM   1037  C  CE2   . TYR A  1 156 ? -53.241  26.276  -28.585  1.00 36.54 ? 137 TYR A CE2   1 
ATOM   1038  C  CZ    . TYR A  1 156 ? -52.945  24.962  -28.911  1.00 36.97 ? 137 TYR A CZ    1 
ATOM   1039  O  OH    . TYR A  1 156 ? -53.586  23.912  -28.306  1.00 37.67 ? 137 TYR A OH    1 
ATOM   1040  N  N     . THR A  1 157 ? -51.111  27.120  -33.835  1.00 37.75 ? 138 THR A N     1 
ATOM   1041  C  CA    . THR A  1 157 ? -51.399  26.097  -34.840  1.00 38.76 ? 138 THR A CA    1 
ATOM   1042  C  C     . THR A  1 157 ? -50.446  24.948  -34.660  1.00 39.29 ? 138 THR A C     1 
ATOM   1043  O  O     . THR A  1 157 ? -49.266  25.180  -34.474  1.00 40.74 ? 138 THR A O     1 
ATOM   1044  C  CB    . THR A  1 157 ? -51.258  26.649  -36.274  1.00 38.71 ? 138 THR A CB    1 
ATOM   1045  O  OG1   . THR A  1 157 ? -52.101  27.808  -36.426  1.00 40.20 ? 138 THR A OG1   1 
ATOM   1046  C  CG2   . THR A  1 157 ? -51.566  25.580  -37.319  1.00 37.61 ? 138 THR A CG2   1 
ATOM   1047  N  N     . LEU A  1 158 ? -50.952  23.720  -34.720  1.00 39.74 ? 139 LEU A N     1 
ATOM   1048  C  CA    . LEU A  1 158 ? -50.135  22.527  -34.528  1.00 40.15 ? 139 LEU A CA    1 
ATOM   1049  C  C     . LEU A  1 158 ? -49.563  22.115  -35.868  1.00 40.82 ? 139 LEU A C     1 
ATOM   1050  O  O     . LEU A  1 158 ? -50.310  21.973  -36.844  1.00 41.41 ? 139 LEU A O     1 
ATOM   1051  C  CB    . LEU A  1 158 ? -50.979  21.382  -33.965  1.00 39.35 ? 139 LEU A CB    1 
ATOM   1052  C  CG    . LEU A  1 158 ? -51.412  21.574  -32.523  1.00 39.08 ? 139 LEU A CG    1 
ATOM   1053  C  CD1   . LEU A  1 158 ? -52.410  20.482  -32.130  1.00 37.13 ? 139 LEU A CD1   1 
ATOM   1054  C  CD2   . LEU A  1 158 ? -50.183  21.675  -31.554  1.00 36.92 ? 139 LEU A CD2   1 
ATOM   1055  N  N     . MET A  1 159 ? -48.250  21.916  -35.900  1.00 42.11 ? 140 MET A N     1 
ATOM   1056  C  CA    . MET A  1 159 ? -47.503  21.614  -37.134  1.00 43.10 ? 140 MET A CA    1 
ATOM   1057  C  C     . MET A  1 159 ? -46.818  20.280  -37.010  1.00 44.11 ? 140 MET A C     1 
ATOM   1058  O  O     . MET A  1 159 ? -46.294  19.915  -35.971  1.00 44.40 ? 140 MET A O     1 
ATOM   1059  C  CB    . MET A  1 159 ? -46.393  22.635  -37.420  1.00 43.39 ? 140 MET A CB    1 
ATOM   1060  C  CG    . MET A  1 159 ? -46.771  24.102  -37.388  1.00 45.43 ? 140 MET A CG    1 
ATOM   1061  S  SD    . MET A  1 159 ? -47.712  24.632  -38.810  1.00 51.79 ? 140 MET A SD    1 
ATOM   1062  C  CE    . MET A  1 159 ? -46.438  25.258  -39.906  1.00 48.42 ? 140 MET A CE    1 
ATOM   1063  N  N     . GLY A  1 160 ? -46.804  19.553  -38.097  1.00 45.80 ? 141 GLY A N     1 
ATOM   1064  C  CA    . GLY A  1 160 ? -45.966  18.393  -38.192  1.00 46.93 ? 141 GLY A CA    1 
ATOM   1065  C  C     . GLY A  1 160 ? -44.542  18.864  -38.225  1.00 48.49 ? 141 GLY A C     1 
ATOM   1066  O  O     . GLY A  1 160 ? -44.206  20.012  -38.586  1.00 49.13 ? 141 GLY A O     1 
ATOM   1067  N  N     . THR A  1 161 ? -43.685  17.962  -37.824  1.00 50.53 ? 142 THR A N     1 
ATOM   1068  C  CA    . THR A  1 161 ? -42.257  18.232  -37.785  1.00 52.03 ? 142 THR A CA    1 
ATOM   1069  C  C     . THR A  1 161 ? -41.698  18.679  -39.194  1.00 52.66 ? 142 THR A C     1 
ATOM   1070  O  O     . THR A  1 161 ? -40.730  19.480  -39.285  1.00 52.60 ? 142 THR A O     1 
ATOM   1071  C  CB    . THR A  1 161 ? -41.565  16.977  -37.221  1.00 52.64 ? 142 THR A CB    1 
ATOM   1072  O  OG1   . THR A  1 161 ? -40.163  17.209  -37.219  1.00 55.01 ? 142 THR A OG1   1 
ATOM   1073  C  CG2   . THR A  1 161 ? -41.971  15.643  -38.029  1.00 51.00 ? 142 THR A CG2   1 
ATOM   1074  N  N     . ASP A  1 162 ? -42.368  18.192  -40.262  1.00 52.51 ? 143 ASP A N     1 
ATOM   1075  C  CA    . ASP A  1 162 ? -42.173  18.657  -41.657  1.00 51.92 ? 143 ASP A CA    1 
ATOM   1076  C  C     . ASP A  1 162 ? -42.681  20.079  -41.993  1.00 51.40 ? 143 ASP A C     1 
ATOM   1077  O  O     . ASP A  1 162 ? -42.821  20.413  -43.178  1.00 51.61 ? 143 ASP A O     1 
ATOM   1078  C  CB    . ASP A  1 162 ? -42.844  17.677  -42.625  1.00 51.99 ? 143 ASP A CB    1 
ATOM   1079  C  CG    . ASP A  1 162 ? -44.367  17.697  -42.521  1.00 54.44 ? 143 ASP A CG    1 
ATOM   1080  O  OD1   . ASP A  1 162 ? -44.901  18.286  -41.540  1.00 56.01 ? 143 ASP A OD1   1 
ATOM   1081  O  OD2   . ASP A  1 162 ? -45.040  17.109  -43.421  1.00 56.97 ? 143 ASP A OD2   1 
ATOM   1082  N  N     . GLY A  1 163 ? -42.983  20.900  -40.988  1.00 50.39 ? 144 GLY A N     1 
ATOM   1083  C  CA    . GLY A  1 163 ? -43.430  22.280  -41.234  1.00 49.62 ? 144 GLY A CA    1 
ATOM   1084  C  C     . GLY A  1 163 ? -44.835  22.489  -41.809  1.00 49.20 ? 144 GLY A C     1 
ATOM   1085  O  O     . GLY A  1 163 ? -45.221  23.648  -42.051  1.00 49.76 ? 144 GLY A O     1 
ATOM   1086  N  N     . HIS A  1 164 ? -45.598  21.401  -42.026  1.00 48.21 ? 145 HIS A N     1 
ATOM   1087  C  CA    . HIS A  1 164 ? -46.978  21.466  -42.569  1.00 46.87 ? 145 HIS A CA    1 
ATOM   1088  C  C     . HIS A  1 164 ? -47.959  21.311  -41.406  1.00 45.53 ? 145 HIS A C     1 
ATOM   1089  O  O     . HIS A  1 164 ? -47.705  20.600  -40.432  1.00 44.21 ? 145 HIS A O     1 
ATOM   1090  C  CB    . HIS A  1 164 ? -47.198  20.353  -43.631  1.00 47.60 ? 145 HIS A CB    1 
ATOM   1091  C  CG    . HIS A  1 164 ? -48.264  20.651  -44.667  1.00 49.01 ? 145 HIS A CG    1 
ATOM   1092  N  ND1   . HIS A  1 164 ? -48.350  21.855  -45.350  1.00 51.21 ? 145 HIS A ND1   1 
ATOM   1093  C  CD2   . HIS A  1 164 ? -49.253  19.867  -45.177  1.00 51.02 ? 145 HIS A CD2   1 
ATOM   1094  C  CE1   . HIS A  1 164 ? -49.364  21.812  -46.205  1.00 51.49 ? 145 HIS A CE1   1 
ATOM   1095  N  NE2   . HIS A  1 164 ? -49.925  20.615  -46.124  1.00 51.25 ? 145 HIS A NE2   1 
ATOM   1096  N  N     . PRO A  1 165 ? -49.085  21.995  -41.478  1.00 44.24 ? 146 PRO A N     1 
ATOM   1097  C  CA    . PRO A  1 165 ? -49.989  21.846  -40.347  1.00 43.61 ? 146 PRO A CA    1 
ATOM   1098  C  C     . PRO A  1 165 ? -50.439  20.407  -40.037  1.00 43.06 ? 146 PRO A C     1 
ATOM   1099  O  O     . PRO A  1 165 ? -50.712  19.609  -40.953  1.00 41.58 ? 146 PRO A O     1 
ATOM   1100  C  CB    . PRO A  1 165 ? -51.162  22.731  -40.740  1.00 43.65 ? 146 PRO A CB    1 
ATOM   1101  C  CG    . PRO A  1 165 ? -50.572  23.740  -41.682  1.00 43.33 ? 146 PRO A CG    1 
ATOM   1102  C  CD    . PRO A  1 165 ? -49.570  22.979  -42.456  1.00 44.05 ? 146 PRO A CD    1 
ATOM   1103  N  N     . PHE A  1 166 ? -50.502  20.097  -38.728  1.00 42.61 ? 147 PHE A N     1 
ATOM   1104  C  CA    . PHE A  1 166 ? -50.875  18.769  -38.238  1.00 42.13 ? 147 PHE A CA    1 
ATOM   1105  C  C     . PHE A  1 166 ? -52.197  18.328  -38.753  1.00 41.26 ? 147 PHE A C     1 
ATOM   1106  O  O     . PHE A  1 166 ? -53.210  19.041  -38.606  1.00 41.04 ? 147 PHE A O     1 
ATOM   1107  C  CB    . PHE A  1 166 ? -50.983  18.728  -36.712  1.00 42.73 ? 147 PHE A CB    1 
ATOM   1108  C  CG    . PHE A  1 166 ? -51.215  17.344  -36.166  1.00 42.42 ? 147 PHE A CG    1 
ATOM   1109  C  CD1   . PHE A  1 166 ? -50.188  16.396  -36.173  1.00 43.08 ? 147 PHE A CD1   1 
ATOM   1110  C  CD2   . PHE A  1 166 ? -52.449  16.975  -35.665  1.00 43.89 ? 147 PHE A CD2   1 
ATOM   1111  C  CE1   . PHE A  1 166 ? -50.381  15.098  -35.672  1.00 42.60 ? 147 PHE A CE1   1 
ATOM   1112  C  CE2   . PHE A  1 166 ? -52.661  15.671  -35.148  1.00 43.30 ? 147 PHE A CE2   1 
ATOM   1113  C  CZ    . PHE A  1 166 ? -51.632  14.743  -35.145  1.00 43.29 ? 147 PHE A CZ    1 
ATOM   1114  N  N     . GLY A  1 167 ? -52.190  17.123  -39.297  1.00 41.06 ? 148 GLY A N     1 
ATOM   1115  C  CA    . GLY A  1 167 ? -53.373  16.494  -39.879  1.00 40.97 ? 148 GLY A CA    1 
ATOM   1116  C  C     . GLY A  1 167 ? -53.772  16.966  -41.273  1.00 41.15 ? 148 GLY A C     1 
ATOM   1117  O  O     . GLY A  1 167 ? -54.767  16.493  -41.805  1.00 41.71 ? 148 GLY A O     1 
ATOM   1118  N  N     . TRP A  1 168 ? -53.065  17.925  -41.871  1.00 41.38 ? 149 TRP A N     1 
ATOM   1119  C  CA    . TRP A  1 168 ? -53.512  18.414  -43.173  1.00 41.74 ? 149 TRP A CA    1 
ATOM   1120  C  C     . TRP A  1 168 ? -53.101  17.407  -44.225  1.00 42.11 ? 149 TRP A C     1 
ATOM   1121  O  O     . TRP A  1 168 ? -52.197  16.612  -43.997  1.00 42.56 ? 149 TRP A O     1 
ATOM   1122  C  CB    . TRP A  1 168 ? -52.941  19.770  -43.535  1.00 40.92 ? 149 TRP A CB    1 
ATOM   1123  C  CG    . TRP A  1 168 ? -53.570  20.923  -42.899  1.00 40.17 ? 149 TRP A CG    1 
ATOM   1124  C  CD1   . TRP A  1 168 ? -54.186  20.958  -41.697  1.00 40.36 ? 149 TRP A CD1   1 
ATOM   1125  C  CD2   . TRP A  1 168 ? -53.545  22.270  -43.382  1.00 38.26 ? 149 TRP A CD2   1 
ATOM   1126  N  NE1   . TRP A  1 168 ? -54.600  22.242  -41.423  1.00 40.36 ? 149 TRP A NE1   1 
ATOM   1127  C  CE2   . TRP A  1 168 ? -54.202  23.061  -42.445  1.00 39.45 ? 149 TRP A CE2   1 
ATOM   1128  C  CE3   . TRP A  1 168 ? -53.047  22.869  -44.533  1.00 39.76 ? 149 TRP A CE3   1 
ATOM   1129  C  CZ2   . TRP A  1 168 ? -54.381  24.431  -42.620  1.00 41.74 ? 149 TRP A CZ2   1 
ATOM   1130  C  CZ3   . TRP A  1 168 ? -53.205  24.223  -44.710  1.00 40.37 ? 149 TRP A CZ3   1 
ATOM   1131  C  CH2   . TRP A  1 168 ? -53.855  25.001  -43.754  1.00 40.92 ? 149 TRP A CH2   1 
ATOM   1132  N  N     . PRO A  1 169 ? -53.770  17.432  -45.376  1.00 43.13 ? 150 PRO A N     1 
ATOM   1133  C  CA    . PRO A  1 169 ? -53.339  16.570  -46.463  1.00 44.20 ? 150 PRO A CA    1 
ATOM   1134  C  C     . PRO A  1 169 ? -51.867  16.776  -46.818  1.00 45.06 ? 150 PRO A C     1 
ATOM   1135  O  O     . PRO A  1 169 ? -51.359  17.900  -46.851  1.00 45.76 ? 150 PRO A O     1 
ATOM   1136  C  CB    . PRO A  1 169 ? -54.249  17.005  -47.610  1.00 44.08 ? 150 PRO A CB    1 
ATOM   1137  C  CG    . PRO A  1 169 ? -55.489  17.484  -46.921  1.00 43.15 ? 150 PRO A CG    1 
ATOM   1138  C  CD    . PRO A  1 169 ? -54.954  18.226  -45.757  1.00 43.23 ? 150 PRO A CD    1 
ATOM   1139  N  N     . SER A  1 170 ? -51.166  15.692  -47.044  1.00 46.00 ? 151 SER A N     1 
ATOM   1140  C  CA    . SER A  1 170 ? -49.748  15.799  -47.327  1.00 46.88 ? 151 SER A CA    1 
ATOM   1141  C  C     . SER A  1 170 ? -49.534  16.627  -48.619  1.00 47.39 ? 151 SER A C     1 
ATOM   1142  O  O     . SER A  1 170 ? -50.111  16.292  -49.690  1.00 47.01 ? 151 SER A O     1 
ATOM   1143  C  CB    . SER A  1 170 ? -49.177  14.390  -47.456  1.00 47.30 ? 151 SER A CB    1 
ATOM   1144  O  OG    . SER A  1 170 ? -47.851  14.449  -47.899  1.00 50.05 ? 151 SER A OG    1 
ATOM   1145  N  N     . ASN A  1 171 ? -48.753  17.715  -48.503  1.00 47.37 ? 152 ASN A N     1 
ATOM   1146  C  CA    . ASN A  1 171 ? -48.537  18.663  -49.617  1.00 47.39 ? 152 ASN A CA    1 
ATOM   1147  C  C     . ASN A  1 171 ? -49.811  19.386  -50.118  1.00 46.87 ? 152 ASN A C     1 
ATOM   1148  O  O     . ASN A  1 171 ? -49.913  19.745  -51.288  1.00 47.14 ? 152 ASN A O     1 
ATOM   1149  C  CB    . ASN A  1 171 ? -47.871  17.929  -50.803  1.00 48.40 ? 152 ASN A CB    1 
ATOM   1150  C  CG    . ASN A  1 171 ? -46.379  18.200  -50.909  1.00 51.25 ? 152 ASN A CG    1 
ATOM   1151  O  OD1   . ASN A  1 171 ? -45.693  18.491  -49.913  1.00 53.39 ? 152 ASN A OD1   1 
ATOM   1152  N  ND2   . ASN A  1 171 ? -45.861  18.108  -52.141  1.00 56.81 ? 152 ASN A ND2   1 
ATOM   1153  N  N     . GLY A  1 172 ? -50.778  19.613  -49.246  1.00 45.63 ? 153 GLY A N     1 
ATOM   1154  C  CA    . GLY A  1 172 ? -52.058  20.113  -49.701  1.00 45.11 ? 153 GLY A CA    1 
ATOM   1155  C  C     . GLY A  1 172 ? -52.919  20.743  -48.639  1.00 43.88 ? 153 GLY A C     1 
ATOM   1156  O  O     . GLY A  1 172 ? -52.462  21.017  -47.508  1.00 43.81 ? 153 GLY A O     1 
ATOM   1157  N  N     . PHE A  1 173 ? -54.176  20.962  -49.011  1.00 41.97 ? 154 PHE A N     1 
ATOM   1158  C  CA    . PHE A  1 173 ? -55.083  21.718  -48.179  1.00 40.83 ? 154 PHE A CA    1 
ATOM   1159  C  C     . PHE A  1 173 ? -56.289  20.890  -47.862  1.00 40.34 ? 154 PHE A C     1 
ATOM   1160  O  O     . PHE A  1 173 ? -56.778  20.109  -48.703  1.00 40.40 ? 154 PHE A O     1 
ATOM   1161  C  CB    . PHE A  1 173 ? -55.528  23.025  -48.858  1.00 40.73 ? 154 PHE A CB    1 
ATOM   1162  C  CG    . PHE A  1 173 ? -54.404  23.962  -49.170  1.00 40.04 ? 154 PHE A CG    1 
ATOM   1163  C  CD1   . PHE A  1 173 ? -53.979  24.887  -48.229  1.00 40.29 ? 154 PHE A CD1   1 
ATOM   1164  C  CD2   . PHE A  1 173 ? -53.762  23.905  -50.409  1.00 40.47 ? 154 PHE A CD2   1 
ATOM   1165  C  CE1   . PHE A  1 173 ? -52.889  25.755  -48.514  1.00 40.96 ? 154 PHE A CE1   1 
ATOM   1166  C  CE2   . PHE A  1 173 ? -52.688  24.757  -50.716  1.00 40.67 ? 154 PHE A CE2   1 
ATOM   1167  C  CZ    . PHE A  1 173 ? -52.245  25.689  -49.769  1.00 40.30 ? 154 PHE A CZ    1 
ATOM   1168  N  N     . PRO A  1 174 ? -56.790  21.048  -46.641  1.00 39.73 ? 155 PRO A N     1 
ATOM   1169  C  CA    . PRO A  1 174 ? -58.065  20.454  -46.343  1.00 39.04 ? 155 PRO A CA    1 
ATOM   1170  C  C     . PRO A  1 174 ? -59.180  21.299  -46.952  1.00 38.54 ? 155 PRO A C     1 
ATOM   1171  O  O     . PRO A  1 174 ? -58.910  22.271  -47.704  1.00 38.19 ? 155 PRO A O     1 
ATOM   1172  C  CB    . PRO A  1 174 ? -58.105  20.461  -44.804  1.00 39.60 ? 155 PRO A CB    1 
ATOM   1173  C  CG    . PRO A  1 174 ? -57.280  21.630  -44.404  1.00 40.38 ? 155 PRO A CG    1 
ATOM   1174  C  CD    . PRO A  1 174 ? -56.216  21.764  -45.484  1.00 40.29 ? 155 PRO A CD    1 
ATOM   1175  N  N     . GLY A  1 175 ? -60.417  20.911  -46.648  1.00 37.69 ? 156 GLY A N     1 
ATOM   1176  C  CA    . GLY A  1 175 ? -61.580  21.638  -47.107  1.00 37.25 ? 156 GLY A CA    1 
ATOM   1177  C  C     . GLY A  1 175 ? -61.591  23.000  -46.460  1.00 36.62 ? 156 GLY A C     1 
ATOM   1178  O  O     . GLY A  1 175 ? -60.980  23.190  -45.409  1.00 35.39 ? 156 GLY A O     1 
ATOM   1179  N  N     . PRO A  1 176 ? -62.285  23.955  -47.088  1.00 36.73 ? 157 PRO A N     1 
ATOM   1180  C  CA    . PRO A  1 176 ? -62.361  25.339  -46.607  1.00 36.86 ? 157 PRO A CA    1 
ATOM   1181  C  C     . PRO A  1 176 ? -62.842  25.481  -45.194  1.00 36.30 ? 157 PRO A C     1 
ATOM   1182  O  O     . PRO A  1 176 ? -63.518  24.619  -44.665  1.00 36.39 ? 157 PRO A O     1 
ATOM   1183  C  CB    . PRO A  1 176 ? -63.390  25.993  -47.549  1.00 36.42 ? 157 PRO A CB    1 
ATOM   1184  C  CG    . PRO A  1 176 ? -63.294  25.224  -48.798  1.00 36.37 ? 157 PRO A CG    1 
ATOM   1185  C  CD    . PRO A  1 176 ? -63.032  23.791  -48.344  1.00 36.90 ? 157 PRO A CD    1 
ATOM   1186  N  N     . GLN A  1 177 ? -62.504  26.611  -44.622  1.00 36.69 ? 158 GLN A N     1 
ATOM   1187  C  CA    . GLN A  1 177 ? -62.859  26.931  -43.264  1.00 36.77 ? 158 GLN A CA    1 
ATOM   1188  C  C     . GLN A  1 177 ? -64.353  27.035  -43.236  1.00 36.87 ? 158 GLN A C     1 
ATOM   1189  O  O     . GLN A  1 177 ? -64.994  27.278  -44.265  1.00 36.92 ? 158 GLN A O     1 
ATOM   1190  C  CB    . GLN A  1 177 ? -62.210  28.245  -42.808  1.00 36.23 ? 158 GLN A CB    1 
ATOM   1191  C  CG    . GLN A  1 177 ? -60.712  28.221  -42.836  1.00 35.84 ? 158 GLN A CG    1 
ATOM   1192  C  CD    . GLN A  1 177 ? -60.048  29.459  -42.198  1.00 36.49 ? 158 GLN A CD    1 
ATOM   1193  O  OE1   . GLN A  1 177 ? -59.137  29.330  -41.383  1.00 33.50 ? 158 GLN A OE1   1 
ATOM   1194  N  NE2   . GLN A  1 177 ? -60.484  30.652  -42.600  1.00 34.17 ? 158 GLN A NE2   1 
ATOM   1195  N  N     . GLY A  1 178 ? -64.891  26.831  -42.041  1.00 37.38 ? 159 GLY A N     1 
ATOM   1196  C  CA    . GLY A  1 178 ? -66.326  26.677  -41.822  1.00 36.72 ? 159 GLY A CA    1 
ATOM   1197  C  C     . GLY A  1 178 ? -66.562  25.683  -40.702  1.00 36.73 ? 159 GLY A C     1 
ATOM   1198  O  O     . GLY A  1 178 ? -67.025  26.060  -39.659  1.00 37.14 ? 159 GLY A O     1 
ATOM   1199  N  N     . PRO A  1 179 ? -66.258  24.396  -40.929  1.00 36.28 ? 160 PRO A N     1 
ATOM   1200  C  CA    . PRO A  1 179 ? -66.557  23.332  -39.985  1.00 36.28 ? 160 PRO A CA    1 
ATOM   1201  C  C     . PRO A  1 179 ? -65.585  23.033  -38.834  1.00 36.36 ? 160 PRO A C     1 
ATOM   1202  O  O     . PRO A  1 179 ? -65.874  22.145  -38.026  1.00 36.48 ? 160 PRO A O     1 
ATOM   1203  C  CB    . PRO A  1 179 ? -66.673  22.103  -40.894  1.00 36.05 ? 160 PRO A CB    1 
ATOM   1204  C  CG    . PRO A  1 179 ? -65.828  22.384  -42.020  1.00 36.62 ? 160 PRO A CG    1 
ATOM   1205  C  CD    . PRO A  1 179 ? -65.709  23.869  -42.179  1.00 36.24 ? 160 PRO A CD    1 
ATOM   1206  N  N     . TYR A  1 180 ? -64.475  23.762  -38.722  1.00 36.28 ? 161 TYR A N     1 
ATOM   1207  C  CA    . TYR A  1 180 ? -63.441  23.386  -37.767  1.00 35.80 ? 161 TYR A CA    1 
ATOM   1208  C  C     . TYR A  1 180 ? -63.551  24.143  -36.449  1.00 36.06 ? 161 TYR A C     1 
ATOM   1209  O  O     . TYR A  1 180 ? -63.147  23.619  -35.409  1.00 36.96 ? 161 TYR A O     1 
ATOM   1210  C  CB    . TYR A  1 180 ? -62.053  23.599  -38.363  1.00 35.37 ? 161 TYR A CB    1 
ATOM   1211  C  CG    . TYR A  1 180 ? -61.876  23.053  -39.747  1.00 35.26 ? 161 TYR A CG    1 
ATOM   1212  C  CD1   . TYR A  1 180 ? -61.711  21.684  -39.954  1.00 37.26 ? 161 TYR A CD1   1 
ATOM   1213  C  CD2   . TYR A  1 180 ? -61.861  23.893  -40.867  1.00 35.09 ? 161 TYR A CD2   1 
ATOM   1214  C  CE1   . TYR A  1 180 ? -61.535  21.150  -41.252  1.00 35.81 ? 161 TYR A CE1   1 
ATOM   1215  C  CE2   . TYR A  1 180 ? -61.681  23.374  -42.142  1.00 35.17 ? 161 TYR A CE2   1 
ATOM   1216  C  CZ    . TYR A  1 180 ? -61.520  21.999  -42.311  1.00 34.87 ? 161 TYR A CZ    1 
ATOM   1217  O  OH    . TYR A  1 180 ? -61.333  21.458  -43.525  1.00 35.34 ? 161 TYR A OH    1 
ATOM   1218  N  N     . TYR A  1 181 ? -64.034  25.385  -36.483  1.00 35.96 ? 162 TYR A N     1 
ATOM   1219  C  CA    . TYR A  1 181 ? -64.216  26.164  -35.254  1.00 36.12 ? 162 TYR A CA    1 
ATOM   1220  C  C     . TYR A  1 181 ? -65.060  25.386  -34.239  1.00 35.93 ? 162 TYR A C     1 
ATOM   1221  O  O     . TYR A  1 181 ? -66.123  24.896  -34.571  1.00 35.12 ? 162 TYR A O     1 
ATOM   1222  C  CB    . TYR A  1 181 ? -64.848  27.523  -35.559  1.00 36.02 ? 162 TYR A CB    1 
ATOM   1223  C  CG    . TYR A  1 181 ? -65.227  28.344  -34.346  1.00 35.86 ? 162 TYR A CG    1 
ATOM   1224  C  CD1   . TYR A  1 181 ? -64.282  29.106  -33.670  1.00 35.65 ? 162 TYR A CD1   1 
ATOM   1225  C  CD2   . TYR A  1 181 ? -66.532  28.346  -33.864  1.00 36.10 ? 162 TYR A CD2   1 
ATOM   1226  C  CE1   . TYR A  1 181 ? -64.636  29.864  -32.553  1.00 36.08 ? 162 TYR A CE1   1 
ATOM   1227  C  CE2   . TYR A  1 181 ? -66.887  29.098  -32.751  1.00 36.02 ? 162 TYR A CE2   1 
ATOM   1228  C  CZ    . TYR A  1 181 ? -65.942  29.850  -32.106  1.00 35.43 ? 162 TYR A CZ    1 
ATOM   1229  O  OH    . TYR A  1 181 ? -66.298  30.589  -31.026  1.00 35.54 ? 162 TYR A OH    1 
ATOM   1230  N  N     . CYS A  1 182 ? -64.534  25.224  -33.025  1.00 36.27 ? 163 CYS A N     1 
ATOM   1231  C  CA    . CYS A  1 182 ? -65.169  24.368  -31.991  1.00 36.57 ? 163 CYS A CA    1 
ATOM   1232  C  C     . CYS A  1 182 ? -65.700  23.019  -32.508  1.00 36.47 ? 163 CYS A C     1 
ATOM   1233  O  O     . CYS A  1 182 ? -66.705  22.511  -31.992  1.00 35.76 ? 163 CYS A O     1 
ATOM   1234  C  CB    . CYS A  1 182 ? -66.312  25.140  -31.348  1.00 37.19 ? 163 CYS A CB    1 
ATOM   1235  S  SG    . CYS A  1 182 ? -65.721  26.558  -30.501  1.00 36.99 ? 163 CYS A SG    1 
ATOM   1236  N  N     . GLY A  1 183 ? -65.018  22.439  -33.503  1.00 36.51 ? 164 GLY A N     1 
ATOM   1237  C  CA    . GLY A  1 183 ? -65.538  21.261  -34.211  1.00 36.65 ? 164 GLY A CA    1 
ATOM   1238  C  C     . GLY A  1 183 ? -65.325  19.980  -33.431  1.00 36.93 ? 164 GLY A C     1 
ATOM   1239  O  O     . GLY A  1 183 ? -64.536  19.949  -32.486  1.00 37.92 ? 164 GLY A O     1 
ATOM   1240  N  N     . VAL A  1 184 ? -66.021  18.921  -33.812  1.00 36.78 ? 165 VAL A N     1 
ATOM   1241  C  CA    . VAL A  1 184 ? -65.784  17.605  -33.243  1.00 36.61 ? 165 VAL A CA    1 
ATOM   1242  C  C     . VAL A  1 184 ? -65.829  16.519  -34.320  1.00 36.61 ? 165 VAL A C     1 
ATOM   1243  O  O     . VAL A  1 184 ? -66.649  16.549  -35.239  1.00 36.12 ? 165 VAL A O     1 
ATOM   1244  C  CB    . VAL A  1 184 ? -66.768  17.261  -32.096  1.00 37.06 ? 165 VAL A CB    1 
ATOM   1245  C  CG1   . VAL A  1 184 ? -68.184  17.346  -32.548  1.00 35.68 ? 165 VAL A CG1   1 
ATOM   1246  C  CG2   . VAL A  1 184 ? -66.456  15.831  -31.499  1.00 37.29 ? 165 VAL A CG2   1 
ATOM   1247  N  N     . GLY A  1 185 ? -64.922  15.555  -34.192  1.00 37.14 ? 166 GLY A N     1 
ATOM   1248  C  CA    . GLY A  1 185 ? -64.813  14.448  -35.131  1.00 37.72 ? 166 GLY A CA    1 
ATOM   1249  C  C     . GLY A  1 185 ? -63.413  14.428  -35.732  1.00 38.31 ? 166 GLY A C     1 
ATOM   1250  O  O     . GLY A  1 185 ? -62.705  15.432  -35.706  1.00 38.64 ? 166 GLY A O     1 
ATOM   1251  N  N     . ALA A  1 186 ? -63.015  13.262  -36.235  1.00 38.37 ? 167 ALA A N     1 
ATOM   1252  C  CA    . ALA A  1 186 ? -61.672  13.031  -36.727  1.00 38.11 ? 167 ALA A CA    1 
ATOM   1253  C  C     . ALA A  1 186 ? -61.420  13.836  -37.990  1.00 38.21 ? 167 ALA A C     1 
ATOM   1254  O  O     . ALA A  1 186 ? -60.298  14.222  -38.263  1.00 38.46 ? 167 ALA A O     1 
ATOM   1255  C  CB    . ALA A  1 186 ? -61.457  11.535  -36.985  1.00 37.01 ? 167 ALA A CB    1 
ATOM   1256  N  N     . ASP A  1 187 ? -62.463  14.109  -38.750  1.00 38.51 ? 168 ASP A N     1 
ATOM   1257  C  CA    . ASP A  1 187 ? -62.325  14.919  -39.958  1.00 39.08 ? 168 ASP A CA    1 
ATOM   1258  C  C     . ASP A  1 187 ? -62.373  16.401  -39.700  1.00 39.46 ? 168 ASP A C     1 
ATOM   1259  O  O     . ASP A  1 187 ? -62.443  17.177  -40.644  1.00 39.39 ? 168 ASP A O     1 
ATOM   1260  C  CB    . ASP A  1 187 ? -63.430  14.584  -40.972  1.00 38.84 ? 168 ASP A CB    1 
ATOM   1261  C  CG    . ASP A  1 187 ? -64.842  14.750  -40.403  1.00 38.92 ? 168 ASP A CG    1 
ATOM   1262  O  OD1   . ASP A  1 187 ? -65.038  14.921  -39.176  1.00 37.98 ? 168 ASP A OD1   1 
ATOM   1263  O  OD2   . ASP A  1 187 ? -65.776  14.691  -41.208  1.00 40.17 ? 168 ASP A OD2   1 
ATOM   1264  N  N     . ARG A  1 188 ? -62.391  16.831  -38.449  1.00 40.37 ? 169 ARG A N     1 
ATOM   1265  C  CA    . ARG A  1 188 ? -62.320  18.279  -38.224  1.00 41.24 ? 169 ARG A CA    1 
ATOM   1266  C  C     . ARG A  1 188 ? -61.595  18.816  -36.992  1.00 41.37 ? 169 ARG A C     1 
ATOM   1267  O  O     . ARG A  1 188 ? -61.210  19.970  -37.007  1.00 42.03 ? 169 ARG A O     1 
ATOM   1268  C  CB    . ARG A  1 188 ? -63.708  18.901  -38.294  1.00 41.94 ? 169 ARG A CB    1 
ATOM   1269  C  CG    . ARG A  1 188 ? -64.624  18.456  -37.207  1.00 42.70 ? 169 ARG A CG    1 
ATOM   1270  C  CD    . ARG A  1 188 ? -66.013  18.672  -37.656  1.00 43.98 ? 169 ARG A CD    1 
ATOM   1271  N  NE    . ARG A  1 188 ? -66.366  17.715  -38.691  1.00 44.90 ? 169 ARG A NE    1 
ATOM   1272  C  CZ    . ARG A  1 188 ? -67.451  17.806  -39.456  1.00 46.70 ? 169 ARG A CZ    1 
ATOM   1273  N  NH1   . ARG A  1 188 ? -68.302  18.830  -39.324  1.00 47.10 ? 169 ARG A NH1   1 
ATOM   1274  N  NH2   . ARG A  1 188 ? -67.697  16.859  -40.355  1.00 46.74 ? 169 ARG A NH2   1 
ATOM   1275  N  N     . ALA A  1 189 ? -61.412  18.028  -35.946  1.00 40.91 ? 170 ALA A N     1 
ATOM   1276  C  CA    . ALA A  1 189 ? -60.667  18.497  -34.797  1.00 40.49 ? 170 ALA A CA    1 
ATOM   1277  C  C     . ALA A  1 189 ? -59.355  17.792  -34.905  1.00 40.30 ? 170 ALA A C     1 
ATOM   1278  O  O     . ALA A  1 189 ? -59.266  16.664  -34.518  1.00 40.88 ? 170 ALA A O     1 
ATOM   1279  C  CB    . ALA A  1 189 ? -61.402  18.129  -33.500  1.00 40.37 ? 170 ALA A CB    1 
ATOM   1280  N  N     . TYR A  1 190 ? -58.345  18.441  -35.484  1.00 40.84 ? 171 TYR A N     1 
ATOM   1281  C  CA    . TYR A  1 190 ? -56.964  17.899  -35.586  1.00 39.86 ? 171 TYR A CA    1 
ATOM   1282  C  C     . TYR A  1 190 ? -56.095  18.242  -34.387  1.00 39.66 ? 171 TYR A C     1 
ATOM   1283  O  O     . TYR A  1 190 ? -55.784  19.409  -34.184  1.00 39.18 ? 171 TYR A O     1 
ATOM   1284  C  CB    . TYR A  1 190 ? -56.257  18.453  -36.814  1.00 40.91 ? 171 TYR A CB    1 
ATOM   1285  C  CG    . TYR A  1 190 ? -56.978  18.245  -38.102  1.00 41.11 ? 171 TYR A CG    1 
ATOM   1286  C  CD1   . TYR A  1 190 ? -57.958  17.275  -38.230  1.00 43.22 ? 171 TYR A CD1   1 
ATOM   1287  C  CD2   . TYR A  1 190 ? -56.642  18.978  -39.221  1.00 42.69 ? 171 TYR A CD2   1 
ATOM   1288  C  CE1   . TYR A  1 190 ? -58.624  17.067  -39.437  1.00 43.65 ? 171 TYR A CE1   1 
ATOM   1289  C  CE2   . TYR A  1 190 ? -57.306  18.779  -40.436  1.00 43.08 ? 171 TYR A CE2   1 
ATOM   1290  C  CZ    . TYR A  1 190 ? -58.313  17.832  -40.518  1.00 43.00 ? 171 TYR A CZ    1 
ATOM   1291  O  OH    . TYR A  1 190 ? -59.001  17.611  -41.675  1.00 42.86 ? 171 TYR A OH    1 
ATOM   1292  N  N     . GLY A  1 191 ? -55.721  17.234  -33.590  1.00 38.78 ? 172 GLY A N     1 
ATOM   1293  C  CA    . GLY A  1 191 ? -54.833  17.431  -32.440  1.00 38.04 ? 172 GLY A CA    1 
ATOM   1294  C  C     . GLY A  1 191 ? -55.420  17.609  -31.036  1.00 37.29 ? 172 GLY A C     1 
ATOM   1295  O  O     . GLY A  1 191 ? -54.755  18.141  -30.159  1.00 36.73 ? 172 GLY A O     1 
ATOM   1296  N  N     . ARG A  1 192 ? -56.630  17.130  -30.780  1.00 36.82 ? 173 ARG A N     1 
ATOM   1297  C  CA    . ARG A  1 192 ? -57.246  17.339  -29.452  1.00 36.85 ? 173 ARG A CA    1 
ATOM   1298  C  C     . ARG A  1 192 ? -56.401  16.793  -28.297  1.00 36.23 ? 173 ARG A C     1 
ATOM   1299  O  O     . ARG A  1 192 ? -56.402  17.349  -27.208  1.00 35.66 ? 173 ARG A O     1 
ATOM   1300  C  CB    . ARG A  1 192 ? -58.684  16.748  -29.372  1.00 36.51 ? 173 ARG A CB    1 
ATOM   1301  C  CG    . ARG A  1 192 ? -59.510  17.395  -28.254  1.00 36.35 ? 173 ARG A CG    1 
ATOM   1302  C  CD    . ARG A  1 192 ? -60.809  16.678  -27.984  1.00 36.34 ? 173 ARG A CD    1 
ATOM   1303  N  NE    . ARG A  1 192 ? -61.724  16.753  -29.118  1.00 36.29 ? 173 ARG A NE    1 
ATOM   1304  C  CZ    . ARG A  1 192 ? -62.408  17.824  -29.475  1.00 33.85 ? 173 ARG A CZ    1 
ATOM   1305  N  NH1   . ARG A  1 192 ? -62.315  18.942  -28.820  1.00 34.71 ? 173 ARG A NH1   1 
ATOM   1306  N  NH2   . ARG A  1 192 ? -63.172  17.779  -30.532  1.00 36.77 ? 173 ARG A NH2   1 
ATOM   1307  N  N     . ASP A  1 193 ? -55.684  15.709  -28.545  1.00 35.93 ? 174 ASP A N     1 
ATOM   1308  C  CA    . ASP A  1 193 ? -54.854  15.140  -27.509  1.00 36.70 ? 174 ASP A CA    1 
ATOM   1309  C  C     . ASP A  1 193 ? -53.886  16.117  -26.869  1.00 36.79 ? 174 ASP A C     1 
ATOM   1310  O  O     . ASP A  1 193 ? -53.786  16.152  -25.622  1.00 37.00 ? 174 ASP A O     1 
ATOM   1311  C  CB    . ASP A  1 193 ? -54.127  13.883  -27.995  1.00 36.60 ? 174 ASP A CB    1 
ATOM   1312  C  CG    . ASP A  1 193 ? -55.095  12.766  -28.331  1.00 38.80 ? 174 ASP A CG    1 
ATOM   1313  O  OD1   . ASP A  1 193 ? -56.308  12.876  -28.034  1.00 40.04 ? 174 ASP A OD1   1 
ATOM   1314  O  OD2   . ASP A  1 193 ? -54.643  11.782  -28.916  1.00 42.64 ? 174 ASP A OD2   1 
ATOM   1315  N  N     . ILE A  1 194 ? -53.179  16.888  -27.702  1.00 36.04 ? 175 ILE A N     1 
ATOM   1316  C  CA    . ILE A  1 194 ? -52.309  17.935  -27.212  1.00 35.90 ? 175 ILE A CA    1 
ATOM   1317  C  C     . ILE A  1 194 ? -53.111  18.895  -26.318  1.00 35.78 ? 175 ILE A C     1 
ATOM   1318  O  O     . ILE A  1 194 ? -52.659  19.264  -25.227  1.00 35.14 ? 175 ILE A O     1 
ATOM   1319  C  CB    . ILE A  1 194 ? -51.662  18.743  -28.383  1.00 36.08 ? 175 ILE A CB    1 
ATOM   1320  C  CG1   . ILE A  1 194 ? -50.508  17.959  -29.040  1.00 36.14 ? 175 ILE A CG1   1 
ATOM   1321  C  CG2   . ILE A  1 194 ? -51.161  20.089  -27.903  1.00 35.10 ? 175 ILE A CG2   1 
ATOM   1322  C  CD1   . ILE A  1 194 ? -50.939  16.933  -30.072  1.00 35.00 ? 175 ILE A CD1   1 
ATOM   1323  N  N     . VAL A  1 195 ? -54.307  19.265  -26.789  1.00 35.59 ? 176 VAL A N     1 
ATOM   1324  C  CA    . VAL A  1 195 ? -55.083  20.342  -26.190  1.00 35.59 ? 176 VAL A CA    1 
ATOM   1325  C  C     . VAL A  1 195 ? -55.560  19.941  -24.817  1.00 36.04 ? 176 VAL A C     1 
ATOM   1326  O  O     . VAL A  1 195 ? -55.493  20.755  -23.870  1.00 36.53 ? 176 VAL A O     1 
ATOM   1327  C  CB    . VAL A  1 195 ? -56.300  20.704  -27.053  1.00 35.59 ? 176 VAL A CB    1 
ATOM   1328  C  CG1   . VAL A  1 195 ? -57.155  21.661  -26.313  1.00 34.07 ? 176 VAL A CG1   1 
ATOM   1329  C  CG2   . VAL A  1 195 ? -55.865  21.291  -28.395  1.00 34.93 ? 176 VAL A CG2   1 
ATOM   1330  N  N     . GLU A  1 196 ? -56.021  18.689  -24.722  1.00 35.42 ? 177 GLU A N     1 
ATOM   1331  C  CA    . GLU A  1 196 ? -56.495  18.100  -23.481  1.00 35.73 ? 177 GLU A CA    1 
ATOM   1332  C  C     . GLU A  1 196 ? -55.366  17.924  -22.478  1.00 36.01 ? 177 GLU A C     1 
ATOM   1333  O  O     . GLU A  1 196 ? -55.523  18.239  -21.279  1.00 35.43 ? 177 GLU A O     1 
ATOM   1334  C  CB    . GLU A  1 196 ? -57.115  16.712  -23.745  1.00 36.07 ? 177 GLU A CB    1 
ATOM   1335  C  CG    . GLU A  1 196 ? -58.453  16.704  -24.553  1.00 36.31 ? 177 GLU A CG    1 
ATOM   1336  C  CD    . GLU A  1 196 ? -59.649  17.250  -23.773  1.00 37.79 ? 177 GLU A CD    1 
ATOM   1337  O  OE1   . GLU A  1 196 ? -59.706  17.001  -22.523  1.00 37.25 ? 177 GLU A OE1   1 
ATOM   1338  O  OE2   . GLU A  1 196 ? -60.524  17.905  -24.435  1.00 37.30 ? 177 GLU A OE2   1 
ATOM   1339  N  N     . ALA A  1 197 ? -54.241  17.391  -22.969  1.00 36.18 ? 178 ALA A N     1 
ATOM   1340  C  CA    . ALA A  1 197 ? -53.033  17.207  -22.165  1.00 36.59 ? 178 ALA A CA    1 
ATOM   1341  C  C     . ALA A  1 197 ? -52.555  18.526  -21.578  1.00 37.11 ? 178 ALA A C     1 
ATOM   1342  O  O     . ALA A  1 197 ? -52.292  18.630  -20.368  1.00 37.21 ? 178 ALA A O     1 
ATOM   1343  C  CB    . ALA A  1 197 ? -51.922  16.571  -22.999  1.00 37.04 ? 178 ALA A CB    1 
ATOM   1344  N  N     . HIS A  1 198 ? -52.506  19.552  -22.433  1.00 37.17 ? 179 HIS A N     1 
ATOM   1345  C  CA    . HIS A  1 198 ? -52.103  20.885  -22.013  1.00 37.05 ? 179 HIS A CA    1 
ATOM   1346  C  C     . HIS A  1 198 ? -52.989  21.482  -20.924  1.00 38.03 ? 179 HIS A C     1 
ATOM   1347  O  O     . HIS A  1 198 ? -52.477  22.138  -19.975  1.00 37.56 ? 179 HIS A O     1 
ATOM   1348  C  CB    . HIS A  1 198 ? -52.123  21.789  -23.211  1.00 36.95 ? 179 HIS A CB    1 
ATOM   1349  C  CG    . HIS A  1 198 ? -51.658  23.176  -22.924  1.00 37.22 ? 179 HIS A CG    1 
ATOM   1350  N  ND1   . HIS A  1 198 ? -52.529  24.217  -22.700  1.00 38.64 ? 179 HIS A ND1   1 
ATOM   1351  C  CD2   . HIS A  1 198 ? -50.411  23.693  -22.819  1.00 38.41 ? 179 HIS A CD2   1 
ATOM   1352  C  CE1   . HIS A  1 198 ? -51.840  25.320  -22.472  1.00 39.56 ? 179 HIS A CE1   1 
ATOM   1353  N  NE2   . HIS A  1 198 ? -50.550  25.029  -22.536  1.00 39.18 ? 179 HIS A NE2   1 
ATOM   1354  N  N     . TYR A  1 199 ? -54.316  21.267  -21.088  1.00 38.36 ? 180 TYR A N     1 
ATOM   1355  C  CA    . TYR A  1 199 ? -55.330  21.838  -20.211  1.00 38.09 ? 180 TYR A CA    1 
ATOM   1356  C  C     . TYR A  1 199 ? -55.111  21.280  -18.812  1.00 38.50 ? 180 TYR A C     1 
ATOM   1357  O  O     . TYR A  1 199 ? -55.005  22.001  -17.807  1.00 38.97 ? 180 TYR A O     1 
ATOM   1358  C  CB    . TYR A  1 199 ? -56.726  21.497  -20.754  1.00 38.84 ? 180 TYR A CB    1 
ATOM   1359  C  CG    . TYR A  1 199 ? -57.869  22.427  -20.298  1.00 38.64 ? 180 TYR A CG    1 
ATOM   1360  C  CD1   . TYR A  1 199 ? -58.904  22.779  -21.158  1.00 37.36 ? 180 TYR A CD1   1 
ATOM   1361  C  CD2   . TYR A  1 199 ? -57.892  22.954  -19.001  1.00 39.41 ? 180 TYR A CD2   1 
ATOM   1362  C  CE1   . TYR A  1 199 ? -59.932  23.609  -20.735  1.00 37.85 ? 180 TYR A CE1   1 
ATOM   1363  C  CE2   . TYR A  1 199 ? -58.897  23.759  -18.584  1.00 40.02 ? 180 TYR A CE2   1 
ATOM   1364  C  CZ    . TYR A  1 199 ? -59.922  24.089  -19.437  1.00 39.47 ? 180 TYR A CZ    1 
ATOM   1365  O  OH    . TYR A  1 199 ? -60.881  24.941  -18.926  1.00 39.78 ? 180 TYR A OH    1 
ATOM   1366  N  N     . ARG A  1 200 ? -54.947  19.978  -18.756  1.00 39.31 ? 181 ARG A N     1 
ATOM   1367  C  CA    . ARG A  1 200 ? -54.703  19.296  -17.486  1.00 39.48 ? 181 ARG A CA    1 
ATOM   1368  C  C     . ARG A  1 200 ? -53.299  19.615  -16.922  1.00 39.53 ? 181 ARG A C     1 
ATOM   1369  O  O     . ARG A  1 200 ? -53.134  19.824  -15.698  1.00 38.97 ? 181 ARG A O     1 
ATOM   1370  C  CB    . ARG A  1 200 ? -54.884  17.799  -17.720  1.00 40.04 ? 181 ARG A CB    1 
ATOM   1371  C  CG    . ARG A  1 200 ? -55.340  17.047  -16.543  1.00 44.15 ? 181 ARG A CG    1 
ATOM   1372  C  CD    . ARG A  1 200 ? -56.683  17.617  -16.050  1.00 49.27 ? 181 ARG A CD    1 
ATOM   1373  N  NE    . ARG A  1 200 ? -57.859  16.856  -16.457  1.00 50.85 ? 181 ARG A NE    1 
ATOM   1374  C  CZ    . ARG A  1 200 ? -58.112  15.614  -16.026  1.00 50.83 ? 181 ARG A CZ    1 
ATOM   1375  N  NH1   . ARG A  1 200 ? -57.256  14.965  -15.239  1.00 47.89 ? 181 ARG A NH1   1 
ATOM   1376  N  NH2   . ARG A  1 200 ? -59.223  15.005  -16.412  1.00 52.29 ? 181 ARG A NH2   1 
ATOM   1377  N  N     . ALA A  1 201 ? -52.288  19.655  -17.810  1.00 39.09 ? 182 ALA A N     1 
ATOM   1378  C  CA    . ALA A  1 201 ? -50.947  20.018  -17.374  1.00 38.95 ? 182 ALA A CA    1 
ATOM   1379  C  C     . ALA A  1 201 ? -50.967  21.415  -16.685  1.00 39.29 ? 182 ALA A C     1 
ATOM   1380  O  O     . ALA A  1 201 ? -50.399  21.571  -15.585  1.00 39.62 ? 182 ALA A O     1 
ATOM   1381  C  CB    . ALA A  1 201 ? -50.010  20.003  -18.499  1.00 38.20 ? 182 ALA A CB    1 
ATOM   1382  N  N     . CYS A  1 202 ? -51.653  22.392  -17.301  1.00 38.58 ? 183 CYS A N     1 
ATOM   1383  C  CA    . CYS A  1 202 ? -51.745  23.729  -16.734  1.00 38.07 ? 183 CYS A CA    1 
ATOM   1384  C  C     . CYS A  1 202 ? -52.524  23.752  -15.435  1.00 37.83 ? 183 CYS A C     1 
ATOM   1385  O  O     . CYS A  1 202 ? -52.167  24.528  -14.543  1.00 37.58 ? 183 CYS A O     1 
ATOM   1386  C  CB    . CYS A  1 202 ? -52.394  24.718  -17.694  1.00 38.22 ? 183 CYS A CB    1 
ATOM   1387  S  SG    . CYS A  1 202 ? -51.432  25.111  -19.177  1.00 38.65 ? 183 CYS A SG    1 
ATOM   1388  N  N     . LEU A  1 203 ? -53.596  22.950  -15.326  1.00 37.05 ? 184 LEU A N     1 
ATOM   1389  C  CA    . LEU A  1 203 ? -54.354  22.911  -14.081  1.00 36.67 ? 184 LEU A CA    1 
ATOM   1390  C  C     . LEU A  1 203 ? -53.487  22.364  -12.947  1.00 36.60 ? 184 LEU A C     1 
ATOM   1391  O  O     . LEU A  1 203 ? -53.417  22.955  -11.879  1.00 36.37 ? 184 LEU A O     1 
ATOM   1392  C  CB    . LEU A  1 203 ? -55.657  22.118  -14.216  1.00 36.54 ? 184 LEU A CB    1 
ATOM   1393  C  CG    . LEU A  1 203 ? -56.819  22.785  -15.000  1.00 36.58 ? 184 LEU A CG    1 
ATOM   1394  C  CD1   . LEU A  1 203 ? -58.015  21.850  -15.200  1.00 29.78 ? 184 LEU A CD1   1 
ATOM   1395  C  CD2   . LEU A  1 203 ? -57.240  24.053  -14.309  1.00 32.44 ? 184 LEU A CD2   1 
ATOM   1396  N  N     . TYR A  1 204 ? -52.814  21.240  -13.173  1.00 37.21 ? 185 TYR A N     1 
ATOM   1397  C  CA    . TYR A  1 204 ? -51.912  20.667  -12.164  1.00 37.14 ? 185 TYR A CA    1 
ATOM   1398  C  C     . TYR A  1 204 ? -50.826  21.653  -11.836  1.00 37.61 ? 185 TYR A C     1 
ATOM   1399  O  O     . TYR A  1 204 ? -50.509  21.855  -10.650  1.00 38.27 ? 185 TYR A O     1 
ATOM   1400  C  CB    . TYR A  1 204 ? -51.282  19.398  -12.678  1.00 37.68 ? 185 TYR A CB    1 
ATOM   1401  C  CG    . TYR A  1 204 ? -50.376  18.674  -11.707  1.00 37.62 ? 185 TYR A CG    1 
ATOM   1402  C  CD1   . TYR A  1 204 ? -50.882  17.724  -10.842  1.00 38.60 ? 185 TYR A CD1   1 
ATOM   1403  C  CD2   . TYR A  1 204 ? -49.005  18.893  -11.692  1.00 39.23 ? 185 TYR A CD2   1 
ATOM   1404  C  CE1   . TYR A  1 204 ? -50.066  17.016  -9.964   1.00 37.41 ? 185 TYR A CE1   1 
ATOM   1405  C  CE2   . TYR A  1 204 ? -48.165  18.187  -10.795  1.00 40.36 ? 185 TYR A CE2   1 
ATOM   1406  C  CZ    . TYR A  1 204 ? -48.725  17.231  -9.944   1.00 39.20 ? 185 TYR A CZ    1 
ATOM   1407  O  OH    . TYR A  1 204 ? -47.944  16.522  -9.052   1.00 38.66 ? 185 TYR A OH    1 
ATOM   1408  N  N     . ALA A  1 205 ? -50.295  22.311  -12.867  1.00 37.23 ? 186 ALA A N     1 
ATOM   1409  C  CA    . ALA A  1 205 ? -49.231  23.291  -12.675  1.00 37.71 ? 186 ALA A CA    1 
ATOM   1410  C  C     . ALA A  1 205 ? -49.620  24.436  -11.743  1.00 38.32 ? 186 ALA A C     1 
ATOM   1411  O  O     . ALA A  1 205 ? -48.766  24.935  -10.984  1.00 40.11 ? 186 ALA A O     1 
ATOM   1412  C  CB    . ALA A  1 205 ? -48.781  23.869  -14.011  1.00 37.45 ? 186 ALA A CB    1 
ATOM   1413  N  N     . GLY A  1 206 ? -50.867  24.887  -11.816  1.00 37.45 ? 187 GLY A N     1 
ATOM   1414  C  CA    . GLY A  1 206 ? -51.274  26.123  -11.129  1.00 37.32 ? 187 GLY A CA    1 
ATOM   1415  C  C     . GLY A  1 206 ? -51.428  27.338  -12.029  1.00 37.28 ? 187 GLY A C     1 
ATOM   1416  O  O     . GLY A  1 206 ? -51.621  28.444  -11.539  1.00 36.28 ? 187 GLY A O     1 
ATOM   1417  N  N     . VAL A  1 207 ? -51.288  27.132  -13.345  1.00 37.86 ? 188 VAL A N     1 
ATOM   1418  C  CA    . VAL A  1 207 ? -51.505  28.163  -14.354  1.00 37.98 ? 188 VAL A CA    1 
ATOM   1419  C  C     . VAL A  1 207 ? -53.016  28.357  -14.453  1.00 39.38 ? 188 VAL A C     1 
ATOM   1420  O  O     . VAL A  1 207 ? -53.794  27.370  -14.465  1.00 40.46 ? 188 VAL A O     1 
ATOM   1421  C  CB    . VAL A  1 207 ? -50.925  27.720  -15.726  1.00 38.48 ? 188 VAL A CB    1 
ATOM   1422  C  CG1   . VAL A  1 207 ? -51.547  28.470  -16.898  1.00 36.44 ? 188 VAL A CG1   1 
ATOM   1423  C  CG2   . VAL A  1 207 ? -49.350  27.796  -15.743  1.00 37.10 ? 188 VAL A CG2   1 
ATOM   1424  N  N     . LYS A  1 208 ? -53.439  29.620  -14.493  1.00 39.25 ? 189 LYS A N     1 
ATOM   1425  C  CA    . LYS A  1 208 ? -54.837  29.986  -14.477  1.00 39.11 ? 189 LYS A CA    1 
ATOM   1426  C  C     . LYS A  1 208 ? -55.452  29.931  -15.899  1.00 39.28 ? 189 LYS A C     1 
ATOM   1427  O  O     . LYS A  1 208 ? -55.793  30.950  -16.535  1.00 38.70 ? 189 LYS A O     1 
ATOM   1428  C  CB    . LYS A  1 208 ? -54.987  31.373  -13.867  1.00 39.55 ? 189 LYS A CB    1 
ATOM   1429  C  CG    . LYS A  1 208 ? -56.426  31.717  -13.482  1.00 39.24 ? 189 LYS A CG    1 
ATOM   1430  C  CD    . LYS A  1 208 ? -56.410  32.993  -12.626  1.00 40.62 ? 189 LYS A CD    1 
ATOM   1431  C  CE    . LYS A  1 208 ? -57.811  33.358  -12.237  1.00 42.60 ? 189 LYS A CE    1 
ATOM   1432  N  NZ    . LYS A  1 208 ? -58.408  32.476  -11.172  1.00 45.86 ? 189 LYS A NZ    1 
ATOM   1433  N  N     . ILE A  1 209 ? -55.584  28.703  -16.376  1.00 38.96 ? 190 ILE A N     1 
ATOM   1434  C  CA    . ILE A  1 209 ? -56.174  28.431  -17.668  1.00 38.52 ? 190 ILE A CA    1 
ATOM   1435  C  C     . ILE A  1 209 ? -57.711  28.527  -17.533  1.00 38.49 ? 190 ILE A C     1 
ATOM   1436  O  O     . ILE A  1 209 ? -58.312  27.825  -16.723  1.00 39.43 ? 190 ILE A O     1 
ATOM   1437  C  CB    . ILE A  1 209 ? -55.683  27.043  -18.197  1.00 38.90 ? 190 ILE A CB    1 
ATOM   1438  C  CG1   . ILE A  1 209 ? -56.358  26.698  -19.535  1.00 39.22 ? 190 ILE A CG1   1 
ATOM   1439  C  CG2   . ILE A  1 209 ? -55.839  25.917  -17.117  1.00 37.64 ? 190 ILE A CG2   1 
ATOM   1440  C  CD1   . ILE A  1 209 ? -55.522  25.764  -20.390  1.00 38.29 ? 190 ILE A CD1   1 
ATOM   1441  N  N     . ALA A  1 210 ? -58.324  29.434  -18.298  1.00 37.65 ? 191 ALA A N     1 
ATOM   1442  C  CA    . ALA A  1 210 ? -59.756  29.738  -18.207  1.00 36.79 ? 191 ALA A CA    1 
ATOM   1443  C  C     . ALA A  1 210 ? -60.614  28.884  -19.157  1.00 36.32 ? 191 ALA A C     1 
ATOM   1444  O  O     . ALA A  1 210 ? -61.820  28.754  -18.974  1.00 35.72 ? 191 ALA A O     1 
ATOM   1445  C  CB    . ALA A  1 210 ? -59.979  31.221  -18.500  1.00 35.76 ? 191 ALA A CB    1 
ATOM   1446  N  N     . GLY A  1 211 ? -60.010  28.335  -20.200  1.00 36.18 ? 192 GLY A N     1 
ATOM   1447  C  CA    . GLY A  1 211 ? -60.755  27.510  -21.123  1.00 36.39 ? 192 GLY A CA    1 
ATOM   1448  C  C     . GLY A  1 211 ? -60.038  27.281  -22.412  1.00 36.03 ? 192 GLY A C     1 
ATOM   1449  O  O     . GLY A  1 211 ? -58.964  27.789  -22.596  1.00 37.20 ? 192 GLY A O     1 
ATOM   1450  N  N     . THR A  1 212 ? -60.637  26.526  -23.311  1.00 35.92 ? 193 THR A N     1 
ATOM   1451  C  CA    . THR A  1 212 ? -60.023  26.219  -24.580  1.00 36.44 ? 193 THR A CA    1 
ATOM   1452  C  C     . THR A  1 212 ? -61.066  26.132  -25.678  1.00 36.57 ? 193 THR A C     1 
ATOM   1453  O  O     . THR A  1 212 ? -62.243  25.961  -25.387  1.00 37.69 ? 193 THR A O     1 
ATOM   1454  C  CB    . THR A  1 212 ? -59.316  24.825  -24.509  1.00 37.09 ? 193 THR A CB    1 
ATOM   1455  O  OG1   . THR A  1 212 ? -60.286  23.851  -24.117  1.00 37.81 ? 193 THR A OG1   1 
ATOM   1456  C  CG2   . THR A  1 212 ? -58.151  24.825  -23.523  1.00 35.36 ? 193 THR A CG2   1 
ATOM   1457  N  N     . ASN A  1 213 ? -60.641  26.233  -26.935  1.00 36.31 ? 194 ASN A N     1 
ATOM   1458  C  CA    . ASN A  1 213 ? -61.511  25.903  -28.061  1.00 35.97 ? 194 ASN A CA    1 
ATOM   1459  C  C     . ASN A  1 213 ? -60.706  25.561  -29.304  1.00 35.83 ? 194 ASN A C     1 
ATOM   1460  O  O     . ASN A  1 213 ? -59.657  26.157  -29.510  1.00 36.64 ? 194 ASN A O     1 
ATOM   1461  C  CB    . ASN A  1 213 ? -62.458  27.062  -28.373  1.00 35.39 ? 194 ASN A CB    1 
ATOM   1462  C  CG    . ASN A  1 213 ? -61.735  28.375  -28.674  1.00 35.41 ? 194 ASN A CG    1 
ATOM   1463  O  OD1   . ASN A  1 213 ? -61.267  29.023  -27.757  1.00 34.92 ? 194 ASN A OD1   1 
ATOM   1464  N  ND2   . ASN A  1 213 ? -61.699  28.799  -29.954  1.00 34.12 ? 194 ASN A ND2   1 
ATOM   1465  N  N     . ALA A  1 214 ? -61.187  24.619  -30.116  1.00 35.46 ? 195 ALA A N     1 
ATOM   1466  C  CA    . ALA A  1 214 ? -60.763  24.495  -31.516  1.00 36.17 ? 195 ALA A CA    1 
ATOM   1467  C  C     . ALA A  1 214 ? -61.046  25.823  -32.245  1.00 36.97 ? 195 ALA A C     1 
ATOM   1468  O  O     . ALA A  1 214 ? -62.078  26.455  -31.966  1.00 38.51 ? 195 ALA A O     1 
ATOM   1469  C  CB    . ALA A  1 214 ? -61.493  23.366  -32.221  1.00 35.00 ? 195 ALA A CB    1 
ATOM   1470  N  N     . GLU A  1 215 ? -60.169  26.243  -33.161  1.00 36.66 ? 196 GLU A N     1 
ATOM   1471  C  CA    . GLU A  1 215 ? -60.345  27.520  -33.863  1.00 37.08 ? 196 GLU A CA    1 
ATOM   1472  C  C     . GLU A  1 215 ? -60.691  27.334  -35.350  1.00 37.50 ? 196 GLU A C     1 
ATOM   1473  O  O     . GLU A  1 215 ? -60.865  26.217  -35.821  1.00 37.40 ? 196 GLU A O     1 
ATOM   1474  C  CB    . GLU A  1 215 ? -59.116  28.426  -33.680  1.00 37.22 ? 196 GLU A CB    1 
ATOM   1475  C  CG    . GLU A  1 215 ? -59.284  29.475  -32.581  1.00 37.76 ? 196 GLU A CG    1 
ATOM   1476  C  CD    . GLU A  1 215 ? -60.284  30.552  -32.967  1.00 39.04 ? 196 GLU A CD    1 
ATOM   1477  O  OE1   . GLU A  1 215 ? -60.806  31.228  -32.055  1.00 36.87 ? 196 GLU A OE1   1 
ATOM   1478  O  OE2   . GLU A  1 215 ? -60.552  30.687  -34.182  1.00 39.61 ? 196 GLU A OE2   1 
ATOM   1479  N  N     . VAL A  1 216 ? -60.830  28.456  -36.058  1.00 37.99 ? 197 VAL A N     1 
ATOM   1480  C  CA    . VAL A  1 216 ? -61.384  28.491  -37.417  1.00 37.66 ? 197 VAL A CA    1 
ATOM   1481  C  C     . VAL A  1 216 ? -60.534  27.725  -38.421  1.00 38.02 ? 197 VAL A C     1 
ATOM   1482  O  O     . VAL A  1 216 ? -61.069  27.058  -39.308  1.00 38.21 ? 197 VAL A O     1 
ATOM   1483  C  CB    . VAL A  1 216 ? -61.579  29.986  -37.879  1.00 37.54 ? 197 VAL A CB    1 
ATOM   1484  C  CG1   . VAL A  1 216 ? -61.863  30.117  -39.381  1.00 34.87 ? 197 VAL A CG1   1 
ATOM   1485  C  CG2   . VAL A  1 216 ? -62.673  30.614  -37.060  1.00 36.73 ? 197 VAL A CG2   1 
ATOM   1486  N  N     . MET A  1 217 ? -59.216  27.831  -38.291  1.00 38.38 ? 198 MET A N     1 
ATOM   1487  C  CA    . MET A  1 217 ? -58.306  27.094  -39.178  1.00 38.36 ? 198 MET A CA    1 
ATOM   1488  C  C     . MET A  1 217 ? -58.122  25.653  -38.656  1.00 38.41 ? 198 MET A C     1 
ATOM   1489  O  O     . MET A  1 217 ? -57.940  25.402  -37.424  1.00 37.80 ? 198 MET A O     1 
ATOM   1490  C  CB    . MET A  1 217 ? -56.957  27.817  -39.315  1.00 38.16 ? 198 MET A CB    1 
ATOM   1491  C  CG    . MET A  1 217 ? -56.024  27.208  -40.375  1.00 39.26 ? 198 MET A CG    1 
ATOM   1492  S  SD    . MET A  1 217 ? -54.277  27.756  -40.320  1.00 39.90 ? 198 MET A SD    1 
ATOM   1493  C  CE    . MET A  1 217 ? -53.449  26.446  -39.470  1.00 41.99 ? 198 MET A CE    1 
ATOM   1494  N  N     . PRO A  1 218 ? -58.160  24.689  -39.582  1.00 38.09 ? 199 PRO A N     1 
ATOM   1495  C  CA    . PRO A  1 218 ? -57.936  23.339  -39.109  1.00 38.20 ? 199 PRO A CA    1 
ATOM   1496  C  C     . PRO A  1 218 ? -56.545  23.217  -38.528  1.00 38.00 ? 199 PRO A C     1 
ATOM   1497  O  O     . PRO A  1 218 ? -55.610  23.888  -38.986  1.00 38.15 ? 199 PRO A O     1 
ATOM   1498  C  CB    . PRO A  1 218 ? -58.157  22.471  -40.354  1.00 38.37 ? 199 PRO A CB    1 
ATOM   1499  C  CG    . PRO A  1 218 ? -58.026  23.401  -41.535  1.00 38.81 ? 199 PRO A CG    1 
ATOM   1500  C  CD    . PRO A  1 218 ? -58.392  24.762  -41.035  1.00 38.37 ? 199 PRO A CD    1 
ATOM   1501  N  N     . ALA A  1 219 ? -56.434  22.395  -37.489  1.00 38.24 ? 200 ALA A N     1 
ATOM   1502  C  CA    . ALA A  1 219 ? -55.211  22.283  -36.637  1.00 38.18 ? 200 ALA A CA    1 
ATOM   1503  C  C     . ALA A  1 219 ? -54.877  23.530  -35.813  1.00 37.98 ? 200 ALA A C     1 
ATOM   1504  O  O     . ALA A  1 219 ? -53.877  23.538  -35.134  1.00 38.08 ? 200 ALA A O     1 
ATOM   1505  C  CB    . ALA A  1 219 ? -53.959  21.830  -37.467  1.00 37.88 ? 200 ALA A CB    1 
ATOM   1506  N  N     . GLN A  1 220 ? -55.695  24.572  -35.867  1.00 38.18 ? 201 GLN A N     1 
ATOM   1507  C  CA    . GLN A  1 220 ? -55.464  25.772  -35.058  1.00 38.27 ? 201 GLN A CA    1 
ATOM   1508  C  C     . GLN A  1 220 ? -56.384  25.704  -33.818  1.00 37.82 ? 201 GLN A C     1 
ATOM   1509  O  O     . GLN A  1 220 ? -57.531  25.258  -33.908  1.00 37.65 ? 201 GLN A O     1 
ATOM   1510  C  CB    . GLN A  1 220 ? -55.726  27.041  -35.896  1.00 38.37 ? 201 GLN A CB    1 
ATOM   1511  C  CG    . GLN A  1 220 ? -55.591  28.319  -35.139  1.00 38.70 ? 201 GLN A CG    1 
ATOM   1512  C  CD    . GLN A  1 220 ? -55.956  29.547  -35.950  1.00 39.70 ? 201 GLN A CD    1 
ATOM   1513  O  OE1   . GLN A  1 220 ? -57.124  29.786  -36.276  1.00 41.39 ? 201 GLN A OE1   1 
ATOM   1514  N  NE2   . GLN A  1 220 ? -54.953  30.369  -36.237  1.00 44.03 ? 201 GLN A NE2   1 
ATOM   1515  N  N     . TRP A  1 221 ? -55.861  26.120  -32.673  1.00 37.42 ? 202 TRP A N     1 
ATOM   1516  C  CA    . TRP A  1 221 ? -56.545  25.976  -31.397  1.00 37.84 ? 202 TRP A CA    1 
ATOM   1517  C  C     . TRP A  1 221 ? -56.255  27.171  -30.513  1.00 37.91 ? 202 TRP A C     1 
ATOM   1518  O  O     . TRP A  1 221 ? -55.503  28.084  -30.886  1.00 37.41 ? 202 TRP A O     1 
ATOM   1519  C  CB    . TRP A  1 221 ? -56.084  24.723  -30.656  1.00 37.66 ? 202 TRP A CB    1 
ATOM   1520  C  CG    . TRP A  1 221 ? -56.420  23.418  -31.325  1.00 38.11 ? 202 TRP A CG    1 
ATOM   1521  C  CD1   . TRP A  1 221 ? -55.721  22.801  -32.326  1.00 37.72 ? 202 TRP A CD1   1 
ATOM   1522  C  CD2   . TRP A  1 221 ? -57.507  22.547  -31.004  1.00 36.77 ? 202 TRP A CD2   1 
ATOM   1523  N  NE1   . TRP A  1 221 ? -56.298  21.599  -32.625  1.00 37.75 ? 202 TRP A NE1   1 
ATOM   1524  C  CE2   . TRP A  1 221 ? -57.395  21.421  -31.827  1.00 36.96 ? 202 TRP A CE2   1 
ATOM   1525  C  CE3   . TRP A  1 221 ? -58.544  22.596  -30.069  1.00 38.16 ? 202 TRP A CE3   1 
ATOM   1526  C  CZ2   . TRP A  1 221 ? -58.307  20.370  -31.775  1.00 38.45 ? 202 TRP A CZ2   1 
ATOM   1527  C  CZ3   . TRP A  1 221 ? -59.449  21.565  -30.016  1.00 37.80 ? 202 TRP A CZ3   1 
ATOM   1528  C  CH2   . TRP A  1 221 ? -59.325  20.459  -30.865  1.00 38.36 ? 202 TRP A CH2   1 
ATOM   1529  N  N     . GLU A  1 222 ? -56.856  27.156  -29.328  1.00 38.19 ? 203 GLU A N     1 
ATOM   1530  C  CA    . GLU A  1 222 ? -56.793  28.311  -28.454  1.00 38.35 ? 203 GLU A CA    1 
ATOM   1531  C  C     . GLU A  1 222 ? -56.923  27.899  -27.042  1.00 37.85 ? 203 GLU A C     1 
ATOM   1532  O  O     . GLU A  1 222 ? -57.628  26.949  -26.732  1.00 37.69 ? 203 GLU A O     1 
ATOM   1533  C  CB    . GLU A  1 222 ? -57.948  29.266  -28.773  1.00 39.18 ? 203 GLU A CB    1 
ATOM   1534  C  CG    . GLU A  1 222 ? -58.045  30.579  -27.939  1.00 39.01 ? 203 GLU A CG    1 
ATOM   1535  C  CD    . GLU A  1 222 ? -59.292  31.421  -28.305  1.00 38.59 ? 203 GLU A CD    1 
ATOM   1536  O  OE1   . GLU A  1 222 ? -59.700  31.428  -29.480  1.00 39.66 ? 203 GLU A OE1   1 
ATOM   1537  O  OE2   . GLU A  1 222 ? -59.879  32.045  -27.405  1.00 39.93 ? 203 GLU A OE2   1 
ATOM   1538  N  N     . PHE A  1 223 ? -56.246  28.646  -26.187  1.00 37.83 ? 204 PHE A N     1 
ATOM   1539  C  CA    . PHE A  1 223 ? -56.465  28.561  -24.765  1.00 37.51 ? 204 PHE A CA    1 
ATOM   1540  C  C     . PHE A  1 223 ? -56.396  29.973  -24.189  1.00 37.55 ? 204 PHE A C     1 
ATOM   1541  O  O     . PHE A  1 223 ? -55.721  30.869  -24.713  1.00 36.46 ? 204 PHE A O     1 
ATOM   1542  C  CB    . PHE A  1 223 ? -55.491  27.579  -24.097  1.00 37.43 ? 204 PHE A CB    1 
ATOM   1543  C  CG    . PHE A  1 223 ? -54.003  27.972  -24.181  1.00 37.50 ? 204 PHE A CG    1 
ATOM   1544  C  CD1   . PHE A  1 223 ? -53.443  28.905  -23.283  1.00 38.41 ? 204 PHE A CD1   1 
ATOM   1545  C  CD2   . PHE A  1 223 ? -53.157  27.345  -25.068  1.00 36.94 ? 204 PHE A CD2   1 
ATOM   1546  C  CE1   . PHE A  1 223 ? -52.106  29.248  -23.331  1.00 36.58 ? 204 PHE A CE1   1 
ATOM   1547  C  CE2   . PHE A  1 223 ? -51.822  27.702  -25.128  1.00 37.25 ? 204 PHE A CE2   1 
ATOM   1548  C  CZ    . PHE A  1 223 ? -51.302  28.667  -24.251  1.00 36.09 ? 204 PHE A CZ    1 
ATOM   1549  N  N     . GLN A  1 224 ? -57.098  30.147  -23.097  1.00 37.90 ? 205 GLN A N     1 
ATOM   1550  C  CA    . GLN A  1 224 ? -57.295  31.419  -22.472  1.00 37.99 ? 205 GLN A CA    1 
ATOM   1551  C  C     . GLN A  1 224 ? -56.676  31.354  -21.116  1.00 37.90 ? 205 GLN A C     1 
ATOM   1552  O  O     . GLN A  1 224 ? -56.811  30.388  -20.445  1.00 37.73 ? 205 GLN A O     1 
ATOM   1553  C  CB    . GLN A  1 224 ? -58.788  31.668  -22.341  1.00 37.57 ? 205 GLN A CB    1 
ATOM   1554  C  CG    . GLN A  1 224 ? -59.490  31.825  -23.632  1.00 37.60 ? 205 GLN A CG    1 
ATOM   1555  C  CD    . GLN A  1 224 ? -60.391  30.687  -23.973  1.00 37.99 ? 205 GLN A CD    1 
ATOM   1556  O  OE1   . GLN A  1 224 ? -61.133  30.214  -23.163  1.00 37.70 ? 205 GLN A OE1   1 
ATOM   1557  N  NE2   . GLN A  1 224 ? -60.341  30.262  -25.189  1.00 36.70 ? 205 GLN A NE2   1 
ATOM   1558  N  N     . ILE A  1 225 ? -55.986  32.400  -20.728  1.00 38.13 ? 206 ILE A N     1 
ATOM   1559  C  CA    . ILE A  1 225 ? -55.322  32.446  -19.449  1.00 39.00 ? 206 ILE A CA    1 
ATOM   1560  C  C     . ILE A  1 225 ? -55.739  33.719  -18.778  1.00 39.81 ? 206 ILE A C     1 
ATOM   1561  O  O     . ILE A  1 225 ? -55.612  34.748  -19.330  1.00 40.63 ? 206 ILE A O     1 
ATOM   1562  C  CB    . ILE A  1 225 ? -53.787  32.433  -19.614  1.00 39.10 ? 206 ILE A CB    1 
ATOM   1563  C  CG1   . ILE A  1 225 ? -53.301  31.170  -20.302  1.00 38.50 ? 206 ILE A CG1   1 
ATOM   1564  C  CG2   . ILE A  1 225 ? -53.077  32.664  -18.329  1.00 37.50 ? 206 ILE A CG2   1 
ATOM   1565  C  CD1   . ILE A  1 225 ? -53.335  29.974  -19.496  1.00 37.18 ? 206 ILE A CD1   1 
ATOM   1566  N  N     . GLY A  1 226 ? -56.279  33.632  -17.589  1.00 39.98 ? 207 GLY A N     1 
ATOM   1567  C  CA    . GLY A  1 226 ? -56.785  34.797  -16.932  1.00 40.87 ? 207 GLY A CA    1 
ATOM   1568  C  C     . GLY A  1 226 ? -57.990  34.481  -16.112  1.00 41.07 ? 207 GLY A C     1 
ATOM   1569  O  O     . GLY A  1 226 ? -58.458  33.385  -16.134  1.00 41.92 ? 207 GLY A O     1 
ATOM   1570  N  N     . PRO A  1 227 ? -58.479  35.440  -15.363  1.00 40.98 ? 208 PRO A N     1 
ATOM   1571  C  CA    . PRO A  1 227 ? -57.883  36.756  -15.280  1.00 40.98 ? 208 PRO A CA    1 
ATOM   1572  C  C     . PRO A  1 227 ? -56.737  36.785  -14.329  1.00 40.85 ? 208 PRO A C     1 
ATOM   1573  O  O     . PRO A  1 227 ? -56.781  36.193  -13.293  1.00 40.96 ? 208 PRO A O     1 
ATOM   1574  C  CB    . PRO A  1 227 ? -59.018  37.595  -14.747  1.00 41.39 ? 208 PRO A CB    1 
ATOM   1575  C  CG    . PRO A  1 227 ? -60.189  36.865  -15.059  1.00 41.23 ? 208 PRO A CG    1 
ATOM   1576  C  CD    . PRO A  1 227 ? -59.887  35.468  -14.998  1.00 40.52 ? 208 PRO A CD    1 
ATOM   1577  N  N     . CYS A  1 228 ? -55.695  37.475  -14.720  1.00 40.92 ? 209 CYS A N     1 
ATOM   1578  C  CA    . CYS A  1 228 ? -54.482  37.509  -13.968  1.00 40.94 ? 209 CYS A CA    1 
ATOM   1579  C  C     . CYS A  1 228 ? -54.200  38.943  -13.625  1.00 41.22 ? 209 CYS A C     1 
ATOM   1580  O  O     . CYS A  1 228 ? -54.147  39.763  -14.472  1.00 40.49 ? 209 CYS A O     1 
ATOM   1581  C  CB    . CYS A  1 228 ? -53.348  36.906  -14.794  1.00 41.47 ? 209 CYS A CB    1 
ATOM   1582  S  SG    . CYS A  1 228 ? -53.348  35.170  -15.060  1.00 39.88 ? 209 CYS A SG    1 
ATOM   1583  N  N     . GLU A  1 229 ? -54.038  39.235  -12.353  1.00 42.07 ? 210 GLU A N     1 
ATOM   1584  C  CA    . GLU A  1 229 ? -53.728  40.584  -11.907  1.00 42.54 ? 210 GLU A CA    1 
ATOM   1585  C  C     . GLU A  1 229 ? -52.239  40.897  -12.108  1.00 42.52 ? 210 GLU A C     1 
ATOM   1586  O  O     . GLU A  1 229 ? -51.356  40.111  -11.750  1.00 42.42 ? 210 GLU A O     1 
ATOM   1587  C  CB    . GLU A  1 229 ? -54.121  40.771  -10.428  1.00 43.15 ? 210 GLU A CB    1 
ATOM   1588  C  CG    . GLU A  1 229 ? -53.702  42.101  -9.830   1.00 43.06 ? 210 GLU A CG    1 
ATOM   1589  C  CD    . GLU A  1 229 ? -54.504  42.482  -8.589   1.00 44.94 ? 210 GLU A CD    1 
ATOM   1590  O  OE1   . GLU A  1 229 ? -55.657  42.024  -8.387   1.00 49.79 ? 210 GLU A OE1   1 
ATOM   1591  O  OE2   . GLU A  1 229 ? -53.991  43.306  -7.808   1.00 50.27 ? 210 GLU A OE2   1 
ATOM   1592  N  N     . GLY A  1 230 ? -51.984  42.033  -12.740  1.00 42.40 ? 211 GLY A N     1 
ATOM   1593  C  CA    . GLY A  1 230 ? -50.655  42.634  -12.779  1.00 42.05 ? 211 GLY A CA    1 
ATOM   1594  C  C     . GLY A  1 230 ? -49.645  41.826  -13.530  1.00 41.95 ? 211 GLY A C     1 
ATOM   1595  O  O     . GLY A  1 230 ? -49.910  41.356  -14.641  1.00 42.48 ? 211 GLY A O     1 
ATOM   1596  N  N     . ILE A  1 231 ? -48.474  41.677  -12.920  1.00 41.73 ? 212 ILE A N     1 
ATOM   1597  C  CA    . ILE A  1 231 ? -47.393  40.943  -13.534  1.00 41.14 ? 212 ILE A CA    1 
ATOM   1598  C  C     . ILE A  1 231 ? -47.694  39.438  -13.679  1.00 41.45 ? 212 ILE A C     1 
ATOM   1599  O  O     . ILE A  1 231 ? -47.046  38.767  -14.462  1.00 42.39 ? 212 ILE A O     1 
ATOM   1600  C  CB    . ILE A  1 231 ? -46.064  41.122  -12.735  1.00 41.34 ? 212 ILE A CB    1 
ATOM   1601  C  CG1   . ILE A  1 231 ? -44.852  40.858  -13.647  1.00 40.31 ? 212 ILE A CG1   1 
ATOM   1602  C  CG2   . ILE A  1 231 ? -46.075  40.264  -11.413  1.00 38.85 ? 212 ILE A CG2   1 
ATOM   1603  C  CD1   . ILE A  1 231 ? -44.843  41.752  -14.909  1.00 39.14 ? 212 ILE A CD1   1 
ATOM   1604  N  N     . SER A  1 232 ? -48.654  38.889  -12.952  1.00 40.80 ? 213 SER A N     1 
ATOM   1605  C  CA    . SER A  1 232 ? -48.841  37.443  -13.037  1.00 40.93 ? 213 SER A CA    1 
ATOM   1606  C  C     . SER A  1 232 ? -49.383  37.047  -14.451  1.00 41.02 ? 213 SER A C     1 
ATOM   1607  O  O     . SER A  1 232 ? -49.352  35.865  -14.845  1.00 41.58 ? 213 SER A O     1 
ATOM   1608  C  CB    . SER A  1 232 ? -49.763  36.942  -11.905  1.00 40.07 ? 213 SER A CB    1 
ATOM   1609  O  OG    . SER A  1 232 ? -51.072  37.421  -12.159  1.00 39.92 ? 213 SER A OG    1 
ATOM   1610  N  N     . MET A  1 233 ? -49.884  38.011  -15.207  1.00 40.64 ? 214 MET A N     1 
ATOM   1611  C  CA    . MET A  1 233 ? -50.407  37.686  -16.532  1.00 40.87 ? 214 MET A CA    1 
ATOM   1612  C  C     . MET A  1 233 ? -49.298  37.164  -17.397  1.00 40.65 ? 214 MET A C     1 
ATOM   1613  O  O     . MET A  1 233 ? -49.396  36.095  -17.952  1.00 42.08 ? 214 MET A O     1 
ATOM   1614  C  CB    . MET A  1 233 ? -51.041  38.907  -17.209  1.00 41.09 ? 214 MET A CB    1 
ATOM   1615  C  CG    . MET A  1 233 ? -51.592  38.636  -18.617  1.00 41.49 ? 214 MET A CG    1 
ATOM   1616  S  SD    . MET A  1 233 ? -53.055  37.559  -18.722  1.00 41.92 ? 214 MET A SD    1 
ATOM   1617  C  CE    . MET A  1 233 ? -52.309  35.998  -19.216  1.00 40.24 ? 214 MET A CE    1 
ATOM   1618  N  N     . GLY A  1 234 ? -48.222  37.910  -17.502  1.00 40.46 ? 215 GLY A N     1 
ATOM   1619  C  CA    . GLY A  1 234 ? -47.099  37.485  -18.326  1.00 40.02 ? 215 GLY A CA    1 
ATOM   1620  C  C     . GLY A  1 234 ? -46.444  36.229  -17.826  1.00 39.63 ? 215 GLY A C     1 
ATOM   1621  O  O     . GLY A  1 234 ? -45.999  35.415  -18.605  1.00 40.00 ? 215 GLY A O     1 
ATOM   1622  N  N     . ASP A  1 235 ? -46.377  36.076  -16.519  1.00 39.45 ? 216 ASP A N     1 
ATOM   1623  C  CA    . ASP A  1 235 ? -45.798  34.894  -15.920  1.00 39.07 ? 216 ASP A CA    1 
ATOM   1624  C  C     . ASP A  1 235 ? -46.594  33.644  -16.313  1.00 39.11 ? 216 ASP A C     1 
ATOM   1625  O  O     . ASP A  1 235 ? -46.048  32.623  -16.750  1.00 38.92 ? 216 ASP A O     1 
ATOM   1626  C  CB    . ASP A  1 235 ? -45.791  35.073  -14.420  1.00 38.67 ? 216 ASP A CB    1 
ATOM   1627  C  CG    . ASP A  1 235 ? -44.796  36.148  -13.960  1.00 40.66 ? 216 ASP A CG    1 
ATOM   1628  O  OD1   . ASP A  1 235 ? -43.920  36.571  -14.774  1.00 38.42 ? 216 ASP A OD1   1 
ATOM   1629  O  OD2   . ASP A  1 235 ? -44.898  36.569  -12.770  1.00 42.30 ? 216 ASP A OD2   1 
ATOM   1630  N  N     . HIS A  1 236 ? -47.913  33.748  -16.177  1.00 39.22 ? 217 HIS A N     1 
ATOM   1631  C  CA    . HIS A  1 236 ? -48.784  32.620  -16.418  1.00 38.50 ? 217 HIS A CA    1 
ATOM   1632  C  C     . HIS A  1 236 ? -48.786  32.245  -17.909  1.00 38.08 ? 217 HIS A C     1 
ATOM   1633  O  O     . HIS A  1 236 ? -48.755  31.066  -18.253  1.00 38.03 ? 217 HIS A O     1 
ATOM   1634  C  CB    . HIS A  1 236 ? -50.194  32.925  -15.904  1.00 38.63 ? 217 HIS A CB    1 
ATOM   1635  C  CG    . HIS A  1 236 ? -50.414  32.594  -14.458  1.00 38.85 ? 217 HIS A CG    1 
ATOM   1636  N  ND1   . HIS A  1 236 ? -51.341  31.652  -14.050  1.00 38.78 ? 217 HIS A ND1   1 
ATOM   1637  C  CD2   . HIS A  1 236 ? -49.852  33.091  -13.322  1.00 37.24 ? 217 HIS A CD2   1 
ATOM   1638  C  CE1   . HIS A  1 236 ? -51.344  31.585  -12.726  1.00 37.09 ? 217 HIS A CE1   1 
ATOM   1639  N  NE2   . HIS A  1 236 ? -50.453  32.450  -12.261  1.00 36.58 ? 217 HIS A NE2   1 
ATOM   1640  N  N     . LEU A  1 237 ? -48.811  33.233  -18.797  1.00 37.48 ? 218 LEU A N     1 
ATOM   1641  C  CA    . LEU A  1 237 ? -48.809  32.904  -20.211  1.00 37.47 ? 218 LEU A CA    1 
ATOM   1642  C  C     . LEU A  1 237 ? -47.462  32.318  -20.656  1.00 37.34 ? 218 LEU A C     1 
ATOM   1643  O  O     . LEU A  1 237 ? -47.418  31.348  -21.391  1.00 37.85 ? 218 LEU A O     1 
ATOM   1644  C  CB    . LEU A  1 237 ? -49.240  34.102  -21.067  1.00 37.61 ? 218 LEU A CB    1 
ATOM   1645  C  CG    . LEU A  1 237 ? -49.407  33.889  -22.600  1.00 37.36 ? 218 LEU A CG    1 
ATOM   1646  C  CD1   . LEU A  1 237 ? -50.308  32.693  -22.912  1.00 36.79 ? 218 LEU A CD1   1 
ATOM   1647  C  CD2   . LEU A  1 237 ? -49.887  35.167  -23.304  1.00 35.84 ? 218 LEU A CD2   1 
ATOM   1648  N  N     . TRP A  1 238 ? -46.359  32.891  -20.212  1.00 37.29 ? 219 TRP A N     1 
ATOM   1649  C  CA    . TRP A  1 238 ? -45.093  32.382  -20.659  1.00 37.41 ? 219 TRP A CA    1 
ATOM   1650  C  C     . TRP A  1 238 ? -44.944  30.926  -20.217  1.00 37.90 ? 219 TRP A C     1 
ATOM   1651  O  O     . TRP A  1 238 ? -44.500  30.089  -21.034  1.00 38.39 ? 219 TRP A O     1 
ATOM   1652  C  CB    . TRP A  1 238 ? -43.914  33.237  -20.183  1.00 37.78 ? 219 TRP A CB    1 
ATOM   1653  C  CG    . TRP A  1 238 ? -43.593  34.354  -21.124  1.00 38.24 ? 219 TRP A CG    1 
ATOM   1654  C  CD1   . TRP A  1 238 ? -43.753  35.667  -20.886  1.00 38.82 ? 219 TRP A CD1   1 
ATOM   1655  C  CD2   . TRP A  1 238 ? -43.100  34.245  -22.475  1.00 37.62 ? 219 TRP A CD2   1 
ATOM   1656  N  NE1   . TRP A  1 238 ? -43.376  36.399  -21.980  1.00 38.92 ? 219 TRP A NE1   1 
ATOM   1657  C  CE2   . TRP A  1 238 ? -42.981  35.553  -22.977  1.00 38.23 ? 219 TRP A CE2   1 
ATOM   1658  C  CE3   . TRP A  1 238 ? -42.755  33.170  -23.302  1.00 37.82 ? 219 TRP A CE3   1 
ATOM   1659  C  CZ2   . TRP A  1 238 ? -42.528  35.835  -24.275  1.00 38.65 ? 219 TRP A CZ2   1 
ATOM   1660  C  CZ3   . TRP A  1 238 ? -42.302  33.439  -24.605  1.00 38.77 ? 219 TRP A CZ3   1 
ATOM   1661  C  CH2   . TRP A  1 238 ? -42.185  34.770  -25.075  1.00 39.06 ? 219 TRP A CH2   1 
ATOM   1662  N  N     . VAL A  1 239 ? -45.326  30.622  -18.961  1.00 37.07 ? 220 VAL A N     1 
ATOM   1663  C  CA    . VAL A  1 239 ? -45.238  29.254  -18.458  1.00 36.47 ? 220 VAL A CA    1 
ATOM   1664  C  C     . VAL A  1 239 ? -46.250  28.400  -19.224  1.00 36.55 ? 220 VAL A C     1 
ATOM   1665  O  O     . VAL A  1 239 ? -45.987  27.226  -19.465  1.00 35.95 ? 220 VAL A O     1 
ATOM   1666  C  CB    . VAL A  1 239 ? -45.399  29.135  -16.880  1.00 36.51 ? 220 VAL A CB    1 
ATOM   1667  C  CG1   . VAL A  1 239 ? -45.507  27.653  -16.419  1.00 35.13 ? 220 VAL A CG1   1 
ATOM   1668  C  CG2   . VAL A  1 239 ? -44.234  29.804  -16.132  1.00 34.27 ? 220 VAL A CG2   1 
ATOM   1669  N  N     . ALA A  1 240 ? -47.396  28.981  -19.603  1.00 36.36 ? 221 ALA A N     1 
ATOM   1670  C  CA    . ALA A  1 240 ? -48.427  28.221  -20.356  1.00 36.51 ? 221 ALA A CA    1 
ATOM   1671  C  C     . ALA A  1 240 ? -47.871  27.861  -21.745  1.00 36.54 ? 221 ALA A C     1 
ATOM   1672  O  O     . ALA A  1 240 ? -48.075  26.727  -22.270  1.00 36.76 ? 221 ALA A O     1 
ATOM   1673  C  CB    . ALA A  1 240 ? -49.755  28.996  -20.483  1.00 35.83 ? 221 ALA A CB    1 
ATOM   1674  N  N     . ARG A  1 241 ? -47.146  28.808  -22.322  1.00 35.99 ? 222 ARG A N     1 
ATOM   1675  C  CA    . ARG A  1 241 ? -46.556  28.559  -23.615  1.00 36.54 ? 222 ARG A CA    1 
ATOM   1676  C  C     . ARG A  1 241 ? -45.527  27.482  -23.468  1.00 35.90 ? 222 ARG A C     1 
ATOM   1677  O  O     . ARG A  1 241 ? -45.485  26.573  -24.299  1.00 34.57 ? 222 ARG A O     1 
ATOM   1678  C  CB    . ARG A  1 241 ? -45.927  29.796  -24.187  1.00 36.72 ? 222 ARG A CB    1 
ATOM   1679  C  CG    . ARG A  1 241 ? -46.930  30.844  -24.590  1.00 37.04 ? 222 ARG A CG    1 
ATOM   1680  C  CD    . ARG A  1 241 ? -46.204  32.150  -24.883  1.00 37.49 ? 222 ARG A CD    1 
ATOM   1681  N  NE    . ARG A  1 241 ? -46.984  33.044  -25.720  1.00 38.17 ? 222 ARG A NE    1 
ATOM   1682  C  CZ    . ARG A  1 241 ? -46.585  34.259  -26.078  1.00 38.73 ? 222 ARG A CZ    1 
ATOM   1683  N  NH1   . ARG A  1 241 ? -45.405  34.729  -25.717  1.00 40.17 ? 222 ARG A NH1   1 
ATOM   1684  N  NH2   . ARG A  1 241 ? -47.364  35.004  -26.820  1.00 39.56 ? 222 ARG A NH2   1 
ATOM   1685  N  N     . PHE A  1 242 ? -44.754  27.549  -22.375  1.00 36.10 ? 223 PHE A N     1 
ATOM   1686  C  CA    . PHE A  1 242 ? -43.710  26.547  -22.137  1.00 36.31 ? 223 PHE A CA    1 
ATOM   1687  C  C     . PHE A  1 242 ? -44.292  25.159  -22.026  1.00 36.13 ? 223 PHE A C     1 
ATOM   1688  O  O     . PHE A  1 242 ? -43.765  24.223  -22.616  1.00 36.66 ? 223 PHE A O     1 
ATOM   1689  C  CB    . PHE A  1 242 ? -42.871  26.813  -20.879  1.00 37.09 ? 223 PHE A CB    1 
ATOM   1690  C  CG    . PHE A  1 242 ? -41.751  25.785  -20.689  1.00 37.01 ? 223 PHE A CG    1 
ATOM   1691  C  CD1   . PHE A  1 242 ? -40.596  25.866  -21.437  1.00 35.89 ? 223 PHE A CD1   1 
ATOM   1692  C  CD2   . PHE A  1 242 ? -41.920  24.703  -19.833  1.00 37.36 ? 223 PHE A CD2   1 
ATOM   1693  C  CE1   . PHE A  1 242 ? -39.636  24.926  -21.317  1.00 37.75 ? 223 PHE A CE1   1 
ATOM   1694  C  CE2   . PHE A  1 242 ? -40.958  23.762  -19.685  1.00 37.47 ? 223 PHE A CE2   1 
ATOM   1695  C  CZ    . PHE A  1 242 ? -39.791  23.871  -20.430  1.00 38.43 ? 223 PHE A CZ    1 
ATOM   1696  N  N     . ILE A  1 243 ? -45.406  25.048  -21.296  1.00 36.51 ? 224 ILE A N     1 
ATOM   1697  C  CA    . ILE A  1 243 ? -46.093  23.786  -21.088  1.00 36.35 ? 224 ILE A CA    1 
ATOM   1698  C  C     . ILE A  1 243 ? -46.601  23.256  -22.437  1.00 36.65 ? 224 ILE A C     1 
ATOM   1699  O  O     . ILE A  1 243 ? -46.528  22.080  -22.702  1.00 37.51 ? 224 ILE A O     1 
ATOM   1700  C  CB    . ILE A  1 243 ? -47.190  23.906  -19.983  1.00 36.57 ? 224 ILE A CB    1 
ATOM   1701  C  CG1   . ILE A  1 243 ? -46.493  24.225  -18.645  1.00 36.55 ? 224 ILE A CG1   1 
ATOM   1702  C  CG2   . ILE A  1 243 ? -48.020  22.579  -19.874  1.00 35.34 ? 224 ILE A CG2   1 
ATOM   1703  C  CD1   . ILE A  1 243 ? -47.334  24.650  -17.512  1.00 35.12 ? 224 ILE A CD1   1 
ATOM   1704  N  N     . LEU A  1 244 ? -47.036  24.140  -23.315  1.00 36.74 ? 225 LEU A N     1 
ATOM   1705  C  CA    . LEU A  1 244 ? -47.486  23.739  -24.660  1.00 36.42 ? 225 LEU A CA    1 
ATOM   1706  C  C     . LEU A  1 244 ? -46.395  23.083  -25.498  1.00 36.11 ? 225 LEU A C     1 
ATOM   1707  O  O     . LEU A  1 244 ? -46.579  22.017  -26.098  1.00 35.41 ? 225 LEU A O     1 
ATOM   1708  C  CB    . LEU A  1 244 ? -48.070  24.979  -25.404  1.00 36.47 ? 225 LEU A CB    1 
ATOM   1709  C  CG    . LEU A  1 244 ? -48.789  24.692  -26.726  1.00 36.32 ? 225 LEU A CG    1 
ATOM   1710  C  CD1   . LEU A  1 244 ? -49.942  23.650  -26.514  1.00 33.36 ? 225 LEU A CD1   1 
ATOM   1711  C  CD2   . LEU A  1 244 ? -49.252  26.034  -27.381  1.00 35.05 ? 225 LEU A CD2   1 
ATOM   1712  N  N     . HIS A  1 245 ? -45.246  23.740  -25.539  1.00 36.91 ? 226 HIS A N     1 
ATOM   1713  C  CA    . HIS A  1 245 ? -44.115  23.220  -26.322  1.00 36.51 ? 226 HIS A CA    1 
ATOM   1714  C  C     . HIS A  1 245 ? -43.647  21.901  -25.788  1.00 36.05 ? 226 HIS A C     1 
ATOM   1715  O  O     . HIS A  1 245 ? -43.382  20.991  -26.577  1.00 35.27 ? 226 HIS A O     1 
ATOM   1716  C  CB    . HIS A  1 245 ? -42.976  24.176  -26.362  1.00 36.23 ? 226 HIS A CB    1 
ATOM   1717  C  CG    . HIS A  1 245 ? -43.280  25.436  -27.087  1.00 36.75 ? 226 HIS A CG    1 
ATOM   1718  N  ND1   . HIS A  1 245 ? -43.609  25.456  -28.431  1.00 36.74 ? 226 HIS A ND1   1 
ATOM   1719  C  CD2   . HIS A  1 245 ? -43.259  26.725  -26.669  1.00 35.17 ? 226 HIS A CD2   1 
ATOM   1720  C  CE1   . HIS A  1 245 ? -43.782  26.710  -28.807  1.00 38.47 ? 226 HIS A CE1   1 
ATOM   1721  N  NE2   . HIS A  1 245 ? -43.594  27.498  -27.753  1.00 39.01 ? 226 HIS A NE2   1 
ATOM   1722  N  N     . ARG A  1 246 ? -43.599  21.779  -24.466  1.00 36.10 ? 227 ARG A N     1 
ATOM   1723  C  CA    . ARG A  1 246 ? -43.222  20.499  -23.867  1.00 36.75 ? 227 ARG A CA    1 
ATOM   1724  C  C     . ARG A  1 246 ? -44.207  19.392  -24.153  1.00 36.74 ? 227 ARG A C     1 
ATOM   1725  O  O     . ARG A  1 246 ? -43.802  18.258  -24.380  1.00 37.25 ? 227 ARG A O     1 
ATOM   1726  C  CB    . ARG A  1 246 ? -43.109  20.595  -22.345  1.00 37.39 ? 227 ARG A CB    1 
ATOM   1727  C  CG    . ARG A  1 246 ? -41.696  20.703  -21.793  1.00 39.60 ? 227 ARG A CG    1 
ATOM   1728  C  CD    . ARG A  1 246 ? -40.797  19.536  -22.192  1.00 40.50 ? 227 ARG A CD    1 
ATOM   1729  N  NE    . ARG A  1 246 ? -40.778  18.444  -21.220  1.00 41.32 ? 227 ARG A NE    1 
ATOM   1730  C  CZ    . ARG A  1 246 ? -41.319  17.235  -21.382  1.00 42.09 ? 227 ARG A CZ    1 
ATOM   1731  N  NH1   . ARG A  1 246 ? -42.028  16.917  -22.457  1.00 44.64 ? 227 ARG A NH1   1 
ATOM   1732  N  NH2   . ARG A  1 246 ? -41.190  16.333  -20.429  1.00 41.86 ? 227 ARG A NH2   1 
ATOM   1733  N  N     . VAL A  1 247 ? -45.498  19.696  -24.033  1.00 36.49 ? 228 VAL A N     1 
ATOM   1734  C  CA    . VAL A  1 247 ? -46.521  18.712  -24.265  1.00 36.35 ? 228 VAL A CA    1 
ATOM   1735  C  C     . VAL A  1 247 ? -46.413  18.330  -25.731  1.00 36.60 ? 228 VAL A C     1 
ATOM   1736  O  O     . VAL A  1 247 ? -46.303  17.153  -26.090  1.00 36.13 ? 228 VAL A O     1 
ATOM   1737  C  CB    . VAL A  1 247 ? -47.947  19.258  -23.947  1.00 36.65 ? 228 VAL A CB    1 
ATOM   1738  C  CG1   . VAL A  1 247 ? -49.037  18.323  -24.514  1.00 34.09 ? 228 VAL A CG1   1 
ATOM   1739  C  CG2   . VAL A  1 247 ? -48.120  19.478  -22.439  1.00 35.06 ? 228 VAL A CG2   1 
ATOM   1740  N  N     . CYS A  1 248 ? -46.404  19.339  -26.587  1.00 37.12 ? 229 CYS A N     1 
ATOM   1741  C  CA    . CYS A  1 248 ? -46.322  19.078  -28.018  1.00 37.33 ? 229 CYS A CA    1 
ATOM   1742  C  C     . CYS A  1 248 ? -45.124  18.218  -28.307  1.00 37.72 ? 229 CYS A C     1 
ATOM   1743  O  O     . CYS A  1 248 ? -45.199  17.278  -29.109  1.00 38.28 ? 229 CYS A O     1 
ATOM   1744  C  CB    . CYS A  1 248 ? -46.189  20.386  -28.759  1.00 38.14 ? 229 CYS A CB    1 
ATOM   1745  S  SG    . CYS A  1 248 ? -47.727  21.201  -28.930  1.00 38.62 ? 229 CYS A SG    1 
ATOM   1746  N  N     . GLU A  1 249 ? -44.019  18.515  -27.630  1.00 37.26 ? 230 GLU A N     1 
ATOM   1747  C  CA    . GLU A  1 249 ? -42.840  17.712  -27.797  1.00 37.58 ? 230 GLU A CA    1 
ATOM   1748  C  C     . GLU A  1 249 ? -43.142  16.256  -27.560  1.00 37.72 ? 230 GLU A C     1 
ATOM   1749  O  O     . GLU A  1 249 ? -42.821  15.445  -28.418  1.00 38.21 ? 230 GLU A O     1 
ATOM   1750  C  CB    . GLU A  1 249 ? -41.737  18.163  -26.877  1.00 37.84 ? 230 GLU A CB    1 
ATOM   1751  C  CG    . GLU A  1 249 ? -40.341  17.766  -27.292  1.00 37.84 ? 230 GLU A CG    1 
ATOM   1752  C  CD    . GLU A  1 249 ? -39.349  18.128  -26.196  1.00 39.29 ? 230 GLU A CD    1 
ATOM   1753  O  OE1   . GLU A  1 249 ? -39.074  19.364  -26.018  1.00 37.87 ? 230 GLU A OE1   1 
ATOM   1754  O  OE2   . GLU A  1 249 ? -38.892  17.163  -25.508  1.00 40.96 ? 230 GLU A OE2   1 
ATOM   1755  N  N     . ASP A  1 250 ? -43.806  15.913  -26.452  1.00 37.41 ? 231 ASP A N     1 
ATOM   1756  C  CA    . ASP A  1 250 ? -44.133  14.519  -26.188  1.00 37.57 ? 231 ASP A CA    1 
ATOM   1757  C  C     . ASP A  1 250 ? -44.895  13.894  -27.337  1.00 37.57 ? 231 ASP A C     1 
ATOM   1758  O  O     . ASP A  1 250 ? -44.763  12.713  -27.593  1.00 37.54 ? 231 ASP A O     1 
ATOM   1759  C  CB    . ASP A  1 250 ? -45.027  14.353  -24.952  1.00 38.29 ? 231 ASP A CB    1 
ATOM   1760  C  CG    . ASP A  1 250 ? -44.318  14.602  -23.641  1.00 39.99 ? 231 ASP A CG    1 
ATOM   1761  O  OD1   . ASP A  1 250 ? -43.062  14.753  -23.635  1.00 37.65 ? 231 ASP A OD1   1 
ATOM   1762  O  OD2   . ASP A  1 250 ? -45.071  14.630  -22.611  1.00 42.65 ? 231 ASP A OD2   1 
ATOM   1763  N  N     . PHE A  1 251 ? -45.748  14.674  -27.995  1.00 37.56 ? 232 PHE A N     1 
ATOM   1764  C  CA    . PHE A  1 251 ? -46.579  14.124  -29.062  1.00 37.25 ? 232 PHE A CA    1 
ATOM   1765  C  C     . PHE A  1 251 ? -45.917  14.139  -30.424  1.00 37.10 ? 232 PHE A C     1 
ATOM   1766  O  O     . PHE A  1 251 ? -46.573  13.845  -31.414  1.00 36.14 ? 232 PHE A O     1 
ATOM   1767  C  CB    . PHE A  1 251 ? -47.883  14.897  -29.150  1.00 37.49 ? 232 PHE A CB    1 
ATOM   1768  C  CG    . PHE A  1 251 ? -48.849  14.539  -28.083  1.00 37.50 ? 232 PHE A CG    1 
ATOM   1769  C  CD1   . PHE A  1 251 ? -49.696  13.459  -28.246  1.00 35.72 ? 232 PHE A CD1   1 
ATOM   1770  C  CD2   . PHE A  1 251 ? -48.893  15.272  -26.886  1.00 38.19 ? 232 PHE A CD2   1 
ATOM   1771  C  CE1   . PHE A  1 251 ? -50.568  13.109  -27.226  1.00 37.55 ? 232 PHE A CE1   1 
ATOM   1772  C  CE2   . PHE A  1 251 ? -49.789  14.942  -25.880  1.00 36.94 ? 232 PHE A CE2   1 
ATOM   1773  C  CZ    . PHE A  1 251 ? -50.618  13.855  -26.044  1.00 36.84 ? 232 PHE A CZ    1 
ATOM   1774  N  N     . GLY A  1 252 ? -44.631  14.516  -30.484  1.00 37.22 ? 233 GLY A N     1 
ATOM   1775  C  CA    . GLY A  1 252 ? -43.936  14.640  -31.757  1.00 36.89 ? 233 GLY A CA    1 
ATOM   1776  C  C     . GLY A  1 252 ? -44.468  15.741  -32.666  1.00 37.00 ? 233 GLY A C     1 
ATOM   1777  O  O     . GLY A  1 252 ? -44.359  15.631  -33.863  1.00 37.70 ? 233 GLY A O     1 
ATOM   1778  N  N     . VAL A  1 253 ? -45.034  16.813  -32.120  1.00 37.02 ? 234 VAL A N     1 
ATOM   1779  C  CA    . VAL A  1 253 ? -45.486  17.919  -32.954  1.00 37.53 ? 234 VAL A CA    1 
ATOM   1780  C  C     . VAL A  1 253 ? -45.001  19.251  -32.426  1.00 37.76 ? 234 VAL A C     1 
ATOM   1781  O  O     . VAL A  1 253 ? -44.430  19.318  -31.363  1.00 38.49 ? 234 VAL A O     1 
ATOM   1782  C  CB    . VAL A  1 253 ? -47.053  17.903  -33.182  1.00 37.72 ? 234 VAL A CB    1 
ATOM   1783  C  CG1   . VAL A  1 253 ? -47.522  16.480  -33.538  1.00 36.68 ? 234 VAL A CG1   1 
ATOM   1784  C  CG2   . VAL A  1 253 ? -47.779  18.435  -32.000  1.00 36.32 ? 234 VAL A CG2   1 
ATOM   1785  N  N     . ILE A  1 254 ? -45.222  20.295  -33.206  1.00 38.22 ? 235 ILE A N     1 
ATOM   1786  C  CA    . ILE A  1 254 ? -44.662  21.602  -32.996  1.00 38.74 ? 235 ILE A CA    1 
ATOM   1787  C  C     . ILE A  1 254 ? -45.864  22.506  -32.870  1.00 39.05 ? 235 ILE A C     1 
ATOM   1788  O  O     . ILE A  1 254 ? -46.820  22.368  -33.647  1.00 38.13 ? 235 ILE A O     1 
ATOM   1789  C  CB    . ILE A  1 254 ? -43.862  22.005  -34.271  1.00 39.50 ? 235 ILE A CB    1 
ATOM   1790  C  CG1   . ILE A  1 254 ? -42.434  21.471  -34.223  1.00 40.88 ? 235 ILE A CG1   1 
ATOM   1791  C  CG2   . ILE A  1 254 ? -43.805  23.502  -34.548  1.00 38.70 ? 235 ILE A CG2   1 
ATOM   1792  C  CD1   . ILE A  1 254 ? -41.964  21.111  -35.657  1.00 40.96 ? 235 ILE A CD1   1 
ATOM   1793  N  N     . ALA A  1 255 ? -45.805  23.435  -31.909  1.00 38.84 ? 236 ALA A N     1 
ATOM   1794  C  CA    . ALA A  1 255 ? -46.778  24.521  -31.782  1.00 38.44 ? 236 ALA A CA    1 
ATOM   1795  C  C     . ALA A  1 255 ? -46.176  25.766  -32.410  1.00 38.69 ? 236 ALA A C     1 
ATOM   1796  O  O     . ALA A  1 255 ? -45.096  26.166  -32.021  1.00 39.78 ? 236 ALA A O     1 
ATOM   1797  C  CB    . ALA A  1 255 ? -47.072  24.778  -30.317  1.00 37.18 ? 236 ALA A CB    1 
ATOM   1798  N  N     . THR A  1 256 ? -46.835  26.406  -33.357  1.00 38.40 ? 237 THR A N     1 
ATOM   1799  C  CA    . THR A  1 256 ? -46.326  27.722  -33.829  1.00 38.00 ? 237 THR A CA    1 
ATOM   1800  C  C     . THR A  1 256 ? -47.222  28.851  -33.324  1.00 37.73 ? 237 THR A C     1 
ATOM   1801  O  O     . THR A  1 256 ? -48.414  28.669  -33.181  1.00 37.78 ? 237 THR A O     1 
ATOM   1802  C  CB    . THR A  1 256 ? -46.217  27.810  -35.378  1.00 37.96 ? 237 THR A CB    1 
ATOM   1803  O  OG1   . THR A  1 256 ? -45.891  29.153  -35.761  1.00 38.04 ? 237 THR A OG1   1 
ATOM   1804  C  CG2   . THR A  1 256 ? -47.533  27.421  -36.081  1.00 37.75 ? 237 THR A CG2   1 
ATOM   1805  N  N     . PHE A  1 257 ? -46.638  29.991  -33.014  1.00 37.56 ? 238 PHE A N     1 
ATOM   1806  C  CA    . PHE A  1 257 ? -47.391  31.166  -32.677  1.00 38.14 ? 238 PHE A CA    1 
ATOM   1807  C  C     . PHE A  1 257 ? -47.159  32.238  -33.720  1.00 38.54 ? 238 PHE A C     1 
ATOM   1808  O  O     . PHE A  1 257 ? -47.351  33.411  -33.445  1.00 39.02 ? 238 PHE A O     1 
ATOM   1809  C  CB    . PHE A  1 257 ? -47.004  31.760  -31.332  1.00 38.59 ? 238 PHE A CB    1 
ATOM   1810  C  CG    . PHE A  1 257 ? -47.104  30.812  -30.167  1.00 39.70 ? 238 PHE A CG    1 
ATOM   1811  C  CD1   . PHE A  1 257 ? -48.197  29.992  -30.001  1.00 39.08 ? 238 PHE A CD1   1 
ATOM   1812  C  CD2   . PHE A  1 257 ? -46.109  30.798  -29.195  1.00 38.82 ? 238 PHE A CD2   1 
ATOM   1813  C  CE1   . PHE A  1 257 ? -48.273  29.157  -28.922  1.00 39.01 ? 238 PHE A CE1   1 
ATOM   1814  C  CE2   . PHE A  1 257 ? -46.185  29.973  -28.120  1.00 39.74 ? 238 PHE A CE2   1 
ATOM   1815  C  CZ    . PHE A  1 257 ? -47.263  29.148  -27.971  1.00 40.33 ? 238 PHE A CZ    1 
ATOM   1816  N  N     . ASP A  1 258 ? -46.776  31.862  -34.925  1.00 38.55 ? 239 ASP A N     1 
ATOM   1817  C  CA    . ASP A  1 258 ? -46.775  32.837  -35.976  1.00 39.14 ? 239 ASP A CA    1 
ATOM   1818  C  C     . ASP A  1 258 ? -48.183  33.380  -36.212  1.00 39.74 ? 239 ASP A C     1 
ATOM   1819  O  O     . ASP A  1 258 ? -49.140  32.613  -36.276  1.00 40.60 ? 239 ASP A O     1 
ATOM   1820  C  CB    . ASP A  1 258 ? -46.292  32.236  -37.254  1.00 39.30 ? 239 ASP A CB    1 
ATOM   1821  C  CG    . ASP A  1 258 ? -46.016  33.272  -38.270  1.00 40.69 ? 239 ASP A CG    1 
ATOM   1822  O  OD1   . ASP A  1 258 ? -44.907  33.856  -38.166  1.00 44.27 ? 239 ASP A OD1   1 
ATOM   1823  O  OD2   . ASP A  1 258 ? -46.907  33.531  -39.118  1.00 40.86 ? 239 ASP A OD2   1 
ATOM   1824  N  N     . PRO A  1 259 ? -48.311  34.697  -36.368  1.00 39.63 ? 240 PRO A N     1 
ATOM   1825  C  CA    . PRO A  1 259 ? -49.623  35.247  -36.604  1.00 39.48 ? 240 PRO A CA    1 
ATOM   1826  C  C     . PRO A  1 259 ? -50.287  34.892  -37.929  1.00 39.40 ? 240 PRO A C     1 
ATOM   1827  O  O     . PRO A  1 259 ? -51.484  35.124  -38.043  1.00 40.42 ? 240 PRO A O     1 
ATOM   1828  C  CB    . PRO A  1 259 ? -49.404  36.776  -36.525  1.00 39.45 ? 240 PRO A CB    1 
ATOM   1829  C  CG    . PRO A  1 259 ? -47.969  36.995  -36.761  1.00 39.62 ? 240 PRO A CG    1 
ATOM   1830  C  CD    . PRO A  1 259 ? -47.258  35.730  -36.340  1.00 40.12 ? 240 PRO A CD    1 
ATOM   1831  N  N     . LYS A  1 260 ? -49.565  34.390  -38.921  1.00 38.98 ? 241 LYS A N     1 
ATOM   1832  C  CA    . LYS A  1 260 ? -50.187  34.018  -40.211  1.00 39.39 ? 241 LYS A CA    1 
ATOM   1833  C  C     . LYS A  1 260 ? -49.415  32.839  -40.789  1.00 39.59 ? 241 LYS A C     1 
ATOM   1834  O  O     . LYS A  1 260 ? -48.701  32.970  -41.757  1.00 39.63 ? 241 LYS A O     1 
ATOM   1835  C  CB    . LYS A  1 260 ? -50.212  35.197  -41.215  1.00 39.51 ? 241 LYS A CB    1 
ATOM   1836  C  CG    . LYS A  1 260 ? -51.030  34.954  -42.517  1.00 38.50 ? 241 LYS A CG    1 
ATOM   1837  C  CD    . LYS A  1 260 ? -52.522  35.234  -42.269  1.00 39.74 ? 241 LYS A CD    1 
ATOM   1838  C  CE    . LYS A  1 260 ? -53.423  34.749  -43.397  1.00 39.62 ? 241 LYS A CE    1 
ATOM   1839  N  NZ    . LYS A  1 260 ? -54.743  35.439  -43.409  1.00 40.47 ? 241 LYS A NZ    1 
ATOM   1840  N  N     . PRO A  1 261 ? -49.550  31.671  -40.171  1.00 40.30 ? 242 PRO A N     1 
ATOM   1841  C  CA    . PRO A  1 261 ? -48.742  30.556  -40.580  1.00 40.46 ? 242 PRO A CA    1 
ATOM   1842  C  C     . PRO A  1 261 ? -49.045  30.028  -41.985  1.00 40.76 ? 242 PRO A C     1 
ATOM   1843  O  O     . PRO A  1 261 ? -48.161  29.525  -42.638  1.00 41.83 ? 242 PRO A O     1 
ATOM   1844  C  CB    . PRO A  1 261 ? -49.061  29.510  -39.519  1.00 40.91 ? 242 PRO A CB    1 
ATOM   1845  C  CG    . PRO A  1 261 ? -50.459  29.812  -39.127  1.00 40.41 ? 242 PRO A CG    1 
ATOM   1846  C  CD    . PRO A  1 261 ? -50.467  31.306  -39.077  1.00 40.30 ? 242 PRO A CD    1 
ATOM   1847  N  N     . ILE A  1 262 ? -50.265  30.113  -42.460  1.00 41.25 ? 243 ILE A N     1 
ATOM   1848  C  CA    . ILE A  1 262 ? -50.517  29.721  -43.839  1.00 41.20 ? 243 ILE A CA    1 
ATOM   1849  C  C     . ILE A  1 262 ? -51.152  30.890  -44.528  1.00 41.37 ? 243 ILE A C     1 
ATOM   1850  O  O     . ILE A  1 262 ? -52.251  31.266  -44.163  1.00 40.78 ? 243 ILE A O     1 
ATOM   1851  C  CB    . ILE A  1 262 ? -51.459  28.540  -43.927  1.00 41.01 ? 243 ILE A CB    1 
ATOM   1852  C  CG1   . ILE A  1 262 ? -50.855  27.350  -43.156  1.00 41.17 ? 243 ILE A CG1   1 
ATOM   1853  C  CG2   . ILE A  1 262 ? -51.703  28.187  -45.383  1.00 40.44 ? 243 ILE A CG2   1 
ATOM   1854  C  CD1   . ILE A  1 262 ? -49.627  26.669  -43.814  1.00 38.19 ? 243 ILE A CD1   1 
ATOM   1855  N  N     . PRO A  1 263 ? -50.456  31.476  -45.517  1.00 41.52 ? 244 PRO A N     1 
ATOM   1856  C  CA    . PRO A  1 263 ? -51.009  32.635  -46.214  1.00 41.74 ? 244 PRO A CA    1 
ATOM   1857  C  C     . PRO A  1 263 ? -52.226  32.262  -46.998  1.00 41.88 ? 244 PRO A C     1 
ATOM   1858  O  O     . PRO A  1 263 ? -52.397  31.105  -47.335  1.00 42.56 ? 244 PRO A O     1 
ATOM   1859  C  CB    . PRO A  1 263 ? -49.897  33.070  -47.175  1.00 41.34 ? 244 PRO A CB    1 
ATOM   1860  C  CG    . PRO A  1 263 ? -48.939  31.960  -47.224  1.00 42.05 ? 244 PRO A CG    1 
ATOM   1861  C  CD    . PRO A  1 263 ? -49.137  31.078  -46.032  1.00 41.60 ? 244 PRO A CD    1 
ATOM   1862  N  N     . GLY A  1 264 ? -53.061  33.243  -47.283  1.00 42.07 ? 245 GLY A N     1 
ATOM   1863  C  CA    . GLY A  1 264 ? -54.198  33.047  -48.168  1.00 42.47 ? 245 GLY A CA    1 
ATOM   1864  C  C     . GLY A  1 264 ? -55.492  32.970  -47.379  1.00 42.91 ? 245 GLY A C     1 
ATOM   1865  O  O     . GLY A  1 264 ? -55.632  33.629  -46.340  1.00 42.92 ? 245 GLY A O     1 
ATOM   1866  N  N     . ASN A  1 265 ? -56.423  32.146  -47.847  1.00 42.85 ? 246 ASN A N     1 
ATOM   1867  C  CA    . ASN A  1 265 ? -57.715  32.119  -47.230  1.00 43.31 ? 246 ASN A CA    1 
ATOM   1868  C  C     . ASN A  1 265 ? -57.726  31.221  -45.976  1.00 43.24 ? 246 ASN A C     1 
ATOM   1869  O  O     . ASN A  1 265 ? -58.466  30.234  -45.890  1.00 44.10 ? 246 ASN A O     1 
ATOM   1870  C  CB    . ASN A  1 265 ? -58.790  31.735  -48.273  1.00 43.67 ? 246 ASN A CB    1 
ATOM   1871  C  CG    . ASN A  1 265 ? -60.216  31.908  -47.739  1.00 44.03 ? 246 ASN A CG    1 
ATOM   1872  O  OD1   . ASN A  1 265 ? -60.426  32.473  -46.656  1.00 46.55 ? 246 ASN A OD1   1 
ATOM   1873  N  ND2   . ASN A  1 265 ? -61.194  31.405  -48.483  1.00 44.48 ? 246 ASN A ND2   1 
ATOM   1874  N  N     . TRP A  1 266 ? -56.898  31.559  -45.000  1.00 42.52 ? 247 TRP A N     1 
ATOM   1875  C  CA    . TRP A  1 266 ? -56.846  30.792  -43.768  1.00 42.01 ? 247 TRP A CA    1 
ATOM   1876  C  C     . TRP A  1 266 ? -56.668  31.773  -42.661  1.00 41.80 ? 247 TRP A C     1 
ATOM   1877  O  O     . TRP A  1 266 ? -55.944  32.719  -42.817  1.00 42.53 ? 247 TRP A O     1 
ATOM   1878  C  CB    . TRP A  1 266 ? -55.694  29.789  -43.798  1.00 41.44 ? 247 TRP A CB    1 
ATOM   1879  C  CG    . TRP A  1 266 ? -55.854  28.820  -44.927  1.00 41.50 ? 247 TRP A CG    1 
ATOM   1880  C  CD1   . TRP A  1 266 ? -55.212  28.845  -46.134  1.00 40.95 ? 247 TRP A CD1   1 
ATOM   1881  C  CD2   . TRP A  1 266 ? -56.750  27.710  -44.966  1.00 40.08 ? 247 TRP A CD2   1 
ATOM   1882  N  NE1   . TRP A  1 266 ? -55.646  27.801  -46.914  1.00 41.22 ? 247 TRP A NE1   1 
ATOM   1883  C  CE2   . TRP A  1 266 ? -56.592  27.092  -46.222  1.00 40.27 ? 247 TRP A CE2   1 
ATOM   1884  C  CE3   . TRP A  1 266 ? -57.660  27.170  -44.048  1.00 40.07 ? 247 TRP A CE3   1 
ATOM   1885  C  CZ2   . TRP A  1 266 ? -57.331  25.974  -46.606  1.00 40.21 ? 247 TRP A CZ2   1 
ATOM   1886  C  CZ3   . TRP A  1 266 ? -58.371  26.051  -44.411  1.00 40.33 ? 247 TRP A CZ3   1 
ATOM   1887  C  CH2   . TRP A  1 266 ? -58.210  25.464  -45.695  1.00 40.75 ? 247 TRP A CH2   1 
ATOM   1888  N  N     . ASN A  1 267 ? -57.341  31.567  -41.541  1.00 42.12 ? 248 ASN A N     1 
ATOM   1889  C  CA    . ASN A  1 267 ? -57.214  32.483  -40.415  1.00 41.78 ? 248 ASN A CA    1 
ATOM   1890  C  C     . ASN A  1 267 ? -55.806  32.510  -39.867  1.00 41.62 ? 248 ASN A C     1 
ATOM   1891  O  O     . ASN A  1 267 ? -55.107  31.508  -39.884  1.00 41.77 ? 248 ASN A O     1 
ATOM   1892  C  CB    . ASN A  1 267 ? -58.185  32.141  -39.265  1.00 41.51 ? 248 ASN A CB    1 
ATOM   1893  C  CG    . ASN A  1 267 ? -59.535  32.758  -39.458  1.00 40.07 ? 248 ASN A CG    1 
ATOM   1894  O  OD1   . ASN A  1 267 ? -59.946  32.910  -40.579  1.00 39.93 ? 248 ASN A OD1   1 
ATOM   1895  N  ND2   . ASN A  1 267 ? -60.231  33.124  -38.366  1.00 38.40 ? 248 ASN A ND2   1 
ATOM   1896  N  N     . GLY A  1 268 ? -55.438  33.692  -39.387  1.00 41.67 ? 249 GLY A N     1 
ATOM   1897  C  CA    . GLY A  1 268 ? -54.259  33.924  -38.596  1.00 41.46 ? 249 GLY A CA    1 
ATOM   1898  C  C     . GLY A  1 268 ? -54.536  33.688  -37.122  1.00 41.77 ? 249 GLY A C     1 
ATOM   1899  O  O     . GLY A  1 268 ? -55.623  33.247  -36.719  1.00 41.48 ? 249 GLY A O     1 
ATOM   1900  N  N     . ALA A  1 269 ? -53.506  33.974  -36.326  1.00 42.07 ? 250 ALA A N     1 
ATOM   1901  C  CA    . ALA A  1 269 ? -53.438  33.623  -34.908  1.00 41.39 ? 250 ALA A CA    1 
ATOM   1902  C  C     . ALA A  1 269 ? -53.109  34.906  -34.207  1.00 41.16 ? 250 ALA A C     1 
ATOM   1903  O  O     . ALA A  1 269 ? -52.054  35.503  -34.462  1.00 41.01 ? 250 ALA A O     1 
ATOM   1904  C  CB    . ALA A  1 269 ? -52.347  32.617  -34.663  1.00 40.83 ? 250 ALA A CB    1 
ATOM   1905  N  N     . GLY A  1 270 ? -54.022  35.358  -33.369  1.00 40.59 ? 251 GLY A N     1 
ATOM   1906  C  CA    . GLY A  1 270 ? -53.760  36.509  -32.535  1.00 40.85 ? 251 GLY A CA    1 
ATOM   1907  C  C     . GLY A  1 270 ? -53.552  36.066  -31.103  1.00 40.87 ? 251 GLY A C     1 
ATOM   1908  O  O     . GLY A  1 270 ? -53.604  34.864  -30.795  1.00 40.63 ? 251 GLY A O     1 
ATOM   1909  N  N     . CYS A  1 271 ? -53.359  37.049  -30.229  1.00 41.03 ? 252 CYS A N     1 
ATOM   1910  C  CA    . CYS A  1 271 ? -53.405  36.828  -28.787  1.00 40.63 ? 252 CYS A CA    1 
ATOM   1911  C  C     . CYS A  1 271 ? -54.199  37.963  -28.154  1.00 40.30 ? 252 CYS A C     1 
ATOM   1912  O  O     . CYS A  1 271 ? -53.615  38.859  -27.516  1.00 40.12 ? 252 CYS A O     1 
ATOM   1913  C  CB    . CYS A  1 271 ? -51.990  36.788  -28.208  1.00 41.16 ? 252 CYS A CB    1 
ATOM   1914  S  SG    . CYS A  1 271 ? -51.926  36.301  -26.438  1.00 42.93 ? 252 CYS A SG    1 
ATOM   1915  N  N     . HIS A  1 272 ? -55.524  37.921  -28.348  1.00 40.13 ? 253 HIS A N     1 
ATOM   1916  C  CA    . HIS A  1 272 ? -56.466  38.967  -27.867  1.00 39.43 ? 253 HIS A CA    1 
ATOM   1917  C  C     . HIS A  1 272 ? -56.253  39.177  -26.382  1.00 39.33 ? 253 HIS A C     1 
ATOM   1918  O  O     . HIS A  1 272 ? -56.215  38.213  -25.607  1.00 39.31 ? 253 HIS A O     1 
ATOM   1919  C  CB    . HIS A  1 272 ? -57.927  38.573  -28.079  1.00 39.00 ? 253 HIS A CB    1 
ATOM   1920  C  CG    . HIS A  1 272 ? -58.259  38.156  -29.481  1.00 38.30 ? 253 HIS A CG    1 
ATOM   1921  N  ND1   . HIS A  1 272 ? -59.330  37.335  -29.783  1.00 38.71 ? 253 HIS A ND1   1 
ATOM   1922  C  CD2   . HIS A  1 272 ? -57.658  38.440  -30.659  1.00 37.54 ? 253 HIS A CD2   1 
ATOM   1923  C  CE1   . HIS A  1 272 ? -59.372  37.137  -31.089  1.00 38.14 ? 253 HIS A CE1   1 
ATOM   1924  N  NE2   . HIS A  1 272 ? -58.370  37.802  -31.645  1.00 37.24 ? 253 HIS A NE2   1 
ATOM   1925  N  N     . THR A  1 273 ? -56.096  40.429  -25.975  1.00 39.53 ? 254 THR A N     1 
ATOM   1926  C  CA    . THR A  1 273 ? -55.812  40.728  -24.589  1.00 39.97 ? 254 THR A CA    1 
ATOM   1927  C  C     . THR A  1 273 ? -57.008  41.449  -24.027  1.00 40.39 ? 254 THR A C     1 
ATOM   1928  O  O     . THR A  1 273 ? -57.385  42.480  -24.525  1.00 40.21 ? 254 THR A O     1 
ATOM   1929  C  CB    . THR A  1 273 ? -54.508  41.505  -24.460  1.00 39.70 ? 254 THR A CB    1 
ATOM   1930  O  OG1   . THR A  1 273 ? -53.459  40.707  -25.025  1.00 39.97 ? 254 THR A OG1   1 
ATOM   1931  C  CG2   . THR A  1 273 ? -54.157  41.786  -23.011  1.00 39.04 ? 254 THR A CG2   1 
ATOM   1932  N  N     . ASN A  1 274 ? -57.644  40.826  -23.036  1.00 41.33 ? 255 ASN A N     1 
ATOM   1933  C  CA    . ASN A  1 274 ? -58.819  41.358  -22.371  1.00 41.73 ? 255 ASN A CA    1 
ATOM   1934  C  C     . ASN A  1 274 ? -58.349  42.071  -21.110  1.00 42.41 ? 255 ASN A C     1 
ATOM   1935  O  O     . ASN A  1 274 ? -57.571  41.506  -20.348  1.00 43.35 ? 255 ASN A O     1 
ATOM   1936  C  CB    . ASN A  1 274 ? -59.787  40.229  -22.023  1.00 41.14 ? 255 ASN A CB    1 
ATOM   1937  C  CG    . ASN A  1 274 ? -60.353  39.556  -23.252  1.00 42.21 ? 255 ASN A CG    1 
ATOM   1938  O  OD1   . ASN A  1 274 ? -61.371  39.993  -23.812  1.00 41.09 ? 255 ASN A OD1   1 
ATOM   1939  N  ND2   . ASN A  1 274 ? -59.707  38.471  -23.678  1.00 42.29 ? 255 ASN A ND2   1 
ATOM   1940  N  N     . PHE A  1 275 ? -58.841  43.282  -20.873  1.00 42.89 ? 256 PHE A N     1 
ATOM   1941  C  CA    . PHE A  1 275 ? -58.309  44.131  -19.834  1.00 43.38 ? 256 PHE A CA    1 
ATOM   1942  C  C     . PHE A  1 275 ? -59.419  44.787  -19.005  1.00 44.26 ? 256 PHE A C     1 
ATOM   1943  O  O     . PHE A  1 275 ? -60.441  45.220  -19.544  1.00 44.87 ? 256 PHE A O     1 
ATOM   1944  C  CB    . PHE A  1 275 ? -57.419  45.183  -20.507  1.00 43.86 ? 256 PHE A CB    1 
ATOM   1945  C  CG    . PHE A  1 275 ? -56.884  46.229  -19.582  1.00 42.81 ? 256 PHE A CG    1 
ATOM   1946  C  CD1   . PHE A  1 275 ? -56.353  45.897  -18.375  1.00 43.39 ? 256 PHE A CD1   1 
ATOM   1947  C  CD2   . PHE A  1 275 ? -56.924  47.554  -19.939  1.00 44.49 ? 256 PHE A CD2   1 
ATOM   1948  C  CE1   . PHE A  1 275 ? -55.871  46.881  -17.520  1.00 44.82 ? 256 PHE A CE1   1 
ATOM   1949  C  CE2   . PHE A  1 275 ? -56.426  48.531  -19.112  1.00 44.12 ? 256 PHE A CE2   1 
ATOM   1950  C  CZ    . PHE A  1 275 ? -55.905  48.196  -17.890  1.00 43.86 ? 256 PHE A CZ    1 
ATOM   1951  N  N     . SER A  1 276 ? -59.217  44.847  -17.690  1.00 44.59 ? 257 SER A N     1 
ATOM   1952  C  CA    . SER A  1 276 ? -60.066  45.639  -16.824  1.00 44.90 ? 257 SER A CA    1 
ATOM   1953  C  C     . SER A  1 276 ? -59.342  46.120  -15.573  1.00 45.55 ? 257 SER A C     1 
ATOM   1954  O  O     . SER A  1 276 ? -58.443  45.474  -15.057  1.00 45.81 ? 257 SER A O     1 
ATOM   1955  C  CB    . SER A  1 276 ? -61.285  44.844  -16.412  1.00 44.93 ? 257 SER A CB    1 
ATOM   1956  O  OG    . SER A  1 276 ? -60.947  43.885  -15.438  1.00 43.77 ? 257 SER A OG    1 
ATOM   1957  N  N     . THR A  1 277 ? -59.754  47.280  -15.099  1.00 46.69 ? 258 THR A N     1 
ATOM   1958  C  CA    . THR A  1 277 ? -59.376  47.768  -13.782  1.00 47.18 ? 258 THR A CA    1 
ATOM   1959  C  C     . THR A  1 277 ? -60.578  47.501  -12.868  1.00 48.09 ? 258 THR A C     1 
ATOM   1960  O  O     . THR A  1 277 ? -61.648  47.068  -13.328  1.00 48.17 ? 258 THR A O     1 
ATOM   1961  C  CB    . THR A  1 277 ? -59.057  49.303  -13.801  1.00 46.94 ? 258 THR A CB    1 
ATOM   1962  O  OG1   . THR A  1 277 ? -60.240  50.033  -14.161  1.00 47.06 ? 258 THR A OG1   1 
ATOM   1963  C  CG2   . THR A  1 277 ? -57.944  49.644  -14.782  1.00 45.63 ? 258 THR A CG2   1 
ATOM   1964  N  N     . LYS A  1 278 ? -60.399  47.792  -11.583  1.00 49.00 ? 259 LYS A N     1 
ATOM   1965  C  CA    . LYS A  1 278 ? -61.457  47.680  -10.592  1.00 49.00 ? 259 LYS A CA    1 
ATOM   1966  C  C     . LYS A  1 278 ? -62.669  48.527  -10.977  1.00 48.64 ? 259 LYS A C     1 
ATOM   1967  O  O     . LYS A  1 278 ? -63.807  48.063  -10.885  1.00 48.51 ? 259 LYS A O     1 
ATOM   1968  C  CB    . LYS A  1 278 ? -60.920  48.111  -9.224   1.00 49.66 ? 259 LYS A CB    1 
ATOM   1969  C  CG    . LYS A  1 278 ? -61.714  47.575  -8.027   1.00 50.54 ? 259 LYS A CG    1 
ATOM   1970  C  CD    . LYS A  1 278 ? -61.396  48.406  -6.761   1.00 51.64 ? 259 LYS A CD    1 
ATOM   1971  C  CE    . LYS A  1 278 ? -62.187  47.920  -5.521   1.00 53.30 ? 259 LYS A CE    1 
ATOM   1972  N  NZ    . LYS A  1 278 ? -62.169  48.967  -4.438   1.00 53.28 ? 259 LYS A NZ    1 
ATOM   1973  N  N     . ALA A  1 279 ? -62.410  49.762  -11.406  1.00 48.34 ? 260 ALA A N     1 
ATOM   1974  C  CA    . ALA A  1 279 ? -63.465  50.711  -11.785  1.00 48.15 ? 260 ALA A CA    1 
ATOM   1975  C  C     . ALA A  1 279 ? -64.277  50.165  -12.946  1.00 48.27 ? 260 ALA A C     1 
ATOM   1976  O  O     . ALA A  1 279 ? -65.489  50.377  -13.031  1.00 48.22 ? 260 ALA A O     1 
ATOM   1977  C  CB    . ALA A  1 279 ? -62.872  52.059  -12.164  1.00 47.06 ? 260 ALA A CB    1 
ATOM   1978  N  N     . MET A  1 280 ? -63.609  49.473  -13.857  1.00 48.43 ? 261 MET A N     1 
ATOM   1979  C  CA    . MET A  1 280 ? -64.284  48.984  -15.041  1.00 48.66 ? 261 MET A CA    1 
ATOM   1980  C  C     . MET A  1 280 ? -65.167  47.821  -14.676  1.00 49.13 ? 261 MET A C     1 
ATOM   1981  O  O     . MET A  1 280 ? -66.187  47.594  -15.341  1.00 48.66 ? 261 MET A O     1 
ATOM   1982  C  CB    . MET A  1 280 ? -63.289  48.560  -16.107  1.00 48.60 ? 261 MET A CB    1 
ATOM   1983  C  CG    . MET A  1 280 ? -62.595  49.703  -16.733  1.00 48.38 ? 261 MET A CG    1 
ATOM   1984  S  SD    . MET A  1 280 ? -61.218  49.184  -17.732  1.00 47.12 ? 261 MET A SD    1 
ATOM   1985  C  CE    . MET A  1 280 ? -60.294  50.713  -17.897  1.00 46.21 ? 261 MET A CE    1 
ATOM   1986  N  N     . ARG A  1 281 ? -64.779  47.094  -13.622  1.00 49.83 ? 262 ARG A N     1 
ATOM   1987  C  CA    . ARG A  1 281 ? -65.552  45.928  -13.153  1.00 50.37 ? 262 ARG A CA    1 
ATOM   1988  C  C     . ARG A  1 281 ? -66.698  46.255  -12.209  1.00 50.85 ? 262 ARG A C     1 
ATOM   1989  O  O     . ARG A  1 281 ? -67.451  45.371  -11.866  1.00 50.77 ? 262 ARG A O     1 
ATOM   1990  C  CB    . ARG A  1 281 ? -64.640  44.922  -12.466  1.00 50.08 ? 262 ARG A CB    1 
ATOM   1991  C  CG    . ARG A  1 281 ? -63.573  44.395  -13.353  1.00 49.64 ? 262 ARG A CG    1 
ATOM   1992  C  CD    . ARG A  1 281 ? -62.794  43.222  -12.712  1.00 49.82 ? 262 ARG A CD    1 
ATOM   1993  N  NE    . ARG A  1 281 ? -61.950  43.549  -11.561  1.00 48.09 ? 262 ARG A NE    1 
ATOM   1994  C  CZ    . ARG A  1 281 ? -60.746  44.093  -11.614  1.00 46.86 ? 262 ARG A CZ    1 
ATOM   1995  N  NH1   . ARG A  1 281 ? -60.198  44.427  -12.770  1.00 48.10 ? 262 ARG A NH1   1 
ATOM   1996  N  NH2   . ARG A  1 281 ? -60.096  44.320  -10.492  1.00 47.48 ? 262 ARG A NH2   1 
ATOM   1997  N  N     . GLU A  1 282 ? -66.815  47.504  -11.770  1.00 52.23 ? 263 GLU A N     1 
ATOM   1998  C  CA    . GLU A  1 282 ? -67.904  47.919  -10.877  1.00 53.22 ? 263 GLU A CA    1 
ATOM   1999  C  C     . GLU A  1 282 ? -69.107  48.392  -11.678  1.00 53.73 ? 263 GLU A C     1 
ATOM   2000  O  O     . GLU A  1 282 ? -69.044  48.474  -12.909  1.00 53.28 ? 263 GLU A O     1 
ATOM   2001  C  CB    . GLU A  1 282 ? -67.430  49.011  -9.918   1.00 53.41 ? 263 GLU A CB    1 
ATOM   2002  C  CG    . GLU A  1 282 ? -66.674  48.448  -8.711   1.00 54.36 ? 263 GLU A CG    1 
ATOM   2003  C  CD    . GLU A  1 282 ? -65.725  49.457  -8.057   1.00 55.00 ? 263 GLU A CD    1 
ATOM   2004  O  OE1   . GLU A  1 282 ? -65.911  50.697  -8.222   1.00 56.20 ? 263 GLU A OE1   1 
ATOM   2005  O  OE2   . GLU A  1 282 ? -64.775  48.984  -7.379   1.00 58.25 ? 263 GLU A OE2   1 
ATOM   2006  N  N     . GLU A  1 283 ? -70.209  48.675  -10.977  1.00 54.61 ? 264 GLU A N     1 
ATOM   2007  C  CA    . GLU A  1 283 ? -71.438  49.099  -11.638  1.00 55.25 ? 264 GLU A CA    1 
ATOM   2008  C  C     . GLU A  1 283 ? -71.153  50.329  -12.471  1.00 55.21 ? 264 GLU A C     1 
ATOM   2009  O  O     . GLU A  1 283 ? -70.532  51.282  -11.986  1.00 54.89 ? 264 GLU A O     1 
ATOM   2010  C  CB    . GLU A  1 283 ? -72.598  49.383  -10.645  1.00 56.23 ? 264 GLU A CB    1 
ATOM   2011  C  CG    . GLU A  1 283 ? -73.324  48.119  -10.065  1.00 59.12 ? 264 GLU A CG    1 
ATOM   2012  C  CD    . GLU A  1 283 ? -73.733  47.045  -11.133  1.00 63.30 ? 264 GLU A CD    1 
ATOM   2013  O  OE1   . GLU A  1 283 ? -73.949  47.371  -12.339  1.00 65.39 ? 264 GLU A OE1   1 
ATOM   2014  O  OE2   . GLU A  1 283 ? -73.833  45.855  -10.750  1.00 65.03 ? 264 GLU A OE2   1 
ATOM   2015  N  N     . ASN A  1 284 ? -71.619  50.283  -13.721  1.00 55.22 ? 265 ASN A N     1 
ATOM   2016  C  CA    . ASN A  1 284 ? -71.374  51.325  -14.711  1.00 55.49 ? 265 ASN A CA    1 
ATOM   2017  C  C     . ASN A  1 284 ? -69.883  51.568  -14.940  1.00 55.42 ? 265 ASN A C     1 
ATOM   2018  O  O     . ASN A  1 284 ? -69.416  52.702  -15.080  1.00 55.75 ? 265 ASN A O     1 
ATOM   2019  C  CB    . ASN A  1 284 ? -72.156  52.584  -14.357  1.00 55.83 ? 265 ASN A CB    1 
ATOM   2020  C  CG    . ASN A  1 284 ? -73.657  52.343  -14.442  1.00 57.50 ? 265 ASN A CG    1 
ATOM   2021  O  OD1   . ASN A  1 284 ? -74.358  52.330  -13.425  1.00 59.16 ? 265 ASN A OD1   1 
ATOM   2022  N  ND2   . ASN A  1 284 ? -74.146  52.081  -15.659  1.00 57.79 ? 265 ASN A ND2   1 
ATOM   2023  N  N     . GLY A  1 285 ? -69.146  50.465  -14.985  1.00 55.14 ? 266 GLY A N     1 
ATOM   2024  C  CA    . GLY A  1 285 ? -67.754  50.495  -15.335  1.00 54.89 ? 266 GLY A CA    1 
ATOM   2025  C  C     . GLY A  1 285 ? -67.563  50.680  -16.825  1.00 54.69 ? 266 GLY A C     1 
ATOM   2026  O  O     . GLY A  1 285 ? -66.449  50.981  -17.258  1.00 54.78 ? 266 GLY A O     1 
ATOM   2027  N  N     . LEU A  1 286 ? -68.631  50.498  -17.612  1.00 54.41 ? 267 LEU A N     1 
ATOM   2028  C  CA    . LEU A  1 286 ? -68.586  50.771  -19.061  1.00 54.39 ? 267 LEU A CA    1 
ATOM   2029  C  C     . LEU A  1 286 ? -68.102  52.207  -19.332  1.00 54.36 ? 267 LEU A C     1 
ATOM   2030  O  O     . LEU A  1 286 ? -67.490  52.496  -20.363  1.00 54.66 ? 267 LEU A O     1 
ATOM   2031  C  CB    . LEU A  1 286 ? -69.965  50.489  -19.708  1.00 54.10 ? 267 LEU A CB    1 
ATOM   2032  C  CG    . LEU A  1 286 ? -70.190  50.615  -21.231  1.00 53.97 ? 267 LEU A CG    1 
ATOM   2033  C  CD1   . LEU A  1 286 ? -69.143  49.837  -22.037  1.00 53.25 ? 267 LEU A CD1   1 
ATOM   2034  C  CD2   . LEU A  1 286 ? -71.618  50.157  -21.606  1.00 53.54 ? 267 LEU A CD2   1 
ATOM   2035  N  N     . LYS A  1 287 ? -68.375  53.100  -18.393  1.00 54.63 ? 268 LYS A N     1 
ATOM   2036  C  CA    . LYS A  1 287 ? -67.927  54.476  -18.480  1.00 54.86 ? 268 LYS A CA    1 
ATOM   2037  C  C     . LYS A  1 287 ? -66.402  54.536  -18.643  1.00 54.46 ? 268 LYS A C     1 
ATOM   2038  O  O     . LYS A  1 287 ? -65.889  55.235  -19.516  1.00 54.36 ? 268 LYS A O     1 
ATOM   2039  C  CB    . LYS A  1 287 ? -68.399  55.232  -17.218  1.00 55.24 ? 268 LYS A CB    1 
ATOM   2040  C  CG    . LYS A  1 287 ? -68.030  56.707  -17.148  1.00 55.56 ? 268 LYS A CG    1 
ATOM   2041  C  CD    . LYS A  1 287 ? -68.071  57.244  -15.705  1.00 56.43 ? 268 LYS A CD    1 
ATOM   2042  C  CE    . LYS A  1 287 ? -67.864  58.780  -15.644  1.00 57.65 ? 268 LYS A CE    1 
ATOM   2043  N  NZ    . LYS A  1 287 ? -66.428  59.162  -15.629  1.00 58.87 ? 268 LYS A NZ    1 
ATOM   2044  N  N     . TYR A  1 288 ? -65.701  53.782  -17.798  1.00 54.25 ? 269 TYR A N     1 
ATOM   2045  C  CA    . TYR A  1 288 ? -64.238  53.751  -17.759  1.00 53.93 ? 269 TYR A CA    1 
ATOM   2046  C  C     . TYR A  1 288 ? -63.656  52.878  -18.856  1.00 53.36 ? 269 TYR A C     1 
ATOM   2047  O  O     . TYR A  1 288 ? -62.529  53.124  -19.305  1.00 53.36 ? 269 TYR A O     1 
ATOM   2048  C  CB    . TYR A  1 288 ? -63.727  53.278  -16.376  1.00 54.80 ? 269 TYR A CB    1 
ATOM   2049  C  CG    . TYR A  1 288 ? -64.227  54.150  -15.242  1.00 55.74 ? 269 TYR A CG    1 
ATOM   2050  C  CD1   . TYR A  1 288 ? -63.645  55.392  -14.982  1.00 56.11 ? 269 TYR A CD1   1 
ATOM   2051  C  CD2   . TYR A  1 288 ? -65.327  53.761  -14.461  1.00 56.60 ? 269 TYR A CD2   1 
ATOM   2052  C  CE1   . TYR A  1 288 ? -64.124  56.213  -13.951  1.00 56.51 ? 269 TYR A CE1   1 
ATOM   2053  C  CE2   . TYR A  1 288 ? -65.817  54.572  -13.445  1.00 56.06 ? 269 TYR A CE2   1 
ATOM   2054  C  CZ    . TYR A  1 288 ? -65.209  55.792  -13.195  1.00 57.14 ? 269 TYR A CZ    1 
ATOM   2055  O  OH    . TYR A  1 288 ? -65.694  56.594  -12.195  1.00 57.35 ? 269 TYR A OH    1 
ATOM   2056  N  N     . ILE A  1 289 ? -64.392  51.856  -19.283  1.00 52.27 ? 270 ILE A N     1 
ATOM   2057  C  CA    . ILE A  1 289 ? -63.976  51.126  -20.445  1.00 52.25 ? 270 ILE A CA    1 
ATOM   2058  C  C     . ILE A  1 289 ? -63.921  52.089  -21.615  1.00 52.18 ? 270 ILE A C     1 
ATOM   2059  O  O     . ILE A  1 289 ? -62.918  52.181  -22.321  1.00 51.87 ? 270 ILE A O     1 
ATOM   2060  C  CB    . ILE A  1 289 ? -64.897  49.983  -20.771  1.00 52.15 ? 270 ILE A CB    1 
ATOM   2061  C  CG1   . ILE A  1 289 ? -64.760  48.891  -19.708  1.00 51.76 ? 270 ILE A CG1   1 
ATOM   2062  C  CG2   . ILE A  1 289 ? -64.561  49.435  -22.147  1.00 51.10 ? 270 ILE A CG2   1 
ATOM   2063  C  CD1   . ILE A  1 289 ? -65.870  47.892  -19.739  1.00 51.32 ? 270 ILE A CD1   1 
ATOM   2064  N  N     . GLU A  1 290 ? -64.986  52.848  -21.797  1.00 52.76 ? 271 GLU A N     1 
ATOM   2065  C  CA    . GLU A  1 290 ? -65.031  53.813  -22.896  1.00 53.20 ? 271 GLU A CA    1 
ATOM   2066  C  C     . GLU A  1 290 ? -63.926  54.844  -22.797  1.00 52.84 ? 271 GLU A C     1 
ATOM   2067  O  O     . GLU A  1 290 ? -63.374  55.241  -23.816  1.00 52.81 ? 271 GLU A O     1 
ATOM   2068  C  CB    . GLU A  1 290 ? -66.418  54.438  -23.028  1.00 53.07 ? 271 GLU A CB    1 
ATOM   2069  C  CG    . GLU A  1 290 ? -67.381  53.452  -23.690  1.00 54.11 ? 271 GLU A CG    1 
ATOM   2070  C  CD    . GLU A  1 290 ? -68.867  53.785  -23.531  1.00 55.02 ? 271 GLU A CD    1 
ATOM   2071  O  OE1   . GLU A  1 290 ? -69.223  54.786  -22.854  1.00 57.09 ? 271 GLU A OE1   1 
ATOM   2072  O  OE2   . GLU A  1 290 ? -69.686  53.018  -24.091  1.00 57.45 ? 271 GLU A OE2   1 
ATOM   2073  N  N     . GLU A  1 291 ? -63.573  55.252  -21.583  1.00 52.72 ? 272 GLU A N     1 
ATOM   2074  C  CA    . GLU A  1 291 ? -62.446  56.164  -21.407  1.00 53.16 ? 272 GLU A CA    1 
ATOM   2075  C  C     . GLU A  1 291 ? -61.142  55.520  -21.809  1.00 52.49 ? 272 GLU A C     1 
ATOM   2076  O  O     . GLU A  1 291 ? -60.293  56.195  -22.370  1.00 52.44 ? 272 GLU A O     1 
ATOM   2077  C  CB    . GLU A  1 291 ? -62.304  56.640  -19.962  1.00 53.36 ? 272 GLU A CB    1 
ATOM   2078  C  CG    . GLU A  1 291 ? -63.283  57.722  -19.579  1.00 55.21 ? 272 GLU A CG    1 
ATOM   2079  C  CD    . GLU A  1 291 ? -63.143  58.175  -18.119  1.00 55.80 ? 272 GLU A CD    1 
ATOM   2080  O  OE1   . GLU A  1 291 ? -61.979  58.208  -17.608  1.00 58.38 ? 272 GLU A OE1   1 
ATOM   2081  O  OE2   . GLU A  1 291 ? -64.209  58.502  -17.507  1.00 57.58 ? 272 GLU A OE2   1 
ATOM   2082  N  N     . ALA A  1 292 ? -60.969  54.235  -21.489  1.00 51.82 ? 273 ALA A N     1 
ATOM   2083  C  CA    . ALA A  1 292 ? -59.734  53.530  -21.848  1.00 51.70 ? 273 ALA A CA    1 
ATOM   2084  C  C     . ALA A  1 292 ? -59.599  53.384  -23.366  1.00 51.20 ? 273 ALA A C     1 
ATOM   2085  O  O     . ALA A  1 292 ? -58.533  53.633  -23.908  1.00 50.74 ? 273 ALA A O     1 
ATOM   2086  C  CB    . ALA A  1 292 ? -59.646  52.172  -21.160  1.00 51.22 ? 273 ALA A CB    1 
ATOM   2087  N  N     . ILE A  1 293 ? -60.683  53.012  -24.042  1.00 51.12 ? 274 ILE A N     1 
ATOM   2088  C  CA    . ILE A  1 293 ? -60.687  52.894  -25.506  1.00 51.30 ? 274 ILE A CA    1 
ATOM   2089  C  C     . ILE A  1 293 ? -60.356  54.229  -26.178  1.00 51.40 ? 274 ILE A C     1 
ATOM   2090  O  O     . ILE A  1 293 ? -59.637  54.276  -27.180  1.00 51.30 ? 274 ILE A O     1 
ATOM   2091  C  CB    . ILE A  1 293 ? -62.049  52.398  -26.013  1.00 51.43 ? 274 ILE A CB    1 
ATOM   2092  C  CG1   . ILE A  1 293 ? -62.255  50.935  -25.585  1.00 51.86 ? 274 ILE A CG1   1 
ATOM   2093  C  CG2   . ILE A  1 293 ? -62.120  52.517  -27.515  1.00 51.14 ? 274 ILE A CG2   1 
ATOM   2094  C  CD1   . ILE A  1 293 ? -63.676  50.464  -25.608  1.00 50.85 ? 274 ILE A CD1   1 
ATOM   2095  N  N     . GLU A  1 294 ? -60.877  55.310  -25.607  1.00 51.85 ? 275 GLU A N     1 
ATOM   2096  C  CA    . GLU A  1 294 ? -60.626  56.651  -26.098  1.00 51.52 ? 275 GLU A CA    1 
ATOM   2097  C  C     . GLU A  1 294 ? -59.137  56.923  -26.135  1.00 51.19 ? 275 GLU A C     1 
ATOM   2098  O  O     . GLU A  1 294 ? -58.626  57.389  -27.142  1.00 51.43 ? 275 GLU A O     1 
ATOM   2099  C  CB    . GLU A  1 294 ? -61.345  57.662  -25.205  1.00 52.41 ? 275 GLU A CB    1 
ATOM   2100  C  CG    . GLU A  1 294 ? -60.921  59.154  -25.342  1.00 53.86 ? 275 GLU A CG    1 
ATOM   2101  C  CD    . GLU A  1 294 ? -61.235  59.740  -26.723  1.00 58.65 ? 275 GLU A CD    1 
ATOM   2102  O  OE1   . GLU A  1 294 ? -62.021  59.105  -27.483  1.00 60.38 ? 275 GLU A OE1   1 
ATOM   2103  O  OE2   . GLU A  1 294 ? -60.690  60.834  -27.048  1.00 60.91 ? 275 GLU A OE2   1 
ATOM   2104  N  N     . LYS A  1 295 ? -58.441  56.628  -25.044  1.00 50.68 ? 276 LYS A N     1 
ATOM   2105  C  CA    . LYS A  1 295 ? -56.995  56.847  -24.968  1.00 50.68 ? 276 LYS A CA    1 
ATOM   2106  C  C     . LYS A  1 295 ? -56.235  55.947  -25.924  1.00 50.64 ? 276 LYS A C     1 
ATOM   2107  O  O     . LYS A  1 295 ? -55.250  56.355  -26.499  1.00 50.84 ? 276 LYS A O     1 
ATOM   2108  C  CB    . LYS A  1 295 ? -56.480  56.620  -23.546  1.00 50.75 ? 276 LYS A CB    1 
ATOM   2109  C  CG    . LYS A  1 295 ? -56.974  57.628  -22.548  1.00 50.56 ? 276 LYS A CG    1 
ATOM   2110  C  CD    . LYS A  1 295 ? -56.909  57.141  -21.139  1.00 50.57 ? 276 LYS A CD    1 
ATOM   2111  C  CE    . LYS A  1 295 ? -57.327  58.259  -20.201  1.00 50.17 ? 276 LYS A CE    1 
ATOM   2112  N  NZ    . LYS A  1 295 ? -57.506  57.767  -18.821  1.00 50.07 ? 276 LYS A NZ    1 
ATOM   2113  N  N     . LEU A  1 296 ? -56.695  54.714  -26.091  1.00 50.89 ? 277 LEU A N     1 
ATOM   2114  C  CA    . LEU A  1 296 ? -56.094  53.808  -27.049  1.00 50.76 ? 277 LEU A CA    1 
ATOM   2115  C  C     . LEU A  1 296 ? -56.244  54.298  -28.503  1.00 50.71 ? 277 LEU A C     1 
ATOM   2116  O  O     . LEU A  1 296 ? -55.343  54.139  -29.292  1.00 51.00 ? 277 LEU A O     1 
ATOM   2117  C  CB    . LEU A  1 296 ? -56.663  52.389  -26.876  1.00 50.39 ? 277 LEU A CB    1 
ATOM   2118  C  CG    . LEU A  1 296 ? -56.359  51.657  -25.552  1.00 49.32 ? 277 LEU A CG    1 
ATOM   2119  C  CD1   . LEU A  1 296 ? -57.223  50.371  -25.465  1.00 46.85 ? 277 LEU A CD1   1 
ATOM   2120  C  CD2   . LEU A  1 296 ? -54.884  51.349  -25.354  1.00 45.73 ? 277 LEU A CD2   1 
ATOM   2121  N  N     . SER A  1 297 ? -57.363  54.894  -28.868  1.00 51.01 ? 278 SER A N     1 
ATOM   2122  C  CA    . SER A  1 297 ? -57.534  55.346  -30.256  1.00 51.44 ? 278 SER A CA    1 
ATOM   2123  C  C     . SER A  1 297 ? -56.491  56.394  -30.670  1.00 51.67 ? 278 SER A C     1 
ATOM   2124  O  O     . SER A  1 297 ? -56.187  56.567  -31.854  1.00 51.95 ? 278 SER A O     1 
ATOM   2125  C  CB    . SER A  1 297 ? -58.934  55.907  -30.466  1.00 51.27 ? 278 SER A CB    1 
ATOM   2126  O  OG    . SER A  1 297 ? -59.130  57.028  -29.634  1.00 51.43 ? 278 SER A OG    1 
ATOM   2127  N  N     . LYS A  1 298 ? -55.913  57.070  -29.692  1.00 51.88 ? 279 LYS A N     1 
ATOM   2128  C  CA    . LYS A  1 298 ? -54.919  58.104  -29.971  1.00 52.05 ? 279 LYS A CA    1 
ATOM   2129  C  C     . LYS A  1 298 ? -53.513  57.571  -29.974  1.00 51.62 ? 279 LYS A C     1 
ATOM   2130  O  O     . LYS A  1 298 ? -52.582  58.289  -30.279  1.00 51.79 ? 279 LYS A O     1 
ATOM   2131  C  CB    . LYS A  1 298 ? -55.042  59.215  -28.925  1.00 52.21 ? 279 LYS A CB    1 
ATOM   2132  C  CG    . LYS A  1 298 ? -56.403  59.841  -28.963  1.00 53.07 ? 279 LYS A CG    1 
ATOM   2133  C  CD    . LYS A  1 298 ? -56.597  60.957  -27.997  1.00 53.58 ? 279 LYS A CD    1 
ATOM   2134  C  CE    . LYS A  1 298 ? -58.071  61.435  -28.078  1.00 55.19 ? 279 LYS A CE    1 
ATOM   2135  N  NZ    . LYS A  1 298 ? -58.320  62.780  -27.450  1.00 56.01 ? 279 LYS A NZ    1 
ATOM   2136  N  N     . ARG A  1 299 ? -53.345  56.320  -29.596  1.00 51.43 ? 280 ARG A N     1 
ATOM   2137  C  CA    . ARG A  1 299 ? -52.032  55.777  -29.415  1.00 51.25 ? 280 ARG A CA    1 
ATOM   2138  C  C     . ARG A  1 299 ? -51.923  54.448  -30.143  1.00 50.79 ? 280 ARG A C     1 
ATOM   2139  O  O     . ARG A  1 299 ? -51.171  53.570  -29.714  1.00 50.88 ? 280 ARG A O     1 
ATOM   2140  C  CB    . ARG A  1 299 ? -51.738  55.658  -27.912  1.00 51.55 ? 280 ARG A CB    1 
ATOM   2141  C  CG    . ARG A  1 299 ? -50.401  56.312  -27.502  1.00 52.15 ? 280 ARG A CG    1 
ATOM   2142  C  CD    . ARG A  1 299 ? -50.339  56.672  -26.025  1.00 52.53 ? 280 ARG A CD    1 
ATOM   2143  N  NE    . ARG A  1 299 ? -49.370  55.904  -25.207  1.00 53.64 ? 280 ARG A NE    1 
ATOM   2144  C  CZ    . ARG A  1 299 ? -48.046  55.982  -25.327  1.00 53.16 ? 280 ARG A CZ    1 
ATOM   2145  N  NH1   . ARG A  1 299 ? -47.488  56.762  -26.259  1.00 53.02 ? 280 ARG A NH1   1 
ATOM   2146  N  NH2   . ARG A  1 299 ? -47.275  55.274  -24.506  1.00 54.21 ? 280 ARG A NH2   1 
ATOM   2147  N  N     . HIS A  1 300 ? -52.633  54.340  -31.249  1.00 50.32 ? 281 HIS A N     1 
ATOM   2148  C  CA    . HIS A  1 300 ? -52.717  53.118  -32.004  1.00 50.17 ? 281 HIS A CA    1 
ATOM   2149  C  C     . HIS A  1 300 ? -51.384  52.567  -32.447  1.00 49.99 ? 281 HIS A C     1 
ATOM   2150  O  O     . HIS A  1 300 ? -51.065  51.436  -32.196  1.00 49.85 ? 281 HIS A O     1 
ATOM   2151  C  CB    . HIS A  1 300 ? -53.674  53.265  -33.174  1.00 49.62 ? 281 HIS A CB    1 
ATOM   2152  C  CG    . HIS A  1 300 ? -53.670  52.103  -34.119  1.00 49.51 ? 281 HIS A CG    1 
ATOM   2153  N  ND1   . HIS A  1 300 ? -54.267  50.904  -33.829  1.00 47.43 ? 281 HIS A ND1   1 
ATOM   2154  C  CD2   . HIS A  1 300 ? -53.142  51.963  -35.350  1.00 47.84 ? 281 HIS A CD2   1 
ATOM   2155  C  CE1   . HIS A  1 300 ? -54.115  50.082  -34.840  1.00 47.94 ? 281 HIS A CE1   1 
ATOM   2156  N  NE2   . HIS A  1 300 ? -53.425  50.695  -35.772  1.00 47.64 ? 281 HIS A NE2   1 
ATOM   2157  N  N     . GLN A  1 301 ? -50.586  53.370  -33.102  1.00 49.83 ? 282 GLN A N     1 
ATOM   2158  C  CA    . GLN A  1 301 ? -49.356  52.864  -33.621  1.00 50.21 ? 282 GLN A CA    1 
ATOM   2159  C  C     . GLN A  1 301 ? -48.309  52.519  -32.602  1.00 48.82 ? 282 GLN A C     1 
ATOM   2160  O  O     . GLN A  1 301 ? -47.448  51.736  -32.857  1.00 47.52 ? 282 GLN A O     1 
ATOM   2161  C  CB    . GLN A  1 301 ? -48.822  53.784  -34.658  1.00 50.75 ? 282 GLN A CB    1 
ATOM   2162  C  CG    . GLN A  1 301 ? -48.130  53.044  -35.709  1.00 52.39 ? 282 GLN A CG    1 
ATOM   2163  C  CD    . GLN A  1 301 ? -48.913  52.980  -36.956  1.00 53.62 ? 282 GLN A CD    1 
ATOM   2164  O  OE1   . GLN A  1 301 ? -49.662  52.045  -37.195  1.00 59.14 ? 282 GLN A OE1   1 
ATOM   2165  N  NE2   . GLN A  1 301 ? -48.739  53.977  -37.785  1.00 52.65 ? 282 GLN A NE2   1 
ATOM   2166  N  N     . TYR A  1 302 ? -48.408  53.092  -31.428  1.00 48.08 ? 283 TYR A N     1 
ATOM   2167  C  CA    . TYR A  1 302 ? -47.503  52.784  -30.368  1.00 47.58 ? 283 TYR A CA    1 
ATOM   2168  C  C     . TYR A  1 302 ? -47.736  51.392  -29.897  1.00 47.40 ? 283 TYR A C     1 
ATOM   2169  O  O     . TYR A  1 302 ? -46.818  50.712  -29.523  1.00 47.23 ? 283 TYR A O     1 
ATOM   2170  C  CB    . TYR A  1 302 ? -47.743  53.723  -29.223  1.00 47.75 ? 283 TYR A CB    1 
ATOM   2171  C  CG    . TYR A  1 302 ? -47.031  53.377  -27.970  1.00 47.03 ? 283 TYR A CG    1 
ATOM   2172  C  CD1   . TYR A  1 302 ? -45.696  53.590  -27.839  1.00 48.14 ? 283 TYR A CD1   1 
ATOM   2173  C  CD2   . TYR A  1 302 ? -47.692  52.843  -26.919  1.00 47.25 ? 283 TYR A CD2   1 
ATOM   2174  C  CE1   . TYR A  1 302 ? -45.053  53.279  -26.699  1.00 48.61 ? 283 TYR A CE1   1 
ATOM   2175  C  CE2   . TYR A  1 302 ? -47.055  52.528  -25.784  1.00 47.73 ? 283 TYR A CE2   1 
ATOM   2176  C  CZ    . TYR A  1 302 ? -45.740  52.748  -25.675  1.00 48.37 ? 283 TYR A CZ    1 
ATOM   2177  O  OH    . TYR A  1 302 ? -45.113  52.438  -24.526  1.00 48.14 ? 283 TYR A OH    1 
ATOM   2178  N  N     . HIS A  1 303 ? -48.990  50.990  -29.898  1.00 46.94 ? 284 HIS A N     1 
ATOM   2179  C  CA    . HIS A  1 303 ? -49.410  49.624  -29.515  1.00 46.68 ? 284 HIS A CA    1 
ATOM   2180  C  C     . HIS A  1 303 ? -49.058  48.555  -30.524  1.00 45.86 ? 284 HIS A C     1 
ATOM   2181  O  O     . HIS A  1 303 ? -48.516  47.513  -30.153  1.00 45.15 ? 284 HIS A O     1 
ATOM   2182  C  CB    . HIS A  1 303 ? -50.909  49.580  -29.163  1.00 46.71 ? 284 HIS A CB    1 
ATOM   2183  C  CG    . HIS A  1 303 ? -51.196  50.156  -27.818  1.00 46.87 ? 284 HIS A CG    1 
ATOM   2184  N  ND1   . HIS A  1 303 ? -51.604  49.388  -26.750  1.00 47.49 ? 284 HIS A ND1   1 
ATOM   2185  C  CD2   . HIS A  1 303 ? -51.038  51.412  -27.343  1.00 46.51 ? 284 HIS A CD2   1 
ATOM   2186  C  CE1   . HIS A  1 303 ? -51.719  50.156  -25.684  1.00 47.34 ? 284 HIS A CE1   1 
ATOM   2187  N  NE2   . HIS A  1 303 ? -51.376  51.388  -26.017  1.00 46.96 ? 284 HIS A NE2   1 
ATOM   2188  N  N     . ILE A  1 304 ? -49.348  48.815  -31.787  1.00 45.59 ? 285 ILE A N     1 
ATOM   2189  C  CA    . ILE A  1 304 ? -48.921  47.919  -32.856  1.00 46.33 ? 285 ILE A CA    1 
ATOM   2190  C  C     . ILE A  1 304 ? -47.427  47.550  -32.698  1.00 46.64 ? 285 ILE A C     1 
ATOM   2191  O  O     . ILE A  1 304 ? -47.064  46.385  -32.797  1.00 47.03 ? 285 ILE A O     1 
ATOM   2192  C  CB    . ILE A  1 304 ? -49.238  48.516  -34.268  1.00 45.59 ? 285 ILE A CB    1 
ATOM   2193  C  CG1   . ILE A  1 304 ? -50.733  48.516  -34.509  1.00 45.28 ? 285 ILE A CG1   1 
ATOM   2194  C  CG2   . ILE A  1 304 ? -48.596  47.719  -35.379  1.00 45.03 ? 285 ILE A CG2   1 
ATOM   2195  C  CD1   . ILE A  1 304 ? -51.356  47.113  -34.518  1.00 45.07 ? 285 ILE A CD1   1 
ATOM   2196  N  N     . ARG A  1 305 ? -46.580  48.541  -32.424  1.00 47.49 ? 286 ARG A N     1 
ATOM   2197  C  CA    . ARG A  1 305 ? -45.155  48.318  -32.161  1.00 47.89 ? 286 ARG A CA    1 
ATOM   2198  C  C     . ARG A  1 305 ? -44.851  47.484  -30.923  1.00 46.92 ? 286 ARG A C     1 
ATOM   2199  O  O     . ARG A  1 305 ? -43.780  46.857  -30.879  1.00 47.12 ? 286 ARG A O     1 
ATOM   2200  C  CB    . ARG A  1 305 ? -44.400  49.644  -32.037  1.00 48.11 ? 286 ARG A CB    1 
ATOM   2201  C  CG    . ARG A  1 305 ? -44.265  50.400  -33.365  1.00 50.91 ? 286 ARG A CG    1 
ATOM   2202  C  CD    . ARG A  1 305 ? -43.182  51.541  -33.297  1.00 53.03 ? 286 ARG A CD    1 
ATOM   2203  N  NE    . ARG A  1 305 ? -43.425  52.505  -32.205  1.00 56.98 ? 286 ARG A NE    1 
ATOM   2204  C  CZ    . ARG A  1 305 ? -44.121  53.647  -32.304  1.00 58.64 ? 286 ARG A CZ    1 
ATOM   2205  N  NH1   . ARG A  1 305 ? -44.678  54.023  -33.464  1.00 59.92 ? 286 ARG A NH1   1 
ATOM   2206  N  NH2   . ARG A  1 305 ? -44.269  54.426  -31.231  1.00 57.96 ? 286 ARG A NH2   1 
ATOM   2207  N  N     . ALA A  1 306 ? -45.743  47.505  -29.925  1.00 45.56 ? 287 ALA A N     1 
ATOM   2208  C  CA    . ALA A  1 306 ? -45.574  46.730  -28.682  1.00 45.55 ? 287 ALA A CA    1 
ATOM   2209  C  C     . ALA A  1 306 ? -46.167  45.275  -28.780  1.00 45.45 ? 287 ALA A C     1 
ATOM   2210  O  O     . ALA A  1 306 ? -46.006  44.433  -27.877  1.00 44.65 ? 287 ALA A O     1 
ATOM   2211  C  CB    . ALA A  1 306 ? -46.189  47.490  -27.503  1.00 43.92 ? 287 ALA A CB    1 
ATOM   2212  N  N     . TYR A  1 307 ? -46.828  45.002  -29.899  1.00 45.34 ? 288 TYR A N     1 
ATOM   2213  C  CA    . TYR A  1 307 ? -47.723  43.881  -30.020  1.00 45.54 ? 288 TYR A CA    1 
ATOM   2214  C  C     . TYR A  1 307 ? -47.166  42.714  -30.841  1.00 45.76 ? 288 TYR A C     1 
ATOM   2215  O  O     . TYR A  1 307 ? -47.818  41.703  -30.970  1.00 45.82 ? 288 TYR A O     1 
ATOM   2216  C  CB    . TYR A  1 307 ? -49.079  44.372  -30.574  1.00 45.30 ? 288 TYR A CB    1 
ATOM   2217  C  CG    . TYR A  1 307 ? -50.035  45.006  -29.538  1.00 44.57 ? 288 TYR A CG    1 
ATOM   2218  C  CD1   . TYR A  1 307 ? -49.610  45.359  -28.247  1.00 44.11 ? 288 TYR A CD1   1 
ATOM   2219  C  CD2   . TYR A  1 307 ? -51.360  45.270  -29.874  1.00 44.54 ? 288 TYR A CD2   1 
ATOM   2220  C  CE1   . TYR A  1 307 ? -50.493  45.948  -27.320  1.00 44.57 ? 288 TYR A CE1   1 
ATOM   2221  C  CE2   . TYR A  1 307 ? -52.251  45.858  -28.954  1.00 44.83 ? 288 TYR A CE2   1 
ATOM   2222  C  CZ    . TYR A  1 307 ? -51.812  46.198  -27.684  1.00 44.50 ? 288 TYR A CZ    1 
ATOM   2223  O  OH    . TYR A  1 307 ? -52.705  46.771  -26.798  1.00 43.47 ? 288 TYR A OH    1 
ATOM   2224  N  N     . ASP A  1 308 ? -45.961  42.830  -31.379  1.00 46.36 ? 289 ASP A N     1 
ATOM   2225  C  CA    . ASP A  1 308 ? -45.246  41.640  -31.843  1.00 46.57 ? 289 ASP A CA    1 
ATOM   2226  C  C     . ASP A  1 308 ? -43.724  41.891  -31.805  1.00 46.66 ? 289 ASP A C     1 
ATOM   2227  O  O     . ASP A  1 308 ? -43.312  43.029  -31.855  1.00 47.01 ? 289 ASP A O     1 
ATOM   2228  C  CB    . ASP A  1 308 ? -45.762  41.180  -33.225  1.00 46.80 ? 289 ASP A CB    1 
ATOM   2229  C  CG    . ASP A  1 308 ? -45.394  42.140  -34.378  1.00 47.45 ? 289 ASP A CG    1 
ATOM   2230  O  OD1   . ASP A  1 308 ? -44.174  42.348  -34.692  1.00 45.42 ? 289 ASP A OD1   1 
ATOM   2231  O  OD2   . ASP A  1 308 ? -46.373  42.644  -34.985  1.00 47.11 ? 289 ASP A OD2   1 
ATOM   2232  N  N     . PRO A  1 309 ? -42.889  40.832  -31.725  1.00 46.98 ? 290 PRO A N     1 
ATOM   2233  C  CA    . PRO A  1 309 ? -41.469  41.058  -31.449  1.00 47.28 ? 290 PRO A CA    1 
ATOM   2234  C  C     . PRO A  1 309 ? -40.731  41.758  -32.578  1.00 47.48 ? 290 PRO A C     1 
ATOM   2235  O  O     . PRO A  1 309 ? -39.618  42.196  -32.357  1.00 47.48 ? 290 PRO A O     1 
ATOM   2236  C  CB    . PRO A  1 309 ? -40.892  39.643  -31.259  1.00 47.19 ? 290 PRO A CB    1 
ATOM   2237  C  CG    . PRO A  1 309 ? -42.055  38.734  -31.184  1.00 47.26 ? 290 PRO A CG    1 
ATOM   2238  C  CD    . PRO A  1 309 ? -43.163  39.403  -31.946  1.00 47.28 ? 290 PRO A CD    1 
ATOM   2239  N  N     . LYS A  1 310 ? -41.341  41.872  -33.756  1.00 47.75 ? 291 LYS A N     1 
ATOM   2240  C  CA    . LYS A  1 310 ? -40.758  42.635  -34.858  1.00 48.26 ? 291 LYS A CA    1 
ATOM   2241  C  C     . LYS A  1 310 ? -41.355  44.044  -35.065  1.00 48.02 ? 291 LYS A C     1 
ATOM   2242  O  O     . LYS A  1 310 ? -41.263  44.581  -36.166  1.00 47.78 ? 291 LYS A O     1 
ATOM   2243  C  CB    . LYS A  1 310 ? -40.819  41.806  -36.147  1.00 48.52 ? 291 LYS A CB    1 
ATOM   2244  C  CG    . LYS A  1 310 ? -39.885  40.567  -36.068  1.00 49.97 ? 291 LYS A CG    1 
ATOM   2245  C  CD    . LYS A  1 310 ? -39.898  39.729  -37.347  1.00 50.70 ? 291 LYS A CD    1 
ATOM   2246  C  CE    . LYS A  1 310 ? -38.661  38.835  -37.470  1.00 52.02 ? 291 LYS A CE    1 
ATOM   2247  N  NZ    . LYS A  1 310 ? -38.642  37.760  -36.435  1.00 53.91 ? 291 LYS A NZ    1 
ATOM   2248  N  N     . GLY A  1 311 ? -41.918  44.643  -34.003  1.00 47.68 ? 292 GLY A N     1 
ATOM   2249  C  CA    . GLY A  1 311 ? -42.421  46.026  -34.026  1.00 47.68 ? 292 GLY A CA    1 
ATOM   2250  C  C     . GLY A  1 311 ? -43.596  46.326  -34.969  1.00 47.71 ? 292 GLY A C     1 
ATOM   2251  O  O     . GLY A  1 311 ? -43.797  47.482  -35.385  1.00 47.10 ? 292 GLY A O     1 
ATOM   2252  N  N     . GLY A  1 312 ? -44.360  45.283  -35.312  1.00 47.56 ? 293 GLY A N     1 
ATOM   2253  C  CA    . GLY A  1 312 ? -45.518  45.387  -36.207  1.00 47.20 ? 293 GLY A CA    1 
ATOM   2254  C  C     . GLY A  1 312 ? -45.355  44.651  -37.528  1.00 46.94 ? 293 GLY A C     1 
ATOM   2255  O  O     . GLY A  1 312 ? -46.311  44.503  -38.283  1.00 46.76 ? 293 GLY A O     1 
ATOM   2256  N  N     . LEU A  1 313 ? -44.142  44.212  -37.834  1.00 46.90 ? 294 LEU A N     1 
ATOM   2257  C  CA    . LEU A  1 313 ? -43.889  43.563  -39.119  1.00 47.01 ? 294 LEU A CA    1 
ATOM   2258  C  C     . LEU A  1 313 ? -44.527  42.189  -39.192  1.00 46.55 ? 294 LEU A C     1 
ATOM   2259  O  O     . LEU A  1 313 ? -45.003  41.816  -40.260  1.00 46.79 ? 294 LEU A O     1 
ATOM   2260  C  CB    . LEU A  1 313 ? -42.388  43.458  -39.444  1.00 47.40 ? 294 LEU A CB    1 
ATOM   2261  C  CG    . LEU A  1 313 ? -41.693  44.762  -39.873  1.00 48.34 ? 294 LEU A CG    1 
ATOM   2262  C  CD1   . LEU A  1 313 ? -40.279  44.418  -40.219  1.00 47.52 ? 294 LEU A CD1   1 
ATOM   2263  C  CD2   . LEU A  1 313 ? -42.400  45.516  -41.035  1.00 47.50 ? 294 LEU A CD2   1 
ATOM   2264  N  N     . ASP A  1 314 ? -44.565  41.449  -38.088  1.00 45.68 ? 295 ASP A N     1 
ATOM   2265  C  CA    . ASP A  1 314 ? -45.259  40.165  -38.116  1.00 45.94 ? 295 ASP A CA    1 
ATOM   2266  C  C     . ASP A  1 314 ? -46.774  40.371  -38.280  1.00 45.65 ? 295 ASP A C     1 
ATOM   2267  O  O     . ASP A  1 314 ? -47.380  39.705  -39.111  1.00 46.14 ? 295 ASP A O     1 
ATOM   2268  C  CB    . ASP A  1 314 ? -44.936  39.278  -36.885  1.00 46.46 ? 295 ASP A CB    1 
ATOM   2269  C  CG    . ASP A  1 314 ? -43.546  38.594  -36.974  1.00 46.57 ? 295 ASP A CG    1 
ATOM   2270  O  OD1   . ASP A  1 314 ? -43.058  38.305  -38.081  1.00 47.40 ? 295 ASP A OD1   1 
ATOM   2271  O  OD2   . ASP A  1 314 ? -42.935  38.328  -35.928  1.00 48.93 ? 295 ASP A OD2   1 
ATOM   2272  N  N     . ASN A  1 315 ? -47.371  41.310  -37.537  1.00 44.72 ? 296 ASN A N     1 
ATOM   2273  C  CA    . ASN A  1 315 ? -48.813  41.552  -37.616  1.00 44.39 ? 296 ASN A CA    1 
ATOM   2274  C  C     . ASN A  1 315 ? -49.304  42.080  -38.973  1.00 44.10 ? 296 ASN A C     1 
ATOM   2275  O  O     . ASN A  1 315 ? -50.517  41.985  -39.259  1.00 44.01 ? 296 ASN A O     1 
ATOM   2276  C  CB    . ASN A  1 315 ? -49.310  42.524  -36.512  1.00 44.54 ? 296 ASN A CB    1 
ATOM   2277  C  CG    . ASN A  1 315 ? -50.114  41.834  -35.413  1.00 44.42 ? 296 ASN A CG    1 
ATOM   2278  O  OD1   . ASN A  1 315 ? -50.841  40.857  -35.666  1.00 46.03 ? 296 ASN A OD1   1 
ATOM   2279  N  ND2   . ASN A  1 315 ? -49.984  42.339  -34.173  1.00 42.57 ? 296 ASN A ND2   1 
ATOM   2280  N  N     . ALA A  1 316 ? -48.412  42.647  -39.784  1.00 43.14 ? 297 ALA A N     1 
ATOM   2281  C  CA    . ALA A  1 316 ? -48.795  43.094  -41.143  1.00 43.21 ? 297 ALA A CA    1 
ATOM   2282  C  C     . ALA A  1 316 ? -49.350  41.931  -41.953  1.00 43.15 ? 297 ALA A C     1 
ATOM   2283  O  O     . ALA A  1 316 ? -50.252  42.113  -42.780  1.00 43.71 ? 297 ALA A O     1 
ATOM   2284  C  CB    . ALA A  1 316 ? -47.618  43.712  -41.878  1.00 42.63 ? 297 ALA A CB    1 
ATOM   2285  N  N     . ARG A  1 317 ? -48.811  40.733  -41.700  1.00 42.79 ? 298 ARG A N     1 
ATOM   2286  C  CA    . ARG A  1 317 ? -49.308  39.512  -42.324  1.00 42.18 ? 298 ARG A CA    1 
ATOM   2287  C  C     . ARG A  1 317 ? -50.680  39.063  -41.818  1.00 42.17 ? 298 ARG A C     1 
ATOM   2288  O  O     . ARG A  1 317 ? -51.357  38.352  -42.531  1.00 42.20 ? 298 ARG A O     1 
ATOM   2289  C  CB    . ARG A  1 317 ? -48.264  38.397  -42.201  1.00 42.01 ? 298 ARG A CB    1 
ATOM   2290  C  CG    . ARG A  1 317 ? -46.991  38.768  -42.984  1.00 41.15 ? 298 ARG A CG    1 
ATOM   2291  C  CD    . ARG A  1 317 ? -45.898  37.714  -42.985  1.00 40.86 ? 298 ARG A CD    1 
ATOM   2292  N  NE    . ARG A  1 317 ? -45.370  37.519  -41.640  1.00 41.09 ? 298 ARG A NE    1 
ATOM   2293  C  CZ    . ARG A  1 317 ? -45.635  36.477  -40.848  1.00 41.50 ? 298 ARG A CZ    1 
ATOM   2294  N  NH1   . ARG A  1 317 ? -46.432  35.484  -41.258  1.00 42.26 ? 298 ARG A NH1   1 
ATOM   2295  N  NH2   . ARG A  1 317 ? -45.101  36.431  -39.633  1.00 40.58 ? 298 ARG A NH2   1 
ATOM   2296  N  N     . ARG A  1 318 ? -51.083  39.469  -40.609  1.00 42.37 ? 299 ARG A N     1 
ATOM   2297  C  CA    . ARG A  1 318 ? -52.384  39.071  -40.014  1.00 42.48 ? 299 ARG A CA    1 
ATOM   2298  C  C     . ARG A  1 318 ? -53.474  40.152  -40.050  1.00 41.99 ? 299 ARG A C     1 
ATOM   2299  O  O     . ARG A  1 318 ? -54.598  39.878  -40.430  1.00 40.55 ? 299 ARG A O     1 
ATOM   2300  C  CB    . ARG A  1 318 ? -52.236  38.660  -38.539  1.00 42.34 ? 299 ARG A CB    1 
ATOM   2301  C  CG    . ARG A  1 318 ? -53.611  38.315  -37.868  1.00 42.91 ? 299 ARG A CG    1 
ATOM   2302  C  CD    . ARG A  1 318 ? -53.514  37.638  -36.474  1.00 43.55 ? 299 ARG A CD    1 
ATOM   2303  N  NE    . ARG A  1 318 ? -53.111  38.660  -35.544  1.00 46.09 ? 299 ARG A NE    1 
ATOM   2304  C  CZ    . ARG A  1 318 ? -53.875  39.251  -34.635  1.00 45.55 ? 299 ARG A CZ    1 
ATOM   2305  N  NH1   . ARG A  1 318 ? -55.114  38.889  -34.403  1.00 43.78 ? 299 ARG A NH1   1 
ATOM   2306  N  NH2   . ARG A  1 318 ? -53.344  40.215  -33.911  1.00 47.79 ? 299 ARG A NH2   1 
ATOM   2307  N  N     . LEU A  1 319 ? -53.134  41.355  -39.578  1.00 42.58 ? 300 LEU A N     1 
ATOM   2308  C  CA    . LEU A  1 319 ? -54.110  42.442  -39.401  1.00 42.69 ? 300 LEU A CA    1 
ATOM   2309  C  C     . LEU A  1 319 ? -54.455  43.086  -40.753  1.00 42.96 ? 300 LEU A C     1 
ATOM   2310  O  O     . LEU A  1 319 ? -54.039  44.183  -41.048  1.00 43.63 ? 300 LEU A O     1 
ATOM   2311  C  CB    . LEU A  1 319 ? -53.616  43.480  -38.380  1.00 42.15 ? 300 LEU A CB    1 
ATOM   2312  C  CG    . LEU A  1 319 ? -53.492  43.035  -36.915  1.00 41.95 ? 300 LEU A CG    1 
ATOM   2313  C  CD1   . LEU A  1 319 ? -52.966  44.143  -36.004  1.00 40.93 ? 300 LEU A CD1   1 
ATOM   2314  C  CD2   . LEU A  1 319 ? -54.761  42.523  -36.356  1.00 40.84 ? 300 LEU A CD2   1 
ATOM   2315  N  N     . THR A  1 320 ? -55.241  42.363  -41.545  1.00 43.62 ? 301 THR A N     1 
ATOM   2316  C  CA    . THR A  1 320 ? -55.575  42.697  -42.925  1.00 43.49 ? 301 THR A CA    1 
ATOM   2317  C  C     . THR A  1 320 ? -56.953  43.330  -43.023  1.00 44.25 ? 301 THR A C     1 
ATOM   2318  O  O     . THR A  1 320 ? -57.297  43.894  -44.058  1.00 44.55 ? 301 THR A O     1 
ATOM   2319  C  CB    . THR A  1 320 ? -55.629  41.411  -43.799  1.00 43.72 ? 301 THR A CB    1 
ATOM   2320  O  OG1   . THR A  1 320 ? -56.645  40.497  -43.291  1.00 42.84 ? 301 THR A OG1   1 
ATOM   2321  C  CG2   . THR A  1 320 ? -54.264  40.741  -43.849  1.00 40.42 ? 301 THR A CG2   1 
ATOM   2322  N  N     . GLY A  1 321 ? -57.722  43.230  -41.936  1.00 44.81 ? 302 GLY A N     1 
ATOM   2323  C  CA    . GLY A  1 321 ? -59.137  43.556  -41.921  1.00 44.85 ? 302 GLY A CA    1 
ATOM   2324  C  C     . GLY A  1 321 ? -60.005  42.426  -42.438  1.00 45.11 ? 302 GLY A C     1 
ATOM   2325  O  O     . GLY A  1 321 ? -61.152  42.647  -42.732  1.00 45.39 ? 302 GLY A O     1 
ATOM   2326  N  N     . PHE A  1 322 ? -59.450  41.233  -42.620  1.00 45.94 ? 303 PHE A N     1 
ATOM   2327  C  CA    . PHE A  1 322 ? -60.242  40.044  -42.991  1.00 45.91 ? 303 PHE A CA    1 
ATOM   2328  C  C     . PHE A  1 322 ? -59.971  38.976  -41.970  1.00 45.72 ? 303 PHE A C     1 
ATOM   2329  O  O     . PHE A  1 322 ? -59.115  39.154  -41.089  1.00 45.21 ? 303 PHE A O     1 
ATOM   2330  C  CB    . PHE A  1 322 ? -59.875  39.486  -44.376  1.00 46.91 ? 303 PHE A CB    1 
ATOM   2331  C  CG    . PHE A  1 322 ? -60.047  40.476  -45.508  1.00 48.22 ? 303 PHE A CG    1 
ATOM   2332  C  CD1   . PHE A  1 322 ? -58.943  41.197  -46.010  1.00 50.24 ? 303 PHE A CD1   1 
ATOM   2333  C  CD2   . PHE A  1 322 ? -61.283  40.690  -46.081  1.00 47.63 ? 303 PHE A CD2   1 
ATOM   2334  C  CE1   . PHE A  1 322 ? -59.111  42.124  -47.064  1.00 49.69 ? 303 PHE A CE1   1 
ATOM   2335  C  CE2   . PHE A  1 322 ? -61.440  41.613  -47.121  1.00 48.54 ? 303 PHE A CE2   1 
ATOM   2336  C  CZ    . PHE A  1 322 ? -60.366  42.327  -47.612  1.00 48.09 ? 303 PHE A CZ    1 
ATOM   2337  N  N     . HIS A  1 323 ? -60.698  37.863  -42.098  1.00 45.47 ? 304 HIS A N     1 
ATOM   2338  C  CA    . HIS A  1 323 ? -60.498  36.678  -41.261  1.00 45.19 ? 304 HIS A CA    1 
ATOM   2339  C  C     . HIS A  1 323 ? -60.549  37.039  -39.775  1.00 44.88 ? 304 HIS A C     1 
ATOM   2340  O  O     . HIS A  1 323 ? -59.769  36.551  -38.944  1.00 44.06 ? 304 HIS A O     1 
ATOM   2341  C  CB    . HIS A  1 323 ? -59.209  35.971  -41.643  1.00 45.06 ? 304 HIS A CB    1 
ATOM   2342  C  CG    . HIS A  1 323 ? -59.194  35.469  -43.057  1.00 45.96 ? 304 HIS A CG    1 
ATOM   2343  N  ND1   . HIS A  1 323 ? -58.343  35.981  -44.023  1.00 46.61 ? 304 HIS A ND1   1 
ATOM   2344  C  CD2   . HIS A  1 323 ? -59.913  34.490  -43.665  1.00 44.62 ? 304 HIS A CD2   1 
ATOM   2345  C  CE1   . HIS A  1 323 ? -58.551  35.345  -45.167  1.00 46.53 ? 304 HIS A CE1   1 
ATOM   2346  N  NE2   . HIS A  1 323 ? -59.491  34.431  -44.976  1.00 46.18 ? 304 HIS A NE2   1 
ATOM   2347  N  N     . GLU A  1 324 ? -61.522  37.908  -39.490  1.00 45.05 ? 305 GLU A N     1 
ATOM   2348  C  CA    . GLU A  1 324 ? -61.863  38.371  -38.153  1.00 45.11 ? 305 GLU A CA    1 
ATOM   2349  C  C     . GLU A  1 324 ? -60.717  39.192  -37.540  1.00 45.18 ? 305 GLU A C     1 
ATOM   2350  O  O     . GLU A  1 324 ? -60.361  39.027  -36.381  1.00 45.11 ? 305 GLU A O     1 
ATOM   2351  C  CB    . GLU A  1 324 ? -62.298  37.186  -37.278  1.00 45.27 ? 305 GLU A CB    1 
ATOM   2352  C  CG    . GLU A  1 324 ? -63.256  36.214  -37.969  1.00 44.46 ? 305 GLU A CG    1 
ATOM   2353  C  CD    . GLU A  1 324 ? -63.813  35.164  -37.017  1.00 45.89 ? 305 GLU A CD    1 
ATOM   2354  O  OE1   . GLU A  1 324 ? -64.940  35.345  -36.492  1.00 45.87 ? 305 GLU A OE1   1 
ATOM   2355  O  OE2   . GLU A  1 324 ? -63.133  34.147  -36.797  1.00 47.56 ? 305 GLU A OE2   1 
ATOM   2356  N  N     . THR A  1 325 ? -60.152  40.088  -38.346  1.00 45.44 ? 306 THR A N     1 
ATOM   2357  C  CA    . THR A  1 325 ? -59.173  41.047  -37.879  1.00 45.20 ? 306 THR A CA    1 
ATOM   2358  C  C     . THR A  1 325 ? -59.579  42.452  -38.299  1.00 45.81 ? 306 THR A C     1 
ATOM   2359  O  O     . THR A  1 325 ? -60.482  42.657  -39.113  1.00 46.60 ? 306 THR A O     1 
ATOM   2360  C  CB    . THR A  1 325 ? -57.754  40.751  -38.425  1.00 45.33 ? 306 THR A CB    1 
ATOM   2361  O  OG1   . THR A  1 325 ? -57.693  41.052  -39.831  1.00 44.33 ? 306 THR A OG1   1 
ATOM   2362  C  CG2   . THR A  1 325 ? -57.347  39.279  -38.154  1.00 43.74 ? 306 THR A CG2   1 
ATOM   2363  N  N     . SER A  1 326 ? -58.904  43.411  -37.691  1.00 46.19 ? 307 SER A N     1 
ATOM   2364  C  CA    . SER A  1 326 ? -58.889  44.783  -38.124  1.00 46.15 ? 307 SER A CA    1 
ATOM   2365  C  C     . SER A  1 326 ? -57.684  45.011  -39.050  1.00 46.34 ? 307 SER A C     1 
ATOM   2366  O  O     . SER A  1 326 ? -56.721  44.256  -39.012  1.00 46.13 ? 307 SER A O     1 
ATOM   2367  C  CB    . SER A  1 326 ? -58.734  45.665  -36.903  1.00 46.02 ? 307 SER A CB    1 
ATOM   2368  O  OG    . SER A  1 326 ? -57.595  45.253  -36.169  1.00 45.91 ? 307 SER A OG    1 
ATOM   2369  N  N     . ASN A  1 327 ? -57.741  46.065  -39.861  1.00 46.64 ? 308 ASN A N     1 
ATOM   2370  C  CA    . ASN A  1 327 ? -56.592  46.501  -40.652  1.00 46.56 ? 308 ASN A CA    1 
ATOM   2371  C  C     . ASN A  1 327 ? -55.530  47.145  -39.771  1.00 46.64 ? 308 ASN A C     1 
ATOM   2372  O  O     . ASN A  1 327 ? -55.824  47.979  -38.905  1.00 45.92 ? 308 ASN A O     1 
ATOM   2373  C  CB    . ASN A  1 327 ? -57.045  47.501  -41.711  1.00 46.82 ? 308 ASN A CB    1 
ATOM   2374  C  CG    . ASN A  1 327 ? -56.052  47.657  -42.811  1.00 46.70 ? 308 ASN A CG    1 
ATOM   2375  O  OD1   . ASN A  1 327 ? -55.057  48.368  -42.665  1.00 48.76 ? 308 ASN A OD1   1 
ATOM   2376  N  ND2   . ASN A  1 327 ? -56.308  46.997  -43.933  1.00 45.99 ? 308 ASN A ND2   1 
ATOM   2377  N  N     . ILE A  1 328 ? -54.280  46.774  -40.017  1.00 47.15 ? 309 ILE A N     1 
ATOM   2378  C  CA    . ILE A  1 328 ? -53.172  47.202  -39.169  1.00 47.26 ? 309 ILE A CA    1 
ATOM   2379  C  C     . ILE A  1 328 ? -53.105  48.744  -39.050  1.00 47.73 ? 309 ILE A C     1 
ATOM   2380  O  O     . ILE A  1 328 ? -52.652  49.282  -38.017  1.00 47.54 ? 309 ILE A O     1 
ATOM   2381  C  CB    . ILE A  1 328 ? -51.826  46.579  -39.651  1.00 47.14 ? 309 ILE A CB    1 
ATOM   2382  C  CG1   . ILE A  1 328 ? -50.726  46.789  -38.601  1.00 47.56 ? 309 ILE A CG1   1 
ATOM   2383  C  CG2   . ILE A  1 328 ? -51.387  47.154  -40.975  1.00 46.25 ? 309 ILE A CG2   1 
ATOM   2384  C  CD1   . ILE A  1 328 ? -49.520  45.854  -38.773  1.00 46.94 ? 309 ILE A CD1   1 
ATOM   2385  N  N     . ASN A  1 329 ? -53.604  49.446  -40.069  1.00 47.95 ? 310 ASN A N     1 
ATOM   2386  C  CA    . ASN A  1 329 ? -53.537  50.924  -40.113  1.00 48.42 ? 310 ASN A CA    1 
ATOM   2387  C  C     . ASN A  1 329 ? -54.660  51.671  -39.408  1.00 48.59 ? 310 ASN A C     1 
ATOM   2388  O  O     . ASN A  1 329 ? -54.489  52.829  -39.030  1.00 48.75 ? 310 ASN A O     1 
ATOM   2389  C  CB    . ASN A  1 329 ? -53.470  51.393  -41.556  1.00 48.49 ? 310 ASN A CB    1 
ATOM   2390  C  CG    . ASN A  1 329 ? -52.350  50.719  -42.313  1.00 49.81 ? 310 ASN A CG    1 
ATOM   2391  O  OD1   . ASN A  1 329 ? -51.184  50.738  -41.888  1.00 48.24 ? 310 ASN A OD1   1 
ATOM   2392  N  ND2   . ASN A  1 329 ? -52.706  50.064  -43.411  1.00 51.36 ? 310 ASN A ND2   1 
ATOM   2393  N  N     . ASP A  1 330 ? -55.790  51.007  -39.203  1.00 48.93 ? 311 ASP A N     1 
ATOM   2394  C  CA    . ASP A  1 330 ? -56.989  51.675  -38.732  1.00 48.93 ? 311 ASP A CA    1 
ATOM   2395  C  C     . ASP A  1 330 ? -57.365  51.227  -37.322  1.00 49.00 ? 311 ASP A C     1 
ATOM   2396  O  O     . ASP A  1 330 ? -57.390  50.034  -37.037  1.00 50.36 ? 311 ASP A O     1 
ATOM   2397  C  CB    . ASP A  1 330 ? -58.127  51.404  -39.712  1.00 49.07 ? 311 ASP A CB    1 
ATOM   2398  C  CG    . ASP A  1 330 ? -57.711  51.648  -41.162  1.00 51.18 ? 311 ASP A CG    1 
ATOM   2399  O  OD1   . ASP A  1 330 ? -56.955  52.615  -41.433  1.00 52.00 ? 311 ASP A OD1   1 
ATOM   2400  O  OD2   . ASP A  1 330 ? -58.133  50.865  -42.040  1.00 54.72 ? 311 ASP A OD2   1 
ATOM   2401  N  N     . PHE A  1 331 ? -57.659  52.190  -36.446  1.00 48.37 ? 312 PHE A N     1 
ATOM   2402  C  CA    . PHE A  1 331 ? -58.211  51.905  -35.139  1.00 47.70 ? 312 PHE A CA    1 
ATOM   2403  C  C     . PHE A  1 331 ? -59.721  51.927  -35.229  1.00 47.47 ? 312 PHE A C     1 
ATOM   2404  O  O     . PHE A  1 331 ? -60.286  52.853  -35.800  1.00 47.57 ? 312 PHE A O     1 
ATOM   2405  C  CB    . PHE A  1 331 ? -57.770  52.929  -34.124  1.00 47.55 ? 312 PHE A CB    1 
ATOM   2406  C  CG    . PHE A  1 331 ? -58.172  52.583  -32.741  1.00 47.81 ? 312 PHE A CG    1 
ATOM   2407  C  CD1   . PHE A  1 331 ? -57.342  51.806  -31.937  1.00 47.71 ? 312 PHE A CD1   1 
ATOM   2408  C  CD2   . PHE A  1 331 ? -59.396  52.994  -32.238  1.00 47.71 ? 312 PHE A CD2   1 
ATOM   2409  C  CE1   . PHE A  1 331 ? -57.717  51.455  -30.629  1.00 47.98 ? 312 PHE A CE1   1 
ATOM   2410  C  CE2   . PHE A  1 331 ? -59.787  52.640  -30.944  1.00 48.34 ? 312 PHE A CE2   1 
ATOM   2411  C  CZ    . PHE A  1 331 ? -58.939  51.869  -30.131  1.00 48.28 ? 312 PHE A CZ    1 
ATOM   2412  N  N     . SER A  1 332 ? -60.366  50.908  -34.660  1.00 47.05 ? 313 SER A N     1 
ATOM   2413  C  CA    . SER A  1 332 ? -61.829  50.852  -34.572  1.00 46.79 ? 313 SER A CA    1 
ATOM   2414  C  C     . SER A  1 332 ? -62.291  50.115  -33.309  1.00 46.29 ? 313 SER A C     1 
ATOM   2415  O  O     . SER A  1 332 ? -61.554  49.330  -32.757  1.00 46.38 ? 313 SER A O     1 
ATOM   2416  C  CB    . SER A  1 332 ? -62.429  50.173  -35.816  1.00 46.78 ? 313 SER A CB    1 
ATOM   2417  O  OG    . SER A  1 332 ? -61.929  48.860  -35.981  1.00 46.99 ? 313 SER A OG    1 
ATOM   2418  N  N     . ALA A  1 333 ? -63.510  50.387  -32.854  1.00 45.60 ? 314 ALA A N     1 
ATOM   2419  C  CA    . ALA A  1 333 ? -64.046  49.715  -31.697  1.00 45.24 ? 314 ALA A CA    1 
ATOM   2420  C  C     . ALA A  1 333 ? -65.538  49.501  -31.884  1.00 45.15 ? 314 ALA A C     1 
ATOM   2421  O  O     . ALA A  1 333 ? -66.191  50.228  -32.620  1.00 45.92 ? 314 ALA A O     1 
ATOM   2422  C  CB    . ALA A  1 333 ? -63.779  50.501  -30.489  1.00 45.15 ? 314 ALA A CB    1 
ATOM   2423  N  N     . GLY A  1 334 ? -66.087  48.481  -31.246  1.00 44.78 ? 315 GLY A N     1 
ATOM   2424  C  CA    . GLY A  1 334 ? -67.481  48.151  -31.448  1.00 44.49 ? 315 GLY A CA    1 
ATOM   2425  C  C     . GLY A  1 334 ? -67.925  47.007  -30.577  1.00 44.59 ? 315 GLY A C     1 
ATOM   2426  O  O     . GLY A  1 334 ? -67.129  46.147  -30.217  1.00 44.93 ? 315 GLY A O     1 
ATOM   2427  N  N     . VAL A  1 335 ? -69.212  46.999  -30.243  1.00 44.59 ? 316 VAL A N     1 
ATOM   2428  C  CA    . VAL A  1 335 ? -69.774  45.951  -29.429  1.00 44.23 ? 316 VAL A CA    1 
ATOM   2429  C  C     . VAL A  1 335 ? -69.941  44.685  -30.254  1.00 44.58 ? 316 VAL A C     1 
ATOM   2430  O  O     . VAL A  1 335 ? -70.541  44.723  -31.324  1.00 45.09 ? 316 VAL A O     1 
ATOM   2431  C  CB    . VAL A  1 335 ? -71.136  46.350  -28.855  1.00 44.01 ? 316 VAL A CB    1 
ATOM   2432  C  CG1   . VAL A  1 335 ? -71.739  45.157  -28.130  1.00 43.10 ? 316 VAL A CG1   1 
ATOM   2433  C  CG2   . VAL A  1 335 ? -70.984  47.556  -27.925  1.00 42.22 ? 316 VAL A CG2   1 
ATOM   2434  N  N     . ALA A  1 336 ? -69.396  43.566  -29.776  1.00 44.64 ? 317 ALA A N     1 
ATOM   2435  C  CA    . ALA A  1 336 ? -69.666  42.268  -30.394  1.00 44.71 ? 317 ALA A CA    1 
ATOM   2436  C  C     . ALA A  1 336 ? -69.028  42.148  -31.779  1.00 44.78 ? 317 ALA A C     1 
ATOM   2437  O  O     . ALA A  1 336 ? -69.289  41.185  -32.511  1.00 44.40 ? 317 ALA A O     1 
ATOM   2438  C  CB    . ALA A  1 336 ? -71.201  42.060  -30.497  1.00 44.47 ? 317 ALA A CB    1 
ATOM   2439  N  N     . ASN A  1 337 ? -68.195  43.137  -32.119  1.00 45.46 ? 318 ASN A N     1 
ATOM   2440  C  CA    . ASN A  1 337 ? -67.586  43.294  -33.460  1.00 45.38 ? 318 ASN A CA    1 
ATOM   2441  C  C     . ASN A  1 337 ? -66.200  42.675  -33.583  1.00 45.42 ? 318 ASN A C     1 
ATOM   2442  O  O     . ASN A  1 337 ? -65.201  43.249  -33.067  1.00 45.48 ? 318 ASN A O     1 
ATOM   2443  C  CB    . ASN A  1 337 ? -67.460  44.779  -33.830  1.00 45.41 ? 318 ASN A CB    1 
ATOM   2444  C  CG    . ASN A  1 337 ? -67.179  44.988  -35.314  1.00 45.29 ? 318 ASN A CG    1 
ATOM   2445  O  OD1   . ASN A  1 337 ? -66.503  44.186  -35.964  1.00 44.09 ? 318 ASN A OD1   1 
ATOM   2446  N  ND2   . ASN A  1 337 ? -67.726  46.063  -35.858  1.00 45.28 ? 318 ASN A ND2   1 
ATOM   2447  N  N     . ARG A  1 338 ? -66.130  41.563  -34.322  1.00 45.05 ? 319 ARG A N     1 
ATOM   2448  C  CA    . ARG A  1 338 ? -64.856  40.835  -34.515  1.00 45.11 ? 319 ARG A CA    1 
ATOM   2449  C  C     . ARG A  1 338 ? -63.983  41.403  -35.642  1.00 44.75 ? 319 ARG A C     1 
ATOM   2450  O  O     . ARG A  1 338 ? -62.937  40.848  -35.968  1.00 44.87 ? 319 ARG A O     1 
ATOM   2451  C  CB    . ARG A  1 338 ? -65.123  39.320  -34.694  1.00 45.13 ? 319 ARG A CB    1 
ATOM   2452  C  CG    . ARG A  1 338 ? -65.473  38.607  -33.362  1.00 44.82 ? 319 ARG A CG    1 
ATOM   2453  C  CD    . ARG A  1 338 ? -65.692  37.084  -33.486  1.00 45.23 ? 319 ARG A CD    1 
ATOM   2454  N  NE    . ARG A  1 338 ? -65.517  36.422  -32.198  1.00 45.18 ? 319 ARG A NE    1 
ATOM   2455  C  CZ    . ARG A  1 338 ? -66.427  36.390  -31.216  1.00 45.64 ? 319 ARG A CZ    1 
ATOM   2456  N  NH1   . ARG A  1 338 ? -66.130  35.783  -30.072  1.00 45.14 ? 319 ARG A NH1   1 
ATOM   2457  N  NH2   . ARG A  1 338 ? -67.618  36.968  -31.347  1.00 45.42 ? 319 ARG A NH2   1 
ATOM   2458  N  N     . SER A  1 339 ? -64.412  42.520  -36.217  1.00 44.89 ? 320 SER A N     1 
ATOM   2459  C  CA    . SER A  1 339 ? -63.626  43.251  -37.222  1.00 44.87 ? 320 SER A CA    1 
ATOM   2460  C  C     . SER A  1 339 ? -62.951  44.438  -36.640  1.00 44.28 ? 320 SER A C     1 
ATOM   2461  O  O     . SER A  1 339 ? -62.129  45.038  -37.318  1.00 44.60 ? 320 SER A O     1 
ATOM   2462  C  CB    . SER A  1 339 ? -64.514  43.755  -38.358  1.00 44.97 ? 320 SER A CB    1 
ATOM   2463  O  OG    . SER A  1 339 ? -64.941  42.644  -39.120  1.00 47.63 ? 320 SER A OG    1 
ATOM   2464  N  N     . ALA A  1 340 ? -63.294  44.788  -35.399  1.00 43.82 ? 321 ALA A N     1 
ATOM   2465  C  CA    . ALA A  1 340 ? -62.773  46.011  -34.790  1.00 43.86 ? 321 ALA A CA    1 
ATOM   2466  C  C     . ALA A  1 340 ? -61.418  45.755  -34.155  1.00 43.37 ? 321 ALA A C     1 
ATOM   2467  O  O     . ALA A  1 340 ? -61.079  44.607  -33.851  1.00 43.91 ? 321 ALA A O     1 
ATOM   2468  C  CB    . ALA A  1 340 ? -63.759  46.571  -33.753  1.00 43.46 ? 321 ALA A CB    1 
ATOM   2469  N  N     . SER A  1 341 ? -60.655  46.818  -33.969  1.00 42.73 ? 322 SER A N     1 
ATOM   2470  C  CA    . SER A  1 341 ? -59.450  46.763  -33.169  1.00 43.13 ? 322 SER A CA    1 
ATOM   2471  C  C     . SER A  1 341 ? -59.793  46.374  -31.728  1.00 43.01 ? 322 SER A C     1 
ATOM   2472  O  O     . SER A  1 341 ? -59.180  45.470  -31.150  1.00 43.11 ? 322 SER A O     1 
ATOM   2473  C  CB    . SER A  1 341 ? -58.706  48.110  -33.184  1.00 43.00 ? 322 SER A CB    1 
ATOM   2474  O  OG    . SER A  1 341 ? -58.633  48.664  -34.488  1.00 42.05 ? 322 SER A OG    1 
ATOM   2475  N  N     . ILE A  1 342 ? -60.760  47.068  -31.143  1.00 43.03 ? 323 ILE A N     1 
ATOM   2476  C  CA    . ILE A  1 342 ? -61.272  46.721  -29.819  1.00 43.44 ? 323 ILE A CA    1 
ATOM   2477  C  C     . ILE A  1 342 ? -62.690  46.185  -29.949  1.00 43.64 ? 323 ILE A C     1 
ATOM   2478  O  O     . ILE A  1 342 ? -63.511  46.788  -30.653  1.00 43.90 ? 323 ILE A O     1 
ATOM   2479  C  CB    . ILE A  1 342 ? -61.282  47.924  -28.861  1.00 43.26 ? 323 ILE A CB    1 
ATOM   2480  C  CG1   . ILE A  1 342 ? -59.862  48.571  -28.757  1.00 44.01 ? 323 ILE A CG1   1 
ATOM   2481  C  CG2   . ILE A  1 342 ? -61.895  47.543  -27.503  1.00 42.16 ? 323 ILE A CG2   1 
ATOM   2482  C  CD1   . ILE A  1 342 ? -58.669  47.679  -28.832  1.00 41.04 ? 323 ILE A CD1   1 
ATOM   2483  N  N     . ARG A  1 343 ? -62.961  45.045  -29.302  1.00 43.66 ? 324 ARG A N     1 
ATOM   2484  C  CA    . ARG A  1 343 ? -64.343  44.553  -29.136  1.00 43.80 ? 324 ARG A CA    1 
ATOM   2485  C  C     . ARG A  1 343 ? -64.820  44.662  -27.700  1.00 43.19 ? 324 ARG A C     1 
ATOM   2486  O  O     . ARG A  1 343 ? -64.152  44.194  -26.792  1.00 41.53 ? 324 ARG A O     1 
ATOM   2487  C  CB    . ARG A  1 343 ? -64.480  43.106  -29.609  1.00 43.87 ? 324 ARG A CB    1 
ATOM   2488  C  CG    . ARG A  1 343 ? -65.767  42.390  -29.167  1.00 44.04 ? 324 ARG A CG    1 
ATOM   2489  C  CD    . ARG A  1 343 ? -65.971  41.100  -29.940  1.00 44.80 ? 324 ARG A CD    1 
ATOM   2490  N  NE    . ARG A  1 343 ? -66.618  40.057  -29.140  1.00 46.12 ? 324 ARG A NE    1 
ATOM   2491  C  CZ    . ARG A  1 343 ? -65.987  39.053  -28.517  1.00 47.57 ? 324 ARG A CZ    1 
ATOM   2492  N  NH1   . ARG A  1 343 ? -64.658  38.945  -28.565  1.00 48.25 ? 324 ARG A NH1   1 
ATOM   2493  N  NH2   . ARG A  1 343 ? -66.680  38.156  -27.823  1.00 45.46 ? 324 ARG A NH2   1 
ATOM   2494  N  N     . ILE A  1 344 ? -65.990  45.277  -27.518  1.00 43.49 ? 325 ILE A N     1 
ATOM   2495  C  CA    . ILE A  1 344 ? -66.703  45.173  -26.260  1.00 44.13 ? 325 ILE A CA    1 
ATOM   2496  C  C     . ILE A  1 344 ? -67.617  43.974  -26.397  1.00 44.47 ? 325 ILE A C     1 
ATOM   2497  O  O     . ILE A  1 344 ? -68.468  43.951  -27.269  1.00 44.70 ? 325 ILE A O     1 
ATOM   2498  C  CB    . ILE A  1 344 ? -67.541  46.399  -25.906  1.00 43.82 ? 325 ILE A CB    1 
ATOM   2499  C  CG1   . ILE A  1 344 ? -66.632  47.638  -25.772  1.00 43.87 ? 325 ILE A CG1   1 
ATOM   2500  C  CG2   . ILE A  1 344 ? -68.275  46.093  -24.595  1.00 43.20 ? 325 ILE A CG2   1 
ATOM   2501  C  CD1   . ILE A  1 344 ? -67.364  48.969  -25.692  1.00 43.94 ? 325 ILE A CD1   1 
ATOM   2502  N  N     . PRO A  1 345 ? -67.433  42.952  -25.560  1.00 45.10 ? 326 PRO A N     1 
ATOM   2503  C  CA    . PRO A  1 345 ? -68.292  41.777  -25.729  1.00 45.52 ? 326 PRO A CA    1 
ATOM   2504  C  C     . PRO A  1 345 ? -69.738  42.075  -25.321  1.00 45.79 ? 326 PRO A C     1 
ATOM   2505  O  O     . PRO A  1 345 ? -69.992  42.960  -24.489  1.00 46.49 ? 326 PRO A O     1 
ATOM   2506  C  CB    . PRO A  1 345 ? -67.647  40.724  -24.809  1.00 45.43 ? 326 PRO A CB    1 
ATOM   2507  C  CG    . PRO A  1 345 ? -66.270  41.280  -24.456  1.00 45.26 ? 326 PRO A CG    1 
ATOM   2508  C  CD    . PRO A  1 345 ? -66.492  42.770  -24.445  1.00 45.54 ? 326 PRO A CD    1 
ATOM   2509  N  N     . ARG A  1 346 ? -70.684  41.372  -25.924  1.00 46.05 ? 327 ARG A N     1 
ATOM   2510  C  CA    . ARG A  1 346 ? -72.101  41.677  -25.702  1.00 45.99 ? 327 ARG A CA    1 
ATOM   2511  C  C     . ARG A  1 346 ? -72.408  41.733  -24.202  1.00 46.34 ? 327 ARG A C     1 
ATOM   2512  O  O     . ARG A  1 346 ? -73.016  42.683  -23.724  1.00 47.04 ? 327 ARG A O     1 
ATOM   2513  C  CB    . ARG A  1 346 ? -73.000  40.672  -26.421  1.00 45.49 ? 327 ARG A CB    1 
ATOM   2514  C  CG    . ARG A  1 346 ? -74.448  41.174  -26.586  1.00 46.45 ? 327 ARG A CG    1 
ATOM   2515  C  CD    . ARG A  1 346 ? -75.350  40.174  -27.343  1.00 46.44 ? 327 ARG A CD    1 
ATOM   2516  N  NE    . ARG A  1 346 ? -74.764  39.712  -28.603  1.00 46.67 ? 327 ARG A NE    1 
ATOM   2517  C  CZ    . ARG A  1 346 ? -74.608  40.481  -29.679  1.00 46.32 ? 327 ARG A CZ    1 
ATOM   2518  N  NH1   . ARG A  1 346 ? -74.949  41.762  -29.645  1.00 45.35 ? 327 ARG A NH1   1 
ATOM   2519  N  NH2   . ARG A  1 346 ? -74.069  39.975  -30.781  1.00 46.66 ? 327 ARG A NH2   1 
ATOM   2520  N  N     . THR A  1 347 ? -71.913  40.758  -23.451  1.00 46.85 ? 328 THR A N     1 
ATOM   2521  C  CA    . THR A  1 347 ? -72.214  40.661  -22.028  1.00 46.78 ? 328 THR A CA    1 
ATOM   2522  C  C     . THR A  1 347 ? -71.917  41.937  -21.300  1.00 46.95 ? 328 THR A C     1 
ATOM   2523  O  O     . THR A  1 347 ? -72.698  42.379  -20.472  1.00 46.39 ? 328 THR A O     1 
ATOM   2524  C  CB    . THR A  1 347 ? -71.422  39.534  -21.375  1.00 46.55 ? 328 THR A CB    1 
ATOM   2525  O  OG1   . THR A  1 347 ? -71.905  38.301  -21.888  1.00 45.24 ? 328 THR A OG1   1 
ATOM   2526  C  CG2   . THR A  1 347 ? -71.636  39.506  -19.860  1.00 47.34 ? 328 THR A CG2   1 
ATOM   2527  N  N     . VAL A  1 348 ? -70.780  42.526  -21.636  1.00 47.71 ? 329 VAL A N     1 
ATOM   2528  C  CA    . VAL A  1 348 ? -70.319  43.764  -21.007  1.00 47.98 ? 329 VAL A CA    1 
ATOM   2529  C  C     . VAL A  1 348 ? -71.163  44.957  -21.452  1.00 48.55 ? 329 VAL A C     1 
ATOM   2530  O  O     . VAL A  1 348 ? -71.418  45.841  -20.631  1.00 48.63 ? 329 VAL A O     1 
ATOM   2531  C  CB    . VAL A  1 348 ? -68.808  43.997  -21.300  1.00 48.12 ? 329 VAL A CB    1 
ATOM   2532  C  CG1   . VAL A  1 348 ? -68.323  45.313  -20.697  1.00 46.95 ? 329 VAL A CG1   1 
ATOM   2533  C  CG2   . VAL A  1 348 ? -68.008  42.798  -20.797  1.00 45.84 ? 329 VAL A CG2   1 
ATOM   2534  N  N     . GLY A  1 349 ? -71.602  44.977  -22.721  1.00 48.74 ? 330 GLY A N     1 
ATOM   2535  C  CA    . GLY A  1 349 ? -72.519  46.022  -23.193  1.00 49.46 ? 330 GLY A CA    1 
ATOM   2536  C  C     . GLY A  1 349 ? -73.862  46.047  -22.442  1.00 50.02 ? 330 GLY A C     1 
ATOM   2537  O  O     . GLY A  1 349 ? -74.361  47.098  -22.021  1.00 49.20 ? 330 GLY A O     1 
ATOM   2538  N  N     . GLN A  1 350 ? -74.423  44.852  -22.260  1.00 51.06 ? 331 GLN A N     1 
ATOM   2539  C  CA    . GLN A  1 350 ? -75.648  44.638  -21.494  1.00 51.35 ? 331 GLN A CA    1 
ATOM   2540  C  C     . GLN A  1 350 ? -75.470  44.981  -20.021  1.00 51.62 ? 331 GLN A C     1 
ATOM   2541  O  O     . GLN A  1 350 ? -76.295  45.692  -19.467  1.00 51.91 ? 331 GLN A O     1 
ATOM   2542  C  CB    . GLN A  1 350 ? -76.095  43.175  -21.596  1.00 51.77 ? 331 GLN A CB    1 
ATOM   2543  C  CG    . GLN A  1 350 ? -76.366  42.697  -23.010  1.00 53.23 ? 331 GLN A CG    1 
ATOM   2544  C  CD    . GLN A  1 350 ? -77.473  43.459  -23.665  1.00 54.38 ? 331 GLN A CD    1 
ATOM   2545  O  OE1   . GLN A  1 350 ? -78.595  43.435  -23.192  1.00 56.00 ? 331 GLN A OE1   1 
ATOM   2546  N  NE2   . GLN A  1 350 ? -77.170  44.141  -24.759  1.00 55.05 ? 331 GLN A NE2   1 
ATOM   2547  N  N     . GLU A  1 351 ? -74.406  44.480  -19.391  1.00 51.87 ? 332 GLU A N     1 
ATOM   2548  C  CA    . GLU A  1 351 ? -74.199  44.661  -17.937  1.00 52.26 ? 332 GLU A CA    1 
ATOM   2549  C  C     . GLU A  1 351 ? -73.590  46.005  -17.566  1.00 52.35 ? 332 GLU A C     1 
ATOM   2550  O  O     . GLU A  1 351 ? -73.514  46.358  -16.377  1.00 52.36 ? 332 GLU A O     1 
ATOM   2551  C  CB    . GLU A  1 351 ? -73.356  43.524  -17.368  1.00 51.87 ? 332 GLU A CB    1 
ATOM   2552  C  CG    . GLU A  1 351 ? -74.080  42.200  -17.482  1.00 52.61 ? 332 GLU A CG    1 
ATOM   2553  C  CD    . GLU A  1 351 ? -73.319  41.021  -16.907  1.00 54.05 ? 332 GLU A CD    1 
ATOM   2554  O  OE1   . GLU A  1 351 ? -72.379  41.224  -16.103  1.00 54.31 ? 332 GLU A OE1   1 
ATOM   2555  O  OE2   . GLU A  1 351 ? -73.687  39.867  -17.256  1.00 58.12 ? 332 GLU A OE2   1 
ATOM   2556  N  N     . LYS A  1 352 ? -73.179  46.757  -18.585  1.00 52.19 ? 333 LYS A N     1 
ATOM   2557  C  CA    . LYS A  1 352 ? -72.607  48.070  -18.396  1.00 52.63 ? 333 LYS A CA    1 
ATOM   2558  C  C     . LYS A  1 352 ? -71.426  48.069  -17.405  1.00 52.27 ? 333 LYS A C     1 
ATOM   2559  O  O     . LYS A  1 352 ? -71.182  49.037  -16.684  1.00 52.85 ? 333 LYS A O     1 
ATOM   2560  C  CB    . LYS A  1 352 ? -73.703  49.074  -18.022  1.00 53.26 ? 333 LYS A CB    1 
ATOM   2561  C  CG    . LYS A  1 352 ? -74.688  49.300  -19.188  1.00 54.18 ? 333 LYS A CG    1 
ATOM   2562  C  CD    . LYS A  1 352 ? -75.989  49.918  -18.715  1.00 54.88 ? 333 LYS A CD    1 
ATOM   2563  C  CE    . LYS A  1 352 ? -76.990  50.218  -19.879  1.00 57.01 ? 333 LYS A CE    1 
ATOM   2564  N  NZ    . LYS A  1 352 ? -77.189  51.700  -20.176  1.00 58.61 ? 333 LYS A NZ    1 
ATOM   2565  N  N     . LYS A  1 353 ? -70.664  46.981  -17.443  1.00 51.41 ? 334 LYS A N     1 
ATOM   2566  C  CA    . LYS A  1 353 ? -69.489  46.800  -16.611  1.00 50.67 ? 334 LYS A CA    1 
ATOM   2567  C  C     . LYS A  1 353 ? -68.718  45.575  -17.074  1.00 49.69 ? 334 LYS A C     1 
ATOM   2568  O  O     . LYS A  1 353 ? -69.294  44.656  -17.662  1.00 49.95 ? 334 LYS A O     1 
ATOM   2569  C  CB    . LYS A  1 353 ? -69.884  46.579  -15.153  1.00 50.87 ? 334 LYS A CB    1 
ATOM   2570  C  CG    . LYS A  1 353 ? -70.487  45.189  -14.864  1.00 50.87 ? 334 LYS A CG    1 
ATOM   2571  C  CD    . LYS A  1 353 ? -70.947  45.108  -13.403  1.00 51.35 ? 334 LYS A CD    1 
ATOM   2572  C  CE    . LYS A  1 353 ? -71.782  43.879  -13.124  1.00 51.04 ? 334 LYS A CE    1 
ATOM   2573  N  NZ    . LYS A  1 353 ? -72.312  43.995  -11.773  1.00 50.83 ? 334 LYS A NZ    1 
ATOM   2574  N  N     . GLY A  1 354 ? -67.427  45.548  -16.767  1.00 48.48 ? 335 GLY A N     1 
ATOM   2575  C  CA    . GLY A  1 354 ? -66.579  44.399  -17.063  1.00 47.73 ? 335 GLY A CA    1 
ATOM   2576  C  C     . GLY A  1 354 ? -65.241  44.780  -17.674  1.00 47.15 ? 335 GLY A C     1 
ATOM   2577  O  O     . GLY A  1 354 ? -64.389  45.401  -17.034  1.00 46.32 ? 335 GLY A O     1 
ATOM   2578  N  N     . TYR A  1 355 ? -65.065  44.395  -18.933  1.00 46.74 ? 336 TYR A N     1 
ATOM   2579  C  CA    . TYR A  1 355 ? -63.759  44.410  -19.571  1.00 46.19 ? 336 TYR A CA    1 
ATOM   2580  C  C     . TYR A  1 355 ? -63.931  44.591  -21.045  1.00 45.38 ? 336 TYR A C     1 
ATOM   2581  O  O     . TYR A  1 355 ? -64.977  44.263  -21.584  1.00 45.38 ? 336 TYR A O     1 
ATOM   2582  C  CB    . TYR A  1 355 ? -63.012  43.082  -19.306  1.00 46.71 ? 336 TYR A CB    1 
ATOM   2583  C  CG    . TYR A  1 355 ? -63.689  41.817  -19.866  1.00 47.07 ? 336 TYR A CG    1 
ATOM   2584  C  CD1   . TYR A  1 355 ? -63.370  41.337  -21.152  1.00 46.17 ? 336 TYR A CD1   1 
ATOM   2585  C  CD2   . TYR A  1 355 ? -64.618  41.092  -19.103  1.00 46.15 ? 336 TYR A CD2   1 
ATOM   2586  C  CE1   . TYR A  1 355 ? -63.976  40.197  -21.662  1.00 46.29 ? 336 TYR A CE1   1 
ATOM   2587  C  CE2   . TYR A  1 355 ? -65.221  39.924  -19.607  1.00 46.69 ? 336 TYR A CE2   1 
ATOM   2588  C  CZ    . TYR A  1 355 ? -64.901  39.490  -20.886  1.00 46.38 ? 336 TYR A CZ    1 
ATOM   2589  O  OH    . TYR A  1 355 ? -65.477  38.356  -21.399  1.00 45.44 ? 336 TYR A OH    1 
ATOM   2590  N  N     . PHE A  1 356 ? -62.904  45.123  -21.691  1.00 44.73 ? 337 PHE A N     1 
ATOM   2591  C  CA    . PHE A  1 356 ? -62.864  45.160  -23.150  1.00 44.25 ? 337 PHE A CA    1 
ATOM   2592  C  C     . PHE A  1 356 ? -61.733  44.240  -23.674  1.00 43.67 ? 337 PHE A C     1 
ATOM   2593  O  O     . PHE A  1 356 ? -60.876  43.786  -22.898  1.00 42.84 ? 337 PHE A O     1 
ATOM   2594  C  CB    . PHE A  1 356 ? -62.739  46.597  -23.669  1.00 43.64 ? 337 PHE A CB    1 
ATOM   2595  C  CG    . PHE A  1 356 ? -61.454  47.254  -23.336  1.00 43.59 ? 337 PHE A CG    1 
ATOM   2596  C  CD1   . PHE A  1 356 ? -60.397  47.224  -24.229  1.00 43.84 ? 337 PHE A CD1   1 
ATOM   2597  C  CD2   . PHE A  1 356 ? -61.301  47.936  -22.154  1.00 43.87 ? 337 PHE A CD2   1 
ATOM   2598  C  CE1   . PHE A  1 356 ? -59.206  47.846  -23.930  1.00 44.03 ? 337 PHE A CE1   1 
ATOM   2599  C  CE2   . PHE A  1 356 ? -60.098  48.581  -21.851  1.00 43.72 ? 337 PHE A CE2   1 
ATOM   2600  C  CZ    . PHE A  1 356 ? -59.063  48.539  -22.732  1.00 43.31 ? 337 PHE A CZ    1 
ATOM   2601  N  N     . GLU A  1 357 ? -61.770  43.988  -24.985  1.00 42.92 ? 338 GLU A N     1 
ATOM   2602  C  CA    . GLU A  1 357 ? -60.897  43.042  -25.661  1.00 42.56 ? 338 GLU A CA    1 
ATOM   2603  C  C     . GLU A  1 357 ? -60.105  43.781  -26.706  1.00 41.78 ? 338 GLU A C     1 
ATOM   2604  O  O     . GLU A  1 357 ? -60.682  44.258  -27.677  1.00 41.22 ? 338 GLU A O     1 
ATOM   2605  C  CB    . GLU A  1 357 ? -61.733  41.948  -26.355  1.00 42.32 ? 338 GLU A CB    1 
ATOM   2606  C  CG    . GLU A  1 357 ? -60.916  40.805  -26.952  1.00 42.69 ? 338 GLU A CG    1 
ATOM   2607  C  CD    . GLU A  1 357 ? -61.617  40.045  -28.081  1.00 42.62 ? 338 GLU A CD    1 
ATOM   2608  O  OE1   . GLU A  1 357 ? -62.481  40.640  -28.737  1.00 42.91 ? 338 GLU A OE1   1 
ATOM   2609  O  OE2   . GLU A  1 357 ? -61.294  38.856  -28.320  1.00 43.25 ? 338 GLU A OE2   1 
ATOM   2610  N  N     . ASP A  1 358 ? -58.788  43.864  -26.513  1.00 41.55 ? 339 ASP A N     1 
ATOM   2611  C  CA    . ASP A  1 358 ? -57.880  44.359  -27.554  1.00 41.58 ? 339 ASP A CA    1 
ATOM   2612  C  C     . ASP A  1 358 ? -57.528  43.157  -28.439  1.00 41.63 ? 339 ASP A C     1 
ATOM   2613  O  O     . ASP A  1 358 ? -56.853  42.234  -28.012  1.00 41.07 ? 339 ASP A O     1 
ATOM   2614  C  CB    . ASP A  1 358 ? -56.636  44.989  -26.937  1.00 41.09 ? 339 ASP A CB    1 
ATOM   2615  C  CG    . ASP A  1 358 ? -55.771  45.763  -27.954  1.00 42.54 ? 339 ASP A CG    1 
ATOM   2616  O  OD1   . ASP A  1 358 ? -55.794  45.462  -29.181  1.00 42.69 ? 339 ASP A OD1   1 
ATOM   2617  O  OD2   . ASP A  1 358 ? -55.026  46.685  -27.508  1.00 43.86 ? 339 ASP A OD2   1 
ATOM   2618  N  N     . ARG A  1 359 ? -58.028  43.184  -29.675  1.00 41.91 ? 340 ARG A N     1 
ATOM   2619  C  CA    . ARG A  1 359 ? -57.817  42.107  -30.647  1.00 41.60 ? 340 ARG A CA    1 
ATOM   2620  C  C     . ARG A  1 359 ? -56.583  42.296  -31.513  1.00 41.60 ? 340 ARG A C     1 
ATOM   2621  O  O     . ARG A  1 359 ? -56.337  41.489  -32.398  1.00 42.31 ? 340 ARG A O     1 
ATOM   2622  C  CB    . ARG A  1 359 ? -59.032  41.982  -31.556  1.00 41.43 ? 340 ARG A CB    1 
ATOM   2623  C  CG    . ARG A  1 359 ? -60.325  41.713  -30.795  1.00 41.71 ? 340 ARG A CG    1 
ATOM   2624  C  CD    . ARG A  1 359 ? -61.542  41.655  -31.722  1.00 41.57 ? 340 ARG A CD    1 
ATOM   2625  N  NE    . ARG A  1 359 ? -61.427  40.628  -32.748  1.00 41.30 ? 340 ARG A NE    1 
ATOM   2626  C  CZ    . ARG A  1 359 ? -61.724  39.337  -32.597  1.00 40.83 ? 340 ARG A CZ    1 
ATOM   2627  N  NH1   . ARG A  1 359 ? -62.160  38.843  -31.434  1.00 41.85 ? 340 ARG A NH1   1 
ATOM   2628  N  NH2   . ARG A  1 359 ? -61.555  38.524  -33.628  1.00 39.29 ? 340 ARG A NH2   1 
ATOM   2629  N  N     . ARG A  1 360 ? -55.787  43.328  -31.249  1.00 41.17 ? 341 ARG A N     1 
ATOM   2630  C  CA    . ARG A  1 360 ? -54.590  43.600  -32.087  1.00 41.38 ? 341 ARG A CA    1 
ATOM   2631  C  C     . ARG A  1 360 ? -53.361  42.691  -31.817  1.00 40.74 ? 341 ARG A C     1 
ATOM   2632  O  O     . ARG A  1 360 ? -52.655  42.348  -32.751  1.00 40.94 ? 341 ARG A O     1 
ATOM   2633  C  CB    . ARG A  1 360 ? -54.182  45.108  -32.031  1.00 41.21 ? 341 ARG A CB    1 
ATOM   2634  C  CG    . ARG A  1 360 ? -55.279  46.085  -32.541  1.00 41.66 ? 341 ARG A CG    1 
ATOM   2635  C  CD    . ARG A  1 360 ? -54.939  47.554  -32.243  1.00 42.18 ? 341 ARG A CD    1 
ATOM   2636  N  NE    . ARG A  1 360 ? -54.985  47.862  -30.810  1.00 43.52 ? 341 ARG A NE    1 
ATOM   2637  C  CZ    . ARG A  1 360 ? -54.714  49.058  -30.264  1.00 43.04 ? 341 ARG A CZ    1 
ATOM   2638  N  NH1   . ARG A  1 360 ? -54.412  50.136  -31.000  1.00 42.54 ? 341 ARG A NH1   1 
ATOM   2639  N  NH2   . ARG A  1 360 ? -54.795  49.182  -28.948  1.00 42.35 ? 341 ARG A NH2   1 
ATOM   2640  N  N     . PRO A  1 361 ? -53.080  42.320  -30.565  1.00 40.14 ? 342 PRO A N     1 
ATOM   2641  C  CA    . PRO A  1 361 ? -51.838  41.566  -30.344  1.00 40.24 ? 342 PRO A CA    1 
ATOM   2642  C  C     . PRO A  1 361 ? -51.698  40.242  -31.099  1.00 39.69 ? 342 PRO A C     1 
ATOM   2643  O  O     . PRO A  1 361 ? -52.655  39.484  -31.226  1.00 38.98 ? 342 PRO A O     1 
ATOM   2644  C  CB    . PRO A  1 361 ? -51.835  41.317  -28.847  1.00 40.05 ? 342 PRO A CB    1 
ATOM   2645  C  CG    . PRO A  1 361 ? -52.718  42.355  -28.300  1.00 40.68 ? 342 PRO A CG    1 
ATOM   2646  C  CD    . PRO A  1 361 ? -53.783  42.565  -29.305  1.00 40.59 ? 342 PRO A CD    1 
ATOM   2647  N  N     . SER A  1 362 ? -50.488  40.007  -31.608  1.00 39.91 ? 343 SER A N     1 
ATOM   2648  C  CA    . SER A  1 362 ? -50.161  38.798  -32.377  1.00 40.03 ? 343 SER A CA    1 
ATOM   2649  C  C     . SER A  1 362 ? -50.127  37.577  -31.461  1.00 39.67 ? 343 SER A C     1 
ATOM   2650  O  O     . SER A  1 362 ? -49.840  37.692  -30.262  1.00 39.63 ? 343 SER A O     1 
ATOM   2651  C  CB    . SER A  1 362 ? -48.801  38.965  -33.088  1.00 39.99 ? 343 SER A CB    1 
ATOM   2652  O  OG    . SER A  1 362 ? -48.288  37.727  -33.595  1.00 41.05 ? 343 SER A OG    1 
ATOM   2653  N  N     . ALA A  1 363 ? -50.419  36.410  -32.024  1.00 39.32 ? 344 ALA A N     1 
ATOM   2654  C  CA    . ALA A  1 363 ? -50.215  35.171  -31.284  1.00 39.57 ? 344 ALA A CA    1 
ATOM   2655  C  C     . ALA A  1 363 ? -48.797  35.134  -30.729  1.00 39.76 ? 344 ALA A C     1 
ATOM   2656  O  O     . ALA A  1 363 ? -48.626  34.530  -29.674  1.00 40.68 ? 344 ALA A O     1 
ATOM   2657  C  CB    . ALA A  1 363 ? -50.480  33.932  -32.127  1.00 38.25 ? 344 ALA A CB    1 
ATOM   2658  N  N     . ASN A  1 364 ? -47.799  35.742  -31.411  1.00 39.67 ? 345 ASN A N     1 
ATOM   2659  C  CA    . ASN A  1 364 ? -46.358  35.722  -30.941  1.00 39.93 ? 345 ASN A CA    1 
ATOM   2660  C  C     . ASN A  1 364 ? -45.890  36.959  -30.123  1.00 40.14 ? 345 ASN A C     1 
ATOM   2661  O  O     . ASN A  1 364 ? -44.712  37.182  -29.972  1.00 41.21 ? 345 ASN A O     1 
ATOM   2662  C  CB    . ASN A  1 364 ? -45.358  35.457  -32.102  1.00 39.85 ? 345 ASN A CB    1 
ATOM   2663  C  CG    . ASN A  1 364 ? -45.136  36.710  -33.048  1.00 40.71 ? 345 ASN A CG    1 
ATOM   2664  O  OD1   . ASN A  1 364 ? -45.938  37.632  -33.086  1.00 42.05 ? 345 ASN A OD1   1 
ATOM   2665  N  ND2   . ASN A  1 364 ? -44.041  36.704  -33.806  1.00 40.16 ? 345 ASN A ND2   1 
ATOM   2666  N  N     . CYS A  1 365 ? -46.805  37.750  -29.587  1.00 39.97 ? 346 CYS A N     1 
ATOM   2667  C  CA    . CYS A  1 365 ? -46.428  38.876  -28.762  1.00 39.83 ? 346 CYS A CA    1 
ATOM   2668  C  C     . CYS A  1 365 ? -45.778  38.419  -27.452  1.00 39.23 ? 346 CYS A C     1 
ATOM   2669  O  O     . CYS A  1 365 ? -45.936  37.289  -27.048  1.00 39.19 ? 346 CYS A O     1 
ATOM   2670  C  CB    . CYS A  1 365 ? -47.682  39.658  -28.412  1.00 39.34 ? 346 CYS A CB    1 
ATOM   2671  S  SG    . CYS A  1 365 ? -48.651  38.684  -27.272  1.00 40.89 ? 346 CYS A SG    1 
ATOM   2672  N  N     . ASP A  1 366 ? -45.073  39.323  -26.789  1.00 39.26 ? 347 ASP A N     1 
ATOM   2673  C  CA    . ASP A  1 366 ? -44.579  39.092  -25.441  1.00 39.56 ? 347 ASP A CA    1 
ATOM   2674  C  C     . ASP A  1 366 ? -45.558  39.791  -24.504  1.00 39.99 ? 347 ASP A C     1 
ATOM   2675  O  O     . ASP A  1 366 ? -45.659  41.026  -24.516  1.00 39.96 ? 347 ASP A O     1 
ATOM   2676  C  CB    . ASP A  1 366 ? -43.161  39.664  -25.234  1.00 39.39 ? 347 ASP A CB    1 
ATOM   2677  C  CG    . ASP A  1 366 ? -42.606  39.447  -23.772  1.00 40.14 ? 347 ASP A CG    1 
ATOM   2678  O  OD1   . ASP A  1 366 ? -43.382  39.166  -22.828  1.00 40.77 ? 347 ASP A OD1   1 
ATOM   2679  O  OD2   . ASP A  1 366 ? -41.369  39.574  -23.569  1.00 42.07 ? 347 ASP A OD2   1 
ATOM   2680  N  N     . PRO A  1 367 ? -46.261  39.009  -23.663  1.00 40.00 ? 348 PRO A N     1 
ATOM   2681  C  CA    . PRO A  1 367 ? -47.282  39.550  -22.764  1.00 39.96 ? 348 PRO A CA    1 
ATOM   2682  C  C     . PRO A  1 367 ? -46.801  40.681  -21.868  1.00 40.24 ? 348 PRO A C     1 
ATOM   2683  O  O     . PRO A  1 367 ? -47.616  41.514  -21.451  1.00 41.02 ? 348 PRO A O     1 
ATOM   2684  C  CB    . PRO A  1 367 ? -47.680  38.347  -21.902  1.00 40.04 ? 348 PRO A CB    1 
ATOM   2685  C  CG    . PRO A  1 367 ? -46.633  37.290  -22.135  1.00 39.99 ? 348 PRO A CG    1 
ATOM   2686  C  CD    . PRO A  1 367 ? -46.116  37.552  -23.524  1.00 39.90 ? 348 PRO A CD    1 
ATOM   2687  N  N     . PHE A  1 368 ? -45.509  40.725  -21.547  1.00 40.18 ? 349 PHE A N     1 
ATOM   2688  C  CA    . PHE A  1 368 ? -45.011  41.817  -20.694  1.00 40.47 ? 349 PHE A CA    1 
ATOM   2689  C  C     . PHE A  1 368 ? -45.039  43.161  -21.435  1.00 40.76 ? 349 PHE A C     1 
ATOM   2690  O  O     . PHE A  1 368 ? -45.177  44.220  -20.830  1.00 40.94 ? 349 PHE A O     1 
ATOM   2691  C  CB    . PHE A  1 368 ? -43.599  41.518  -20.219  1.00 40.13 ? 349 PHE A CB    1 
ATOM   2692  C  CG    . PHE A  1 368 ? -43.521  40.311  -19.339  1.00 40.52 ? 349 PHE A CG    1 
ATOM   2693  C  CD1   . PHE A  1 368 ? -44.361  40.184  -18.249  1.00 38.66 ? 349 PHE A CD1   1 
ATOM   2694  C  CD2   . PHE A  1 368 ? -42.582  39.308  -19.584  1.00 39.13 ? 349 PHE A CD2   1 
ATOM   2695  C  CE1   . PHE A  1 368 ? -44.275  39.069  -17.420  1.00 40.67 ? 349 PHE A CE1   1 
ATOM   2696  C  CE2   . PHE A  1 368 ? -42.500  38.187  -18.756  1.00 39.18 ? 349 PHE A CE2   1 
ATOM   2697  C  CZ    . PHE A  1 368 ? -43.327  38.055  -17.686  1.00 39.43 ? 349 PHE A CZ    1 
ATOM   2698  N  N     . SER A  1 369 ? -44.889  43.073  -22.750  1.00 40.51 ? 350 SER A N     1 
ATOM   2699  C  CA    . SER A  1 369 ? -44.878  44.198  -23.609  1.00 40.51 ? 350 SER A CA    1 
ATOM   2700  C  C     . SER A  1 369 ? -46.316  44.655  -23.868  1.00 40.71 ? 350 SER A C     1 
ATOM   2701  O  O     . SER A  1 369 ? -46.624  45.844  -23.779  1.00 40.94 ? 350 SER A O     1 
ATOM   2702  C  CB    . SER A  1 369 ? -44.149  43.817  -24.890  1.00 40.55 ? 350 SER A CB    1 
ATOM   2703  O  OG    . SER A  1 369 ? -44.116  44.907  -25.762  1.00 41.37 ? 350 SER A OG    1 
ATOM   2704  N  N     . VAL A  1 370 ? -47.210  43.711  -24.143  1.00 40.88 ? 351 VAL A N     1 
ATOM   2705  C  CA    . VAL A  1 370 ? -48.614  44.052  -24.366  1.00 40.44 ? 351 VAL A CA    1 
ATOM   2706  C  C     . VAL A  1 370 ? -49.239  44.634  -23.108  1.00 40.75 ? 351 VAL A C     1 
ATOM   2707  O  O     . VAL A  1 370 ? -49.915  45.653  -23.190  1.00 40.73 ? 351 VAL A O     1 
ATOM   2708  C  CB    . VAL A  1 370 ? -49.431  42.835  -24.817  1.00 40.54 ? 351 VAL A CB    1 
ATOM   2709  C  CG1   . VAL A  1 370 ? -50.980  43.160  -24.847  1.00 39.45 ? 351 VAL A CG1   1 
ATOM   2710  C  CG2   . VAL A  1 370 ? -48.901  42.325  -26.157  1.00 39.22 ? 351 VAL A CG2   1 
ATOM   2711  N  N     . THR A  1 371 ? -49.027  43.995  -21.953  1.00 40.68 ? 352 THR A N     1 
ATOM   2712  C  CA    . THR A  1 371 ? -49.700  44.440  -20.727  1.00 41.06 ? 352 THR A CA    1 
ATOM   2713  C  C     . THR A  1 371 ? -49.136  45.774  -20.235  1.00 41.13 ? 352 THR A C     1 
ATOM   2714  O  O     . THR A  1 371 ? -49.844  46.607  -19.728  1.00 41.23 ? 352 THR A O     1 
ATOM   2715  C  CB    . THR A  1 371 ? -49.635  43.380  -19.599  1.00 40.70 ? 352 THR A CB    1 
ATOM   2716  O  OG1   . THR A  1 371 ? -48.301  42.968  -19.435  1.00 40.47 ? 352 THR A OG1   1 
ATOM   2717  C  CG2   . THR A  1 371 ? -50.448  42.158  -19.938  1.00 40.56 ? 352 THR A CG2   1 
ATOM   2718  N  N     . GLU A  1 372 ? -47.838  45.946  -20.382  1.00 41.92 ? 353 GLU A N     1 
ATOM   2719  C  CA    . GLU A  1 372 ? -47.174  47.209  -20.060  1.00 42.00 ? 353 GLU A CA    1 
ATOM   2720  C  C     . GLU A  1 372 ? -47.770  48.339  -20.890  1.00 41.98 ? 353 GLU A C     1 
ATOM   2721  O  O     . GLU A  1 372 ? -48.099  49.375  -20.343  1.00 41.99 ? 353 GLU A O     1 
ATOM   2722  C  CB    . GLU A  1 372 ? -45.646  47.104  -20.287  1.00 41.99 ? 353 GLU A CB    1 
ATOM   2723  C  CG    . GLU A  1 372 ? -44.868  48.322  -19.844  1.00 42.30 ? 353 GLU A CG    1 
ATOM   2724  C  CD    . GLU A  1 372 ? -43.375  48.225  -20.106  1.00 41.97 ? 353 GLU A CD    1 
ATOM   2725  O  OE1   . GLU A  1 372 ? -42.731  47.172  -19.876  1.00 44.06 ? 353 GLU A OE1   1 
ATOM   2726  O  OE2   . GLU A  1 372 ? -42.838  49.238  -20.556  1.00 41.46 ? 353 GLU A OE2   1 
ATOM   2727  N  N     . ALA A  1 373 ? -47.911  48.125  -22.201  1.00 41.78 ? 354 ALA A N     1 
ATOM   2728  C  CA    . ALA A  1 373 ? -48.470  49.130  -23.088  1.00 41.79 ? 354 ALA A CA    1 
ATOM   2729  C  C     . ALA A  1 373 ? -49.880  49.542  -22.639  1.00 41.90 ? 354 ALA A C     1 
ATOM   2730  O  O     . ALA A  1 373 ? -50.203  50.722  -22.590  1.00 41.87 ? 354 ALA A O     1 
ATOM   2731  C  CB    . ALA A  1 373 ? -48.492  48.620  -24.511  1.00 41.58 ? 354 ALA A CB    1 
ATOM   2732  N  N     . LEU A  1 374 ? -50.714  48.569  -22.295  1.00 42.28 ? 355 LEU A N     1 
ATOM   2733  C  CA    . LEU A  1 374 ? -52.085  48.874  -21.894  1.00 42.30 ? 355 LEU A CA    1 
ATOM   2734  C  C     . LEU A  1 374 ? -52.027  49.756  -20.650  1.00 42.90 ? 355 LEU A C     1 
ATOM   2735  O  O     . LEU A  1 374 ? -52.753  50.750  -20.597  1.00 43.41 ? 355 LEU A O     1 
ATOM   2736  C  CB    . LEU A  1 374 ? -52.938  47.613  -21.681  1.00 41.73 ? 355 LEU A CB    1 
ATOM   2737  C  CG    . LEU A  1 374 ? -53.394  46.855  -22.971  1.00 41.30 ? 355 LEU A CG    1 
ATOM   2738  C  CD1   . LEU A  1 374 ? -53.881  45.426  -22.657  1.00 38.52 ? 355 LEU A CD1   1 
ATOM   2739  C  CD2   . LEU A  1 374 ? -54.475  47.583  -23.776  1.00 37.63 ? 355 LEU A CD2   1 
ATOM   2740  N  N     . ILE A  1 375 ? -51.132  49.451  -19.695  1.00 42.69 ? 356 ILE A N     1 
ATOM   2741  C  CA    . ILE A  1 375 ? -51.072  50.209  -18.440  1.00 42.92 ? 356 ILE A CA    1 
ATOM   2742  C  C     . ILE A  1 375 ? -50.633  51.642  -18.682  1.00 43.28 ? 356 ILE A C     1 
ATOM   2743  O  O     . ILE A  1 375 ? -51.235  52.578  -18.166  1.00 43.41 ? 356 ILE A O     1 
ATOM   2744  C  CB    . ILE A  1 375 ? -50.146  49.571  -17.399  1.00 42.47 ? 356 ILE A CB    1 
ATOM   2745  C  CG1   . ILE A  1 375 ? -50.707  48.231  -16.916  1.00 43.70 ? 356 ILE A CG1   1 
ATOM   2746  C  CG2   . ILE A  1 375 ? -49.945  50.477  -16.224  1.00 41.94 ? 356 ILE A CG2   1 
ATOM   2747  C  CD1   . ILE A  1 375 ? -52.233  48.247  -16.512  1.00 43.80 ? 356 ILE A CD1   1 
ATOM   2748  N  N     . ARG A  1 376 ? -49.591  51.815  -19.471  1.00 43.79 ? 357 ARG A N     1 
ATOM   2749  C  CA    . ARG A  1 376 ? -49.040  53.139  -19.695  1.00 44.31 ? 357 ARG A CA    1 
ATOM   2750  C  C     . ARG A  1 376 ? -50.049  54.034  -20.360  1.00 44.53 ? 357 ARG A C     1 
ATOM   2751  O  O     . ARG A  1 376 ? -50.247  55.165  -19.931  1.00 44.69 ? 357 ARG A O     1 
ATOM   2752  C  CB    . ARG A  1 376 ? -47.815  53.062  -20.584  1.00 44.59 ? 357 ARG A CB    1 
ATOM   2753  C  CG    . ARG A  1 376 ? -46.602  52.419  -19.913  1.00 44.88 ? 357 ARG A CG    1 
ATOM   2754  C  CD    . ARG A  1 376 ? -45.473  52.409  -20.898  1.00 44.70 ? 357 ARG A CD    1 
ATOM   2755  N  NE    . ARG A  1 376 ? -44.255  51.842  -20.367  1.00 45.27 ? 357 ARG A NE    1 
ATOM   2756  C  CZ    . ARG A  1 376 ? -43.298  52.538  -19.778  1.00 44.61 ? 357 ARG A CZ    1 
ATOM   2757  N  NH1   . ARG A  1 376 ? -43.430  53.837  -19.610  1.00 44.66 ? 357 ARG A NH1   1 
ATOM   2758  N  NH2   . ARG A  1 376 ? -42.223  51.917  -19.333  1.00 43.74 ? 357 ARG A NH2   1 
ATOM   2759  N  N     . THR A  1 377 ? -50.694  53.512  -21.395  1.00 44.34 ? 358 THR A N     1 
ATOM   2760  C  CA    . THR A  1 377 ? -51.626  54.288  -22.193  1.00 44.83 ? 358 THR A CA    1 
ATOM   2761  C  C     . THR A  1 377 ? -52.928  54.521  -21.436  1.00 45.32 ? 358 THR A C     1 
ATOM   2762  O  O     . THR A  1 377 ? -53.418  55.635  -21.389  1.00 46.19 ? 358 THR A O     1 
ATOM   2763  C  CB    . THR A  1 377 ? -51.871  53.589  -23.565  1.00 44.93 ? 358 THR A CB    1 
ATOM   2764  O  OG1   . THR A  1 377 ? -50.638  53.567  -24.318  1.00 44.37 ? 358 THR A OG1   1 
ATOM   2765  C  CG2   . THR A  1 377 ? -52.965  54.260  -24.357  1.00 43.32 ? 358 THR A CG2   1 
ATOM   2766  N  N     . CYS A  1 378 ? -53.468  53.492  -20.799  1.00 45.90 ? 359 CYS A N     1 
ATOM   2767  C  CA    . CYS A  1 378 ? -54.785  53.604  -20.197  1.00 46.42 ? 359 CYS A CA    1 
ATOM   2768  C  C     . CYS A  1 378 ? -54.827  54.087  -18.776  1.00 46.91 ? 359 CYS A C     1 
ATOM   2769  O  O     . CYS A  1 378 ? -55.822  54.690  -18.395  1.00 47.76 ? 359 CYS A O     1 
ATOM   2770  C  CB    . CYS A  1 378 ? -55.525  52.284  -20.270  1.00 46.22 ? 359 CYS A CB    1 
ATOM   2771  S  SG    . CYS A  1 378 ? -55.657  51.749  -21.949  1.00 47.57 ? 359 CYS A SG    1 
ATOM   2772  N  N     . LEU A  1 379 ? -53.807  53.809  -17.976  1.00 47.47 ? 360 LEU A N     1 
ATOM   2773  C  CA    . LEU A  1 379 ? -53.878  54.146  -16.551  1.00 47.88 ? 360 LEU A CA    1 
ATOM   2774  C  C     . LEU A  1 379 ? -52.900  55.242  -16.141  1.00 48.46 ? 360 LEU A C     1 
ATOM   2775  O  O     . LEU A  1 379 ? -53.177  55.960  -15.185  1.00 48.69 ? 360 LEU A O     1 
ATOM   2776  C  CB    . LEU A  1 379 ? -53.694  52.897  -15.668  1.00 47.81 ? 360 LEU A CB    1 
ATOM   2777  C  CG    . LEU A  1 379 ? -54.641  51.701  -15.911  1.00 48.28 ? 360 LEU A CG    1 
ATOM   2778  C  CD1   . LEU A  1 379 ? -54.499  50.641  -14.842  1.00 47.47 ? 360 LEU A CD1   1 
ATOM   2779  C  CD2   . LEU A  1 379 ? -56.108  52.135  -15.989  1.00 48.54 ? 360 LEU A CD2   1 
ATOM   2780  N  N     . LEU A  1 380 ? -51.761  55.356  -16.830  1.00 48.96 ? 361 LEU A N     1 
ATOM   2781  C  CA    . LEU A  1 380 ? -50.747  56.391  -16.527  1.00 49.39 ? 361 LEU A CA    1 
ATOM   2782  C  C     . LEU A  1 380 ? -50.811  57.544  -17.547  1.00 50.05 ? 361 LEU A C     1 
ATOM   2783  O  O     . LEU A  1 380 ? -49.987  58.453  -17.525  1.00 49.30 ? 361 LEU A O     1 
ATOM   2784  C  CB    . LEU A  1 380 ? -49.342  55.790  -16.534  1.00 49.11 ? 361 LEU A CB    1 
ATOM   2785  C  CG    . LEU A  1 380 ? -49.037  54.671  -15.537  1.00 48.58 ? 361 LEU A CG    1 
ATOM   2786  C  CD1   . LEU A  1 380 ? -47.683  54.010  -15.860  1.00 46.58 ? 361 LEU A CD1   1 
ATOM   2787  C  CD2   . LEU A  1 380 ? -49.079  55.231  -14.121  1.00 46.11 ? 361 LEU A CD2   1 
ATOM   2788  N  N     . ASN A  1 381 ? -51.788  57.469  -18.455  1.00 50.91 ? 362 ASN A N     1 
ATOM   2789  C  CA    . ASN A  1 381 ? -52.052  58.518  -19.451  1.00 51.13 ? 362 ASN A CA    1 
ATOM   2790  C  C     . ASN A  1 381 ? -50.836  59.008  -20.176  1.00 51.21 ? 362 ASN A C     1 
ATOM   2791  O  O     . ASN A  1 381 ? -50.649  60.190  -20.315  1.00 50.76 ? 362 ASN A O     1 
ATOM   2792  C  CB    . ASN A  1 381 ? -52.786  59.697  -18.810  1.00 51.13 ? 362 ASN A CB    1 
ATOM   2793  C  CG    . ASN A  1 381 ? -54.018  59.258  -18.088  1.00 52.17 ? 362 ASN A CG    1 
ATOM   2794  O  OD1   . ASN A  1 381 ? -54.665  58.266  -18.455  1.00 53.47 ? 362 ASN A OD1   1 
ATOM   2795  N  ND2   . ASN A  1 381 ? -54.336  59.958  -17.024  1.00 53.96 ? 362 ASN A ND2   1 
ATOM   2796  N  N     . GLU A  1 382 ? -50.026  58.092  -20.662  1.00 51.85 ? 363 GLU A N     1 
ATOM   2797  C  CA    . GLU A  1 382 ? -48.915  58.477  -21.479  1.00 52.94 ? 363 GLU A CA    1 
ATOM   2798  C  C     . GLU A  1 382 ? -49.360  58.782  -22.879  1.00 52.95 ? 363 GLU A C     1 
ATOM   2799  O  O     . GLU A  1 382 ? -50.347  58.241  -23.356  1.00 53.04 ? 363 GLU A O     1 
ATOM   2800  C  CB    . GLU A  1 382 ? -47.854  57.394  -21.487  1.00 53.04 ? 363 GLU A CB    1 
ATOM   2801  C  CG    . GLU A  1 382 ? -46.966  57.466  -20.257  1.00 53.58 ? 363 GLU A CG    1 
ATOM   2802  C  CD    . GLU A  1 382 ? -45.861  56.447  -20.272  1.00 54.09 ? 363 GLU A CD    1 
ATOM   2803  O  OE1   . GLU A  1 382 ? -45.539  55.886  -21.356  1.00 56.34 ? 363 GLU A OE1   1 
ATOM   2804  O  OE2   . GLU A  1 382 ? -45.321  56.211  -19.175  1.00 56.23 ? 363 GLU A OE2   1 
ATOM   2805  N  N     . THR A  1 383 ? -48.608  59.674  -23.508  1.00 53.89 ? 364 THR A N     1 
ATOM   2806  C  CA    . THR A  1 383 ? -48.798  60.099  -24.887  1.00 54.72 ? 364 THR A CA    1 
ATOM   2807  C  C     . THR A  1 383 ? -47.392  60.313  -25.482  1.00 55.61 ? 364 THR A C     1 
ATOM   2808  O  O     . THR A  1 383 ? -46.388  60.129  -24.794  1.00 55.25 ? 364 THR A O     1 
ATOM   2809  C  CB    . THR A  1 383 ? -49.611  61.432  -24.962  1.00 54.63 ? 364 THR A CB    1 
ATOM   2810  O  OG1   . THR A  1 383 ? -49.105  62.352  -23.984  1.00 53.70 ? 364 THR A OG1   1 
ATOM   2811  C  CG2   . THR A  1 383 ? -51.108  61.200  -24.726  1.00 53.17 ? 364 THR A CG2   1 
ATOM   2812  N  N     . GLY A  1 384 ? -47.324  60.694  -26.757  1.00 57.18 ? 365 GLY A N     1 
ATOM   2813  C  CA    . GLY A  1 384 ? -46.029  60.956  -27.435  1.00 57.49 ? 365 GLY A CA    1 
ATOM   2814  C  C     . GLY A  1 384 ? -45.356  59.662  -27.902  1.00 58.45 ? 365 GLY A C     1 
ATOM   2815  O  O     . GLY A  1 384 ? -46.015  58.748  -28.442  1.00 59.45 ? 365 GLY A O     1 
ATOM   2816  N  N     . ASN B  1 29  ? -40.814  -6.494  -27.272  1.00 62.19 ? 10  ASN B N     1 
ATOM   2817  C  CA    . ASN B  1 29  ? -41.697  -5.350  -26.855  1.00 61.61 ? 10  ASN B CA    1 
ATOM   2818  C  C     . ASN B  1 29  ? -41.723  -5.127  -25.328  1.00 61.33 ? 10  ASN B C     1 
ATOM   2819  O  O     . ASN B  1 29  ? -41.888  -6.051  -24.513  1.00 61.01 ? 10  ASN B O     1 
ATOM   2820  C  CB    . ASN B  1 29  ? -43.118  -5.578  -27.375  1.00 62.41 ? 10  ASN B CB    1 
ATOM   2821  C  CG    . ASN B  1 29  ? -43.983  -4.311  -27.368  1.00 63.22 ? 10  ASN B CG    1 
ATOM   2822  O  OD1   . ASN B  1 29  ? -45.122  -4.337  -26.878  1.00 63.04 ? 10  ASN B OD1   1 
ATOM   2823  N  ND2   . ASN B  1 29  ? -43.457  -3.210  -27.939  1.00 64.38 ? 10  ASN B ND2   1 
ATOM   2824  N  N     . LYS B  1 30  ? -41.598  -3.868  -24.946  1.00 60.72 ? 11  LYS B N     1 
ATOM   2825  C  CA    . LYS B  1 30  ? -41.413  -3.515  -23.546  1.00 59.89 ? 11  LYS B CA    1 
ATOM   2826  C  C     . LYS B  1 30  ? -42.686  -3.676  -22.738  1.00 58.97 ? 11  LYS B C     1 
ATOM   2827  O  O     . LYS B  1 30  ? -42.628  -3.775  -21.516  1.00 59.89 ? 11  LYS B O     1 
ATOM   2828  C  CB    . LYS B  1 30  ? -40.895  -2.078  -23.401  1.00 60.63 ? 11  LYS B CB    1 
ATOM   2829  C  CG    . LYS B  1 30  ? -39.677  -1.750  -24.294  1.00 61.90 ? 11  LYS B CG    1 
ATOM   2830  C  CD    . LYS B  1 30  ? -38.336  -2.338  -23.847  1.00 61.80 ? 11  LYS B CD    1 
ATOM   2831  C  CE    . LYS B  1 30  ? -37.433  -2.448  -25.074  1.00 60.70 ? 11  LYS B CE    1 
ATOM   2832  N  NZ    . LYS B  1 30  ? -36.107  -2.888  -24.714  1.00 61.42 ? 11  LYS B NZ    1 
ATOM   2833  N  N     . GLY B  1 31  ? -43.834  -3.693  -23.400  1.00 57.14 ? 12  GLY B N     1 
ATOM   2834  C  CA    . GLY B  1 31  ? -45.084  -3.975  -22.706  1.00 55.68 ? 12  GLY B CA    1 
ATOM   2835  C  C     . GLY B  1 31  ? -45.081  -5.405  -22.174  1.00 54.35 ? 12  GLY B C     1 
ATOM   2836  O  O     . GLY B  1 31  ? -45.366  -5.636  -20.999  1.00 54.74 ? 12  GLY B O     1 
ATOM   2837  N  N     . ILE B  1 32  ? -44.745  -6.355  -23.044  1.00 52.39 ? 13  ILE B N     1 
ATOM   2838  C  CA    . ILE B  1 32  ? -44.531  -7.758  -22.656  1.00 51.24 ? 13  ILE B CA    1 
ATOM   2839  C  C     . ILE B  1 32  ? -43.516  -7.807  -21.498  1.00 49.52 ? 13  ILE B C     1 
ATOM   2840  O  O     . ILE B  1 32  ? -43.759  -8.458  -20.494  1.00 48.62 ? 13  ILE B O     1 
ATOM   2841  C  CB    . ILE B  1 32  ? -43.977  -8.637  -23.829  1.00 51.12 ? 13  ILE B CB    1 
ATOM   2842  C  CG1   . ILE B  1 32  ? -44.863  -8.513  -25.089  1.00 51.96 ? 13  ILE B CG1   1 
ATOM   2843  C  CG2   . ILE B  1 32  ? -43.916  -10.078 -23.391  1.00 51.25 ? 13  ILE B CG2   1 
ATOM   2844  C  CD1   . ILE B  1 32  ? -44.130  -8.710  -26.420  1.00 51.54 ? 13  ILE B CD1   1 
ATOM   2845  N  N     . LYS B  1 33  ? -42.406  -7.093  -21.615  1.00 47.06 ? 14  LYS B N     1 
ATOM   2846  C  CA    . LYS B  1 33  ? -41.431  -7.211  -20.571  1.00 46.63 ? 14  LYS B CA    1 
ATOM   2847  C  C     . LYS B  1 33  ? -42.010  -6.812  -19.232  1.00 45.49 ? 14  LYS B C     1 
ATOM   2848  O  O     . LYS B  1 33  ? -41.758  -7.466  -18.216  1.00 44.12 ? 14  LYS B O     1 
ATOM   2849  C  CB    . LYS B  1 33  ? -40.194  -6.374  -20.846  1.00 46.54 ? 14  LYS B CB    1 
ATOM   2850  C  CG    . LYS B  1 33  ? -39.126  -6.520  -19.780  1.00 45.90 ? 14  LYS B CG    1 
ATOM   2851  C  CD    . LYS B  1 33  ? -37.992  -5.605  -20.032  1.00 45.31 ? 14  LYS B CD    1 
ATOM   2852  C  CE    . LYS B  1 33  ? -37.212  -5.391  -18.788  1.00 44.15 ? 14  LYS B CE    1 
ATOM   2853  N  NZ    . LYS B  1 33  ? -36.240  -4.336  -19.045  1.00 43.69 ? 14  LYS B NZ    1 
ATOM   2854  N  N     . GLN B  1 34  ? -42.802  -5.750  -19.240  1.00 44.83 ? 15  GLN B N     1 
ATOM   2855  C  CA    . GLN B  1 34  ? -43.237  -5.129  -17.995  1.00 44.52 ? 15  GLN B CA    1 
ATOM   2856  C  C     . GLN B  1 34  ? -44.196  -6.013  -17.161  1.00 43.44 ? 15  GLN B C     1 
ATOM   2857  O  O     . GLN B  1 34  ? -44.165  -5.986  -15.923  1.00 42.34 ? 15  GLN B O     1 
ATOM   2858  C  CB    . GLN B  1 34  ? -43.845  -3.786  -18.310  1.00 45.13 ? 15  GLN B CB    1 
ATOM   2859  C  CG    . GLN B  1 34  ? -44.044  -2.903  -17.127  1.00 48.27 ? 15  GLN B CG    1 
ATOM   2860  C  CD    . GLN B  1 34  ? -42.762  -2.659  -16.328  1.00 54.28 ? 15  GLN B CD    1 
ATOM   2861  O  OE1   . GLN B  1 34  ? -41.589  -2.760  -16.834  1.00 56.15 ? 15  GLN B OE1   1 
ATOM   2862  N  NE2   . GLN B  1 34  ? -42.977  -2.337  -15.044  1.00 56.35 ? 15  GLN B NE2   1 
ATOM   2863  N  N     . VAL B  1 35  ? -44.979  -6.840  -17.851  1.00 42.16 ? 16  VAL B N     1 
ATOM   2864  C  CA    . VAL B  1 35  ? -45.778  -7.862  -17.197  1.00 42.04 ? 16  VAL B CA    1 
ATOM   2865  C  C     . VAL B  1 35  ? -44.901  -8.816  -16.362  1.00 41.41 ? 16  VAL B C     1 
ATOM   2866  O  O     . VAL B  1 35  ? -45.205  -9.096  -15.202  1.00 40.99 ? 16  VAL B O     1 
ATOM   2867  C  CB    . VAL B  1 35  ? -46.666  -8.638  -18.228  1.00 42.18 ? 16  VAL B CB    1 
ATOM   2868  C  CG1   . VAL B  1 35  ? -47.429  -9.795  -17.573  1.00 41.10 ? 16  VAL B CG1   1 
ATOM   2869  C  CG2   . VAL B  1 35  ? -47.664  -7.690  -18.861  1.00 41.65 ? 16  VAL B CG2   1 
ATOM   2870  N  N     . TYR B  1 36  ? -43.801  -9.277  -16.947  1.00 41.03 ? 17  TYR B N     1 
ATOM   2871  C  CA    . TYR B  1 36  ? -42.871  -10.186 -16.261  1.00 40.41 ? 17  TYR B CA    1 
ATOM   2872  C  C     . TYR B  1 36  ? -42.219  -9.478  -15.072  1.00 40.08 ? 17  TYR B C     1 
ATOM   2873  O  O     . TYR B  1 36  ? -42.030  -10.056 -13.993  1.00 39.63 ? 17  TYR B O     1 
ATOM   2874  C  CB    . TYR B  1 36  ? -41.824  -10.715 -17.239  1.00 39.37 ? 17  TYR B CB    1 
ATOM   2875  C  CG    . TYR B  1 36  ? -42.336  -11.795 -18.174  1.00 38.81 ? 17  TYR B CG    1 
ATOM   2876  C  CD1   . TYR B  1 36  ? -42.402  -13.109 -17.761  1.00 38.23 ? 17  TYR B CD1   1 
ATOM   2877  C  CD2   . TYR B  1 36  ? -42.753  -11.497 -19.464  1.00 37.53 ? 17  TYR B CD2   1 
ATOM   2878  C  CE1   . TYR B  1 36  ? -42.891  -14.096 -18.607  1.00 39.95 ? 17  TYR B CE1   1 
ATOM   2879  C  CE2   . TYR B  1 36  ? -43.220  -12.468 -20.311  1.00 37.89 ? 17  TYR B CE2   1 
ATOM   2880  C  CZ    . TYR B  1 36  ? -43.290  -13.777 -19.886  1.00 38.63 ? 17  TYR B CZ    1 
ATOM   2881  O  OH    . TYR B  1 36  ? -43.768  -14.783 -20.702  1.00 36.47 ? 17  TYR B OH    1 
ATOM   2882  N  N     . MET B  1 37  ? -41.941  -8.197  -15.246  1.00 40.26 ? 18  MET B N     1 
ATOM   2883  C  CA    . MET B  1 37  ? -41.320  -7.429  -14.177  1.00 40.55 ? 18  MET B CA    1 
ATOM   2884  C  C     . MET B  1 37  ? -42.254  -7.084  -13.013  1.00 40.84 ? 18  MET B C     1 
ATOM   2885  O  O     . MET B  1 37  ? -41.794  -6.750  -11.964  1.00 41.71 ? 18  MET B O     1 
ATOM   2886  C  CB    . MET B  1 37  ? -40.693  -6.169  -14.740  1.00 40.34 ? 18  MET B CB    1 
ATOM   2887  C  CG    . MET B  1 37  ? -39.620  -6.415  -15.798  1.00 40.00 ? 18  MET B CG    1 
ATOM   2888  S  SD    . MET B  1 37  ? -38.134  -7.324  -15.342  1.00 40.11 ? 18  MET B SD    1 
ATOM   2889  C  CE    . MET B  1 37  ? -37.427  -6.432  -13.960  1.00 34.88 ? 18  MET B CE    1 
ATOM   2890  N  N     . SER B  1 38  ? -43.562  -7.174  -13.198  1.00 41.66 ? 19  SER B N     1 
ATOM   2891  C  CA    . SER B  1 38  ? -44.521  -7.080  -12.104  1.00 41.45 ? 19  SER B CA    1 
ATOM   2892  C  C     . SER B  1 38  ? -44.601  -8.296  -11.215  1.00 41.86 ? 19  SER B C     1 
ATOM   2893  O  O     . SER B  1 38  ? -45.135  -8.189  -10.109  1.00 42.32 ? 19  SER B O     1 
ATOM   2894  C  CB    . SER B  1 38  ? -45.910  -6.933  -12.679  1.00 41.85 ? 19  SER B CB    1 
ATOM   2895  O  OG    . SER B  1 38  ? -45.877  -5.911  -13.640  1.00 44.86 ? 19  SER B OG    1 
ATOM   2896  N  N     . LEU B  1 39  ? -44.187  -9.470  -11.705  1.00 41.68 ? 20  LEU B N     1 
ATOM   2897  C  CA    . LEU B  1 39  ? -44.254  -10.680 -10.896  1.00 41.39 ? 20  LEU B CA    1 
ATOM   2898  C  C     . LEU B  1 39  ? -43.483  -10.432 -9.610   1.00 41.93 ? 20  LEU B C     1 
ATOM   2899  O  O     . LEU B  1 39  ? -42.315  -10.030 -9.657   1.00 42.87 ? 20  LEU B O     1 
ATOM   2900  C  CB    . LEU B  1 39  ? -43.656  -11.879 -11.630  1.00 40.57 ? 20  LEU B CB    1 
ATOM   2901  C  CG    . LEU B  1 39  ? -44.409  -12.359 -12.863  1.00 39.34 ? 20  LEU B CG    1 
ATOM   2902  C  CD1   . LEU B  1 39  ? -43.605  -13.393 -13.664  1.00 37.22 ? 20  LEU B CD1   1 
ATOM   2903  C  CD2   . LEU B  1 39  ? -45.764  -12.884 -12.474  1.00 34.84 ? 20  LEU B CD2   1 
ATOM   2904  N  N     . PRO B  1 40  ? -44.109  -10.668 -8.464   1.00 42.38 ? 21  PRO B N     1 
ATOM   2905  C  CA    . PRO B  1 40  ? -43.342  -10.529 -7.212   1.00 42.99 ? 21  PRO B CA    1 
ATOM   2906  C  C     . PRO B  1 40  ? -42.233  -11.547 -7.199   1.00 43.34 ? 21  PRO B C     1 
ATOM   2907  O  O     . PRO B  1 40  ? -42.491  -12.702 -7.511   1.00 43.68 ? 21  PRO B O     1 
ATOM   2908  C  CB    . PRO B  1 40  ? -44.344  -10.874 -6.106   1.00 43.38 ? 21  PRO B CB    1 
ATOM   2909  C  CG    . PRO B  1 40  ? -45.648  -11.424 -6.828   1.00 43.32 ? 21  PRO B CG    1 
ATOM   2910  C  CD    . PRO B  1 40  ? -45.506  -11.134 -8.289   1.00 42.57 ? 21  PRO B CD    1 
ATOM   2911  N  N     . GLN B  1 41  ? -41.018  -11.149 -6.832   1.00 44.09 ? 22  GLN B N     1 
ATOM   2912  C  CA    . GLN B  1 41  ? -39.843  -12.056 -7.012   1.00 44.69 ? 22  GLN B CA    1 
ATOM   2913  C  C     . GLN B  1 41  ? -39.486  -12.914 -5.789   1.00 45.52 ? 22  GLN B C     1 
ATOM   2914  O  O     . GLN B  1 41  ? -38.710  -13.899 -5.952   1.00 46.72 ? 22  GLN B O     1 
ATOM   2915  C  CB    . GLN B  1 41  ? -38.569  -11.296 -7.474   1.00 44.21 ? 22  GLN B CB    1 
ATOM   2916  C  CG    . GLN B  1 41  ? -38.004  -10.344 -6.473   1.00 44.26 ? 22  GLN B CG    1 
ATOM   2917  C  CD    . GLN B  1 41  ? -36.767  -9.584  -6.994   1.00 45.38 ? 22  GLN B CD    1 
ATOM   2918  O  OE1   . GLN B  1 41  ? -36.884  -8.563  -7.709   1.00 44.61 ? 22  GLN B OE1   1 
ATOM   2919  N  NE2   . GLN B  1 41  ? -35.570  -10.068 -6.596   1.00 43.46 ? 22  GLN B NE2   1 
ATOM   2920  N  N     . GLY B  1 42  ? -39.976  -12.531 -4.593   1.00 44.55 ? 23  GLY B N     1 
ATOM   2921  C  CA    . GLY B  1 42  ? -39.751  -13.323 -3.378   1.00 43.97 ? 23  GLY B CA    1 
ATOM   2922  C  C     . GLY B  1 42  ? -38.500  -12.967 -2.610   1.00 43.76 ? 23  GLY B C     1 
ATOM   2923  O  O     . GLY B  1 42  ? -38.004  -11.855 -2.719   1.00 44.89 ? 23  GLY B O     1 
ATOM   2924  N  N     . GLU B  1 43  ? -37.942  -13.923 -1.872   1.00 43.73 ? 24  GLU B N     1 
ATOM   2925  C  CA    . GLU B  1 43  ? -36.785  -13.659 -0.960   1.00 43.23 ? 24  GLU B CA    1 
ATOM   2926  C  C     . GLU B  1 43  ? -35.436  -13.420 -1.682   1.00 42.59 ? 24  GLU B C     1 
ATOM   2927  O  O     . GLU B  1 43  ? -34.577  -12.701 -1.174   1.00 42.94 ? 24  GLU B O     1 
ATOM   2928  C  CB    . GLU B  1 43  ? -36.669  -14.805 0.068    1.00 43.65 ? 24  GLU B CB    1 
ATOM   2929  C  CG    . GLU B  1 43  ? -38.082  -15.452 0.473    1.00 45.11 ? 24  GLU B CG    1 
ATOM   2930  N  N     . LYS B  1 44  ? -35.251  -13.994 -2.873   1.00 42.03 ? 25  LYS B N     1 
ATOM   2931  C  CA    . LYS B  1 44  ? -33.977  -13.871 -3.613   1.00 41.90 ? 25  LYS B CA    1 
ATOM   2932  C  C     . LYS B  1 44  ? -33.795  -12.475 -4.240   1.00 41.22 ? 25  LYS B C     1 
ATOM   2933  O  O     . LYS B  1 44  ? -34.770  -11.789 -4.621   1.00 41.14 ? 25  LYS B O     1 
ATOM   2934  C  CB    . LYS B  1 44  ? -33.868  -14.912 -4.737   1.00 42.37 ? 25  LYS B CB    1 
ATOM   2935  C  CG    . LYS B  1 44  ? -34.222  -16.372 -4.376   1.00 42.85 ? 25  LYS B CG    1 
ATOM   2936  C  CD    . LYS B  1 44  ? -33.064  -17.087 -3.747   1.00 43.68 ? 25  LYS B CD    1 
ATOM   2937  C  CE    . LYS B  1 44  ? -33.374  -18.533 -3.389   1.00 42.47 ? 25  LYS B CE    1 
ATOM   2938  N  NZ    . LYS B  1 44  ? -32.467  -18.922 -2.232   1.00 43.13 ? 25  LYS B NZ    1 
ATOM   2939  N  N     . VAL B  1 45  ? -32.533  -12.082 -4.381   1.00 40.26 ? 26  VAL B N     1 
ATOM   2940  C  CA    . VAL B  1 45  ? -32.171  -10.727 -4.780   1.00 39.92 ? 26  VAL B CA    1 
ATOM   2941  C  C     . VAL B  1 45  ? -31.254  -10.852 -5.986   1.00 39.74 ? 26  VAL B C     1 
ATOM   2942  O  O     . VAL B  1 45  ? -30.478  -11.813 -6.060   1.00 39.55 ? 26  VAL B O     1 
ATOM   2943  C  CB    . VAL B  1 45  ? -31.478  -9.945  -3.598   1.00 39.91 ? 26  VAL B CB    1 
ATOM   2944  C  CG1   . VAL B  1 45  ? -31.063  -8.539  -4.029   1.00 37.94 ? 26  VAL B CG1   1 
ATOM   2945  C  CG2   . VAL B  1 45  ? -32.409  -9.922  -2.356   1.00 38.09 ? 26  VAL B CG2   1 
ATOM   2946  N  N     . GLN B  1 46  ? -31.387  -9.920  -6.937   1.00 39.22 ? 27  GLN B N     1 
ATOM   2947  C  CA    . GLN B  1 46  ? -30.472  -9.829  -8.097   1.00 39.16 ? 27  GLN B CA    1 
ATOM   2948  C  C     . GLN B  1 46  ? -29.358  -8.825  -7.865   1.00 38.60 ? 27  GLN B C     1 
ATOM   2949  O  O     . GLN B  1 46  ? -29.613  -7.712  -7.455   1.00 38.54 ? 27  GLN B O     1 
ATOM   2950  C  CB    . GLN B  1 46  ? -31.215  -9.457  -9.400   1.00 39.17 ? 27  GLN B CB    1 
ATOM   2951  C  CG    . GLN B  1 46  ? -32.105  -10.577 -9.909   1.00 38.98 ? 27  GLN B CG    1 
ATOM   2952  C  CD    . GLN B  1 46  ? -33.115  -10.106 -10.884  1.00 38.42 ? 27  GLN B CD    1 
ATOM   2953  O  OE1   . GLN B  1 46  ? -33.932  -9.239  -10.553  1.00 39.79 ? 27  GLN B OE1   1 
ATOM   2954  N  NE2   . GLN B  1 46  ? -33.082  -10.657 -12.105  1.00 35.03 ? 27  GLN B NE2   1 
ATOM   2955  N  N     . ALA B  1 47  ? -28.121  -9.238  -8.128   1.00 38.17 ? 28  ALA B N     1 
ATOM   2956  C  CA    . ALA B  1 47  ? -26.985  -8.336  -7.999   1.00 38.06 ? 28  ALA B CA    1 
ATOM   2957  C  C     . ALA B  1 47  ? -26.192  -8.326  -9.328   1.00 37.72 ? 28  ALA B C     1 
ATOM   2958  O  O     . ALA B  1 47  ? -25.701  -9.354  -9.798   1.00 37.16 ? 28  ALA B O     1 
ATOM   2959  C  CB    . ALA B  1 47  ? -26.119  -8.693  -6.788   1.00 36.92 ? 28  ALA B CB    1 
ATOM   2960  N  N     . MET B  1 48  ? -26.179  -7.146  -9.944   1.00 37.37 ? 29  MET B N     1 
ATOM   2961  C  CA    . MET B  1 48  ? -25.561  -6.925  -11.226  1.00 37.74 ? 29  MET B CA    1 
ATOM   2962  C  C     . MET B  1 48  ? -24.195  -6.294  -11.001  1.00 37.61 ? 29  MET B C     1 
ATOM   2963  O  O     . MET B  1 48  ? -24.093  -5.135  -10.580  1.00 37.40 ? 29  MET B O     1 
ATOM   2964  C  CB    . MET B  1 48  ? -26.431  -6.007  -12.147  1.00 37.78 ? 29  MET B CB    1 
ATOM   2965  C  CG    . MET B  1 48  ? -25.749  -5.781  -13.511  1.00 37.29 ? 29  MET B CG    1 
ATOM   2966  S  SD    . MET B  1 48  ? -26.657  -5.067  -14.850  1.00 36.35 ? 29  MET B SD    1 
ATOM   2967  C  CE    . MET B  1 48  ? -27.540  -6.490  -15.529  1.00 31.97 ? 29  MET B CE    1 
ATOM   2968  N  N     . TYR B  1 49  ? -23.159  -7.066  -11.299  1.00 37.98 ? 30  TYR B N     1 
ATOM   2969  C  CA    . TYR B  1 49  ? -21.794  -6.636  -11.087  1.00 38.42 ? 30  TYR B CA    1 
ATOM   2970  C  C     . TYR B  1 49  ? -21.318  -5.958  -12.365  1.00 38.55 ? 30  TYR B C     1 
ATOM   2971  O  O     . TYR B  1 49  ? -21.384  -6.547  -13.434  1.00 38.46 ? 30  TYR B O     1 
ATOM   2972  C  CB    . TYR B  1 49  ? -20.917  -7.838  -10.751  1.00 39.00 ? 30  TYR B CB    1 
ATOM   2973  C  CG    . TYR B  1 49  ? -20.995  -8.355  -9.313   1.00 39.18 ? 30  TYR B CG    1 
ATOM   2974  C  CD1   . TYR B  1 49  ? -22.214  -8.675  -8.711   1.00 39.60 ? 30  TYR B CD1   1 
ATOM   2975  C  CD2   . TYR B  1 49  ? -19.825  -8.613  -8.594   1.00 37.94 ? 30  TYR B CD2   1 
ATOM   2976  C  CE1   . TYR B  1 49  ? -22.258  -9.175  -7.373   1.00 39.73 ? 30  TYR B CE1   1 
ATOM   2977  C  CE2   . TYR B  1 49  ? -19.854  -9.084  -7.289   1.00 37.67 ? 30  TYR B CE2   1 
ATOM   2978  C  CZ    . TYR B  1 49  ? -21.059  -9.369  -6.670   1.00 39.87 ? 30  TYR B CZ    1 
ATOM   2979  O  OH    . TYR B  1 49  ? -21.038  -9.888  -5.369   1.00 38.72 ? 30  TYR B OH    1 
ATOM   2980  N  N     . ILE B  1 50  ? -20.844  -4.716  -12.226  1.00 38.93 ? 31  ILE B N     1 
ATOM   2981  C  CA    . ILE B  1 50  ? -20.350  -3.877  -13.334  1.00 38.65 ? 31  ILE B CA    1 
ATOM   2982  C  C     . ILE B  1 50  ? -18.844  -3.669  -13.242  1.00 38.43 ? 31  ILE B C     1 
ATOM   2983  O  O     . ILE B  1 50  ? -18.290  -3.499  -12.160  1.00 37.96 ? 31  ILE B O     1 
ATOM   2984  C  CB    . ILE B  1 50  ? -21.008  -2.432  -13.294  1.00 39.23 ? 31  ILE B CB    1 
ATOM   2985  C  CG1   . ILE B  1 50  ? -22.542  -2.521  -13.393  1.00 38.58 ? 31  ILE B CG1   1 
ATOM   2986  C  CG2   . ILE B  1 50  ? -20.419  -1.535  -14.389  1.00 38.13 ? 31  ILE B CG2   1 
ATOM   2987  C  CD1   . ILE B  1 50  ? -23.273  -1.495  -12.573  1.00 38.12 ? 31  ILE B CD1   1 
ATOM   2988  N  N     . TRP B  1 51  ? -18.171  -3.678  -14.385  1.00 38.77 ? 32  TRP B N     1 
ATOM   2989  C  CA    . TRP B  1 51  ? -16.754  -3.365  -14.396  1.00 38.68 ? 32  TRP B CA    1 
ATOM   2990  C  C     . TRP B  1 51  ? -16.269  -2.776  -15.698  1.00 38.73 ? 32  TRP B C     1 
ATOM   2991  O  O     . TRP B  1 51  ? -16.970  -2.864  -16.701  1.00 39.56 ? 32  TRP B O     1 
ATOM   2992  C  CB    . TRP B  1 51  ? -15.933  -4.605  -14.061  1.00 39.04 ? 32  TRP B CB    1 
ATOM   2993  C  CG    . TRP B  1 51  ? -15.958  -5.723  -15.085  1.00 38.99 ? 32  TRP B CG    1 
ATOM   2994  C  CD1   . TRP B  1 51  ? -15.004  -6.007  -16.047  1.00 38.64 ? 32  TRP B CD1   1 
ATOM   2995  C  CD2   . TRP B  1 51  ? -16.933  -6.746  -15.186  1.00 38.20 ? 32  TRP B CD2   1 
ATOM   2996  N  NE1   . TRP B  1 51  ? -15.360  -7.123  -16.744  1.00 38.34 ? 32  TRP B NE1   1 
ATOM   2997  C  CE2   . TRP B  1 51  ? -16.548  -7.590  -16.241  1.00 38.48 ? 32  TRP B CE2   1 
ATOM   2998  C  CE3   . TRP B  1 51  ? -18.112  -7.016  -14.505  1.00 38.93 ? 32  TRP B CE3   1 
ATOM   2999  C  CZ2   . TRP B  1 51  ? -17.300  -8.679  -16.626  1.00 39.13 ? 32  TRP B CZ2   1 
ATOM   3000  C  CZ3   . TRP B  1 51  ? -18.870  -8.095  -14.906  1.00 39.41 ? 32  TRP B CZ3   1 
ATOM   3001  C  CH2   . TRP B  1 51  ? -18.455  -8.917  -15.957  1.00 38.89 ? 32  TRP B CH2   1 
ATOM   3002  N  N     . ILE B  1 52  ? -15.054  -2.212  -15.668  1.00 38.41 ? 33  ILE B N     1 
ATOM   3003  C  CA    . ILE B  1 52  ? -14.442  -1.573  -16.826  1.00 38.75 ? 33  ILE B CA    1 
ATOM   3004  C  C     . ILE B  1 52  ? -13.535  -2.567  -17.538  1.00 38.68 ? 33  ILE B C     1 
ATOM   3005  O  O     . ILE B  1 52  ? -12.790  -3.288  -16.900  1.00 38.78 ? 33  ILE B O     1 
ATOM   3006  C  CB    . ILE B  1 52  ? -13.628  -0.309  -16.403  1.00 38.67 ? 33  ILE B CB    1 
ATOM   3007  C  CG1   . ILE B  1 52  ? -14.583  0.784   -15.884  1.00 39.36 ? 33  ILE B CG1   1 
ATOM   3008  C  CG2   . ILE B  1 52  ? -12.833  0.205   -17.584  1.00 37.72 ? 33  ILE B CG2   1 
ATOM   3009  C  CD1   . ILE B  1 52  ? -14.031  1.674   -14.765  1.00 38.65 ? 33  ILE B CD1   1 
ATOM   3010  N  N     . ASP B  1 53  ? -13.588  -2.598  -18.868  1.00 39.58 ? 34  ASP B N     1 
ATOM   3011  C  CA    . ASP B  1 53  ? -12.899  -3.658  -19.629  1.00 39.63 ? 34  ASP B CA    1 
ATOM   3012  C  C     . ASP B  1 53  ? -11.513  -3.223  -20.079  1.00 40.52 ? 34  ASP B C     1 
ATOM   3013  O  O     . ASP B  1 53  ? -10.968  -2.209  -19.597  1.00 40.91 ? 34  ASP B O     1 
ATOM   3014  C  CB    . ASP B  1 53  ? -13.790  -4.195  -20.780  1.00 40.02 ? 34  ASP B CB    1 
ATOM   3015  C  CG    . ASP B  1 53  ? -14.095  -3.153  -21.878  1.00 41.29 ? 34  ASP B CG    1 
ATOM   3016  O  OD1   . ASP B  1 53  ? -13.282  -2.208  -22.080  1.00 43.23 ? 34  ASP B OD1   1 
ATOM   3017  O  OD2   . ASP B  1 53  ? -15.149  -3.307  -22.579  1.00 41.26 ? 34  ASP B OD2   1 
ATOM   3018  N  N     . GLY B  1 54  ? -10.922  -4.015  -20.977  1.00 40.83 ? 35  GLY B N     1 
ATOM   3019  C  CA    . GLY B  1 54  ? -9.564   -3.801  -21.426  1.00 39.90 ? 35  GLY B CA    1 
ATOM   3020  C  C     . GLY B  1 54  ? -9.368   -2.595  -22.300  1.00 40.15 ? 35  GLY B C     1 
ATOM   3021  O  O     . GLY B  1 54  ? -8.196   -2.221  -22.564  1.00 40.77 ? 35  GLY B O     1 
ATOM   3022  N  N     . THR B  1 55  ? -10.468  -1.989  -22.770  1.00 39.55 ? 36  THR B N     1 
ATOM   3023  C  CA    . THR B  1 55  ? -10.379  -0.755  -23.586  1.00 39.65 ? 36  THR B CA    1 
ATOM   3024  C  C     . THR B  1 55  ? -10.275  0.498   -22.703  1.00 40.32 ? 36  THR B C     1 
ATOM   3025  O  O     . THR B  1 55  ? -10.067  1.604   -23.232  1.00 39.80 ? 36  THR B O     1 
ATOM   3026  C  CB    . THR B  1 55  ? -11.645  -0.490  -24.479  1.00 39.58 ? 36  THR B CB    1 
ATOM   3027  O  OG1   . THR B  1 55  ? -12.764  -0.105  -23.637  1.00 38.71 ? 36  THR B OG1   1 
ATOM   3028  C  CG2   . THR B  1 55  ? -12.021  -1.692  -25.376  1.00 37.03 ? 36  THR B CG2   1 
ATOM   3029  N  N     . GLY B  1 56  ? -10.540  0.342   -21.394  1.00 40.52 ? 37  GLY B N     1 
ATOM   3030  C  CA    . GLY B  1 56  ? -10.603  1.472   -20.458  1.00 40.63 ? 37  GLY B CA    1 
ATOM   3031  C  C     . GLY B  1 56  ? -11.831  2.368   -20.626  1.00 41.48 ? 37  GLY B C     1 
ATOM   3032  O  O     . GLY B  1 56  ? -12.006  3.356   -19.885  1.00 41.82 ? 37  GLY B O     1 
ATOM   3033  N  N     . GLU B  1 57  ? -12.688  2.027   -21.583  1.00 41.30 ? 38  GLU B N     1 
ATOM   3034  C  CA    . GLU B  1 57  ? -13.852  2.835   -21.909  1.00 41.78 ? 38  GLU B CA    1 
ATOM   3035  C  C     . GLU B  1 57  ? -15.161  2.053   -21.823  1.00 41.39 ? 38  GLU B C     1 
ATOM   3036  O  O     . GLU B  1 57  ? -16.152  2.613   -21.493  1.00 42.44 ? 38  GLU B O     1 
ATOM   3037  C  CB    . GLU B  1 57  ? -13.762  3.311   -23.355  1.00 42.35 ? 38  GLU B CB    1 
ATOM   3038  C  CG    . GLU B  1 57  ? -12.878  4.459   -23.615  1.00 43.15 ? 38  GLU B CG    1 
ATOM   3039  C  CD    . GLU B  1 57  ? -13.042  4.899   -25.058  1.00 44.06 ? 38  GLU B CD    1 
ATOM   3040  O  OE1   . GLU B  1 57  ? -14.042  5.562   -25.377  1.00 47.07 ? 38  GLU B OE1   1 
ATOM   3041  O  OE2   . GLU B  1 57  ? -12.162  4.585   -25.888  1.00 48.66 ? 38  GLU B OE2   1 
ATOM   3042  N  N     . GLY B  1 58  ? -15.151  0.779   -22.186  1.00 41.32 ? 39  GLY B N     1 
ATOM   3043  C  CA    . GLY B  1 58  ? -16.309  -0.063  -22.151  1.00 40.92 ? 39  GLY B CA    1 
ATOM   3044  C  C     . GLY B  1 58  ? -16.643  -0.702  -20.813  1.00 41.15 ? 39  GLY B C     1 
ATOM   3045  O  O     . GLY B  1 58  ? -15.782  -1.335  -20.122  1.00 41.99 ? 39  GLY B O     1 
ATOM   3046  N  N     . LEU B  1 59  ? -17.928  -0.598  -20.481  1.00 40.33 ? 40  LEU B N     1 
ATOM   3047  C  CA    . LEU B  1 59  ? -18.470  -1.192  -19.305  1.00 39.14 ? 40  LEU B CA    1 
ATOM   3048  C  C     . LEU B  1 59  ? -19.023  -2.566  -19.623  1.00 39.24 ? 40  LEU B C     1 
ATOM   3049  O  O     . LEU B  1 59  ? -19.545  -2.834  -20.711  1.00 38.84 ? 40  LEU B O     1 
ATOM   3050  C  CB    . LEU B  1 59  ? -19.559  -0.288  -18.752  1.00 39.14 ? 40  LEU B CB    1 
ATOM   3051  C  CG    . LEU B  1 59  ? -18.977  0.963   -18.080  1.00 39.72 ? 40  LEU B CG    1 
ATOM   3052  C  CD1   . LEU B  1 59  ? -19.916  2.143   -18.236  1.00 38.61 ? 40  LEU B CD1   1 
ATOM   3053  C  CD2   . LEU B  1 59  ? -18.618  0.720   -16.595  1.00 37.44 ? 40  LEU B CD2   1 
ATOM   3054  N  N     . ARG B  1 60  ? -18.917  -3.441  -18.627  1.00 39.13 ? 41  ARG B N     1 
ATOM   3055  C  CA    . ARG B  1 60  ? -19.399  -4.824  -18.728  1.00 38.41 ? 41  ARG B CA    1 
ATOM   3056  C  C     . ARG B  1 60  ? -20.160  -5.154  -17.489  1.00 37.70 ? 41  ARG B C     1 
ATOM   3057  O  O     . ARG B  1 60  ? -19.952  -4.532  -16.433  1.00 37.61 ? 41  ARG B O     1 
ATOM   3058  C  CB    . ARG B  1 60  ? -18.241  -5.803  -18.806  1.00 38.21 ? 41  ARG B CB    1 
ATOM   3059  C  CG    . ARG B  1 60  ? -17.276  -5.526  -19.927  1.00 39.05 ? 41  ARG B CG    1 
ATOM   3060  C  CD    . ARG B  1 60  ? -17.774  -6.053  -21.292  1.00 37.57 ? 41  ARG B CD    1 
ATOM   3061  N  NE    . ARG B  1 60  ? -16.809  -5.721  -22.341  1.00 37.02 ? 41  ARG B NE    1 
ATOM   3062  C  CZ    . ARG B  1 60  ? -16.454  -6.496  -23.364  1.00 38.81 ? 41  ARG B CZ    1 
ATOM   3063  N  NH1   . ARG B  1 60  ? -16.920  -7.714  -23.510  1.00 41.52 ? 41  ARG B NH1   1 
ATOM   3064  N  NH2   . ARG B  1 60  ? -15.583  -6.054  -24.254  1.00 39.29 ? 41  ARG B NH2   1 
ATOM   3065  N  N     . CYS B  1 61  ? -21.040  -6.134  -17.607  1.00 37.30 ? 42  CYS B N     1 
ATOM   3066  C  CA    . CYS B  1 61  ? -21.853  -6.492  -16.486  1.00 37.16 ? 42  CYS B CA    1 
ATOM   3067  C  C     . CYS B  1 61  ? -22.426  -7.883  -16.584  1.00 37.15 ? 42  CYS B C     1 
ATOM   3068  O  O     . CYS B  1 61  ? -22.551  -8.451  -17.680  1.00 37.11 ? 42  CYS B O     1 
ATOM   3069  C  CB    . CYS B  1 61  ? -22.972  -5.497  -16.353  1.00 37.07 ? 42  CYS B CB    1 
ATOM   3070  S  SG    . CYS B  1 61  ? -24.293  -5.760  -17.556  1.00 38.52 ? 42  CYS B SG    1 
ATOM   3071  N  N     . LYS B  1 62  ? -22.772  -8.427  -15.424  1.00 36.65 ? 43  LYS B N     1 
ATOM   3072  C  CA    . LYS B  1 62  ? -23.450  -9.716  -15.358  1.00 36.65 ? 43  LYS B CA    1 
ATOM   3073  C  C     . LYS B  1 62  ? -24.116  -9.875  -13.975  1.00 36.99 ? 43  LYS B C     1 
ATOM   3074  O  O     . LYS B  1 62  ? -23.698  -9.217  -13.027  1.00 36.04 ? 43  LYS B O     1 
ATOM   3075  C  CB    . LYS B  1 62  ? -22.468  -10.869 -15.647  1.00 36.31 ? 43  LYS B CB    1 
ATOM   3076  C  CG    . LYS B  1 62  ? -21.395  -11.156 -14.605  1.00 34.43 ? 43  LYS B CG    1 
ATOM   3077  C  CD    . LYS B  1 62  ? -20.966  -12.620 -14.661  1.00 35.42 ? 43  LYS B CD    1 
ATOM   3078  C  CE    . LYS B  1 62  ? -19.668  -12.821 -13.953  1.00 35.26 ? 43  LYS B CE    1 
ATOM   3079  N  NZ    . LYS B  1 62  ? -19.306  -14.227 -13.929  1.00 33.87 ? 43  LYS B NZ    1 
ATOM   3080  N  N     . THR B  1 63  ? -25.121  -10.753 -13.883  1.00 37.23 ? 44  THR B N     1 
ATOM   3081  C  CA    . THR B  1 63  ? -25.968  -10.875 -12.684  1.00 37.83 ? 44  THR B CA    1 
ATOM   3082  C  C     . THR B  1 63  ? -25.856  -12.246 -11.966  1.00 37.94 ? 44  THR B C     1 
ATOM   3083  O  O     . THR B  1 63  ? -25.773  -13.307 -12.621  1.00 36.93 ? 44  THR B O     1 
ATOM   3084  C  CB    . THR B  1 63  ? -27.452  -10.617 -13.081  1.00 38.17 ? 44  THR B CB    1 
ATOM   3085  O  OG1   . THR B  1 63  ? -27.534  -9.357  -13.756  1.00 38.50 ? 44  THR B OG1   1 
ATOM   3086  C  CG2   . THR B  1 63  ? -28.378  -10.627 -11.884  1.00 36.75 ? 44  THR B CG2   1 
ATOM   3087  N  N     . ARG B  1 64  ? -25.811  -12.191 -10.627  1.00 38.08 ? 45  ARG B N     1 
ATOM   3088  C  CA    . ARG B  1 64  ? -25.966  -13.382 -9.772   1.00 38.67 ? 45  ARG B CA    1 
ATOM   3089  C  C     . ARG B  1 64  ? -27.156  -13.212 -8.858   1.00 38.18 ? 45  ARG B C     1 
ATOM   3090  O  O     . ARG B  1 64  ? -27.564  -12.071 -8.591   1.00 38.79 ? 45  ARG B O     1 
ATOM   3091  C  CB    . ARG B  1 64  ? -24.722  -13.665 -8.931   1.00 38.55 ? 45  ARG B CB    1 
ATOM   3092  C  CG    . ARG B  1 64  ? -24.473  -12.665 -7.803   1.00 40.96 ? 45  ARG B CG    1 
ATOM   3093  C  CD    . ARG B  1 64  ? -23.011  -12.743 -7.363   1.00 41.80 ? 45  ARG B CD    1 
ATOM   3094  N  NE    . ARG B  1 64  ? -22.736  -14.009 -6.682   1.00 44.97 ? 45  ARG B NE    1 
ATOM   3095  C  CZ    . ARG B  1 64  ? -21.531  -14.402 -6.251   1.00 44.98 ? 45  ARG B CZ    1 
ATOM   3096  N  NH1   . ARG B  1 64  ? -20.461  -13.647 -6.431   1.00 46.66 ? 45  ARG B NH1   1 
ATOM   3097  N  NH2   . ARG B  1 64  ? -21.390  -15.587 -5.667   1.00 43.83 ? 45  ARG B NH2   1 
ATOM   3098  N  N     . THR B  1 65  ? -27.727  -14.338 -8.425   1.00 37.58 ? 46  THR B N     1 
ATOM   3099  C  CA    . THR B  1 65  ? -28.783  -14.366 -7.413   1.00 38.46 ? 46  THR B CA    1 
ATOM   3100  C  C     . THR B  1 65  ? -28.146  -14.495 -6.036   1.00 38.86 ? 46  THR B C     1 
ATOM   3101  O  O     . THR B  1 65  ? -27.319  -15.356 -5.836   1.00 39.27 ? 46  THR B O     1 
ATOM   3102  C  CB    . THR B  1 65  ? -29.664  -15.587 -7.601   1.00 38.28 ? 46  THR B CB    1 
ATOM   3103  O  OG1   . THR B  1 65  ? -30.085  -15.638 -8.963   1.00 40.23 ? 46  THR B OG1   1 
ATOM   3104  C  CG2   . THR B  1 65  ? -30.853  -15.565 -6.678   1.00 36.42 ? 46  THR B CG2   1 
ATOM   3105  N  N     . LEU B  1 66  ? -28.530  -13.651 -5.095   1.00 39.29 ? 47  LEU B N     1 
ATOM   3106  C  CA    . LEU B  1 66  ? -28.117  -13.788 -3.698   1.00 39.21 ? 47  LEU B CA    1 
ATOM   3107  C  C     . LEU B  1 66  ? -29.343  -14.240 -2.881   1.00 39.16 ? 47  LEU B C     1 
ATOM   3108  O  O     . LEU B  1 66  ? -30.461  -14.108 -3.340   1.00 38.55 ? 47  LEU B O     1 
ATOM   3109  C  CB    . LEU B  1 66  ? -27.584  -12.453 -3.160   1.00 38.56 ? 47  LEU B CB    1 
ATOM   3110  C  CG    . LEU B  1 66  ? -26.521  -11.727 -3.979   1.00 39.14 ? 47  LEU B CG    1 
ATOM   3111  C  CD1   . LEU B  1 66  ? -26.451  -10.170 -3.667   1.00 36.95 ? 47  LEU B CD1   1 
ATOM   3112  C  CD2   . LEU B  1 66  ? -25.152  -12.404 -3.841   1.00 35.57 ? 47  LEU B CD2   1 
ATOM   3113  N  N     . ASP B  1 67  ? -29.108  -14.758 -1.673   1.00 40.05 ? 48  ASP B N     1 
ATOM   3114  C  CA    . ASP B  1 67  ? -30.158  -15.320 -0.799   1.00 40.60 ? 48  ASP B CA    1 
ATOM   3115  C  C     . ASP B  1 67  ? -30.932  -14.312 -0.006   1.00 40.71 ? 48  ASP B C     1 
ATOM   3116  O  O     . ASP B  1 67  ? -32.092  -14.564 0.364    1.00 41.25 ? 48  ASP B O     1 
ATOM   3117  C  CB    . ASP B  1 67  ? -29.589  -16.327 0.182    1.00 41.17 ? 48  ASP B CB    1 
ATOM   3118  C  CG    . ASP B  1 67  ? -29.009  -17.535 -0.511   1.00 45.06 ? 48  ASP B CG    1 
ATOM   3119  O  OD1   . ASP B  1 67  ? -29.536  -17.897 -1.604   1.00 50.23 ? 48  ASP B OD1   1 
ATOM   3120  O  OD2   . ASP B  1 67  ? -28.024  -18.102 0.020    1.00 48.89 ? 48  ASP B OD2   1 
ATOM   3121  N  N     . SER B  1 68  ? -30.318  -13.171 0.252    1.00 40.78 ? 49  SER B N     1 
ATOM   3122  C  CA    . SER B  1 68  ? -31.032  -12.064 0.847    1.00 41.21 ? 49  SER B CA    1 
ATOM   3123  C  C     . SER B  1 68  ? -30.444  -10.781 0.346    1.00 40.99 ? 49  SER B C     1 
ATOM   3124  O  O     . SER B  1 68  ? -29.603  -10.794 -0.505   1.00 39.82 ? 49  SER B O     1 
ATOM   3125  C  CB    . SER B  1 68  ? -30.962  -12.149 2.348    1.00 40.82 ? 49  SER B CB    1 
ATOM   3126  O  OG    . SER B  1 68  ? -29.631  -12.144 2.725    1.00 41.83 ? 49  SER B OG    1 
ATOM   3127  N  N     . GLU B  1 69  ? -30.969  -9.673  0.837    1.00 42.08 ? 50  GLU B N     1 
ATOM   3128  C  CA    . GLU B  1 69  ? -30.549  -8.346  0.411    1.00 42.60 ? 50  GLU B CA    1 
ATOM   3129  C  C     . GLU B  1 69  ? -29.299  -7.916  1.210    1.00 43.06 ? 50  GLU B C     1 
ATOM   3130  O  O     . GLU B  1 69  ? -29.293  -7.921  2.448    1.00 43.42 ? 50  GLU B O     1 
ATOM   3131  C  CB    . GLU B  1 69  ? -31.691  -7.334  0.608    1.00 41.85 ? 50  GLU B CB    1 
ATOM   3132  C  CG    . GLU B  1 69  ? -31.394  -5.936  0.092    1.00 41.99 ? 50  GLU B CG    1 
ATOM   3133  C  CD    . GLU B  1 69  ? -32.508  -4.924  0.379    1.00 43.02 ? 50  GLU B CD    1 
ATOM   3134  O  OE1   . GLU B  1 69  ? -33.534  -5.320  0.979    1.00 44.21 ? 50  GLU B OE1   1 
ATOM   3135  O  OE2   . GLU B  1 69  ? -32.355  -3.726  0.011    1.00 41.31 ? 50  GLU B OE2   1 
ATOM   3136  N  N     . PRO B  1 70  ? -28.249  -7.508  0.507    1.00 43.64 ? 51  PRO B N     1 
ATOM   3137  C  CA    . PRO B  1 70  ? -27.101  -7.037  1.251    1.00 44.40 ? 51  PRO B CA    1 
ATOM   3138  C  C     . PRO B  1 70  ? -27.369  -5.632  1.739    1.00 45.12 ? 51  PRO B C     1 
ATOM   3139  O  O     . PRO B  1 70  ? -28.045  -4.867  1.050    1.00 45.04 ? 51  PRO B O     1 
ATOM   3140  C  CB    . PRO B  1 70  ? -25.976  -7.056  0.215    1.00 44.35 ? 51  PRO B CB    1 
ATOM   3141  C  CG    . PRO B  1 70  ? -26.676  -6.883  -1.108   1.00 44.37 ? 51  PRO B CG    1 
ATOM   3142  C  CD    . PRO B  1 70  ? -28.073  -7.419  -0.956   1.00 43.47 ? 51  PRO B CD    1 
ATOM   3143  N  N     . LYS B  1 71  ? -26.849  -5.291  2.915    1.00 46.11 ? 52  LYS B N     1 
ATOM   3144  C  CA    . LYS B  1 71  ? -27.177  -3.989  3.526    1.00 46.87 ? 52  LYS B CA    1 
ATOM   3145  C  C     . LYS B  1 71  ? -26.195  -2.932  3.187    1.00 46.43 ? 52  LYS B C     1 
ATOM   3146  O  O     . LYS B  1 71  ? -26.424  -1.776  3.467    1.00 45.88 ? 52  LYS B O     1 
ATOM   3147  C  CB    . LYS B  1 71  ? -27.300  -4.101  5.050    1.00 48.51 ? 52  LYS B CB    1 
ATOM   3148  C  CG    . LYS B  1 71  ? -28.752  -4.165  5.505    1.00 51.69 ? 52  LYS B CG    1 
ATOM   3149  C  CD    . LYS B  1 71  ? -29.524  -5.405  4.935    1.00 55.28 ? 52  LYS B CD    1 
ATOM   3150  C  CE    . LYS B  1 71  ? -31.090  -5.157  4.784    1.00 55.88 ? 52  LYS B CE    1 
ATOM   3151  N  NZ    . LYS B  1 71  ? -31.818  -6.482  4.585    1.00 56.25 ? 52  LYS B NZ    1 
ATOM   3152  N  N     . CYS B  1 72  ? -25.079  -3.355  2.607    1.00 46.60 ? 53  CYS B N     1 
ATOM   3153  C  CA    . CYS B  1 72  ? -24.008  -2.459  2.196    1.00 46.22 ? 53  CYS B CA    1 
ATOM   3154  C  C     . CYS B  1 72  ? -23.016  -3.240  1.352    1.00 45.81 ? 53  CYS B C     1 
ATOM   3155  O  O     . CYS B  1 72  ? -23.025  -4.468  1.335    1.00 45.03 ? 53  CYS B O     1 
ATOM   3156  C  CB    . CYS B  1 72  ? -23.304  -1.898  3.396    1.00 45.49 ? 53  CYS B CB    1 
ATOM   3157  S  SG    . CYS B  1 72  ? -22.660  -3.236  4.349    1.00 50.22 ? 53  CYS B SG    1 
ATOM   3158  N  N     . VAL B  1 73  ? -22.149  -2.498  0.677    1.00 45.98 ? 54  VAL B N     1 
ATOM   3159  C  CA    . VAL B  1 73  ? -21.198  -3.058  -0.279   1.00 45.85 ? 54  VAL B CA    1 
ATOM   3160  C  C     . VAL B  1 73  ? -20.343  -4.174  0.343    1.00 46.15 ? 54  VAL B C     1 
ATOM   3161  O  O     . VAL B  1 73  ? -20.034  -5.161  -0.327   1.00 45.69 ? 54  VAL B O     1 
ATOM   3162  C  CB    . VAL B  1 73  ? -20.330  -1.936  -0.957   1.00 44.67 ? 54  VAL B CB    1 
ATOM   3163  C  CG1   . VAL B  1 73  ? -19.340  -1.372  0.000    1.00 41.98 ? 54  VAL B CG1   1 
ATOM   3164  C  CG2   . VAL B  1 73  ? -19.682  -2.472  -2.155   1.00 45.64 ? 54  VAL B CG2   1 
ATOM   3165  N  N     . GLU B  1 74  ? -20.010  -4.061  1.626    1.00 46.47 ? 55  GLU B N     1 
ATOM   3166  C  CA    . GLU B  1 74  ? -19.100  -5.043  2.224    1.00 46.98 ? 55  GLU B CA    1 
ATOM   3167  C  C     . GLU B  1 74  ? -19.656  -6.441  2.328    1.00 46.84 ? 55  GLU B C     1 
ATOM   3168  O  O     . GLU B  1 74  ? -18.904  -7.355  2.494    1.00 47.91 ? 55  GLU B O     1 
ATOM   3169  C  CB    . GLU B  1 74  ? -18.624  -4.612  3.608    1.00 47.99 ? 55  GLU B CB    1 
ATOM   3170  C  CG    . GLU B  1 74  ? -17.634  -3.428  3.596    1.00 51.79 ? 55  GLU B CG    1 
ATOM   3171  C  CD    . GLU B  1 74  ? -18.296  -2.024  3.541    1.00 56.81 ? 55  GLU B CD    1 
ATOM   3172  O  OE1   . GLU B  1 74  ? -19.561  -1.868  3.611    1.00 59.57 ? 55  GLU B OE1   1 
ATOM   3173  O  OE2   . GLU B  1 74  ? -17.503  -1.060  3.430    1.00 60.60 ? 55  GLU B OE2   1 
ATOM   3174  N  N     . GLU B  1 75  ? -20.966  -6.614  2.261    1.00 46.69 ? 56  GLU B N     1 
ATOM   3175  C  CA    . GLU B  1 75  ? -21.576  -7.947  2.326    1.00 46.25 ? 56  GLU B CA    1 
ATOM   3176  C  C     . GLU B  1 75  ? -21.670  -8.620  0.964    1.00 45.66 ? 56  GLU B C     1 
ATOM   3177  O  O     . GLU B  1 75  ? -22.177  -9.742  0.857    1.00 45.38 ? 56  GLU B O     1 
ATOM   3178  C  CB    . GLU B  1 75  ? -23.005  -7.858  2.893    1.00 46.61 ? 56  GLU B CB    1 
ATOM   3179  C  CG    . GLU B  1 75  ? -23.117  -7.301  4.303    1.00 46.52 ? 56  GLU B CG    1 
ATOM   3180  C  CD    . GLU B  1 75  ? -24.538  -7.357  4.837    1.00 47.31 ? 56  GLU B CD    1 
ATOM   3181  O  OE1   . GLU B  1 75  ? -25.502  -7.635  4.081    1.00 47.84 ? 56  GLU B OE1   1 
ATOM   3182  O  OE2   . GLU B  1 75  ? -24.695  -7.107  6.044    1.00 50.98 ? 56  GLU B OE2   1 
ATOM   3183  N  N     . LEU B  1 76  ? -21.262  -7.925  -0.089   1.00 44.77 ? 57  LEU B N     1 
ATOM   3184  C  CA    . LEU B  1 76  ? -21.340  -8.521  -1.402   1.00 44.30 ? 57  LEU B CA    1 
ATOM   3185  C  C     . LEU B  1 76  ? -20.154  -9.437  -1.562   1.00 43.99 ? 57  LEU B C     1 
ATOM   3186  O  O     . LEU B  1 76  ? -19.031  -9.082  -1.181   1.00 44.58 ? 57  LEU B O     1 
ATOM   3187  C  CB    . LEU B  1 76  ? -21.355  -7.464  -2.482   1.00 44.06 ? 57  LEU B CB    1 
ATOM   3188  C  CG    . LEU B  1 76  ? -22.670  -6.703  -2.616   1.00 43.61 ? 57  LEU B CG    1 
ATOM   3189  C  CD1   . LEU B  1 76  ? -22.469  -5.438  -3.465   1.00 43.51 ? 57  LEU B CD1   1 
ATOM   3190  C  CD2   . LEU B  1 76  ? -23.731  -7.602  -3.200   1.00 39.50 ? 57  LEU B CD2   1 
ATOM   3191  N  N     . PRO B  1 77  ? -20.388  -10.650 -2.076   1.00 43.68 ? 58  PRO B N     1 
ATOM   3192  C  CA    . PRO B  1 77  ? -19.224  -11.543 -2.275   1.00 42.92 ? 58  PRO B CA    1 
ATOM   3193  C  C     . PRO B  1 77  ? -18.390  -11.125 -3.456   1.00 42.44 ? 58  PRO B C     1 
ATOM   3194  O  O     . PRO B  1 77  ? -18.866  -10.496 -4.372   1.00 42.21 ? 58  PRO B O     1 
ATOM   3195  C  CB    . PRO B  1 77  ? -19.850  -12.914 -2.512   1.00 42.59 ? 58  PRO B CB    1 
ATOM   3196  C  CG    . PRO B  1 77  ? -21.361  -12.658 -2.759   1.00 42.62 ? 58  PRO B CG    1 
ATOM   3197  C  CD    . PRO B  1 77  ? -21.681  -11.254 -2.461   1.00 42.90 ? 58  PRO B CD    1 
ATOM   3198  N  N     . GLU B  1 78  ? -17.112  -11.423 -3.388   1.00 43.28 ? 59  GLU B N     1 
ATOM   3199  C  CA    . GLU B  1 78  ? -16.228  -11.307 -4.529   1.00 43.37 ? 59  GLU B CA    1 
ATOM   3200  C  C     . GLU B  1 78  ? -16.758  -12.197 -5.642   1.00 42.50 ? 59  GLU B C     1 
ATOM   3201  O  O     . GLU B  1 78  ? -17.463  -13.177 -5.388   1.00 42.87 ? 59  GLU B O     1 
ATOM   3202  C  CB    . GLU B  1 78  ? -14.856  -11.853 -4.177   1.00 42.79 ? 59  GLU B CB    1 
ATOM   3203  C  CG    . GLU B  1 78  ? -14.022  -10.941 -3.404   1.00 45.12 ? 59  GLU B CG    1 
ATOM   3204  C  CD    . GLU B  1 78  ? -12.550  -11.329 -3.445   1.00 46.21 ? 59  GLU B CD    1 
ATOM   3205  O  OE1   . GLU B  1 78  ? -12.215  -12.333 -4.155   1.00 49.06 ? 59  GLU B OE1   1 
ATOM   3206  O  OE2   . GLU B  1 78  ? -11.759  -10.627 -2.751   1.00 47.57 ? 59  GLU B OE2   1 
ATOM   3207  N  N     . TRP B  1 79  ? -16.375  -11.884 -6.869   1.00 41.11 ? 60  TRP B N     1 
ATOM   3208  C  CA    . TRP B  1 79  ? -16.740  -12.721 -7.976   1.00 39.66 ? 60  TRP B CA    1 
ATOM   3209  C  C     . TRP B  1 79  ? -15.614  -12.711 -8.983   1.00 39.45 ? 60  TRP B C     1 
ATOM   3210  O  O     . TRP B  1 79  ? -14.470  -12.341 -8.664   1.00 39.45 ? 60  TRP B O     1 
ATOM   3211  C  CB    . TRP B  1 79  ? -18.054  -12.212 -8.550   1.00 39.58 ? 60  TRP B CB    1 
ATOM   3212  C  CG    . TRP B  1 79  ? -18.879  -13.229 -9.297   1.00 39.14 ? 60  TRP B CG    1 
ATOM   3213  C  CD1   . TRP B  1 79  ? -18.643  -14.556 -9.413   1.00 38.09 ? 60  TRP B CD1   1 
ATOM   3214  C  CD2   . TRP B  1 79  ? -20.045  -12.962 -10.060  1.00 36.61 ? 60  TRP B CD2   1 
ATOM   3215  N  NE1   . TRP B  1 79  ? -19.591  -15.133 -10.201  1.00 37.58 ? 60  TRP B NE1   1 
ATOM   3216  C  CE2   . TRP B  1 79  ? -20.483  -14.181 -10.590  1.00 38.58 ? 60  TRP B CE2   1 
ATOM   3217  C  CE3   . TRP B  1 79  ? -20.774  -11.827 -10.310  1.00 36.61 ? 60  TRP B CE3   1 
ATOM   3218  C  CZ2   . TRP B  1 79  ? -21.657  -14.300 -11.362  1.00 39.32 ? 60  TRP B CZ2   1 
ATOM   3219  C  CZ3   . TRP B  1 79  ? -21.928  -11.934 -11.082  1.00 38.90 ? 60  TRP B CZ3   1 
ATOM   3220  C  CH2   . TRP B  1 79  ? -22.363  -13.156 -11.596  1.00 38.43 ? 60  TRP B CH2   1 
ATOM   3221  N  N     . ASN B  1 80  ? -15.918  -13.131 -10.200  1.00 39.00 ? 61  ASN B N     1 
ATOM   3222  C  CA    . ASN B  1 80  ? -14.898  -13.233 -11.236  1.00 38.73 ? 61  ASN B CA    1 
ATOM   3223  C  C     . ASN B  1 80  ? -15.588  -13.339 -12.589  1.00 37.41 ? 61  ASN B C     1 
ATOM   3224  O  O     . ASN B  1 80  ? -16.749  -13.515 -12.626  1.00 36.00 ? 61  ASN B O     1 
ATOM   3225  C  CB    . ASN B  1 80  ? -14.031  -14.477 -10.981  1.00 38.67 ? 61  ASN B CB    1 
ATOM   3226  C  CG    . ASN B  1 80  ? -14.870  -15.719 -10.885  1.00 38.12 ? 61  ASN B CG    1 
ATOM   3227  O  OD1   . ASN B  1 80  ? -15.267  -16.104 -9.794   1.00 38.40 ? 61  ASN B OD1   1 
ATOM   3228  N  ND2   . ASN B  1 80  ? -15.231  -16.292 -12.024  1.00 37.58 ? 61  ASN B ND2   1 
ATOM   3229  N  N     . PHE B  1 81  ? -14.847  -13.181 -13.679  1.00 37.49 ? 62  PHE B N     1 
ATOM   3230  C  CA    . PHE B  1 81  ? -15.398  -13.227 -15.028  1.00 37.95 ? 62  PHE B CA    1 
ATOM   3231  C  C     . PHE B  1 81  ? -14.338  -13.752 -15.975  1.00 37.79 ? 62  PHE B C     1 
ATOM   3232  O  O     . PHE B  1 81  ? -13.224  -13.938 -15.585  1.00 37.51 ? 62  PHE B O     1 
ATOM   3233  C  CB    . PHE B  1 81  ? -15.871  -11.836 -15.471  1.00 38.02 ? 62  PHE B CB    1 
ATOM   3234  C  CG    . PHE B  1 81  ? -14.758  -10.842 -15.661  1.00 38.35 ? 62  PHE B CG    1 
ATOM   3235  C  CD1   . PHE B  1 81  ? -14.247  -10.572 -16.927  1.00 39.00 ? 62  PHE B CD1   1 
ATOM   3236  C  CD2   . PHE B  1 81  ? -14.201  -10.198 -14.584  1.00 38.36 ? 62  PHE B CD2   1 
ATOM   3237  C  CE1   . PHE B  1 81  ? -13.179  -9.634  -17.108  1.00 38.95 ? 62  PHE B CE1   1 
ATOM   3238  C  CE2   . PHE B  1 81  ? -13.138  -9.272  -14.748  1.00 38.39 ? 62  PHE B CE2   1 
ATOM   3239  C  CZ    . PHE B  1 81  ? -12.631  -8.993  -16.008  1.00 38.99 ? 62  PHE B CZ    1 
ATOM   3240  N  N     . ASP B  1 82  ? -14.711  -13.977 -17.223  1.00 38.34 ? 63  ASP B N     1 
ATOM   3241  C  CA    . ASP B  1 82  ? -13.781  -14.349 -18.268  1.00 38.58 ? 63  ASP B CA    1 
ATOM   3242  C  C     . ASP B  1 82  ? -13.034  -13.153 -18.855  1.00 38.23 ? 63  ASP B C     1 
ATOM   3243  O  O     . ASP B  1 82  ? -13.503  -12.487 -19.752  1.00 37.68 ? 63  ASP B O     1 
ATOM   3244  C  CB    . ASP B  1 82  ? -14.527  -15.046 -19.390  1.00 38.58 ? 63  ASP B CB    1 
ATOM   3245  C  CG    . ASP B  1 82  ? -13.609  -15.499 -20.495  1.00 38.39 ? 63  ASP B CG    1 
ATOM   3246  O  OD1   . ASP B  1 82  ? -12.378  -15.483 -20.274  1.00 36.89 ? 63  ASP B OD1   1 
ATOM   3247  O  OD2   . ASP B  1 82  ? -14.121  -15.869 -21.578  1.00 37.61 ? 63  ASP B OD2   1 
ATOM   3248  N  N     . GLY B  1 83  ? -11.822  -12.942 -18.384  1.00 38.89 ? 64  GLY B N     1 
ATOM   3249  C  CA    . GLY B  1 83  ? -10.974  -11.858 -18.889  1.00 39.50 ? 64  GLY B CA    1 
ATOM   3250  C  C     . GLY B  1 83  ? -10.547  -11.988 -20.341  1.00 39.79 ? 64  GLY B C     1 
ATOM   3251  O  O     . GLY B  1 83  ? -10.144  -11.008 -20.970  1.00 39.56 ? 64  GLY B O     1 
ATOM   3252  N  N     . SER B  1 84  ? -10.606  -13.205 -20.857  1.00 40.10 ? 65  SER B N     1 
ATOM   3253  C  CA    . SER B  1 84  ? -10.265  -13.455 -22.235  1.00 40.17 ? 65  SER B CA    1 
ATOM   3254  C  C     . SER B  1 84  ? -11.370  -13.006 -23.188  1.00 40.58 ? 65  SER B C     1 
ATOM   3255  O  O     . SER B  1 84  ? -11.143  -12.931 -24.395  1.00 39.88 ? 65  SER B O     1 
ATOM   3256  C  CB    . SER B  1 84  ? -9.963   -14.943 -22.435  1.00 40.28 ? 65  SER B CB    1 
ATOM   3257  O  OG    . SER B  1 84  ? -11.116  -15.773 -22.495  1.00 38.47 ? 65  SER B OG    1 
ATOM   3258  N  N     . SER B  1 85  ? -12.566  -12.731 -22.659  1.00 40.71 ? 66  SER B N     1 
ATOM   3259  C  CA    . SER B  1 85  ? -13.653  -12.304 -23.519  1.00 40.82 ? 66  SER B CA    1 
ATOM   3260  C  C     . SER B  1 85  ? -13.837  -10.838 -23.382  1.00 41.36 ? 66  SER B C     1 
ATOM   3261  O  O     . SER B  1 85  ? -14.769  -10.295 -23.998  1.00 42.00 ? 66  SER B O     1 
ATOM   3262  C  CB    . SER B  1 85  ? -14.940  -13.051 -23.219  1.00 39.93 ? 66  SER B CB    1 
ATOM   3263  O  OG    . SER B  1 85  ? -14.780  -14.406 -23.558  1.00 38.62 ? 66  SER B OG    1 
ATOM   3264  N  N     . THR B  1 86  ? -12.974  -10.197 -22.583  1.00 41.47 ? 67  THR B N     1 
ATOM   3265  C  CA    . THR B  1 86  ? -13.012  -8.737  -22.417  1.00 42.59 ? 67  THR B CA    1 
ATOM   3266  C  C     . THR B  1 86  ? -11.679  -8.044  -22.683  1.00 43.46 ? 67  THR B C     1 
ATOM   3267  O  O     . THR B  1 86  ? -11.490  -6.877  -22.297  1.00 43.70 ? 67  THR B O     1 
ATOM   3268  C  CB    . THR B  1 86  ? -13.458  -8.336  -20.973  1.00 42.73 ? 67  THR B CB    1 
ATOM   3269  O  OG1   . THR B  1 86  ? -12.417  -8.628  -20.034  1.00 43.54 ? 67  THR B OG1   1 
ATOM   3270  C  CG2   . THR B  1 86  ? -14.734  -9.087  -20.569  1.00 43.25 ? 67  THR B CG2   1 
ATOM   3271  N  N     . LEU B  1 87  ? -10.754  -8.756  -23.331  1.00 44.14 ? 68  LEU B N     1 
ATOM   3272  C  CA    . LEU B  1 87  ? -9.462   -8.214  -23.712  1.00 44.35 ? 68  LEU B CA    1 
ATOM   3273  C  C     . LEU B  1 87  ? -8.553   -7.915  -22.522  1.00 44.47 ? 68  LEU B C     1 
ATOM   3274  O  O     . LEU B  1 87  ? -7.836   -6.917  -22.498  1.00 44.19 ? 68  LEU B O     1 
ATOM   3275  C  CB    . LEU B  1 87  ? -9.651   -6.967  -24.577  1.00 45.07 ? 68  LEU B CB    1 
ATOM   3276  C  CG    . LEU B  1 87  ? -9.447   -7.169  -26.091  1.00 47.20 ? 68  LEU B CG    1 
ATOM   3277  C  CD1   . LEU B  1 87  ? -9.071   -5.759  -26.660  1.00 48.97 ? 68  LEU B CD1   1 
ATOM   3278  C  CD2   . LEU B  1 87  ? -8.368   -8.255  -26.444  1.00 45.21 ? 68  LEU B CD2   1 
ATOM   3279  N  N     . GLN B  1 88  ? -8.578   -8.789  -21.528  1.00 44.60 ? 69  GLN B N     1 
ATOM   3280  C  CA    . GLN B  1 88  ? -7.815   -8.549  -20.316  1.00 44.75 ? 69  GLN B CA    1 
ATOM   3281  C  C     . GLN B  1 88  ? -6.960   -9.725  -19.844  1.00 44.78 ? 69  GLN B C     1 
ATOM   3282  O  O     . GLN B  1 88  ? -6.175   -9.556  -18.925  1.00 45.15 ? 69  GLN B O     1 
ATOM   3283  C  CB    . GLN B  1 88  ? -8.768   -8.056  -19.214  1.00 44.42 ? 69  GLN B CB    1 
ATOM   3284  C  CG    . GLN B  1 88  ? -9.323   -6.661  -19.498  1.00 44.03 ? 69  GLN B CG    1 
ATOM   3285  C  CD    . GLN B  1 88  ? -10.436  -6.226  -18.563  1.00 45.40 ? 69  GLN B CD    1 
ATOM   3286  O  OE1   . GLN B  1 88  ? -10.241  -5.331  -17.737  1.00 47.32 ? 69  GLN B OE1   1 
ATOM   3287  N  NE2   . GLN B  1 88  ? -11.620  -6.829  -18.706  1.00 45.02 ? 69  GLN B NE2   1 
ATOM   3288  N  N     . SER B  1 89  ? -7.103   -10.904 -20.453  1.00 44.84 ? 70  SER B N     1 
ATOM   3289  C  CA    . SER B  1 89  ? -6.306   -12.076 -20.077  1.00 45.04 ? 70  SER B CA    1 
ATOM   3290  C  C     . SER B  1 89  ? -6.452   -13.149 -21.116  1.00 45.57 ? 70  SER B C     1 
ATOM   3291  O  O     . SER B  1 89  ? -7.203   -13.006 -22.055  1.00 46.48 ? 70  SER B O     1 
ATOM   3292  C  CB    . SER B  1 89  ? -6.634   -12.622 -18.661  1.00 44.94 ? 70  SER B CB    1 
ATOM   3293  O  OG    . SER B  1 89  ? -7.901   -13.196 -18.552  1.00 44.67 ? 70  SER B OG    1 
ATOM   3294  N  N     . GLU B  1 90  ? -5.710   -14.229 -20.963  1.00 46.17 ? 71  GLU B N     1 
ATOM   3295  C  CA    . GLU B  1 90  ? -5.703   -15.272 -21.960  1.00 46.34 ? 71  GLU B CA    1 
ATOM   3296  C  C     . GLU B  1 90  ? -6.667   -16.346 -21.581  1.00 45.23 ? 71  GLU B C     1 
ATOM   3297  O  O     . GLU B  1 90  ? -6.836   -16.667 -20.411  1.00 43.66 ? 71  GLU B O     1 
ATOM   3298  C  CB    . GLU B  1 90  ? -4.325   -15.897 -22.050  1.00 47.25 ? 71  GLU B CB    1 
ATOM   3299  C  CG    . GLU B  1 90  ? -3.201   -14.901 -22.202  1.00 51.25 ? 71  GLU B CG    1 
ATOM   3300  C  CD    . GLU B  1 90  ? -2.930   -14.640 -23.635  1.00 57.47 ? 71  GLU B CD    1 
ATOM   3301  O  OE1   . GLU B  1 90  ? -3.761   -13.950 -24.295  1.00 59.58 ? 71  GLU B OE1   1 
ATOM   3302  O  OE2   . GLU B  1 90  ? -1.883   -15.168 -24.100  1.00 62.73 ? 71  GLU B OE2   1 
ATOM   3303  N  N     . GLY B  1 91  ? -7.236   -16.946 -22.614  1.00 45.01 ? 72  GLY B N     1 
ATOM   3304  C  CA    . GLY B  1 91  ? -8.183   -18.034 -22.474  1.00 44.91 ? 72  GLY B CA    1 
ATOM   3305  C  C     . GLY B  1 91  ? -7.782   -19.169 -21.570  1.00 45.10 ? 72  GLY B C     1 
ATOM   3306  O  O     . GLY B  1 91  ? -8.646   -19.772 -20.953  1.00 45.68 ? 72  GLY B O     1 
ATOM   3307  N  N     . SER B  1 92  ? -6.497   -19.503 -21.482  1.00 45.00 ? 73  SER B N     1 
ATOM   3308  C  CA    . SER B  1 92  ? -6.122   -20.707 -20.700  1.00 44.78 ? 73  SER B CA    1 
ATOM   3309  C  C     . SER B  1 92  ? -5.741   -20.416 -19.249  1.00 44.46 ? 73  SER B C     1 
ATOM   3310  O  O     . SER B  1 92  ? -5.520   -21.360 -18.460  1.00 44.71 ? 73  SER B O     1 
ATOM   3311  C  CB    . SER B  1 92  ? -5.012   -21.476 -21.383  1.00 44.48 ? 73  SER B CB    1 
ATOM   3312  O  OG    . SER B  1 92  ? -3.959   -20.583 -21.559  1.00 45.34 ? 73  SER B OG    1 
ATOM   3313  N  N     . ASN B  1 93  ? -5.666   -19.127 -18.920  1.00 43.47 ? 74  ASN B N     1 
ATOM   3314  C  CA    . ASN B  1 93  ? -5.613   -18.664 -17.546  1.00 43.14 ? 74  ASN B CA    1 
ATOM   3315  C  C     . ASN B  1 93  ? -6.506   -17.409 -17.410  1.00 42.79 ? 74  ASN B C     1 
ATOM   3316  O  O     . ASN B  1 93  ? -6.044   -16.291 -17.189  1.00 42.38 ? 74  ASN B O     1 
ATOM   3317  C  CB    . ASN B  1 93  ? -4.170   -18.403 -17.146  1.00 42.47 ? 74  ASN B CB    1 
ATOM   3318  C  CG    . ASN B  1 93  ? -4.008   -18.219 -15.652  1.00 42.96 ? 74  ASN B CG    1 
ATOM   3319  O  OD1   . ASN B  1 93  ? -4.945   -18.422 -14.879  1.00 41.28 ? 74  ASN B OD1   1 
ATOM   3320  N  ND2   . ASN B  1 93  ? -2.828   -17.828 -15.240  1.00 41.53 ? 74  ASN B ND2   1 
ATOM   3321  N  N     . SER B  1 94  ? -7.811   -17.626 -17.558  1.00 42.65 ? 75  SER B N     1 
ATOM   3322  C  CA    . SER B  1 94  ? -8.744   -16.555 -17.935  1.00 42.05 ? 75  SER B CA    1 
ATOM   3323  C  C     . SER B  1 94  ? -9.512   -15.875 -16.795  1.00 41.82 ? 75  SER B C     1 
ATOM   3324  O  O     . SER B  1 94  ? -9.774   -14.680 -16.894  1.00 42.07 ? 75  SER B O     1 
ATOM   3325  C  CB    . SER B  1 94  ? -9.713   -17.093 -18.970  1.00 41.88 ? 75  SER B CB    1 
ATOM   3326  O  OG    . SER B  1 94  ? -10.053  -18.401 -18.615  1.00 40.02 ? 75  SER B OG    1 
ATOM   3327  N  N     . ASP B  1 95  ? -9.850   -16.603 -15.727  1.00 41.39 ? 76  ASP B N     1 
ATOM   3328  C  CA    . ASP B  1 95  ? -10.575  -16.030 -14.603  1.00 41.52 ? 76  ASP B CA    1 
ATOM   3329  C  C     . ASP B  1 95  ? -9.927   -14.726 -14.186  1.00 41.61 ? 76  ASP B C     1 
ATOM   3330  O  O     . ASP B  1 95  ? -8.708   -14.647 -14.062  1.00 42.61 ? 76  ASP B O     1 
ATOM   3331  C  CB    . ASP B  1 95  ? -10.589  -16.957 -13.381  1.00 41.22 ? 76  ASP B CB    1 
ATOM   3332  C  CG    . ASP B  1 95  ? -11.259  -18.312 -13.639  1.00 42.02 ? 76  ASP B CG    1 
ATOM   3333  O  OD1   . ASP B  1 95  ? -11.766  -18.907 -12.656  1.00 42.43 ? 76  ASP B OD1   1 
ATOM   3334  O  OD2   . ASP B  1 95  ? -11.255  -18.823 -14.784  1.00 42.53 ? 76  ASP B OD2   1 
ATOM   3335  N  N     . MET B  1 96  ? -10.719  -13.686 -13.982  1.00 41.98 ? 77  MET B N     1 
ATOM   3336  C  CA    . MET B  1 96  ? -10.210  -12.435 -13.352  1.00 42.25 ? 77  MET B CA    1 
ATOM   3337  C  C     . MET B  1 96  ? -11.156  -12.070 -12.229  1.00 41.99 ? 77  MET B C     1 
ATOM   3338  O  O     . MET B  1 96  ? -12.331  -12.418 -12.315  1.00 42.59 ? 77  MET B O     1 
ATOM   3339  C  CB    . MET B  1 96  ? -10.062  -11.275 -14.355  1.00 42.02 ? 77  MET B CB    1 
ATOM   3340  C  CG    . MET B  1 96  ? -9.105   -11.543 -15.498  1.00 41.59 ? 77  MET B CG    1 
ATOM   3341  S  SD    . MET B  1 96  ? -8.727   -10.081 -16.488  1.00 43.59 ? 77  MET B SD    1 
ATOM   3342  C  CE    . MET B  1 96  ? -7.541   -9.265  -15.433  1.00 37.95 ? 77  MET B CE    1 
ATOM   3343  N  N     . TYR B  1 97  ? -10.646  -11.418 -11.176  1.00 41.96 ? 78  TYR B N     1 
ATOM   3344  C  CA    . TYR B  1 97  ? -11.433  -11.113 -9.959   1.00 41.53 ? 78  TYR B CA    1 
ATOM   3345  C  C     . TYR B  1 97  ? -12.265  -9.830  -10.071  1.00 41.14 ? 78  TYR B C     1 
ATOM   3346  O  O     . TYR B  1 97  ? -11.793  -8.806  -10.602  1.00 39.91 ? 78  TYR B O     1 
ATOM   3347  C  CB    . TYR B  1 97  ? -10.536  -10.898 -8.756   1.00 42.62 ? 78  TYR B CB    1 
ATOM   3348  C  CG    . TYR B  1 97  ? -9.741   -12.073 -8.348   1.00 43.40 ? 78  TYR B CG    1 
ATOM   3349  C  CD1   . TYR B  1 97  ? -10.230  -12.950 -7.414   1.00 43.60 ? 78  TYR B CD1   1 
ATOM   3350  C  CD2   . TYR B  1 97  ? -8.463   -12.284 -8.856   1.00 45.21 ? 78  TYR B CD2   1 
ATOM   3351  C  CE1   . TYR B  1 97  ? -9.508   -14.055 -7.009   1.00 44.67 ? 78  TYR B CE1   1 
ATOM   3352  C  CE2   . TYR B  1 97  ? -7.701   -13.387 -8.448   1.00 45.35 ? 78  TYR B CE2   1 
ATOM   3353  C  CZ    . TYR B  1 97  ? -8.242   -14.279 -7.520   1.00 45.38 ? 78  TYR B CZ    1 
ATOM   3354  O  OH    . TYR B  1 97  ? -7.539   -15.390 -7.085   1.00 46.25 ? 78  TYR B OH    1 
ATOM   3355  N  N     . LEU B  1 98  ? -13.490  -9.901  -9.530   1.00 40.27 ? 79  LEU B N     1 
ATOM   3356  C  CA    . LEU B  1 98  ? -14.317  -8.737  -9.305   1.00 39.42 ? 79  LEU B CA    1 
ATOM   3357  C  C     . LEU B  1 98  ? -14.386  -8.529  -7.799   1.00 39.77 ? 79  LEU B C     1 
ATOM   3358  O  O     . LEU B  1 98  ? -14.775  -9.463  -7.057   1.00 40.65 ? 79  LEU B O     1 
ATOM   3359  C  CB    . LEU B  1 98  ? -15.709  -8.968  -9.874   1.00 38.53 ? 79  LEU B CB    1 
ATOM   3360  C  CG    . LEU B  1 98  ? -15.803  -9.081  -11.394  1.00 37.31 ? 79  LEU B CG    1 
ATOM   3361  C  CD1   . LEU B  1 98  ? -17.139  -9.600  -11.826  1.00 35.44 ? 79  LEU B CD1   1 
ATOM   3362  C  CD2   . LEU B  1 98  ? -15.544  -7.765  -12.047  1.00 35.62 ? 79  LEU B CD2   1 
ATOM   3363  N  N     . VAL B  1 99  ? -14.012  -7.329  -7.345   1.00 38.93 ? 80  VAL B N     1 
ATOM   3364  C  CA    . VAL B  1 99  ? -14.140  -6.956  -5.953   1.00 38.48 ? 80  VAL B CA    1 
ATOM   3365  C  C     . VAL B  1 99  ? -15.103  -5.781  -5.834   1.00 38.85 ? 80  VAL B C     1 
ATOM   3366  O  O     . VAL B  1 99  ? -14.818  -4.711  -6.356   1.00 39.00 ? 80  VAL B O     1 
ATOM   3367  C  CB    . VAL B  1 99  ? -12.788  -6.515  -5.380   1.00 38.32 ? 80  VAL B CB    1 
ATOM   3368  C  CG1   . VAL B  1 99  ? -12.945  -6.053  -3.918   1.00 35.83 ? 80  VAL B CG1   1 
ATOM   3369  C  CG2   . VAL B  1 99  ? -11.810  -7.645  -5.466   1.00 38.35 ? 80  VAL B CG2   1 
ATOM   3370  N  N     . PRO B  1 100 ? -16.241  -5.957  -5.143   1.00 38.66 ? 81  PRO B N     1 
ATOM   3371  C  CA    . PRO B  1 100 ? -17.193  -4.860  -5.018   1.00 38.64 ? 81  PRO B CA    1 
ATOM   3372  C  C     . PRO B  1 100 ? -16.565  -3.591  -4.461   1.00 38.62 ? 81  PRO B C     1 
ATOM   3373  O  O     . PRO B  1 100 ? -15.791  -3.658  -3.538   1.00 38.32 ? 81  PRO B O     1 
ATOM   3374  C  CB    . PRO B  1 100 ? -18.219  -5.403  -4.028   1.00 38.84 ? 81  PRO B CB    1 
ATOM   3375  C  CG    . PRO B  1 100 ? -18.175  -6.861  -4.207   1.00 39.34 ? 81  PRO B CG    1 
ATOM   3376  C  CD    . PRO B  1 100 ? -16.736  -7.172  -4.491   1.00 39.13 ? 81  PRO B CD    1 
ATOM   3377  N  N     . ALA B  1 101 ? -16.909  -2.455  -5.043   1.00 38.59 ? 82  ALA B N     1 
ATOM   3378  C  CA    . ALA B  1 101 ? -16.344  -1.179  -4.671   1.00 38.36 ? 82  ALA B CA    1 
ATOM   3379  C  C     . ALA B  1 101 ? -17.472  -0.235  -4.222   1.00 38.91 ? 82  ALA B C     1 
ATOM   3380  O  O     . ALA B  1 101 ? -17.395  0.327   -3.142   1.00 39.42 ? 82  ALA B O     1 
ATOM   3381  C  CB    . ALA B  1 101 ? -15.604  -0.620  -5.802   1.00 37.04 ? 82  ALA B CB    1 
ATOM   3382  N  N     . ALA B  1 102 ? -18.529  -0.082  -5.024   1.00 39.24 ? 83  ALA B N     1 
ATOM   3383  C  CA    . ALA B  1 102 ? -19.673  0.787   -4.684   1.00 38.99 ? 83  ALA B CA    1 
ATOM   3384  C  C     . ALA B  1 102 ? -21.009  0.119   -5.028   1.00 39.25 ? 83  ALA B C     1 
ATOM   3385  O  O     . ALA B  1 102 ? -21.198  -0.456  -6.096   1.00 39.92 ? 83  ALA B O     1 
ATOM   3386  C  CB    . ALA B  1 102 ? -19.551  2.145   -5.426   1.00 38.86 ? 83  ALA B CB    1 
ATOM   3387  N  N     . MET B  1 103 ? -21.971  0.224   -4.129   1.00 39.97 ? 84  MET B N     1 
ATOM   3388  C  CA    . MET B  1 103 ? -23.291  -0.374  -4.350   1.00 39.21 ? 84  MET B CA    1 
ATOM   3389  C  C     . MET B  1 103 ? -24.335  0.675   -4.530   1.00 38.99 ? 84  MET B C     1 
ATOM   3390  O  O     . MET B  1 103 ? -24.383  1.647   -3.766   1.00 38.88 ? 84  MET B O     1 
ATOM   3391  C  CB    . MET B  1 103 ? -23.698  -1.223  -3.153   1.00 38.85 ? 84  MET B CB    1 
ATOM   3392  C  CG    . MET B  1 103 ? -24.863  -2.142  -3.444   1.00 39.50 ? 84  MET B CG    1 
ATOM   3393  S  SD    . MET B  1 103 ? -25.161  -3.280  -2.099   1.00 40.86 ? 84  MET B SD    1 
ATOM   3394  C  CE    . MET B  1 103 ? -25.880  -2.162  -0.867   1.00 34.15 ? 84  MET B CE    1 
ATOM   3395  N  N     . PHE B  1 104 ? -25.237  0.434   -5.477   1.00 39.16 ? 85  PHE B N     1 
ATOM   3396  C  CA    . PHE B  1 104 ? -26.389  1.303   -5.659   1.00 39.22 ? 85  PHE B CA    1 
ATOM   3397  C  C     . PHE B  1 104 ? -27.664  0.505   -5.801   1.00 39.05 ? 85  PHE B C     1 
ATOM   3398  O  O     . PHE B  1 104 ? -27.643  -0.712  -6.040   1.00 39.58 ? 85  PHE B O     1 
ATOM   3399  C  CB    . PHE B  1 104 ? -26.167  2.169   -6.909   1.00 39.96 ? 85  PHE B CB    1 
ATOM   3400  C  CG    . PHE B  1 104 ? -24.986  3.090   -6.800   1.00 39.53 ? 85  PHE B CG    1 
ATOM   3401  C  CD1   . PHE B  1 104 ? -25.156  4.386   -6.379   1.00 38.95 ? 85  PHE B CD1   1 
ATOM   3402  C  CD2   . PHE B  1 104 ? -23.711  2.643   -7.114   1.00 41.02 ? 85  PHE B CD2   1 
ATOM   3403  C  CE1   . PHE B  1 104 ? -24.086  5.237   -6.277   1.00 40.39 ? 85  PHE B CE1   1 
ATOM   3404  C  CE2   . PHE B  1 104 ? -22.616  3.490   -7.041   1.00 40.99 ? 85  PHE B CE2   1 
ATOM   3405  C  CZ    . PHE B  1 104 ? -22.812  4.800   -6.602   1.00 41.20 ? 85  PHE B CZ    1 
ATOM   3406  N  N     . ARG B  1 105 ? -28.784  1.197   -5.730   1.00 38.43 ? 86  ARG B N     1 
ATOM   3407  C  CA    . ARG B  1 105 ? -30.070  0.529   -5.984   1.00 38.45 ? 86  ARG B CA    1 
ATOM   3408  C  C     . ARG B  1 105 ? -30.283  0.383   -7.502   1.00 38.38 ? 86  ARG B C     1 
ATOM   3409  O  O     . ARG B  1 105 ? -29.873  1.258   -8.287   1.00 38.42 ? 86  ARG B O     1 
ATOM   3410  C  CB    . ARG B  1 105 ? -31.227  1.302   -5.343   1.00 38.40 ? 86  ARG B CB    1 
ATOM   3411  C  CG    . ARG B  1 105 ? -31.068  1.559   -3.822   1.00 36.87 ? 86  ARG B CG    1 
ATOM   3412  C  CD    . ARG B  1 105 ? -31.974  2.711   -3.379   1.00 37.55 ? 86  ARG B CD    1 
ATOM   3413  N  NE    . ARG B  1 105 ? -33.386  2.304   -3.312   1.00 38.09 ? 86  ARG B NE    1 
ATOM   3414  C  CZ    . ARG B  1 105 ? -34.450  3.075   -3.593   1.00 38.99 ? 86  ARG B CZ    1 
ATOM   3415  N  NH1   . ARG B  1 105 ? -34.311  4.317   -4.033   1.00 38.19 ? 86  ARG B NH1   1 
ATOM   3416  N  NH2   . ARG B  1 105 ? -35.694  2.585   -3.457   1.00 36.40 ? 86  ARG B NH2   1 
ATOM   3417  N  N     . ASP B  1 106 ? -30.874  -0.742  -7.909   1.00 38.05 ? 87  ASP B N     1 
ATOM   3418  C  CA    . ASP B  1 106 ? -31.058  -1.065  -9.326   1.00 37.68 ? 87  ASP B CA    1 
ATOM   3419  C  C     . ASP B  1 106 ? -32.392  -0.460  -9.808   1.00 37.55 ? 87  ASP B C     1 
ATOM   3420  O  O     . ASP B  1 106 ? -33.468  -0.890  -9.357   1.00 36.88 ? 87  ASP B O     1 
ATOM   3421  C  CB    . ASP B  1 106 ? -31.016  -2.581  -9.511   1.00 37.71 ? 87  ASP B CB    1 
ATOM   3422  C  CG    . ASP B  1 106 ? -31.016  -3.002  -10.982  1.00 38.44 ? 87  ASP B CG    1 
ATOM   3423  O  OD1   . ASP B  1 106 ? -31.679  -2.302  -11.782  1.00 39.45 ? 87  ASP B OD1   1 
ATOM   3424  O  OD2   . ASP B  1 106 ? -30.380  -4.034  -11.330  1.00 37.31 ? 87  ASP B OD2   1 
ATOM   3425  N  N     . PRO B  1 107 ? -32.323  0.569   -10.686  1.00 37.36 ? 88  PRO B N     1 
ATOM   3426  C  CA    . PRO B  1 107 ? -33.495  1.265   -11.180  1.00 37.81 ? 88  PRO B CA    1 
ATOM   3427  C  C     . PRO B  1 107 ? -34.158  0.533   -12.341  1.00 37.95 ? 88  PRO B C     1 
ATOM   3428  O  O     . PRO B  1 107 ? -35.292  0.849   -12.694  1.00 38.96 ? 88  PRO B O     1 
ATOM   3429  C  CB    . PRO B  1 107 ? -32.927  2.599   -11.650  1.00 37.53 ? 88  PRO B CB    1 
ATOM   3430  C  CG    . PRO B  1 107 ? -31.585  2.240   -12.149  1.00 37.83 ? 88  PRO B CG    1 
ATOM   3431  C  CD    . PRO B  1 107 ? -31.097  1.125   -11.279  1.00 37.58 ? 88  PRO B CD    1 
ATOM   3432  N  N     . PHE B  1 108 ? -33.461  -0.439  -12.918  1.00 38.18 ? 89  PHE B N     1 
ATOM   3433  C  CA    . PHE B  1 108 ? -34.009  -1.299  -13.986  1.00 38.17 ? 89  PHE B CA    1 
ATOM   3434  C  C     . PHE B  1 108 ? -34.819  -2.452  -13.392  1.00 38.44 ? 89  PHE B C     1 
ATOM   3435  O  O     . PHE B  1 108 ? -35.827  -2.845  -13.938  1.00 38.26 ? 89  PHE B O     1 
ATOM   3436  C  CB    . PHE B  1 108 ? -32.854  -1.806  -14.863  1.00 38.33 ? 89  PHE B CB    1 
ATOM   3437  C  CG    . PHE B  1 108 ? -31.944  -0.686  -15.316  1.00 39.69 ? 89  PHE B CG    1 
ATOM   3438  C  CD1   . PHE B  1 108 ? -32.393  0.244   -16.264  1.00 38.87 ? 89  PHE B CD1   1 
ATOM   3439  C  CD2   . PHE B  1 108 ? -30.693  -0.483  -14.715  1.00 39.49 ? 89  PHE B CD2   1 
ATOM   3440  C  CE1   . PHE B  1 108 ? -31.601  1.291   -16.638  1.00 38.89 ? 89  PHE B CE1   1 
ATOM   3441  C  CE2   . PHE B  1 108 ? -29.916  0.579   -15.077  1.00 38.94 ? 89  PHE B CE2   1 
ATOM   3442  C  CZ    . PHE B  1 108 ? -30.365  1.479   -16.035  1.00 38.31 ? 89  PHE B CZ    1 
ATOM   3443  N  N     . ARG B  1 109 ? -34.415  -2.927  -12.233  1.00 38.98 ? 90  ARG B N     1 
ATOM   3444  C  CA    . ARG B  1 109 ? -35.007  -4.063  -11.590  1.00 38.46 ? 90  ARG B CA    1 
ATOM   3445  C  C     . ARG B  1 109 ? -35.676  -3.787  -10.268  1.00 38.31 ? 90  ARG B C     1 
ATOM   3446  O  O     . ARG B  1 109 ? -36.412  -4.606  -9.796   1.00 37.30 ? 90  ARG B O     1 
ATOM   3447  C  CB    . ARG B  1 109 ? -34.004  -5.181  -11.433  1.00 38.25 ? 90  ARG B CB    1 
ATOM   3448  C  CG    . ARG B  1 109 ? -33.545  -5.795  -12.674  1.00 37.49 ? 90  ARG B CG    1 
ATOM   3449  C  CD    . ARG B  1 109 ? -32.296  -6.441  -12.416  1.00 37.14 ? 90  ARG B CD    1 
ATOM   3450  N  NE    . ARG B  1 109 ? -31.878  -7.314  -13.462  1.00 35.88 ? 90  ARG B NE    1 
ATOM   3451  C  CZ    . ARG B  1 109 ? -30.713  -7.911  -13.485  1.00 36.45 ? 90  ARG B CZ    1 
ATOM   3452  N  NH1   . ARG B  1 109 ? -29.861  -7.721  -12.526  1.00 36.70 ? 90  ARG B NH1   1 
ATOM   3453  N  NH2   . ARG B  1 109 ? -30.411  -8.701  -14.464  1.00 36.61 ? 90  ARG B NH2   1 
ATOM   3454  N  N     . LYS B  1 110 ? -35.417  -2.630  -9.685   1.00 38.64 ? 91  LYS B N     1 
ATOM   3455  C  CA    . LYS B  1 110 ? -36.034  -2.195  -8.436   1.00 39.55 ? 91  LYS B CA    1 
ATOM   3456  C  C     . LYS B  1 110 ? -35.544  -2.855  -7.168   1.00 39.43 ? 91  LYS B C     1 
ATOM   3457  O  O     . LYS B  1 110 ? -34.903  -3.840  -7.221   1.00 39.91 ? 91  LYS B O     1 
ATOM   3458  C  CB    . LYS B  1 110 ? -37.552  -2.231  -8.519   1.00 39.17 ? 91  LYS B CB    1 
ATOM   3459  C  CG    . LYS B  1 110 ? -38.175  -1.072  -9.215   1.00 40.98 ? 91  LYS B CG    1 
ATOM   3460  C  CD    . LYS B  1 110 ? -39.627  -1.280  -9.476   1.00 41.73 ? 91  LYS B CD    1 
ATOM   3461  C  CE    . LYS B  1 110 ? -40.525  -0.596  -8.466   1.00 46.55 ? 91  LYS B CE    1 
ATOM   3462  N  NZ    . LYS B  1 110 ? -41.438  0.435   -9.023   1.00 46.02 ? 91  LYS B NZ    1 
ATOM   3463  N  N     . ASP B  1 111 ? -35.864  -2.290  -6.022   1.00 39.63 ? 92  ASP B N     1 
ATOM   3464  C  CA    . ASP B  1 111 ? -35.528  -2.893  -4.750   1.00 39.27 ? 92  ASP B CA    1 
ATOM   3465  C  C     . ASP B  1 111 ? -36.127  -4.262  -4.733   1.00 39.31 ? 92  ASP B C     1 
ATOM   3466  O  O     . ASP B  1 111 ? -37.189  -4.430  -5.236   1.00 39.30 ? 92  ASP B O     1 
ATOM   3467  C  CB    . ASP B  1 111 ? -36.096  -2.091  -3.606   1.00 37.95 ? 92  ASP B CB    1 
ATOM   3468  C  CG    . ASP B  1 111 ? -35.411  -0.803  -3.405   1.00 39.98 ? 92  ASP B CG    1 
ATOM   3469  O  OD1   . ASP B  1 111 ? -34.298  -0.658  -3.882   1.00 38.20 ? 92  ASP B OD1   1 
ATOM   3470  O  OD2   . ASP B  1 111 ? -35.971  0.065   -2.748   1.00 37.46 ? 92  ASP B OD2   1 
ATOM   3471  N  N     . PRO B  1 112 ? -35.465  -5.271  -4.194   1.00 39.58 ? 93  PRO B N     1 
ATOM   3472  C  CA    . PRO B  1 112 ? -34.284  -5.186  -3.350   1.00 39.15 ? 93  PRO B CA    1 
ATOM   3473  C  C     . PRO B  1 112 ? -32.995  -5.407  -4.098   1.00 38.69 ? 93  PRO B C     1 
ATOM   3474  O  O     . PRO B  1 112 ? -31.972  -5.628  -3.537   1.00 39.15 ? 93  PRO B O     1 
ATOM   3475  C  CB    . PRO B  1 112 ? -34.504  -6.348  -2.425   1.00 38.71 ? 93  PRO B CB    1 
ATOM   3476  C  CG    . PRO B  1 112 ? -35.133  -7.308  -3.252   1.00 39.02 ? 93  PRO B CG    1 
ATOM   3477  C  CD    . PRO B  1 112 ? -36.010  -6.620  -4.185   1.00 39.72 ? 93  PRO B CD    1 
ATOM   3478  N  N     . ASN B  1 113 ? -33.089  -5.337  -5.392   1.00 38.11 ? 94  ASN B N     1 
ATOM   3479  C  CA    . ASN B  1 113 ? -31.960  -5.628  -6.283   1.00 38.54 ? 94  ASN B CA    1 
ATOM   3480  C  C     . ASN B  1 113 ? -30.922  -4.534  -6.371   1.00 38.37 ? 94  ASN B C     1 
ATOM   3481  O  O     . ASN B  1 113 ? -31.235  -3.358  -6.184   1.00 39.11 ? 94  ASN B O     1 
ATOM   3482  C  CB    . ASN B  1 113 ? -32.479  -5.953  -7.692   1.00 38.66 ? 94  ASN B CB    1 
ATOM   3483  C  CG    . ASN B  1 113 ? -33.583  -7.027  -7.671   1.00 38.39 ? 94  ASN B CG    1 
ATOM   3484  O  OD1   . ASN B  1 113 ? -33.356  -8.147  -7.183   1.00 38.98 ? 94  ASN B OD1   1 
ATOM   3485  N  ND2   . ASN B  1 113 ? -34.771  -6.679  -8.158   1.00 32.32 ? 94  ASN B ND2   1 
ATOM   3486  N  N     . LYS B  1 114 ? -29.697  -4.911  -6.711   1.00 38.34 ? 95  LYS B N     1 
ATOM   3487  C  CA    . LYS B  1 114 ? -28.556  -3.986  -6.618   1.00 38.89 ? 95  LYS B CA    1 
ATOM   3488  C  C     . LYS B  1 114 ? -27.721  -3.887  -7.875   1.00 39.54 ? 95  LYS B C     1 
ATOM   3489  O  O     . LYS B  1 114 ? -27.689  -4.808  -8.697   1.00 40.56 ? 95  LYS B O     1 
ATOM   3490  C  CB    . LYS B  1 114 ? -27.594  -4.365  -5.485   1.00 38.24 ? 95  LYS B CB    1 
ATOM   3491  C  CG    . LYS B  1 114 ? -28.266  -4.630  -4.163   1.00 38.26 ? 95  LYS B CG    1 
ATOM   3492  C  CD    . LYS B  1 114 ? -29.056  -3.415  -3.702   1.00 37.66 ? 95  LYS B CD    1 
ATOM   3493  C  CE    . LYS B  1 114 ? -29.396  -3.532  -2.236   1.00 37.48 ? 95  LYS B CE    1 
ATOM   3494  N  NZ    . LYS B  1 114 ? -30.626  -2.740  -1.909   1.00 35.67 ? 95  LYS B NZ    1 
ATOM   3495  N  N     . LEU B  1 115 ? -27.058  -2.745  -8.008   1.00 39.35 ? 96  LEU B N     1 
ATOM   3496  C  CA    . LEU B  1 115 ? -26.007  -2.594  -8.958   1.00 39.69 ? 96  LEU B CA    1 
ATOM   3497  C  C     . LEU B  1 115 ? -24.718  -2.443  -8.127   1.00 39.86 ? 96  LEU B C     1 
ATOM   3498  O  O     . LEU B  1 115 ? -24.719  -1.731  -7.123   1.00 39.44 ? 96  LEU B O     1 
ATOM   3499  C  CB    . LEU B  1 115 ? -26.220  -1.345  -9.795   1.00 39.34 ? 96  LEU B CB    1 
ATOM   3500  C  CG    . LEU B  1 115 ? -27.367  -1.151  -10.777  1.00 39.12 ? 96  LEU B CG    1 
ATOM   3501  C  CD1   . LEU B  1 115 ? -27.192  0.292   -11.417  1.00 35.74 ? 96  LEU B CD1   1 
ATOM   3502  C  CD2   . LEU B  1 115 ? -27.437  -2.252  -11.847  1.00 36.93 ? 96  LEU B CD2   1 
ATOM   3503  N  N     . VAL B  1 116 ? -23.643  -3.112  -8.553   1.00 39.87 ? 97  VAL B N     1 
ATOM   3504  C  CA    . VAL B  1 116 ? -22.348  -3.069  -7.850   1.00 39.92 ? 97  VAL B CA    1 
ATOM   3505  C  C     . VAL B  1 116 ? -21.227  -2.725  -8.813   1.00 39.48 ? 97  VAL B C     1 
ATOM   3506  O  O     . VAL B  1 116 ? -20.940  -3.509  -9.728   1.00 39.09 ? 97  VAL B O     1 
ATOM   3507  C  CB    . VAL B  1 116 ? -22.003  -4.454  -7.268   1.00 40.12 ? 97  VAL B CB    1 
ATOM   3508  C  CG1   . VAL B  1 116 ? -20.842  -4.334  -6.339   1.00 39.69 ? 97  VAL B CG1   1 
ATOM   3509  C  CG2   . VAL B  1 116 ? -23.189  -5.013  -6.561   1.00 41.30 ? 97  VAL B CG2   1 
ATOM   3510  N  N     . LEU B  1 117 ? -20.599  -1.569  -8.637   1.00 39.26 ? 98  LEU B N     1 
ATOM   3511  C  CA    . LEU B  1 117 ? -19.447  -1.247  -9.459   1.00 39.42 ? 98  LEU B CA    1 
ATOM   3512  C  C     . LEU B  1 117 ? -18.289  -1.975  -8.783   1.00 39.58 ? 98  LEU B C     1 
ATOM   3513  O  O     . LEU B  1 117 ? -18.156  -1.897  -7.545   1.00 38.70 ? 98  LEU B O     1 
ATOM   3514  C  CB    . LEU B  1 117 ? -19.194  0.266   -9.574   1.00 39.43 ? 98  LEU B CB    1 
ATOM   3515  C  CG    . LEU B  1 117 ? -17.916  0.706   -10.344  1.00 38.82 ? 98  LEU B CG    1 
ATOM   3516  C  CD1   . LEU B  1 117 ? -17.999  0.401   -11.820  1.00 37.11 ? 98  LEU B CD1   1 
ATOM   3517  C  CD2   . LEU B  1 117 ? -17.632  2.172   -10.158  1.00 38.59 ? 98  LEU B CD2   1 
ATOM   3518  N  N     . CYS B  1 118 ? -17.489  -2.688  -9.583   1.00 39.47 ? 99  CYS B N     1 
ATOM   3519  C  CA    . CYS B  1 118 ? -16.359  -3.448  -9.072   1.00 40.50 ? 99  CYS B CA    1 
ATOM   3520  C  C     . CYS B  1 118 ? -14.994  -2.975  -9.601   1.00 41.22 ? 99  CYS B C     1 
ATOM   3521  O  O     . CYS B  1 118 ? -14.869  -2.425  -10.703  1.00 42.00 ? 99  CYS B O     1 
ATOM   3522  C  CB    . CYS B  1 118 ? -16.519  -4.922  -9.430   1.00 40.01 ? 99  CYS B CB    1 
ATOM   3523  S  SG    . CYS B  1 118 ? -18.001  -5.703  -8.756   1.00 40.08 ? 99  CYS B SG    1 
ATOM   3524  N  N     . GLU B  1 119 ? -13.961  -3.243  -8.815   1.00 41.98 ? 100 GLU B N     1 
ATOM   3525  C  CA    . GLU B  1 119 ? -12.585  -3.220  -9.295   1.00 42.34 ? 100 GLU B CA    1 
ATOM   3526  C  C     . GLU B  1 119 ? -12.162  -4.586  -9.889   1.00 42.65 ? 100 GLU B C     1 
ATOM   3527  O  O     . GLU B  1 119 ? -12.529  -5.637  -9.368   1.00 43.59 ? 100 GLU B O     1 
ATOM   3528  C  CB    . GLU B  1 119 ? -11.646  -2.850  -8.165   1.00 42.62 ? 100 GLU B CB    1 
ATOM   3529  C  CG    . GLU B  1 119 ? -11.540  -1.356  -7.874   1.00 43.37 ? 100 GLU B CG    1 
ATOM   3530  C  CD    . GLU B  1 119 ? -10.397  -1.055  -6.883   1.00 43.72 ? 100 GLU B CD    1 
ATOM   3531  O  OE1   . GLU B  1 119 ? -9.301   -1.690  -7.011   1.00 43.83 ? 100 GLU B OE1   1 
ATOM   3532  O  OE2   . GLU B  1 119 ? -10.596  -0.178  -6.007   1.00 41.20 ? 100 GLU B OE2   1 
ATOM   3533  N  N     . VAL B  1 120 ? -11.412  -4.547  -10.987  1.00 42.27 ? 101 VAL B N     1 
ATOM   3534  C  CA    . VAL B  1 120 ? -10.846  -5.722  -11.593  1.00 42.44 ? 101 VAL B CA    1 
ATOM   3535  C  C     . VAL B  1 120 ? -9.365   -5.974  -11.115  1.00 43.48 ? 101 VAL B C     1 
ATOM   3536  O  O     . VAL B  1 120 ? -8.492   -5.043  -11.075  1.00 43.84 ? 101 VAL B O     1 
ATOM   3537  C  CB    . VAL B  1 120 ? -10.904  -5.593  -13.141  1.00 41.75 ? 101 VAL B CB    1 
ATOM   3538  C  CG1   . VAL B  1 120 ? -10.338  -6.849  -13.820  1.00 41.18 ? 101 VAL B CG1   1 
ATOM   3539  C  CG2   . VAL B  1 120 ? -12.336  -5.324  -13.578  1.00 40.72 ? 101 VAL B CG2   1 
ATOM   3540  N  N     . PHE B  1 121 ? -9.094   -7.233  -10.783  1.00 43.30 ? 102 PHE B N     1 
ATOM   3541  C  CA    . PHE B  1 121 ? -7.757   -7.697  -10.521  1.00 44.04 ? 102 PHE B CA    1 
ATOM   3542  C  C     . PHE B  1 121 ? -7.398   -8.952  -11.363  1.00 44.92 ? 102 PHE B C     1 
ATOM   3543  O  O     . PHE B  1 121 ? -8.272   -9.781  -11.689  1.00 44.22 ? 102 PHE B O     1 
ATOM   3544  C  CB    . PHE B  1 121 ? -7.631   -8.045  -9.044   1.00 43.67 ? 102 PHE B CB    1 
ATOM   3545  C  CG    . PHE B  1 121 ? -7.821   -6.878  -8.117   1.00 43.64 ? 102 PHE B CG    1 
ATOM   3546  C  CD1   . PHE B  1 121 ? -6.721   -6.172  -7.619   1.00 44.49 ? 102 PHE B CD1   1 
ATOM   3547  C  CD2   . PHE B  1 121 ? -9.077   -6.503  -7.711   1.00 44.33 ? 102 PHE B CD2   1 
ATOM   3548  C  CE1   . PHE B  1 121 ? -6.878   -5.122  -6.748   1.00 42.69 ? 102 PHE B CE1   1 
ATOM   3549  C  CE2   . PHE B  1 121 ? -9.252   -5.428  -6.844   1.00 43.95 ? 102 PHE B CE2   1 
ATOM   3550  C  CZ    . PHE B  1 121 ? -8.144   -4.754  -6.362   1.00 44.47 ? 102 PHE B CZ    1 
ATOM   3551  N  N     . LYS B  1 122 ? -6.098   -9.116  -11.631  1.00 45.69 ? 103 LYS B N     1 
ATOM   3552  C  CA    . LYS B  1 122 ? -5.570   -10.212 -12.449  1.00 47.10 ? 103 LYS B CA    1 
ATOM   3553  C  C     . LYS B  1 122 ? -5.377   -11.577 -11.745  1.00 47.26 ? 103 LYS B C     1 
ATOM   3554  O  O     . LYS B  1 122 ? -5.533   -11.705 -10.537  1.00 47.46 ? 103 LYS B O     1 
ATOM   3555  C  CB    . LYS B  1 122 ? -4.237   -9.764  -13.045  1.00 48.04 ? 103 LYS B CB    1 
ATOM   3556  C  CG    . LYS B  1 122 ? -4.272   -8.454  -13.860  1.00 48.88 ? 103 LYS B CG    1 
ATOM   3557  C  CD    . LYS B  1 122 ? -2.836   -7.849  -14.051  1.00 48.71 ? 103 LYS B CD    1 
ATOM   3558  C  CE    . LYS B  1 122 ? -2.162   -8.370  -15.319  1.00 51.75 ? 103 LYS B CE    1 
ATOM   3559  N  NZ    . LYS B  1 122 ? -0.664   -8.034  -15.399  1.00 52.40 ? 103 LYS B NZ    1 
ATOM   3560  N  N     . TYR B  1 123 ? -5.041   -12.606 -12.515  1.00 48.27 ? 104 TYR B N     1 
ATOM   3561  C  CA    . TYR B  1 123 ? -4.815   -13.962 -11.957  1.00 48.99 ? 104 TYR B CA    1 
ATOM   3562  C  C     . TYR B  1 123 ? -3.947   -13.938 -10.698  1.00 49.50 ? 104 TYR B C     1 
ATOM   3563  O  O     . TYR B  1 123 ? -4.169   -14.702 -9.787   1.00 50.20 ? 104 TYR B O     1 
ATOM   3564  C  CB    . TYR B  1 123 ? -4.194   -14.892 -13.006  1.00 50.00 ? 104 TYR B CB    1 
ATOM   3565  C  CG    . TYR B  1 123 ? -2.788   -14.520 -13.376  1.00 51.02 ? 104 TYR B CG    1 
ATOM   3566  C  CD1   . TYR B  1 123 ? -1.680   -15.232 -12.872  1.00 52.50 ? 104 TYR B CD1   1 
ATOM   3567  C  CD2   . TYR B  1 123 ? -2.541   -13.434 -14.187  1.00 52.66 ? 104 TYR B CD2   1 
ATOM   3568  C  CE1   . TYR B  1 123 ? -0.365   -14.860 -13.197  1.00 51.99 ? 104 TYR B CE1   1 
ATOM   3569  C  CE2   . TYR B  1 123 ? -1.237   -13.040 -14.508  1.00 52.82 ? 104 TYR B CE2   1 
ATOM   3570  C  CZ    . TYR B  1 123 ? -0.155   -13.752 -14.018  1.00 53.30 ? 104 TYR B CZ    1 
ATOM   3571  O  OH    . TYR B  1 123 ? 1.109    -13.311 -14.360  1.00 52.96 ? 104 TYR B OH    1 
ATOM   3572  N  N     . ASN B  1 124 ? -2.978   -13.031 -10.654  1.00 49.65 ? 105 ASN B N     1 
ATOM   3573  C  CA    . ASN B  1 124 ? -2.036   -12.884 -9.537   1.00 50.02 ? 105 ASN B CA    1 
ATOM   3574  C  C     . ASN B  1 124 ? -2.433   -11.867 -8.460   1.00 50.02 ? 105 ASN B C     1 
ATOM   3575  O  O     . ASN B  1 124 ? -1.566   -11.390 -7.757   1.00 49.65 ? 105 ASN B O     1 
ATOM   3576  C  CB    . ASN B  1 124 ? -0.641   -12.481 -10.086  1.00 49.74 ? 105 ASN B CB    1 
ATOM   3577  C  CG    . ASN B  1 124 ? -0.648   -11.120 -10.796  1.00 50.10 ? 105 ASN B CG    1 
ATOM   3578  O  OD1   . ASN B  1 124 ? -1.707   -10.499 -10.975  1.00 53.07 ? 105 ASN B OD1   1 
ATOM   3579  N  ND2   . ASN B  1 124 ? 0.516    -10.663 -11.223  1.00 48.46 ? 105 ASN B ND2   1 
ATOM   3580  N  N     . ARG B  1 125 ? -3.717   -11.513 -8.395   1.00 50.54 ? 106 ARG B N     1 
ATOM   3581  C  CA    . ARG B  1 125 ? -4.289   -10.467 -7.498   1.00 51.12 ? 106 ARG B CA    1 
ATOM   3582  C  C     . ARG B  1 125 ? -3.766   -9.016  -7.628   1.00 50.27 ? 106 ARG B C     1 
ATOM   3583  O  O     . ARG B  1 125 ? -4.139   -8.132  -6.850   1.00 49.90 ? 106 ARG B O     1 
ATOM   3584  C  CB    . ARG B  1 125 ? -4.263   -10.930 -6.039   1.00 51.36 ? 106 ARG B CB    1 
ATOM   3585  C  CG    . ARG B  1 125 ? -5.036   -12.219 -5.825   1.00 53.42 ? 106 ARG B CG    1 
ATOM   3586  C  CD    . ARG B  1 125 ? -5.174   -12.651 -4.345   1.00 55.01 ? 106 ARG B CD    1 
ATOM   3587  N  NE    . ARG B  1 125 ? -6.543   -13.153 -4.047   1.00 57.61 ? 106 ARG B NE    1 
ATOM   3588  C  CZ    . ARG B  1 125 ? -7.647   -12.381 -3.964   1.00 59.54 ? 106 ARG B CZ    1 
ATOM   3589  N  NH1   . ARG B  1 125 ? -7.597   -11.043 -4.173   1.00 58.93 ? 106 ARG B NH1   1 
ATOM   3590  N  NH2   . ARG B  1 125 ? -8.832   -12.951 -3.696   1.00 59.66 ? 106 ARG B NH2   1 
ATOM   3591  N  N     . ARG B  1 126 ? -2.940   -8.750  -8.619   1.00 49.82 ? 107 ARG B N     1 
ATOM   3592  C  CA    . ARG B  1 126 ? -2.589   -7.365  -8.922   1.00 50.56 ? 107 ARG B CA    1 
ATOM   3593  C  C     . ARG B  1 126 ? -3.679   -6.670  -9.730   1.00 48.41 ? 107 ARG B C     1 
ATOM   3594  O  O     . ARG B  1 126 ? -4.341   -7.284  -10.538  1.00 47.50 ? 107 ARG B O     1 
ATOM   3595  C  CB    . ARG B  1 126 ? -1.279   -7.301  -9.702   1.00 51.27 ? 107 ARG B CB    1 
ATOM   3596  C  CG    . ARG B  1 126 ? -0.175   -8.005  -8.977   1.00 53.79 ? 107 ARG B CG    1 
ATOM   3597  C  CD    . ARG B  1 126 ? 1.221    -7.707  -9.519   1.00 56.50 ? 107 ARG B CD    1 
ATOM   3598  N  NE    . ARG B  1 126 ? 2.186    -8.165  -8.504   1.00 61.66 ? 107 ARG B NE    1 
ATOM   3599  C  CZ    . ARG B  1 126 ? 3.525    -8.164  -8.615   1.00 65.30 ? 107 ARG B CZ    1 
ATOM   3600  N  NH1   . ARG B  1 126 ? 4.120    -7.739  -9.736   1.00 66.23 ? 107 ARG B NH1   1 
ATOM   3601  N  NH2   . ARG B  1 126 ? 4.272    -8.595  -7.580   1.00 64.64 ? 107 ARG B NH2   1 
ATOM   3602  N  N     . PRO B  1 127 ? -3.843   -5.373  -9.537   1.00 47.48 ? 108 PRO B N     1 
ATOM   3603  C  CA    . PRO B  1 127 ? -4.814   -4.610  -10.333  1.00 47.25 ? 108 PRO B CA    1 
ATOM   3604  C  C     . PRO B  1 127 ? -4.676   -4.794  -11.832  1.00 46.26 ? 108 PRO B C     1 
ATOM   3605  O  O     . PRO B  1 127 ? -3.580   -4.819  -12.352  1.00 46.89 ? 108 PRO B O     1 
ATOM   3606  C  CB    . PRO B  1 127 ? -4.504   -3.166  -9.971   1.00 47.08 ? 108 PRO B CB    1 
ATOM   3607  C  CG    . PRO B  1 127 ? -3.794   -3.232  -8.685   1.00 47.30 ? 108 PRO B CG    1 
ATOM   3608  C  CD    . PRO B  1 127 ? -3.155   -4.541  -8.546   1.00 47.05 ? 108 PRO B CD    1 
ATOM   3609  N  N     . ALA B  1 128 ? -5.782   -4.963  -12.522  1.00 45.55 ? 109 ALA B N     1 
ATOM   3610  C  CA    . ALA B  1 128 ? -5.762   -4.910  -13.965  1.00 44.89 ? 109 ALA B CA    1 
ATOM   3611  C  C     . ALA B  1 128 ? -5.192   -3.567  -14.462  1.00 44.00 ? 109 ALA B C     1 
ATOM   3612  O  O     . ALA B  1 128 ? -5.215   -2.535  -13.784  1.00 41.87 ? 109 ALA B O     1 
ATOM   3613  C  CB    . ALA B  1 128 ? -7.179   -5.094  -14.504  1.00 44.76 ? 109 ALA B CB    1 
ATOM   3614  N  N     . GLU B  1 129 ? -4.726   -3.617  -15.697  1.00 43.95 ? 110 GLU B N     1 
ATOM   3615  C  CA    . GLU B  1 129 ? -4.187   -2.469  -16.397  1.00 43.86 ? 110 GLU B CA    1 
ATOM   3616  C  C     . GLU B  1 129 ? -5.171   -1.314  -16.495  1.00 43.23 ? 110 GLU B C     1 
ATOM   3617  O  O     . GLU B  1 129 ? -4.764   -0.166  -16.452  1.00 43.11 ? 110 GLU B O     1 
ATOM   3618  C  CB    . GLU B  1 129 ? -3.728   -2.921  -17.778  1.00 44.84 ? 110 GLU B CB    1 
ATOM   3619  C  CG    . GLU B  1 129 ? -2.391   -3.732  -17.749  1.00 47.89 ? 110 GLU B CG    1 
ATOM   3620  C  CD    . GLU B  1 129 ? -2.513   -5.250  -17.383  1.00 53.68 ? 110 GLU B CD    1 
ATOM   3621  O  OE1   . GLU B  1 129 ? -3.640   -5.815  -17.309  1.00 55.51 ? 110 GLU B OE1   1 
ATOM   3622  O  OE2   . GLU B  1 129 ? -1.438   -5.892  -17.147  1.00 54.21 ? 110 GLU B OE2   1 
ATOM   3623  N  N     . THR B  1 130 ? -6.467   -1.624  -16.629  1.00 42.39 ? 111 THR B N     1 
ATOM   3624  C  CA    . THR B  1 130 ? -7.505   -0.598  -16.711  1.00 41.02 ? 111 THR B CA    1 
ATOM   3625  C  C     . THR B  1 130 ? -8.211   -0.369  -15.359  1.00 40.40 ? 111 THR B C     1 
ATOM   3626  O  O     . THR B  1 130 ? -9.167   0.398   -15.278  1.00 39.34 ? 111 THR B O     1 
ATOM   3627  C  CB    . THR B  1 130 ? -8.497   -0.873  -17.843  1.00 40.58 ? 111 THR B CB    1 
ATOM   3628  O  OG1   . THR B  1 130 ? -9.121   -2.158  -17.675  1.00 42.66 ? 111 THR B OG1   1 
ATOM   3629  C  CG2   . THR B  1 130 ? -7.798   -0.827  -19.208  1.00 38.73 ? 111 THR B CG2   1 
ATOM   3630  N  N     . ASN B  1 131 ? -7.693   -0.963  -14.282  1.00 39.61 ? 112 ASN B N     1 
ATOM   3631  C  CA    . ASN B  1 131 ? -8.148   -0.636  -12.931  1.00 39.39 ? 112 ASN B CA    1 
ATOM   3632  C  C     . ASN B  1 131 ? -7.436   0.608   -12.468  1.00 39.82 ? 112 ASN B C     1 
ATOM   3633  O  O     . ASN B  1 131 ? -6.405   0.518   -11.845  1.00 42.28 ? 112 ASN B O     1 
ATOM   3634  C  CB    . ASN B  1 131 ? -7.908   -1.808  -11.985  1.00 38.09 ? 112 ASN B CB    1 
ATOM   3635  C  CG    . ASN B  1 131 ? -8.349   -1.524  -10.548  1.00 38.69 ? 112 ASN B CG    1 
ATOM   3636  O  OD1   . ASN B  1 131 ? -8.523   -0.360  -10.143  1.00 37.03 ? 112 ASN B OD1   1 
ATOM   3637  N  ND2   . ASN B  1 131 ? -8.520   -2.604  -9.748   1.00 35.16 ? 112 ASN B ND2   1 
ATOM   3638  N  N     . LEU B  1 132 ? -7.955   1.779   -12.800  1.00 40.19 ? 113 LEU B N     1 
ATOM   3639  C  CA    . LEU B  1 132 ? -7.358   3.040   -12.399  1.00 40.14 ? 113 LEU B CA    1 
ATOM   3640  C  C     . LEU B  1 132 ? -7.864   3.529   -11.057  1.00 41.13 ? 113 LEU B C     1 
ATOM   3641  O  O     . LEU B  1 132 ? -7.430   4.574   -10.554  1.00 42.04 ? 113 LEU B O     1 
ATOM   3642  C  CB    . LEU B  1 132 ? -7.643   4.104   -13.450  1.00 39.86 ? 113 LEU B CB    1 
ATOM   3643  C  CG    . LEU B  1 132 ? -7.008   3.852   -14.834  1.00 38.92 ? 113 LEU B CG    1 
ATOM   3644  C  CD1   . LEU B  1 132 ? -7.088   5.105   -15.729  1.00 33.11 ? 113 LEU B CD1   1 
ATOM   3645  C  CD2   . LEU B  1 132 ? -5.570   3.394   -14.614  1.00 34.89 ? 113 LEU B CD2   1 
ATOM   3646  N  N     . ARG B  1 133 ? -8.794   2.783   -10.470  1.00 41.97 ? 114 ARG B N     1 
ATOM   3647  C  CA    . ARG B  1 133 ? -9.431   3.182   -9.225   1.00 41.91 ? 114 ARG B CA    1 
ATOM   3648  C  C     . ARG B  1 133 ? -8.491   2.839   -8.078   1.00 42.24 ? 114 ARG B C     1 
ATOM   3649  O  O     . ARG B  1 133 ? -8.392   3.569   -7.103   1.00 41.60 ? 114 ARG B O     1 
ATOM   3650  C  CB    . ARG B  1 133 ? -10.771  2.458   -9.048   1.00 41.38 ? 114 ARG B CB    1 
ATOM   3651  C  CG    . ARG B  1 133 ? -11.511  2.784   -7.750   1.00 41.14 ? 114 ARG B CG    1 
ATOM   3652  C  CD    . ARG B  1 133 ? -12.853  2.026   -7.623   1.00 41.25 ? 114 ARG B CD    1 
ATOM   3653  N  NE    . ARG B  1 133 ? -13.695  2.622   -6.573   1.00 41.79 ? 114 ARG B NE    1 
ATOM   3654  C  CZ    . ARG B  1 133 ? -13.552  2.388   -5.264   1.00 39.38 ? 114 ARG B CZ    1 
ATOM   3655  N  NH1   . ARG B  1 133 ? -12.640  1.559   -4.841   1.00 38.07 ? 114 ARG B NH1   1 
ATOM   3656  N  NH2   . ARG B  1 133 ? -14.337  2.971   -4.383   1.00 39.17 ? 114 ARG B NH2   1 
ATOM   3657  N  N     . HIS B  1 134 ? -7.828   1.704   -8.187   1.00 42.97 ? 115 HIS B N     1 
ATOM   3658  C  CA    . HIS B  1 134 ? -6.932   1.278   -7.118   1.00 43.87 ? 115 HIS B CA    1 
ATOM   3659  C  C     . HIS B  1 134 ? -5.942   2.350   -6.607   1.00 44.03 ? 115 HIS B C     1 
ATOM   3660  O  O     . HIS B  1 134 ? -5.931   2.646   -5.397   1.00 43.78 ? 115 HIS B O     1 
ATOM   3661  C  CB    . HIS B  1 134 ? -6.172   0.023   -7.484   1.00 43.85 ? 115 HIS B CB    1 
ATOM   3662  C  CG    . HIS B  1 134 ? -5.752   -0.743  -6.285   1.00 46.77 ? 115 HIS B CG    1 
ATOM   3663  N  ND1   . HIS B  1 134 ? -6.662   -1.441  -5.499   1.00 46.57 ? 115 HIS B ND1   1 
ATOM   3664  C  CD2   . HIS B  1 134 ? -4.531   -0.869  -5.690   1.00 48.49 ? 115 HIS B CD2   1 
ATOM   3665  C  CE1   . HIS B  1 134 ? -6.006   -1.976  -4.480   1.00 51.10 ? 115 HIS B CE1   1 
ATOM   3666  N  NE2   . HIS B  1 134 ? -4.714   -1.638  -4.567   1.00 50.43 ? 115 HIS B NE2   1 
ATOM   3667  N  N     . THR B  1 135 ? -5.142   2.931   -7.505   1.00 44.38 ? 116 THR B N     1 
ATOM   3668  C  CA    . THR B  1 135 ? -4.240   4.035   -7.132   1.00 44.99 ? 116 THR B CA    1 
ATOM   3669  C  C     . THR B  1 135 ? -5.037   5.301   -6.773   1.00 45.82 ? 116 THR B C     1 
ATOM   3670  O  O     . THR B  1 135 ? -4.751   5.978   -5.760   1.00 45.86 ? 116 THR B O     1 
ATOM   3671  C  CB    . THR B  1 135 ? -3.198   4.285   -8.225   1.00 44.71 ? 116 THR B CB    1 
ATOM   3672  O  OG1   . THR B  1 135 ? -2.330   3.165   -8.240   1.00 43.78 ? 116 THR B OG1   1 
ATOM   3673  C  CG2   . THR B  1 135 ? -2.356   5.526   -7.993   1.00 44.24 ? 116 THR B CG2   1 
ATOM   3674  N  N     . CYS B  1 136 ? -6.082   5.578   -7.548   1.00 46.48 ? 117 CYS B N     1 
ATOM   3675  C  CA    . CYS B  1 136 ? -6.871   6.772   -7.309   1.00 46.74 ? 117 CYS B CA    1 
ATOM   3676  C  C     . CYS B  1 136 ? -7.370   6.865   -5.860   1.00 47.14 ? 117 CYS B C     1 
ATOM   3677  O  O     . CYS B  1 136 ? -7.253   7.925   -5.223   1.00 46.49 ? 117 CYS B O     1 
ATOM   3678  C  CB    . CYS B  1 136 ? -8.007   6.869   -8.296   1.00 46.59 ? 117 CYS B CB    1 
ATOM   3679  S  SG    . CYS B  1 136 ? -8.832   8.432   -8.160   1.00 46.92 ? 117 CYS B SG    1 
ATOM   3680  N  N     . LYS B  1 137 ? -7.879   5.744   -5.344   1.00 47.89 ? 118 LYS B N     1 
ATOM   3681  C  CA    . LYS B  1 137 ? -8.367   5.647   -3.963   1.00 48.42 ? 118 LYS B CA    1 
ATOM   3682  C  C     . LYS B  1 137 ? -7.293   5.945   -2.934   1.00 48.79 ? 118 LYS B C     1 
ATOM   3683  O  O     . LYS B  1 137 ? -7.529   6.644   -1.965   1.00 48.39 ? 118 LYS B O     1 
ATOM   3684  C  CB    . LYS B  1 137 ? -8.879   4.248   -3.688   1.00 48.44 ? 118 LYS B CB    1 
ATOM   3685  C  CG    . LYS B  1 137 ? -9.985   4.225   -2.668   1.00 49.47 ? 118 LYS B CG    1 
ATOM   3686  C  CD    . LYS B  1 137 ? -9.948   2.968   -1.870   1.00 52.07 ? 118 LYS B CD    1 
ATOM   3687  C  CE    . LYS B  1 137 ? -10.272  3.194   -0.381   1.00 53.73 ? 118 LYS B CE    1 
ATOM   3688  N  NZ    . LYS B  1 137 ? -9.201   2.495   0.486    1.00 55.95 ? 118 LYS B NZ    1 
ATOM   3689  N  N     . ARG B  1 138 ? -6.116   5.359   -3.135   1.00 49.83 ? 119 ARG B N     1 
ATOM   3690  C  CA    . ARG B  1 138 ? -4.963   5.628   -2.277   1.00 50.06 ? 119 ARG B CA    1 
ATOM   3691  C  C     . ARG B  1 138 ? -4.604   7.110   -2.255   1.00 49.38 ? 119 ARG B C     1 
ATOM   3692  O  O     . ARG B  1 138 ? -4.485   7.703   -1.196   1.00 49.17 ? 119 ARG B O     1 
ATOM   3693  C  CB    . ARG B  1 138 ? -3.751   4.841   -2.741   1.00 51.39 ? 119 ARG B CB    1 
ATOM   3694  C  CG    . ARG B  1 138 ? -3.495   3.577   -2.005   1.00 54.41 ? 119 ARG B CG    1 
ATOM   3695  C  CD    . ARG B  1 138 ? -3.812   2.312   -2.782   1.00 60.63 ? 119 ARG B CD    1 
ATOM   3696  N  NE    . ARG B  1 138 ? -2.678   1.374   -2.924   1.00 64.50 ? 119 ARG B NE    1 
ATOM   3697  C  CZ    . ARG B  1 138 ? -1.820   0.978   -1.961   1.00 66.61 ? 119 ARG B CZ    1 
ATOM   3698  N  NH1   . ARG B  1 138 ? -1.894   1.422   -0.700   1.00 66.71 ? 119 ARG B NH1   1 
ATOM   3699  N  NH2   . ARG B  1 138 ? -0.846   0.119   -2.280   1.00 66.09 ? 119 ARG B NH2   1 
ATOM   3700  N  N     . ILE B  1 139 ? -4.449   7.703   -3.428   1.00 48.30 ? 120 ILE B N     1 
ATOM   3701  C  CA    . ILE B  1 139 ? -4.217   9.132   -3.500   1.00 48.40 ? 120 ILE B CA    1 
ATOM   3702  C  C     . ILE B  1 139 ? -5.300   9.958   -2.749   1.00 48.26 ? 120 ILE B C     1 
ATOM   3703  O  O     . ILE B  1 139 ? -4.951   10.924  -2.058   1.00 48.01 ? 120 ILE B O     1 
ATOM   3704  C  CB    . ILE B  1 139 ? -4.131   9.598   -4.963   1.00 47.97 ? 120 ILE B CB    1 
ATOM   3705  C  CG1   . ILE B  1 139 ? -2.878   8.999   -5.638   1.00 48.15 ? 120 ILE B CG1   1 
ATOM   3706  C  CG2   . ILE B  1 139 ? -4.244   11.155  -5.054   1.00 47.09 ? 120 ILE B CG2   1 
ATOM   3707  C  CD1   . ILE B  1 139 ? -1.542   9.255   -4.928   1.00 44.77 ? 120 ILE B CD1   1 
ATOM   3708  N  N     . MET B  1 140 ? -6.585   9.589   -2.884   1.00 47.64 ? 121 MET B N     1 
ATOM   3709  C  CA    . MET B  1 140 ? -7.684   10.336  -2.217   1.00 47.65 ? 121 MET B CA    1 
ATOM   3710  C  C     . MET B  1 140 ? -7.649   10.148  -0.713   1.00 47.40 ? 121 MET B C     1 
ATOM   3711  O  O     . MET B  1 140 ? -7.921   11.060  0.029    1.00 47.16 ? 121 MET B O     1 
ATOM   3712  C  CB    . MET B  1 140 ? -9.065   9.926   -2.707   1.00 46.85 ? 121 MET B CB    1 
ATOM   3713  C  CG    . MET B  1 140 ? -9.310   10.130  -4.175   1.00 46.81 ? 121 MET B CG    1 
ATOM   3714  S  SD    . MET B  1 140 ? -9.372   11.852  -4.633   1.00 44.62 ? 121 MET B SD    1 
ATOM   3715  C  CE    . MET B  1 140 ? -9.410   11.657  -6.456   1.00 44.73 ? 121 MET B CE    1 
ATOM   3716  N  N     . ASP B  1 141 ? -7.311   8.953   -0.263   1.00 48.08 ? 122 ASP B N     1 
ATOM   3717  C  CA    . ASP B  1 141 ? -7.098   8.723   1.164    1.00 48.43 ? 122 ASP B CA    1 
ATOM   3718  C  C     . ASP B  1 141 ? -5.991   9.601   1.742    1.00 48.67 ? 122 ASP B C     1 
ATOM   3719  O  O     . ASP B  1 141 ? -6.131   10.099  2.863    1.00 48.63 ? 122 ASP B O     1 
ATOM   3720  C  CB    . ASP B  1 141 ? -6.803   7.254   1.433    1.00 48.12 ? 122 ASP B CB    1 
ATOM   3721  C  CG    . ASP B  1 141 ? -8.045   6.381   1.349    1.00 49.09 ? 122 ASP B CG    1 
ATOM   3722  O  OD1   . ASP B  1 141 ? -9.190   6.900   1.281    1.00 46.62 ? 122 ASP B OD1   1 
ATOM   3723  O  OD2   . ASP B  1 141 ? -7.855   5.151   1.359    1.00 51.67 ? 122 ASP B OD2   1 
ATOM   3724  N  N     . MET B  1 142 ? -4.923   9.823   0.968    1.00 48.89 ? 123 MET B N     1 
ATOM   3725  C  CA    . MET B  1 142 ? -3.812   10.641  1.442    1.00 49.03 ? 123 MET B CA    1 
ATOM   3726  C  C     . MET B  1 142 ? -4.193   12.097  1.714    1.00 48.65 ? 123 MET B C     1 
ATOM   3727  O  O     . MET B  1 142 ? -3.563   12.736  2.551    1.00 49.38 ? 123 MET B O     1 
ATOM   3728  C  CB    . MET B  1 142 ? -2.612   10.614  0.467    1.00 50.34 ? 123 MET B CB    1 
ATOM   3729  C  CG    . MET B  1 142 ? -1.756   9.331   0.507    1.00 52.10 ? 123 MET B CG    1 
ATOM   3730  S  SD    . MET B  1 142 ? -0.876   9.073   2.100    1.00 58.88 ? 123 MET B SD    1 
ATOM   3731  C  CE    . MET B  1 142 ? -0.443   7.320   2.023    1.00 53.69 ? 123 MET B CE    1 
ATOM   3732  N  N     . VAL B  1 143 ? -5.198   12.619  1.019    1.00 47.63 ? 124 VAL B N     1 
ATOM   3733  C  CA    . VAL B  1 143 ? -5.525   14.053  1.091    1.00 46.83 ? 124 VAL B CA    1 
ATOM   3734  C  C     . VAL B  1 143 ? -6.939   14.287  1.638    1.00 46.65 ? 124 VAL B C     1 
ATOM   3735  O  O     . VAL B  1 143 ? -7.539   15.330  1.415    1.00 46.51 ? 124 VAL B O     1 
ATOM   3736  C  CB    . VAL B  1 143 ? -5.391   14.739  -0.289   1.00 46.23 ? 124 VAL B CB    1 
ATOM   3737  C  CG1   . VAL B  1 143 ? -3.970   14.717  -0.738   1.00 43.44 ? 124 VAL B CG1   1 
ATOM   3738  C  CG2   . VAL B  1 143 ? -6.362   14.098  -1.365   1.00 45.70 ? 124 VAL B CG2   1 
ATOM   3739  N  N     . SER B  1 144 ? -7.443   13.331  2.401    1.00 46.17 ? 125 SER B N     1 
ATOM   3740  C  CA    . SER B  1 144 ? -8.829   13.330  2.793    1.00 45.82 ? 125 SER B CA    1 
ATOM   3741  C  C     . SER B  1 144 ? -9.227   14.433  3.812    1.00 45.94 ? 125 SER B C     1 
ATOM   3742  O  O     . SER B  1 144 ? -10.356  14.900  3.781    1.00 46.89 ? 125 SER B O     1 
ATOM   3743  C  CB    . SER B  1 144 ? -9.217   11.917  3.253    1.00 45.41 ? 125 SER B CB    1 
ATOM   3744  O  OG    . SER B  1 144 ? -8.827   11.651  4.560    1.00 43.78 ? 125 SER B OG    1 
ATOM   3745  N  N     . ASN B  1 145 ? -8.323   14.873  4.674    1.00 45.72 ? 126 ASN B N     1 
ATOM   3746  C  CA    . ASN B  1 145 ? -8.573   16.026  5.525    1.00 45.77 ? 126 ASN B CA    1 
ATOM   3747  C  C     . ASN B  1 145 ? -8.757   17.303  4.716    1.00 45.94 ? 126 ASN B C     1 
ATOM   3748  O  O     . ASN B  1 145 ? -9.256   18.298  5.238    1.00 45.75 ? 126 ASN B O     1 
ATOM   3749  C  CB    . ASN B  1 145 ? -7.452   16.230  6.563    1.00 46.10 ? 126 ASN B CB    1 
ATOM   3750  C  CG    . ASN B  1 145 ? -7.430   15.136  7.653    1.00 47.57 ? 126 ASN B CG    1 
ATOM   3751  O  OD1   . ASN B  1 145 ? -8.238   14.242  7.617    1.00 51.48 ? 126 ASN B OD1   1 
ATOM   3752  N  ND2   . ASN B  1 145 ? -6.508   15.210  8.602    1.00 46.38 ? 126 ASN B ND2   1 
ATOM   3753  N  N     . GLN B  1 146 ? -8.364   17.302  3.443    1.00 45.78 ? 127 GLN B N     1 
ATOM   3754  C  CA    . GLN B  1 146 ? -8.630   18.465  2.588    1.00 45.57 ? 127 GLN B CA    1 
ATOM   3755  C  C     . GLN B  1 146 ? -10.015  18.415  1.890    1.00 45.52 ? 127 GLN B C     1 
ATOM   3756  O  O     . GLN B  1 146 ? -10.415  19.380  1.216    1.00 44.99 ? 127 GLN B O     1 
ATOM   3757  C  CB    . GLN B  1 146 ? -7.489   18.631  1.585    1.00 45.19 ? 127 GLN B CB    1 
ATOM   3758  C  CG    . GLN B  1 146 ? -6.202   19.079  2.280    1.00 45.95 ? 127 GLN B CG    1 
ATOM   3759  C  CD    . GLN B  1 146 ? -5.018   19.196  1.359    1.00 45.97 ? 127 GLN B CD    1 
ATOM   3760  O  OE1   . GLN B  1 146 ? -5.005   20.035  0.468    1.00 46.34 ? 127 GLN B OE1   1 
ATOM   3761  N  NE2   . GLN B  1 146 ? -4.014   18.342  1.565    1.00 45.83 ? 127 GLN B NE2   1 
ATOM   3762  N  N     . HIS B  1 147 ? -10.720  17.278  2.036    1.00 44.81 ? 128 HIS B N     1 
ATOM   3763  C  CA    . HIS B  1 147 ? -12.045  17.074  1.464    1.00 44.72 ? 128 HIS B CA    1 
ATOM   3764  C  C     . HIS B  1 147 ? -12.176  17.562  0.039    1.00 44.33 ? 128 HIS B C     1 
ATOM   3765  O  O     . HIS B  1 147 ? -12.920  18.482  -0.212   1.00 44.51 ? 128 HIS B O     1 
ATOM   3766  C  CB    . HIS B  1 147 ? -13.118  17.724  2.340    1.00 44.58 ? 128 HIS B CB    1 
ATOM   3767  C  CG    . HIS B  1 147 ? -13.108  17.193  3.721    1.00 45.14 ? 128 HIS B CG    1 
ATOM   3768  N  ND1   . HIS B  1 147 ? -13.489  15.898  4.011    1.00 44.71 ? 128 HIS B ND1   1 
ATOM   3769  C  CD2   . HIS B  1 147 ? -12.651  17.727  4.878    1.00 45.81 ? 128 HIS B CD2   1 
ATOM   3770  C  CE1   . HIS B  1 147 ? -13.319  15.680  5.304    1.00 45.70 ? 128 HIS B CE1   1 
ATOM   3771  N  NE2   . HIS B  1 147 ? -12.806  16.772  5.851    1.00 46.34 ? 128 HIS B NE2   1 
ATOM   3772  N  N     . PRO B  1 148 ? -11.452  16.932  -0.891   1.00 43.67 ? 129 PRO B N     1 
ATOM   3773  C  CA    . PRO B  1 148 ? -11.585  17.331  -2.292   1.00 43.42 ? 129 PRO B CA    1 
ATOM   3774  C  C     . PRO B  1 148 ? -12.969  16.952  -2.819   1.00 42.72 ? 129 PRO B C     1 
ATOM   3775  O  O     . PRO B  1 148 ? -13.332  15.791  -2.732   1.00 42.63 ? 129 PRO B O     1 
ATOM   3776  C  CB    . PRO B  1 148 ? -10.483  16.509  -2.994   1.00 43.53 ? 129 PRO B CB    1 
ATOM   3777  C  CG    . PRO B  1 148 ? -10.306  15.276  -2.064   1.00 43.12 ? 129 PRO B CG    1 
ATOM   3778  C  CD    . PRO B  1 148 ? -10.508  15.812  -0.699   1.00 42.75 ? 129 PRO B CD    1 
ATOM   3779  N  N     . TRP B  1 149 ? -13.726  17.929  -3.325   1.00 42.35 ? 130 TRP B N     1 
ATOM   3780  C  CA    . TRP B  1 149 ? -14.992  17.674  -4.036   1.00 42.16 ? 130 TRP B CA    1 
ATOM   3781  C  C     . TRP B  1 149 ? -14.881  17.880  -5.581   1.00 42.04 ? 130 TRP B C     1 
ATOM   3782  O  O     . TRP B  1 149 ? -14.201  18.785  -6.080   1.00 40.61 ? 130 TRP B O     1 
ATOM   3783  C  CB    . TRP B  1 149 ? -16.096  18.595  -3.544   1.00 41.94 ? 130 TRP B CB    1 
ATOM   3784  C  CG    . TRP B  1 149 ? -16.477  18.508  -2.098   1.00 41.69 ? 130 TRP B CG    1 
ATOM   3785  C  CD1   . TRP B  1 149 ? -16.025  17.607  -1.161   1.00 41.92 ? 130 TRP B CD1   1 
ATOM   3786  C  CD2   . TRP B  1 149 ? -17.454  19.309  -1.439   1.00 40.97 ? 130 TRP B CD2   1 
ATOM   3787  N  NE1   . TRP B  1 149 ? -16.635  17.833  0.047    1.00 41.26 ? 130 TRP B NE1   1 
ATOM   3788  C  CE2   . TRP B  1 149 ? -17.512  18.879  -0.090   1.00 42.17 ? 130 TRP B CE2   1 
ATOM   3789  C  CE3   . TRP B  1 149 ? -18.262  20.377  -1.838   1.00 41.75 ? 130 TRP B CE3   1 
ATOM   3790  C  CZ2   . TRP B  1 149 ? -18.351  19.489  0.860    1.00 40.19 ? 130 TRP B CZ2   1 
ATOM   3791  C  CZ3   . TRP B  1 149 ? -19.102  20.973  -0.888   1.00 41.32 ? 130 TRP B CZ3   1 
ATOM   3792  C  CH2   . TRP B  1 149 ? -19.138  20.520  0.435    1.00 40.29 ? 130 TRP B CH2   1 
ATOM   3793  N  N     . PHE B  1 150 ? -15.572  17.022  -6.316   1.00 41.92 ? 131 PHE B N     1 
ATOM   3794  C  CA    . PHE B  1 150 ? -15.540  17.060  -7.771   1.00 42.15 ? 131 PHE B CA    1 
ATOM   3795  C  C     . PHE B  1 150 ? -16.973  17.148  -8.317   1.00 42.22 ? 131 PHE B C     1 
ATOM   3796  O  O     . PHE B  1 150 ? -17.923  16.669  -7.693   1.00 42.42 ? 131 PHE B O     1 
ATOM   3797  C  CB    . PHE B  1 150 ? -14.866  15.806  -8.332   1.00 41.72 ? 131 PHE B CB    1 
ATOM   3798  C  CG    . PHE B  1 150 ? -13.416  15.672  -7.947   1.00 42.01 ? 131 PHE B CG    1 
ATOM   3799  C  CD1   . PHE B  1 150 ? -12.433  16.361  -8.624   1.00 41.48 ? 131 PHE B CD1   1 
ATOM   3800  C  CD2   . PHE B  1 150 ? -13.034  14.858  -6.889   1.00 42.45 ? 131 PHE B CD2   1 
ATOM   3801  C  CE1   . PHE B  1 150 ? -11.120  16.242  -8.255   1.00 41.86 ? 131 PHE B CE1   1 
ATOM   3802  C  CE2   . PHE B  1 150 ? -11.689  14.712  -6.537   1.00 41.20 ? 131 PHE B CE2   1 
ATOM   3803  C  CZ    . PHE B  1 150 ? -10.749  15.407  -7.199   1.00 41.51 ? 131 PHE B CZ    1 
ATOM   3804  N  N     . GLY B  1 151 ? -17.122  17.789  -9.466   1.00 41.54 ? 132 GLY B N     1 
ATOM   3805  C  CA    . GLY B  1 151 ? -18.395  17.816  -10.148  1.00 41.70 ? 132 GLY B CA    1 
ATOM   3806  C  C     . GLY B  1 151 ? -18.131  17.669  -11.619  1.00 41.31 ? 132 GLY B C     1 
ATOM   3807  O  O     . GLY B  1 151 ? -17.477  18.527  -12.206  1.00 42.05 ? 132 GLY B O     1 
ATOM   3808  N  N     . MET B  1 152 ? -18.618  16.589  -12.210  1.00 40.53 ? 133 MET B N     1 
ATOM   3809  C  CA    . MET B  1 152 ? -18.362  16.344  -13.599  1.00 40.88 ? 133 MET B CA    1 
ATOM   3810  C  C     . MET B  1 152 ? -19.598  16.502  -14.472  1.00 40.78 ? 133 MET B C     1 
ATOM   3811  O  O     . MET B  1 152 ? -20.715  16.053  -14.116  1.00 41.78 ? 133 MET B O     1 
ATOM   3812  C  CB    . MET B  1 152 ? -17.672  14.999  -13.740  1.00 41.24 ? 133 MET B CB    1 
ATOM   3813  C  CG    . MET B  1 152 ? -16.247  15.075  -13.095  1.00 42.64 ? 133 MET B CG    1 
ATOM   3814  S  SD    . MET B  1 152 ? -15.298  13.571  -12.949  1.00 42.61 ? 133 MET B SD    1 
ATOM   3815  C  CE    . MET B  1 152 ? -14.653  13.501  -14.614  1.00 41.49 ? 133 MET B CE    1 
ATOM   3816  N  N     . GLU B  1 153 ? -19.388  17.196  -15.583  1.00 39.81 ? 134 GLU B N     1 
ATOM   3817  C  CA    . GLU B  1 153 ? -20.414  17.506  -16.551  1.00 39.44 ? 134 GLU B CA    1 
ATOM   3818  C  C     . GLU B  1 153 ? -20.261  16.562  -17.737  1.00 39.30 ? 134 GLU B C     1 
ATOM   3819  O  O     . GLU B  1 153 ? -19.495  16.810  -18.695  1.00 38.78 ? 134 GLU B O     1 
ATOM   3820  C  CB    . GLU B  1 153 ? -20.274  18.946  -17.039  1.00 39.09 ? 134 GLU B CB    1 
ATOM   3821  C  CG    . GLU B  1 153 ? -20.256  20.001  -15.928  1.00 40.00 ? 134 GLU B CG    1 
ATOM   3822  C  CD    . GLU B  1 153 ? -19.952  21.382  -16.484  1.00 40.54 ? 134 GLU B CD    1 
ATOM   3823  O  OE1   . GLU B  1 153 ? -20.548  21.733  -17.538  1.00 41.23 ? 134 GLU B OE1   1 
ATOM   3824  O  OE2   . GLU B  1 153 ? -19.100  22.105  -15.890  1.00 39.47 ? 134 GLU B OE2   1 
ATOM   3825  N  N     . GLN B  1 154 ? -21.000  15.462  -17.673  1.00 38.83 ? 135 GLN B N     1 
ATOM   3826  C  CA    . GLN B  1 154 ? -20.906  14.461  -18.701  1.00 38.80 ? 135 GLN B CA    1 
ATOM   3827  C  C     . GLN B  1 154 ? -21.694  14.893  -19.930  1.00 38.43 ? 135 GLN B C     1 
ATOM   3828  O  O     . GLN B  1 154 ? -22.918  14.785  -19.947  1.00 38.37 ? 135 GLN B O     1 
ATOM   3829  C  CB    . GLN B  1 154 ? -21.418  13.111  -18.194  1.00 38.86 ? 135 GLN B CB    1 
ATOM   3830  C  CG    . GLN B  1 154 ? -21.261  11.979  -19.223  1.00 38.67 ? 135 GLN B CG    1 
ATOM   3831  C  CD    . GLN B  1 154 ? -19.831  11.703  -19.533  1.00 37.64 ? 135 GLN B CD    1 
ATOM   3832  O  OE1   . GLN B  1 154 ? -19.105  11.133  -18.705  1.00 36.13 ? 135 GLN B OE1   1 
ATOM   3833  N  NE2   . GLN B  1 154 ? -19.413  12.062  -20.740  1.00 38.20 ? 135 GLN B NE2   1 
ATOM   3834  N  N     . GLU B  1 155 ? -21.013  15.356  -20.968  1.00 37.79 ? 136 GLU B N     1 
ATOM   3835  C  CA    . GLU B  1 155 ? -21.722  15.574  -22.234  1.00 38.30 ? 136 GLU B CA    1 
ATOM   3836  C  C     . GLU B  1 155 ? -21.722  14.258  -23.024  1.00 38.18 ? 136 GLU B C     1 
ATOM   3837  O  O     . GLU B  1 155 ? -20.849  13.390  -22.848  1.00 38.75 ? 136 GLU B O     1 
ATOM   3838  C  CB    . GLU B  1 155 ? -21.139  16.764  -23.013  1.00 37.80 ? 136 GLU B CB    1 
ATOM   3839  C  CG    . GLU B  1 155 ? -21.289  18.081  -22.254  1.00 38.34 ? 136 GLU B CG    1 
ATOM   3840  C  CD    . GLU B  1 155 ? -20.743  19.316  -22.974  1.00 39.26 ? 136 GLU B CD    1 
ATOM   3841  O  OE1   . GLU B  1 155 ? -19.649  19.205  -23.630  1.00 37.45 ? 136 GLU B OE1   1 
ATOM   3842  O  OE2   . GLU B  1 155 ? -21.451  20.385  -22.877  1.00 37.82 ? 136 GLU B OE2   1 
ATOM   3843  N  N     . TYR B  1 156 ? -22.744  14.087  -23.836  1.00 37.83 ? 137 TYR B N     1 
ATOM   3844  C  CA    . TYR B  1 156 ? -22.897  12.870  -24.649  1.00 37.92 ? 137 TYR B CA    1 
ATOM   3845  C  C     . TYR B  1 156 ? -23.846  13.155  -25.790  1.00 37.13 ? 137 TYR B C     1 
ATOM   3846  O  O     . TYR B  1 156 ? -24.574  14.114  -25.723  1.00 36.55 ? 137 TYR B O     1 
ATOM   3847  C  CB    . TYR B  1 156 ? -23.408  11.690  -23.810  1.00 37.47 ? 137 TYR B CB    1 
ATOM   3848  C  CG    . TYR B  1 156 ? -24.786  11.876  -23.227  1.00 37.13 ? 137 TYR B CG    1 
ATOM   3849  C  CD1   . TYR B  1 156 ? -25.890  11.385  -23.875  1.00 35.74 ? 137 TYR B CD1   1 
ATOM   3850  C  CD2   . TYR B  1 156 ? -24.968  12.518  -22.005  1.00 37.22 ? 137 TYR B CD2   1 
ATOM   3851  C  CE1   . TYR B  1 156 ? -27.143  11.537  -23.341  1.00 37.00 ? 137 TYR B CE1   1 
ATOM   3852  C  CE2   . TYR B  1 156 ? -26.219  12.679  -21.462  1.00 36.23 ? 137 TYR B CE2   1 
ATOM   3853  C  CZ    . TYR B  1 156 ? -27.306  12.181  -22.135  1.00 36.89 ? 137 TYR B CZ    1 
ATOM   3854  O  OH    . TYR B  1 156 ? -28.586  12.342  -21.645  1.00 35.96 ? 137 TYR B OH    1 
ATOM   3855  N  N     . THR B  1 157 ? -23.806  12.329  -26.820  1.00 37.41 ? 138 THR B N     1 
ATOM   3856  C  CA    . THR B  1 157 ? -24.667  12.468  -27.989  1.00 38.53 ? 138 THR B CA    1 
ATOM   3857  C  C     . THR B  1 157 ? -25.392  11.147  -28.209  1.00 38.79 ? 138 THR B C     1 
ATOM   3858  O  O     . THR B  1 157 ? -24.773  10.099  -28.207  1.00 39.86 ? 138 THR B O     1 
ATOM   3859  C  CB    . THR B  1 157 ? -23.815  12.796  -29.234  1.00 38.84 ? 138 THR B CB    1 
ATOM   3860  O  OG1   . THR B  1 157 ? -23.093  13.994  -28.975  1.00 42.44 ? 138 THR B OG1   1 
ATOM   3861  C  CG2   . THR B  1 157 ? -24.621  12.942  -30.502  1.00 37.31 ? 138 THR B CG2   1 
ATOM   3862  N  N     . LEU B  1 158 ? -26.704  11.217  -28.380  1.00 39.34 ? 139 LEU B N     1 
ATOM   3863  C  CA    . LEU B  1 158 ? -27.543  10.085  -28.688  1.00 39.48 ? 139 LEU B CA    1 
ATOM   3864  C  C     . LEU B  1 158 ? -27.446  9.818   -30.190  1.00 40.29 ? 139 LEU B C     1 
ATOM   3865  O  O     . LEU B  1 158 ? -27.527  10.740  -31.010  1.00 39.50 ? 139 LEU B O     1 
ATOM   3866  C  CB    . LEU B  1 158 ? -28.992  10.403  -28.299  1.00 38.77 ? 139 LEU B CB    1 
ATOM   3867  C  CG    . LEU B  1 158 ? -29.255  10.757  -26.831  1.00 37.97 ? 139 LEU B CG    1 
ATOM   3868  C  CD1   . LEU B  1 158 ? -30.711  11.209  -26.647  1.00 35.53 ? 139 LEU B CD1   1 
ATOM   3869  C  CD2   . LEU B  1 158 ? -28.872  9.574   -25.873  1.00 34.10 ? 139 LEU B CD2   1 
ATOM   3870  N  N     . MET B  1 159 ? -27.278  8.540   -30.527  1.00 41.59 ? 140 MET B N     1 
ATOM   3871  C  CA    . MET B  1 159 ? -27.055  8.087   -31.903  1.00 42.51 ? 140 MET B CA    1 
ATOM   3872  C  C     . MET B  1 159 ? -28.062  7.019   -32.276  1.00 43.62 ? 140 MET B C     1 
ATOM   3873  O  O     . MET B  1 159 ? -28.479  6.200   -31.466  1.00 43.76 ? 140 MET B O     1 
ATOM   3874  C  CB    . MET B  1 159 ? -25.663  7.447   -32.068  1.00 43.06 ? 140 MET B CB    1 
ATOM   3875  C  CG    . MET B  1 159 ? -24.483  8.266   -31.641  1.00 44.59 ? 140 MET B CG    1 
ATOM   3876  S  SD    . MET B  1 159 ? -24.160  9.642   -32.726  1.00 51.30 ? 140 MET B SD    1 
ATOM   3877  C  CE    . MET B  1 159 ? -23.328  8.767   -34.043  1.00 49.66 ? 140 MET B CE    1 
ATOM   3878  N  N     . GLY B  1 160 ? -28.444  7.013   -33.523  1.00 45.25 ? 141 GLY B N     1 
ATOM   3879  C  CA    . GLY B  1 160 ? -29.152  5.884   -34.040  1.00 47.07 ? 141 GLY B CA    1 
ATOM   3880  C  C     . GLY B  1 160 ? -28.246  4.682   -34.069  1.00 48.02 ? 141 GLY B C     1 
ATOM   3881  O  O     . GLY B  1 160 ? -27.006  4.758   -34.096  1.00 47.90 ? 141 GLY B O     1 
ATOM   3882  N  N     . THR B  1 161 ? -28.889  3.538   -34.066  1.00 50.06 ? 142 THR B N     1 
ATOM   3883  C  CA    . THR B  1 161 ? -28.205  2.249   -34.214  1.00 50.99 ? 142 THR B CA    1 
ATOM   3884  C  C     . THR B  1 161 ? -27.455  2.262   -35.576  1.00 51.92 ? 142 THR B C     1 
ATOM   3885  O  O     . THR B  1 161 ? -26.428  1.593   -35.741  1.00 52.68 ? 142 THR B O     1 
ATOM   3886  C  CB    . THR B  1 161 ? -29.263  1.076   -34.069  1.00 51.85 ? 142 THR B CB    1 
ATOM   3887  O  OG1   . THR B  1 161 ? -28.640  -0.169  -34.365  1.00 53.87 ? 142 THR B OG1   1 
ATOM   3888  C  CG2   . THR B  1 161 ? -30.569  1.289   -34.996  1.00 50.93 ? 142 THR B CG2   1 
ATOM   3889  N  N     . ASP B  1 162 ? -27.951  3.072   -36.524  1.00 51.55 ? 143 ASP B N     1 
ATOM   3890  C  CA    . ASP B  1 162 ? -27.236  3.346   -37.780  1.00 51.13 ? 143 ASP B CA    1 
ATOM   3891  C  C     . ASP B  1 162 ? -25.997  4.257   -37.718  1.00 50.70 ? 143 ASP B C     1 
ATOM   3892  O  O     . ASP B  1 162 ? -25.453  4.599   -38.759  1.00 50.58 ? 143 ASP B O     1 
ATOM   3893  C  CB    . ASP B  1 162 ? -28.206  3.906   -38.835  1.00 51.40 ? 143 ASP B CB    1 
ATOM   3894  C  CG    . ASP B  1 162 ? -28.650  5.327   -38.543  1.00 53.35 ? 143 ASP B CG    1 
ATOM   3895  O  OD1   . ASP B  1 162 ? -28.253  5.912   -37.478  1.00 54.34 ? 143 ASP B OD1   1 
ATOM   3896  O  OD2   . ASP B  1 162 ? -29.424  5.851   -39.392  1.00 53.93 ? 143 ASP B OD2   1 
ATOM   3897  N  N     . GLY B  1 163 ? -25.561  4.684   -36.537  1.00 50.02 ? 144 GLY B N     1 
ATOM   3898  C  CA    . GLY B  1 163 ? -24.377  5.560   -36.444  1.00 49.09 ? 144 GLY B CA    1 
ATOM   3899  C  C     . GLY B  1 163 ? -24.614  7.045   -36.732  1.00 48.50 ? 144 GLY B C     1 
ATOM   3900  O  O     . GLY B  1 163 ? -23.684  7.854   -36.670  1.00 47.96 ? 144 GLY B O     1 
ATOM   3901  N  N     . HIS B  1 164 ? -25.863  7.413   -37.030  1.00 47.87 ? 145 HIS B N     1 
ATOM   3902  C  CA    . HIS B  1 164 ? -26.215  8.801   -37.307  1.00 46.82 ? 145 HIS B CA    1 
ATOM   3903  C  C     . HIS B  1 164 ? -26.873  9.382   -36.053  1.00 45.43 ? 145 HIS B C     1 
ATOM   3904  O  O     . HIS B  1 164 ? -27.565  8.692   -35.317  1.00 43.97 ? 145 HIS B O     1 
ATOM   3905  C  CB    . HIS B  1 164 ? -27.126  8.861   -38.533  1.00 47.32 ? 145 HIS B CB    1 
ATOM   3906  C  CG    . HIS B  1 164 ? -27.070  10.164  -39.274  1.00 49.74 ? 145 HIS B CG    1 
ATOM   3907  N  ND1   . HIS B  1 164 ? -25.880  10.786  -39.603  1.00 49.94 ? 145 HIS B ND1   1 
ATOM   3908  C  CD2   . HIS B  1 164 ? -28.064  10.964  -39.758  1.00 51.36 ? 145 HIS B CD2   1 
ATOM   3909  C  CE1   . HIS B  1 164 ? -26.144  11.915  -40.248  1.00 51.63 ? 145 HIS B CE1   1 
ATOM   3910  N  NE2   . HIS B  1 164 ? -27.458  12.050  -40.356  1.00 51.24 ? 145 HIS B NE2   1 
ATOM   3911  N  N     . PRO B  1 165 ? -26.593  10.644  -35.753  1.00 44.64 ? 146 PRO B N     1 
ATOM   3912  C  CA    . PRO B  1 165 ? -27.234  11.205  -34.552  1.00 43.96 ? 146 PRO B CA    1 
ATOM   3913  C  C     . PRO B  1 165 ? -28.777  11.117  -34.567  1.00 43.61 ? 146 PRO B C     1 
ATOM   3914  O  O     . PRO B  1 165 ? -29.434  11.247  -35.618  1.00 42.31 ? 146 PRO B O     1 
ATOM   3915  C  CB    . PRO B  1 165 ? -26.759  12.665  -34.540  1.00 43.57 ? 146 PRO B CB    1 
ATOM   3916  C  CG    . PRO B  1 165 ? -25.495  12.687  -35.354  1.00 43.81 ? 146 PRO B CG    1 
ATOM   3917  C  CD    . PRO B  1 165 ? -25.666  11.593  -36.395  1.00 44.60 ? 146 PRO B CD    1 
ATOM   3918  N  N     . PHE B  1 166 ? -29.326  10.889  -33.374  1.00 43.13 ? 147 PHE B N     1 
ATOM   3919  C  CA    . PHE B  1 166 ? -30.742  10.603  -33.187  1.00 42.36 ? 147 PHE B CA    1 
ATOM   3920  C  C     . PHE B  1 166 ? -31.533  11.835  -33.545  1.00 41.49 ? 147 PHE B C     1 
ATOM   3921  O  O     . PHE B  1 166 ? -31.166  12.939  -33.167  1.00 41.11 ? 147 PHE B O     1 
ATOM   3922  C  CB    . PHE B  1 166 ? -30.994  10.194  -31.727  1.00 42.56 ? 147 PHE B CB    1 
ATOM   3923  C  CG    . PHE B  1 166 ? -32.431  9.940   -31.407  1.00 42.66 ? 147 PHE B CG    1 
ATOM   3924  C  CD1   . PHE B  1 166 ? -33.057  8.774   -31.847  1.00 43.58 ? 147 PHE B CD1   1 
ATOM   3925  C  CD2   . PHE B  1 166 ? -33.160  10.846  -30.649  1.00 42.77 ? 147 PHE B CD2   1 
ATOM   3926  C  CE1   . PHE B  1 166 ? -34.401  8.525   -31.556  1.00 42.78 ? 147 PHE B CE1   1 
ATOM   3927  C  CE2   . PHE B  1 166 ? -34.508  10.609  -30.352  1.00 42.23 ? 147 PHE B CE2   1 
ATOM   3928  C  CZ    . PHE B  1 166 ? -35.126  9.463   -30.800  1.00 42.74 ? 147 PHE B CZ    1 
ATOM   3929  N  N     . GLY B  1 167 ? -32.608  11.632  -34.295  1.00 41.23 ? 148 GLY B N     1 
ATOM   3930  C  CA    . GLY B  1 167 ? -33.428  12.713  -34.829  1.00 41.27 ? 148 GLY B CA    1 
ATOM   3931  C  C     . GLY B  1 167 ? -32.871  13.497  -36.007  1.00 40.96 ? 148 GLY B C     1 
ATOM   3932  O  O     . GLY B  1 167 ? -33.559  14.312  -36.576  1.00 41.38 ? 148 GLY B O     1 
ATOM   3933  N  N     . TRP B  1 168 ? -31.622  13.278  -36.386  1.00 41.77 ? 149 TRP B N     1 
ATOM   3934  C  CA    . TRP B  1 168 ? -31.033  14.028  -37.503  1.00 41.89 ? 149 TRP B CA    1 
ATOM   3935  C  C     . TRP B  1 168 ? -31.634  13.569  -38.833  1.00 42.26 ? 149 TRP B C     1 
ATOM   3936  O  O     . TRP B  1 168 ? -32.072  12.430  -38.976  1.00 41.82 ? 149 TRP B O     1 
ATOM   3937  C  CB    . TRP B  1 168 ? -29.507  13.880  -37.541  1.00 41.19 ? 149 TRP B CB    1 
ATOM   3938  C  CG    . TRP B  1 168 ? -28.750  14.738  -36.569  1.00 40.04 ? 149 TRP B CG    1 
ATOM   3939  C  CD1   . TRP B  1 168 ? -29.137  15.099  -35.314  1.00 39.52 ? 149 TRP B CD1   1 
ATOM   3940  C  CD2   . TRP B  1 168 ? -27.441  15.299  -36.766  1.00 38.66 ? 149 TRP B CD2   1 
ATOM   3941  N  NE1   . TRP B  1 168 ? -28.156  15.870  -34.729  1.00 39.08 ? 149 TRP B NE1   1 
ATOM   3942  C  CE2   . TRP B  1 168 ? -27.106  15.997  -35.601  1.00 37.29 ? 149 TRP B CE2   1 
ATOM   3943  C  CE3   . TRP B  1 168 ? -26.524  15.281  -37.829  1.00 40.00 ? 149 TRP B CE3   1 
ATOM   3944  C  CZ2   . TRP B  1 168 ? -25.908  16.685  -35.466  1.00 39.52 ? 149 TRP B CZ2   1 
ATOM   3945  C  CZ3   . TRP B  1 168 ? -25.309  15.958  -37.682  1.00 39.64 ? 149 TRP B CZ3   1 
ATOM   3946  C  CH2   . TRP B  1 168 ? -25.021  16.655  -36.516  1.00 39.60 ? 149 TRP B CH2   1 
ATOM   3947  N  N     . PRO B  1 169 ? -31.668  14.472  -39.821  1.00 43.47 ? 150 PRO B N     1 
ATOM   3948  C  CA    . PRO B  1 169 ? -32.164  14.006  -41.106  1.00 43.99 ? 150 PRO B CA    1 
ATOM   3949  C  C     . PRO B  1 169 ? -31.340  12.820  -41.587  1.00 44.95 ? 150 PRO B C     1 
ATOM   3950  O  O     . PRO B  1 169 ? -30.118  12.746  -41.445  1.00 45.31 ? 150 PRO B O     1 
ATOM   3951  C  CB    . PRO B  1 169 ? -31.996  15.226  -42.007  1.00 43.70 ? 150 PRO B CB    1 
ATOM   3952  C  CG    . PRO B  1 169 ? -32.016  16.370  -41.073  1.00 43.12 ? 150 PRO B CG    1 
ATOM   3953  C  CD    . PRO B  1 169 ? -31.285  15.891  -39.883  1.00 43.35 ? 150 PRO B CD    1 
ATOM   3954  N  N     . SER B  1 170 ? -32.028  11.848  -42.098  1.00 46.21 ? 151 SER B N     1 
ATOM   3955  C  CA    . SER B  1 170 ? -31.340  10.692  -42.571  1.00 47.64 ? 151 SER B CA    1 
ATOM   3956  C  C     . SER B  1 170 ? -30.343  11.118  -43.699  1.00 47.72 ? 151 SER B C     1 
ATOM   3957  O  O     . SER B  1 170 ? -30.698  11.837  -44.655  1.00 47.08 ? 151 SER B O     1 
ATOM   3958  C  CB    . SER B  1 170 ? -32.400  9.680   -42.988  1.00 47.81 ? 151 SER B CB    1 
ATOM   3959  O  OG    . SER B  1 170 ? -32.027  9.051   -44.165  1.00 51.07 ? 151 SER B OG    1 
ATOM   3960  N  N     . ASN B  1 171 ? -29.078  10.734  -43.529  1.00 48.22 ? 152 ASN B N     1 
ATOM   3961  C  CA    . ASN B  1 171 ? -28.009  11.146  -44.447  1.00 48.36 ? 152 ASN B CA    1 
ATOM   3962  C  C     . ASN B  1 171 ? -27.829  12.653  -44.570  1.00 47.72 ? 152 ASN B C     1 
ATOM   3963  O  O     . ASN B  1 171 ? -27.513  13.185  -45.636  1.00 48.45 ? 152 ASN B O     1 
ATOM   3964  C  CB    . ASN B  1 171 ? -28.270  10.571  -45.839  1.00 49.47 ? 152 ASN B CB    1 
ATOM   3965  C  CG    . ASN B  1 171 ? -27.298  9.515   -46.189  1.00 52.50 ? 152 ASN B CG    1 
ATOM   3966  O  OD1   . ASN B  1 171 ? -27.144  8.553   -45.446  1.00 57.57 ? 152 ASN B OD1   1 
ATOM   3967  N  ND2   . ASN B  1 171 ? -26.591  9.690   -47.303  1.00 57.28 ? 152 ASN B ND2   1 
ATOM   3968  N  N     . GLY B  1 172 ? -28.031  13.371  -43.492  1.00 46.37 ? 153 GLY B N     1 
ATOM   3969  C  CA    . GLY B  1 172 ? -28.018  14.803  -43.619  1.00 44.95 ? 153 GLY B CA    1 
ATOM   3970  C  C     . GLY B  1 172 ? -27.832  15.484  -42.311  1.00 43.66 ? 153 GLY B C     1 
ATOM   3971  O  O     . GLY B  1 172 ? -27.512  14.853  -41.292  1.00 43.36 ? 153 GLY B O     1 
ATOM   3972  N  N     . PHE B  1 173 ? -28.053  16.790  -42.362  1.00 42.24 ? 154 PHE B N     1 
ATOM   3973  C  CA    . PHE B  1 173 ? -27.805  17.659  -41.234  1.00 40.69 ? 154 PHE B CA    1 
ATOM   3974  C  C     . PHE B  1 173 ? -29.028  18.491  -40.919  1.00 40.09 ? 154 PHE B C     1 
ATOM   3975  O  O     . PHE B  1 173 ? -29.712  18.985  -41.810  1.00 39.47 ? 154 PHE B O     1 
ATOM   3976  C  CB    . PHE B  1 173 ? -26.653  18.607  -41.543  1.00 40.60 ? 154 PHE B CB    1 
ATOM   3977  C  CG    . PHE B  1 173 ? -25.345  17.921  -41.828  1.00 39.90 ? 154 PHE B CG    1 
ATOM   3978  C  CD1   . PHE B  1 173 ? -24.508  17.555  -40.790  1.00 38.74 ? 154 PHE B CD1   1 
ATOM   3979  C  CD2   . PHE B  1 173 ? -24.940  17.682  -43.155  1.00 40.66 ? 154 PHE B CD2   1 
ATOM   3980  C  CE1   . PHE B  1 173 ? -23.296  16.924  -41.049  1.00 40.20 ? 154 PHE B CE1   1 
ATOM   3981  C  CE2   . PHE B  1 173 ? -23.733  17.065  -43.433  1.00 40.68 ? 154 PHE B CE2   1 
ATOM   3982  C  CZ    . PHE B  1 173 ? -22.901  16.678  -42.379  1.00 40.14 ? 154 PHE B CZ    1 
ATOM   3983  N  N     . PRO B  1 174 ? -29.290  18.687  -39.630  1.00 39.70 ? 155 PRO B N     1 
ATOM   3984  C  CA    . PRO B  1 174 ? -30.328  19.616  -39.239  1.00 39.24 ? 155 PRO B CA    1 
ATOM   3985  C  C     . PRO B  1 174 ? -29.794  21.042  -39.412  1.00 38.57 ? 155 PRO B C     1 
ATOM   3986  O  O     . PRO B  1 174 ? -28.637  21.218  -39.823  1.00 38.09 ? 155 PRO B O     1 
ATOM   3987  C  CB    . PRO B  1 174 ? -30.550  19.276  -37.785  1.00 39.08 ? 155 PRO B CB    1 
ATOM   3988  C  CG    . PRO B  1 174 ? -29.191  18.827  -37.325  1.00 40.33 ? 155 PRO B CG    1 
ATOM   3989  C  CD    . PRO B  1 174 ? -28.608  18.096  -38.471  1.00 39.87 ? 155 PRO B CD    1 
ATOM   3990  N  N     . GLY B  1 175 ? -30.648  22.035  -39.176  1.00 37.77 ? 156 GLY B N     1 
ATOM   3991  C  CA    . GLY B  1 175 ? -30.249  23.429  -39.314  1.00 37.60 ? 156 GLY B CA    1 
ATOM   3992  C  C     . GLY B  1 175 ? -29.150  23.697  -38.302  1.00 36.82 ? 156 GLY B C     1 
ATOM   3993  O  O     . GLY B  1 175 ? -29.000  22.926  -37.372  1.00 36.47 ? 156 GLY B O     1 
ATOM   3994  N  N     . PRO B  1 176 ? -28.385  24.778  -38.487  1.00 36.40 ? 157 PRO B N     1 
ATOM   3995  C  CA    . PRO B  1 176 ? -27.200  25.052  -37.660  1.00 37.06 ? 157 PRO B CA    1 
ATOM   3996  C  C     . PRO B  1 176 ? -27.436  25.280  -36.178  1.00 36.83 ? 157 PRO B C     1 
ATOM   3997  O  O     . PRO B  1 176 ? -28.524  25.609  -35.731  1.00 37.35 ? 157 PRO B O     1 
ATOM   3998  C  CB    . PRO B  1 176 ? -26.593  26.342  -38.273  1.00 36.58 ? 157 PRO B CB    1 
ATOM   3999  C  CG    . PRO B  1 176 ? -27.297  26.528  -39.559  1.00 36.96 ? 157 PRO B CG    1 
ATOM   4000  C  CD    . PRO B  1 176 ? -28.594  25.805  -39.513  1.00 35.83 ? 157 PRO B CD    1 
ATOM   4001  N  N     . GLN B  1 177 ? -26.370  25.100  -35.430  1.00 37.53 ? 158 GLN B N     1 
ATOM   4002  C  CA    . GLN B  1 177 ? -26.394  25.336  -33.989  1.00 37.62 ? 158 GLN B CA    1 
ATOM   4003  C  C     . GLN B  1 177 ? -26.927  26.727  -33.683  1.00 38.08 ? 158 GLN B C     1 
ATOM   4004  O  O     . GLN B  1 177 ? -26.921  27.618  -34.551  1.00 38.47 ? 158 GLN B O     1 
ATOM   4005  C  CB    . GLN B  1 177 ? -25.017  25.112  -33.389  1.00 36.83 ? 158 GLN B CB    1 
ATOM   4006  C  CG    . GLN B  1 177 ? -24.567  23.691  -33.651  1.00 37.45 ? 158 GLN B CG    1 
ATOM   4007  C  CD    . GLN B  1 177 ? -23.300  23.284  -32.926  1.00 36.91 ? 158 GLN B CD    1 
ATOM   4008  O  OE1   . GLN B  1 177 ? -23.217  22.157  -32.419  1.00 35.20 ? 158 GLN B OE1   1 
ATOM   4009  N  NE2   . GLN B  1 177 ? -22.299  24.165  -32.907  1.00 32.92 ? 158 GLN B NE2   1 
ATOM   4010  N  N     . GLY B  1 178 ? -27.443  26.873  -32.463  1.00 38.08 ? 159 GLY B N     1 
ATOM   4011  C  CA    . GLY B  1 178 ? -28.153  28.079  -32.061  1.00 37.36 ? 159 GLY B CA    1 
ATOM   4012  C  C     . GLY B  1 178 ? -29.349  27.709  -31.201  1.00 37.41 ? 159 GLY B C     1 
ATOM   4013  O  O     . GLY B  1 178 ? -29.310  27.940  -30.012  1.00 38.45 ? 159 GLY B O     1 
ATOM   4014  N  N     . PRO B  1 179 ? -30.390  27.101  -31.785  1.00 36.15 ? 160 PRO B N     1 
ATOM   4015  C  CA    . PRO B  1 179 ? -31.630  26.788  -31.071  1.00 36.60 ? 160 PRO B CA    1 
ATOM   4016  C  C     . PRO B  1 179 ? -31.674  25.557  -30.125  1.00 36.53 ? 160 PRO B C     1 
ATOM   4017  O  O     . PRO B  1 179 ? -32.638  25.387  -29.380  1.00 37.13 ? 160 PRO B O     1 
ATOM   4018  C  CB    . PRO B  1 179 ? -32.645  26.561  -32.216  1.00 36.06 ? 160 PRO B CB    1 
ATOM   4019  C  CG    . PRO B  1 179 ? -31.836  26.107  -33.372  1.00 35.63 ? 160 PRO B CG    1 
ATOM   4020  C  CD    . PRO B  1 179 ? -30.429  26.664  -33.188  1.00 36.48 ? 160 PRO B CD    1 
ATOM   4021  N  N     . TYR B  1 180 ? -30.669  24.704  -30.159  1.00 36.54 ? 161 TYR B N     1 
ATOM   4022  C  CA    . TYR B  1 180 ? -30.766  23.401  -29.518  1.00 36.02 ? 161 TYR B CA    1 
ATOM   4023  C  C     . TYR B  1 180 ? -30.370  23.472  -28.064  1.00 35.80 ? 161 TYR B C     1 
ATOM   4024  O  O     . TYR B  1 180 ? -30.917  22.755  -27.256  1.00 35.97 ? 161 TYR B O     1 
ATOM   4025  C  CB    . TYR B  1 180 ? -29.917  22.368  -30.261  1.00 35.60 ? 161 TYR B CB    1 
ATOM   4026  C  CG    . TYR B  1 180 ? -30.196  22.347  -31.743  1.00 34.79 ? 161 TYR B CG    1 
ATOM   4027  C  CD1   . TYR B  1 180 ? -31.409  21.912  -32.228  1.00 36.14 ? 161 TYR B CD1   1 
ATOM   4028  C  CD2   . TYR B  1 180 ? -29.265  22.799  -32.649  1.00 35.36 ? 161 TYR B CD2   1 
ATOM   4029  C  CE1   . TYR B  1 180 ? -31.692  21.904  -33.594  1.00 35.48 ? 161 TYR B CE1   1 
ATOM   4030  C  CE2   . TYR B  1 180 ? -29.528  22.793  -34.017  1.00 35.28 ? 161 TYR B CE2   1 
ATOM   4031  C  CZ    . TYR B  1 180 ? -30.739  22.338  -34.470  1.00 35.70 ? 161 TYR B CZ    1 
ATOM   4032  O  OH    . TYR B  1 180 ? -30.994  22.315  -35.803  1.00 35.37 ? 161 TYR B OH    1 
ATOM   4033  N  N     . TYR B  1 181 ? -29.426  24.337  -27.716  1.00 36.46 ? 162 TYR B N     1 
ATOM   4034  C  CA    . TYR B  1 181 ? -28.937  24.416  -26.320  1.00 36.36 ? 162 TYR B CA    1 
ATOM   4035  C  C     . TYR B  1 181 ? -30.114  24.759  -25.405  1.00 36.46 ? 162 TYR B C     1 
ATOM   4036  O  O     . TYR B  1 181 ? -30.895  25.709  -25.687  1.00 35.22 ? 162 TYR B O     1 
ATOM   4037  C  CB    . TYR B  1 181 ? -27.819  25.456  -26.202  1.00 36.26 ? 162 TYR B CB    1 
ATOM   4038  C  CG    . TYR B  1 181 ? -27.392  25.822  -24.785  1.00 36.50 ? 162 TYR B CG    1 
ATOM   4039  C  CD1   . TYR B  1 181 ? -26.476  25.063  -24.100  1.00 36.85 ? 162 TYR B CD1   1 
ATOM   4040  C  CD2   . TYR B  1 181 ? -27.906  26.957  -24.146  1.00 37.48 ? 162 TYR B CD2   1 
ATOM   4041  C  CE1   . TYR B  1 181 ? -26.066  25.421  -22.821  1.00 38.07 ? 162 TYR B CE1   1 
ATOM   4042  C  CE2   . TYR B  1 181 ? -27.522  27.305  -22.863  1.00 36.91 ? 162 TYR B CE2   1 
ATOM   4043  C  CZ    . TYR B  1 181 ? -26.607  26.540  -22.209  1.00 36.89 ? 162 TYR B CZ    1 
ATOM   4044  O  OH    . TYR B  1 181 ? -26.197  26.883  -20.955  1.00 36.82 ? 162 TYR B OH    1 
ATOM   4045  N  N     . CYS B  1 182 ? -30.271  23.942  -24.355  1.00 36.51 ? 163 CYS B N     1 
ATOM   4046  C  CA    . CYS B  1 182 ? -31.411  24.072  -23.420  1.00 36.73 ? 163 CYS B CA    1 
ATOM   4047  C  C     . CYS B  1 182 ? -32.762  24.338  -24.100  1.00 36.36 ? 163 CYS B C     1 
ATOM   4048  O  O     . CYS B  1 182 ? -33.593  25.083  -23.556  1.00 35.18 ? 163 CYS B O     1 
ATOM   4049  C  CB    . CYS B  1 182 ? -31.145  25.214  -22.439  1.00 37.69 ? 163 CYS B CB    1 
ATOM   4050  S  SG    . CYS B  1 182 ? -29.758  24.957  -21.414  1.00 38.01 ? 163 CYS B SG    1 
ATOM   4051  N  N     . GLY B  1 183 ? -32.981  23.695  -25.255  1.00 36.01 ? 164 GLY B N     1 
ATOM   4052  C  CA    . GLY B  1 183 ? -34.121  23.997  -26.103  1.00 36.67 ? 164 GLY B CA    1 
ATOM   4053  C  C     . GLY B  1 183 ? -35.335  23.170  -25.755  1.00 36.95 ? 164 GLY B C     1 
ATOM   4054  O  O     . GLY B  1 183 ? -35.201  22.205  -25.038  1.00 37.66 ? 164 GLY B O     1 
ATOM   4055  N  N     . VAL B  1 184 ? -36.498  23.570  -26.273  1.00 36.89 ? 165 VAL B N     1 
ATOM   4056  C  CA    . VAL B  1 184 ? -37.761  22.874  -26.067  1.00 36.98 ? 165 VAL B CA    1 
ATOM   4057  C  C     . VAL B  1 184 ? -38.569  22.816  -27.400  1.00 37.14 ? 165 VAL B C     1 
ATOM   4058  O  O     . VAL B  1 184 ? -38.666  23.794  -28.149  1.00 37.18 ? 165 VAL B O     1 
ATOM   4059  C  CB    . VAL B  1 184 ? -38.621  23.525  -24.937  1.00 36.65 ? 165 VAL B CB    1 
ATOM   4060  C  CG1   . VAL B  1 184 ? -39.104  24.899  -25.355  1.00 34.83 ? 165 VAL B CG1   1 
ATOM   4061  C  CG2   . VAL B  1 184 ? -39.819  22.615  -24.587  1.00 36.43 ? 165 VAL B CG2   1 
ATOM   4062  N  N     . GLY B  1 185 ? -39.121  21.656  -27.701  1.00 37.07 ? 166 GLY B N     1 
ATOM   4063  C  CA    . GLY B  1 185 ? -39.842  21.489  -28.956  1.00 37.49 ? 166 GLY B CA    1 
ATOM   4064  C  C     . GLY B  1 185 ? -39.363  20.281  -29.711  1.00 37.33 ? 166 GLY B C     1 
ATOM   4065  O  O     . GLY B  1 185 ? -38.196  20.026  -29.734  1.00 38.08 ? 166 GLY B O     1 
ATOM   4066  N  N     . ALA B  1 186 ? -40.268  19.525  -30.302  1.00 37.82 ? 167 ALA B N     1 
ATOM   4067  C  CA    . ALA B  1 186 ? -39.910  18.332  -31.105  1.00 38.07 ? 167 ALA B CA    1 
ATOM   4068  C  C     . ALA B  1 186 ? -38.951  18.683  -32.220  1.00 38.32 ? 167 ALA B C     1 
ATOM   4069  O  O     . ALA B  1 186 ? -38.196  17.830  -32.648  1.00 39.71 ? 167 ALA B O     1 
ATOM   4070  C  CB    . ALA B  1 186 ? -41.166  17.641  -31.705  1.00 36.47 ? 167 ALA B CB    1 
ATOM   4071  N  N     . ASP B  1 187 ? -38.969  19.923  -32.695  1.00 38.48 ? 168 ASP B N     1 
ATOM   4072  C  CA    . ASP B  1 187 ? -37.997  20.353  -33.698  1.00 39.05 ? 168 ASP B CA    1 
ATOM   4073  C  C     . ASP B  1 187 ? -36.614  20.746  -33.117  1.00 39.36 ? 168 ASP B C     1 
ATOM   4074  O  O     . ASP B  1 187 ? -35.779  21.238  -33.841  1.00 39.47 ? 168 ASP B O     1 
ATOM   4075  C  CB    . ASP B  1 187 ? -38.563  21.501  -34.531  1.00 38.56 ? 168 ASP B CB    1 
ATOM   4076  C  CG    . ASP B  1 187 ? -38.843  22.740  -33.705  1.00 38.46 ? 168 ASP B CG    1 
ATOM   4077  O  OD1   . ASP B  1 187 ? -38.963  22.656  -32.462  1.00 36.51 ? 168 ASP B OD1   1 
ATOM   4078  O  OD2   . ASP B  1 187 ? -38.946  23.810  -34.318  1.00 38.04 ? 168 ASP B OD2   1 
ATOM   4079  N  N     . ARG B  1 188 ? -36.358  20.533  -31.833  1.00 40.21 ? 169 ARG B N     1 
ATOM   4080  C  CA    . ARG B  1 188 ? -35.045  20.893  -31.287  1.00 41.03 ? 169 ARG B CA    1 
ATOM   4081  C  C     . ARG B  1 188 ? -34.474  20.096  -30.099  1.00 40.90 ? 169 ARG B C     1 
ATOM   4082  O  O     . ARG B  1 188 ? -33.227  19.956  -29.972  1.00 40.77 ? 169 ARG B O     1 
ATOM   4083  C  CB    . ARG B  1 188 ? -34.983  22.379  -30.996  1.00 41.34 ? 169 ARG B CB    1 
ATOM   4084  C  CG    . ARG B  1 188 ? -36.024  22.890  -30.107  1.00 42.21 ? 169 ARG B CG    1 
ATOM   4085  C  CD    . ARG B  1 188 ? -36.059  24.381  -30.273  1.00 43.01 ? 169 ARG B CD    1 
ATOM   4086  N  NE    . ARG B  1 188 ? -36.791  24.750  -31.462  1.00 44.03 ? 169 ARG B NE    1 
ATOM   4087  C  CZ    . ARG B  1 188 ? -36.993  25.998  -31.883  1.00 46.32 ? 169 ARG B CZ    1 
ATOM   4088  N  NH1   . ARG B  1 188 ? -36.480  27.041  -31.223  1.00 46.70 ? 169 ARG B NH1   1 
ATOM   4089  N  NH2   . ARG B  1 188 ? -37.750  26.203  -32.969  1.00 46.38 ? 169 ARG B NH2   1 
ATOM   4090  N  N     . ALA B  1 189 ? -35.338  19.566  -29.251  1.00 40.34 ? 170 ALA B N     1 
ATOM   4091  C  CA    . ALA B  1 189 ? -34.854  18.674  -28.209  1.00 40.47 ? 170 ALA B CA    1 
ATOM   4092  C  C     . ALA B  1 189 ? -35.082  17.297  -28.739  1.00 40.11 ? 170 ALA B C     1 
ATOM   4093  O  O     . ALA B  1 189 ? -36.195  16.849  -28.729  1.00 40.99 ? 170 ALA B O     1 
ATOM   4094  C  CB    . ALA B  1 189 ? -35.612  18.887  -26.906  1.00 40.58 ? 170 ALA B CB    1 
ATOM   4095  N  N     . TYR B  1 190 ? -34.038  16.662  -29.241  1.00 40.04 ? 171 TYR B N     1 
ATOM   4096  C  CA    . TYR B  1 190 ? -34.098  15.319  -29.742  1.00 39.53 ? 171 TYR B CA    1 
ATOM   4097  C  C     . TYR B  1 190 ? -33.669  14.364  -28.635  1.00 39.19 ? 171 TYR B C     1 
ATOM   4098  O  O     . TYR B  1 190 ? -32.505  14.361  -28.264  1.00 38.64 ? 171 TYR B O     1 
ATOM   4099  C  CB    . TYR B  1 190 ? -33.142  15.146  -30.932  1.00 41.18 ? 171 TYR B CB    1 
ATOM   4100  C  CG    . TYR B  1 190 ? -33.366  16.073  -32.109  1.00 41.74 ? 171 TYR B CG    1 
ATOM   4101  C  CD1   . TYR B  1 190 ? -34.605  16.574  -32.385  1.00 44.06 ? 171 TYR B CD1   1 
ATOM   4102  C  CD2   . TYR B  1 190 ? -32.338  16.384  -32.977  1.00 42.73 ? 171 TYR B CD2   1 
ATOM   4103  C  CE1   . TYR B  1 190 ? -34.818  17.405  -33.474  1.00 45.14 ? 171 TYR B CE1   1 
ATOM   4104  C  CE2   . TYR B  1 190 ? -32.524  17.226  -34.071  1.00 42.71 ? 171 TYR B CE2   1 
ATOM   4105  C  CZ    . TYR B  1 190 ? -33.765  17.739  -34.311  1.00 44.37 ? 171 TYR B CZ    1 
ATOM   4106  O  OH    . TYR B  1 190 ? -34.032  18.589  -35.365  1.00 43.10 ? 171 TYR B OH    1 
ATOM   4107  N  N     . GLY B  1 191 ? -34.594  13.557  -28.114  1.00 38.31 ? 172 GLY B N     1 
ATOM   4108  C  CA    . GLY B  1 191 ? -34.251  12.469  -27.199  1.00 37.81 ? 172 GLY B CA    1 
ATOM   4109  C  C     . GLY B  1 191 ? -34.527  12.686  -25.712  1.00 37.61 ? 172 GLY B C     1 
ATOM   4110  O  O     . GLY B  1 191 ? -34.062  11.893  -24.898  1.00 37.61 ? 172 GLY B O     1 
ATOM   4111  N  N     . ARG B  1 192 ? -35.318  13.707  -25.352  1.00 36.86 ? 173 ARG B N     1 
ATOM   4112  C  CA    . ARG B  1 192 ? -35.590  14.018  -23.943  1.00 36.70 ? 173 ARG B CA    1 
ATOM   4113  C  C     . ARG B  1 192 ? -36.056  12.835  -23.091  1.00 36.45 ? 173 ARG B C     1 
ATOM   4114  O  O     . ARG B  1 192 ? -35.816  12.783  -21.865  1.00 35.88 ? 173 ARG B O     1 
ATOM   4115  C  CB    . ARG B  1 192 ? -36.586  15.179  -23.779  1.00 36.21 ? 173 ARG B CB    1 
ATOM   4116  C  CG    . ARG B  1 192 ? -36.501  15.777  -22.365  1.00 36.64 ? 173 ARG B CG    1 
ATOM   4117  C  CD    . ARG B  1 192 ? -37.681  16.627  -22.028  1.00 36.18 ? 173 ARG B CD    1 
ATOM   4118  N  NE    . ARG B  1 192 ? -37.752  17.730  -22.957  1.00 36.54 ? 173 ARG B NE    1 
ATOM   4119  C  CZ    . ARG B  1 192 ? -36.986  18.817  -22.886  1.00 35.62 ? 173 ARG B CZ    1 
ATOM   4120  N  NH1   . ARG B  1 192 ? -36.152  18.962  -21.896  1.00 34.81 ? 173 ARG B NH1   1 
ATOM   4121  N  NH2   . ARG B  1 192 ? -37.089  19.783  -23.798  1.00 35.85 ? 173 ARG B NH2   1 
ATOM   4122  N  N     . ASP B  1 193 ? -36.711  11.884  -23.730  1.00 36.21 ? 174 ASP B N     1 
ATOM   4123  C  CA    . ASP B  1 193 ? -37.188  10.742  -22.997  1.00 36.69 ? 174 ASP B CA    1 
ATOM   4124  C  C     . ASP B  1 193 ? -36.059  10.026  -22.265  1.00 37.17 ? 174 ASP B C     1 
ATOM   4125  O  O     . ASP B  1 193 ? -36.204  9.702   -21.053  1.00 37.53 ? 174 ASP B O     1 
ATOM   4126  C  CB    . ASP B  1 193 ? -37.895  9.787   -23.930  1.00 36.79 ? 174 ASP B CB    1 
ATOM   4127  C  CG    . ASP B  1 193 ? -39.261  10.275  -24.330  1.00 38.77 ? 174 ASP B CG    1 
ATOM   4128  O  OD1   . ASP B  1 193 ? -39.753  11.306  -23.799  1.00 41.47 ? 174 ASP B OD1   1 
ATOM   4129  O  OD2   . ASP B  1 193 ? -39.861  9.596   -25.177  1.00 43.63 ? 174 ASP B OD2   1 
ATOM   4130  N  N     . ILE B  1 194 ? -34.954  9.785   -22.987  1.00 36.25 ? 175 ILE B N     1 
ATOM   4131  C  CA    . ILE B  1 194 ? -33.767  9.186   -22.392  1.00 36.10 ? 175 ILE B CA    1 
ATOM   4132  C  C     . ILE B  1 194 ? -33.294  10.033  -21.200  1.00 36.19 ? 175 ILE B C     1 
ATOM   4133  O  O     . ILE B  1 194 ? -32.951  9.498   -20.135  1.00 36.03 ? 175 ILE B O     1 
ATOM   4134  C  CB    . ILE B  1 194 ? -32.585  9.040   -23.419  1.00 36.21 ? 175 ILE B CB    1 
ATOM   4135  C  CG1   . ILE B  1 194 ? -32.823  7.908   -24.478  1.00 36.08 ? 175 ILE B CG1   1 
ATOM   4136  C  CG2   . ILE B  1 194 ? -31.312  8.769   -22.690  1.00 35.26 ? 175 ILE B CG2   1 
ATOM   4137  C  CD1   . ILE B  1 194 ? -33.876  8.188   -25.522  1.00 34.76 ? 175 ILE B CD1   1 
ATOM   4138  N  N     . VAL B  1 195 ? -33.280  11.359  -21.377  1.00 36.35 ? 176 VAL B N     1 
ATOM   4139  C  CA    . VAL B  1 195 ? -32.730  12.267  -20.351  1.00 35.93 ? 176 VAL B CA    1 
ATOM   4140  C  C     . VAL B  1 195 ? -33.545  12.165  -19.078  1.00 36.02 ? 176 VAL B C     1 
ATOM   4141  O  O     . VAL B  1 195 ? -33.005  11.986  -18.005  1.00 36.07 ? 176 VAL B O     1 
ATOM   4142  C  CB    . VAL B  1 195 ? -32.703  13.728  -20.882  1.00 36.34 ? 176 VAL B CB    1 
ATOM   4143  C  CG1   . VAL B  1 195 ? -32.326  14.769  -19.759  1.00 32.31 ? 176 VAL B CG1   1 
ATOM   4144  C  CG2   . VAL B  1 195 ? -31.754  13.795  -22.098  1.00 34.56 ? 176 VAL B CG2   1 
ATOM   4145  N  N     . GLU B  1 196 ? -34.859  12.195  -19.240  1.00 36.02 ? 177 GLU B N     1 
ATOM   4146  C  CA    . GLU B  1 196 ? -35.794  12.124  -18.124  1.00 36.33 ? 177 GLU B CA    1 
ATOM   4147  C  C     . GLU B  1 196 ? -35.751  10.806  -17.365  1.00 36.12 ? 177 GLU B C     1 
ATOM   4148  O  O     . GLU B  1 196 ? -35.762  10.778  -16.109  1.00 35.36 ? 177 GLU B O     1 
ATOM   4149  C  CB    . GLU B  1 196 ? -37.221  12.377  -18.635  1.00 36.30 ? 177 GLU B CB    1 
ATOM   4150  C  CG    . GLU B  1 196 ? -37.412  13.807  -19.175  1.00 37.13 ? 177 GLU B CG    1 
ATOM   4151  C  CD    . GLU B  1 196 ? -37.457  14.881  -18.077  1.00 38.82 ? 177 GLU B CD    1 
ATOM   4152  O  OE1   . GLU B  1 196 ? -37.784  14.541  -16.911  1.00 40.00 ? 177 GLU B OE1   1 
ATOM   4153  O  OE2   . GLU B  1 196 ? -37.250  16.077  -18.405  1.00 39.79 ? 177 GLU B OE2   1 
ATOM   4154  N  N     . ALA B  1 197 ? -35.745  9.721   -18.134  1.00 36.53 ? 178 ALA B N     1 
ATOM   4155  C  CA    . ALA B  1 197 ? -35.614  8.351   -17.580  1.00 37.06 ? 178 ALA B CA    1 
ATOM   4156  C  C     . ALA B  1 197 ? -34.344  8.199   -16.792  1.00 37.42 ? 178 ALA B C     1 
ATOM   4157  O  O     . ALA B  1 197 ? -34.372  7.678   -15.676  1.00 37.41 ? 178 ALA B O     1 
ATOM   4158  C  CB    . ALA B  1 197 ? -35.611  7.292   -18.702  1.00 37.26 ? 178 ALA B CB    1 
ATOM   4159  N  N     . HIS B  1 198 ? -33.232  8.665   -17.382  1.00 37.44 ? 179 HIS B N     1 
ATOM   4160  C  CA    . HIS B  1 198 ? -31.933  8.569   -16.747  1.00 37.56 ? 179 HIS B CA    1 
ATOM   4161  C  C     . HIS B  1 198 ? -31.817  9.403   -15.460  1.00 38.21 ? 179 HIS B C     1 
ATOM   4162  O  O     . HIS B  1 198 ? -31.215  8.946   -14.437  1.00 38.78 ? 179 HIS B O     1 
ATOM   4163  C  CB    . HIS B  1 198 ? -30.888  9.014   -17.731  1.00 37.65 ? 179 HIS B CB    1 
ATOM   4164  C  CG    . HIS B  1 198 ? -29.497  8.984   -17.197  1.00 37.22 ? 179 HIS B CG    1 
ATOM   4165  N  ND1   . HIS B  1 198 ? -28.843  10.119  -16.795  1.00 38.70 ? 179 HIS B ND1   1 
ATOM   4166  C  CD2   . HIS B  1 198 ? -28.625  7.961   -17.027  1.00 39.62 ? 179 HIS B CD2   1 
ATOM   4167  C  CE1   . HIS B  1 198 ? -27.620  9.801   -16.402  1.00 40.26 ? 179 HIS B CE1   1 
ATOM   4168  N  NE2   . HIS B  1 198 ? -27.459  8.495   -16.539  1.00 39.29 ? 179 HIS B NE2   1 
ATOM   4169  N  N     . TYR B  1 199 ? -32.390  10.608  -15.498  1.00 37.70 ? 180 TYR B N     1 
ATOM   4170  C  CA    . TYR B  1 199 ? -32.327  11.504  -14.354  1.00 38.02 ? 180 TYR B CA    1 
ATOM   4171  C  C     . TYR B  1 199 ? -33.033  10.751  -13.211  1.00 38.39 ? 180 TYR B C     1 
ATOM   4172  O  O     . TYR B  1 199 ? -32.489  10.552  -12.120  1.00 39.23 ? 180 TYR B O     1 
ATOM   4173  C  CB    . TYR B  1 199 ? -32.992  12.859  -14.698  1.00 37.91 ? 180 TYR B CB    1 
ATOM   4174  C  CG    . TYR B  1 199 ? -32.627  14.063  -13.821  1.00 37.92 ? 180 TYR B CG    1 
ATOM   4175  C  CD1   . TYR B  1 199 ? -32.581  15.349  -14.366  1.00 37.69 ? 180 TYR B CD1   1 
ATOM   4176  C  CD2   . TYR B  1 199 ? -32.335  13.932  -12.463  1.00 37.80 ? 180 TYR B CD2   1 
ATOM   4177  C  CE1   . TYR B  1 199 ? -32.227  16.447  -13.612  1.00 36.65 ? 180 TYR B CE1   1 
ATOM   4178  C  CE2   . TYR B  1 199 ? -31.988  15.041  -11.691  1.00 37.10 ? 180 TYR B CE2   1 
ATOM   4179  C  CZ    . TYR B  1 199 ? -31.946  16.295  -12.266  1.00 38.47 ? 180 TYR B CZ    1 
ATOM   4180  O  OH    . TYR B  1 199 ? -31.631  17.417  -11.480  1.00 39.38 ? 180 TYR B OH    1 
ATOM   4181  N  N     . ARG B  1 200 ? -34.222  10.262  -13.483  1.00 38.83 ? 181 ARG B N     1 
ATOM   4182  C  CA    . ARG B  1 200 ? -34.972  9.549   -12.476  1.00 39.17 ? 181 ARG B CA    1 
ATOM   4183  C  C     . ARG B  1 200 ? -34.299  8.198   -12.127  1.00 39.15 ? 181 ARG B C     1 
ATOM   4184  O  O     . ARG B  1 200 ? -34.259  7.821   -10.960  1.00 39.17 ? 181 ARG B O     1 
ATOM   4185  C  CB    . ARG B  1 200 ? -36.386  9.355   -12.990  1.00 40.05 ? 181 ARG B CB    1 
ATOM   4186  C  CG    . ARG B  1 200 ? -37.384  9.003   -11.962  1.00 43.99 ? 181 ARG B CG    1 
ATOM   4187  C  CD    . ARG B  1 200 ? -37.482  10.134  -10.927  1.00 49.39 ? 181 ARG B CD    1 
ATOM   4188  N  NE    . ARG B  1 200 ? -38.469  11.147  -11.281  1.00 51.34 ? 181 ARG B NE    1 
ATOM   4189  C  CZ    . ARG B  1 200 ? -39.781  10.945  -11.180  1.00 50.58 ? 181 ARG B CZ    1 
ATOM   4190  N  NH1   . ARG B  1 200 ? -40.255  9.772   -10.768  1.00 48.89 ? 181 ARG B NH1   1 
ATOM   4191  N  NH2   . ARG B  1 200 ? -40.612  11.914  -11.507  1.00 50.47 ? 181 ARG B NH2   1 
ATOM   4192  N  N     . ALA B  1 201 ? -33.748  7.471   -13.104  1.00 38.71 ? 182 ALA B N     1 
ATOM   4193  C  CA    . ALA B  1 201 ? -33.078  6.209   -12.772  1.00 38.80 ? 182 ALA B CA    1 
ATOM   4194  C  C     . ALA B  1 201 ? -31.937  6.468   -11.760  1.00 39.06 ? 182 ALA B C     1 
ATOM   4195  O  O     . ALA B  1 201 ? -31.791  5.722   -10.777  1.00 38.97 ? 182 ALA B O     1 
ATOM   4196  C  CB    . ALA B  1 201 ? -32.557  5.530   -13.995  1.00 38.11 ? 182 ALA B CB    1 
ATOM   4197  N  N     . CYS B  1 202 ? -31.175  7.549   -11.983  1.00 38.49 ? 183 CYS B N     1 
ATOM   4198  C  CA    . CYS B  1 202 ? -30.049  7.872   -11.106  1.00 38.62 ? 183 CYS B CA    1 
ATOM   4199  C  C     . CYS B  1 202 ? -30.501  8.257   -9.717   1.00 37.97 ? 183 CYS B C     1 
ATOM   4200  O  O     . CYS B  1 202 ? -29.806  7.950   -8.759   1.00 37.54 ? 183 CYS B O     1 
ATOM   4201  C  CB    . CYS B  1 202 ? -29.169  9.026   -11.662  1.00 38.68 ? 183 CYS B CB    1 
ATOM   4202  S  SG    . CYS B  1 202 ? -28.218  8.608   -13.161  1.00 41.62 ? 183 CYS B SG    1 
ATOM   4203  N  N     . LEU B  1 203 ? -31.623  8.983   -9.618   1.00 37.49 ? 184 LEU B N     1 
ATOM   4204  C  CA    . LEU B  1 203 ? -32.075  9.479   -8.319   1.00 37.33 ? 184 LEU B CA    1 
ATOM   4205  C  C     . LEU B  1 203 ? -32.492  8.292   -7.481   1.00 37.21 ? 184 LEU B C     1 
ATOM   4206  O  O     . LEU B  1 203 ? -32.183  8.224   -6.311   1.00 37.84 ? 184 LEU B O     1 
ATOM   4207  C  CB    . LEU B  1 203 ? -33.230  10.461  -8.467   1.00 37.22 ? 184 LEU B CB    1 
ATOM   4208  C  CG    . LEU B  1 203 ? -32.882  11.906  -8.878   1.00 37.00 ? 184 LEU B CG    1 
ATOM   4209  C  CD1   . LEU B  1 203 ? -34.159  12.760  -9.147   1.00 31.99 ? 184 LEU B CD1   1 
ATOM   4210  C  CD2   . LEU B  1 203 ? -32.029  12.555  -7.795   1.00 32.51 ? 184 LEU B CD2   1 
ATOM   4211  N  N     . TYR B  1 204 ? -33.173  7.342   -8.103   1.00 37.34 ? 185 TYR B N     1 
ATOM   4212  C  CA    . TYR B  1 204 ? -33.532  6.075   -7.443   1.00 37.68 ? 185 TYR B CA    1 
ATOM   4213  C  C     . TYR B  1 204 ? -32.302  5.259   -7.074   1.00 37.77 ? 185 TYR B C     1 
ATOM   4214  O  O     . TYR B  1 204 ? -32.213  4.722   -5.976   1.00 37.72 ? 185 TYR B O     1 
ATOM   4215  C  CB    . TYR B  1 204 ? -34.408  5.228   -8.356   1.00 37.37 ? 185 TYR B CB    1 
ATOM   4216  C  CG    . TYR B  1 204 ? -34.953  3.964   -7.745   1.00 37.36 ? 185 TYR B CG    1 
ATOM   4217  C  CD1   . TYR B  1 204 ? -36.182  3.949   -7.092   1.00 39.83 ? 185 TYR B CD1   1 
ATOM   4218  C  CD2   . TYR B  1 204 ? -34.292  2.770   -7.869   1.00 37.28 ? 185 TYR B CD2   1 
ATOM   4219  C  CE1   . TYR B  1 204 ? -36.701  2.782   -6.567   1.00 36.82 ? 185 TYR B CE1   1 
ATOM   4220  C  CE2   . TYR B  1 204 ? -34.805  1.610   -7.344   1.00 36.76 ? 185 TYR B CE2   1 
ATOM   4221  C  CZ    . TYR B  1 204 ? -35.999  1.624   -6.700   1.00 36.78 ? 185 TYR B CZ    1 
ATOM   4222  O  OH    . TYR B  1 204 ? -36.508  0.455   -6.195   1.00 37.58 ? 185 TYR B OH    1 
ATOM   4223  N  N     . ALA B  1 205 ? -31.370  5.139   -8.006   1.00 37.74 ? 186 ALA B N     1 
ATOM   4224  C  CA    . ALA B  1 205 ? -30.130  4.422   -7.728   1.00 38.03 ? 186 ALA B CA    1 
ATOM   4225  C  C     . ALA B  1 205 ? -29.392  4.949   -6.464   1.00 38.21 ? 186 ALA B C     1 
ATOM   4226  O  O     . ALA B  1 205 ? -28.797  4.175   -5.711   1.00 38.71 ? 186 ALA B O     1 
ATOM   4227  C  CB    . ALA B  1 205 ? -29.210  4.484   -8.953   1.00 36.97 ? 186 ALA B CB    1 
ATOM   4228  N  N     . GLY B  1 206 ? -29.445  6.260   -6.232   1.00 38.53 ? 187 GLY B N     1 
ATOM   4229  C  CA    . GLY B  1 206 ? -28.589  6.908   -5.231   1.00 38.38 ? 187 GLY B CA    1 
ATOM   4230  C  C     . GLY B  1 206 ? -27.366  7.571   -5.840   1.00 38.95 ? 187 GLY B C     1 
ATOM   4231  O  O     . GLY B  1 206 ? -26.444  7.958   -5.111   1.00 39.71 ? 187 GLY B O     1 
ATOM   4232  N  N     . VAL B  1 207 ? -27.328  7.659   -7.177   1.00 38.53 ? 188 VAL B N     1 
ATOM   4233  C  CA    . VAL B  1 207 ? -26.270  8.389   -7.874   1.00 38.17 ? 188 VAL B CA    1 
ATOM   4234  C  C     . VAL B  1 207 ? -26.530  9.864   -7.659   1.00 38.19 ? 188 VAL B C     1 
ATOM   4235  O  O     . VAL B  1 207 ? -27.668  10.299  -7.692   1.00 38.45 ? 188 VAL B O     1 
ATOM   4236  C  CB    . VAL B  1 207 ? -26.253  8.098   -9.402   1.00 37.83 ? 188 VAL B CB    1 
ATOM   4237  C  CG1   . VAL B  1 207 ? -25.482  9.173   -10.130  1.00 35.40 ? 188 VAL B CG1   1 
ATOM   4238  C  CG2   . VAL B  1 207 ? -25.692  6.680   -9.696   1.00 36.96 ? 188 VAL B CG2   1 
ATOM   4239  N  N     . LYS B  1 208 ? -25.481  10.618  -7.416   1.00 38.53 ? 189 LYS B N     1 
ATOM   4240  C  CA    . LYS B  1 208 ? -25.595  12.024  -7.075   1.00 39.04 ? 189 LYS B CA    1 
ATOM   4241  C  C     . LYS B  1 208 ? -25.733  12.936  -8.324   1.00 39.20 ? 189 LYS B C     1 
ATOM   4242  O  O     . LYS B  1 208 ? -24.849  13.730  -8.634   1.00 39.57 ? 189 LYS B O     1 
ATOM   4243  C  CB    . LYS B  1 208 ? -24.383  12.454  -6.235   1.00 39.41 ? 189 LYS B CB    1 
ATOM   4244  C  CG    . LYS B  1 208 ? -24.597  13.844  -5.576   1.00 39.01 ? 189 LYS B CG    1 
ATOM   4245  C  CD    . LYS B  1 208 ? -23.726  14.025  -4.354   1.00 40.81 ? 189 LYS B CD    1 
ATOM   4246  C  CE    . LYS B  1 208 ? -23.904  15.455  -3.759   1.00 42.35 ? 189 LYS B CE    1 
ATOM   4247  N  NZ    . LYS B  1 208 ? -25.156  15.570  -3.012   1.00 44.71 ? 189 LYS B NZ    1 
ATOM   4248  N  N     . ILE B  1 209 ? -26.840  12.801  -9.043   1.00 38.58 ? 190 ILE B N     1 
ATOM   4249  C  CA    . ILE B  1 209 ? -27.082  13.627  -10.207  1.00 38.18 ? 190 ILE B CA    1 
ATOM   4250  C  C     . ILE B  1 209 ? -27.508  15.047  -9.764   1.00 38.45 ? 190 ILE B C     1 
ATOM   4251  O  O     . ILE B  1 209 ? -28.485  15.227  -9.027   1.00 39.66 ? 190 ILE B O     1 
ATOM   4252  C  CB    . ILE B  1 209 ? -28.107  12.947  -11.155  1.00 38.01 ? 190 ILE B CB    1 
ATOM   4253  C  CG1   . ILE B  1 209 ? -28.336  13.774  -12.406  1.00 37.13 ? 190 ILE B CG1   1 
ATOM   4254  C  CG2   . ILE B  1 209 ? -29.407  12.671  -10.458  1.00 37.17 ? 190 ILE B CG2   1 
ATOM   4255  C  CD1   . ILE B  1 209 ? -28.827  12.943  -13.584  1.00 37.38 ? 190 ILE B CD1   1 
ATOM   4256  N  N     . ALA B  1 210 ? -26.739  16.038  -10.199  1.00 37.91 ? 191 ALA B N     1 
ATOM   4257  C  CA    . ALA B  1 210 ? -26.913  17.468  -9.840   1.00 37.40 ? 191 ALA B CA    1 
ATOM   4258  C  C     . ALA B  1 210 ? -27.846  18.229  -10.772  1.00 37.45 ? 191 ALA B C     1 
ATOM   4259  O  O     . ALA B  1 210 ? -28.353  19.305  -10.398  1.00 37.07 ? 191 ALA B O     1 
ATOM   4260  C  CB    . ALA B  1 210 ? -25.545  18.192  -9.850   1.00 36.26 ? 191 ALA B CB    1 
ATOM   4261  N  N     . GLY B  1 211 ? -28.031  17.712  -11.994  1.00 36.83 ? 192 GLY B N     1 
ATOM   4262  C  CA    . GLY B  1 211 ? -28.762  18.447  -12.992  1.00 36.59 ? 192 GLY B CA    1 
ATOM   4263  C  C     . GLY B  1 211 ? -28.565  17.917  -14.392  1.00 36.49 ? 192 GLY B C     1 
ATOM   4264  O  O     . GLY B  1 211 ? -27.741  17.025  -14.615  1.00 36.35 ? 192 GLY B O     1 
ATOM   4265  N  N     . THR B  1 212 ? -29.310  18.505  -15.327  1.00 35.89 ? 193 THR B N     1 
ATOM   4266  C  CA    . THR B  1 212 ? -29.256  18.117  -16.707  1.00 36.42 ? 193 THR B CA    1 
ATOM   4267  C  C     . THR B  1 212 ? -29.573  19.318  -17.577  1.00 36.40 ? 193 THR B C     1 
ATOM   4268  O  O     . THR B  1 212 ? -30.204  20.280  -17.131  1.00 37.08 ? 193 THR B O     1 
ATOM   4269  C  CB    . THR B  1 212 ? -30.270  16.941  -17.065  1.00 37.12 ? 193 THR B CB    1 
ATOM   4270  O  OG1   . THR B  1 212 ? -31.625  17.363  -16.817  1.00 37.48 ? 193 THR B OG1   1 
ATOM   4271  C  CG2   . THR B  1 212 ? -29.958  15.623  -16.304  1.00 35.20 ? 193 THR B CG2   1 
ATOM   4272  N  N     . ASN B  1 213 ? -29.131  19.247  -18.823  1.00 36.15 ? 194 ASN B N     1 
ATOM   4273  C  CA    . ASN B  1 213 ? -29.471  20.239  -19.837  1.00 36.27 ? 194 ASN B CA    1 
ATOM   4274  C  C     . ASN B  1 213 ? -29.239  19.697  -21.240  1.00 35.98 ? 194 ASN B C     1 
ATOM   4275  O  O     . ASN B  1 213 ? -28.273  18.954  -21.453  1.00 36.37 ? 194 ASN B O     1 
ATOM   4276  C  CB    . ASN B  1 213 ? -28.650  21.519  -19.632  1.00 36.11 ? 194 ASN B CB    1 
ATOM   4277  C  CG    . ASN B  1 213 ? -27.145  21.305  -19.808  1.00 36.42 ? 194 ASN B CG    1 
ATOM   4278  O  OD1   . ASN B  1 213 ? -26.436  20.808  -18.929  1.00 34.40 ? 194 ASN B OD1   1 
ATOM   4279  N  ND2   . ASN B  1 213 ? -26.657  21.698  -20.958  1.00 38.25 ? 194 ASN B ND2   1 
ATOM   4280  N  N     . ALA B  1 214 ? -30.126  20.043  -22.172  1.00 35.73 ? 195 ALA B N     1 
ATOM   4281  C  CA    . ALA B  1 214 ? -29.863  19.917  -23.613  1.00 35.66 ? 195 ALA B CA    1 
ATOM   4282  C  C     . ALA B  1 214 ? -28.597  20.687  -23.956  1.00 35.91 ? 195 ALA B C     1 
ATOM   4283  O  O     . ALA B  1 214 ? -28.394  21.779  -23.440  1.00 37.66 ? 195 ALA B O     1 
ATOM   4284  C  CB    . ALA B  1 214 ? -30.983  20.470  -24.376  1.00 34.16 ? 195 ALA B CB    1 
ATOM   4285  N  N     . GLU B  1 215 ? -27.732  20.127  -24.788  1.00 35.96 ? 196 GLU B N     1 
ATOM   4286  C  CA    . GLU B  1 215 ? -26.536  20.854  -25.257  1.00 36.76 ? 196 GLU B CA    1 
ATOM   4287  C  C     . GLU B  1 215 ? -26.614  21.444  -26.689  1.00 37.02 ? 196 GLU B C     1 
ATOM   4288  O  O     . GLU B  1 215 ? -27.664  21.382  -27.358  1.00 36.48 ? 196 GLU B O     1 
ATOM   4289  C  CB    . GLU B  1 215 ? -25.295  19.979  -25.116  1.00 37.31 ? 196 GLU B CB    1 
ATOM   4290  C  CG    . GLU B  1 215 ? -24.494  20.299  -23.862  1.00 39.07 ? 196 GLU B CG    1 
ATOM   4291  C  CD    . GLU B  1 215 ? -23.898  21.686  -23.900  1.00 41.44 ? 196 GLU B CD    1 
ATOM   4292  O  OE1   . GLU B  1 215 ? -23.591  22.182  -22.784  1.00 40.02 ? 196 GLU B OE1   1 
ATOM   4293  O  OE2   . GLU B  1 215 ? -23.749  22.257  -25.036  1.00 43.19 ? 196 GLU B OE2   1 
ATOM   4294  N  N     . VAL B  1 216 ? -25.496  22.049  -27.100  1.00 37.03 ? 197 VAL B N     1 
ATOM   4295  C  CA    . VAL B  1 216 ? -25.450  22.950  -28.246  1.00 37.49 ? 197 VAL B CA    1 
ATOM   4296  C  C     . VAL B  1 216 ? -25.691  22.190  -29.558  1.00 37.60 ? 197 VAL B C     1 
ATOM   4297  O  O     . VAL B  1 216 ? -26.433  22.640  -30.420  1.00 36.85 ? 197 VAL B O     1 
ATOM   4298  C  CB    . VAL B  1 216 ? -24.068  23.755  -28.264  1.00 37.88 ? 197 VAL B CB    1 
ATOM   4299  C  CG1   . VAL B  1 216 ? -23.863  24.515  -29.590  1.00 36.39 ? 197 VAL B CG1   1 
ATOM   4300  C  CG2   . VAL B  1 216 ? -24.012  24.702  -27.081  1.00 36.62 ? 197 VAL B CG2   1 
ATOM   4301  N  N     . MET B  1 217 ? -25.070  21.024  -29.679  1.00 38.13 ? 198 MET B N     1 
ATOM   4302  C  CA    . MET B  1 217 ? -25.311  20.149  -30.812  1.00 38.45 ? 198 MET B CA    1 
ATOM   4303  C  C     . MET B  1 217 ? -26.685  19.432  -30.646  1.00 38.07 ? 198 MET B C     1 
ATOM   4304  O  O     . MET B  1 217 ? -26.990  18.920  -29.566  1.00 37.30 ? 198 MET B O     1 
ATOM   4305  C  CB    . MET B  1 217 ? -24.191  19.113  -30.932  1.00 37.52 ? 198 MET B CB    1 
ATOM   4306  C  CG    . MET B  1 217 ? -24.303  18.302  -32.193  1.00 39.38 ? 198 MET B CG    1 
ATOM   4307  S  SD    . MET B  1 217 ? -23.199  16.882  -32.398  1.00 43.57 ? 198 MET B SD    1 
ATOM   4308  C  CE    . MET B  1 217 ? -24.117  15.500  -31.791  1.00 44.03 ? 198 MET B CE    1 
ATOM   4309  N  N     . PRO B  1 218 ? -27.480  19.356  -31.728  1.00 37.70 ? 199 PRO B N     1 
ATOM   4310  C  CA    . PRO B  1 218 ? -28.711  18.627  -31.643  1.00 37.97 ? 199 PRO B CA    1 
ATOM   4311  C  C     . PRO B  1 218 ? -28.421  17.157  -31.435  1.00 38.49 ? 199 PRO B C     1 
ATOM   4312  O  O     . PRO B  1 218 ? -27.451  16.598  -31.970  1.00 38.68 ? 199 PRO B O     1 
ATOM   4313  C  CB    . PRO B  1 218 ? -29.393  18.884  -32.981  1.00 38.28 ? 199 PRO B CB    1 
ATOM   4314  C  CG    . PRO B  1 218 ? -28.335  19.387  -33.916  1.00 38.63 ? 199 PRO B CG    1 
ATOM   4315  C  CD    . PRO B  1 218 ? -27.218  19.890  -33.071  1.00 37.91 ? 199 PRO B CD    1 
ATOM   4316  N  N     . ALA B  1 219 ? -29.254  16.560  -30.588  1.00 39.16 ? 200 ALA B N     1 
ATOM   4317  C  CA    . ALA B  1 219 ? -29.110  15.184  -30.097  1.00 38.62 ? 200 ALA B CA    1 
ATOM   4318  C  C     . ALA B  1 219 ? -28.086  15.112  -28.978  1.00 38.36 ? 200 ALA B C     1 
ATOM   4319  O  O     . ALA B  1 219 ? -27.903  14.058  -28.415  1.00 38.52 ? 200 ALA B O     1 
ATOM   4320  C  CB    . ALA B  1 219 ? -28.769  14.209  -31.234  1.00 38.71 ? 200 ALA B CB    1 
ATOM   4321  N  N     . GLN B  1 220 ? -27.448  16.226  -28.631  1.00 38.29 ? 201 GLN B N     1 
ATOM   4322  C  CA    . GLN B  1 220 ? -26.434  16.229  -27.566  1.00 38.55 ? 201 GLN B CA    1 
ATOM   4323  C  C     . GLN B  1 220 ? -27.002  16.767  -26.255  1.00 38.09 ? 201 GLN B C     1 
ATOM   4324  O  O     . GLN B  1 220 ? -27.693  17.768  -26.251  1.00 37.91 ? 201 GLN B O     1 
ATOM   4325  C  CB    . GLN B  1 220 ? -25.221  17.067  -27.988  1.00 38.50 ? 201 GLN B CB    1 
ATOM   4326  C  CG    . GLN B  1 220 ? -24.026  16.947  -27.123  1.00 38.64 ? 201 GLN B CG    1 
ATOM   4327  C  CD    . GLN B  1 220 ? -22.887  17.853  -27.588  1.00 40.36 ? 201 GLN B CD    1 
ATOM   4328  O  OE1   . GLN B  1 220 ? -23.017  19.088  -27.664  1.00 41.40 ? 201 GLN B OE1   1 
ATOM   4329  N  NE2   . GLN B  1 220 ? -21.741  17.233  -27.885  1.00 44.62 ? 201 GLN B NE2   1 
ATOM   4330  N  N     . TRP B  1 221 ? -26.670  16.096  -25.151  1.00 38.01 ? 202 TRP B N     1 
ATOM   4331  C  CA    . TRP B  1 221 ? -27.212  16.378  -23.829  1.00 37.85 ? 202 TRP B CA    1 
ATOM   4332  C  C     . TRP B  1 221 ? -26.120  16.319  -22.786  1.00 37.66 ? 202 TRP B C     1 
ATOM   4333  O  O     . TRP B  1 221 ? -24.996  16.033  -23.106  1.00 37.77 ? 202 TRP B O     1 
ATOM   4334  C  CB    . TRP B  1 221 ? -28.283  15.342  -23.477  1.00 37.48 ? 202 TRP B CB    1 
ATOM   4335  C  CG    . TRP B  1 221 ? -29.461  15.438  -24.333  1.00 37.87 ? 202 TRP B CG    1 
ATOM   4336  C  CD1   . TRP B  1 221 ? -29.629  14.879  -25.573  1.00 38.26 ? 202 TRP B CD1   1 
ATOM   4337  C  CD2   . TRP B  1 221 ? -30.645  16.154  -24.061  1.00 37.25 ? 202 TRP B CD2   1 
ATOM   4338  N  NE1   . TRP B  1 221 ? -30.854  15.190  -26.069  1.00 36.93 ? 202 TRP B NE1   1 
ATOM   4339  C  CE2   . TRP B  1 221 ? -31.507  15.965  -25.159  1.00 36.52 ? 202 TRP B CE2   1 
ATOM   4340  C  CE3   . TRP B  1 221 ? -31.082  16.914  -22.982  1.00 37.42 ? 202 TRP B CE3   1 
ATOM   4341  C  CZ2   . TRP B  1 221 ? -32.762  16.523  -25.215  1.00 36.96 ? 202 TRP B CZ2   1 
ATOM   4342  C  CZ3   . TRP B  1 221 ? -32.328  17.465  -23.039  1.00 36.88 ? 202 TRP B CZ3   1 
ATOM   4343  C  CH2   . TRP B  1 221 ? -33.152  17.273  -24.144  1.00 37.33 ? 202 TRP B CH2   1 
ATOM   4344  N  N     . GLU B  1 222 ? -26.477  16.584  -21.530  1.00 38.12 ? 203 GLU B N     1 
ATOM   4345  C  CA    . GLU B  1 222 ? -25.532  16.667  -20.430  1.00 38.17 ? 203 GLU B CA    1 
ATOM   4346  C  C     . GLU B  1 222 ? -26.199  16.283  -19.147  1.00 38.06 ? 203 GLU B C     1 
ATOM   4347  O  O     . GLU B  1 222 ? -27.382  16.543  -18.933  1.00 38.81 ? 203 GLU B O     1 
ATOM   4348  C  CB    . GLU B  1 222 ? -25.053  18.106  -20.307  1.00 38.88 ? 203 GLU B CB    1 
ATOM   4349  C  CG    . GLU B  1 222 ? -23.881  18.409  -19.322  1.00 38.56 ? 203 GLU B CG    1 
ATOM   4350  C  CD    . GLU B  1 222 ? -23.530  19.913  -19.326  1.00 38.96 ? 203 GLU B CD    1 
ATOM   4351  O  OE1   . GLU B  1 222 ? -23.503  20.499  -20.420  1.00 39.83 ? 203 GLU B OE1   1 
ATOM   4352  O  OE2   . GLU B  1 222 ? -23.332  20.522  -18.255  1.00 39.35 ? 203 GLU B OE2   1 
ATOM   4353  N  N     . PHE B  1 223 ? -25.465  15.635  -18.278  1.00 37.77 ? 204 PHE B N     1 
ATOM   4354  C  CA    . PHE B  1 223 ? -25.936  15.528  -16.919  1.00 38.01 ? 204 PHE B CA    1 
ATOM   4355  C  C     . PHE B  1 223 ? -24.747  15.809  -16.051  1.00 37.69 ? 204 PHE B C     1 
ATOM   4356  O  O     . PHE B  1 223 ? -23.644  15.552  -16.457  1.00 37.07 ? 204 PHE B O     1 
ATOM   4357  C  CB    . PHE B  1 223 ? -26.574  14.163  -16.616  1.00 37.78 ? 204 PHE B CB    1 
ATOM   4358  C  CG    . PHE B  1 223 ? -25.638  12.984  -16.762  1.00 37.55 ? 204 PHE B CG    1 
ATOM   4359  C  CD1   . PHE B  1 223 ? -24.769  12.637  -15.750  1.00 37.88 ? 204 PHE B CD1   1 
ATOM   4360  C  CD2   . PHE B  1 223 ? -25.664  12.205  -17.897  1.00 37.88 ? 204 PHE B CD2   1 
ATOM   4361  C  CE1   . PHE B  1 223 ? -23.938  11.534  -15.870  1.00 38.26 ? 204 PHE B CE1   1 
ATOM   4362  C  CE2   . PHE B  1 223 ? -24.810  11.121  -18.050  1.00 37.30 ? 204 PHE B CE2   1 
ATOM   4363  C  CZ    . PHE B  1 223 ? -23.952  10.778  -17.045  1.00 38.21 ? 204 PHE B CZ    1 
ATOM   4364  N  N     . GLN B  1 224 ? -24.951  16.344  -14.868  1.00 38.09 ? 205 GLN B N     1 
ATOM   4365  C  CA    . GLN B  1 224 ? -23.873  16.691  -13.977  1.00 38.35 ? 205 GLN B CA    1 
ATOM   4366  C  C     . GLN B  1 224 ? -23.866  15.781  -12.802  1.00 38.52 ? 205 GLN B C     1 
ATOM   4367  O  O     . GLN B  1 224 ? -24.885  15.407  -12.354  1.00 38.04 ? 205 GLN B O     1 
ATOM   4368  C  CB    . GLN B  1 224 ? -24.052  18.109  -13.518  1.00 37.89 ? 205 GLN B CB    1 
ATOM   4369  C  CG    . GLN B  1 224 ? -23.964  19.073  -14.628  1.00 37.12 ? 205 GLN B CG    1 
ATOM   4370  C  CD    . GLN B  1 224 ? -25.285  19.626  -15.033  1.00 37.76 ? 205 GLN B CD    1 
ATOM   4371  O  OE1   . GLN B  1 224 ? -26.092  19.946  -14.222  1.00 36.91 ? 205 GLN B OE1   1 
ATOM   4372  N  NE2   . GLN B  1 224 ? -25.495  19.742  -16.287  1.00 36.22 ? 205 GLN B NE2   1 
ATOM   4373  N  N     . ILE B  1 225 ? -22.695  15.407  -12.333  1.00 38.79 ? 206 ILE B N     1 
ATOM   4374  C  CA    . ILE B  1 225 ? -22.568  14.576  -11.156  1.00 39.18 ? 206 ILE B CA    1 
ATOM   4375  C  C     . ILE B  1 225 ? -21.728  15.241  -10.113  1.00 39.64 ? 206 ILE B C     1 
ATOM   4376  O  O     . ILE B  1 225 ? -20.615  15.546  -10.351  1.00 39.22 ? 206 ILE B O     1 
ATOM   4377  C  CB    . ILE B  1 225 ? -21.968  13.214  -11.495  1.00 38.98 ? 206 ILE B CB    1 
ATOM   4378  C  CG1   . ILE B  1 225 ? -22.753  12.538  -12.603  1.00 38.53 ? 206 ILE B CG1   1 
ATOM   4379  C  CG2   . ILE B  1 225 ? -21.833  12.361  -10.302  1.00 37.01 ? 206 ILE B CG2   1 
ATOM   4380  C  CD1   . ILE B  1 225 ? -24.047  12.052  -12.222  1.00 36.86 ? 206 ILE B CD1   1 
ATOM   4381  N  N     . GLY B  1 226 ? -22.285  15.494  -8.950   1.00 40.42 ? 207 GLY B N     1 
ATOM   4382  C  CA    . GLY B  1 226 ? -21.514  16.065  -7.876   1.00 41.19 ? 207 GLY B CA    1 
ATOM   4383  C  C     . GLY B  1 226 ? -22.320  16.911  -6.960   1.00 40.76 ? 207 GLY B C     1 
ATOM   4384  O  O     . GLY B  1 226 ? -23.483  17.007  -7.126   1.00 41.97 ? 207 GLY B O     1 
ATOM   4385  N  N     . PRO B  1 227 ? -21.692  17.536  -5.990   1.00 41.28 ? 208 PRO B N     1 
ATOM   4386  C  CA    . PRO B  1 227 ? -20.277  17.374  -5.741   1.00 41.19 ? 208 PRO B CA    1 
ATOM   4387  C  C     . PRO B  1 227 ? -20.014  16.110  -4.997   1.00 41.25 ? 208 PRO B C     1 
ATOM   4388  O  O     . PRO B  1 227 ? -20.669  15.831  -4.059   1.00 41.09 ? 208 PRO B O     1 
ATOM   4389  C  CB    . PRO B  1 227 ? -19.956  18.565  -4.866   1.00 41.54 ? 208 PRO B CB    1 
ATOM   4390  C  CG    . PRO B  1 227 ? -20.987  19.484  -5.070   1.00 41.06 ? 208 PRO B CG    1 
ATOM   4391  C  CD    . PRO B  1 227 ? -22.192  18.769  -5.394   1.00 40.43 ? 208 PRO B CD    1 
ATOM   4392  N  N     . CYS B  1 228 ? -19.048  15.350  -5.447   1.00 41.79 ? 209 CYS B N     1 
ATOM   4393  C  CA    . CYS B  1 228 ? -18.733  14.081  -4.868   1.00 41.41 ? 209 CYS B CA    1 
ATOM   4394  C  C     . CYS B  1 228 ? -17.344  14.158  -4.298   1.00 41.30 ? 209 CYS B C     1 
ATOM   4395  O  O     . CYS B  1 228 ? -16.446  14.587  -4.952   1.00 40.71 ? 209 CYS B O     1 
ATOM   4396  C  CB    . CYS B  1 228 ? -18.797  12.999  -5.936   1.00 41.86 ? 209 CYS B CB    1 
ATOM   4397  S  SG    . CYS B  1 228 ? -20.349  12.586  -6.635   1.00 42.38 ? 209 CYS B SG    1 
ATOM   4398  N  N     . GLU B  1 229 ? -17.192  13.726  -3.062   1.00 41.97 ? 210 GLU B N     1 
ATOM   4399  C  CA    . GLU B  1 229 ? -15.939  13.784  -2.335   1.00 42.36 ? 210 GLU B CA    1 
ATOM   4400  C  C     . GLU B  1 229 ? -15.072  12.559  -2.723   1.00 42.39 ? 210 GLU B C     1 
ATOM   4401  O  O     . GLU B  1 229 ? -15.571  11.426  -2.814   1.00 43.00 ? 210 GLU B O     1 
ATOM   4402  C  CB    . GLU B  1 229 ? -16.177  13.838  -0.826   1.00 41.66 ? 210 GLU B CB    1 
ATOM   4403  C  CG    . GLU B  1 229 ? -14.846  13.801  -0.031   1.00 43.91 ? 210 GLU B CG    1 
ATOM   4404  C  CD    . GLU B  1 229 ? -14.951  14.384  1.384    1.00 45.66 ? 210 GLU B CD    1 
ATOM   4405  O  OE1   . GLU B  1 229 ? -15.713  15.374  1.601    1.00 52.50 ? 210 GLU B OE1   1 
ATOM   4406  O  OE2   . GLU B  1 229 ? -14.262  13.869  2.288    1.00 49.60 ? 210 GLU B OE2   1 
ATOM   4407  N  N     . GLY B  1 230 ? -13.810  12.822  -3.046   1.00 41.70 ? 211 GLY B N     1 
ATOM   4408  C  CA    . GLY B  1 230 ? -12.814  11.793  -3.255   1.00 41.56 ? 211 GLY B CA    1 
ATOM   4409  C  C     . GLY B  1 230 ? -13.073  10.761  -4.322   1.00 41.97 ? 211 GLY B C     1 
ATOM   4410  O  O     . GLY B  1 230 ? -13.425  11.092  -5.475   1.00 42.84 ? 211 GLY B O     1 
ATOM   4411  N  N     . ILE B  1 231 ? -12.895  9.502   -3.924   1.00 41.25 ? 212 ILE B N     1 
ATOM   4412  C  CA    . ILE B  1 231 ? -13.126  8.361   -4.783   1.00 40.88 ? 212 ILE B CA    1 
ATOM   4413  C  C     . ILE B  1 231 ? -14.616  8.206   -5.235   1.00 41.39 ? 212 ILE B C     1 
ATOM   4414  O  O     . ILE B  1 231 ? -14.922  7.516   -6.236   1.00 41.64 ? 212 ILE B O     1 
ATOM   4415  C  CB    . ILE B  1 231 ? -12.696  7.061   -4.042   1.00 40.57 ? 212 ILE B CB    1 
ATOM   4416  C  CG1   . ILE B  1 231 ? -12.382  5.967   -5.041   1.00 39.73 ? 212 ILE B CG1   1 
ATOM   4417  C  CG2   . ILE B  1 231 ? -13.775  6.610   -3.061   1.00 37.75 ? 212 ILE B CG2   1 
ATOM   4418  C  CD1   . ILE B  1 231 ? -11.405  6.382   -6.079   1.00 38.84 ? 212 ILE B CD1   1 
ATOM   4419  N  N     . SER B  1 232 ? -15.551  8.830   -4.528   1.00 40.41 ? 213 SER B N     1 
ATOM   4420  C  CA    . SER B  1 232 ? -16.965  8.597   -4.881   1.00 40.70 ? 213 SER B CA    1 
ATOM   4421  C  C     . SER B  1 232 ? -17.317  9.341   -6.194   1.00 40.33 ? 213 SER B C     1 
ATOM   4422  O  O     . SER B  1 232 ? -18.358  9.126   -6.755   1.00 40.23 ? 213 SER B O     1 
ATOM   4423  C  CB    . SER B  1 232 ? -17.890  9.024   -3.736   1.00 39.58 ? 213 SER B CB    1 
ATOM   4424  O  OG    . SER B  1 232 ? -17.779  10.419  -3.588   1.00 38.70 ? 213 SER B OG    1 
ATOM   4425  N  N     . MET B  1 233 ? -16.440  10.214  -6.664   1.00 40.35 ? 214 MET B N     1 
ATOM   4426  C  CA    . MET B  1 233 ? -16.697  10.929  -7.908   1.00 40.54 ? 214 MET B CA    1 
ATOM   4427  C  C     . MET B  1 233 ? -16.699  9.943   -9.060   1.00 40.11 ? 214 MET B C     1 
ATOM   4428  O  O     . MET B  1 233 ? -17.669  9.830   -9.802   1.00 39.52 ? 214 MET B O     1 
ATOM   4429  C  CB    . MET B  1 233 ? -15.648  12.028  -8.143   1.00 40.42 ? 214 MET B CB    1 
ATOM   4430  C  CG    . MET B  1 233 ? -15.790  12.798  -9.457   1.00 41.19 ? 214 MET B CG    1 
ATOM   4431  S  SD    . MET B  1 233 ? -17.355  13.703  -9.576   1.00 43.47 ? 214 MET B SD    1 
ATOM   4432  C  CE    . MET B  1 233 ? -18.247  12.802  -10.833  1.00 38.95 ? 214 MET B CE    1 
ATOM   4433  N  N     . GLY B  1 234 ? -15.608  9.218   -9.182   1.00 39.65 ? 215 GLY B N     1 
ATOM   4434  C  CA    . GLY B  1 234 ? -15.485  8.257   -10.238  1.00 39.79 ? 215 GLY B CA    1 
ATOM   4435  C  C     . GLY B  1 234 ? -16.496  7.152   -10.072  1.00 39.93 ? 215 GLY B C     1 
ATOM   4436  O  O     . GLY B  1 234 ? -16.943  6.571   -11.065  1.00 40.21 ? 215 GLY B O     1 
ATOM   4437  N  N     . ASP B  1 235 ? -16.856  6.843   -8.825   1.00 39.68 ? 216 ASP B N     1 
ATOM   4438  C  CA    . ASP B  1 235 ? -17.778  5.733   -8.580   1.00 39.66 ? 216 ASP B CA    1 
ATOM   4439  C  C     . ASP B  1 235 ? -19.116  6.110   -9.160   1.00 39.78 ? 216 ASP B C     1 
ATOM   4440  O  O     . ASP B  1 235 ? -19.684  5.365   -9.954   1.00 39.61 ? 216 ASP B O     1 
ATOM   4441  C  CB    . ASP B  1 235 ? -17.914  5.435   -7.087   1.00 39.63 ? 216 ASP B CB    1 
ATOM   4442  C  CG    . ASP B  1 235 ? -16.721  4.678   -6.539   1.00 40.96 ? 216 ASP B CG    1 
ATOM   4443  O  OD1   . ASP B  1 235 ? -15.902  4.263   -7.384   1.00 39.24 ? 216 ASP B OD1   1 
ATOM   4444  O  OD2   . ASP B  1 235 ? -16.604  4.513   -5.282   1.00 41.37 ? 216 ASP B OD2   1 
ATOM   4445  N  N     . HIS B  1 236 ? -19.584  7.298   -8.763   1.00 39.55 ? 217 HIS B N     1 
ATOM   4446  C  CA    . HIS B  1 236 ? -20.878  7.816   -9.166   1.00 39.12 ? 217 HIS B CA    1 
ATOM   4447  C  C     . HIS B  1 236 ? -20.934  8.087   -10.673  1.00 38.19 ? 217 HIS B C     1 
ATOM   4448  O  O     . HIS B  1 236 ? -21.923  7.810   -11.316  1.00 38.93 ? 217 HIS B O     1 
ATOM   4449  C  CB    . HIS B  1 236 ? -21.213  9.106   -8.363   1.00 39.02 ? 217 HIS B CB    1 
ATOM   4450  C  CG    . HIS B  1 236 ? -21.747  8.845   -6.985   1.00 38.96 ? 217 HIS B CG    1 
ATOM   4451  N  ND1   . HIS B  1 236 ? -23.038  9.169   -6.617   1.00 40.05 ? 217 HIS B ND1   1 
ATOM   4452  C  CD2   . HIS B  1 236 ? -21.173  8.289   -5.886   1.00 37.62 ? 217 HIS B CD2   1 
ATOM   4453  C  CE1   . HIS B  1 236 ? -23.244  8.814   -5.358   1.00 37.57 ? 217 HIS B CE1   1 
ATOM   4454  N  NE2   . HIS B  1 236 ? -22.122  8.289   -4.889   1.00 37.60 ? 217 HIS B NE2   1 
ATOM   4455  N  N     . LEU B  1 237 ? -19.893  8.645   -11.244  1.00 37.65 ? 218 LEU B N     1 
ATOM   4456  C  CA    . LEU B  1 237 ? -19.921  8.868   -12.690  1.00 38.14 ? 218 LEU B CA    1 
ATOM   4457  C  C     . LEU B  1 237 ? -19.938  7.560   -13.482  1.00 38.11 ? 218 LEU B C     1 
ATOM   4458  O  O     . LEU B  1 237 ? -20.688  7.446   -14.448  1.00 38.60 ? 218 LEU B O     1 
ATOM   4459  C  CB    . LEU B  1 237 ? -18.781  9.773   -13.177  1.00 37.50 ? 218 LEU B CB    1 
ATOM   4460  C  CG    . LEU B  1 237 ? -18.842  10.148  -14.659  1.00 37.72 ? 218 LEU B CG    1 
ATOM   4461  C  CD1   . LEU B  1 237 ? -20.161  10.805  -15.031  1.00 36.64 ? 218 LEU B CD1   1 
ATOM   4462  C  CD2   . LEU B  1 237 ? -17.607  11.003  -15.071  1.00 37.31 ? 218 LEU B CD2   1 
ATOM   4463  N  N     . TRP B  1 238 ? -19.128  6.580   -13.092  1.00 38.10 ? 219 TRP B N     1 
ATOM   4464  C  CA    . TRP B  1 238 ? -19.120  5.317   -13.840  1.00 37.96 ? 219 TRP B CA    1 
ATOM   4465  C  C     . TRP B  1 238 ? -20.497  4.657   -13.804  1.00 37.97 ? 219 TRP B C     1 
ATOM   4466  O  O     . TRP B  1 238 ? -20.984  4.197   -14.850  1.00 38.63 ? 219 TRP B O     1 
ATOM   4467  C  CB    . TRP B  1 238 ? -18.045  4.359   -13.361  1.00 38.12 ? 219 TRP B CB    1 
ATOM   4468  C  CG    . TRP B  1 238 ? -16.721  4.579   -14.029  1.00 38.34 ? 219 TRP B CG    1 
ATOM   4469  C  CD1   . TRP B  1 238 ? -15.554  4.950   -13.425  1.00 38.78 ? 219 TRP B CD1   1 
ATOM   4470  C  CD2   . TRP B  1 238 ? -16.423  4.442   -15.418  1.00 38.54 ? 219 TRP B CD2   1 
ATOM   4471  N  NE1   . TRP B  1 238 ? -14.553  5.044   -14.343  1.00 38.87 ? 219 TRP B NE1   1 
ATOM   4472  C  CE2   . TRP B  1 238 ? -15.058  4.742   -15.580  1.00 39.57 ? 219 TRP B CE2   1 
ATOM   4473  C  CE3   . TRP B  1 238 ? -17.174  4.078   -16.542  1.00 39.12 ? 219 TRP B CE3   1 
ATOM   4474  C  CZ2   . TRP B  1 238 ? -14.422  4.700   -16.828  1.00 39.35 ? 219 TRP B CZ2   1 
ATOM   4475  C  CZ3   . TRP B  1 238 ? -16.557  4.045   -17.776  1.00 38.93 ? 219 TRP B CZ3   1 
ATOM   4476  C  CH2   . TRP B  1 238 ? -15.181  4.351   -17.912  1.00 39.13 ? 219 TRP B CH2   1 
ATOM   4477  N  N     . VAL B  1 239 ? -21.133  4.619   -12.630  1.00 37.31 ? 220 VAL B N     1 
ATOM   4478  C  CA    . VAL B  1 239 ? -22.437  3.988   -12.501  1.00 36.58 ? 220 VAL B CA    1 
ATOM   4479  C  C     . VAL B  1 239 ? -23.460  4.853   -13.247  1.00 37.05 ? 220 VAL B C     1 
ATOM   4480  O  O     . VAL B  1 239 ? -24.355  4.308   -13.875  1.00 37.52 ? 220 VAL B O     1 
ATOM   4481  C  CB    . VAL B  1 239 ? -22.827  3.719   -11.009  1.00 36.59 ? 220 VAL B CB    1 
ATOM   4482  C  CG1   . VAL B  1 239 ? -24.345  3.197   -10.852  1.00 34.65 ? 220 VAL B CG1   1 
ATOM   4483  C  CG2   . VAL B  1 239 ? -21.874  2.732   -10.377  1.00 34.80 ? 220 VAL B CG2   1 
ATOM   4484  N  N     . ALA B  1 240 ? -23.317  6.186   -13.212  1.00 36.90 ? 221 ALA B N     1 
ATOM   4485  C  CA    . ALA B  1 240 ? -24.199  7.082   -13.981  1.00 36.65 ? 221 ALA B CA    1 
ATOM   4486  C  C     . ALA B  1 240 ? -24.140  6.781   -15.478  1.00 36.57 ? 221 ALA B C     1 
ATOM   4487  O  O     . ALA B  1 240 ? -25.149  6.853   -16.208  1.00 37.13 ? 221 ALA B O     1 
ATOM   4488  C  CB    . ALA B  1 240 ? -23.847  8.512   -13.737  1.00 36.56 ? 221 ALA B CB    1 
ATOM   4489  N  N     . ARG B  1 241 ? -22.949  6.439   -15.922  1.00 36.53 ? 222 ARG B N     1 
ATOM   4490  C  CA    . ARG B  1 241 ? -22.699  6.090   -17.310  1.00 36.75 ? 222 ARG B CA    1 
ATOM   4491  C  C     . ARG B  1 241 ? -23.277  4.730   -17.625  1.00 36.23 ? 222 ARG B C     1 
ATOM   4492  O  O     . ARG B  1 241 ? -23.799  4.533   -18.714  1.00 35.95 ? 222 ARG B O     1 
ATOM   4493  C  CB    . ARG B  1 241 ? -21.194  6.066   -17.596  1.00 36.59 ? 222 ARG B CB    1 
ATOM   4494  C  CG    . ARG B  1 241 ? -20.545  7.402   -17.766  1.00 37.22 ? 222 ARG B CG    1 
ATOM   4495  C  CD    . ARG B  1 241 ? -19.010  7.233   -17.784  1.00 38.86 ? 222 ARG B CD    1 
ATOM   4496  N  NE    . ARG B  1 241 ? -18.281  8.427   -18.226  1.00 40.14 ? 222 ARG B NE    1 
ATOM   4497  C  CZ    . ARG B  1 241 ? -16.957  8.495   -18.327  1.00 39.46 ? 222 ARG B CZ    1 
ATOM   4498  N  NH1   . ARG B  1 241 ? -16.211  7.441   -18.038  1.00 41.50 ? 222 ARG B NH1   1 
ATOM   4499  N  NH2   . ARG B  1 241 ? -16.385  9.600   -18.778  1.00 39.25 ? 222 ARG B NH2   1 
ATOM   4500  N  N     . PHE B  1 242 ? -23.151  3.780   -16.697  1.00 36.11 ? 223 PHE B N     1 
ATOM   4501  C  CA    . PHE B  1 242 ? -23.710  2.478   -16.930  1.00 36.30 ? 223 PHE B CA    1 
ATOM   4502  C  C     . PHE B  1 242 ? -25.209  2.611   -17.105  1.00 36.51 ? 223 PHE B C     1 
ATOM   4503  O  O     . PHE B  1 242 ? -25.791  2.060   -18.057  1.00 37.76 ? 223 PHE B O     1 
ATOM   4504  C  CB    . PHE B  1 242 ? -23.423  1.499   -15.795  1.00 36.94 ? 223 PHE B CB    1 
ATOM   4505  C  CG    . PHE B  1 242 ? -24.022  0.133   -16.039  1.00 36.29 ? 223 PHE B CG    1 
ATOM   4506  C  CD1   . PHE B  1 242 ? -23.418  -0.747  -16.918  1.00 36.95 ? 223 PHE B CD1   1 
ATOM   4507  C  CD2   . PHE B  1 242 ? -25.232  -0.225  -15.472  1.00 36.28 ? 223 PHE B CD2   1 
ATOM   4508  C  CE1   . PHE B  1 242 ? -23.981  -1.986  -17.199  1.00 37.36 ? 223 PHE B CE1   1 
ATOM   4509  C  CE2   . PHE B  1 242 ? -25.795  -1.446  -15.741  1.00 36.83 ? 223 PHE B CE2   1 
ATOM   4510  C  CZ    . PHE B  1 242 ? -25.161  -2.337  -16.608  1.00 37.10 ? 223 PHE B CZ    1 
ATOM   4511  N  N     . ILE B  1 243 ? -25.835  3.360   -16.201  1.00 36.63 ? 224 ILE B N     1 
ATOM   4512  C  CA    . ILE B  1 243 ? -27.296  3.597   -16.209  1.00 36.42 ? 224 ILE B CA    1 
ATOM   4513  C  C     . ILE B  1 243 ? -27.712  4.214   -17.533  1.00 36.32 ? 224 ILE B C     1 
ATOM   4514  O  O     . ILE B  1 243 ? -28.670  3.771   -18.128  1.00 37.60 ? 224 ILE B O     1 
ATOM   4515  C  CB    . ILE B  1 243 ? -27.739  4.468   -14.974  1.00 36.83 ? 224 ILE B CB    1 
ATOM   4516  C  CG1   . ILE B  1 243 ? -27.410  3.664   -13.680  1.00 36.93 ? 224 ILE B CG1   1 
ATOM   4517  C  CG2   . ILE B  1 243 ? -29.220  4.910   -15.088  1.00 34.73 ? 224 ILE B CG2   1 
ATOM   4518  C  CD1   . ILE B  1 243 ? -27.740  4.354   -12.325  1.00 36.29 ? 224 ILE B CD1   1 
ATOM   4519  N  N     . LEU B  1 244 ? -26.969  5.194   -18.023  1.00 36.35 ? 225 LEU B N     1 
ATOM   4520  C  CA    . LEU B  1 244 ? -27.270  5.815   -19.347  1.00 36.23 ? 225 LEU B CA    1 
ATOM   4521  C  C     . LEU B  1 244 ? -27.303  4.782   -20.470  1.00 36.48 ? 225 LEU B C     1 
ATOM   4522  O  O     . LEU B  1 244 ? -28.264  4.697   -21.232  1.00 36.30 ? 225 LEU B O     1 
ATOM   4523  C  CB    . LEU B  1 244 ? -26.257  6.911   -19.699  1.00 35.71 ? 225 LEU B CB    1 
ATOM   4524  C  CG    . LEU B  1 244 ? -26.479  7.701   -20.984  1.00 36.46 ? 225 LEU B CG    1 
ATOM   4525  C  CD1   . LEU B  1 244 ? -27.869  8.416   -20.985  1.00 32.55 ? 225 LEU B CD1   1 
ATOM   4526  C  CD2   . LEU B  1 244 ? -25.242  8.672   -21.268  1.00 33.50 ? 225 LEU B CD2   1 
ATOM   4527  N  N     . HIS B  1 245 ? -26.251  3.985   -20.557  1.00 36.88 ? 226 HIS B N     1 
ATOM   4528  C  CA    . HIS B  1 245 ? -26.198  2.969   -21.592  1.00 36.94 ? 226 HIS B CA    1 
ATOM   4529  C  C     . HIS B  1 245 ? -27.382  2.019   -21.427  1.00 36.56 ? 226 HIS B C     1 
ATOM   4530  O  O     . HIS B  1 245 ? -28.002  1.654   -22.424  1.00 36.17 ? 226 HIS B O     1 
ATOM   4531  C  CB    . HIS B  1 245 ? -24.872  2.214   -21.572  1.00 37.25 ? 226 HIS B CB    1 
ATOM   4532  C  CG    . HIS B  1 245 ? -23.695  3.046   -21.980  1.00 38.95 ? 226 HIS B CG    1 
ATOM   4533  N  ND1   . HIS B  1 245 ? -23.593  3.642   -23.229  1.00 39.30 ? 226 HIS B ND1   1 
ATOM   4534  C  CD2   . HIS B  1 245 ? -22.556  3.358   -21.315  1.00 38.70 ? 226 HIS B CD2   1 
ATOM   4535  C  CE1   . HIS B  1 245 ? -22.442  4.286   -23.303  1.00 38.78 ? 226 HIS B CE1   1 
ATOM   4536  N  NE2   . HIS B  1 245 ? -21.798  4.137   -22.156  1.00 39.29 ? 226 HIS B NE2   1 
ATOM   4537  N  N     . ARG B  1 246 ? -27.724  1.651   -20.195  1.00 35.90 ? 227 ARG B N     1 
ATOM   4538  C  CA    . ARG B  1 246 ? -28.823  0.715   -20.029  1.00 36.34 ? 227 ARG B CA    1 
ATOM   4539  C  C     . ARG B  1 246 ? -30.120  1.365   -20.417  1.00 36.01 ? 227 ARG B C     1 
ATOM   4540  O  O     . ARG B  1 246 ? -31.007  0.747   -20.984  1.00 36.05 ? 227 ARG B O     1 
ATOM   4541  C  CB    . ARG B  1 246 ? -28.956  0.219   -18.588  1.00 36.46 ? 227 ARG B CB    1 
ATOM   4542  C  CG    . ARG B  1 246 ? -28.361  -1.118  -18.302  1.00 38.70 ? 227 ARG B CG    1 
ATOM   4543  C  CD    . ARG B  1 246 ? -28.870  -2.262  -19.164  1.00 40.61 ? 227 ARG B CD    1 
ATOM   4544  N  NE    . ARG B  1 246 ? -29.996  -2.918  -18.516  1.00 41.62 ? 227 ARG B NE    1 
ATOM   4545  C  CZ    . ARG B  1 246 ? -31.276  -2.696  -18.807  1.00 41.89 ? 227 ARG B CZ    1 
ATOM   4546  N  NH1   . ARG B  1 246 ? -31.624  -1.815  -19.749  1.00 41.43 ? 227 ARG B NH1   1 
ATOM   4547  N  NH2   . ARG B  1 246 ? -32.214  -3.347  -18.124  1.00 41.38 ? 227 ARG B NH2   1 
ATOM   4548  N  N     . VAL B  1 247 ? -30.261  2.615   -20.033  1.00 36.29 ? 228 VAL B N     1 
ATOM   4549  C  CA    . VAL B  1 247 ? -31.457  3.342   -20.360  1.00 36.18 ? 228 VAL B CA    1 
ATOM   4550  C  C     . VAL B  1 247 ? -31.573  3.461   -21.878  1.00 36.45 ? 228 VAL B C     1 
ATOM   4551  O  O     . VAL B  1 247 ? -32.626  3.161   -22.446  1.00 37.29 ? 228 VAL B O     1 
ATOM   4552  C  CB    . VAL B  1 247 ? -31.496  4.723   -19.641  1.00 36.31 ? 228 VAL B CB    1 
ATOM   4553  C  CG1   . VAL B  1 247 ? -32.608  5.561   -20.242  1.00 34.14 ? 228 VAL B CG1   1 
ATOM   4554  C  CG2   . VAL B  1 247 ? -31.641  4.517   -18.101  1.00 32.03 ? 228 VAL B CG2   1 
ATOM   4555  N  N     . CYS B  1 248 ? -30.488  3.826   -22.553  1.00 36.76 ? 229 CYS B N     1 
ATOM   4556  C  CA    . CYS B  1 248 ? -30.551  4.014   -24.019  1.00 37.26 ? 229 CYS B CA    1 
ATOM   4557  C  C     . CYS B  1 248 ? -30.907  2.691   -24.728  1.00 37.35 ? 229 CYS B C     1 
ATOM   4558  O  O     . CYS B  1 248 ? -31.619  2.652   -25.729  1.00 37.05 ? 229 CYS B O     1 
ATOM   4559  C  CB    . CYS B  1 248 ? -29.215  4.541   -24.528  1.00 36.96 ? 229 CYS B CB    1 
ATOM   4560  S  SG    . CYS B  1 248 ? -28.894  6.277   -24.063  1.00 39.47 ? 229 CYS B SG    1 
ATOM   4561  N  N     . GLU B  1 249 ? -30.372  1.618   -24.183  1.00 37.31 ? 230 GLU B N     1 
ATOM   4562  C  CA    . GLU B  1 249 ? -30.606  0.302   -24.672  1.00 37.99 ? 230 GLU B CA    1 
ATOM   4563  C  C     . GLU B  1 249 ? -32.076  0.014   -24.729  1.00 37.99 ? 230 GLU B C     1 
ATOM   4564  O  O     . GLU B  1 249 ? -32.530  -0.493  -25.734  1.00 38.15 ? 230 GLU B O     1 
ATOM   4565  C  CB    . GLU B  1 249 ? -29.917  -0.731  -23.781  1.00 38.00 ? 230 GLU B CB    1 
ATOM   4566  C  CG    . GLU B  1 249 ? -29.770  -2.066  -24.438  1.00 38.98 ? 230 GLU B CG    1 
ATOM   4567  C  CD    . GLU B  1 249 ? -29.201  -3.098  -23.493  1.00 40.11 ? 230 GLU B CD    1 
ATOM   4568  O  OE1   . GLU B  1 249 ? -27.999  -3.007  -23.118  1.00 40.72 ? 230 GLU B OE1   1 
ATOM   4569  O  OE2   . GLU B  1 249 ? -29.983  -4.006  -23.138  1.00 45.73 ? 230 GLU B OE2   1 
ATOM   4570  N  N     . ASP B  1 250 ? -32.825  0.355   -23.676  1.00 38.18 ? 231 ASP B N     1 
ATOM   4571  C  CA    . ASP B  1 250 ? -34.294  0.185   -23.688  1.00 38.28 ? 231 ASP B CA    1 
ATOM   4572  C  C     . ASP B  1 250 ? -34.991  0.959   -24.799  1.00 38.36 ? 231 ASP B C     1 
ATOM   4573  O  O     . ASP B  1 250 ? -36.045  0.541   -25.276  1.00 39.11 ? 231 ASP B O     1 
ATOM   4574  C  CB    . ASP B  1 250 ? -34.929  0.649   -22.366  1.00 38.74 ? 231 ASP B CB    1 
ATOM   4575  C  CG    . ASP B  1 250 ? -34.587  -0.251  -21.160  1.00 39.90 ? 231 ASP B CG    1 
ATOM   4576  O  OD1   . ASP B  1 250 ? -33.908  -1.302  -21.328  1.00 38.91 ? 231 ASP B OD1   1 
ATOM   4577  O  OD2   . ASP B  1 250 ? -34.987  0.146   -20.031  1.00 40.22 ? 231 ASP B OD2   1 
ATOM   4578  N  N     . PHE B  1 251 ? -34.456  2.133   -25.133  1.00 38.28 ? 232 PHE B N     1 
ATOM   4579  C  CA    . PHE B  1 251 ? -35.037  3.025   -26.141  1.00 37.75 ? 232 PHE B CA    1 
ATOM   4580  C  C     . PHE B  1 251 ? -34.468  2.766   -27.537  1.00 38.03 ? 232 PHE B C     1 
ATOM   4581  O  O     . PHE B  1 251 ? -34.778  3.502   -28.484  1.00 37.77 ? 232 PHE B O     1 
ATOM   4582  C  CB    . PHE B  1 251 ? -34.753  4.487   -25.789  1.00 37.86 ? 232 PHE B CB    1 
ATOM   4583  C  CG    . PHE B  1 251 ? -35.573  5.011   -24.640  1.00 37.48 ? 232 PHE B CG    1 
ATOM   4584  C  CD1   . PHE B  1 251 ? -36.837  5.533   -24.859  1.00 35.92 ? 232 PHE B CD1   1 
ATOM   4585  C  CD2   . PHE B  1 251 ? -35.058  4.999   -23.342  1.00 37.68 ? 232 PHE B CD2   1 
ATOM   4586  C  CE1   . PHE B  1 251 ? -37.581  6.021   -23.801  1.00 37.97 ? 232 PHE B CE1   1 
ATOM   4587  C  CE2   . PHE B  1 251 ? -35.791  5.466   -22.290  1.00 37.53 ? 232 PHE B CE2   1 
ATOM   4588  C  CZ    . PHE B  1 251 ? -37.057  5.991   -22.506  1.00 37.66 ? 232 PHE B CZ    1 
ATOM   4589  N  N     . GLY B  1 252 ? -33.631  1.730   -27.663  1.00 38.05 ? 233 GLY B N     1 
ATOM   4590  C  CA    . GLY B  1 252 ? -33.055  1.356   -28.948  1.00 37.77 ? 233 GLY B CA    1 
ATOM   4591  C  C     . GLY B  1 252 ? -32.128  2.411   -29.511  1.00 38.18 ? 233 GLY B C     1 
ATOM   4592  O  O     . GLY B  1 252 ? -32.046  2.565   -30.718  1.00 38.51 ? 233 GLY B O     1 
ATOM   4593  N  N     . VAL B  1 253 ? -31.435  3.155   -28.641  1.00 38.24 ? 234 VAL B N     1 
ATOM   4594  C  CA    . VAL B  1 253 ? -30.457  4.129   -29.106  1.00 38.28 ? 234 VAL B CA    1 
ATOM   4595  C  C     . VAL B  1 253 ? -29.113  3.937   -28.368  1.00 38.40 ? 234 VAL B C     1 
ATOM   4596  O  O     . VAL B  1 253 ? -29.037  3.104   -27.463  1.00 37.93 ? 234 VAL B O     1 
ATOM   4597  C  CB    . VAL B  1 253 ? -31.027  5.581   -29.064  1.00 38.27 ? 234 VAL B CB    1 
ATOM   4598  C  CG1   . VAL B  1 253 ? -32.309  5.626   -29.879  1.00 38.19 ? 234 VAL B CG1   1 
ATOM   4599  C  CG2   . VAL B  1 253 ? -31.255  6.054   -27.638  1.00 37.04 ? 234 VAL B CG2   1 
ATOM   4600  N  N     . ILE B  1 254 ? -28.083  4.670   -28.810  1.00 38.36 ? 235 ILE B N     1 
ATOM   4601  C  CA    . ILE B  1 254 ? -26.701  4.520   -28.339  1.00 39.46 ? 235 ILE B CA    1 
ATOM   4602  C  C     . ILE B  1 254 ? -26.355  5.876   -27.813  1.00 39.02 ? 235 ILE B C     1 
ATOM   4603  O  O     . ILE B  1 254 ? -26.764  6.876   -28.438  1.00 38.20 ? 235 ILE B O     1 
ATOM   4604  C  CB    . ILE B  1 254 ? -25.741  4.193   -29.542  1.00 40.18 ? 235 ILE B CB    1 
ATOM   4605  C  CG1   . ILE B  1 254 ? -25.730  2.711   -29.852  1.00 42.68 ? 235 ILE B CG1   1 
ATOM   4606  C  CG2   . ILE B  1 254 ? -24.315  4.569   -29.338  1.00 38.56 ? 235 ILE B CG2   1 
ATOM   4607  C  CD1   . ILE B  1 254 ? -25.201  2.492   -31.282  1.00 42.95 ? 235 ILE B CD1   1 
ATOM   4608  N  N     . ALA B  1 255 ? -25.659  5.901   -26.666  1.00 38.32 ? 236 ALA B N     1 
ATOM   4609  C  CA    . ALA B  1 255 ? -24.982  7.104   -26.166  1.00 38.54 ? 236 ALA B CA    1 
ATOM   4610  C  C     . ALA B  1 255 ? -23.499  7.004   -26.510  1.00 38.50 ? 236 ALA B C     1 
ATOM   4611  O  O     . ALA B  1 255 ? -22.855  6.015   -26.219  1.00 38.15 ? 236 ALA B O     1 
ATOM   4612  C  CB    . ALA B  1 255 ? -25.162  7.264   -24.654  1.00 38.04 ? 236 ALA B CB    1 
ATOM   4613  N  N     . THR B  1 256 ? -22.960  8.016   -27.175  1.00 39.10 ? 237 THR B N     1 
ATOM   4614  C  CA    . THR B  1 256 ? -21.526  8.027   -27.499  1.00 38.74 ? 237 THR B CA    1 
ATOM   4615  C  C     . THR B  1 256 ? -20.902  9.104   -26.620  1.00 38.65 ? 237 THR B C     1 
ATOM   4616  O  O     . THR B  1 256 ? -21.470  10.183  -26.467  1.00 38.17 ? 237 THR B O     1 
ATOM   4617  C  CB    . THR B  1 256 ? -21.246  8.328   -29.009  1.00 38.40 ? 237 THR B CB    1 
ATOM   4618  O  OG1   . THR B  1 256 ? -19.845  8.213   -29.257  1.00 38.43 ? 237 THR B OG1   1 
ATOM   4619  C  CG2   . THR B  1 256 ? -21.676  9.772   -29.390  1.00 38.12 ? 237 THR B CG2   1 
ATOM   4620  N  N     . PHE B  1 257 ? -19.768  8.762   -26.012  1.00 39.12 ? 238 PHE B N     1 
ATOM   4621  C  CA    . PHE B  1 257 ? -18.927  9.703   -25.254  1.00 39.15 ? 238 PHE B CA    1 
ATOM   4622  C  C     . PHE B  1 257 ? -17.719  10.134  -26.069  1.00 39.44 ? 238 PHE B C     1 
ATOM   4623  O  O     . PHE B  1 257 ? -16.773  10.679  -25.504  1.00 39.06 ? 238 PHE B O     1 
ATOM   4624  C  CB    . PHE B  1 257 ? -18.442  9.087   -23.952  1.00 38.89 ? 238 PHE B CB    1 
ATOM   4625  C  CG    . PHE B  1 257 ? -19.555  8.683   -22.998  1.00 39.94 ? 238 PHE B CG    1 
ATOM   4626  C  CD1   . PHE B  1 257 ? -20.717  9.420   -22.882  1.00 39.89 ? 238 PHE B CD1   1 
ATOM   4627  C  CD2   . PHE B  1 257 ? -19.429  7.550   -22.214  1.00 40.02 ? 238 PHE B CD2   1 
ATOM   4628  C  CE1   . PHE B  1 257 ? -21.721  9.029   -22.002  1.00 39.78 ? 238 PHE B CE1   1 
ATOM   4629  C  CE2   . PHE B  1 257 ? -20.433  7.160   -21.340  1.00 40.61 ? 238 PHE B CE2   1 
ATOM   4630  C  CZ    . PHE B  1 257 ? -21.571  7.896   -21.229  1.00 39.36 ? 238 PHE B CZ    1 
ATOM   4631  N  N     . ASP B  1 258 ? -17.748  9.901   -27.392  1.00 39.61 ? 239 ASP B N     1 
ATOM   4632  C  CA    . ASP B  1 258 ? -16.664  10.370  -28.247  1.00 39.64 ? 239 ASP B CA    1 
ATOM   4633  C  C     . ASP B  1 258 ? -16.626  11.897  -28.247  1.00 40.06 ? 239 ASP B C     1 
ATOM   4634  O  O     . ASP B  1 258 ? -17.674  12.556  -28.355  1.00 40.33 ? 239 ASP B O     1 
ATOM   4635  C  CB    . ASP B  1 258 ? -16.846  9.890   -29.676  1.00 40.00 ? 239 ASP B CB    1 
ATOM   4636  C  CG    . ASP B  1 258 ? -15.699  10.281  -30.533  1.00 40.79 ? 239 ASP B CG    1 
ATOM   4637  O  OD1   . ASP B  1 258 ? -14.692  9.522   -30.540  1.00 44.14 ? 239 ASP B OD1   1 
ATOM   4638  O  OD2   . ASP B  1 258 ? -15.760  11.379  -31.102  1.00 41.72 ? 239 ASP B OD2   1 
ATOM   4639  N  N     . PRO B  1 259 ? -15.435  12.474  -28.090  1.00 39.84 ? 240 PRO B N     1 
ATOM   4640  C  CA    . PRO B  1 259 ? -15.385  13.922  -27.919  1.00 39.70 ? 240 PRO B CA    1 
ATOM   4641  C  C     . PRO B  1 259 ? -15.687  14.729  -29.148  1.00 39.94 ? 240 PRO B C     1 
ATOM   4642  O  O     . PRO B  1 259 ? -15.856  15.942  -29.019  1.00 40.45 ? 240 PRO B O     1 
ATOM   4643  C  CB    . PRO B  1 259 ? -13.947  14.192  -27.508  1.00 39.79 ? 240 PRO B CB    1 
ATOM   4644  C  CG    . PRO B  1 259 ? -13.184  12.979  -27.880  1.00 39.63 ? 240 PRO B CG    1 
ATOM   4645  C  CD    . PRO B  1 259 ? -14.118  11.839  -27.976  1.00 39.96 ? 240 PRO B CD    1 
ATOM   4646  N  N     . LYS B  1 260 ? -15.704  14.106  -30.322  1.00 39.39 ? 241 LYS B N     1 
ATOM   4647  C  CA    . LYS B  1 260 ? -16.034  14.842  -31.519  1.00 39.60 ? 241 LYS B CA    1 
ATOM   4648  C  C     . LYS B  1 260 ? -16.775  13.942  -32.480  1.00 39.78 ? 241 LYS B C     1 
ATOM   4649  O  O     . LYS B  1 260 ? -16.275  13.566  -33.506  1.00 40.21 ? 241 LYS B O     1 
ATOM   4650  C  CB    . LYS B  1 260 ? -14.784  15.449  -32.152  1.00 39.78 ? 241 LYS B CB    1 
ATOM   4651  C  CG    . LYS B  1 260 ? -15.064  16.540  -33.222  1.00 39.07 ? 241 LYS B CG    1 
ATOM   4652  C  CD    . LYS B  1 260 ? -15.469  17.860  -32.603  1.00 37.85 ? 241 LYS B CD    1 
ATOM   4653  C  CE    . LYS B  1 260 ? -15.684  18.874  -33.695  1.00 39.40 ? 241 LYS B CE    1 
ATOM   4654  N  NZ    . LYS B  1 260 ? -15.905  20.294  -33.262  1.00 39.62 ? 241 LYS B NZ    1 
ATOM   4655  N  N     . PRO B  1 261 ? -18.004  13.592  -32.144  1.00 40.61 ? 242 PRO B N     1 
ATOM   4656  C  CA    . PRO B  1 261 ? -18.667  12.544  -32.923  1.00 40.48 ? 242 PRO B CA    1 
ATOM   4657  C  C     . PRO B  1 261 ? -18.999  12.984  -34.348  1.00 40.80 ? 242 PRO B C     1 
ATOM   4658  O  O     . PRO B  1 261 ? -19.154  12.145  -35.237  1.00 41.18 ? 242 PRO B O     1 
ATOM   4659  C  CB    . PRO B  1 261 ? -19.956  12.332  -32.144  1.00 40.84 ? 242 PRO B CB    1 
ATOM   4660  C  CG    . PRO B  1 261 ? -20.235  13.721  -31.528  1.00 39.78 ? 242 PRO B CG    1 
ATOM   4661  C  CD    . PRO B  1 261 ? -18.877  14.157  -31.092  1.00 40.19 ? 242 PRO B CD    1 
ATOM   4662  N  N     . ILE B  1 262 ? -19.159  14.285  -34.551  1.00 40.87 ? 243 ILE B N     1 
ATOM   4663  C  CA    . ILE B  1 262 ? -19.479  14.805  -35.875  1.00 41.38 ? 243 ILE B CA    1 
ATOM   4664  C  C     . ILE B  1 262 ? -18.506  15.942  -36.154  1.00 41.83 ? 243 ILE B C     1 
ATOM   4665  O  O     . ILE B  1 262 ? -18.545  16.988  -35.482  1.00 41.37 ? 243 ILE B O     1 
ATOM   4666  C  CB    . ILE B  1 262 ? -20.931  15.325  -36.019  1.00 41.06 ? 243 ILE B CB    1 
ATOM   4667  C  CG1   . ILE B  1 262 ? -21.946  14.273  -35.559  1.00 40.60 ? 243 ILE B CG1   1 
ATOM   4668  C  CG2   . ILE B  1 262 ? -21.209  15.679  -37.468  1.00 40.28 ? 243 ILE B CG2   1 
ATOM   4669  C  CD1   . ILE B  1 262 ? -22.216  13.171  -36.585  1.00 37.32 ? 243 ILE B CD1   1 
ATOM   4670  N  N     . PRO B  1 263 ? -17.626  15.724  -37.140  1.00 42.09 ? 244 PRO B N     1 
ATOM   4671  C  CA    . PRO B  1 263 ? -16.641  16.710  -37.500  1.00 42.32 ? 244 PRO B CA    1 
ATOM   4672  C  C     . PRO B  1 263 ? -17.290  17.921  -38.134  1.00 42.44 ? 244 PRO B C     1 
ATOM   4673  O  O     . PRO B  1 263 ? -18.402  17.838  -38.630  1.00 42.74 ? 244 PRO B O     1 
ATOM   4674  C  CB    . PRO B  1 263 ? -15.738  15.984  -38.503  1.00 42.13 ? 244 PRO B CB    1 
ATOM   4675  C  CG    . PRO B  1 263 ? -16.407  14.752  -38.853  1.00 42.64 ? 244 PRO B CG    1 
ATOM   4676  C  CD    . PRO B  1 263 ? -17.551  14.509  -37.967  1.00 42.09 ? 244 PRO B CD    1 
ATOM   4677  N  N     . GLY B  1 264 ? -16.585  19.042  -38.077  1.00 42.79 ? 245 GLY B N     1 
ATOM   4678  C  CA    . GLY B  1 264 ? -17.024  20.274  -38.694  1.00 42.80 ? 245 GLY B CA    1 
ATOM   4679  C  C     . GLY B  1 264 ? -17.642  21.239  -37.696  1.00 43.44 ? 245 GLY B C     1 
ATOM   4680  O  O     . GLY B  1 264 ? -17.246  21.297  -36.513  1.00 43.02 ? 245 GLY B O     1 
ATOM   4681  N  N     . ASN B  1 265 ? -18.629  21.993  -38.183  1.00 43.64 ? 246 ASN B N     1 
ATOM   4682  C  CA    . ASN B  1 265 ? -19.180  23.073  -37.420  1.00 43.33 ? 246 ASN B CA    1 
ATOM   4683  C  C     . ASN B  1 265 ? -20.216  22.563  -36.417  1.00 43.14 ? 246 ASN B C     1 
ATOM   4684  O  O     . ASN B  1 265 ? -21.377  22.997  -36.429  1.00 44.04 ? 246 ASN B O     1 
ATOM   4685  C  CB    . ASN B  1 265 ? -19.758  24.157  -38.353  1.00 43.60 ? 246 ASN B CB    1 
ATOM   4686  C  CG    . ASN B  1 265 ? -20.116  25.438  -37.587  1.00 45.01 ? 246 ASN B CG    1 
ATOM   4687  O  OD1   . ASN B  1 265 ? -19.581  25.675  -36.494  1.00 46.14 ? 246 ASN B OD1   1 
ATOM   4688  N  ND2   . ASN B  1 265 ? -21.067  26.226  -38.111  1.00 47.16 ? 246 ASN B ND2   1 
ATOM   4689  N  N     . TRP B  1 266 ? -19.798  21.643  -35.551  1.00 41.94 ? 247 TRP B N     1 
ATOM   4690  C  CA    . TRP B  1 266 ? -20.673  21.055  -34.542  1.00 41.68 ? 247 TRP B CA    1 
ATOM   4691  C  C     . TRP B  1 266 ? -19.917  20.874  -33.251  1.00 41.63 ? 247 TRP B C     1 
ATOM   4692  O  O     . TRP B  1 266 ? -18.780  20.446  -33.265  1.00 41.98 ? 247 TRP B O     1 
ATOM   4693  C  CB    . TRP B  1 266 ? -21.203  19.703  -35.011  1.00 41.03 ? 247 TRP B CB    1 
ATOM   4694  C  CG    . TRP B  1 266 ? -21.931  19.808  -36.305  1.00 40.88 ? 247 TRP B CG    1 
ATOM   4695  C  CD1   . TRP B  1 266 ? -21.443  19.526  -37.545  1.00 40.28 ? 247 TRP B CD1   1 
ATOM   4696  C  CD2   . TRP B  1 266 ? -23.285  20.266  -36.492  1.00 39.90 ? 247 TRP B CD2   1 
ATOM   4697  N  NE1   . TRP B  1 266 ? -22.418  19.772  -38.491  1.00 40.45 ? 247 TRP B NE1   1 
ATOM   4698  C  CE2   . TRP B  1 266 ? -23.549  20.229  -37.865  1.00 39.57 ? 247 TRP B CE2   1 
ATOM   4699  C  CE3   . TRP B  1 266 ? -24.290  20.694  -35.622  1.00 39.44 ? 247 TRP B CE3   1 
ATOM   4700  C  CZ2   . TRP B  1 266 ? -24.772  20.613  -38.392  1.00 40.38 ? 247 TRP B CZ2   1 
ATOM   4701  C  CZ3   . TRP B  1 266 ? -25.490  21.075  -36.136  1.00 40.26 ? 247 TRP B CZ3   1 
ATOM   4702  C  CH2   . TRP B  1 266 ? -25.729  21.045  -37.508  1.00 40.53 ? 247 TRP B CH2   1 
ATOM   4703  N  N     . ASN B  1 267 ? -20.539  21.159  -32.112  1.00 42.03 ? 248 ASN B N     1 
ATOM   4704  C  CA    . ASN B  1 267 ? -19.783  21.104  -30.869  1.00 42.04 ? 248 ASN B CA    1 
ATOM   4705  C  C     . ASN B  1 267 ? -19.304  19.687  -30.611  1.00 42.31 ? 248 ASN B C     1 
ATOM   4706  O  O     . ASN B  1 267 ? -19.881  18.726  -31.079  1.00 43.12 ? 248 ASN B O     1 
ATOM   4707  C  CB    . ASN B  1 267 ? -20.588  21.614  -29.674  1.00 42.09 ? 248 ASN B CB    1 
ATOM   4708  C  CG    . ASN B  1 267 ? -20.533  23.144  -29.510  1.00 40.91 ? 248 ASN B CG    1 
ATOM   4709  O  OD1   . ASN B  1 267 ? -20.499  23.894  -30.506  1.00 39.14 ? 248 ASN B OD1   1 
ATOM   4710  N  ND2   . ASN B  1 267 ? -20.577  23.612  -28.238  1.00 36.88 ? 248 ASN B ND2   1 
ATOM   4711  N  N     . GLY B  1 268 ? -18.217  19.574  -29.880  1.00 42.42 ? 249 GLY B N     1 
ATOM   4712  C  CA    . GLY B  1 268 ? -17.777  18.295  -29.371  1.00 42.07 ? 249 GLY B CA    1 
ATOM   4713  C  C     . GLY B  1 268 ? -18.277  18.120  -27.953  1.00 42.17 ? 249 GLY B C     1 
ATOM   4714  O  O     . GLY B  1 268 ? -18.987  18.990  -27.393  1.00 42.31 ? 249 GLY B O     1 
ATOM   4715  N  N     . ALA B  1 269 ? -17.872  16.996  -27.370  1.00 41.58 ? 250 ALA B N     1 
ATOM   4716  C  CA    . ALA B  1 269 ? -18.379  16.549  -26.096  1.00 41.14 ? 250 ALA B CA    1 
ATOM   4717  C  C     . ALA B  1 269 ? -17.254  16.476  -25.054  1.00 40.86 ? 250 ALA B C     1 
ATOM   4718  O  O     . ALA B  1 269 ? -16.236  15.826  -25.259  1.00 40.97 ? 250 ALA B O     1 
ATOM   4719  C  CB    . ALA B  1 269 ? -19.034  15.216  -26.273  1.00 40.47 ? 250 ALA B CB    1 
ATOM   4720  N  N     . GLY B  1 270 ? -17.440  17.150  -23.936  1.00 40.41 ? 251 GLY B N     1 
ATOM   4721  C  CA    . GLY B  1 270 ? -16.415  17.172  -22.935  1.00 40.95 ? 251 GLY B CA    1 
ATOM   4722  C  C     . GLY B  1 270 ? -16.893  16.558  -21.640  1.00 41.09 ? 251 GLY B C     1 
ATOM   4723  O  O     . GLY B  1 270 ? -18.024  16.076  -21.557  1.00 40.89 ? 251 GLY B O     1 
ATOM   4724  N  N     . CYS B  1 271 ? -16.019  16.567  -20.634  1.00 40.91 ? 252 CYS B N     1 
ATOM   4725  C  CA    . CYS B  1 271 ? -16.410  16.146  -19.319  1.00 40.50 ? 252 CYS B CA    1 
ATOM   4726  C  C     . CYS B  1 271 ? -15.841  17.088  -18.268  1.00 40.11 ? 252 CYS B C     1 
ATOM   4727  O  O     . CYS B  1 271 ? -14.998  16.701  -17.457  1.00 40.31 ? 252 CYS B O     1 
ATOM   4728  C  CB    . CYS B  1 271 ? -15.998  14.702  -19.094  1.00 40.90 ? 252 CYS B CB    1 
ATOM   4729  S  SG    . CYS B  1 271 ? -16.809  14.055  -17.614  1.00 41.57 ? 252 CYS B SG    1 
ATOM   4730  N  N     . HIS B  1 272 ? -16.313  18.342  -18.307  1.00 39.98 ? 253 HIS B N     1 
ATOM   4731  C  CA    . HIS B  1 272 ? -15.737  19.454  -17.520  1.00 39.13 ? 253 HIS B CA    1 
ATOM   4732  C  C     . HIS B  1 272 ? -15.717  19.007  -16.097  1.00 38.93 ? 253 HIS B C     1 
ATOM   4733  O  O     . HIS B  1 272 ? -16.712  18.553  -15.582  1.00 38.37 ? 253 HIS B O     1 
ATOM   4734  C  CB    . HIS B  1 272 ? -16.546  20.768  -17.603  1.00 38.89 ? 253 HIS B CB    1 
ATOM   4735  C  CG    . HIS B  1 272 ? -16.804  21.259  -18.993  1.00 37.59 ? 253 HIS B CG    1 
ATOM   4736  N  ND1   . HIS B  1 272 ? -17.851  22.109  -19.295  1.00 38.33 ? 253 HIS B ND1   1 
ATOM   4737  C  CD2   . HIS B  1 272 ? -16.202  20.971  -20.169  1.00 36.07 ? 253 HIS B CD2   1 
ATOM   4738  C  CE1   . HIS B  1 272 ? -17.854  22.353  -20.595  1.00 37.01 ? 253 HIS B CE1   1 
ATOM   4739  N  NE2   . HIS B  1 272 ? -16.861  21.678  -21.148  1.00 34.75 ? 253 HIS B NE2   1 
ATOM   4740  N  N     . THR B  1 273 ? -14.562  19.116  -15.463  1.00 39.70 ? 254 THR B N     1 
ATOM   4741  C  CA    . THR B  1 273 ? -14.406  18.673  -14.099  1.00 40.23 ? 254 THR B CA    1 
ATOM   4742  C  C     . THR B  1 273 ? -14.183  19.859  -13.211  1.00 40.55 ? 254 THR B C     1 
ATOM   4743  O  O     . THR B  1 273 ? -13.175  20.541  -13.329  1.00 40.47 ? 254 THR B O     1 
ATOM   4744  C  CB    . THR B  1 273 ? -13.276  17.679  -13.992  1.00 40.09 ? 254 THR B CB    1 
ATOM   4745  O  OG1   . THR B  1 273 ? -13.610  16.580  -14.844  1.00 38.80 ? 254 THR B OG1   1 
ATOM   4746  C  CG2   . THR B  1 273 ? -13.105  17.187  -12.531  1.00 39.46 ? 254 THR B CG2   1 
ATOM   4747  N  N     . ASN B  1 274 ? -15.176  20.115  -12.364  1.00 40.95 ? 255 ASN B N     1 
ATOM   4748  C  CA    . ASN B  1 274 ? -15.115  21.154  -11.349  1.00 41.22 ? 255 ASN B CA    1 
ATOM   4749  C  C     . ASN B  1 274 ? -14.521  20.575  -10.074  1.00 41.73 ? 255 ASN B C     1 
ATOM   4750  O  O     . ASN B  1 274 ? -14.753  19.429  -9.716   1.00 41.92 ? 255 ASN B O     1 
ATOM   4751  C  CB    . ASN B  1 274 ? -16.524  21.731  -11.070  1.00 41.14 ? 255 ASN B CB    1 
ATOM   4752  C  CG    . ASN B  1 274 ? -17.196  22.264  -12.318  1.00 40.98 ? 255 ASN B CG    1 
ATOM   4753  O  OD1   . ASN B  1 274 ? -17.179  23.463  -12.600  1.00 38.77 ? 255 ASN B OD1   1 
ATOM   4754  N  ND2   . ASN B  1 274 ? -17.804  21.373  -13.066  1.00 41.23 ? 255 ASN B ND2   1 
ATOM   4755  N  N     . PHE B  1 275 ? -13.801  21.409  -9.359   1.00 42.91 ? 256 PHE B N     1 
ATOM   4756  C  CA    . PHE B  1 275 ? -12.931  20.967  -8.295   1.00 43.88 ? 256 PHE B CA    1 
ATOM   4757  C  C     . PHE B  1 275 ? -12.758  22.034  -7.202   1.00 44.69 ? 256 PHE B C     1 
ATOM   4758  O  O     . PHE B  1 275 ? -12.610  23.247  -7.464   1.00 45.00 ? 256 PHE B O     1 
ATOM   4759  C  CB    . PHE B  1 275 ? -11.600  20.589  -8.908   1.00 43.71 ? 256 PHE B CB    1 
ATOM   4760  C  CG    . PHE B  1 275 ? -10.560  20.203  -7.920   1.00 43.82 ? 256 PHE B CG    1 
ATOM   4761  C  CD1   . PHE B  1 275 ? -10.834  19.292  -6.930   1.00 43.71 ? 256 PHE B CD1   1 
ATOM   4762  C  CD2   . PHE B  1 275 ? -9.287   20.725  -8.015   1.00 45.28 ? 256 PHE B CD2   1 
ATOM   4763  C  CE1   . PHE B  1 275 ? -9.892   18.928  -6.038   1.00 44.69 ? 256 PHE B CE1   1 
ATOM   4764  C  CE2   . PHE B  1 275 ? -8.319   20.381  -7.101   1.00 45.81 ? 256 PHE B CE2   1 
ATOM   4765  C  CZ    . PHE B  1 275 ? -8.622   19.468  -6.096   1.00 44.59 ? 256 PHE B CZ    1 
ATOM   4766  N  N     . SER B  1 276 ? -12.850  21.578  -5.964   1.00 45.56 ? 257 SER B N     1 
ATOM   4767  C  CA    . SER B  1 276 ? -12.537  22.423  -4.803   1.00 45.60 ? 257 SER B CA    1 
ATOM   4768  C  C     . SER B  1 276 ? -11.982  21.580  -3.681   1.00 46.45 ? 257 SER B C     1 
ATOM   4769  O  O     . SER B  1 276 ? -12.231  20.382  -3.574   1.00 47.33 ? 257 SER B O     1 
ATOM   4770  C  CB    . SER B  1 276 ? -13.757  23.204  -4.307   1.00 45.26 ? 257 SER B CB    1 
ATOM   4771  O  OG    . SER B  1 276 ? -14.768  22.347  -3.837   1.00 43.69 ? 257 SER B OG    1 
ATOM   4772  N  N     . THR B  1 277 ? -11.205  22.224  -2.853   1.00 47.47 ? 258 THR B N     1 
ATOM   4773  C  CA    . THR B  1 277 ? -10.845  21.663  -1.565   1.00 48.19 ? 258 THR B CA    1 
ATOM   4774  C  C     . THR B  1 277 ? -11.585  22.496  -0.547   1.00 48.28 ? 258 THR B C     1 
ATOM   4775  O  O     . THR B  1 277 ? -12.185  23.531  -0.905   1.00 47.92 ? 258 THR B O     1 
ATOM   4776  C  CB    . THR B  1 277 ? -9.330   21.794  -1.334   1.00 47.87 ? 258 THR B CB    1 
ATOM   4777  O  OG1   . THR B  1 277 ? -8.961   23.169  -1.541   1.00 47.63 ? 258 THR B OG1   1 
ATOM   4778  C  CG2   . THR B  1 277 ? -8.579   20.881  -2.314   1.00 47.13 ? 258 THR B CG2   1 
ATOM   4779  N  N     . LYS B  1 278 ? -11.514  22.050  0.707    1.00 49.18 ? 259 LYS B N     1 
ATOM   4780  C  CA    . LYS B  1 278 ? -12.100  22.774  1.818    1.00 49.56 ? 259 LYS B CA    1 
ATOM   4781  C  C     . LYS B  1 278 ? -11.567  24.196  1.855    1.00 48.88 ? 259 LYS B C     1 
ATOM   4782  O  O     . LYS B  1 278 ? -12.323  25.124  2.047    1.00 49.16 ? 259 LYS B O     1 
ATOM   4783  C  CB    . LYS B  1 278 ? -11.818  22.084  3.150    1.00 50.47 ? 259 LYS B CB    1 
ATOM   4784  C  CG    . LYS B  1 278 ? -12.676  22.640  4.317    1.00 51.50 ? 259 LYS B CG    1 
ATOM   4785  C  CD    . LYS B  1 278 ? -12.042  22.388  5.724    1.00 52.64 ? 259 LYS B CD    1 
ATOM   4786  C  CE    . LYS B  1 278 ? -13.153  22.604  6.863    1.00 55.10 ? 259 LYS B CE    1 
ATOM   4787  N  NZ    . LYS B  1 278 ? -12.660  22.707  8.328    1.00 54.86 ? 259 LYS B NZ    1 
ATOM   4788  N  N     . ALA B  1 279 ? -10.273  24.366  1.640    1.00 48.66 ? 260 ALA B N     1 
ATOM   4789  C  CA    . ALA B  1 279 ? -9.670   25.702  1.693    1.00 48.70 ? 260 ALA B CA    1 
ATOM   4790  C  C     . ALA B  1 279 ? -10.231  26.613  0.570    1.00 49.14 ? 260 ALA B C     1 
ATOM   4791  O  O     . ALA B  1 279 ? -10.471  27.786  0.806    1.00 49.84 ? 260 ALA B O     1 
ATOM   4792  C  CB    . ALA B  1 279 ? -8.130   25.608  1.637    1.00 47.16 ? 260 ALA B CB    1 
ATOM   4793  N  N     . MET B  1 280 ? -10.463  26.064  -0.631   1.00 49.17 ? 261 MET B N     1 
ATOM   4794  C  CA    . MET B  1 280 ? -11.080  26.827  -1.719   1.00 49.12 ? 261 MET B CA    1 
ATOM   4795  C  C     . MET B  1 280 ? -12.523  27.201  -1.436   1.00 49.73 ? 261 MET B C     1 
ATOM   4796  O  O     . MET B  1 280 ? -13.011  28.175  -2.005   1.00 50.03 ? 261 MET B O     1 
ATOM   4797  C  CB    . MET B  1 280 ? -11.053  26.054  -3.028   1.00 48.92 ? 261 MET B CB    1 
ATOM   4798  C  CG    . MET B  1 280 ? -9.665   25.825  -3.521   1.00 48.72 ? 261 MET B CG    1 
ATOM   4799  S  SD    . MET B  1 280 ? -9.497   24.720  -4.913   1.00 47.48 ? 261 MET B SD    1 
ATOM   4800  C  CE    . MET B  1 280 ? -7.856   24.126  -4.610   1.00 46.14 ? 261 MET B CE    1 
ATOM   4801  N  N     . ARG B  1 281 ? -13.207  26.438  -0.582   1.00 50.26 ? 262 ARG B N     1 
ATOM   4802  C  CA    . ARG B  1 281 ? -14.633  26.699  -0.281   1.00 50.56 ? 262 ARG B CA    1 
ATOM   4803  C  C     . ARG B  1 281 ? -14.847  27.684  0.843    1.00 50.76 ? 262 ARG B C     1 
ATOM   4804  O  O     . ARG B  1 281 ? -15.903  28.237  0.934    1.00 49.93 ? 262 ARG B O     1 
ATOM   4805  C  CB    . ARG B  1 281 ? -15.366  25.400  0.058    1.00 50.24 ? 262 ARG B CB    1 
ATOM   4806  C  CG    . ARG B  1 281 ? -15.345  24.428  -1.087   1.00 49.59 ? 262 ARG B CG    1 
ATOM   4807  C  CD    . ARG B  1 281 ? -16.281  23.285  -0.889   1.00 49.92 ? 262 ARG B CD    1 
ATOM   4808  N  NE    . ARG B  1 281 ? -15.828  22.333  0.111    1.00 47.76 ? 262 ARG B NE    1 
ATOM   4809  C  CZ    . ARG B  1 281 ? -14.993  21.343  -0.113   1.00 47.04 ? 262 ARG B CZ    1 
ATOM   4810  N  NH1   . ARG B  1 281 ? -14.476  21.145  -1.314   1.00 48.10 ? 262 ARG B NH1   1 
ATOM   4811  N  NH2   . ARG B  1 281 ? -14.684  20.534  0.878    1.00 48.49 ? 262 ARG B NH2   1 
ATOM   4812  N  N     . GLU B  1 282 ? -13.840  27.905  1.688    1.00 52.45 ? 263 GLU B N     1 
ATOM   4813  C  CA    . GLU B  1 282 ? -13.934  28.872  2.799    1.00 53.46 ? 263 GLU B CA    1 
ATOM   4814  C  C     . GLU B  1 282 ? -13.806  30.332  2.314    1.00 54.23 ? 263 GLU B C     1 
ATOM   4815  O  O     . GLU B  1 282 ? -13.530  30.555  1.128    1.00 54.43 ? 263 GLU B O     1 
ATOM   4816  C  CB    . GLU B  1 282 ? -12.873  28.537  3.849    1.00 53.49 ? 263 GLU B CB    1 
ATOM   4817  C  CG    . GLU B  1 282 ? -13.382  27.472  4.817    1.00 55.03 ? 263 GLU B CG    1 
ATOM   4818  C  CD    . GLU B  1 282 ? -12.299  26.711  5.557    1.00 54.72 ? 263 GLU B CD    1 
ATOM   4819  O  OE1   . GLU B  1 282 ? -11.126  27.077  5.469    1.00 57.24 ? 263 GLU B OE1   1 
ATOM   4820  O  OE2   . GLU B  1 282 ? -12.630  25.707  6.221    1.00 57.78 ? 263 GLU B OE2   1 
ATOM   4821  N  N     . GLU B  1 283 ? -14.010  31.321  3.207    1.00 55.00 ? 264 GLU B N     1 
ATOM   4822  C  CA    . GLU B  1 283 ? -13.883  32.754  2.818    1.00 55.20 ? 264 GLU B CA    1 
ATOM   4823  C  C     . GLU B  1 283 ? -12.521  32.956  2.172    1.00 54.80 ? 264 GLU B C     1 
ATOM   4824  O  O     . GLU B  1 283 ? -11.538  32.417  2.636    1.00 53.82 ? 264 GLU B O     1 
ATOM   4825  C  CB    . GLU B  1 283 ? -14.083  33.759  3.981    1.00 55.51 ? 264 GLU B CB    1 
ATOM   4826  C  CG    . GLU B  1 283 ? -15.547  33.917  4.500    1.00 58.91 ? 264 GLU B CG    1 
ATOM   4827  C  CD    . GLU B  1 283 ? -16.643  34.126  3.395    1.00 63.33 ? 264 GLU B CD    1 
ATOM   4828  O  OE1   . GLU B  1 283 ? -16.677  35.174  2.708    1.00 65.57 ? 264 GLU B OE1   1 
ATOM   4829  O  OE2   . GLU B  1 283 ? -17.515  33.237  3.236    1.00 66.25 ? 264 GLU B OE2   1 
ATOM   4830  N  N     . ASN B  1 284 ? -12.501  33.685  1.062    1.00 54.72 ? 265 ASN B N     1 
ATOM   4831  C  CA    . ASN B  1 284 ? -11.269  33.969  0.335    1.00 55.33 ? 265 ASN B CA    1 
ATOM   4832  C  C     . ASN B  1 284 ? -10.506  32.756  -0.215   1.00 55.09 ? 265 ASN B C     1 
ATOM   4833  O  O     . ASN B  1 284 ? -9.300   32.840  -0.472   1.00 55.02 ? 265 ASN B O     1 
ATOM   4834  C  CB    . ASN B  1 284 ? -10.354  34.896  1.157    1.00 55.53 ? 265 ASN B CB    1 
ATOM   4835  C  CG    . ASN B  1 284 ? -10.922  36.296  1.242    1.00 57.48 ? 265 ASN B CG    1 
ATOM   4836  O  OD1   . ASN B  1 284 ? -11.216  36.805  2.337    1.00 58.45 ? 265 ASN B OD1   1 
ATOM   4837  N  ND2   . ASN B  1 284 ? -11.168  36.901  0.067    1.00 57.33 ? 265 ASN B ND2   1 
ATOM   4838  N  N     . GLY B  1 285 ? -11.228  31.668  -0.475   1.00 54.69 ? 266 GLY B N     1 
ATOM   4839  C  CA    . GLY B  1 285 ? -10.652  30.483  -1.110   1.00 54.63 ? 266 GLY B CA    1 
ATOM   4840  C  C     . GLY B  1 285 ? -10.216  30.652  -2.570   1.00 54.27 ? 266 GLY B C     1 
ATOM   4841  O  O     . GLY B  1 285 ? -9.536   29.789  -3.135   1.00 53.30 ? 266 GLY B O     1 
ATOM   4842  N  N     . LEU B  1 286 ? -10.610  31.772  -3.174   1.00 54.12 ? 267 LEU B N     1 
ATOM   4843  C  CA    . LEU B  1 286 ? -10.089  32.182  -4.466   1.00 54.01 ? 267 LEU B CA    1 
ATOM   4844  C  C     . LEU B  1 286 ? -8.563   32.253  -4.427   1.00 54.03 ? 267 LEU B C     1 
ATOM   4845  O  O     . LEU B  1 286 ? -7.899   31.904  -5.388   1.00 54.20 ? 267 LEU B O     1 
ATOM   4846  C  CB    . LEU B  1 286 ? -10.700  33.527  -4.878   1.00 54.09 ? 267 LEU B CB    1 
ATOM   4847  C  CG    . LEU B  1 286 ? -10.482  34.019  -6.303   1.00 54.10 ? 267 LEU B CG    1 
ATOM   4848  C  CD1   . LEU B  1 286 ? -10.846  32.872  -7.277   1.00 52.05 ? 267 LEU B CD1   1 
ATOM   4849  C  CD2   . LEU B  1 286 ? -11.279  35.315  -6.554   1.00 52.33 ? 267 LEU B CD2   1 
ATOM   4850  N  N     . LYS B  1 287 ? -8.005   32.688  -3.312   1.00 54.26 ? 268 LYS B N     1 
ATOM   4851  C  CA    . LYS B  1 287 ? -6.570   32.642  -3.131   1.00 54.46 ? 268 LYS B CA    1 
ATOM   4852  C  C     . LYS B  1 287 ? -6.036   31.242  -3.521   1.00 54.52 ? 268 LYS B C     1 
ATOM   4853  O  O     . LYS B  1 287 ? -5.105   31.120  -4.336   1.00 53.99 ? 268 LYS B O     1 
ATOM   4854  C  CB    . LYS B  1 287 ? -6.261   32.964  -1.680   1.00 54.67 ? 268 LYS B CB    1 
ATOM   4855  C  CG    . LYS B  1 287 ? -4.794   32.982  -1.312   1.00 55.27 ? 268 LYS B CG    1 
ATOM   4856  C  CD    . LYS B  1 287 ? -4.607   32.797  0.224    1.00 56.59 ? 268 LYS B CD    1 
ATOM   4857  C  CE    . LYS B  1 287 ? -3.282   33.414  0.776    1.00 57.76 ? 268 LYS B CE    1 
ATOM   4858  N  NZ    . LYS B  1 287 ? -2.082   32.540  0.691    1.00 57.66 ? 268 LYS B NZ    1 
ATOM   4859  N  N     . TYR B  1 288 ? -6.660   30.189  -2.971   1.00 54.31 ? 269 TYR B N     1 
ATOM   4860  C  CA    . TYR B  1 288 ? -6.226   28.803  -3.211   1.00 53.75 ? 269 TYR B CA    1 
ATOM   4861  C  C     . TYR B  1 288 ? -6.634   28.262  -4.576   1.00 53.02 ? 269 TYR B C     1 
ATOM   4862  O  O     . TYR B  1 288 ? -5.941   27.423  -5.147   1.00 51.72 ? 269 TYR B O     1 
ATOM   4863  C  CB    . TYR B  1 288 ? -6.731   27.879  -2.109   1.00 54.74 ? 269 TYR B CB    1 
ATOM   4864  C  CG    . TYR B  1 288 ? -6.289   28.303  -0.727   1.00 55.82 ? 269 TYR B CG    1 
ATOM   4865  C  CD1   . TYR B  1 288 ? -4.983   28.136  -0.315   1.00 56.42 ? 269 TYR B CD1   1 
ATOM   4866  C  CD2   . TYR B  1 288 ? -7.184   28.888  0.162    1.00 57.61 ? 269 TYR B CD2   1 
ATOM   4867  C  CE1   . TYR B  1 288 ? -4.568   28.535  0.949    1.00 56.73 ? 269 TYR B CE1   1 
ATOM   4868  C  CE2   . TYR B  1 288 ? -6.784   29.288  1.425    1.00 57.04 ? 269 TYR B CE2   1 
ATOM   4869  C  CZ    . TYR B  1 288 ? -5.470   29.107  1.809    1.00 57.45 ? 269 TYR B CZ    1 
ATOM   4870  O  OH    . TYR B  1 288 ? -5.068   29.502  3.064    1.00 58.00 ? 269 TYR B OH    1 
ATOM   4871  N  N     . ILE B  1 289 ? -7.760   28.744  -5.106   1.00 52.40 ? 270 ILE B N     1 
ATOM   4872  C  CA    . ILE B  1 289 ? -8.100   28.424  -6.472   1.00 52.32 ? 270 ILE B CA    1 
ATOM   4873  C  C     . ILE B  1 289 ? -6.958   28.888  -7.386   1.00 52.45 ? 270 ILE B C     1 
ATOM   4874  O  O     . ILE B  1 289 ? -6.464   28.127  -8.209   1.00 51.63 ? 270 ILE B O     1 
ATOM   4875  C  CB    . ILE B  1 289 ? -9.459   28.996  -6.890   1.00 52.30 ? 270 ILE B CB    1 
ATOM   4876  C  CG1   . ILE B  1 289 ? -10.578  28.300  -6.100   1.00 52.10 ? 270 ILE B CG1   1 
ATOM   4877  C  CG2   . ILE B  1 289 ? -9.717   28.801  -8.393   1.00 50.94 ? 270 ILE B CG2   1 
ATOM   4878  C  CD1   . ILE B  1 289 ? -11.914  29.021  -6.202   1.00 50.78 ? 270 ILE B CD1   1 
ATOM   4879  N  N     . GLU B  1 290 ? -6.523   30.130  -7.207   1.00 52.85 ? 271 GLU B N     1 
ATOM   4880  C  CA    . GLU B  1 290 ? -5.514   30.710  -8.063   1.00 52.92 ? 271 GLU B CA    1 
ATOM   4881  C  C     . GLU B  1 290 ? -4.204   29.969  -7.877   1.00 52.46 ? 271 GLU B C     1 
ATOM   4882  O  O     . GLU B  1 290 ? -3.530   29.668  -8.853   1.00 53.05 ? 271 GLU B O     1 
ATOM   4883  C  CB    . GLU B  1 290 ? -5.402   32.228  -7.854   1.00 52.82 ? 271 GLU B CB    1 
ATOM   4884  C  CG    . GLU B  1 290 ? -6.441   33.027  -8.679   1.00 53.93 ? 271 GLU B CG    1 
ATOM   4885  C  CD    . GLU B  1 290 ? -6.728   34.451  -8.146   1.00 55.62 ? 271 GLU B CD    1 
ATOM   4886  O  OE1   . GLU B  1 290 ? -5.891   34.996  -7.399   1.00 58.45 ? 271 GLU B OE1   1 
ATOM   4887  O  OE2   . GLU B  1 290 ? -7.804   35.037  -8.473   1.00 60.01 ? 271 GLU B OE2   1 
ATOM   4888  N  N     . GLU B  1 291 ? -3.863   29.591  -6.662   1.00 52.24 ? 272 GLU B N     1 
ATOM   4889  C  CA    . GLU B  1 291 ? -2.674   28.739  -6.470   1.00 52.55 ? 272 GLU B CA    1 
ATOM   4890  C  C     . GLU B  1 291 ? -2.758   27.442  -7.272   1.00 51.94 ? 272 GLU B C     1 
ATOM   4891  O  O     . GLU B  1 291 ? -1.738   26.994  -7.826   1.00 52.48 ? 272 GLU B O     1 
ATOM   4892  C  CB    . GLU B  1 291 ? -2.474   28.365  -5.001   1.00 52.41 ? 272 GLU B CB    1 
ATOM   4893  C  CG    . GLU B  1 291 ? -1.890   29.482  -4.142   1.00 55.02 ? 272 GLU B CG    1 
ATOM   4894  C  CD    . GLU B  1 291 ? -1.705   29.091  -2.648   1.00 55.96 ? 272 GLU B CD    1 
ATOM   4895  O  OE1   . GLU B  1 291 ? -1.689   27.843  -2.311   1.00 58.66 ? 272 GLU B OE1   1 
ATOM   4896  O  OE2   . GLU B  1 291 ? -1.577   30.055  -1.834   1.00 56.64 ? 272 GLU B OE2   1 
ATOM   4897  N  N     . ALA B  1 292 ? -3.953   26.831  -7.314   1.00 50.74 ? 273 ALA B N     1 
ATOM   4898  C  CA    . ALA B  1 292 ? -4.131   25.516  -7.943   1.00 50.55 ? 273 ALA B CA    1 
ATOM   4899  C  C     . ALA B  1 292 ? -3.992   25.591  -9.468   1.00 49.56 ? 273 ALA B C     1 
ATOM   4900  O  O     . ALA B  1 292 ? -3.371   24.753  -10.092  1.00 47.93 ? 273 ALA B O     1 
ATOM   4901  C  CB    . ALA B  1 292 ? -5.492   24.870  -7.520   1.00 50.19 ? 273 ALA B CB    1 
ATOM   4902  N  N     . ILE B  1 293 ? -4.563   26.630  -10.043  1.00 49.57 ? 274 ILE B N     1 
ATOM   4903  C  CA    . ILE B  1 293 ? -4.496   26.880  -11.461  1.00 50.30 ? 274 ILE B CA    1 
ATOM   4904  C  C     . ILE B  1 293 ? -3.043   27.127  -11.915  1.00 50.54 ? 274 ILE B C     1 
ATOM   4905  O  O     . ILE B  1 293 ? -2.619   26.654  -12.973  1.00 49.51 ? 274 ILE B O     1 
ATOM   4906  C  CB    . ILE B  1 293 ? -5.408   28.096  -11.838  1.00 50.70 ? 274 ILE B CB    1 
ATOM   4907  C  CG1   . ILE B  1 293 ? -6.901   27.735  -11.609  1.00 50.42 ? 274 ILE B CG1   1 
ATOM   4908  C  CG2   . ILE B  1 293 ? -5.109   28.608  -13.285  1.00 48.87 ? 274 ILE B CG2   1 
ATOM   4909  C  CD1   . ILE B  1 293 ? -7.836   28.933  -11.739  1.00 49.61 ? 274 ILE B CD1   1 
ATOM   4910  N  N     . GLU B  1 294 ? -2.296   27.862  -11.094  1.00 51.26 ? 275 GLU B N     1 
ATOM   4911  C  CA    . GLU B  1 294 ? -0.884   28.115  -11.345  1.00 51.16 ? 275 GLU B CA    1 
ATOM   4912  C  C     . GLU B  1 294 ? -0.110   26.784  -11.415  1.00 50.68 ? 275 GLU B C     1 
ATOM   4913  O  O     . GLU B  1 294 ? 0.689    26.572  -12.337  1.00 50.33 ? 275 GLU B O     1 
ATOM   4914  C  CB    . GLU B  1 294 ? -0.330   29.067  -10.274  1.00 51.96 ? 275 GLU B CB    1 
ATOM   4915  C  CG    . GLU B  1 294 ? 1.197    29.137  -10.164  1.00 53.54 ? 275 GLU B CG    1 
ATOM   4916  C  CD    . GLU B  1 294 ? 1.860    29.946  -11.264  1.00 59.33 ? 275 GLU B CD    1 
ATOM   4917  O  OE1   . GLU B  1 294 ? 1.130    30.685  -12.007  1.00 63.31 ? 275 GLU B OE1   1 
ATOM   4918  O  OE2   . GLU B  1 294 ? 3.122    29.857  -11.374  1.00 61.53 ? 275 GLU B OE2   1 
ATOM   4919  N  N     . LYS B  1 295 ? -0.395   25.869  -10.494  1.00 49.95 ? 276 LYS B N     1 
ATOM   4920  C  CA    . LYS B  1 295 ? 0.169    24.522  -10.592  1.00 50.14 ? 276 LYS B CA    1 
ATOM   4921  C  C     . LYS B  1 295 ? -0.298   23.830  -11.863  1.00 49.97 ? 276 LYS B C     1 
ATOM   4922  O  O     . LYS B  1 295 ? 0.504    23.197  -12.579  1.00 49.51 ? 276 LYS B O     1 
ATOM   4923  C  CB    . LYS B  1 295 ? -0.149   23.695  -9.361   1.00 49.62 ? 276 LYS B CB    1 
ATOM   4924  C  CG    . LYS B  1 295 ? 0.492    24.278  -8.149   1.00 50.19 ? 276 LYS B CG    1 
ATOM   4925  C  CD    . LYS B  1 295 ? 0.041    23.663  -6.858   1.00 51.43 ? 276 LYS B CD    1 
ATOM   4926  C  CE    . LYS B  1 295 ? 0.798    24.293  -5.668   1.00 51.44 ? 276 LYS B CE    1 
ATOM   4927  N  NZ    . LYS B  1 295 ? 0.128    24.015  -4.382   1.00 50.88 ? 276 LYS B NZ    1 
ATOM   4928  N  N     . LEU B  1 296 ? -1.576   24.003  -12.199  1.00 50.01 ? 277 LEU B N     1 
ATOM   4929  C  CA    . LEU B  1 296 ? -2.085   23.359  -13.386  1.00 49.93 ? 277 LEU B CA    1 
ATOM   4930  C  C     . LEU B  1 296 ? -1.463   23.927  -14.657  1.00 49.75 ? 277 LEU B C     1 
ATOM   4931  O  O     . LEU B  1 296 ? -1.223   23.179  -15.613  1.00 49.93 ? 277 LEU B O     1 
ATOM   4932  C  CB    . LEU B  1 296 ? -3.603   23.363  -13.400  1.00 50.11 ? 277 LEU B CB    1 
ATOM   4933  C  CG    . LEU B  1 296 ? -4.280   22.479  -12.333  1.00 48.77 ? 277 LEU B CG    1 
ATOM   4934  C  CD1   . LEU B  1 296 ? -5.725   22.826  -12.308  1.00 46.37 ? 277 LEU B CD1   1 
ATOM   4935  C  CD2   . LEU B  1 296 ? -4.098   20.994  -12.574  1.00 46.71 ? 277 LEU B CD2   1 
ATOM   4936  N  N     . SER B  1 297 ? -1.085   25.198  -14.626  1.00 49.56 ? 278 SER B N     1 
ATOM   4937  C  CA    . SER B  1 297 ? -0.461   25.838  -15.788  1.00 50.24 ? 278 SER B CA    1 
ATOM   4938  C  C     . SER B  1 297 ? 0.861    25.195  -16.200  1.00 50.42 ? 278 SER B C     1 
ATOM   4939  O  O     . SER B  1 297 ? 1.243    25.231  -17.374  1.00 49.51 ? 278 SER B O     1 
ATOM   4940  C  CB    . SER B  1 297 ? -0.280   27.353  -15.571  1.00 50.26 ? 278 SER B CB    1 
ATOM   4941  O  OG    . SER B  1 297 ? 0.832    27.670  -14.753  1.00 50.42 ? 278 SER B OG    1 
ATOM   4942  N  N     . LYS B  1 298 ? 1.546    24.593  -15.231  1.00 51.28 ? 279 LYS B N     1 
ATOM   4943  C  CA    . LYS B  1 298 ? 2.860    23.962  -15.458  1.00 51.52 ? 279 LYS B CA    1 
ATOM   4944  C  C     . LYS B  1 298 ? 2.790    22.463  -15.755  1.00 51.01 ? 279 LYS B C     1 
ATOM   4945  O  O     . LYS B  1 298 ? 3.813    21.823  -15.982  1.00 50.66 ? 279 LYS B O     1 
ATOM   4946  C  CB    . LYS B  1 298 ? 3.773    24.221  -14.251  1.00 52.01 ? 279 LYS B CB    1 
ATOM   4947  C  CG    . LYS B  1 298 ? 3.939    25.714  -13.914  1.00 54.00 ? 279 LYS B CG    1 
ATOM   4948  C  CD    . LYS B  1 298 ? 4.548    25.961  -12.549  1.00 53.57 ? 279 LYS B CD    1 
ATOM   4949  C  CE    . LYS B  1 298 ? 4.864    27.455  -12.382  1.00 55.78 ? 279 LYS B CE    1 
ATOM   4950  N  NZ    . LYS B  1 298 ? 5.861    27.690  -11.273  1.00 57.19 ? 279 LYS B NZ    1 
ATOM   4951  N  N     . ARG B  1 299 ? 1.583    21.904  -15.777  1.00 51.05 ? 280 ARG B N     1 
ATOM   4952  C  CA    . ARG B  1 299 ? 1.443    20.469  -15.947  1.00 50.74 ? 280 ARG B CA    1 
ATOM   4953  C  C     . ARG B  1 299 ? 0.384    20.102  -16.981  1.00 50.10 ? 280 ARG B C     1 
ATOM   4954  O  O     . ARG B  1 299 ? -0.284   19.087  -16.866  1.00 49.75 ? 280 ARG B O     1 
ATOM   4955  C  CB    . ARG B  1 299 ? 1.201    19.836  -14.580  1.00 50.76 ? 280 ARG B CB    1 
ATOM   4956  C  CG    . ARG B  1 299 ? 2.259    18.843  -14.254  1.00 51.32 ? 280 ARG B CG    1 
ATOM   4957  C  CD    . ARG B  1 299 ? 2.513    18.673  -12.815  1.00 51.45 ? 280 ARG B CD    1 
ATOM   4958  N  NE    . ARG B  1 299 ? 1.791    17.543  -12.248  1.00 53.29 ? 280 ARG B NE    1 
ATOM   4959  C  CZ    . ARG B  1 299 ? 2.118    16.264  -12.372  1.00 52.87 ? 280 ARG B CZ    1 
ATOM   4960  N  NH1   . ARG B  1 299 ? 3.207    15.867  -13.023  1.00 52.82 ? 280 ARG B NH1   1 
ATOM   4961  N  NH2   . ARG B  1 299 ? 1.342    15.370  -11.788  1.00 55.28 ? 280 ARG B NH2   1 
ATOM   4962  N  N     . HIS B  1 300 ? 0.300    20.924  -18.031  1.00 49.58 ? 281 HIS B N     1 
ATOM   4963  C  CA    . HIS B  1 300 ? -0.755   20.836  -19.046  1.00 49.51 ? 281 HIS B CA    1 
ATOM   4964  C  C     . HIS B  1 300 ? -0.646   19.539  -19.830  1.00 49.28 ? 281 HIS B C     1 
ATOM   4965  O  O     . HIS B  1 300 ? -1.639   18.822  -19.978  1.00 49.86 ? 281 HIS B O     1 
ATOM   4966  C  CB    . HIS B  1 300 ? -0.751   22.078  -19.966  1.00 48.68 ? 281 HIS B CB    1 
ATOM   4967  C  CG    . HIS B  1 300 ? -1.692   21.995  -21.135  1.00 48.14 ? 281 HIS B CG    1 
ATOM   4968  N  ND1   . HIS B  1 300 ? -3.045   22.253  -21.027  1.00 46.07 ? 281 HIS B ND1   1 
ATOM   4969  C  CD2   . HIS B  1 300 ? -1.469   21.718  -22.443  1.00 46.05 ? 281 HIS B CD2   1 
ATOM   4970  C  CE1   . HIS B  1 300 ? -3.616   22.108  -22.207  1.00 45.89 ? 281 HIS B CE1   1 
ATOM   4971  N  NE2   . HIS B  1 300 ? -2.683   21.794  -23.089  1.00 45.32 ? 281 HIS B NE2   1 
ATOM   4972  N  N     . GLN B  1 301 ? 0.554    19.196  -20.279  1.00 48.87 ? 282 GLN B N     1 
ATOM   4973  C  CA    . GLN B  1 301 ? 0.709    18.011  -21.085  1.00 49.37 ? 282 GLN B CA    1 
ATOM   4974  C  C     . GLN B  1 301 ? 0.360    16.773  -20.320  1.00 48.04 ? 282 GLN B C     1 
ATOM   4975  O  O     . GLN B  1 301 ? -0.239   15.864  -20.871  1.00 47.84 ? 282 GLN B O     1 
ATOM   4976  C  CB    . GLN B  1 301 ? 2.113    17.887  -21.624  1.00 49.63 ? 282 GLN B CB    1 
ATOM   4977  C  CG    . GLN B  1 301 ? 2.288    18.268  -23.085  1.00 52.10 ? 282 GLN B CG    1 
ATOM   4978  C  CD    . GLN B  1 301 ? 3.356    17.362  -23.773  1.00 54.89 ? 282 GLN B CD    1 
ATOM   4979  O  OE1   . GLN B  1 301 ? 4.309    16.847  -23.110  1.00 61.42 ? 282 GLN B OE1   1 
ATOM   4980  N  NE2   . GLN B  1 301 ? 3.211    17.178  -25.104  1.00 59.16 ? 282 GLN B NE2   1 
ATOM   4981  N  N     . TYR B  1 302 ? 0.729    16.748  -19.052  1.00 47.58 ? 283 TYR B N     1 
ATOM   4982  C  CA    . TYR B  1 302 ? 0.432    15.632  -18.183  1.00 47.39 ? 283 TYR B CA    1 
ATOM   4983  C  C     . TYR B  1 302 ? -1.074   15.431  -18.032  1.00 47.06 ? 283 TYR B C     1 
ATOM   4984  O  O     . TYR B  1 302 ? -1.555   14.303  -18.121  1.00 46.22 ? 283 TYR B O     1 
ATOM   4985  C  CB    . TYR B  1 302 ? 1.086    15.836  -16.813  1.00 47.56 ? 283 TYR B CB    1 
ATOM   4986  C  CG    . TYR B  1 302 ? 0.860    14.709  -15.812  1.00 47.61 ? 283 TYR B CG    1 
ATOM   4987  C  CD1   . TYR B  1 302 ? 1.727    13.634  -15.723  1.00 49.04 ? 283 TYR B CD1   1 
ATOM   4988  C  CD2   . TYR B  1 302 ? -0.224   14.734  -14.949  1.00 47.55 ? 283 TYR B CD2   1 
ATOM   4989  C  CE1   . TYR B  1 302 ? 1.494    12.592  -14.790  1.00 48.98 ? 283 TYR B CE1   1 
ATOM   4990  C  CE2   . TYR B  1 302 ? -0.455   13.733  -14.043  1.00 47.45 ? 283 TYR B CE2   1 
ATOM   4991  C  CZ    . TYR B  1 302 ? 0.395    12.665  -13.958  1.00 48.46 ? 283 TYR B CZ    1 
ATOM   4992  O  OH    . TYR B  1 302 ? 0.151    11.702  -13.006  1.00 48.60 ? 283 TYR B OH    1 
ATOM   4993  N  N     . HIS B  1 303 ? -1.814   16.514  -17.812  1.00 46.75 ? 284 HIS B N     1 
ATOM   4994  C  CA    . HIS B  1 303 ? -3.271   16.405  -17.694  1.00 46.80 ? 284 HIS B CA    1 
ATOM   4995  C  C     . HIS B  1 303 ? -3.909   16.010  -19.033  1.00 46.33 ? 284 HIS B C     1 
ATOM   4996  O  O     . HIS B  1 303 ? -4.762   15.127  -19.047  1.00 45.98 ? 284 HIS B O     1 
ATOM   4997  C  CB    . HIS B  1 303 ? -3.888   17.664  -17.067  1.00 46.65 ? 284 HIS B CB    1 
ATOM   4998  C  CG    . HIS B  1 303 ? -3.602   17.772  -15.603  1.00 47.28 ? 284 HIS B CG    1 
ATOM   4999  N  ND1   . HIS B  1 303 ? -4.585   17.752  -14.646  1.00 48.00 ? 284 HIS B ND1   1 
ATOM   5000  C  CD2   . HIS B  1 303 ? -2.431   17.807  -14.927  1.00 47.89 ? 284 HIS B CD2   1 
ATOM   5001  C  CE1   . HIS B  1 303 ? -4.041   17.831  -13.449  1.00 46.29 ? 284 HIS B CE1   1 
ATOM   5002  N  NE2   . HIS B  1 303 ? -2.734   17.857  -13.592  1.00 46.86 ? 284 HIS B NE2   1 
ATOM   5003  N  N     . ILE B  1 304 ? -3.451   16.588  -20.141  1.00 45.27 ? 285 ILE B N     1 
ATOM   5004  C  CA    . ILE B  1 304 ? -3.915   16.139  -21.441  1.00 45.99 ? 285 ILE B CA    1 
ATOM   5005  C  C     . ILE B  1 304 ? -3.770   14.625  -21.606  1.00 46.28 ? 285 ILE B C     1 
ATOM   5006  O  O     . ILE B  1 304 ? -4.681   13.973  -22.018  1.00 46.79 ? 285 ILE B O     1 
ATOM   5007  C  CB    . ILE B  1 304 ? -3.205   16.874  -22.595  1.00 45.26 ? 285 ILE B CB    1 
ATOM   5008  C  CG1   . ILE B  1 304 ? -3.701   18.309  -22.661  1.00 45.09 ? 285 ILE B CG1   1 
ATOM   5009  C  CG2   . ILE B  1 304 ? -3.429   16.180  -23.910  1.00 43.82 ? 285 ILE B CG2   1 
ATOM   5010  C  CD1   . ILE B  1 304 ? -5.190   18.409  -22.833  1.00 44.64 ? 285 ILE B CD1   1 
ATOM   5011  N  N     . ARG B  1 305 ? -2.634   14.056  -21.270  1.00 47.28 ? 286 ARG B N     1 
ATOM   5012  C  CA    . ARG B  1 305 ? -2.454   12.604  -21.377  1.00 47.95 ? 286 ARG B CA    1 
ATOM   5013  C  C     . ARG B  1 305 ? -3.414   11.815  -20.486  1.00 46.64 ? 286 ARG B C     1 
ATOM   5014  O  O     . ARG B  1 305 ? -3.727   10.682  -20.794  1.00 46.29 ? 286 ARG B O     1 
ATOM   5015  C  CB    . ARG B  1 305 ? -1.001   12.207  -21.013  1.00 48.06 ? 286 ARG B CB    1 
ATOM   5016  C  CG    . ARG B  1 305 ? 0.012    12.637  -22.052  1.00 51.59 ? 286 ARG B CG    1 
ATOM   5017  C  CD    . ARG B  1 305 ? 1.415    11.964  -21.875  1.00 54.32 ? 286 ARG B CD    1 
ATOM   5018  N  NE    . ARG B  1 305 ? 2.132    12.384  -20.639  1.00 59.53 ? 286 ARG B NE    1 
ATOM   5019  C  CZ    . ARG B  1 305 ? 2.990    13.413  -20.532  1.00 59.36 ? 286 ARG B CZ    1 
ATOM   5020  N  NH1   . ARG B  1 305 ? 3.275    14.193  -21.583  1.00 60.50 ? 286 ARG B NH1   1 
ATOM   5021  N  NH2   . ARG B  1 305 ? 3.539    13.679  -19.347  1.00 59.10 ? 286 ARG B NH2   1 
ATOM   5022  N  N     . ALA B  1 306 ? -3.806   12.404  -19.356  1.00 45.83 ? 287 ALA B N     1 
ATOM   5023  C  CA    . ALA B  1 306 ? -4.684   11.768  -18.368  1.00 45.55 ? 287 ALA B CA    1 
ATOM   5024  C  C     . ALA B  1 306 ? -6.165   11.940  -18.719  1.00 45.69 ? 287 ALA B C     1 
ATOM   5025  O  O     . ALA B  1 306 ? -7.010   11.301  -18.108  1.00 45.91 ? 287 ALA B O     1 
ATOM   5026  C  CB    . ALA B  1 306 ? -4.419   12.359  -16.959  1.00 44.31 ? 287 ALA B CB    1 
ATOM   5027  N  N     . TYR B  1 307 ? -6.484   12.817  -19.680  1.00 45.28 ? 288 TYR B N     1 
ATOM   5028  C  CA    . TYR B  1 307 ? -7.831   13.301  -19.863  1.00 45.07 ? 288 TYR B CA    1 
ATOM   5029  C  C     . TYR B  1 307 ? -8.592   12.632  -21.003  1.00 45.42 ? 288 TYR B C     1 
ATOM   5030  O  O     . TYR B  1 307 ? -9.746   12.986  -21.252  1.00 45.33 ? 288 TYR B O     1 
ATOM   5031  C  CB    . TYR B  1 307 ? -7.812   14.826  -20.050  1.00 44.66 ? 288 TYR B CB    1 
ATOM   5032  C  CG    . TYR B  1 307 ? -7.733   15.637  -18.766  1.00 42.54 ? 288 TYR B CG    1 
ATOM   5033  C  CD1   . TYR B  1 307 ? -7.577   15.037  -17.533  1.00 42.88 ? 288 TYR B CD1   1 
ATOM   5034  C  CD2   . TYR B  1 307 ? -7.760   17.003  -18.813  1.00 41.93 ? 288 TYR B CD2   1 
ATOM   5035  C  CE1   . TYR B  1 307 ? -7.482   15.796  -16.371  1.00 43.76 ? 288 TYR B CE1   1 
ATOM   5036  C  CE2   . TYR B  1 307 ? -7.650   17.771  -17.664  1.00 43.67 ? 288 TYR B CE2   1 
ATOM   5037  C  CZ    . TYR B  1 307 ? -7.495   17.167  -16.445  1.00 42.29 ? 288 TYR B CZ    1 
ATOM   5038  O  OH    . TYR B  1 307 ? -7.384   17.928  -15.312  1.00 40.82 ? 288 TYR B OH    1 
ATOM   5039  N  N     . ASP B  1 308 ? -7.963   11.677  -21.685  1.00 45.70 ? 289 ASP B N     1 
ATOM   5040  C  CA    . ASP B  1 308 ? -8.697   10.721  -22.523  1.00 46.29 ? 289 ASP B CA    1 
ATOM   5041  C  C     . ASP B  1 308 ? -7.958   9.367   -22.562  1.00 46.69 ? 289 ASP B C     1 
ATOM   5042  O  O     . ASP B  1 308 ? -6.786   9.322   -22.262  1.00 46.77 ? 289 ASP B O     1 
ATOM   5043  C  CB    . ASP B  1 308 ? -9.027   11.290  -23.936  1.00 46.17 ? 289 ASP B CB    1 
ATOM   5044  C  CG    . ASP B  1 308 ? -7.832   11.332  -24.888  1.00 46.43 ? 289 ASP B CG    1 
ATOM   5045  O  OD1   . ASP B  1 308 ? -7.255   10.278  -25.277  1.00 45.46 ? 289 ASP B OD1   1 
ATOM   5046  O  OD2   . ASP B  1 308 ? -7.512   12.455  -25.302  1.00 46.71 ? 289 ASP B OD2   1 
ATOM   5047  N  N     . PRO B  1 309 ? -8.656   8.265   -22.901  1.00 47.40 ? 290 PRO B N     1 
ATOM   5048  C  CA    . PRO B  1 309 ? -8.064   6.953   -22.793  1.00 47.58 ? 290 PRO B CA    1 
ATOM   5049  C  C     . PRO B  1 309 ? -7.055   6.690   -23.845  1.00 48.05 ? 290 PRO B C     1 
ATOM   5050  O  O     . PRO B  1 309 ? -6.438   5.642   -23.777  1.00 49.03 ? 290 PRO B O     1 
ATOM   5051  C  CB    . PRO B  1 309 ? -9.243   5.989   -23.028  1.00 48.18 ? 290 PRO B CB    1 
ATOM   5052  C  CG    . PRO B  1 309 ? -10.459  6.811   -22.933  1.00 47.39 ? 290 PRO B CG    1 
ATOM   5053  C  CD    . PRO B  1 309 ? -10.037  8.169   -23.399  1.00 47.59 ? 290 PRO B CD    1 
ATOM   5054  N  N     . LYS B  1 310 ? -6.869   7.595   -24.802  1.00 47.97 ? 291 LYS B N     1 
ATOM   5055  C  CA    . LYS B  1 310 ? -5.778   7.438   -25.776  1.00 48.61 ? 291 LYS B CA    1 
ATOM   5056  C  C     . LYS B  1 310 ? -4.665   8.508   -25.619  1.00 48.59 ? 291 LYS B C     1 
ATOM   5057  O  O     . LYS B  1 310 ? -4.055   8.969   -26.604  1.00 48.16 ? 291 LYS B O     1 
ATOM   5058  C  CB    . LYS B  1 310 ? -6.362   7.416   -27.206  1.00 49.06 ? 291 LYS B CB    1 
ATOM   5059  C  CG    . LYS B  1 310 ? -7.290   6.224   -27.472  1.00 49.12 ? 291 LYS B CG    1 
ATOM   5060  C  CD    . LYS B  1 310 ? -7.849   6.250   -28.903  1.00 51.12 ? 291 LYS B CD    1 
ATOM   5061  C  CE    . LYS B  1 310 ? -8.385   4.869   -29.395  1.00 52.08 ? 291 LYS B CE    1 
ATOM   5062  N  NZ    . LYS B  1 310 ? -9.237   4.260   -28.329  1.00 52.88 ? 291 LYS B NZ    1 
ATOM   5063  N  N     . GLY B  1 311 ? -4.431   8.910   -24.368  1.00 48.33 ? 292 GLY B N     1 
ATOM   5064  C  CA    . GLY B  1 311 ? -3.351   9.809   -24.018  1.00 47.91 ? 292 GLY B CA    1 
ATOM   5065  C  C     . GLY B  1 311 ? -3.382   11.179  -24.674  1.00 48.00 ? 292 GLY B C     1 
ATOM   5066  O  O     . GLY B  1 311 ? -2.351   11.865  -24.692  1.00 48.08 ? 292 GLY B O     1 
ATOM   5067  N  N     . GLY B  1 312 ? -4.534   11.608  -25.193  1.00 47.25 ? 293 GLY B N     1 
ATOM   5068  C  CA    . GLY B  1 312 ? -4.637   12.927  -25.800  1.00 46.97 ? 293 GLY B CA    1 
ATOM   5069  C  C     . GLY B  1 312 ? -5.066   12.918  -27.239  1.00 46.63 ? 293 GLY B C     1 
ATOM   5070  O  O     . GLY B  1 312 ? -5.427   13.939  -27.756  1.00 46.48 ? 293 GLY B O     1 
ATOM   5071  N  N     . LEU B  1 313 ? -5.019   11.765  -27.894  1.00 47.32 ? 294 LEU B N     1 
ATOM   5072  C  CA    . LEU B  1 313 ? -5.361   11.664  -29.324  1.00 47.45 ? 294 LEU B CA    1 
ATOM   5073  C  C     . LEU B  1 313 ? -6.846   11.859  -29.582  1.00 47.21 ? 294 LEU B C     1 
ATOM   5074  O  O     . LEU B  1 313 ? -7.207   12.343  -30.626  1.00 48.23 ? 294 LEU B O     1 
ATOM   5075  C  CB    . LEU B  1 313 ? -4.942   10.305  -29.937  1.00 47.80 ? 294 LEU B CB    1 
ATOM   5076  C  CG    . LEU B  1 313 ? -3.441   9.947   -30.007  1.00 49.82 ? 294 LEU B CG    1 
ATOM   5077  C  CD1   . LEU B  1 313 ? -3.248   8.483   -30.545  1.00 48.55 ? 294 LEU B CD1   1 
ATOM   5078  C  CD2   . LEU B  1 313 ? -2.589   11.003  -30.785  1.00 48.77 ? 294 LEU B CD2   1 
ATOM   5079  N  N     . ASP B  1 314 ? -7.716   11.464  -28.667  1.00 46.97 ? 295 ASP B N     1 
ATOM   5080  C  CA    . ASP B  1 314 ? -9.145   11.713  -28.874  1.00 46.47 ? 295 ASP B CA    1 
ATOM   5081  C  C     . ASP B  1 314 ? -9.432   13.204  -28.704  1.00 45.73 ? 295 ASP B C     1 
ATOM   5082  O  O     . ASP B  1 314 ? -9.998   13.811  -29.590  1.00 45.97 ? 295 ASP B O     1 
ATOM   5083  C  CB    . ASP B  1 314 ? -10.012  10.857  -27.953  1.00 46.60 ? 295 ASP B CB    1 
ATOM   5084  C  CG    . ASP B  1 314 ? -10.191  9.409   -28.448  1.00 47.28 ? 295 ASP B CG    1 
ATOM   5085  O  OD1   . ASP B  1 314 ? -10.059  9.133   -29.669  1.00 47.66 ? 295 ASP B OD1   1 
ATOM   5086  O  OD2   . ASP B  1 314 ? -10.519  8.541   -27.599  1.00 48.92 ? 295 ASP B OD2   1 
ATOM   5087  N  N     . ASN B  1 315 ? -8.964   13.810  -27.618  1.00 45.02 ? 296 ASN B N     1 
ATOM   5088  C  CA    . ASN B  1 315 ? -9.137   15.262  -27.415  1.00 44.73 ? 296 ASN B CA    1 
ATOM   5089  C  C     . ASN B  1 315 ? -8.529   16.119  -28.525  1.00 44.12 ? 296 ASN B C     1 
ATOM   5090  O  O     . ASN B  1 315 ? -8.919   17.257  -28.666  1.00 45.05 ? 296 ASN B O     1 
ATOM   5091  C  CB    . ASN B  1 315 ? -8.564   15.743  -26.066  1.00 44.66 ? 296 ASN B CB    1 
ATOM   5092  C  CG    . ASN B  1 315 ? -9.639   16.090  -25.022  1.00 45.47 ? 296 ASN B CG    1 
ATOM   5093  O  OD1   . ASN B  1 315 ? -10.731  16.565  -25.354  1.00 46.88 ? 296 ASN B OD1   1 
ATOM   5094  N  ND2   . ASN B  1 315 ? -9.298   15.897  -23.729  1.00 44.43 ? 296 ASN B ND2   1 
ATOM   5095  N  N     . ALA B  1 316 ? -7.587   15.604  -29.306  1.00 43.44 ? 297 ALA B N     1 
ATOM   5096  C  CA    . ALA B  1 316 ? -7.034   16.382  -30.460  1.00 43.22 ? 297 ALA B CA    1 
ATOM   5097  C  C     . ALA B  1 316 ? -8.128   16.767  -31.443  1.00 42.70 ? 297 ALA B C     1 
ATOM   5098  O  O     . ALA B  1 316 ? -8.031   17.809  -32.049  1.00 43.16 ? 297 ALA B O     1 
ATOM   5099  C  CB    . ALA B  1 316 ? -5.889   15.633  -31.198  1.00 41.56 ? 297 ALA B CB    1 
ATOM   5100  N  N     . ARG B  1 317 ? -9.168   15.932  -31.576  1.00 42.56 ? 298 ARG B N     1 
ATOM   5101  C  CA    . ARG B  1 317 ? -10.321  16.207  -32.467  1.00 41.95 ? 298 ARG B CA    1 
ATOM   5102  C  C     . ARG B  1 317 ? -11.309  17.221  -31.875  1.00 42.03 ? 298 ARG B C     1 
ATOM   5103  O  O     . ARG B  1 317 ? -12.100  17.791  -32.625  1.00 41.15 ? 298 ARG B O     1 
ATOM   5104  C  CB    . ARG B  1 317 ? -11.041  14.903  -32.830  1.00 41.42 ? 298 ARG B CB    1 
ATOM   5105  C  CG    . ARG B  1 317 ? -10.197  14.038  -33.748  1.00 40.38 ? 298 ARG B CG    1 
ATOM   5106  C  CD    . ARG B  1 317 ? -10.757  12.675  -34.041  1.00 41.10 ? 298 ARG B CD    1 
ATOM   5107  N  NE    . ARG B  1 317 ? -10.922  11.875  -32.816  1.00 42.40 ? 298 ARG B NE    1 
ATOM   5108  C  CZ    . ARG B  1 317 ? -12.091  11.555  -32.233  1.00 42.73 ? 298 ARG B CZ    1 
ATOM   5109  N  NH1   . ARG B  1 317 ? -13.256  11.952  -32.734  1.00 42.99 ? 298 ARG B NH1   1 
ATOM   5110  N  NH2   . ARG B  1 317 ? -12.108  10.824  -31.124  1.00 42.39 ? 298 ARG B NH2   1 
ATOM   5111  N  N     . ARG B  1 318 ? -11.223  17.450  -30.550  1.00 42.17 ? 299 ARG B N     1 
ATOM   5112  C  CA    . ARG B  1 318 ? -12.090  18.392  -29.825  1.00 42.47 ? 299 ARG B CA    1 
ATOM   5113  C  C     . ARG B  1 318 ? -11.443  19.742  -29.393  1.00 43.08 ? 299 ARG B C     1 
ATOM   5114  O  O     . ARG B  1 318 ? -12.071  20.841  -29.541  1.00 41.92 ? 299 ARG B O     1 
ATOM   5115  C  CB    . ARG B  1 318 ? -12.657  17.746  -28.534  1.00 42.31 ? 299 ARG B CB    1 
ATOM   5116  C  CG    . ARG B  1 318 ? -13.508  18.764  -27.668  1.00 42.87 ? 299 ARG B CG    1 
ATOM   5117  C  CD    . ARG B  1 318 ? -14.413  18.182  -26.565  1.00 43.38 ? 299 ARG B CD    1 
ATOM   5118  N  NE    . ARG B  1 318 ? -13.570  17.943  -25.427  1.00 45.58 ? 299 ARG B NE    1 
ATOM   5119  C  CZ    . ARG B  1 318 ? -13.471  18.689  -24.329  1.00 45.40 ? 299 ARG B CZ    1 
ATOM   5120  N  NH1   . ARG B  1 318 ? -14.233  19.731  -24.089  1.00 42.31 ? 299 ARG B NH1   1 
ATOM   5121  N  NH2   . ARG B  1 318 ? -12.576  18.336  -23.432  1.00 48.44 ? 299 ARG B NH2   1 
ATOM   5122  N  N     . LEU B  1 319 ? -10.258  19.660  -28.763  1.00 42.59 ? 300 LEU B N     1 
ATOM   5123  C  CA    . LEU B  1 319 ? -9.666   20.834  -28.169  1.00 42.75 ? 300 LEU B CA    1 
ATOM   5124  C  C     . LEU B  1 319 ? -8.970   21.609  -29.265  1.00 43.19 ? 300 LEU B C     1 
ATOM   5125  O  O     . LEU B  1 319 ? -7.744   21.603  -29.375  1.00 44.52 ? 300 LEU B O     1 
ATOM   5126  C  CB    . LEU B  1 319 ? -8.728   20.494  -27.025  1.00 42.42 ? 300 LEU B CB    1 
ATOM   5127  C  CG    . LEU B  1 319 ? -9.364   19.866  -25.789  1.00 42.14 ? 300 LEU B CG    1 
ATOM   5128  C  CD1   . LEU B  1 319 ? -8.323   19.503  -24.773  1.00 36.40 ? 300 LEU B CD1   1 
ATOM   5129  C  CD2   . LEU B  1 319 ? -10.454  20.750  -25.210  1.00 39.75 ? 300 LEU B CD2   1 
ATOM   5130  N  N     . THR B  1 320 ? -9.785   22.289  -30.066  1.00 43.65 ? 301 THR B N     1 
ATOM   5131  C  CA    . THR B  1 320 ? -9.361   23.047  -31.243  1.00 43.69 ? 301 THR B CA    1 
ATOM   5132  C  C     . THR B  1 320 ? -9.291   24.552  -30.967  1.00 44.40 ? 301 THR B C     1 
ATOM   5133  O  O     . THR B  1 320 ? -8.910   25.299  -31.843  1.00 44.32 ? 301 THR B O     1 
ATOM   5134  C  CB    . THR B  1 320 ? -10.405  22.917  -32.350  1.00 43.22 ? 301 THR B CB    1 
ATOM   5135  O  OG1   . THR B  1 320 ? -11.617  23.552  -31.907  1.00 43.39 ? 301 THR B OG1   1 
ATOM   5136  C  CG2   . THR B  1 320 ? -10.671  21.471  -32.695  1.00 42.13 ? 301 THR B CG2   1 
ATOM   5137  N  N     . GLY B  1 321 ? -9.711   24.990  -29.770  1.00 45.38 ? 302 GLY B N     1 
ATOM   5138  C  CA    . GLY B  1 321 ? -9.933   26.403  -29.523  1.00 45.61 ? 302 GLY B CA    1 
ATOM   5139  C  C     . GLY B  1 321 ? -11.232  26.922  -30.116  1.00 46.58 ? 302 GLY B C     1 
ATOM   5140  O  O     . GLY B  1 321 ? -11.630  28.042  -29.823  1.00 47.46 ? 302 GLY B O     1 
ATOM   5141  N  N     . PHE B  1 322 ? -11.924  26.140  -30.944  1.00 47.03 ? 303 PHE B N     1 
ATOM   5142  C  CA    . PHE B  1 322 ? -13.279  26.561  -31.398  1.00 46.56 ? 303 PHE B CA    1 
ATOM   5143  C  C     . PHE B  1 322 ? -14.363  25.809  -30.610  1.00 45.96 ? 303 PHE B C     1 
ATOM   5144  O  O     . PHE B  1 322 ? -14.041  24.919  -29.820  1.00 45.19 ? 303 PHE B O     1 
ATOM   5145  C  CB    . PHE B  1 322 ? -13.443  26.333  -32.911  1.00 47.49 ? 303 PHE B CB    1 
ATOM   5146  C  CG    . PHE B  1 322 ? -12.538  27.184  -33.740  1.00 48.21 ? 303 PHE B CG    1 
ATOM   5147  C  CD1   . PHE B  1 322 ? -11.378  26.644  -34.305  1.00 51.11 ? 303 PHE B CD1   1 
ATOM   5148  C  CD2   . PHE B  1 322 ? -12.807  28.545  -33.922  1.00 48.45 ? 303 PHE B CD2   1 
ATOM   5149  C  CE1   . PHE B  1 322 ? -10.490  27.465  -35.081  1.00 50.29 ? 303 PHE B CE1   1 
ATOM   5150  C  CE2   . PHE B  1 322 ? -11.957  29.355  -34.668  1.00 48.77 ? 303 PHE B CE2   1 
ATOM   5151  C  CZ    . PHE B  1 322 ? -10.792  28.819  -35.252  1.00 49.38 ? 303 PHE B CZ    1 
ATOM   5152  N  N     . HIS B  1 323 ? -15.624  26.176  -30.828  1.00 44.98 ? 304 HIS B N     1 
ATOM   5153  C  CA    . HIS B  1 323 ? -16.778  25.454  -30.270  1.00 44.98 ? 304 HIS B CA    1 
ATOM   5154  C  C     . HIS B  1 323 ? -16.741  25.277  -28.744  1.00 44.77 ? 304 HIS B C     1 
ATOM   5155  O  O     . HIS B  1 323 ? -17.061  24.194  -28.179  1.00 44.49 ? 304 HIS B O     1 
ATOM   5156  C  CB    . HIS B  1 323 ? -16.990  24.118  -30.988  1.00 44.59 ? 304 HIS B CB    1 
ATOM   5157  C  CG    . HIS B  1 323 ? -17.295  24.279  -32.443  1.00 44.83 ? 304 HIS B CG    1 
ATOM   5158  N  ND1   . HIS B  1 323 ? -16.419  23.897  -33.435  1.00 45.06 ? 304 HIS B ND1   1 
ATOM   5159  C  CD2   . HIS B  1 323 ? -18.351  24.848  -33.069  1.00 43.97 ? 304 HIS B CD2   1 
ATOM   5160  C  CE1   . HIS B  1 323 ? -16.940  24.183  -34.612  1.00 44.43 ? 304 HIS B CE1   1 
ATOM   5161  N  NE2   . HIS B  1 323 ? -18.114  24.757  -34.418  1.00 44.52 ? 304 HIS B NE2   1 
ATOM   5162  N  N     . GLU B  1 324 ? -16.361  26.370  -28.094  1.00 44.04 ? 305 GLU B N     1 
ATOM   5163  C  CA    . GLU B  1 324 ? -16.323  26.444  -26.648  1.00 44.24 ? 305 GLU B CA    1 
ATOM   5164  C  C     . GLU B  1 324 ? -15.266  25.537  -26.009  1.00 43.82 ? 305 GLU B C     1 
ATOM   5165  O  O     . GLU B  1 324 ? -15.417  25.054  -24.916  1.00 42.99 ? 305 GLU B O     1 
ATOM   5166  C  CB    . GLU B  1 324 ? -17.711  26.255  -26.084  1.00 43.67 ? 305 GLU B CB    1 
ATOM   5167  C  CG    . GLU B  1 324 ? -18.727  27.224  -26.707  1.00 42.96 ? 305 GLU B CG    1 
ATOM   5168  C  CD    . GLU B  1 324 ? -20.031  27.243  -25.935  1.00 45.13 ? 305 GLU B CD    1 
ATOM   5169  O  OE1   . GLU B  1 324 ? -20.276  28.236  -25.187  1.00 44.80 ? 305 GLU B OE1   1 
ATOM   5170  O  OE2   . GLU B  1 324 ? -20.796  26.234  -26.036  1.00 45.80 ? 305 GLU B OE2   1 
ATOM   5171  N  N     . THR B  1 325 ? -14.169  25.370  -26.734  1.00 44.31 ? 306 THR B N     1 
ATOM   5172  C  CA    . THR B  1 325 ? -13.001  24.653  -26.286  1.00 44.56 ? 306 THR B CA    1 
ATOM   5173  C  C     . THR B  1 325 ? -11.809  25.603  -26.266  1.00 44.87 ? 306 THR B C     1 
ATOM   5174  O  O     . THR B  1 325 ? -11.799  26.662  -26.910  1.00 44.98 ? 306 THR B O     1 
ATOM   5175  C  CB    . THR B  1 325 ? -12.675  23.447  -27.212  1.00 44.81 ? 306 THR B CB    1 
ATOM   5176  O  OG1   . THR B  1 325 ? -12.163  23.917  -28.478  1.00 44.00 ? 306 THR B OG1   1 
ATOM   5177  C  CG2   . THR B  1 325 ? -13.925  22.550  -27.393  1.00 43.13 ? 306 THR B CG2   1 
ATOM   5178  N  N     . SER B  1 326 ? -10.816  25.218  -25.486  1.00 45.32 ? 307 SER B N     1 
ATOM   5179  C  CA    . SER B  1 326 ? -9.464   25.764  -25.602  1.00 45.50 ? 307 SER B CA    1 
ATOM   5180  C  C     . SER B  1 326 ? -8.673   24.904  -26.573  1.00 45.61 ? 307 SER B C     1 
ATOM   5181  O  O     . SER B  1 326 ? -9.026   23.756  -26.800  1.00 45.84 ? 307 SER B O     1 
ATOM   5182  C  CB    . SER B  1 326 ? -8.797   25.715  -24.247  1.00 45.35 ? 307 SER B CB    1 
ATOM   5183  O  OG    . SER B  1 326 ? -8.816   24.393  -23.763  1.00 46.04 ? 307 SER B OG    1 
ATOM   5184  N  N     . ASN B  1 327 ? -7.602   25.449  -27.142  1.00 46.28 ? 308 ASN B N     1 
ATOM   5185  C  CA    . ASN B  1 327 ? -6.725   24.670  -28.043  1.00 46.26 ? 308 ASN B CA    1 
ATOM   5186  C  C     . ASN B  1 327 ? -5.920   23.685  -27.220  1.00 46.47 ? 308 ASN B C     1 
ATOM   5187  O  O     . ASN B  1 327 ? -5.370   24.066  -26.178  1.00 46.34 ? 308 ASN B O     1 
ATOM   5188  C  CB    . ASN B  1 327 ? -5.813   25.604  -28.826  1.00 46.38 ? 308 ASN B CB    1 
ATOM   5189  C  CG    . ASN B  1 327 ? -5.077   24.917  -29.940  1.00 46.81 ? 308 ASN B CG    1 
ATOM   5190  O  OD1   . ASN B  1 327 ? -4.196   24.085  -29.719  1.00 48.76 ? 308 ASN B OD1   1 
ATOM   5191  N  ND2   . ASN B  1 327 ? -5.395   25.300  -31.155  1.00 46.59 ? 308 ASN B ND2   1 
ATOM   5192  N  N     . ILE B  1 328 ? -5.858   22.427  -27.667  1.00 46.73 ? 309 ILE B N     1 
ATOM   5193  C  CA    . ILE B  1 328 ? -5.081   21.375  -26.971  1.00 46.57 ? 309 ILE B CA    1 
ATOM   5194  C  C     . ILE B  1 328 ? -3.625   21.778  -26.648  1.00 47.39 ? 309 ILE B C     1 
ATOM   5195  O  O     . ILE B  1 328 ? -3.063   21.319  -25.648  1.00 47.64 ? 309 ILE B O     1 
ATOM   5196  C  CB    . ILE B  1 328 ? -5.059   20.063  -27.785  1.00 46.20 ? 309 ILE B CB    1 
ATOM   5197  C  CG1   . ILE B  1 328 ? -4.728   18.886  -26.861  1.00 46.24 ? 309 ILE B CG1   1 
ATOM   5198  C  CG2   . ILE B  1 328 ? -4.112   20.142  -28.976  1.00 43.54 ? 309 ILE B CG2   1 
ATOM   5199  C  CD1   . ILE B  1 328 ? -5.142   17.530  -27.415  1.00 46.16 ? 309 ILE B CD1   1 
ATOM   5200  N  N     . ASN B  1 329 ? -3.043   22.643  -27.486  1.00 47.72 ? 310 ASN B N     1 
ATOM   5201  C  CA    . ASN B  1 329 ? -1.681   23.140  -27.322  1.00 48.32 ? 310 ASN B CA    1 
ATOM   5202  C  C     . ASN B  1 329 ? -1.463   24.293  -26.327  1.00 48.72 ? 310 ASN B C     1 
ATOM   5203  O  O     . ASN B  1 329 ? -0.356   24.457  -25.901  1.00 47.93 ? 310 ASN B O     1 
ATOM   5204  C  CB    . ASN B  1 329 ? -1.124   23.569  -28.680  1.00 49.08 ? 310 ASN B CB    1 
ATOM   5205  C  CG    . ASN B  1 329 ? -1.064   22.418  -29.677  1.00 50.37 ? 310 ASN B CG    1 
ATOM   5206  O  OD1   . ASN B  1 329 ? -0.613   21.303  -29.342  1.00 51.88 ? 310 ASN B OD1   1 
ATOM   5207  N  ND2   . ASN B  1 329 ? -1.544   22.664  -30.897  1.00 50.70 ? 310 ASN B ND2   1 
ATOM   5208  N  N     . ASP B  1 330 ? -2.485   25.072  -25.950  1.00 49.56 ? 311 ASP B N     1 
ATOM   5209  C  CA    . ASP B  1 330 ? -2.318   26.176  -24.965  1.00 49.91 ? 311 ASP B CA    1 
ATOM   5210  C  C     . ASP B  1 330 ? -3.079   25.937  -23.659  1.00 49.32 ? 311 ASP B C     1 
ATOM   5211  O  O     . ASP B  1 330 ? -4.195   25.498  -23.687  1.00 51.08 ? 311 ASP B O     1 
ATOM   5212  C  CB    . ASP B  1 330 ? -2.803   27.548  -25.501  1.00 50.49 ? 311 ASP B CB    1 
ATOM   5213  C  CG    . ASP B  1 330 ? -2.383   27.807  -26.943  1.00 55.80 ? 311 ASP B CG    1 
ATOM   5214  O  OD1   . ASP B  1 330 ? -1.138   27.857  -27.170  1.00 63.41 ? 311 ASP B OD1   1 
ATOM   5215  O  OD2   . ASP B  1 330 ? -3.284   28.005  -27.835  1.00 58.10 ? 311 ASP B OD2   1 
ATOM   5216  N  N     . PHE B  1 331 ? -2.485   26.356  -22.545  1.00 48.59 ? 312 PHE B N     1 
ATOM   5217  C  CA    . PHE B  1 331 ? -3.135   26.527  -21.275  1.00 47.75 ? 312 PHE B CA    1 
ATOM   5218  C  C     . PHE B  1 331 ? -3.559   27.998  -21.084  1.00 47.53 ? 312 PHE B C     1 
ATOM   5219  O  O     . PHE B  1 331 ? -2.737   28.897  -21.257  1.00 46.82 ? 312 PHE B O     1 
ATOM   5220  C  CB    . PHE B  1 331 ? -2.185   26.169  -20.152  1.00 47.44 ? 312 PHE B CB    1 
ATOM   5221  C  CG    . PHE B  1 331 ? -2.850   26.100  -18.834  1.00 46.92 ? 312 PHE B CG    1 
ATOM   5222  C  CD1   . PHE B  1 331 ? -3.420   24.915  -18.401  1.00 46.74 ? 312 PHE B CD1   1 
ATOM   5223  C  CD2   . PHE B  1 331 ? -2.972   27.235  -18.057  1.00 47.04 ? 312 PHE B CD2   1 
ATOM   5224  C  CE1   . PHE B  1 331 ? -4.068   24.833  -17.179  1.00 47.80 ? 312 PHE B CE1   1 
ATOM   5225  C  CE2   . PHE B  1 331 ? -3.606   27.185  -16.833  1.00 48.14 ? 312 PHE B CE2   1 
ATOM   5226  C  CZ    . PHE B  1 331 ? -4.182   25.970  -16.386  1.00 47.99 ? 312 PHE B CZ    1 
ATOM   5227  N  N     . SER B  1 332 ? -4.836   28.204  -20.706  1.00 46.90 ? 313 SER B N     1 
ATOM   5228  C  CA    . SER B  1 332 ? -5.400   29.512  -20.352  1.00 46.19 ? 313 SER B CA    1 
ATOM   5229  C  C     . SER B  1 332 ? -6.484   29.375  -19.292  1.00 46.17 ? 313 SER B C     1 
ATOM   5230  O  O     . SER B  1 332 ? -7.100   28.318  -19.180  1.00 46.44 ? 313 SER B O     1 
ATOM   5231  C  CB    . SER B  1 332 ? -6.033   30.167  -21.569  1.00 45.78 ? 313 SER B CB    1 
ATOM   5232  O  OG    . SER B  1 332 ? -6.924   29.264  -22.177  1.00 45.68 ? 313 SER B OG    1 
ATOM   5233  N  N     . ALA B  1 333 ? -6.729   30.462  -18.546  1.00 45.38 ? 314 ALA B N     1 
ATOM   5234  C  CA    . ALA B  1 333 ? -7.717   30.497  -17.481  1.00 44.97 ? 314 ALA B CA    1 
ATOM   5235  C  C     . ALA B  1 333 ? -8.378   31.861  -17.525  1.00 45.24 ? 314 ALA B C     1 
ATOM   5236  O  O     . ALA B  1 333 ? -7.749   32.835  -17.891  1.00 45.84 ? 314 ALA B O     1 
ATOM   5237  C  CB    . ALA B  1 333 ? -7.096   30.261  -16.151  1.00 44.19 ? 314 ALA B CB    1 
ATOM   5238  N  N     . GLY B  1 334 ? -9.671   31.914  -17.199  1.00 45.24 ? 315 GLY B N     1 
ATOM   5239  C  CA    . GLY B  1 334 ? -10.407  33.153  -17.133  1.00 44.60 ? 315 GLY B CA    1 
ATOM   5240  C  C     . GLY B  1 334 ? -11.740  32.989  -16.433  1.00 44.53 ? 315 GLY B C     1 
ATOM   5241  O  O     . GLY B  1 334 ? -12.312  31.892  -16.376  1.00 44.10 ? 315 GLY B O     1 
ATOM   5242  N  N     . VAL B  1 335 ? -12.218  34.104  -15.893  1.00 44.64 ? 316 VAL B N     1 
ATOM   5243  C  CA    . VAL B  1 335 ? -13.541  34.198  -15.289  1.00 44.50 ? 316 VAL B CA    1 
ATOM   5244  C  C     . VAL B  1 335 ? -14.568  34.155  -16.410  1.00 44.72 ? 316 VAL B C     1 
ATOM   5245  O  O     . VAL B  1 335 ? -14.419  34.884  -17.387  1.00 45.92 ? 316 VAL B O     1 
ATOM   5246  C  CB    . VAL B  1 335 ? -13.670  35.504  -14.406  1.00 44.59 ? 316 VAL B CB    1 
ATOM   5247  C  CG1   . VAL B  1 335 ? -15.034  35.600  -13.695  1.00 43.28 ? 316 VAL B CG1   1 
ATOM   5248  C  CG2   . VAL B  1 335 ? -12.523  35.502  -13.367  1.00 43.10 ? 316 VAL B CG2   1 
ATOM   5249  N  N     . ALA B  1 336 ? -15.552  33.257  -16.304  1.00 44.01 ? 317 ALA B N     1 
ATOM   5250  C  CA    . ALA B  1 336 ? -16.697  33.241  -17.190  1.00 44.12 ? 317 ALA B CA    1 
ATOM   5251  C  C     . ALA B  1 336 ? -16.293  32.953  -18.637  1.00 44.19 ? 317 ALA B C     1 
ATOM   5252  O  O     . ALA B  1 336 ? -17.007  33.316  -19.589  1.00 44.10 ? 317 ALA B O     1 
ATOM   5253  C  CB    . ALA B  1 336 ? -17.424  34.591  -17.090  1.00 43.41 ? 317 ALA B CB    1 
ATOM   5254  N  N     . ASN B  1 337 ? -15.141  32.320  -18.815  1.00 44.30 ? 318 ASN B N     1 
ATOM   5255  C  CA    . ASN B  1 337 ? -14.554  32.189  -20.154  1.00 44.60 ? 318 ASN B CA    1 
ATOM   5256  C  C     . ASN B  1 337 ? -14.598  30.761  -20.695  1.00 44.38 ? 318 ASN B C     1 
ATOM   5257  O  O     . ASN B  1 337 ? -13.751  29.919  -20.376  1.00 44.47 ? 318 ASN B O     1 
ATOM   5258  C  CB    . ASN B  1 337 ? -13.106  32.743  -20.188  1.00 44.63 ? 318 ASN B CB    1 
ATOM   5259  C  CG    . ASN B  1 337 ? -12.486  32.741  -21.608  1.00 44.49 ? 318 ASN B CG    1 
ATOM   5260  O  OD1   . ASN B  1 337 ? -13.094  32.336  -22.596  1.00 44.86 ? 318 ASN B OD1   1 
ATOM   5261  N  ND2   . ASN B  1 337 ? -11.280  33.220  -21.692  1.00 44.26 ? 318 ASN B ND2   1 
ATOM   5262  N  N     . ARG B  1 338 ? -15.546  30.529  -21.589  1.00 44.59 ? 319 ARG B N     1 
ATOM   5263  C  CA    . ARG B  1 338 ? -15.757  29.205  -22.170  1.00 44.75 ? 319 ARG B CA    1 
ATOM   5264  C  C     . ARG B  1 338 ? -14.769  28.886  -23.296  1.00 44.85 ? 319 ARG B C     1 
ATOM   5265  O  O     . ARG B  1 338 ? -14.888  27.858  -23.961  1.00 44.94 ? 319 ARG B O     1 
ATOM   5266  C  CB    . ARG B  1 338 ? -17.214  29.084  -22.634  1.00 44.66 ? 319 ARG B CB    1 
ATOM   5267  C  CG    . ARG B  1 338 ? -18.180  28.938  -21.444  1.00 44.90 ? 319 ARG B CG    1 
ATOM   5268  C  CD    . ARG B  1 338 ? -19.607  28.761  -21.908  1.00 45.24 ? 319 ARG B CD    1 
ATOM   5269  N  NE    . ARG B  1 338 ? -20.436  28.059  -20.940  1.00 45.31 ? 319 ARG B NE    1 
ATOM   5270  C  CZ    . ARG B  1 338 ? -20.887  28.588  -19.810  1.00 44.79 ? 319 ARG B CZ    1 
ATOM   5271  N  NH1   . ARG B  1 338 ? -21.640  27.858  -19.004  1.00 44.06 ? 319 ARG B NH1   1 
ATOM   5272  N  NH2   . ARG B  1 338 ? -20.579  29.823  -19.462  1.00 45.49 ? 319 ARG B NH2   1 
ATOM   5273  N  N     . SER B  1 339 ? -13.783  29.756  -23.500  1.00 45.00 ? 320 SER B N     1 
ATOM   5274  C  CA    . SER B  1 339 ? -12.664  29.449  -24.392  1.00 44.79 ? 320 SER B CA    1 
ATOM   5275  C  C     . SER B  1 339 ? -11.421  29.086  -23.646  1.00 44.10 ? 320 SER B C     1 
ATOM   5276  O  O     . SER B  1 339 ? -10.458  28.694  -24.291  1.00 44.43 ? 320 SER B O     1 
ATOM   5277  C  CB    . SER B  1 339 ? -12.342  30.637  -25.309  1.00 44.84 ? 320 SER B CB    1 
ATOM   5278  O  OG    . SER B  1 339 ? -13.349  30.750  -26.309  1.00 47.28 ? 320 SER B OG    1 
ATOM   5279  N  N     . ALA B  1 340 ? -11.404  29.250  -22.324  1.00 43.66 ? 321 ALA B N     1 
ATOM   5280  C  CA    . ALA B  1 340 ? -10.181  28.963  -21.548  1.00 44.22 ? 321 ALA B CA    1 
ATOM   5281  C  C     . ALA B  1 340 ? -10.074  27.478  -21.205  1.00 44.39 ? 321 ALA B C     1 
ATOM   5282  O  O     . ALA B  1 340 ? -11.086  26.786  -21.089  1.00 43.46 ? 321 ALA B O     1 
ATOM   5283  C  CB    . ALA B  1 340 ? -10.120  29.790  -20.249  1.00 43.97 ? 321 ALA B CB    1 
ATOM   5284  N  N     . SER B  1 341 ? -8.835   27.001  -21.041  1.00 44.31 ? 322 SER B N     1 
ATOM   5285  C  CA    . SER B  1 341 ? -8.603   25.679  -20.477  1.00 44.06 ? 322 SER B CA    1 
ATOM   5286  C  C     . SER B  1 341 ? -9.304   25.567  -19.124  1.00 43.73 ? 322 SER B C     1 
ATOM   5287  O  O     . SER B  1 341 ? -9.936   24.564  -18.860  1.00 44.76 ? 322 SER B O     1 
ATOM   5288  C  CB    . SER B  1 341 ? -7.114   25.397  -20.316  1.00 44.01 ? 322 SER B CB    1 
ATOM   5289  O  OG    . SER B  1 341 ? -6.388   25.614  -21.513  1.00 44.37 ? 322 SER B OG    1 
ATOM   5290  N  N     . ILE B  1 342 ? -9.198   26.589  -18.288  1.00 43.27 ? 323 ILE B N     1 
ATOM   5291  C  CA    . ILE B  1 342 ? -9.838   26.614  -16.978  1.00 43.84 ? 323 ILE B CA    1 
ATOM   5292  C  C     . ILE B  1 342 ? -10.760  27.813  -16.942  1.00 44.00 ? 323 ILE B C     1 
ATOM   5293  O  O     . ILE B  1 342 ? -10.357  28.913  -17.320  1.00 44.77 ? 323 ILE B O     1 
ATOM   5294  C  CB    . ILE B  1 342 ? -8.826   26.801  -15.769  1.00 44.08 ? 323 ILE B CB    1 
ATOM   5295  C  CG1   . ILE B  1 342 ? -7.756   25.665  -15.658  1.00 45.03 ? 323 ILE B CG1   1 
ATOM   5296  C  CG2   . ILE B  1 342 ? -9.551   26.927  -14.452  1.00 43.24 ? 323 ILE B CG2   1 
ATOM   5297  C  CD1   . ILE B  1 342 ? -8.157   24.304  -16.023  1.00 42.46 ? 323 ILE B CD1   1 
ATOM   5298  N  N     . ARG B  1 343 ? -11.994  27.605  -16.501  1.00 43.65 ? 324 ARG B N     1 
ATOM   5299  C  CA    . ARG B  1 343 ? -12.900  28.703  -16.245  1.00 44.22 ? 324 ARG B CA    1 
ATOM   5300  C  C     . ARG B  1 343 ? -13.194  28.832  -14.763  1.00 43.97 ? 324 ARG B C     1 
ATOM   5301  O  O     . ARG B  1 343 ? -13.497  27.846  -14.096  1.00 42.51 ? 324 ARG B O     1 
ATOM   5302  C  CB    . ARG B  1 343 ? -14.229  28.530  -17.002  1.00 44.55 ? 324 ARG B CB    1 
ATOM   5303  C  CG    . ARG B  1 343 ? -15.440  29.265  -16.400  1.00 43.71 ? 324 ARG B CG    1 
ATOM   5304  C  CD    . ARG B  1 343 ? -16.570  29.318  -17.411  1.00 45.07 ? 324 ARG B CD    1 
ATOM   5305  N  NE    . ARG B  1 343 ? -17.920  29.442  -16.823  1.00 45.88 ? 324 ARG B NE    1 
ATOM   5306  C  CZ    . ARG B  1 343 ? -18.756  28.425  -16.559  1.00 46.13 ? 324 ARG B CZ    1 
ATOM   5307  N  NH1   . ARG B  1 343 ? -18.414  27.157  -16.758  1.00 46.17 ? 324 ARG B NH1   1 
ATOM   5308  N  NH2   . ARG B  1 343 ? -19.948  28.680  -16.055  1.00 46.45 ? 324 ARG B NH2   1 
ATOM   5309  N  N     . ILE B  1 344 ? -13.123  30.076  -14.284  1.00 44.01 ? 325 ILE B N     1 
ATOM   5310  C  CA    . ILE B  1 344 ? -13.614  30.428  -12.969  1.00 44.27 ? 325 ILE B CA    1 
ATOM   5311  C  C     . ILE B  1 344 ? -15.025  30.950  -13.225  1.00 44.56 ? 325 ILE B C     1 
ATOM   5312  O  O     . ILE B  1 344 ? -15.202  31.977  -13.866  1.00 44.25 ? 325 ILE B O     1 
ATOM   5313  C  CB    . ILE B  1 344 ? -12.728  31.497  -12.288  1.00 44.14 ? 325 ILE B CB    1 
ATOM   5314  C  CG1   . ILE B  1 344 ? -11.300  30.954  -12.099  1.00 44.06 ? 325 ILE B CG1   1 
ATOM   5315  C  CG2   . ILE B  1 344 ? -13.312  31.889  -10.962  1.00 43.44 ? 325 ILE B CG2   1 
ATOM   5316  C  CD1   . ILE B  1 344 ? -10.308  31.960  -11.414  1.00 43.40 ? 325 ILE B CD1   1 
ATOM   5317  N  N     . PRO B  1 345 ? -16.045  30.219  -12.767  1.00 45.01 ? 326 PRO B N     1 
ATOM   5318  C  CA    . PRO B  1 345 ? -17.410  30.730  -12.951  1.00 45.09 ? 326 PRO B CA    1 
ATOM   5319  C  C     . PRO B  1 345 ? -17.573  32.114  -12.338  1.00 45.64 ? 326 PRO B C     1 
ATOM   5320  O  O     . PRO B  1 345 ? -16.898  32.432  -11.326  1.00 46.46 ? 326 PRO B O     1 
ATOM   5321  C  CB    . PRO B  1 345 ? -18.269  29.724  -12.184  1.00 44.66 ? 326 PRO B CB    1 
ATOM   5322  C  CG    . PRO B  1 345 ? -17.469  28.493  -12.139  1.00 45.29 ? 326 PRO B CG    1 
ATOM   5323  C  CD    . PRO B  1 345 ? -16.027  28.914  -12.082  1.00 45.03 ? 326 PRO B CD    1 
ATOM   5324  N  N     . ARG B  1 346 ? -18.445  32.928  -12.928  1.00 45.57 ? 327 ARG B N     1 
ATOM   5325  C  CA    . ARG B  1 346 ? -18.676  34.280  -12.426  1.00 45.90 ? 327 ARG B CA    1 
ATOM   5326  C  C     . ARG B  1 346 ? -19.009  34.278  -10.918  1.00 46.31 ? 327 ARG B C     1 
ATOM   5327  O  O     . ARG B  1 346 ? -18.435  35.036  -10.132  1.00 46.66 ? 327 ARG B O     1 
ATOM   5328  C  CB    . ARG B  1 346 ? -19.791  34.966  -13.218  1.00 45.34 ? 327 ARG B CB    1 
ATOM   5329  C  CG    . ARG B  1 346 ? -19.852  36.413  -12.929  1.00 45.49 ? 327 ARG B CG    1 
ATOM   5330  C  CD    . ARG B  1 346 ? -20.912  37.134  -13.727  1.00 46.65 ? 327 ARG B CD    1 
ATOM   5331  N  NE    . ARG B  1 346 ? -20.958  36.777  -15.143  1.00 46.83 ? 327 ARG B NE    1 
ATOM   5332  C  CZ    . ARG B  1 346 ? -20.038  37.074  -16.048  1.00 45.99 ? 327 ARG B CZ    1 
ATOM   5333  N  NH1   . ARG B  1 346 ? -18.917  37.690  -15.703  1.00 47.21 ? 327 ARG B NH1   1 
ATOM   5334  N  NH2   . ARG B  1 346 ? -20.229  36.707  -17.304  1.00 46.68 ? 327 ARG B NH2   1 
ATOM   5335  N  N     . THR B  1 347 ? -19.932  33.406  -10.539  1.00 46.84 ? 328 THR B N     1 
ATOM   5336  C  CA    . THR B  1 347 ? -20.370  33.267  -9.177   1.00 46.69 ? 328 THR B CA    1 
ATOM   5337  C  C     . THR B  1 347 ? -19.186  33.241  -8.259   1.00 47.20 ? 328 THR B C     1 
ATOM   5338  O  O     . THR B  1 347 ? -19.150  33.990  -7.281   1.00 47.35 ? 328 THR B O     1 
ATOM   5339  C  CB    . THR B  1 347 ? -21.185  31.965  -9.008   1.00 47.07 ? 328 THR B CB    1 
ATOM   5340  O  OG1   . THR B  1 347 ? -22.548  32.235  -9.320   1.00 42.53 ? 328 THR B OG1   1 
ATOM   5341  C  CG2   . THR B  1 347 ? -21.088  31.405  -7.563   1.00 47.98 ? 328 THR B CG2   1 
ATOM   5342  N  N     . VAL B  1 348 ? -18.214  32.395  -8.605   1.00 47.63 ? 329 VAL B N     1 
ATOM   5343  C  CA    . VAL B  1 348 ? -17.013  32.155  -7.788   1.00 47.81 ? 329 VAL B CA    1 
ATOM   5344  C  C     . VAL B  1 348 ? -16.053  33.360  -7.746   1.00 48.55 ? 329 VAL B C     1 
ATOM   5345  O  O     . VAL B  1 348 ? -15.391  33.596  -6.727   1.00 48.48 ? 329 VAL B O     1 
ATOM   5346  C  CB    . VAL B  1 348 ? -16.248  30.865  -8.289   1.00 47.90 ? 329 VAL B CB    1 
ATOM   5347  C  CG1   . VAL B  1 348 ? -14.842  30.713  -7.643   1.00 44.89 ? 329 VAL B CG1   1 
ATOM   5348  C  CG2   . VAL B  1 348 ? -17.106  29.644  -8.039   1.00 45.28 ? 329 VAL B CG2   1 
ATOM   5349  N  N     . GLY B  1 349 ? -15.950  34.090  -8.856   1.00 49.21 ? 330 GLY B N     1 
ATOM   5350  C  CA    . GLY B  1 349 ? -15.186  35.326  -8.874   1.00 49.81 ? 330 GLY B CA    1 
ATOM   5351  C  C     . GLY B  1 349 ? -15.804  36.385  -7.954   1.00 50.65 ? 330 GLY B C     1 
ATOM   5352  O  O     . GLY B  1 349 ? -15.089  37.116  -7.269   1.00 50.78 ? 330 GLY B O     1 
ATOM   5353  N  N     . GLN B  1 350 ? -17.134  36.435  -7.926   1.00 51.20 ? 331 GLN B N     1 
ATOM   5354  C  CA    . GLN B  1 350 ? -17.873  37.420  -7.154   1.00 51.67 ? 331 GLN B CA    1 
ATOM   5355  C  C     . GLN B  1 350 ? -17.827  37.119  -5.670   1.00 52.11 ? 331 GLN B C     1 
ATOM   5356  O  O     . GLN B  1 350 ? -17.741  38.037  -4.862   1.00 52.01 ? 331 GLN B O     1 
ATOM   5357  C  CB    . GLN B  1 350 ? -19.335  37.409  -7.586   1.00 51.94 ? 331 GLN B CB    1 
ATOM   5358  C  CG    . GLN B  1 350 ? -19.520  37.815  -9.013   1.00 53.43 ? 331 GLN B CG    1 
ATOM   5359  C  CD    . GLN B  1 350 ? -19.178  39.265  -9.236   1.00 54.70 ? 331 GLN B CD    1 
ATOM   5360  O  OE1   . GLN B  1 350 ? -19.984  40.131  -8.937   1.00 57.32 ? 331 GLN B OE1   1 
ATOM   5361  N  NE2   . GLN B  1 350 ? -17.989  39.539  -9.771   1.00 54.45 ? 331 GLN B NE2   1 
ATOM   5362  N  N     . GLU B  1 351 ? -17.932  35.836  -5.316   1.00 52.13 ? 332 GLU B N     1 
ATOM   5363  C  CA    . GLU B  1 351 ? -17.944  35.423  -3.915   1.00 52.41 ? 332 GLU B CA    1 
ATOM   5364  C  C     . GLU B  1 351 ? -16.532  35.205  -3.376   1.00 52.48 ? 332 GLU B C     1 
ATOM   5365  O  O     . GLU B  1 351 ? -16.346  35.083  -2.162   1.00 52.65 ? 332 GLU B O     1 
ATOM   5366  C  CB    . GLU B  1 351 ? -18.798  34.165  -3.741   1.00 52.17 ? 332 GLU B CB    1 
ATOM   5367  C  CG    . GLU B  1 351 ? -20.250  34.454  -3.973   1.00 52.71 ? 332 GLU B CG    1 
ATOM   5368  C  CD    . GLU B  1 351 ? -21.157  33.257  -3.762   1.00 54.66 ? 332 GLU B CD    1 
ATOM   5369  O  OE1   . GLU B  1 351 ? -20.688  32.217  -3.257   1.00 59.23 ? 332 GLU B OE1   1 
ATOM   5370  O  OE2   . GLU B  1 351 ? -22.364  33.350  -4.105   1.00 58.37 ? 332 GLU B OE2   1 
ATOM   5371  N  N     . LYS B  1 352 ? -15.535  35.210  -4.264   1.00 52.50 ? 333 LYS B N     1 
ATOM   5372  C  CA    . LYS B  1 352 ? -14.125  35.020  -3.874   1.00 52.88 ? 333 LYS B CA    1 
ATOM   5373  C  C     . LYS B  1 352 ? -13.877  33.699  -3.122   1.00 52.39 ? 333 LYS B C     1 
ATOM   5374  O  O     . LYS B  1 352 ? -13.005  33.604  -2.257   1.00 52.65 ? 333 LYS B O     1 
ATOM   5375  C  CB    . LYS B  1 352 ? -13.608  36.221  -3.080   1.00 53.34 ? 333 LYS B CB    1 
ATOM   5376  C  CG    . LYS B  1 352 ? -13.513  37.505  -3.916   1.00 54.47 ? 333 LYS B CG    1 
ATOM   5377  C  CD    . LYS B  1 352 ? -14.019  38.700  -3.107   1.00 55.91 ? 333 LYS B CD    1 
ATOM   5378  C  CE    . LYS B  1 352 ? -13.664  40.066  -3.755   1.00 57.40 ? 333 LYS B CE    1 
ATOM   5379  N  NZ    . LYS B  1 352 ? -12.172  40.208  -3.816   1.00 59.75 ? 333 LYS B NZ    1 
ATOM   5380  N  N     . LYS B  1 353 ? -14.627  32.673  -3.505   1.00 51.31 ? 334 LYS B N     1 
ATOM   5381  C  CA    . LYS B  1 353 ? -14.528  31.371  -2.898   1.00 50.63 ? 334 LYS B CA    1 
ATOM   5382  C  C     . LYS B  1 353 ? -15.354  30.441  -3.774   1.00 50.09 ? 334 LYS B C     1 
ATOM   5383  O  O     . LYS B  1 353 ? -16.243  30.906  -4.515   1.00 49.97 ? 334 LYS B O     1 
ATOM   5384  C  CB    . LYS B  1 353 ? -15.071  31.391  -1.460   1.00 50.68 ? 334 LYS B CB    1 
ATOM   5385  C  CG    . LYS B  1 353 ? -16.588  31.611  -1.336   1.00 50.56 ? 334 LYS B CG    1 
ATOM   5386  C  CD    . LYS B  1 353 ? -17.069  31.629  0.115    1.00 51.15 ? 334 LYS B CD    1 
ATOM   5387  C  CE    . LYS B  1 353 ? -18.622  31.618  0.202    1.00 52.30 ? 334 LYS B CE    1 
ATOM   5388  N  NZ    . LYS B  1 353 ? -19.108  31.542  1.615    1.00 51.76 ? 334 LYS B NZ    1 
ATOM   5389  N  N     . GLY B  1 354 ? -15.064  29.143  -3.699   1.00 49.08 ? 335 GLY B N     1 
ATOM   5390  C  CA    . GLY B  1 354 ? -15.871  28.125  -4.370   1.00 48.30 ? 335 GLY B CA    1 
ATOM   5391  C  C     . GLY B  1 354 ? -15.044  27.033  -5.018   1.00 47.89 ? 335 GLY B C     1 
ATOM   5392  O  O     . GLY B  1 354 ? -14.436  26.235  -4.326   1.00 48.07 ? 335 GLY B O     1 
ATOM   5393  N  N     . TYR B  1 355 ? -15.027  27.016  -6.350   1.00 46.94 ? 336 TYR B N     1 
ATOM   5394  C  CA    . TYR B  1 355 ? -14.456  25.934  -7.127   1.00 46.22 ? 336 TYR B CA    1 
ATOM   5395  C  C     . TYR B  1 355 ? -14.057  26.480  -8.499   1.00 45.76 ? 336 TYR B C     1 
ATOM   5396  O  O     . TYR B  1 355 ? -14.588  27.510  -8.930   1.00 45.03 ? 336 TYR B O     1 
ATOM   5397  C  CB    . TYR B  1 355 ? -15.482  24.786  -7.286   1.00 46.14 ? 336 TYR B CB    1 
ATOM   5398  C  CG    . TYR B  1 355 ? -16.768  25.156  -8.010   1.00 45.88 ? 336 TYR B CG    1 
ATOM   5399  C  CD1   . TYR B  1 355 ? -16.901  25.013  -9.385   1.00 46.33 ? 336 TYR B CD1   1 
ATOM   5400  C  CD2   . TYR B  1 355 ? -17.860  25.646  -7.320   1.00 47.22 ? 336 TYR B CD2   1 
ATOM   5401  C  CE1   . TYR B  1 355 ? -18.087  25.367  -10.053  1.00 45.34 ? 336 TYR B CE1   1 
ATOM   5402  C  CE2   . TYR B  1 355 ? -19.053  25.979  -7.979   1.00 46.63 ? 336 TYR B CE2   1 
ATOM   5403  C  CZ    . TYR B  1 355 ? -19.145  25.863  -9.340   1.00 45.97 ? 336 TYR B CZ    1 
ATOM   5404  O  OH    . TYR B  1 355 ? -20.339  26.200  -9.960   1.00 46.87 ? 336 TYR B OH    1 
ATOM   5405  N  N     . PHE B  1 356 ? -13.148  25.780  -9.196   1.00 44.96 ? 337 PHE B N     1 
ATOM   5406  C  CA    . PHE B  1 356 ? -12.853  26.110  -10.603  1.00 44.18 ? 337 PHE B CA    1 
ATOM   5407  C  C     . PHE B  1 356 ? -13.234  24.948  -11.481  1.00 43.76 ? 337 PHE B C     1 
ATOM   5408  O  O     . PHE B  1 356 ? -13.400  23.843  -10.994  1.00 44.07 ? 337 PHE B O     1 
ATOM   5409  C  CB    . PHE B  1 356 ? -11.400  26.511  -10.827  1.00 44.18 ? 337 PHE B CB    1 
ATOM   5410  C  CG    . PHE B  1 356 ? -10.390  25.425  -10.545  1.00 43.93 ? 337 PHE B CG    1 
ATOM   5411  C  CD1   . PHE B  1 356 ? -9.907   24.626  -11.569  1.00 44.29 ? 337 PHE B CD1   1 
ATOM   5412  C  CD2   . PHE B  1 356 ? -9.909   25.223  -9.261   1.00 43.03 ? 337 PHE B CD2   1 
ATOM   5413  C  CE1   . PHE B  1 356 ? -8.967   23.625  -11.315  1.00 44.04 ? 337 PHE B CE1   1 
ATOM   5414  C  CE2   . PHE B  1 356 ? -9.002   24.233  -8.997   1.00 42.69 ? 337 PHE B CE2   1 
ATOM   5415  C  CZ    . PHE B  1 356 ? -8.515   23.441  -10.024  1.00 43.90 ? 337 PHE B CZ    1 
ATOM   5416  N  N     . GLU B  1 357 ? -13.386  25.224  -12.770  1.00 43.06 ? 338 GLU B N     1 
ATOM   5417  C  CA    . GLU B  1 357 ? -13.876  24.277  -13.734  1.00 42.79 ? 338 GLU B CA    1 
ATOM   5418  C  C     . GLU B  1 357 ? -12.783  23.986  -14.704  1.00 42.30 ? 338 GLU B C     1 
ATOM   5419  O  O     . GLU B  1 357 ? -12.412  24.863  -15.473  1.00 41.74 ? 338 GLU B O     1 
ATOM   5420  C  CB    . GLU B  1 357 ? -15.044  24.880  -14.522  1.00 42.98 ? 338 GLU B CB    1 
ATOM   5421  C  CG    . GLU B  1 357 ? -15.673  23.956  -15.601  1.00 43.20 ? 338 GLU B CG    1 
ATOM   5422  C  CD    . GLU B  1 357 ? -16.412  24.704  -16.738  1.00 43.67 ? 338 GLU B CD    1 
ATOM   5423  O  OE1   . GLU B  1 357 ? -16.089  25.872  -17.030  1.00 43.03 ? 338 GLU B OE1   1 
ATOM   5424  O  OE2   . GLU B  1 357 ? -17.321  24.105  -17.363  1.00 47.80 ? 338 GLU B OE2   1 
ATOM   5425  N  N     . ASP B  1 358 ? -12.294  22.740  -14.709  1.00 42.14 ? 339 ASP B N     1 
ATOM   5426  C  CA    . ASP B  1 358 ? -11.285  22.308  -15.719  1.00 41.87 ? 339 ASP B CA    1 
ATOM   5427  C  C     . ASP B  1 358 ? -12.020  21.802  -16.961  1.00 41.11 ? 339 ASP B C     1 
ATOM   5428  O  O     . ASP B  1 358 ? -12.647  20.791  -16.915  1.00 40.87 ? 339 ASP B O     1 
ATOM   5429  C  CB    . ASP B  1 358 ? -10.357  21.248  -15.143  1.00 40.89 ? 339 ASP B CB    1 
ATOM   5430  C  CG    . ASP B  1 358 ? -9.208   20.905  -16.066  1.00 42.29 ? 339 ASP B CG    1 
ATOM   5431  O  OD1   . ASP B  1 358 ? -9.293   21.209  -17.295  1.00 41.94 ? 339 ASP B OD1   1 
ATOM   5432  O  OD2   . ASP B  1 358 ? -8.218   20.321  -15.537  1.00 40.79 ? 339 ASP B OD2   1 
ATOM   5433  N  N     . ARG B  1 359 ? -11.923  22.527  -18.065  1.00 41.42 ? 340 ARG B N     1 
ATOM   5434  C  CA    . ARG B  1 359 ? -12.766  22.264  -19.255  1.00 41.40 ? 340 ARG B CA    1 
ATOM   5435  C  C     . ARG B  1 359 ? -12.124  21.327  -20.267  1.00 41.32 ? 340 ARG B C     1 
ATOM   5436  O  O     . ARG B  1 359 ? -12.735  21.026  -21.292  1.00 42.12 ? 340 ARG B O     1 
ATOM   5437  C  CB    . ARG B  1 359 ? -13.138  23.572  -19.964  1.00 41.04 ? 340 ARG B CB    1 
ATOM   5438  C  CG    . ARG B  1 359 ? -13.976  24.525  -19.114  1.00 41.29 ? 340 ARG B CG    1 
ATOM   5439  C  CD    . ARG B  1 359 ? -14.237  25.841  -19.816  1.00 41.37 ? 340 ARG B CD    1 
ATOM   5440  N  NE    . ARG B  1 359 ? -14.998  25.677  -21.052  1.00 42.93 ? 340 ARG B NE    1 
ATOM   5441  C  CZ    . ARG B  1 359 ? -16.327  25.549  -21.125  1.00 40.37 ? 340 ARG B CZ    1 
ATOM   5442  N  NH1   . ARG B  1 359 ? -17.077  25.558  -20.028  1.00 41.80 ? 340 ARG B NH1   1 
ATOM   5443  N  NH2   . ARG B  1 359 ? -16.901  25.406  -22.302  1.00 37.28 ? 340 ARG B NH2   1 
ATOM   5444  N  N     . ARG B  1 360 ? -10.924  20.839  -19.963  1.00 40.59 ? 341 ARG B N     1 
ATOM   5445  C  CA    . ARG B  1 360 ? -10.184  20.011  -20.888  1.00 40.61 ? 341 ARG B CA    1 
ATOM   5446  C  C     . ARG B  1 360 ? -10.585  18.515  -20.976  1.00 40.21 ? 341 ARG B C     1 
ATOM   5447  O  O     . ARG B  1 360 ? -10.323  17.888  -21.989  1.00 41.01 ? 341 ARG B O     1 
ATOM   5448  C  CB    . ARG B  1 360 ? -8.670   20.093  -20.546  1.00 40.89 ? 341 ARG B CB    1 
ATOM   5449  C  CG    . ARG B  1 360 ? -8.026   21.481  -20.774  1.00 41.06 ? 341 ARG B CG    1 
ATOM   5450  C  CD    . ARG B  1 360 ? -6.612   21.552  -20.190  1.00 40.86 ? 341 ARG B CD    1 
ATOM   5451  N  NE    . ARG B  1 360 ? -6.634   21.374  -18.742  1.00 41.05 ? 341 ARG B NE    1 
ATOM   5452  C  CZ    . ARG B  1 360 ? -5.548   21.269  -17.990  1.00 43.11 ? 341 ARG B CZ    1 
ATOM   5453  N  NH1   . ARG B  1 360 ? -4.335   21.378  -18.542  1.00 45.11 ? 341 ARG B NH1   1 
ATOM   5454  N  NH2   . ARG B  1 360 ? -5.661   21.097  -16.675  1.00 42.17 ? 341 ARG B NH2   1 
ATOM   5455  N  N     . PRO B  1 361 ? -11.076  17.899  -19.901  1.00 39.86 ? 342 PRO B N     1 
ATOM   5456  C  CA    . PRO B  1 361 ? -11.310  16.463  -20.053  1.00 39.99 ? 342 PRO B CA    1 
ATOM   5457  C  C     . PRO B  1 361 ? -12.336  16.106  -21.129  1.00 39.99 ? 342 PRO B C     1 
ATOM   5458  O  O     . PRO B  1 361 ? -13.383  16.778  -21.268  1.00 39.26 ? 342 PRO B O     1 
ATOM   5459  C  CB    . PRO B  1 361 ? -11.822  16.024  -18.675  1.00 40.21 ? 342 PRO B CB    1 
ATOM   5460  C  CG    . PRO B  1 361 ? -11.355  17.075  -17.728  1.00 40.12 ? 342 PRO B CG    1 
ATOM   5461  C  CD    . PRO B  1 361 ? -11.335  18.359  -18.524  1.00 40.31 ? 342 PRO B CD    1 
ATOM   5462  N  N     . SER B  1 362 ? -11.998  15.062  -21.895  1.00 40.03 ? 343 SER B N     1 
ATOM   5463  C  CA    . SER B  1 362 ? -12.876  14.507  -22.917  1.00 40.01 ? 343 SER B CA    1 
ATOM   5464  C  C     . SER B  1 362 ? -14.123  13.856  -22.290  1.00 39.92 ? 343 SER B C     1 
ATOM   5465  O  O     . SER B  1 362 ? -14.078  13.301  -21.151  1.00 39.95 ? 343 SER B O     1 
ATOM   5466  C  CB    . SER B  1 362 ? -12.120  13.486  -23.755  1.00 39.90 ? 343 SER B CB    1 
ATOM   5467  O  OG    . SER B  1 362 ? -12.951  12.872  -24.729  1.00 41.64 ? 343 SER B OG    1 
ATOM   5468  N  N     . ALA B  1 363 ? -15.228  13.939  -23.031  1.00 39.18 ? 344 ALA B N     1 
ATOM   5469  C  CA    . ALA B  1 363 ? -16.424  13.191  -22.677  1.00 39.44 ? 344 ALA B CA    1 
ATOM   5470  C  C     . ALA B  1 363 ? -16.075  11.732  -22.342  1.00 39.74 ? 344 ALA B C     1 
ATOM   5471  O  O     . ALA B  1 363 ? -16.753  11.156  -21.491  1.00 40.58 ? 344 ALA B O     1 
ATOM   5472  C  CB    . ALA B  1 363 ? -17.455  13.246  -23.764  1.00 38.32 ? 344 ALA B CB    1 
ATOM   5473  N  N     . ASN B  1 364 ? -15.046  11.135  -22.988  1.00 39.85 ? 345 ASN B N     1 
ATOM   5474  C  CA    . ASN B  1 364 ? -14.728  9.714   -22.761  1.00 39.72 ? 345 ASN B CA    1 
ATOM   5475  C  C     . ASN B  1 364 ? -13.608  9.486   -21.785  1.00 39.83 ? 345 ASN B C     1 
ATOM   5476  O  O     . ASN B  1 364 ? -13.057  8.412   -21.784  1.00 39.38 ? 345 ASN B O     1 
ATOM   5477  C  CB    . ASN B  1 364 ? -14.407  8.964   -24.059  1.00 39.85 ? 345 ASN B CB    1 
ATOM   5478  C  CG    . ASN B  1 364 ? -13.169  9.460   -24.736  1.00 41.48 ? 345 ASN B CG    1 
ATOM   5479  O  OD1   . ASN B  1 364 ? -12.635  10.508  -24.373  1.00 42.26 ? 345 ASN B OD1   1 
ATOM   5480  N  ND2   . ASN B  1 364 ? -12.710  8.727   -25.763  1.00 40.44 ? 345 ASN B ND2   1 
ATOM   5481  N  N     . CYS B  1 365 ? -13.327  10.461  -20.912  1.00 39.77 ? 346 CYS B N     1 
ATOM   5482  C  CA    . CYS B  1 365 ? -12.289  10.294  -19.896  1.00 39.82 ? 346 CYS B CA    1 
ATOM   5483  C  C     . CYS B  1 365 ? -12.625  9.271   -18.861  1.00 39.27 ? 346 CYS B C     1 
ATOM   5484  O  O     . CYS B  1 365 ? -13.779  8.897   -18.705  1.00 40.18 ? 346 CYS B O     1 
ATOM   5485  C  CB    . CYS B  1 365 ? -11.980  11.614  -19.186  1.00 39.54 ? 346 CYS B CB    1 
ATOM   5486  S  SG    . CYS B  1 365 ? -13.269  12.194  -18.171  1.00 41.60 ? 346 CYS B SG    1 
ATOM   5487  N  N     . ASP B  1 366 ? -11.617  8.803   -18.143  1.00 39.23 ? 347 ASP B N     1 
ATOM   5488  C  CA    . ASP B  1 366 ? -11.876  7.958   -16.995  1.00 39.13 ? 347 ASP B CA    1 
ATOM   5489  C  C     . ASP B  1 366 ? -11.765  8.862   -15.784  1.00 39.09 ? 347 ASP B C     1 
ATOM   5490  O  O     . ASP B  1 366 ? -10.694  9.350   -15.471  1.00 38.45 ? 347 ASP B O     1 
ATOM   5491  C  CB    . ASP B  1 366 ? -10.951  6.728   -16.942  1.00 38.77 ? 347 ASP B CB    1 
ATOM   5492  C  CG    . ASP B  1 366 ? -11.169  5.845   -15.662  1.00 40.16 ? 347 ASP B CG    1 
ATOM   5493  O  OD1   . ASP B  1 366 ? -11.743  6.302   -14.630  1.00 38.78 ? 347 ASP B OD1   1 
ATOM   5494  O  OD2   . ASP B  1 366 ? -10.710  4.679   -15.679  1.00 43.20 ? 347 ASP B OD2   1 
ATOM   5495  N  N     . PRO B  1 367 ? -12.889  9.082   -15.086  1.00 39.45 ? 348 PRO B N     1 
ATOM   5496  C  CA    . PRO B  1 367 ? -12.894  10.003  -13.968  1.00 39.59 ? 348 PRO B CA    1 
ATOM   5497  C  C     . PRO B  1 367 ? -11.805  9.693   -12.929  1.00 39.91 ? 348 PRO B C     1 
ATOM   5498  O  O     . PRO B  1 367 ? -11.380  10.584  -12.178  1.00 39.52 ? 348 PRO B O     1 
ATOM   5499  C  CB    . PRO B  1 367 ? -14.302  9.827   -13.356  1.00 39.69 ? 348 PRO B CB    1 
ATOM   5500  C  CG    . PRO B  1 367 ? -14.850  8.567   -13.900  1.00 39.37 ? 348 PRO B CG    1 
ATOM   5501  C  CD    . PRO B  1 367 ? -14.202  8.428   -15.267  1.00 39.83 ? 348 PRO B CD    1 
ATOM   5502  N  N     . PHE B  1 368 ? -11.345  8.448   -12.879  1.00 40.06 ? 349 PHE B N     1 
ATOM   5503  C  CA    . PHE B  1 368 ? -10.358  8.099   -11.861  1.00 40.27 ? 349 PHE B CA    1 
ATOM   5504  C  C     . PHE B  1 368 ? -8.975   8.621   -12.252  1.00 40.04 ? 349 PHE B C     1 
ATOM   5505  O  O     . PHE B  1 368 ? -8.150   8.962   -11.430  1.00 39.67 ? 349 PHE B O     1 
ATOM   5506  C  CB    . PHE B  1 368 ? -10.290  6.590   -11.668  1.00 40.15 ? 349 PHE B CB    1 
ATOM   5507  C  CG    . PHE B  1 368 ? -11.526  5.970   -11.079  1.00 39.67 ? 349 PHE B CG    1 
ATOM   5508  C  CD1   . PHE B  1 368 ? -12.064  6.434   -9.892   1.00 40.83 ? 349 PHE B CD1   1 
ATOM   5509  C  CD2   . PHE B  1 368 ? -12.103  4.845   -11.679  1.00 38.39 ? 349 PHE B CD2   1 
ATOM   5510  C  CE1   . PHE B  1 368 ? -13.204  5.796   -9.330   1.00 40.71 ? 349 PHE B CE1   1 
ATOM   5511  C  CE2   . PHE B  1 368 ? -13.192  4.215   -11.133  1.00 37.42 ? 349 PHE B CE2   1 
ATOM   5512  C  CZ    . PHE B  1 368 ? -13.751  4.680   -9.966   1.00 38.91 ? 349 PHE B CZ    1 
ATOM   5513  N  N     . SER B  1 369 ? -8.728   8.642   -13.534  1.00 40.45 ? 350 SER B N     1 
ATOM   5514  C  CA    . SER B  1 369 ? -7.555   9.292   -14.068  1.00 40.50 ? 350 SER B CA    1 
ATOM   5515  C  C     . SER B  1 369 ? -7.657   10.813  -13.907  1.00 40.54 ? 350 SER B C     1 
ATOM   5516  O  O     . SER B  1 369 ? -6.743   11.441  -13.401  1.00 41.68 ? 350 SER B O     1 
ATOM   5517  C  CB    . SER B  1 369 ? -7.388   8.901   -15.533  1.00 40.28 ? 350 SER B CB    1 
ATOM   5518  O  OG    . SER B  1 369 ? -6.404   9.711   -16.120  1.00 41.44 ? 350 SER B OG    1 
ATOM   5519  N  N     . VAL B  1 370 ? -8.769   11.406  -14.303  1.00 40.80 ? 351 VAL B N     1 
ATOM   5520  C  CA    . VAL B  1 370 ? -8.959   12.864  -14.148  1.00 40.60 ? 351 VAL B CA    1 
ATOM   5521  C  C     . VAL B  1 370 ? -8.797   13.330  -12.702  1.00 40.72 ? 351 VAL B C     1 
ATOM   5522  O  O     . VAL B  1 370 ? -7.991   14.234  -12.399  1.00 41.11 ? 351 VAL B O     1 
ATOM   5523  C  CB    . VAL B  1 370 ? -10.330  13.312  -14.699  1.00 40.06 ? 351 VAL B CB    1 
ATOM   5524  C  CG1   . VAL B  1 370 ? -10.580  14.773  -14.414  1.00 40.69 ? 351 VAL B CG1   1 
ATOM   5525  C  CG2   . VAL B  1 370 ? -10.392  13.063  -16.165  1.00 38.30 ? 351 VAL B CG2   1 
ATOM   5526  N  N     . THR B  1 371 ? -9.521   12.688  -11.796  1.00 41.14 ? 352 THR B N     1 
ATOM   5527  C  CA    . THR B  1 371 ? -9.547   13.143  -10.405  1.00 41.22 ? 352 THR B CA    1 
ATOM   5528  C  C     . THR B  1 371 ? -8.188   12.934  -9.753   1.00 42.01 ? 352 THR B C     1 
ATOM   5529  O  O     . THR B  1 371 ? -7.720   13.788  -8.993   1.00 42.51 ? 352 THR B O     1 
ATOM   5530  C  CB    . THR B  1 371 ? -10.673  12.481  -9.589   1.00 41.24 ? 352 THR B CB    1 
ATOM   5531  O  OG1   . THR B  1 371 ? -10.508  11.059  -9.593   1.00 42.10 ? 352 THR B OG1   1 
ATOM   5532  C  CG2   . THR B  1 371 ? -12.027  12.848  -10.163  1.00 39.32 ? 352 THR B CG2   1 
ATOM   5533  N  N     . GLU B  1 372 ? -7.524   11.826  -10.081  1.00 42.23 ? 353 GLU B N     1 
ATOM   5534  C  CA    . GLU B  1 372 ? -6.167   11.570  -9.565   1.00 42.06 ? 353 GLU B CA    1 
ATOM   5535  C  C     . GLU B  1 372 ? -5.162   12.615  -10.017  1.00 41.78 ? 353 GLU B C     1 
ATOM   5536  O  O     . GLU B  1 372 ? -4.389   13.105  -9.207   1.00 41.61 ? 353 GLU B O     1 
ATOM   5537  C  CB    . GLU B  1 372 ? -5.672   10.167  -9.961   1.00 42.62 ? 353 GLU B CB    1 
ATOM   5538  C  CG    . GLU B  1 372 ? -4.319   9.774   -9.342   1.00 42.11 ? 353 GLU B CG    1 
ATOM   5539  C  CD    . GLU B  1 372 ? -3.865   8.382   -9.754   1.00 42.53 ? 353 GLU B CD    1 
ATOM   5540  O  OE1   . GLU B  1 372 ? -4.761   7.466   -9.785   1.00 44.38 ? 353 GLU B OE1   1 
ATOM   5541  O  OE2   . GLU B  1 372 ? -2.620   8.200   -10.031  1.00 39.98 ? 353 GLU B OE2   1 
ATOM   5542  N  N     . ALA B  1 373 ? -5.164   12.957  -11.301  1.00 41.57 ? 354 ALA B N     1 
ATOM   5543  C  CA    . ALA B  1 373 ? -4.269   14.002  -11.777  1.00 41.68 ? 354 ALA B CA    1 
ATOM   5544  C  C     . ALA B  1 373 ? -4.511   15.333  -11.038  1.00 42.18 ? 354 ALA B C     1 
ATOM   5545  O  O     . ALA B  1 373 ? -3.561   15.994  -10.614  1.00 42.78 ? 354 ALA B O     1 
ATOM   5546  C  CB    . ALA B  1 373 ? -4.372   14.180  -13.263  1.00 41.23 ? 354 ALA B CB    1 
ATOM   5547  N  N     . LEU B  1 374 ? -5.755   15.738  -10.842  1.00 42.12 ? 355 LEU B N     1 
ATOM   5548  C  CA    . LEU B  1 374 ? -5.948   16.997  -10.179  1.00 42.15 ? 355 LEU B CA    1 
ATOM   5549  C  C     . LEU B  1 374 ? -5.346   16.955  -8.765   1.00 42.74 ? 355 LEU B C     1 
ATOM   5550  O  O     . LEU B  1 374 ? -4.775   17.954  -8.332   1.00 43.93 ? 355 LEU B O     1 
ATOM   5551  C  CB    . LEU B  1 374 ? -7.420   17.427  -10.170  1.00 42.20 ? 355 LEU B CB    1 
ATOM   5552  C  CG    . LEU B  1 374 ? -8.057   17.842  -11.517  1.00 41.52 ? 355 LEU B CG    1 
ATOM   5553  C  CD1   . LEU B  1 374 ? -9.540   17.664  -11.434  1.00 39.27 ? 355 LEU B CD1   1 
ATOM   5554  C  CD2   . LEU B  1 374 ? -7.752   19.265  -11.906  1.00 39.40 ? 355 LEU B CD2   1 
ATOM   5555  N  N     . ILE B  1 375 ? -5.420   15.837  -8.050   1.00 42.41 ? 356 ILE B N     1 
ATOM   5556  C  CA    . ILE B  1 375 ? -4.950   15.832  -6.665   1.00 42.72 ? 356 ILE B CA    1 
ATOM   5557  C  C     . ILE B  1 375 ? -3.426   15.866  -6.670   1.00 43.45 ? 356 ILE B C     1 
ATOM   5558  O  O     . ILE B  1 375 ? -2.815   16.661  -5.955   1.00 44.12 ? 356 ILE B O     1 
ATOM   5559  C  CB    . ILE B  1 375 ? -5.384   14.549  -5.859   1.00 43.22 ? 356 ILE B CB    1 
ATOM   5560  C  CG1   . ILE B  1 375 ? -6.908   14.406  -5.771   1.00 41.47 ? 356 ILE B CG1   1 
ATOM   5561  C  CG2   . ILE B  1 375 ? -4.651   14.473  -4.472   1.00 42.42 ? 356 ILE B CG2   1 
ATOM   5562  C  CD1   . ILE B  1 375 ? -7.615   15.569  -5.168   1.00 43.30 ? 356 ILE B CD1   1 
ATOM   5563  N  N     . ARG B  1 376 ? -2.812   14.990  -7.455   1.00 43.22 ? 357 ARG B N     1 
ATOM   5564  C  CA    . ARG B  1 376 ? -1.364   14.980  -7.585   1.00 43.74 ? 357 ARG B CA    1 
ATOM   5565  C  C     . ARG B  1 376 ? -0.780   16.358  -7.888   1.00 44.04 ? 357 ARG B C     1 
ATOM   5566  O  O     . ARG B  1 376 ? 0.181    16.791  -7.249   1.00 43.88 ? 357 ARG B O     1 
ATOM   5567  C  CB    . ARG B  1 376 ? -0.937   14.012  -8.685   1.00 43.75 ? 357 ARG B CB    1 
ATOM   5568  C  CG    . ARG B  1 376 ? -1.079   12.537  -8.278   1.00 44.01 ? 357 ARG B CG    1 
ATOM   5569  C  CD    . ARG B  1 376 ? -0.381   11.629  -9.276   1.00 43.93 ? 357 ARG B CD    1 
ATOM   5570  N  NE    . ARG B  1 376 ? -0.633   10.199  -9.083   1.00 43.35 ? 357 ARG B NE    1 
ATOM   5571  C  CZ    . ARG B  1 376 ? 0.037    9.410   -8.255   1.00 43.34 ? 357 ARG B CZ    1 
ATOM   5572  N  NH1   . ARG B  1 376 ? 1.012    9.885   -7.488   1.00 45.35 ? 357 ARG B NH1   1 
ATOM   5573  N  NH2   . ARG B  1 376 ? -0.287   8.141   -8.163   1.00 43.01 ? 357 ARG B NH2   1 
ATOM   5574  N  N     . THR B  1 377 ? -1.374   17.049  -8.857   1.00 43.96 ? 358 THR B N     1 
ATOM   5575  C  CA    . THR B  1 377 ? -0.900   18.367  -9.244   1.00 44.21 ? 358 THR B CA    1 
ATOM   5576  C  C     . THR B  1 377 ? -1.238   19.429  -8.210   1.00 44.42 ? 358 THR B C     1 
ATOM   5577  O  O     . THR B  1 377 ? -0.395   20.181  -7.815   1.00 44.36 ? 358 THR B O     1 
ATOM   5578  C  CB    . THR B  1 377 ? -1.419   18.773  -10.649  1.00 44.17 ? 358 THR B CB    1 
ATOM   5579  O  OG1   . THR B  1 377 ? -0.852   17.877  -11.628  1.00 44.16 ? 358 THR B OG1   1 
ATOM   5580  C  CG2   . THR B  1 377 ? -1.090   20.247  -10.980  1.00 42.02 ? 358 THR B CG2   1 
ATOM   5581  N  N     . CYS B  1 378 ? -2.461   19.484  -7.737   1.00 45.31 ? 359 CYS B N     1 
ATOM   5582  C  CA    . CYS B  1 378 ? -2.850   20.630  -6.934   1.00 45.90 ? 359 CYS B CA    1 
ATOM   5583  C  C     . CYS B  1 378 ? -2.590   20.520  -5.442   1.00 46.10 ? 359 CYS B C     1 
ATOM   5584  O  O     . CYS B  1 378 ? -2.444   21.536  -4.790   1.00 45.89 ? 359 CYS B O     1 
ATOM   5585  C  CB    . CYS B  1 378 ? -4.297   20.973  -7.221   1.00 45.36 ? 359 CYS B CB    1 
ATOM   5586  S  SG    . CYS B  1 378 ? -4.449   21.288  -8.983   1.00 47.80 ? 359 CYS B SG    1 
ATOM   5587  N  N     . LEU B  1 379 ? -2.533   19.305  -4.914   1.00 46.74 ? 360 LEU B N     1 
ATOM   5588  C  CA    . LEU B  1 379 ? -2.452   19.102  -3.471   1.00 47.35 ? 360 LEU B CA    1 
ATOM   5589  C  C     . LEU B  1 379 ? -1.173   18.420  -3.052   1.00 47.99 ? 360 LEU B C     1 
ATOM   5590  O  O     . LEU B  1 379 ? -0.675   18.723  -1.974   1.00 48.29 ? 360 LEU B O     1 
ATOM   5591  C  CB    . LEU B  1 379 ? -3.633   18.277  -2.962   1.00 47.39 ? 360 LEU B CB    1 
ATOM   5592  C  CG    . LEU B  1 379 ? -4.995   18.782  -3.425   1.00 48.28 ? 360 LEU B CG    1 
ATOM   5593  C  CD1   . LEU B  1 379 ? -6.113   18.064  -2.693   1.00 48.67 ? 360 LEU B CD1   1 
ATOM   5594  C  CD2   . LEU B  1 379 ? -5.083   20.242  -3.203   1.00 47.82 ? 360 LEU B CD2   1 
ATOM   5595  N  N     . LEU B  1 380 ? -0.671   17.484  -3.873   1.00 48.46 ? 361 LEU B N     1 
ATOM   5596  C  CA    . LEU B  1 380 ? 0.582    16.796  -3.611   1.00 48.49 ? 361 LEU B CA    1 
ATOM   5597  C  C     . LEU B  1 380 ? 1.745    17.481  -4.323   1.00 49.03 ? 361 LEU B C     1 
ATOM   5598  O  O     . LEU B  1 380 ? 2.895    17.068  -4.183   1.00 48.07 ? 361 LEU B O     1 
ATOM   5599  C  CB    . LEU B  1 380 ? 0.495    15.332  -4.011   1.00 48.50 ? 361 LEU B CB    1 
ATOM   5600  C  CG    . LEU B  1 380 ? -0.503   14.449  -3.217   1.00 49.14 ? 361 LEU B CG    1 
ATOM   5601  C  CD1   . LEU B  1 380 ? -0.510   13.009  -3.780   1.00 45.81 ? 361 LEU B CD1   1 
ATOM   5602  C  CD2   . LEU B  1 380 ? -0.307   14.445  -1.680   1.00 45.48 ? 361 LEU B CD2   1 
ATOM   5603  N  N     . ASN B  1 381 ? 1.442    18.557  -5.053   1.00 49.82 ? 362 ASN B N     1 
ATOM   5604  C  CA    . ASN B  1 381 ? 2.453    19.367  -5.741   1.00 50.13 ? 362 ASN B CA    1 
ATOM   5605  C  C     . ASN B  1 381 ? 3.450    18.534  -6.494   1.00 50.42 ? 362 ASN B C     1 
ATOM   5606  O  O     . ASN B  1 381 ? 4.634    18.765  -6.423   1.00 49.82 ? 362 ASN B O     1 
ATOM   5607  C  CB    . ASN B  1 381 ? 3.185    20.327  -4.790   1.00 50.36 ? 362 ASN B CB    1 
ATOM   5608  C  CG    . ASN B  1 381 ? 2.237    21.189  -3.995   1.00 51.24 ? 362 ASN B CG    1 
ATOM   5609  O  OD1   . ASN B  1 381 ? 1.192    21.619  -4.475   1.00 52.21 ? 362 ASN B OD1   1 
ATOM   5610  N  ND2   . ASN B  1 381 ? 2.575    21.408  -2.760   1.00 52.53 ? 362 ASN B ND2   1 
ATOM   5611  N  N     . GLU B  1 382 ? 2.953    17.565  -7.235   1.00 51.21 ? 363 GLU B N     1 
ATOM   5612  C  CA    . GLU B  1 382 ? 3.806    16.814  -8.123   1.00 52.35 ? 363 GLU B CA    1 
ATOM   5613  C  C     . GLU B  1 382 ? 4.176    17.630  -9.346   1.00 52.55 ? 363 GLU B C     1 
ATOM   5614  O  O     . GLU B  1 382 ? 3.420    18.507  -9.774   1.00 51.93 ? 363 GLU B O     1 
ATOM   5615  C  CB    . GLU B  1 382 ? 3.139    15.519  -8.551   1.00 52.25 ? 363 GLU B CB    1 
ATOM   5616  C  CG    . GLU B  1 382 ? 3.148    14.535  -7.450   1.00 52.51 ? 363 GLU B CG    1 
ATOM   5617  C  CD    . GLU B  1 382 ? 2.668    13.189  -7.872   1.00 52.30 ? 363 GLU B CD    1 
ATOM   5618  O  OE1   . GLU B  1 382 ? 2.884    12.803  -9.026   1.00 53.83 ? 363 GLU B OE1   1 
ATOM   5619  O  OE2   . GLU B  1 382 ? 2.069    12.511  -7.044   1.00 51.48 ? 363 GLU B OE2   1 
ATOM   5620  N  N     . THR B  1 383 ? 5.354    17.299  -9.874   1.00 53.30 ? 364 THR B N     1 
ATOM   5621  C  CA    . THR B  1 383 ? 6.000    18.001  -10.965  1.00 54.09 ? 364 THR B CA    1 
ATOM   5622  C  C     . THR B  1 383 ? 6.656    17.036  -11.988  1.00 54.57 ? 364 THR B C     1 
ATOM   5623  O  O     . THR B  1 383 ? 7.320    17.488  -12.878  1.00 54.86 ? 364 THR B O     1 
ATOM   5624  C  CB    . THR B  1 383 ? 7.105    18.981  -10.405  1.00 54.21 ? 364 THR B CB    1 
ATOM   5625  O  OG1   . THR B  1 383 ? 8.036    18.247  -9.601   1.00 53.23 ? 364 THR B OG1   1 
ATOM   5626  C  CG2   . THR B  1 383 ? 6.492    20.144  -9.572   1.00 52.33 ? 364 THR B CG2   1 
ATOM   5627  N  N     . GLY B  1 384 ? 6.437    15.730  -11.890  1.00 55.37 ? 365 GLY B N     1 
ATOM   5628  C  CA    . GLY B  1 384 ? 7.220    14.729  -12.651  1.00 55.98 ? 365 GLY B CA    1 
ATOM   5629  C  C     . GLY B  1 384 ? 6.649    14.211  -13.976  1.00 57.33 ? 365 GLY B C     1 
ATOM   5630  O  O     . GLY B  1 384 ? 6.051    14.973  -14.780  1.00 58.37 ? 365 GLY B O     1 
ATOM   5631  N  N     . ASN C  1 29  ? -52.089  -9.268  -30.477  1.00 62.81 ? 10  ASN C N     1 
ATOM   5632  C  CA    . ASN C  1 29  ? -51.369  -8.200  -29.706  1.00 62.34 ? 10  ASN C CA    1 
ATOM   5633  C  C     . ASN C  1 29  ? -51.406  -8.374  -28.171  1.00 62.31 ? 10  ASN C C     1 
ATOM   5634  O  O     . ASN C  1 29  ? -52.449  -8.692  -27.563  1.00 63.09 ? 10  ASN C O     1 
ATOM   5635  C  CB    . ASN C  1 29  ? -51.927  -6.829  -30.069  1.00 63.05 ? 10  ASN C CB    1 
ATOM   5636  C  CG    . ASN C  1 29  ? -51.108  -5.686  -29.470  1.00 63.89 ? 10  ASN C CG    1 
ATOM   5637  O  OD1   . ASN C  1 29  ? -51.658  -4.853  -28.734  1.00 66.04 ? 10  ASN C OD1   1 
ATOM   5638  N  ND2   . ASN C  1 29  ? -49.786  -5.643  -29.774  1.00 65.42 ? 10  ASN C ND2   1 
ATOM   5639  N  N     . LYS C  1 30  ? -50.277  -8.107  -27.529  1.00 61.17 ? 11  LYS C N     1 
ATOM   5640  C  CA    . LYS C  1 30  ? -50.092  -8.536  -26.167  1.00 59.99 ? 11  LYS C CA    1 
ATOM   5641  C  C     . LYS C  1 30  ? -50.799  -7.616  -25.168  1.00 58.91 ? 11  LYS C C     1 
ATOM   5642  O  O     . LYS C  1 30  ? -51.196  -8.061  -24.090  1.00 60.09 ? 11  LYS C O     1 
ATOM   5643  C  CB    . LYS C  1 30  ? -48.605  -8.702  -25.860  1.00 60.86 ? 11  LYS C CB    1 
ATOM   5644  C  CG    . LYS C  1 30  ? -47.808  -9.499  -26.949  1.00 62.35 ? 11  LYS C CG    1 
ATOM   5645  C  CD    . LYS C  1 30  ? -47.938  -11.056 -26.845  1.00 62.76 ? 11  LYS C CD    1 
ATOM   5646  C  CE    . LYS C  1 30  ? -47.483  -11.719 -28.189  1.00 62.26 ? 11  LYS C CE    1 
ATOM   5647  N  NZ    . LYS C  1 30  ? -47.472  -13.242 -28.211  1.00 63.16 ? 11  LYS C NZ    1 
ATOM   5648  N  N     . GLY C  1 31  ? -51.016  -6.363  -25.519  1.00 56.87 ? 12  GLY C N     1 
ATOM   5649  C  CA    . GLY C  1 31  ? -51.910  -5.516  -24.717  1.00 55.80 ? 12  GLY C CA    1 
ATOM   5650  C  C     . GLY C  1 31  ? -53.351  -6.038  -24.549  1.00 54.49 ? 12  GLY C C     1 
ATOM   5651  O  O     . GLY C  1 31  ? -53.946  -5.934  -23.462  1.00 54.44 ? 12  GLY C O     1 
ATOM   5652  N  N     . ILE C  1 32  ? -53.917  -6.583  -25.627  1.00 52.82 ? 13  ILE C N     1 
ATOM   5653  C  CA    . ILE C  1 32  ? -55.241  -7.204  -25.586  1.00 51.74 ? 13  ILE C CA    1 
ATOM   5654  C  C     . ILE C  1 32  ? -55.171  -8.366  -24.597  1.00 50.37 ? 13  ILE C C     1 
ATOM   5655  O  O     . ILE C  1 32  ? -56.050  -8.510  -23.739  1.00 49.85 ? 13  ILE C O     1 
ATOM   5656  C  CB    . ILE C  1 32  ? -55.663  -7.793  -26.955  1.00 51.61 ? 13  ILE C CB    1 
ATOM   5657  C  CG1   . ILE C  1 32  ? -55.731  -6.702  -28.027  1.00 52.82 ? 13  ILE C CG1   1 
ATOM   5658  C  CG2   . ILE C  1 32  ? -57.002  -8.445  -26.839  1.00 51.71 ? 13  ILE C CG2   1 
ATOM   5659  C  CD1   . ILE C  1 32  ? -55.532  -7.199  -29.486  1.00 52.55 ? 13  ILE C CD1   1 
ATOM   5660  N  N     . LYS C  1 33  ? -54.120  -9.177  -24.708  1.00 47.82 ? 14  LYS C N     1 
ATOM   5661  C  CA    . LYS C  1 33  ? -54.081  -10.360 -23.902  1.00 47.34 ? 14  LYS C CA    1 
ATOM   5662  C  C     . LYS C  1 33  ? -54.076  -10.013 -22.425  1.00 46.54 ? 14  LYS C C     1 
ATOM   5663  O  O     . LYS C  1 33  ? -54.755  -10.651 -21.609  1.00 46.63 ? 14  LYS C O     1 
ATOM   5664  C  CB    . LYS C  1 33  ? -52.869  -11.214 -24.234  1.00 47.07 ? 14  LYS C CB    1 
ATOM   5665  C  CG    . LYS C  1 33  ? -52.788  -12.507 -23.421  1.00 46.23 ? 14  LYS C CG    1 
ATOM   5666  C  CD    . LYS C  1 33  ? -51.417  -13.103 -23.555  1.00 45.65 ? 14  LYS C CD    1 
ATOM   5667  C  CE    . LYS C  1 33  ? -51.072  -14.089 -22.465  1.00 44.44 ? 14  LYS C CE    1 
ATOM   5668  N  NZ    . LYS C  1 33  ? -49.628  -14.534 -22.623  1.00 42.89 ? 14  LYS C NZ    1 
ATOM   5669  N  N     . GLN C  1 34  ? -53.328  -8.991  -22.071  1.00 45.87 ? 15  GLN C N     1 
ATOM   5670  C  CA    . GLN C  1 34  ? -53.187  -8.656  -20.663  1.00 45.10 ? 15  GLN C CA    1 
ATOM   5671  C  C     . GLN C  1 34  ? -54.502  -8.266  -19.992  1.00 43.91 ? 15  GLN C C     1 
ATOM   5672  O  O     . GLN C  1 34  ? -54.677  -8.466  -18.789  1.00 43.56 ? 15  GLN C O     1 
ATOM   5673  C  CB    . GLN C  1 34  ? -52.176  -7.534  -20.490  1.00 45.69 ? 15  GLN C CB    1 
ATOM   5674  C  CG    . GLN C  1 34  ? -51.652  -7.428  -19.063  1.00 47.83 ? 15  GLN C CG    1 
ATOM   5675  C  CD    . GLN C  1 34  ? -51.068  -8.759  -18.566  1.00 53.10 ? 15  GLN C CD    1 
ATOM   5676  O  OE1   . GLN C  1 34  ? -50.449  -9.529  -19.338  1.00 55.54 ? 15  GLN C OE1   1 
ATOM   5677  N  NE2   . GLN C  1 34  ? -51.281  -9.046  -17.277  1.00 55.09 ? 15  GLN C NE2   1 
ATOM   5678  N  N     . VAL C  1 35  ? -55.426  -7.728  -20.779  1.00 42.96 ? 16  VAL C N     1 
ATOM   5679  C  CA    . VAL C  1 35  ? -56.750  -7.399  -20.274  1.00 42.35 ? 16  VAL C CA    1 
ATOM   5680  C  C     . VAL C  1 35  ? -57.502  -8.662  -19.852  1.00 41.96 ? 16  VAL C C     1 
ATOM   5681  O  O     . VAL C  1 35  ? -58.046  -8.702  -18.755  1.00 41.69 ? 16  VAL C O     1 
ATOM   5682  C  CB    . VAL C  1 35  ? -57.540  -6.558  -21.270  1.00 42.12 ? 16  VAL C CB    1 
ATOM   5683  C  CG1   . VAL C  1 35  ? -58.970  -6.380  -20.801  1.00 40.85 ? 16  VAL C CG1   1 
ATOM   5684  C  CG2   . VAL C  1 35  ? -56.846  -5.179  -21.426  1.00 40.46 ? 16  VAL C CG2   1 
ATOM   5685  N  N     . TYR C  1 36  ? -57.470  -9.711  -20.677  1.00 41.32 ? 17  TYR C N     1 
ATOM   5686  C  CA    . TYR C  1 36  ? -58.108  -10.978 -20.303  1.00 40.76 ? 17  TYR C CA    1 
ATOM   5687  C  C     . TYR C  1 36  ? -57.406  -11.590 -19.104  1.00 40.42 ? 17  TYR C C     1 
ATOM   5688  O  O     . TYR C  1 36  ? -58.045  -12.177 -18.215  1.00 39.55 ? 17  TYR C O     1 
ATOM   5689  C  CB    . TYR C  1 36  ? -58.109  -11.967 -21.477  1.00 40.14 ? 17  TYR C CB    1 
ATOM   5690  C  CG    . TYR C  1 36  ? -59.072  -11.580 -22.607  1.00 39.79 ? 17  TYR C CG    1 
ATOM   5691  C  CD1   . TYR C  1 36  ? -60.375  -12.060 -22.627  1.00 38.91 ? 17  TYR C CD1   1 
ATOM   5692  C  CD2   . TYR C  1 36  ? -58.678  -10.722 -23.633  1.00 37.99 ? 17  TYR C CD2   1 
ATOM   5693  C  CE1   . TYR C  1 36  ? -61.262  -11.682 -23.626  1.00 39.89 ? 17  TYR C CE1   1 
ATOM   5694  C  CE2   . TYR C  1 36  ? -59.557  -10.351 -24.637  1.00 38.54 ? 17  TYR C CE2   1 
ATOM   5695  C  CZ    . TYR C  1 36  ? -60.849  -10.826 -24.630  1.00 39.21 ? 17  TYR C CZ    1 
ATOM   5696  O  OH    . TYR C  1 36  ? -61.732  -10.492 -25.632  1.00 37.74 ? 17  TYR C OH    1 
ATOM   5697  N  N     . MET C  1 37  ? -56.090  -11.450 -19.071  1.00 40.36 ? 18  MET C N     1 
ATOM   5698  C  CA    . MET C  1 37  ? -55.301  -12.106 -18.021  1.00 40.81 ? 18  MET C CA    1 
ATOM   5699  C  C     . MET C  1 37  ? -55.433  -11.427 -16.643  1.00 40.99 ? 18  MET C C     1 
ATOM   5700  O  O     . MET C  1 37  ? -55.005  -11.983 -15.663  1.00 40.58 ? 18  MET C O     1 
ATOM   5701  C  CB    . MET C  1 37  ? -53.839  -12.187 -18.416  1.00 40.23 ? 18  MET C CB    1 
ATOM   5702  C  CG    . MET C  1 37  ? -53.590  -13.020 -19.662  1.00 40.89 ? 18  MET C CG    1 
ATOM   5703  S  SD    . MET C  1 37  ? -54.026  -14.780 -19.563  1.00 43.60 ? 18  MET C SD    1 
ATOM   5704  C  CE    . MET C  1 37  ? -52.957  -15.393 -18.219  1.00 36.59 ? 18  MET C CE    1 
ATOM   5705  N  N     . SER C  1 38  ? -56.000  -10.219 -16.609  1.00 41.66 ? 19  SER C N     1 
ATOM   5706  C  CA    . SER C  1 38  ? -56.416  -9.514  -15.378  1.00 41.67 ? 19  SER C CA    1 
ATOM   5707  C  C     . SER C  1 38  ? -57.755  -9.954  -14.797  1.00 41.63 ? 19  SER C C     1 
ATOM   5708  O  O     . SER C  1 38  ? -58.072  -9.581  -13.669  1.00 42.24 ? 19  SER C O     1 
ATOM   5709  C  CB    . SER C  1 38  ? -56.593  -8.012  -15.682  1.00 42.24 ? 19  SER C CB    1 
ATOM   5710  O  OG    . SER C  1 38  ? -55.440  -7.480  -16.324  1.00 44.66 ? 19  SER C OG    1 
ATOM   5711  N  N     . LEU C  1 39  ? -58.578  -10.660 -15.575  1.00 41.36 ? 20  LEU C N     1 
ATOM   5712  C  CA    . LEU C  1 39  ? -59.836  -11.195 -15.062  1.00 41.40 ? 20  LEU C CA    1 
ATOM   5713  C  C     . LEU C  1 39  ? -59.566  -12.148 -13.882  1.00 41.81 ? 20  LEU C C     1 
ATOM   5714  O  O     . LEU C  1 39  ? -58.803  -13.087 -14.015  1.00 42.12 ? 20  LEU C O     1 
ATOM   5715  C  CB    . LEU C  1 39  ? -60.618  -11.929 -16.157  1.00 40.45 ? 20  LEU C CB    1 
ATOM   5716  C  CG    . LEU C  1 39  ? -61.171  -11.081 -17.304  1.00 38.80 ? 20  LEU C CG    1 
ATOM   5717  C  CD1   . LEU C  1 39  ? -61.656  -11.974 -18.498  1.00 36.45 ? 20  LEU C CD1   1 
ATOM   5718  C  CD2   . LEU C  1 39  ? -62.258  -10.176 -16.803  1.00 34.85 ? 20  LEU C CD2   1 
ATOM   5719  N  N     . PRO C  1 40  ? -60.171  -11.890 -12.719  1.00 42.28 ? 21  PRO C N     1 
ATOM   5720  C  CA    . PRO C  1 40  ? -60.062  -12.890 -11.627  1.00 42.50 ? 21  PRO C CA    1 
ATOM   5721  C  C     . PRO C  1 40  ? -60.519  -14.249 -12.104  1.00 42.85 ? 21  PRO C C     1 
ATOM   5722  O  O     . PRO C  1 40  ? -61.522  -14.324 -12.754  1.00 43.96 ? 21  PRO C O     1 
ATOM   5723  C  CB    . PRO C  1 40  ? -61.016  -12.358 -10.551  1.00 42.10 ? 21  PRO C CB    1 
ATOM   5724  C  CG    . PRO C  1 40  ? -61.764  -11.203 -11.203  1.00 42.77 ? 21  PRO C CG    1 
ATOM   5725  C  CD    . PRO C  1 40  ? -60.957  -10.699 -12.343  1.00 41.44 ? 21  PRO C CD    1 
ATOM   5726  N  N     . GLN C  1 41  ? -59.820  -15.332 -11.820  1.00 43.91 ? 22  GLN C N     1 
ATOM   5727  C  CA    . GLN C  1 41  ? -60.166  -16.608 -12.523  1.00 43.91 ? 22  GLN C CA    1 
ATOM   5728  C  C     . GLN C  1 41  ? -61.166  -17.429 -11.813  1.00 44.29 ? 22  GLN C C     1 
ATOM   5729  O  O     . GLN C  1 41  ? -61.815  -18.239 -12.467  1.00 44.66 ? 22  GLN C O     1 
ATOM   5730  C  CB    . GLN C  1 41  ? -58.938  -17.501 -12.887  1.00 44.10 ? 22  GLN C CB    1 
ATOM   5731  C  CG    . GLN C  1 41  ? -58.198  -18.227 -11.795  1.00 43.33 ? 22  GLN C CG    1 
ATOM   5732  C  CD    . GLN C  1 41  ? -56.896  -18.873 -12.319  1.00 43.66 ? 22  GLN C CD    1 
ATOM   5733  O  OE1   . GLN C  1 41  ? -55.935  -18.167 -12.645  1.00 42.65 ? 22  GLN C OE1   1 
ATOM   5734  N  NE2   . GLN C  1 41  ? -56.863  -20.221 -12.388  1.00 41.92 ? 22  GLN C NE2   1 
ATOM   5735  N  N     . GLY C  1 42  ? -61.242  -17.264 -10.483  1.00 44.33 ? 23  GLY C N     1 
ATOM   5736  C  CA    . GLY C  1 42  ? -62.171  -18.022 -9.644   1.00 43.65 ? 23  GLY C CA    1 
ATOM   5737  C  C     . GLY C  1 42  ? -61.544  -19.177 -8.893   1.00 43.32 ? 23  GLY C C     1 
ATOM   5738  O  O     . GLY C  1 42  ? -60.399  -19.121 -8.544   1.00 43.61 ? 23  GLY C O     1 
ATOM   5739  N  N     . GLU C  1 43  ? -62.321  -20.238 -8.648   1.00 43.74 ? 24  GLU C N     1 
ATOM   5740  C  CA    . GLU C  1 43  ? -61.901  -21.398 -7.816   1.00 43.11 ? 24  GLU C CA    1 
ATOM   5741  C  C     . GLU C  1 43  ? -60.996  -22.411 -8.599   1.00 42.29 ? 24  GLU C C     1 
ATOM   5742  O  O     . GLU C  1 43  ? -60.151  -23.074 -8.015   1.00 41.76 ? 24  GLU C O     1 
ATOM   5743  C  CB    . GLU C  1 43  ? -63.143  -22.115 -7.193   1.00 43.50 ? 24  GLU C CB    1 
ATOM   5744  C  CG    . GLU C  1 43  ? -64.358  -21.226 -6.803   1.00 43.89 ? 24  GLU C CG    1 
ATOM   5745  N  N     . LYS C  1 44  ? -61.174  -22.507 -9.915   1.00 41.58 ? 25  LYS C N     1 
ATOM   5746  C  CA    . LYS C  1 44  ? -60.486  -23.509 -10.715  1.00 41.48 ? 25  LYS C CA    1 
ATOM   5747  C  C     . LYS C  1 44  ? -59.034  -23.128 -11.006  1.00 41.06 ? 25  LYS C C     1 
ATOM   5748  O  O     . LYS C  1 44  ? -58.638  -21.948 -10.951  1.00 41.67 ? 25  LYS C O     1 
ATOM   5749  C  CB    . LYS C  1 44  ? -61.211  -23.750 -12.030  1.00 42.08 ? 25  LYS C CB    1 
ATOM   5750  C  CG    . LYS C  1 44  ? -62.692  -24.020 -11.950  1.00 43.27 ? 25  LYS C CG    1 
ATOM   5751  C  CD    . LYS C  1 44  ? -63.014  -25.452 -11.600  1.00 43.64 ? 25  LYS C CD    1 
ATOM   5752  C  CE    . LYS C  1 44  ? -64.512  -25.658 -11.672  1.00 42.52 ? 25  LYS C CE    1 
ATOM   5753  N  NZ    . LYS C  1 44  ? -64.921  -26.824 -10.845  1.00 43.77 ? 25  LYS C NZ    1 
ATOM   5754  N  N     . VAL C  1 45  ? -58.224  -24.127 -11.313  1.00 40.05 ? 26  VAL C N     1 
ATOM   5755  C  CA    . VAL C  1 45  ? -56.773  -23.934 -11.313  1.00 39.65 ? 26  VAL C CA    1 
ATOM   5756  C  C     . VAL C  1 45  ? -56.270  -24.567 -12.618  1.00 39.69 ? 26  VAL C C     1 
ATOM   5757  O  O     . VAL C  1 45  ? -56.763  -25.643 -13.000  1.00 40.19 ? 26  VAL C O     1 
ATOM   5758  C  CB    . VAL C  1 45  ? -56.159  -24.622 -10.049  1.00 39.62 ? 26  VAL C CB    1 
ATOM   5759  C  CG1   . VAL C  1 45  ? -54.618  -24.707 -10.106  1.00 37.85 ? 26  VAL C CG1   1 
ATOM   5760  C  CG2   . VAL C  1 45  ? -56.667  -23.924 -8.756   1.00 37.44 ? 26  VAL C CG2   1 
ATOM   5761  N  N     . GLN C  1 46  ? -55.352  -23.904 -13.322  1.00 38.91 ? 27  GLN C N     1 
ATOM   5762  C  CA    . GLN C  1 46  ? -54.785  -24.455 -14.561  1.00 38.89 ? 27  GLN C CA    1 
ATOM   5763  C  C     . GLN C  1 46  ? -53.437  -25.142 -14.259  1.00 39.07 ? 27  GLN C C     1 
ATOM   5764  O  O     . GLN C  1 46  ? -52.631  -24.611 -13.498  1.00 38.65 ? 27  GLN C O     1 
ATOM   5765  C  CB    . GLN C  1 46  ? -54.571  -23.369 -15.603  1.00 38.75 ? 27  GLN C CB    1 
ATOM   5766  C  CG    . GLN C  1 46  ? -55.811  -22.651 -16.051  1.00 38.05 ? 27  GLN C CG    1 
ATOM   5767  C  CD    . GLN C  1 46  ? -55.471  -21.381 -16.798  1.00 38.42 ? 27  GLN C CD    1 
ATOM   5768  O  OE1   . GLN C  1 46  ? -55.038  -20.433 -16.193  1.00 39.97 ? 27  GLN C OE1   1 
ATOM   5769  N  NE2   . GLN C  1 46  ? -55.633  -21.375 -18.121  1.00 37.71 ? 27  GLN C NE2   1 
ATOM   5770  N  N     . ALA C  1 47  ? -53.249  -26.348 -14.820  1.00 38.93 ? 28  ALA C N     1 
ATOM   5771  C  CA    . ALA C  1 47  ? -52.024  -27.150 -14.633  1.00 38.59 ? 28  ALA C CA    1 
ATOM   5772  C  C     . ALA C  1 47  ? -51.481  -27.460 -16.027  1.00 38.44 ? 28  ALA C C     1 
ATOM   5773  O  O     . ALA C  1 47  ? -52.139  -28.118 -16.828  1.00 37.23 ? 28  ALA C O     1 
ATOM   5774  C  CB    . ALA C  1 47  ? -52.301  -28.441 -13.851  1.00 37.21 ? 28  ALA C CB    1 
ATOM   5775  N  N     . MET C  1 48  ? -50.303  -26.920 -16.331  1.00 38.40 ? 29  MET C N     1 
ATOM   5776  C  CA    . MET C  1 48  ? -49.699  -27.139 -17.636  1.00 38.40 ? 29  MET C CA    1 
ATOM   5777  C  C     . MET C  1 48  ? -48.731  -28.248 -17.501  1.00 37.56 ? 29  MET C C     1 
ATOM   5778  O  O     . MET C  1 48  ? -47.761  -28.115 -16.802  1.00 37.59 ? 29  MET C O     1 
ATOM   5779  C  CB    . MET C  1 48  ? -49.008  -25.890 -18.196  1.00 37.97 ? 29  MET C CB    1 
ATOM   5780  C  CG    . MET C  1 48  ? -48.342  -26.131 -19.571  1.00 38.49 ? 29  MET C CG    1 
ATOM   5781  S  SD    . MET C  1 48  ? -47.811  -24.616 -20.430  1.00 39.42 ? 29  MET C SD    1 
ATOM   5782  C  CE    . MET C  1 48  ? -49.237  -24.167 -21.373  1.00 30.14 ? 29  MET C CE    1 
ATOM   5783  N  N     . TYR C  1 49  ? -49.019  -29.348 -18.174  1.00 37.93 ? 30  TYR C N     1 
ATOM   5784  C  CA    . TYR C  1 49  ? -48.174  -30.514 -18.130  1.00 38.11 ? 30  TYR C CA    1 
ATOM   5785  C  C     . TYR C  1 49  ? -47.195  -30.391 -19.255  1.00 38.05 ? 30  TYR C C     1 
ATOM   5786  O  O     . TYR C  1 49  ? -47.576  -30.065 -20.345  1.00 38.54 ? 30  TYR C O     1 
ATOM   5787  C  CB    . TYR C  1 49  ? -49.017  -31.800 -18.279  1.00 38.86 ? 30  TYR C CB    1 
ATOM   5788  C  CG    . TYR C  1 49  ? -49.779  -32.261 -17.036  1.00 37.83 ? 30  TYR C CG    1 
ATOM   5789  C  CD1   . TYR C  1 49  ? -50.586  -31.398 -16.314  1.00 38.99 ? 30  TYR C CD1   1 
ATOM   5790  C  CD2   . TYR C  1 49  ? -49.723  -33.578 -16.628  1.00 38.28 ? 30  TYR C CD2   1 
ATOM   5791  C  CE1   . TYR C  1 49  ? -51.322  -31.850 -15.173  1.00 39.53 ? 30  TYR C CE1   1 
ATOM   5792  C  CE2   . TYR C  1 49  ? -50.409  -34.026 -15.503  1.00 38.32 ? 30  TYR C CE2   1 
ATOM   5793  C  CZ    . TYR C  1 49  ? -51.207  -33.171 -14.777  1.00 39.19 ? 30  TYR C CZ    1 
ATOM   5794  O  OH    . TYR C  1 49  ? -51.883  -33.656 -13.675  1.00 38.87 ? 30  TYR C OH    1 
ATOM   5795  N  N     . ILE C  1 50  ? -45.927  -30.676 -18.963  1.00 38.95 ? 31  ILE C N     1 
ATOM   5796  C  CA    . ILE C  1 50  ? -44.767  -30.514 -19.857  1.00 38.50 ? 31  ILE C CA    1 
ATOM   5797  C  C     . ILE C  1 50  ? -43.974  -31.829 -20.015  1.00 39.05 ? 31  ILE C C     1 
ATOM   5798  O  O     . ILE C  1 50  ? -43.583  -32.492 -19.011  1.00 38.86 ? 31  ILE C O     1 
ATOM   5799  C  CB    . ILE C  1 50  ? -43.775  -29.512 -19.212  1.00 38.90 ? 31  ILE C CB    1 
ATOM   5800  C  CG1   . ILE C  1 50  ? -44.467  -28.179 -18.892  1.00 37.90 ? 31  ILE C CG1   1 
ATOM   5801  C  CG2   . ILE C  1 50  ? -42.484  -29.351 -20.063  1.00 37.71 ? 31  ILE C CG2   1 
ATOM   5802  C  CD1   . ILE C  1 50  ? -43.637  -27.286 -18.054  1.00 38.32 ? 31  ILE C CD1   1 
ATOM   5803  N  N     . TRP C  1 51  ? -43.672  -32.203 -21.258  1.00 38.99 ? 32  TRP C N     1 
ATOM   5804  C  CA    . TRP C  1 51  ? -42.830  -33.376 -21.464  1.00 38.70 ? 32  TRP C CA    1 
ATOM   5805  C  C     . TRP C  1 51  ? -41.861  -33.294 -22.637  1.00 39.16 ? 32  TRP C C     1 
ATOM   5806  O  O     . TRP C  1 51  ? -42.025  -32.473 -23.559  1.00 40.08 ? 32  TRP C O     1 
ATOM   5807  C  CB    . TRP C  1 51  ? -43.690  -34.628 -21.591  1.00 38.75 ? 32  TRP C CB    1 
ATOM   5808  C  CG    . TRP C  1 51  ? -44.568  -34.652 -22.789  1.00 39.41 ? 32  TRP C CG    1 
ATOM   5809  C  CD1   . TRP C  1 51  ? -44.332  -35.313 -23.940  1.00 39.07 ? 32  TRP C CD1   1 
ATOM   5810  C  CD2   . TRP C  1 51  ? -45.834  -34.012 -22.947  1.00 38.05 ? 32  TRP C CD2   1 
ATOM   5811  N  NE1   . TRP C  1 51  ? -45.352  -35.124 -24.810  1.00 38.26 ? 32  TRP C NE1   1 
ATOM   5812  C  CE2   . TRP C  1 51  ? -46.292  -34.323 -24.230  1.00 38.44 ? 32  TRP C CE2   1 
ATOM   5813  C  CE3   . TRP C  1 51  ? -46.622  -33.213 -22.126  1.00 39.28 ? 32  TRP C CE3   1 
ATOM   5814  C  CZ2   . TRP C  1 51  ? -47.526  -33.859 -24.735  1.00 39.36 ? 32  TRP C CZ2   1 
ATOM   5815  C  CZ3   . TRP C  1 51  ? -47.861  -32.717 -22.628  1.00 39.27 ? 32  TRP C CZ3   1 
ATOM   5816  C  CH2   . TRP C  1 51  ? -48.292  -33.049 -23.922  1.00 39.09 ? 32  TRP C CH2   1 
ATOM   5817  N  N     . ILE C  1 52  ? -40.854  -34.176 -22.591  1.00 39.10 ? 33  ILE C N     1 
ATOM   5818  C  CA    . ILE C  1 52  ? -39.854  -34.325 -23.645  1.00 38.46 ? 33  ILE C CA    1 
ATOM   5819  C  C     . ILE C  1 52  ? -40.363  -35.289 -24.706  1.00 38.07 ? 33  ILE C C     1 
ATOM   5820  O  O     . ILE C  1 52  ? -40.798  -36.396 -24.402  1.00 36.93 ? 33  ILE C O     1 
ATOM   5821  C  CB    . ILE C  1 52  ? -38.535  -34.857 -23.052  1.00 38.60 ? 33  ILE C CB    1 
ATOM   5822  C  CG1   . ILE C  1 52  ? -37.984  -33.852 -22.017  1.00 39.48 ? 33  ILE C CG1   1 
ATOM   5823  C  CG2   . ILE C  1 52  ? -37.533  -35.167 -24.170  1.00 38.60 ? 33  ILE C CG2   1 
ATOM   5824  C  CD1   . ILE C  1 52  ? -37.086  -34.461 -20.914  1.00 37.78 ? 33  ILE C CD1   1 
ATOM   5825  N  N     . ASP C  1 53  ? -40.287  -34.874 -25.971  1.00 38.97 ? 34  ASP C N     1 
ATOM   5826  C  CA    . ASP C  1 53  ? -40.824  -35.697 -27.076  1.00 39.33 ? 34  ASP C CA    1 
ATOM   5827  C  C     . ASP C  1 53  ? -39.852  -36.751 -27.632  1.00 40.19 ? 34  ASP C C     1 
ATOM   5828  O  O     . ASP C  1 53  ? -38.818  -37.066 -27.019  1.00 40.55 ? 34  ASP C O     1 
ATOM   5829  C  CB    . ASP C  1 53  ? -41.388  -34.809 -28.174  1.00 38.95 ? 34  ASP C CB    1 
ATOM   5830  C  CG    . ASP C  1 53  ? -40.339  -34.051 -28.933  1.00 40.37 ? 34  ASP C CG    1 
ATOM   5831  O  OD1   . ASP C  1 53  ? -39.139  -34.458 -29.022  1.00 41.04 ? 34  ASP C OD1   1 
ATOM   5832  O  OD2   . ASP C  1 53  ? -40.739  -32.998 -29.470  1.00 41.45 ? 34  ASP C OD2   1 
ATOM   5833  N  N     . GLY C  1 54  ? -40.196  -37.293 -28.802  1.00 40.56 ? 35  GLY C N     1 
ATOM   5834  C  CA    . GLY C  1 54  ? -39.436  -38.366 -29.426  1.00 39.83 ? 35  GLY C CA    1 
ATOM   5835  C  C     . GLY C  1 54  ? -38.086  -37.945 -29.898  1.00 40.34 ? 35  GLY C C     1 
ATOM   5836  O  O     . GLY C  1 54  ? -37.233  -38.799 -30.084  1.00 41.76 ? 35  GLY C O     1 
ATOM   5837  N  N     . THR C  1 55  ? -37.846  -36.641 -30.065  1.00 40.55 ? 36  THR C N     1 
ATOM   5838  C  CA    . THR C  1 55  ? -36.506  -36.135 -30.500  1.00 40.19 ? 36  THR C CA    1 
ATOM   5839  C  C     . THR C  1 55  ? -35.497  -36.037 -29.358  1.00 40.49 ? 36  THR C C     1 
ATOM   5840  O  O     . THR C  1 55  ? -34.306  -35.794 -29.614  1.00 41.62 ? 36  THR C O     1 
ATOM   5841  C  CB    . THR C  1 55  ? -36.554  -34.721 -31.150  1.00 39.65 ? 36  THR C CB    1 
ATOM   5842  O  OG1   . THR C  1 55  ? -36.825  -33.737 -30.122  1.00 40.48 ? 36  THR C OG1   1 
ATOM   5843  C  CG2   . THR C  1 55  ? -37.571  -34.649 -32.309  1.00 36.47 ? 36  THR C CG2   1 
ATOM   5844  N  N     . GLY C  1 56  ? -35.963  -36.177 -28.118  1.00 40.20 ? 37  GLY C N     1 
ATOM   5845  C  CA    . GLY C  1 56  ? -35.104  -36.051 -26.950  1.00 40.40 ? 37  GLY C CA    1 
ATOM   5846  C  C     . GLY C  1 56  ? -34.700  -34.615 -26.669  1.00 41.03 ? 37  GLY C C     1 
ATOM   5847  O  O     . GLY C  1 56  ? -33.984  -34.372 -25.718  1.00 41.87 ? 37  GLY C O     1 
ATOM   5848  N  N     . GLU C  1 57  ? -35.144  -33.673 -27.505  1.00 41.56 ? 38  GLU C N     1 
ATOM   5849  C  CA    . GLU C  1 57  ? -34.768  -32.254 -27.435  1.00 41.83 ? 38  GLU C CA    1 
ATOM   5850  C  C     . GLU C  1 57  ? -35.980  -31.358 -27.341  1.00 41.85 ? 38  GLU C C     1 
ATOM   5851  O  O     . GLU C  1 57  ? -35.943  -30.371 -26.625  1.00 42.01 ? 38  GLU C O     1 
ATOM   5852  C  CB    . GLU C  1 57  ? -34.051  -31.831 -28.705  1.00 42.21 ? 38  GLU C CB    1 
ATOM   5853  C  CG    . GLU C  1 57  ? -32.647  -32.319 -28.820  1.00 43.57 ? 38  GLU C CG    1 
ATOM   5854  C  CD    . GLU C  1 57  ? -31.957  -31.744 -30.045  1.00 43.94 ? 38  GLU C CD    1 
ATOM   5855  O  OE1   . GLU C  1 57  ? -31.495  -30.590 -30.025  1.00 47.10 ? 38  GLU C OE1   1 
ATOM   5856  O  OE2   . GLU C  1 57  ? -31.847  -32.481 -31.026  1.00 48.78 ? 38  GLU C OE2   1 
ATOM   5857  N  N     . GLY C  1 58  ? -37.044  -31.709 -28.078  1.00 41.70 ? 39  GLY C N     1 
ATOM   5858  C  CA    . GLY C  1 58  ? -38.288  -30.958 -28.078  1.00 41.13 ? 39  GLY C CA    1 
ATOM   5859  C  C     . GLY C  1 58  ? -39.165  -31.118 -26.833  1.00 41.18 ? 39  GLY C C     1 
ATOM   5860  O  O     . GLY C  1 58  ? -39.447  -32.234 -26.378  1.00 41.82 ? 39  GLY C O     1 
ATOM   5861  N  N     . LEU C  1 59  ? -39.622  -29.986 -26.306  1.00 40.45 ? 40  LEU C N     1 
ATOM   5862  C  CA    . LEU C  1 59  ? -40.533  -29.950 -25.204  1.00 39.25 ? 40  LEU C CA    1 
ATOM   5863  C  C     . LEU C  1 59  ? -41.959  -29.753 -25.738  1.00 38.91 ? 40  LEU C C     1 
ATOM   5864  O  O     . LEU C  1 59  ? -42.177  -29.017 -26.712  1.00 38.04 ? 40  LEU C O     1 
ATOM   5865  C  CB    . LEU C  1 59  ? -40.136  -28.815 -24.277  1.00 39.29 ? 40  LEU C CB    1 
ATOM   5866  C  CG    . LEU C  1 59  ? -38.954  -29.120 -23.341  1.00 39.60 ? 40  LEU C CG    1 
ATOM   5867  C  CD1   . LEU C  1 59  ? -38.146  -27.845 -22.940  1.00 35.81 ? 40  LEU C CD1   1 
ATOM   5868  C  CD2   . LEU C  1 59  ? -39.480  -29.889 -22.116  1.00 37.40 ? 40  LEU C CD2   1 
ATOM   5869  N  N     . ARG C  1 60  ? -42.919  -30.429 -25.087  1.00 38.17 ? 41  ARG C N     1 
ATOM   5870  C  CA    . ARG C  1 60  ? -44.339  -30.305 -25.408  1.00 37.92 ? 41  ARG C CA    1 
ATOM   5871  C  C     . ARG C  1 60  ? -45.151  -30.027 -24.174  1.00 37.88 ? 41  ARG C C     1 
ATOM   5872  O  O     . ARG C  1 60  ? -44.769  -30.400 -23.063  1.00 38.26 ? 41  ARG C O     1 
ATOM   5873  C  CB    . ARG C  1 60  ? -44.893  -31.596 -25.970  1.00 37.56 ? 41  ARG C CB    1 
ATOM   5874  C  CG    . ARG C  1 60  ? -44.119  -32.154 -27.119  1.00 37.68 ? 41  ARG C CG    1 
ATOM   5875  C  CD    . ARG C  1 60  ? -44.511  -31.582 -28.466  1.00 37.08 ? 41  ARG C CD    1 
ATOM   5876  N  NE    . ARG C  1 60  ? -43.666  -32.190 -29.478  1.00 37.40 ? 41  ARG C NE    1 
ATOM   5877  C  CZ    . ARG C  1 60  ? -43.997  -32.410 -30.743  1.00 38.98 ? 41  ARG C CZ    1 
ATOM   5878  N  NH1   . ARG C  1 60  ? -45.197  -32.102 -31.204  1.00 41.71 ? 41  ARG C NH1   1 
ATOM   5879  N  NH2   . ARG C  1 60  ? -43.128  -32.971 -31.552  1.00 37.31 ? 41  ARG C NH2   1 
ATOM   5880  N  N     . CYS C  1 61  ? -46.325  -29.443 -24.363  1.00 37.42 ? 42  CYS C N     1 
ATOM   5881  C  CA    . CYS C  1 61  ? -47.132  -29.193 -23.226  1.00 37.08 ? 42  CYS C CA    1 
ATOM   5882  C  C     . CYS C  1 61  ? -48.590  -29.044 -23.560  1.00 36.34 ? 42  CYS C C     1 
ATOM   5883  O  O     . CYS C  1 61  ? -48.940  -28.836 -24.705  1.00 36.40 ? 42  CYS C O     1 
ATOM   5884  C  CB    . CYS C  1 61  ? -46.633  -27.916 -22.580  1.00 37.82 ? 42  CYS C CB    1 
ATOM   5885  S  SG    . CYS C  1 61  ? -47.068  -26.509 -23.603  1.00 38.28 ? 42  CYS C SG    1 
ATOM   5886  N  N     . LYS C  1 62  ? -49.433  -29.184 -22.540  1.00 35.85 ? 43  LYS C N     1 
ATOM   5887  C  CA    . LYS C  1 62  ? -50.891  -28.994 -22.679  1.00 36.17 ? 43  LYS C CA    1 
ATOM   5888  C  C     . LYS C  1 62  ? -51.471  -28.782 -21.278  1.00 36.46 ? 43  LYS C C     1 
ATOM   5889  O  O     . LYS C  1 62  ? -50.794  -29.123 -20.277  1.00 35.36 ? 43  LYS C O     1 
ATOM   5890  C  CB    . LYS C  1 62  ? -51.590  -30.145 -23.417  1.00 35.35 ? 43  LYS C CB    1 
ATOM   5891  C  CG    . LYS C  1 62  ? -51.737  -31.475 -22.635  1.00 35.66 ? 43  LYS C CG    1 
ATOM   5892  C  CD    . LYS C  1 62  ? -52.792  -32.427 -23.292  1.00 35.53 ? 43  LYS C CD    1 
ATOM   5893  C  CE    . LYS C  1 62  ? -52.636  -33.856 -22.853  1.00 35.00 ? 43  LYS C CE    1 
ATOM   5894  N  NZ    . LYS C  1 62  ? -53.851  -34.702 -23.059  1.00 33.73 ? 43  LYS C NZ    1 
ATOM   5895  N  N     . THR C  1 63  ? -52.676  -28.191 -21.215  1.00 36.40 ? 44  THR C N     1 
ATOM   5896  C  CA    . THR C  1 63  ? -53.250  -27.714 -19.948  1.00 36.85 ? 44  THR C CA    1 
ATOM   5897  C  C     . THR C  1 63  ? -54.581  -28.371 -19.608  1.00 36.95 ? 44  THR C C     1 
ATOM   5898  O  O     . THR C  1 63  ? -55.437  -28.597 -20.475  1.00 36.36 ? 44  THR C O     1 
ATOM   5899  C  CB    . THR C  1 63  ? -53.474  -26.151 -19.955  1.00 37.21 ? 44  THR C CB    1 
ATOM   5900  O  OG1   . THR C  1 63  ? -52.244  -25.477 -20.263  1.00 37.35 ? 44  THR C OG1   1 
ATOM   5901  C  CG2   . THR C  1 63  ? -53.994  -25.654 -18.613  1.00 35.87 ? 44  THR C CG2   1 
ATOM   5902  N  N     . ARG C  1 64  ? -54.743  -28.662 -18.323  1.00 37.53 ? 45  ARG C N     1 
ATOM   5903  C  CA    . ARG C  1 64  ? -56.018  -29.091 -17.782  1.00 38.25 ? 45  ARG C CA    1 
ATOM   5904  C  C     . ARG C  1 64  ? -56.399  -28.235 -16.601  1.00 37.84 ? 45  ARG C C     1 
ATOM   5905  O  O     . ARG C  1 64  ? -55.498  -27.673 -15.952  1.00 36.93 ? 45  ARG C O     1 
ATOM   5906  C  CB    . ARG C  1 64  ? -56.005  -30.550 -17.372  1.00 38.01 ? 45  ARG C CB    1 
ATOM   5907  C  CG    . ARG C  1 64  ? -55.262  -30.802 -16.089  1.00 40.37 ? 45  ARG C CG    1 
ATOM   5908  C  CD    . ARG C  1 64  ? -54.915  -32.301 -15.982  1.00 41.37 ? 45  ARG C CD    1 
ATOM   5909  N  NE    . ARG C  1 64  ? -56.083  -33.070 -15.579  1.00 43.13 ? 45  ARG C NE    1 
ATOM   5910  C  CZ    . ARG C  1 64  ? -56.157  -34.389 -15.574  1.00 44.15 ? 45  ARG C CZ    1 
ATOM   5911  N  NH1   . ARG C  1 64  ? -55.150  -35.128 -15.984  1.00 48.38 ? 45  ARG C NH1   1 
ATOM   5912  N  NH2   . ARG C  1 64  ? -57.262  -34.974 -15.182  1.00 44.48 ? 45  ARG C NH2   1 
ATOM   5913  N  N     . THR C  1 65  ? -57.740  -28.121 -16.413  1.00 37.45 ? 46  THR C N     1 
ATOM   5914  C  CA    . THR C  1 65  ? -58.409  -27.461 -15.286  1.00 38.33 ? 46  THR C CA    1 
ATOM   5915  C  C     . THR C  1 65  ? -58.526  -28.442 -14.104  1.00 38.76 ? 46  THR C C     1 
ATOM   5916  O  O     . THR C  1 65  ? -58.898  -29.581 -14.289  1.00 38.87 ? 46  THR C O     1 
ATOM   5917  C  CB    . THR C  1 65  ? -59.831  -26.992 -15.677  1.00 38.13 ? 46  THR C CB    1 
ATOM   5918  O  OG1   . THR C  1 65  ? -59.788  -26.364 -16.975  1.00 38.85 ? 46  THR C OG1   1 
ATOM   5919  C  CG2   . THR C  1 65  ? -60.382  -26.045 -14.648  1.00 35.52 ? 46  THR C CG2   1 
ATOM   5920  N  N     . LEU C  1 66  ? -58.129  -28.005 -12.912  1.00 39.40 ? 47  LEU C N     1 
ATOM   5921  C  CA    . LEU C  1 66  ? -58.291  -28.779 -11.678  1.00 39.55 ? 47  LEU C CA    1 
ATOM   5922  C  C     . LEU C  1 66  ? -59.255  -28.006 -10.791  1.00 39.72 ? 47  LEU C C     1 
ATOM   5923  O  O     . LEU C  1 66  ? -59.396  -26.772 -10.911  1.00 38.31 ? 47  LEU C O     1 
ATOM   5924  C  CB    . LEU C  1 66  ? -56.961  -28.941 -10.912  1.00 39.24 ? 47  LEU C CB    1 
ATOM   5925  C  CG    . LEU C  1 66  ? -55.726  -29.553 -11.573  1.00 39.32 ? 47  LEU C CG    1 
ATOM   5926  C  CD1   . LEU C  1 66  ? -54.480  -29.241 -10.733  1.00 36.03 ? 47  LEU C CD1   1 
ATOM   5927  C  CD2   . LEU C  1 66  ? -55.882  -31.067 -11.805  1.00 38.33 ? 47  LEU C CD2   1 
ATOM   5928  N  N     . ASP C  1 67  ? -59.891  -28.744 -9.879   1.00 40.53 ? 48  ASP C N     1 
ATOM   5929  C  CA    . ASP C  1 67  ? -60.893  -28.159 -8.987   1.00 41.32 ? 48  ASP C CA    1 
ATOM   5930  C  C     . ASP C  1 67  ? -60.319  -27.338 -7.866   1.00 41.13 ? 48  ASP C C     1 
ATOM   5931  O  O     . ASP C  1 67  ? -60.994  -26.499 -7.342   1.00 42.05 ? 48  ASP C O     1 
ATOM   5932  C  CB    . ASP C  1 67  ? -61.811  -29.231 -8.442   1.00 41.78 ? 48  ASP C CB    1 
ATOM   5933  C  CG    . ASP C  1 67  ? -62.683  -29.859 -9.547   1.00 46.05 ? 48  ASP C CG    1 
ATOM   5934  O  OD1   . ASP C  1 67  ? -63.094  -29.103 -10.465  1.00 48.58 ? 48  ASP C OD1   1 
ATOM   5935  O  OD2   . ASP C  1 67  ? -62.953  -31.102 -9.498   1.00 50.10 ? 48  ASP C OD2   1 
ATOM   5936  N  N     . SER C  1 68  ? -59.061  -27.543 -7.533   1.00 41.45 ? 49  SER C N     1 
ATOM   5937  C  CA    . SER C  1 68  ? -58.448  -26.816 -6.440   1.00 41.98 ? 49  SER C CA    1 
ATOM   5938  C  C     . SER C  1 68  ? -56.942  -26.751 -6.682   1.00 41.96 ? 49  SER C C     1 
ATOM   5939  O  O     . SER C  1 68  ? -56.450  -27.436 -7.542   1.00 41.93 ? 49  SER C O     1 
ATOM   5940  C  CB    . SER C  1 68  ? -58.786  -27.482 -5.108   1.00 41.61 ? 49  SER C CB    1 
ATOM   5941  O  OG    . SER C  1 68  ? -58.422  -28.853 -5.116   1.00 42.56 ? 49  SER C OG    1 
ATOM   5942  N  N     . GLU C  1 69  ? -56.239  -25.880 -5.967   1.00 42.67 ? 50  GLU C N     1 
ATOM   5943  C  CA    . GLU C  1 69  ? -54.785  -25.766 -6.089   1.00 42.88 ? 50  GLU C CA    1 
ATOM   5944  C  C     . GLU C  1 69  ? -54.112  -26.979 -5.483   1.00 42.59 ? 50  GLU C C     1 
ATOM   5945  O  O     . GLU C  1 69  ? -54.316  -27.281 -4.321   1.00 42.26 ? 50  GLU C O     1 
ATOM   5946  C  CB    . GLU C  1 69  ? -54.255  -24.516 -5.375   1.00 42.66 ? 50  GLU C CB    1 
ATOM   5947  C  CG    . GLU C  1 69  ? -52.804  -24.159 -5.794   1.00 43.34 ? 50  GLU C CG    1 
ATOM   5948  C  CD    . GLU C  1 69  ? -52.184  -23.032 -4.970   1.00 44.01 ? 50  GLU C CD    1 
ATOM   5949  O  OE1   . GLU C  1 69  ? -52.931  -22.429 -4.182   1.00 42.90 ? 50  GLU C OE1   1 
ATOM   5950  O  OE2   . GLU C  1 69  ? -50.935  -22.771 -5.080   1.00 46.25 ? 50  GLU C OE2   1 
ATOM   5951  N  N     . PRO C  1 70  ? -53.300  -27.675 -6.265   1.00 43.09 ? 51  PRO C N     1 
ATOM   5952  C  CA    . PRO C  1 70  ? -52.502  -28.741 -5.651   1.00 43.92 ? 51  PRO C CA    1 
ATOM   5953  C  C     . PRO C  1 70  ? -51.332  -28.166 -4.853   1.00 44.54 ? 51  PRO C C     1 
ATOM   5954  O  O     . PRO C  1 70  ? -50.678  -27.209 -5.274   1.00 44.14 ? 51  PRO C O     1 
ATOM   5955  C  CB    . PRO C  1 70  ? -51.983  -29.555 -6.857   1.00 43.61 ? 51  PRO C CB    1 
ATOM   5956  C  CG    . PRO C  1 70  ? -51.986  -28.582 -8.014   1.00 43.25 ? 51  PRO C CG    1 
ATOM   5957  C  CD    . PRO C  1 70  ? -53.047  -27.526 -7.707   1.00 43.07 ? 51  PRO C CD    1 
ATOM   5958  N  N     . LYS C  1 71  ? -51.040  -28.803 -3.733   1.00 45.76 ? 52  LYS C N     1 
ATOM   5959  C  CA    . LYS C  1 71  ? -49.988  -28.342 -2.853   1.00 46.22 ? 52  LYS C CA    1 
ATOM   5960  C  C     . LYS C  1 71  ? -48.678  -29.119 -2.853   1.00 46.12 ? 52  LYS C C     1 
ATOM   5961  O  O     . LYS C  1 71  ? -47.704  -28.608 -2.389   1.00 46.97 ? 52  LYS C O     1 
ATOM   5962  C  CB    . LYS C  1 71  ? -50.557  -28.268 -1.450   1.00 48.10 ? 52  LYS C CB    1 
ATOM   5963  C  CG    . LYS C  1 71  ? -51.033  -26.887 -1.125   1.00 50.25 ? 52  LYS C CG    1 
ATOM   5964  C  CD    . LYS C  1 71  ? -52.382  -26.579 -1.641   1.00 52.84 ? 52  LYS C CD    1 
ATOM   5965  C  CE    . LYS C  1 71  ? -52.744  -25.143 -1.213   1.00 53.53 ? 52  LYS C CE    1 
ATOM   5966  N  NZ    . LYS C  1 71  ? -54.187  -24.983 -1.028   1.00 54.57 ? 52  LYS C NZ    1 
ATOM   5967  N  N     . CYS C  1 72  ? -48.662  -30.344 -3.360   1.00 45.61 ? 53  CYS C N     1 
ATOM   5968  C  CA    . CYS C  1 72  ? -47.449  -31.157 -3.549   1.00 44.35 ? 53  CYS C CA    1 
ATOM   5969  C  C     . CYS C  1 72  ? -47.643  -31.556 -5.004   1.00 44.40 ? 53  CYS C C     1 
ATOM   5970  O  O     . CYS C  1 72  ? -48.779  -31.510 -5.486   1.00 43.55 ? 53  CYS C O     1 
ATOM   5971  C  CB    . CYS C  1 72  ? -47.398  -32.417 -2.612   1.00 43.02 ? 53  CYS C CB    1 
ATOM   5972  S  SG    . CYS C  1 72  ? -49.026  -33.002 -1.854   1.00 42.03 ? 53  CYS C SG    1 
ATOM   5973  N  N     . VAL C  1 73  ? -46.564  -31.946 -5.696   1.00 44.50 ? 54  VAL C N     1 
ATOM   5974  C  CA    . VAL C  1 73  ? -46.636  -32.567 -7.029   1.00 44.67 ? 54  VAL C CA    1 
ATOM   5975  C  C     . VAL C  1 73  ? -47.472  -33.880 -7.071   1.00 45.16 ? 54  VAL C C     1 
ATOM   5976  O  O     . VAL C  1 73  ? -48.015  -34.275 -8.098   1.00 45.48 ? 54  VAL C O     1 
ATOM   5977  C  CB    . VAL C  1 73  ? -45.160  -32.804 -7.646   1.00 44.62 ? 54  VAL C CB    1 
ATOM   5978  C  CG1   . VAL C  1 73  ? -44.327  -33.808 -6.861   1.00 39.85 ? 54  VAL C CG1   1 
ATOM   5979  C  CG2   . VAL C  1 73  ? -45.239  -33.198 -9.125   1.00 44.72 ? 54  VAL C CG2   1 
ATOM   5980  N  N     . GLU C  1 74  ? -47.572  -34.547 -5.945   1.00 45.43 ? 55  GLU C N     1 
ATOM   5981  C  CA    . GLU C  1 74  ? -48.216  -35.847 -5.870   1.00 46.62 ? 55  GLU C CA    1 
ATOM   5982  C  C     . GLU C  1 74  ? -49.744  -35.754 -5.937   1.00 46.31 ? 55  GLU C C     1 
ATOM   5983  O  O     . GLU C  1 74  ? -50.417  -36.701 -6.319   1.00 46.01 ? 55  GLU C O     1 
ATOM   5984  C  CB    . GLU C  1 74  ? -47.851  -36.492 -4.537   1.00 48.49 ? 55  GLU C CB    1 
ATOM   5985  C  CG    . GLU C  1 74  ? -46.382  -36.284 -4.118   1.00 52.01 ? 55  GLU C CG    1 
ATOM   5986  C  CD    . GLU C  1 74  ? -45.621  -37.521 -4.224   1.00 57.19 ? 55  GLU C CD    1 
ATOM   5987  O  OE1   . GLU C  1 74  ? -46.271  -38.563 -4.516   1.00 59.80 ? 55  GLU C OE1   1 
ATOM   5988  O  OE2   . GLU C  1 74  ? -44.385  -37.445 -3.996   1.00 63.10 ? 55  GLU C OE2   1 
ATOM   5989  N  N     . GLU C  1 75  ? -50.280  -34.614 -5.538   1.00 45.85 ? 56  GLU C N     1 
ATOM   5990  C  CA    . GLU C  1 75  ? -51.682  -34.349 -5.707   1.00 45.48 ? 56  GLU C CA    1 
ATOM   5991  C  C     . GLU C  1 75  ? -52.088  -34.175 -7.141   1.00 45.10 ? 56  GLU C C     1 
ATOM   5992  O  O     . GLU C  1 75  ? -53.268  -34.064 -7.401   1.00 44.89 ? 56  GLU C O     1 
ATOM   5993  C  CB    . GLU C  1 75  ? -52.044  -33.105 -4.939   1.00 45.57 ? 56  GLU C CB    1 
ATOM   5994  C  CG    . GLU C  1 75  ? -51.970  -33.357 -3.463   1.00 45.65 ? 56  GLU C CG    1 
ATOM   5995  C  CD    . GLU C  1 75  ? -51.720  -32.086 -2.671   1.00 45.61 ? 56  GLU C CD    1 
ATOM   5996  O  OE1   . GLU C  1 75  ? -52.574  -31.181 -2.870   1.00 44.07 ? 56  GLU C OE1   1 
ATOM   5997  O  OE2   . GLU C  1 75  ? -50.683  -32.042 -1.891   1.00 40.18 ? 56  GLU C OE2   1 
ATOM   5998  N  N     . LEU C  1 76  ? -51.135  -34.105 -8.070   1.00 44.78 ? 57  LEU C N     1 
ATOM   5999  C  CA    . LEU C  1 76  ? -51.479  -33.956 -9.489   1.00 44.68 ? 57  LEU C CA    1 
ATOM   6000  C  C     . LEU C  1 76  ? -51.827  -35.301 -10.082  1.00 44.43 ? 57  LEU C C     1 
ATOM   6001  O  O     . LEU C  1 76  ? -51.168  -36.295 -9.824   1.00 45.92 ? 57  LEU C O     1 
ATOM   6002  C  CB    . LEU C  1 76  ? -50.343  -33.301 -10.281  1.00 44.24 ? 57  LEU C CB    1 
ATOM   6003  C  CG    . LEU C  1 76  ? -50.224  -31.793 -10.019  1.00 44.25 ? 57  LEU C CG    1 
ATOM   6004  C  CD1   . LEU C  1 76  ? -48.815  -31.325 -10.299  1.00 44.12 ? 57  LEU C CD1   1 
ATOM   6005  C  CD2   . LEU C  1 76  ? -51.249  -31.011 -10.839  1.00 41.33 ? 57  LEU C CD2   1 
ATOM   6006  N  N     . PRO C  1 77  ? -52.889  -35.377 -10.857  1.00 43.96 ? 58  PRO C N     1 
ATOM   6007  C  CA    . PRO C  1 77  ? -53.141  -36.729 -11.389  1.00 43.16 ? 58  PRO C CA    1 
ATOM   6008  C  C     . PRO C  1 77  ? -52.310  -37.091 -12.592  1.00 42.66 ? 58  PRO C C     1 
ATOM   6009  O  O     . PRO C  1 77  ? -51.872  -36.230 -13.323  1.00 42.04 ? 58  PRO C O     1 
ATOM   6010  C  CB    . PRO C  1 77  ? -54.611  -36.687 -11.768  1.00 42.37 ? 58  PRO C CB    1 
ATOM   6011  C  CG    . PRO C  1 77  ? -54.889  -35.267 -12.027  1.00 44.00 ? 58  PRO C CG    1 
ATOM   6012  C  CD    . PRO C  1 77  ? -53.939  -34.417 -11.209  1.00 43.78 ? 58  PRO C CD    1 
ATOM   6013  N  N     . GLU C  1 78  ? -52.129  -38.387 -12.798  1.00 42.84 ? 59  GLU C N     1 
ATOM   6014  C  CA    . GLU C  1 78  ? -51.532  -38.878 -14.028  1.00 42.79 ? 59  GLU C CA    1 
ATOM   6015  C  C     . GLU C  1 78  ? -52.324  -38.367 -15.198  1.00 41.75 ? 59  GLU C C     1 
ATOM   6016  O  O     . GLU C  1 78  ? -53.491  -38.175 -15.052  1.00 41.94 ? 59  GLU C O     1 
ATOM   6017  C  CB    . GLU C  1 78  ? -51.647  -40.385 -14.118  1.00 42.67 ? 59  GLU C CB    1 
ATOM   6018  C  CG    . GLU C  1 78  ? -50.800  -41.125 -13.201  1.00 45.51 ? 59  GLU C CG    1 
ATOM   6019  C  CD    . GLU C  1 78  ? -50.522  -42.561 -13.674  1.00 45.59 ? 59  GLU C CD    1 
ATOM   6020  O  OE1   . GLU C  1 78  ? -51.271  -43.055 -14.568  1.00 46.66 ? 59  GLU C OE1   1 
ATOM   6021  O  OE2   . GLU C  1 78  ? -49.553  -43.161 -13.107  1.00 47.25 ? 59  GLU C OE2   1 
ATOM   6022  N  N     . TRP C  1 79  ? -51.713  -38.231 -16.368  1.00 40.31 ? 60  TRP C N     1 
ATOM   6023  C  CA    . TRP C  1 79  ? -52.472  -37.936 -17.558  1.00 39.35 ? 60  TRP C CA    1 
ATOM   6024  C  C     . TRP C  1 79  ? -51.886  -38.712 -18.716  1.00 38.61 ? 60  TRP C C     1 
ATOM   6025  O  O     . TRP C  1 79  ? -51.220  -39.734 -18.532  1.00 38.51 ? 60  TRP C O     1 
ATOM   6026  C  CB    . TRP C  1 79  ? -52.423  -36.439 -17.792  1.00 39.44 ? 60  TRP C CB    1 
ATOM   6027  C  CG    . TRP C  1 79  ? -53.512  -35.829 -18.592  1.00 39.30 ? 60  TRP C CG    1 
ATOM   6028  C  CD1   . TRP C  1 79  ? -54.672  -36.426 -19.036  1.00 39.01 ? 60  TRP C CD1   1 
ATOM   6029  C  CD2   . TRP C  1 79  ? -53.569  -34.465 -19.023  1.00 37.92 ? 60  TRP C CD2   1 
ATOM   6030  N  NE1   . TRP C  1 79  ? -55.434  -35.502 -19.726  1.00 39.08 ? 60  TRP C NE1   1 
ATOM   6031  C  CE2   . TRP C  1 79  ? -54.786  -34.294 -19.724  1.00 39.09 ? 60  TRP C CE2   1 
ATOM   6032  C  CE3   . TRP C  1 79  ? -52.726  -33.381 -18.874  1.00 37.80 ? 60  TRP C CE3   1 
ATOM   6033  C  CZ2   . TRP C  1 79  ? -55.169  -33.070 -20.277  1.00 38.97 ? 60  TRP C CZ2   1 
ATOM   6034  C  CZ3   . TRP C  1 79  ? -53.092  -32.177 -19.426  1.00 38.88 ? 60  TRP C CZ3   1 
ATOM   6035  C  CH2   . TRP C  1 79  ? -54.306  -32.027 -20.128  1.00 39.56 ? 60  TRP C CH2   1 
ATOM   6036  N  N     . ASN C  1 80  ? -52.147  -38.254 -19.922  1.00 38.03 ? 61  ASN C N     1 
ATOM   6037  C  CA    . ASN C  1 80  ? -51.677  -38.937 -21.123  1.00 37.84 ? 61  ASN C CA    1 
ATOM   6038  C  C     . ASN C  1 80  ? -51.836  -37.997 -22.335  1.00 36.86 ? 61  ASN C C     1 
ATOM   6039  O  O     . ASN C  1 80  ? -52.426  -36.938 -22.189  1.00 36.51 ? 61  ASN C O     1 
ATOM   6040  C  CB    . ASN C  1 80  ? -52.473  -40.214 -21.339  1.00 38.01 ? 61  ASN C CB    1 
ATOM   6041  C  CG    . ASN C  1 80  ? -53.952  -39.936 -21.576  1.00 37.53 ? 61  ASN C CG    1 
ATOM   6042  O  OD1   . ASN C  1 80  ? -54.733  -39.873 -20.634  1.00 38.72 ? 61  ASN C OD1   1 
ATOM   6043  N  ND2   . ASN C  1 80  ? -54.334  -39.800 -22.841  1.00 36.37 ? 61  ASN C ND2   1 
ATOM   6044  N  N     . PHE C  1 81  ? -51.306  -38.382 -23.493  1.00 35.68 ? 62  PHE C N     1 
ATOM   6045  C  CA    . PHE C  1 81  ? -51.363  -37.555 -24.672  1.00 36.46 ? 62  PHE C CA    1 
ATOM   6046  C  C     . PHE C  1 81  ? -51.210  -38.466 -25.845  1.00 37.03 ? 62  PHE C C     1 
ATOM   6047  O  O     . PHE C  1 81  ? -50.917  -39.662 -25.673  1.00 36.67 ? 62  PHE C O     1 
ATOM   6048  C  CB    . PHE C  1 81  ? -50.219  -36.535 -24.682  1.00 37.69 ? 62  PHE C CB    1 
ATOM   6049  C  CG    . PHE C  1 81  ? -48.828  -37.179 -24.756  1.00 37.52 ? 62  PHE C CG    1 
ATOM   6050  C  CD1   . PHE C  1 81  ? -48.165  -37.278 -25.949  1.00 36.84 ? 62  PHE C CD1   1 
ATOM   6051  C  CD2   . PHE C  1 81  ? -48.252  -37.745 -23.634  1.00 37.06 ? 62  PHE C CD2   1 
ATOM   6052  C  CE1   . PHE C  1 81  ? -46.924  -37.885 -26.017  1.00 38.70 ? 62  PHE C CE1   1 
ATOM   6053  C  CE2   . PHE C  1 81  ? -47.034  -38.345 -23.699  1.00 38.39 ? 62  PHE C CE2   1 
ATOM   6054  C  CZ    . PHE C  1 81  ? -46.367  -38.425 -24.897  1.00 38.87 ? 62  PHE C CZ    1 
ATOM   6055  N  N     . ASP C  1 82  ? -51.402  -37.905 -27.036  1.00 37.46 ? 63  ASP C N     1 
ATOM   6056  C  CA    . ASP C  1 82  ? -51.235  -38.643 -28.253  1.00 38.70 ? 63  ASP C CA    1 
ATOM   6057  C  C     . ASP C  1 82  ? -49.755  -38.831 -28.610  1.00 39.49 ? 63  ASP C C     1 
ATOM   6058  O  O     . ASP C  1 82  ? -49.100  -37.908 -29.112  1.00 40.22 ? 63  ASP C O     1 
ATOM   6059  C  CB    . ASP C  1 82  ? -51.898  -37.879 -29.382  1.00 38.88 ? 63  ASP C CB    1 
ATOM   6060  C  CG    . ASP C  1 82  ? -51.764  -38.585 -30.714  1.00 38.97 ? 63  ASP C CG    1 
ATOM   6061  O  OD1   . ASP C  1 82  ? -51.343  -39.774 -30.701  1.00 37.34 ? 63  ASP C OD1   1 
ATOM   6062  O  OD2   . ASP C  1 82  ? -52.081  -37.951 -31.756  1.00 37.46 ? 63  ASP C OD2   1 
ATOM   6063  N  N     . GLY C  1 83  ? -49.217  -40.027 -28.405  1.00 39.83 ? 64  GLY C N     1 
ATOM   6064  C  CA    . GLY C  1 83  ? -47.817  -40.278 -28.781  1.00 39.95 ? 64  GLY C CA    1 
ATOM   6065  C  C     . GLY C  1 83  ? -47.570  -40.344 -30.283  1.00 39.98 ? 64  GLY C C     1 
ATOM   6066  O  O     . GLY C  1 83  ? -46.445  -40.240 -30.725  1.00 40.11 ? 64  GLY C O     1 
ATOM   6067  N  N     . SER C  1 84  ? -48.614  -40.567 -31.065  1.00 40.37 ? 65  SER C N     1 
ATOM   6068  C  CA    . SER C  1 84  ? -48.483  -40.634 -32.513  1.00 40.44 ? 65  SER C CA    1 
ATOM   6069  C  C     . SER C  1 84  ? -48.260  -39.240 -33.093  1.00 40.68 ? 65  SER C C     1 
ATOM   6070  O  O     . SER C  1 84  ? -47.726  -39.094 -34.202  1.00 40.24 ? 65  SER C O     1 
ATOM   6071  C  CB    . SER C  1 84  ? -49.703  -41.304 -33.145  1.00 40.43 ? 65  SER C CB    1 
ATOM   6072  O  OG    . SER C  1 84  ? -50.866  -40.474 -33.137  1.00 39.45 ? 65  SER C OG    1 
ATOM   6073  N  N     . SER C  1 85  ? -48.613  -38.212 -32.324  1.00 40.99 ? 66  SER C N     1 
ATOM   6074  C  CA    . SER C  1 85  ? -48.377  -36.833 -32.774  1.00 41.08 ? 66  SER C CA    1 
ATOM   6075  C  C     . SER C  1 85  ? -47.088  -36.227 -32.243  1.00 41.33 ? 66  SER C C     1 
ATOM   6076  O  O     . SER C  1 85  ? -46.772  -35.084 -32.584  1.00 41.63 ? 66  SER C O     1 
ATOM   6077  C  CB    . SER C  1 85  ? -49.585  -35.966 -32.446  1.00 40.04 ? 66  SER C CB    1 
ATOM   6078  O  OG    . SER C  1 85  ? -50.640  -36.302 -33.330  1.00 40.45 ? 66  SER C OG    1 
ATOM   6079  N  N     . THR C  1 86  ? -46.364  -36.956 -31.389  1.00 42.29 ? 67  THR C N     1 
ATOM   6080  C  CA    . THR C  1 86  ? -45.008  -36.542 -30.935  1.00 43.14 ? 67  THR C CA    1 
ATOM   6081  C  C     . THR C  1 86  ? -43.915  -37.531 -31.333  1.00 43.49 ? 67  THR C C     1 
ATOM   6082  O  O     . THR C  1 86  ? -42.861  -37.550 -30.716  1.00 42.95 ? 67  THR C O     1 
ATOM   6083  C  CB    . THR C  1 86  ? -44.918  -36.441 -29.416  1.00 43.25 ? 67  THR C CB    1 
ATOM   6084  O  OG1   . THR C  1 86  ? -45.107  -37.746 -28.851  1.00 44.57 ? 67  THR C OG1   1 
ATOM   6085  C  CG2   . THR C  1 86  ? -45.965  -35.495 -28.877  1.00 43.51 ? 67  THR C CG2   1 
ATOM   6086  N  N     . LEU C  1 87  ? -44.162  -38.341 -32.364  1.00 44.45 ? 68  LEU C N     1 
ATOM   6087  C  CA    . LEU C  1 87  ? -43.168  -39.300 -32.836  1.00 45.09 ? 68  LEU C CA    1 
ATOM   6088  C  C     . LEU C  1 87  ? -42.791  -40.341 -31.770  1.00 45.38 ? 68  LEU C C     1 
ATOM   6089  O  O     . LEU C  1 87  ? -41.642  -40.715 -31.675  1.00 46.37 ? 68  LEU C O     1 
ATOM   6090  C  CB    . LEU C  1 87  ? -41.878  -38.553 -33.267  1.00 45.41 ? 68  LEU C CB    1 
ATOM   6091  C  CG    . LEU C  1 87  ? -41.542  -38.358 -34.755  1.00 47.49 ? 68  LEU C CG    1 
ATOM   6092  C  CD1   . LEU C  1 87  ? -39.991  -38.081 -34.867  1.00 49.28 ? 68  LEU C CD1   1 
ATOM   6093  C  CD2   . LEU C  1 87  ? -42.003  -39.561 -35.647  1.00 45.42 ? 68  LEU C CD2   1 
ATOM   6094  N  N     . GLN C  1 88  ? -43.702  -40.779 -30.925  1.00 45.18 ? 69  GLN C N     1 
ATOM   6095  C  CA    . GLN C  1 88  ? -43.297  -41.727 -29.886  1.00 45.24 ? 69  GLN C CA    1 
ATOM   6096  C  C     . GLN C  1 88  ? -44.120  -43.020 -29.876  1.00 45.39 ? 69  GLN C C     1 
ATOM   6097  O  O     . GLN C  1 88  ? -43.766  -43.951 -29.169  1.00 45.55 ? 69  GLN C O     1 
ATOM   6098  C  CB    . GLN C  1 88  ? -43.309  -41.033 -28.503  1.00 45.45 ? 69  GLN C CB    1 
ATOM   6099  C  CG    . GLN C  1 88  ? -42.207  -39.977 -28.330  1.00 44.45 ? 69  GLN C CG    1 
ATOM   6100  C  CD    . GLN C  1 88  ? -42.401  -39.023 -27.140  1.00 45.29 ? 69  GLN C CD    1 
ATOM   6101  O  OE1   . GLN C  1 88  ? -41.760  -39.173 -26.095  1.00 45.63 ? 69  GLN C OE1   1 
ATOM   6102  N  NE2   . GLN C  1 88  ? -43.241  -38.007 -27.320  1.00 44.92 ? 69  GLN C NE2   1 
ATOM   6103  N  N     . SER C  1 89  ? -45.208  -43.069 -30.647  1.00 45.57 ? 70  SER C N     1 
ATOM   6104  C  CA    . SER C  1 89  ? -46.124  -44.221 -30.666  1.00 45.80 ? 70  SER C CA    1 
ATOM   6105  C  C     . SER C  1 89  ? -46.903  -44.246 -31.986  1.00 45.61 ? 70  SER C C     1 
ATOM   6106  O  O     . SER C  1 89  ? -46.722  -43.386 -32.815  1.00 45.87 ? 70  SER C O     1 
ATOM   6107  C  CB    . SER C  1 89  ? -47.067  -44.196 -29.439  1.00 45.92 ? 70  SER C CB    1 
ATOM   6108  O  OG    . SER C  1 89  ? -48.177  -43.329 -29.608  1.00 46.43 ? 70  SER C OG    1 
ATOM   6109  N  N     . GLU C  1 90  ? -47.743  -45.242 -32.189  1.00 46.07 ? 71  GLU C N     1 
ATOM   6110  C  CA    . GLU C  1 90  ? -48.512  -45.370 -33.419  1.00 46.26 ? 71  GLU C CA    1 
ATOM   6111  C  C     . GLU C  1 90  ? -49.927  -44.925 -33.125  1.00 46.25 ? 71  GLU C C     1 
ATOM   6112  O  O     . GLU C  1 90  ? -50.477  -45.193 -32.029  1.00 45.96 ? 71  GLU C O     1 
ATOM   6113  C  CB    . GLU C  1 90  ? -48.613  -46.815 -33.857  1.00 47.02 ? 71  GLU C CB    1 
ATOM   6114  C  CG    . GLU C  1 90  ? -47.352  -47.581 -33.819  1.00 51.12 ? 71  GLU C CG    1 
ATOM   6115  C  CD    . GLU C  1 90  ? -46.581  -47.439 -35.088  1.00 57.78 ? 71  GLU C CD    1 
ATOM   6116  O  OE1   . GLU C  1 90  ? -45.936  -46.366 -35.281  1.00 59.35 ? 71  GLU C OE1   1 
ATOM   6117  O  OE2   . GLU C  1 90  ? -46.636  -48.417 -35.891  1.00 62.09 ? 71  GLU C OE2   1 
ATOM   6118  N  N     . GLY C  1 91  ? -50.548  -44.297 -34.121  1.00 45.73 ? 72  GLY C N     1 
ATOM   6119  C  CA    . GLY C  1 91  ? -51.916  -43.805 -33.991  1.00 45.33 ? 72  GLY C CA    1 
ATOM   6120  C  C     . GLY C  1 91  ? -52.928  -44.812 -33.500  1.00 45.03 ? 72  GLY C C     1 
ATOM   6121  O  O     . GLY C  1 91  ? -53.856  -44.445 -32.802  1.00 45.02 ? 72  GLY C O     1 
ATOM   6122  N  N     . SER C  1 92  ? -52.769  -46.083 -33.870  1.00 45.02 ? 73  SER C N     1 
ATOM   6123  C  CA    . SER C  1 92  ? -53.817  -47.080 -33.596  1.00 44.77 ? 73  SER C CA    1 
ATOM   6124  C  C     . SER C  1 92  ? -53.707  -47.671 -32.186  1.00 44.38 ? 73  SER C C     1 
ATOM   6125  O  O     . SER C  1 92  ? -54.613  -48.351 -31.746  1.00 44.52 ? 73  SER C O     1 
ATOM   6126  C  CB    . SER C  1 92  ? -53.812  -48.184 -34.651  1.00 44.58 ? 73  SER C CB    1 
ATOM   6127  O  OG    . SER C  1 92  ? -52.593  -48.906 -34.583  1.00 46.06 ? 73  SER C OG    1 
ATOM   6128  N  N     . ASN C  1 93  ? -52.596  -47.411 -31.497  1.00 44.12 ? 74  ASN C N     1 
ATOM   6129  C  CA    . ASN C  1 93  ? -52.436  -47.668 -30.048  1.00 43.53 ? 74  ASN C CA    1 
ATOM   6130  C  C     . ASN C  1 93  ? -51.647  -46.470 -29.427  1.00 43.06 ? 74  ASN C C     1 
ATOM   6131  O  O     . ASN C  1 93  ? -50.487  -46.579 -29.076  1.00 42.72 ? 74  ASN C O     1 
ATOM   6132  C  CB    . ASN C  1 93  ? -51.731  -49.018 -29.838  1.00 42.93 ? 74  ASN C CB    1 
ATOM   6133  C  CG    . ASN C  1 93  ? -51.621  -49.396 -28.376  1.00 44.33 ? 74  ASN C CG    1 
ATOM   6134  O  OD1   . ASN C  1 93  ? -52.308  -48.809 -27.520  1.00 43.74 ? 74  ASN C OD1   1 
ATOM   6135  N  ND2   . ASN C  1 93  ? -50.759  -50.380 -28.069  1.00 43.83 ? 74  ASN C ND2   1 
ATOM   6136  N  N     . SER C  1 94  ? -52.287  -45.311 -29.338  1.00 42.93 ? 75  SER C N     1 
ATOM   6137  C  CA    . SER C  1 94  ? -51.540  -44.034 -29.298  1.00 42.47 ? 75  SER C CA    1 
ATOM   6138  C  C     . SER C  1 94  ? -51.307  -43.444 -27.906  1.00 42.34 ? 75  SER C C     1 
ATOM   6139  O  O     . SER C  1 94  ? -50.217  -42.955 -27.642  1.00 43.30 ? 75  SER C O     1 
ATOM   6140  C  CB    . SER C  1 94  ? -52.188  -42.994 -30.229  1.00 41.90 ? 75  SER C CB    1 
ATOM   6141  O  OG    . SER C  1 94  ? -53.607  -43.068 -30.232  1.00 40.60 ? 75  SER C OG    1 
ATOM   6142  N  N     . ASP C  1 95  ? -52.282  -43.538 -27.009  1.00 41.99 ? 76  ASP C N     1 
ATOM   6143  C  CA    . ASP C  1 95  ? -52.175  -42.919 -25.697  1.00 42.22 ? 76  ASP C CA    1 
ATOM   6144  C  C     . ASP C  1 95  ? -50.824  -43.240 -25.054  1.00 42.62 ? 76  ASP C C     1 
ATOM   6145  O  O     . ASP C  1 95  ? -50.352  -44.392 -25.124  1.00 43.63 ? 76  ASP C O     1 
ATOM   6146  C  CB    . ASP C  1 95  ? -53.289  -43.394 -24.742  1.00 42.18 ? 76  ASP C CB    1 
ATOM   6147  C  CG    . ASP C  1 95  ? -54.717  -43.162 -25.284  1.00 41.63 ? 76  ASP C CG    1 
ATOM   6148  O  OD1   . ASP C  1 95  ? -55.670  -43.171 -24.466  1.00 43.15 ? 76  ASP C OD1   1 
ATOM   6149  O  OD2   . ASP C  1 95  ? -54.911  -43.013 -26.500  1.00 38.32 ? 76  ASP C OD2   1 
ATOM   6150  N  N     . MET C  1 96  ? -50.173  -42.239 -24.464  1.00 42.26 ? 77  MET C N     1 
ATOM   6151  C  CA    . MET C  1 96  ? -48.965  -42.511 -23.663  1.00 42.45 ? 77  MET C CA    1 
ATOM   6152  C  C     . MET C  1 96  ? -49.061  -41.766 -22.362  1.00 42.02 ? 77  MET C C     1 
ATOM   6153  O  O     . MET C  1 96  ? -49.692  -40.720 -22.310  1.00 42.55 ? 77  MET C O     1 
ATOM   6154  C  CB    . MET C  1 96  ? -47.685  -42.108 -24.379  1.00 42.40 ? 77  MET C CB    1 
ATOM   6155  C  CG    . MET C  1 96  ? -47.436  -42.794 -25.697  1.00 42.35 ? 77  MET C CG    1 
ATOM   6156  S  SD    . MET C  1 96  ? -45.829  -42.274 -26.352  1.00 44.56 ? 77  MET C SD    1 
ATOM   6157  C  CE    . MET C  1 96  ? -44.631  -43.288 -25.477  1.00 39.44 ? 77  MET C CE    1 
ATOM   6158  N  N     . TYR C  1 97  ? -48.451  -42.299 -21.310  1.00 41.78 ? 78  TYR C N     1 
ATOM   6159  C  CA    . TYR C  1 97  ? -48.679  -41.758 -19.962  1.00 41.58 ? 78  TYR C CA    1 
ATOM   6160  C  C     . TYR C  1 97  ? -47.800  -40.545 -19.669  1.00 40.49 ? 78  TYR C C     1 
ATOM   6161  O  O     . TYR C  1 97  ? -46.631  -40.523 -20.059  1.00 39.73 ? 78  TYR C O     1 
ATOM   6162  C  CB    . TYR C  1 97  ? -48.373  -42.797 -18.893  1.00 42.56 ? 78  TYR C CB    1 
ATOM   6163  C  CG    . TYR C  1 97  ? -49.243  -44.001 -18.902  1.00 43.19 ? 78  TYR C CG    1 
ATOM   6164  C  CD1   . TYR C  1 97  ? -50.376  -44.069 -18.098  1.00 43.84 ? 78  TYR C CD1   1 
ATOM   6165  C  CD2   . TYR C  1 97  ? -48.906  -45.103 -19.651  1.00 44.39 ? 78  TYR C CD2   1 
ATOM   6166  C  CE1   . TYR C  1 97  ? -51.164  -45.202 -18.049  1.00 43.88 ? 78  TYR C CE1   1 
ATOM   6167  C  CE2   . TYR C  1 97  ? -49.682  -46.247 -19.619  1.00 45.25 ? 78  TYR C CE2   1 
ATOM   6168  C  CZ    . TYR C  1 97  ? -50.822  -46.294 -18.827  1.00 45.25 ? 78  TYR C CZ    1 
ATOM   6169  O  OH    . TYR C  1 97  ? -51.607  -47.428 -18.815  1.00 45.78 ? 78  TYR C OH    1 
ATOM   6170  N  N     . LEU C  1 98  ? -48.384  -39.582 -18.959  1.00 39.15 ? 79  LEU C N     1 
ATOM   6171  C  CA    . LEU C  1 98  ? -47.681  -38.507 -18.288  1.00 39.33 ? 79  LEU C CA    1 
ATOM   6172  C  C     . LEU C  1 98  ? -47.770  -38.729 -16.800  1.00 38.84 ? 79  LEU C C     1 
ATOM   6173  O  O     . LEU C  1 98  ? -48.862  -38.675 -16.242  1.00 39.62 ? 79  LEU C O     1 
ATOM   6174  C  CB    . LEU C  1 98  ? -48.334  -37.140 -18.607  1.00 38.98 ? 79  LEU C CB    1 
ATOM   6175  C  CG    . LEU C  1 98  ? -48.266  -36.725 -20.076  1.00 38.35 ? 79  LEU C CG    1 
ATOM   6176  C  CD1   . LEU C  1 98  ? -49.037  -35.459 -20.277  1.00 36.38 ? 79  LEU C CD1   1 
ATOM   6177  C  CD2   . LEU C  1 98  ? -46.803  -36.574 -20.560  1.00 36.10 ? 79  LEU C CD2   1 
ATOM   6178  N  N     . VAL C  1 99  ? -46.633  -38.935 -16.149  1.00 39.02 ? 80  VAL C N     1 
ATOM   6179  C  CA    . VAL C  1 99  ? -46.552  -39.011 -14.678  1.00 38.66 ? 80  VAL C CA    1 
ATOM   6180  C  C     . VAL C  1 99  ? -45.844  -37.776 -14.134  1.00 39.22 ? 80  VAL C C     1 
ATOM   6181  O  O     . VAL C  1 99  ? -44.670  -37.556 -14.444  1.00 40.36 ? 80  VAL C O     1 
ATOM   6182  C  CB    . VAL C  1 99  ? -45.797  -40.270 -14.240  1.00 38.50 ? 80  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C  1 99  ? -45.664  -40.358 -12.712  1.00 34.13 ? 80  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C  1 99  ? -46.533  -41.484 -14.810  1.00 37.26 ? 80  VAL C CG2   1 
ATOM   6185  N  N     . PRO C  1 100 ? -46.553  -36.939 -13.351  1.00 39.12 ? 81  PRO C N     1 
ATOM   6186  C  CA    . PRO C  1 100 ? -45.931  -35.734 -12.773  1.00 38.68 ? 81  PRO C CA    1 
ATOM   6187  C  C     . PRO C  1 100 ? -44.647  -36.041 -12.031  1.00 38.57 ? 81  PRO C C     1 
ATOM   6188  O  O     . PRO C  1 100 ? -44.597  -37.020 -11.328  1.00 38.55 ? 81  PRO C O     1 
ATOM   6189  C  CB    . PRO C  1 100 ? -46.999  -35.202 -11.811  1.00 38.71 ? 81  PRO C CB    1 
ATOM   6190  C  CG    . PRO C  1 100 ? -48.301  -35.692 -12.361  1.00 39.08 ? 81  PRO C CG    1 
ATOM   6191  C  CD    . PRO C  1 100 ? -47.995  -37.019 -13.057  1.00 39.10 ? 81  PRO C CD    1 
ATOM   6192  N  N     . ALA C  1 101 ? -43.608  -35.230 -12.248  1.00 38.86 ? 82  ALA C N     1 
ATOM   6193  C  CA    . ALA C  1 101 ? -42.288  -35.411 -11.616  1.00 38.28 ? 82  ALA C CA    1 
ATOM   6194  C  C     . ALA C  1 101 ? -41.888  -34.200 -10.737  1.00 38.46 ? 82  ALA C C     1 
ATOM   6195  O  O     . ALA C  1 101 ? -41.472  -34.395 -9.576   1.00 37.69 ? 82  ALA C O     1 
ATOM   6196  C  CB    . ALA C  1 101 ? -41.244  -35.681 -12.645  1.00 37.14 ? 82  ALA C CB    1 
ATOM   6197  N  N     . ALA C  1 102 ? -41.996  -32.976 -11.290  1.00 37.92 ? 83  ALA C N     1 
ATOM   6198  C  CA    . ALA C  1 102 ? -41.643  -31.749 -10.558  1.00 37.78 ? 83  ALA C CA    1 
ATOM   6199  C  C     . ALA C  1 102 ? -42.672  -30.650 -10.865  1.00 37.28 ? 83  ALA C C     1 
ATOM   6200  O  O     . ALA C  1 102 ? -43.092  -30.495 -11.997  1.00 37.06 ? 83  ALA C O     1 
ATOM   6201  C  CB    . ALA C  1 102 ? -40.192  -31.282 -10.888  1.00 36.82 ? 83  ALA C CB    1 
ATOM   6202  N  N     . MET C  1 103 ? -43.070  -29.921 -9.830   1.00 37.57 ? 84  MET C N     1 
ATOM   6203  C  CA    . MET C  1 103 ? -44.126  -28.919 -9.907   1.00 38.31 ? 84  MET C CA    1 
ATOM   6204  C  C     . MET C  1 103 ? -43.575  -27.559 -9.586   1.00 38.08 ? 84  MET C C     1 
ATOM   6205  O  O     . MET C  1 103 ? -42.871  -27.430 -8.617   1.00 38.34 ? 84  MET C O     1 
ATOM   6206  C  CB    . MET C  1 103 ? -45.262  -29.189 -8.909   1.00 37.67 ? 84  MET C CB    1 
ATOM   6207  C  CG    . MET C  1 103 ? -46.405  -28.215 -9.078   1.00 37.99 ? 84  MET C CG    1 
ATOM   6208  S  SD    . MET C  1 103 ? -47.855  -28.594 -8.094   1.00 40.60 ? 84  MET C SD    1 
ATOM   6209  C  CE    . MET C  1 103 ? -47.259  -28.022 -6.462   1.00 35.92 ? 84  MET C CE    1 
ATOM   6210  N  N     . PHE C  1 104 ? -43.964  -26.555 -10.370  1.00 38.07 ? 85  PHE C N     1 
ATOM   6211  C  CA    . PHE C  1 104 ? -43.552  -25.190 -10.163  1.00 38.30 ? 85  PHE C CA    1 
ATOM   6212  C  C     . PHE C  1 104 ? -44.737  -24.268 -10.354  1.00 38.29 ? 85  PHE C C     1 
ATOM   6213  O  O     . PHE C  1 104 ? -45.754  -24.671 -10.929  1.00 38.00 ? 85  PHE C O     1 
ATOM   6214  C  CB    . PHE C  1 104 ? -42.469  -24.784 -11.165  1.00 38.81 ? 85  PHE C CB    1 
ATOM   6215  C  CG    . PHE C  1 104 ? -41.214  -25.626 -11.098  1.00 38.93 ? 85  PHE C CG    1 
ATOM   6216  C  CD1   . PHE C  1 104 ? -40.124  -25.203 -10.359  1.00 39.09 ? 85  PHE C CD1   1 
ATOM   6217  C  CD2   . PHE C  1 104 ? -41.129  -26.824 -11.790  1.00 39.22 ? 85  PHE C CD2   1 
ATOM   6218  C  CE1   . PHE C  1 104 ? -38.962  -25.966 -10.297  1.00 40.08 ? 85  PHE C CE1   1 
ATOM   6219  C  CE2   . PHE C  1 104 ? -39.971  -27.604 -11.732  1.00 39.45 ? 85  PHE C CE2   1 
ATOM   6220  C  CZ    . PHE C  1 104 ? -38.889  -27.171 -10.986  1.00 39.54 ? 85  PHE C CZ    1 
ATOM   6221  N  N     . ARG C  1 105 ? -44.569  -23.026 -9.896   1.00 37.88 ? 86  ARG C N     1 
ATOM   6222  C  CA    . ARG C  1 105 ? -45.558  -21.991 -10.068  1.00 38.10 ? 86  ARG C CA    1 
ATOM   6223  C  C     . ARG C  1 105 ? -45.536  -21.517 -11.524  1.00 38.02 ? 86  ARG C C     1 
ATOM   6224  O  O     . ARG C  1 105 ? -44.504  -21.523 -12.139  1.00 38.29 ? 86  ARG C O     1 
ATOM   6225  C  CB    . ARG C  1 105 ? -45.268  -20.839 -9.124   1.00 38.29 ? 86  ARG C CB    1 
ATOM   6226  C  CG    . ARG C  1 105 ? -45.269  -21.252 -7.677   1.00 37.47 ? 86  ARG C CG    1 
ATOM   6227  C  CD    . ARG C  1 105 ? -44.708  -20.165 -6.800   1.00 38.12 ? 86  ARG C CD    1 
ATOM   6228  N  NE    . ARG C  1 105 ? -45.624  -19.016 -6.655   1.00 41.05 ? 86  ARG C NE    1 
ATOM   6229  C  CZ    . ARG C  1 105 ? -45.238  -17.765 -6.375   1.00 39.57 ? 86  ARG C CZ    1 
ATOM   6230  N  NH1   . ARG C  1 105 ? -43.949  -17.468 -6.239   1.00 38.23 ? 86  ARG C NH1   1 
ATOM   6231  N  NH2   . ARG C  1 105 ? -46.140  -16.794 -6.247   1.00 35.87 ? 86  ARG C NH2   1 
ATOM   6232  N  N     . ASP C  1 106 ? -46.680  -21.157 -12.083  1.00 37.96 ? 87  ASP C N     1 
ATOM   6233  C  CA    . ASP C  1 106 ? -46.755  -20.768 -13.482  1.00 38.01 ? 87  ASP C CA    1 
ATOM   6234  C  C     . ASP C  1 106 ? -46.574  -19.247 -13.599  1.00 37.87 ? 87  ASP C C     1 
ATOM   6235  O  O     . ASP C  1 106 ? -47.452  -18.501 -13.216  1.00 37.84 ? 87  ASP C O     1 
ATOM   6236  C  CB    . ASP C  1 106 ? -48.100  -21.192 -14.083  1.00 38.35 ? 87  ASP C CB    1 
ATOM   6237  C  CG    . ASP C  1 106 ? -48.147  -21.026 -15.617  1.00 39.03 ? 87  ASP C CG    1 
ATOM   6238  O  OD1   . ASP C  1 106 ? -47.557  -20.043 -16.143  1.00 40.51 ? 87  ASP C OD1   1 
ATOM   6239  O  OD2   . ASP C  1 106 ? -48.775  -21.887 -16.278  1.00 39.24 ? 87  ASP C OD2   1 
ATOM   6240  N  N     . PRO C  1 107 ? -45.432  -18.791 -14.127  1.00 37.59 ? 88  PRO C N     1 
ATOM   6241  C  CA    . PRO C  1 107 ? -45.173  -17.367 -14.251  1.00 38.07 ? 88  PRO C CA    1 
ATOM   6242  C  C     . PRO C  1 107 ? -45.894  -16.711 -15.437  1.00 38.01 ? 88  PRO C C     1 
ATOM   6243  O  O     . PRO C  1 107 ? -45.984  -15.482 -15.470  1.00 38.24 ? 88  PRO C O     1 
ATOM   6244  C  CB    . PRO C  1 107 ? -43.649  -17.302 -14.444  1.00 37.64 ? 88  PRO C CB    1 
ATOM   6245  C  CG    . PRO C  1 107 ? -43.322  -18.569 -15.129  1.00 37.83 ? 88  PRO C CG    1 
ATOM   6246  C  CD    . PRO C  1 107 ? -44.312  -19.593 -14.655  1.00 37.94 ? 88  PRO C CD    1 
ATOM   6247  N  N     . PHE C  1 108 ? -46.426  -17.516 -16.354  1.00 37.53 ? 89  PHE C N     1 
ATOM   6248  C  CA    . PHE C  1 108 ? -47.262  -17.005 -17.457  1.00 38.21 ? 89  PHE C CA    1 
ATOM   6249  C  C     . PHE C  1 108 ? -48.712  -16.802 -17.025  1.00 38.54 ? 89  PHE C C     1 
ATOM   6250  O  O     . PHE C  1 108 ? -49.382  -15.888 -17.487  1.00 39.28 ? 89  PHE C O     1 
ATOM   6251  C  CB    . PHE C  1 108 ? -47.167  -17.958 -18.656  1.00 38.50 ? 89  PHE C CB    1 
ATOM   6252  C  CG    . PHE C  1 108 ? -45.761  -18.335 -18.955  1.00 38.83 ? 89  PHE C CG    1 
ATOM   6253  C  CD1   . PHE C  1 108 ? -44.887  -17.393 -19.439  1.00 39.07 ? 89  PHE C CD1   1 
ATOM   6254  C  CD2   . PHE C  1 108 ? -45.285  -19.574 -18.630  1.00 38.78 ? 89  PHE C CD2   1 
ATOM   6255  C  CE1   . PHE C  1 108 ? -43.560  -17.713 -19.650  1.00 40.70 ? 89  PHE C CE1   1 
ATOM   6256  C  CE2   . PHE C  1 108 ? -43.985  -19.889 -18.823  1.00 39.56 ? 89  PHE C CE2   1 
ATOM   6257  C  CZ    . PHE C  1 108 ? -43.109  -18.958 -19.336  1.00 39.50 ? 89  PHE C CZ    1 
ATOM   6258  N  N     . ARG C  1 109 ? -49.193  -17.627 -16.101  1.00 38.65 ? 90  ARG C N     1 
ATOM   6259  C  CA    . ARG C  1 109 ? -50.599  -17.539 -15.657  1.00 38.45 ? 90  ARG C CA    1 
ATOM   6260  C  C     . ARG C  1 109 ? -50.811  -17.090 -14.193  1.00 37.87 ? 90  ARG C C     1 
ATOM   6261  O  O     . ARG C  1 109 ? -51.910  -16.772 -13.829  1.00 35.40 ? 90  ARG C O     1 
ATOM   6262  C  CB    . ARG C  1 109 ? -51.254  -18.887 -15.885  1.00 38.27 ? 90  ARG C CB    1 
ATOM   6263  C  CG    . ARG C  1 109 ? -51.447  -19.147 -17.338  1.00 38.28 ? 90  ARG C CG    1 
ATOM   6264  C  CD    . ARG C  1 109 ? -51.691  -20.586 -17.542  1.00 37.68 ? 90  ARG C CD    1 
ATOM   6265  N  NE    . ARG C  1 109 ? -52.025  -20.926 -18.919  1.00 36.33 ? 90  ARG C NE    1 
ATOM   6266  C  CZ    . ARG C  1 109 ? -52.111  -22.184 -19.316  1.00 35.70 ? 90  ARG C CZ    1 
ATOM   6267  N  NH1   . ARG C  1 109 ? -51.879  -23.155 -18.442  1.00 36.30 ? 90  ARG C NH1   1 
ATOM   6268  N  NH2   . ARG C  1 109 ? -52.398  -22.480 -20.570  1.00 36.07 ? 90  ARG C NH2   1 
ATOM   6269  N  N     . LYS C  1 110 ? -49.730  -17.064 -13.437  1.00 37.95 ? 91  LYS C N     1 
ATOM   6270  C  CA    . LYS C  1 110 ? -49.696  -16.722 -12.037  1.00 38.54 ? 91  LYS C CA    1 
ATOM   6271  C  C     . LYS C  1 110 ? -50.281  -17.701 -11.082  1.00 38.03 ? 91  LYS C C     1 
ATOM   6272  O  O     . LYS C  1 110 ? -50.922  -18.581 -11.467  1.00 37.41 ? 91  LYS C O     1 
ATOM   6273  C  CB    . LYS C  1 110 ? -50.073  -15.281 -11.759  1.00 38.36 ? 91  LYS C CB    1 
ATOM   6274  C  CG    . LYS C  1 110 ? -49.382  -14.330 -12.648  1.00 40.55 ? 91  LYS C CG    1 
ATOM   6275  C  CD    . LYS C  1 110 ? -49.915  -12.981 -12.529  1.00 40.68 ? 91  LYS C CD    1 
ATOM   6276  C  CE    . LYS C  1 110 ? -49.857  -12.538 -11.129  1.00 45.56 ? 91  LYS C CE    1 
ATOM   6277  N  NZ    . LYS C  1 110 ? -49.880  -11.079 -10.950  1.00 45.61 ? 91  LYS C NZ    1 
ATOM   6278  N  N     . ASP C  1 111 ? -50.011  -17.538 -9.816   1.00 38.59 ? 92  ASP C N     1 
ATOM   6279  C  CA    . ASP C  1 111 ? -50.659  -18.313 -8.790   1.00 39.06 ? 92  ASP C CA    1 
ATOM   6280  C  C     . ASP C  1 111 ? -52.131  -18.229 -8.991   1.00 38.53 ? 92  ASP C C     1 
ATOM   6281  O  O     . ASP C  1 111 ? -52.625  -17.186 -9.264   1.00 38.60 ? 92  ASP C O     1 
ATOM   6282  C  CB    . ASP C  1 111 ? -50.306  -17.766 -7.433   1.00 37.95 ? 92  ASP C CB    1 
ATOM   6283  C  CG    . ASP C  1 111 ? -48.961  -18.179 -6.988   1.00 40.69 ? 92  ASP C CG    1 
ATOM   6284  O  OD1   . ASP C  1 111 ? -48.435  -19.149 -7.522   1.00 39.45 ? 92  ASP C OD1   1 
ATOM   6285  O  OD2   . ASP C  1 111 ? -48.422  -17.547 -6.094   1.00 41.62 ? 92  ASP C OD2   1 
ATOM   6286  N  N     . PRO C  1 112 ? -52.858  -19.326 -8.911   1.00 38.99 ? 93  PRO C N     1 
ATOM   6287  C  CA    . PRO C  1 112 ? -52.453  -20.596 -8.334   1.00 38.55 ? 93  PRO C CA    1 
ATOM   6288  C  C     . PRO C  1 112 ? -52.096  -21.644 -9.356   1.00 38.35 ? 93  PRO C C     1 
ATOM   6289  O  O     . PRO C  1 112 ? -52.188  -22.808 -9.132   1.00 38.91 ? 93  PRO C O     1 
ATOM   6290  C  CB    . PRO C  1 112 ? -53.722  -21.020 -7.639   1.00 39.09 ? 93  PRO C CB    1 
ATOM   6291  C  CG    . PRO C  1 112 ? -54.769  -20.486 -8.463   1.00 38.48 ? 93  PRO C CG    1 
ATOM   6292  C  CD    . PRO C  1 112 ? -54.311  -19.228 -9.031   1.00 39.07 ? 93  PRO C CD    1 
ATOM   6293  N  N     . ASN C  1 113 ? -51.694  -21.198 -10.508  1.00 38.09 ? 94  ASN C N     1 
ATOM   6294  C  CA    . ASN C  1 113 ? -51.499  -22.075 -11.604  1.00 38.08 ? 94  ASN C CA    1 
ATOM   6295  C  C     . ASN C  1 113 ? -50.144  -22.655 -11.618  1.00 37.71 ? 94  ASN C C     1 
ATOM   6296  O  O     . ASN C  1 113 ? -49.251  -22.171 -10.990  1.00 37.48 ? 94  ASN C O     1 
ATOM   6297  C  CB    . ASN C  1 113 ? -51.829  -21.372 -12.887  1.00 38.33 ? 94  ASN C CB    1 
ATOM   6298  C  CG    . ASN C  1 113 ? -53.139  -20.716 -12.839  1.00 37.71 ? 94  ASN C CG    1 
ATOM   6299  O  OD1   . ASN C  1 113 ? -54.134  -21.355 -12.808  1.00 40.71 ? 94  ASN C OD1   1 
ATOM   6300  N  ND2   . ASN C  1 113 ? -53.144  -19.445 -12.820  1.00 34.51 ? 94  ASN C ND2   1 
ATOM   6301  N  N     . LYS C  1 114 ? -50.024  -23.763 -12.290  1.00 37.91 ? 95  LYS C N     1 
ATOM   6302  C  CA    . LYS C  1 114 ? -48.843  -24.620 -12.094  1.00 38.38 ? 95  LYS C CA    1 
ATOM   6303  C  C     . LYS C  1 114 ? -48.201  -25.071 -13.414  1.00 39.03 ? 95  LYS C C     1 
ATOM   6304  O  O     . LYS C  1 114 ? -48.894  -25.294 -14.406  1.00 39.33 ? 95  LYS C O     1 
ATOM   6305  C  CB    . LYS C  1 114 ? -49.204  -25.887 -11.336  1.00 38.12 ? 95  LYS C CB    1 
ATOM   6306  C  CG    . LYS C  1 114 ? -49.878  -25.712 -9.967   1.00 38.92 ? 95  LYS C CG    1 
ATOM   6307  C  CD    . LYS C  1 114 ? -48.955  -24.972 -8.990   1.00 37.91 ? 95  LYS C CD    1 
ATOM   6308  C  CE    . LYS C  1 114 ? -49.507  -24.913 -7.579   1.00 36.95 ? 95  LYS C CE    1 
ATOM   6309  N  NZ    . LYS C  1 114 ? -49.437  -23.540 -7.098   1.00 32.67 ? 95  LYS C NZ    1 
ATOM   6310  N  N     . LEU C  1 115 ? -46.876  -25.180 -13.420  1.00 39.00 ? 96  LEU C N     1 
ATOM   6311  C  CA    . LEU C  1 115 ? -46.188  -25.933 -14.444  1.00 38.97 ? 96  LEU C CA    1 
ATOM   6312  C  C     . LEU C  1 115 ? -45.876  -27.278 -13.793  1.00 39.30 ? 96  LEU C C     1 
ATOM   6313  O  O     . LEU C  1 115 ? -45.512  -27.320 -12.600  1.00 38.48 ? 96  LEU C O     1 
ATOM   6314  C  CB    . LEU C  1 115 ? -44.896  -25.242 -14.849  1.00 38.88 ? 96  LEU C CB    1 
ATOM   6315  C  CG    . LEU C  1 115 ? -45.029  -23.823 -15.394  1.00 38.94 ? 96  LEU C CG    1 
ATOM   6316  C  CD1   . LEU C  1 115 ? -43.628  -23.210 -15.698  1.00 36.34 ? 96  LEU C CD1   1 
ATOM   6317  C  CD2   . LEU C  1 115 ? -45.943  -23.789 -16.585  1.00 36.58 ? 96  LEU C CD2   1 
ATOM   6318  N  N     . VAL C  1 116 ? -46.039  -28.365 -14.553  1.00 39.28 ? 97  VAL C N     1 
ATOM   6319  C  CA    . VAL C  1 116 ? -45.694  -29.699 -14.066  1.00 39.53 ? 97  VAL C CA    1 
ATOM   6320  C  C     . VAL C  1 116 ? -44.830  -30.394 -15.072  1.00 39.70 ? 97  VAL C C     1 
ATOM   6321  O  O     . VAL C  1 116 ? -45.282  -30.682 -16.185  1.00 39.99 ? 97  VAL C O     1 
ATOM   6322  C  CB    . VAL C  1 116 ? -46.929  -30.606 -13.937  1.00 40.07 ? 97  VAL C CB    1 
ATOM   6323  C  CG1   . VAL C  1 116 ? -46.498  -32.008 -13.359  1.00 39.06 ? 97  VAL C CG1   1 
ATOM   6324  C  CG2   . VAL C  1 116 ? -47.997  -29.946 -13.101  1.00 39.97 ? 97  VAL C CG2   1 
ATOM   6325  N  N     . LEU C  1 117 ? -43.596  -30.694 -14.713  1.00 39.52 ? 98  LEU C N     1 
ATOM   6326  C  CA    . LEU C  1 117 ? -42.756  -31.465 -15.627  1.00 39.47 ? 98  LEU C CA    1 
ATOM   6327  C  C     . LEU C  1 117 ? -43.106  -32.934 -15.386  1.00 39.93 ? 98  LEU C C     1 
ATOM   6328  O  O     . LEU C  1 117 ? -43.224  -33.349 -14.236  1.00 40.57 ? 98  LEU C O     1 
ATOM   6329  C  CB    . LEU C  1 117 ? -41.269  -31.202 -15.357  1.00 39.21 ? 98  LEU C CB    1 
ATOM   6330  C  CG    . LEU C  1 117 ? -40.304  -32.047 -16.196  1.00 38.66 ? 98  LEU C CG    1 
ATOM   6331  C  CD1   . LEU C  1 117 ? -40.326  -31.544 -17.611  1.00 37.34 ? 98  LEU C CD1   1 
ATOM   6332  C  CD2   . LEU C  1 117 ? -38.910  -32.093 -15.613  1.00 37.41 ? 98  LEU C CD2   1 
ATOM   6333  N  N     . CYS C  1 118 ? -43.235  -33.716 -16.450  1.00 40.09 ? 99  CYS C N     1 
ATOM   6334  C  CA    . CYS C  1 118 ? -43.611  -35.092 -16.333  1.00 40.76 ? 99  CYS C CA    1 
ATOM   6335  C  C     . CYS C  1 118 ? -42.623  -36.090 -16.932  1.00 41.27 ? 99  CYS C C     1 
ATOM   6336  O  O     . CYS C  1 118 ? -41.822  -35.746 -17.782  1.00 42.24 ? 99  CYS C O     1 
ATOM   6337  C  CB    . CYS C  1 118 ? -44.934  -35.271 -17.041  1.00 40.93 ? 99  CYS C CB    1 
ATOM   6338  S  SG    . CYS C  1 118 ? -46.314  -34.293 -16.393  1.00 42.14 ? 99  CYS C SG    1 
ATOM   6339  N  N     . GLU C  1 119 ? -42.689  -37.339 -16.459  1.00 41.94 ? 100 GLU C N     1 
ATOM   6340  C  CA    . GLU C  1 119 ? -42.086  -38.491 -17.155  1.00 41.91 ? 100 GLU C CA    1 
ATOM   6341  C  C     . GLU C  1 119 ? -43.099  -39.135 -18.099  1.00 42.02 ? 100 GLU C C     1 
ATOM   6342  O  O     . GLU C  1 119 ? -44.282  -39.235 -17.760  1.00 42.05 ? 100 GLU C O     1 
ATOM   6343  C  CB    . GLU C  1 119 ? -41.569  -39.542 -16.178  1.00 42.28 ? 100 GLU C CB    1 
ATOM   6344  C  CG    . GLU C  1 119 ? -40.227  -39.168 -15.547  1.00 42.52 ? 100 GLU C CG    1 
ATOM   6345  C  CD    . GLU C  1 119 ? -39.642  -40.261 -14.691  1.00 41.78 ? 100 GLU C CD    1 
ATOM   6346  O  OE1   . GLU C  1 119 ? -39.674  -41.451 -15.063  1.00 43.12 ? 100 GLU C OE1   1 
ATOM   6347  O  OE2   . GLU C  1 119 ? -39.113  -39.924 -13.633  1.00 40.76 ? 100 GLU C OE2   1 
ATOM   6348  N  N     . VAL C  1 120 ? -42.622  -39.543 -19.281  1.00 41.65 ? 101 VAL C N     1 
ATOM   6349  C  CA    . VAL C  1 120 ? -43.420  -40.220 -20.286  1.00 41.63 ? 101 VAL C CA    1 
ATOM   6350  C  C     . VAL C  1 120 ? -43.217  -41.739 -20.165  1.00 42.28 ? 101 VAL C C     1 
ATOM   6351  O  O     . VAL C  1 120 ? -42.097  -42.177 -19.998  1.00 43.67 ? 101 VAL C O     1 
ATOM   6352  C  CB    . VAL C  1 120 ? -43.011  -39.771 -21.701  1.00 40.56 ? 101 VAL C CB    1 
ATOM   6353  C  CG1   . VAL C  1 120 ? -43.850  -40.492 -22.737  1.00 40.71 ? 101 VAL C CG1   1 
ATOM   6354  C  CG2   . VAL C  1 120 ? -43.116  -38.280 -21.848  1.00 37.55 ? 101 VAL C CG2   1 
ATOM   6355  N  N     . PHE C  1 121 ? -44.280  -42.531 -20.232  1.00 43.23 ? 102 PHE C N     1 
ATOM   6356  C  CA    . PHE C  1 121 ? -44.189  -43.989 -20.351  1.00 43.65 ? 102 PHE C CA    1 
ATOM   6357  C  C     . PHE C  1 121 ? -45.035  -44.520 -21.494  1.00 44.32 ? 102 PHE C C     1 
ATOM   6358  O  O     . PHE C  1 121 ? -45.994  -43.890 -21.910  1.00 43.57 ? 102 PHE C O     1 
ATOM   6359  C  CB    . PHE C  1 121 ? -44.672  -44.656 -19.084  1.00 43.11 ? 102 PHE C CB    1 
ATOM   6360  C  CG    . PHE C  1 121 ? -43.923  -44.253 -17.889  1.00 42.64 ? 102 PHE C CG    1 
ATOM   6361  C  CD1   . PHE C  1 121 ? -42.982  -45.104 -17.325  1.00 43.74 ? 102 PHE C CD1   1 
ATOM   6362  C  CD2   . PHE C  1 121 ? -44.122  -43.011 -17.328  1.00 42.15 ? 102 PHE C CD2   1 
ATOM   6363  C  CE1   . PHE C  1 121 ? -42.260  -44.718 -16.184  1.00 43.64 ? 102 PHE C CE1   1 
ATOM   6364  C  CE2   . PHE C  1 121 ? -43.416  -42.614 -16.198  1.00 43.04 ? 102 PHE C CE2   1 
ATOM   6365  C  CZ    . PHE C  1 121 ? -42.487  -43.462 -15.617  1.00 43.10 ? 102 PHE C CZ    1 
ATOM   6366  N  N     . LYS C  1 122 ? -44.718  -45.733 -21.931  1.00 45.82 ? 103 LYS C N     1 
ATOM   6367  C  CA    . LYS C  1 122 ? -45.363  -46.347 -23.099  1.00 47.41 ? 103 LYS C CA    1 
ATOM   6368  C  C     . LYS C  1 122 ? -46.700  -47.024 -22.814  1.00 47.98 ? 103 LYS C C     1 
ATOM   6369  O  O     . LYS C  1 122 ? -47.177  -47.066 -21.669  1.00 48.50 ? 103 LYS C O     1 
ATOM   6370  C  CB    . LYS C  1 122 ? -44.390  -47.352 -23.717  1.00 47.91 ? 103 LYS C CB    1 
ATOM   6371  C  CG    . LYS C  1 122 ? -43.128  -46.677 -24.185  1.00 48.24 ? 103 LYS C CG    1 
ATOM   6372  C  CD    . LYS C  1 122 ? -42.059  -47.659 -24.453  1.00 49.43 ? 103 LYS C CD    1 
ATOM   6373  C  CE    . LYS C  1 122 ? -42.117  -48.129 -25.857  1.00 52.48 ? 103 LYS C CE    1 
ATOM   6374  N  NZ    . LYS C  1 122 ? -41.116  -49.222 -26.076  1.00 52.46 ? 103 LYS C NZ    1 
ATOM   6375  N  N     . TYR C  1 123 ? -47.320  -47.552 -23.858  1.00 49.10 ? 104 TYR C N     1 
ATOM   6376  C  CA    . TYR C  1 123 ? -48.606  -48.282 -23.705  1.00 49.77 ? 104 TYR C CA    1 
ATOM   6377  C  C     . TYR C  1 123 ? -48.482  -49.383 -22.625  1.00 50.28 ? 104 TYR C C     1 
ATOM   6378  O  O     . TYR C  1 123 ? -49.470  -49.705 -21.941  1.00 50.34 ? 104 TYR C O     1 
ATOM   6379  C  CB    . TYR C  1 123 ? -49.095  -48.876 -25.062  1.00 50.90 ? 104 TYR C CB    1 
ATOM   6380  C  CG    . TYR C  1 123 ? -48.220  -50.005 -25.545  1.00 51.19 ? 104 TYR C CG    1 
ATOM   6381  C  CD1   . TYR C  1 123 ? -48.609  -51.350 -25.382  1.00 52.39 ? 104 TYR C CD1   1 
ATOM   6382  C  CD2   . TYR C  1 123 ? -46.985  -49.738 -26.102  1.00 52.44 ? 104 TYR C CD2   1 
ATOM   6383  C  CE1   . TYR C  1 123 ? -47.793  -52.391 -25.788  1.00 51.73 ? 104 TYR C CE1   1 
ATOM   6384  C  CE2   . TYR C  1 123 ? -46.138  -50.767 -26.508  1.00 53.66 ? 104 TYR C CE2   1 
ATOM   6385  C  CZ    . TYR C  1 123 ? -46.543  -52.093 -26.349  1.00 54.06 ? 104 TYR C CZ    1 
ATOM   6386  O  OH    . TYR C  1 123 ? -45.661  -53.083 -26.748  1.00 53.95 ? 104 TYR C OH    1 
ATOM   6387  N  N     . ASN C  1 124 ? -47.269  -49.930 -22.454  1.00 50.11 ? 105 ASN C N     1 
ATOM   6388  C  CA    . ASN C  1 124 ? -47.051  -51.025 -21.523  1.00 50.17 ? 105 ASN C CA    1 
ATOM   6389  C  C     . ASN C  1 124 ? -46.462  -50.612 -20.198  1.00 49.96 ? 105 ASN C C     1 
ATOM   6390  O  O     . ASN C  1 124 ? -45.891  -51.440 -19.511  1.00 49.43 ? 105 ASN C O     1 
ATOM   6391  C  CB    . ASN C  1 124 ? -46.165  -52.080 -22.165  1.00 50.22 ? 105 ASN C CB    1 
ATOM   6392  C  CG    . ASN C  1 124 ? -44.782  -51.569 -22.467  1.00 51.23 ? 105 ASN C CG    1 
ATOM   6393  O  OD1   . ASN C  1 124 ? -44.426  -50.432 -22.132  1.00 52.75 ? 105 ASN C OD1   1 
ATOM   6394  N  ND2   . ASN C  1 124 ? -43.985  -52.405 -23.105  1.00 50.16 ? 105 ASN C ND2   1 
ATOM   6395  N  N     . ARG C  1 125 ? -46.603  -49.330 -19.856  1.00 50.62 ? 106 ARG C N     1 
ATOM   6396  C  CA    . ARG C  1 125 ? -46.056  -48.725 -18.616  1.00 51.35 ? 106 ARG C CA    1 
ATOM   6397  C  C     . ARG C  1 125 ? -44.522  -48.737 -18.477  1.00 50.57 ? 106 ARG C C     1 
ATOM   6398  O  O     . ARG C  1 125 ? -43.993  -48.428 -17.409  1.00 50.49 ? 106 ARG C O     1 
ATOM   6399  C  CB    . ARG C  1 125 ? -46.732  -49.319 -17.352  1.00 51.67 ? 106 ARG C CB    1 
ATOM   6400  C  CG    . ARG C  1 125 ? -48.227  -49.028 -17.273  1.00 52.91 ? 106 ARG C CG    1 
ATOM   6401  C  CD    . ARG C  1 125 ? -48.915  -49.409 -15.916  1.00 55.03 ? 106 ARG C CD    1 
ATOM   6402  N  NE    . ARG C  1 125 ? -49.949  -48.412 -15.533  1.00 56.94 ? 106 ARG C NE    1 
ATOM   6403  C  CZ    . ARG C  1 125 ? -49.683  -47.135 -15.176  1.00 59.39 ? 106 ARG C CZ    1 
ATOM   6404  N  NH1   . ARG C  1 125 ? -48.402  -46.655 -15.115  1.00 58.72 ? 106 ARG C NH1   1 
ATOM   6405  N  NH2   . ARG C  1 125 ? -50.705  -46.317 -14.876  1.00 58.41 ? 106 ARG C NH2   1 
ATOM   6406  N  N     . ARG C  1 126 ? -43.803  -49.066 -19.543  1.00 50.28 ? 107 ARG C N     1 
ATOM   6407  C  CA    . ARG C  1 126 ? -42.343  -48.922 -19.534  1.00 51.00 ? 107 ARG C CA    1 
ATOM   6408  C  C     . ARG C  1 126 ? -41.930  -47.529 -19.971  1.00 48.95 ? 107 ARG C C     1 
ATOM   6409  O  O     . ARG C  1 126 ? -42.619  -46.892 -20.756  1.00 48.18 ? 107 ARG C O     1 
ATOM   6410  C  CB    . ARG C  1 126 ? -41.663  -49.962 -20.440  1.00 51.86 ? 107 ARG C CB    1 
ATOM   6411  C  CG    . ARG C  1 126 ? -42.013  -51.379 -20.054  1.00 53.84 ? 107 ARG C CG    1 
ATOM   6412  C  CD    . ARG C  1 126 ? -40.887  -52.375 -20.297  1.00 57.05 ? 107 ARG C CD    1 
ATOM   6413  N  NE    . ARG C  1 126 ? -41.339  -53.737 -19.939  1.00 61.42 ? 107 ARG C NE    1 
ATOM   6414  C  CZ    . ARG C  1 126 ? -40.614  -54.860 -20.059  1.00 64.55 ? 107 ARG C CZ    1 
ATOM   6415  N  NH1   . ARG C  1 126 ? -39.359  -54.835 -20.533  1.00 64.47 ? 107 ARG C NH1   1 
ATOM   6416  N  NH2   . ARG C  1 126 ? -41.161  -56.026 -19.698  1.00 65.70 ? 107 ARG C NH2   1 
ATOM   6417  N  N     . PRO C  1 127 ? -40.779  -47.067 -19.495  1.00 47.84 ? 108 PRO C N     1 
ATOM   6418  C  CA    . PRO C  1 127 ? -40.355  -45.705 -19.849  1.00 47.25 ? 108 PRO C CA    1 
ATOM   6419  C  C     . PRO C  1 127 ? -40.183  -45.515 -21.346  1.00 46.31 ? 108 PRO C C     1 
ATOM   6420  O  O     . PRO C  1 127 ? -39.758  -46.444 -22.031  1.00 45.90 ? 108 PRO C O     1 
ATOM   6421  C  CB    . PRO C  1 127 ? -39.015  -45.552 -19.131  1.00 46.99 ? 108 PRO C CB    1 
ATOM   6422  C  CG    . PRO C  1 127 ? -39.023  -46.641 -18.073  1.00 47.11 ? 108 PRO C CG    1 
ATOM   6423  C  CD    . PRO C  1 127 ? -39.804  -47.750 -18.628  1.00 47.21 ? 108 PRO C CD    1 
ATOM   6424  N  N     . ALA C  1 128 ? -40.565  -44.339 -21.843  1.00 45.23 ? 109 ALA C N     1 
ATOM   6425  C  CA    . ALA C  1 128 ? -40.295  -43.957 -23.220  1.00 44.81 ? 109 ALA C CA    1 
ATOM   6426  C  C     . ALA C  1 128 ? -38.799  -43.937 -23.496  1.00 43.94 ? 109 ALA C C     1 
ATOM   6427  O  O     . ALA C  1 128 ? -37.981  -43.710 -22.605  1.00 42.66 ? 109 ALA C O     1 
ATOM   6428  C  CB    . ALA C  1 128 ? -40.865  -42.598 -23.524  1.00 44.18 ? 109 ALA C CB    1 
ATOM   6429  N  N     . GLU C  1 129 ? -38.469  -44.139 -24.764  1.00 43.86 ? 110 GLU C N     1 
ATOM   6430  C  CA    . GLU C  1 129 ? -37.098  -44.181 -25.225  1.00 44.07 ? 110 GLU C CA    1 
ATOM   6431  C  C     . GLU C  1 129 ? -36.398  -42.875 -24.880  1.00 43.29 ? 110 GLU C C     1 
ATOM   6432  O  O     . GLU C  1 129 ? -35.230  -42.890 -24.561  1.00 43.35 ? 110 GLU C O     1 
ATOM   6433  C  CB    . GLU C  1 129 ? -37.029  -44.488 -26.733  1.00 45.23 ? 110 GLU C CB    1 
ATOM   6434  C  CG    . GLU C  1 129 ? -37.404  -45.992 -27.133  1.00 48.41 ? 110 GLU C CG    1 
ATOM   6435  C  CD    . GLU C  1 129 ? -38.958  -46.334 -27.104  1.00 54.09 ? 110 GLU C CD    1 
ATOM   6436  O  OE1   . GLU C  1 129 ? -39.813  -45.394 -26.962  1.00 56.80 ? 110 GLU C OE1   1 
ATOM   6437  O  OE2   . GLU C  1 129 ? -39.333  -47.558 -27.215  1.00 52.73 ? 110 GLU C OE2   1 
ATOM   6438  N  N     . THR C  1 130 ? -37.110  -41.755 -24.905  1.00 42.11 ? 111 THR C N     1 
ATOM   6439  C  CA    . THR C  1 130 ? -36.511  -40.484 -24.529  1.00 41.59 ? 111 THR C CA    1 
ATOM   6440  C  C     . THR C  1 130 ? -36.825  -40.051 -23.081  1.00 41.01 ? 111 THR C C     1 
ATOM   6441  O  O     . THR C  1 130 ? -36.638  -38.896 -22.728  1.00 40.99 ? 111 THR C O     1 
ATOM   6442  C  CB    . THR C  1 130 ? -36.873  -39.374 -25.523  1.00 41.57 ? 111 THR C CB    1 
ATOM   6443  O  OG1   . THR C  1 130 ? -38.289  -39.115 -25.461  1.00 41.49 ? 111 THR C OG1   1 
ATOM   6444  C  CG2   . THR C  1 130 ? -36.458  -39.786 -26.944  1.00 39.03 ? 111 THR C CG2   1 
ATOM   6445  N  N     . ASN C  1 131 ? -37.228  -40.996 -22.242  1.00 40.09 ? 112 ASN C N     1 
ATOM   6446  C  CA    . ASN C  1 131 ? -37.339  -40.774 -20.818  1.00 40.10 ? 112 ASN C CA    1 
ATOM   6447  C  C     . ASN C  1 131 ? -36.053  -41.224 -20.134  1.00 40.59 ? 112 ASN C C     1 
ATOM   6448  O  O     . ASN C  1 131 ? -35.847  -42.419 -19.858  1.00 42.16 ? 112 ASN C O     1 
ATOM   6449  C  CB    . ASN C  1 131 ? -38.541  -41.527 -20.234  1.00 40.17 ? 112 ASN C CB    1 
ATOM   6450  C  CG    . ASN C  1 131 ? -38.596  -41.433 -18.718  1.00 39.75 ? 112 ASN C CG    1 
ATOM   6451  O  OD1   . ASN C  1 131 ? -37.592  -41.047 -18.072  1.00 37.88 ? 112 ASN C OD1   1 
ATOM   6452  N  ND2   . ASN C  1 131 ? -39.763  -41.733 -18.142  1.00 34.19 ? 112 ASN C ND2   1 
ATOM   6453  N  N     . LEU C  1 132 ? -35.168  -40.267 -19.891  1.00 40.38 ? 113 LEU C N     1 
ATOM   6454  C  CA    . LEU C  1 132 ? -33.880  -40.520 -19.339  1.00 40.10 ? 113 LEU C CA    1 
ATOM   6455  C  C     . LEU C  1 132 ? -33.845  -40.166 -17.864  1.00 40.90 ? 113 LEU C C     1 
ATOM   6456  O  O     . LEU C  1 132 ? -32.852  -40.439 -17.167  1.00 42.06 ? 113 LEU C O     1 
ATOM   6457  C  CB    . LEU C  1 132 ? -32.832  -39.754 -20.123  1.00 39.69 ? 113 LEU C CB    1 
ATOM   6458  C  CG    . LEU C  1 132 ? -32.641  -40.179 -21.605  1.00 38.93 ? 113 LEU C CG    1 
ATOM   6459  C  CD1   . LEU C  1 132 ? -31.509  -39.381 -22.252  1.00 34.80 ? 113 LEU C CD1   1 
ATOM   6460  C  CD2   . LEU C  1 132 ? -32.353  -41.649 -21.787  1.00 35.88 ? 113 LEU C CD2   1 
ATOM   6461  N  N     . ARG C  1 133 ? -34.940  -39.606 -17.370  1.00 41.33 ? 114 ARG C N     1 
ATOM   6462  C  CA    . ARG C  1 133 ? -35.076  -39.280 -15.963  1.00 41.45 ? 114 ARG C CA    1 
ATOM   6463  C  C     . ARG C  1 133 ? -35.249  -40.551 -15.132  1.00 41.49 ? 114 ARG C C     1 
ATOM   6464  O  O     . ARG C  1 133 ? -34.761  -40.640 -14.000  1.00 40.36 ? 114 ARG C O     1 
ATOM   6465  C  CB    . ARG C  1 133 ? -36.298  -38.391 -15.747  1.00 41.05 ? 114 ARG C CB    1 
ATOM   6466  C  CG    . ARG C  1 133 ? -36.395  -37.882 -14.346  1.00 40.62 ? 114 ARG C CG    1 
ATOM   6467  C  CD    . ARG C  1 133 ? -37.611  -36.968 -14.149  1.00 41.47 ? 114 ARG C CD    1 
ATOM   6468  N  NE    . ARG C  1 133 ? -37.541  -36.241 -12.868  1.00 42.20 ? 114 ARG C NE    1 
ATOM   6469  C  CZ    . ARG C  1 133 ? -37.931  -36.717 -11.683  1.00 39.50 ? 114 ARG C CZ    1 
ATOM   6470  N  NH1   . ARG C  1 133 ? -38.437  -37.916 -11.525  1.00 38.53 ? 114 ARG C NH1   1 
ATOM   6471  N  NH2   . ARG C  1 133 ? -37.803  -35.960 -10.633  1.00 40.76 ? 114 ARG C NH2   1 
ATOM   6472  N  N     . HIS C  1 134 ? -35.999  -41.505 -15.672  1.00 42.33 ? 115 HIS C N     1 
ATOM   6473  C  CA    . HIS C  1 134 ? -36.257  -42.726 -14.940  1.00 43.38 ? 115 HIS C CA    1 
ATOM   6474  C  C     . HIS C  1 134 ? -34.994  -43.379 -14.359  1.00 43.86 ? 115 HIS C C     1 
ATOM   6475  O  O     . HIS C  1 134 ? -34.886  -43.469 -13.129  1.00 42.89 ? 115 HIS C O     1 
ATOM   6476  C  CB    . HIS C  1 134 ? -37.037  -43.744 -15.741  1.00 44.29 ? 115 HIS C CB    1 
ATOM   6477  C  CG    . HIS C  1 134 ? -37.730  -44.741 -14.867  1.00 47.14 ? 115 HIS C CG    1 
ATOM   6478  N  ND1   . HIS C  1 134 ? -38.817  -44.393 -14.068  1.00 48.32 ? 115 HIS C ND1   1 
ATOM   6479  C  CD2   . HIS C  1 134 ? -37.450  -46.048 -14.606  1.00 47.05 ? 115 HIS C CD2   1 
ATOM   6480  C  CE1   . HIS C  1 134 ? -39.179  -45.460 -13.369  1.00 50.55 ? 115 HIS C CE1   1 
ATOM   6481  N  NE2   . HIS C  1 134 ? -38.373  -46.473 -13.681  1.00 49.42 ? 115 HIS C NE2   1 
ATOM   6482  N  N     . THR C  1 135 ? -34.046  -43.789 -15.226  1.00 44.20 ? 116 THR C N     1 
ATOM   6483  C  CA    . THR C  1 135 ? -32.750  -44.315 -14.771  1.00 44.66 ? 116 THR C CA    1 
ATOM   6484  C  C     . THR C  1 135 ? -31.935  -43.292 -13.976  1.00 45.06 ? 116 THR C C     1 
ATOM   6485  O  O     . THR C  1 135 ? -31.346  -43.613 -12.942  1.00 45.13 ? 116 THR C O     1 
ATOM   6486  C  CB    . THR C  1 135 ? -31.902  -44.900 -15.947  1.00 44.69 ? 116 THR C CB    1 
ATOM   6487  O  OG1   . THR C  1 135 ? -32.610  -45.998 -16.537  1.00 44.29 ? 116 THR C OG1   1 
ATOM   6488  C  CG2   . THR C  1 135 ? -30.525  -45.394 -15.488  1.00 43.17 ? 116 THR C CG2   1 
ATOM   6489  N  N     . CYS C  1 136 ? -31.881  -42.061 -14.439  1.00 45.77 ? 117 CYS C N     1 
ATOM   6490  C  CA    . CYS C  1 136 ? -31.089  -41.055 -13.710  1.00 46.61 ? 117 CYS C CA    1 
ATOM   6491  C  C     . CYS C  1 136 ? -31.485  -40.954 -12.212  1.00 47.44 ? 117 CYS C C     1 
ATOM   6492  O  O     . CYS C  1 136 ? -30.631  -40.921 -11.312  1.00 47.57 ? 117 CYS C O     1 
ATOM   6493  C  CB    . CYS C  1 136 ? -31.241  -39.689 -14.385  1.00 46.33 ? 117 CYS C CB    1 
ATOM   6494  S  SG    . CYS C  1 136 ? -30.266  -38.374 -13.669  1.00 46.09 ? 117 CYS C SG    1 
ATOM   6495  N  N     . LYS C  1 137 ? -32.786  -40.890 -11.959  1.00 48.16 ? 118 LYS C N     1 
ATOM   6496  C  CA    . LYS C  1 137 ? -33.285  -40.787 -10.621  1.00 48.92 ? 118 LYS C CA    1 
ATOM   6497  C  C     . LYS C  1 137 ? -32.821  -41.912 -9.728   1.00 49.51 ? 118 LYS C C     1 
ATOM   6498  O  O     . LYS C  1 137 ? -32.491  -41.675 -8.573   1.00 49.62 ? 118 LYS C O     1 
ATOM   6499  C  CB    . LYS C  1 137 ? -34.795  -40.814 -10.617  1.00 49.13 ? 118 LYS C CB    1 
ATOM   6500  C  CG    . LYS C  1 137 ? -35.322  -40.211 -9.346   1.00 50.48 ? 118 LYS C CG    1 
ATOM   6501  C  CD    . LYS C  1 137 ? -36.630  -40.792 -8.933   1.00 51.92 ? 118 LYS C CD    1 
ATOM   6502  C  CE    . LYS C  1 137 ? -37.037  -40.246 -7.583   1.00 53.25 ? 118 LYS C CE    1 
ATOM   6503  N  NZ    . LYS C  1 137 ? -37.336  -41.406 -6.673   1.00 57.05 ? 118 LYS C NZ    1 
ATOM   6504  N  N     . ARG C  1 138 ? -32.884  -43.142 -10.237  1.00 49.78 ? 119 ARG C N     1 
ATOM   6505  C  CA    . ARG C  1 138 ? -32.406  -44.268 -9.492   1.00 50.92 ? 119 ARG C CA    1 
ATOM   6506  C  C     . ARG C  1 138 ? -30.921  -44.117 -9.228   1.00 49.52 ? 119 ARG C C     1 
ATOM   6507  O  O     . ARG C  1 138 ? -30.483  -44.438 -8.129   1.00 49.22 ? 119 ARG C O     1 
ATOM   6508  C  CB    . ARG C  1 138 ? -32.612  -45.590 -10.220  1.00 51.54 ? 119 ARG C CB    1 
ATOM   6509  C  CG    . ARG C  1 138 ? -34.000  -46.008 -10.366  1.00 54.92 ? 119 ARG C CG    1 
ATOM   6510  C  CD    . ARG C  1 138 ? -34.060  -47.294 -11.195  1.00 58.45 ? 119 ARG C CD    1 
ATOM   6511  N  NE    . ARG C  1 138 ? -35.471  -47.711 -11.384  1.00 64.42 ? 119 ARG C NE    1 
ATOM   6512  C  CZ    . ARG C  1 138 ? -35.919  -48.985 -11.375  1.00 67.31 ? 119 ARG C CZ    1 
ATOM   6513  N  NH1   . ARG C  1 138 ? -35.073  -50.027 -11.190  1.00 68.23 ? 119 ARG C NH1   1 
ATOM   6514  N  NH2   . ARG C  1 138 ? -37.238  -49.227 -11.547  1.00 67.58 ? 119 ARG C NH2   1 
ATOM   6515  N  N     . ILE C  1 139 ? -30.156  -43.659 -10.219  1.00 48.14 ? 120 ILE C N     1 
ATOM   6516  C  CA    . ILE C  1 139 ? -28.714  -43.499 -10.007  1.00 48.96 ? 120 ILE C CA    1 
ATOM   6517  C  C     . ILE C  1 139 ? -28.421  -42.464 -8.902   1.00 48.49 ? 120 ILE C C     1 
ATOM   6518  O  O     . ILE C  1 139 ? -27.572  -42.711 -8.066   1.00 48.27 ? 120 ILE C O     1 
ATOM   6519  C  CB    . ILE C  1 139 ? -27.890  -43.207 -11.323  1.00 48.76 ? 120 ILE C CB    1 
ATOM   6520  C  CG1   . ILE C  1 139 ? -27.969  -44.399 -12.332  1.00 48.34 ? 120 ILE C CG1   1 
ATOM   6521  C  CG2   . ILE C  1 139 ? -26.470  -42.862 -10.991  1.00 47.39 ? 120 ILE C CG2   1 
ATOM   6522  C  CD1   . ILE C  1 139 ? -27.267  -45.678 -11.937  1.00 44.42 ? 120 ILE C CD1   1 
ATOM   6523  N  N     . MET C  1 140 ? -29.163  -41.359 -8.855   1.00 48.59 ? 121 MET C N     1 
ATOM   6524  C  CA    . MET C  1 140 ? -28.972  -40.363 -7.787   1.00 48.67 ? 121 MET C CA    1 
ATOM   6525  C  C     . MET C  1 140 ? -29.310  -40.942 -6.425   1.00 48.97 ? 121 MET C C     1 
ATOM   6526  O  O     . MET C  1 140 ? -28.608  -40.678 -5.443   1.00 48.85 ? 121 MET C O     1 
ATOM   6527  C  CB    . MET C  1 140 ? -29.829  -39.137 -8.012   1.00 48.20 ? 121 MET C CB    1 
ATOM   6528  C  CG    . MET C  1 140 ? -29.543  -38.424 -9.319   1.00 49.07 ? 121 MET C CG    1 
ATOM   6529  S  SD    . MET C  1 140 ? -27.869  -37.804 -9.360   1.00 47.69 ? 121 MET C SD    1 
ATOM   6530  C  CE    . MET C  1 140 ? -27.784  -37.116 -11.017  1.00 46.69 ? 121 MET C CE    1 
ATOM   6531  N  N     . ASP C  1 141 ? -30.362  -41.765 -6.370   1.00 49.10 ? 122 ASP C N     1 
ATOM   6532  C  CA    . ASP C  1 141 ? -30.775  -42.364 -5.101   1.00 49.29 ? 122 ASP C CA    1 
ATOM   6533  C  C     . ASP C  1 141 ? -29.721  -43.285 -4.531   1.00 49.44 ? 122 ASP C C     1 
ATOM   6534  O  O     . ASP C  1 141 ? -29.670  -43.455 -3.326   1.00 50.22 ? 122 ASP C O     1 
ATOM   6535  C  CB    . ASP C  1 141 ? -32.107  -43.103 -5.207   1.00 48.87 ? 122 ASP C CB    1 
ATOM   6536  C  CG    . ASP C  1 141 ? -33.276  -42.168 -5.363   1.00 49.70 ? 122 ASP C CG    1 
ATOM   6537  O  OD1   . ASP C  1 141 ? -33.111  -40.924 -5.221   1.00 48.70 ? 122 ASP C OD1   1 
ATOM   6538  O  OD2   . ASP C  1 141 ? -34.375  -42.678 -5.647   1.00 52.67 ? 122 ASP C OD2   1 
ATOM   6539  N  N     . MET C  1 142 ? -28.869  -43.845 -5.381   1.00 49.54 ? 123 MET C N     1 
ATOM   6540  C  CA    . MET C  1 142 ? -27.785  -44.709 -4.910   1.00 49.71 ? 123 MET C CA    1 
ATOM   6541  C  C     . MET C  1 142 ? -26.656  -43.952 -4.224   1.00 48.99 ? 123 MET C C     1 
ATOM   6542  O  O     . MET C  1 142 ? -25.893  -44.560 -3.527   1.00 49.94 ? 123 MET C O     1 
ATOM   6543  C  CB    . MET C  1 142 ? -27.172  -45.518 -6.065   1.00 49.83 ? 123 MET C CB    1 
ATOM   6544  C  CG    . MET C  1 142 ? -28.087  -46.584 -6.671   1.00 50.03 ? 123 MET C CG    1 
ATOM   6545  S  SD    . MET C  1 142 ? -27.252  -47.335 -8.093   1.00 53.79 ? 123 MET C SD    1 
ATOM   6546  C  CE    . MET C  1 142 ? -28.666  -48.146 -8.900   1.00 51.05 ? 123 MET C CE    1 
ATOM   6547  N  N     . VAL C  1 143 ? -26.528  -42.651 -4.435   1.00 48.07 ? 124 VAL C N     1 
ATOM   6548  C  CA    . VAL C  1 143 ? -25.380  -41.911 -3.925   1.00 47.45 ? 124 VAL C CA    1 
ATOM   6549  C  C     . VAL C  1 143 ? -25.821  -40.698 -3.110   1.00 46.79 ? 124 VAL C C     1 
ATOM   6550  O  O     . VAL C  1 143 ? -25.049  -39.750 -2.937   1.00 46.26 ? 124 VAL C O     1 
ATOM   6551  C  CB    . VAL C  1 143 ? -24.420  -41.443 -5.091   1.00 47.55 ? 124 VAL C CB    1 
ATOM   6552  C  CG1   . VAL C  1 143 ? -23.900  -42.636 -5.882   1.00 45.95 ? 124 VAL C CG1   1 
ATOM   6553  C  CG2   . VAL C  1 143 ? -25.115  -40.394 -6.032   1.00 47.22 ? 124 VAL C CG2   1 
ATOM   6554  N  N     . SER C  1 144 ? -27.055  -40.729 -2.611   1.00 46.61 ? 125 SER C N     1 
ATOM   6555  C  CA    . SER C  1 144 ? -27.638  -39.573 -1.924   1.00 47.14 ? 125 SER C CA    1 
ATOM   6556  C  C     . SER C  1 144 ? -26.867  -39.076 -0.684   1.00 47.42 ? 125 SER C C     1 
ATOM   6557  O  O     . SER C  1 144 ? -26.870  -37.883 -0.386   1.00 48.04 ? 125 SER C O     1 
ATOM   6558  C  CB    . SER C  1 144 ? -29.087  -39.853 -1.575   1.00 46.68 ? 125 SER C CB    1 
ATOM   6559  O  OG    . SER C  1 144 ? -29.223  -41.120 -0.975   1.00 48.17 ? 125 SER C OG    1 
ATOM   6560  N  N     . ASN C  1 145 ? -26.179  -39.975 0.004    1.00 47.64 ? 126 ASN C N     1 
ATOM   6561  C  CA    . ASN C  1 145 ? -25.295  -39.583 1.098    1.00 47.91 ? 126 ASN C CA    1 
ATOM   6562  C  C     . ASN C  1 145 ? -24.152  -38.698 0.698    1.00 47.98 ? 126 ASN C C     1 
ATOM   6563  O  O     . ASN C  1 145 ? -23.529  -38.069 1.571    1.00 48.29 ? 126 ASN C O     1 
ATOM   6564  C  CB    . ASN C  1 145 ? -24.672  -40.807 1.753    1.00 47.86 ? 126 ASN C CB    1 
ATOM   6565  C  CG    . ASN C  1 145 ? -25.613  -41.457 2.686    1.00 50.09 ? 126 ASN C CG    1 
ATOM   6566  O  OD1   . ASN C  1 145 ? -26.665  -40.864 3.026    1.00 51.51 ? 126 ASN C OD1   1 
ATOM   6567  N  ND2   . ASN C  1 145 ? -25.286  -42.693 3.112    1.00 50.14 ? 126 ASN C ND2   1 
ATOM   6568  N  N     . GLN C  1 146 ? -23.820  -38.709 -0.589   1.00 47.17 ? 127 GLN C N     1 
ATOM   6569  C  CA    . GLN C  1 146 ? -22.703  -37.944 -1.054   1.00 46.70 ? 127 GLN C CA    1 
ATOM   6570  C  C     . GLN C  1 146 ? -23.193  -36.607 -1.550   1.00 46.39 ? 127 GLN C C     1 
ATOM   6571  O  O     . GLN C  1 146 ? -22.376  -35.734 -1.901   1.00 46.74 ? 127 GLN C O     1 
ATOM   6572  C  CB    . GLN C  1 146 ? -21.942  -38.710 -2.136   1.00 46.94 ? 127 GLN C CB    1 
ATOM   6573  C  CG    . GLN C  1 146 ? -21.128  -39.859 -1.589   1.00 47.11 ? 127 GLN C CG    1 
ATOM   6574  C  CD    . GLN C  1 146 ? -20.691  -40.804 -2.680   1.00 47.69 ? 127 GLN C CD    1 
ATOM   6575  O  OE1   . GLN C  1 146 ? -19.779  -40.487 -3.440   1.00 49.78 ? 127 GLN C OE1   1 
ATOM   6576  N  NE2   . GLN C  1 146 ? -21.340  -41.977 -2.771   1.00 47.12 ? 127 GLN C NE2   1 
ATOM   6577  N  N     . HIS C  1 147 ? -24.518  -36.440 -1.573   1.00 45.49 ? 128 HIS C N     1 
ATOM   6578  C  CA    . HIS C  1 147 ? -25.131  -35.134 -1.839   1.00 45.14 ? 128 HIS C CA    1 
ATOM   6579  C  C     . HIS C  1 147 ? -24.551  -34.428 -3.050   1.00 44.59 ? 128 HIS C C     1 
ATOM   6580  O  O     . HIS C  1 147 ? -24.037  -33.321 -2.927   1.00 44.37 ? 128 HIS C O     1 
ATOM   6581  C  CB    . HIS C  1 147 ? -25.019  -34.228 -0.623   1.00 44.82 ? 128 HIS C CB    1 
ATOM   6582  C  CG    . HIS C  1 147 ? -25.780  -34.741 0.548    1.00 45.77 ? 128 HIS C CG    1 
ATOM   6583  N  ND1   . HIS C  1 147 ? -27.162  -34.768 0.574    1.00 45.52 ? 128 HIS C ND1   1 
ATOM   6584  C  CD2   . HIS C  1 147 ? -25.359  -35.272 1.723    1.00 45.42 ? 128 HIS C CD2   1 
ATOM   6585  C  CE1   . HIS C  1 147 ? -27.560  -35.298 1.720    1.00 46.57 ? 128 HIS C CE1   1 
ATOM   6586  N  NE2   . HIS C  1 147 ? -26.483  -35.616 2.431    1.00 47.65 ? 128 HIS C NE2   1 
ATOM   6587  N  N     . PRO C  1 148 ? -24.646  -35.064 -4.230   1.00 44.10 ? 129 PRO C N     1 
ATOM   6588  C  CA    . PRO C  1 148 ? -24.089  -34.439 -5.462   1.00 43.46 ? 129 PRO C CA    1 
ATOM   6589  C  C     . PRO C  1 148 ? -24.859  -33.192 -5.828   1.00 42.45 ? 129 PRO C C     1 
ATOM   6590  O  O     . PRO C  1 148 ? -26.035  -33.261 -5.958   1.00 42.05 ? 129 PRO C O     1 
ATOM   6591  C  CB    . PRO C  1 148 ? -24.301  -35.515 -6.522   1.00 43.43 ? 129 PRO C CB    1 
ATOM   6592  C  CG    . PRO C  1 148 ? -25.516  -36.340 -5.968   1.00 43.60 ? 129 PRO C CG    1 
ATOM   6593  C  CD    . PRO C  1 148 ? -25.291  -36.369 -4.492   1.00 43.65 ? 129 PRO C CD    1 
ATOM   6594  N  N     . TRP C  1 149 ? -24.197  -32.056 -5.943   1.00 42.53 ? 130 TRP C N     1 
ATOM   6595  C  CA    . TRP C  1 149 ? -24.827  -30.837 -6.450   1.00 42.15 ? 130 TRP C CA    1 
ATOM   6596  C  C     . TRP C  1 149 ? -24.312  -30.531 -7.843   1.00 41.87 ? 130 TRP C C     1 
ATOM   6597  O  O     . TRP C  1 149 ? -23.106  -30.710 -8.128   1.00 41.81 ? 130 TRP C O     1 
ATOM   6598  C  CB    . TRP C  1 149 ? -24.455  -29.631 -5.603   1.00 42.06 ? 130 TRP C CB    1 
ATOM   6599  C  CG    . TRP C  1 149 ? -24.908  -29.640 -4.230   1.00 41.61 ? 130 TRP C CG    1 
ATOM   6600  C  CD1   . TRP C  1 149 ? -25.723  -30.551 -3.641   1.00 41.67 ? 130 TRP C CD1   1 
ATOM   6601  C  CD2   . TRP C  1 149 ? -24.605  -28.659 -3.242   1.00 41.53 ? 130 TRP C CD2   1 
ATOM   6602  N  NE1   . TRP C  1 149 ? -25.923  -30.215 -2.326   1.00 41.39 ? 130 TRP C NE1   1 
ATOM   6603  C  CE2   . TRP C  1 149 ? -25.258  -29.045 -2.058   1.00 41.73 ? 130 TRP C CE2   1 
ATOM   6604  C  CE3   . TRP C  1 149 ? -23.831  -27.489 -3.237   1.00 41.86 ? 130 TRP C CE3   1 
ATOM   6605  C  CZ2   . TRP C  1 149 ? -25.166  -28.299 -0.866   1.00 40.94 ? 130 TRP C CZ2   1 
ATOM   6606  C  CZ3   . TRP C  1 149 ? -23.737  -26.743 -2.044   1.00 41.07 ? 130 TRP C CZ3   1 
ATOM   6607  C  CH2   . TRP C  1 149 ? -24.396  -27.157 -0.887   1.00 41.09 ? 130 TRP C CH2   1 
ATOM   6608  N  N     . PHE C  1 150 ? -25.205  -30.020 -8.685   1.00 41.51 ? 131 PHE C N     1 
ATOM   6609  C  CA    . PHE C  1 150 ? -24.861  -29.618 -10.044  1.00 41.47 ? 131 PHE C CA    1 
ATOM   6610  C  C     . PHE C  1 150 ? -25.212  -28.151 -10.291  1.00 41.49 ? 131 PHE C C     1 
ATOM   6611  O  O     . PHE C  1 150 ? -26.056  -27.583 -9.612   1.00 41.93 ? 131 PHE C O     1 
ATOM   6612  C  CB    . PHE C  1 150 ? -25.550  -30.484 -11.075  1.00 41.39 ? 131 PHE C CB    1 
ATOM   6613  C  CG    . PHE C  1 150 ? -25.268  -31.946 -10.933  1.00 41.52 ? 131 PHE C CG    1 
ATOM   6614  C  CD1   . PHE C  1 150 ? -24.244  -32.530 -11.600  1.00 42.11 ? 131 PHE C CD1   1 
ATOM   6615  C  CD2   . PHE C  1 150 ? -26.075  -32.746 -10.165  1.00 42.64 ? 131 PHE C CD2   1 
ATOM   6616  C  CE1   . PHE C  1 150 ? -23.993  -33.899 -11.457  1.00 42.71 ? 131 PHE C CE1   1 
ATOM   6617  C  CE2   . PHE C  1 150 ? -25.842  -34.103 -10.038  1.00 42.36 ? 131 PHE C CE2   1 
ATOM   6618  C  CZ    . PHE C  1 150 ? -24.793  -34.676 -10.689  1.00 41.54 ? 131 PHE C CZ    1 
ATOM   6619  N  N     . GLY C  1 151 ? -24.509  -27.542 -11.250  1.00 41.76 ? 132 GLY C N     1 
ATOM   6620  C  CA    . GLY C  1 151 ? -24.723  -26.160 -11.687  1.00 41.28 ? 132 GLY C CA    1 
ATOM   6621  C  C     . GLY C  1 151 ? -24.479  -26.126 -13.189  1.00 41.41 ? 132 GLY C C     1 
ATOM   6622  O  O     . GLY C  1 151 ? -23.347  -26.383 -13.659  1.00 42.01 ? 132 GLY C O     1 
ATOM   6623  N  N     . MET C  1 152 ? -25.530  -25.833 -13.956  1.00 40.95 ? 133 MET C N     1 
ATOM   6624  C  CA    . MET C  1 152 ? -25.457  -25.921 -15.396  1.00 40.40 ? 133 MET C CA    1 
ATOM   6625  C  C     . MET C  1 152 ? -25.636  -24.556 -16.020  1.00 40.29 ? 133 MET C C     1 
ATOM   6626  O  O     . MET C  1 152 ? -26.558  -23.802 -15.668  1.00 39.98 ? 133 MET C O     1 
ATOM   6627  C  CB    . MET C  1 152 ? -26.440  -26.951 -15.931  1.00 40.27 ? 133 MET C CB    1 
ATOM   6628  C  CG    . MET C  1 152 ? -26.056  -28.377 -15.514  1.00 40.89 ? 133 MET C CG    1 
ATOM   6629  S  SD    . MET C  1 152 ? -27.089  -29.744 -16.076  1.00 39.96 ? 133 MET C SD    1 
ATOM   6630  C  CE    . MET C  1 152 ? -26.633  -30.035 -17.770  1.00 39.11 ? 133 MET C CE    1 
ATOM   6631  N  N     . GLU C  1 153 ? -24.676  -24.230 -16.890  1.00 40.08 ? 134 GLU C N     1 
ATOM   6632  C  CA    . GLU C  1 153 ? -24.613  -22.944 -17.577  1.00 40.35 ? 134 GLU C CA    1 
ATOM   6633  C  C     . GLU C  1 153 ? -25.221  -23.102 -18.977  1.00 40.17 ? 134 GLU C C     1 
ATOM   6634  O  O     . GLU C  1 153 ? -24.509  -23.478 -19.943  1.00 39.82 ? 134 GLU C O     1 
ATOM   6635  C  CB    . GLU C  1 153 ? -23.165  -22.462 -17.715  1.00 40.34 ? 134 GLU C CB    1 
ATOM   6636  C  CG    . GLU C  1 153 ? -22.441  -22.255 -16.386  1.00 41.33 ? 134 GLU C CG    1 
ATOM   6637  C  CD    . GLU C  1 153 ? -20.956  -21.962 -16.598  1.00 41.57 ? 134 GLU C CD    1 
ATOM   6638  O  OE1   . GLU C  1 153 ? -20.625  -20.894 -17.187  1.00 42.80 ? 134 GLU C OE1   1 
ATOM   6639  O  OE2   . GLU C  1 153 ? -20.119  -22.827 -16.208  1.00 43.21 ? 134 GLU C OE2   1 
ATOM   6640  N  N     . GLN C  1 154 ? -26.526  -22.795 -19.079  1.00 39.38 ? 135 GLN C N     1 
ATOM   6641  C  CA    . GLN C  1 154 ? -27.246  -22.927 -20.345  1.00 38.67 ? 135 GLN C CA    1 
ATOM   6642  C  C     . GLN C  1 154 ? -26.936  -21.725 -21.185  1.00 38.23 ? 135 GLN C C     1 
ATOM   6643  O  O     . GLN C  1 154 ? -27.414  -20.631 -20.885  1.00 38.49 ? 135 GLN C O     1 
ATOM   6644  C  CB    . GLN C  1 154 ? -28.751  -23.005 -20.111  1.00 38.22 ? 135 GLN C CB    1 
ATOM   6645  C  CG    . GLN C  1 154 ? -29.553  -23.238 -21.387  1.00 38.81 ? 135 GLN C CG    1 
ATOM   6646  C  CD    . GLN C  1 154 ? -29.231  -24.576 -22.024  1.00 37.18 ? 135 GLN C CD    1 
ATOM   6647  O  OE1   . GLN C  1 154 ? -29.592  -25.643 -21.503  1.00 34.44 ? 135 GLN C OE1   1 
ATOM   6648  N  NE2   . GLN C  1 154 ? -28.557  -24.529 -23.142  1.00 35.88 ? 135 GLN C NE2   1 
ATOM   6649  N  N     . GLU C  1 155 ? -26.137  -21.907 -22.221  1.00 37.43 ? 136 GLU C N     1 
ATOM   6650  C  CA    . GLU C  1 155 ? -25.950  -20.833 -23.207  1.00 37.80 ? 136 GLU C CA    1 
ATOM   6651  C  C     . GLU C  1 155 ? -26.935  -21.098 -24.328  1.00 36.75 ? 136 GLU C C     1 
ATOM   6652  O  O     . GLU C  1 155 ? -27.284  -22.241 -24.591  1.00 36.66 ? 136 GLU C O     1 
ATOM   6653  C  CB    . GLU C  1 155 ? -24.481  -20.800 -23.749  1.00 38.04 ? 136 GLU C CB    1 
ATOM   6654  C  CG    . GLU C  1 155 ? -23.399  -20.420 -22.707  1.00 38.39 ? 136 GLU C CG    1 
ATOM   6655  C  CD    . GLU C  1 155 ? -21.973  -20.548 -23.201  1.00 39.41 ? 136 GLU C CD    1 
ATOM   6656  O  OE1   . GLU C  1 155 ? -21.691  -21.529 -23.962  1.00 40.80 ? 136 GLU C OE1   1 
ATOM   6657  O  OE2   . GLU C  1 155 ? -21.140  -19.665 -22.827  1.00 38.08 ? 136 GLU C OE2   1 
ATOM   6658  N  N     . TYR C  1 156 ? -27.392  -20.050 -24.984  1.00 36.57 ? 137 TYR C N     1 
ATOM   6659  C  CA    . TYR C  1 156 ? -28.353  -20.183 -26.096  1.00 36.90 ? 137 TYR C CA    1 
ATOM   6660  C  C     . TYR C  1 156 ? -28.244  -18.978 -26.977  1.00 36.94 ? 137 TYR C C     1 
ATOM   6661  O  O     . TYR C  1 156 ? -27.729  -17.928 -26.542  1.00 36.15 ? 137 TYR C O     1 
ATOM   6662  C  CB    . TYR C  1 156 ? -29.818  -20.275 -25.611  1.00 36.93 ? 137 TYR C CB    1 
ATOM   6663  C  CG    . TYR C  1 156 ? -30.248  -19.117 -24.744  1.00 36.00 ? 137 TYR C CG    1 
ATOM   6664  C  CD1   . TYR C  1 156 ? -30.928  -18.047 -25.273  1.00 35.67 ? 137 TYR C CD1   1 
ATOM   6665  C  CD2   . TYR C  1 156 ? -29.899  -19.070 -23.391  1.00 37.62 ? 137 TYR C CD2   1 
ATOM   6666  C  CE1   . TYR C  1 156 ? -31.301  -16.961 -24.467  1.00 36.48 ? 137 TYR C CE1   1 
ATOM   6667  C  CE2   . TYR C  1 156 ? -30.247  -17.992 -22.586  1.00 37.03 ? 137 TYR C CE2   1 
ATOM   6668  C  CZ    . TYR C  1 156 ? -30.960  -16.950 -23.127  1.00 36.63 ? 137 TYR C CZ    1 
ATOM   6669  O  OH    . TYR C  1 156 ? -31.309  -15.897 -22.323  1.00 35.45 ? 137 TYR C OH    1 
ATOM   6670  N  N     . THR C  1 157 ? -28.775  -19.113 -28.199  1.00 37.35 ? 138 THR C N     1 
ATOM   6671  C  CA    . THR C  1 157 ? -28.797  -17.997 -29.122  1.00 38.06 ? 138 THR C CA    1 
ATOM   6672  C  C     . THR C  1 157 ? -30.217  -17.599 -29.509  1.00 38.55 ? 138 THR C C     1 
ATOM   6673  O  O     . THR C  1 157 ? -31.057  -18.445 -29.830  1.00 39.26 ? 138 THR C O     1 
ATOM   6674  C  CB    . THR C  1 157 ? -27.916  -18.273 -30.379  1.00 38.12 ? 138 THR C CB    1 
ATOM   6675  O  OG1   . THR C  1 157 ? -26.592  -18.661 -29.966  1.00 37.92 ? 138 THR C OG1   1 
ATOM   6676  C  CG2   . THR C  1 157 ? -27.872  -17.051 -31.255  1.00 36.55 ? 138 THR C CG2   1 
ATOM   6677  N  N     . LEU C  1 158 ? -30.469  -16.297 -29.488  1.00 39.05 ? 139 LEU C N     1 
ATOM   6678  C  CA    . LEU C  1 158 ? -31.775  -15.762 -29.830  1.00 39.68 ? 139 LEU C CA    1 
ATOM   6679  C  C     . LEU C  1 158 ? -31.794  -15.548 -31.325  1.00 40.32 ? 139 LEU C C     1 
ATOM   6680  O  O     . LEU C  1 158 ? -30.898  -14.924 -31.883  1.00 41.14 ? 139 LEU C O     1 
ATOM   6681  C  CB    . LEU C  1 158 ? -32.057  -14.452 -29.082  1.00 39.01 ? 139 LEU C CB    1 
ATOM   6682  C  CG    . LEU C  1 158 ? -32.288  -14.539 -27.561  1.00 38.42 ? 139 LEU C CG    1 
ATOM   6683  C  CD1   . LEU C  1 158 ? -32.461  -13.149 -26.940  1.00 36.99 ? 139 LEU C CD1   1 
ATOM   6684  C  CD2   . LEU C  1 158 ? -33.465  -15.451 -27.218  1.00 35.91 ? 139 LEU C CD2   1 
ATOM   6685  N  N     . MET C  1 159 ? -32.816  -16.088 -31.965  1.00 41.79 ? 140 MET C N     1 
ATOM   6686  C  CA    . MET C  1 159 ? -32.928  -16.114 -33.409  1.00 42.67 ? 140 MET C CA    1 
ATOM   6687  C  C     . MET C  1 159 ? -34.206  -15.455 -33.785  1.00 44.35 ? 140 MET C C     1 
ATOM   6688  O  O     . MET C  1 159 ? -35.239  -15.565 -33.090  1.00 45.00 ? 140 MET C O     1 
ATOM   6689  C  CB    . MET C  1 159 ? -33.008  -17.539 -33.960  1.00 43.03 ? 140 MET C CB    1 
ATOM   6690  C  CG    . MET C  1 159 ? -31.886  -18.452 -33.559  1.00 44.52 ? 140 MET C CG    1 
ATOM   6691  S  SD    . MET C  1 159 ? -30.425  -18.078 -34.449  1.00 49.32 ? 140 MET C SD    1 
ATOM   6692  C  CE    . MET C  1 159 ? -30.624  -19.020 -35.946  1.00 48.87 ? 140 MET C CE    1 
ATOM   6693  N  N     . GLY C  1 160 ? -34.135  -14.785 -34.914  1.00 45.95 ? 141 GLY C N     1 
ATOM   6694  C  CA    . GLY C  1 160 ? -35.297  -14.318 -35.571  1.00 47.55 ? 141 GLY C CA    1 
ATOM   6695  C  C     . GLY C  1 160 ? -36.042  -15.507 -36.125  1.00 49.20 ? 141 GLY C C     1 
ATOM   6696  O  O     . GLY C  1 160 ? -35.511  -16.634 -36.311  1.00 49.34 ? 141 GLY C O     1 
ATOM   6697  N  N     . THR C  1 161 ? -37.297  -15.229 -36.407  1.00 50.91 ? 142 THR C N     1 
ATOM   6698  C  CA    . THR C  1 161 ? -38.204  -16.225 -36.948  1.00 52.46 ? 142 THR C CA    1 
ATOM   6699  C  C     . THR C  1 161 ? -37.805  -16.612 -38.411  1.00 53.03 ? 142 THR C C     1 
ATOM   6700  O  O     . THR C  1 161 ? -38.176  -17.691 -38.926  1.00 53.60 ? 142 THR C O     1 
ATOM   6701  C  CB    . THR C  1 161 ? -39.630  -15.649 -36.860  1.00 52.96 ? 142 THR C CB    1 
ATOM   6702  O  OG1   . THR C  1 161 ? -40.539  -16.745 -36.751  1.00 54.10 ? 142 THR C OG1   1 
ATOM   6703  C  CG2   . THR C  1 161 ? -39.916  -14.655 -38.055  1.00 51.69 ? 142 THR C CG2   1 
ATOM   6704  N  N     . ASP C  1 162 ? -37.027  -15.726 -39.045  1.00 52.48 ? 143 ASP C N     1 
ATOM   6705  C  CA    . ASP C  1 162 ? -36.347  -16.040 -40.291  1.00 51.99 ? 143 ASP C CA    1 
ATOM   6706  C  C     . ASP C  1 162 ? -35.086  -16.923 -40.179  1.00 51.48 ? 143 ASP C C     1 
ATOM   6707  O  O     . ASP C  1 162 ? -34.416  -17.112 -41.179  1.00 52.23 ? 143 ASP C O     1 
ATOM   6708  C  CB    . ASP C  1 162 ? -35.976  -14.737 -41.007  1.00 52.08 ? 143 ASP C CB    1 
ATOM   6709  C  CG    . ASP C  1 162 ? -35.013  -13.889 -40.209  1.00 55.00 ? 143 ASP C CG    1 
ATOM   6710  O  OD1   . ASP C  1 162 ? -34.657  -14.329 -39.058  1.00 56.98 ? 143 ASP C OD1   1 
ATOM   6711  O  OD2   . ASP C  1 162 ? -34.620  -12.792 -40.730  1.00 56.44 ? 143 ASP C OD2   1 
ATOM   6712  N  N     . GLY C  1 163 ? -34.723  -17.433 -39.006  1.00 50.73 ? 144 GLY C N     1 
ATOM   6713  C  CA    . GLY C  1 163 ? -33.509  -18.292 -38.881  1.00 49.78 ? 144 GLY C CA    1 
ATOM   6714  C  C     . GLY C  1 163 ? -32.140  -17.592 -38.693  1.00 49.37 ? 144 GLY C C     1 
ATOM   6715  O  O     . GLY C  1 163 ? -31.094  -18.254 -38.500  1.00 49.46 ? 144 GLY C O     1 
ATOM   6716  N  N     . HIS C  1 164 ? -32.154  -16.258 -38.726  1.00 48.26 ? 145 HIS C N     1 
ATOM   6717  C  CA    . HIS C  1 164 ? -30.969  -15.423 -38.583  1.00 46.92 ? 145 HIS C CA    1 
ATOM   6718  C  C     . HIS C  1 164 ? -30.958  -14.918 -37.155  1.00 45.66 ? 145 HIS C C     1 
ATOM   6719  O  O     . HIS C  1 164 ? -31.983  -14.529 -36.627  1.00 44.97 ? 145 HIS C O     1 
ATOM   6720  C  CB    . HIS C  1 164 ? -31.095  -14.238 -39.540  1.00 47.68 ? 145 HIS C CB    1 
ATOM   6721  C  CG    . HIS C  1 164 ? -29.785  -13.654 -39.968  1.00 49.45 ? 145 HIS C CG    1 
ATOM   6722  N  ND1   . HIS C  1 164 ? -28.717  -14.434 -40.375  1.00 51.29 ? 145 HIS C ND1   1 
ATOM   6723  C  CD2   . HIS C  1 164 ? -29.372  -12.365 -40.065  1.00 50.24 ? 145 HIS C CD2   1 
ATOM   6724  C  CE1   . HIS C  1 164 ? -27.694  -13.650 -40.681  1.00 52.26 ? 145 HIS C CE1   1 
ATOM   6725  N  NE2   . HIS C  1 164 ? -28.066  -12.391 -40.508  1.00 52.11 ? 145 HIS C NE2   1 
ATOM   6726  N  N     . PRO C  1 165 ? -29.795  -14.875 -36.526  1.00 44.51 ? 146 PRO C N     1 
ATOM   6727  C  CA    . PRO C  1 165 ? -29.781  -14.441 -35.127  1.00 43.89 ? 146 PRO C CA    1 
ATOM   6728  C  C     . PRO C  1 165 ? -30.435  -13.086 -34.880  1.00 43.13 ? 146 PRO C C     1 
ATOM   6729  O  O     . PRO C  1 165 ? -30.342  -12.181 -35.699  1.00 43.12 ? 146 PRO C O     1 
ATOM   6730  C  CB    . PRO C  1 165 ? -28.284  -14.366 -34.814  1.00 44.09 ? 146 PRO C CB    1 
ATOM   6731  C  CG    . PRO C  1 165 ? -27.604  -15.237 -35.829  1.00 43.65 ? 146 PRO C CG    1 
ATOM   6732  C  CD    . PRO C  1 165 ? -28.443  -15.182 -37.042  1.00 44.23 ? 146 PRO C CD    1 
ATOM   6733  N  N     . PHE C  1 166 ? -31.083  -12.940 -33.738  1.00 42.79 ? 147 PHE C N     1 
ATOM   6734  C  CA    . PHE C  1 166 ? -31.816  -11.706 -33.405  1.00 42.14 ? 147 PHE C CA    1 
ATOM   6735  C  C     . PHE C  1 166 ? -30.915  -10.486 -33.309  1.00 41.29 ? 147 PHE C C     1 
ATOM   6736  O  O     . PHE C  1 166 ? -29.870  -10.517 -32.676  1.00 41.44 ? 147 PHE C O     1 
ATOM   6737  C  CB    . PHE C  1 166 ? -32.544  -11.878 -32.074  1.00 42.16 ? 147 PHE C CB    1 
ATOM   6738  C  CG    . PHE C  1 166 ? -33.402  -10.694 -31.677  1.00 42.32 ? 147 PHE C CG    1 
ATOM   6739  C  CD1   . PHE C  1 166 ? -34.570  -10.399 -32.362  1.00 41.68 ? 147 PHE C CD1   1 
ATOM   6740  C  CD2   . PHE C  1 166 ? -33.055  -9.898  -30.589  1.00 43.97 ? 147 PHE C CD2   1 
ATOM   6741  C  CE1   . PHE C  1 166 ? -35.389  -9.328  -31.991  1.00 42.39 ? 147 PHE C CE1   1 
ATOM   6742  C  CE2   . PHE C  1 166 ? -33.868  -8.812  -30.186  1.00 43.74 ? 147 PHE C CE2   1 
ATOM   6743  C  CZ    . PHE C  1 166 ? -35.043  -8.527  -30.888  1.00 43.71 ? 147 PHE C CZ    1 
ATOM   6744  N  N     . GLY C  1 167 ? -31.344  -9.404  -33.923  1.00 41.05 ? 148 GLY C N     1 
ATOM   6745  C  CA    . GLY C  1 167 ? -30.564  -8.185  -34.005  1.00 41.44 ? 148 GLY C CA    1 
ATOM   6746  C  C     . GLY C  1 167 ? -29.460  -8.168  -35.068  1.00 41.45 ? 148 GLY C C     1 
ATOM   6747  O  O     . GLY C  1 167 ? -28.850  -7.131  -35.294  1.00 41.74 ? 148 GLY C O     1 
ATOM   6748  N  N     . TRP C  1 168 ? -29.176  -9.280  -35.732  1.00 41.44 ? 149 TRP C N     1 
ATOM   6749  C  CA    . TRP C  1 168 ? -28.066  -9.267  -36.684  1.00 42.07 ? 149 TRP C CA    1 
ATOM   6750  C  C     . TRP C  1 168 ? -28.508  -8.503  -37.914  1.00 42.42 ? 149 TRP C C     1 
ATOM   6751  O  O     . TRP C  1 168 ? -29.686  -8.388  -38.143  1.00 42.74 ? 149 TRP C O     1 
ATOM   6752  C  CB    . TRP C  1 168 ? -27.621  -10.669 -37.058  1.00 41.38 ? 149 TRP C CB    1 
ATOM   6753  C  CG    . TRP C  1 168 ? -26.740  -11.308 -36.041  1.00 41.27 ? 149 TRP C CG    1 
ATOM   6754  C  CD1   . TRP C  1 168 ? -26.775  -11.132 -34.686  1.00 40.97 ? 149 TRP C CD1   1 
ATOM   6755  C  CD2   . TRP C  1 168 ? -25.719  -12.278 -36.293  1.00 40.23 ? 149 TRP C CD2   1 
ATOM   6756  N  NE1   . TRP C  1 168 ? -25.812  -11.907 -34.081  1.00 40.34 ? 149 TRP C NE1   1 
ATOM   6757  C  CE2   . TRP C  1 168 ? -25.156  -12.625 -35.044  1.00 39.67 ? 149 TRP C CE2   1 
ATOM   6758  C  CE3   . TRP C  1 168 ? -25.224  -12.881 -37.459  1.00 40.64 ? 149 TRP C CE3   1 
ATOM   6759  C  CZ2   . TRP C  1 168 ? -24.129  -13.545 -34.923  1.00 41.08 ? 149 TRP C CZ2   1 
ATOM   6760  C  CZ3   . TRP C  1 168 ? -24.204  -13.791 -37.347  1.00 40.75 ? 149 TRP C CZ3   1 
ATOM   6761  C  CH2   . TRP C  1 168 ? -23.660  -14.117 -36.086  1.00 41.71 ? 149 TRP C CH2   1 
ATOM   6762  N  N     . PRO C  1 169 ? -27.565  -7.966  -38.701  1.00 43.30 ? 150 PRO C N     1 
ATOM   6763  C  CA    . PRO C  1 169 ? -27.980  -7.316  -39.919  1.00 43.90 ? 150 PRO C CA    1 
ATOM   6764  C  C     . PRO C  1 169 ? -28.648  -8.300  -40.852  1.00 45.21 ? 150 PRO C C     1 
ATOM   6765  O  O     . PRO C  1 169 ? -28.394  -9.500  -40.834  1.00 45.44 ? 150 PRO C O     1 
ATOM   6766  C  CB    . PRO C  1 169 ? -26.663  -6.835  -40.516  1.00 43.77 ? 150 PRO C CB    1 
ATOM   6767  C  CG    . PRO C  1 169 ? -25.784  -6.722  -39.388  1.00 42.87 ? 150 PRO C CG    1 
ATOM   6768  C  CD    . PRO C  1 169 ? -26.110  -7.897  -38.568  1.00 43.13 ? 150 PRO C CD    1 
ATOM   6769  N  N     . SER C  1 170 ? -29.533  -7.790  -41.662  1.00 46.74 ? 151 SER C N     1 
ATOM   6770  C  CA    . SER C  1 170 ? -30.290  -8.669  -42.493  1.00 47.82 ? 151 SER C CA    1 
ATOM   6771  C  C     . SER C  1 170 ? -29.340  -9.257  -43.522  1.00 47.70 ? 151 SER C C     1 
ATOM   6772  O  O     . SER C  1 170 ? -28.670  -8.515  -44.264  1.00 47.27 ? 151 SER C O     1 
ATOM   6773  C  CB    . SER C  1 170 ? -31.424  -7.894  -43.145  1.00 48.07 ? 151 SER C CB    1 
ATOM   6774  O  OG    . SER C  1 170 ? -32.236  -8.806  -43.846  1.00 51.12 ? 151 SER C OG    1 
ATOM   6775  N  N     . ASN C  1 171 ? -29.267  -10.587 -43.545  1.00 47.78 ? 152 ASN C N     1 
ATOM   6776  C  CA    . ASN C  1 171 ? -28.459  -11.280 -44.532  1.00 48.09 ? 152 ASN C CA    1 
ATOM   6777  C  C     . ASN C  1 171 ? -26.977  -11.029 -44.354  1.00 47.93 ? 152 ASN C C     1 
ATOM   6778  O  O     . ASN C  1 171 ? -26.213  -11.213 -45.297  1.00 48.80 ? 152 ASN C O     1 
ATOM   6779  C  CB    . ASN C  1 171 ? -28.841  -10.829 -45.942  1.00 49.20 ? 152 ASN C CB    1 
ATOM   6780  C  CG    . ASN C  1 171 ? -29.716  -11.838 -46.660  1.00 53.47 ? 152 ASN C CG    1 
ATOM   6781  O  OD1   . ASN C  1 171 ? -30.948  -11.945 -46.419  1.00 55.51 ? 152 ASN C OD1   1 
ATOM   6782  N  ND2   . ASN C  1 171 ? -29.083  -12.577 -47.592  1.00 58.84 ? 152 ASN C ND2   1 
ATOM   6783  N  N     . GLY C  1 172 ? -26.558  -10.614 -43.159  1.00 46.78 ? 153 GLY C N     1 
ATOM   6784  C  CA    . GLY C  1 172 ? -25.159  -10.297 -42.913  1.00 45.29 ? 153 GLY C CA    1 
ATOM   6785  C  C     . GLY C  1 172 ? -24.723  -10.532 -41.481  1.00 43.71 ? 153 GLY C C     1 
ATOM   6786  O  O     . GLY C  1 172 ? -25.420  -11.208 -40.656  1.00 42.79 ? 153 GLY C O     1 
ATOM   6787  N  N     . PHE C  1 173 ? -23.544  -9.982  -41.202  1.00 41.52 ? 154 PHE C N     1 
ATOM   6788  C  CA    . PHE C  1 173 ? -22.886  -10.200 -39.945  1.00 40.14 ? 154 PHE C CA    1 
ATOM   6789  C  C     . PHE C  1 173 ? -22.674  -8.898  -39.171  1.00 39.54 ? 154 PHE C C     1 
ATOM   6790  O  O     . PHE C  1 173 ? -22.308  -7.863  -39.735  1.00 38.73 ? 154 PHE C O     1 
ATOM   6791  C  CB    . PHE C  1 173 ? -21.550  -10.907 -40.172  1.00 39.47 ? 154 PHE C CB    1 
ATOM   6792  C  CG    . PHE C  1 173 ? -21.661  -12.269 -40.826  1.00 39.21 ? 154 PHE C CG    1 
ATOM   6793  C  CD1   . PHE C  1 173 ? -21.814  -13.424 -40.060  1.00 39.62 ? 154 PHE C CD1   1 
ATOM   6794  C  CD2   . PHE C  1 173 ? -21.545  -12.410 -42.210  1.00 39.77 ? 154 PHE C CD2   1 
ATOM   6795  C  CE1   . PHE C  1 173 ? -21.884  -14.711 -40.664  1.00 38.89 ? 154 PHE C CE1   1 
ATOM   6796  C  CE2   . PHE C  1 173 ? -21.635  -13.677 -42.824  1.00 39.32 ? 154 PHE C CE2   1 
ATOM   6797  C  CZ    . PHE C  1 173 ? -21.812  -14.825 -42.052  1.00 39.09 ? 154 PHE C CZ    1 
ATOM   6798  N  N     . PRO C  1 174 ? -22.847  -8.960  -37.848  1.00 38.97 ? 155 PRO C N     1 
ATOM   6799  C  CA    . PRO C  1 174 ? -22.427  -7.818  -37.044  1.00 38.81 ? 155 PRO C CA    1 
ATOM   6800  C  C     . PRO C  1 174 ? -20.892  -7.772  -37.017  1.00 38.03 ? 155 PRO C C     1 
ATOM   6801  O  O     . PRO C  1 174 ? -20.228  -8.659  -37.583  1.00 38.11 ? 155 PRO C O     1 
ATOM   6802  C  CB    . PRO C  1 174 ? -23.000  -8.125  -35.647  1.00 38.82 ? 155 PRO C CB    1 
ATOM   6803  C  CG    . PRO C  1 174 ? -23.073  -9.649  -35.587  1.00 39.74 ? 155 PRO C CG    1 
ATOM   6804  C  CD    . PRO C  1 174 ? -23.325  -10.089 -37.034  1.00 39.42 ? 155 PRO C CD    1 
ATOM   6805  N  N     . GLY C  1 175 ? -20.325  -6.765  -36.374  1.00 37.12 ? 156 GLY C N     1 
ATOM   6806  C  CA    . GLY C  1 175 ? -18.862  -6.724  -36.203  1.00 36.81 ? 156 GLY C CA    1 
ATOM   6807  C  C     . GLY C  1 175 ? -18.349  -7.887  -35.360  1.00 36.03 ? 156 GLY C C     1 
ATOM   6808  O  O     . GLY C  1 175 ? -19.100  -8.495  -34.599  1.00 36.01 ? 156 GLY C O     1 
ATOM   6809  N  N     . PRO C  1 176 ? -17.062  -8.175  -35.455  1.00 35.69 ? 157 PRO C N     1 
ATOM   6810  C  CA    . PRO C  1 176 ? -16.494  -9.364  -34.821  1.00 35.85 ? 157 PRO C CA    1 
ATOM   6811  C  C     . PRO C  1 176 ? -16.648  -9.405  -33.336  1.00 35.83 ? 157 PRO C C     1 
ATOM   6812  O  O     . PRO C  1 176 ? -16.872  -8.375  -32.684  1.00 36.36 ? 157 PRO C O     1 
ATOM   6813  C  CB    . PRO C  1 176 ? -14.976  -9.284  -35.148  1.00 35.59 ? 157 PRO C CB    1 
ATOM   6814  C  CG    . PRO C  1 176 ? -14.794  -8.176  -36.086  1.00 35.15 ? 157 PRO C CG    1 
ATOM   6815  C  CD    . PRO C  1 176 ? -16.039  -7.355  -36.142  1.00 35.84 ? 157 PRO C CD    1 
ATOM   6816  N  N     . GLN C  1 177 ? -16.461  -10.590 -32.790  1.00 36.02 ? 158 GLN C N     1 
ATOM   6817  C  CA    . GLN C  1 177 ? -16.594  -10.778 -31.367  1.00 36.62 ? 158 GLN C CA    1 
ATOM   6818  C  C     . GLN C  1 177 ? -15.549  -9.945  -30.629  1.00 37.19 ? 158 GLN C C     1 
ATOM   6819  O  O     . GLN C  1 177 ? -14.511  -9.570  -31.209  1.00 37.23 ? 158 GLN C O     1 
ATOM   6820  C  CB    . GLN C  1 177 ? -16.490  -12.257 -31.034  1.00 36.51 ? 158 GLN C CB    1 
ATOM   6821  C  CG    . GLN C  1 177 ? -17.564  -13.063 -31.759  1.00 37.32 ? 158 GLN C CG    1 
ATOM   6822  C  CD    . GLN C  1 177 ? -17.628  -14.517 -31.391  1.00 36.56 ? 158 GLN C CD    1 
ATOM   6823  O  OE1   . GLN C  1 177 ? -18.712  -15.057 -31.189  1.00 37.86 ? 158 GLN C OE1   1 
ATOM   6824  N  NE2   . GLN C  1 177 ? -16.494  -15.159 -31.318  1.00 33.00 ? 158 GLN C NE2   1 
ATOM   6825  N  N     . GLY C  1 178 ? -15.877  -9.638  -29.371  1.00 37.50 ? 159 GLY C N     1 
ATOM   6826  C  CA    . GLY C  1 178 ? -15.070  -8.814  -28.452  1.00 36.89 ? 159 GLY C CA    1 
ATOM   6827  C  C     . GLY C  1 178 ? -15.977  -8.034  -27.481  1.00 37.12 ? 159 GLY C C     1 
ATOM   6828  O  O     . GLY C  1 178 ? -15.942  -8.271  -26.270  1.00 36.64 ? 159 GLY C O     1 
ATOM   6829  N  N     . PRO C  1 179 ? -16.812  -7.115  -28.016  1.00 36.29 ? 160 PRO C N     1 
ATOM   6830  C  CA    . PRO C  1 179 ? -17.676  -6.214  -27.230  1.00 36.30 ? 160 PRO C CA    1 
ATOM   6831  C  C     . PRO C  1 179 ? -19.030  -6.760  -26.692  1.00 36.64 ? 160 PRO C C     1 
ATOM   6832  O  O     . PRO C  1 179 ? -19.671  -6.091  -25.876  1.00 37.17 ? 160 PRO C O     1 
ATOM   6833  C  CB    . PRO C  1 179 ? -17.932  -5.043  -28.196  1.00 36.02 ? 160 PRO C CB    1 
ATOM   6834  C  CG    . PRO C  1 179 ? -17.883  -5.654  -29.588  1.00 35.82 ? 160 PRO C CG    1 
ATOM   6835  C  CD    . PRO C  1 179 ? -16.931  -6.877  -29.469  1.00 36.73 ? 160 PRO C CD    1 
ATOM   6836  N  N     . TYR C  1 180 ? -19.429  -7.964  -27.093  1.00 36.24 ? 161 TYR C N     1 
ATOM   6837  C  CA    . TYR C  1 180 ? -20.757  -8.459  -26.775  1.00 35.77 ? 161 TYR C CA    1 
ATOM   6838  C  C     . TYR C  1 180 ? -20.795  -9.197  -25.443  1.00 35.57 ? 161 TYR C C     1 
ATOM   6839  O  O     . TYR C  1 180 ? -21.764  -9.068  -24.701  1.00 34.65 ? 161 TYR C O     1 
ATOM   6840  C  CB    . TYR C  1 180 ? -21.261  -9.359  -27.896  1.00 35.44 ? 161 TYR C CB    1 
ATOM   6841  C  CG    . TYR C  1 180 ? -21.075  -8.790  -29.275  1.00 34.76 ? 161 TYR C CG    1 
ATOM   6842  C  CD1   . TYR C  1 180 ? -21.856  -7.729  -29.725  1.00 37.45 ? 161 TYR C CD1   1 
ATOM   6843  C  CD2   . TYR C  1 180 ? -20.143  -9.303  -30.131  1.00 34.05 ? 161 TYR C CD2   1 
ATOM   6844  C  CE1   . TYR C  1 180 ? -21.692  -7.182  -31.016  1.00 35.59 ? 161 TYR C CE1   1 
ATOM   6845  C  CE2   . TYR C  1 180 ? -19.974  -8.781  -31.412  1.00 34.76 ? 161 TYR C CE2   1 
ATOM   6846  C  CZ    . TYR C  1 180 ? -20.743  -7.709  -31.838  1.00 35.79 ? 161 TYR C CZ    1 
ATOM   6847  O  OH    . TYR C  1 180 ? -20.580  -7.204  -33.114  1.00 35.63 ? 161 TYR C OH    1 
ATOM   6848  N  N     . TYR C  1 181 ? -19.759  -9.975  -25.133  1.00 35.93 ? 162 TYR C N     1 
ATOM   6849  C  CA    . TYR C  1 181 ? -19.684  -10.659 -23.815  1.00 36.22 ? 162 TYR C CA    1 
ATOM   6850  C  C     . TYR C  1 181 ? -19.967  -9.685  -22.653  1.00 36.35 ? 162 TYR C C     1 
ATOM   6851  O  O     . TYR C  1 181 ? -19.303  -8.667  -22.523  1.00 34.51 ? 162 TYR C O     1 
ATOM   6852  C  CB    . TYR C  1 181 ? -18.306  -11.287 -23.612  1.00 36.01 ? 162 TYR C CB    1 
ATOM   6853  C  CG    . TYR C  1 181 ? -18.102  -11.964 -22.264  1.00 36.28 ? 162 TYR C CG    1 
ATOM   6854  C  CD1   . TYR C  1 181 ? -18.622  -13.244 -21.996  1.00 36.28 ? 162 TYR C CD1   1 
ATOM   6855  C  CD2   . TYR C  1 181 ? -17.357  -11.333 -21.261  1.00 37.67 ? 162 TYR C CD2   1 
ATOM   6856  C  CE1   . TYR C  1 181 ? -18.423  -13.864 -20.743  1.00 36.75 ? 162 TYR C CE1   1 
ATOM   6857  C  CE2   . TYR C  1 181 ? -17.147  -11.941 -19.995  1.00 36.96 ? 162 TYR C CE2   1 
ATOM   6858  C  CZ    . TYR C  1 181 ? -17.675  -13.182 -19.751  1.00 37.29 ? 162 TYR C CZ    1 
ATOM   6859  O  OH    . TYR C  1 181 ? -17.426  -13.724 -18.528  1.00 36.46 ? 162 TYR C OH    1 
ATOM   6860  N  N     . CYS C  1 182 ? -20.998  -9.977  -21.853  1.00 36.90 ? 163 CYS C N     1 
ATOM   6861  C  CA    . CYS C  1 182 ? -21.401  -9.092  -20.748  1.00 36.77 ? 163 CYS C CA    1 
ATOM   6862  C  C     . CYS C  1 182 ? -21.556  -7.617  -21.127  1.00 36.95 ? 163 CYS C C     1 
ATOM   6863  O  O     . CYS C  1 182 ? -21.286  -6.737  -20.292  1.00 36.45 ? 163 CYS C O     1 
ATOM   6864  C  CB    . CYS C  1 182 ? -20.358  -9.192  -19.632  1.00 37.68 ? 163 CYS C CB    1 
ATOM   6865  S  SG    . CYS C  1 182 ? -20.420  -10.763 -18.927  1.00 37.54 ? 163 CYS C SG    1 
ATOM   6866  N  N     . GLY C  1 183 ? -22.031  -7.349  -22.351  1.00 36.62 ? 164 GLY C N     1 
ATOM   6867  C  CA    . GLY C  1 183 ? -22.012  -6.000  -22.888  1.00 36.50 ? 164 GLY C CA    1 
ATOM   6868  C  C     . GLY C  1 183 ? -23.258  -5.220  -22.548  1.00 36.63 ? 164 GLY C C     1 
ATOM   6869  O  O     . GLY C  1 183 ? -24.270  -5.812  -22.200  1.00 36.78 ? 164 GLY C O     1 
ATOM   6870  N  N     . VAL C  1 184 ? -23.172  -3.894  -22.673  1.00 36.27 ? 165 VAL C N     1 
ATOM   6871  C  CA    . VAL C  1 184 ? -24.297  -3.033  -22.471  1.00 36.35 ? 165 VAL C CA    1 
ATOM   6872  C  C     . VAL C  1 184 ? -24.335  -2.024  -23.633  1.00 36.47 ? 165 VAL C C     1 
ATOM   6873  O  O     . VAL C  1 184 ? -23.309  -1.533  -24.052  1.00 36.16 ? 165 VAL C O     1 
ATOM   6874  C  CB    . VAL C  1 184 ? -24.253  -2.328  -21.079  1.00 36.22 ? 165 VAL C CB    1 
ATOM   6875  C  CG1   . VAL C  1 184 ? -23.125  -1.436  -20.997  1.00 34.73 ? 165 VAL C CG1   1 
ATOM   6876  C  CG2   . VAL C  1 184 ? -25.568  -1.501  -20.811  1.00 36.78 ? 165 VAL C CG2   1 
ATOM   6877  N  N     . GLY C  1 185 ? -25.527  -1.750  -24.150  1.00 36.59 ? 166 GLY C N     1 
ATOM   6878  C  CA    . GLY C  1 185 ? -25.708  -0.843  -25.274  1.00 37.25 ? 166 GLY C CA    1 
ATOM   6879  C  C     . GLY C  1 185 ? -26.581  -1.467  -26.364  1.00 37.83 ? 166 GLY C C     1 
ATOM   6880  O  O     . GLY C  1 185 ? -26.506  -2.663  -26.603  1.00 38.21 ? 166 GLY C O     1 
ATOM   6881  N  N     . ALA C  1 186 ? -27.420  -0.664  -27.016  1.00 38.06 ? 167 ALA C N     1 
ATOM   6882  C  CA    . ALA C  1 186 ? -28.295  -1.141  -28.111  1.00 38.16 ? 167 ALA C CA    1 
ATOM   6883  C  C     . ALA C  1 186 ? -27.487  -1.745  -29.234  1.00 38.77 ? 167 ALA C C     1 
ATOM   6884  O  O     . ALA C  1 186 ? -27.997  -2.547  -29.964  1.00 40.20 ? 167 ALA C O     1 
ATOM   6885  C  CB    . ALA C  1 186 ? -29.174  -0.026  -28.664  1.00 36.44 ? 167 ALA C CB    1 
ATOM   6886  N  N     . ASP C  1 187 ? -26.226  -1.367  -29.354  1.00 39.11 ? 168 ASP C N     1 
ATOM   6887  C  CA    . ASP C  1 187 ? -25.339  -1.897  -30.371  1.00 39.37 ? 168 ASP C CA    1 
ATOM   6888  C  C     . ASP C  1 187 ? -24.544  -3.105  -29.918  1.00 39.99 ? 168 ASP C C     1 
ATOM   6889  O  O     . ASP C  1 187 ? -23.664  -3.552  -30.627  1.00 40.35 ? 168 ASP C O     1 
ATOM   6890  C  CB    . ASP C  1 187 ? -24.361  -0.807  -30.803  1.00 38.97 ? 168 ASP C CB    1 
ATOM   6891  C  CG    . ASP C  1 187 ? -23.454  -0.328  -29.668  1.00 39.25 ? 168 ASP C CG    1 
ATOM   6892  O  OD1   . ASP C  1 187 ? -23.654  -0.624  -28.470  1.00 39.40 ? 168 ASP C OD1   1 
ATOM   6893  O  OD2   . ASP C  1 187 ? -22.503  0.381   -29.987  1.00 41.11 ? 168 ASP C OD2   1 
ATOM   6894  N  N     . ARG C  1 188 ? -24.826  -3.660  -28.747  1.00 41.21 ? 169 ARG C N     1 
ATOM   6895  C  CA    . ARG C  1 188 ? -24.143  -4.912  -28.365  1.00 41.47 ? 169 ARG C CA    1 
ATOM   6896  C  C     . ARG C  1 188 ? -24.888  -5.929  -27.481  1.00 41.10 ? 169 ARG C C     1 
ATOM   6897  O  O     . ARG C  1 188 ? -24.508  -7.108  -27.442  1.00 40.83 ? 169 ARG C O     1 
ATOM   6898  C  CB    . ARG C  1 188 ? -22.776  -4.585  -27.767  1.00 42.67 ? 169 ARG C CB    1 
ATOM   6899  C  CG    . ARG C  1 188 ? -22.801  -3.716  -26.508  1.00 43.66 ? 169 ARG C CG    1 
ATOM   6900  C  CD    . ARG C  1 188 ? -21.439  -3.057  -26.321  1.00 43.35 ? 169 ARG C CD    1 
ATOM   6901  N  NE    . ARG C  1 188 ? -21.225  -1.986  -27.265  1.00 44.63 ? 169 ARG C NE    1 
ATOM   6902  C  CZ    . ARG C  1 188 ? -20.063  -1.347  -27.449  1.00 46.68 ? 169 ARG C CZ    1 
ATOM   6903  N  NH1   . ARG C  1 188 ? -18.954  -1.690  -26.791  1.00 47.45 ? 169 ARG C NH1   1 
ATOM   6904  N  NH2   . ARG C  1 188 ? -20.006  -0.353  -28.315  1.00 45.24 ? 169 ARG C NH2   1 
ATOM   6905  N  N     . ALA C  1 189 ? -25.934  -5.516  -26.780  1.00 40.48 ? 170 ALA C N     1 
ATOM   6906  C  CA    . ALA C  1 189 ? -26.708  -6.491  -26.032  1.00 40.53 ? 170 ALA C CA    1 
ATOM   6907  C  C     . ALA C  1 189 ? -27.943  -6.630  -26.840  1.00 40.33 ? 170 ALA C C     1 
ATOM   6908  O  O     . ALA C  1 189 ? -28.770  -5.761  -26.758  1.00 41.07 ? 170 ALA C O     1 
ATOM   6909  C  CB    . ALA C  1 189 ? -27.032  -6.020  -24.611  1.00 39.80 ? 170 ALA C CB    1 
ATOM   6910  N  N     . TYR C  1 190 ? -28.048  -7.695  -27.641  1.00 40.46 ? 171 TYR C N     1 
ATOM   6911  C  CA    . TYR C  1 190 ? -29.233  -7.960  -28.439  1.00 40.14 ? 171 TYR C CA    1 
ATOM   6912  C  C     . TYR C  1 190 ? -30.169  -8.907  -27.750  1.00 39.78 ? 171 TYR C C     1 
ATOM   6913  O  O     . TYR C  1 190 ? -29.881  -10.107 -27.697  1.00 39.19 ? 171 TYR C O     1 
ATOM   6914  C  CB    . TYR C  1 190 ? -28.879  -8.602  -29.778  1.00 41.67 ? 171 TYR C CB    1 
ATOM   6915  C  CG    . TYR C  1 190 ? -27.916  -7.832  -30.632  1.00 42.48 ? 171 TYR C CG    1 
ATOM   6916  C  CD1   . TYR C  1 190 ? -27.884  -6.448  -30.608  1.00 45.08 ? 171 TYR C CD1   1 
ATOM   6917  C  CD2   . TYR C  1 190 ? -27.062  -8.491  -31.509  1.00 44.55 ? 171 TYR C CD2   1 
ATOM   6918  C  CE1   . TYR C  1 190 ? -26.994  -5.724  -31.418  1.00 44.72 ? 171 TYR C CE1   1 
ATOM   6919  C  CE2   . TYR C  1 190 ? -26.182  -7.784  -32.324  1.00 44.10 ? 171 TYR C CE2   1 
ATOM   6920  C  CZ    . TYR C  1 190 ? -26.158  -6.398  -32.259  1.00 44.45 ? 171 TYR C CZ    1 
ATOM   6921  O  OH    . TYR C  1 190 ? -25.304  -5.665  -33.035  1.00 44.83 ? 171 TYR C OH    1 
ATOM   6922  N  N     . GLY C  1 191 ? -31.292  -8.385  -27.240  1.00 38.68 ? 172 GLY C N     1 
ATOM   6923  C  CA    . GLY C  1 191 ? -32.340  -9.261  -26.712  1.00 38.41 ? 172 GLY C CA    1 
ATOM   6924  C  C     . GLY C  1 191 ? -32.491  -9.366  -25.199  1.00 38.07 ? 172 GLY C C     1 
ATOM   6925  O  O     . GLY C  1 191 ? -33.154  -10.297 -24.698  1.00 38.02 ? 172 GLY C O     1 
ATOM   6926  N  N     . ARG C  1 192 ? -31.955  -8.386  -24.473  1.00 37.49 ? 173 ARG C N     1 
ATOM   6927  C  CA    . ARG C  1 192 ? -32.019  -8.363  -22.995  1.00 37.53 ? 173 ARG C CA    1 
ATOM   6928  C  C     . ARG C  1 192 ? -33.464  -8.467  -22.445  1.00 37.47 ? 173 ARG C C     1 
ATOM   6929  O  O     . ARG C  1 192 ? -33.722  -9.041  -21.370  1.00 37.84 ? 173 ARG C O     1 
ATOM   6930  C  CB    . ARG C  1 192 ? -31.345  -7.086  -22.432  1.00 37.06 ? 173 ARG C CB    1 
ATOM   6931  C  CG    . ARG C  1 192 ? -30.950  -7.270  -20.995  1.00 37.38 ? 173 ARG C CG    1 
ATOM   6932  C  CD    . ARG C  1 192 ? -30.624  -5.980  -20.320  1.00 36.93 ? 173 ARG C CD    1 
ATOM   6933  N  NE    . ARG C  1 192 ? -29.436  -5.354  -20.887  1.00 36.50 ? 173 ARG C NE    1 
ATOM   6934  C  CZ    . ARG C  1 192 ? -28.200  -5.768  -20.665  1.00 35.04 ? 173 ARG C CZ    1 
ATOM   6935  N  NH1   . ARG C  1 192 ? -27.967  -6.790  -19.892  1.00 35.44 ? 173 ARG C NH1   1 
ATOM   6936  N  NH2   . ARG C  1 192 ? -27.189  -5.163  -21.236  1.00 36.22 ? 173 ARG C NH2   1 
ATOM   6937  N  N     . ASP C  1 193 ? -34.418  -7.913  -23.156  1.00 37.12 ? 174 ASP C N     1 
ATOM   6938  C  CA    . ASP C  1 193 ? -35.779  -8.041  -22.675  1.00 37.36 ? 174 ASP C CA    1 
ATOM   6939  C  C     . ASP C  1 193 ? -36.114  -9.467  -22.344  1.00 37.28 ? 174 ASP C C     1 
ATOM   6940  O  O     . ASP C  1 193 ? -36.645  -9.701  -21.265  1.00 37.46 ? 174 ASP C O     1 
ATOM   6941  C  CB    . ASP C  1 193 ? -36.786  -7.512  -23.669  1.00 37.02 ? 174 ASP C CB    1 
ATOM   6942  C  CG    . ASP C  1 193 ? -36.788  -6.022  -23.716  1.00 38.87 ? 174 ASP C CG    1 
ATOM   6943  O  OD1   . ASP C  1 193 ? -36.205  -5.354  -22.817  1.00 39.37 ? 174 ASP C OD1   1 
ATOM   6944  O  OD2   . ASP C  1 193 ? -37.364  -5.516  -24.687  1.00 43.23 ? 174 ASP C OD2   1 
ATOM   6945  N  N     . ILE C  1 194 ? -35.813  -10.395 -23.262  1.00 36.72 ? 175 ILE C N     1 
ATOM   6946  C  CA    . ILE C  1 194 ? -36.066  -11.831 -23.043  1.00 36.19 ? 175 ILE C CA    1 
ATOM   6947  C  C     . ILE C  1 194 ? -35.349  -12.328 -21.790  1.00 36.45 ? 175 ILE C C     1 
ATOM   6948  O  O     . ILE C  1 194 ? -35.928  -13.087 -21.016  1.00 37.61 ? 175 ILE C O     1 
ATOM   6949  C  CB    . ILE C  1 194 ? -35.592  -12.709 -24.216  1.00 35.53 ? 175 ILE C CB    1 
ATOM   6950  C  CG1   . ILE C  1 194 ? -36.540  -12.592 -25.424  1.00 36.71 ? 175 ILE C CG1   1 
ATOM   6951  C  CG2   . ILE C  1 194 ? -35.475  -14.151 -23.792  1.00 34.89 ? 175 ILE C CG2   1 
ATOM   6952  C  CD1   . ILE C  1 194 ? -36.391  -11.292 -26.338  1.00 35.15 ? 175 ILE C CD1   1 
ATOM   6953  N  N     . VAL C  1 195 ? -34.099  -11.903 -21.591  1.00 36.07 ? 176 VAL C N     1 
ATOM   6954  C  CA    . VAL C  1 195 ? -33.254  -12.414 -20.507  1.00 35.43 ? 176 VAL C CA    1 
ATOM   6955  C  C     . VAL C  1 195 ? -33.791  -11.967 -19.165  1.00 35.80 ? 176 VAL C C     1 
ATOM   6956  O  O     . VAL C  1 195 ? -33.893  -12.757 -18.233  1.00 36.58 ? 176 VAL C O     1 
ATOM   6957  C  CB    . VAL C  1 195 ? -31.798  -11.920 -20.680  1.00 35.48 ? 176 VAL C CB    1 
ATOM   6958  C  CG1   . VAL C  1 195 ? -30.965  -12.177 -19.400  1.00 32.66 ? 176 VAL C CG1   1 
ATOM   6959  C  CG2   . VAL C  1 195 ? -31.159  -12.528 -21.991  1.00 32.89 ? 176 VAL C CG2   1 
ATOM   6960  N  N     . GLU C  1 196 ? -34.183  -10.702 -19.093  1.00 36.08 ? 177 GLU C N     1 
ATOM   6961  C  CA    . GLU C  1 196 ? -34.741  -10.108 -17.866  1.00 36.45 ? 177 GLU C CA    1 
ATOM   6962  C  C     . GLU C  1 196 ? -36.067  -10.719 -17.522  1.00 36.25 ? 177 GLU C C     1 
ATOM   6963  O  O     . GLU C  1 196 ? -36.325  -11.014 -16.340  1.00 35.82 ? 177 GLU C O     1 
ATOM   6964  C  CB    . GLU C  1 196 ? -34.926  -8.578  -18.006  1.00 36.88 ? 177 GLU C CB    1 
ATOM   6965  C  CG    . GLU C  1 196 ? -33.598  -7.819  -18.150  1.00 36.81 ? 177 GLU C CG    1 
ATOM   6966  C  CD    . GLU C  1 196 ? -32.830  -7.732  -16.827  1.00 37.24 ? 177 GLU C CD    1 
ATOM   6967  O  OE1   . GLU C  1 196 ? -33.487  -7.737  -15.758  1.00 40.10 ? 177 GLU C OE1   1 
ATOM   6968  O  OE2   . GLU C  1 196 ? -31.578  -7.612  -16.862  1.00 38.78 ? 177 GLU C OE2   1 
ATOM   6969  N  N     . ALA C  1 197 ? -36.895  -10.918 -18.545  1.00 36.18 ? 178 ALA C N     1 
ATOM   6970  C  CA    . ALA C  1 197 ? -38.210  -11.532 -18.357  1.00 37.08 ? 178 ALA C CA    1 
ATOM   6971  C  C     . ALA C  1 197 ? -38.074  -12.987 -17.842  1.00 37.79 ? 178 ALA C C     1 
ATOM   6972  O  O     . ALA C  1 197 ? -38.728  -13.376 -16.861  1.00 38.18 ? 178 ALA C O     1 
ATOM   6973  C  CB    . ALA C  1 197 ? -39.047  -11.471 -19.660  1.00 36.81 ? 178 ALA C CB    1 
ATOM   6974  N  N     . HIS C  1 198 ? -37.170  -13.751 -18.462  1.00 37.85 ? 179 HIS C N     1 
ATOM   6975  C  CA    . HIS C  1 198 ? -36.931  -15.148 -18.094  1.00 37.58 ? 179 HIS C CA    1 
ATOM   6976  C  C     . HIS C  1 198 ? -36.321  -15.341 -16.696  1.00 38.09 ? 179 HIS C C     1 
ATOM   6977  O  O     . HIS C  1 198 ? -36.672  -16.299 -15.964  1.00 37.60 ? 179 HIS C O     1 
ATOM   6978  C  CB    . HIS C  1 198 ? -36.008  -15.764 -19.115  1.00 36.80 ? 179 HIS C CB    1 
ATOM   6979  C  CG    . HIS C  1 198 ? -35.640  -17.162 -18.804  1.00 35.78 ? 179 HIS C CG    1 
ATOM   6980  N  ND1   . HIS C  1 198 ? -34.423  -17.500 -18.283  1.00 37.71 ? 179 HIS C ND1   1 
ATOM   6981  C  CD2   . HIS C  1 198 ? -36.323  -18.316 -18.949  1.00 37.95 ? 179 HIS C CD2   1 
ATOM   6982  C  CE1   . HIS C  1 198 ? -34.372  -18.808 -18.109  1.00 39.00 ? 179 HIS C CE1   1 
ATOM   6983  N  NE2   . HIS C  1 198 ? -35.512  -19.329 -18.519  1.00 37.60 ? 179 HIS C NE2   1 
ATOM   6984  N  N     . TYR C  1 199 ? -35.415  -14.425 -16.340  1.00 38.22 ? 180 TYR C N     1 
ATOM   6985  C  CA    . TYR C  1 199 ? -34.841  -14.386 -14.997  1.00 38.37 ? 180 TYR C CA    1 
ATOM   6986  C  C     . TYR C  1 199 ? -35.977  -14.277 -13.952  1.00 38.79 ? 180 TYR C C     1 
ATOM   6987  O  O     . TYR C  1 199 ? -36.104  -15.042 -12.991  1.00 38.81 ? 180 TYR C O     1 
ATOM   6988  C  CB    . TYR C  1 199 ? -33.866  -13.194 -14.884  1.00 38.65 ? 180 TYR C CB    1 
ATOM   6989  C  CG    . TYR C  1 199 ? -32.744  -13.385 -13.852  1.00 39.03 ? 180 TYR C CG    1 
ATOM   6990  C  CD1   . TYR C  1 199 ? -31.442  -12.957 -14.101  1.00 37.70 ? 180 TYR C CD1   1 
ATOM   6991  C  CD2   . TYR C  1 199 ? -32.999  -13.998 -12.624  1.00 40.80 ? 180 TYR C CD2   1 
ATOM   6992  C  CE1   . TYR C  1 199 ? -30.444  -13.142 -13.171  1.00 38.59 ? 180 TYR C CE1   1 
ATOM   6993  C  CE2   . TYR C  1 199 ? -31.997  -14.196 -11.702  1.00 40.52 ? 180 TYR C CE2   1 
ATOM   6994  C  CZ    . TYR C  1 199 ? -30.735  -13.758 -11.956  1.00 39.57 ? 180 TYR C CZ    1 
ATOM   6995  O  OH    . TYR C  1 199 ? -29.789  -13.992 -10.968  1.00 40.26 ? 180 TYR C OH    1 
ATOM   6996  N  N     . ARG C  1 200 ? -36.855  -13.336 -14.184  1.00 39.44 ? 181 ARG C N     1 
ATOM   6997  C  CA    . ARG C  1 200 ? -37.934  -13.089 -13.255  1.00 39.59 ? 181 ARG C CA    1 
ATOM   6998  C  C     . ARG C  1 200 ? -38.990  -14.233 -13.234  1.00 39.40 ? 181 ARG C C     1 
ATOM   6999  O  O     . ARG C  1 200 ? -39.465  -14.625 -12.151  1.00 39.38 ? 181 ARG C O     1 
ATOM   7000  C  CB    . ARG C  1 200 ? -38.528  -11.744 -13.623  1.00 40.16 ? 181 ARG C CB    1 
ATOM   7001  C  CG    . ARG C  1 200 ? -39.173  -11.085 -12.513  1.00 45.26 ? 181 ARG C CG    1 
ATOM   7002  C  CD    . ARG C  1 200 ? -38.235  -10.946 -11.286  1.00 49.81 ? 181 ARG C CD    1 
ATOM   7003  N  NE    . ARG C  1 200 ? -37.623  -9.625  -11.180  1.00 51.35 ? 181 ARG C NE    1 
ATOM   7004  C  CZ    . ARG C  1 200 ? -38.310  -8.523  -10.892  1.00 50.20 ? 181 ARG C CZ    1 
ATOM   7005  N  NH1   . ARG C  1 200 ? -39.624  -8.567  -10.712  1.00 47.26 ? 181 ARG C NH1   1 
ATOM   7006  N  NH2   . ARG C  1 200 ? -37.656  -7.377  -10.804  1.00 51.75 ? 181 ARG C NH2   1 
ATOM   7007  N  N     . ALA C  1 201 ? -39.328  -14.771 -14.420  1.00 38.94 ? 182 ALA C N     1 
ATOM   7008  C  CA    . ALA C  1 201 ? -40.233  -15.923 -14.559  1.00 38.65 ? 182 ALA C CA    1 
ATOM   7009  C  C     . ALA C  1 201 ? -39.717  -17.140 -13.778  1.00 39.03 ? 182 ALA C C     1 
ATOM   7010  O  O     . ALA C  1 201 ? -40.459  -17.771 -13.035  1.00 38.90 ? 182 ALA C O     1 
ATOM   7011  C  CB    . ALA C  1 201 ? -40.406  -16.278 -16.012  1.00 38.11 ? 182 ALA C CB    1 
ATOM   7012  N  N     . CYS C  1 202 ? -38.426  -17.448 -13.926  1.00 39.04 ? 183 CYS C N     1 
ATOM   7013  C  CA    . CYS C  1 202 ? -37.829  -18.510 -13.130  1.00 38.81 ? 183 CYS C CA    1 
ATOM   7014  C  C     . CYS C  1 202 ? -37.846  -18.278 -11.618  1.00 38.39 ? 183 CYS C C     1 
ATOM   7015  O  O     . CYS C  1 202 ? -38.095  -19.230 -10.856  1.00 38.22 ? 183 CYS C O     1 
ATOM   7016  C  CB    . CYS C  1 202 ? -36.393  -18.754 -13.565  1.00 39.30 ? 183 CYS C CB    1 
ATOM   7017  S  SG    . CYS C  1 202 ? -36.358  -19.463 -15.190  1.00 41.79 ? 183 CYS C SG    1 
ATOM   7018  N  N     . LEU C  1 203 ? -37.534  -17.053 -11.183  1.00 37.58 ? 184 LEU C N     1 
ATOM   7019  C  CA    . LEU C  1 203 ? -37.559  -16.754 -9.746   1.00 37.57 ? 184 LEU C CA    1 
ATOM   7020  C  C     . LEU C  1 203 ? -38.990  -17.000 -9.230   1.00 37.86 ? 184 LEU C C     1 
ATOM   7021  O  O     . LEU C  1 203 ? -39.196  -17.715 -8.258   1.00 38.44 ? 184 LEU C O     1 
ATOM   7022  C  CB    . LEU C  1 203 ? -37.092  -15.315 -9.438   1.00 36.98 ? 184 LEU C CB    1 
ATOM   7023  C  CG    . LEU C  1 203 ? -35.577  -15.062 -9.445   1.00 36.57 ? 184 LEU C CG    1 
ATOM   7024  C  CD1   . LEU C  1 203 ? -35.255  -13.583 -9.141   1.00 32.70 ? 184 LEU C CD1   1 
ATOM   7025  C  CD2   . LEU C  1 203 ? -34.837  -16.041 -8.484   1.00 30.28 ? 184 LEU C CD2   1 
ATOM   7026  N  N     . TYR C  1 204 ? -39.984  -16.479 -9.943   1.00 37.90 ? 185 TYR C N     1 
ATOM   7027  C  CA    . TYR C  1 204 ? -41.356  -16.669 -9.544   1.00 37.69 ? 185 TYR C CA    1 
ATOM   7028  C  C     . TYR C  1 204 ? -41.732  -18.146 -9.622   1.00 37.63 ? 185 TYR C C     1 
ATOM   7029  O  O     . TYR C  1 204 ? -42.422  -18.653 -8.737   1.00 37.99 ? 185 TYR C O     1 
ATOM   7030  C  CB    . TYR C  1 204 ? -42.263  -15.799 -10.411  1.00 37.84 ? 185 TYR C CB    1 
ATOM   7031  C  CG    . TYR C  1 204 ? -43.733  -15.863 -10.048  1.00 38.19 ? 185 TYR C CG    1 
ATOM   7032  C  CD1   . TYR C  1 204 ? -44.320  -14.930 -9.202   1.00 38.50 ? 185 TYR C CD1   1 
ATOM   7033  C  CD2   . TYR C  1 204 ? -44.552  -16.849 -10.592  1.00 38.85 ? 185 TYR C CD2   1 
ATOM   7034  C  CE1   . TYR C  1 204 ? -45.669  -14.994 -8.905   1.00 36.68 ? 185 TYR C CE1   1 
ATOM   7035  C  CE2   . TYR C  1 204 ? -45.900  -16.915 -10.302  1.00 38.25 ? 185 TYR C CE2   1 
ATOM   7036  C  CZ    . TYR C  1 204 ? -46.453  -15.986 -9.482   1.00 38.05 ? 185 TYR C CZ    1 
ATOM   7037  O  OH    . TYR C  1 204 ? -47.795  -16.134 -9.212   1.00 38.58 ? 185 TYR C OH    1 
ATOM   7038  N  N     . ALA C  1 205 ? -41.278  -18.844 -10.660  1.00 37.55 ? 186 ALA C N     1 
ATOM   7039  C  CA    . ALA C  1 205 ? -41.585  -20.263 -10.813  1.00 37.76 ? 186 ALA C CA    1 
ATOM   7040  C  C     . ALA C  1 205 ? -41.004  -21.077 -9.650   1.00 38.40 ? 186 ALA C C     1 
ATOM   7041  O  O     . ALA C  1 205 ? -41.557  -22.104 -9.274   1.00 39.51 ? 186 ALA C O     1 
ATOM   7042  C  CB    . ALA C  1 205 ? -41.073  -20.801 -12.159  1.00 36.38 ? 186 ALA C CB    1 
ATOM   7043  N  N     . GLY C  1 206 ? -39.914  -20.612 -9.048   1.00 38.94 ? 187 GLY C N     1 
ATOM   7044  C  CA    . GLY C  1 206 ? -39.209  -21.416 -8.025   1.00 38.73 ? 187 GLY C CA    1 
ATOM   7045  C  C     . GLY C  1 206 ? -38.089  -22.244 -8.648   1.00 39.20 ? 187 GLY C C     1 
ATOM   7046  O  O     . GLY C  1 206 ? -37.621  -23.220 -8.053   1.00 39.38 ? 187 GLY C O     1 
ATOM   7047  N  N     . VAL C  1 207 ? -37.675  -21.862 -9.859   1.00 38.76 ? 188 VAL C N     1 
ATOM   7048  C  CA    . VAL C  1 207 ? -36.532  -22.481 -10.512  1.00 38.62 ? 188 VAL C CA    1 
ATOM   7049  C  C     . VAL C  1 207 ? -35.278  -21.824 -9.956   1.00 39.06 ? 188 VAL C C     1 
ATOM   7050  O  O     . VAL C  1 207 ? -35.229  -20.601 -9.804   1.00 40.26 ? 188 VAL C O     1 
ATOM   7051  C  CB    . VAL C  1 207 ? -36.595  -22.268 -12.049  1.00 38.93 ? 188 VAL C CB    1 
ATOM   7052  C  CG1   . VAL C  1 207 ? -35.215  -22.529 -12.688  1.00 35.24 ? 188 VAL C CG1   1 
ATOM   7053  C  CG2   . VAL C  1 207 ? -37.739  -23.151 -12.635  1.00 37.46 ? 188 VAL C CG2   1 
ATOM   7054  N  N     . LYS C  1 208 ? -34.265  -22.612 -9.652   1.00 38.72 ? 189 LYS C N     1 
ATOM   7055  C  CA    . LYS C  1 208 ? -33.088  -22.111 -8.971   1.00 38.52 ? 189 LYS C CA    1 
ATOM   7056  C  C     . LYS C  1 208 ? -32.086  -21.488 -9.959   1.00 38.25 ? 189 LYS C C     1 
ATOM   7057  O  O     . LYS C  1 208 ? -31.027  -22.021 -10.248  1.00 36.64 ? 189 LYS C O     1 
ATOM   7058  C  CB    . LYS C  1 208 ? -32.459  -23.219 -8.128   1.00 39.01 ? 189 LYS C CB    1 
ATOM   7059  C  CG    . LYS C  1 208 ? -31.323  -22.738 -7.199   1.00 38.78 ? 189 LYS C CG    1 
ATOM   7060  C  CD    . LYS C  1 208 ? -30.999  -23.810 -6.192   1.00 40.20 ? 189 LYS C CD    1 
ATOM   7061  C  CE    . LYS C  1 208 ? -29.962  -23.338 -5.200   1.00 41.53 ? 189 LYS C CE    1 
ATOM   7062  N  NZ    . LYS C  1 208 ? -30.585  -22.910 -3.940   1.00 44.95 ? 189 LYS C NZ    1 
ATOM   7063  N  N     . ILE C  1 209 ? -32.470  -20.318 -10.461  1.00 38.37 ? 190 ILE C N     1 
ATOM   7064  C  CA    . ILE C  1 209 ? -31.646  -19.571 -11.371  1.00 38.12 ? 190 ILE C CA    1 
ATOM   7065  C  C     . ILE C  1 209 ? -30.575  -18.826 -10.530  1.00 38.25 ? 190 ILE C C     1 
ATOM   7066  O  O     . ILE C  1 209 ? -30.904  -18.070 -9.604   1.00 38.77 ? 190 ILE C O     1 
ATOM   7067  C  CB    . ILE C  1 209 ? -32.513  -18.636 -12.229  1.00 38.13 ? 190 ILE C CB    1 
ATOM   7068  C  CG1   . ILE C  1 209 ? -31.666  -17.942 -13.311  1.00 38.28 ? 190 ILE C CG1   1 
ATOM   7069  C  CG2   . ILE C  1 209 ? -33.241  -17.640 -11.357  1.00 37.76 ? 190 ILE C CG2   1 
ATOM   7070  C  CD1   . ILE C  1 209 ? -32.501  -17.402 -14.506  1.00 38.00 ? 190 ILE C CD1   1 
ATOM   7071  N  N     . ALA C  1 210 ? -29.307  -19.082 -10.860  1.00 37.43 ? 191 ALA C N     1 
ATOM   7072  C  CA    . ALA C  1 210 ? -28.151  -18.592 -10.116  1.00 36.97 ? 191 ALA C CA    1 
ATOM   7073  C  C     . ALA C  1 210 ? -27.635  -17.273 -10.663  1.00 36.68 ? 191 ALA C C     1 
ATOM   7074  O  O     . ALA C  1 210 ? -27.032  -16.497 -9.943   1.00 36.37 ? 191 ALA C O     1 
ATOM   7075  C  CB    . ALA C  1 210 ? -27.033  -19.641 -10.125  1.00 35.98 ? 191 ALA C CB    1 
ATOM   7076  N  N     . GLY C  1 211 ? -27.877  -17.016 -11.941  1.00 36.70 ? 192 GLY C N     1 
ATOM   7077  C  CA    . GLY C  1 211 ? -27.374  -15.814 -12.561  1.00 36.33 ? 192 GLY C CA    1 
ATOM   7078  C  C     . GLY C  1 211 ? -27.566  -15.885 -14.050  1.00 36.06 ? 192 GLY C C     1 
ATOM   7079  O  O     . GLY C  1 211 ? -28.077  -16.874 -14.562  1.00 34.52 ? 192 GLY C O     1 
ATOM   7080  N  N     . THR C  1 212 ? -27.137  -14.808 -14.716  1.00 36.63 ? 193 THR C N     1 
ATOM   7081  C  CA    . THR C  1 212 ? -27.209  -14.645 -16.167  1.00 36.96 ? 193 THR C CA    1 
ATOM   7082  C  C     . THR C  1 212 ? -26.062  -13.744 -16.649  1.00 37.15 ? 193 THR C C     1 
ATOM   7083  O  O     . THR C  1 212 ? -25.488  -12.957 -15.883  1.00 37.98 ? 193 THR C O     1 
ATOM   7084  C  CB    . THR C  1 212 ? -28.535  -13.899 -16.611  1.00 37.45 ? 193 THR C CB    1 
ATOM   7085  O  OG1   . THR C  1 212 ? -28.589  -12.642 -15.934  1.00 39.18 ? 193 THR C OG1   1 
ATOM   7086  C  CG2   . THR C  1 212 ? -29.810  -14.653 -16.272  1.00 35.90 ? 193 THR C CG2   1 
ATOM   7087  N  N     . ASN C  1 213 ? -25.744  -13.875 -17.934  1.00 37.31 ? 194 ASN C N     1 
ATOM   7088  C  CA    . ASN C  1 213 ? -24.834  -12.974 -18.627  1.00 36.76 ? 194 ASN C CA    1 
ATOM   7089  C  C     . ASN C  1 213 ? -25.061  -13.028 -20.120  1.00 36.34 ? 194 ASN C C     1 
ATOM   7090  O  O     . ASN C  1 213 ? -25.380  -14.096 -20.633  1.00 36.22 ? 194 ASN C O     1 
ATOM   7091  C  CB    . ASN C  1 213 ? -23.356  -13.305 -18.320  1.00 36.58 ? 194 ASN C CB    1 
ATOM   7092  C  CG    . ASN C  1 213 ? -22.926  -14.683 -18.796  1.00 36.86 ? 194 ASN C CG    1 
ATOM   7093  O  OD1   . ASN C  1 213 ? -23.188  -15.691 -18.150  1.00 36.03 ? 194 ASN C OD1   1 
ATOM   7094  N  ND2   . ASN C  1 213 ? -22.209  -14.717 -19.910  1.00 36.08 ? 194 ASN C ND2   1 
ATOM   7095  N  N     . ALA C  1 214 ? -24.918  -11.869 -20.781  1.00 35.79 ? 195 ALA C N     1 
ATOM   7096  C  CA    . ALA C  1 214 ? -24.648  -11.778 -22.225  1.00 35.82 ? 195 ALA C CA    1 
ATOM   7097  C  C     . ALA C  1 214 ? -23.404  -12.601 -22.583  1.00 35.71 ? 195 ALA C C     1 
ATOM   7098  O  O     . ALA C  1 214 ? -22.438  -12.567 -21.846  1.00 37.23 ? 195 ALA C O     1 
ATOM   7099  C  CB    . ALA C  1 214 ? -24.451  -10.327 -22.614  1.00 34.30 ? 195 ALA C CB    1 
ATOM   7100  N  N     . GLU C  1 215 ? -23.408  -13.351 -23.683  1.00 36.14 ? 196 GLU C N     1 
ATOM   7101  C  CA    . GLU C  1 215 ? -22.218  -14.174 -24.089  1.00 36.02 ? 196 GLU C CA    1 
ATOM   7102  C  C     . GLU C  1 215 ? -21.416  -13.613 -25.275  1.00 36.12 ? 196 GLU C C     1 
ATOM   7103  O  O     . GLU C  1 215 ? -21.754  -12.567 -25.806  1.00 35.44 ? 196 GLU C O     1 
ATOM   7104  C  CB    . GLU C  1 215 ? -22.640  -15.633 -24.349  1.00 35.81 ? 196 GLU C CB    1 
ATOM   7105  C  CG    . GLU C  1 215 ? -22.354  -16.595 -23.213  1.00 35.64 ? 196 GLU C CG    1 
ATOM   7106  C  CD    . GLU C  1 215 ? -20.864  -16.716 -22.901  1.00 37.95 ? 196 GLU C CD    1 
ATOM   7107  O  OE1   . GLU C  1 215 ? -20.498  -16.978 -21.726  1.00 36.19 ? 196 GLU C OE1   1 
ATOM   7108  O  OE2   . GLU C  1 215 ? -20.040  -16.546 -23.836  1.00 40.27 ? 196 GLU C OE2   1 
ATOM   7109  N  N     . VAL C  1 216 ? -20.331  -14.312 -25.658  1.00 37.20 ? 197 VAL C N     1 
ATOM   7110  C  CA    . VAL C  1 216 ? -19.339  -13.799 -26.606  1.00 37.33 ? 197 VAL C CA    1 
ATOM   7111  C  C     . VAL C  1 216 ? -19.949  -13.500 -27.958  1.00 38.23 ? 197 VAL C C     1 
ATOM   7112  O  O     . VAL C  1 216 ? -19.636  -12.466 -28.576  1.00 39.08 ? 197 VAL C O     1 
ATOM   7113  C  CB    . VAL C  1 216 ? -18.131  -14.759 -26.791  1.00 37.60 ? 197 VAL C CB    1 
ATOM   7114  C  CG1   . VAL C  1 216 ? -17.210  -14.342 -28.019  1.00 35.69 ? 197 VAL C CG1   1 
ATOM   7115  C  CG2   . VAL C  1 216 ? -17.320  -14.779 -25.543  1.00 37.76 ? 197 VAL C CG2   1 
ATOM   7116  N  N     . MET C  1 217 ? -20.827  -14.367 -28.439  1.00 38.41 ? 198 MET C N     1 
ATOM   7117  C  CA    . MET C  1 217 ? -21.469  -14.094 -29.734  1.00 38.62 ? 198 MET C CA    1 
ATOM   7118  C  C     . MET C  1 217 ? -22.611  -13.140 -29.525  1.00 38.58 ? 198 MET C C     1 
ATOM   7119  O  O     . MET C  1 217 ? -23.391  -13.289 -28.580  1.00 38.78 ? 198 MET C O     1 
ATOM   7120  C  CB    . MET C  1 217 ? -22.016  -15.362 -30.384  1.00 38.45 ? 198 MET C CB    1 
ATOM   7121  C  CG    . MET C  1 217 ? -22.587  -15.194 -31.770  1.00 38.70 ? 198 MET C CG    1 
ATOM   7122  S  SD    . MET C  1 217 ? -23.351  -16.726 -32.324  1.00 41.70 ? 198 MET C SD    1 
ATOM   7123  C  CE    . MET C  1 217 ? -25.087  -16.287 -32.368  1.00 41.50 ? 198 MET C CE    1 
ATOM   7124  N  N     . PRO C  1 218 ? -22.778  -12.204 -30.451  1.00 38.24 ? 199 PRO C N     1 
ATOM   7125  C  CA    . PRO C  1 218 ? -23.909  -11.328 -30.324  1.00 38.26 ? 199 PRO C CA    1 
ATOM   7126  C  C     . PRO C  1 218 ? -25.225  -12.104 -30.508  1.00 38.62 ? 199 PRO C C     1 
ATOM   7127  O  O     . PRO C  1 218 ? -25.280  -13.015 -31.327  1.00 39.84 ? 199 PRO C O     1 
ATOM   7128  C  CB    . PRO C  1 218 ? -23.686  -10.331 -31.444  1.00 38.57 ? 199 PRO C CB    1 
ATOM   7129  C  CG    . PRO C  1 218 ? -22.829  -11.067 -32.440  1.00 38.73 ? 199 PRO C CG    1 
ATOM   7130  C  CD    . PRO C  1 218 ? -21.991  -11.964 -31.664  1.00 37.75 ? 199 PRO C CD    1 
ATOM   7131  N  N     . ALA C  1 219 ? -26.266  -11.715 -29.763  1.00 38.82 ? 200 ALA C N     1 
ATOM   7132  C  CA    . ALA C  1 219 ? -27.556  -12.451 -29.606  1.00 38.51 ? 200 ALA C CA    1 
ATOM   7133  C  C     . ALA C  1 219 ? -27.433  -13.737 -28.785  1.00 38.71 ? 200 ALA C C     1 
ATOM   7134  O  O     . ALA C  1 219 ? -28.418  -14.423 -28.582  1.00 39.37 ? 200 ALA C O     1 
ATOM   7135  C  CB    . ALA C  1 219 ? -28.241  -12.735 -30.954  1.00 38.06 ? 200 ALA C CB    1 
ATOM   7136  N  N     . GLN C  1 220 ? -26.243  -14.067 -28.297  1.00 38.80 ? 201 GLN C N     1 
ATOM   7137  C  CA    . GLN C  1 220 ? -26.069  -15.273 -27.477  1.00 38.89 ? 201 GLN C CA    1 
ATOM   7138  C  C     . GLN C  1 220 ? -26.052  -14.882 -25.974  1.00 38.79 ? 201 GLN C C     1 
ATOM   7139  O  O     . GLN C  1 220 ? -25.486  -13.846 -25.601  1.00 38.85 ? 201 GLN C O     1 
ATOM   7140  C  CB    . GLN C  1 220 ? -24.763  -15.978 -27.887  1.00 38.69 ? 201 GLN C CB    1 
ATOM   7141  C  CG    . GLN C  1 220 ? -24.549  -17.342 -27.289  1.00 39.41 ? 201 GLN C CG    1 
ATOM   7142  C  CD    . GLN C  1 220 ? -23.186  -17.968 -27.646  1.00 40.47 ? 201 GLN C CD    1 
ATOM   7143  O  OE1   . GLN C  1 220 ? -22.112  -17.400 -27.350  1.00 42.06 ? 201 GLN C OE1   1 
ATOM   7144  N  NE2   . GLN C  1 220 ? -23.230  -19.160 -28.245  1.00 42.58 ? 201 GLN C NE2   1 
ATOM   7145  N  N     . TRP C  1 221 ? -26.671  -15.706 -25.125  1.00 38.13 ? 202 TRP C N     1 
ATOM   7146  C  CA    . TRP C  1 221 ? -26.872  -15.361 -23.717  1.00 37.96 ? 202 TRP C CA    1 
ATOM   7147  C  C     . TRP C  1 221 ? -26.742  -16.605 -22.867  1.00 37.59 ? 202 TRP C C     1 
ATOM   7148  O  O     . TRP C  1 221 ? -26.618  -17.698 -23.384  1.00 37.23 ? 202 TRP C O     1 
ATOM   7149  C  CB    . TRP C  1 221 ? -28.262  -14.735 -23.497  1.00 37.38 ? 202 TRP C CB    1 
ATOM   7150  C  CG    . TRP C  1 221 ? -28.409  -13.365 -24.106  1.00 37.60 ? 202 TRP C CG    1 
ATOM   7151  C  CD1   . TRP C  1 221 ? -28.722  -13.082 -25.391  1.00 37.26 ? 202 TRP C CD1   1 
ATOM   7152  C  CD2   . TRP C  1 221 ? -28.236  -12.106 -23.449  1.00 36.11 ? 202 TRP C CD2   1 
ATOM   7153  N  NE1   . TRP C  1 221 ? -28.766  -11.722 -25.578  1.00 36.84 ? 202 TRP C NE1   1 
ATOM   7154  C  CE2   . TRP C  1 221 ? -28.476  -11.105 -24.396  1.00 35.63 ? 202 TRP C CE2   1 
ATOM   7155  C  CE3   . TRP C  1 221 ? -27.940  -11.732 -22.134  1.00 37.62 ? 202 TRP C CE3   1 
ATOM   7156  C  CZ2   . TRP C  1 221 ? -28.417  -9.748  -24.084  1.00 37.30 ? 202 TRP C CZ2   1 
ATOM   7157  C  CZ3   . TRP C  1 221 ? -27.898  -10.381 -21.809  1.00 36.78 ? 202 TRP C CZ3   1 
ATOM   7158  C  CH2   . TRP C  1 221 ? -28.134  -9.406  -22.777  1.00 37.26 ? 202 TRP C CH2   1 
ATOM   7159  N  N     . GLU C  1 222 ? -26.784  -16.435 -21.553  1.00 37.29 ? 203 GLU C N     1 
ATOM   7160  C  CA    . GLU C  1 222 ? -26.539  -17.542 -20.686  1.00 37.46 ? 203 GLU C CA    1 
ATOM   7161  C  C     . GLU C  1 222 ? -27.370  -17.436 -19.454  1.00 36.64 ? 203 GLU C C     1 
ATOM   7162  O  O     . GLU C  1 222 ? -27.643  -16.336 -18.978  1.00 36.85 ? 203 GLU C O     1 
ATOM   7163  C  CB    . GLU C  1 222 ? -25.055  -17.555 -20.299  1.00 38.47 ? 203 GLU C CB    1 
ATOM   7164  C  CG    . GLU C  1 222 ? -24.596  -18.768 -19.456  1.00 38.24 ? 203 GLU C CG    1 
ATOM   7165  C  CD    . GLU C  1 222 ? -23.128  -18.727 -19.074  1.00 39.13 ? 203 GLU C CD    1 
ATOM   7166  O  OE1   . GLU C  1 222 ? -22.265  -18.297 -19.886  1.00 41.31 ? 203 GLU C OE1   1 
ATOM   7167  O  OE2   . GLU C  1 222 ? -22.846  -19.128 -17.934  1.00 39.97 ? 203 GLU C OE2   1 
ATOM   7168  N  N     . PHE C  1 223 ? -27.777  -18.575 -18.915  1.00 36.06 ? 204 PHE C N     1 
ATOM   7169  C  CA    . PHE C  1 223 ? -28.324  -18.563 -17.572  1.00 36.33 ? 204 PHE C CA    1 
ATOM   7170  C  C     . PHE C  1 223 ? -27.802  -19.771 -16.839  1.00 36.67 ? 204 PHE C C     1 
ATOM   7171  O  O     . PHE C  1 223 ? -27.555  -20.827 -17.439  1.00 36.54 ? 204 PHE C O     1 
ATOM   7172  C  CB    . PHE C  1 223 ? -29.862  -18.398 -17.518  1.00 35.78 ? 204 PHE C CB    1 
ATOM   7173  C  CG    . PHE C  1 223 ? -30.631  -19.548 -18.089  1.00 36.20 ? 204 PHE C CG    1 
ATOM   7174  C  CD1   . PHE C  1 223 ? -30.856  -20.704 -17.336  1.00 36.94 ? 204 PHE C CD1   1 
ATOM   7175  C  CD2   . PHE C  1 223 ? -31.152  -19.481 -19.364  1.00 35.45 ? 204 PHE C CD2   1 
ATOM   7176  C  CE1   . PHE C  1 223 ? -31.553  -21.777 -17.851  1.00 35.40 ? 204 PHE C CE1   1 
ATOM   7177  C  CE2   . PHE C  1 223 ? -31.823  -20.543 -19.882  1.00 35.69 ? 204 PHE C CE2   1 
ATOM   7178  C  CZ    . PHE C  1 223 ? -32.034  -21.702 -19.117  1.00 35.54 ? 204 PHE C CZ    1 
ATOM   7179  N  N     . GLN C  1 224 ? -27.593  -19.605 -15.557  1.00 37.11 ? 205 GLN C N     1 
ATOM   7180  C  CA    . GLN C  1 224 ? -27.014  -20.612 -14.725  1.00 38.18 ? 205 GLN C CA    1 
ATOM   7181  C  C     . GLN C  1 224 ? -28.075  -21.158 -13.824  1.00 38.96 ? 205 GLN C C     1 
ATOM   7182  O  O     . GLN C  1 224 ? -28.831  -20.421 -13.292  1.00 39.33 ? 205 GLN C O     1 
ATOM   7183  C  CB    . GLN C  1 224 ? -25.899  -19.990 -13.910  1.00 37.89 ? 205 GLN C CB    1 
ATOM   7184  C  CG    . GLN C  1 224 ? -24.747  -19.507 -14.721  1.00 38.34 ? 205 GLN C CG    1 
ATOM   7185  C  CD    . GLN C  1 224 ? -24.674  -18.036 -14.845  1.00 37.66 ? 205 GLN C CD    1 
ATOM   7186  O  OE1   . GLN C  1 224 ? -24.724  -17.331 -13.892  1.00 35.50 ? 205 GLN C OE1   1 
ATOM   7187  N  NE2   . GLN C  1 224 ? -24.543  -17.577 -16.027  1.00 37.07 ? 205 GLN C NE2   1 
ATOM   7188  N  N     . ILE C  1 225 ? -28.149  -22.465 -13.678  1.00 39.60 ? 206 ILE C N     1 
ATOM   7189  C  CA    . ILE C  1 225 ? -29.111  -23.078 -12.778  1.00 39.83 ? 206 ILE C CA    1 
ATOM   7190  C  C     . ILE C  1 225 ? -28.410  -23.976 -11.801  1.00 40.27 ? 206 ILE C C     1 
ATOM   7191  O  O     . ILE C  1 225 ? -27.891  -24.962 -12.167  1.00 40.33 ? 206 ILE C O     1 
ATOM   7192  C  CB    . ILE C  1 225 ? -30.202  -23.911 -13.526  1.00 39.95 ? 206 ILE C CB    1 
ATOM   7193  C  CG1   . ILE C  1 225 ? -30.947  -23.089 -14.556  1.00 39.12 ? 206 ILE C CG1   1 
ATOM   7194  C  CG2   . ILE C  1 225 ? -31.164  -24.565 -12.580  1.00 38.23 ? 206 ILE C CG2   1 
ATOM   7195  C  CD1   . ILE C  1 225 ? -31.735  -22.048 -14.025  1.00 38.47 ? 206 ILE C CD1   1 
ATOM   7196  N  N     . GLY C  1 226 ? -28.417  -23.617 -10.542  1.00 40.61 ? 207 GLY C N     1 
ATOM   7197  C  CA    . GLY C  1 226 ? -27.829  -24.449 -9.535   1.00 41.31 ? 207 GLY C CA    1 
ATOM   7198  C  C     . GLY C  1 226 ? -27.605  -23.659 -8.302   1.00 41.30 ? 207 GLY C C     1 
ATOM   7199  O  O     . GLY C  1 226 ? -27.967  -22.528 -8.247   1.00 41.29 ? 207 GLY C O     1 
ATOM   7200  N  N     . PRO C  1 227 ? -27.016  -24.271 -7.303   1.00 42.03 ? 208 PRO C N     1 
ATOM   7201  C  CA    . PRO C  1 227 ? -26.674  -25.678 -7.356   1.00 41.73 ? 208 PRO C CA    1 
ATOM   7202  C  C     . PRO C  1 227 ? -27.845  -26.545 -6.989   1.00 41.82 ? 208 PRO C C     1 
ATOM   7203  O  O     . PRO C  1 227 ? -28.515  -26.272 -6.058   1.00 42.12 ? 208 PRO C O     1 
ATOM   7204  C  CB    . PRO C  1 227 ? -25.576  -25.801 -6.307   1.00 42.45 ? 208 PRO C CB    1 
ATOM   7205  C  CG    . PRO C  1 227 ? -25.163  -24.478 -5.990   1.00 41.57 ? 208 PRO C CG    1 
ATOM   7206  C  CD    . PRO C  1 227 ? -26.252  -23.572 -6.270   1.00 41.64 ? 208 PRO C CD    1 
ATOM   7207  N  N     . CYS C  1 228 ? -28.072  -27.588 -7.747   1.00 41.81 ? 209 CYS C N     1 
ATOM   7208  C  CA    . CYS C  1 228 ? -29.204  -28.431 -7.569   1.00 41.09 ? 209 CYS C CA    1 
ATOM   7209  C  C     . CYS C  1 228 ? -28.761  -29.811 -7.228   1.00 41.23 ? 209 CYS C C     1 
ATOM   7210  O  O     . CYS C  1 228 ? -27.950  -30.353 -7.877   1.00 39.64 ? 209 CYS C O     1 
ATOM   7211  C  CB    . CYS C  1 228 ? -30.002  -28.467 -8.851   1.00 42.11 ? 209 CYS C CB    1 
ATOM   7212  S  SG    . CYS C  1 228 ? -30.789  -27.009 -9.297   1.00 42.98 ? 209 CYS C SG    1 
ATOM   7213  N  N     . GLU C  1 229 ? -29.344  -30.389 -6.201   1.00 42.54 ? 210 GLU C N     1 
ATOM   7214  C  CA    . GLU C  1 229 ? -28.930  -31.678 -5.708   1.00 42.94 ? 210 GLU C CA    1 
ATOM   7215  C  C     . GLU C  1 229 ? -29.651  -32.778 -6.465   1.00 42.78 ? 210 GLU C C     1 
ATOM   7216  O  O     . GLU C  1 229 ? -30.850  -32.717 -6.669   1.00 43.00 ? 210 GLU C O     1 
ATOM   7217  C  CB    . GLU C  1 229 ? -29.194  -31.784 -4.209   1.00 42.94 ? 210 GLU C CB    1 
ATOM   7218  C  CG    . GLU C  1 229 ? -28.831  -33.155 -3.581   1.00 44.54 ? 210 GLU C CG    1 
ATOM   7219  C  CD    . GLU C  1 229 ? -28.618  -33.073 -2.059   1.00 46.16 ? 210 GLU C CD    1 
ATOM   7220  O  OE1   . GLU C  1 229 ? -28.278  -31.996 -1.525   1.00 52.80 ? 210 GLU C OE1   1 
ATOM   7221  O  OE2   . GLU C  1 229 ? -28.756  -34.090 -1.385   1.00 50.91 ? 210 GLU C OE2   1 
ATOM   7222  N  N     . GLY C  1 230 ? -28.888  -33.756 -6.920   1.00 42.33 ? 211 GLY C N     1 
ATOM   7223  C  CA    . GLY C  1 230 ? -29.449  -34.961 -7.468   1.00 42.05 ? 211 GLY C CA    1 
ATOM   7224  C  C     . GLY C  1 230 ? -30.291  -34.686 -8.690   1.00 42.37 ? 211 GLY C C     1 
ATOM   7225  O  O     . GLY C  1 230 ? -29.879  -33.948 -9.611   1.00 42.28 ? 211 GLY C O     1 
ATOM   7226  N  N     . ILE C  1 231 ? -31.495  -35.278 -8.667   1.00 42.32 ? 212 ILE C N     1 
ATOM   7227  C  CA    . ILE C  1 231 ? -32.398  -35.296 -9.801   1.00 40.90 ? 212 ILE C CA    1 
ATOM   7228  C  C     . ILE C  1 231 ? -32.985  -33.942 -10.044  1.00 40.85 ? 212 ILE C C     1 
ATOM   7229  O  O     . ILE C  1 231 ? -33.372  -33.647 -11.159  1.00 41.62 ? 212 ILE C O     1 
ATOM   7230  C  CB    . ILE C  1 231 ? -33.543  -36.312 -9.600   1.00 40.91 ? 212 ILE C CB    1 
ATOM   7231  C  CG1   . ILE C  1 231 ? -34.103  -36.725 -10.954  1.00 40.11 ? 212 ILE C CG1   1 
ATOM   7232  C  CG2   . ILE C  1 231 ? -34.680  -35.758 -8.628   1.00 37.32 ? 212 ILE C CG2   1 
ATOM   7233  C  CD1   . ILE C  1 231 ? -33.099  -37.255 -11.897  1.00 39.51 ? 212 ILE C CD1   1 
ATOM   7234  N  N     . SER C  1 232 ? -33.056  -33.106 -9.023   1.00 39.94 ? 213 SER C N     1 
ATOM   7235  C  CA    . SER C  1 232 ? -33.606  -31.768 -9.238   1.00 40.43 ? 213 SER C CA    1 
ATOM   7236  C  C     . SER C  1 232 ? -32.822  -30.925 -10.318  1.00 40.51 ? 213 SER C C     1 
ATOM   7237  O  O     . SER C  1 232 ? -33.338  -29.925 -10.840  1.00 41.02 ? 213 SER C O     1 
ATOM   7238  C  CB    . SER C  1 232 ? -33.675  -31.023 -7.887   1.00 39.59 ? 213 SER C CB    1 
ATOM   7239  O  OG    . SER C  1 232 ? -32.359  -30.720 -7.440   1.00 40.94 ? 213 SER C OG    1 
ATOM   7240  N  N     . MET C  1 233 ? -31.577  -31.290 -10.618  1.00 40.50 ? 214 MET C N     1 
ATOM   7241  C  CA    . MET C  1 233 ? -30.830  -30.557 -11.598  1.00 40.88 ? 214 MET C CA    1 
ATOM   7242  C  C     . MET C  1 233 ? -31.552  -30.620 -12.893  1.00 40.72 ? 214 MET C C     1 
ATOM   7243  O  O     . MET C  1 233 ? -31.864  -29.596 -13.476  1.00 41.57 ? 214 MET C O     1 
ATOM   7244  C  CB    . MET C  1 233 ? -29.421  -31.120 -11.802  1.00 41.85 ? 214 MET C CB    1 
ATOM   7245  C  CG    . MET C  1 233 ? -28.538  -30.292 -12.786  1.00 41.98 ? 214 MET C CG    1 
ATOM   7246  S  SD    . MET C  1 233 ? -28.165  -28.566 -12.290  1.00 44.69 ? 214 MET C SD    1 
ATOM   7247  C  CE    . MET C  1 233 ? -29.236  -27.660 -13.418  1.00 42.08 ? 214 MET C CE    1 
ATOM   7248  N  N     . GLY C  1 234 ? -31.843  -31.830 -13.329  1.00 40.28 ? 215 GLY C N     1 
ATOM   7249  C  CA    . GLY C  1 234 ? -32.508  -32.039 -14.599  1.00 39.84 ? 215 GLY C CA    1 
ATOM   7250  C  C     . GLY C  1 234 ? -33.891  -31.466 -14.598  1.00 40.01 ? 215 GLY C C     1 
ATOM   7251  O  O     . GLY C  1 234 ? -34.332  -30.907 -15.595  1.00 41.04 ? 215 GLY C O     1 
ATOM   7252  N  N     . ASP C  1 235 ? -34.590  -31.592 -13.484  1.00 39.72 ? 216 ASP C N     1 
ATOM   7253  C  CA    . ASP C  1 235 ? -35.925  -31.032 -13.391  1.00 39.36 ? 216 ASP C CA    1 
ATOM   7254  C  C     . ASP C  1 235 ? -35.881  -29.531 -13.609  1.00 39.11 ? 216 ASP C C     1 
ATOM   7255  O  O     . ASP C  1 235 ? -36.641  -28.973 -14.399  1.00 38.18 ? 216 ASP C O     1 
ATOM   7256  C  CB    . ASP C  1 235 ? -36.520  -31.332 -12.045  1.00 39.30 ? 216 ASP C CB    1 
ATOM   7257  C  CG    . ASP C  1 235 ? -36.851  -32.835 -11.866  1.00 42.53 ? 216 ASP C CG    1 
ATOM   7258  O  OD1   . ASP C  1 235 ? -36.833  -33.608 -12.875  1.00 40.55 ? 216 ASP C OD1   1 
ATOM   7259  O  OD2   . ASP C  1 235 ? -37.120  -33.225 -10.684  1.00 45.91 ? 216 ASP C OD2   1 
ATOM   7260  N  N     . HIS C  1 236 ? -34.959  -28.875 -12.923  1.00 38.92 ? 217 HIS C N     1 
ATOM   7261  C  CA    . HIS C  1 236 ? -34.960  -27.419 -12.918  1.00 38.56 ? 217 HIS C CA    1 
ATOM   7262  C  C     . HIS C  1 236 ? -34.510  -26.910 -14.286  1.00 38.16 ? 217 HIS C C     1 
ATOM   7263  O  O     . HIS C  1 236 ? -35.043  -25.952 -14.778  1.00 38.44 ? 217 HIS C O     1 
ATOM   7264  C  CB    . HIS C  1 236 ? -34.032  -26.883 -11.816  1.00 38.56 ? 217 HIS C CB    1 
ATOM   7265  C  CG    . HIS C  1 236 ? -34.670  -26.775 -10.472  1.00 38.64 ? 217 HIS C CG    1 
ATOM   7266  N  ND1   . HIS C  1 236 ? -34.875  -25.563 -9.858   1.00 37.49 ? 217 HIS C ND1   1 
ATOM   7267  C  CD2   . HIS C  1 236 ? -35.144  -27.718 -9.616   1.00 38.90 ? 217 HIS C CD2   1 
ATOM   7268  C  CE1   . HIS C  1 236 ? -35.433  -25.759 -8.673   1.00 37.63 ? 217 HIS C CE1   1 
ATOM   7269  N  NE2   . HIS C  1 236 ? -35.628  -27.056 -8.509   1.00 37.83 ? 217 HIS C NE2   1 
ATOM   7270  N  N     . LEU C  1 237 ? -33.503  -27.537 -14.885  1.00 37.97 ? 218 LEU C N     1 
ATOM   7271  C  CA    . LEU C  1 237 ? -33.028  -27.070 -16.163  1.00 37.95 ? 218 LEU C CA    1 
ATOM   7272  C  C     . LEU C  1 237 ? -34.093  -27.242 -17.262  1.00 38.00 ? 218 LEU C C     1 
ATOM   7273  O  O     . LEU C  1 237 ? -34.427  -26.287 -17.978  1.00 38.04 ? 218 LEU C O     1 
ATOM   7274  C  CB    . LEU C  1 237 ? -31.709  -27.732 -16.539  1.00 38.18 ? 218 LEU C CB    1 
ATOM   7275  C  CG    . LEU C  1 237 ? -31.086  -27.293 -17.886  1.00 38.17 ? 218 LEU C CG    1 
ATOM   7276  C  CD1   . LEU C  1 237 ? -30.993  -25.790 -17.975  1.00 35.89 ? 218 LEU C CD1   1 
ATOM   7277  C  CD2   . LEU C  1 237 ? -29.707  -28.042 -18.159  1.00 35.95 ? 218 LEU C CD2   1 
ATOM   7278  N  N     . TRP C  1 238 ? -34.664  -28.435 -17.360  1.00 37.77 ? 219 TRP C N     1 
ATOM   7279  C  CA    . TRP C  1 238 ? -35.776  -28.629 -18.298  1.00 37.75 ? 219 TRP C CA    1 
ATOM   7280  C  C     . TRP C  1 238 ? -36.915  -27.611 -18.115  1.00 37.53 ? 219 TRP C C     1 
ATOM   7281  O  O     . TRP C  1 238 ? -37.465  -27.124 -19.108  1.00 37.48 ? 219 TRP C O     1 
ATOM   7282  C  CB    . TRP C  1 238 ? -36.339  -30.036 -18.219  1.00 37.75 ? 219 TRP C CB    1 
ATOM   7283  C  CG    . TRP C  1 238 ? -35.563  -30.988 -19.014  1.00 38.36 ? 219 TRP C CG    1 
ATOM   7284  C  CD1   . TRP C  1 238 ? -34.868  -32.067 -18.537  1.00 39.42 ? 219 TRP C CD1   1 
ATOM   7285  C  CD2   . TRP C  1 238 ? -35.359  -30.972 -20.434  1.00 37.34 ? 219 TRP C CD2   1 
ATOM   7286  N  NE1   . TRP C  1 238 ? -34.265  -32.733 -19.578  1.00 39.88 ? 219 TRP C NE1   1 
ATOM   7287  C  CE2   . TRP C  1 238 ? -34.547  -32.085 -20.752  1.00 39.30 ? 219 TRP C CE2   1 
ATOM   7288  C  CE3   . TRP C  1 238 ? -35.801  -30.150 -21.467  1.00 39.15 ? 219 TRP C CE3   1 
ATOM   7289  C  CZ2   . TRP C  1 238 ? -34.151  -32.392 -22.076  1.00 39.03 ? 219 TRP C CZ2   1 
ATOM   7290  C  CZ3   . TRP C  1 238 ? -35.398  -30.450 -22.807  1.00 39.62 ? 219 TRP C CZ3   1 
ATOM   7291  C  CH2   . TRP C  1 238 ? -34.584  -31.568 -23.087  1.00 38.73 ? 219 TRP C CH2   1 
ATOM   7292  N  N     . VAL C  1 239 ? -37.264  -27.271 -16.877  1.00 36.85 ? 220 VAL C N     1 
ATOM   7293  C  CA    . VAL C  1 239 ? -38.352  -26.307 -16.685  1.00 36.88 ? 220 VAL C CA    1 
ATOM   7294  C  C     . VAL C  1 239 ? -37.859  -24.900 -17.107  1.00 37.09 ? 220 VAL C C     1 
ATOM   7295  O  O     . VAL C  1 239 ? -38.607  -24.172 -17.774  1.00 37.04 ? 220 VAL C O     1 
ATOM   7296  C  CB    . VAL C  1 239 ? -39.032  -26.327 -15.241  1.00 36.37 ? 220 VAL C CB    1 
ATOM   7297  C  CG1   . VAL C  1 239 ? -40.058  -25.186 -15.118  1.00 34.98 ? 220 VAL C CG1   1 
ATOM   7298  C  CG2   . VAL C  1 239 ? -39.738  -27.638 -15.005  1.00 34.01 ? 220 VAL C CG2   1 
ATOM   7299  N  N     . ALA C  1 240 ? -36.616  -24.559 -16.750  1.00 36.56 ? 221 ALA C N     1 
ATOM   7300  C  CA    . ALA C  1 240 ? -35.986  -23.281 -17.154  1.00 36.58 ? 221 ALA C CA    1 
ATOM   7301  C  C     . ALA C  1 240 ? -36.020  -23.113 -18.684  1.00 36.39 ? 221 ALA C C     1 
ATOM   7302  O  O     . ALA C  1 240 ? -36.260  -22.008 -19.232  1.00 36.11 ? 221 ALA C O     1 
ATOM   7303  C  CB    . ALA C  1 240 ? -34.556  -23.193 -16.632  1.00 35.66 ? 221 ALA C CB    1 
ATOM   7304  N  N     . ARG C  1 241 ? -35.797  -24.234 -19.352  1.00 36.20 ? 222 ARG C N     1 
ATOM   7305  C  CA    . ARG C  1 241 ? -35.739  -24.271 -20.793  1.00 36.62 ? 222 ARG C CA    1 
ATOM   7306  C  C     . ARG C  1 241 ? -37.126  -24.089 -21.331  1.00 36.19 ? 222 ARG C C     1 
ATOM   7307  O  O     . ARG C  1 241 ? -37.315  -23.387 -22.325  1.00 35.59 ? 222 ARG C O     1 
ATOM   7308  C  CB    . ARG C  1 241 ? -35.202  -25.635 -21.253  1.00 36.56 ? 222 ARG C CB    1 
ATOM   7309  C  CG    . ARG C  1 241 ? -33.711  -25.798 -21.164  1.00 36.76 ? 222 ARG C CG    1 
ATOM   7310  C  CD    . ARG C  1 241 ? -33.310  -27.208 -21.579  1.00 38.14 ? 222 ARG C CD    1 
ATOM   7311  N  NE    . ARG C  1 241 ? -31.873  -27.356 -21.788  1.00 38.97 ? 222 ARG C NE    1 
ATOM   7312  C  CZ    . ARG C  1 241 ? -31.288  -28.509 -22.117  1.00 40.08 ? 222 ARG C CZ    1 
ATOM   7313  N  NH1   . ARG C  1 241 ? -32.025  -29.611 -22.318  1.00 41.75 ? 222 ARG C NH1   1 
ATOM   7314  N  NH2   . ARG C  1 241 ? -29.968  -28.565 -22.278  1.00 39.05 ? 222 ARG C NH2   1 
ATOM   7315  N  N     . PHE C  1 242 ? -38.094  -24.740 -20.682  1.00 35.94 ? 223 PHE C N     1 
ATOM   7316  C  CA    . PHE C  1 242 ? -39.485  -24.527 -21.066  1.00 36.32 ? 223 PHE C CA    1 
ATOM   7317  C  C     . PHE C  1 242 ? -39.876  -23.070 -20.896  1.00 35.94 ? 223 PHE C C     1 
ATOM   7318  O  O     . PHE C  1 242 ? -40.421  -22.475 -21.807  1.00 37.17 ? 223 PHE C O     1 
ATOM   7319  C  CB    . PHE C  1 242 ? -40.472  -25.421 -20.326  1.00 36.70 ? 223 PHE C CB    1 
ATOM   7320  C  CG    . PHE C  1 242 ? -41.894  -25.217 -20.778  1.00 36.96 ? 223 PHE C CG    1 
ATOM   7321  C  CD1   . PHE C  1 242 ? -42.329  -25.748 -21.988  1.00 39.32 ? 223 PHE C CD1   1 
ATOM   7322  C  CD2   . PHE C  1 242 ? -42.778  -24.462 -20.040  1.00 38.03 ? 223 PHE C CD2   1 
ATOM   7323  C  CE1   . PHE C  1 242 ? -43.611  -25.548 -22.446  1.00 37.98 ? 223 PHE C CE1   1 
ATOM   7324  C  CE2   . PHE C  1 242 ? -44.071  -24.234 -20.499  1.00 39.22 ? 223 PHE C CE2   1 
ATOM   7325  C  CZ    . PHE C  1 242 ? -44.493  -24.781 -21.707  1.00 38.75 ? 223 PHE C CZ    1 
ATOM   7326  N  N     . ILE C  1 243 ? -39.568  -22.486 -19.747  1.00 36.13 ? 224 ILE C N     1 
ATOM   7327  C  CA    . ILE C  1 243 ? -39.912  -21.114 -19.467  1.00 36.30 ? 224 ILE C CA    1 
ATOM   7328  C  C     . ILE C  1 243 ? -39.237  -20.209 -20.503  1.00 36.92 ? 224 ILE C C     1 
ATOM   7329  O  O     . ILE C  1 243 ? -39.823  -19.250 -20.921  1.00 38.34 ? 224 ILE C O     1 
ATOM   7330  C  CB    . ILE C  1 243 ? -39.509  -20.711 -18.016  1.00 36.88 ? 224 ILE C CB    1 
ATOM   7331  C  CG1   . ILE C  1 243 ? -40.330  -21.540 -17.017  1.00 36.63 ? 224 ILE C CG1   1 
ATOM   7332  C  CG2   . ILE C  1 243 ? -39.626  -19.124 -17.808  1.00 35.65 ? 224 ILE C CG2   1 
ATOM   7333  C  CD1   . ILE C  1 243 ? -39.894  -21.480 -15.570  1.00 35.73 ? 224 ILE C CD1   1 
ATOM   7334  N  N     . LEU C  1 244 ? -38.018  -20.521 -20.943  1.00 37.02 ? 225 LEU C N     1 
ATOM   7335  C  CA    . LEU C  1 244 ? -37.328  -19.676 -21.961  1.00 36.67 ? 225 LEU C CA    1 
ATOM   7336  C  C     . LEU C  1 244 ? -38.072  -19.692 -23.294  1.00 36.82 ? 225 LEU C C     1 
ATOM   7337  O  O     . LEU C  1 244 ? -38.370  -18.644 -23.884  1.00 37.40 ? 225 LEU C O     1 
ATOM   7338  C  CB    . LEU C  1 244 ? -35.870  -20.131 -22.169  1.00 36.70 ? 225 LEU C CB    1 
ATOM   7339  C  CG    . LEU C  1 244 ? -35.042  -19.359 -23.208  1.00 36.84 ? 225 LEU C CG    1 
ATOM   7340  C  CD1   . LEU C  1 244 ? -34.785  -17.874 -22.760  1.00 36.01 ? 225 LEU C CD1   1 
ATOM   7341  C  CD2   . LEU C  1 244 ? -33.733  -20.068 -23.492  1.00 35.33 ? 225 LEU C CD2   1 
ATOM   7342  N  N     . HIS C  1 245 ? -38.393  -20.887 -23.770  1.00 37.15 ? 226 HIS C N     1 
ATOM   7343  C  CA    . HIS C  1 245 ? -39.137  -20.998 -25.022  1.00 37.04 ? 226 HIS C CA    1 
ATOM   7344  C  C     . HIS C  1 245 ? -40.458  -20.263 -24.911  1.00 36.85 ? 226 HIS C C     1 
ATOM   7345  O  O     . HIS C  1 245 ? -40.795  -19.537 -25.814  1.00 36.21 ? 226 HIS C O     1 
ATOM   7346  C  CB    . HIS C  1 245 ? -39.382  -22.448 -25.388  1.00 37.58 ? 226 HIS C CB    1 
ATOM   7347  C  CG    . HIS C  1 245 ? -38.144  -23.205 -25.755  1.00 37.99 ? 226 HIS C CG    1 
ATOM   7348  N  ND1   . HIS C  1 245 ? -37.298  -22.806 -26.774  1.00 38.29 ? 226 HIS C ND1   1 
ATOM   7349  C  CD2   . HIS C  1 245 ? -37.626  -24.350 -25.253  1.00 37.65 ? 226 HIS C CD2   1 
ATOM   7350  C  CE1   . HIS C  1 245 ? -36.320  -23.683 -26.887  1.00 39.06 ? 226 HIS C CE1   1 
ATOM   7351  N  NE2   . HIS C  1 245 ? -36.483  -24.619 -25.962  1.00 40.33 ? 226 HIS C NE2   1 
ATOM   7352  N  N     . ARG C  1 246 ? -41.187  -20.403 -23.799  1.00 36.88 ? 227 ARG C N     1 
ATOM   7353  C  CA    . ARG C  1 246 ? -42.441  -19.645 -23.675  1.00 37.46 ? 227 ARG C CA    1 
ATOM   7354  C  C     . ARG C  1 246 ? -42.219  -18.124 -23.669  1.00 37.38 ? 227 ARG C C     1 
ATOM   7355  O  O     . ARG C  1 246 ? -42.925  -17.373 -24.350  1.00 37.29 ? 227 ARG C O     1 
ATOM   7356  C  CB    . ARG C  1 246 ? -43.212  -19.991 -22.389  1.00 38.42 ? 227 ARG C CB    1 
ATOM   7357  C  CG    . ARG C  1 246 ? -44.262  -21.041 -22.510  1.00 40.07 ? 227 ARG C CG    1 
ATOM   7358  C  CD    . ARG C  1 246 ? -45.416  -20.640 -23.425  1.00 41.12 ? 227 ARG C CD    1 
ATOM   7359  N  NE    . ARG C  1 246 ? -46.462  -19.950 -22.714  1.00 41.62 ? 227 ARG C NE    1 
ATOM   7360  C  CZ    . ARG C  1 246 ? -46.763  -18.657 -22.867  1.00 43.14 ? 227 ARG C CZ    1 
ATOM   7361  N  NH1   . ARG C  1 246 ? -46.067  -17.852 -23.685  1.00 45.22 ? 227 ARG C NH1   1 
ATOM   7362  N  NH2   . ARG C  1 246 ? -47.742  -18.138 -22.155  1.00 40.75 ? 227 ARG C NH2   1 
ATOM   7363  N  N     . VAL C  1 247 ? -41.264  -17.670 -22.863  1.00 36.66 ? 228 VAL C N     1 
ATOM   7364  C  CA    . VAL C  1 247 ? -40.934  -16.256 -22.860  1.00 36.32 ? 228 VAL C CA    1 
ATOM   7365  C  C     . VAL C  1 247 ? -40.589  -15.762 -24.274  1.00 36.51 ? 228 VAL C C     1 
ATOM   7366  O  O     . VAL C  1 247 ? -41.005  -14.698 -24.666  1.00 36.07 ? 228 VAL C O     1 
ATOM   7367  C  CB    . VAL C  1 247 ? -39.745  -15.914 -21.936  1.00 35.91 ? 228 VAL C CB    1 
ATOM   7368  C  CG1   . VAL C  1 247 ? -39.399  -14.423 -22.108  1.00 35.53 ? 228 VAL C CG1   1 
ATOM   7369  C  CG2   . VAL C  1 247 ? -40.030  -16.252 -20.472  1.00 32.53 ? 228 VAL C CG2   1 
ATOM   7370  N  N     . CYS C  1 248 ? -39.814  -16.524 -25.047  1.00 37.27 ? 229 CYS C N     1 
ATOM   7371  C  CA    . CYS C  1 248 ? -39.378  -16.026 -26.375  1.00 37.08 ? 229 CYS C CA    1 
ATOM   7372  C  C     . CYS C  1 248 ? -40.592  -15.967 -27.281  1.00 36.94 ? 229 CYS C C     1 
ATOM   7373  O  O     . CYS C  1 248 ? -40.784  -15.048 -28.091  1.00 36.11 ? 229 CYS C O     1 
ATOM   7374  C  CB    . CYS C  1 248 ? -38.287  -16.930 -26.952  1.00 37.49 ? 229 CYS C CB    1 
ATOM   7375  S  SG    . CYS C  1 248 ? -36.629  -16.822 -26.133  1.00 37.94 ? 229 CYS C SG    1 
ATOM   7376  N  N     . GLU C  1 249 ? -41.451  -16.963 -27.106  1.00 37.16 ? 230 GLU C N     1 
ATOM   7377  C  CA    . GLU C  1 249 ? -42.670  -17.035 -27.882  1.00 37.13 ? 230 GLU C CA    1 
ATOM   7378  C  C     . GLU C  1 249 ? -43.424  -15.707 -27.732  1.00 36.30 ? 230 GLU C C     1 
ATOM   7379  O  O     . GLU C  1 249 ? -43.804  -15.129 -28.717  1.00 35.43 ? 230 GLU C O     1 
ATOM   7380  C  CB    . GLU C  1 249 ? -43.464  -18.253 -27.455  1.00 36.83 ? 230 GLU C CB    1 
ATOM   7381  C  CG    . GLU C  1 249 ? -44.592  -18.556 -28.345  1.00 39.31 ? 230 GLU C CG    1 
ATOM   7382  C  CD    . GLU C  1 249 ? -45.489  -19.670 -27.813  1.00 39.56 ? 230 GLU C CD    1 
ATOM   7383  O  OE1   . GLU C  1 249 ? -45.020  -20.845 -27.714  1.00 40.82 ? 230 GLU C OE1   1 
ATOM   7384  O  OE2   . GLU C  1 249 ? -46.662  -19.347 -27.537  1.00 42.66 ? 230 GLU C OE2   1 
ATOM   7385  N  N     . ASP C  1 250 ? -43.538  -15.175 -26.516  1.00 36.11 ? 231 ASP C N     1 
ATOM   7386  C  CA    . ASP C  1 250 ? -44.181  -13.880 -26.309  1.00 36.94 ? 231 ASP C CA    1 
ATOM   7387  C  C     . ASP C  1 250 ? -43.547  -12.718 -27.081  1.00 37.05 ? 231 ASP C C     1 
ATOM   7388  O  O     . ASP C  1 250 ? -44.232  -11.838 -27.546  1.00 36.08 ? 231 ASP C O     1 
ATOM   7389  C  CB    . ASP C  1 250 ? -44.189  -13.487 -24.825  1.00 37.14 ? 231 ASP C CB    1 
ATOM   7390  C  CG    . ASP C  1 250 ? -45.181  -14.280 -23.989  1.00 38.26 ? 231 ASP C CG    1 
ATOM   7391  O  OD1   . ASP C  1 250 ? -45.908  -15.160 -24.497  1.00 36.96 ? 231 ASP C OD1   1 
ATOM   7392  O  OD2   . ASP C  1 250 ? -45.184  -14.027 -22.772  1.00 40.87 ? 231 ASP C OD2   1 
ATOM   7393  N  N     . PHE C  1 251 ? -42.218  -12.718 -27.143  1.00 37.84 ? 232 PHE C N     1 
ATOM   7394  C  CA    . PHE C  1 251 ? -41.434  -11.704 -27.850  1.00 37.35 ? 232 PHE C CA    1 
ATOM   7395  C  C     . PHE C  1 251 ? -41.259  -11.986 -29.346  1.00 37.60 ? 232 PHE C C     1 
ATOM   7396  O  O     . PHE C  1 251 ? -40.601  -11.207 -30.041  1.00 38.04 ? 232 PHE C O     1 
ATOM   7397  C  CB    . PHE C  1 251 ? -40.076  -11.568 -27.205  1.00 36.88 ? 232 PHE C CB    1 
ATOM   7398  C  CG    . PHE C  1 251 ? -40.123  -10.984 -25.813  1.00 36.80 ? 232 PHE C CG    1 
ATOM   7399  C  CD1   . PHE C  1 251 ? -40.094  -9.620  -25.621  1.00 35.17 ? 232 PHE C CD1   1 
ATOM   7400  C  CD2   . PHE C  1 251 ? -40.150  -11.809 -24.698  1.00 37.40 ? 232 PHE C CD2   1 
ATOM   7401  C  CE1   . PHE C  1 251 ? -40.113  -9.095  -24.349  1.00 36.27 ? 232 PHE C CE1   1 
ATOM   7402  C  CE2   . PHE C  1 251 ? -40.185  -11.283 -23.422  1.00 36.65 ? 232 PHE C CE2   1 
ATOM   7403  C  CZ    . PHE C  1 251 ? -40.183  -9.916  -23.252  1.00 36.33 ? 232 PHE C CZ    1 
ATOM   7404  N  N     . GLY C  1 252 ? -41.870  -13.060 -29.858  1.00 37.49 ? 233 GLY C N     1 
ATOM   7405  C  CA    . GLY C  1 252 ? -41.819  -13.342 -31.303  1.00 37.62 ? 233 GLY C CA    1 
ATOM   7406  C  C     . GLY C  1 252 ? -40.433  -13.789 -31.768  1.00 38.40 ? 233 GLY C C     1 
ATOM   7407  O  O     . GLY C  1 252 ? -40.072  -13.571 -32.936  1.00 38.73 ? 233 GLY C O     1 
ATOM   7408  N  N     . VAL C  1 253 ? -39.655  -14.410 -30.856  1.00 38.26 ? 234 VAL C N     1 
ATOM   7409  C  CA    . VAL C  1 253 ? -38.305  -14.891 -31.151  1.00 38.09 ? 234 VAL C CA    1 
ATOM   7410  C  C     . VAL C  1 253 ? -38.116  -16.350 -30.700  1.00 38.32 ? 234 VAL C C     1 
ATOM   7411  O  O     . VAL C  1 253 ? -38.926  -16.892 -29.982  1.00 39.27 ? 234 VAL C O     1 
ATOM   7412  C  CB    . VAL C  1 253 ? -37.226  -13.924 -30.581  1.00 38.48 ? 234 VAL C CB    1 
ATOM   7413  C  CG1   . VAL C  1 253 ? -37.616  -12.451 -30.939  1.00 38.30 ? 234 VAL C CG1   1 
ATOM   7414  C  CG2   . VAL C  1 253 ? -37.052  -14.091 -29.096  1.00 36.07 ? 234 VAL C CG2   1 
ATOM   7415  N  N     . ILE C  1 254 ? -37.061  -16.987 -31.186  1.00 39.10 ? 235 ILE C N     1 
ATOM   7416  C  CA    . ILE C  1 254 ? -36.804  -18.402 -30.983  1.00 39.36 ? 235 ILE C CA    1 
ATOM   7417  C  C     . ILE C  1 254 ? -35.485  -18.436 -30.216  1.00 39.40 ? 235 ILE C C     1 
ATOM   7418  O  O     . ILE C  1 254 ? -34.595  -17.605 -30.463  1.00 38.78 ? 235 ILE C O     1 
ATOM   7419  C  CB    . ILE C  1 254 ? -36.652  -19.108 -32.363  1.00 39.88 ? 235 ILE C CB    1 
ATOM   7420  C  CG1   . ILE C  1 254 ? -38.003  -19.413 -32.958  1.00 41.41 ? 235 ILE C CG1   1 
ATOM   7421  C  CG2   . ILE C  1 254 ? -35.801  -20.407 -32.353  1.00 39.57 ? 235 ILE C CG2   1 
ATOM   7422  C  CD1   . ILE C  1 254 ? -37.929  -19.302 -34.565  1.00 42.10 ? 235 ILE C CD1   1 
ATOM   7423  N  N     . ALA C  1 255 ? -35.398  -19.371 -29.269  1.00 38.95 ? 236 ALA C N     1 
ATOM   7424  C  CA    . ALA C  1 255 ? -34.156  -19.747 -28.631  1.00 38.43 ? 236 ALA C CA    1 
ATOM   7425  C  C     . ALA C  1 255 ? -33.705  -21.045 -29.324  1.00 38.63 ? 236 ALA C C     1 
ATOM   7426  O  O     . ALA C  1 255 ? -34.503  -21.963 -29.502  1.00 39.01 ? 236 ALA C O     1 
ATOM   7427  C  CB    . ALA C  1 255 ? -34.360  -19.958 -27.136  1.00 36.98 ? 236 ALA C CB    1 
ATOM   7428  N  N     . THR C  1 256 ? -32.449  -21.088 -29.778  1.00 38.34 ? 237 THR C N     1 
ATOM   7429  C  CA    . THR C  1 256 ? -31.843  -22.326 -30.197  1.00 37.94 ? 237 THR C CA    1 
ATOM   7430  C  C     . THR C  1 256 ? -30.757  -22.751 -29.171  1.00 38.01 ? 237 THR C C     1 
ATOM   7431  O  O     . THR C  1 256 ? -29.982  -21.925 -28.681  1.00 37.59 ? 237 THR C O     1 
ATOM   7432  C  CB    . THR C  1 256 ? -31.216  -22.230 -31.574  1.00 37.83 ? 237 THR C CB    1 
ATOM   7433  O  OG1   . THR C  1 256 ? -30.620  -23.496 -31.873  1.00 38.56 ? 237 THR C OG1   1 
ATOM   7434  C  CG2   . THR C  1 256 ? -30.098  -21.140 -31.639  1.00 37.11 ? 237 THR C CG2   1 
ATOM   7435  N  N     . PHE C  1 257 ? -30.757  -24.041 -28.859  1.00 37.83 ? 238 PHE C N     1 
ATOM   7436  C  CA    . PHE C  1 257 ? -29.724  -24.668 -28.102  1.00 38.72 ? 238 PHE C CA    1 
ATOM   7437  C  C     . PHE C  1 257 ? -28.753  -25.449 -28.986  1.00 39.40 ? 238 PHE C C     1 
ATOM   7438  O  O     . PHE C  1 257 ? -28.010  -26.272 -28.467  1.00 39.29 ? 238 PHE C O     1 
ATOM   7439  C  CB    . PHE C  1 257 ? -30.294  -25.636 -27.071  1.00 39.15 ? 238 PHE C CB    1 
ATOM   7440  C  CG    . PHE C  1 257 ? -31.234  -25.002 -26.078  1.00 39.93 ? 238 PHE C CG    1 
ATOM   7441  C  CD1   . PHE C  1 257 ? -31.002  -23.728 -25.574  1.00 40.80 ? 238 PHE C CD1   1 
ATOM   7442  C  CD2   . PHE C  1 257 ? -32.359  -25.680 -25.658  1.00 39.10 ? 238 PHE C CD2   1 
ATOM   7443  C  CE1   . PHE C  1 257 ? -31.906  -23.163 -24.677  1.00 40.51 ? 238 PHE C CE1   1 
ATOM   7444  C  CE2   . PHE C  1 257 ? -33.228  -25.117 -24.788  1.00 39.54 ? 238 PHE C CE2   1 
ATOM   7445  C  CZ    . PHE C  1 257 ? -33.001  -23.886 -24.277  1.00 39.66 ? 238 PHE C CZ    1 
ATOM   7446  N  N     . ASP C  1 258 ? -28.749  -25.193 -30.301  1.00 39.79 ? 239 ASP C N     1 
ATOM   7447  C  CA    . ASP C  1 258 ? -27.748  -25.806 -31.177  1.00 39.94 ? 239 ASP C CA    1 
ATOM   7448  C  C     . ASP C  1 258 ? -26.344  -25.391 -30.744  1.00 40.23 ? 239 ASP C C     1 
ATOM   7449  O  O     . ASP C  1 258 ? -26.096  -24.219 -30.493  1.00 40.82 ? 239 ASP C O     1 
ATOM   7450  C  CB    . ASP C  1 258 ? -27.947  -25.409 -32.648  1.00 40.15 ? 239 ASP C CB    1 
ATOM   7451  C  CG    . ASP C  1 258 ? -27.031  -26.183 -33.568  1.00 40.63 ? 239 ASP C CG    1 
ATOM   7452  O  OD1   . ASP C  1 258 ? -27.375  -27.321 -33.972  1.00 42.88 ? 239 ASP C OD1   1 
ATOM   7453  O  OD2   . ASP C  1 258 ? -25.939  -25.684 -33.831  1.00 42.39 ? 239 ASP C OD2   1 
ATOM   7454  N  N     . PRO C  1 259 ? -25.420  -26.356 -30.654  1.00 40.35 ? 240 PRO C N     1 
ATOM   7455  C  CA    . PRO C  1 259 ? -24.095  -25.969 -30.141  1.00 40.06 ? 240 PRO C CA    1 
ATOM   7456  C  C     . PRO C  1 259 ? -23.260  -25.115 -31.077  1.00 40.02 ? 240 PRO C C     1 
ATOM   7457  O  O     . PRO C  1 259 ? -22.307  -24.541 -30.604  1.00 40.67 ? 240 PRO C O     1 
ATOM   7458  C  CB    . PRO C  1 259 ? -23.379  -27.313 -29.895  1.00 39.80 ? 240 PRO C CB    1 
ATOM   7459  C  CG    . PRO C  1 259 ? -24.128  -28.325 -30.705  1.00 39.68 ? 240 PRO C CG    1 
ATOM   7460  C  CD    . PRO C  1 259 ? -25.526  -27.800 -30.955  1.00 40.21 ? 240 PRO C CD    1 
ATOM   7461  N  N     . LYS C  1 260 ? -23.571  -25.059 -32.372  1.00 39.58 ? 241 LYS C N     1 
ATOM   7462  C  CA    . LYS C  1 260 ? -22.812  -24.219 -33.293  1.00 39.45 ? 241 LYS C CA    1 
ATOM   7463  C  C     . LYS C  1 260 ? -23.757  -23.647 -34.307  1.00 39.25 ? 241 LYS C C     1 
ATOM   7464  O  O     . LYS C  1 260 ? -23.841  -24.091 -35.431  1.00 39.47 ? 241 LYS C O     1 
ATOM   7465  C  CB    . LYS C  1 260 ? -21.684  -25.021 -33.964  1.00 39.92 ? 241 LYS C CB    1 
ATOM   7466  C  CG    . LYS C  1 260 ? -20.586  -24.166 -34.699  1.00 39.75 ? 241 LYS C CG    1 
ATOM   7467  C  CD    . LYS C  1 260 ? -19.525  -23.573 -33.753  1.00 39.82 ? 241 LYS C CD    1 
ATOM   7468  C  CE    . LYS C  1 260 ? -18.565  -22.684 -34.521  1.00 40.39 ? 241 LYS C CE    1 
ATOM   7469  N  NZ    . LYS C  1 260 ? -17.519  -22.101 -33.654  1.00 40.34 ? 241 LYS C NZ    1 
ATOM   7470  N  N     . PRO C  1 261 ? -24.511  -22.659 -33.904  1.00 40.08 ? 242 PRO C N     1 
ATOM   7471  C  CA    . PRO C  1 261 ? -25.584  -22.205 -34.766  1.00 40.37 ? 242 PRO C CA    1 
ATOM   7472  C  C     . PRO C  1 261 ? -25.106  -21.384 -35.939  1.00 40.48 ? 242 PRO C C     1 
ATOM   7473  O  O     . PRO C  1 261 ? -25.769  -21.300 -36.932  1.00 41.13 ? 242 PRO C O     1 
ATOM   7474  C  CB    . PRO C  1 261 ? -26.419  -21.345 -33.830  1.00 40.54 ? 242 PRO C CB    1 
ATOM   7475  C  CG    . PRO C  1 261 ? -25.462  -20.809 -32.837  1.00 40.01 ? 242 PRO C CG    1 
ATOM   7476  C  CD    . PRO C  1 261 ? -24.454  -21.912 -32.633  1.00 40.54 ? 242 PRO C CD    1 
ATOM   7477  N  N     . ILE C  1 262 ? -23.987  -20.725 -35.798  1.00 40.93 ? 243 ILE C N     1 
ATOM   7478  C  CA    . ILE C  1 262 ? -23.410  -19.984 -36.892  1.00 41.17 ? 243 ILE C CA    1 
ATOM   7479  C  C     . ILE C  1 262 ? -22.000  -20.528 -37.074  1.00 41.28 ? 243 ILE C C     1 
ATOM   7480  O  O     . ILE C  1 262 ? -21.187  -20.419 -36.161  1.00 41.10 ? 243 ILE C O     1 
ATOM   7481  C  CB    . ILE C  1 262 ? -23.385  -18.466 -36.585  1.00 40.92 ? 243 ILE C CB    1 
ATOM   7482  C  CG1   . ILE C  1 262 ? -24.778  -17.994 -36.191  1.00 40.72 ? 243 ILE C CG1   1 
ATOM   7483  C  CG2   . ILE C  1 262 ? -22.971  -17.685 -37.812  1.00 40.50 ? 243 ILE C CG2   1 
ATOM   7484  C  CD1   . ILE C  1 262 ? -25.843  -18.097 -37.357  1.00 38.54 ? 243 ILE C CD1   1 
ATOM   7485  N  N     . PRO C  1 263 ? -21.722  -21.146 -38.239  1.00 41.72 ? 244 PRO C N     1 
ATOM   7486  C  CA    . PRO C  1 263 ? -20.380  -21.663 -38.492  1.00 41.85 ? 244 PRO C CA    1 
ATOM   7487  C  C     . PRO C  1 263 ? -19.406  -20.559 -38.681  1.00 42.20 ? 244 PRO C C     1 
ATOM   7488  O  O     . PRO C  1 263 ? -19.801  -19.414 -38.930  1.00 42.67 ? 244 PRO C O     1 
ATOM   7489  C  CB    . PRO C  1 263 ? -20.509  -22.454 -39.794  1.00 41.60 ? 244 PRO C CB    1 
ATOM   7490  C  CG    . PRO C  1 263 ? -21.773  -22.055 -40.387  1.00 42.07 ? 244 PRO C CG    1 
ATOM   7491  C  CD    . PRO C  1 263 ? -22.635  -21.394 -39.369  1.00 41.67 ? 244 PRO C CD    1 
ATOM   7492  N  N     . GLY C  1 264 ? -18.136  -20.919 -38.543  1.00 42.57 ? 245 GLY C N     1 
ATOM   7493  C  CA    . GLY C  1 264 ? -17.037  -20.005 -38.740  1.00 42.64 ? 245 GLY C CA    1 
ATOM   7494  C  C     . GLY C  1 264 ? -16.607  -19.345 -37.432  1.00 43.22 ? 245 GLY C C     1 
ATOM   7495  O  O     . GLY C  1 264 ? -16.587  -19.965 -36.357  1.00 42.94 ? 245 GLY C O     1 
ATOM   7496  N  N     . ASN C  1 265 ? -16.281  -18.060 -37.535  1.00 43.45 ? 246 ASN C N     1 
ATOM   7497  C  CA    . ASN C  1 265 ? -15.629  -17.371 -36.455  1.00 43.40 ? 246 ASN C CA    1 
ATOM   7498  C  C     . ASN C  1 265 ? -16.581  -16.748 -35.428  1.00 43.06 ? 246 ASN C C     1 
ATOM   7499  O  O     . ASN C  1 265 ? -16.589  -15.533 -35.199  1.00 43.31 ? 246 ASN C O     1 
ATOM   7500  C  CB    . ASN C  1 265 ? -14.701  -16.315 -37.026  1.00 43.93 ? 246 ASN C CB    1 
ATOM   7501  C  CG    . ASN C  1 265 ? -13.847  -15.727 -35.979  1.00 44.76 ? 246 ASN C CG    1 
ATOM   7502  O  OD1   . ASN C  1 265 ? -13.731  -16.273 -34.867  1.00 46.81 ? 246 ASN C OD1   1 
ATOM   7503  N  ND2   . ASN C  1 265 ? -13.268  -14.593 -36.281  1.00 47.56 ? 246 ASN C ND2   1 
ATOM   7504  N  N     . TRP C  1 266 ? -17.370  -17.606 -34.803  1.00 42.42 ? 247 TRP C N     1 
ATOM   7505  C  CA    . TRP C  1 266 ? -18.424  -17.176 -33.893  1.00 42.13 ? 247 TRP C CA    1 
ATOM   7506  C  C     . TRP C  1 266 ? -18.524  -18.267 -32.847  1.00 41.93 ? 247 TRP C C     1 
ATOM   7507  O  O     . TRP C  1 266 ? -18.428  -19.447 -33.172  1.00 41.96 ? 247 TRP C O     1 
ATOM   7508  C  CB    . TRP C  1 266 ? -19.766  -17.016 -34.628  1.00 41.04 ? 247 TRP C CB    1 
ATOM   7509  C  CG    . TRP C  1 266 ? -19.719  -15.988 -35.700  1.00 40.63 ? 247 TRP C CG    1 
ATOM   7510  C  CD1   . TRP C  1 266 ? -19.643  -16.204 -37.044  1.00 40.01 ? 247 TRP C CD1   1 
ATOM   7511  C  CD2   . TRP C  1 266 ? -19.711  -14.573 -35.521  1.00 39.74 ? 247 TRP C CD2   1 
ATOM   7512  N  NE1   . TRP C  1 266 ? -19.585  -15.004 -37.709  1.00 39.41 ? 247 TRP C NE1   1 
ATOM   7513  C  CE2   . TRP C  1 266 ? -19.630  -13.991 -36.795  1.00 38.51 ? 247 TRP C CE2   1 
ATOM   7514  C  CE3   . TRP C  1 266 ? -19.786  -13.743 -34.406  1.00 38.78 ? 247 TRP C CE3   1 
ATOM   7515  C  CZ2   . TRP C  1 266 ? -19.626  -12.630 -36.982  1.00 39.49 ? 247 TRP C CZ2   1 
ATOM   7516  C  CZ3   . TRP C  1 266 ? -19.764  -12.397 -34.592  1.00 39.48 ? 247 TRP C CZ3   1 
ATOM   7517  C  CH2   . TRP C  1 266 ? -19.681  -11.841 -35.864  1.00 39.61 ? 247 TRP C CH2   1 
ATOM   7518  N  N     . ASN C  1 267 ? -18.695  -17.877 -31.600  1.00 41.50 ? 248 ASN C N     1 
ATOM   7519  C  CA    . ASN C  1 267 ? -18.685  -18.862 -30.564  1.00 42.04 ? 248 ASN C CA    1 
ATOM   7520  C  C     . ASN C  1 267 ? -19.832  -19.830 -30.646  1.00 41.98 ? 248 ASN C C     1 
ATOM   7521  O  O     . ASN C  1 267 ? -20.944  -19.474 -31.037  1.00 42.09 ? 248 ASN C O     1 
ATOM   7522  C  CB    . ASN C  1 267 ? -18.708  -18.211 -29.185  1.00 42.30 ? 248 ASN C CB    1 
ATOM   7523  C  CG    . ASN C  1 267 ? -17.336  -17.974 -28.675  1.00 39.82 ? 248 ASN C CG    1 
ATOM   7524  O  OD1   . ASN C  1 267 ? -17.068  -18.018 -27.466  1.00 38.68 ? 248 ASN C OD1   1 
ATOM   7525  N  ND2   . ASN C  1 267 ? -16.451  -17.715 -29.594  1.00 35.80 ? 248 ASN C ND2   1 
ATOM   7526  N  N     . GLY C  1 268 ? -19.538  -21.060 -30.255  1.00 41.83 ? 249 GLY C N     1 
ATOM   7527  C  CA    . GLY C  1 268 ? -20.577  -22.070 -30.082  1.00 41.70 ? 249 GLY C CA    1 
ATOM   7528  C  C     . GLY C  1 268 ? -21.272  -21.913 -28.748  1.00 41.77 ? 249 GLY C C     1 
ATOM   7529  O  O     . GLY C  1 268 ? -20.987  -20.981 -27.972  1.00 42.46 ? 249 GLY C O     1 
ATOM   7530  N  N     . ALA C  1 269 ? -22.174  -22.845 -28.476  1.00 41.54 ? 250 ALA C N     1 
ATOM   7531  C  CA    . ALA C  1 269 ? -23.001  -22.810 -27.290  1.00 41.13 ? 250 ALA C CA    1 
ATOM   7532  C  C     . ALA C  1 269 ? -22.922  -24.153 -26.563  1.00 40.79 ? 250 ALA C C     1 
ATOM   7533  O  O     . ALA C  1 269 ? -23.260  -25.189 -27.116  1.00 40.76 ? 250 ALA C O     1 
ATOM   7534  C  CB    . ALA C  1 269 ? -24.419  -22.488 -27.674  1.00 40.89 ? 250 ALA C CB    1 
ATOM   7535  N  N     . GLY C  1 270 ? -22.476  -24.110 -25.317  1.00 40.49 ? 251 GLY C N     1 
ATOM   7536  C  CA    . GLY C  1 270 ? -22.383  -25.296 -24.489  1.00 40.48 ? 251 GLY C CA    1 
ATOM   7537  C  C     . GLY C  1 270 ? -23.313  -25.256 -23.296  1.00 40.32 ? 251 GLY C C     1 
ATOM   7538  O  O     . GLY C  1 270 ? -24.095  -24.340 -23.116  1.00 39.66 ? 251 GLY C O     1 
ATOM   7539  N  N     . CYS C  1 271 ? -23.210  -26.275 -22.469  1.00 40.77 ? 252 CYS C N     1 
ATOM   7540  C  CA    . CYS C  1 271 ? -23.959  -26.334 -21.221  1.00 40.55 ? 252 CYS C CA    1 
ATOM   7541  C  C     . CYS C  1 271 ? -23.036  -26.778 -20.086  1.00 39.99 ? 252 CYS C C     1 
ATOM   7542  O  O     . CYS C  1 271 ? -23.208  -27.843 -19.539  1.00 39.20 ? 252 CYS C O     1 
ATOM   7543  C  CB    . CYS C  1 271 ? -25.139  -27.289 -21.372  1.00 40.88 ? 252 CYS C CB    1 
ATOM   7544  S  SG    . CYS C  1 271 ? -26.333  -27.154 -20.040  1.00 41.15 ? 252 CYS C SG    1 
ATOM   7545  N  N     . HIS C  1 272 ? -22.061  -25.932 -19.743  1.00 40.04 ? 253 HIS C N     1 
ATOM   7546  C  CA    . HIS C  1 272 ? -20.987  -26.299 -18.774  1.00 39.93 ? 253 HIS C CA    1 
ATOM   7547  C  C     . HIS C  1 272 ? -21.636  -26.856 -17.533  1.00 39.88 ? 253 HIS C C     1 
ATOM   7548  O  O     . HIS C  1 272 ? -22.513  -26.221 -16.975  1.00 40.48 ? 253 HIS C O     1 
ATOM   7549  C  CB    . HIS C  1 272 ? -20.063  -25.094 -18.394  1.00 39.69 ? 253 HIS C CB    1 
ATOM   7550  C  CG    . HIS C  1 272 ? -19.441  -24.383 -19.568  1.00 37.91 ? 253 HIS C CG    1 
ATOM   7551  N  ND1   . HIS C  1 272 ? -19.037  -23.063 -19.511  1.00 39.29 ? 253 HIS C ND1   1 
ATOM   7552  C  CD2   . HIS C  1 272 ? -19.234  -24.780 -20.850  1.00 38.10 ? 253 HIS C CD2   1 
ATOM   7553  C  CE1   . HIS C  1 272 ? -18.583  -22.690 -20.700  1.00 38.04 ? 253 HIS C CE1   1 
ATOM   7554  N  NE2   . HIS C  1 272 ? -18.700  -23.711 -21.534  1.00 36.14 ? 253 HIS C NE2   1 
ATOM   7555  N  N     . THR C  1 273 ? -21.258  -28.055 -17.123  1.00 39.84 ? 254 THR C N     1 
ATOM   7556  C  CA    . THR C  1 273 ? -21.852  -28.644 -15.928  1.00 39.97 ? 254 THR C CA    1 
ATOM   7557  C  C     . THR C  1 273 ? -20.841  -28.628 -14.766  1.00 40.30 ? 254 THR C C     1 
ATOM   7558  O  O     . THR C  1 273 ? -19.803  -29.265 -14.819  1.00 39.26 ? 254 THR C O     1 
ATOM   7559  C  CB    . THR C  1 273 ? -22.305  -30.059 -16.224  1.00 40.21 ? 254 THR C CB    1 
ATOM   7560  O  OG1   . THR C  1 273 ? -23.306  -30.023 -17.261  1.00 37.49 ? 254 THR C OG1   1 
ATOM   7561  C  CG2   . THR C  1 273 ? -22.809  -30.716 -14.965  1.00 38.20 ? 254 THR C CG2   1 
ATOM   7562  N  N     . ASN C  1 274 ? -21.138  -27.828 -13.747  1.00 41.35 ? 255 ASN C N     1 
ATOM   7563  C  CA    . ASN C  1 274 ? -20.305  -27.741 -12.543  1.00 41.48 ? 255 ASN C CA    1 
ATOM   7564  C  C     . ASN C  1 274 ? -20.796  -28.786 -11.566  1.00 41.77 ? 255 ASN C C     1 
ATOM   7565  O  O     . ASN C  1 274 ? -21.991  -28.990 -11.438  1.00 40.78 ? 255 ASN C O     1 
ATOM   7566  C  CB    . ASN C  1 274 ? -20.394  -26.359 -11.951  1.00 40.51 ? 255 ASN C CB    1 
ATOM   7567  C  CG    . ASN C  1 274 ? -19.950  -25.313 -12.918  1.00 41.86 ? 255 ASN C CG    1 
ATOM   7568  O  OD1   . ASN C  1 274 ? -18.749  -25.018 -13.037  1.00 43.17 ? 255 ASN C OD1   1 
ATOM   7569  N  ND2   . ASN C  1 274 ? -20.903  -24.741 -13.647  1.00 41.96 ? 255 ASN C ND2   1 
ATOM   7570  N  N     . PHE C  1 275 ? -19.875  -29.436 -10.871  1.00 42.91 ? 256 PHE C N     1 
ATOM   7571  C  CA    . PHE C  1 275 ? -20.214  -30.633 -10.084  1.00 43.78 ? 256 PHE C CA    1 
ATOM   7572  C  C     . PHE C  1 275 ? -19.401  -30.722 -8.801   1.00 44.67 ? 256 PHE C C     1 
ATOM   7573  O  O     . PHE C  1 275 ? -18.176  -30.493 -8.820   1.00 45.41 ? 256 PHE C O     1 
ATOM   7574  C  CB    . PHE C  1 275 ? -19.955  -31.876 -10.942  1.00 43.73 ? 256 PHE C CB    1 
ATOM   7575  C  CG    . PHE C  1 275 ? -20.080  -33.179 -10.218  1.00 43.62 ? 256 PHE C CG    1 
ATOM   7576  C  CD1   . PHE C  1 275 ? -21.166  -33.449 -9.408   1.00 44.50 ? 256 PHE C CD1   1 
ATOM   7577  C  CD2   . PHE C  1 275 ? -19.128  -34.168 -10.391  1.00 45.25 ? 256 PHE C CD2   1 
ATOM   7578  C  CE1   . PHE C  1 275 ? -21.282  -34.665 -8.762   1.00 45.32 ? 256 PHE C CE1   1 
ATOM   7579  C  CE2   . PHE C  1 275 ? -19.250  -35.394 -9.748   1.00 44.38 ? 256 PHE C CE2   1 
ATOM   7580  C  CZ    . PHE C  1 275 ? -20.315  -35.639 -8.927   1.00 44.15 ? 256 PHE C CZ    1 
ATOM   7581  N  N     . SER C  1 276 ? -20.080  -31.055 -7.709   1.00 44.73 ? 257 SER C N     1 
ATOM   7582  C  CA    . SER C  1 276 ? -19.420  -31.339 -6.455   1.00 45.14 ? 257 SER C CA    1 
ATOM   7583  C  C     . SER C  1 276 ? -20.183  -32.341 -5.612   1.00 45.76 ? 257 SER C C     1 
ATOM   7584  O  O     . SER C  1 276 ? -21.382  -32.480 -5.740   1.00 47.09 ? 257 SER C O     1 
ATOM   7585  C  CB    . SER C  1 276 ? -19.201  -30.062 -5.660   1.00 45.20 ? 257 SER C CB    1 
ATOM   7586  O  OG    . SER C  1 276 ? -20.398  -29.479 -5.210   1.00 44.32 ? 257 SER C OG    1 
ATOM   7587  N  N     . THR C  1 277 ? -19.461  -33.067 -4.785   1.00 46.53 ? 258 THR C N     1 
ATOM   7588  C  CA    . THR C  1 277 ? -20.034  -33.900 -3.737   1.00 47.19 ? 258 THR C CA    1 
ATOM   7589  C  C     . THR C  1 277 ? -19.748  -33.233 -2.379   1.00 47.80 ? 258 THR C C     1 
ATOM   7590  O  O     . THR C  1 277 ? -18.994  -32.253 -2.268   1.00 47.03 ? 258 THR C O     1 
ATOM   7591  C  CB    . THR C  1 277 ? -19.391  -35.310 -3.733   1.00 47.08 ? 258 THR C CB    1 
ATOM   7592  O  OG1   . THR C  1 277 ? -17.961  -35.178 -3.646   1.00 47.55 ? 258 THR C OG1   1 
ATOM   7593  C  CG2   . THR C  1 277 ? -19.723  -36.065 -4.996   1.00 46.41 ? 258 THR C CG2   1 
ATOM   7594  N  N     . LYS C  1 278 ? -20.345  -33.785 -1.336   1.00 49.06 ? 259 LYS C N     1 
ATOM   7595  C  CA    . LYS C  1 278 ? -20.075  -33.313 0.013    1.00 49.49 ? 259 LYS C CA    1 
ATOM   7596  C  C     . LYS C  1 278 ? -18.579  -33.249 0.288    1.00 49.38 ? 259 LYS C C     1 
ATOM   7597  O  O     . LYS C  1 278 ? -18.054  -32.233 0.788    1.00 49.28 ? 259 LYS C O     1 
ATOM   7598  C  CB    . LYS C  1 278 ? -20.702  -34.248 1.029    1.00 50.35 ? 259 LYS C CB    1 
ATOM   7599  C  CG    . LYS C  1 278 ? -20.767  -33.647 2.398    1.00 50.92 ? 259 LYS C CG    1 
ATOM   7600  C  CD    . LYS C  1 278 ? -21.393  -34.629 3.381    1.00 52.26 ? 259 LYS C CD    1 
ATOM   7601  C  CE    . LYS C  1 278 ? -21.310  -34.085 4.806    1.00 53.85 ? 259 LYS C CE    1 
ATOM   7602  N  NZ    . LYS C  1 278 ? -20.920  -35.188 5.699    1.00 54.45 ? 259 LYS C NZ    1 
ATOM   7603  N  N     . ALA C  1 279 ? -17.906  -34.354 -0.041   1.00 49.08 ? 260 ALA C N     1 
ATOM   7604  C  CA    . ALA C  1 279 ? -16.466  -34.474 0.142    1.00 48.26 ? 260 ALA C CA    1 
ATOM   7605  C  C     . ALA C  1 279 ? -15.771  -33.326 -0.575   1.00 47.83 ? 260 ALA C C     1 
ATOM   7606  O  O     . ALA C  1 279 ? -14.974  -32.626 0.020    1.00 48.17 ? 260 ALA C O     1 
ATOM   7607  C  CB    . ALA C  1 279 ? -15.969  -35.843 -0.356   1.00 47.34 ? 260 ALA C CB    1 
ATOM   7608  N  N     . MET C  1 280 ? -16.101  -33.088 -1.833   1.00 47.75 ? 261 MET C N     1 
ATOM   7609  C  CA    . MET C  1 280 ? -15.428  -32.013 -2.578   1.00 48.18 ? 261 MET C CA    1 
ATOM   7610  C  C     . MET C  1 280 ? -15.619  -30.596 -2.005   1.00 48.57 ? 261 MET C C     1 
ATOM   7611  O  O     . MET C  1 280 ? -14.757  -29.746 -2.207   1.00 47.58 ? 261 MET C O     1 
ATOM   7612  C  CB    . MET C  1 280 ? -15.842  -32.028 -4.036   1.00 48.09 ? 261 MET C CB    1 
ATOM   7613  C  CG    . MET C  1 280 ? -15.471  -33.293 -4.743   1.00 48.26 ? 261 MET C CG    1 
ATOM   7614  S  SD    . MET C  1 280 ? -16.191  -33.413 -6.374   1.00 45.76 ? 261 MET C SD    1 
ATOM   7615  C  CE    . MET C  1 280 ? -16.004  -35.172 -6.723   1.00 46.68 ? 261 MET C CE    1 
ATOM   7616  N  N     . ARG C  1 281 ? -16.724  -30.367 -1.292   1.00 49.24 ? 262 ARG C N     1 
ATOM   7617  C  CA    . ARG C  1 281 ? -17.068  -29.051 -0.729   1.00 50.17 ? 262 ARG C CA    1 
ATOM   7618  C  C     . ARG C  1 281 ? -16.421  -28.775 0.618    1.00 50.90 ? 262 ARG C C     1 
ATOM   7619  O  O     . ARG C  1 281 ? -16.297  -27.615 1.012    1.00 50.79 ? 262 ARG C O     1 
ATOM   7620  C  CB    . ARG C  1 281 ? -18.599  -28.899 -0.570   1.00 49.72 ? 262 ARG C CB    1 
ATOM   7621  C  CG    . ARG C  1 281 ? -19.334  -29.017 -1.887   1.00 50.11 ? 262 ARG C CG    1 
ATOM   7622  C  CD    . ARG C  1 281 ? -20.770  -28.583 -1.857   1.00 50.07 ? 262 ARG C CD    1 
ATOM   7623  N  NE    . ARG C  1 281 ? -21.655  -29.551 -1.218   1.00 49.95 ? 262 ARG C NE    1 
ATOM   7624  C  CZ    . ARG C  1 281 ? -22.115  -30.649 -1.799   1.00 48.26 ? 262 ARG C CZ    1 
ATOM   7625  N  NH1   . ARG C  1 281 ? -21.758  -30.957 -3.027   1.00 48.03 ? 262 ARG C NH1   1 
ATOM   7626  N  NH2   . ARG C  1 281 ? -22.908  -31.465 -1.119   1.00 50.47 ? 262 ARG C NH2   1 
ATOM   7627  N  N     . GLU C  1 282 ? -16.019  -29.837 1.322    1.00 52.40 ? 263 GLU C N     1 
ATOM   7628  C  CA    . GLU C  1 282 ? -15.379  -29.726 2.662    1.00 52.96 ? 263 GLU C CA    1 
ATOM   7629  C  C     . GLU C  1 282 ? -13.955  -29.273 2.551    1.00 53.28 ? 263 GLU C C     1 
ATOM   7630  O  O     . GLU C  1 282 ? -13.430  -29.125 1.455    1.00 52.45 ? 263 GLU C O     1 
ATOM   7631  C  CB    . GLU C  1 282 ? -15.468  -31.048 3.434    1.00 53.08 ? 263 GLU C CB    1 
ATOM   7632  C  CG    . GLU C  1 282 ? -16.911  -31.319 3.902    1.00 53.84 ? 263 GLU C CG    1 
ATOM   7633  C  CD    . GLU C  1 282 ? -17.155  -32.739 4.402    1.00 54.65 ? 263 GLU C CD    1 
ATOM   7634  O  OE1   . GLU C  1 282 ? -16.290  -33.634 4.229    1.00 56.30 ? 263 GLU C OE1   1 
ATOM   7635  O  OE2   . GLU C  1 282 ? -18.252  -32.959 4.971    1.00 58.37 ? 263 GLU C OE2   1 
ATOM   7636  N  N     . GLU C  1 283 ? -13.336  -29.012 3.691    1.00 54.47 ? 264 GLU C N     1 
ATOM   7637  C  CA    . GLU C  1 283 ? -11.966  -28.527 3.669    1.00 55.43 ? 264 GLU C CA    1 
ATOM   7638  C  C     . GLU C  1 283 ? -11.092  -29.570 2.958    1.00 54.87 ? 264 GLU C C     1 
ATOM   7639  O  O     . GLU C  1 283 ? -11.289  -30.774 3.097    1.00 53.70 ? 264 GLU C O     1 
ATOM   7640  C  CB    . GLU C  1 283 ? -11.438  -28.167 5.077    1.00 56.13 ? 264 GLU C CB    1 
ATOM   7641  C  CG    . GLU C  1 283 ? -12.042  -26.872 5.677    1.00 58.81 ? 264 GLU C CG    1 
ATOM   7642  C  CD    . GLU C  1 283 ? -11.720  -25.599 4.849    1.00 63.73 ? 264 GLU C CD    1 
ATOM   7643  O  OE1   . GLU C  1 283 ? -10.515  -25.327 4.578    1.00 66.42 ? 264 GLU C OE1   1 
ATOM   7644  O  OE2   . GLU C  1 283 ? -12.668  -24.859 4.474    1.00 65.45 ? 264 GLU C OE2   1 
ATOM   7645  N  N     . ASN C  1 284 ? -10.173  -29.065 2.151    1.00 55.01 ? 265 ASN C N     1 
ATOM   7646  C  CA    . ASN C  1 284 ? -9.326   -29.891 1.299    1.00 55.56 ? 265 ASN C CA    1 
ATOM   7647  C  C     . ASN C  1 284 ? -10.058  -30.822 0.331    1.00 55.21 ? 265 ASN C C     1 
ATOM   7648  O  O     . ASN C  1 284 ? -9.483   -31.792 -0.147   1.00 55.33 ? 265 ASN C O     1 
ATOM   7649  C  CB    . ASN C  1 284 ? -8.325   -30.685 2.147    1.00 56.18 ? 265 ASN C CB    1 
ATOM   7650  C  CG    . ASN C  1 284 ? -7.216   -29.801 2.723    1.00 57.57 ? 265 ASN C CG    1 
ATOM   7651  O  OD1   . ASN C  1 284 ? -6.945   -29.836 3.941    1.00 57.89 ? 265 ASN C OD1   1 
ATOM   7652  N  ND2   . ASN C  1 284 ? -6.560   -29.014 1.845    1.00 56.56 ? 265 ASN C ND2   1 
ATOM   7653  N  N     . GLY C  1 285 ? -11.297  -30.505 -0.002   1.00 54.56 ? 266 GLY C N     1 
ATOM   7654  C  CA    . GLY C  1 285 ? -12.014  -31.285 -0.975   1.00 54.29 ? 266 GLY C CA    1 
ATOM   7655  C  C     . GLY C  1 285 ? -11.380  -31.312 -2.363   1.00 53.98 ? 266 GLY C C     1 
ATOM   7656  O  O     . GLY C  1 285 ? -11.784  -32.129 -3.204   1.00 53.25 ? 266 GLY C O     1 
ATOM   7657  N  N     . LEU C  1 286 ? -10.374  -30.468 -2.623   1.00 53.71 ? 267 LEU C N     1 
ATOM   7658  C  CA    . LEU C  1 286 ? -9.677   -30.542 -3.920   1.00 53.65 ? 267 LEU C CA    1 
ATOM   7659  C  C     . LEU C  1 286 ? -9.067   -31.914 -4.197   1.00 53.39 ? 267 LEU C C     1 
ATOM   7660  O  O     . LEU C  1 286 ? -8.938   -32.303 -5.334   1.00 53.49 ? 267 LEU C O     1 
ATOM   7661  C  CB    . LEU C  1 286 ? -8.614   -29.442 -4.072   1.00 53.66 ? 267 LEU C CB    1 
ATOM   7662  C  CG    . LEU C  1 286 ? -7.885   -29.291 -5.430   1.00 53.43 ? 267 LEU C CG    1 
ATOM   7663  C  CD1   . LEU C  1 286 ? -8.857   -28.938 -6.585   1.00 50.38 ? 267 LEU C CD1   1 
ATOM   7664  C  CD2   . LEU C  1 286 ? -6.757   -28.271 -5.283   1.00 52.30 ? 267 LEU C CD2   1 
ATOM   7665  N  N     . LYS C  1 287 ? -8.682   -32.637 -3.160   1.00 53.68 ? 268 LYS C N     1 
ATOM   7666  C  CA    . LYS C  1 287 ? -8.199   -33.997 -3.322   1.00 54.11 ? 268 LYS C CA    1 
ATOM   7667  C  C     . LYS C  1 287 ? -9.213   -34.858 -4.117   1.00 53.75 ? 268 LYS C C     1 
ATOM   7668  O  O     . LYS C  1 287 ? -8.853   -35.560 -5.066   1.00 52.98 ? 268 LYS C O     1 
ATOM   7669  C  CB    . LYS C  1 287 ? -7.929   -34.586 -1.933   1.00 54.15 ? 268 LYS C CB    1 
ATOM   7670  C  CG    . LYS C  1 287 ? -7.523   -36.057 -1.912   1.00 54.63 ? 268 LYS C CG    1 
ATOM   7671  C  CD    . LYS C  1 287 ? -7.601   -36.634 -0.479   1.00 56.18 ? 268 LYS C CD    1 
ATOM   7672  C  CE    . LYS C  1 287 ? -6.977   -38.034 -0.365   1.00 57.19 ? 268 LYS C CE    1 
ATOM   7673  N  NZ    . LYS C  1 287 ? -7.984   -39.043 -0.727   1.00 58.77 ? 268 LYS C NZ    1 
ATOM   7674  N  N     . TYR C  1 288 ? -10.482  -34.769 -3.714   1.00 53.51 ? 269 TYR C N     1 
ATOM   7675  C  CA    . TYR C  1 288 ? -11.565  -35.521 -4.324   1.00 53.34 ? 269 TYR C CA    1 
ATOM   7676  C  C     . TYR C  1 288 ? -12.032  -34.960 -5.662   1.00 52.59 ? 269 TYR C C     1 
ATOM   7677  O  O     . TYR C  1 288 ? -12.521  -35.711 -6.495   1.00 51.66 ? 269 TYR C O     1 
ATOM   7678  C  CB    . TYR C  1 288 ? -12.732  -35.572 -3.370   1.00 54.54 ? 269 TYR C CB    1 
ATOM   7679  C  CG    . TYR C  1 288 ? -12.388  -36.201 -2.046   1.00 55.24 ? 269 TYR C CG    1 
ATOM   7680  C  CD1   . TYR C  1 288 ? -12.203  -37.588 -1.948   1.00 55.87 ? 269 TYR C CD1   1 
ATOM   7681  C  CD2   . TYR C  1 288 ? -12.246  -35.416 -0.890   1.00 56.05 ? 269 TYR C CD2   1 
ATOM   7682  C  CE1   . TYR C  1 288 ? -11.869  -38.176 -0.731   1.00 56.50 ? 269 TYR C CE1   1 
ATOM   7683  C  CE2   . TYR C  1 288 ? -11.913  -35.986 0.326    1.00 55.77 ? 269 TYR C CE2   1 
ATOM   7684  C  CZ    . TYR C  1 288 ? -11.733  -37.367 0.392    1.00 56.58 ? 269 TYR C CZ    1 
ATOM   7685  O  OH    . TYR C  1 288 ? -11.439  -37.955 1.568    1.00 56.47 ? 269 TYR C OH    1 
ATOM   7686  N  N     . ILE C  1 289 ? -11.893  -33.647 -5.855   1.00 51.93 ? 270 ILE C N     1 
ATOM   7687  C  CA    . ILE C  1 289 ? -12.074  -33.059 -7.163   1.00 51.89 ? 270 ILE C CA    1 
ATOM   7688  C  C     . ILE C  1 289 ? -11.100  -33.712 -8.110   1.00 52.16 ? 270 ILE C C     1 
ATOM   7689  O  O     . ILE C  1 289 ? -11.484  -34.241 -9.159   1.00 52.34 ? 270 ILE C O     1 
ATOM   7690  C  CB    . ILE C  1 289 ? -11.838  -31.546 -7.182   1.00 51.74 ? 270 ILE C CB    1 
ATOM   7691  C  CG1   . ILE C  1 289 ? -12.982  -30.828 -6.465   1.00 51.52 ? 270 ILE C CG1   1 
ATOM   7692  C  CG2   . ILE C  1 289 ? -11.762  -31.058 -8.613   1.00 51.08 ? 270 ILE C CG2   1 
ATOM   7693  C  CD1   . ILE C  1 289 ? -12.749  -29.366 -6.136   1.00 50.48 ? 270 ILE C CD1   1 
ATOM   7694  N  N     . GLU C  1 290 ? -9.836   -33.706 -7.725   1.00 52.12 ? 271 GLU C N     1 
ATOM   7695  C  CA    . GLU C  1 290 ? -8.819   -34.258 -8.561   1.00 52.62 ? 271 GLU C CA    1 
ATOM   7696  C  C     . GLU C  1 290 ? -9.007   -35.741 -8.787   1.00 52.10 ? 271 GLU C C     1 
ATOM   7697  O  O     . GLU C  1 290 ? -8.740   -36.196 -9.872   1.00 52.28 ? 271 GLU C O     1 
ATOM   7698  C  CB    . GLU C  1 290 ? -7.434   -33.965 -7.993   1.00 52.85 ? 271 GLU C CB    1 
ATOM   7699  C  CG    . GLU C  1 290 ? -6.939   -32.559 -8.289   1.00 53.78 ? 271 GLU C CG    1 
ATOM   7700  C  CD    . GLU C  1 290 ? -5.843   -32.126 -7.353   1.00 55.36 ? 271 GLU C CD    1 
ATOM   7701  O  OE1   . GLU C  1 290 ? -5.444   -32.949 -6.488   1.00 58.55 ? 271 GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C  1 290 ? -5.378   -30.954 -7.462   1.00 60.93 ? 271 GLU C OE2   1 
ATOM   7703  N  N     . GLU C  1 291 ? -9.445   -36.503 -7.792   1.00 51.89 ? 272 GLU C N     1 
ATOM   7704  C  CA    . GLU C  1 291 ? -9.782   -37.914 -8.022   1.00 52.56 ? 272 GLU C CA    1 
ATOM   7705  C  C     . GLU C  1 291 ? -10.907  -38.091 -9.057   1.00 51.89 ? 272 GLU C C     1 
ATOM   7706  O  O     . GLU C  1 291 ? -10.865  -39.028 -9.879   1.00 51.48 ? 272 GLU C O     1 
ATOM   7707  C  CB    . GLU C  1 291 ? -10.230  -38.616 -6.734   1.00 52.74 ? 272 GLU C CB    1 
ATOM   7708  C  CG    . GLU C  1 291 ? -9.131   -38.919 -5.738   1.00 55.11 ? 272 GLU C CG    1 
ATOM   7709  C  CD    . GLU C  1 291 ? -9.645   -39.605 -4.446   1.00 56.24 ? 272 GLU C CD    1 
ATOM   7710  O  OE1   . GLU C  1 291 ? -10.817  -40.151 -4.430   1.00 59.50 ? 272 GLU C OE1   1 
ATOM   7711  O  OE2   . GLU C  1 291 ? -8.850   -39.595 -3.460   1.00 57.55 ? 272 GLU C OE2   1 
ATOM   7712  N  N     . ALA C  1 292 ? -11.918  -37.219 -8.993   1.00 51.00 ? 273 ALA C N     1 
ATOM   7713  C  CA    . ALA C  1 292 ? -13.046  -37.293 -9.930   1.00 50.95 ? 273 ALA C CA    1 
ATOM   7714  C  C     . ALA C  1 292 ? -12.563  -37.013 -11.362  1.00 50.25 ? 273 ALA C C     1 
ATOM   7715  O  O     . ALA C  1 292 ? -12.920  -37.726 -12.304  1.00 49.30 ? 273 ALA C O     1 
ATOM   7716  C  CB    . ALA C  1 292 ? -14.217  -36.335 -9.511   1.00 49.95 ? 273 ALA C CB    1 
ATOM   7717  N  N     . ILE C  1 293 ? -11.725  -35.995 -11.507  1.00 50.09 ? 274 ILE C N     1 
ATOM   7718  C  CA    . ILE C  1 293 ? -11.208  -35.617 -12.809  1.00 50.55 ? 274 ILE C CA    1 
ATOM   7719  C  C     . ILE C  1 293 ? -10.331  -36.740 -13.410  1.00 51.00 ? 274 ILE C C     1 
ATOM   7720  O  O     . ILE C  1 293 ? -10.296  -36.916 -14.629  1.00 51.49 ? 274 ILE C O     1 
ATOM   7721  C  CB    . ILE C  1 293 ? -10.409  -34.312 -12.727  1.00 50.38 ? 274 ILE C CB    1 
ATOM   7722  C  CG1   . ILE C  1 293 ? -11.318  -33.129 -12.372  1.00 50.22 ? 274 ILE C CG1   1 
ATOM   7723  C  CG2   . ILE C  1 293 ? -9.677   -34.059 -14.026  1.00 49.74 ? 274 ILE C CG2   1 
ATOM   7724  C  CD1   . ILE C  1 293 ? -10.572  -31.806 -12.210  1.00 49.74 ? 274 ILE C CD1   1 
ATOM   7725  N  N     . GLU C  1 294 ? -9.650   -37.512 -12.579  1.00 51.08 ? 275 GLU C N     1 
ATOM   7726  C  CA    . GLU C  1 294 ? -8.840   -38.592 -13.100  1.00 51.50 ? 275 GLU C CA    1 
ATOM   7727  C  C     . GLU C  1 294 ? -9.744   -39.717 -13.641  1.00 51.37 ? 275 GLU C C     1 
ATOM   7728  O  O     . GLU C  1 294 ? -9.518   -40.286 -14.717  1.00 51.43 ? 275 GLU C O     1 
ATOM   7729  C  CB    . GLU C  1 294 ? -7.847   -39.062 -12.025  1.00 52.44 ? 275 GLU C CB    1 
ATOM   7730  C  CG    . GLU C  1 294 ? -7.199   -40.446 -12.199  1.00 53.93 ? 275 GLU C CG    1 
ATOM   7731  C  CD    . GLU C  1 294 ? -5.938   -40.486 -13.081  1.00 59.49 ? 275 GLU C CD    1 
ATOM   7732  O  OE1   . GLU C  1 294 ? -5.361   -39.419 -13.433  1.00 61.66 ? 275 GLU C OE1   1 
ATOM   7733  O  OE2   . GLU C  1 294 ? -5.513   -41.633 -13.404  1.00 61.70 ? 275 GLU C OE2   1 
ATOM   7734  N  N     . LYS C  1 295 ? -10.803  -40.017 -12.921  1.00 51.01 ? 276 LYS C N     1 
ATOM   7735  C  CA    . LYS C  1 295 ? -11.766  -40.978 -13.430  1.00 50.79 ? 276 LYS C CA    1 
ATOM   7736  C  C     . LYS C  1 295 ? -12.406  -40.485 -14.731  1.00 50.38 ? 276 LYS C C     1 
ATOM   7737  O  O     . LYS C  1 295 ? -12.683  -41.288 -15.626  1.00 49.90 ? 276 LYS C O     1 
ATOM   7738  C  CB    . LYS C  1 295 ? -12.814  -41.271 -12.374  1.00 50.78 ? 276 LYS C CB    1 
ATOM   7739  C  CG    . LYS C  1 295 ? -12.264  -42.023 -11.168  1.00 51.05 ? 276 LYS C CG    1 
ATOM   7740  C  CD    . LYS C  1 295 ? -13.201  -41.931 -9.947   1.00 51.42 ? 276 LYS C CD    1 
ATOM   7741  C  CE    . LYS C  1 295 ? -12.645  -42.760 -8.803   1.00 51.78 ? 276 LYS C CE    1 
ATOM   7742  N  NZ    . LYS C  1 295 ? -13.411  -42.612 -7.547   1.00 52.60 ? 276 LYS C NZ    1 
ATOM   7743  N  N     . LEU C  1 296 ? -12.599  -39.165 -14.848  1.00 50.07 ? 277 LEU C N     1 
ATOM   7744  C  CA    . LEU C  1 296 ? -13.214  -38.595 -16.044  1.00 50.23 ? 277 LEU C CA    1 
ATOM   7745  C  C     . LEU C  1 296 ? -12.291  -38.711 -17.241  1.00 50.20 ? 277 LEU C C     1 
ATOM   7746  O  O     . LEU C  1 296 ? -12.739  -39.011 -18.350  1.00 49.41 ? 277 LEU C O     1 
ATOM   7747  C  CB    . LEU C  1 296 ? -13.695  -37.152 -15.803  1.00 50.09 ? 277 LEU C CB    1 
ATOM   7748  C  CG    . LEU C  1 296 ? -15.032  -37.084 -15.009  1.00 49.43 ? 277 LEU C CG    1 
ATOM   7749  C  CD1   . LEU C  1 296 ? -15.373  -35.701 -14.447  1.00 46.48 ? 277 LEU C CD1   1 
ATOM   7750  C  CD2   . LEU C  1 296 ? -16.170  -37.636 -15.837  1.00 46.44 ? 277 LEU C CD2   1 
ATOM   7751  N  N     . SER C  1 297 ? -10.999  -38.535 -16.979  1.00 50.38 ? 278 SER C N     1 
ATOM   7752  C  CA    . SER C  1 297 ? -9.970   -38.616 -18.002  1.00 50.71 ? 278 SER C CA    1 
ATOM   7753  C  C     . SER C  1 297 ? -9.913   -39.974 -18.723  1.00 50.91 ? 278 SER C C     1 
ATOM   7754  O  O     . SER C  1 297 ? -9.484   -40.052 -19.871  1.00 50.05 ? 278 SER C O     1 
ATOM   7755  C  CB    . SER C  1 297 ? -8.600   -38.269 -17.390  1.00 50.95 ? 278 SER C CB    1 
ATOM   7756  O  OG    . SER C  1 297 ? -8.097   -39.294 -16.541  1.00 51.30 ? 278 SER C OG    1 
ATOM   7757  N  N     . LYS C  1 298 ? -10.380  -41.033 -18.064  1.00 51.47 ? 279 LYS C N     1 
ATOM   7758  C  CA    . LYS C  1 298 ? -10.351  -42.378 -18.651  1.00 51.79 ? 279 LYS C CA    1 
ATOM   7759  C  C     . LYS C  1 298 ? -11.654  -42.765 -19.338  1.00 51.39 ? 279 LYS C C     1 
ATOM   7760  O  O     . LYS C  1 298 ? -11.801  -43.869 -19.861  1.00 51.03 ? 279 LYS C O     1 
ATOM   7761  C  CB    . LYS C  1 298 ? -10.004  -43.393 -17.573  1.00 51.75 ? 279 LYS C CB    1 
ATOM   7762  C  CG    . LYS C  1 298 ? -8.645   -43.134 -16.962  1.00 53.51 ? 279 LYS C CG    1 
ATOM   7763  C  CD    . LYS C  1 298 ? -8.430   -43.974 -15.722  1.00 54.07 ? 279 LYS C CD    1 
ATOM   7764  C  CE    . LYS C  1 298 ? -7.136   -43.625 -15.007  1.00 55.58 ? 279 LYS C CE    1 
ATOM   7765  N  NZ    . LYS C  1 298 ? -6.844   -44.697 -13.978  1.00 57.78 ? 279 LYS C NZ    1 
ATOM   7766  N  N     . ARG C  1 299 ? -12.605  -41.850 -19.354  1.00 51.58 ? 280 ARG C N     1 
ATOM   7767  C  CA    . ARG C  1 299 ? -13.930  -42.162 -19.882  1.00 51.27 ? 280 ARG C CA    1 
ATOM   7768  C  C     . ARG C  1 299 ? -14.451  -41.055 -20.788  1.00 50.28 ? 280 ARG C C     1 
ATOM   7769  O  O     . ARG C  1 299 ? -15.617  -40.793 -20.820  1.00 50.81 ? 280 ARG C O     1 
ATOM   7770  C  CB    . ARG C  1 299 ? -14.867  -42.480 -18.692  1.00 51.40 ? 280 ARG C CB    1 
ATOM   7771  C  CG    . ARG C  1 299 ? -15.268  -43.959 -18.668  1.00 52.98 ? 280 ARG C CG    1 
ATOM   7772  C  CD    . ARG C  1 299 ? -15.668  -44.522 -17.322  1.00 52.57 ? 280 ARG C CD    1 
ATOM   7773  N  NE    . ARG C  1 299 ? -17.101  -44.392 -17.025  1.00 55.32 ? 280 ARG C NE    1 
ATOM   7774  C  CZ    . ARG C  1 299 ? -18.072  -45.091 -17.588  1.00 53.28 ? 280 ARG C CZ    1 
ATOM   7775  N  NH1   . ARG C  1 299 ? -17.819  -46.011 -18.505  1.00 53.20 ? 280 ARG C NH1   1 
ATOM   7776  N  NH2   . ARG C  1 299 ? -19.300  -44.863 -17.194  1.00 54.37 ? 280 ARG C NH2   1 
ATOM   7777  N  N     . HIS C  1 300 ? -13.569  -40.431 -21.555  1.00 49.68 ? 281 HIS C N     1 
ATOM   7778  C  CA    . HIS C  1 300 ? -13.918  -39.276 -22.378  1.00 49.48 ? 281 HIS C CA    1 
ATOM   7779  C  C     . HIS C  1 300 ? -14.982  -39.606 -23.419  1.00 49.45 ? 281 HIS C C     1 
ATOM   7780  O  O     . HIS C  1 300 ? -15.966  -38.852 -23.568  1.00 49.37 ? 281 HIS C O     1 
ATOM   7781  C  CB    . HIS C  1 300 ? -12.666  -38.735 -23.053  1.00 48.87 ? 281 HIS C CB    1 
ATOM   7782  C  CG    . HIS C  1 300 ? -12.890  -37.560 -23.954  1.00 47.84 ? 281 HIS C CG    1 
ATOM   7783  N  ND1   . HIS C  1 300 ? -13.198  -36.304 -23.484  1.00 45.41 ? 281 HIS C ND1   1 
ATOM   7784  C  CD2   . HIS C  1 300 ? -12.796  -37.440 -25.298  1.00 45.88 ? 281 HIS C CD2   1 
ATOM   7785  C  CE1   . HIS C  1 300 ? -13.312  -35.469 -24.497  1.00 45.30 ? 281 HIS C CE1   1 
ATOM   7786  N  NE2   . HIS C  1 300 ? -13.079  -36.131 -25.612  1.00 44.95 ? 281 HIS C NE2   1 
ATOM   7787  N  N     . GLN C  1 301 ? -14.822  -40.712 -24.140  1.00 49.08 ? 282 GLN C N     1 
ATOM   7788  C  CA    . GLN C  1 301 ? -15.766  -40.998 -25.227  1.00 49.36 ? 282 GLN C CA    1 
ATOM   7789  C  C     . GLN C  1 301 ? -17.169  -41.276 -24.728  1.00 48.55 ? 282 GLN C C     1 
ATOM   7790  O  O     . GLN C  1 301 ? -18.139  -40.866 -25.345  1.00 47.85 ? 282 GLN C O     1 
ATOM   7791  C  CB    . GLN C  1 301 ? -15.274  -42.095 -26.137  1.00 49.78 ? 282 GLN C CB    1 
ATOM   7792  C  CG    . GLN C  1 301 ? -14.061  -41.613 -26.951  1.00 55.43 ? 282 GLN C CG    1 
ATOM   7793  C  CD    . GLN C  1 301 ? -14.446  -40.928 -28.287  1.00 62.04 ? 282 GLN C CD    1 
ATOM   7794  O  OE1   . GLN C  1 301 ? -14.689  -41.629 -29.296  1.00 66.37 ? 282 GLN C OE1   1 
ATOM   7795  N  NE2   . GLN C  1 301 ? -14.475  -39.564 -28.310  1.00 63.08 ? 282 GLN C NE2   1 
ATOM   7796  N  N     . TYR C  1 302 ? -17.247  -41.933 -23.581  1.00 48.21 ? 283 TYR C N     1 
ATOM   7797  C  CA    . TYR C  1 302 ? -18.497  -42.324 -22.995  1.00 47.96 ? 283 TYR C CA    1 
ATOM   7798  C  C     . TYR C  1 302 ? -19.286  -41.060 -22.654  1.00 47.57 ? 283 TYR C C     1 
ATOM   7799  O  O     . TYR C  1 302 ? -20.462  -40.952 -22.958  1.00 47.03 ? 283 TYR C O     1 
ATOM   7800  C  CB    . TYR C  1 302 ? -18.239  -43.160 -21.748  1.00 47.92 ? 283 TYR C CB    1 
ATOM   7801  C  CG    . TYR C  1 302 ? -19.472  -43.512 -20.994  1.00 48.11 ? 283 TYR C CG    1 
ATOM   7802  C  CD1   . TYR C  1 302 ? -20.236  -44.599 -21.351  1.00 48.70 ? 283 TYR C CD1   1 
ATOM   7803  C  CD2   . TYR C  1 302 ? -19.889  -42.737 -19.919  1.00 48.43 ? 283 TYR C CD2   1 
ATOM   7804  C  CE1   . TYR C  1 302 ? -21.397  -44.908 -20.652  1.00 49.45 ? 283 TYR C CE1   1 
ATOM   7805  C  CE2   . TYR C  1 302 ? -21.036  -43.023 -19.227  1.00 48.17 ? 283 TYR C CE2   1 
ATOM   7806  C  CZ    . TYR C  1 302 ? -21.783  -44.112 -19.584  1.00 48.98 ? 283 TYR C CZ    1 
ATOM   7807  O  OH    . TYR C  1 302 ? -22.913  -44.399 -18.870  1.00 48.99 ? 283 TYR C OH    1 
ATOM   7808  N  N     . HIS C  1 303 ? -18.618  -40.104 -22.034  1.00 47.44 ? 284 HIS C N     1 
ATOM   7809  C  CA    . HIS C  1 303 ? -19.224  -38.786 -21.771  1.00 47.02 ? 284 HIS C CA    1 
ATOM   7810  C  C     . HIS C  1 303 ? -19.608  -37.998 -23.008  1.00 46.46 ? 284 HIS C C     1 
ATOM   7811  O  O     . HIS C  1 303 ? -20.755  -37.604 -23.107  1.00 47.27 ? 284 HIS C O     1 
ATOM   7812  C  CB    . HIS C  1 303 ? -18.375  -37.976 -20.805  1.00 46.48 ? 284 HIS C CB    1 
ATOM   7813  C  CG    . HIS C  1 303 ? -18.443  -38.522 -19.427  1.00 45.97 ? 284 HIS C CG    1 
ATOM   7814  N  ND1   . HIS C  1 303 ? -18.957  -37.812 -18.372  1.00 46.85 ? 284 HIS C ND1   1 
ATOM   7815  C  CD2   . HIS C  1 303 ? -18.171  -39.762 -18.954  1.00 45.92 ? 284 HIS C CD2   1 
ATOM   7816  C  CE1   . HIS C  1 303 ? -18.928  -38.573 -17.288  1.00 47.89 ? 284 HIS C CE1   1 
ATOM   7817  N  NE2   . HIS C  1 303 ? -18.466  -39.767 -17.617  1.00 45.37 ? 284 HIS C NE2   1 
ATOM   7818  N  N     . ILE C  1 304 ? -18.714  -37.834 -23.966  1.00 45.65 ? 285 ILE C N     1 
ATOM   7819  C  CA    . ILE C  1 304 ? -19.081  -37.218 -25.243  1.00 46.15 ? 285 ILE C CA    1 
ATOM   7820  C  C     . ILE C  1 304 ? -20.420  -37.785 -25.832  1.00 46.33 ? 285 ILE C C     1 
ATOM   7821  O  O     . ILE C  1 304 ? -21.302  -37.028 -26.265  1.00 44.87 ? 285 ILE C O     1 
ATOM   7822  C  CB    . ILE C  1 304 ? -17.920  -37.334 -26.267  1.00 45.45 ? 285 ILE C CB    1 
ATOM   7823  C  CG1   . ILE C  1 304 ? -16.725  -36.456 -25.832  1.00 45.59 ? 285 ILE C CG1   1 
ATOM   7824  C  CG2   . ILE C  1 304 ? -18.374  -36.948 -27.636  1.00 44.43 ? 285 ILE C CG2   1 
ATOM   7825  C  CD1   . ILE C  1 304 ? -17.049  -34.970 -25.707  1.00 41.93 ? 285 ILE C CD1   1 
ATOM   7826  N  N     . ARG C  1 305 ? -20.546  -39.113 -25.833  1.00 47.00 ? 286 ARG C N     1 
ATOM   7827  C  CA    . ARG C  1 305 ? -21.749  -39.778 -26.305  1.00 47.98 ? 286 ARG C CA    1 
ATOM   7828  C  C     . ARG C  1 305 ? -22.959  -39.384 -25.467  1.00 46.88 ? 286 ARG C C     1 
ATOM   7829  O  O     . ARG C  1 305 ? -24.068  -39.328 -25.980  1.00 46.86 ? 286 ARG C O     1 
ATOM   7830  C  CB    . ARG C  1 305 ? -21.600  -41.312 -26.310  1.00 48.10 ? 286 ARG C CB    1 
ATOM   7831  C  CG    . ARG C  1 305 ? -20.687  -41.814 -27.448  1.00 51.77 ? 286 ARG C CG    1 
ATOM   7832  C  CD    . ARG C  1 305 ? -20.760  -43.384 -27.694  1.00 54.19 ? 286 ARG C CD    1 
ATOM   7833  N  NE    . ARG C  1 305 ? -20.348  -44.206 -26.526  1.00 59.56 ? 286 ARG C NE    1 
ATOM   7834  C  CZ    . ARG C  1 305 ? -19.089  -44.579 -26.208  1.00 60.16 ? 286 ARG C CZ    1 
ATOM   7835  N  NH1   . ARG C  1 305 ? -18.049  -44.209 -26.957  1.00 61.08 ? 286 ARG C NH1   1 
ATOM   7836  N  NH2   . ARG C  1 305 ? -18.865  -45.312 -25.103  1.00 60.21 ? 286 ARG C NH2   1 
ATOM   7837  N  N     . ALA C  1 306 ? -22.739  -39.121 -24.188  1.00 45.57 ? 287 ALA C N     1 
ATOM   7838  C  CA    . ALA C  1 306 ? -23.815  -38.793 -23.293  1.00 45.43 ? 287 ALA C CA    1 
ATOM   7839  C  C     . ALA C  1 306 ? -24.151  -37.285 -23.322  1.00 44.95 ? 287 ALA C C     1 
ATOM   7840  O  O     . ALA C  1 306 ? -25.130  -36.866 -22.744  1.00 44.33 ? 287 ALA C O     1 
ATOM   7841  C  CB    . ALA C  1 306 ? -23.459  -39.251 -21.880  1.00 44.35 ? 287 ALA C CB    1 
ATOM   7842  N  N     . TYR C  1 307 ? -23.339  -36.491 -24.008  1.00 44.90 ? 288 TYR C N     1 
ATOM   7843  C  CA    . TYR C  1 307 ? -23.323  -35.054 -23.852  1.00 45.00 ? 288 TYR C CA    1 
ATOM   7844  C  C     . TYR C  1 307 ? -24.005  -34.334 -25.007  1.00 45.27 ? 288 TYR C C     1 
ATOM   7845  O  O     . TYR C  1 307 ? -24.058  -33.118 -24.994  1.00 45.23 ? 288 TYR C O     1 
ATOM   7846  C  CB    . TYR C  1 307 ? -21.869  -34.569 -23.682  1.00 44.85 ? 288 TYR C CB    1 
ATOM   7847  C  CG    . TYR C  1 307 ? -21.281  -34.670 -22.264  1.00 43.94 ? 288 TYR C CG    1 
ATOM   7848  C  CD1   . TYR C  1 307 ? -21.964  -35.298 -21.239  1.00 44.29 ? 288 TYR C CD1   1 
ATOM   7849  C  CD2   . TYR C  1 307 ? -20.021  -34.184 -21.980  1.00 44.36 ? 288 TYR C CD2   1 
ATOM   7850  C  CE1   . TYR C  1 307 ? -21.447  -35.405 -19.974  1.00 43.92 ? 288 TYR C CE1   1 
ATOM   7851  C  CE2   . TYR C  1 307 ? -19.483  -34.300 -20.693  1.00 45.11 ? 288 TYR C CE2   1 
ATOM   7852  C  CZ    . TYR C  1 307 ? -20.226  -34.915 -19.692  1.00 43.82 ? 288 TYR C CZ    1 
ATOM   7853  O  OH    . TYR C  1 307 ? -19.752  -35.068 -18.410  1.00 42.99 ? 288 TYR C OH    1 
ATOM   7854  N  N     . ASP C  1 308 ? -24.538  -35.057 -25.993  1.00 45.50 ? 289 ASP C N     1 
ATOM   7855  C  CA    . ASP C  1 308 ? -25.547  -34.461 -26.866  1.00 46.28 ? 289 ASP C CA    1 
ATOM   7856  C  C     . ASP C  1 308 ? -26.558  -35.515 -27.377  1.00 47.15 ? 289 ASP C C     1 
ATOM   7857  O  O     . ASP C  1 308 ? -26.298  -36.706 -27.286  1.00 47.49 ? 289 ASP C O     1 
ATOM   7858  C  CB    . ASP C  1 308 ? -24.924  -33.580 -27.975  1.00 46.40 ? 289 ASP C CB    1 
ATOM   7859  C  CG    . ASP C  1 308 ? -24.268  -34.376 -29.103  1.00 46.32 ? 289 ASP C CG    1 
ATOM   7860  O  OD1   . ASP C  1 308 ? -25.001  -35.156 -29.753  1.00 45.37 ? 289 ASP C OD1   1 
ATOM   7861  O  OD2   . ASP C  1 308 ? -23.033  -34.175 -29.377  1.00 46.29 ? 289 ASP C OD2   1 
ATOM   7862  N  N     . PRO C  1 309 ? -27.734  -35.076 -27.882  1.00 47.53 ? 290 PRO C N     1 
ATOM   7863  C  CA    . PRO C  1 309 ? -28.748  -36.061 -28.214  1.00 47.51 ? 290 PRO C CA    1 
ATOM   7864  C  C     . PRO C  1 309 ? -28.417  -36.893 -29.443  1.00 47.72 ? 290 PRO C C     1 
ATOM   7865  O  O     . PRO C  1 309 ? -29.073  -37.894 -29.686  1.00 48.13 ? 290 PRO C O     1 
ATOM   7866  C  CB    . PRO C  1 309 ? -30.013  -35.224 -28.440  1.00 47.38 ? 290 PRO C CB    1 
ATOM   7867  C  CG    . PRO C  1 309 ? -29.648  -33.818 -28.076  1.00 47.71 ? 290 PRO C CG    1 
ATOM   7868  C  CD    . PRO C  1 309 ? -28.181  -33.704 -28.173  1.00 47.70 ? 290 PRO C CD    1 
ATOM   7869  N  N     . LYS C  1 310 ? -27.413  -36.501 -30.206  1.00 48.36 ? 291 LYS C N     1 
ATOM   7870  C  CA    . LYS C  1 310 ? -26.990  -37.282 -31.374  1.00 48.92 ? 291 LYS C CA    1 
ATOM   7871  C  C     . LYS C  1 310 ? -25.679  -38.006 -31.114  1.00 48.77 ? 291 LYS C C     1 
ATOM   7872  O  O     . LYS C  1 310 ? -24.966  -38.309 -32.055  1.00 49.34 ? 291 LYS C O     1 
ATOM   7873  C  CB    . LYS C  1 310 ? -26.881  -36.392 -32.631  1.00 49.36 ? 291 LYS C CB    1 
ATOM   7874  C  CG    . LYS C  1 310 ? -28.249  -35.831 -33.114  1.00 50.13 ? 291 LYS C CG    1 
ATOM   7875  C  CD    . LYS C  1 310 ? -28.076  -34.857 -34.305  1.00 51.01 ? 291 LYS C CD    1 
ATOM   7876  C  CE    . LYS C  1 310 ? -29.287  -34.811 -35.255  1.00 51.66 ? 291 LYS C CE    1 
ATOM   7877  N  NZ    . LYS C  1 310 ? -30.547  -34.617 -34.505  1.00 52.80 ? 291 LYS C NZ    1 
ATOM   7878  N  N     . GLY C  1 311 ? -25.384  -38.285 -29.842  1.00 48.41 ? 292 GLY C N     1 
ATOM   7879  C  CA    . GLY C  1 311 ? -24.264  -39.137 -29.452  1.00 48.24 ? 292 GLY C CA    1 
ATOM   7880  C  C     . GLY C  1 311 ? -22.868  -38.585 -29.711  1.00 48.33 ? 292 GLY C C     1 
ATOM   7881  O  O     . GLY C  1 311 ? -21.900  -39.357 -29.771  1.00 48.42 ? 292 GLY C O     1 
ATOM   7882  N  N     . GLY C  1 312 ? -22.764  -37.269 -29.859  1.00 47.72 ? 293 GLY C N     1 
ATOM   7883  C  CA    . GLY C  1 312 ? -21.502  -36.604 -30.095  1.00 47.67 ? 293 GLY C CA    1 
ATOM   7884  C  C     . GLY C  1 312 ? -21.430  -35.900 -31.441  1.00 47.64 ? 293 GLY C C     1 
ATOM   7885  O  O     . GLY C  1 312 ? -20.524  -35.098 -31.669  1.00 47.68 ? 293 GLY C O     1 
ATOM   7886  N  N     . LEU C  1 313 ? -22.338  -36.212 -32.363  1.00 47.71 ? 294 LEU C N     1 
ATOM   7887  C  CA    . LEU C  1 313 ? -22.278  -35.565 -33.696  1.00 47.71 ? 294 LEU C CA    1 
ATOM   7888  C  C     . LEU C  1 313 ? -22.624  -34.083 -33.662  1.00 47.33 ? 294 LEU C C     1 
ATOM   7889  O  O     . LEU C  1 313 ? -22.089  -33.306 -34.467  1.00 47.99 ? 294 LEU C O     1 
ATOM   7890  C  CB    . LEU C  1 313 ? -23.178  -36.245 -34.718  1.00 48.12 ? 294 LEU C CB    1 
ATOM   7891  C  CG    . LEU C  1 313 ? -22.783  -37.688 -35.042  1.00 49.19 ? 294 LEU C CG    1 
ATOM   7892  C  CD1   . LEU C  1 313 ? -23.829  -38.269 -36.028  1.00 48.35 ? 294 LEU C CD1   1 
ATOM   7893  C  CD2   . LEU C  1 313 ? -21.328  -37.797 -35.552  1.00 47.81 ? 294 LEU C CD2   1 
ATOM   7894  N  N     . ASP C  1 314 ? -23.469  -33.663 -32.733  1.00 46.39 ? 295 ASP C N     1 
ATOM   7895  C  CA    . ASP C  1 314 ? -23.713  -32.215 -32.620  1.00 46.21 ? 295 ASP C CA    1 
ATOM   7896  C  C     . ASP C  1 314 ? -22.484  -31.495 -32.083  1.00 45.18 ? 295 ASP C C     1 
ATOM   7897  O  O     . ASP C  1 314 ? -22.046  -30.547 -32.694  1.00 44.96 ? 295 ASP C O     1 
ATOM   7898  C  CB    . ASP C  1 314 ? -24.981  -31.877 -31.811  1.00 46.40 ? 295 ASP C CB    1 
ATOM   7899  C  CG    . ASP C  1 314 ? -26.269  -32.146 -32.597  1.00 46.69 ? 295 ASP C CG    1 
ATOM   7900  O  OD1   . ASP C  1 314 ? -26.284  -31.910 -33.824  1.00 47.32 ? 295 ASP C OD1   1 
ATOM   7901  O  OD2   . ASP C  1 314 ? -27.268  -32.589 -31.990  1.00 49.57 ? 295 ASP C OD2   1 
ATOM   7902  N  N     . ASN C  1 315 ? -21.908  -31.985 -30.987  1.00 44.56 ? 296 ASN C N     1 
ATOM   7903  C  CA    . ASN C  1 315 ? -20.731  -31.359 -30.391  1.00 44.36 ? 296 ASN C CA    1 
ATOM   7904  C  C     . ASN C  1 315 ? -19.537  -31.351 -31.338  1.00 43.96 ? 296 ASN C C     1 
ATOM   7905  O  O     . ASN C  1 315 ? -18.630  -30.541 -31.162  1.00 44.29 ? 296 ASN C O     1 
ATOM   7906  C  CB    . ASN C  1 315 ? -20.301  -32.056 -29.089  1.00 44.42 ? 296 ASN C CB    1 
ATOM   7907  C  CG    . ASN C  1 315 ? -20.601  -31.257 -27.826  1.00 44.91 ? 296 ASN C CG    1 
ATOM   7908  O  OD1   . ASN C  1 315 ? -20.554  -30.017 -27.813  1.00 46.22 ? 296 ASN C OD1   1 
ATOM   7909  N  ND2   . ASN C  1 315 ? -20.865  -31.985 -26.723  1.00 43.05 ? 296 ASN C ND2   1 
ATOM   7910  N  N     . ALA C  1 316 ? -19.497  -32.242 -32.328  1.00 43.50 ? 297 ALA C N     1 
ATOM   7911  C  CA    . ALA C  1 316 ? -18.336  -32.243 -33.259  1.00 42.99 ? 297 ALA C CA    1 
ATOM   7912  C  C     . ALA C  1 316 ? -18.221  -30.908 -33.956  1.00 42.22 ? 297 ALA C C     1 
ATOM   7913  O  O     . ALA C  1 316 ? -17.143  -30.585 -34.418  1.00 42.85 ? 297 ALA C O     1 
ATOM   7914  C  CB    . ALA C  1 316 ? -18.397  -33.366 -34.280  1.00 41.42 ? 297 ALA C CB    1 
ATOM   7915  N  N     . ARG C  1 317 ? -19.312  -30.144 -34.034  1.00 41.97 ? 298 ARG C N     1 
ATOM   7916  C  CA    . ARG C  1 317 ? -19.305  -28.790 -34.654  1.00 42.13 ? 298 ARG C CA    1 
ATOM   7917  C  C     . ARG C  1 317 ? -18.873  -27.670 -33.704  1.00 42.35 ? 298 ARG C C     1 
ATOM   7918  O  O     . ARG C  1 317 ? -18.509  -26.580 -34.161  1.00 43.14 ? 298 ARG C O     1 
ATOM   7919  C  CB    . ARG C  1 317 ? -20.673  -28.452 -35.278  1.00 41.46 ? 298 ARG C CB    1 
ATOM   7920  C  CG    . ARG C  1 317 ? -21.072  -29.442 -36.362  1.00 41.04 ? 298 ARG C CG    1 
ATOM   7921  C  CD    . ARG C  1 317 ? -22.435  -29.200 -36.974  1.00 41.32 ? 298 ARG C CD    1 
ATOM   7922  N  NE    . ARG C  1 317 ? -23.491  -29.510 -36.019  1.00 41.20 ? 298 ARG C NE    1 
ATOM   7923  C  CZ    . ARG C  1 317 ? -24.288  -28.634 -35.405  1.00 41.32 ? 298 ARG C CZ    1 
ATOM   7924  N  NH1   . ARG C  1 317 ? -24.203  -27.328 -35.653  1.00 42.32 ? 298 ARG C NH1   1 
ATOM   7925  N  NH2   . ARG C  1 317 ? -25.208  -29.074 -34.544  1.00 40.70 ? 298 ARG C NH2   1 
ATOM   7926  N  N     . ARG C  1 318 ? -18.924  -27.939 -32.397  1.00 42.41 ? 299 ARG C N     1 
ATOM   7927  C  CA    . ARG C  1 318 ? -18.503  -26.983 -31.357  1.00 42.40 ? 299 ARG C CA    1 
ATOM   7928  C  C     . ARG C  1 318 ? -17.108  -27.250 -30.720  1.00 42.33 ? 299 ARG C C     1 
ATOM   7929  O  O     . ARG C  1 318 ? -16.335  -26.312 -30.458  1.00 41.29 ? 299 ARG C O     1 
ATOM   7930  C  CB    . ARG C  1 318 ? -19.514  -26.978 -30.221  1.00 41.78 ? 299 ARG C CB    1 
ATOM   7931  C  CG    . ARG C  1 318 ? -19.083  -26.115 -29.040  1.00 42.41 ? 299 ARG C CG    1 
ATOM   7932  C  CD    . ARG C  1 318 ? -20.154  -25.902 -27.975  1.00 43.16 ? 299 ARG C CD    1 
ATOM   7933  N  NE    . ARG C  1 318 ? -20.133  -27.029 -27.088  1.00 43.91 ? 299 ARG C NE    1 
ATOM   7934  C  CZ    . ARG C  1 318 ? -19.627  -27.059 -25.864  1.00 43.87 ? 299 ARG C CZ    1 
ATOM   7935  N  NH1   . ARG C  1 318 ? -19.123  -26.020 -25.232  1.00 41.79 ? 299 ARG C NH1   1 
ATOM   7936  N  NH2   . ARG C  1 318 ? -19.677  -28.200 -25.248  1.00 47.94 ? 299 ARG C NH2   1 
ATOM   7937  N  N     . LEU C  1 319 ? -16.836  -28.514 -30.391  1.00 42.66 ? 300 LEU C N     1 
ATOM   7938  C  CA    . LEU C  1 319 ? -15.650  -28.850 -29.625  1.00 43.03 ? 300 LEU C CA    1 
ATOM   7939  C  C     . LEU C  1 319 ? -14.472  -28.926 -30.606  1.00 43.51 ? 300 LEU C C     1 
ATOM   7940  O  O     . LEU C  1 319 ? -14.003  -30.002 -30.954  1.00 44.54 ? 300 LEU C O     1 
ATOM   7941  C  CB    . LEU C  1 319 ? -15.845  -30.133 -28.827  1.00 42.39 ? 300 LEU C CB    1 
ATOM   7942  C  CG    . LEU C  1 319 ? -16.793  -30.053 -27.638  1.00 41.48 ? 300 LEU C CG    1 
ATOM   7943  C  CD1   . LEU C  1 319 ? -16.851  -31.417 -26.991  1.00 39.70 ? 300 LEU C CD1   1 
ATOM   7944  C  CD2   . LEU C  1 319 ? -16.435  -28.994 -26.625  1.00 39.24 ? 300 LEU C CD2   1 
ATOM   7945  N  N     . THR C  1 320 ? -14.033  -27.754 -31.047  1.00 43.56 ? 301 THR C N     1 
ATOM   7946  C  CA    . THR C  1 320 ? -13.044  -27.634 -32.075  1.00 44.04 ? 301 THR C CA    1 
ATOM   7947  C  C     . THR C  1 320 ? -11.659  -27.399 -31.459  1.00 44.79 ? 301 THR C C     1 
ATOM   7948  O  O     . THR C  1 320 ? -10.629  -27.640 -32.121  1.00 44.53 ? 301 THR C O     1 
ATOM   7949  C  CB    . THR C  1 320 ? -13.395  -26.474 -33.047  1.00 44.23 ? 301 THR C CB    1 
ATOM   7950  O  OG1   . THR C  1 320 ? -13.459  -25.226 -32.323  1.00 44.19 ? 301 THR C OG1   1 
ATOM   7951  C  CG2   . THR C  1 320 ? -14.717  -26.746 -33.741  1.00 42.25 ? 301 THR C CG2   1 
ATOM   7952  N  N     . GLY C  1 321 ? -11.646  -26.963 -30.194  1.00 45.23 ? 302 GLY C N     1 
ATOM   7953  C  CA    . GLY C  1 321 ? -10.432  -26.525 -29.526  1.00 45.40 ? 302 GLY C CA    1 
ATOM   7954  C  C     . GLY C  1 321 ? -10.191  -25.035 -29.711  1.00 46.23 ? 302 GLY C C     1 
ATOM   7955  O  O     . GLY C  1 321 ? -9.186   -24.492 -29.261  1.00 46.94 ? 302 GLY C O     1 
ATOM   7956  N  N     . PHE C  1 322 ? -11.102  -24.375 -30.413  1.00 47.01 ? 303 PHE C N     1 
ATOM   7957  C  CA    . PHE C  1 322 ? -11.123  -22.923 -30.524  1.00 46.21 ? 303 PHE C CA    1 
ATOM   7958  C  C     . PHE C  1 322 ? -12.398  -22.438 -29.852  1.00 45.86 ? 303 PHE C C     1 
ATOM   7959  O  O     . PHE C  1 322 ? -13.261  -23.241 -29.450  1.00 44.64 ? 303 PHE C O     1 
ATOM   7960  C  CB    . PHE C  1 322 ? -11.103  -22.485 -32.004  1.00 47.25 ? 303 PHE C CB    1 
ATOM   7961  C  CG    . PHE C  1 322 ? -9.889   -22.952 -32.764  1.00 47.81 ? 303 PHE C CG    1 
ATOM   7962  C  CD1   . PHE C  1 322 ? -9.946   -24.085 -33.568  1.00 50.39 ? 303 PHE C CD1   1 
ATOM   7963  C  CD2   . PHE C  1 322 ? -8.675   -22.268 -32.665  1.00 48.44 ? 303 PHE C CD2   1 
ATOM   7964  C  CE1   . PHE C  1 322 ? -8.793   -24.532 -34.279  1.00 49.49 ? 303 PHE C CE1   1 
ATOM   7965  C  CE2   . PHE C  1 322 ? -7.534   -22.703 -33.350  1.00 48.54 ? 303 PHE C CE2   1 
ATOM   7966  C  CZ    . PHE C  1 322 ? -7.591   -23.831 -34.153  1.00 48.75 ? 303 PHE C CZ    1 
ATOM   7967  N  N     . HIS C  1 323 ? -12.497  -21.111 -29.754  1.00 45.43 ? 304 HIS C N     1 
ATOM   7968  C  CA    . HIS C  1 323 ? -13.689  -20.417 -29.277  1.00 45.00 ? 304 HIS C CA    1 
ATOM   7969  C  C     . HIS C  1 323 ? -14.055  -20.891 -27.887  1.00 45.34 ? 304 HIS C C     1 
ATOM   7970  O  O     . HIS C  1 323 ? -15.230  -21.108 -27.570  1.00 46.44 ? 304 HIS C O     1 
ATOM   7971  C  CB    . HIS C  1 323 ? -14.824  -20.553 -30.288  1.00 44.10 ? 304 HIS C CB    1 
ATOM   7972  C  CG    . HIS C  1 323 ? -14.544  -19.849 -31.581  1.00 44.50 ? 304 HIS C CG    1 
ATOM   7973  N  ND1   . HIS C  1 323 ? -14.357  -20.524 -32.775  1.00 44.67 ? 304 HIS C ND1   1 
ATOM   7974  C  CD2   . HIS C  1 323 ? -14.353  -18.532 -31.856  1.00 42.33 ? 304 HIS C CD2   1 
ATOM   7975  C  CE1   . HIS C  1 323 ? -14.091  -19.649 -33.733  1.00 44.84 ? 304 HIS C CE1   1 
ATOM   7976  N  NE2   . HIS C  1 323 ? -14.089  -18.433 -33.204  1.00 44.03 ? 304 HIS C NE2   1 
ATOM   7977  N  N     . GLU C  1 324 ? -13.013  -21.055 -27.070  1.00 45.14 ? 305 GLU C N     1 
ATOM   7978  C  CA    . GLU C  1 324 ? -13.083  -21.427 -25.650  1.00 44.67 ? 305 GLU C CA    1 
ATOM   7979  C  C     . GLU C  1 324 ? -13.667  -22.815 -25.450  1.00 44.61 ? 305 GLU C C     1 
ATOM   7980  O  O     . GLU C  1 324 ? -14.370  -23.094 -24.492  1.00 45.00 ? 305 GLU C O     1 
ATOM   7981  C  CB    . GLU C  1 324 ? -13.761  -20.327 -24.844  1.00 43.91 ? 305 GLU C CB    1 
ATOM   7982  C  CG    . GLU C  1 324 ? -13.419  -18.901 -25.324  1.00 43.84 ? 305 GLU C CG    1 
ATOM   7983  C  CD    . GLU C  1 324 ? -13.963  -17.818 -24.381  1.00 46.46 ? 305 GLU C CD    1 
ATOM   7984  O  OE1   . GLU C  1 324 ? -13.339  -17.614 -23.292  1.00 47.62 ? 305 GLU C OE1   1 
ATOM   7985  O  OE2   . GLU C  1 324 ? -15.013  -17.183 -24.717  1.00 46.78 ? 305 GLU C OE2   1 
ATOM   7986  N  N     . THR C  1 325 ? -13.338  -23.694 -26.384  1.00 45.04 ? 306 THR C N     1 
ATOM   7987  C  CA    . THR C  1 325 ? -13.654  -25.103 -26.304  1.00 45.00 ? 306 THR C CA    1 
ATOM   7988  C  C     . THR C  1 325 ? -12.392  -25.956 -26.294  1.00 45.52 ? 306 THR C C     1 
ATOM   7989  O  O     . THR C  1 325 ? -11.280  -25.509 -26.675  1.00 46.10 ? 306 THR C O     1 
ATOM   7990  C  CB    . THR C  1 325 ? -14.471  -25.549 -27.513  1.00 45.16 ? 306 THR C CB    1 
ATOM   7991  O  OG1   . THR C  1 325 ? -13.658  -25.488 -28.700  1.00 44.53 ? 306 THR C OG1   1 
ATOM   7992  C  CG2   . THR C  1 325 ? -15.739  -24.674 -27.666  1.00 44.56 ? 306 THR C CG2   1 
ATOM   7993  N  N     . SER C  1 326 ? -12.583  -27.193 -25.861  1.00 45.58 ? 307 SER C N     1 
ATOM   7994  C  CA    . SER C  1 326 ? -11.618  -28.257 -26.020  1.00 45.55 ? 307 SER C CA    1 
ATOM   7995  C  C     . SER C  1 326 ? -11.901  -28.918 -27.359  1.00 46.03 ? 307 SER C C     1 
ATOM   7996  O  O     . SER C  1 326 ? -13.000  -28.802 -27.895  1.00 47.03 ? 307 SER C O     1 
ATOM   7997  C  CB    . SER C  1 326 ? -11.817  -29.271 -24.913  1.00 45.19 ? 307 SER C CB    1 
ATOM   7998  O  OG    . SER C  1 326 ? -13.172  -29.718 -24.936  1.00 45.58 ? 307 SER C OG    1 
ATOM   7999  N  N     . ASN C  1 327 ? -10.919  -29.600 -27.914  1.00 46.33 ? 308 ASN C N     1 
ATOM   8000  C  CA    . ASN C  1 327 ? -11.136  -30.467 -29.050  1.00 46.49 ? 308 ASN C CA    1 
ATOM   8001  C  C     . ASN C  1 327 ? -11.893  -31.727 -28.597  1.00 46.94 ? 308 ASN C C     1 
ATOM   8002  O  O     . ASN C  1 327 ? -11.601  -32.313 -27.542  1.00 46.79 ? 308 ASN C O     1 
ATOM   8003  C  CB    . ASN C  1 327 ? -9.794   -30.844 -29.697  1.00 46.56 ? 308 ASN C CB    1 
ATOM   8004  C  CG    . ASN C  1 327 ? -9.965   -31.594 -31.016  1.00 46.93 ? 308 ASN C CG    1 
ATOM   8005  O  OD1   . ASN C  1 327 ? -10.304  -32.782 -31.035  1.00 49.22 ? 308 ASN C OD1   1 
ATOM   8006  N  ND2   . ASN C  1 327 ? -9.734   -30.907 -32.118  1.00 46.04 ? 308 ASN C ND2   1 
ATOM   8007  N  N     . ILE C  1 328 ? -12.887  -32.131 -29.392  1.00 47.44 ? 309 ILE C N     1 
ATOM   8008  C  CA    . ILE C  1 328 ? -13.708  -33.312 -29.079  1.00 47.58 ? 309 ILE C CA    1 
ATOM   8009  C  C     . ILE C  1 328 ? -12.888  -34.608 -28.908  1.00 48.17 ? 309 ILE C C     1 
ATOM   8010  O  O     . ILE C  1 328 ? -13.332  -35.530 -28.223  1.00 48.98 ? 309 ILE C O     1 
ATOM   8011  C  CB    . ILE C  1 328 ? -14.809  -33.528 -30.150  1.00 47.43 ? 309 ILE C CB    1 
ATOM   8012  C  CG1   . ILE C  1 328 ? -15.892  -34.485 -29.632  1.00 47.00 ? 309 ILE C CG1   1 
ATOM   8013  C  CG2   . ILE C  1 328 ? -14.215  -34.007 -31.448  1.00 45.29 ? 309 ILE C CG2   1 
ATOM   8014  C  CD1   . ILE C  1 328 ? -17.227  -34.347 -30.387  1.00 47.07 ? 309 ILE C CD1   1 
ATOM   8015  N  N     . ASN C  1 329 ? -11.707  -34.665 -29.507  1.00 48.45 ? 310 ASN C N     1 
ATOM   8016  C  CA    . ASN C  1 329 ? -10.869  -35.869 -29.449  1.00 49.25 ? 310 ASN C CA    1 
ATOM   8017  C  C     . ASN C  1 329 ? -9.939   -35.960 -28.260  1.00 49.84 ? 310 ASN C C     1 
ATOM   8018  O  O     . ASN C  1 329 ? -9.444   -37.029 -28.009  1.00 50.33 ? 310 ASN C O     1 
ATOM   8019  C  CB    . ASN C  1 329 ? -10.011  -36.019 -30.699  1.00 48.95 ? 310 ASN C CB    1 
ATOM   8020  C  CG    . ASN C  1 329 ? -10.829  -36.033 -31.970  1.00 50.17 ? 310 ASN C CG    1 
ATOM   8021  O  OD1   . ASN C  1 329 ? -11.854  -36.706 -32.068  1.00 50.13 ? 310 ASN C OD1   1 
ATOM   8022  N  ND2   . ASN C  1 329 ? -10.385  -35.263 -32.957  1.00 53.20 ? 310 ASN C ND2   1 
ATOM   8023  N  N     . ASP C  1 330 ? -9.692   -34.876 -27.537  1.00 50.47 ? 311 ASP C N     1 
ATOM   8024  C  CA    . ASP C  1 330 ? -8.715   -34.909 -26.472  1.00 51.13 ? 311 ASP C CA    1 
ATOM   8025  C  C     . ASP C  1 330 ? -9.351   -34.546 -25.131  1.00 50.54 ? 311 ASP C C     1 
ATOM   8026  O  O     . ASP C  1 330 ? -10.165  -33.645 -25.078  1.00 51.57 ? 311 ASP C O     1 
ATOM   8027  C  CB    . ASP C  1 330 ? -7.541   -33.937 -26.774  1.00 52.66 ? 311 ASP C CB    1 
ATOM   8028  C  CG    . ASP C  1 330 ? -6.955   -34.112 -28.232  1.00 59.60 ? 311 ASP C CG    1 
ATOM   8029  O  OD1   . ASP C  1 330 ? -6.040   -34.997 -28.438  1.00 68.53 ? 311 ASP C OD1   1 
ATOM   8030  O  OD2   . ASP C  1 330 ? -7.374   -33.344 -29.163  1.00 63.93 ? 311 ASP C OD2   1 
ATOM   8031  N  N     . PHE C  1 331 ? -8.924   -35.201 -24.051  1.00 49.12 ? 312 PHE C N     1 
ATOM   8032  C  CA    . PHE C  1 331 ? -9.258   -34.805 -22.696  1.00 48.19 ? 312 PHE C CA    1 
ATOM   8033  C  C     . PHE C  1 331 ? -8.143   -33.980 -22.112  1.00 47.86 ? 312 PHE C C     1 
ATOM   8034  O  O     . PHE C  1 331 ? -6.999   -34.359 -22.250  1.00 47.52 ? 312 PHE C O     1 
ATOM   8035  C  CB    . PHE C  1 331 ? -9.396   -36.011 -21.818  1.00 47.83 ? 312 PHE C CB    1 
ATOM   8036  C  CG    . PHE C  1 331 ? -9.881   -35.699 -20.453  1.00 46.97 ? 312 PHE C CG    1 
ATOM   8037  C  CD1   . PHE C  1 331 ? -11.250  -35.684 -20.180  1.00 47.66 ? 312 PHE C CD1   1 
ATOM   8038  C  CD2   . PHE C  1 331 ? -8.994   -35.446 -19.441  1.00 45.56 ? 312 PHE C CD2   1 
ATOM   8039  C  CE1   . PHE C  1 331 ? -11.734  -35.412 -18.884  1.00 47.57 ? 312 PHE C CE1   1 
ATOM   8040  C  CE2   . PHE C  1 331 ? -9.447   -35.177 -18.169  1.00 47.25 ? 312 PHE C CE2   1 
ATOM   8041  C  CZ    . PHE C  1 331 ? -10.839  -35.155 -17.884  1.00 47.19 ? 312 PHE C CZ    1 
ATOM   8042  N  N     . SER C  1 332 ? -8.484   -32.861 -21.459  1.00 47.37 ? 313 SER C N     1 
ATOM   8043  C  CA    . SER C  1 332 ? -7.516   -32.038 -20.712  1.00 46.58 ? 313 SER C CA    1 
ATOM   8044  C  C     . SER C  1 332 ? -8.209   -31.304 -19.580  1.00 46.43 ? 313 SER C C     1 
ATOM   8045  O  O     . SER C  1 332 ? -9.393   -31.034 -19.659  1.00 47.49 ? 313 SER C O     1 
ATOM   8046  C  CB    . SER C  1 332 ? -6.852   -31.007 -21.613  1.00 46.02 ? 313 SER C CB    1 
ATOM   8047  O  OG    . SER C  1 332 ? -7.796   -30.116 -22.136  1.00 45.96 ? 313 SER C OG    1 
ATOM   8048  N  N     . ALA C  1 333 ? -7.465   -30.933 -18.554  1.00 45.76 ? 314 ALA C N     1 
ATOM   8049  C  CA    . ALA C  1 333 ? -8.033   -30.268 -17.411  1.00 45.27 ? 314 ALA C CA    1 
ATOM   8050  C  C     . ALA C  1 333 ? -7.014   -29.258 -16.939  1.00 45.21 ? 314 ALA C C     1 
ATOM   8051  O  O     . ALA C  1 333 ? -5.850   -29.491 -17.070  1.00 46.14 ? 314 ALA C O     1 
ATOM   8052  C  CB    . ALA C  1 333 ? -8.303   -31.254 -16.358  1.00 44.69 ? 314 ALA C CB    1 
ATOM   8053  N  N     . GLY C  1 334 ? -7.441   -28.124 -16.417  1.00 44.79 ? 315 GLY C N     1 
ATOM   8054  C  CA    . GLY C  1 334 ? -6.514   -27.168 -15.874  1.00 44.05 ? 315 GLY C CA    1 
ATOM   8055  C  C     . GLY C  1 334 ? -7.237   -26.079 -15.113  1.00 43.76 ? 315 GLY C C     1 
ATOM   8056  O  O     . GLY C  1 334 ? -8.393   -25.782 -15.390  1.00 43.66 ? 315 GLY C O     1 
ATOM   8057  N  N     . VAL C  1 335 ? -6.546   -25.499 -14.148  1.00 43.23 ? 316 VAL C N     1 
ATOM   8058  C  CA    . VAL C  1 335 ? -7.075   -24.394 -13.380  1.00 43.35 ? 316 VAL C CA    1 
ATOM   8059  C  C     . VAL C  1 335 ? -7.313   -23.167 -14.266  1.00 43.40 ? 316 VAL C C     1 
ATOM   8060  O  O     . VAL C  1 335 ? -6.431   -22.754 -14.966  1.00 43.34 ? 316 VAL C O     1 
ATOM   8061  C  CB    . VAL C  1 335 ? -6.130   -24.043 -12.177  1.00 43.29 ? 316 VAL C CB    1 
ATOM   8062  C  CG1   . VAL C  1 335 ? -6.582   -22.744 -11.486  1.00 41.03 ? 316 VAL C CG1   1 
ATOM   8063  C  CG2   . VAL C  1 335 ? -6.084   -25.258 -11.216  1.00 40.49 ? 316 VAL C CG2   1 
ATOM   8064  N  N     . ALA C  1 336 ? -8.525   -22.612 -14.258  1.00 43.36 ? 317 ALA C N     1 
ATOM   8065  C  CA    . ALA C  1 336 ? -8.797   -21.323 -14.923  1.00 43.59 ? 317 ALA C CA    1 
ATOM   8066  C  C     . ALA C  1 336 ? -8.698   -21.446 -16.431  1.00 43.48 ? 317 ALA C C     1 
ATOM   8067  O  O     . ALA C  1 336 ? -8.699   -20.461 -17.128  1.00 43.23 ? 317 ALA C O     1 
ATOM   8068  C  CB    . ALA C  1 336 ? -7.869   -20.226 -14.401  1.00 43.21 ? 317 ALA C CB    1 
ATOM   8069  N  N     . ASN C  1 337 ? -8.693   -22.675 -16.933  1.00 44.41 ? 318 ASN C N     1 
ATOM   8070  C  CA    . ASN C  1 337 ? -8.382   -22.915 -18.330  1.00 44.66 ? 318 ASN C CA    1 
ATOM   8071  C  C     . ASN C  1 337 ? -9.620   -23.091 -19.202  1.00 44.64 ? 318 ASN C C     1 
ATOM   8072  O  O     . ASN C  1 337 ? -10.157  -24.188 -19.297  1.00 44.14 ? 318 ASN C O     1 
ATOM   8073  C  CB    . ASN C  1 337 ? -7.457   -24.129 -18.481  1.00 45.02 ? 318 ASN C CB    1 
ATOM   8074  C  CG    . ASN C  1 337 ? -6.800   -24.204 -19.874  1.00 45.46 ? 318 ASN C CG    1 
ATOM   8075  O  OD1   . ASN C  1 337 ? -7.339   -23.741 -20.881  1.00 47.14 ? 318 ASN C OD1   1 
ATOM   8076  N  ND2   . ASN C  1 337 ? -5.634   -24.772 -19.917  1.00 45.49 ? 318 ASN C ND2   1 
ATOM   8077  N  N     . ARG C  1 338 ? -10.031  -22.011 -19.869  1.00 44.69 ? 319 ARG C N     1 
ATOM   8078  C  CA    . ARG C  1 338 ? -11.206  -22.050 -20.739  1.00 44.91 ? 319 ARG C CA    1 
ATOM   8079  C  C     . ARG C  1 338 ? -11.035  -22.851 -22.043  1.00 45.30 ? 319 ARG C C     1 
ATOM   8080  O  O     . ARG C  1 338 ? -11.990  -22.957 -22.840  1.00 45.84 ? 319 ARG C O     1 
ATOM   8081  C  CB    . ARG C  1 338 ? -11.736  -20.642 -21.001  1.00 44.79 ? 319 ARG C CB    1 
ATOM   8082  C  CG    . ARG C  1 338 ? -12.675  -20.171 -19.886  1.00 45.31 ? 319 ARG C CG    1 
ATOM   8083  C  CD    . ARG C  1 338 ? -13.184  -18.792 -20.109  1.00 44.91 ? 319 ARG C CD    1 
ATOM   8084  N  NE    . ARG C  1 338 ? -14.235  -18.455 -19.168  1.00 45.08 ? 319 ARG C NE    1 
ATOM   8085  C  CZ    . ARG C  1 338 ? -14.059  -18.206 -17.870  1.00 45.72 ? 319 ARG C CZ    1 
ATOM   8086  N  NH1   . ARG C  1 338 ? -15.109  -17.890 -17.136  1.00 45.35 ? 319 ARG C NH1   1 
ATOM   8087  N  NH2   . ARG C  1 338 ? -12.867  -18.279 -17.274  1.00 46.08 ? 319 ARG C NH2   1 
ATOM   8088  N  N     . SER C  1 339 ? -9.846   -23.440 -22.219  1.00 45.05 ? 320 SER C N     1 
ATOM   8089  C  CA    . SER C  1 339 ? -9.537   -24.376 -23.308  1.00 44.50 ? 320 SER C CA    1 
ATOM   8090  C  C     . SER C  1 339 ? -9.544   -25.825 -22.917  1.00 43.62 ? 320 SER C C     1 
ATOM   8091  O  O     . SER C  1 339 ? -9.322   -26.674 -23.761  1.00 42.86 ? 320 SER C O     1 
ATOM   8092  C  CB    . SER C  1 339 ? -8.138   -24.094 -23.854  1.00 44.18 ? 320 SER C CB    1 
ATOM   8093  O  OG    . SER C  1 339 ? -8.286   -23.096 -24.804  1.00 47.25 ? 320 SER C OG    1 
ATOM   8094  N  N     . ALA C  1 340 ? -9.715   -26.119 -21.640  1.00 43.70 ? 321 ALA C N     1 
ATOM   8095  C  CA    . ALA C  1 340 ? -9.628   -27.499 -21.202  1.00 43.90 ? 321 ALA C CA    1 
ATOM   8096  C  C     . ALA C  1 340 ? -11.026  -28.132 -21.298  1.00 44.28 ? 321 ALA C C     1 
ATOM   8097  O  O     . ALA C  1 340 ? -12.064  -27.409 -21.355  1.00 43.21 ? 321 ALA C O     1 
ATOM   8098  C  CB    . ALA C  1 340 ? -9.074   -27.597 -19.815  1.00 43.39 ? 321 ALA C CB    1 
ATOM   8099  N  N     . SER C  1 341 ? -11.023  -29.474 -21.376  1.00 43.89 ? 322 SER C N     1 
ATOM   8100  C  CA    . SER C  1 341 ? -12.244  -30.252 -21.198  1.00 44.00 ? 322 SER C CA    1 
ATOM   8101  C  C     . SER C  1 341 ? -12.838  -29.921 -19.867  1.00 43.44 ? 322 SER C C     1 
ATOM   8102  O  O     . SER C  1 341 ? -14.023  -29.612 -19.803  1.00 44.13 ? 322 SER C O     1 
ATOM   8103  C  CB    . SER C  1 341 ? -12.006  -31.777 -21.258  1.00 44.24 ? 322 SER C CB    1 
ATOM   8104  O  OG    . SER C  1 341 ? -11.298  -32.106 -22.420  1.00 44.58 ? 322 SER C OG    1 
ATOM   8105  N  N     . ILE C  1 342 ? -12.036  -30.030 -18.810  1.00 43.02 ? 323 ILE C N     1 
ATOM   8106  C  CA    . ILE C  1 342 ? -12.457  -29.646 -17.466  1.00 43.50 ? 323 ILE C CA    1 
ATOM   8107  C  C     . ILE C  1 342 ? -11.696  -28.386 -17.046  1.00 43.69 ? 323 ILE C C     1 
ATOM   8108  O  O     . ILE C  1 342 ? -10.497  -28.260 -17.340  1.00 44.88 ? 323 ILE C O     1 
ATOM   8109  C  CB    . ILE C  1 342 ? -12.179  -30.743 -16.410  1.00 43.24 ? 323 ILE C CB    1 
ATOM   8110  C  CG1   . ILE C  1 342 ? -12.883  -32.078 -16.721  1.00 43.78 ? 323 ILE C CG1   1 
ATOM   8111  C  CG2   . ILE C  1 342 ? -12.518  -30.243 -15.044  1.00 42.79 ? 323 ILE C CG2   1 
ATOM   8112  C  CD1   . ILE C  1 342 ? -14.164  -32.028 -17.380  1.00 41.65 ? 323 ILE C CD1   1 
ATOM   8113  N  N     . ARG C  1 343 ? -12.375  -27.472 -16.358  1.00 43.26 ? 324 ARG C N     1 
ATOM   8114  C  CA    . ARG C  1 343 ? -11.739  -26.303 -15.754  1.00 43.14 ? 324 ARG C CA    1 
ATOM   8115  C  C     . ARG C  1 343 ? -11.961  -26.308 -14.264  1.00 42.74 ? 324 ARG C C     1 
ATOM   8116  O  O     . ARG C  1 343 ? -13.080  -26.499 -13.801  1.00 41.94 ? 324 ARG C O     1 
ATOM   8117  C  CB    . ARG C  1 343 ? -12.244  -24.989 -16.367  1.00 42.97 ? 324 ARG C CB    1 
ATOM   8118  C  CG    . ARG C  1 343 ? -12.160  -23.773 -15.437  1.00 43.11 ? 324 ARG C CG    1 
ATOM   8119  C  CD    . ARG C  1 343 ? -12.234  -22.444 -16.199  1.00 43.47 ? 324 ARG C CD    1 
ATOM   8120  N  NE    . ARG C  1 343 ? -12.630  -21.348 -15.317  1.00 43.97 ? 324 ARG C NE    1 
ATOM   8121  C  CZ    . ARG C  1 343 ? -13.905  -20.986 -15.087  1.00 47.49 ? 324 ARG C CZ    1 
ATOM   8122  N  NH1   . ARG C  1 343 ? -14.928  -21.614 -15.698  1.00 46.98 ? 324 ARG C NH1   1 
ATOM   8123  N  NH2   . ARG C  1 343 ? -14.177  -19.986 -14.248  1.00 44.46 ? 324 ARG C NH2   1 
ATOM   8124  N  N     . ILE C  1 344 ? -10.879  -26.119 -13.507  1.00 43.12 ? 325 ILE C N     1 
ATOM   8125  C  CA    . ILE C  1 344 ? -10.999  -25.885 -12.087  1.00 43.24 ? 325 ILE C CA    1 
ATOM   8126  C  C     . ILE C  1 344 ? -11.007  -24.393 -11.890  1.00 43.78 ? 325 ILE C C     1 
ATOM   8127  O  O     . ILE C  1 344 ? -10.053  -23.734 -12.169  1.00 44.75 ? 325 ILE C O     1 
ATOM   8128  C  CB    . ILE C  1 344 ? -9.884   -26.512 -11.304  1.00 43.33 ? 325 ILE C CB    1 
ATOM   8129  C  CG1   . ILE C  1 344 ? -9.910   -28.029 -11.499  1.00 43.01 ? 325 ILE C CG1   1 
ATOM   8130  C  CG2   . ILE C  1 344 ? -10.029  -26.140 -9.796   1.00 42.71 ? 325 ILE C CG2   1 
ATOM   8131  C  CD1   . ILE C  1 344 ? -8.773   -28.772 -10.756  1.00 42.33 ? 325 ILE C CD1   1 
ATOM   8132  N  N     . PRO C  1 345 ? -12.113  -23.831 -11.442  1.00 44.74 ? 326 PRO C N     1 
ATOM   8133  C  CA    . PRO C  1 345 ? -12.069  -22.380 -11.313  1.00 44.62 ? 326 PRO C CA    1 
ATOM   8134  C  C     . PRO C  1 345 ? -10.997  -21.917 -10.326  1.00 44.41 ? 326 PRO C C     1 
ATOM   8135  O  O     . PRO C  1 345 ? -10.679  -22.629 -9.356   1.00 42.94 ? 326 PRO C O     1 
ATOM   8136  C  CB    . PRO C  1 345 ? -13.461  -22.041 -10.768  1.00 44.07 ? 326 PRO C CB    1 
ATOM   8137  C  CG    . PRO C  1 345 ? -14.284  -23.183 -11.067  1.00 44.39 ? 326 PRO C CG    1 
ATOM   8138  C  CD    . PRO C  1 345 ? -13.412  -24.386 -11.016  1.00 44.73 ? 326 PRO C CD    1 
ATOM   8139  N  N     . ARG C  1 346 ? -10.480  -20.715 -10.566  1.00 44.99 ? 327 ARG C N     1 
ATOM   8140  C  CA    . ARG C  1 346 ? -9.401   -20.179 -9.755   1.00 45.58 ? 327 ARG C CA    1 
ATOM   8141  C  C     . ARG C  1 346 ? -9.781   -20.180 -8.261   1.00 46.24 ? 327 ARG C C     1 
ATOM   8142  O  O     . ARG C  1 346 ? -9.024   -20.682 -7.439   1.00 47.31 ? 327 ARG C O     1 
ATOM   8143  C  CB    . ARG C  1 346 ? -8.988   -18.792 -10.229  1.00 45.04 ? 327 ARG C CB    1 
ATOM   8144  C  CG    . ARG C  1 346 ? -7.681   -18.308 -9.613   1.00 45.32 ? 327 ARG C CG    1 
ATOM   8145  C  CD    . ARG C  1 346 ? -7.326   -16.842 -10.004  1.00 46.26 ? 327 ARG C CD    1 
ATOM   8146  N  NE    . ARG C  1 346 ? -7.430   -16.593 -11.444  1.00 46.37 ? 327 ARG C NE    1 
ATOM   8147  C  CZ    . ARG C  1 346 ? -6.674   -17.178 -12.366  1.00 46.16 ? 327 ARG C CZ    1 
ATOM   8148  N  NH1   . ARG C  1 346 ? -5.733   -18.038 -12.001  1.00 46.85 ? 327 ARG C NH1   1 
ATOM   8149  N  NH2   . ARG C  1 346 ? -6.855   -16.897 -13.652  1.00 45.93 ? 327 ARG C NH2   1 
ATOM   8150  N  N     . THR C  1 347 ? -10.959  -19.674 -7.923   1.00 46.46 ? 328 THR C N     1 
ATOM   8151  C  CA    . THR C  1 347 ? -11.460  -19.723 -6.554   1.00 46.68 ? 328 THR C CA    1 
ATOM   8152  C  C     . THR C  1 347 ? -11.276  -21.074 -5.863   1.00 46.98 ? 328 THR C C     1 
ATOM   8153  O  O     . THR C  1 347 ? -10.907  -21.159 -4.685   1.00 45.90 ? 328 THR C O     1 
ATOM   8154  C  CB    . THR C  1 347 ? -12.968  -19.378 -6.542   1.00 46.55 ? 328 THR C CB    1 
ATOM   8155  O  OG1   . THR C  1 347 ? -13.080  -17.986 -6.751   1.00 44.62 ? 328 THR C OG1   1 
ATOM   8156  C  CG2   . THR C  1 347 ? -13.633  -19.679 -5.200   1.00 47.18 ? 328 THR C CG2   1 
ATOM   8157  N  N     . VAL C  1 348 ? -11.579  -22.120 -6.610   1.00 47.68 ? 329 VAL C N     1 
ATOM   8158  C  CA    . VAL C  1 348 ? -11.566  -23.454 -6.065   1.00 48.20 ? 329 VAL C CA    1 
ATOM   8159  C  C     . VAL C  1 348 ? -10.145  -23.920 -5.847   1.00 48.82 ? 329 VAL C C     1 
ATOM   8160  O  O     . VAL C  1 348 ? -9.851   -24.505 -4.808   1.00 49.88 ? 329 VAL C O     1 
ATOM   8161  C  CB    . VAL C  1 348 ? -12.357  -24.445 -6.956   1.00 48.40 ? 329 VAL C CB    1 
ATOM   8162  C  CG1   . VAL C  1 348 ? -12.125  -25.918 -6.502   1.00 46.41 ? 329 VAL C CG1   1 
ATOM   8163  C  CG2   . VAL C  1 348 ? -13.821  -24.037 -6.953   1.00 44.56 ? 329 VAL C CG2   1 
ATOM   8164  N  N     . GLY C  1 349 ? -9.264   -23.650 -6.794   1.00 49.09 ? 330 GLY C N     1 
ATOM   8165  C  CA    . GLY C  1 349 ? -7.865   -23.974 -6.605   1.00 49.55 ? 330 GLY C CA    1 
ATOM   8166  C  C     . GLY C  1 349 ? -7.330   -23.295 -5.353   1.00 50.22 ? 330 GLY C C     1 
ATOM   8167  O  O     . GLY C  1 349 ? -6.691   -23.919 -4.498   1.00 51.07 ? 330 GLY C O     1 
ATOM   8168  N  N     . GLN C  1 350 ? -7.646   -22.022 -5.230   1.00 50.50 ? 331 GLN C N     1 
ATOM   8169  C  CA    . GLN C  1 350 ? -7.227   -21.218 -4.114   1.00 50.98 ? 331 GLN C CA    1 
ATOM   8170  C  C     . GLN C  1 350 ? -7.773   -21.713 -2.786   1.00 51.31 ? 331 GLN C C     1 
ATOM   8171  O  O     . GLN C  1 350 ? -7.029   -21.758 -1.817   1.00 52.09 ? 331 GLN C O     1 
ATOM   8172  C  CB    . GLN C  1 350 ? -7.686   -19.782 -4.330   1.00 51.43 ? 331 GLN C CB    1 
ATOM   8173  C  CG    . GLN C  1 350 ? -7.043   -19.128 -5.503   1.00 52.04 ? 331 GLN C CG    1 
ATOM   8174  C  CD    . GLN C  1 350 ? -5.669   -18.764 -5.199   1.00 53.16 ? 331 GLN C CD    1 
ATOM   8175  O  OE1   . GLN C  1 350 ? -5.449   -17.951 -4.311   1.00 55.10 ? 331 GLN C OE1   1 
ATOM   8176  N  NE2   . GLN C  1 350 ? -4.704   -19.360 -5.909   1.00 53.68 ? 331 GLN C NE2   1 
ATOM   8177  N  N     . GLU C  1 351 ? -9.051   -22.062 -2.715   1.00 51.17 ? 332 GLU C N     1 
ATOM   8178  C  CA    . GLU C  1 351 ? -9.615   -22.512 -1.451   1.00 52.02 ? 332 GLU C CA    1 
ATOM   8179  C  C     . GLU C  1 351 ? -9.360   -24.008 -1.216   1.00 51.92 ? 332 GLU C C     1 
ATOM   8180  O  O     . GLU C  1 351 ? -9.635   -24.544 -0.130   1.00 51.24 ? 332 GLU C O     1 
ATOM   8181  C  CB    . GLU C  1 351 ? -11.106  -22.178 -1.366   1.00 52.03 ? 332 GLU C CB    1 
ATOM   8182  C  CG    . GLU C  1 351 ? -11.355  -20.677 -1.271   1.00 53.43 ? 332 GLU C CG    1 
ATOM   8183  C  CD    . GLU C  1 351 ? -12.821  -20.247 -1.397   1.00 53.88 ? 332 GLU C CD    1 
ATOM   8184  O  OE1   . GLU C  1 351 ? -13.754  -21.064 -1.212   1.00 55.20 ? 332 GLU C OE1   1 
ATOM   8185  O  OE2   . GLU C  1 351 ? -13.029  -19.053 -1.695   1.00 57.98 ? 332 GLU C OE2   1 
ATOM   8186  N  N     . LYS C  1 352 ? -8.840   -24.678 -2.237   1.00 51.73 ? 333 LYS C N     1 
ATOM   8187  C  CA    . LYS C  1 352 ? -8.611   -26.110 -2.154   1.00 52.35 ? 333 LYS C CA    1 
ATOM   8188  C  C     . LYS C  1 352 ? -9.895   -26.879 -1.800   1.00 51.26 ? 333 LYS C C     1 
ATOM   8189  O  O     . LYS C  1 352 ? -9.854   -27.932 -1.176   1.00 50.99 ? 333 LYS C O     1 
ATOM   8190  C  CB    . LYS C  1 352 ? -7.474   -26.426 -1.151   1.00 52.93 ? 333 LYS C CB    1 
ATOM   8191  C  CG    . LYS C  1 352 ? -6.078   -25.908 -1.568   1.00 54.13 ? 333 LYS C CG    1 
ATOM   8192  C  CD    . LYS C  1 352 ? -5.261   -25.488 -0.336   1.00 55.00 ? 333 LYS C CD    1 
ATOM   8193  C  CE    . LYS C  1 352 ? -3.794   -25.132 -0.657   1.00 57.20 ? 333 LYS C CE    1 
ATOM   8194  N  NZ    . LYS C  1 352 ? -2.920   -26.349 -0.606   1.00 59.06 ? 333 LYS C NZ    1 
ATOM   8195  N  N     . LYS C  1 353 ? -11.022  -26.342 -2.237   1.00 50.60 ? 334 LYS C N     1 
ATOM   8196  C  CA    . LYS C  1 353 ? -12.317  -26.984 -2.078   1.00 50.11 ? 334 LYS C CA    1 
ATOM   8197  C  C     . LYS C  1 353 ? -13.327  -26.339 -3.000   1.00 49.32 ? 334 LYS C C     1 
ATOM   8198  O  O     . LYS C  1 353 ? -13.123  -25.218 -3.462   1.00 49.52 ? 334 LYS C O     1 
ATOM   8199  C  CB    . LYS C  1 353 ? -12.823  -26.852 -0.654   1.00 50.20 ? 334 LYS C CB    1 
ATOM   8200  C  CG    . LYS C  1 353 ? -13.291  -25.436 -0.281   1.00 50.56 ? 334 LYS C CG    1 
ATOM   8201  C  CD    . LYS C  1 353 ? -13.619  -25.326 1.212    1.00 50.56 ? 334 LYS C CD    1 
ATOM   8202  C  CE    . LYS C  1 353 ? -13.960  -23.914 1.580    1.00 50.93 ? 334 LYS C CE    1 
ATOM   8203  N  NZ    . LYS C  1 353 ? -14.221  -23.810 3.030    1.00 51.88 ? 334 LYS C NZ    1 
ATOM   8204  N  N     . GLY C  1 354 ? -14.427  -27.057 -3.230   1.00 48.80 ? 335 GLY C N     1 
ATOM   8205  C  CA    . GLY C  1 354 ? -15.576  -26.607 -4.039   1.00 47.87 ? 335 GLY C CA    1 
ATOM   8206  C  C     . GLY C  1 354 ? -15.990  -27.638 -5.084   1.00 47.32 ? 335 GLY C C     1 
ATOM   8207  O  O     . GLY C  1 354 ? -16.249  -28.802 -4.785   1.00 46.66 ? 335 GLY C O     1 
ATOM   8208  N  N     . TYR C  1 355 ? -15.996  -27.201 -6.337   1.00 46.96 ? 336 TYR C N     1 
ATOM   8209  C  CA    . TYR C  1 355 ? -16.519  -27.981 -7.470   1.00 46.26 ? 336 TYR C CA    1 
ATOM   8210  C  C     . TYR C  1 355 ? -15.577  -27.850 -8.660   1.00 45.62 ? 336 TYR C C     1 
ATOM   8211  O  O     . TYR C  1 355 ? -14.741  -26.941 -8.690   1.00 45.04 ? 336 TYR C O     1 
ATOM   8212  C  CB    . TYR C  1 355 ? -17.881  -27.419 -7.900   1.00 46.23 ? 336 TYR C CB    1 
ATOM   8213  C  CG    . TYR C  1 355 ? -17.845  -25.947 -8.231   1.00 45.64 ? 336 TYR C CG    1 
ATOM   8214  C  CD1   . TYR C  1 355 ? -17.676  -25.502 -9.536   1.00 45.79 ? 336 TYR C CD1   1 
ATOM   8215  C  CD2   . TYR C  1 355 ? -17.984  -24.994 -7.236   1.00 46.52 ? 336 TYR C CD2   1 
ATOM   8216  C  CE1   . TYR C  1 355 ? -17.667  -24.147 -9.844   1.00 45.91 ? 336 TYR C CE1   1 
ATOM   8217  C  CE2   . TYR C  1 355 ? -17.988  -23.617 -7.534   1.00 47.22 ? 336 TYR C CE2   1 
ATOM   8218  C  CZ    . TYR C  1 355 ? -17.812  -23.210 -8.832   1.00 46.60 ? 336 TYR C CZ    1 
ATOM   8219  O  OH    . TYR C  1 355 ? -17.791  -21.874 -9.095   1.00 46.98 ? 336 TYR C OH    1 
ATOM   8220  N  N     . PHE C  1 356 ? -15.739  -28.724 -9.654   1.00 44.72 ? 337 PHE C N     1 
ATOM   8221  C  CA    . PHE C  1 356 ? -15.110  -28.487 -10.949  1.00 44.13 ? 337 PHE C CA    1 
ATOM   8222  C  C     . PHE C  1 356 ? -16.171  -28.307 -11.996  1.00 43.58 ? 337 PHE C C     1 
ATOM   8223  O  O     . PHE C  1 356 ? -17.340  -28.577 -11.732  1.00 43.64 ? 337 PHE C O     1 
ATOM   8224  C  CB    . PHE C  1 356 ? -14.176  -29.605 -11.347  1.00 43.99 ? 337 PHE C CB    1 
ATOM   8225  C  CG    . PHE C  1 356 ? -14.826  -30.957 -11.445  1.00 44.26 ? 337 PHE C CG    1 
ATOM   8226  C  CD1   . PHE C  1 356 ? -15.232  -31.458 -12.676  1.00 45.42 ? 337 PHE C CD1   1 
ATOM   8227  C  CD2   . PHE C  1 356 ? -14.973  -31.756 -10.324  1.00 43.18 ? 337 PHE C CD2   1 
ATOM   8228  C  CE1   . PHE C  1 356 ? -15.789  -32.711 -12.780  1.00 44.55 ? 337 PHE C CE1   1 
ATOM   8229  C  CE2   . PHE C  1 356 ? -15.523  -33.008 -10.426  1.00 43.78 ? 337 PHE C CE2   1 
ATOM   8230  C  CZ    . PHE C  1 356 ? -15.930  -33.485 -11.655  1.00 44.72 ? 337 PHE C CZ    1 
ATOM   8231  N  N     . GLU C  1 357 ? -15.730  -27.876 -13.176  1.00 42.93 ? 338 GLU C N     1 
ATOM   8232  C  CA    . GLU C  1 357 ? -16.586  -27.518 -14.280  1.00 42.73 ? 338 GLU C CA    1 
ATOM   8233  C  C     . GLU C  1 357 ? -16.283  -28.437 -15.433  1.00 42.07 ? 338 GLU C C     1 
ATOM   8234  O  O     . GLU C  1 357 ? -15.183  -28.387 -15.969  1.00 41.40 ? 338 GLU C O     1 
ATOM   8235  C  CB    . GLU C  1 357 ? -16.291  -26.075 -14.728  1.00 42.60 ? 338 GLU C CB    1 
ATOM   8236  C  CG    . GLU C  1 357 ? -17.072  -25.624 -15.956  1.00 43.08 ? 338 GLU C CG    1 
ATOM   8237  C  CD    . GLU C  1 357 ? -16.591  -24.288 -16.600  1.00 43.74 ? 338 GLU C CD    1 
ATOM   8238  O  OE1   . GLU C  1 357 ? -15.360  -24.014 -16.608  1.00 42.58 ? 338 GLU C OE1   1 
ATOM   8239  O  OE2   . GLU C  1 357 ? -17.459  -23.527 -17.128  1.00 44.36 ? 338 GLU C OE2   1 
ATOM   8240  N  N     . ASP C  1 358 ? -17.263  -29.240 -15.858  1.00 41.30 ? 339 ASP C N     1 
ATOM   8241  C  CA    . ASP C  1 358 ? -17.118  -29.999 -17.110  1.00 41.03 ? 339 ASP C CA    1 
ATOM   8242  C  C     . ASP C  1 358 ? -17.638  -29.159 -18.291  1.00 40.68 ? 339 ASP C C     1 
ATOM   8243  O  O     . ASP C  1 358 ? -18.834  -28.951 -18.413  1.00 40.77 ? 339 ASP C O     1 
ATOM   8244  C  CB    . ASP C  1 358 ? -17.807  -31.343 -17.014  1.00 40.05 ? 339 ASP C CB    1 
ATOM   8245  C  CG    . ASP C  1 358 ? -17.569  -32.207 -18.222  1.00 40.58 ? 339 ASP C CG    1 
ATOM   8246  O  OD1   . ASP C  1 358 ? -17.236  -31.698 -19.305  1.00 38.14 ? 339 ASP C OD1   1 
ATOM   8247  O  OD2   . ASP C  1 358 ? -17.753  -33.429 -18.102  1.00 42.15 ? 339 ASP C OD2   1 
ATOM   8248  N  N     . ARG C  1 359 ? -16.732  -28.708 -19.158  1.00 40.53 ? 340 ARG C N     1 
ATOM   8249  C  CA    . ARG C  1 359 ? -17.076  -27.773 -20.247  1.00 40.68 ? 340 ARG C CA    1 
ATOM   8250  C  C     . ARG C  1 359 ? -17.506  -28.429 -21.536  1.00 40.39 ? 340 ARG C C     1 
ATOM   8251  O  O     . ARG C  1 359 ? -17.825  -27.724 -22.504  1.00 40.75 ? 340 ARG C O     1 
ATOM   8252  C  CB    . ARG C  1 359 ? -15.883  -26.860 -20.554  1.00 40.73 ? 340 ARG C CB    1 
ATOM   8253  C  CG    . ARG C  1 359 ? -15.424  -26.035 -19.349  1.00 41.29 ? 340 ARG C CG    1 
ATOM   8254  C  CD    . ARG C  1 359 ? -14.284  -25.119 -19.656  1.00 41.21 ? 340 ARG C CD    1 
ATOM   8255  N  NE    . ARG C  1 359 ? -14.580  -24.178 -20.730  1.00 42.68 ? 340 ARG C NE    1 
ATOM   8256  C  CZ    . ARG C  1 359 ? -15.111  -22.975 -20.590  1.00 40.89 ? 340 ARG C CZ    1 
ATOM   8257  N  NH1   . ARG C  1 359 ? -15.440  -22.485 -19.395  1.00 43.73 ? 340 ARG C NH1   1 
ATOM   8258  N  NH2   . ARG C  1 359 ? -15.301  -22.255 -21.664  1.00 39.03 ? 340 ARG C NH2   1 
ATOM   8259  N  N     . ARG C  1 360 ? -17.527  -29.759 -21.560  1.00 40.13 ? 341 ARG C N     1 
ATOM   8260  C  CA    . ARG C  1 360 ? -17.882  -30.529 -22.763  1.00 40.68 ? 341 ARG C CA    1 
ATOM   8261  C  C     . ARG C  1 360 ? -19.400  -30.639 -23.177  1.00 40.47 ? 341 ARG C C     1 
ATOM   8262  O  O     . ARG C  1 360 ? -19.725  -30.813 -24.364  1.00 40.44 ? 341 ARG C O     1 
ATOM   8263  C  CB    . ARG C  1 360 ? -17.316  -31.962 -22.612  1.00 40.83 ? 341 ARG C CB    1 
ATOM   8264  C  CG    . ARG C  1 360 ? -15.797  -32.039 -22.668  1.00 41.02 ? 341 ARG C CG    1 
ATOM   8265  C  CD    . ARG C  1 360 ? -15.315  -33.420 -22.322  1.00 41.71 ? 341 ARG C CD    1 
ATOM   8266  N  NE    . ARG C  1 360 ? -15.729  -33.830 -20.980  1.00 43.01 ? 341 ARG C NE    1 
ATOM   8267  C  CZ    . ARG C  1 360 ? -15.482  -35.029 -20.445  1.00 43.35 ? 341 ARG C CZ    1 
ATOM   8268  N  NH1   . ARG C  1 360 ? -14.787  -35.935 -21.111  1.00 43.71 ? 341 ARG C NH1   1 
ATOM   8269  N  NH2   . ARG C  1 360 ? -15.920  -35.319 -19.225  1.00 43.17 ? 341 ARG C NH2   1 
ATOM   8270  N  N     . PRO C  1 361 ? -20.333  -30.647 -22.218  1.00 40.42 ? 342 PRO C N     1 
ATOM   8271  C  CA    . PRO C  1 361 ? -21.730  -30.840 -22.669  1.00 40.17 ? 342 PRO C CA    1 
ATOM   8272  C  C     . PRO C  1 361 ? -22.221  -29.773 -23.664  1.00 40.19 ? 342 PRO C C     1 
ATOM   8273  O  O     . PRO C  1 361 ? -21.946  -28.573 -23.487  1.00 39.76 ? 342 PRO C O     1 
ATOM   8274  C  CB    . PRO C  1 361 ? -22.535  -30.742 -21.376  1.00 39.73 ? 342 PRO C CB    1 
ATOM   8275  C  CG    . PRO C  1 361 ? -21.606  -31.097 -20.311  1.00 39.90 ? 342 PRO C CG    1 
ATOM   8276  C  CD    . PRO C  1 361 ? -20.239  -30.585 -20.754  1.00 40.53 ? 342 PRO C CD    1 
ATOM   8277  N  N     . SER C  1 362 ? -22.947  -30.224 -24.684  1.00 39.90 ? 343 SER C N     1 
ATOM   8278  C  CA    . SER C  1 362 ? -23.607  -29.346 -25.653  1.00 40.03 ? 343 SER C CA    1 
ATOM   8279  C  C     . SER C  1 362 ? -24.731  -28.536 -24.999  1.00 39.69 ? 343 SER C C     1 
ATOM   8280  O  O     . SER C  1 362 ? -25.382  -28.999 -24.073  1.00 39.65 ? 343 SER C O     1 
ATOM   8281  C  CB    . SER C  1 362 ? -24.172  -30.191 -26.802  1.00 40.11 ? 343 SER C CB    1 
ATOM   8282  O  OG    . SER C  1 362 ? -24.891  -29.394 -27.727  1.00 42.91 ? 343 SER C OG    1 
ATOM   8283  N  N     . ALA C  1 363 ? -24.941  -27.319 -25.491  1.00 39.55 ? 344 ALA C N     1 
ATOM   8284  C  CA    . ALA C  1 363 ? -26.095  -26.505 -25.110  1.00 39.37 ? 344 ALA C CA    1 
ATOM   8285  C  C     . ALA C  1 363 ? -27.376  -27.310 -25.224  1.00 39.61 ? 344 ALA C C     1 
ATOM   8286  O  O     . ALA C  1 363 ? -28.279  -27.097 -24.405  1.00 39.41 ? 344 ALA C O     1 
ATOM   8287  C  CB    . ALA C  1 363 ? -26.200  -25.269 -25.984  1.00 39.04 ? 344 ALA C CB    1 
ATOM   8288  N  N     . ASN C  1 364 ? -27.461  -28.244 -26.204  1.00 39.77 ? 345 ASN C N     1 
ATOM   8289  C  CA    . ASN C  1 364 ? -28.665  -29.092 -26.349  1.00 39.84 ? 345 ASN C CA    1 
ATOM   8290  C  C     . ASN C  1 364 ? -28.544  -30.467 -25.692  1.00 40.37 ? 345 ASN C C     1 
ATOM   8291  O  O     . ASN C  1 364 ? -29.255  -31.398 -26.085  1.00 41.50 ? 345 ASN C O     1 
ATOM   8292  C  CB    . ASN C  1 364 ? -29.106  -29.255 -27.810  1.00 39.98 ? 345 ASN C CB    1 
ATOM   8293  C  CG    . ASN C  1 364 ? -28.170  -30.143 -28.615  1.00 40.50 ? 345 ASN C CG    1 
ATOM   8294  O  OD1   . ASN C  1 364 ? -27.063  -30.436 -28.175  1.00 42.33 ? 345 ASN C OD1   1 
ATOM   8295  N  ND2   . ASN C  1 364 ? -28.597  -30.547 -29.800  1.00 37.51 ? 345 ASN C ND2   1 
ATOM   8296  N  N     . CYS C  1 365 ? -27.687  -30.604 -24.687  1.00 39.72 ? 346 CYS C N     1 
ATOM   8297  C  CA    . CYS C  1 365 ? -27.670  -31.833 -23.921  1.00 39.86 ? 346 CYS C CA    1 
ATOM   8298  C  C     . CYS C  1 365 ? -28.949  -32.074 -23.133  1.00 40.04 ? 346 CYS C C     1 
ATOM   8299  O  O     . CYS C  1 365 ? -29.726  -31.166 -22.861  1.00 41.45 ? 346 CYS C O     1 
ATOM   8300  C  CB    . CYS C  1 365 ? -26.483  -31.860 -22.956  1.00 39.60 ? 346 CYS C CB    1 
ATOM   8301  S  SG    . CYS C  1 365 ? -26.628  -30.730 -21.562  1.00 40.22 ? 346 CYS C SG    1 
ATOM   8302  N  N     . ASP C  1 366 ? -29.174  -33.318 -22.763  1.00 39.97 ? 347 ASP C N     1 
ATOM   8303  C  CA    . ASP C  1 366 ? -30.212  -33.644 -21.812  1.00 39.65 ? 347 ASP C CA    1 
ATOM   8304  C  C     . ASP C  1 366 ? -29.570  -33.770 -20.403  1.00 39.79 ? 347 ASP C C     1 
ATOM   8305  O  O     . ASP C  1 366 ? -28.757  -34.680 -20.129  1.00 39.38 ? 347 ASP C O     1 
ATOM   8306  C  CB    . ASP C  1 366 ? -30.909  -34.928 -22.219  1.00 39.50 ? 347 ASP C CB    1 
ATOM   8307  C  CG    . ASP C  1 366 ? -32.038  -35.326 -21.256  1.00 40.49 ? 347 ASP C CG    1 
ATOM   8308  O  OD1   . ASP C  1 366 ? -32.004  -34.977 -20.045  1.00 40.14 ? 347 ASP C OD1   1 
ATOM   8309  O  OD2   . ASP C  1 366 ? -32.955  -36.027 -21.722  1.00 42.96 ? 347 ASP C OD2   1 
ATOM   8310  N  N     . PRO C  1 367 ? -29.946  -32.868 -19.493  1.00 39.51 ? 348 PRO C N     1 
ATOM   8311  C  CA    . PRO C  1 367 ? -29.291  -32.864 -18.219  1.00 39.53 ? 348 PRO C CA    1 
ATOM   8312  C  C     . PRO C  1 367 ? -29.394  -34.202 -17.469  1.00 39.48 ? 348 PRO C C     1 
ATOM   8313  O  O     . PRO C  1 367 ? -28.537  -34.549 -16.680  1.00 38.97 ? 348 PRO C O     1 
ATOM   8314  C  CB    . PRO C  1 367 ? -29.983  -31.723 -17.485  1.00 39.32 ? 348 PRO C CB    1 
ATOM   8315  C  CG    . PRO C  1 367 ? -31.254  -31.541 -18.166  1.00 40.53 ? 348 PRO C CG    1 
ATOM   8316  C  CD    . PRO C  1 367 ? -30.980  -31.833 -19.582  1.00 39.98 ? 348 PRO C CD    1 
ATOM   8317  N  N     . PHE C  1 368 ? -30.427  -34.976 -17.724  1.00 40.26 ? 349 PHE C N     1 
ATOM   8318  C  CA    . PHE C  1 368 ? -30.528  -36.248 -17.036  1.00 40.24 ? 349 PHE C CA    1 
ATOM   8319  C  C     . PHE C  1 368 ? -29.427  -37.171 -17.520  1.00 40.38 ? 349 PHE C C     1 
ATOM   8320  O  O     . PHE C  1 368 ? -28.921  -38.003 -16.774  1.00 40.80 ? 349 PHE C O     1 
ATOM   8321  C  CB    . PHE C  1 368 ? -31.877  -36.896 -17.289  1.00 40.17 ? 349 PHE C CB    1 
ATOM   8322  C  CG    . PHE C  1 368 ? -33.032  -36.137 -16.694  1.00 40.64 ? 349 PHE C CG    1 
ATOM   8323  C  CD1   . PHE C  1 368 ? -33.044  -35.819 -15.334  1.00 40.20 ? 349 PHE C CD1   1 
ATOM   8324  C  CD2   . PHE C  1 368 ? -34.117  -35.778 -17.476  1.00 37.26 ? 349 PHE C CD2   1 
ATOM   8325  C  CE1   . PHE C  1 368 ? -34.084  -35.125 -14.784  1.00 39.15 ? 349 PHE C CE1   1 
ATOM   8326  C  CE2   . PHE C  1 368 ? -35.131  -35.093 -16.923  1.00 37.93 ? 349 PHE C CE2   1 
ATOM   8327  C  CZ    . PHE C  1 368 ? -35.124  -34.764 -15.566  1.00 38.37 ? 349 PHE C CZ    1 
ATOM   8328  N  N     . SER C  1 369 ? -29.066  -37.033 -18.783  1.00 40.20 ? 350 SER C N     1 
ATOM   8329  C  CA    . SER C  1 369 ? -28.027  -37.857 -19.319  1.00 40.26 ? 350 SER C CA    1 
ATOM   8330  C  C     . SER C  1 369 ? -26.634  -37.391 -18.834  1.00 40.34 ? 350 SER C C     1 
ATOM   8331  O  O     . SER C  1 369 ? -25.766  -38.211 -18.531  1.00 40.88 ? 350 SER C O     1 
ATOM   8332  C  CB    . SER C  1 369 ? -28.116  -37.908 -20.841  1.00 40.01 ? 350 SER C CB    1 
ATOM   8333  O  OG    . SER C  1 369 ? -26.876  -38.390 -21.379  1.00 40.60 ? 350 SER C OG    1 
ATOM   8334  N  N     . VAL C  1 370 ? -26.429  -36.078 -18.763  1.00 41.01 ? 351 VAL C N     1 
ATOM   8335  C  CA    . VAL C  1 370 ? -25.137  -35.519 -18.357  1.00 40.74 ? 351 VAL C CA    1 
ATOM   8336  C  C     . VAL C  1 370 ? -24.879  -35.838 -16.891  1.00 41.22 ? 351 VAL C C     1 
ATOM   8337  O  O     . VAL C  1 370 ? -23.799  -36.318 -16.559  1.00 41.30 ? 351 VAL C O     1 
ATOM   8338  C  CB    . VAL C  1 370 ? -25.058  -33.960 -18.587  1.00 41.00 ? 351 VAL C CB    1 
ATOM   8339  C  CG1   . VAL C  1 370 ? -23.748  -33.354 -17.971  1.00 38.14 ? 351 VAL C CG1   1 
ATOM   8340  C  CG2   . VAL C  1 370 ? -25.171  -33.632 -20.093  1.00 39.76 ? 351 VAL C CG2   1 
ATOM   8341  N  N     . THR C  1 371 ? -25.863  -35.569 -16.032  1.00 41.00 ? 352 THR C N     1 
ATOM   8342  C  CA    . THR C  1 371 ? -25.693  -35.722 -14.591  1.00 41.30 ? 352 THR C CA    1 
ATOM   8343  C  C     . THR C  1 371 ? -25.502  -37.198 -14.242  1.00 41.62 ? 352 THR C C     1 
ATOM   8344  O  O     . THR C  1 371 ? -24.757  -37.556 -13.353  1.00 41.75 ? 352 THR C O     1 
ATOM   8345  C  CB    . THR C  1 371 ? -26.917  -35.102 -13.769  1.00 41.22 ? 352 THR C CB    1 
ATOM   8346  O  OG1   . THR C  1 371 ? -28.164  -35.536 -14.324  1.00 41.28 ? 352 THR C OG1   1 
ATOM   8347  C  CG2   . THR C  1 371 ? -26.892  -33.593 -13.795  1.00 40.33 ? 352 THR C CG2   1 
ATOM   8348  N  N     . GLU C  1 372 ? -26.198  -38.072 -14.948  1.00 42.53 ? 353 GLU C N     1 
ATOM   8349  C  CA    . GLU C  1 372 ? -26.080  -39.498 -14.680  1.00 42.11 ? 353 GLU C CA    1 
ATOM   8350  C  C     . GLU C  1 372 ? -24.681  -40.001 -15.039  1.00 41.98 ? 353 GLU C C     1 
ATOM   8351  O  O     . GLU C  1 372 ? -24.100  -40.751 -14.261  1.00 42.28 ? 353 GLU C O     1 
ATOM   8352  C  CB    . GLU C  1 372 ? -27.144  -40.271 -15.440  1.00 42.19 ? 353 GLU C CB    1 
ATOM   8353  C  CG    . GLU C  1 372 ? -27.018  -41.792 -15.324  1.00 42.79 ? 353 GLU C CG    1 
ATOM   8354  C  CD    . GLU C  1 372 ? -28.087  -42.536 -16.123  1.00 42.83 ? 353 GLU C CD    1 
ATOM   8355  O  OE1   . GLU C  1 372 ? -29.222  -42.007 -16.318  1.00 42.99 ? 353 GLU C OE1   1 
ATOM   8356  O  OE2   . GLU C  1 372 ? -27.767  -43.656 -16.562  1.00 43.75 ? 353 GLU C OE2   1 
ATOM   8357  N  N     . ALA C  1 373 ? -24.151  -39.609 -16.202  1.00 41.50 ? 354 ALA C N     1 
ATOM   8358  C  CA    . ALA C  1 373 ? -22.801  -40.043 -16.600  1.00 41.71 ? 354 ALA C CA    1 
ATOM   8359  C  C     . ALA C  1 373 ? -21.771  -39.663 -15.509  1.00 41.68 ? 354 ALA C C     1 
ATOM   8360  O  O     . ALA C  1 373 ? -20.976  -40.478 -15.072  1.00 41.08 ? 354 ALA C O     1 
ATOM   8361  C  CB    . ALA C  1 373 ? -22.424  -39.466 -17.952  1.00 40.83 ? 354 ALA C CB    1 
ATOM   8362  N  N     . LEU C  1 374 ? -21.861  -38.424 -15.036  1.00 42.06 ? 355 LEU C N     1 
ATOM   8363  C  CA    . LEU C  1 374 ? -20.987  -37.903 -14.018  1.00 42.29 ? 355 LEU C CA    1 
ATOM   8364  C  C     . LEU C  1 374 ? -21.040  -38.767 -12.774  1.00 42.95 ? 355 LEU C C     1 
ATOM   8365  O  O     . LEU C  1 374 ? -19.995  -39.007 -12.164  1.00 43.63 ? 355 LEU C O     1 
ATOM   8366  C  CB    . LEU C  1 374 ? -21.323  -36.433 -13.685  1.00 42.39 ? 355 LEU C CB    1 
ATOM   8367  C  CG    . LEU C  1 374 ? -20.908  -35.306 -14.685  1.00 41.37 ? 355 LEU C CG    1 
ATOM   8368  C  CD1   . LEU C  1 374 ? -21.380  -33.944 -14.220  1.00 37.64 ? 355 LEU C CD1   1 
ATOM   8369  C  CD2   . LEU C  1 374 ? -19.418  -35.277 -14.876  1.00 38.87 ? 355 LEU C CD2   1 
ATOM   8370  N  N     . ILE C  1 375 ? -22.222  -39.244 -12.396  1.00 42.95 ? 356 ILE C N     1 
ATOM   8371  C  CA    . ILE C  1 375 ? -22.327  -40.057 -11.194  1.00 43.57 ? 356 ILE C CA    1 
ATOM   8372  C  C     . ILE C  1 375 ? -21.702  -41.418 -11.419  1.00 43.85 ? 356 ILE C C     1 
ATOM   8373  O  O     . ILE C  1 375 ? -20.944  -41.896 -10.580  1.00 44.50 ? 356 ILE C O     1 
ATOM   8374  C  CB    . ILE C  1 375 ? -23.806  -40.254 -10.657  1.00 43.92 ? 356 ILE C CB    1 
ATOM   8375  C  CG1   . ILE C  1 375 ? -24.439  -38.903 -10.212  1.00 43.54 ? 356 ILE C CG1   1 
ATOM   8376  C  CG2   . ILE C  1 375 ? -23.826  -41.276 -9.503   1.00 42.52 ? 356 ILE C CG2   1 
ATOM   8377  C  CD1   . ILE C  1 375 ? -23.625  -38.044 -9.171   1.00 41.41 ? 356 ILE C CD1   1 
ATOM   8378  N  N     . ARG C  1 376 ? -21.993  -42.028 -12.551  1.00 43.88 ? 357 ARG C N     1 
ATOM   8379  C  CA    . ARG C  1 376 ? -21.526  -43.374 -12.799  1.00 44.19 ? 357 ARG C CA    1 
ATOM   8380  C  C     . ARG C  1 376 ? -20.002  -43.431 -12.829  1.00 44.74 ? 357 ARG C C     1 
ATOM   8381  O  O     . ARG C  1 376 ? -19.368  -44.322 -12.237  1.00 45.17 ? 357 ARG C O     1 
ATOM   8382  C  CB    . ARG C  1 376 ? -22.101  -43.892 -14.113  1.00 44.83 ? 357 ARG C CB    1 
ATOM   8383  C  CG    . ARG C  1 376 ? -23.620  -44.202 -14.095  1.00 43.40 ? 357 ARG C CG    1 
ATOM   8384  C  CD    . ARG C  1 376 ? -24.019  -44.719 -15.452  1.00 44.42 ? 357 ARG C CD    1 
ATOM   8385  N  NE    . ARG C  1 376 ? -25.434  -45.066 -15.581  1.00 45.81 ? 357 ARG C NE    1 
ATOM   8386  C  CZ    . ARG C  1 376 ? -25.963  -46.237 -15.229  1.00 45.72 ? 357 ARG C CZ    1 
ATOM   8387  N  NH1   . ARG C  1 376 ? -25.188  -47.199 -14.729  1.00 45.94 ? 357 ARG C NH1   1 
ATOM   8388  N  NH2   . ARG C  1 376 ? -27.265  -46.442 -15.367  1.00 43.67 ? 357 ARG C NH2   1 
ATOM   8389  N  N     . THR C  1 377 ? -19.408  -42.468 -13.511  1.00 44.43 ? 358 THR C N     1 
ATOM   8390  C  CA    . THR C  1 377 ? -17.974  -42.393 -13.641  1.00 44.51 ? 358 THR C CA    1 
ATOM   8391  C  C     . THR C  1 377 ? -17.321  -41.965 -12.323  1.00 44.60 ? 358 THR C C     1 
ATOM   8392  O  O     . THR C  1 377 ? -16.444  -42.646 -11.802  1.00 44.90 ? 358 THR C O     1 
ATOM   8393  C  CB    . THR C  1 377 ? -17.608  -41.470 -14.847  1.00 44.84 ? 358 THR C CB    1 
ATOM   8394  O  OG1   . THR C  1 377 ? -18.179  -42.027 -16.069  1.00 43.86 ? 358 THR C OG1   1 
ATOM   8395  C  CG2   . THR C  1 377 ? -16.078  -41.265 -14.961  1.00 42.80 ? 358 THR C CG2   1 
ATOM   8396  N  N     . CYS C  1 378 ? -17.757  -40.870 -11.748  1.00 45.07 ? 359 CYS C N     1 
ATOM   8397  C  CA    . CYS C  1 378 ? -17.054  -40.341 -10.581  1.00 46.02 ? 359 CYS C CA    1 
ATOM   8398  C  C     . CYS C  1 378 ? -17.405  -40.965 -9.241   1.00 46.21 ? 359 CYS C C     1 
ATOM   8399  O  O     . CYS C  1 378 ? -16.558  -41.040 -8.390   1.00 45.92 ? 359 CYS C O     1 
ATOM   8400  C  CB    . CYS C  1 378 ? -17.244  -38.835 -10.491  1.00 45.64 ? 359 CYS C CB    1 
ATOM   8401  S  SG    . CYS C  1 378 ? -16.759  -38.106 -12.004  1.00 48.62 ? 359 CYS C SG    1 
ATOM   8402  N  N     . LEU C  1 379 ? -18.645  -41.384 -9.036   1.00 46.96 ? 360 LEU C N     1 
ATOM   8403  C  CA    . LEU C  1 379 ? -19.018  -41.925 -7.741   1.00 47.43 ? 360 LEU C CA    1 
ATOM   8404  C  C     . LEU C  1 379 ? -19.243  -43.437 -7.743   1.00 48.06 ? 360 LEU C C     1 
ATOM   8405  O  O     . LEU C  1 379 ? -18.926  -44.076 -6.752   1.00 48.35 ? 360 LEU C O     1 
ATOM   8406  C  CB    . LEU C  1 379 ? -20.242  -41.216 -7.199   1.00 47.29 ? 360 LEU C CB    1 
ATOM   8407  C  CG    . LEU C  1 379 ? -20.207  -39.683 -7.244   1.00 48.09 ? 360 LEU C CG    1 
ATOM   8408  C  CD1   . LEU C  1 379 ? -21.534  -39.149 -6.641   1.00 47.99 ? 360 LEU C CD1   1 
ATOM   8409  C  CD2   . LEU C  1 379 ? -19.005  -39.111 -6.541   1.00 46.88 ? 360 LEU C CD2   1 
ATOM   8410  N  N     . LEU C  1 380 ? -19.793  -44.016 -8.816   1.00 48.51 ? 361 LEU C N     1 
ATOM   8411  C  CA    . LEU C  1 380 ? -20.008  -45.479 -8.875   1.00 48.85 ? 361 LEU C CA    1 
ATOM   8412  C  C     . LEU C  1 380 ? -18.846  -46.223 -9.558   1.00 49.53 ? 361 LEU C C     1 
ATOM   8413  O  O     . LEU C  1 380 ? -18.877  -47.436 -9.691   1.00 49.09 ? 361 LEU C O     1 
ATOM   8414  C  CB    . LEU C  1 380 ? -21.335  -45.815 -9.547   1.00 48.45 ? 361 LEU C CB    1 
ATOM   8415  C  CG    . LEU C  1 380 ? -22.561  -45.253 -8.822   1.00 48.14 ? 361 LEU C CG    1 
ATOM   8416  C  CD1   . LEU C  1 380 ? -23.820  -45.445 -9.653   1.00 45.73 ? 361 LEU C CD1   1 
ATOM   8417  C  CD2   . LEU C  1 380 ? -22.730  -45.851 -7.430   1.00 46.22 ? 361 LEU C CD2   1 
ATOM   8418  N  N     . ASN C  1 381 ? -17.817  -45.480 -9.970   1.00 50.43 ? 362 ASN C N     1 
ATOM   8419  C  CA    . ASN C  1 381 ? -16.570  -46.057 -10.450  1.00 50.82 ? 362 ASN C CA    1 
ATOM   8420  C  C     . ASN C  1 381 ? -16.742  -47.034 -11.620  1.00 51.05 ? 362 ASN C C     1 
ATOM   8421  O  O     . ASN C  1 381 ? -16.010  -48.001 -11.768  1.00 49.59 ? 362 ASN C O     1 
ATOM   8422  C  CB    . ASN C  1 381 ? -15.806  -46.669 -9.271   1.00 51.26 ? 362 ASN C CB    1 
ATOM   8423  C  CG    . ASN C  1 381 ? -15.482  -45.628 -8.181   1.00 52.33 ? 362 ASN C CG    1 
ATOM   8424  O  OD1   . ASN C  1 381 ? -15.380  -44.435 -8.445   1.00 53.54 ? 362 ASN C OD1   1 
ATOM   8425  N  ND2   . ASN C  1 381 ? -15.346  -46.086 -6.959   1.00 52.76 ? 362 ASN C ND2   1 
ATOM   8426  N  N     . GLU C  1 382 ? -17.698  -46.723 -12.490  1.00 51.96 ? 363 GLU C N     1 
ATOM   8427  C  CA    . GLU C  1 382 ? -17.917  -47.510 -13.694  1.00 52.47 ? 363 GLU C CA    1 
ATOM   8428  C  C     . GLU C  1 382 ? -16.826  -47.372 -14.735  1.00 52.24 ? 363 GLU C C     1 
ATOM   8429  O  O     . GLU C  1 382 ? -16.186  -46.350 -14.829  1.00 52.28 ? 363 GLU C O     1 
ATOM   8430  C  CB    . GLU C  1 382 ? -19.268  -47.169 -14.299  1.00 52.59 ? 363 GLU C CB    1 
ATOM   8431  C  CG    . GLU C  1 382 ? -20.405  -47.832 -13.518  1.00 53.51 ? 363 GLU C CG    1 
ATOM   8432  C  CD    . GLU C  1 382 ? -21.771  -47.586 -14.111  1.00 53.39 ? 363 GLU C CD    1 
ATOM   8433  O  OE1   . GLU C  1 382 ? -21.855  -47.282 -15.332  1.00 56.46 ? 363 GLU C OE1   1 
ATOM   8434  O  OE2   . GLU C  1 382 ? -22.744  -47.686 -13.346  1.00 52.57 ? 363 GLU C OE2   1 
ATOM   8435  N  N     . THR C  1 383 ? -16.638  -48.432 -15.501  1.00 52.81 ? 364 THR C N     1 
ATOM   8436  C  CA    . THR C  1 383 ? -15.644  -48.515 -16.562  1.00 53.44 ? 364 THR C CA    1 
ATOM   8437  C  C     . THR C  1 383 ? -16.335  -49.288 -17.714  1.00 54.19 ? 364 THR C C     1 
ATOM   8438  O  O     . THR C  1 383 ? -17.234  -50.095 -17.467  1.00 55.69 ? 364 THR C O     1 
ATOM   8439  C  CB    . THR C  1 383 ? -14.338  -49.151 -16.019  1.00 53.53 ? 364 THR C CB    1 
ATOM   8440  O  OG1   . THR C  1 383 ? -14.655  -50.364 -15.348  1.00 53.00 ? 364 THR C OG1   1 
ATOM   8441  C  CG2   . THR C  1 383 ? -13.625  -48.224 -14.982  1.00 51.19 ? 364 THR C CG2   1 
ATOM   8442  N  N     . GLY C  1 384 ? -16.018  -48.972 -18.966  1.00 54.54 ? 365 GLY C N     1 
ATOM   8443  C  CA    . GLY C  1 384 ? -16.916  -49.328 -20.122  1.00 54.64 ? 365 GLY C CA    1 
ATOM   8444  C  C     . GLY C  1 384 ? -17.258  -48.224 -21.149  1.00 54.98 ? 365 GLY C C     1 
ATOM   8445  O  O     . GLY C  1 384 ? -16.602  -47.148 -21.233  1.00 54.39 ? 365 GLY C O     1 
ATOM   8446  N  N     . ASN D  1 29  ? -57.937  1.350   -31.957  1.00 62.38 ? 10  ASN D N     1 
ATOM   8447  C  CA    . ASN D  1 29  ? -56.883  0.659   -31.117  1.00 61.89 ? 10  ASN D CA    1 
ATOM   8448  C  C     . ASN D  1 29  ? -57.371  0.271   -29.708  1.00 61.73 ? 10  ASN D C     1 
ATOM   8449  O  O     . ASN D  1 29  ? -58.176  0.972   -29.096  1.00 61.95 ? 10  ASN D O     1 
ATOM   8450  C  CB    . ASN D  1 29  ? -55.656  1.557   -31.002  1.00 62.61 ? 10  ASN D CB    1 
ATOM   8451  C  CG    . ASN D  1 29  ? -54.446  0.857   -30.370  1.00 63.78 ? 10  ASN D CG    1 
ATOM   8452  O  OD1   . ASN D  1 29  ? -53.986  1.279   -29.293  1.00 65.98 ? 10  ASN D OD1   1 
ATOM   8453  N  ND2   . ASN D  1 29  ? -53.913  -0.207  -31.036  1.00 65.09 ? 10  ASN D ND2   1 
ATOM   8454  N  N     . LYS D  1 30  ? -56.845  -0.828  -29.177  1.00 60.69 ? 11  LYS D N     1 
ATOM   8455  C  CA    . LYS D  1 30  ? -57.398  -1.426  -27.979  1.00 59.63 ? 11  LYS D CA    1 
ATOM   8456  C  C     . LYS D  1 30  ? -57.018  -0.721  -26.680  1.00 58.54 ? 11  LYS D C     1 
ATOM   8457  O  O     . LYS D  1 30  ? -57.720  -0.841  -25.681  1.00 59.13 ? 11  LYS D O     1 
ATOM   8458  C  CB    . LYS D  1 30  ? -57.026  -2.909  -27.916  1.00 60.36 ? 11  LYS D CB    1 
ATOM   8459  C  CG    . LYS D  1 30  ? -57.431  -3.700  -29.194  1.00 61.75 ? 11  LYS D CG    1 
ATOM   8460  C  CD    . LYS D  1 30  ? -58.933  -3.988  -29.308  1.00 61.88 ? 11  LYS D CD    1 
ATOM   8461  C  CE    . LYS D  1 30  ? -59.295  -4.388  -30.747  1.00 61.89 ? 11  LYS D CE    1 
ATOM   8462  N  NZ    . LYS D  1 30  ? -60.704  -4.897  -30.865  1.00 62.20 ? 11  LYS D NZ    1 
ATOM   8463  N  N     . GLY D  1 31  ? -55.934  0.029   -26.675  1.00 56.76 ? 12  GLY D N     1 
ATOM   8464  C  CA    . GLY D  1 31  ? -55.611  0.811   -25.503  1.00 55.46 ? 12  GLY D CA    1 
ATOM   8465  C  C     . GLY D  1 31  ? -56.590  1.958   -25.287  1.00 54.16 ? 12  GLY D C     1 
ATOM   8466  O  O     . GLY D  1 31  ? -56.860  2.345   -24.139  1.00 54.02 ? 12  GLY D O     1 
ATOM   8467  N  N     . ILE D  1 32  ? -57.104  2.521   -26.383  1.00 52.31 ? 13  ILE D N     1 
ATOM   8468  C  CA    . ILE D  1 32  ? -58.074  3.614   -26.293  1.00 51.50 ? 13  ILE D CA    1 
ATOM   8469  C  C     . ILE D  1 32  ? -59.343  3.044   -25.639  1.00 50.20 ? 13  ILE D C     1 
ATOM   8470  O  O     . ILE D  1 32  ? -59.885  3.609   -24.677  1.00 49.68 ? 13  ILE D O     1 
ATOM   8471  C  CB    . ILE D  1 32  ? -58.468  4.183   -27.678  1.00 51.62 ? 13  ILE D CB    1 
ATOM   8472  C  CG1   . ILE D  1 32  ? -57.232  4.702   -28.455  1.00 52.43 ? 13  ILE D CG1   1 
ATOM   8473  C  CG2   . ILE D  1 32  ? -59.526  5.268   -27.485  1.00 51.72 ? 13  ILE D CG2   1 
ATOM   8474  C  CD1   . ILE D  1 32  ? -57.304  4.547   -30.041  1.00 51.80 ? 13  ILE D CD1   1 
ATOM   8475  N  N     . LYS D  1 33  ? -59.773  1.898   -26.155  1.00 48.07 ? 14  LYS D N     1 
ATOM   8476  C  CA    . LYS D  1 33  ? -60.917  1.225   -25.629  1.00 47.09 ? 14  LYS D CA    1 
ATOM   8477  C  C     . LYS D  1 33  ? -60.787  0.944   -24.129  1.00 46.13 ? 14  LYS D C     1 
ATOM   8478  O  O     . LYS D  1 33  ? -61.748  1.123   -23.383  1.00 45.42 ? 14  LYS D O     1 
ATOM   8479  C  CB    . LYS D  1 33  ? -61.127  -0.080  -26.366  1.00 46.71 ? 14  LYS D CB    1 
ATOM   8480  C  CG    . LYS D  1 33  ? -62.406  -0.770  -26.000  1.00 45.79 ? 14  LYS D CG    1 
ATOM   8481  C  CD    . LYS D  1 33  ? -62.320  -2.224  -26.320  1.00 45.50 ? 14  LYS D CD    1 
ATOM   8482  C  CE    . LYS D  1 33  ? -63.556  -2.912  -25.892  1.00 44.46 ? 14  LYS D CE    1 
ATOM   8483  N  NZ    . LYS D  1 33  ? -63.354  -4.319  -26.072  1.00 43.03 ? 14  LYS D NZ    1 
ATOM   8484  N  N     . GLN D  1 34  ? -59.614  0.526   -23.683  1.00 45.37 ? 15  GLN D N     1 
ATOM   8485  C  CA    . GLN D  1 34  ? -59.485  0.098   -22.304  1.00 45.10 ? 15  GLN D CA    1 
ATOM   8486  C  C     . GLN D  1 34  ? -59.710  1.228   -21.316  1.00 43.66 ? 15  GLN D C     1 
ATOM   8487  O  O     . GLN D  1 34  ? -60.216  1.018   -20.207  1.00 42.93 ? 15  GLN D O     1 
ATOM   8488  C  CB    . GLN D  1 34  ? -58.137  -0.537  -22.047  1.00 45.23 ? 15  GLN D CB    1 
ATOM   8489  C  CG    . GLN D  1 34  ? -58.125  -1.421  -20.791  1.00 47.51 ? 15  GLN D CG    1 
ATOM   8490  C  CD    . GLN D  1 34  ? -59.319  -2.399  -20.733  1.00 53.09 ? 15  GLN D CD    1 
ATOM   8491  O  OE1   . GLN D  1 34  ? -59.736  -3.013  -21.771  1.00 56.01 ? 15  GLN D OE1   1 
ATOM   8492  N  NE2   . GLN D  1 34  ? -59.895  -2.535  -19.525  1.00 53.99 ? 15  GLN D NE2   1 
ATOM   8493  N  N     . VAL D  1 35  ? -59.365  2.426   -21.750  1.00 42.12 ? 16  VAL D N     1 
ATOM   8494  C  CA    . VAL D  1 35  ? -59.623  3.592   -20.982  1.00 41.35 ? 16  VAL D CA    1 
ATOM   8495  C  C     . VAL D  1 35  ? -61.115  3.758   -20.732  1.00 41.27 ? 16  VAL D C     1 
ATOM   8496  O  O     . VAL D  1 35  ? -61.511  4.026   -19.595  1.00 41.66 ? 16  VAL D O     1 
ATOM   8497  C  CB    . VAL D  1 35  ? -59.015  4.856   -21.664  1.00 42.02 ? 16  VAL D CB    1 
ATOM   8498  C  CG1   . VAL D  1 35  ? -59.455  6.169   -20.952  1.00 40.41 ? 16  VAL D CG1   1 
ATOM   8499  C  CG2   . VAL D  1 35  ? -57.488  4.736   -21.711  1.00 40.31 ? 16  VAL D CG2   1 
ATOM   8500  N  N     . TYR D  1 36  ? -61.935  3.616   -21.770  1.00 40.47 ? 17  TYR D N     1 
ATOM   8501  C  CA    . TYR D  1 36  ? -63.382  3.785   -21.620  1.00 40.36 ? 17  TYR D CA    1 
ATOM   8502  C  C     . TYR D  1 36  ? -63.967  2.672   -20.729  1.00 40.18 ? 17  TYR D C     1 
ATOM   8503  O  O     . TYR D  1 36  ? -64.807  2.909   -19.878  1.00 40.13 ? 17  TYR D O     1 
ATOM   8504  C  CB    . TYR D  1 36  ? -64.076  3.790   -22.999  1.00 39.92 ? 17  TYR D CB    1 
ATOM   8505  C  CG    . TYR D  1 36  ? -63.880  5.074   -23.795  1.00 39.32 ? 17  TYR D CG    1 
ATOM   8506  C  CD1   . TYR D  1 36  ? -64.742  6.153   -23.634  1.00 38.73 ? 17  TYR D CD1   1 
ATOM   8507  C  CD2   . TYR D  1 36  ? -62.832  5.204   -24.714  1.00 38.42 ? 17  TYR D CD2   1 
ATOM   8508  C  CE1   . TYR D  1 36  ? -64.546  7.338   -24.353  1.00 40.41 ? 17  TYR D CE1   1 
ATOM   8509  C  CE2   . TYR D  1 36  ? -62.625  6.378   -25.442  1.00 37.66 ? 17  TYR D CE2   1 
ATOM   8510  C  CZ    . TYR D  1 36  ? -63.477  7.449   -25.259  1.00 38.95 ? 17  TYR D CZ    1 
ATOM   8511  O  OH    . TYR D  1 36  ? -63.297  8.623   -25.961  1.00 36.73 ? 17  TYR D OH    1 
ATOM   8512  N  N     . MET D  1 37  ? -63.492  1.449   -20.930  1.00 40.45 ? 18  MET D N     1 
ATOM   8513  C  CA    . MET D  1 37  ? -63.911  0.275   -20.147  1.00 39.91 ? 18  MET D CA    1 
ATOM   8514  C  C     . MET D  1 37  ? -63.419  0.307   -18.680  1.00 39.97 ? 18  MET D C     1 
ATOM   8515  O  O     . MET D  1 37  ? -63.762  -0.560  -17.917  1.00 39.25 ? 18  MET D O     1 
ATOM   8516  C  CB    . MET D  1 37  ? -63.388  -0.970  -20.816  1.00 39.11 ? 18  MET D CB    1 
ATOM   8517  C  CG    . MET D  1 37  ? -63.849  -1.145  -22.241  1.00 39.37 ? 18  MET D CG    1 
ATOM   8518  S  SD    . MET D  1 37  ? -65.624  -1.331  -22.450  1.00 42.62 ? 18  MET D SD    1 
ATOM   8519  C  CE    . MET D  1 37  ? -65.955  -2.897  -21.580  1.00 36.47 ? 18  MET D CE    1 
ATOM   8520  N  N     . SER D  1 38  ? -62.605  1.298   -18.303  1.00 40.61 ? 19  SER D N     1 
ATOM   8521  C  CA    . SER D  1 38  ? -62.214  1.539   -16.906  1.00 40.94 ? 19  SER D CA    1 
ATOM   8522  C  C     . SER D  1 38  ? -63.161  2.456   -16.220  1.00 40.95 ? 19  SER D C     1 
ATOM   8523  O  O     . SER D  1 38  ? -63.072  2.601   -15.002  1.00 41.30 ? 19  SER D O     1 
ATOM   8524  C  CB    . SER D  1 38  ? -60.862  2.244   -16.826  1.00 41.31 ? 19  SER D CB    1 
ATOM   8525  O  OG    . SER D  1 38  ? -59.892  1.379   -17.335  1.00 43.99 ? 19  SER D OG    1 
ATOM   8526  N  N     . LEU D  1 39  ? -64.008  3.134   -16.990  1.00 40.86 ? 20  LEU D N     1 
ATOM   8527  C  CA    . LEU D  1 39  ? -65.014  4.027   -16.408  1.00 41.21 ? 20  LEU D CA    1 
ATOM   8528  C  C     . LEU D  1 39  ? -65.996  3.171   -15.602  1.00 41.51 ? 20  LEU D C     1 
ATOM   8529  O  O     . LEU D  1 39  ? -66.478  2.154   -16.107  1.00 41.54 ? 20  LEU D O     1 
ATOM   8530  C  CB    . LEU D  1 39  ? -65.769  4.855   -17.483  1.00 40.38 ? 20  LEU D CB    1 
ATOM   8531  C  CG    . LEU D  1 39  ? -64.991  5.951   -18.238  1.00 38.78 ? 20  LEU D CG    1 
ATOM   8532  C  CD1   . LEU D  1 39  ? -65.768  6.487   -19.459  1.00 36.75 ? 20  LEU D CD1   1 
ATOM   8533  C  CD2   . LEU D  1 39  ? -64.658  7.063   -17.319  1.00 33.67 ? 20  LEU D CD2   1 
ATOM   8534  N  N     . PRO D  1 40  ? -66.265  3.563   -14.346  1.00 42.34 ? 21  PRO D N     1 
ATOM   8535  C  CA    . PRO D  1 40  ? -67.349  2.923   -13.577  1.00 42.61 ? 21  PRO D CA    1 
ATOM   8536  C  C     . PRO D  1 40  ? -68.699  3.102   -14.251  1.00 43.03 ? 21  PRO D C     1 
ATOM   8537  O  O     . PRO D  1 40  ? -69.058  4.225   -14.619  1.00 43.77 ? 21  PRO D O     1 
ATOM   8538  C  CB    . PRO D  1 40  ? -67.328  3.642   -12.227  1.00 42.46 ? 21  PRO D CB    1 
ATOM   8539  C  CG    . PRO D  1 40  ? -66.322  4.754   -12.329  1.00 43.32 ? 21  PRO D CG    1 
ATOM   8540  C  CD    . PRO D  1 40  ? -65.529  4.592   -13.579  1.00 42.33 ? 21  PRO D CD    1 
ATOM   8541  N  N     . GLN D  1 41  ? -69.444  2.014   -14.405  1.00 43.26 ? 22  GLN D N     1 
ATOM   8542  C  CA    . GLN D  1 41  ? -70.673  2.044   -15.227  1.00 43.84 ? 22  GLN D CA    1 
ATOM   8543  C  C     . GLN D  1 41  ? -71.921  2.477   -14.512  1.00 44.13 ? 22  GLN D C     1 
ATOM   8544  O  O     . GLN D  1 41  ? -72.867  2.842   -15.200  1.00 44.36 ? 22  GLN D O     1 
ATOM   8545  C  CB    . GLN D  1 41  ? -70.966  0.697   -15.943  1.00 43.90 ? 22  GLN D CB    1 
ATOM   8546  C  CG    . GLN D  1 41  ? -71.327  -0.494  -15.081  1.00 43.46 ? 22  GLN D CG    1 
ATOM   8547  C  CD    . GLN D  1 41  ? -71.536  -1.755  -15.943  1.00 44.10 ? 22  GLN D CD    1 
ATOM   8548  O  OE1   . GLN D  1 41  ? -70.597  -2.322  -16.468  1.00 42.95 ? 22  GLN D OE1   1 
ATOM   8549  N  NE2   . GLN D  1 41  ? -72.787  -2.163  -16.102  1.00 43.65 ? 22  GLN D NE2   1 
ATOM   8550  N  N     . GLY D  1 42  ? -71.949  2.395   -13.172  1.00 43.90 ? 23  GLY D N     1 
ATOM   8551  C  CA    . GLY D  1 42  ? -73.113  2.829   -12.390  1.00 43.38 ? 23  GLY D CA    1 
ATOM   8552  C  C     . GLY D  1 42  ? -74.044  1.676   -12.088  1.00 43.42 ? 23  GLY D C     1 
ATOM   8553  O  O     . GLY D  1 42  ? -73.616  0.553   -12.060  1.00 44.22 ? 23  GLY D O     1 
ATOM   8554  N  N     . GLU D  1 43  ? -75.332  1.953   -11.899  1.00 43.61 ? 24  GLU D N     1 
ATOM   8555  C  CA    . GLU D  1 43  ? -76.318  0.946   -11.453  1.00 43.27 ? 24  GLU D CA    1 
ATOM   8556  C  C     . GLU D  1 43  ? -76.860  0.026   -12.562  1.00 42.95 ? 24  GLU D C     1 
ATOM   8557  O  O     . GLU D  1 43  ? -77.325  -1.074  -12.274  1.00 43.08 ? 24  GLU D O     1 
ATOM   8558  C  CB    . GLU D  1 43  ? -77.483  1.653   -10.716  1.00 43.82 ? 24  GLU D CB    1 
ATOM   8559  C  CG    . GLU D  1 43  ? -77.141  2.127   -9.229   1.00 45.17 ? 24  GLU D CG    1 
ATOM   8560  N  N     . LYS D  1 44  ? -76.799  0.484   -13.821  1.00 42.47 ? 25  LYS D N     1 
ATOM   8561  C  CA    . LYS D  1 44  ? -77.341  -0.252  -14.982  1.00 42.28 ? 25  LYS D CA    1 
ATOM   8562  C  C     . LYS D  1 44  ? -76.473  -1.446  -15.421  1.00 41.54 ? 25  LYS D C     1 
ATOM   8563  O  O     . LYS D  1 44  ? -75.267  -1.453  -15.216  1.00 42.91 ? 25  LYS D O     1 
ATOM   8564  C  CB    . LYS D  1 44  ? -77.527  0.685   -16.186  1.00 43.26 ? 25  LYS D CB    1 
ATOM   8565  C  CG    . LYS D  1 44  ? -78.337  1.961   -15.926  1.00 42.89 ? 25  LYS D CG    1 
ATOM   8566  C  CD    . LYS D  1 44  ? -79.771  1.666   -15.620  1.00 43.91 ? 25  LYS D CD    1 
ATOM   8567  C  CE    . LYS D  1 44  ? -80.602  2.962   -15.596  1.00 43.64 ? 25  LYS D CE    1 
ATOM   8568  N  NZ    . LYS D  1 44  ? -81.772  2.781   -14.695  1.00 44.48 ? 25  LYS D NZ    1 
ATOM   8569  N  N     . VAL D  1 45  ? -77.078  -2.461  -16.015  1.00 40.52 ? 26  VAL D N     1 
ATOM   8570  C  CA    . VAL D  1 45  ? -76.386  -3.724  -16.252  1.00 39.95 ? 26  VAL D CA    1 
ATOM   8571  C  C     . VAL D  1 45  ? -76.574  -4.020  -17.728  1.00 40.17 ? 26  VAL D C     1 
ATOM   8572  O  O     . VAL D  1 45  ? -77.618  -3.701  -18.279  1.00 41.00 ? 26  VAL D O     1 
ATOM   8573  C  CB    . VAL D  1 45  ? -76.970  -4.835  -15.360  1.00 39.62 ? 26  VAL D CB    1 
ATOM   8574  C  CG1   . VAL D  1 45  ? -76.339  -6.213  -15.664  1.00 38.20 ? 26  VAL D CG1   1 
ATOM   8575  C  CG2   . VAL D  1 45  ? -76.842  -4.443  -13.870  1.00 38.14 ? 26  VAL D CG2   1 
ATOM   8576  N  N     . GLN D  1 46  ? -75.544  -4.553  -18.379  1.00 39.93 ? 27  GLN D N     1 
ATOM   8577  C  CA    . GLN D  1 46  ? -75.588  -4.906  -19.826  1.00 39.24 ? 27  GLN D CA    1 
ATOM   8578  C  C     . GLN D  1 46  ? -75.794  -6.393  -19.962  1.00 38.66 ? 27  GLN D C     1 
ATOM   8579  O  O     . GLN D  1 46  ? -75.157  -7.161  -19.258  1.00 38.47 ? 27  GLN D O     1 
ATOM   8580  C  CB    . GLN D  1 46  ? -74.280  -4.539  -20.559  1.00 38.74 ? 27  GLN D CB    1 
ATOM   8581  C  CG    . GLN D  1 46  ? -74.085  -3.074  -20.790  1.00 38.41 ? 27  GLN D CG    1 
ATOM   8582  C  CD    . GLN D  1 46  ? -72.698  -2.730  -21.278  1.00 38.85 ? 27  GLN D CD    1 
ATOM   8583  O  OE1   . GLN D  1 46  ? -71.742  -2.963  -20.562  1.00 42.20 ? 27  GLN D OE1   1 
ATOM   8584  N  NE2   . GLN D  1 46  ? -72.574  -2.195  -22.516  1.00 38.09 ? 27  GLN D NE2   1 
ATOM   8585  N  N     . ALA D  1 47  ? -76.692  -6.797  -20.860  1.00 38.56 ? 28  ALA D N     1 
ATOM   8586  C  CA    . ALA D  1 47  ? -76.966  -8.225  -21.079  1.00 38.41 ? 28  ALA D CA    1 
ATOM   8587  C  C     . ALA D  1 47  ? -76.867  -8.457  -22.569  1.00 38.08 ? 28  ALA D C     1 
ATOM   8588  O  O     . ALA D  1 47  ? -77.630  -7.878  -23.341  1.00 37.66 ? 28  ALA D O     1 
ATOM   8589  C  CB    . ALA D  1 47  ? -78.358  -8.630  -20.528  1.00 36.89 ? 28  ALA D CB    1 
ATOM   8590  N  N     . MET D  1 48  ? -75.894  -9.267  -22.968  1.00 38.15 ? 29  MET D N     1 
ATOM   8591  C  CA    . MET D  1 48  ? -75.725  -9.609  -24.388  1.00 38.41 ? 29  MET D CA    1 
ATOM   8592  C  C     . MET D  1 48  ? -76.454  -10.909 -24.698  1.00 38.52 ? 29  MET D C     1 
ATOM   8593  O  O     . MET D  1 48  ? -76.142  -11.930 -24.113  1.00 39.38 ? 29  MET D O     1 
ATOM   8594  C  CB    . MET D  1 48  ? -74.257  -9.774  -24.753  1.00 37.91 ? 29  MET D CB    1 
ATOM   8595  C  CG    . MET D  1 48  ? -74.058  -10.066 -26.245  1.00 37.89 ? 29  MET D CG    1 
ATOM   8596  S  SD    . MET D  1 48  ? -72.362  -9.944  -26.818  1.00 37.46 ? 29  MET D SD    1 
ATOM   8597  C  CE    . MET D  1 48  ? -72.210  -8.215  -27.342  1.00 27.95 ? 29  MET D CE    1 
ATOM   8598  N  N     . TYR D  1 49  ? -77.402  -10.854 -25.625  1.00 38.53 ? 30  TYR D N     1 
ATOM   8599  C  CA    . TYR D  1 49  ? -78.229  -11.991 -25.948  1.00 38.69 ? 30  TYR D CA    1 
ATOM   8600  C  C     . TYR D  1 49  ? -77.617  -12.561 -27.195  1.00 38.88 ? 30  TYR D C     1 
ATOM   8601  O  O     . TYR D  1 49  ? -77.282  -11.810 -28.098  1.00 38.92 ? 30  TYR D O     1 
ATOM   8602  C  CB    . TYR D  1 49  ? -79.676  -11.561 -26.229  1.00 39.33 ? 30  TYR D CB    1 
ATOM   8603  C  CG    . TYR D  1 49  ? -80.574  -11.321 -25.018  1.00 38.43 ? 30  TYR D CG    1 
ATOM   8604  C  CD1   . TYR D  1 49  ? -80.193  -10.489 -23.994  1.00 38.96 ? 30  TYR D CD1   1 
ATOM   8605  C  CD2   . TYR D  1 49  ? -81.837  -11.904 -24.947  1.00 38.38 ? 30  TYR D CD2   1 
ATOM   8606  C  CE1   . TYR D  1 49  ? -81.046  -10.275 -22.866  1.00 39.86 ? 30  TYR D CE1   1 
ATOM   8607  C  CE2   . TYR D  1 49  ? -82.688  -11.687 -23.869  1.00 38.29 ? 30  TYR D CE2   1 
ATOM   8608  C  CZ    . TYR D  1 49  ? -82.295  -10.866 -22.829  1.00 39.23 ? 30  TYR D CZ    1 
ATOM   8609  O  OH    . TYR D  1 49  ? -83.140  -10.662 -21.771  1.00 38.10 ? 30  TYR D OH    1 
ATOM   8610  N  N     . ILE D  1 50  ? -77.489  -13.889 -27.213  1.00 38.78 ? 31  ILE D N     1 
ATOM   8611  C  CA    . ILE D  1 50  ? -76.757  -14.649 -28.213  1.00 38.47 ? 31  ILE D CA    1 
ATOM   8612  C  C     . ILE D  1 50  ? -77.690  -15.726 -28.763  1.00 38.54 ? 31  ILE D C     1 
ATOM   8613  O  O     . ILE D  1 50  ? -78.347  -16.426 -27.983  1.00 38.08 ? 31  ILE D O     1 
ATOM   8614  C  CB    . ILE D  1 50  ? -75.548  -15.394 -27.532  1.00 38.82 ? 31  ILE D CB    1 
ATOM   8615  C  CG1   . ILE D  1 50  ? -74.592  -14.384 -26.871  1.00 38.89 ? 31  ILE D CG1   1 
ATOM   8616  C  CG2   . ILE D  1 50  ? -74.822  -16.320 -28.519  1.00 37.65 ? 31  ILE D CG2   1 
ATOM   8617  C  CD1   . ILE D  1 50  ? -73.578  -14.973 -25.972  1.00 37.69 ? 31  ILE D CD1   1 
ATOM   8618  N  N     . TRP D  1 51  ? -77.734  -15.884 -30.083  1.00 38.39 ? 32  TRP D N     1 
ATOM   8619  C  CA    . TRP D  1 51  ? -78.473  -16.992 -30.678  1.00 38.59 ? 32  TRP D CA    1 
ATOM   8620  C  C     . TRP D  1 51  ? -77.874  -17.551 -31.976  1.00 38.86 ? 32  TRP D C     1 
ATOM   8621  O  O     . TRP D  1 51  ? -76.990  -16.950 -32.592  1.00 39.65 ? 32  TRP D O     1 
ATOM   8622  C  CB    . TRP D  1 51  ? -79.932  -16.593 -30.922  1.00 38.33 ? 32  TRP D CB    1 
ATOM   8623  C  CG    . TRP D  1 51  ? -80.124  -15.534 -31.959  1.00 38.77 ? 32  TRP D CG    1 
ATOM   8624  C  CD1   . TRP D  1 51  ? -80.511  -15.712 -33.239  1.00 37.96 ? 32  TRP D CD1   1 
ATOM   8625  C  CD2   . TRP D  1 51  ? -79.956  -14.116 -31.780  1.00 38.13 ? 32  TRP D CD2   1 
ATOM   8626  N  NE1   . TRP D  1 51  ? -80.578  -14.504 -33.879  1.00 37.50 ? 32  TRP D NE1   1 
ATOM   8627  C  CE2   . TRP D  1 51  ? -80.246  -13.510 -33.002  1.00 37.17 ? 32  TRP D CE2   1 
ATOM   8628  C  CE3   . TRP D  1 51  ? -79.573  -13.312 -30.696  1.00 38.50 ? 32  TRP D CE3   1 
ATOM   8629  C  CZ2   . TRP D  1 51  ? -80.159  -12.131 -33.194  1.00 39.06 ? 32  TRP D CZ2   1 
ATOM   8630  C  CZ3   . TRP D  1 51  ? -79.473  -11.940 -30.879  1.00 38.20 ? 32  TRP D CZ3   1 
ATOM   8631  C  CH2   . TRP D  1 51  ? -79.772  -11.359 -32.117  1.00 38.75 ? 32  TRP D CH2   1 
ATOM   8632  N  N     . ILE D  1 52  ? -78.401  -18.699 -32.395  1.00 38.60 ? 33  ILE D N     1 
ATOM   8633  C  CA    . ILE D  1 52  ? -77.957  -19.401 -33.600  1.00 38.93 ? 33  ILE D CA    1 
ATOM   8634  C  C     . ILE D  1 52  ? -78.834  -18.987 -34.752  1.00 38.61 ? 33  ILE D C     1 
ATOM   8635  O  O     . ILE D  1 52  ? -80.027  -19.029 -34.637  1.00 38.83 ? 33  ILE D O     1 
ATOM   8636  C  CB    . ILE D  1 52  ? -78.061  -20.939 -33.378  1.00 38.76 ? 33  ILE D CB    1 
ATOM   8637  C  CG1   . ILE D  1 52  ? -77.183  -21.322 -32.169  1.00 39.55 ? 33  ILE D CG1   1 
ATOM   8638  C  CG2   . ILE D  1 52  ? -77.715  -21.717 -34.603  1.00 36.62 ? 33  ILE D CG2   1 
ATOM   8639  C  CD1   . ILE D  1 52  ? -77.408  -22.747 -31.680  1.00 39.59 ? 33  ILE D CD1   1 
ATOM   8640  N  N     . ASP D  1 53  ? -78.232  -18.592 -35.871  1.00 39.61 ? 34  ASP D N     1 
ATOM   8641  C  CA    . ASP D  1 53  ? -78.989  -18.050 -37.030  1.00 39.76 ? 34  ASP D CA    1 
ATOM   8642  C  C     . ASP D  1 53  ? -79.486  -19.135 -37.979  1.00 40.10 ? 34  ASP D C     1 
ATOM   8643  O  O     . ASP D  1 53  ? -79.515  -20.311 -37.622  1.00 40.44 ? 34  ASP D O     1 
ATOM   8644  C  CB    . ASP D  1 53  ? -78.170  -16.981 -37.779  1.00 39.49 ? 34  ASP D CB    1 
ATOM   8645  C  CG    . ASP D  1 53  ? -76.955  -17.550 -38.515  1.00 40.88 ? 34  ASP D CG    1 
ATOM   8646  O  OD1   . ASP D  1 53  ? -76.961  -18.705 -39.031  1.00 39.52 ? 34  ASP D OD1   1 
ATOM   8647  O  OD2   . ASP D  1 53  ? -75.967  -16.789 -38.588  1.00 42.64 ? 34  ASP D OD2   1 
ATOM   8648  N  N     . GLY D  1 54  ? -79.891  -18.722 -39.184  1.00 40.42 ? 35  GLY D N     1 
ATOM   8649  C  CA    . GLY D  1 54  ? -80.564  -19.594 -40.129  1.00 40.10 ? 35  GLY D CA    1 
ATOM   8650  C  C     . GLY D  1 54  ? -79.636  -20.581 -40.790  1.00 40.75 ? 35  GLY D C     1 
ATOM   8651  O  O     . GLY D  1 54  ? -80.104  -21.535 -41.422  1.00 42.41 ? 35  GLY D O     1 
ATOM   8652  N  N     . THR D  1 55  ? -78.325  -20.382 -40.649  1.00 40.48 ? 36  THR D N     1 
ATOM   8653  C  CA    . THR D  1 55  ? -77.358  -21.314 -41.183  1.00 40.11 ? 36  THR D CA    1 
ATOM   8654  C  C     . THR D  1 55  ? -77.113  -22.501 -40.253  1.00 40.33 ? 36  THR D C     1 
ATOM   8655  O  O     . THR D  1 55  ? -76.444  -23.442 -40.668  1.00 40.79 ? 36  THR D O     1 
ATOM   8656  C  CB    . THR D  1 55  ? -75.969  -20.640 -41.379  1.00 40.47 ? 36  THR D CB    1 
ATOM   8657  O  OG1   . THR D  1 55  ? -75.310  -20.496 -40.090  1.00 40.84 ? 36  THR D OG1   1 
ATOM   8658  C  CG2   . THR D  1 55  ? -76.078  -19.298 -42.135  1.00 37.57 ? 36  THR D CG2   1 
ATOM   8659  N  N     . GLY D  1 56  ? -77.532  -22.395 -38.988  1.00 40.13 ? 37  GLY D N     1 
ATOM   8660  C  CA    . GLY D  1 56  ? -77.271  -23.392 -37.959  1.00 40.41 ? 37  GLY D CA    1 
ATOM   8661  C  C     . GLY D  1 56  ? -75.843  -23.427 -37.465  1.00 41.28 ? 37  GLY D C     1 
ATOM   8662  O  O     . GLY D  1 56  ? -75.489  -24.258 -36.613  1.00 41.71 ? 37  GLY D O     1 
ATOM   8663  N  N     . GLU D  1 57  ? -74.999  -22.535 -37.996  1.00 41.87 ? 38  GLU D N     1 
ATOM   8664  C  CA    . GLU D  1 57  ? -73.583  -22.458 -37.584  1.00 41.64 ? 38  GLU D CA    1 
ATOM   8665  C  C     . GLU D  1 57  ? -73.180  -21.087 -37.075  1.00 41.51 ? 38  GLU D C     1 
ATOM   8666  O  O     . GLU D  1 57  ? -72.335  -21.001 -36.210  1.00 41.96 ? 38  GLU D O     1 
ATOM   8667  C  CB    . GLU D  1 57  ? -72.669  -22.757 -38.746  1.00 41.66 ? 38  GLU D CB    1 
ATOM   8668  C  CG    . GLU D  1 57  ? -72.528  -24.193 -39.098  1.00 42.43 ? 38  GLU D CG    1 
ATOM   8669  C  CD    . GLU D  1 57  ? -71.597  -24.361 -40.305  1.00 43.54 ? 38  GLU D CD    1 
ATOM   8670  O  OE1   . GLU D  1 57  ? -70.338  -24.350 -40.151  1.00 46.82 ? 38  GLU D OE1   1 
ATOM   8671  O  OE2   . GLU D  1 57  ? -72.142  -24.505 -41.413  1.00 45.25 ? 38  GLU D OE2   1 
ATOM   8672  N  N     . GLY D  1 58  ? -73.723  -20.020 -37.652  1.00 41.36 ? 39  GLY D N     1 
ATOM   8673  C  CA    . GLY D  1 58  ? -73.393  -18.669 -37.219  1.00 40.34 ? 39  GLY D CA    1 
ATOM   8674  C  C     . GLY D  1 58  ? -74.107  -18.299 -35.919  1.00 40.26 ? 39  GLY D C     1 
ATOM   8675  O  O     . GLY D  1 58  ? -75.281  -18.609 -35.726  1.00 40.51 ? 39  GLY D O     1 
ATOM   8676  N  N     . LEU D  1 59  ? -73.404  -17.582 -35.058  1.00 39.28 ? 40  LEU D N     1 
ATOM   8677  C  CA    . LEU D  1 59  ? -73.953  -17.026 -33.852  1.00 38.89 ? 40  LEU D CA    1 
ATOM   8678  C  C     . LEU D  1 59  ? -74.204  -15.523 -34.062  1.00 38.79 ? 40  LEU D C     1 
ATOM   8679  O  O     . LEU D  1 59  ? -73.464  -14.839 -34.775  1.00 38.88 ? 40  LEU D O     1 
ATOM   8680  C  CB    . LEU D  1 59  ? -72.944  -17.230 -32.734  1.00 39.05 ? 40  LEU D CB    1 
ATOM   8681  C  CG    . LEU D  1 59  ? -72.828  -18.686 -32.285  1.00 39.75 ? 40  LEU D CG    1 
ATOM   8682  C  CD1   . LEU D  1 59  ? -71.420  -19.035 -31.741  1.00 36.80 ? 40  LEU D CD1   1 
ATOM   8683  C  CD2   . LEU D  1 59  ? -73.974  -18.956 -31.255  1.00 37.38 ? 40  LEU D CD2   1 
ATOM   8684  N  N     . ARG D  1 60  ? -75.254  -15.011 -33.435  1.00 37.92 ? 41  ARG D N     1 
ATOM   8685  C  CA    . ARG D  1 60  ? -75.574  -13.601 -33.506  1.00 37.39 ? 41  ARG D CA    1 
ATOM   8686  C  C     . ARG D  1 60  ? -75.778  -13.071 -32.108  1.00 36.55 ? 41  ARG D C     1 
ATOM   8687  O  O     . ARG D  1 60  ? -76.045  -13.827 -31.190  1.00 36.54 ? 41  ARG D O     1 
ATOM   8688  C  CB    . ARG D  1 60  ? -76.858  -13.390 -34.281  1.00 37.40 ? 41  ARG D CB    1 
ATOM   8689  C  CG    . ARG D  1 60  ? -76.862  -14.011 -35.640  1.00 37.71 ? 41  ARG D CG    1 
ATOM   8690  C  CD    . ARG D  1 60  ? -76.232  -13.147 -36.712  1.00 37.17 ? 41  ARG D CD    1 
ATOM   8691  N  NE    . ARG D  1 60  ? -76.376  -13.813 -37.992  1.00 36.70 ? 41  ARG D NE    1 
ATOM   8692  C  CZ    . ARG D  1 60  ? -76.510  -13.220 -39.175  1.00 37.32 ? 41  ARG D CZ    1 
ATOM   8693  N  NH1   . ARG D  1 60  ? -76.539  -11.905 -39.331  1.00 37.92 ? 41  ARG D NH1   1 
ATOM   8694  N  NH2   . ARG D  1 60  ? -76.631  -13.981 -40.233  1.00 38.49 ? 41  ARG D NH2   1 
ATOM   8695  N  N     . CYS D  1 61  ? -75.659  -11.773 -31.943  1.00 35.88 ? 42  CYS D N     1 
ATOM   8696  C  CA    . CYS D  1 61  ? -75.852  -11.208 -30.647  1.00 35.94 ? 42  CYS D CA    1 
ATOM   8697  C  C     . CYS D  1 61  ? -76.183  -9.751  -30.674  1.00 35.56 ? 42  CYS D C     1 
ATOM   8698  O  O     . CYS D  1 61  ? -75.907  -9.054  -31.652  1.00 34.56 ? 42  CYS D O     1 
ATOM   8699  C  CB    . CYS D  1 61  ? -74.575  -11.359 -29.835  1.00 37.24 ? 42  CYS D CB    1 
ATOM   8700  S  SG    . CYS D  1 61  ? -73.194  -10.265 -30.392  1.00 36.18 ? 42  CYS D SG    1 
ATOM   8701  N  N     . LYS D  1 62  ? -76.751  -9.300  -29.559  1.00 35.66 ? 43  LYS D N     1 
ATOM   8702  C  CA    . LYS D  1 62  ? -77.044  -7.876  -29.337  1.00 35.74 ? 43  LYS D CA    1 
ATOM   8703  C  C     . LYS D  1 62  ? -77.300  -7.666  -27.845  1.00 35.83 ? 43  LYS D C     1 
ATOM   8704  O  O     . LYS D  1 62  ? -77.507  -8.643  -27.120  1.00 34.73 ? 43  LYS D O     1 
ATOM   8705  C  CB    . LYS D  1 62  ? -78.223  -7.398  -30.208  1.00 35.80 ? 43  LYS D CB    1 
ATOM   8706  C  CG    . LYS D  1 62  ? -79.610  -7.994  -29.882  1.00 34.23 ? 43  LYS D CG    1 
ATOM   8707  C  CD    . LYS D  1 62  ? -80.692  -7.123  -30.477  1.00 34.62 ? 43  LYS D CD    1 
ATOM   8708  C  CE    . LYS D  1 62  ? -82.086  -7.770  -30.366  1.00 35.72 ? 43  LYS D CE    1 
ATOM   8709  N  NZ    . LYS D  1 62  ? -83.181  -6.778  -30.568  1.00 33.03 ? 43  LYS D NZ    1 
ATOM   8710  N  N     . THR D  1 63  ? -77.238  -6.402  -27.411  1.00 36.01 ? 44  THR D N     1 
ATOM   8711  C  CA    . THR D  1 63  ? -77.176  -6.040  -25.984  1.00 36.87 ? 44  THR D CA    1 
ATOM   8712  C  C     . THR D  1 63  ? -78.331  -5.126  -25.578  1.00 37.44 ? 44  THR D C     1 
ATOM   8713  O  O     . THR D  1 63  ? -78.687  -4.194  -26.309  1.00 38.12 ? 44  THR D O     1 
ATOM   8714  C  CB    . THR D  1 63  ? -75.868  -5.277  -25.653  1.00 36.78 ? 44  THR D CB    1 
ATOM   8715  O  OG1   . THR D  1 63  ? -74.740  -6.018  -26.135  1.00 36.54 ? 44  THR D OG1   1 
ATOM   8716  C  CG2   . THR D  1 63  ? -75.731  -5.029  -24.169  1.00 34.75 ? 44  THR D CG2   1 
ATOM   8717  N  N     . ARG D  1 64  ? -78.919  -5.388  -24.422  1.00 37.65 ? 45  ARG D N     1 
ATOM   8718  C  CA    . ARG D  1 64  ? -79.899  -4.471  -23.865  1.00 38.46 ? 45  ARG D CA    1 
ATOM   8719  C  C     . ARG D  1 64  ? -79.412  -4.017  -22.492  1.00 38.38 ? 45  ARG D C     1 
ATOM   8720  O  O     . ARG D  1 64  ? -78.611  -4.737  -21.844  1.00 38.63 ? 45  ARG D O     1 
ATOM   8721  C  CB    . ARG D  1 64  ? -81.269  -5.132  -23.794  1.00 38.25 ? 45  ARG D CB    1 
ATOM   8722  C  CG    . ARG D  1 64  ? -81.333  -6.317  -22.867  1.00 40.67 ? 45  ARG D CG    1 
ATOM   8723  C  CD    . ARG D  1 64  ? -82.669  -7.040  -22.989  1.00 41.62 ? 45  ARG D CD    1 
ATOM   8724  N  NE    . ARG D  1 64  ? -83.831  -6.184  -22.667  1.00 43.77 ? 45  ARG D NE    1 
ATOM   8725  C  CZ    . ARG D  1 64  ? -85.100  -6.521  -22.914  1.00 44.46 ? 45  ARG D CZ    1 
ATOM   8726  N  NH1   . ARG D  1 64  ? -85.406  -7.670  -23.498  1.00 46.53 ? 45  ARG D NH1   1 
ATOM   8727  N  NH2   . ARG D  1 64  ? -86.082  -5.708  -22.595  1.00 45.70 ? 45  ARG D NH2   1 
ATOM   8728  N  N     . THR D  1 65  ? -79.854  -2.833  -22.064  1.00 37.72 ? 46  THR D N     1 
ATOM   8729  C  CA    . THR D  1 65  ? -79.577  -2.330  -20.704  1.00 37.87 ? 46  THR D CA    1 
ATOM   8730  C  C     . THR D  1 65  ? -80.669  -2.806  -19.754  1.00 38.53 ? 46  THR D C     1 
ATOM   8731  O  O     . THR D  1 65  ? -81.863  -2.733  -20.091  1.00 38.86 ? 46  THR D O     1 
ATOM   8732  C  CB    . THR D  1 65  ? -79.600  -0.805  -20.655  1.00 37.12 ? 46  THR D CB    1 
ATOM   8733  O  OG1   . THR D  1 65  ? -78.834  -0.272  -21.737  1.00 35.43 ? 46  THR D OG1   1 
ATOM   8734  C  CG2   . THR D  1 65  ? -79.074  -0.315  -19.307  1.00 36.50 ? 46  THR D CG2   1 
ATOM   8735  N  N     . LEU D  1 66  ? -80.296  -3.260  -18.568  1.00 38.58 ? 47  LEU D N     1 
ATOM   8736  C  CA    . LEU D  1 66  ? -81.287  -3.612  -17.558  1.00 39.16 ? 47  LEU D CA    1 
ATOM   8737  C  C     . LEU D  1 66  ? -81.070  -2.757  -16.318  1.00 39.66 ? 47  LEU D C     1 
ATOM   8738  O  O     . LEU D  1 66  ? -79.961  -2.304  -16.057  1.00 39.53 ? 47  LEU D O     1 
ATOM   8739  C  CB    . LEU D  1 66  ? -81.171  -5.093  -17.145  1.00 39.27 ? 47  LEU D CB    1 
ATOM   8740  C  CG    . LEU D  1 66  ? -81.223  -6.203  -18.194  1.00 38.72 ? 47  LEU D CG    1 
ATOM   8741  C  CD1   . LEU D  1 66  ? -80.654  -7.480  -17.588  1.00 37.14 ? 47  LEU D CD1   1 
ATOM   8742  C  CD2   . LEU D  1 66  ? -82.630  -6.422  -18.715  1.00 37.24 ? 47  LEU D CD2   1 
ATOM   8743  N  N     . ASP D  1 67  ? -82.122  -2.602  -15.519  1.00 40.57 ? 48  ASP D N     1 
ATOM   8744  C  CA    . ASP D  1 67  ? -82.073  -1.782  -14.301  1.00 41.20 ? 48  ASP D CA    1 
ATOM   8745  C  C     . ASP D  1 67  ? -81.299  -2.355  -13.163  1.00 41.13 ? 48  ASP D C     1 
ATOM   8746  O  O     . ASP D  1 67  ? -80.846  -1.622  -12.302  1.00 41.59 ? 48  ASP D O     1 
ATOM   8747  C  CB    . ASP D  1 67  ? -83.471  -1.439  -13.817  1.00 41.43 ? 48  ASP D CB    1 
ATOM   8748  C  CG    . ASP D  1 67  ? -84.182  -0.569  -14.785  1.00 45.03 ? 48  ASP D CG    1 
ATOM   8749  O  OD1   . ASP D  1 67  ? -83.484  0.021   -15.663  1.00 48.40 ? 48  ASP D OD1   1 
ATOM   8750  O  OD2   . ASP D  1 67  ? -85.429  -0.483  -14.691  1.00 50.47 ? 48  ASP D OD2   1 
ATOM   8751  N  N     . SER D  1 68  ? -81.137  -3.661  -13.135  1.00 41.72 ? 49  SER D N     1 
ATOM   8752  C  CA    . SER D  1 68  ? -80.291  -4.246  -12.092  1.00 42.23 ? 49  SER D CA    1 
ATOM   8753  C  C     . SER D  1 68  ? -79.823  -5.611  -12.503  1.00 41.81 ? 49  SER D C     1 
ATOM   8754  O  O     . SER D  1 68  ? -80.172  -6.092  -13.554  1.00 41.36 ? 49  SER D O     1 
ATOM   8755  C  CB    . SER D  1 68  ? -81.039  -4.311  -10.775  1.00 42.13 ? 49  SER D CB    1 
ATOM   8756  O  OG    . SER D  1 68  ? -82.185  -5.072  -10.987  1.00 43.13 ? 49  SER D OG    1 
ATOM   8757  N  N     . GLU D  1 69  ? -78.990  -6.202  -11.670  1.00 42.38 ? 50  GLU D N     1 
ATOM   8758  C  CA    . GLU D  1 69  ? -78.298  -7.396  -12.045  1.00 42.66 ? 50  GLU D CA    1 
ATOM   8759  C  C     . GLU D  1 69  ? -79.210  -8.577  -11.832  1.00 42.31 ? 50  GLU D C     1 
ATOM   8760  O  O     . GLU D  1 69  ? -79.668  -8.799  -10.759  1.00 42.16 ? 50  GLU D O     1 
ATOM   8761  C  CB    . GLU D  1 69  ? -77.037  -7.538  -11.223  1.00 42.26 ? 50  GLU D CB    1 
ATOM   8762  C  CG    . GLU D  1 69  ? -76.116  -8.671  -11.682  1.00 43.21 ? 50  GLU D CG    1 
ATOM   8763  C  CD    . GLU D  1 69  ? -74.976  -8.935  -10.716  1.00 43.40 ? 50  GLU D CD    1 
ATOM   8764  O  OE1   . GLU D  1 69  ? -74.830  -8.172  -9.745   1.00 45.33 ? 50  GLU D OE1   1 
ATOM   8765  O  OE2   . GLU D  1 69  ? -74.251  -9.921  -10.916  1.00 44.22 ? 50  GLU D OE2   1 
ATOM   8766  N  N     . PRO D  1 70  ? -79.456  -9.350  -12.864  1.00 42.89 ? 51  PRO D N     1 
ATOM   8767  C  CA    . PRO D  1 70  ? -80.279  -10.527 -12.709  1.00 44.04 ? 51  PRO D CA    1 
ATOM   8768  C  C     . PRO D  1 70  ? -79.577  -11.643 -11.948  1.00 45.27 ? 51  PRO D C     1 
ATOM   8769  O  O     . PRO D  1 70  ? -78.410  -11.957 -12.249  1.00 45.79 ? 51  PRO D O     1 
ATOM   8770  C  CB    . PRO D  1 70  ? -80.522  -10.973 -14.149  1.00 44.23 ? 51  PRO D CB    1 
ATOM   8771  C  CG    . PRO D  1 70  ? -79.417  -10.419 -14.938  1.00 43.72 ? 51  PRO D CG    1 
ATOM   8772  C  CD    . PRO D  1 70  ? -78.967  -9.175  -14.238  1.00 43.08 ? 51  PRO D CD    1 
ATOM   8773  N  N     . LYS D  1 71  ? -80.274  -12.254 -10.992  1.00 45.85 ? 52  LYS D N     1 
ATOM   8774  C  CA    . LYS D  1 71  ? -79.622  -13.233 -10.134  1.00 46.74 ? 52  LYS D CA    1 
ATOM   8775  C  C     . LYS D  1 71  ? -79.623  -14.611 -10.762  1.00 46.79 ? 52  LYS D C     1 
ATOM   8776  O  O     . LYS D  1 71  ? -78.966  -15.489 -10.253  1.00 46.33 ? 52  LYS D O     1 
ATOM   8777  C  CB    . LYS D  1 71  ? -80.235  -13.251 -8.725   1.00 48.13 ? 52  LYS D CB    1 
ATOM   8778  C  CG    . LYS D  1 71  ? -79.387  -12.469 -7.674   1.00 52.55 ? 52  LYS D CG    1 
ATOM   8779  C  CD    . LYS D  1 71  ? -79.299  -10.888 -7.904   1.00 55.06 ? 52  LYS D CD    1 
ATOM   8780  C  CE    . LYS D  1 71  ? -77.898  -10.276 -7.496   1.00 54.79 ? 52  LYS D CE    1 
ATOM   8781  N  NZ    . LYS D  1 71  ? -77.899  -8.744  -7.398   1.00 55.99 ? 52  LYS D NZ    1 
ATOM   8782  N  N     . CYS D  1 72  ? -80.367  -14.790 -11.860  1.00 46.96 ? 53  CYS D N     1 
ATOM   8783  C  CA    . CYS D  1 72  ? -80.331  -16.030 -12.640  1.00 46.87 ? 53  CYS D CA    1 
ATOM   8784  C  C     . CYS D  1 72  ? -81.121  -15.898 -13.940  1.00 46.29 ? 53  CYS D C     1 
ATOM   8785  O  O     . CYS D  1 72  ? -81.849  -14.936 -14.154  1.00 46.00 ? 53  CYS D O     1 
ATOM   8786  C  CB    . CYS D  1 72  ? -80.886  -17.187 -11.835  1.00 46.82 ? 53  CYS D CB    1 
ATOM   8787  S  SG    . CYS D  1 72  ? -82.534  -16.818 -11.364  1.00 52.80 ? 53  CYS D SG    1 
ATOM   8788  N  N     . VAL D  1 73  ? -80.968  -16.893 -14.802  1.00 46.26 ? 54  VAL D N     1 
ATOM   8789  C  CA    . VAL D  1 73  ? -81.473  -16.832 -16.164  1.00 46.24 ? 54  VAL D CA    1 
ATOM   8790  C  C     . VAL D  1 73  ? -82.978  -16.547 -16.168  1.00 46.92 ? 54  VAL D C     1 
ATOM   8791  O  O     . VAL D  1 73  ? -83.498  -15.812 -17.008  1.00 47.31 ? 54  VAL D O     1 
ATOM   8792  C  CB    . VAL D  1 73  ? -81.074  -18.125 -16.941  1.00 45.62 ? 54  VAL D CB    1 
ATOM   8793  C  CG1   . VAL D  1 73  ? -81.757  -19.391 -16.371  1.00 42.54 ? 54  VAL D CG1   1 
ATOM   8794  C  CG2   . VAL D  1 73  ? -81.318  -17.948 -18.397  1.00 45.60 ? 54  VAL D CG2   1 
ATOM   8795  N  N     . GLU D  1 74  ? -83.682  -17.092 -15.191  1.00 47.69 ? 55  GLU D N     1 
ATOM   8796  C  CA    . GLU D  1 74  ? -85.138  -16.924 -15.138  1.00 47.77 ? 55  GLU D CA    1 
ATOM   8797  C  C     . GLU D  1 74  ? -85.582  -15.495 -14.930  1.00 47.65 ? 55  GLU D C     1 
ATOM   8798  O  O     . GLU D  1 74  ? -86.715  -15.210 -15.216  1.00 49.20 ? 55  GLU D O     1 
ATOM   8799  C  CB    . GLU D  1 74  ? -85.761  -17.768 -14.026  1.00 48.34 ? 55  GLU D CB    1 
ATOM   8800  C  CG    . GLU D  1 74  ? -85.725  -19.272 -14.265  1.00 50.97 ? 55  GLU D CG    1 
ATOM   8801  C  CD    . GLU D  1 74  ? -84.439  -19.968 -13.805  1.00 55.48 ? 55  GLU D CD    1 
ATOM   8802  O  OE1   . GLU D  1 74  ? -83.559  -19.351 -13.086  1.00 55.03 ? 55  GLU D OE1   1 
ATOM   8803  O  OE2   . GLU D  1 74  ? -84.336  -21.170 -14.193  1.00 57.87 ? 55  GLU D OE2   1 
ATOM   8804  N  N     . GLU D  1 75  ? -84.729  -14.619 -14.403  1.00 47.06 ? 56  GLU D N     1 
ATOM   8805  C  CA    . GLU D  1 75  ? -85.065  -13.204 -14.193  1.00 46.52 ? 56  GLU D CA    1 
ATOM   8806  C  C     . GLU D  1 75  ? -84.862  -12.313 -15.435  1.00 46.26 ? 56  GLU D C     1 
ATOM   8807  O  O     . GLU D  1 75  ? -85.193  -11.116 -15.398  1.00 45.67 ? 56  GLU D O     1 
ATOM   8808  C  CB    . GLU D  1 75  ? -84.202  -12.629 -13.072  1.00 46.58 ? 56  GLU D CB    1 
ATOM   8809  C  CG    . GLU D  1 75  ? -84.589  -13.071 -11.673  1.00 46.66 ? 56  GLU D CG    1 
ATOM   8810  C  CD    . GLU D  1 75  ? -83.845  -12.298 -10.564  1.00 47.48 ? 56  GLU D CD    1 
ATOM   8811  O  OE1   . GLU D  1 75  ? -83.180  -11.273 -10.835  1.00 49.27 ? 56  GLU D OE1   1 
ATOM   8812  O  OE2   . GLU D  1 75  ? -83.918  -12.716 -9.396   1.00 49.12 ? 56  GLU D OE2   1 
ATOM   8813  N  N     . LEU D  1 76  ? -84.278  -12.874 -16.503  1.00 45.55 ? 57  LEU D N     1 
ATOM   8814  C  CA    . LEU D  1 76  ? -84.044  -12.121 -17.729  1.00 44.89 ? 57  LEU D CA    1 
ATOM   8815  C  C     . LEU D  1 76  ? -85.314  -12.105 -18.549  1.00 44.71 ? 57  LEU D C     1 
ATOM   8816  O  O     . LEU D  1 76  ? -86.007  -13.111 -18.647  1.00 45.75 ? 57  LEU D O     1 
ATOM   8817  C  CB    . LEU D  1 76  ? -82.927  -12.737 -18.542  1.00 44.79 ? 57  LEU D CB    1 
ATOM   8818  C  CG    . LEU D  1 76  ? -81.492  -12.643 -17.983  1.00 44.07 ? 57  LEU D CG    1 
ATOM   8819  C  CD1   . LEU D  1 76  ? -80.623  -13.727 -18.680  1.00 42.90 ? 57  LEU D CD1   1 
ATOM   8820  C  CD2   . LEU D  1 76  ? -80.918  -11.211 -18.123  1.00 38.60 ? 57  LEU D CD2   1 
ATOM   8821  N  N     . PRO D  1 77  ? -85.658  -10.950 -19.112  1.00 43.97 ? 58  PRO D N     1 
ATOM   8822  C  CA    . PRO D  1 77  ? -86.834  -10.912 -19.935  1.00 43.23 ? 58  PRO D CA    1 
ATOM   8823  C  C     . PRO D  1 77  ? -86.625  -11.516 -21.318  1.00 42.94 ? 58  PRO D C     1 
ATOM   8824  O  O     . PRO D  1 77  ? -85.523  -11.551 -21.825  1.00 42.47 ? 58  PRO D O     1 
ATOM   8825  C  CB    . PRO D  1 77  ? -87.123  -9.418  -20.037  1.00 43.02 ? 58  PRO D CB    1 
ATOM   8826  C  CG    . PRO D  1 77  ? -85.792  -8.766  -19.893  1.00 43.73 ? 58  PRO D CG    1 
ATOM   8827  C  CD    . PRO D  1 77  ? -85.005  -9.630  -18.997  1.00 43.98 ? 58  PRO D CD    1 
ATOM   8828  N  N     . GLU D  1 78  ? -87.716  -11.981 -21.920  1.00 43.29 ? 59  GLU D N     1 
ATOM   8829  C  CA    . GLU D  1 78  ? -87.730  -12.354 -23.322  1.00 43.18 ? 59  GLU D CA    1 
ATOM   8830  C  C     . GLU D  1 78  ? -87.330  -11.181 -24.165  1.00 42.10 ? 59  GLU D C     1 
ATOM   8831  O  O     . GLU D  1 78  ? -87.432  -10.044 -23.752  1.00 42.28 ? 59  GLU D O     1 
ATOM   8832  C  CB    . GLU D  1 78  ? -89.129  -12.742 -23.757  1.00 42.89 ? 59  GLU D CB    1 
ATOM   8833  C  CG    . GLU D  1 78  ? -89.537  -14.097 -23.265  1.00 45.96 ? 59  GLU D CG    1 
ATOM   8834  C  CD    . GLU D  1 78  ? -90.814  -14.634 -23.898  1.00 45.29 ? 59  GLU D CD    1 
ATOM   8835  O  OE1   . GLU D  1 78  ? -91.426  -13.933 -24.765  1.00 49.04 ? 59  GLU D OE1   1 
ATOM   8836  O  OE2   . GLU D  1 78  ? -91.178  -15.775 -23.505  1.00 47.70 ? 59  GLU D OE2   1 
ATOM   8837  N  N     . TRP D  1 79  ? -86.922  -11.459 -25.383  1.00 40.76 ? 60  TRP D N     1 
ATOM   8838  C  CA    . TRP D  1 79  ? -86.688  -10.399 -26.300  1.00 39.46 ? 60  TRP D CA    1 
ATOM   8839  C  C     . TRP D  1 79  ? -86.972  -10.934 -27.702  1.00 39.13 ? 60  TRP D C     1 
ATOM   8840  O  O     . TRP D  1 79  ? -87.669  -11.937 -27.866  1.00 38.61 ? 60  TRP D O     1 
ATOM   8841  C  CB    . TRP D  1 79  ? -85.249  -9.919  -26.110  1.00 39.16 ? 60  TRP D CB    1 
ATOM   8842  C  CG    . TRP D  1 79  ? -84.952  -8.539  -26.553  1.00 38.58 ? 60  TRP D CG    1 
ATOM   8843  C  CD1   . TRP D  1 79  ? -85.842  -7.576  -26.900  1.00 38.72 ? 60  TRP D CD1   1 
ATOM   8844  C  CD2   . TRP D  1 79  ? -83.650  -7.954  -26.685  1.00 38.12 ? 60  TRP D CD2   1 
ATOM   8845  N  NE1   . TRP D  1 79  ? -85.185  -6.414  -27.230  1.00 39.05 ? 60  TRP D NE1   1 
ATOM   8846  C  CE2   . TRP D  1 79  ? -83.833  -6.618  -27.101  1.00 40.30 ? 60  TRP D CE2   1 
ATOM   8847  C  CE3   . TRP D  1 79  ? -82.359  -8.416  -26.459  1.00 37.77 ? 60  TRP D CE3   1 
ATOM   8848  C  CZ2   . TRP D  1 79  ? -82.755  -5.742  -27.326  1.00 38.32 ? 60  TRP D CZ2   1 
ATOM   8849  C  CZ3   . TRP D  1 79  ? -81.306  -7.566  -26.679  1.00 39.04 ? 60  TRP D CZ3   1 
ATOM   8850  C  CH2   . TRP D  1 79  ? -81.510  -6.232  -27.113  1.00 38.98 ? 60  TRP D CH2   1 
ATOM   8851  N  N     . ASN D  1 80  ? -86.429  -10.261 -28.705  1.00 38.48 ? 61  ASN D N     1 
ATOM   8852  C  CA    . ASN D  1 80  ? -86.722  -10.575 -30.101  1.00 38.47 ? 61  ASN D CA    1 
ATOM   8853  C  C     . ASN D  1 80  ? -85.727  -9.837  -31.029  1.00 37.28 ? 61  ASN D C     1 
ATOM   8854  O  O     . ASN D  1 80  ? -85.057  -8.914  -30.592  1.00 36.63 ? 61  ASN D O     1 
ATOM   8855  C  CB    . ASN D  1 80  ? -88.161  -10.150 -30.446  1.00 38.04 ? 61  ASN D CB    1 
ATOM   8856  C  CG    . ASN D  1 80  ? -88.388  -8.663  -30.197  1.00 37.95 ? 61  ASN D CG    1 
ATOM   8857  O  OD1   . ASN D  1 80  ? -88.847  -8.288  -29.125  1.00 38.73 ? 61  ASN D OD1   1 
ATOM   8858  N  ND2   . ASN D  1 80  ? -88.025  -7.820  -31.162  1.00 35.44 ? 61  ASN D ND2   1 
ATOM   8859  N  N     . PHE D  1 81  ? -85.669  -10.270 -32.283  1.00 36.78 ? 62  PHE D N     1 
ATOM   8860  C  CA    . PHE D  1 81  ? -84.787  -9.698  -33.276  1.00 37.61 ? 62  PHE D CA    1 
ATOM   8861  C  C     . PHE D  1 81  ? -85.425  -9.743  -34.649  1.00 37.77 ? 62  PHE D C     1 
ATOM   8862  O  O     . PHE D  1 81  ? -86.456  -10.358 -34.843  1.00 38.02 ? 62  PHE D O     1 
ATOM   8863  C  CB    . PHE D  1 81  ? -83.451  -10.471 -33.295  1.00 37.97 ? 62  PHE D CB    1 
ATOM   8864  C  CG    . PHE D  1 81  ? -83.567  -11.922 -33.728  1.00 37.22 ? 62  PHE D CG    1 
ATOM   8865  C  CD1   . PHE D  1 81  ? -83.313  -12.296 -35.038  1.00 37.62 ? 62  PHE D CD1   1 
ATOM   8866  C  CD2   . PHE D  1 81  ? -83.929  -12.898 -32.836  1.00 37.67 ? 62  PHE D CD2   1 
ATOM   8867  C  CE1   . PHE D  1 81  ? -83.404  -13.635 -35.432  1.00 37.84 ? 62  PHE D CE1   1 
ATOM   8868  C  CE2   . PHE D  1 81  ? -84.022  -14.238 -33.227  1.00 37.90 ? 62  PHE D CE2   1 
ATOM   8869  C  CZ    . PHE D  1 81  ? -83.772  -14.597 -34.524  1.00 37.25 ? 62  PHE D CZ    1 
ATOM   8870  N  N     . ASP D  1 82  ? -84.776  -9.103  -35.604  1.00 38.62 ? 63  ASP D N     1 
ATOM   8871  C  CA    . ASP D  1 82  ? -85.188  -9.114  -36.996  1.00 38.91 ? 63  ASP D CA    1 
ATOM   8872  C  C     . ASP D  1 82  ? -84.770  -10.421 -37.605  1.00 39.36 ? 63  ASP D C     1 
ATOM   8873  O  O     . ASP D  1 82  ? -83.622  -10.573 -38.012  1.00 40.31 ? 63  ASP D O     1 
ATOM   8874  C  CB    . ASP D  1 82  ? -84.487  -7.986  -37.765  1.00 38.92 ? 63  ASP D CB    1 
ATOM   8875  C  CG    . ASP D  1 82  ? -84.830  -7.985  -39.259  1.00 39.07 ? 63  ASP D CG    1 
ATOM   8876  O  OD1   . ASP D  1 82  ? -85.750  -8.766  -39.685  1.00 34.40 ? 63  ASP D OD1   1 
ATOM   8877  O  OD2   . ASP D  1 82  ? -84.172  -7.172  -39.981  1.00 38.31 ? 63  ASP D OD2   1 
ATOM   8878  N  N     . GLY D  1 83  ? -85.692  -11.366 -37.692  1.00 39.67 ? 64  GLY D N     1 
ATOM   8879  C  CA    . GLY D  1 83  ? -85.394  -12.641 -38.341  1.00 39.97 ? 64  GLY D CA    1 
ATOM   8880  C  C     . GLY D  1 83  ? -85.147  -12.549 -39.840  1.00 40.09 ? 64  GLY D C     1 
ATOM   8881  O  O     . GLY D  1 83  ? -84.628  -13.486 -40.431  1.00 40.52 ? 64  GLY D O     1 
ATOM   8882  N  N     . SER D  1 84  ? -85.534  -11.445 -40.467  1.00 40.21 ? 65  SER D N     1 
ATOM   8883  C  CA    . SER D  1 84  ? -85.304  -11.288 -41.895  1.00 40.50 ? 65  SER D CA    1 
ATOM   8884  C  C     . SER D  1 84  ? -83.871  -10.865 -42.176  1.00 41.10 ? 65  SER D C     1 
ATOM   8885  O  O     . SER D  1 84  ? -83.447  -10.852 -43.326  1.00 41.81 ? 65  SER D O     1 
ATOM   8886  C  CB    . SER D  1 84  ? -86.266  -10.285 -42.500  1.00 40.15 ? 65  SER D CB    1 
ATOM   8887  O  OG    . SER D  1 84  ? -85.890  -8.970  -42.186  1.00 38.72 ? 65  SER D OG    1 
ATOM   8888  N  N     . SER D  1 85  ? -83.110  -10.541 -41.134  1.00 41.51 ? 66  SER D N     1 
ATOM   8889  C  CA    . SER D  1 85  ? -81.711  -10.133 -41.327  1.00 41.47 ? 66  SER D CA    1 
ATOM   8890  C  C     . SER D  1 85  ? -80.777  -11.252 -40.880  1.00 41.92 ? 66  SER D C     1 
ATOM   8891  O  O     . SER D  1 85  ? -79.538  -11.105 -40.952  1.00 41.90 ? 66  SER D O     1 
ATOM   8892  C  CB    . SER D  1 85  ? -81.408  -8.799  -40.609  1.00 41.14 ? 66  SER D CB    1 
ATOM   8893  O  OG    . SER D  1 85  ? -82.091  -7.712  -41.216  1.00 39.50 ? 66  SER D OG    1 
ATOM   8894  N  N     . THR D  1 86  ? -81.356  -12.384 -40.465  1.00 42.48 ? 67  THR D N     1 
ATOM   8895  C  CA    . THR D  1 86  ? -80.546  -13.595 -40.164  1.00 43.00 ? 67  THR D CA    1 
ATOM   8896  C  C     . THR D  1 86  ? -80.962  -14.827 -40.955  1.00 43.23 ? 67  THR D C     1 
ATOM   8897  O  O     . THR D  1 86  ? -80.640  -15.927 -40.550  1.00 43.03 ? 67  THR D O     1 
ATOM   8898  C  CB    . THR D  1 86  ? -80.640  -13.957 -38.670  1.00 42.91 ? 67  THR D CB    1 
ATOM   8899  O  OG1   . THR D  1 86  ? -81.992  -14.354 -38.374  1.00 43.22 ? 67  THR D OG1   1 
ATOM   8900  C  CG2   . THR D  1 86  ? -80.230  -12.743 -37.800  1.00 42.29 ? 67  THR D CG2   1 
ATOM   8901  N  N     . LEU D  1 87  ? -81.664  -14.643 -42.073  1.00 43.93 ? 68  LEU D N     1 
ATOM   8902  C  CA    . LEU D  1 87  ? -82.161  -15.766 -42.897  1.00 44.63 ? 68  LEU D CA    1 
ATOM   8903  C  C     . LEU D  1 87  ? -83.155  -16.686 -42.185  1.00 44.54 ? 68  LEU D C     1 
ATOM   8904  O  O     . LEU D  1 87  ? -83.164  -17.894 -42.425  1.00 44.68 ? 68  LEU D O     1 
ATOM   8905  C  CB    . LEU D  1 87  ? -81.012  -16.641 -43.453  1.00 45.15 ? 68  LEU D CB    1 
ATOM   8906  C  CG    . LEU D  1 87  ? -80.468  -16.377 -44.877  1.00 47.61 ? 68  LEU D CG    1 
ATOM   8907  C  CD1   . LEU D  1 87  ? -79.725  -17.670 -45.357  1.00 50.07 ? 68  LEU D CD1   1 
ATOM   8908  C  CD2   . LEU D  1 87  ? -81.487  -15.906 -45.937  1.00 45.31 ? 68  LEU D CD2   1 
ATOM   8909  N  N     . GLN D  1 88  ? -83.985  -16.135 -41.314  1.00 44.56 ? 69  GLN D N     1 
ATOM   8910  C  CA    . GLN D  1 88  ? -84.908  -16.968 -40.557  1.00 44.57 ? 69  GLN D CA    1 
ATOM   8911  C  C     . GLN D  1 88  ? -86.387  -16.607 -40.680  1.00 44.35 ? 69  GLN D C     1 
ATOM   8912  O  O     . GLN D  1 88  ? -87.217  -17.368 -40.243  1.00 44.20 ? 69  GLN D O     1 
ATOM   8913  C  CB    . GLN D  1 88  ? -84.449  -17.004 -39.107  1.00 44.56 ? 69  GLN D CB    1 
ATOM   8914  C  CG    . GLN D  1 88  ? -83.117  -17.757 -38.930  1.00 43.78 ? 69  GLN D CG    1 
ATOM   8915  C  CD    . GLN D  1 88  ? -82.635  -17.723 -37.496  1.00 44.82 ? 69  GLN D CD    1 
ATOM   8916  O  OE1   . GLN D  1 88  ? -82.647  -18.739 -36.803  1.00 45.81 ? 69  GLN D OE1   1 
ATOM   8917  N  NE2   . GLN D  1 88  ? -82.216  -16.546 -37.036  1.00 43.80 ? 69  GLN D NE2   1 
ATOM   8918  N  N     . SER D  1 89  ? -86.707  -15.463 -41.280  1.00 44.73 ? 70  SER D N     1 
ATOM   8919  C  CA    . SER D  1 89  ? -88.099  -15.027 -41.441  1.00 45.32 ? 70  SER D CA    1 
ATOM   8920  C  C     . SER D  1 89  ? -88.247  -13.951 -42.515  1.00 45.38 ? 70  SER D C     1 
ATOM   8921  O  O     . SER D  1 89  ? -87.276  -13.472 -43.052  1.00 46.26 ? 70  SER D O     1 
ATOM   8922  C  CB    . SER D  1 89  ? -88.666  -14.534 -40.105  1.00 45.36 ? 70  SER D CB    1 
ATOM   8923  O  OG    . SER D  1 89  ? -88.251  -13.220 -39.812  1.00 45.96 ? 70  SER D OG    1 
ATOM   8924  N  N     . GLU D  1 90  ? -89.466  -13.559 -42.830  1.00 46.33 ? 71  GLU D N     1 
ATOM   8925  C  CA    . GLU D  1 90  ? -89.693  -12.566 -43.894  1.00 46.39 ? 71  GLU D CA    1 
ATOM   8926  C  C     . GLU D  1 90  ? -89.751  -11.165 -43.342  1.00 46.02 ? 71  GLU D C     1 
ATOM   8927  O  O     . GLU D  1 90  ? -90.371  -10.919 -42.295  1.00 45.40 ? 71  GLU D O     1 
ATOM   8928  C  CB    . GLU D  1 90  ? -91.018  -12.808 -44.595  1.00 47.28 ? 71  GLU D CB    1 
ATOM   8929  C  CG    . GLU D  1 90  ? -91.244  -14.213 -45.065  1.00 50.78 ? 71  GLU D CG    1 
ATOM   8930  C  CD    . GLU D  1 90  ? -90.648  -14.435 -46.419  1.00 56.05 ? 71  GLU D CD    1 
ATOM   8931  O  OE1   . GLU D  1 90  ? -89.391  -14.388 -46.505  1.00 57.33 ? 71  GLU D OE1   1 
ATOM   8932  O  OE2   . GLU D  1 90  ? -91.445  -14.649 -47.384  1.00 59.47 ? 71  GLU D OE2   1 
ATOM   8933  N  N     . GLY D  1 91  ? -89.173  -10.241 -44.105  1.00 45.68 ? 72  GLY D N     1 
ATOM   8934  C  CA    . GLY D  1 91  ? -89.160  -8.823  -43.759  1.00 45.34 ? 72  GLY D CA    1 
ATOM   8935  C  C     . GLY D  1 91  ? -90.449  -8.306  -43.172  1.00 44.85 ? 72  GLY D C     1 
ATOM   8936  O  O     . GLY D  1 91  ? -90.435  -7.638  -42.134  1.00 44.66 ? 72  GLY D O     1 
ATOM   8937  N  N     . SER D  1 92  ? -91.563  -8.638  -43.821  1.00 44.49 ? 73  SER D N     1 
ATOM   8938  C  CA    . SER D  1 92  ? -92.835  -7.979  -43.501  1.00 44.50 ? 73  SER D CA    1 
ATOM   8939  C  C     . SER D  1 92  ? -93.583  -8.633  -42.346  1.00 44.15 ? 73  SER D C     1 
ATOM   8940  O  O     . SER D  1 92  ? -94.623  -8.153  -41.954  1.00 44.11 ? 73  SER D O     1 
ATOM   8941  C  CB    . SER D  1 92  ? -93.733  -7.916  -44.720  1.00 43.98 ? 73  SER D CB    1 
ATOM   8942  O  OG    . SER D  1 92  ? -94.065  -9.235  -45.083  1.00 45.00 ? 73  SER D OG    1 
ATOM   8943  N  N     . ASN D  1 93  ? -93.050  -9.723  -41.816  1.00 43.97 ? 74  ASN D N     1 
ATOM   8944  C  CA    . ASN D  1 93  ? -93.546  -10.345 -40.583  1.00 43.42 ? 74  ASN D CA    1 
ATOM   8945  C  C     . ASN D  1 93  ? -92.318  -10.893 -39.815  1.00 42.80 ? 74  ASN D C     1 
ATOM   8946  O  O     . ASN D  1 93  ? -92.135  -12.080 -39.599  1.00 42.29 ? 74  ASN D O     1 
ATOM   8947  C  CB    . ASN D  1 93  ? -94.568  -11.421 -40.926  1.00 42.75 ? 74  ASN D CB    1 
ATOM   8948  C  CG    . ASN D  1 93  ? -95.223  -11.993 -39.708  1.00 43.53 ? 74  ASN D CG    1 
ATOM   8949  O  OD1   . ASN D  1 93  ? -95.134  -11.415 -38.613  1.00 43.90 ? 74  ASN D OD1   1 
ATOM   8950  N  ND2   . ASN D  1 93  ? -95.866  -13.152 -39.865  1.00 43.05 ? 74  ASN D ND2   1 
ATOM   8951  N  N     . SER D  1 94  ? -91.459  -9.966  -39.422  1.00 43.02 ? 75  SER D N     1 
ATOM   8952  C  CA    . SER D  1 94  ? -90.045  -10.281 -39.203  1.00 42.54 ? 75  SER D CA    1 
ATOM   8953  C  C     . SER D  1 94  ? -89.674  -10.620 -37.776  1.00 42.62 ? 75  SER D C     1 
ATOM   8954  O  O     . SER D  1 94  ? -88.795  -11.456 -37.569  1.00 43.19 ? 75  SER D O     1 
ATOM   8955  C  CB    . SER D  1 94  ? -89.153  -9.150  -39.713  1.00 42.06 ? 75  SER D CB    1 
ATOM   8956  O  OG    . SER D  1 94  ? -89.684  -7.904  -39.422  1.00 38.69 ? 75  SER D OG    1 
ATOM   8957  N  N     . ASP D  1 95  ? -90.326  -10.018 -36.792  1.00 42.33 ? 76  ASP D N     1 
ATOM   8958  C  CA    . ASP D  1 95  ? -89.910  -10.250 -35.409  1.00 42.60 ? 76  ASP D CA    1 
ATOM   8959  C  C     . ASP D  1 95  ? -89.839  -11.754 -35.125  1.00 43.05 ? 76  ASP D C     1 
ATOM   8960  O  O     . ASP D  1 95  ? -90.752  -12.536 -35.538  1.00 44.04 ? 76  ASP D O     1 
ATOM   8961  C  CB    . ASP D  1 95  ? -90.868  -9.631  -34.397  1.00 42.50 ? 76  ASP D CB    1 
ATOM   8962  C  CG    . ASP D  1 95  ? -91.056  -8.149  -34.586  1.00 42.29 ? 76  ASP D CG    1 
ATOM   8963  O  OD1   . ASP D  1 95  ? -91.489  -7.512  -33.600  1.00 42.87 ? 76  ASP D OD1   1 
ATOM   8964  O  OD2   . ASP D  1 95  ? -90.807  -7.621  -35.701  1.00 42.05 ? 76  ASP D OD2   1 
ATOM   8965  N  N     . MET D  1 96  ? -88.760  -12.158 -34.455  1.00 42.30 ? 77  MET D N     1 
ATOM   8966  C  CA    . MET D  1 96  ? -88.669  -13.511 -33.916  1.00 42.23 ? 77  MET D CA    1 
ATOM   8967  C  C     . MET D  1 96  ? -88.276  -13.413 -32.475  1.00 42.11 ? 77  MET D C     1 
ATOM   8968  O  O     . MET D  1 96  ? -87.675  -12.429 -32.076  1.00 42.34 ? 77  MET D O     1 
ATOM   8969  C  CB    . MET D  1 96  ? -87.664  -14.369 -34.687  1.00 42.43 ? 77  MET D CB    1 
ATOM   8970  C  CG    . MET D  1 96  ? -88.027  -14.566 -36.141  1.00 41.81 ? 77  MET D CG    1 
ATOM   8971  S  SD    . MET D  1 96  ? -86.938  -15.732 -36.920  1.00 41.59 ? 77  MET D SD    1 
ATOM   8972  C  CE    . MET D  1 96  ? -87.652  -17.290 -36.413  1.00 37.40 ? 77  MET D CE    1 
ATOM   8973  N  N     . TYR D  1 97  ? -88.617  -14.444 -31.708  1.00 42.02 ? 78  TYR D N     1 
ATOM   8974  C  CA    . TYR D  1 97  ? -88.484  -14.424 -30.253  1.00 41.49 ? 78  TYR D CA    1 
ATOM   8975  C  C     . TYR D  1 97  ? -87.152  -14.939 -29.776  1.00 40.84 ? 78  TYR D C     1 
ATOM   8976  O  O     . TYR D  1 97  ? -86.654  -15.938 -30.309  1.00 39.95 ? 78  TYR D O     1 
ATOM   8977  C  CB    . TYR D  1 97  ? -89.498  -15.361 -29.621  1.00 42.69 ? 78  TYR D CB    1 
ATOM   8978  C  CG    . TYR D  1 97  ? -90.897  -14.911 -29.682  1.00 42.97 ? 78  TYR D CG    1 
ATOM   8979  C  CD1   . TYR D  1 97  ? -91.427  -14.108 -28.672  1.00 43.75 ? 78  TYR D CD1   1 
ATOM   8980  C  CD2   . TYR D  1 97  ? -91.721  -15.327 -30.711  1.00 44.60 ? 78  TYR D CD2   1 
ATOM   8981  C  CE1   . TYR D  1 97  ? -92.742  -13.723 -28.689  1.00 44.57 ? 78  TYR D CE1   1 
ATOM   8982  C  CE2   . TYR D  1 97  ? -93.057  -14.922 -30.758  1.00 45.12 ? 78  TYR D CE2   1 
ATOM   8983  C  CZ    . TYR D  1 97  ? -93.549  -14.126 -29.744  1.00 43.97 ? 78  TYR D CZ    1 
ATOM   8984  O  OH    . TYR D  1 97  ? -94.831  -13.721 -29.792  1.00 45.25 ? 78  TYR D OH    1 
ATOM   8985  N  N     . LEU D  1 98  ? -86.632  -14.296 -28.727  1.00 39.75 ? 79  LEU D N     1 
ATOM   8986  C  CA    . LEU D  1 98  ? -85.491  -14.796 -27.988  1.00 39.33 ? 79  LEU D CA    1 
ATOM   8987  C  C     . LEU D  1 98  ? -85.904  -15.157 -26.566  1.00 38.79 ? 79  LEU D C     1 
ATOM   8988  O  O     . LEU D  1 98  ? -86.336  -14.283 -25.795  1.00 39.48 ? 79  LEU D O     1 
ATOM   8989  C  CB    . LEU D  1 98  ? -84.363  -13.741 -27.942  1.00 38.99 ? 79  LEU D CB    1 
ATOM   8990  C  CG    . LEU D  1 98  ? -83.668  -13.351 -29.250  1.00 38.77 ? 79  LEU D CG    1 
ATOM   8991  C  CD1   . LEU D  1 98  ? -82.695  -12.180 -29.093  1.00 34.16 ? 79  LEU D CD1   1 
ATOM   8992  C  CD2   . LEU D  1 98  ? -82.972  -14.565 -29.836  1.00 37.83 ? 79  LEU D CD2   1 
ATOM   8993  N  N     . VAL D  1 99  ? -85.730  -16.418 -26.198  1.00 37.92 ? 80  VAL D N     1 
ATOM   8994  C  CA    . VAL D  1 99  ? -86.059  -16.883 -24.853  1.00 37.96 ? 80  VAL D CA    1 
ATOM   8995  C  C     . VAL D  1 99  ? -84.781  -17.362 -24.180  1.00 38.44 ? 80  VAL D C     1 
ATOM   8996  O  O     . VAL D  1 99  ? -84.174  -18.321 -24.654  1.00 38.31 ? 80  VAL D O     1 
ATOM   8997  C  CB    . VAL D  1 99  ? -87.086  -18.050 -24.877  1.00 37.77 ? 80  VAL D CB    1 
ATOM   8998  C  CG1   . VAL D  1 99  ? -87.360  -18.591 -23.436  1.00 33.24 ? 80  VAL D CG1   1 
ATOM   8999  C  CG2   . VAL D  1 99  ? -88.336  -17.597 -25.646  1.00 35.12 ? 80  VAL D CG2   1 
ATOM   9000  N  N     . PRO D  1 100 ? -84.350  -16.674 -23.104  1.00 38.47 ? 81  PRO D N     1 
ATOM   9001  C  CA    . PRO D  1 100 ? -83.136  -17.064 -22.381  1.00 38.19 ? 81  PRO D CA    1 
ATOM   9002  C  C     . PRO D  1 100 ? -83.134  -18.514 -21.968  1.00 38.32 ? 81  PRO D C     1 
ATOM   9003  O  O     . PRO D  1 100 ? -84.149  -19.039 -21.550  1.00 39.62 ? 81  PRO D O     1 
ATOM   9004  C  CB    . PRO D  1 100 ? -83.130  -16.140 -21.156  1.00 38.33 ? 81  PRO D CB    1 
ATOM   9005  C  CG    . PRO D  1 100 ? -83.914  -14.906 -21.595  1.00 39.03 ? 81  PRO D CG    1 
ATOM   9006  C  CD    . PRO D  1 100 ? -84.941  -15.421 -22.580  1.00 38.65 ? 81  PRO D CD    1 
ATOM   9007  N  N     . ALA D  1 101 ? -82.000  -19.160 -22.148  1.00 38.23 ? 82  ALA D N     1 
ATOM   9008  C  CA    . ALA D  1 101 ? -81.814  -20.557 -21.857  1.00 38.03 ? 82  ALA D CA    1 
ATOM   9009  C  C     . ALA D  1 101 ? -80.705  -20.703 -20.799  1.00 38.16 ? 82  ALA D C     1 
ATOM   9010  O  O     . ALA D  1 101 ? -80.903  -21.423 -19.823  1.00 37.23 ? 82  ALA D O     1 
ATOM   9011  C  CB    . ALA D  1 101 ? -81.443  -21.307 -23.128  1.00 37.15 ? 82  ALA D CB    1 
ATOM   9012  N  N     . ALA D  1 102 ? -79.548  -20.040 -21.028  1.00 38.21 ? 83  ALA D N     1 
ATOM   9013  C  CA    . ALA D  1 102 ? -78.345  -20.170 -20.166  1.00 38.67 ? 83  ALA D CA    1 
ATOM   9014  C  C     . ALA D  1 102 ? -77.621  -18.820 -19.971  1.00 38.89 ? 83  ALA D C     1 
ATOM   9015  O  O     . ALA D  1 102 ? -77.286  -18.106 -20.946  1.00 37.92 ? 83  ALA D O     1 
ATOM   9016  C  CB    . ALA D  1 102 ? -77.371  -21.230 -20.712  1.00 38.09 ? 83  ALA D CB    1 
ATOM   9017  N  N     . MET D  1 103 ? -77.436  -18.467 -18.697  1.00 39.06 ? 84  MET D N     1 
ATOM   9018  C  CA    . MET D  1 103 ? -76.781  -17.214 -18.326  1.00 39.46 ? 84  MET D CA    1 
ATOM   9019  C  C     . MET D  1 103 ? -75.361  -17.420 -17.805  1.00 39.12 ? 84  MET D C     1 
ATOM   9020  O  O     . MET D  1 103 ? -75.125  -18.332 -17.021  1.00 39.27 ? 84  MET D O     1 
ATOM   9021  C  CB    . MET D  1 103 ? -77.588  -16.470 -17.261  1.00 39.12 ? 84  MET D CB    1 
ATOM   9022  C  CG    . MET D  1 103 ? -77.056  -15.054 -17.015  1.00 39.74 ? 84  MET D CG    1 
ATOM   9023  S  SD    . MET D  1 103 ? -78.040  -14.115 -15.833  1.00 42.83 ? 84  MET D SD    1 
ATOM   9024  C  CE    . MET D  1 103 ? -77.482  -14.915 -14.282  1.00 33.39 ? 84  MET D CE    1 
ATOM   9025  N  N     . PHE D  1 104 ? -74.463  -16.516 -18.207  1.00 39.07 ? 85  PHE D N     1 
ATOM   9026  C  CA    . PHE D  1 104 ? -73.057  -16.537 -17.850  1.00 38.92 ? 85  PHE D CA    1 
ATOM   9027  C  C     . PHE D  1 104 ? -72.586  -15.113 -17.583  1.00 38.74 ? 85  PHE D C     1 
ATOM   9028  O  O     . PHE D  1 104 ? -73.179  -14.129 -18.048  1.00 38.82 ? 85  PHE D O     1 
ATOM   9029  C  CB    . PHE D  1 104 ? -72.227  -17.116 -19.001  1.00 39.75 ? 85  PHE D CB    1 
ATOM   9030  C  CG    . PHE D  1 104 ? -72.463  -18.589 -19.252  1.00 39.73 ? 85  PHE D CG    1 
ATOM   9031  C  CD1   . PHE D  1 104 ? -71.751  -19.538 -18.569  1.00 39.68 ? 85  PHE D CD1   1 
ATOM   9032  C  CD2   . PHE D  1 104 ? -73.409  -19.002 -20.173  1.00 41.75 ? 85  PHE D CD2   1 
ATOM   9033  C  CE1   . PHE D  1 104 ? -71.979  -20.902 -18.772  1.00 41.08 ? 85  PHE D CE1   1 
ATOM   9034  C  CE2   . PHE D  1 104 ? -73.652  -20.360 -20.395  1.00 42.05 ? 85  PHE D CE2   1 
ATOM   9035  C  CZ    . PHE D  1 104 ? -72.922  -21.315 -19.680  1.00 41.33 ? 85  PHE D CZ    1 
ATOM   9036  N  N     . ARG D  1 105 ? -71.491  -15.007 -16.851  1.00 38.78 ? 86  ARG D N     1 
ATOM   9037  C  CA    . ARG D  1 105 ? -70.842  -13.701 -16.621  1.00 38.67 ? 86  ARG D CA    1 
ATOM   9038  C  C     . ARG D  1 105 ? -70.071  -13.290 -17.879  1.00 38.41 ? 86  ARG D C     1 
ATOM   9039  O  O     . ARG D  1 105 ? -69.534  -14.136 -18.574  1.00 39.04 ? 86  ARG D O     1 
ATOM   9040  C  CB    . ARG D  1 105 ? -69.906  -13.714 -15.395  1.00 38.86 ? 86  ARG D CB    1 
ATOM   9041  C  CG    . ARG D  1 105 ? -70.520  -14.277 -14.084  1.00 36.85 ? 86  ARG D CG    1 
ATOM   9042  C  CD    . ARG D  1 105 ? -69.395  -14.788 -13.162  1.00 37.63 ? 86  ARG D CD    1 
ATOM   9043  N  NE    . ARG D  1 105 ? -68.642  -13.698 -12.530  1.00 38.14 ? 86  ARG D NE    1 
ATOM   9044  C  CZ    . ARG D  1 105 ? -67.348  -13.723 -12.183  1.00 38.83 ? 86  ARG D CZ    1 
ATOM   9045  N  NH1   . ARG D  1 105 ? -66.583  -14.788 -12.409  1.00 38.15 ? 86  ARG D NH1   1 
ATOM   9046  N  NH2   . ARG D  1 105 ? -66.789  -12.641 -11.611  1.00 36.76 ? 86  ARG D NH2   1 
ATOM   9047  N  N     . ASP D  1 106 ? -70.072  -11.993 -18.181  1.00 37.88 ? 87  ASP D N     1 
ATOM   9048  C  CA    . ASP D  1 106 ? -69.511  -11.485 -19.401  1.00 37.73 ? 87  ASP D CA    1 
ATOM   9049  C  C     . ASP D  1 106 ? -68.063  -11.099 -19.145  1.00 37.39 ? 87  ASP D C     1 
ATOM   9050  O  O     . ASP D  1 106 ? -67.808  -10.123 -18.455  1.00 36.69 ? 87  ASP D O     1 
ATOM   9051  C  CB    . ASP D  1 106 ? -70.306  -10.266 -19.839  1.00 38.02 ? 87  ASP D CB    1 
ATOM   9052  C  CG    . ASP D  1 106 ? -69.848  -9.695  -21.181  1.00 38.01 ? 87  ASP D CG    1 
ATOM   9053  O  OD1   . ASP D  1 106 ? -68.638  -9.792  -21.548  1.00 39.07 ? 87  ASP D OD1   1 
ATOM   9054  O  OD2   . ASP D  1 106 ? -70.731  -9.146  -21.855  1.00 37.19 ? 87  ASP D OD2   1 
ATOM   9055  N  N     . PRO D  1 107 ? -67.118  -11.857 -19.726  1.00 37.74 ? 88  PRO D N     1 
ATOM   9056  C  CA    . PRO D  1 107 ? -65.691  -11.656 -19.532  1.00 38.19 ? 88  PRO D CA    1 
ATOM   9057  C  C     . PRO D  1 107 ? -65.142  -10.560 -20.433  1.00 38.41 ? 88  PRO D C     1 
ATOM   9058  O  O     . PRO D  1 107 ? -63.980  -10.194 -20.259  1.00 38.56 ? 88  PRO D O     1 
ATOM   9059  C  CB    . PRO D  1 107 ? -65.101  -12.993 -19.956  1.00 37.92 ? 88  PRO D CB    1 
ATOM   9060  C  CG    . PRO D  1 107 ? -65.989  -13.405 -21.056  1.00 38.08 ? 88  PRO D CG    1 
ATOM   9061  C  CD    . PRO D  1 107 ? -67.357  -12.962 -20.672  1.00 38.04 ? 88  PRO D CD    1 
ATOM   9062  N  N     . PHE D  1 108 ? -65.964  -10.054 -21.367  1.00 38.36 ? 89  PHE D N     1 
ATOM   9063  C  CA    . PHE D  1 108 ? -65.615  -8.853  -22.153  1.00 38.29 ? 89  PHE D CA    1 
ATOM   9064  C  C     . PHE D  1 108 ? -65.973  -7.571  -21.410  1.00 38.34 ? 89  PHE D C     1 
ATOM   9065  O  O     . PHE D  1 108 ? -65.325  -6.580  -21.601  1.00 39.31 ? 89  PHE D O     1 
ATOM   9066  C  CB    . PHE D  1 108 ? -66.240  -8.894  -23.574  1.00 37.95 ? 89  PHE D CB    1 
ATOM   9067  C  CG    . PHE D  1 108 ? -66.079  -10.230 -24.217  1.00 38.71 ? 89  PHE D CG    1 
ATOM   9068  C  CD1   . PHE D  1 108 ? -64.826  -10.667 -24.598  1.00 37.73 ? 89  PHE D CD1   1 
ATOM   9069  C  CD2   . PHE D  1 108 ? -67.140  -11.106 -24.315  1.00 39.21 ? 89  PHE D CD2   1 
ATOM   9070  C  CE1   . PHE D  1 108 ? -64.662  -11.913 -25.124  1.00 39.23 ? 89  PHE D CE1   1 
ATOM   9071  C  CE2   . PHE D  1 108 ? -66.961  -12.361 -24.835  1.00 38.83 ? 89  PHE D CE2   1 
ATOM   9072  C  CZ    . PHE D  1 108 ? -65.728  -12.768 -25.224  1.00 38.67 ? 89  PHE D CZ    1 
ATOM   9073  N  N     . ARG D  1 109 ? -66.983  -7.574  -20.555  1.00 38.24 ? 90  ARG D N     1 
ATOM   9074  C  CA    . ARG D  1 109 ? -67.429  -6.311  -19.906  1.00 38.21 ? 90  ARG D CA    1 
ATOM   9075  C  C     . ARG D  1 109 ? -67.390  -6.366  -18.355  1.00 38.14 ? 90  ARG D C     1 
ATOM   9076  O  O     . ARG D  1 109 ? -67.529  -5.345  -17.686  1.00 36.31 ? 90  ARG D O     1 
ATOM   9077  C  CB    . ARG D  1 109 ? -68.848  -5.960  -20.381  1.00 38.59 ? 90  ARG D CB    1 
ATOM   9078  C  CG    . ARG D  1 109 ? -68.963  -5.767  -21.903  1.00 37.82 ? 90  ARG D CG    1 
ATOM   9079  C  CD    . ARG D  1 109 ? -70.384  -5.820  -22.291  1.00 37.60 ? 90  ARG D CD    1 
ATOM   9080  N  NE    . ARG D  1 109 ? -70.624  -5.323  -23.644  1.00 37.95 ? 90  ARG D NE    1 
ATOM   9081  C  CZ    . ARG D  1 109 ? -71.780  -5.473  -24.278  1.00 36.01 ? 90  ARG D CZ    1 
ATOM   9082  N  NH1   . ARG D  1 109 ? -72.758  -6.138  -23.697  1.00 36.68 ? 90  ARG D NH1   1 
ATOM   9083  N  NH2   . ARG D  1 109 ? -71.938  -5.017  -25.501  1.00 34.97 ? 90  ARG D NH2   1 
ATOM   9084  N  N     . LYS D  1 110 ? -67.183  -7.571  -17.852  1.00 38.50 ? 91  LYS D N     1 
ATOM   9085  C  CA    . LYS D  1 110 ? -67.015  -7.874  -16.450  1.00 39.13 ? 91  LYS D CA    1 
ATOM   9086  C  C     . LYS D  1 110 ? -68.294  -7.830  -15.644  1.00 39.20 ? 91  LYS D C     1 
ATOM   9087  O  O     . LYS D  1 110 ? -69.281  -7.442  -16.132  1.00 38.67 ? 91  LYS D O     1 
ATOM   9088  C  CB    . LYS D  1 110 ? -65.936  -7.016  -15.836  1.00 38.98 ? 91  LYS D CB    1 
ATOM   9089  C  CG    . LYS D  1 110 ? -64.587  -7.306  -16.334  1.00 41.10 ? 91  LYS D CG    1 
ATOM   9090  C  CD    . LYS D  1 110 ? -63.633  -6.294  -15.897  1.00 41.11 ? 91  LYS D CD    1 
ATOM   9091  C  CE    . LYS D  1 110 ? -63.345  -6.458  -14.461  1.00 45.73 ? 91  LYS D CE    1 
ATOM   9092  N  NZ    . LYS D  1 110 ? -61.968  -6.141  -14.082  1.00 46.65 ? 91  LYS D NZ    1 
ATOM   9093  N  N     . ASP D  1 111 ? -68.264  -8.231  -14.395  1.00 38.86 ? 92  ASP D N     1 
ATOM   9094  C  CA    . ASP D  1 111 ? -69.441  -8.145  -13.566  1.00 38.86 ? 92  ASP D CA    1 
ATOM   9095  C  C     . ASP D  1 111 ? -69.893  -6.715  -13.543  1.00 38.37 ? 92  ASP D C     1 
ATOM   9096  O  O     . ASP D  1 111 ? -69.076  -5.864  -13.475  1.00 37.93 ? 92  ASP D O     1 
ATOM   9097  C  CB    . ASP D  1 111 ? -69.125  -8.579  -12.158  1.00 37.98 ? 92  ASP D CB    1 
ATOM   9098  C  CG    . ASP D  1 111 ? -68.978  -10.044 -12.019  1.00 39.16 ? 92  ASP D CG    1 
ATOM   9099  O  OD1   . ASP D  1 111 ? -69.339  -10.761 -12.920  1.00 39.29 ? 92  ASP D OD1   1 
ATOM   9100  O  OD2   . ASP D  1 111 ? -68.483  -10.488 -10.999  1.00 36.72 ? 92  ASP D OD2   1 
ATOM   9101  N  N     . PRO D  1 112 ? -71.177  -6.412  -13.642  1.00 39.00 ? 93  PRO D N     1 
ATOM   9102  C  CA    . PRO D  1 112 ? -72.317  -7.296  -13.446  1.00 38.64 ? 93  PRO D CA    1 
ATOM   9103  C  C     . PRO D  1 112 ? -73.010  -7.694  -14.719  1.00 38.11 ? 93  PRO D C     1 
ATOM   9104  O  O     . PRO D  1 112 ? -74.151  -8.026  -14.713  1.00 38.21 ? 93  PRO D O     1 
ATOM   9105  C  CB    . PRO D  1 112 ? -73.255  -6.396  -12.692  1.00 38.91 ? 93  PRO D CB    1 
ATOM   9106  C  CG    . PRO D  1 112 ? -72.997  -5.099  -13.277  1.00 39.43 ? 93  PRO D CG    1 
ATOM   9107  C  CD    . PRO D  1 112 ? -71.558  -5.013  -13.466  1.00 39.42 ? 93  PRO D CD    1 
ATOM   9108  N  N     . ASN D  1 113 ? -72.303  -7.619  -15.813  1.00 38.10 ? 94  ASN D N     1 
ATOM   9109  C  CA    . ASN D  1 113 ? -72.857  -7.825  -17.105  1.00 38.01 ? 94  ASN D CA    1 
ATOM   9110  C  C     . ASN D  1 113 ? -72.863  -9.242  -17.487  1.00 38.08 ? 94  ASN D C     1 
ATOM   9111  O  O     . ASN D  1 113 ? -72.199  -10.040 -16.907  1.00 39.25 ? 94  ASN D O     1 
ATOM   9112  C  CB    . ASN D  1 113 ? -72.127  -6.986  -18.093  1.00 37.65 ? 94  ASN D CB    1 
ATOM   9113  C  CG    . ASN D  1 113 ? -72.037  -5.603  -17.660  1.00 38.04 ? 94  ASN D CG    1 
ATOM   9114  O  OD1   . ASN D  1 113 ? -73.009  -4.999  -17.356  1.00 39.36 ? 94  ASN D OD1   1 
ATOM   9115  N  ND2   . ASN D  1 113 ? -70.874  -5.094  -17.607  1.00 35.49 ? 94  ASN D ND2   1 
ATOM   9116  N  N     . LYS D  1 114 ? -73.684  -9.568  -18.440  1.00 37.96 ? 95  LYS D N     1 
ATOM   9117  C  CA    . LYS D  1 114 ? -74.059  -10.957 -18.642  1.00 38.05 ? 95  LYS D CA    1 
ATOM   9118  C  C     . LYS D  1 114 ? -74.057  -11.310 -20.092  1.00 38.33 ? 95  LYS D C     1 
ATOM   9119  O  O     . LYS D  1 114 ? -74.310  -10.439 -20.954  1.00 37.76 ? 95  LYS D O     1 
ATOM   9120  C  CB    . LYS D  1 114 ? -75.470  -11.224 -18.094  1.00 37.96 ? 95  LYS D CB    1 
ATOM   9121  C  CG    . LYS D  1 114 ? -75.703  -10.793 -16.645  1.00 37.93 ? 95  LYS D CG    1 
ATOM   9122  C  CD    . LYS D  1 114 ? -74.838  -11.632 -15.671  1.00 37.23 ? 95  LYS D CD    1 
ATOM   9123  C  CE    . LYS D  1 114 ? -75.271  -11.431 -14.240  1.00 36.21 ? 95  LYS D CE    1 
ATOM   9124  N  NZ    . LYS D  1 114 ? -74.128  -11.257 -13.316  1.00 33.42 ? 95  LYS D NZ    1 
ATOM   9125  N  N     . LEU D  1 115 ? -73.771  -12.596 -20.326  1.00 38.56 ? 96  LEU D N     1 
ATOM   9126  C  CA    . LEU D  1 115 ? -74.016  -13.263 -21.601  1.00 39.00 ? 96  LEU D CA    1 
ATOM   9127  C  C     . LEU D  1 115 ? -75.216  -14.205 -21.408  1.00 39.30 ? 96  LEU D C     1 
ATOM   9128  O  O     . LEU D  1 115 ? -75.345  -14.847 -20.347  1.00 38.44 ? 96  LEU D O     1 
ATOM   9129  C  CB    . LEU D  1 115 ? -72.797  -14.088 -22.048  1.00 38.94 ? 96  LEU D CB    1 
ATOM   9130  C  CG    . LEU D  1 115 ? -71.436  -13.375 -22.191  1.00 39.45 ? 96  LEU D CG    1 
ATOM   9131  C  CD1   . LEU D  1 115 ? -70.302  -14.371 -22.603  1.00 35.95 ? 96  LEU D CD1   1 
ATOM   9132  C  CD2   . LEU D  1 115 ? -71.557  -12.174 -23.153  1.00 37.13 ? 96  LEU D CD2   1 
ATOM   9133  N  N     . VAL D  1 116 ? -76.103  -14.242 -22.417  1.00 39.34 ? 97  VAL D N     1 
ATOM   9134  C  CA    . VAL D  1 116 ? -77.326  -15.028 -22.368  1.00 39.26 ? 97  VAL D CA    1 
ATOM   9135  C  C     . VAL D  1 116 ? -77.511  -15.824 -23.644  1.00 39.13 ? 97  VAL D C     1 
ATOM   9136  O  O     . VAL D  1 116 ? -77.788  -15.259 -24.709  1.00 39.07 ? 97  VAL D O     1 
ATOM   9137  C  CB    . VAL D  1 116 ? -78.544  -14.144 -22.165  1.00 39.44 ? 97  VAL D CB    1 
ATOM   9138  C  CG1   . VAL D  1 116 ? -79.761  -15.000 -21.835  1.00 40.25 ? 97  VAL D CG1   1 
ATOM   9139  C  CG2   . VAL D  1 116 ? -78.293  -13.172 -21.047  1.00 40.55 ? 97  VAL D CG2   1 
ATOM   9140  N  N     . LEU D  1 117 ? -77.335  -17.134 -23.548  1.00 38.62 ? 98  LEU D N     1 
ATOM   9141  C  CA    . LEU D  1 117 ? -77.666  -17.965 -24.639  1.00 39.04 ? 98  LEU D CA    1 
ATOM   9142  C  C     . LEU D  1 117 ? -79.212  -18.076 -24.667  1.00 40.39 ? 98  LEU D C     1 
ATOM   9143  O  O     . LEU D  1 117 ? -79.855  -18.288 -23.636  1.00 40.66 ? 98  LEU D O     1 
ATOM   9144  C  CB    . LEU D  1 117 ? -77.030  -19.314 -24.475  1.00 38.70 ? 98  LEU D CB    1 
ATOM   9145  C  CG    . LEU D  1 117 ? -77.230  -20.251 -25.673  1.00 38.80 ? 98  LEU D CG    1 
ATOM   9146  C  CD1   . LEU D  1 117 ? -76.630  -19.704 -26.957  1.00 38.04 ? 98  LEU D CD1   1 
ATOM   9147  C  CD2   . LEU D  1 117 ? -76.679  -21.660 -25.384  1.00 37.94 ? 98  LEU D CD2   1 
ATOM   9148  N  N     . CYS D  1 118 ? -79.788  -17.924 -25.859  1.00 40.82 ? 99  CYS D N     1 
ATOM   9149  C  CA    . CYS D  1 118 ? -81.205  -17.979 -26.078  1.00 40.76 ? 99  CYS D CA    1 
ATOM   9150  C  C     . CYS D  1 118 ? -81.570  -19.047 -27.096  1.00 41.26 ? 99  CYS D C     1 
ATOM   9151  O  O     . CYS D  1 118 ? -80.787  -19.396 -28.003  1.00 40.84 ? 99  CYS D O     1 
ATOM   9152  C  CB    . CYS D  1 118 ? -81.678  -16.631 -26.607  1.00 40.34 ? 99  CYS D CB    1 
ATOM   9153  S  SG    . CYS D  1 118 ? -81.402  -15.268 -25.436  1.00 41.14 ? 99  CYS D SG    1 
ATOM   9154  N  N     . GLU D  1 119 ? -82.791  -19.547 -26.938  1.00 42.00 ? 100 GLU D N     1 
ATOM   9155  C  CA    . GLU D  1 119 ? -83.485  -20.291 -27.991  1.00 42.31 ? 100 GLU D CA    1 
ATOM   9156  C  C     . GLU D  1 119 ? -84.317  -19.344 -28.840  1.00 42.29 ? 100 GLU D C     1 
ATOM   9157  O  O     . GLU D  1 119 ? -84.882  -18.403 -28.306  1.00 42.87 ? 100 GLU D O     1 
ATOM   9158  C  CB    . GLU D  1 119 ? -84.401  -21.339 -27.386  1.00 42.80 ? 100 GLU D CB    1 
ATOM   9159  C  CG    . GLU D  1 119 ? -83.709  -22.605 -26.882  1.00 42.40 ? 100 GLU D CG    1 
ATOM   9160  C  CD    . GLU D  1 119 ? -84.723  -23.644 -26.450  1.00 43.49 ? 100 GLU D CD    1 
ATOM   9161  O  OE1   . GLU D  1 119 ? -85.803  -23.789 -27.110  1.00 46.29 ? 100 GLU D OE1   1 
ATOM   9162  O  OE2   . GLU D  1 119 ? -84.471  -24.288 -25.426  1.00 43.19 ? 100 GLU D OE2   1 
ATOM   9163  N  N     . VAL D  1 120 ? -84.369  -19.606 -30.149  1.00 42.19 ? 101 VAL D N     1 
ATOM   9164  C  CA    . VAL D  1 120 ? -85.160  -18.847 -31.106  1.00 42.21 ? 101 VAL D CA    1 
ATOM   9165  C  C     . VAL D  1 120 ? -86.514  -19.549 -31.422  1.00 43.07 ? 101 VAL D C     1 
ATOM   9166  O  O     . VAL D  1 120 ? -86.579  -20.780 -31.605  1.00 42.99 ? 101 VAL D O     1 
ATOM   9167  C  CB    . VAL D  1 120 ? -84.409  -18.714 -32.394  1.00 42.28 ? 101 VAL D CB    1 
ATOM   9168  C  CG1   . VAL D  1 120 ? -85.237  -17.909 -33.427  1.00 41.76 ? 101 VAL D CG1   1 
ATOM   9169  C  CG2   . VAL D  1 120 ? -83.013  -18.126 -32.129  1.00 41.40 ? 101 VAL D CG2   1 
ATOM   9170  N  N     . PHE D  1 121 ? -87.594  -18.760 -31.455  1.00 43.42 ? 102 PHE D N     1 
ATOM   9171  C  CA    . PHE D  1 121 ? -88.898  -19.231 -31.899  1.00 43.48 ? 102 PHE D CA    1 
ATOM   9172  C  C     . PHE D  1 121 ? -89.484  -18.315 -32.949  1.00 44.08 ? 102 PHE D C     1 
ATOM   9173  O  O     . PHE D  1 121 ? -89.151  -17.138 -33.039  1.00 43.18 ? 102 PHE D O     1 
ATOM   9174  C  CB    . PHE D  1 121 ? -89.872  -19.318 -30.728  1.00 43.48 ? 102 PHE D CB    1 
ATOM   9175  C  CG    . PHE D  1 121 ? -89.442  -20.238 -29.649  1.00 42.84 ? 102 PHE D CG    1 
ATOM   9176  C  CD1   . PHE D  1 121 ? -89.972  -21.511 -29.554  1.00 43.88 ? 102 PHE D CD1   1 
ATOM   9177  C  CD2   . PHE D  1 121 ? -88.505  -19.845 -28.727  1.00 43.40 ? 102 PHE D CD2   1 
ATOM   9178  C  CE1   . PHE D  1 121 ? -89.588  -22.386 -28.516  1.00 43.66 ? 102 PHE D CE1   1 
ATOM   9179  C  CE2   . PHE D  1 121 ? -88.107  -20.718 -27.694  1.00 43.96 ? 102 PHE D CE2   1 
ATOM   9180  C  CZ    . PHE D  1 121 ? -88.655  -21.972 -27.588  1.00 43.09 ? 102 PHE D CZ    1 
ATOM   9181  N  N     . LYS D  1 122 ? -90.426  -18.848 -33.697  1.00 45.21 ? 103 LYS D N     1 
ATOM   9182  C  CA    . LYS D  1 122 ? -90.974  -18.109 -34.798  1.00 47.27 ? 103 LYS D CA    1 
ATOM   9183  C  C     . LYS D  1 122 ? -92.193  -17.210 -34.399  1.00 47.65 ? 103 LYS D C     1 
ATOM   9184  O  O     . LYS D  1 122 ? -92.649  -17.193 -33.233  1.00 46.56 ? 103 LYS D O     1 
ATOM   9185  C  CB    . LYS D  1 122 ? -91.338  -19.106 -35.888  1.00 47.44 ? 103 LYS D CB    1 
ATOM   9186  C  CG    . LYS D  1 122 ? -90.213  -20.052 -36.271  1.00 48.21 ? 103 LYS D CG    1 
ATOM   9187  C  CD    . LYS D  1 122 ? -90.736  -21.270 -37.007  1.00 48.80 ? 103 LYS D CD    1 
ATOM   9188  C  CE    . LYS D  1 122 ? -91.024  -20.951 -38.476  1.00 51.85 ? 103 LYS D CE    1 
ATOM   9189  N  NZ    . LYS D  1 122 ? -91.471  -22.197 -39.200  1.00 51.34 ? 103 LYS D NZ    1 
ATOM   9190  N  N     . TYR D  1 123 ? -92.693  -16.454 -35.384  1.00 48.90 ? 104 TYR D N     1 
ATOM   9191  C  CA    . TYR D  1 123 ? -93.919  -15.603 -35.226  1.00 49.51 ? 104 TYR D CA    1 
ATOM   9192  C  C     . TYR D  1 123 ? -95.040  -16.338 -34.531  1.00 49.49 ? 104 TYR D C     1 
ATOM   9193  O  O     . TYR D  1 123 ? -95.700  -15.746 -33.693  1.00 49.96 ? 104 TYR D O     1 
ATOM   9194  C  CB    . TYR D  1 123 ? -94.431  -15.013 -36.563  1.00 50.30 ? 104 TYR D CB    1 
ATOM   9195  C  CG    . TYR D  1 123 ? -95.012  -16.033 -37.476  1.00 51.04 ? 104 TYR D CG    1 
ATOM   9196  C  CD1   . TYR D  1 123 ? -96.386  -16.135 -37.655  1.00 52.05 ? 104 TYR D CD1   1 
ATOM   9197  C  CD2   . TYR D  1 123 ? -94.189  -16.940 -38.144  1.00 52.41 ? 104 TYR D CD2   1 
ATOM   9198  C  CE1   . TYR D  1 123 ? -96.936  -17.128 -38.482  1.00 51.92 ? 104 TYR D CE1   1 
ATOM   9199  C  CE2   . TYR D  1 123 ? -94.723  -17.933 -38.985  1.00 53.10 ? 104 TYR D CE2   1 
ATOM   9200  C  CZ    . TYR D  1 123 ? -96.099  -18.023 -39.148  1.00 53.05 ? 104 TYR D CZ    1 
ATOM   9201  O  OH    . TYR D  1 123 ? -96.609  -19.001 -39.975  1.00 53.29 ? 104 TYR D OH    1 
ATOM   9202  N  N     . ASN D  1 124 ? -95.206  -17.626 -34.835  1.00 49.51 ? 105 ASN D N     1 
ATOM   9203  C  CA    . ASN D  1 124 ? -96.252  -18.463 -34.233  1.00 49.86 ? 105 ASN D CA    1 
ATOM   9204  C  C     . ASN D  1 124 ? -95.854  -19.199 -32.940  1.00 50.20 ? 105 ASN D C     1 
ATOM   9205  O  O     . ASN D  1 124 ? -96.499  -20.161 -32.562  1.00 50.11 ? 105 ASN D O     1 
ATOM   9206  C  CB    . ASN D  1 124 ? -96.738  -19.485 -35.263  1.00 49.34 ? 105 ASN D CB    1 
ATOM   9207  C  CG    . ASN D  1 124 ? -95.661  -20.438 -35.668  1.00 49.76 ? 105 ASN D CG    1 
ATOM   9208  O  OD1   . ASN D  1 124 ? -94.621  -20.516 -35.009  1.00 50.73 ? 105 ASN D OD1   1 
ATOM   9209  N  ND2   . ASN D  1 124 ? -95.869  -21.146 -36.759  1.00 47.24 ? 105 ASN D ND2   1 
ATOM   9210  N  N     . ARG D  1 125 ? -94.782  -18.762 -32.282  1.00 51.06 ? 106 ARG D N     1 
ATOM   9211  C  CA    . ARG D  1 125 ? -94.313  -19.333 -30.993  1.00 51.31 ? 106 ARG D CA    1 
ATOM   9212  C  C     . ARG D  1 125 ? -93.654  -20.718 -31.094  1.00 50.14 ? 106 ARG D C     1 
ATOM   9213  O  O     . ARG D  1 125 ? -93.208  -21.269 -30.106  1.00 48.91 ? 106 ARG D O     1 
ATOM   9214  C  CB    . ARG D  1 125 ? -95.427  -19.285 -29.902  1.00 51.89 ? 106 ARG D CB    1 
ATOM   9215  C  CG    . ARG D  1 125 ? -95.764  -17.836 -29.443  1.00 53.66 ? 106 ARG D CG    1 
ATOM   9216  C  CD    . ARG D  1 125 ? -96.318  -17.681 -27.991  1.00 54.96 ? 106 ARG D CD    1 
ATOM   9217  N  NE    . ARG D  1 125 ? -95.663  -16.560 -27.255  1.00 56.99 ? 106 ARG D NE    1 
ATOM   9218  C  CZ    . ARG D  1 125 ? -94.422  -16.609 -26.706  1.00 60.17 ? 106 ARG D CZ    1 
ATOM   9219  N  NH1   . ARG D  1 125 ? -93.651  -17.726 -26.772  1.00 59.21 ? 106 ARG D NH1   1 
ATOM   9220  N  NH2   . ARG D  1 125 ? -93.914  -15.525 -26.078  1.00 60.43 ? 106 ARG D NH2   1 
ATOM   9221  N  N     . ARG D  1 126 ? -93.542  -21.256 -32.295  1.00 50.08 ? 107 ARG D N     1 
ATOM   9222  C  CA    . ARG D  1 126 ? -92.854  -22.545 -32.499  1.00 50.55 ? 107 ARG D CA    1 
ATOM   9223  C  C     . ARG D  1 126 ? -91.325  -22.442 -32.710  1.00 48.97 ? 107 ARG D C     1 
ATOM   9224  O  O     . ARG D  1 126 ? -90.823  -21.457 -33.259  1.00 48.31 ? 107 ARG D O     1 
ATOM   9225  C  CB    . ARG D  1 126 ? -93.474  -23.267 -33.699  1.00 51.14 ? 107 ARG D CB    1 
ATOM   9226  C  CG    . ARG D  1 126 ? -94.948  -23.491 -33.542  1.00 52.94 ? 107 ARG D CG    1 
ATOM   9227  C  CD    . ARG D  1 126 ? -95.496  -24.457 -34.550  1.00 55.50 ? 107 ARG D CD    1 
ATOM   9228  N  NE    . ARG D  1 126 ? -96.924  -24.640 -34.243  1.00 62.76 ? 107 ARG D NE    1 
ATOM   9229  C  CZ    . ARG D  1 126 ? -97.775  -25.441 -34.894  1.00 64.51 ? 107 ARG D CZ    1 
ATOM   9230  N  NH1   . ARG D  1 126 ? -97.370  -26.170 -35.940  1.00 67.36 ? 107 ARG D NH1   1 
ATOM   9231  N  NH2   . ARG D  1 126 ? -99.040  -25.514 -34.491  1.00 63.47 ? 107 ARG D NH2   1 
ATOM   9232  N  N     . PRO D  1 127 ? -90.585  -23.477 -32.301  1.00 47.79 ? 108 PRO D N     1 
ATOM   9233  C  CA    . PRO D  1 127 ? -89.129  -23.430 -32.400  1.00 47.44 ? 108 PRO D CA    1 
ATOM   9234  C  C     . PRO D  1 127 ? -88.653  -23.151 -33.818  1.00 46.65 ? 108 PRO D C     1 
ATOM   9235  O  O     . PRO D  1 127 ? -89.205  -23.742 -34.754  1.00 46.64 ? 108 PRO D O     1 
ATOM   9236  C  CB    . PRO D  1 127 ? -88.704  -24.847 -31.992  1.00 47.26 ? 108 PRO D CB    1 
ATOM   9237  C  CG    . PRO D  1 127 ? -89.818  -25.378 -31.243  1.00 47.49 ? 108 PRO D CG    1 
ATOM   9238  C  CD    . PRO D  1 127 ? -91.052  -24.754 -31.752  1.00 47.24 ? 108 PRO D CD    1 
ATOM   9239  N  N     . ALA D  1 128 ? -87.662  -22.262 -33.988  1.00 45.91 ? 109 ALA D N     1 
ATOM   9240  C  CA    . ALA D  1 128 ? -87.081  -22.006 -35.343  1.00 45.38 ? 109 ALA D CA    1 
ATOM   9241  C  C     . ALA D  1 128 ? -86.473  -23.299 -35.909  1.00 44.50 ? 109 ALA D C     1 
ATOM   9242  O  O     . ALA D  1 128 ? -86.121  -24.188 -35.162  1.00 44.09 ? 109 ALA D O     1 
ATOM   9243  C  CB    . ALA D  1 128 ? -86.038  -20.879 -35.322  1.00 44.70 ? 109 ALA D CB    1 
ATOM   9244  N  N     . GLU D  1 129 ? -86.369  -23.380 -37.228  1.00 44.01 ? 110 GLU D N     1 
ATOM   9245  C  CA    . GLU D  1 129 ? -85.830  -24.543 -37.909  1.00 43.97 ? 110 GLU D CA    1 
ATOM   9246  C  C     . GLU D  1 129 ? -84.452  -24.921 -37.381  1.00 43.38 ? 110 GLU D C     1 
ATOM   9247  O  O     . GLU D  1 129 ? -84.142  -26.106 -37.291  1.00 43.27 ? 110 GLU D O     1 
ATOM   9248  C  CB    . GLU D  1 129 ? -85.751  -24.309 -39.428  1.00 44.79 ? 110 GLU D CB    1 
ATOM   9249  C  CG    . GLU D  1 129 ? -87.090  -24.301 -40.183  1.00 47.58 ? 110 GLU D CG    1 
ATOM   9250  C  CD    . GLU D  1 129 ? -88.018  -23.057 -39.881  1.00 53.01 ? 110 GLU D CD    1 
ATOM   9251  O  OE1   . GLU D  1 129 ? -87.509  -22.072 -39.266  1.00 54.68 ? 110 GLU D OE1   1 
ATOM   9252  O  OE2   . GLU D  1 129 ? -89.256  -23.074 -40.258  1.00 50.94 ? 110 GLU D OE2   1 
ATOM   9253  N  N     . THR D  1 130 ? -83.620  -23.925 -37.049  1.00 42.46 ? 111 THR D N     1 
ATOM   9254  C  CA    . THR D  1 130 ? -82.295  -24.201 -36.490  1.00 41.80 ? 111 THR D CA    1 
ATOM   9255  C  C     . THR D  1 130 ? -82.305  -24.164 -34.942  1.00 41.27 ? 111 THR D C     1 
ATOM   9256  O  O     . THR D  1 130 ? -81.249  -24.100 -34.333  1.00 40.79 ? 111 THR D O     1 
ATOM   9257  C  CB    . THR D  1 130 ? -81.172  -23.260 -37.053  1.00 41.46 ? 111 THR D CB    1 
ATOM   9258  O  OG1   . THR D  1 130 ? -81.391  -21.908 -36.607  1.00 42.39 ? 111 THR D OG1   1 
ATOM   9259  C  CG2   . THR D  1 130 ? -81.132  -23.292 -38.554  1.00 38.64 ? 111 THR D CG2   1 
ATOM   9260  N  N     . ASN D  1 131 ? -83.484  -24.234 -34.311  1.00 40.56 ? 112 ASN D N     1 
ATOM   9261  C  CA    . ASN D  1 131 ? -83.566  -24.424 -32.853  1.00 40.31 ? 112 ASN D CA    1 
ATOM   9262  C  C     . ASN D  1 131 ? -83.551  -25.913 -32.491  1.00 39.96 ? 112 ASN D C     1 
ATOM   9263  O  O     . ASN D  1 131 ? -84.585  -26.544 -32.386  1.00 40.13 ? 112 ASN D O     1 
ATOM   9264  C  CB    . ASN D  1 131 ? -84.797  -23.746 -32.249  1.00 39.89 ? 112 ASN D CB    1 
ATOM   9265  C  CG    . ASN D  1 131 ? -84.858  -23.906 -30.730  1.00 39.64 ? 112 ASN D CG    1 
ATOM   9266  O  OD1   . ASN D  1 131 ? -84.127  -24.714 -30.137  1.00 38.05 ? 112 ASN D OD1   1 
ATOM   9267  N  ND2   . ASN D  1 131 ? -85.708  -23.122 -30.095  1.00 36.55 ? 112 ASN D ND2   1 
ATOM   9268  N  N     . LEU D  1 132 ? -82.356  -26.464 -32.302  1.00 40.10 ? 113 LEU D N     1 
ATOM   9269  C  CA    . LEU D  1 132 ? -82.201  -27.868 -32.040  1.00 39.87 ? 113 LEU D CA    1 
ATOM   9270  C  C     . LEU D  1 132 ? -82.083  -28.132 -30.548  1.00 40.18 ? 113 LEU D C     1 
ATOM   9271  O  O     . LEU D  1 132 ? -82.105  -29.287 -30.105  1.00 40.38 ? 113 LEU D O     1 
ATOM   9272  C  CB    . LEU D  1 132 ? -80.994  -28.388 -32.767  1.00 39.84 ? 113 LEU D CB    1 
ATOM