data_2QCB
# 
_entry.id   2QCB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QCB         
RCSB  RCSB043419   
WWPDB D_1000043419 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2BC3 
_pdbx_database_related.details        't7-tagged full-length streptavidin with no ligand' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2QCB 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Le Trong, I.'   1 
'Creus, M.'      2 
'Pordea, A.'     3 
'Ward, T.R.'     4 
'Stenkamp, R.E.' 5 
# 
_citation.id                        primary 
_citation.title                     'X-ray structure and designed evolution of an artificial transfer hydrogenase' 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            47 
_citation.page_first                1400 
_citation.page_last                 1404 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1433-7851 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18176932 
_citation.pdbx_database_id_DOI      10.1002/anie.200704865 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Creus, M.'      1 
primary 'Pordea, A.'     2 
primary 'Rossel, T.'     3 
primary 'Sardo, A.'      4 
primary 'Letondor, C.'   5 
primary 'Ivanova, A.'    6 
primary 'Letrong, I.'    7 
primary 'Stenkamp, R.E.' 8 
primary 'Ward, T.R.'     9 
# 
_cell.length_a           57.651 
_cell.length_b           57.651 
_cell.length_c           183.823 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2QCB 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.entry_id                         2QCB 
_symmetry.Int_Tables_number                98 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Streptavidin 16612.119 1   ? S112K ? ? 
2 non-polymer syn 
;N-(4-{[(2-AMINOETHYL)AMINO]SULFONYL}PHENYL)-5-[(3AS,4S,6AR)-2-OXOHEXAHYDRO-1H-THIENO[3,4-D]IMIDAZOL-4-YL]PENTANAMIDE-(1,2,3,4,5,6-ETA)-BENZENE-CHLORO-RUTHENIUM(III)
;
654.187   1   ? ?     ? ? 
3 water       nat water 18.015    112 ? ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK
NNYRNAHSATTWSGQYVGGAEARINTQWLLTKGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK
NNYRNAHSATTWSGQYVGGAEARINTQWLLTKGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   MET n 
1 5   THR n 
1 6   GLY n 
1 7   GLY n 
1 8   GLN n 
1 9   GLN n 
1 10  MET n 
1 11  GLY n 
1 12  ARG n 
1 13  ASP n 
1 14  GLU n 
1 15  ALA n 
1 16  GLY n 
1 17  ILE n 
1 18  THR n 
1 19  GLY n 
1 20  THR n 
1 21  TRP n 
1 22  TYR n 
1 23  ASN n 
1 24  GLN n 
1 25  LEU n 
1 26  GLY n 
1 27  SER n 
1 28  THR n 
1 29  PHE n 
1 30  ILE n 
1 31  VAL n 
1 32  THR n 
1 33  ALA n 
1 34  GLY n 
1 35  ALA n 
1 36  ASP n 
1 37  GLY n 
1 38  ALA n 
1 39  LEU n 
1 40  THR n 
1 41  GLY n 
1 42  THR n 
1 43  TYR n 
1 44  GLU n 
1 45  SER n 
1 46  ALA n 
1 47  VAL n 
1 48  GLY n 
1 49  ASN n 
1 50  ALA n 
1 51  GLU n 
1 52  SER n 
1 53  ARG n 
1 54  TYR n 
1 55  VAL n 
1 56  LEU n 
1 57  THR n 
1 58  GLY n 
1 59  ARG n 
1 60  TYR n 
1 61  ASP n 
1 62  SER n 
1 63  ALA n 
1 64  PRO n 
1 65  ALA n 
1 66  THR n 
1 67  ASP n 
1 68  GLY n 
1 69  SER n 
1 70  GLY n 
1 71  THR n 
1 72  ALA n 
1 73  LEU n 
1 74  GLY n 
1 75  TRP n 
1 76  THR n 
1 77  VAL n 
1 78  ALA n 
1 79  TRP n 
1 80  LYS n 
1 81  ASN n 
1 82  ASN n 
1 83  TYR n 
1 84  ARG n 
1 85  ASN n 
1 86  ALA n 
1 87  HIS n 
1 88  SER n 
1 89  ALA n 
1 90  THR n 
1 91  THR n 
1 92  TRP n 
1 93  SER n 
1 94  GLY n 
1 95  GLN n 
1 96  TYR n 
1 97  VAL n 
1 98  GLY n 
1 99  GLY n 
1 100 ALA n 
1 101 GLU n 
1 102 ALA n 
1 103 ARG n 
1 104 ILE n 
1 105 ASN n 
1 106 THR n 
1 107 GLN n 
1 108 TRP n 
1 109 LEU n 
1 110 LEU n 
1 111 THR n 
1 112 LYS n 
1 113 GLY n 
1 114 THR n 
1 115 THR n 
1 116 GLU n 
1 117 ALA n 
1 118 ASN n 
1 119 ALA n 
1 120 TRP n 
1 121 LYS n 
1 122 SER n 
1 123 THR n 
1 124 LEU n 
1 125 VAL n 
1 126 GLY n 
1 127 HIS n 
1 128 ASP n 
1 129 THR n 
1 130 PHE n 
1 131 THR n 
1 132 LYS n 
1 133 VAL n 
1 134 LYS n 
1 135 PRO n 
1 136 SER n 
1 137 ALA n 
1 138 ALA n 
1 139 SER n 
1 140 ILE n 
1 141 ASP n 
1 142 ALA n 
1 143 ALA n 
1 144 LYS n 
1 145 LYS n 
1 146 ALA n 
1 147 GLY n 
1 148 VAL n 
1 149 ASN n 
1 150 ASN n 
1 151 GLY n 
1 152 ASN n 
1 153 PRO n 
1 154 LEU n 
1 155 ASP n 
1 156 ALA n 
1 157 VAL n 
1 158 GLN n 
1 159 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Streptomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces avidinii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1895 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       Pet11B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAV_STRAV 
_struct_ref.pdbx_db_accession          P22629 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWS
GQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
;
_struct_ref.pdbx_align_begin           38 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2QCB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 159 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P22629 
_struct_ref_seq.db_align_beg                  38 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  183 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       14 
_struct_ref_seq.pdbx_auth_seq_align_end       159 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2QCB MET A 1   ? UNP P22629 ?   ?   T7-TAG     1   1  
1 2QCB ALA A 2   ? UNP P22629 ?   ?   T7-TAG     2   2  
1 2QCB SER A 3   ? UNP P22629 ?   ?   T7-TAG     3   3  
1 2QCB MET A 4   ? UNP P22629 ?   ?   T7-TAG     4   4  
1 2QCB THR A 5   ? UNP P22629 ?   ?   T7-TAG     5   5  
1 2QCB GLY A 6   ? UNP P22629 ?   ?   T7-TAG     6   6  
1 2QCB GLY A 7   ? UNP P22629 ?   ?   T7-TAG     7   7  
1 2QCB GLN A 8   ? UNP P22629 ?   ?   T7-TAG     8   8  
1 2QCB GLN A 9   ? UNP P22629 ?   ?   T7-TAG     9   9  
1 2QCB MET A 10  ? UNP P22629 ?   ?   T7-TAG     10  10 
1 2QCB GLY A 11  ? UNP P22629 ?   ?   T7-TAG     11  11 
1 2QCB ARG A 12  ? UNP P22629 ?   ?   T7-TAG     12  12 
1 2QCB ASP A 13  ? UNP P22629 ?   ?   T7-TAG     13  13 
1 2QCB LYS A 112 ? UNP P22629 SER 136 ENGINEERED 112 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'             89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'         175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'            132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'             133.103 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'           146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'             147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'             75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'         156.162 
HOH non-polymer         . WATER ? 'H2 O'                   18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'            131.173 
KYS non-polymer         . 
;N-(4-{[(2-AMINOETHYL)AMINO]SULFONYL}PHENYL)-5-[(3AS,4S,6AR)-2-OXOHEXAHYDRO-1H-THIENO[3,4-D]IMIDAZOL-4-YL]PENTANAMIDE-(1,2,3,4,5,6-ETA)-BENZENE-CHLORO-RUTHENIUM(III)
;
? 'C24 H31 Cl N5 O4 Ru S2' 654.187 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'            131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'         147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'          149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'            165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'             115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'             105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'             119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'          204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'            181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'            117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2QCB 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;protein, 26 mg/ml in water. 
4-5x molar excess of ligand. 
reservoir, 1.0 M sodium citrate, 0.1 M cacodylate buffer, pH 6.5 , VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-05-15 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2QCB 
_reflns.d_resolution_high            1.530 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   21478 
_reflns.pdbx_Rmerge_I_obs            0.034 
_reflns.pdbx_chi_squared             1.069 
_reflns.pdbx_redundancy              10.700 
_reflns.percent_possible_obs         89.300 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   21478 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        63.4 
_reflns.B_iso_Wilson_estimate        23.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.53 
_reflns_shell.d_res_low              1.58 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.256 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.069 
_reflns_shell.pdbx_redundancy        2.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      650 
_reflns_shell.percent_possible_all   27.80 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2QCB 
_refine.ls_d_res_high                            1.650 
_refine.ls_d_res_low                             19.900 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.080 
_refine.ls_number_reflns_obs                     19020 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.169 
_refine.ls_R_factor_R_work                       0.168 
_refine.ls_R_factor_R_free                       0.187 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  970 
_refine.B_iso_mean                               14.954 
_refine.aniso_B[1][1]                            -0.030 
_refine.aniso_B[2][2]                            -0.030 
_refine.aniso_B[3][3]                            0.050 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.958 
_refine.pdbx_overall_ESU_R                       0.103 
_refine.pdbx_overall_ESU_R_Free                  0.077 
_refine.overall_SU_ML                            0.042 
_refine.overall_SU_B                             2.651 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     19020 
_refine.ls_R_factor_all                          0.169 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        916 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               1065 
_refine_hist.d_res_high                       1.650 
_refine_hist.d_res_low                        19.900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1009 0.009  0.021  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           616  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1417 1.574  1.985  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1495 2.009  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   121  6.372  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   42   29.918 23.810 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   134  12.490 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    11.947 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           150  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1129 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       216  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            163  0.206  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              607  0.209  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          475  0.190  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            502  0.091  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    62   0.147  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   21   0.217  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     32   0.227  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 19   0.152  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              758  1.242  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           258  0.319  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             944  1.497  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              529  2.089  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             440  2.492  4.500  ? 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       2150 2.376  3.000  ? 'X-RAY DIFFRACTION' ? 
r_sphericity_free        112  4.772  3.000  ? 'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      1593 2.043  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.650 
_refine_ls_shell.d_res_low                        1.693 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               90.620 
_refine_ls_shell.number_reflns_R_work             1173 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.247 
_refine_ls_shell.R_factor_R_free                  0.296 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1237 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2QCB 
_struct.title                     'T7-tagged full-length streptavidin complexed with ruthenium ligand' 
_struct.pdbx_descriptor           Streptavidin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QCB 
_struct_keywords.pdbx_keywords   'BIOTIN BINDING PROTEIN' 
_struct_keywords.text            'streptavidin, t7-tag, artificial transfer hydrogenase, BIOTIN BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The biological assembly is a tetramer generated by the deposited chain and three additional subunits generated by application of these crystallographic symmetry operations: 1-x,1-y,z; y,x,-z; 1-y,1-x,-z.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 13  ? THR A 18  ? ASP A 13  THR A 18  1 ? 6 
HELX_P HELX_P2 2 THR A 115 ? LYS A 121 ? THR A 115 LYS A 121 5 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   9 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 19  ? ASN A 23  ? GLY A 19  ASN A 23  
A 2 THR A 28  ? ALA A 33  ? THR A 28  ALA A 33  
A 3 ALA A 38  ? GLU A 44  ? ALA A 38  GLU A 44  
A 4 TYR A 54  ? TYR A 60  ? TYR A 54  TYR A 60  
A 5 THR A 71  ? LYS A 80  ? THR A 71  LYS A 80  
A 6 ASN A 85  ? VAL A 97  ? ASN A 85  VAL A 97  
A 7 ARG A 103 ? LYS A 112 ? ARG A 103 LYS A 112 
A 8 THR A 123 ? THR A 131 ? THR A 123 THR A 131 
A 9 GLY A 19  ? ASN A 23  ? GLY A 19  ASN A 23  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 21  ? N TRP A 21  O PHE A 29  ? O PHE A 29  
A 2 3 N THR A 32  ? N THR A 32  O THR A 40  ? O THR A 40  
A 3 4 N LEU A 39  ? N LEU A 39  O GLY A 58  ? O GLY A 58  
A 4 5 N THR A 57  ? N THR A 57  O THR A 76  ? O THR A 76  
A 5 6 N TRP A 79  ? N TRP A 79  O SER A 88  ? O SER A 88  
A 6 7 N VAL A 97  ? N VAL A 97  O ARG A 103 ? O ARG A 103 
A 7 8 N LEU A 110 ? N LEU A 110 O LEU A 124 ? O LEU A 124 
A 8 9 O THR A 131 ? O THR A 131 N TYR A 22  ? N TYR A 22  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    23 
_struct_site.details              'BINDING SITE FOR RESIDUE KYS A 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASN A 23  ? ASN A 23  . ? 1_555  ? 
2  AC1 23 LEU A 25  ? LEU A 25  . ? 1_555  ? 
3  AC1 23 SER A 27  ? SER A 27  . ? 1_555  ? 
4  AC1 23 TYR A 43  ? TYR A 43  . ? 1_555  ? 
5  AC1 23 SER A 45  ? SER A 45  . ? 1_555  ? 
6  AC1 23 GLY A 48  ? GLY A 48  . ? 1_555  ? 
7  AC1 23 ASN A 49  ? ASN A 49  . ? 1_555  ? 
8  AC1 23 TRP A 79  ? TRP A 79  . ? 1_555  ? 
9  AC1 23 SER A 88  ? SER A 88  . ? 1_555  ? 
10 AC1 23 THR A 90  ? THR A 90  . ? 1_555  ? 
11 AC1 23 TRP A 92  ? TRP A 92  . ? 1_555  ? 
12 AC1 23 TRP A 108 ? TRP A 108 . ? 1_555  ? 
13 AC1 23 LEU A 110 ? LEU A 110 . ? 1_555  ? 
14 AC1 23 LYS A 112 ? LYS A 112 . ? 1_555  ? 
15 AC1 23 TRP A 120 ? TRP A 120 . ? 10_665 ? 
16 AC1 23 LYS A 121 ? LYS A 121 . ? 10_665 ? 
17 AC1 23 LEU A 124 ? LEU A 124 . ? 1_555  ? 
18 AC1 23 ASP A 128 ? ASP A 128 . ? 1_555  ? 
19 AC1 23 HOH C .   ? HOH A 470 . ? 1_555  ? 
20 AC1 23 HOH C .   ? HOH A 505 . ? 10_665 ? 
21 AC1 23 HOH C .   ? HOH A 506 . ? 10_665 ? 
22 AC1 23 HOH C .   ? HOH A 509 . ? 10_665 ? 
23 AC1 23 HOH C .   ? HOH A 510 . ? 1_555  ? 
# 
_atom_sites.entry_id                    2QCB 
_atom_sites.fract_transf_matrix[1][1]   0.017346 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017346 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005440 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 13  ? 5.211  23.181 12.837  1.00 31.67 ? 13  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 13  ? 4.923  24.127 11.709  1.00 31.06 ? 13  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 13  ? 4.491  23.390 10.461  1.00 30.94 ? 13  ASP A C   1 
ATOM   4    O  O   . ASP A 1 13  ? 4.707  23.871 9.344   1.00 30.87 ? 13  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 13  ? 6.159  24.958 11.368  1.00 31.38 ? 13  ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 13  ? 6.786  25.584 12.580  1.00 31.58 ? 13  ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 13  ? 6.136  26.434 13.233  1.00 32.45 ? 13  ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 13  ? 7.926  25.210 12.887  1.00 30.98 ? 13  ASP A OD2 1 
ATOM   9    N  N   . GLU A 1 14  ? 3.884  22.221 10.641  1.00 30.71 ? 14  GLU A N   1 
ATOM   10   C  CA  . GLU A 1 14  ? 3.406  21.438 9.513   1.00 30.20 ? 14  GLU A CA  1 
ATOM   11   C  C   . GLU A 1 14  ? 2.477  22.292 8.635   1.00 29.32 ? 14  GLU A C   1 
ATOM   12   O  O   . GLU A 1 14  ? 2.706  22.438 7.428   1.00 28.44 ? 14  GLU A O   1 
ATOM   13   C  CB  . GLU A 1 14  ? 2.697  20.179 10.018  1.00 30.59 ? 14  GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 14  ? 2.424  19.173 8.947   1.00 31.36 ? 14  GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 14  ? 1.742  17.923 9.466   1.00 32.40 ? 14  GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 14  ? 0.964  17.320 8.694   1.00 36.02 ? 14  GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 14  ? 1.975  17.547 10.641  1.00 34.87 ? 14  GLU A OE2 1 
ATOM   18   N  N   . ALA A 1 15  ? 1.449  22.883 9.251   1.00 28.24 ? 15  ALA A N   1 
ATOM   19   C  CA  . ALA A 1 15  ? 0.517  23.754 8.527   1.00 27.35 ? 15  ALA A CA  1 
ATOM   20   C  C   . ALA A 1 15  ? 1.173  25.054 8.032   1.00 26.54 ? 15  ALA A C   1 
ATOM   21   O  O   . ALA A 1 15  ? 0.847  25.549 6.936   1.00 26.96 ? 15  ALA A O   1 
ATOM   22   C  CB  . ALA A 1 15  ? -0.699 24.064 9.410   1.00 27.85 ? 15  ALA A CB  1 
ATOM   23   N  N   . GLY A 1 16  ? 2.100  25.598 8.823   1.00 24.68 ? 16  GLY A N   1 
ATOM   24   C  CA  . GLY A 1 16  ? 2.804  26.819 8.444   1.00 23.57 ? 16  GLY A CA  1 
ATOM   25   C  C   . GLY A 1 16  ? 3.603  26.660 7.154   1.00 22.28 ? 16  GLY A C   1 
ATOM   26   O  O   . GLY A 1 16  ? 3.606  27.550 6.291   1.00 22.02 ? 16  GLY A O   1 
ATOM   27   N  N   . ILE A 1 17  ? 4.271  25.519 7.019   1.00 20.63 ? 17  ILE A N   1 
ATOM   28   C  CA  . ILE A 1 17  ? 5.144  25.272 5.864   1.00 20.10 ? 17  ILE A CA  1 
ATOM   29   C  C   . ILE A 1 17  ? 4.377  24.767 4.650   1.00 19.47 ? 17  ILE A C   1 
ATOM   30   O  O   . ILE A 1 17  ? 4.669  25.150 3.518   1.00 19.00 ? 17  ILE A O   1 
ATOM   31   C  CB  . ILE A 1 17  ? 6.251  24.249 6.214   1.00 20.01 ? 17  ILE A CB  1 
ATOM   32   C  CG1 . ILE A 1 17  ? 7.188  24.849 7.261   1.00 20.44 ? 17  ILE A CG1 1 
ATOM   33   C  CG2 . ILE A 1 17  ? 7.025  23.832 4.961   1.00 19.81 ? 17  ILE A CG2 1 
ATOM   34   C  CD1 . ILE A 1 17  ? 8.098  23.821 7.920   1.00 20.23 ? 17  ILE A CD1 1 
ATOM   35   N  N   . THR A 1 18  ? 3.399  23.898 4.873   1.00 19.17 ? 18  THR A N   1 
ATOM   36   C  CA  . THR A 1 18  ? 2.650  23.307 3.759   1.00 19.60 ? 18  THR A CA  1 
ATOM   37   C  C   . THR A 1 18  ? 1.943  24.371 2.920   1.00 19.42 ? 18  THR A C   1 
ATOM   38   O  O   . THR A 1 18  ? 1.266  25.244 3.458   1.00 19.85 ? 18  THR A O   1 
ATOM   39   C  CB  . THR A 1 18  ? 1.609  22.295 4.266   1.00 19.72 ? 18  THR A CB  1 
ATOM   40   O  OG1 . THR A 1 18  ? 2.280  21.170 4.841   1.00 19.95 ? 18  THR A OG1 1 
ATOM   41   C  CG2 . THR A 1 18  ? 0.691  21.836 3.125   1.00 19.37 ? 18  THR A CG2 1 
ATOM   42   N  N   . GLY A 1 19  ? 2.112  24.285 1.601   1.00 18.91 ? 19  GLY A N   1 
ATOM   43   C  CA  . GLY A 1 19  ? 1.459  25.203 0.686   1.00 19.29 ? 19  GLY A CA  1 
ATOM   44   C  C   . GLY A 1 19  ? 2.349  25.605 -0.461  1.00 19.20 ? 19  GLY A C   1 
ATOM   45   O  O   . GLY A 1 19  ? 3.353  24.930 -0.766  1.00 19.12 ? 19  GLY A O   1 
ATOM   46   N  N   . THR A 1 20  ? 1.984  26.731 -1.064  1.00 19.53 ? 20  THR A N   1 
ATOM   47   C  CA  . THR A 1 20  ? 2.649  27.270 -2.238  1.00 19.00 ? 20  THR A CA  1 
ATOM   48   C  C   . THR A 1 20  ? 3.424  28.509 -1.833  1.00 19.46 ? 20  THR A C   1 
ATOM   49   O  O   . THR A 1 20  ? 2.900  29.404 -1.150  1.00 19.84 ? 20  THR A O   1 
ATOM   50   C  CB  . THR A 1 20  ? 1.638  27.642 -3.346  1.00 19.38 ? 20  THR A CB  1 
ATOM   51   O  OG1 . THR A 1 20  ? 0.873  26.484 -3.694  1.00 19.35 ? 20  THR A OG1 1 
ATOM   52   C  CG2 . THR A 1 20  ? 2.346  28.167 -4.589  1.00 19.37 ? 20  THR A CG2 1 
ATOM   53   N  N   . TRP A 1 21  ? 4.691  28.537 -2.240  1.00 18.30 ? 21  TRP A N   1 
ATOM   54   C  CA  . TRP A 1 21  ? 5.595  29.628 -1.931  1.00 17.88 ? 21  TRP A CA  1 
ATOM   55   C  C   . TRP A 1 21  ? 6.216  30.147 -3.211  1.00 17.31 ? 21  TRP A C   1 
ATOM   56   O  O   . TRP A 1 21  ? 6.373  29.408 -4.165  1.00 16.72 ? 21  TRP A O   1 
ATOM   57   C  CB  . TRP A 1 21  ? 6.717  29.147 -1.020  1.00 17.71 ? 21  TRP A CB  1 
ATOM   58   C  CG  . TRP A 1 21  ? 6.286  28.677 0.332   1.00 17.02 ? 21  TRP A CG  1 
ATOM   59   C  CD1 . TRP A 1 21  ? 5.829  27.439 0.663   1.00 17.19 ? 21  TRP A CD1 1 
ATOM   60   C  CD2 . TRP A 1 21  ? 6.322  29.430 1.546   1.00 16.70 ? 21  TRP A CD2 1 
ATOM   61   N  NE1 . TRP A 1 21  ? 5.568  27.372 2.008   1.00 16.49 ? 21  TRP A NE1 1 
ATOM   62   C  CE2 . TRP A 1 21  ? 5.855  28.583 2.576   1.00 16.77 ? 21  TRP A CE2 1 
ATOM   63   C  CE3 . TRP A 1 21  ? 6.679  30.744 1.860   1.00 17.16 ? 21  TRP A CE3 1 
ATOM   64   C  CZ2 . TRP A 1 21  ? 5.752  29.003 3.902   1.00 17.43 ? 21  TRP A CZ2 1 
ATOM   65   C  CZ3 . TRP A 1 21  ? 6.586  31.157 3.181   1.00 16.96 ? 21  TRP A CZ3 1 
ATOM   66   C  CH2 . TRP A 1 21  ? 6.113  30.292 4.182   1.00 17.36 ? 21  TRP A CH2 1 
ATOM   67   N  N   . TYR A 1 22  ? 6.588  31.421 -3.207  1.00 17.43 ? 22  TYR A N   1 
ATOM   68   C  CA  . TYR A 1 22  ? 7.190  32.059 -4.361  1.00 17.72 ? 22  TYR A CA  1 
ATOM   69   C  C   . TYR A 1 22  ? 8.469  32.777 -3.940  1.00 17.32 ? 22  TYR A C   1 
ATOM   70   O  O   . TYR A 1 22  ? 8.515  33.386 -2.870  1.00 16.66 ? 22  TYR A O   1 
ATOM   71   C  CB  . TYR A 1 22  ? 6.213  33.082 -4.958  1.00 19.12 ? 22  TYR A CB  1 
ATOM   72   C  CG  . TYR A 1 22  ? 4.800  32.541 -5.139  1.00 19.21 ? 22  TYR A CG  1 
ATOM   73   C  CD1 . TYR A 1 22  ? 4.453  31.836 -6.272  1.00 22.57 ? 22  TYR A CD1 1 
ATOM   74   C  CD2 . TYR A 1 22  ? 3.830  32.726 -4.152  1.00 19.84 ? 22  TYR A CD2 1 
ATOM   75   C  CE1 . TYR A 1 22  ? 3.173  31.337 -6.444  1.00 21.16 ? 22  TYR A CE1 1 
ATOM   76   C  CE2 . TYR A 1 22  ? 2.544  32.217 -4.303  1.00 19.92 ? 22  TYR A CE2 1 
ATOM   77   C  CZ  . TYR A 1 22  ? 2.224  31.529 -5.464  1.00 21.14 ? 22  TYR A CZ  1 
ATOM   78   O  OH  . TYR A 1 22  ? 0.944  31.019 -5.646  1.00 21.64 ? 22  TYR A OH  1 
ATOM   79   N  N   . ASN A 1 23  ? 9.515  32.694 -4.756  1.00 16.53 ? 23  ASN A N   1 
ATOM   80   C  CA  . ASN A 1 23  ? 10.743 33.430 -4.433  1.00 16.32 ? 23  ASN A CA  1 
ATOM   81   C  C   . ASN A 1 23  ? 10.871 34.718 -5.247  1.00 16.88 ? 23  ASN A C   1 
ATOM   82   O  O   . ASN A 1 23  ? 9.978  35.067 -6.044  1.00 17.33 ? 23  ASN A O   1 
ATOM   83   C  CB  . ASN A 1 23  ? 12.003 32.532 -4.505  1.00 16.08 ? 23  ASN A CB  1 
ATOM   84   C  CG  . ASN A 1 23  ? 12.418 32.177 -5.921  1.00 15.10 ? 23  ASN A CG  1 
ATOM   85   O  OD1 . ASN A 1 23  ? 11.893 32.718 -6.890  1.00 15.70 ? 23  ASN A OD1 1 
ATOM   86   N  ND2 . ASN A 1 23  ? 13.369 31.236 -6.047  1.00 14.98 ? 23  ASN A ND2 1 
ATOM   87   N  N   . GLN A 1 24  ? 11.971 35.425 -5.029  1.00 16.89 ? 24  GLN A N   1 
ATOM   88   C  CA  . GLN A 1 24  ? 12.208 36.719 -5.655  1.00 17.27 ? 24  GLN A CA  1 
ATOM   89   C  C   . GLN A 1 24  ? 12.336 36.679 -7.180  1.00 17.57 ? 24  GLN A C   1 
ATOM   90   O  O   . GLN A 1 24  ? 12.194 37.712 -7.843  1.00 18.89 ? 24  GLN A O   1 
ATOM   91   C  CB  . GLN A 1 24  ? 13.440 37.383 -5.030  1.00 17.31 ? 24  GLN A CB  1 
ATOM   92   C  CG  . GLN A 1 24  ? 14.796 36.818 -5.454  1.00 17.81 ? 24  GLN A CG  1 
ATOM   93   C  CD  . GLN A 1 24  ? 15.143 35.463 -4.831  1.00 17.45 ? 24  GLN A CD  1 
ATOM   94   O  OE1 . GLN A 1 24  ? 14.484 34.989 -3.893  1.00 16.57 ? 24  GLN A OE1 1 
ATOM   95   N  NE2 . GLN A 1 24  ? 16.188 34.836 -5.359  1.00 16.66 ? 24  GLN A NE2 1 
ATOM   96   N  N   . LEU A 1 25  ? 12.625 35.494 -7.710  1.00 17.10 ? 25  LEU A N   1 
ATOM   97   C  CA  . LEU A 1 25  ? 12.754 35.247 -9.143  1.00 17.61 ? 25  LEU A CA  1 
ATOM   98   C  C   . LEU A 1 25  ? 11.418 34.902 -9.794  1.00 18.11 ? 25  LEU A C   1 
ATOM   99   O  O   . LEU A 1 25  ? 11.338 34.826 -11.032 1.00 19.78 ? 25  LEU A O   1 
ATOM   100  C  CB  . LEU A 1 25  ? 13.718 34.079 -9.392  1.00 17.59 ? 25  LEU A CB  1 
ATOM   101  C  CG  . LEU A 1 25  ? 15.180 34.275 -8.953  1.00 18.06 ? 25  LEU A CG  1 
ATOM   102  C  CD1 . LEU A 1 25  ? 15.953 32.980 -9.081  1.00 18.83 ? 25  LEU A CD1 1 
ATOM   103  C  CD2 . LEU A 1 25  ? 15.840 35.384 -9.773  1.00 20.99 ? 25  LEU A CD2 1 
ATOM   104  N  N   . GLY A 1 26  ? 10.394 34.672 -8.978  1.00 18.27 ? 26  GLY A N   1 
ATOM   105  C  CA  . GLY A 1 26  ? 9.091  34.208 -9.471  1.00 18.12 ? 26  GLY A CA  1 
ATOM   106  C  C   . GLY A 1 26  ? 8.968  32.703 -9.618  1.00 18.41 ? 26  GLY A C   1 
ATOM   107  O  O   . GLY A 1 26  ? 8.024  32.210 -10.260 1.00 19.01 ? 26  GLY A O   1 
ATOM   108  N  N   . SER A 1 27  ? 9.911  31.956 -9.033  1.00 17.26 ? 27  SER A N   1 
ATOM   109  C  CA  . SER A 1 27  ? 9.803  30.501 -8.995  1.00 17.10 ? 27  SER A CA  1 
ATOM   110  C  C   . SER A 1 27  ? 8.735  30.070 -7.992  1.00 17.03 ? 27  SER A C   1 
ATOM   111  O  O   . SER A 1 27  ? 8.475  30.778 -7.027  1.00 16.21 ? 27  SER A O   1 
ATOM   112  C  CB  . SER A 1 27  ? 11.160 29.869 -8.654  1.00 17.15 ? 27  SER A CB  1 
ATOM   113  O  OG  . SER A 1 27  ? 12.138 30.257 -9.602  1.00 16.50 ? 27  SER A OG  1 
ATOM   114  N  N   . THR A 1 28  ? 8.146  28.898 -8.229  1.00 17.30 ? 28  THR A N   1 
ATOM   115  C  CA  . THR A 1 28  ? 7.042  28.354 -7.439  1.00 17.64 ? 28  THR A CA  1 
ATOM   116  C  C   . THR A 1 28  ? 7.463  27.061 -6.760  1.00 17.18 ? 28  THR A C   1 
ATOM   117  O  O   . THR A 1 28  ? 7.893  26.111 -7.426  1.00 17.94 ? 28  THR A O   1 
ATOM   118  C  CB  . THR A 1 28  ? 5.805  28.060 -8.326  1.00 17.66 ? 28  THR A CB  1 
ATOM   119  O  OG1 . THR A 1 28  ? 5.460  29.238 -9.074  1.00 20.79 ? 28  THR A OG1 1 
ATOM   120  C  CG2 . THR A 1 28  ? 4.591  27.630 -7.467  1.00 18.68 ? 28  THR A CG2 1 
ATOM   121  N  N   . PHE A 1 29  ? 7.326  27.048 -5.433  1.00 17.04 ? 29  PHE A N   1 
ATOM   122  C  CA  . PHE A 1 29  ? 7.744  25.970 -4.562  1.00 17.33 ? 29  PHE A CA  1 
ATOM   123  C  C   . PHE A 1 29  ? 6.472  25.473 -3.893  1.00 17.82 ? 29  PHE A C   1 
ATOM   124  O  O   . PHE A 1 29  ? 5.870  26.189 -3.103  1.00 17.83 ? 29  PHE A O   1 
ATOM   125  C  CB  . PHE A 1 29  ? 8.766  26.550 -3.558  1.00 17.21 ? 29  PHE A CB  1 
ATOM   126  C  CG  . PHE A 1 29  ? 9.105  25.665 -2.392  1.00 17.00 ? 29  PHE A CG  1 
ATOM   127  C  CD1 . PHE A 1 29  ? 9.407  24.318 -2.547  1.00 16.68 ? 29  PHE A CD1 1 
ATOM   128  C  CD2 . PHE A 1 29  ? 9.231  26.225 -1.124  1.00 17.37 ? 29  PHE A CD2 1 
ATOM   129  C  CE1 . PHE A 1 29  ? 9.765  23.537 -1.457  1.00 16.23 ? 29  PHE A CE1 1 
ATOM   130  C  CE2 . PHE A 1 29  ? 9.585  25.449 -0.034  1.00 16.85 ? 29  PHE A CE2 1 
ATOM   131  C  CZ  . PHE A 1 29  ? 9.864  24.107 -0.194  1.00 16.15 ? 29  PHE A CZ  1 
ATOM   132  N  N   . ILE A 1 30  ? 6.056  24.267 -4.267  1.00 17.91 ? 30  ILE A N   1 
ATOM   133  C  CA  . ILE A 1 30  ? 4.845  23.660 -3.753  1.00 18.78 ? 30  ILE A CA  1 
ATOM   134  C  C   . ILE A 1 30  ? 5.261  22.502 -2.862  1.00 18.62 ? 30  ILE A C   1 
ATOM   135  O  O   . ILE A 1 30  ? 5.932  21.572 -3.311  1.00 18.97 ? 30  ILE A O   1 
ATOM   136  C  CB  . ILE A 1 30  ? 3.939  23.197 -4.912  1.00 19.59 ? 30  ILE A CB  1 
ATOM   137  C  CG1 . ILE A 1 30  ? 3.419  24.420 -5.678  1.00 20.64 ? 30  ILE A CG1 1 
ATOM   138  C  CG2 . ILE A 1 30  ? 2.797  22.346 -4.367  1.00 19.89 ? 30  ILE A CG2 1 
ATOM   139  C  CD1 . ILE A 1 30  ? 2.637  24.075 -6.925  1.00 20.55 ? 30  ILE A CD1 1 
ATOM   140  N  N   . VAL A 1 31  ? 4.922  22.585 -1.582  1.00 18.52 ? 31  VAL A N   1 
ATOM   141  C  CA  . VAL A 1 31  ? 5.461  21.652 -0.613  1.00 18.64 ? 31  VAL A CA  1 
ATOM   142  C  C   . VAL A 1 31  ? 4.412  21.160 0.387   1.00 19.10 ? 31  VAL A C   1 
ATOM   143  O  O   . VAL A 1 31  ? 3.529  21.926 0.811   1.00 18.87 ? 31  VAL A O   1 
ATOM   144  C  CB  . VAL A 1 31  ? 6.657  22.301 0.140   1.00 18.62 ? 31  VAL A CB  1 
ATOM   145  C  CG1 . VAL A 1 31  ? 6.182  23.424 1.068   1.00 17.98 ? 31  VAL A CG1 1 
ATOM   146  C  CG2 . VAL A 1 31  ? 7.472  21.242 0.901   1.00 18.54 ? 31  VAL A CG2 1 
ATOM   147  N  N   . THR A 1 32  ? 4.533  19.881 0.756   1.00 19.32 ? 32  THR A N   1 
ATOM   148  C  CA  . THR A 1 32  ? 3.782  19.308 1.870   1.00 19.87 ? 32  THR A CA  1 
ATOM   149  C  C   . THR A 1 32  ? 4.760  18.891 2.953   1.00 19.70 ? 32  THR A C   1 
ATOM   150  O  O   . THR A 1 32  ? 5.696  18.125 2.685   1.00 18.77 ? 32  THR A O   1 
ATOM   151  C  CB  . THR A 1 32  ? 2.962  18.067 1.441   1.00 20.44 ? 32  THR A CB  1 
ATOM   152  O  OG1 . THR A 1 32  ? 2.005  18.435 0.437   1.00 23.43 ? 32  THR A OG1 1 
ATOM   153  C  CG2 . THR A 1 32  ? 2.228  17.466 2.634   1.00 21.10 ? 32  THR A CG2 1 
ATOM   154  N  N   . ALA A 1 33  ? 4.550  19.417 4.159   1.00 19.44 ? 33  ALA A N   1 
ATOM   155  C  CA  . ALA A 1 33  ? 5.319  19.025 5.338   1.00 20.23 ? 33  ALA A CA  1 
ATOM   156  C  C   . ALA A 1 33  ? 4.561  17.912 6.048   1.00 20.71 ? 33  ALA A C   1 
ATOM   157  O  O   . ALA A 1 33  ? 3.382  18.086 6.408   1.00 21.96 ? 33  ALA A O   1 
ATOM   158  C  CB  . ALA A 1 33  ? 5.544  20.218 6.271   1.00 19.66 ? 33  ALA A CB  1 
ATOM   159  N  N   . GLY A 1 34  ? 5.216  16.767 6.197   1.00 20.70 ? 34  GLY A N   1 
ATOM   160  C  CA  . GLY A 1 34  ? 4.663  15.616 6.911   1.00 21.32 ? 34  GLY A CA  1 
ATOM   161  C  C   . GLY A 1 34  ? 4.922  15.662 8.408   1.00 21.96 ? 34  GLY A C   1 
ATOM   162  O  O   . GLY A 1 34  ? 5.865  16.306 8.884   1.00 21.53 ? 34  GLY A O   1 
ATOM   163  N  N   . ALA A 1 35  ? 4.081  14.954 9.162   1.00 22.83 ? 35  ALA A N   1 
ATOM   164  C  CA  . ALA A 1 35  ? 4.197  14.884 10.617  1.00 23.66 ? 35  ALA A CA  1 
ATOM   165  C  C   . ALA A 1 35  ? 5.548  14.325 11.066  1.00 24.47 ? 35  ALA A C   1 
ATOM   166  O  O   . ALA A 1 35  ? 6.010  14.607 12.168  1.00 26.39 ? 35  ALA A O   1 
ATOM   167  C  CB  . ALA A 1 35  ? 3.066  14.015 11.179  1.00 24.11 ? 35  ALA A CB  1 
ATOM   168  N  N   . ASP A 1 36  ? 6.147  13.529 10.188  1.00 24.72 ? 36  ASP A N   1 
ATOM   169  C  CA  . ASP A 1 36  ? 7.396  12.819 10.430  1.00 24.52 ? 36  ASP A CA  1 
ATOM   170  C  C   . ASP A 1 36  ? 8.657  13.622 10.065  1.00 23.75 ? 36  ASP A C   1 
ATOM   171  O  O   . ASP A 1 36  ? 9.751  13.086 10.165  1.00 25.05 ? 36  ASP A O   1 
ATOM   172  C  CB  . ASP A 1 36  ? 7.386  11.508 9.616   1.00 25.48 ? 36  ASP A CB  1 
ATOM   173  C  CG  . ASP A 1 36  ? 7.331  11.741 8.091   1.00 27.05 ? 36  ASP A CG  1 
ATOM   174  O  OD1 . ASP A 1 36  ? 6.843  12.811 7.638   1.00 25.44 ? 36  ASP A OD1 1 
ATOM   175  O  OD2 . ASP A 1 36  ? 7.769  10.833 7.331   1.00 32.23 ? 36  ASP A OD2 1 
ATOM   176  N  N   . GLY A 1 37  ? 8.512  14.880 9.641   1.00 22.06 ? 37  GLY A N   1 
ATOM   177  C  CA  . GLY A 1 37  ? 9.661  15.687 9.218   1.00 20.91 ? 37  GLY A CA  1 
ATOM   178  C  C   . GLY A 1 37  ? 9.924  15.688 7.721   1.00 19.56 ? 37  GLY A C   1 
ATOM   179  O  O   . GLY A 1 37  ? 10.898 16.282 7.274   1.00 18.35 ? 37  GLY A O   1 
ATOM   180  N  N   . ALA A 1 38  ? 9.068  15.035 6.936   1.00 18.58 ? 38  ALA A N   1 
ATOM   181  C  CA  . ALA A 1 38  ? 9.292  14.943 5.486   1.00 18.59 ? 38  ALA A CA  1 
ATOM   182  C  C   . ALA A 1 38  ? 8.826  16.206 4.773   1.00 18.19 ? 38  ALA A C   1 
ATOM   183  O  O   . ALA A 1 38  ? 7.843  16.818 5.182   1.00 18.29 ? 38  ALA A O   1 
ATOM   184  C  CB  . ALA A 1 38  ? 8.557  13.739 4.912   1.00 19.65 ? 38  ALA A CB  1 
ATOM   185  N  N   . LEU A 1 39  ? 9.547  16.583 3.712   1.00 17.01 ? 39  LEU A N   1 
ATOM   186  C  CA  . LEU A 1 39  ? 9.069  17.559 2.737   1.00 16.68 ? 39  LEU A CA  1 
ATOM   187  C  C   . LEU A 1 39  ? 8.948  16.846 1.390   1.00 16.38 ? 39  LEU A C   1 
ATOM   188  O  O   . LEU A 1 39  ? 9.867  16.143 0.965   1.00 15.73 ? 39  LEU A O   1 
ATOM   189  C  CB  . LEU A 1 39  ? 10.001 18.771 2.612   1.00 16.43 ? 39  LEU A CB  1 
ATOM   190  C  CG  . LEU A 1 39  ? 10.262 19.618 3.858   1.00 16.11 ? 39  LEU A CG  1 
ATOM   191  C  CD1 . LEU A 1 39  ? 11.331 20.675 3.532   1.00 16.52 ? 39  LEU A CD1 1 
ATOM   192  C  CD2 . LEU A 1 39  ? 9.007  20.269 4.412   1.00 14.91 ? 39  LEU A CD2 1 
ATOM   193  N  N   . THR A 1 40  ? 7.799  17.013 0.741   1.00 16.49 ? 40  THR A N   1 
ATOM   194  C  CA  . THR A 1 40  ? 7.576  16.484 -0.617  1.00 16.42 ? 40  THR A CA  1 
ATOM   195  C  C   . THR A 1 40  ? 6.837  17.536 -1.426  1.00 16.99 ? 40  THR A C   1 
ATOM   196  O  O   . THR A 1 40  ? 6.041  18.298 -0.878  1.00 18.67 ? 40  THR A O   1 
ATOM   197  C  CB  . THR A 1 40  ? 6.715  15.187 -0.611  1.00 16.83 ? 40  THR A CB  1 
ATOM   198  O  OG1 A THR A 1 40  ? 5.615  15.451 0.264   0.50 15.10 ? 40  THR A OG1 1 
ATOM   199  O  OG1 B THR A 1 40  ? 6.757  14.555 0.672   0.50 16.25 ? 40  THR A OG1 1 
ATOM   200  C  CG2 A THR A 1 40  ? 7.449  13.985 -0.037  0.50 15.13 ? 40  THR A CG2 1 
ATOM   201  C  CG2 B THR A 1 40  ? 7.411  14.188 -1.495  0.50 17.91 ? 40  THR A CG2 1 
ATOM   202  N  N   . GLY A 1 41  ? 7.090  17.588 -2.731  1.00 16.47 ? 41  GLY A N   1 
ATOM   203  C  CA  . GLY A 1 41  ? 6.359  18.501 -3.575  1.00 16.49 ? 41  GLY A CA  1 
ATOM   204  C  C   . GLY A 1 41  ? 7.000  18.667 -4.929  1.00 16.14 ? 41  GLY A C   1 
ATOM   205  O  O   . GLY A 1 41  ? 7.657  17.752 -5.441  1.00 15.77 ? 41  GLY A O   1 
ATOM   206  N  N   . THR A 1 42  ? 6.830  19.857 -5.481  1.00 16.12 ? 42  THR A N   1 
ATOM   207  C  CA  . THR A 1 42  ? 7.356  20.184 -6.791  1.00 16.37 ? 42  THR A CA  1 
ATOM   208  C  C   . THR A 1 42  ? 7.923  21.595 -6.788  1.00 15.85 ? 42  THR A C   1 
ATOM   209  O  O   . THR A 1 42  ? 7.502  22.446 -5.989  1.00 16.14 ? 42  THR A O   1 
ATOM   210  C  CB  . THR A 1 42  ? 6.281  20.079 -7.886  1.00 16.73 ? 42  THR A CB  1 
ATOM   211  O  OG1 . THR A 1 42  ? 5.226  21.016 -7.630  1.00 17.42 ? 42  THR A OG1 1 
ATOM   212  C  CG2 . THR A 1 42  ? 5.725  18.651 -7.966  1.00 17.39 ? 42  THR A CG2 1 
ATOM   213  N  N   . TYR A 1 43  ? 8.853  21.823 -7.709  1.00 15.45 ? 43  TYR A N   1 
ATOM   214  C  CA  . TYR A 1 43  ? 9.512  23.109 -7.887  1.00 15.52 ? 43  TYR A CA  1 
ATOM   215  C  C   . TYR A 1 43  ? 9.434  23.470 -9.353  1.00 16.19 ? 43  TYR A C   1 
ATOM   216  O  O   . TYR A 1 43  ? 9.711  22.635 -10.211 1.00 16.03 ? 43  TYR A O   1 
ATOM   217  C  CB  . TYR A 1 43  ? 10.988 23.029 -7.478  1.00 15.30 ? 43  TYR A CB  1 
ATOM   218  C  CG  . TYR A 1 43  ? 11.582 24.380 -7.145  1.00 14.45 ? 43  TYR A CG  1 
ATOM   219  C  CD1 . TYR A 1 43  ? 12.108 25.192 -8.137  1.00 14.19 ? 43  TYR A CD1 1 
ATOM   220  C  CD2 . TYR A 1 43  ? 11.580 24.859 -5.832  1.00 14.18 ? 43  TYR A CD2 1 
ATOM   221  C  CE1 . TYR A 1 43  ? 12.643 26.446 -7.837  1.00 14.10 ? 43  TYR A CE1 1 
ATOM   222  C  CE2 . TYR A 1 43  ? 12.104 26.100 -5.524  1.00 14.08 ? 43  TYR A CE2 1 
ATOM   223  C  CZ  . TYR A 1 43  ? 12.640 26.887 -6.508  1.00 14.15 ? 43  TYR A CZ  1 
ATOM   224  O  OH  . TYR A 1 43  ? 13.148 28.118 -6.181  1.00 14.69 ? 43  TYR A OH  1 
ATOM   225  N  N   . GLU A 1 44  ? 9.093  24.725 -9.621  1.00 16.62 ? 44  GLU A N   1 
ATOM   226  C  CA  . GLU A 1 44  ? 9.089  25.270 -10.971 1.00 17.04 ? 44  GLU A CA  1 
ATOM   227  C  C   . GLU A 1 44  ? 9.965  26.510 -10.945 1.00 16.54 ? 44  GLU A C   1 
ATOM   228  O  O   . GLU A 1 44  ? 9.663  27.476 -10.242 1.00 16.89 ? 44  GLU A O   1 
ATOM   229  C  CB  . GLU A 1 44  ? 7.664  25.641 -11.388 1.00 16.98 ? 44  GLU A CB  1 
ATOM   230  C  CG  . GLU A 1 44  ? 7.590  26.250 -12.753 1.00 18.46 ? 44  GLU A CG  1 
ATOM   231  C  CD  . GLU A 1 44  ? 6.175  26.434 -13.290 1.00 20.72 ? 44  GLU A CD  1 
ATOM   232  O  OE1 . GLU A 1 44  ? 6.079  26.909 -14.445 1.00 25.85 ? 44  GLU A OE1 1 
ATOM   233  O  OE2 . GLU A 1 44  ? 5.178  26.102 -12.598 1.00 23.78 ? 44  GLU A OE2 1 
ATOM   234  N  N   . SER A 1 45  ? 11.065 26.467 -11.680 1.00 16.87 ? 45  SER A N   1 
ATOM   235  C  CA  . SER A 1 45  ? 11.988 27.592 -11.720 1.00 16.85 ? 45  SER A CA  1 
ATOM   236  C  C   . SER A 1 45  ? 11.619 28.566 -12.822 1.00 17.37 ? 45  SER A C   1 
ATOM   237  O  O   . SER A 1 45  ? 11.406 28.154 -13.979 1.00 18.63 ? 45  SER A O   1 
ATOM   238  C  CB  . SER A 1 45  ? 13.410 27.118 -11.955 1.00 16.72 ? 45  SER A CB  1 
ATOM   239  O  OG  . SER A 1 45  ? 14.272 28.235 -11.991 1.00 15.63 ? 45  SER A OG  1 
ATOM   240  N  N   . ALA A 1 46  ? 11.582 29.850 -12.479 1.00 17.45 ? 46  ALA A N   1 
ATOM   241  C  CA  . ALA A 1 46  ? 11.361 30.917 -13.464 1.00 17.61 ? 46  ALA A CA  1 
ATOM   242  C  C   . ALA A 1 46  ? 12.599 31.228 -14.314 1.00 17.76 ? 46  ALA A C   1 
ATOM   243  O  O   . ALA A 1 46  ? 12.503 31.974 -15.307 1.00 18.62 ? 46  ALA A O   1 
ATOM   244  C  CB  . ALA A 1 46  ? 10.895 32.163 -12.766 1.00 18.11 ? 46  ALA A CB  1 
ATOM   245  N  N   . VAL A 1 47  ? 13.758 30.693 -13.918 1.00 17.57 ? 47  VAL A N   1 
ATOM   246  C  CA  . VAL A 1 47  ? 15.023 30.947 -14.612 1.00 17.35 ? 47  VAL A CA  1 
ATOM   247  C  C   . VAL A 1 47  ? 15.821 29.663 -14.874 1.00 17.12 ? 47  VAL A C   1 
ATOM   248  O  O   . VAL A 1 47  ? 15.592 28.607 -14.247 1.00 16.83 ? 47  VAL A O   1 
ATOM   249  C  CB  . VAL A 1 47  ? 15.907 31.946 -13.818 1.00 17.31 ? 47  VAL A CB  1 
ATOM   250  C  CG1 . VAL A 1 47  ? 15.151 33.249 -13.552 1.00 17.99 ? 47  VAL A CG1 1 
ATOM   251  C  CG2 . VAL A 1 47  ? 16.368 31.328 -12.487 1.00 16.81 ? 47  VAL A CG2 1 
ATOM   252  N  N   . GLY A 1 48  ? 16.759 29.752 -15.810 1.00 17.07 ? 48  GLY A N   1 
ATOM   253  C  CA  . GLY A 1 48  ? 17.694 28.661 -16.055 1.00 17.47 ? 48  GLY A CA  1 
ATOM   254  C  C   . GLY A 1 48  ? 17.167 27.610 -17.012 1.00 17.70 ? 48  GLY A C   1 
ATOM   255  O  O   . GLY A 1 48  ? 16.133 27.811 -17.684 1.00 17.98 ? 48  GLY A O   1 
ATOM   256  N  N   . ASN A 1 49  ? 17.884 26.492 -17.080 1.00 18.51 ? 49  ASN A N   1 
ATOM   257  C  CA  . ASN A 1 49  ? 17.549 25.416 -18.017 1.00 18.72 ? 49  ASN A CA  1 
ATOM   258  C  C   . ASN A 1 49  ? 16.493 24.517 -17.364 1.00 18.86 ? 49  ASN A C   1 
ATOM   259  O  O   . ASN A 1 49  ? 16.794 23.441 -16.845 1.00 18.51 ? 49  ASN A O   1 
ATOM   260  C  CB  . ASN A 1 49  ? 18.792 24.635 -18.405 1.00 19.15 ? 49  ASN A CB  1 
ATOM   261  C  CG  . ASN A 1 49  ? 18.537 23.622 -19.508 1.00 19.68 ? 49  ASN A CG  1 
ATOM   262  O  OD1 . ASN A 1 49  ? 17.471 23.607 -20.136 1.00 21.28 ? 49  ASN A OD1 1 
ATOM   263  N  ND2 . ASN A 1 49  ? 19.515 22.764 -19.743 1.00 21.51 ? 49  ASN A ND2 1 
ATOM   264  N  N   . ALA A 1 50  ? 15.261 25.013 -17.364 1.00 18.72 ? 50  ALA A N   1 
ATOM   265  C  CA  . ALA A 1 50  ? 14.166 24.385 -16.662 1.00 19.28 ? 50  ALA A CA  1 
ATOM   266  C  C   . ALA A 1 50  ? 12.844 24.744 -17.301 1.00 19.42 ? 50  ALA A C   1 
ATOM   267  O  O   . ALA A 1 50  ? 12.646 25.870 -17.757 1.00 19.75 ? 50  ALA A O   1 
ATOM   268  C  CB  . ALA A 1 50  ? 14.168 24.819 -15.188 1.00 18.86 ? 50  ALA A CB  1 
ATOM   269  N  N   . GLU A 1 51  ? 11.931 23.781 -17.334 1.00 19.76 ? 51  GLU A N   1 
ATOM   270  C  CA  . GLU A 1 51  ? 10.544 24.071 -17.659 1.00 20.73 ? 51  GLU A CA  1 
ATOM   271  C  C   . GLU A 1 51  ? 9.627  23.130 -16.913 1.00 20.00 ? 51  GLU A C   1 
ATOM   272  O  O   . GLU A 1 51  ? 9.973  21.979 -16.678 1.00 19.32 ? 51  GLU A O   1 
ATOM   273  C  CB  . GLU A 1 51  ? 10.279 23.990 -19.165 1.00 21.58 ? 51  GLU A CB  1 
ATOM   274  C  CG  . GLU A 1 51  ? 10.338 22.630 -19.768 1.00 23.48 ? 51  GLU A CG  1 
ATOM   275  C  CD  . GLU A 1 51  ? 10.038 22.642 -21.270 1.00 24.10 ? 51  GLU A CD  1 
ATOM   276  O  OE1 . GLU A 1 51  ? 8.847  22.585 -21.644 1.00 29.58 ? 51  GLU A OE1 1 
ATOM   277  O  OE2 . GLU A 1 51  ? 10.989 22.709 -22.070 1.00 28.26 ? 51  GLU A OE2 1 
ATOM   278  N  N   . SER A 1 52  ? 8.464  23.651 -16.557 1.00 20.12 ? 52  SER A N   1 
ATOM   279  C  CA  . SER A 1 52  ? 7.441  22.913 -15.848 1.00 20.18 ? 52  SER A CA  1 
ATOM   280  C  C   . SER A 1 52  ? 7.957  22.536 -14.463 1.00 19.85 ? 52  SER A C   1 
ATOM   281  O  O   . SER A 1 52  ? 8.890  23.160 -13.940 1.00 19.82 ? 52  SER A O   1 
ATOM   282  C  CB  . SER A 1 52  ? 6.991  21.675 -16.646 1.00 20.67 ? 52  SER A CB  1 
ATOM   283  O  OG  . SER A 1 52  ? 5.789  21.135 -16.121 1.00 23.31 ? 52  SER A OG  1 
ATOM   284  N  N   . ARG A 1 53  ? 7.335  21.524 -13.879 1.00 19.68 ? 53  ARG A N   1 
ATOM   285  C  CA  . ARG A 1 53  ? 7.606  21.130 -12.494 1.00 19.54 ? 53  ARG A CA  1 
ATOM   286  C  C   . ARG A 1 53  ? 8.630  19.983 -12.388 1.00 18.32 ? 53  ARG A C   1 
ATOM   287  O  O   . ARG A 1 53  ? 8.693  19.098 -13.248 1.00 18.09 ? 53  ARG A O   1 
ATOM   288  C  CB  . ARG A 1 53  ? 6.292  20.709 -11.825 1.00 20.37 ? 53  ARG A CB  1 
ATOM   289  C  CG  . ARG A 1 53  ? 5.308  21.870 -11.546 1.00 21.80 ? 53  ARG A CG  1 
ATOM   290  C  CD  . ARG A 1 53  ? 3.839  21.376 -11.426 1.00 24.70 ? 53  ARG A CD  1 
ATOM   291  N  NE  A ARG A 1 53  ? 3.112  22.233 -10.483 0.50 24.58 ? 53  ARG A NE  1 
ATOM   292  N  NE  B ARG A 1 53  ? 3.667  20.372 -12.483 0.50 26.76 ? 53  ARG A NE  1 
ATOM   293  C  CZ  A ARG A 1 53  ? 1.821  22.044 -10.173 0.50 26.62 ? 53  ARG A CZ  1 
ATOM   294  C  CZ  B ARG A 1 53  ? 3.217  20.619 -13.721 0.50 28.16 ? 53  ARG A CZ  1 
ATOM   295  N  NH1 A ARG A 1 53  ? 1.200  22.863 -9.337  0.50 26.86 ? 53  ARG A NH1 1 
ATOM   296  N  NH1 B ARG A 1 53  ? 3.107  19.614 -14.580 0.50 28.96 ? 53  ARG A NH1 1 
ATOM   297  N  NH2 A ARG A 1 53  ? 1.145  21.016 -10.682 0.50 27.72 ? 53  ARG A NH2 1 
ATOM   298  N  NH2 B ARG A 1 53  ? 2.871  21.848 -14.119 0.50 28.16 ? 53  ARG A NH2 1 
ATOM   299  N  N   . TYR A 1 54  ? 9.406  20.015 -11.300 1.00 16.95 ? 54  TYR A N   1 
ATOM   300  C  CA  . TYR A 1 54  ? 10.407 19.001 -10.965 1.00 16.18 ? 54  TYR A CA  1 
ATOM   301  C  C   . TYR A 1 54  ? 10.096 18.490 -9.576  1.00 15.26 ? 54  TYR A C   1 
ATOM   302  O  O   . TYR A 1 54  ? 9.640  19.244 -8.724  1.00 15.42 ? 54  TYR A O   1 
ATOM   303  C  CB  . TYR A 1 54  ? 11.824 19.609 -10.963 1.00 15.74 ? 54  TYR A CB  1 
ATOM   304  C  CG  . TYR A 1 54  ? 12.229 20.086 -12.327 1.00 14.99 ? 54  TYR A CG  1 
ATOM   305  C  CD1 . TYR A 1 54  ? 13.058 19.317 -13.142 1.00 14.62 ? 54  TYR A CD1 1 
ATOM   306  C  CD2 . TYR A 1 54  ? 11.736 21.290 -12.830 1.00 14.91 ? 54  TYR A CD2 1 
ATOM   307  C  CE1 . TYR A 1 54  ? 13.411 19.752 -14.424 1.00 16.33 ? 54  TYR A CE1 1 
ATOM   308  C  CE2 . TYR A 1 54  ? 12.082 21.730 -14.108 1.00 14.97 ? 54  TYR A CE2 1 
ATOM   309  C  CZ  . TYR A 1 54  ? 12.917 20.961 -14.892 1.00 15.03 ? 54  TYR A CZ  1 
ATOM   310  O  OH  . TYR A 1 54  ? 13.236 21.380 -16.168 1.00 16.12 ? 54  TYR A OH  1 
ATOM   311  N  N   . VAL A 1 55  ? 10.364 17.213 -9.358  1.00 15.12 ? 55  VAL A N   1 
ATOM   312  C  CA  . VAL A 1 55  ? 10.130 16.589 -8.065  1.00 15.10 ? 55  VAL A CA  1 
ATOM   313  C  C   . VAL A 1 55  ? 11.105 17.172 -7.049  1.00 14.90 ? 55  VAL A C   1 
ATOM   314  O  O   . VAL A 1 55  ? 12.269 17.380 -7.352  1.00 15.12 ? 55  VAL A O   1 
ATOM   315  C  CB  . VAL A 1 55  ? 10.308 15.057 -8.165  1.00 14.89 ? 55  VAL A CB  1 
ATOM   316  C  CG1 . VAL A 1 55  ? 10.282 14.390 -6.793  1.00 16.26 ? 55  VAL A CG1 1 
ATOM   317  C  CG2 . VAL A 1 55  ? 9.244  14.478 -9.083  1.00 14.84 ? 55  VAL A CG2 1 
ATOM   318  N  N   . LEU A 1 56  ? 10.624 17.435 -5.846  1.00 14.77 ? 56  LEU A N   1 
ATOM   319  C  CA  . LEU A 1 56  ? 11.533 17.762 -4.743  1.00 15.18 ? 56  LEU A CA  1 
ATOM   320  C  C   . LEU A 1 56  ? 11.235 16.890 -3.545  1.00 15.23 ? 56  LEU A C   1 
ATOM   321  O  O   . LEU A 1 56  ? 10.107 16.425 -3.345  1.00 15.28 ? 56  LEU A O   1 
ATOM   322  C  CB  . LEU A 1 56  ? 11.464 19.242 -4.363  1.00 15.39 ? 56  LEU A CB  1 
ATOM   323  C  CG  . LEU A 1 56  ? 10.208 19.735 -3.640  1.00 15.85 ? 56  LEU A CG  1 
ATOM   324  C  CD1 . LEU A 1 56  ? 10.312 19.582 -2.086  1.00 15.09 ? 56  LEU A CD1 1 
ATOM   325  C  CD2 . LEU A 1 56  ? 9.898  21.183 -4.025  1.00 16.84 ? 56  LEU A CD2 1 
ATOM   326  N  N   . THR A 1 57  ? 12.273 16.654 -2.756  1.00 15.08 ? 57  THR A N   1 
ATOM   327  C  CA  . THR A 1 57  ? 12.124 16.025 -1.458  1.00 14.69 ? 57  THR A CA  1 
ATOM   328  C  C   . THR A 1 57  ? 13.095 16.680 -0.484  1.00 14.19 ? 57  THR A C   1 
ATOM   329  O  O   . THR A 1 57  ? 14.158 17.186 -0.875  1.00 13.68 ? 57  THR A O   1 
ATOM   330  C  CB  . THR A 1 57  ? 12.381 14.510 -1.542  1.00 15.01 ? 57  THR A CB  1 
ATOM   331  O  OG1 . THR A 1 57  ? 12.073 13.883 -0.296  1.00 18.78 ? 57  THR A OG1 1 
ATOM   332  C  CG2 . THR A 1 57  ? 13.805 14.208 -1.959  1.00 14.04 ? 57  THR A CG2 1 
ATOM   333  N  N   . GLY A 1 58  ? 12.723 16.676 0.783   1.00 13.96 ? 58  GLY A N   1 
ATOM   334  C  CA  . GLY A 1 58  ? 13.579 17.244 1.809   1.00 13.85 ? 58  GLY A CA  1 
ATOM   335  C  C   . GLY A 1 58  ? 13.118 16.894 3.197   1.00 13.95 ? 58  GLY A C   1 
ATOM   336  O  O   . GLY A 1 58  ? 12.265 16.006 3.381   1.00 13.83 ? 58  GLY A O   1 
ATOM   337  N  N   . ARG A 1 59  ? 13.653 17.628 4.168   1.00 14.09 ? 59  ARG A N   1 
ATOM   338  C  CA  . ARG A 1 59  ? 13.385 17.372 5.592   1.00 14.18 ? 59  ARG A CA  1 
ATOM   339  C  C   . ARG A 1 59  ? 13.272 18.711 6.321   1.00 14.57 ? 59  ARG A C   1 
ATOM   340  O  O   . ARG A 1 59  ? 13.894 19.709 5.931   1.00 14.73 ? 59  ARG A O   1 
ATOM   341  C  CB  . ARG A 1 59  ? 14.525 16.557 6.226   1.00 14.36 ? 59  ARG A CB  1 
ATOM   342  C  CG  . ARG A 1 59  ? 14.816 15.193 5.608   1.00 13.82 ? 59  ARG A CG  1 
ATOM   343  C  CD  . ARG A 1 59  ? 13.748 14.172 5.849   1.00 15.85 ? 59  ARG A CD  1 
ATOM   344  N  NE  . ARG A 1 59  ? 13.652 13.879 7.274   1.00 16.07 ? 59  ARG A NE  1 
ATOM   345  C  CZ  . ARG A 1 59  ? 12.642 13.225 7.843   1.00 16.89 ? 59  ARG A CZ  1 
ATOM   346  N  NH1 . ARG A 1 59  ? 11.627 12.775 7.120   1.00 18.35 ? 59  ARG A NH1 1 
ATOM   347  N  NH2 . ARG A 1 59  ? 12.650 13.040 9.153   1.00 18.06 ? 59  ARG A NH2 1 
ATOM   348  N  N   . TYR A 1 60  ? 12.495 18.731 7.400   1.00 14.93 ? 60  TYR A N   1 
ATOM   349  C  CA  . TYR A 1 60  ? 12.452 19.887 8.276   1.00 15.10 ? 60  TYR A CA  1 
ATOM   350  C  C   . TYR A 1 60  ? 12.423 19.420 9.731   1.00 15.57 ? 60  TYR A C   1 
ATOM   351  O  O   . TYR A 1 60  ? 12.092 18.261 10.018  1.00 15.28 ? 60  TYR A O   1 
ATOM   352  C  CB  . TYR A 1 60  ? 11.251 20.782 7.943   1.00 15.91 ? 60  TYR A CB  1 
ATOM   353  C  CG  . TYR A 1 60  ? 9.916  20.245 8.437   1.00 16.00 ? 60  TYR A CG  1 
ATOM   354  C  CD1 . TYR A 1 60  ? 9.312  19.147 7.826   1.00 18.00 ? 60  TYR A CD1 1 
ATOM   355  C  CD2 . TYR A 1 60  ? 9.270  20.833 9.526   1.00 15.85 ? 60  TYR A CD2 1 
ATOM   356  C  CE1 . TYR A 1 60  ? 8.075  18.651 8.279   1.00 18.63 ? 60  TYR A CE1 1 
ATOM   357  C  CE2 . TYR A 1 60  ? 8.039  20.349 9.994   1.00 16.31 ? 60  TYR A CE2 1 
ATOM   358  C  CZ  . TYR A 1 60  ? 7.448  19.258 9.368   1.00 17.64 ? 60  TYR A CZ  1 
ATOM   359  O  OH  . TYR A 1 60  ? 6.230  18.781 9.838   1.00 18.72 ? 60  TYR A OH  1 
ATOM   360  N  N   . ASP A 1 61  ? 12.822 20.324 10.622  1.00 16.00 ? 61  ASP A N   1 
ATOM   361  C  CA  . ASP A 1 61  ? 12.751 20.092 12.074  1.00 16.34 ? 61  ASP A CA  1 
ATOM   362  C  C   . ASP A 1 61  ? 11.295 20.159 12.523  1.00 17.05 ? 61  ASP A C   1 
ATOM   363  O  O   . ASP A 1 61  ? 10.704 21.234 12.570  1.00 17.11 ? 61  ASP A O   1 
ATOM   364  C  CB  . ASP A 1 61  ? 13.604 21.131 12.802  1.00 16.23 ? 61  ASP A CB  1 
ATOM   365  C  CG  . ASP A 1 61  ? 13.554 20.993 14.315  1.00 16.33 ? 61  ASP A CG  1 
ATOM   366  O  OD1 . ASP A 1 61  ? 12.925 20.024 14.830  1.00 17.29 ? 61  ASP A OD1 1 
ATOM   367  O  OD2 . ASP A 1 61  ? 14.168 21.860 14.970  1.00 17.13 ? 61  ASP A OD2 1 
ATOM   368  N  N   . SER A 1 62  ? 10.726 19.001 12.842  1.00 18.17 ? 62  SER A N   1 
ATOM   369  C  CA  . SER A 1 62  ? 9.300  18.906 13.203  1.00 19.08 ? 62  SER A CA  1 
ATOM   370  C  C   . SER A 1 62  ? 9.017  19.196 14.688  1.00 20.27 ? 62  SER A C   1 
ATOM   371  O  O   . SER A 1 62  ? 7.864  19.104 15.137  1.00 21.27 ? 62  SER A O   1 
ATOM   372  C  CB  . SER A 1 62  ? 8.767  17.525 12.827  1.00 19.57 ? 62  SER A CB  1 
ATOM   373  O  OG  . SER A 1 62  ? 9.516  16.496 13.439  1.00 21.24 ? 62  SER A OG  1 
ATOM   374  N  N   . ALA A 1 63  ? 10.057 19.513 15.444  1.00 20.41 ? 63  ALA A N   1 
ATOM   375  C  CA  . ALA A 1 63  ? 9.914  19.887 16.855  1.00 21.24 ? 63  ALA A CA  1 
ATOM   376  C  C   . ALA A 1 63  ? 10.903 21.015 17.158  1.00 21.66 ? 63  ALA A C   1 
ATOM   377  O  O   . ALA A 1 63  ? 11.877 20.824 17.893  1.00 21.30 ? 63  ALA A O   1 
ATOM   378  C  CB  . ALA A 1 63  ? 10.139 18.674 17.751  1.00 21.23 ? 63  ALA A CB  1 
ATOM   379  N  N   . PRO A 1 64  ? 10.660 22.202 16.569  1.00 22.69 ? 64  PRO A N   1 
ATOM   380  C  CA  . PRO A 1 64  ? 11.602 23.312 16.702  1.00 23.48 ? 64  PRO A CA  1 
ATOM   381  C  C   . PRO A 1 64  ? 11.612 23.903 18.105  1.00 24.14 ? 64  PRO A C   1 
ATOM   382  O  O   . PRO A 1 64  ? 10.741 23.584 18.935  1.00 24.13 ? 64  PRO A O   1 
ATOM   383  C  CB  . PRO A 1 64  ? 11.092 24.334 15.679  1.00 23.48 ? 64  PRO A CB  1 
ATOM   384  C  CG  . PRO A 1 64  ? 9.650  24.049 15.550  1.00 23.61 ? 64  PRO A CG  1 
ATOM   385  C  CD  . PRO A 1 64  ? 9.494  22.563 15.741  1.00 22.94 ? 64  PRO A CD  1 
ATOM   386  N  N   . ALA A 1 65  ? 12.608 24.743 18.354  1.00 24.92 ? 65  ALA A N   1 
ATOM   387  C  CA  . ALA A 1 65  ? 12.728 25.472 19.610  1.00 25.95 ? 65  ALA A CA  1 
ATOM   388  C  C   . ALA A 1 65  ? 11.539 26.420 19.775  1.00 26.78 ? 65  ALA A C   1 
ATOM   389  O  O   . ALA A 1 65  ? 10.928 26.842 18.799  1.00 26.73 ? 65  ALA A O   1 
ATOM   390  C  CB  . ALA A 1 65  ? 14.040 26.238 19.647  1.00 25.88 ? 65  ALA A CB  1 
ATOM   391  N  N   . THR A 1 66  ? 11.215 26.731 21.028  1.00 28.10 ? 66  THR A N   1 
ATOM   392  C  CA  . THR A 1 66  ? 10.063 27.571 21.365  1.00 28.81 ? 66  THR A CA  1 
ATOM   393  C  C   . THR A 1 66  ? 10.513 28.933 21.906  1.00 29.45 ? 66  THR A C   1 
ATOM   394  O  O   . THR A 1 66  ? 9.800  29.571 22.686  1.00 30.70 ? 66  THR A O   1 
ATOM   395  C  CB  . THR A 1 66  ? 9.175  26.861 22.413  1.00 29.50 ? 66  THR A CB  1 
ATOM   396  O  OG1 . THR A 1 66  ? 9.976  26.489 23.540  1.00 31.19 ? 66  THR A OG1 1 
ATOM   397  C  CG2 . THR A 1 66  ? 8.551  25.615 21.817  1.00 30.79 ? 66  THR A CG2 1 
ATOM   398  N  N   . ASP A 1 67  ? 11.685 29.384 21.465  1.00 29.19 ? 67  ASP A N   1 
ATOM   399  C  CA  . ASP A 1 67  ? 12.309 30.607 21.953  1.00 28.37 ? 67  ASP A CA  1 
ATOM   400  C  C   . ASP A 1 67  ? 12.267 31.733 20.911  1.00 28.11 ? 67  ASP A C   1 
ATOM   401  O  O   . ASP A 1 67  ? 12.982 32.730 21.043  1.00 29.18 ? 67  ASP A O   1 
ATOM   402  C  CB  . ASP A 1 67  ? 13.761 30.318 22.359  1.00 28.78 ? 67  ASP A CB  1 
ATOM   403  C  CG  . ASP A 1 67  ? 14.626 29.846 21.190  1.00 29.75 ? 67  ASP A CG  1 
ATOM   404  O  OD1 . ASP A 1 67  ? 14.093 29.687 20.067  1.00 29.01 ? 67  ASP A OD1 1 
ATOM   405  O  OD2 . ASP A 1 67  ? 15.838 29.627 21.408  1.00 33.20 ? 67  ASP A OD2 1 
ATOM   406  N  N   . GLY A 1 68  ? 11.439 31.561 19.881  1.00 26.67 ? 68  GLY A N   1 
ATOM   407  C  CA  . GLY A 1 68  ? 11.328 32.529 18.797  1.00 25.68 ? 68  GLY A CA  1 
ATOM   408  C  C   . GLY A 1 68  ? 12.254 32.240 17.625  1.00 24.60 ? 68  GLY A C   1 
ATOM   409  O  O   . GLY A 1 68  ? 12.262 32.987 16.641  1.00 24.98 ? 68  GLY A O   1 
ATOM   410  N  N   . SER A 1 69  ? 13.036 31.171 17.728  1.00 22.77 ? 69  SER A N   1 
ATOM   411  C  CA  . SER A 1 69  ? 13.920 30.766 16.636  1.00 21.79 ? 69  SER A CA  1 
ATOM   412  C  C   . SER A 1 69  ? 13.125 30.226 15.450  1.00 19.98 ? 69  SER A C   1 
ATOM   413  O  O   . SER A 1 69  ? 12.017 29.702 15.615  1.00 19.77 ? 69  SER A O   1 
ATOM   414  C  CB  . SER A 1 69  ? 14.895 29.689 17.114  1.00 22.18 ? 69  SER A CB  1 
ATOM   415  O  OG  . SER A 1 69  ? 15.798 30.207 18.078  1.00 26.03 ? 69  SER A OG  1 
ATOM   416  N  N   . GLY A 1 70  ? 13.706 30.333 14.257  1.00 18.59 ? 70  GLY A N   1 
ATOM   417  C  CA  . GLY A 1 70  ? 13.137 29.733 13.057  1.00 17.62 ? 70  GLY A CA  1 
ATOM   418  C  C   . GLY A 1 70  ? 13.213 28.215 13.046  1.00 16.57 ? 70  GLY A C   1 
ATOM   419  O  O   . GLY A 1 70  ? 13.805 27.605 13.922  1.00 15.91 ? 70  GLY A O   1 
ATOM   420  N  N   . THR A 1 71  ? 12.621 27.615 12.020  1.00 15.59 ? 71  THR A N   1 
ATOM   421  C  CA  . THR A 1 71  ? 12.557 26.171 11.880  1.00 15.13 ? 71  THR A CA  1 
ATOM   422  C  C   . THR A 1 71  ? 13.467 25.744 10.731  1.00 14.87 ? 71  THR A C   1 
ATOM   423  O  O   . THR A 1 71  ? 13.204 26.089 9.585   1.00 14.38 ? 71  THR A O   1 
ATOM   424  C  CB  . THR A 1 71  ? 11.117 25.746 11.566  1.00 15.26 ? 71  THR A CB  1 
ATOM   425  O  OG1 . THR A 1 71  ? 10.264 26.147 12.652  1.00 16.53 ? 71  THR A OG1 1 
ATOM   426  C  CG2 . THR A 1 71  ? 11.011 24.236 11.344  1.00 16.13 ? 71  THR A CG2 1 
ATOM   427  N  N   . ALA A 1 72  ? 14.514 24.989 11.046  1.00 14.15 ? 72  ALA A N   1 
ATOM   428  C  CA  . ALA A 1 72  ? 15.491 24.570 10.035  1.00 14.00 ? 72  ALA A CA  1 
ATOM   429  C  C   . ALA A 1 72  ? 14.873 23.573 9.046   1.00 13.83 ? 72  ALA A C   1 
ATOM   430  O  O   . ALA A 1 72  ? 14.069 22.707 9.424   1.00 14.10 ? 72  ALA A O   1 
ATOM   431  C  CB  . ALA A 1 72  ? 16.720 23.964 10.712  1.00 14.36 ? 72  ALA A CB  1 
ATOM   432  N  N   . LEU A 1 73  ? 15.259 23.694 7.775   1.00 13.79 ? 73  LEU A N   1 
ATOM   433  C  CA  . LEU A 1 73  ? 14.773 22.804 6.742   1.00 14.12 ? 73  LEU A CA  1 
ATOM   434  C  C   . LEU A 1 73  ? 15.699 22.812 5.530   1.00 13.99 ? 73  LEU A C   1 
ATOM   435  O  O   . LEU A 1 73  ? 16.579 23.674 5.403   1.00 14.25 ? 73  LEU A O   1 
ATOM   436  C  CB  . LEU A 1 73  ? 13.334 23.155 6.318   1.00 14.14 ? 73  LEU A CB  1 
ATOM   437  C  CG  . LEU A 1 73  ? 13.068 24.334 5.387   1.00 17.68 ? 73  LEU A CG  1 
ATOM   438  C  CD1 . LEU A 1 73  ? 11.544 24.588 5.280   1.00 20.73 ? 73  LEU A CD1 1 
ATOM   439  C  CD2 . LEU A 1 73  ? 13.761 25.564 5.828   1.00 21.87 ? 73  LEU A CD2 1 
ATOM   440  N  N   . GLY A 1 74  ? 15.510 21.830 4.663   1.00 13.17 ? 74  GLY A N   1 
ATOM   441  C  CA  . GLY A 1 74  ? 16.203 21.807 3.390   1.00 13.02 ? 74  GLY A CA  1 
ATOM   442  C  C   . GLY A 1 74  ? 15.526 20.882 2.415   1.00 12.58 ? 74  GLY A C   1 
ATOM   443  O  O   . GLY A 1 74  ? 14.751 20.002 2.804   1.00 12.77 ? 74  GLY A O   1 
ATOM   444  N  N   . TRP A 1 75  ? 15.809 21.082 1.137   1.00 12.51 ? 75  TRP A N   1 
ATOM   445  C  CA  . TRP A 1 75  ? 15.259 20.207 0.106   1.00 12.70 ? 75  TRP A CA  1 
ATOM   446  C  C   . TRP A 1 75  ? 16.142 20.214 -1.136  1.00 12.54 ? 75  TRP A C   1 
ATOM   447  O  O   . TRP A 1 75  ? 16.984 21.094 -1.307  1.00 11.80 ? 75  TRP A O   1 
ATOM   448  C  CB  . TRP A 1 75  ? 13.804 20.584 -0.241  1.00 13.26 ? 75  TRP A CB  1 
ATOM   449  C  CG  . TRP A 1 75  ? 13.640 21.890 -0.991  1.00 13.55 ? 75  TRP A CG  1 
ATOM   450  C  CD1 . TRP A 1 75  ? 13.597 22.063 -2.358  1.00 15.09 ? 75  TRP A CD1 1 
ATOM   451  C  CD2 . TRP A 1 75  ? 13.450 23.191 -0.423  1.00 13.63 ? 75  TRP A CD2 1 
ATOM   452  N  NE1 . TRP A 1 75  ? 13.403 23.381 -2.665  1.00 14.81 ? 75  TRP A NE1 1 
ATOM   453  C  CE2 . TRP A 1 75  ? 13.330 24.105 -1.502  1.00 13.63 ? 75  TRP A CE2 1 
ATOM   454  C  CE3 . TRP A 1 75  ? 13.398 23.682 0.890   1.00 13.64 ? 75  TRP A CE3 1 
ATOM   455  C  CZ2 . TRP A 1 75  ? 13.142 25.481 -1.300  1.00 14.33 ? 75  TRP A CZ2 1 
ATOM   456  C  CZ3 . TRP A 1 75  ? 13.217 25.033 1.082   1.00 14.99 ? 75  TRP A CZ3 1 
ATOM   457  C  CH2 . TRP A 1 75  ? 13.099 25.921 -0.011  1.00 14.65 ? 75  TRP A CH2 1 
ATOM   458  N  N   . THR A 1 76  ? 15.923 19.211 -1.982  1.00 12.67 ? 76  THR A N   1 
ATOM   459  C  CA  . THR A 1 76  ? 16.692 18.998 -3.201  1.00 12.43 ? 76  THR A CA  1 
ATOM   460  C  C   . THR A 1 76  ? 15.779 18.882 -4.408  1.00 12.91 ? 76  THR A C   1 
ATOM   461  O  O   . THR A 1 76  ? 14.708 18.269 -4.337  1.00 13.51 ? 76  THR A O   1 
ATOM   462  C  CB  . THR A 1 76  ? 17.549 17.697 -3.117  1.00 13.01 ? 76  THR A CB  1 
ATOM   463  O  OG1 . THR A 1 76  ? 18.394 17.761 -1.966  1.00 13.16 ? 76  THR A OG1 1 
ATOM   464  C  CG2 . THR A 1 76  ? 18.437 17.537 -4.357  1.00 13.25 ? 76  THR A CG2 1 
ATOM   465  N  N   . VAL A 1 77  ? 16.222 19.477 -5.512  1.00 12.69 ? 77  VAL A N   1 
ATOM   466  C  CA  . VAL A 1 77  ? 15.667 19.246 -6.847  1.00 13.30 ? 77  VAL A CA  1 
ATOM   467  C  C   . VAL A 1 77  ? 16.796 18.788 -7.758  1.00 13.09 ? 77  VAL A C   1 
ATOM   468  O  O   . VAL A 1 77  ? 17.835 19.445 -7.833  1.00 13.79 ? 77  VAL A O   1 
ATOM   469  C  CB  . VAL A 1 77  ? 15.051 20.521 -7.453  1.00 12.94 ? 77  VAL A CB  1 
ATOM   470  C  CG1 . VAL A 1 77  ? 14.712 20.314 -8.946  1.00 13.38 ? 77  VAL A CG1 1 
ATOM   471  C  CG2 . VAL A 1 77  ? 13.821 20.961 -6.663  1.00 13.90 ? 77  VAL A CG2 1 
ATOM   472  N  N   . ALA A 1 78  ? 16.620 17.636 -8.406  1.00 13.13 ? 78  ALA A N   1 
ATOM   473  C  CA  . ALA A 1 78  ? 17.467 17.254 -9.545  1.00 13.42 ? 78  ALA A CA  1 
ATOM   474  C  C   . ALA A 1 78  ? 16.749 17.710 -10.802 1.00 13.89 ? 78  ALA A C   1 
ATOM   475  O  O   . ALA A 1 78  ? 15.563 17.426 -10.984 1.00 12.81 ? 78  ALA A O   1 
ATOM   476  C  CB  . ALA A 1 78  ? 17.707 15.754 -9.590  1.00 13.83 ? 78  ALA A CB  1 
ATOM   477  N  N   . TRP A 1 79  ? 17.471 18.401 -11.675 1.00 14.17 ? 79  TRP A N   1 
ATOM   478  C  CA  . TRP A 1 79  ? 16.843 19.152 -12.766 1.00 14.70 ? 79  TRP A CA  1 
ATOM   479  C  C   . TRP A 1 79  ? 16.585 18.273 -13.992 1.00 15.46 ? 79  TRP A C   1 
ATOM   480  O  O   . TRP A 1 79  ? 16.916 18.643 -15.129 1.00 14.78 ? 79  TRP A O   1 
ATOM   481  C  CB  . TRP A 1 79  ? 17.674 20.405 -13.100 1.00 14.67 ? 79  TRP A CB  1 
ATOM   482  C  CG  . TRP A 1 79  ? 17.691 21.352 -11.953 1.00 14.37 ? 79  TRP A CG  1 
ATOM   483  C  CD1 . TRP A 1 79  ? 18.725 21.587 -11.109 1.00 14.12 ? 79  TRP A CD1 1 
ATOM   484  C  CD2 . TRP A 1 79  ? 16.600 22.158 -11.496 1.00 14.61 ? 79  TRP A CD2 1 
ATOM   485  N  NE1 . TRP A 1 79  ? 18.360 22.509 -10.151 1.00 13.77 ? 79  TRP A NE1 1 
ATOM   486  C  CE2 . TRP A 1 79  ? 17.058 22.873 -10.362 1.00 13.89 ? 79  TRP A CE2 1 
ATOM   487  C  CE3 . TRP A 1 79  ? 15.286 22.366 -11.944 1.00 14.18 ? 79  TRP A CE3 1 
ATOM   488  C  CZ2 . TRP A 1 79  ? 16.257 23.782 -9.683  1.00 14.34 ? 79  TRP A CZ2 1 
ATOM   489  C  CZ3 . TRP A 1 79  ? 14.479 23.265 -11.255 1.00 14.96 ? 79  TRP A CZ3 1 
ATOM   490  C  CH2 . TRP A 1 79  ? 14.967 23.959 -10.134 1.00 14.16 ? 79  TRP A CH2 1 
ATOM   491  N  N   . LYS A 1 80  ? 15.988 17.108 -13.732 1.00 16.21 ? 80  LYS A N   1 
ATOM   492  C  CA  . LYS A 1 80  ? 15.512 16.200 -14.778 1.00 16.66 ? 80  LYS A CA  1 
ATOM   493  C  C   . LYS A 1 80  ? 14.019 16.010 -14.601 1.00 16.49 ? 80  LYS A C   1 
ATOM   494  O  O   . LYS A 1 80  ? 13.554 15.694 -13.508 1.00 15.62 ? 80  LYS A O   1 
ATOM   495  C  CB  . LYS A 1 80  ? 16.216 14.844 -14.691 1.00 17.52 ? 80  LYS A CB  1 
ATOM   496  C  CG  . LYS A 1 80  ? 15.635 13.739 -15.612 1.00 17.92 ? 80  LYS A CG  1 
ATOM   497  C  CD  . LYS A 1 80  ? 16.316 12.408 -15.371 1.00 19.65 ? 80  LYS A CD  1 
ATOM   498  C  CE  . LYS A 1 80  ? 15.626 11.273 -16.126 1.00 21.74 ? 80  LYS A CE  1 
ATOM   499  N  NZ  . LYS A 1 80  ? 14.212 11.061 -15.675 1.00 24.40 ? 80  LYS A NZ  1 
ATOM   500  N  N   . ASN A 1 81  ? 13.272 16.210 -15.684 1.00 16.62 ? 81  ASN A N   1 
ATOM   501  C  CA  . ASN A 1 81  ? 11.866 15.838 -15.716 1.00 16.95 ? 81  ASN A CA  1 
ATOM   502  C  C   . ASN A 1 81  ? 11.548 15.314 -17.117 1.00 17.66 ? 81  ASN A C   1 
ATOM   503  O  O   . ASN A 1 81  ? 12.462 14.981 -17.856 1.00 17.44 ? 81  ASN A O   1 
ATOM   504  C  CB  . ASN A 1 81  ? 10.953 16.992 -15.265 1.00 16.98 ? 81  ASN A CB  1 
ATOM   505  C  CG  . ASN A 1 81  ? 10.946 18.179 -16.225 1.00 16.43 ? 81  ASN A CG  1 
ATOM   506  O  OD1 . ASN A 1 81  ? 11.514 18.125 -17.320 1.00 16.30 ? 81  ASN A OD1 1 
ATOM   507  N  ND2 . ASN A 1 81  ? 10.296 19.272 -15.804 1.00 15.60 ? 81  ASN A ND2 1 
ATOM   508  N  N   . ASN A 1 82  ? 10.273 15.229 -17.475 1.00 18.78 ? 82  ASN A N   1 
ATOM   509  C  CA  . ASN A 1 82  ? 9.931  14.665 -18.792 1.00 20.07 ? 82  ASN A CA  1 
ATOM   510  C  C   . ASN A 1 82  ? 10.251 15.577 -19.969 1.00 20.67 ? 82  ASN A C   1 
ATOM   511  O  O   . ASN A 1 82  ? 10.208 15.127 -21.129 1.00 22.27 ? 82  ASN A O   1 
ATOM   512  C  CB  . ASN A 1 82  ? 8.468  14.238 -18.825 1.00 21.15 ? 82  ASN A CB  1 
ATOM   513  C  CG  . ASN A 1 82  ? 8.209  12.984 -18.009 1.00 24.61 ? 82  ASN A CG  1 
ATOM   514  O  OD1 . ASN A 1 82  ? 9.097  12.138 -17.828 1.00 29.37 ? 82  ASN A OD1 1 
ATOM   515  N  ND2 . ASN A 1 82  ? 6.983  12.849 -17.521 1.00 28.92 ? 82  ASN A ND2 1 
ATOM   516  N  N   . TYR A 1 83  ? 10.582 16.840 -19.685 1.00 20.52 ? 83  TYR A N   1 
ATOM   517  C  CA  . TYR A 1 83  ? 10.842 17.857 -20.712 1.00 20.64 ? 83  TYR A CA  1 
ATOM   518  C  C   . TYR A 1 83  ? 12.314 18.108 -20.964 1.00 20.33 ? 83  TYR A C   1 
ATOM   519  O  O   . TYR A 1 83  ? 12.733 18.284 -22.100 1.00 19.69 ? 83  TYR A O   1 
ATOM   520  C  CB  . TYR A 1 83  ? 10.205 19.183 -20.308 1.00 22.06 ? 83  TYR A CB  1 
ATOM   521  C  CG  . TYR A 1 83  ? 8.710  19.114 -20.174 1.00 22.98 ? 83  TYR A CG  1 
ATOM   522  C  CD1 . TYR A 1 83  ? 7.899  19.219 -21.294 1.00 24.97 ? 83  TYR A CD1 1 
ATOM   523  C  CD2 . TYR A 1 83  ? 8.104  18.944 -18.935 1.00 23.23 ? 83  TYR A CD2 1 
ATOM   524  C  CE1 . TYR A 1 83  ? 6.526  19.155 -21.187 1.00 25.88 ? 83  TYR A CE1 1 
ATOM   525  C  CE2 . TYR A 1 83  ? 6.733  18.876 -18.811 1.00 24.12 ? 83  TYR A CE2 1 
ATOM   526  C  CZ  . TYR A 1 83  ? 5.945  18.983 -19.950 1.00 25.39 ? 83  TYR A CZ  1 
ATOM   527  O  OH  . TYR A 1 83  ? 4.573  18.924 -19.863 1.00 26.44 ? 83  TYR A OH  1 
ATOM   528  N  N   . ARG A 1 84  ? 13.101 18.159 -19.890 1.00 19.47 ? 84  ARG A N   1 
ATOM   529  C  CA  . ARG A 1 84  ? 14.494 18.568 -19.980 1.00 19.87 ? 84  ARG A CA  1 
ATOM   530  C  C   . ARG A 1 84  ? 15.318 17.859 -18.940 1.00 18.62 ? 84  ARG A C   1 
ATOM   531  O  O   . ARG A 1 84  ? 14.784 17.375 -17.945 1.00 18.11 ? 84  ARG A O   1 
ATOM   532  C  CB  . ARG A 1 84  ? 14.633 20.060 -19.700 1.00 20.35 ? 84  ARG A CB  1 
ATOM   533  C  CG  . ARG A 1 84  ? 13.880 20.936 -20.640 1.00 22.44 ? 84  ARG A CG  1 
ATOM   534  C  CD  . ARG A 1 84  ? 14.397 22.328 -20.527 1.00 23.73 ? 84  ARG A CD  1 
ATOM   535  N  NE  . ARG A 1 84  ? 13.532 23.289 -21.196 1.00 26.74 ? 84  ARG A NE  1 
ATOM   536  C  CZ  . ARG A 1 84  ? 13.800 24.584 -21.271 1.00 26.69 ? 84  ARG A CZ  1 
ATOM   537  N  NH1 . ARG A 1 84  ? 12.945 25.397 -21.874 1.00 27.67 ? 84  ARG A NH1 1 
ATOM   538  N  NH2 . ARG A 1 84  ? 14.927 25.067 -20.759 1.00 27.76 ? 84  ARG A NH2 1 
ATOM   539  N  N   . ASN A 1 85  ? 16.622 17.845 -19.180 1.00 18.04 ? 85  ASN A N   1 
ATOM   540  C  CA  . ASN A 1 85  ? 17.597 17.402 -18.191 1.00 17.64 ? 85  ASN A CA  1 
ATOM   541  C  C   . ASN A 1 85  ? 18.807 18.340 -18.219 1.00 16.78 ? 85  ASN A C   1 
ATOM   542  O  O   . ASN A 1 85  ? 19.587 18.340 -19.182 1.00 17.11 ? 85  ASN A O   1 
ATOM   543  C  CB  . ASN A 1 85  ? 18.009 15.963 -18.445 1.00 17.51 ? 85  ASN A CB  1 
ATOM   544  C  CG  . ASN A 1 85  ? 18.838 15.388 -17.311 1.00 17.96 ? 85  ASN A CG  1 
ATOM   545  O  OD1 . ASN A 1 85  ? 19.283 16.116 -16.419 1.00 17.50 ? 85  ASN A OD1 1 
ATOM   546  N  ND2 . ASN A 1 85  ? 19.024 14.071 -17.329 1.00 18.00 ? 85  ASN A ND2 1 
ATOM   547  N  N   . ALA A 1 86  ? 18.954 19.140 -17.165 1.00 16.47 ? 86  ALA A N   1 
ATOM   548  C  CA  . ALA A 1 86  ? 20.057 20.096 -17.053 1.00 16.32 ? 86  ALA A CA  1 
ATOM   549  C  C   . ALA A 1 86  ? 21.267 19.518 -16.298 1.00 15.95 ? 86  ALA A C   1 
ATOM   550  O  O   . ALA A 1 86  ? 22.167 20.275 -15.923 1.00 15.92 ? 86  ALA A O   1 
ATOM   551  C  CB  . ALA A 1 86  ? 19.588 21.382 -16.386 1.00 16.43 ? 86  ALA A CB  1 
ATOM   552  N  N   . HIS A 1 87  ? 21.269 18.200 -16.077 1.00 15.69 ? 87  HIS A N   1 
ATOM   553  C  CA  . HIS A 1 87  ? 22.395 17.475 -15.462 1.00 15.58 ? 87  HIS A CA  1 
ATOM   554  C  C   . HIS A 1 87  ? 22.966 18.257 -14.279 1.00 14.94 ? 87  HIS A C   1 
ATOM   555  O  O   . HIS A 1 87  ? 24.161 18.579 -14.212 1.00 14.75 ? 87  HIS A O   1 
ATOM   556  C  CB  . HIS A 1 87  ? 23.476 17.198 -16.495 1.00 16.40 ? 87  HIS A CB  1 
ATOM   557  C  CG  . HIS A 1 87  ? 22.991 16.378 -17.644 1.00 17.73 ? 87  HIS A CG  1 
ATOM   558  N  ND1 . HIS A 1 87  ? 22.323 15.184 -17.468 1.00 17.21 ? 87  HIS A ND1 1 
ATOM   559  C  CD2 . HIS A 1 87  ? 23.053 16.586 -18.983 1.00 18.98 ? 87  HIS A CD2 1 
ATOM   560  C  CE1 . HIS A 1 87  ? 21.999 14.691 -18.653 1.00 18.92 ? 87  HIS A CE1 1 
ATOM   561  N  NE2 . HIS A 1 87  ? 22.431 15.520 -19.586 1.00 18.38 ? 87  HIS A NE2 1 
ATOM   562  N  N   . SER A 1 88  ? 22.070 18.556 -13.350 1.00 14.59 ? 88  SER A N   1 
ATOM   563  C  CA  . SER A 1 88  ? 22.405 19.359 -12.180 1.00 14.11 ? 88  SER A CA  1 
ATOM   564  C  C   . SER A 1 88  ? 21.377 19.146 -11.078 1.00 13.87 ? 88  SER A C   1 
ATOM   565  O  O   . SER A 1 88  ? 20.270 18.643 -11.321 1.00 13.98 ? 88  SER A O   1 
ATOM   566  C  CB  . SER A 1 88  ? 22.498 20.853 -12.536 1.00 14.53 ? 88  SER A CB  1 
ATOM   567  O  OG  . SER A 1 88  ? 21.376 21.309 -13.284 1.00 14.70 ? 88  SER A OG  1 
ATOM   568  N  N   . ALA A 1 89  ? 21.758 19.524 -9.864  1.00 13.23 ? 89  ALA A N   1 
ATOM   569  C  CA  . ALA A 1 89  ? 20.889 19.432 -8.704  1.00 13.00 ? 89  ALA A CA  1 
ATOM   570  C  C   . ALA A 1 89  ? 21.114 20.658 -7.832  1.00 12.79 ? 89  ALA A C   1 
ATOM   571  O  O   . ALA A 1 89  ? 22.251 21.090 -7.655  1.00 13.33 ? 89  ALA A O   1 
ATOM   572  C  CB  . ALA A 1 89  ? 21.168 18.163 -7.922  1.00 13.13 ? 89  ALA A CB  1 
ATOM   573  N  N   . THR A 1 90  ? 20.030 21.225 -7.321  1.00 12.23 ? 90  THR A N   1 
ATOM   574  C  CA  . THR A 1 90  ? 20.100 22.299 -6.335  1.00 11.83 ? 90  THR A CA  1 
ATOM   575  C  C   . THR A 1 90  ? 19.568 21.822 -5.000  1.00 11.69 ? 90  THR A C   1 
ATOM   576  O  O   . THR A 1 90  ? 18.533 21.158 -4.936  1.00 12.40 ? 90  THR A O   1 
ATOM   577  C  CB  . THR A 1 90  ? 19.251 23.513 -6.784  1.00 11.90 ? 90  THR A CB  1 
ATOM   578  O  OG1 . THR A 1 90  ? 19.721 23.950 -8.070  1.00 12.43 ? 90  THR A OG1 1 
ATOM   579  C  CG2 . THR A 1 90  ? 19.365 24.673 -5.768  1.00 12.59 ? 90  THR A CG2 1 
ATOM   580  N  N   . THR A 1 91  ? 20.277 22.188 -3.944  1.00 11.48 ? 91  THR A N   1 
ATOM   581  C  CA  . THR A 1 91  ? 19.816 21.986 -2.574  1.00 11.41 ? 91  THR A CA  1 
ATOM   582  C  C   . THR A 1 91  ? 19.652 23.355 -1.924  1.00 11.75 ? 91  THR A C   1 
ATOM   583  O  O   . THR A 1 91  ? 20.558 24.200 -2.009  1.00 12.40 ? 91  THR A O   1 
ATOM   584  C  CB  . THR A 1 91  ? 20.778 21.132 -1.741  1.00 11.58 ? 91  THR A CB  1 
ATOM   585  O  OG1 . THR A 1 91  ? 22.023 21.826 -1.564  1.00 12.12 ? 91  THR A OG1 1 
ATOM   586  C  CG2 . THR A 1 91  ? 21.005 19.740 -2.383  1.00 12.72 ? 91  THR A CG2 1 
ATOM   587  N  N   . TRP A 1 92  ? 18.477 23.584 -1.345  1.00 11.58 ? 92  TRP A N   1 
ATOM   588  C  CA  . TRP A 1 92  ? 18.201 24.772 -0.558  1.00 12.22 ? 92  TRP A CA  1 
ATOM   589  C  C   . TRP A 1 92  ? 18.278 24.396 0.908   1.00 12.05 ? 92  TRP A C   1 
ATOM   590  O  O   . TRP A 1 92  ? 17.662 23.406 1.332   1.00 11.99 ? 92  TRP A O   1 
ATOM   591  C  CB  . TRP A 1 92  ? 16.797 25.308 -0.818  1.00 12.50 ? 92  TRP A CB  1 
ATOM   592  C  CG  . TRP A 1 92  ? 16.571 25.944 -2.166  1.00 12.31 ? 92  TRP A CG  1 
ATOM   593  C  CD1 . TRP A 1 92  ? 16.519 27.278 -2.448  1.00 13.55 ? 92  TRP A CD1 1 
ATOM   594  C  CD2 . TRP A 1 92  ? 16.308 25.261 -3.398  1.00 12.47 ? 92  TRP A CD2 1 
ATOM   595  N  NE1 . TRP A 1 92  ? 16.243 27.470 -3.782  1.00 12.92 ? 92  TRP A NE1 1 
ATOM   596  C  CE2 . TRP A 1 92  ? 16.110 26.246 -4.388  1.00 13.23 ? 92  TRP A CE2 1 
ATOM   597  C  CE3 . TRP A 1 92  ? 16.207 23.907 -3.757  1.00 13.08 ? 92  TRP A CE3 1 
ATOM   598  C  CZ2 . TRP A 1 92  ? 15.823 25.922 -5.721  1.00 13.34 ? 92  TRP A CZ2 1 
ATOM   599  C  CZ3 . TRP A 1 92  ? 15.912 23.585 -5.086  1.00 13.29 ? 92  TRP A CZ3 1 
ATOM   600  C  CH2 . TRP A 1 92  ? 15.726 24.592 -6.045  1.00 13.19 ? 92  TRP A CH2 1 
ATOM   601  N  N   . SER A 1 93  ? 19.014 25.194 1.674   1.00 12.40 ? 93  SER A N   1 
ATOM   602  C  CA  . SER A 1 93  ? 19.165 25.009 3.116   1.00 12.78 ? 93  SER A CA  1 
ATOM   603  C  C   . SER A 1 93  ? 18.729 26.318 3.770   1.00 12.84 ? 93  SER A C   1 
ATOM   604  O  O   . SER A 1 93  ? 19.179 27.400 3.378   1.00 12.77 ? 93  SER A O   1 
ATOM   605  C  CB  . SER A 1 93  ? 20.628 24.690 3.460   1.00 13.07 ? 93  SER A CB  1 
ATOM   606  O  OG  . SER A 1 93  ? 20.802 24.438 4.848   1.00 13.23 ? 93  SER A OG  1 
ATOM   607  N  N   . GLY A 1 94  ? 17.830 26.238 4.739   1.00 13.09 ? 94  GLY A N   1 
ATOM   608  C  CA  . GLY A 1 94  ? 17.296 27.461 5.310   1.00 13.17 ? 94  GLY A CA  1 
ATOM   609  C  C   . GLY A 1 94  ? 16.469 27.287 6.551   1.00 13.67 ? 94  GLY A C   1 
ATOM   610  O  O   . GLY A 1 94  ? 16.547 26.266 7.243   1.00 13.53 ? 94  GLY A O   1 
ATOM   611  N  N   . GLN A 1 95  ? 15.697 28.325 6.836   1.00 14.03 ? 95  GLN A N   1 
ATOM   612  C  CA  . GLN A 1 95  ? 14.743 28.263 7.924   1.00 15.01 ? 95  GLN A CA  1 
ATOM   613  C  C   . GLN A 1 95  ? 13.447 28.968 7.599   1.00 15.30 ? 95  GLN A C   1 
ATOM   614  O  O   . GLN A 1 95  ? 13.422 29.996 6.913   1.00 14.72 ? 95  GLN A O   1 
ATOM   615  C  CB  . GLN A 1 95  ? 15.346 28.807 9.219   1.00 15.20 ? 95  GLN A CB  1 
ATOM   616  C  CG  . GLN A 1 95  ? 15.798 30.250 9.178   1.00 16.08 ? 95  GLN A CG  1 
ATOM   617  C  CD  . GLN A 1 95  ? 16.451 30.692 10.494  1.00 16.26 ? 95  GLN A CD  1 
ATOM   618  O  OE1 . GLN A 1 95  ? 15.990 30.332 11.580  1.00 17.58 ? 95  GLN A OE1 1 
ATOM   619  N  NE2 . GLN A 1 95  ? 17.522 31.473 10.394  1.00 16.53 ? 95  GLN A NE2 1 
ATOM   620  N  N   . TYR A 1 96  ? 12.380 28.380 8.123   1.00 15.71 ? 96  TYR A N   1 
ATOM   621  C  CA  . TYR A 1 96  ? 11.035 28.939 8.054   1.00 16.84 ? 96  TYR A CA  1 
ATOM   622  C  C   . TYR A 1 96  ? 10.827 29.858 9.243   1.00 17.48 ? 96  TYR A C   1 
ATOM   623  O  O   . TYR A 1 96  ? 11.118 29.487 10.386  1.00 17.23 ? 96  TYR A O   1 
ATOM   624  C  CB  . TYR A 1 96  ? 10.018 27.788 8.073   1.00 17.26 ? 96  TYR A CB  1 
ATOM   625  C  CG  . TYR A 1 96  ? 8.616  28.173 8.465   1.00 17.07 ? 96  TYR A CG  1 
ATOM   626  C  CD1 . TYR A 1 96  ? 7.728  28.677 7.527   1.00 17.85 ? 96  TYR A CD1 1 
ATOM   627  C  CD2 . TYR A 1 96  ? 8.178  28.021 9.769   1.00 18.04 ? 96  TYR A CD2 1 
ATOM   628  C  CE1 . TYR A 1 96  ? 6.431  29.034 7.885   1.00 19.19 ? 96  TYR A CE1 1 
ATOM   629  C  CE2 . TYR A 1 96  ? 6.898  28.362 10.133  1.00 19.11 ? 96  TYR A CE2 1 
ATOM   630  C  CZ  . TYR A 1 96  ? 6.030  28.872 9.195   1.00 18.61 ? 96  TYR A CZ  1 
ATOM   631  O  OH  . TYR A 1 96  ? 4.740  29.207 9.579   1.00 21.09 ? 96  TYR A OH  1 
ATOM   632  N  N   . VAL A 1 97  ? 10.311 31.049 8.957   1.00 18.86 ? 97  VAL A N   1 
ATOM   633  C  CA  . VAL A 1 97  ? 10.051 32.069 9.965   1.00 20.99 ? 97  VAL A CA  1 
ATOM   634  C  C   . VAL A 1 97  ? 8.566  32.388 9.884   1.00 22.12 ? 97  VAL A C   1 
ATOM   635  O  O   . VAL A 1 97  ? 8.105  32.935 8.885   1.00 21.80 ? 97  VAL A O   1 
ATOM   636  C  CB  . VAL A 1 97  ? 10.898 33.324 9.690   1.00 20.76 ? 97  VAL A CB  1 
ATOM   637  C  CG1 . VAL A 1 97  ? 10.602 34.407 10.705  1.00 22.48 ? 97  VAL A CG1 1 
ATOM   638  C  CG2 . VAL A 1 97  ? 12.388 32.957 9.693   1.00 22.10 ? 97  VAL A CG2 1 
ATOM   639  N  N   . GLY A 1 98  ? 7.822  32.012 10.920  1.00 24.24 ? 98  GLY A N   1 
ATOM   640  C  CA  . GLY A 1 98  ? 6.375  32.161 10.917  1.00 25.93 ? 98  GLY A CA  1 
ATOM   641  C  C   . GLY A 1 98  ? 5.945  33.595 11.177  1.00 27.55 ? 98  GLY A C   1 
ATOM   642  O  O   . GLY A 1 98  ? 6.780  34.474 11.405  1.00 28.27 ? 98  GLY A O   1 
ATOM   643  N  N   . GLY A 1 99  ? 4.634  33.824 11.139  1.00 29.42 ? 99  GLY A N   1 
ATOM   644  C  CA  . GLY A 1 99  ? 4.063  35.144 11.425  1.00 29.77 ? 99  GLY A CA  1 
ATOM   645  C  C   . GLY A 1 99  ? 3.262  35.711 10.275  1.00 30.73 ? 99  GLY A C   1 
ATOM   646  O  O   . GLY A 1 99  ? 3.080  35.060 9.238   1.00 31.95 ? 99  GLY A O   1 
ATOM   647  N  N   . ALA A 1 100 ? 2.811  36.951 10.456  1.00 31.39 ? 100 ALA A N   1 
ATOM   648  C  CA  . ALA A 1 100 ? 1.902  37.617 9.521   1.00 30.83 ? 100 ALA A CA  1 
ATOM   649  C  C   . ALA A 1 100 ? 2.420  37.597 8.100   1.00 31.15 ? 100 ALA A C   1 
ATOM   650  O  O   . ALA A 1 100 ? 1.657  37.364 7.144   1.00 32.44 ? 100 ALA A O   1 
ATOM   651  C  CB  . ALA A 1 100 ? 1.655  39.066 9.977   1.00 31.48 ? 100 ALA A CB  1 
ATOM   652  N  N   . GLU A 1 101 ? 3.719  37.842 7.962   1.00 30.01 ? 101 GLU A N   1 
ATOM   653  C  CA  . GLU A 1 101 ? 4.394  37.703 6.687   1.00 28.78 ? 101 GLU A CA  1 
ATOM   654  C  C   . GLU A 1 101 ? 5.439  36.599 6.813   1.00 27.55 ? 101 GLU A C   1 
ATOM   655  O  O   . GLU A 1 101 ? 6.648  36.862 6.955   1.00 28.05 ? 101 GLU A O   1 
ATOM   656  C  CB  . GLU A 1 101 ? 5.023  39.026 6.272   1.00 29.56 ? 101 GLU A CB  1 
ATOM   657  C  CG  . GLU A 1 101 ? 3.999  40.148 6.083   0.50 29.70 ? 101 GLU A CG  1 
ATOM   658  C  CD  . GLU A 1 101 ? 4.638  41.450 5.658   0.50 30.05 ? 101 GLU A CD  1 
ATOM   659  O  OE1 . GLU A 1 101 ? 4.597  42.413 6.450   0.50 32.03 ? 101 GLU A OE1 1 
ATOM   660  O  OE2 . GLU A 1 101 ? 5.196  41.510 4.540   0.50 31.73 ? 101 GLU A OE2 1 
ATOM   661  N  N   . ALA A 1 102 ? 4.954  35.363 6.755   1.00 25.34 ? 102 ALA A N   1 
ATOM   662  C  CA  . ALA A 1 102 ? 5.825  34.193 6.855   1.00 23.82 ? 102 ALA A CA  1 
ATOM   663  C  C   . ALA A 1 102 ? 6.854  34.188 5.733   1.00 21.98 ? 102 ALA A C   1 
ATOM   664  O  O   . ALA A 1 102 ? 6.604  34.672 4.630   1.00 21.02 ? 102 ALA A O   1 
ATOM   665  C  CB  . ALA A 1 102 ? 5.013  32.921 6.840   1.00 23.82 ? 102 ALA A CB  1 
ATOM   666  N  N   . ARG A 1 103 ? 8.031  33.654 6.036   1.00 20.32 ? 103 ARG A N   1 
ATOM   667  C  CA  . ARG A 1 103 ? 9.111  33.581 5.058   1.00 20.19 ? 103 ARG A CA  1 
ATOM   668  C  C   . ARG A 1 103 ? 9.873  32.293 5.218   1.00 18.46 ? 103 ARG A C   1 
ATOM   669  O  O   . ARG A 1 103 ? 9.937  31.748 6.316   1.00 18.32 ? 103 ARG A O   1 
ATOM   670  C  CB  . ARG A 1 103 ? 10.071 34.759 5.248   1.00 20.78 ? 103 ARG A CB  1 
ATOM   671  C  CG  . ARG A 1 103 ? 9.494  36.060 4.715   0.50 21.80 ? 103 ARG A CG  1 
ATOM   672  C  CD  . ARG A 1 103 ? 10.447 37.233 4.861   0.50 22.62 ? 103 ARG A CD  1 
ATOM   673  N  NE  . ARG A 1 103 ? 10.471 38.092 3.676   0.50 24.62 ? 103 ARG A NE  1 
ATOM   674  C  CZ  . ARG A 1 103 ? 9.466  38.853 3.248   0.50 25.67 ? 103 ARG A CZ  1 
ATOM   675  N  NH1 . ARG A 1 103 ? 9.632  39.593 2.159   0.50 24.85 ? 103 ARG A NH1 1 
ATOM   676  N  NH2 . ARG A 1 103 ? 8.297  38.885 3.887   0.50 27.35 ? 103 ARG A NH2 1 
ATOM   677  N  N   . ILE A 1 104 ? 10.422 31.797 4.113   1.00 16.60 ? 104 ILE A N   1 
ATOM   678  C  CA  . ILE A 1 104 ? 11.466 30.762 4.184   1.00 16.51 ? 104 ILE A CA  1 
ATOM   679  C  C   . ILE A 1 104 ? 12.719 31.390 3.581   1.00 15.47 ? 104 ILE A C   1 
ATOM   680  O  O   . ILE A 1 104 ? 12.770 31.696 2.380   1.00 15.66 ? 104 ILE A O   1 
ATOM   681  C  CB  . ILE A 1 104 ? 11.088 29.457 3.436   1.00 16.01 ? 104 ILE A CB  1 
ATOM   682  C  CG1 . ILE A 1 104 ? 9.792  28.847 4.003   1.00 17.03 ? 104 ILE A CG1 1 
ATOM   683  C  CG2 . ILE A 1 104 ? 12.227 28.420 3.529   1.00 16.48 ? 104 ILE A CG2 1 
ATOM   684  C  CD1 . ILE A 1 104 ? 9.294  27.624 3.212   1.00 17.54 ? 104 ILE A CD1 1 
ATOM   685  N  N   . ASN A 1 105 ? 13.733 31.588 4.411   1.00 15.33 ? 105 ASN A N   1 
ATOM   686  C  CA  . ASN A 1 105 ? 14.982 32.217 3.964   1.00 14.77 ? 105 ASN A CA  1 
ATOM   687  C  C   . ASN A 1 105 ? 16.004 31.129 3.740   1.00 14.20 ? 105 ASN A C   1 
ATOM   688  O  O   . ASN A 1 105 ? 16.254 30.341 4.630   1.00 14.29 ? 105 ASN A O   1 
ATOM   689  C  CB  . ASN A 1 105 ? 15.487 33.206 5.003   1.00 15.69 ? 105 ASN A CB  1 
ATOM   690  C  CG  . ASN A 1 105 ? 14.521 34.342 5.219   1.00 17.59 ? 105 ASN A CG  1 
ATOM   691  O  OD1 . ASN A 1 105 ? 13.971 34.870 4.251   1.00 21.13 ? 105 ASN A OD1 1 
ATOM   692  N  ND2 . ASN A 1 105 ? 14.289 34.711 6.480   1.00 20.91 ? 105 ASN A ND2 1 
ATOM   693  N  N   . THR A 1 106 ? 16.561 31.084 2.535   1.00 13.38 ? 106 THR A N   1 
ATOM   694  C  CA  . THR A 1 106 ? 17.457 30.009 2.153   1.00 13.17 ? 106 THR A CA  1 
ATOM   695  C  C   . THR A 1 106 ? 18.750 30.491 1.520   1.00 12.46 ? 106 THR A C   1 
ATOM   696  O  O   . THR A 1 106 ? 18.854 31.602 0.975   1.00 12.09 ? 106 THR A O   1 
ATOM   697  C  CB  . THR A 1 106 ? 16.812 29.047 1.134   1.00 13.02 ? 106 THR A CB  1 
ATOM   698  O  OG1 . THR A 1 106 ? 16.716 29.689 -0.146  1.00 13.28 ? 106 THR A OG1 1 
ATOM   699  C  CG2 . THR A 1 106 ? 15.434 28.551 1.599   1.00 14.11 ? 106 THR A CG2 1 
ATOM   700  N  N   . GLN A 1 107 ? 19.727 29.608 1.603   1.00 12.42 ? 107 GLN A N   1 
ATOM   701  C  CA  . GLN A 1 107 ? 20.905 29.636 0.753   1.00 12.96 ? 107 GLN A CA  1 
ATOM   702  C  C   . GLN A 1 107 ? 20.897 28.327 -0.026  1.00 12.34 ? 107 GLN A C   1 
ATOM   703  O  O   . GLN A 1 107 ? 20.364 27.320 0.446   1.00 12.24 ? 107 GLN A O   1 
ATOM   704  C  CB  . GLN A 1 107 ? 22.138 29.780 1.613   1.00 13.98 ? 107 GLN A CB  1 
ATOM   705  C  CG  A GLN A 1 107 ? 22.085 31.142 2.328   0.50 14.31 ? 107 GLN A CG  1 
ATOM   706  C  CG  B GLN A 1 107 ? 22.257 31.111 2.285   0.50 16.00 ? 107 GLN A CG  1 
ATOM   707  C  CD  A GLN A 1 107 ? 23.395 31.584 2.936   0.50 13.45 ? 107 GLN A CD  1 
ATOM   708  C  CD  B GLN A 1 107 ? 23.401 31.923 1.728   0.50 17.69 ? 107 GLN A CD  1 
ATOM   709  O  OE1 A GLN A 1 107 ? 24.298 32.018 2.229   0.50 15.18 ? 107 GLN A OE1 1 
ATOM   710  O  OE1 B GLN A 1 107 ? 23.635 31.968 0.512   0.50 19.09 ? 107 GLN A OE1 1 
ATOM   711  N  NE2 A GLN A 1 107 ? 23.502 31.477 4.258   0.50 13.14 ? 107 GLN A NE2 1 
ATOM   712  N  NE2 B GLN A 1 107 ? 24.125 32.572 2.611   0.50 19.59 ? 107 GLN A NE2 1 
ATOM   713  N  N   . TRP A 1 108 ? 21.437 28.354 -1.239  1.00 11.82 ? 108 TRP A N   1 
ATOM   714  C  CA  . TRP A 1 108 ? 21.415 27.163 -2.075  1.00 12.02 ? 108 TRP A CA  1 
ATOM   715  C  C   . TRP A 1 108 ? 22.738 26.889 -2.750  1.00 11.65 ? 108 TRP A C   1 
ATOM   716  O  O   . TRP A 1 108 ? 23.540 27.800 -2.953  1.00 12.27 ? 108 TRP A O   1 
ATOM   717  C  CB  . TRP A 1 108 ? 20.279 27.208 -3.108  1.00 12.30 ? 108 TRP A CB  1 
ATOM   718  C  CG  . TRP A 1 108 ? 20.225 28.429 -4.000  1.00 12.57 ? 108 TRP A CG  1 
ATOM   719  C  CD1 . TRP A 1 108 ? 19.371 29.488 -3.877  1.00 13.33 ? 108 TRP A CD1 1 
ATOM   720  C  CD2 . TRP A 1 108 ? 20.995 28.673 -5.184  1.00 12.04 ? 108 TRP A CD2 1 
ATOM   721  N  NE1 . TRP A 1 108 ? 19.581 30.388 -4.893  1.00 13.69 ? 108 TRP A NE1 1 
ATOM   722  C  CE2 . TRP A 1 108 ? 20.573 29.917 -5.710  1.00 12.53 ? 108 TRP A CE2 1 
ATOM   723  C  CE3 . TRP A 1 108 ? 22.006 27.975 -5.841  1.00 13.00 ? 108 TRP A CE3 1 
ATOM   724  C  CZ2 . TRP A 1 108 ? 21.138 30.474 -6.863  1.00 12.54 ? 108 TRP A CZ2 1 
ATOM   725  C  CZ3 . TRP A 1 108 ? 22.576 28.535 -6.985  1.00 12.99 ? 108 TRP A CZ3 1 
ATOM   726  C  CH2 . TRP A 1 108 ? 22.134 29.767 -7.485  1.00 12.86 ? 108 TRP A CH2 1 
ATOM   727  N  N   . LEU A 1 109 ? 22.941 25.616 -3.083  1.00 11.77 ? 109 LEU A N   1 
ATOM   728  C  CA  . LEU A 1 109 ? 24.093 25.124 -3.840  1.00 11.94 ? 109 LEU A CA  1 
ATOM   729  C  C   . LEU A 1 109 ? 23.576 24.346 -5.052  1.00 12.28 ? 109 LEU A C   1 
ATOM   730  O  O   . LEU A 1 109 ? 22.821 23.389 -4.897  1.00 12.74 ? 109 LEU A O   1 
ATOM   731  C  CB  . LEU A 1 109 ? 24.939 24.162 -3.008  1.00 12.48 ? 109 LEU A CB  1 
ATOM   732  C  CG  . LEU A 1 109 ? 25.638 24.718 -1.767  1.00 12.68 ? 109 LEU A CG  1 
ATOM   733  C  CD1 . LEU A 1 109 ? 26.182 23.548 -0.956  1.00 12.54 ? 109 LEU A CD1 1 
ATOM   734  C  CD2 . LEU A 1 109 ? 26.729 25.731 -2.142  1.00 14.35 ? 109 LEU A CD2 1 
ATOM   735  N  N   . LEU A 1 110 ? 23.982 24.765 -6.238  1.00 11.91 ? 110 LEU A N   1 
ATOM   736  C  CA  . LEU A 1 110 ? 23.605 24.101 -7.494  1.00 12.56 ? 110 LEU A CA  1 
ATOM   737  C  C   . LEU A 1 110 ? 24.858 23.453 -8.060  1.00 12.77 ? 110 LEU A C   1 
ATOM   738  O  O   . LEU A 1 110 ? 25.798 24.141 -8.454  1.00 12.86 ? 110 LEU A O   1 
ATOM   739  C  CB  . LEU A 1 110 ? 22.989 25.112 -8.468  1.00 13.06 ? 110 LEU A CB  1 
ATOM   740  C  CG  . LEU A 1 110 ? 22.493 24.632 -9.832  1.00 13.38 ? 110 LEU A CG  1 
ATOM   741  C  CD1 . LEU A 1 110 ? 21.659 25.733 -10.484 1.00 15.20 ? 110 LEU A CD1 1 
ATOM   742  C  CD2 . LEU A 1 110 ? 23.597 24.161 -10.761 1.00 15.00 ? 110 LEU A CD2 1 
ATOM   743  N  N   . THR A 1 111 ? 24.883 22.124 -8.062  1.00 13.41 ? 111 THR A N   1 
ATOM   744  C  CA  . THR A 1 111 ? 26.001 21.371 -8.625  1.00 13.43 ? 111 THR A CA  1 
ATOM   745  C  C   . THR A 1 111 ? 25.619 20.798 -9.969  1.00 14.12 ? 111 THR A C   1 
ATOM   746  O  O   . THR A 1 111 ? 24.570 20.162 -10.097 1.00 13.91 ? 111 THR A O   1 
ATOM   747  C  CB  . THR A 1 111 ? 26.463 20.220 -7.696  1.00 13.55 ? 111 THR A CB  1 
ATOM   748  O  OG1 . THR A 1 111 ? 26.743 20.741 -6.385  1.00 13.01 ? 111 THR A OG1 1 
ATOM   749  C  CG2 . THR A 1 111 ? 27.731 19.558 -8.244  1.00 14.33 ? 111 THR A CG2 1 
ATOM   750  N  N   . LYS A 1 112 ? 26.493 21.012 -10.949 1.00 14.37 ? 112 LYS A N   1 
ATOM   751  C  CA  . LYS A 1 112 ? 26.337 20.425 -12.274 1.00 15.38 ? 112 LYS A CA  1 
ATOM   752  C  C   . LYS A 1 112 ? 27.260 19.208 -12.377 1.00 15.33 ? 112 LYS A C   1 
ATOM   753  O  O   . LYS A 1 112 ? 28.321 19.179 -11.770 1.00 15.22 ? 112 LYS A O   1 
ATOM   754  C  CB  . LYS A 1 112 ? 26.630 21.455 -13.367 1.00 16.80 ? 112 LYS A CB  1 
ATOM   755  C  CG  . LYS A 1 112 ? 28.043 21.877 -13.579 0.50 17.33 ? 112 LYS A CG  1 
ATOM   756  C  CD  . LYS A 1 112 ? 28.089 22.942 -14.697 0.50 17.53 ? 112 LYS A CD  1 
ATOM   757  C  CE  . LYS A 1 112 ? 29.468 23.550 -14.868 0.50 18.64 ? 112 LYS A CE  1 
ATOM   758  N  NZ  . LYS A 1 112 ? 29.487 24.548 -15.988 0.50 20.22 ? 112 LYS A NZ  1 
ATOM   759  N  N   . GLY A 1 113 ? 26.844 18.189 -13.122 1.00 15.89 ? 113 GLY A N   1 
ATOM   760  C  CA  . GLY A 1 113 ? 27.757 17.103 -13.452 1.00 16.76 ? 113 GLY A CA  1 
ATOM   761  C  C   . GLY A 1 113 ? 28.846 17.630 -14.374 1.00 17.22 ? 113 GLY A C   1 
ATOM   762  O  O   . GLY A 1 113 ? 28.547 18.270 -15.381 1.00 18.31 ? 113 GLY A O   1 
ATOM   763  N  N   . THR A 1 114 ? 30.108 17.397 -14.022 1.00 17.62 ? 114 THR A N   1 
ATOM   764  C  CA  . THR A 1 114 ? 31.242 17.891 -14.806 1.00 18.25 ? 114 THR A CA  1 
ATOM   765  C  C   . THR A 1 114 ? 32.282 16.796 -15.006 1.00 18.83 ? 114 THR A C   1 
ATOM   766  O  O   . THR A 1 114 ? 32.284 15.779 -14.311 1.00 18.39 ? 114 THR A O   1 
ATOM   767  C  CB  . THR A 1 114 ? 31.968 19.073 -14.115 1.00 17.68 ? 114 THR A CB  1 
ATOM   768  O  OG1 . THR A 1 114 ? 32.689 18.603 -12.961 1.00 17.14 ? 114 THR A OG1 1 
ATOM   769  C  CG2 . THR A 1 114 ? 30.985 20.179 -13.696 1.00 16.78 ? 114 THR A CG2 1 
ATOM   770  N  N   . THR A 1 115 ? 33.184 17.028 -15.957 1.00 19.46 ? 115 THR A N   1 
ATOM   771  C  CA  . THR A 1 115 ? 34.392 16.232 -16.038 1.00 20.57 ? 115 THR A CA  1 
ATOM   772  C  C   . THR A 1 115 ? 35.291 16.588 -14.844 1.00 20.79 ? 115 THR A C   1 
ATOM   773  O  O   . THR A 1 115 ? 35.092 17.620 -14.191 1.00 19.93 ? 115 THR A O   1 
ATOM   774  C  CB  . THR A 1 115 ? 35.130 16.514 -17.352 1.00 20.98 ? 115 THR A CB  1 
ATOM   775  O  OG1 . THR A 1 115 ? 35.512 17.894 -17.383 1.00 22.58 ? 115 THR A OG1 1 
ATOM   776  C  CG2 . THR A 1 115 ? 34.225 16.201 -18.550 1.00 22.67 ? 115 THR A CG2 1 
ATOM   777  N  N   . GLU A 1 116 ? 36.276 15.744 -14.550 1.00 21.52 ? 116 GLU A N   1 
ATOM   778  C  CA  . GLU A 1 116 ? 37.180 16.020 -13.446 1.00 22.35 ? 116 GLU A CA  1 
ATOM   779  C  C   . GLU A 1 116 ? 37.935 17.334 -13.678 1.00 22.07 ? 116 GLU A C   1 
ATOM   780  O  O   . GLU A 1 116 ? 38.104 18.128 -12.738 1.00 22.23 ? 116 GLU A O   1 
ATOM   781  C  CB  . GLU A 1 116 ? 38.118 14.825 -13.206 1.00 23.01 ? 116 GLU A CB  1 
ATOM   782  C  CG  . GLU A 1 116 ? 37.341 13.633 -12.613 0.50 23.69 ? 116 GLU A CG  1 
ATOM   783  C  CD  . GLU A 1 116 ? 38.186 12.401 -12.342 0.50 24.52 ? 116 GLU A CD  1 
ATOM   784  O  OE1 . GLU A 1 116 ? 37.720 11.286 -12.664 0.50 26.60 ? 116 GLU A OE1 1 
ATOM   785  O  OE2 . GLU A 1 116 ? 39.302 12.541 -11.801 0.50 27.96 ? 116 GLU A OE2 1 
ATOM   786  N  N   . ALA A 1 117 ? 38.327 17.590 -14.931 1.00 22.04 ? 117 ALA A N   1 
ATOM   787  C  CA  . ALA A 1 117 ? 39.012 18.843 -15.306 1.00 21.65 ? 117 ALA A CA  1 
ATOM   788  C  C   . ALA A 1 117 ? 38.207 20.104 -14.978 1.00 21.38 ? 117 ALA A C   1 
ATOM   789  O  O   . ALA A 1 117 ? 38.790 21.146 -14.662 1.00 22.48 ? 117 ALA A O   1 
ATOM   790  C  CB  . ALA A 1 117 ? 39.375 18.840 -16.801 1.00 22.51 ? 117 ALA A CB  1 
ATOM   791  N  N   . ASN A 1 118 ? 36.880 20.007 -15.050 1.00 19.89 ? 118 ASN A N   1 
ATOM   792  C  CA  . ASN A 1 118 ? 36.003 21.154 -14.805 1.00 19.22 ? 118 ASN A CA  1 
ATOM   793  C  C   . ASN A 1 118 ? 35.332 21.147 -13.436 1.00 18.24 ? 118 ASN A C   1 
ATOM   794  O  O   . ASN A 1 118 ? 34.478 21.979 -13.171 1.00 16.81 ? 118 ASN A O   1 
ATOM   795  C  CB  . ASN A 1 118 ? 34.936 21.235 -15.881 1.00 19.33 ? 118 ASN A CB  1 
ATOM   796  C  CG  . ASN A 1 118 ? 35.525 21.530 -17.248 1.00 21.42 ? 118 ASN A CG  1 
ATOM   797  O  OD1 . ASN A 1 118 ? 36.496 22.266 -17.357 1.00 22.28 ? 118 ASN A OD1 1 
ATOM   798  N  ND2 . ASN A 1 118 ? 34.954 20.935 -18.285 1.00 23.67 ? 118 ASN A ND2 1 
ATOM   799  N  N   . ALA A 1 119 ? 35.714 20.214 -12.578 1.00 17.59 ? 119 ALA A N   1 
ATOM   800  C  CA  . ALA A 1 119 ? 35.073 20.076 -11.271 1.00 17.13 ? 119 ALA A CA  1 
ATOM   801  C  C   . ALA A 1 119 ? 35.191 21.325 -10.410 1.00 16.58 ? 119 ALA A C   1 
ATOM   802  O  O   . ALA A 1 119 ? 34.312 21.589 -9.588  1.00 16.45 ? 119 ALA A O   1 
ATOM   803  C  CB  . ALA A 1 119 ? 35.638 18.874 -10.528 1.00 17.42 ? 119 ALA A CB  1 
ATOM   804  N  N   . TRP A 1 120 ? 36.258 22.102 -10.604 1.00 16.39 ? 120 TRP A N   1 
ATOM   805  C  CA  . TRP A 1 120 ? 36.453 23.325 -9.829  1.00 15.87 ? 120 TRP A CA  1 
ATOM   806  C  C   . TRP A 1 120 ? 35.345 24.348 -10.060 1.00 15.40 ? 120 TRP A C   1 
ATOM   807  O  O   . TRP A 1 120 ? 35.117 25.199 -9.197  1.00 15.28 ? 120 TRP A O   1 
ATOM   808  C  CB  . TRP A 1 120 ? 37.815 23.957 -10.133 1.00 16.17 ? 120 TRP A CB  1 
ATOM   809  C  CG  . TRP A 1 120 ? 37.922 24.482 -11.505 1.00 15.80 ? 120 TRP A CG  1 
ATOM   810  C  CD1 . TRP A 1 120 ? 38.294 23.792 -12.624 1.00 16.49 ? 120 TRP A CD1 1 
ATOM   811  C  CD2 . TRP A 1 120 ? 37.626 25.814 -11.936 1.00 16.30 ? 120 TRP A CD2 1 
ATOM   812  N  NE1 . TRP A 1 120 ? 38.254 24.610 -13.717 1.00 16.68 ? 120 TRP A NE1 1 
ATOM   813  C  CE2 . TRP A 1 120 ? 37.840 25.857 -13.330 1.00 16.52 ? 120 TRP A CE2 1 
ATOM   814  C  CE3 . TRP A 1 120 ? 37.188 26.977 -11.281 1.00 16.97 ? 120 TRP A CE3 1 
ATOM   815  C  CZ2 . TRP A 1 120 ? 37.649 27.026 -14.081 1.00 17.12 ? 120 TRP A CZ2 1 
ATOM   816  C  CZ3 . TRP A 1 120 ? 36.999 28.128 -12.027 1.00 16.22 ? 120 TRP A CZ3 1 
ATOM   817  C  CH2 . TRP A 1 120 ? 37.228 28.145 -13.414 1.00 16.82 ? 120 TRP A CH2 1 
ATOM   818  N  N   . LYS A 1 121 ? 34.689 24.287 -11.221 1.00 14.85 ? 121 LYS A N   1 
ATOM   819  C  CA  . LYS A 1 121 ? 33.581 25.203 -11.544 1.00 15.97 ? 121 LYS A CA  1 
ATOM   820  C  C   . LYS A 1 121 ? 32.227 24.503 -11.584 1.00 15.35 ? 121 LYS A C   1 
ATOM   821  O  O   . LYS A 1 121 ? 31.316 24.940 -12.298 1.00 15.52 ? 121 LYS A O   1 
ATOM   822  C  CB  . LYS A 1 121 ? 33.846 25.957 -12.853 1.00 16.94 ? 121 LYS A CB  1 
ATOM   823  C  CG  . LYS A 1 121 ? 34.087 25.094 -14.057 1.00 17.86 ? 121 LYS A CG  1 
ATOM   824  C  CD  . LYS A 1 121 ? 34.358 25.952 -15.289 1.00 18.92 ? 121 LYS A CD  1 
ATOM   825  C  CE  . LYS A 1 121 ? 34.646 25.097 -16.477 1.00 20.85 ? 121 LYS A CE  1 
ATOM   826  N  NZ  . LYS A 1 121 ? 34.842 25.877 -17.729 1.00 23.20 ? 121 LYS A NZ  1 
ATOM   827  N  N   . SER A 1 122 ? 32.079 23.451 -10.778 1.00 14.41 ? 122 SER A N   1 
ATOM   828  C  CA  . SER A 1 122 ? 30.851 22.645 -10.794 1.00 14.16 ? 122 SER A CA  1 
ATOM   829  C  C   . SER A 1 122 ? 29.694 23.278 -10.017 1.00 13.40 ? 122 SER A C   1 
ATOM   830  O  O   . SER A 1 122 ? 28.541 22.913 -10.232 1.00 13.60 ? 122 SER A O   1 
ATOM   831  C  CB  . SER A 1 122 ? 31.113 21.268 -10.188 1.00 14.35 ? 122 SER A CB  1 
ATOM   832  O  OG  . SER A 1 122 ? 31.410 21.380 -8.803  1.00 15.69 ? 122 SER A OG  1 
ATOM   833  N  N   . THR A 1 123 ? 29.989 24.176 -9.078  1.00 12.55 ? 123 THR A N   1 
ATOM   834  C  CA  . THR A 1 123 ? 28.979 24.544 -8.080  1.00 12.56 ? 123 THR A CA  1 
ATOM   835  C  C   . THR A 1 123 ? 28.725 26.061 -7.988  1.00 12.84 ? 123 THR A C   1 
ATOM   836  O  O   . THR A 1 123 ? 29.641 26.844 -7.710  1.00 13.33 ? 123 THR A O   1 
ATOM   837  C  CB  . THR A 1 123 ? 29.389 24.049 -6.676  1.00 12.42 ? 123 THR A CB  1 
ATOM   838  O  OG1 . THR A 1 123 ? 29.871 22.696 -6.753  1.00 13.68 ? 123 THR A OG1 1 
ATOM   839  C  CG2 . THR A 1 123 ? 28.199 24.144 -5.699  1.00 12.56 ? 123 THR A CG2 1 
ATOM   840  N  N   . LEU A 1 124 ? 27.474 26.436 -8.227  1.00 13.01 ? 124 LEU A N   1 
ATOM   841  C  CA  . LEU A 1 124 ? 26.955 27.784 -7.991  1.00 12.85 ? 124 LEU A CA  1 
ATOM   842  C  C   . LEU A 1 124 ? 26.361 27.879 -6.585  1.00 12.80 ? 124 LEU A C   1 
ATOM   843  O  O   . LEU A 1 124 ? 25.808 26.895 -6.051  1.00 12.71 ? 124 LEU A O   1 
ATOM   844  C  CB  . LEU A 1 124 ? 25.855 28.135 -8.997  1.00 13.73 ? 124 LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 124 ? 26.288 28.351 -10.445 1.00 15.16 ? 124 LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 124 ? 25.073 28.380 -11.367 1.00 17.32 ? 124 LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 124 ? 27.108 29.620 -10.587 1.00 16.67 ? 124 LEU A CD2 1 
ATOM   848  N  N   . VAL A 1 125 ? 26.457 29.073 -6.009  1.00 12.40 ? 125 VAL A N   1 
ATOM   849  C  CA  . VAL A 1 125 ? 25.879 29.370 -4.703  1.00 12.22 ? 125 VAL A CA  1 
ATOM   850  C  C   . VAL A 1 125 ? 25.027 30.624 -4.824  1.00 11.63 ? 125 VAL A C   1 
ATOM   851  O  O   . VAL A 1 125 ? 25.369 31.563 -5.553  1.00 11.80 ? 125 VAL A O   1 
ATOM   852  C  CB  . VAL A 1 125 ? 26.951 29.552 -3.610  1.00 12.35 ? 125 VAL A CB  1 
ATOM   853  C  CG1 . VAL A 1 125 ? 27.888 30.726 -3.919  1.00 13.26 ? 125 VAL A CG1 1 
ATOM   854  C  CG2 . VAL A 1 125 ? 26.292 29.702 -2.233  1.00 12.39 ? 125 VAL A CG2 1 
ATOM   855  N  N   . GLY A 1 126 ? 23.900 30.619 -4.129  1.00 11.74 ? 126 GLY A N   1 
ATOM   856  C  CA  . GLY A 1 126 ? 23.005 31.759 -4.117  1.00 12.21 ? 126 GLY A CA  1 
ATOM   857  C  C   . GLY A 1 126 ? 22.104 31.753 -2.908  1.00 12.33 ? 126 GLY A C   1 
ATOM   858  O  O   . GLY A 1 126 ? 22.295 30.984 -1.964  1.00 12.30 ? 126 GLY A O   1 
ATOM   859  N  N   . HIS A 1 127 ? 21.131 32.651 -2.940  1.00 12.84 ? 127 HIS A N   1 
ATOM   860  C  CA  . HIS A 1 127 ? 20.206 32.814 -1.826  1.00 12.77 ? 127 HIS A CA  1 
ATOM   861  C  C   . HIS A 1 127 ? 18.828 33.206 -2.353  1.00 13.14 ? 127 HIS A C   1 
ATOM   862  O  O   . HIS A 1 127 ? 18.717 34.123 -3.184  1.00 13.40 ? 127 HIS A O   1 
ATOM   863  C  CB  . HIS A 1 127 ? 20.742 33.831 -0.828  1.00 13.74 ? 127 HIS A CB  1 
ATOM   864  C  CG  . HIS A 1 127 ? 21.192 35.114 -1.451  1.00 14.69 ? 127 HIS A CG  1 
ATOM   865  N  ND1 . HIS A 1 127 ? 20.394 36.238 -1.491  1.00 17.31 ? 127 HIS A ND1 1 
ATOM   866  C  CD2 . HIS A 1 127 ? 22.347 35.448 -2.078  1.00 16.07 ? 127 HIS A CD2 1 
ATOM   867  C  CE1 . HIS A 1 127 ? 21.043 37.214 -2.104  1.00 17.83 ? 127 HIS A CE1 1 
ATOM   868  N  NE2 . HIS A 1 127 ? 22.229 36.762 -2.475  1.00 17.68 ? 127 HIS A NE2 1 
ATOM   869  N  N   . ASP A 1 128 ? 17.814 32.469 -1.896  1.00 13.11 ? 128 ASP A N   1 
ATOM   870  C  CA  . ASP A 1 128 ? 16.411 32.710 -2.267  1.00 13.70 ? 128 ASP A CA  1 
ATOM   871  C  C   . ASP A 1 128 ? 15.574 32.958 -1.017  1.00 14.22 ? 128 ASP A C   1 
ATOM   872  O  O   . ASP A 1 128 ? 15.706 32.241 -0.021  1.00 13.59 ? 128 ASP A O   1 
ATOM   873  C  CB  . ASP A 1 128 ? 15.811 31.494 -2.953  1.00 13.44 ? 128 ASP A CB  1 
ATOM   874  C  CG  . ASP A 1 128 ? 16.344 31.248 -4.359  1.00 13.49 ? 128 ASP A CG  1 
ATOM   875  O  OD1 . ASP A 1 128 ? 17.080 32.080 -4.917  1.00 14.32 ? 128 ASP A OD1 1 
ATOM   876  O  OD2 . ASP A 1 128 ? 15.989 30.183 -4.902  1.00 13.33 ? 128 ASP A OD2 1 
ATOM   877  N  N   . THR A 1 129 ? 14.676 33.942 -1.093  1.00 14.97 ? 129 THR A N   1 
ATOM   878  C  CA  . THR A 1 129 ? 13.709 34.166 -0.026  1.00 15.73 ? 129 THR A CA  1 
ATOM   879  C  C   . THR A 1 129 ? 12.330 33.895 -0.598  1.00 15.35 ? 129 THR A C   1 
ATOM   880  O  O   . THR A 1 129 ? 11.985 34.432 -1.654  1.00 15.70 ? 129 THR A O   1 
ATOM   881  C  CB  . THR A 1 129 ? 13.775 35.577 0.559   1.00 17.05 ? 129 THR A CB  1 
ATOM   882  O  OG1 . THR A 1 129 ? 15.097 35.825 1.040   1.00 23.20 ? 129 THR A OG1 1 
ATOM   883  C  CG2 . THR A 1 129 ? 12.804 35.717 1.727   1.00 16.59 ? 129 THR A CG2 1 
ATOM   884  N  N   . PHE A 1 130 ? 11.593 33.039 0.098   1.00 15.07 ? 130 PHE A N   1 
ATOM   885  C  CA  . PHE A 1 130 ? 10.260 32.592 -0.296  1.00 16.03 ? 130 PHE A CA  1 
ATOM   886  C  C   . PHE A 1 130 ? 9.205  33.225 0.598   1.00 16.92 ? 130 PHE A C   1 
ATOM   887  O  O   . PHE A 1 130 ? 9.367  33.285 1.826   1.00 16.74 ? 130 PHE A O   1 
ATOM   888  C  CB  . PHE A 1 130 ? 10.153 31.072 -0.175  1.00 15.36 ? 130 PHE A CB  1 
ATOM   889  C  CG  . PHE A 1 130 ? 11.047 30.320 -1.121  1.00 14.48 ? 130 PHE A CG  1 
ATOM   890  C  CD1 . PHE A 1 130 ? 12.356 30.025 -0.769  1.00 14.99 ? 130 PHE A CD1 1 
ATOM   891  C  CD2 . PHE A 1 130 ? 10.586 29.916 -2.378  1.00 14.80 ? 130 PHE A CD2 1 
ATOM   892  C  CE1 . PHE A 1 130 ? 13.191 29.347 -1.641  1.00 14.74 ? 130 PHE A CE1 1 
ATOM   893  C  CE2 . PHE A 1 130 ? 11.413 29.249 -3.246  1.00 14.11 ? 130 PHE A CE2 1 
ATOM   894  C  CZ  . PHE A 1 130 ? 12.730 28.962 -2.877  1.00 14.56 ? 130 PHE A CZ  1 
ATOM   895  N  N   . THR A 1 131 ? 8.127  33.695 -0.030  1.00 18.30 ? 131 THR A N   1 
ATOM   896  C  CA  . THR A 1 131 ? 6.983  34.243 0.694   1.00 20.05 ? 131 THR A CA  1 
ATOM   897  C  C   . THR A 1 131 ? 5.716  33.618 0.130   1.00 21.35 ? 131 THR A C   1 
ATOM   898  O  O   . THR A 1 131 ? 5.746  32.983 -0.925  1.00 19.22 ? 131 THR A O   1 
ATOM   899  C  CB  . THR A 1 131 ? 6.918  35.778 0.583   1.00 20.26 ? 131 THR A CB  1 
ATOM   900  O  OG1 . THR A 1 131 ? 6.737  36.141 -0.783  1.00 22.99 ? 131 THR A OG1 1 
ATOM   901  C  CG2 . THR A 1 131 ? 8.213  36.419 1.109   1.00 20.33 ? 131 THR A CG2 1 
ATOM   902  N  N   . LYS A 1 132 ? 4.618  33.795 0.862   1.00 23.67 ? 132 LYS A N   1 
ATOM   903  C  CA  . LYS A 1 132 ? 3.324  33.199 0.499   1.00 26.13 ? 132 LYS A CA  1 
ATOM   904  C  C   . LYS A 1 132 ? 2.594  33.976 -0.582  1.00 28.09 ? 132 LYS A C   1 
ATOM   905  O  O   . LYS A 1 132 ? 1.637  33.463 -1.169  1.00 28.46 ? 132 LYS A O   1 
ATOM   906  C  CB  . LYS A 1 132 ? 2.417  33.106 1.730   1.00 26.36 ? 132 LYS A CB  1 
ATOM   907  C  CG  . LYS A 1 132 ? 2.965  32.248 2.831   1.00 28.66 ? 132 LYS A CG  1 
ATOM   908  C  CD  . LYS A 1 132 ? 3.031  30.790 2.456   1.00 29.95 ? 132 LYS A CD  1 
ATOM   909  C  CE  . LYS A 1 132 ? 1.683  30.136 2.450   1.00 31.17 ? 132 LYS A CE  1 
ATOM   910  N  NZ  . LYS A 1 132 ? 1.801  28.744 1.900   1.00 31.44 ? 132 LYS A NZ  1 
ATOM   911  N  N   . VAL A 1 133 ? 3.041  35.202 -0.831  1.00 30.30 ? 133 VAL A N   1 
ATOM   912  C  CA  . VAL A 1 133 ? 2.464  36.064 -1.856  1.00 32.26 ? 133 VAL A CA  1 
ATOM   913  C  C   . VAL A 1 133 ? 3.550  36.360 -2.887  1.00 33.75 ? 133 VAL A C   1 
ATOM   914  O  O   . VAL A 1 133 ? 4.727  36.426 -2.535  1.00 35.05 ? 133 VAL A O   1 
ATOM   915  C  CB  . VAL A 1 133 ? 1.915  37.383 -1.236  1.00 32.64 ? 133 VAL A CB  1 
ATOM   916  C  CG1 . VAL A 1 133 ? 1.167  37.096 0.082   1.00 33.75 ? 133 VAL A CG1 1 
ATOM   917  C  CG2 . VAL A 1 133 ? 3.033  38.399 -1.001  1.00 33.64 ? 133 VAL A CG2 1 
ATOM   918  N  N   . LYS A 1 134 ? 3.153  36.494 -4.153  1.00 35.47 ? 134 LYS A N   1 
ATOM   919  C  CA  . LYS A 1 134 ? 4.036  36.908 -5.266  1.00 35.74 ? 134 LYS A CA  1 
ATOM   920  C  C   . LYS A 1 134 ? 4.278  35.762 -6.235  1.00 36.56 ? 134 LYS A C   1 
ATOM   921  O  O   . LYS A 1 134 ? 3.521  35.579 -7.198  1.00 37.62 ? 134 LYS A O   1 
ATOM   922  C  CB  . LYS A 1 134 ? 5.371  37.489 -4.770  1.00 36.75 ? 134 LYS A CB  1 
ATOM   923  C  CG  . LYS A 1 134 ? 6.252  38.073 -5.854  1.00 37.08 ? 134 LYS A CG  1 
ATOM   924  C  CD  . LYS A 1 134 ? 7.265  37.055 -6.406  1.00 38.43 ? 134 LYS A CD  1 
ATOM   925  C  CE  . LYS A 1 134 ? 8.494  37.763 -6.958  1.00 39.07 ? 134 LYS A CE  1 
ATOM   926  N  NZ  . LYS A 1 134 ? 8.157  39.072 -7.593  1.00 40.89 ? 134 LYS A NZ  1 
HETATM 927  O  O56 . KYS B 2 .   ? 14.294 29.446 -8.243  1.00 14.77 ? 400 KYS A O56 1 
HETATM 928  C  C54 . KYS B 2 .   ? 15.490 29.370 -8.507  1.00 14.16 ? 400 KYS A C54 1 
HETATM 929  N  N55 . KYS B 2 .   ? 16.488 29.512 -7.634  1.00 14.17 ? 400 KYS A N55 1 
HETATM 930  C  C50 . KYS B 2 .   ? 17.796 29.368 -8.226  1.00 13.56 ? 400 KYS A C50 1 
HETATM 931  C  C51 . KYS B 2 .   ? 18.542 28.150 -7.698  1.00 15.05 ? 400 KYS A C51 1 
HETATM 932  S  S52 . KYS B 2 .   ? 17.947 26.757 -8.617  1.00 14.00 ? 400 KYS A S52 1 
HETATM 933  N  N53 . KYS B 2 .   ? 16.031 29.156 -9.709  1.00 13.91 ? 400 KYS A N53 1 
HETATM 934  C  C49 . KYS B 2 .   ? 17.483 29.119 -9.702  1.00 13.93 ? 400 KYS A C49 1 
HETATM 935  C  C48 . KYS B 2 .   ? 18.092 27.763 -10.076 1.00 13.98 ? 400 KYS A C48 1 
HETATM 936  C  C47 . KYS B 2 .   ? 17.454 27.100 -11.305 1.00 13.51 ? 400 KYS A C47 1 
HETATM 937  C  C46 . KYS B 2 .   ? 18.322 26.015 -11.943 1.00 13.77 ? 400 KYS A C46 1 
HETATM 938  C  C45 . KYS B 2 .   ? 17.691 25.364 -13.174 1.00 14.44 ? 400 KYS A C45 1 
HETATM 939  C  C40 . KYS B 2 .   ? 18.612 24.306 -13.802 1.00 14.84 ? 400 KYS A C40 1 
HETATM 940  C  C39 . KYS B 2 .   ? 19.889 24.919 -14.349 1.00 15.40 ? 400 KYS A C39 1 
HETATM 941  O  O41 . KYS B 2 .   ? 19.777 25.932 -15.042 1.00 17.00 ? 400 KYS A O41 1 
HETATM 942  N  N19 A KYS B 2 .   ? 21.075 24.376 -14.029 0.80 18.20 ? 400 KYS A N19 1 
HETATM 943  N  N19 B KYS B 2 .   ? 21.063 24.310 -14.097 0.20 16.27 ? 400 KYS A N19 1 
HETATM 944  C  C21 A KYS B 2 .   ? 22.228 24.961 -14.455 0.40 19.30 ? 400 KYS A C21 1 
HETATM 945  C  C21 B KYS B 2 .   ? 22.240 24.770 -14.578 0.20 17.24 ? 400 KYS A C21 1 
HETATM 946  C  C22 A KYS B 2 .   ? 22.424 26.194 -14.204 0.40 20.11 ? 400 KYS A C22 1 
HETATM 947  C  C22 B KYS B 2 .   ? 22.717 25.903 -14.271 0.20 18.63 ? 400 KYS A C22 1 
HETATM 948  C  C23 A KYS B 2 .   ? 23.536 26.869 -14.594 0.40 19.12 ? 400 KYS A C23 1 
HETATM 949  C  C23 B KYS B 2 .   ? 23.899 26.338 -14.785 0.20 15.27 ? 400 KYS A C23 1 
HETATM 950  C  C20 A KYS B 2 .   ? 23.197 24.305 -15.122 0.40 20.06 ? 400 KYS A C20 1 
HETATM 951  C  C20 B KYS B 2 .   ? 22.934 23.992 -15.430 0.20 17.70 ? 400 KYS A C20 1 
HETATM 952  C  C24 A KYS B 2 .   ? 24.312 24.970 -15.506 0.40 19.20 ? 400 KYS A C24 1 
HETATM 953  C  C24 B KYS B 2 .   ? 24.099 24.419 -15.937 0.20 15.73 ? 400 KYS A C24 1 
HETATM 954  C  C33 A KYS B 2 .   ? 24.477 26.293 -15.218 0.40 20.60 ? 400 KYS A C33 1 
HETATM 955  C  C33 B KYS B 2 .   ? 24.581 25.630 -15.586 0.20 18.90 ? 400 KYS A C33 1 
HETATM 956  S  S30 A KYS B 2 .   ? 25.766 27.123 -15.688 0.40 20.33 ? 400 KYS A S30 1 
HETATM 957  S  S30 B KYS B 2 .   ? 25.949 26.164 -16.187 0.20 12.73 ? 400 KYS A S30 1 
HETATM 958  O  O31 A KYS B 2 .   ? 26.134 28.170 -14.712 0.20 21.19 ? 400 KYS A O31 1 
HETATM 959  O  O31 B KYS B 2 .   ? 26.727 26.915 -15.185 0.20 18.01 ? 400 KYS A O31 1 
HETATM 960  O  O31 C KYS B 2 .   ? 26.499 26.561 -16.835 0.20 22.10 ? 400 KYS A O31 1 
HETATM 961  O  O32 A KYS B 2 .   ? 26.898 26.189 -15.885 0.20 21.21 ? 400 KYS A O32 1 
HETATM 962  O  O32 B KYS B 2 .   ? 26.752 25.039 -16.709 0.20 16.79 ? 400 KYS A O32 1 
HETATM 963  O  O32 C KYS B 2 .   ? 25.930 28.582 -15.538 0.20 20.56 ? 400 KYS A O32 1 
HETATM 964  N  N26 A KYS B 2 .   ? 25.295 27.879 -17.078 0.20 28.10 ? 400 KYS A N26 1 
HETATM 965  N  N26 B KYS B 2 .   ? 25.597 27.151 -17.410 0.20 16.58 ? 400 KYS A N26 1 
HETATM 966  N  N26 C KYS B 2 .   ? 26.392 26.444 -14.364 0.20 22.39 ? 400 KYS A N26 1 
HETATM 967  RU RU1 A KYS B 2 .   ? 26.644 29.231 -18.100 0.20 30.62 ? 400 KYS A RU1 1 
HETATM 968  CL CL2 A KYS B 2 .   ? 28.477 28.023 -17.398 0.20 30.86 ? 400 KYS A CL2 1 
HETATM 969  C  C6  A KYS B 2 .   ? 25.766 31.011 -17.223 0.20 30.16 ? 400 KYS A C6  1 
HETATM 970  C  C7  A KYS B 2 .   ? 27.150 31.098 -17.108 0.20 30.05 ? 400 KYS A C7  1 
HETATM 971  C  C8  A KYS B 2 .   ? 27.961 30.959 -18.232 0.20 29.67 ? 400 KYS A C8  1 
HETATM 972  C  C9  A KYS B 2 .   ? 27.396 30.733 -19.483 0.20 29.74 ? 400 KYS A C9  1 
HETATM 973  C  C10 A KYS B 2 .   ? 25.917 30.635 -19.597 0.20 29.84 ? 400 KYS A C10 1 
HETATM 974  C  C5  A KYS B 2 .   ? 25.152 30.774 -18.451 0.20 30.20 ? 400 KYS A C5  1 
HETATM 975  C  C28 A KYS B 2 .   ? 24.792 26.852 -18.035 0.20 28.46 ? 400 KYS A C28 1 
HETATM 976  C  C29 A KYS B 2 .   ? 25.142 27.184 -19.493 0.20 29.36 ? 400 KYS A C29 1 
HETATM 977  N  N27 A KYS B 2 .   ? 26.530 27.645 -19.508 0.20 29.96 ? 400 KYS A N27 1 
HETATM 978  O  O   . HOH C 3 .   ? 19.648 16.723 -13.737 1.00 16.68 ? 401 HOH A O   1 
HETATM 979  O  O   . HOH C 3 .   ? 20.780 29.276 4.850   1.00 14.91 ? 402 HOH A O   1 
HETATM 980  O  O   . HOH C 3 .   ? 16.662 16.661 0.000   0.50 12.83 ? 403 HOH A O   1 
HETATM 981  O  O   . HOH C 3 .   ? 21.188 34.210 -5.407  1.00 15.46 ? 404 HOH A O   1 
HETATM 982  O  O   . HOH C 3 .   ? 15.878 20.831 -16.605 1.00 15.56 ? 405 HOH A O   1 
HETATM 983  O  O   . HOH C 3 .   ? 10.867 25.004 -14.108 1.00 18.97 ? 406 HOH A O   1 
HETATM 984  O  O   . HOH C 3 .   ? 38.879 20.674 -11.478 1.00 23.30 ? 407 HOH A O   1 
HETATM 985  O  O   . HOH C 3 .   ? 16.049 14.203 8.777   1.00 16.22 ? 408 HOH A O   1 
HETATM 986  O  O   . HOH C 3 .   ? 5.716  15.287 2.819   1.00 23.98 ? 409 HOH A O   1 
HETATM 987  O  O   . HOH C 3 .   ? 6.029  23.733 -8.356  1.00 20.54 ? 410 HOH A O   1 
HETATM 988  O  O   . HOH C 3 .   ? 12.325 16.361 11.937  1.00 18.04 ? 411 HOH A O   1 
HETATM 989  O  O   . HOH C 3 .   ? 11.280 15.716 -11.748 1.00 17.09 ? 412 HOH A O   1 
HETATM 990  O  O   . HOH C 3 .   ? 32.336 18.910 -7.849  1.00 20.32 ? 413 HOH A O   1 
HETATM 991  O  O   . HOH C 3 .   ? 17.851 36.202 -0.239  1.00 22.33 ? 414 HOH A O   1 
HETATM 992  O  O   . HOH C 3 .   ? 4.433  35.436 3.224   1.00 21.58 ? 415 HOH A O   1 
HETATM 993  O  O   . HOH C 3 .   ? 25.018 32.561 -7.993  1.00 19.04 ? 416 HOH A O   1 
HETATM 994  O  O   . HOH C 3 .   ? 32.490 19.361 -17.636 1.00 23.00 ? 417 HOH A O   1 
HETATM 995  O  O   . HOH C 3 .   ? 16.647 26.754 17.320  1.00 20.29 ? 418 HOH A O   1 
HETATM 996  O  O   . HOH C 3 .   ? 6.705  18.435 -15.103 1.00 25.41 ? 419 HOH A O   1 
HETATM 997  O  O   . HOH C 3 .   ? 17.619 18.733 -21.752 1.00 20.64 ? 420 HOH A O   1 
HETATM 998  O  O   . HOH C 3 .   ? 18.262 35.898 -7.221  1.00 19.84 ? 421 HOH A O   1 
HETATM 999  O  O   . HOH C 3 .   ? 8.110  22.344 12.673  1.00 24.95 ? 422 HOH A O   1 
HETATM 1000 O  O   . HOH C 3 .   ? 6.408  15.382 -6.024  1.00 26.76 ? 423 HOH A O   1 
HETATM 1001 O  O   . HOH C 3 .   ? 2.303  35.033 5.196   1.00 26.29 ? 424 HOH A O   1 
HETATM 1002 O  O   . HOH C 3 .   ? 7.052  29.785 -11.230 1.00 24.39 ? 425 HOH A O   1 
HETATM 1003 O  O   . HOH C 3 .   ? 24.317 37.187 -4.571  1.00 25.53 ? 426 HOH A O   1 
HETATM 1004 O  O   . HOH C 3 .   ? 38.661 15.458 -16.933 1.00 30.29 ? 427 HOH A O   1 
HETATM 1005 O  O   . HOH C 3 .   ? 14.306 25.833 16.122  1.00 19.74 ? 428 HOH A O   1 
HETATM 1006 O  O   . HOH C 3 .   ? 18.896 33.195 -6.766  1.00 15.66 ? 429 HOH A O   1 
HETATM 1007 O  O   . HOH C 3 .   ? 26.468 38.696 -5.382  1.00 20.37 ? 430 HOH A O   1 
HETATM 1008 O  O   . HOH C 3 .   ? 34.117 22.414 -6.806  1.00 20.92 ? 431 HOH A O   1 
HETATM 1009 O  O   . HOH C 3 .   ? 11.619 11.880 4.397   1.00 23.69 ? 432 HOH A O   1 
HETATM 1010 O  O   . HOH C 3 .   ? 14.470 14.294 -11.207 1.00 19.43 ? 433 HOH A O   1 
HETATM 1011 O  O   . HOH C 3 .   ? 17.809 34.119 1.780   1.00 20.81 ? 434 HOH A O   1 
HETATM 1012 O  O   . HOH C 3 .   ? 4.380  25.070 -10.135 1.00 22.28 ? 435 HOH A O   1 
HETATM 1013 O  O   . HOH C 3 .   ? 7.785  15.919 -16.070 1.00 27.99 ? 436 HOH A O   1 
HETATM 1014 O  O   . HOH C 3 .   ? 11.555 12.714 -12.099 1.00 27.63 ? 437 HOH A O   1 
HETATM 1015 O  O   . HOH C 3 .   ? 9.978  28.423 14.196  1.00 27.86 ? 438 HOH A O   1 
HETATM 1016 O  O   . HOH C 3 .   ? 41.368 20.900 -12.937 1.00 32.87 ? 439 HOH A O   1 
HETATM 1017 O  O   . HOH C 3 .   ? 10.473 36.672 -2.407  1.00 32.47 ? 440 HOH A O   1 
HETATM 1018 O  O   . HOH C 3 .   ? 38.562 23.884 -16.563 1.00 29.83 ? 441 HOH A O   1 
HETATM 1019 O  O   . HOH C 3 .   ? 4.032  27.736 12.175  1.00 33.76 ? 442 HOH A O   1 
HETATM 1020 O  O   . HOH C 3 .   ? 10.595 29.440 17.993  1.00 30.65 ? 443 HOH A O   1 
HETATM 1021 O  O   . HOH C 3 .   ? 22.404 15.644 -22.127 1.00 37.12 ? 444 HOH A O   1 
HETATM 1022 O  O   . HOH C 3 .   ? 0.000  28.825 0.446   0.50 26.88 ? 445 HOH A O   1 
HETATM 1023 O  O   . HOH C 3 .   ? 0.878  30.912 -0.994  1.00 27.34 ? 446 HOH A O   1 
HETATM 1024 O  O   . HOH C 3 .   ? 1.854  27.798 4.263   1.00 29.65 ? 447 HOH A O   1 
HETATM 1025 O  O   . HOH C 3 .   ? 1.745  26.016 -9.896  1.00 32.36 ? 448 HOH A O   1 
HETATM 1026 O  O   . HOH C 3 .   ? 2.785  29.790 -9.833  1.00 32.07 ? 449 HOH A O   1 
HETATM 1027 O  O   . HOH C 3 .   ? 0.403  30.115 -8.082  1.00 31.24 ? 450 HOH A O   1 
HETATM 1028 O  O   . HOH C 3 .   ? 19.736 36.614 -4.999  1.00 25.96 ? 451 HOH A O   1 
HETATM 1029 O  O   . HOH C 3 .   ? 39.334 19.805 -8.995  1.00 29.55 ? 452 HOH A O   1 
HETATM 1030 O  O   . HOH C 3 .   ? 15.204 38.797 -8.272  1.00 60.10 ? 453 HOH A O   1 
HETATM 1031 O  O   . HOH C 3 .   ? 17.175 27.088 19.987  1.00 37.16 ? 454 HOH A O   1 
HETATM 1032 O  O   . HOH C 3 .   ? 8.371  14.594 -3.738  1.00 38.19 ? 455 HOH A O   1 
HETATM 1033 O  O   . HOH C 3 .   ? 7.823  26.526 -16.494 1.00 31.48 ? 456 HOH A O   1 
HETATM 1034 O  O   . HOH C 3 .   ? 6.776  16.988 -11.008 1.00 32.94 ? 457 HOH A O   1 
HETATM 1035 O  O   . HOH C 3 .   ? 8.712  15.733 -12.700 1.00 33.99 ? 458 HOH A O   1 
HETATM 1036 O  O   . HOH C 3 .   ? 5.637  15.364 -8.704  1.00 34.87 ? 459 HOH A O   1 
HETATM 1037 O  O   . HOH C 3 .   ? 8.949  30.549 13.080  1.00 37.14 ? 460 HOH A O   1 
HETATM 1038 O  O   . HOH C 3 .   ? 7.849  27.358 15.534  1.00 33.52 ? 461 HOH A O   1 
HETATM 1039 O  O   . HOH C 3 .   ? 8.364  36.048 8.921   0.50 24.60 ? 462 HOH A O   1 
HETATM 1040 O  O   . HOH C 3 .   ? 16.208 37.262 3.379   1.00 75.08 ? 463 HOH A O   1 
HETATM 1041 O  O   . HOH C 3 .   ? 9.712  13.136 0.475   0.50 17.14 ? 464 HOH A O   1 
HETATM 1042 O  O   . HOH C 3 .   ? 10.740 13.483 2.166   0.50 17.96 ? 465 HOH A O   1 
HETATM 1043 O  O   . HOH C 3 .   ? 12.452 36.422 7.691   0.50 30.67 ? 466 HOH A O   1 
HETATM 1044 O  O   . HOH C 3 .   ? 22.144 39.541 -4.102  1.00 31.06 ? 467 HOH A O   1 
HETATM 1045 O  O   . HOH C 3 .   ? 17.501 38.366 1.376   1.00 37.49 ? 468 HOH A O   1 
HETATM 1046 O  O   . HOH C 3 .   ? 13.858 37.793 4.522   1.00 49.81 ? 469 HOH A O   1 
HETATM 1047 O  O   . HOH C 3 .   ? 21.410 26.776 -17.172 1.00 32.62 ? 470 HOH A O   1 
HETATM 1048 O  O   . HOH C 3 .   ? 2.660  20.283 -7.705  1.00 32.89 ? 471 HOH A O   1 
HETATM 1049 O  O   . HOH C 3 .   ? 3.107  18.994 -2.100  1.00 39.39 ? 472 HOH A O   1 
HETATM 1050 O  O   . HOH C 3 .   ? 0.287  23.827 -2.791  1.00 27.55 ? 473 HOH A O   1 
HETATM 1051 O  O   . HOH C 3 .   ? 1.613  21.047 -1.350  0.50 34.60 ? 474 HOH A O   1 
HETATM 1052 O  O   . HOH C 3 .   ? 1.235  22.168 -1.004  0.50 32.27 ? 475 HOH A O   1 
HETATM 1053 O  O   . HOH C 3 .   ? 0.717  19.154 6.106   1.00 36.97 ? 476 HOH A O   1 
HETATM 1054 O  O   . HOH C 3 .   ? 1.962  13.675 7.824   1.00 29.79 ? 477 HOH A O   1 
HETATM 1055 O  O   . HOH C 3 .   ? 16.867 36.565 -2.531  1.00 36.54 ? 478 HOH A O   1 
HETATM 1056 O  O   . HOH C 3 .   ? 12.605 28.739 -16.538 1.00 28.98 ? 479 HOH A O   1 
HETATM 1057 O  O   . HOH C 3 .   ? 16.944 32.108 -17.383 1.00 30.20 ? 480 HOH A O   1 
HETATM 1058 O  O   . HOH C 3 .   ? 14.577 14.434 -19.539 1.00 30.06 ? 481 HOH A O   1 
HETATM 1059 O  O   . HOH C 3 .   ? 16.904 12.764 -19.283 1.00 30.93 ? 482 HOH A O   1 
HETATM 1060 O  O   . HOH C 3 .   ? 13.972 11.163 -12.694 1.00 28.61 ? 483 HOH A O   1 
HETATM 1061 O  O   . HOH C 3 .   ? 11.220 12.552 -15.184 1.00 39.05 ? 484 HOH A O   1 
HETATM 1062 O  O   . HOH C 3 .   ? 9.087  11.430 -1.626  1.00 31.31 ? 485 HOH A O   1 
HETATM 1063 O  O   . HOH C 3 .   ? 1.001  32.512 5.374   1.00 35.98 ? 486 HOH A O   1 
HETATM 1064 O  O   . HOH C 3 .   ? 36.983 18.507 -19.477 1.00 33.91 ? 487 HOH A O   1 
HETATM 1065 O  O   . HOH C 3 .   ? 30.729 18.165 -19.176 1.00 47.34 ? 488 HOH A O   1 
HETATM 1066 O  O   . HOH C 3 .   ? 33.702 14.853 -12.105 1.00 37.80 ? 489 HOH A O   1 
HETATM 1067 O  O   . HOH C 3 .   ? 13.100 36.102 -12.727 1.00 35.50 ? 490 HOH A O   1 
HETATM 1068 O  O   . HOH C 3 .   ? 7.297  37.647 3.933   0.50 26.06 ? 491 HOH A O   1 
HETATM 1069 O  O   . HOH C 3 .   ? 9.697  20.871 -24.094 1.00 33.61 ? 492 HOH A O   1 
HETATM 1070 O  O   . HOH C 3 .   ? 18.956 25.156 -22.648 1.00 40.55 ? 493 HOH A O   1 
HETATM 1071 O  O   . HOH C 3 .   ? 19.050 13.379 -20.687 1.00 44.36 ? 494 HOH A O   1 
HETATM 1072 O  O   . HOH C 3 .   ? 9.404  16.629 -24.082 1.00 35.93 ? 495 HOH A O   1 
HETATM 1073 O  O   . HOH C 3 .   ? 10.075 27.157 -15.960 1.00 36.92 ? 496 HOH A O   1 
HETATM 1074 O  O   . HOH C 3 .   ? 10.031 10.973 -10.668 1.00 38.09 ? 497 HOH A O   1 
HETATM 1075 O  O   . HOH C 3 .   ? 13.234 25.535 23.004  1.00 45.22 ? 498 HOH A O   1 
HETATM 1076 O  O   . HOH C 3 .   ? 7.901  36.190 -2.785  1.00 38.24 ? 499 HOH A O   1 
HETATM 1077 O  O   . HOH C 3 .   ? 10.239 10.153 8.236   1.00 41.89 ? 500 HOH A O   1 
HETATM 1078 O  O   . HOH C 3 .   ? 3.813  15.990 -4.889  1.00 34.29 ? 501 HOH A O   1 
HETATM 1079 O  O   . HOH C 3 .   ? 7.216  13.058 -5.252  1.00 29.69 ? 502 HOH A O   1 
HETATM 1080 O  O   . HOH C 3 .   ? 10.344 37.544 8.432   1.00 48.29 ? 503 HOH A O   1 
HETATM 1081 O  O   . HOH C 3 .   ? 2.989  30.224 6.925   1.00 37.34 ? 504 HOH A O   1 
HETATM 1082 O  O   . HOH C 3 .   ? 29.073 29.319 -14.083 0.50 27.54 ? 505 HOH A O   1 
HETATM 1083 O  O   . HOH C 3 .   ? 30.584 26.536 -14.216 1.00 35.55 ? 506 HOH A O   1 
HETATM 1084 O  O   . HOH C 3 .   ? 15.640 15.421 -22.016 0.50 32.11 ? 507 HOH A O   1 
HETATM 1085 O  O   . HOH C 3 .   ? 14.125 16.031 -23.841 0.50 23.71 ? 508 HOH A O   1 
HETATM 1086 O  O   . HOH C 3 .   ? 31.602 26.037 -18.166 0.80 52.19 ? 509 HOH A O   1 
HETATM 1087 O  O   . HOH C 3 .   ? 25.724 25.705 -18.306 0.80 53.79 ? 510 HOH A O   1 
HETATM 1088 O  O   . HOH C 3 .   ? 24.318 33.608 -0.016  0.50 31.43 ? 511 HOH A O   1 
HETATM 1089 O  O   . HOH C 3 .   ? 14.865 24.226 13.747  1.00 15.40 ? 512 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASP A 13  ? 0.4023 0.3987 0.4020 -0.0007 -0.0001 0.0059  13  ASP A N   
2    C  CA  . ASP A 13  ? 0.3926 0.3932 0.3940 -0.0002 -0.0001 0.0042  13  ASP A CA  
3    C  C   . ASP A 13  ? 0.3891 0.3920 0.3943 0.0001  0.0013  0.0033  13  ASP A C   
4    O  O   . ASP A 13  ? 0.3905 0.3901 0.3922 0.0019  -0.0030 0.0081  13  ASP A O   
5    C  CB  . ASP A 13  ? 0.3954 0.3978 0.3990 0.0005  0.0026  0.0036  13  ASP A CB  
6    C  CG  . ASP A 13  ? 0.3957 0.3975 0.4066 -0.0024 0.0010  0.0044  13  ASP A CG  
7    O  OD1 . ASP A 13  ? 0.4068 0.4004 0.4257 0.0013  0.0106  -0.0048 13  ASP A OD1 
8    O  OD2 . ASP A 13  ? 0.3678 0.3958 0.4133 -0.0023 0.0181  0.0124  13  ASP A OD2 
9    N  N   . GLU A 14  ? 0.3862 0.3909 0.3895 0.0003  0.0011  0.0022  14  GLU A N   
10   C  CA  . GLU A 14  ? 0.3778 0.3845 0.3851 0.0015  0.0031  0.0015  14  GLU A CA  
11   C  C   . GLU A 14  ? 0.3654 0.3745 0.3738 0.0032  0.0056  -0.0006 14  GLU A C   
12   O  O   . GLU A 14  ? 0.3489 0.3671 0.3646 0.0059  0.0097  -0.0012 14  GLU A O   
13   C  CB  . GLU A 14  ? 0.3860 0.3873 0.3888 -0.0007 0.0014  0.0006  14  GLU A CB  
14   C  CG  . GLU A 14  ? 0.3953 0.3972 0.3988 -0.0007 0.0031  -0.0011 14  GLU A CG  
15   C  CD  . GLU A 14  ? 0.4126 0.4034 0.4149 -0.0046 0.0012  0.0031  14  GLU A CD  
16   O  OE1 . GLU A 14  ? 0.4592 0.4497 0.4595 -0.0086 -0.0133 -0.0043 14  GLU A OE1 
17   O  OE2 . GLU A 14  ? 0.4477 0.4428 0.4342 -0.0046 -0.0073 0.0075  14  GLU A OE2 
18   N  N   . ALA A 15  ? 0.3499 0.3624 0.3608 0.0018  0.0064  0.0000  15  ALA A N   
19   C  CA  . ALA A 15  ? 0.3383 0.3492 0.3517 -0.0014 0.0080  -0.0018 15  ALA A CA  
20   C  C   . ALA A 15  ? 0.3249 0.3450 0.3383 0.0017  0.0064  0.0002  15  ALA A C   
21   O  O   . ALA A 15  ? 0.3200 0.3562 0.3482 0.0001  0.0057  0.0023  15  ALA A O   
22   C  CB  . ALA A 15  ? 0.3421 0.3597 0.3563 -0.0011 0.0092  -0.0037 15  ALA A CB  
23   N  N   . GLY A 16  ? 0.3054 0.3182 0.3141 0.0028  0.0105  -0.0001 16  GLY A N   
24   C  CA  . GLY A 16  ? 0.2880 0.3062 0.3010 0.0072  0.0089  -0.0011 16  GLY A CA  
25   C  C   . GLY A 16  ? 0.2702 0.2899 0.2864 0.0075  0.0078  0.0037  16  GLY A C   
26   O  O   . GLY A 16  ? 0.2496 0.2980 0.2889 0.0199  0.0130  0.0101  16  GLY A O   
27   N  N   . ILE A 17  ? 0.2490 0.2711 0.2635 0.0072  0.0005  0.0013  17  ILE A N   
28   C  CA  . ILE A 17  ? 0.2415 0.2621 0.2600 0.0034  -0.0002 0.0049  17  ILE A CA  
29   C  C   . ILE A 17  ? 0.2332 0.2549 0.2514 0.0036  0.0005  0.0050  17  ILE A C   
30   O  O   . ILE A 17  ? 0.2208 0.2536 0.2473 -0.0031 0.0019  0.0073  17  ILE A O   
31   C  CB  . ILE A 17  ? 0.2457 0.2572 0.2571 0.0040  -0.0017 0.0060  17  ILE A CB  
32   C  CG1 . ILE A 17  ? 0.2564 0.2592 0.2607 0.0018  -0.0059 0.0076  17  ILE A CG1 
33   C  CG2 . ILE A 17  ? 0.2371 0.2558 0.2597 0.0047  -0.0020 0.0001  17  ILE A CG2 
34   C  CD1 . ILE A 17  ? 0.2420 0.2616 0.2650 0.0065  -0.0088 0.0081  17  ILE A CD1 
35   N  N   . THR A 18  ? 0.2261 0.2566 0.2455 0.0007  0.0004  0.0049  18  THR A N   
36   C  CA  . THR A 18  ? 0.2332 0.2593 0.2521 0.0011  0.0015  0.0042  18  THR A CA  
37   C  C   . THR A 18  ? 0.2279 0.2609 0.2488 0.0002  0.0004  0.0013  18  THR A C   
38   O  O   . THR A 18  ? 0.2305 0.2693 0.2543 0.0000  0.0035  0.0037  18  THR A O   
39   C  CB  . THR A 18  ? 0.2316 0.2625 0.2548 0.0005  0.0015  0.0029  18  THR A CB  
40   O  OG1 . THR A 18  ? 0.2298 0.2683 0.2596 -0.0027 0.0085  0.0124  18  THR A OG1 
41   C  CG2 . THR A 18  ? 0.2252 0.2586 0.2520 0.0002  -0.0004 0.0003  18  THR A CG2 
42   N  N   . GLY A 19  ? 0.2170 0.2588 0.2423 0.0037  0.0038  0.0052  19  GLY A N   
43   C  CA  . GLY A 19  ? 0.2248 0.2611 0.2467 0.0013  0.0026  0.0023  19  GLY A CA  
44   C  C   . GLY A 19  ? 0.2223 0.2598 0.2473 0.0043  0.0020  0.0023  19  GLY A C   
45   O  O   . GLY A 19  ? 0.2312 0.2577 0.2376 0.0117  0.0124  -0.0107 19  GLY A O   
46   N  N   . THR A 20  ? 0.2229 0.2645 0.2547 0.0064  -0.0017 0.0031  20  THR A N   
47   C  CA  . THR A 20  ? 0.2127 0.2581 0.2510 0.0038  -0.0026 0.0022  20  THR A CA  
48   C  C   . THR A 20  ? 0.2219 0.2611 0.2563 0.0070  -0.0032 -0.0069 20  THR A C   
49   O  O   . THR A 20  ? 0.2041 0.2735 0.2763 0.0089  0.0026  -0.0174 20  THR A O   
50   C  CB  . THR A 20  ? 0.2258 0.2597 0.2506 0.0071  -0.0059 -0.0016 20  THR A CB  
51   O  OG1 . THR A 20  ? 0.1948 0.2695 0.2708 -0.0023 -0.0151 0.0156  20  THR A OG1 
52   C  CG2 . THR A 20  ? 0.2220 0.2568 0.2569 0.0010  -0.0050 0.0072  20  THR A CG2 
53   N  N   . TRP A 21  ? 0.2072 0.2504 0.2377 0.0043  0.0012  -0.0060 21  TRP A N   
54   C  CA  . TRP A 21  ? 0.2088 0.2375 0.2328 0.0044  -0.0045 -0.0007 21  TRP A CA  
55   C  C   . TRP A 21  ? 0.1976 0.2317 0.2281 0.0040  -0.0070 -0.0018 21  TRP A C   
56   O  O   . TRP A 21  ? 0.1920 0.2254 0.2175 0.0052  -0.0024 -0.0001 21  TRP A O   
57   C  CB  . TRP A 21  ? 0.2092 0.2396 0.2240 0.0030  -0.0043 0.0000  21  TRP A CB  
58   C  CG  . TRP A 21  ? 0.1955 0.2305 0.2204 0.0038  -0.0070 0.0024  21  TRP A CG  
59   C  CD1 . TRP A 21  ? 0.1998 0.2340 0.2189 0.0002  -0.0074 0.0003  21  TRP A CD1 
60   C  CD2 . TRP A 21  ? 0.1858 0.2232 0.2255 0.0029  -0.0053 0.0000  21  TRP A CD2 
61   N  NE1 . TRP A 21  ? 0.1881 0.2222 0.2160 0.0051  -0.0025 -0.0009 21  TRP A NE1 
62   C  CE2 . TRP A 21  ? 0.1888 0.2305 0.2179 0.0045  -0.0064 0.0002  21  TRP A CE2 
63   C  CE3 . TRP A 21  ? 0.1984 0.2268 0.2268 0.0073  -0.0048 -0.0006 21  TRP A CE3 
64   C  CZ2 . TRP A 21  ? 0.2073 0.2299 0.2251 0.0000  -0.0064 0.0017  21  TRP A CZ2 
65   C  CZ3 . TRP A 21  ? 0.1954 0.2305 0.2184 0.0004  -0.0054 0.0011  21  TRP A CZ3 
66   C  CH2 . TRP A 21  ? 0.2052 0.2304 0.2238 -0.0014 -0.0082 0.0004  21  TRP A CH2 
67   N  N   . TYR A 22  ? 0.1989 0.2297 0.2333 0.0057  -0.0103 -0.0013 22  TYR A N   
68   C  CA  . TYR A 22  ? 0.2084 0.2315 0.2332 0.0010  -0.0068 -0.0019 22  TYR A CA  
69   C  C   . TYR A 22  ? 0.2004 0.2286 0.2291 0.0045  -0.0055 -0.0055 22  TYR A C   
70   O  O   . TYR A 22  ? 0.1846 0.2348 0.2136 0.0046  -0.0098 -0.0112 22  TYR A O   
71   C  CB  . TYR A 22  ? 0.2243 0.2479 0.2541 0.0060  -0.0031 0.0016  22  TYR A CB  
72   C  CG  . TYR A 22  ? 0.2304 0.2497 0.2496 -0.0078 -0.0055 0.0028  22  TYR A CG  
73   C  CD1 . TYR A 22  ? 0.2779 0.2822 0.2975 -0.0105 -0.0231 0.0153  22  TYR A CD1 
74   C  CD2 . TYR A 22  ? 0.2344 0.2603 0.2591 -0.0029 -0.0112 -0.0215 22  TYR A CD2 
75   C  CE1 . TYR A 22  ? 0.2410 0.2763 0.2867 -0.0073 -0.0054 0.0196  22  TYR A CE1 
76   C  CE2 . TYR A 22  ? 0.2278 0.2684 0.2604 -0.0069 0.0113  -0.0104 22  TYR A CE2 
77   C  CZ  . TYR A 22  ? 0.2485 0.2785 0.2761 -0.0094 -0.0048 -0.0038 22  TYR A CZ  
78   O  OH  . TYR A 22  ? 0.2438 0.2926 0.2855 -0.0184 -0.0145 -0.0032 22  TYR A OH  
79   N  N   . ASN A 23  ? 0.2009 0.2125 0.2145 0.0038  -0.0018 -0.0033 23  ASN A N   
80   C  CA  . ASN A 23  ? 0.2001 0.2081 0.2117 0.0051  -0.0055 -0.0010 23  ASN A CA  
81   C  C   . ASN A 23  ? 0.2073 0.2110 0.2229 0.0044  -0.0084 -0.0001 23  ASN A C   
82   O  O   . ASN A 23  ? 0.2069 0.2167 0.2346 0.0053  -0.0161 0.0065  23  ASN A O   
83   C  CB  . ASN A 23  ? 0.2015 0.2007 0.2088 0.0072  -0.0047 0.0017  23  ASN A CB  
84   C  CG  . ASN A 23  ? 0.1938 0.1840 0.1956 0.0083  -0.0038 0.0006  23  ASN A CG  
85   O  OD1 . ASN A 23  ? 0.2131 0.1940 0.1895 0.0240  -0.0097 -0.0017 23  ASN A OD1 
86   N  ND2 . ASN A 23  ? 0.1909 0.1776 0.2006 0.0045  -0.0145 -0.0032 23  ASN A ND2 
87   N  N   . GLN A 24  ? 0.2089 0.2108 0.2219 0.0024  -0.0067 0.0037  24  GLN A N   
88   C  CA  . GLN A 24  ? 0.2176 0.2134 0.2251 0.0014  -0.0065 0.0023  24  GLN A CA  
89   C  C   . GLN A 24  ? 0.2247 0.2169 0.2259 -0.0020 -0.0136 0.0076  24  GLN A C   
90   O  O   . GLN A 24  ? 0.2505 0.2185 0.2487 0.0007  -0.0212 0.0094  24  GLN A O   
91   C  CB  . GLN A 24  ? 0.2169 0.2161 0.2244 0.0003  -0.0087 0.0041  24  GLN A CB  
92   C  CG  . GLN A 24  ? 0.2187 0.2254 0.2322 0.0066  -0.0047 0.0074  24  GLN A CG  
93   C  CD  . GLN A 24  ? 0.2133 0.2246 0.2249 0.0017  0.0000  0.0115  24  GLN A CD  
94   O  OE1 . GLN A 24  ? 0.2009 0.2245 0.2042 0.0083  -0.0079 0.0214  24  GLN A OE1 
95   N  NE2 . GLN A 24  ? 0.2065 0.2171 0.2092 -0.0002 -0.0041 0.0068  24  GLN A NE2 
96   N  N   . LEU A 25  ? 0.2183 0.2113 0.2200 0.0019  -0.0095 0.0061  25  LEU A N   
97   C  CA  . LEU A 25  ? 0.2240 0.2192 0.2258 -0.0002 -0.0115 0.0047  25  LEU A CA  
98   C  C   . LEU A 25  ? 0.2277 0.2286 0.2317 0.0020  -0.0118 0.0060  25  LEU A C   
99   O  O   . LEU A 25  ? 0.2562 0.2537 0.2415 -0.0029 -0.0239 0.0072  25  LEU A O   
100  C  CB  . LEU A 25  ? 0.2188 0.2249 0.2246 -0.0010 -0.0056 0.0030  25  LEU A CB  
101  C  CG  . LEU A 25  ? 0.2210 0.2342 0.2309 0.0028  -0.0145 0.0029  25  LEU A CG  
102  C  CD1 . LEU A 25  ? 0.2142 0.2578 0.2433 0.0069  0.0023  -0.0079 25  LEU A CD1 
103  C  CD2 . LEU A 25  ? 0.2507 0.2586 0.2881 -0.0051 -0.0010 0.0047  25  LEU A CD2 
104  N  N   . GLY A 26  ? 0.2265 0.2270 0.2405 0.0011  -0.0172 0.0055  26  GLY A N   
105  C  CA  . GLY A 26  ? 0.2212 0.2248 0.2424 0.0049  -0.0171 0.0061  26  GLY A CA  
106  C  C   . GLY A 26  ? 0.2217 0.2294 0.2482 0.0041  -0.0205 0.0015  26  GLY A C   
107  O  O   . GLY A 26  ? 0.2125 0.2360 0.2734 0.0119  -0.0372 0.0046  26  GLY A O   
108  N  N   . SER A 27  ? 0.2065 0.2231 0.2261 0.0075  -0.0191 0.0045  27  SER A N   
109  C  CA  . SER A 27  ? 0.2072 0.2219 0.2205 0.0079  -0.0141 0.0012  27  SER A CA  
110  C  C   . SER A 27  ? 0.2079 0.2210 0.2181 0.0090  -0.0153 0.0014  27  SER A C   
111  O  O   . SER A 27  ? 0.1958 0.2173 0.2027 0.0077  -0.0157 -0.0019 27  SER A O   
112  C  CB  . SER A 27  ? 0.2065 0.2210 0.2240 0.0049  -0.0146 -0.0003 27  SER A CB  
113  O  OG  . SER A 27  ? 0.1879 0.2174 0.2215 0.0138  -0.0145 0.0100  27  SER A OG  
114  N  N   . THR A 28  ? 0.2129 0.2259 0.2185 0.0043  -0.0133 -0.0016 28  THR A N   
115  C  CA  . THR A 28  ? 0.2183 0.2296 0.2223 0.0038  -0.0104 -0.0021 28  THR A CA  
116  C  C   . THR A 28  ? 0.2109 0.2255 0.2164 0.0029  -0.0076 -0.0052 28  THR A C   
117  O  O   . THR A 28  ? 0.2272 0.2296 0.2246 0.0038  -0.0096 -0.0085 28  THR A O   
118  C  CB  . THR A 28  ? 0.2153 0.2296 0.2258 0.0034  -0.0109 0.0005  28  THR A CB  
119  O  OG1 . THR A 28  ? 0.2585 0.2677 0.2634 -0.0023 -0.0272 0.0195  28  THR A OG1 
120  C  CG2 . THR A 28  ? 0.2267 0.2492 0.2338 0.0012  -0.0126 0.0021  28  THR A CG2 
121  N  N   . PHE A 29  ? 0.2056 0.2277 0.2141 0.0013  -0.0049 -0.0045 29  PHE A N   
122  C  CA  . PHE A 29  ? 0.2108 0.2304 0.2170 -0.0007 -0.0048 -0.0050 29  PHE A CA  
123  C  C   . PHE A 29  ? 0.2157 0.2394 0.2216 0.0006  -0.0069 -0.0020 29  PHE A C   
124  O  O   . PHE A 29  ? 0.1958 0.2539 0.2274 -0.0024 0.0005  -0.0014 29  PHE A O   
125  C  CB  . PHE A 29  ? 0.2112 0.2265 0.2161 -0.0001 -0.0071 -0.0033 29  PHE A CB  
126  C  CG  . PHE A 29  ? 0.2085 0.2257 0.2115 0.0022  -0.0043 -0.0071 29  PHE A CG  
127  C  CD1 . PHE A 29  ? 0.2170 0.2144 0.2022 -0.0067 -0.0093 -0.0066 29  PHE A CD1 
128  C  CD2 . PHE A 29  ? 0.2209 0.2267 0.2123 -0.0041 -0.0053 -0.0093 29  PHE A CD2 
129  C  CE1 . PHE A 29  ? 0.2065 0.2058 0.2041 -0.0064 -0.0038 -0.0145 29  PHE A CE1 
130  C  CE2 . PHE A 29  ? 0.2115 0.2115 0.2171 0.0041  -0.0155 -0.0095 29  PHE A CE2 
131  C  CZ  . PHE A 29  ? 0.1986 0.2076 0.2073 0.0004  -0.0045 -0.0066 29  PHE A CZ  
132  N  N   . ILE A 30  ? 0.2194 0.2394 0.2216 -0.0020 -0.0074 -0.0010 30  ILE A N   
133  C  CA  . ILE A 30  ? 0.2301 0.2475 0.2358 -0.0025 -0.0086 -0.0009 30  ILE A CA  
134  C  C   . ILE A 30  ? 0.2291 0.2466 0.2317 -0.0010 -0.0040 -0.0013 30  ILE A C   
135  O  O   . ILE A 30  ? 0.2423 0.2470 0.2314 0.0066  -0.0080 -0.0034 30  ILE A O   
136  C  CB  . ILE A 30  ? 0.2455 0.2578 0.2408 -0.0039 -0.0074 -0.0009 30  ILE A CB  
137  C  CG1 . ILE A 30  ? 0.2622 0.2717 0.2504 -0.0055 -0.0107 -0.0030 30  ILE A CG1 
138  C  CG2 . ILE A 30  ? 0.2408 0.2707 0.2441 -0.0148 -0.0149 0.0030  30  ILE A CG2 
139  C  CD1 . ILE A 30  ? 0.2513 0.2743 0.2551 -0.0022 -0.0171 0.0042  30  ILE A CD1 
140  N  N   . VAL A 31  ? 0.2190 0.2503 0.2343 0.0014  -0.0014 0.0012  31  VAL A N   
141  C  CA  . VAL A 31  ? 0.2259 0.2461 0.2363 -0.0004 0.0003  0.0031  31  VAL A CA  
142  C  C   . VAL A 31  ? 0.2297 0.2521 0.2439 0.0023  0.0042  0.0043  31  VAL A C   
143  O  O   . VAL A 31  ? 0.2237 0.2550 0.2380 0.0017  0.0131  0.0097  31  VAL A O   
144  C  CB  . VAL A 31  ? 0.2217 0.2441 0.2415 0.0035  -0.0025 0.0040  31  VAL A CB  
145  C  CG1 . VAL A 31  ? 0.2149 0.2461 0.2219 0.0043  0.0015  -0.0002 31  VAL A CG1 
146  C  CG2 . VAL A 31  ? 0.2229 0.2523 0.2289 0.0035  -0.0035 0.0126  31  VAL A CG2 
147  N  N   . THR A 32  ? 0.2314 0.2532 0.2494 0.0013  0.0028  0.0051  32  THR A N   
148  C  CA  . THR A 32  ? 0.2392 0.2582 0.2573 0.0003  0.0020  0.0065  32  THR A CA  
149  C  C   . THR A 32  ? 0.2330 0.2576 0.2580 -0.0019 0.0055  0.0051  32  THR A C   
150  O  O   . THR A 32  ? 0.2281 0.2398 0.2450 0.0041  0.0095  0.0022  32  THR A O   
151  C  CB  . THR A 32  ? 0.2514 0.2639 0.2611 -0.0010 -0.0005 0.0054  32  THR A CB  
152  O  OG1 . THR A 32  ? 0.2854 0.2945 0.3102 0.0066  -0.0145 0.0076  32  THR A OG1 
153  C  CG2 . THR A 32  ? 0.2462 0.2771 0.2785 -0.0012 0.0071  0.0073  32  THR A CG2 
154  N  N   . ALA A 33  ? 0.2241 0.2601 0.2542 -0.0029 0.0053  0.0024  33  ALA A N   
155  C  CA  . ALA A 33  ? 0.2357 0.2682 0.2645 -0.0022 0.0090  0.0057  33  ALA A CA  
156  C  C   . ALA A 33  ? 0.2400 0.2744 0.2723 -0.0047 0.0120  0.0063  33  ALA A C   
157  O  O   . ALA A 33  ? 0.2443 0.2914 0.2985 -0.0043 0.0210  0.0119  33  ALA A O   
158  C  CB  . ALA A 33  ? 0.2229 0.2642 0.2596 -0.0035 0.0103  0.0025  33  ALA A CB  
159  N  N   . GLY A 34  ? 0.2404 0.2744 0.2715 -0.0054 0.0134  0.0074  34  GLY A N   
160  C  CA  . GLY A 34  ? 0.2513 0.2797 0.2788 -0.0094 0.0100  0.0065  34  GLY A CA  
161  C  C   . GLY A 34  ? 0.2632 0.2896 0.2815 -0.0133 0.0103  0.0092  34  GLY A C   
162  O  O   . GLY A 34  ? 0.2516 0.2944 0.2719 -0.0219 0.0188  0.0144  34  GLY A O   
163  N  N   . ALA A 35  ? 0.2705 0.3011 0.2959 -0.0174 0.0111  0.0116  35  ALA A N   
164  C  CA  . ALA A 35  ? 0.2838 0.3098 0.3051 -0.0134 0.0082  0.0105  35  ALA A CA  
165  C  C   . ALA A 35  ? 0.2980 0.3183 0.3134 -0.0125 0.0042  0.0115  35  ALA A C   
166  O  O   . ALA A 35  ? 0.3167 0.3499 0.3359 -0.0180 0.0026  0.0154  35  ALA A O   
167  C  CB  . ALA A 35  ? 0.2884 0.3190 0.3086 -0.0186 0.0093  0.0153  35  ALA A CB  
168  N  N   . ASP A 36  ? 0.2947 0.3184 0.3259 -0.0037 0.0067  0.0145  36  ASP A N   
169  C  CA  . ASP A 36  ? 0.2945 0.3132 0.3238 -0.0071 0.0075  0.0099  36  ASP A CA  
170  C  C   . ASP A 36  ? 0.2824 0.3014 0.3184 -0.0049 0.0084  0.0120  36  ASP A C   
171  O  O   . ASP A 36  ? 0.2891 0.3147 0.3478 -0.0065 0.0081  0.0253  36  ASP A O   
172  C  CB  . ASP A 36  ? 0.3074 0.3177 0.3428 -0.0075 0.0063  0.0075  36  ASP A CB  
173  C  CG  . ASP A 36  ? 0.3329 0.3401 0.3548 -0.0018 0.0038  0.0042  36  ASP A CG  
174  O  OD1 . ASP A 36  ? 0.3160 0.2952 0.3553 -0.0154 0.0046  0.0114  36  ASP A OD1 
175  O  OD2 . ASP A 36  ? 0.4128 0.3848 0.4268 0.0102  0.0137  -0.0088 36  ASP A OD2 
176  N  N   . GLY A 37  ? 0.2608 0.2864 0.2909 -0.0062 0.0091  0.0091  37  GLY A N   
177  C  CA  . GLY A 37  ? 0.2564 0.2705 0.2675 -0.0044 0.0042  0.0049  37  GLY A CA  
178  C  C   . GLY A 37  ? 0.2401 0.2511 0.2520 -0.0048 0.0019  0.0034  37  GLY A C   
179  O  O   . GLY A 37  ? 0.2256 0.2364 0.2351 -0.0083 0.0062  -0.0006 37  GLY A O   
180  N  N   . ALA A 38  ? 0.2284 0.2423 0.2353 -0.0078 0.0018  0.0035  38  ALA A N   
181  C  CA  . ALA A 38  ? 0.2297 0.2379 0.2387 -0.0089 0.0014  0.0040  38  ALA A CA  
182  C  C   . ALA A 38  ? 0.2251 0.2351 0.2305 -0.0062 0.0028  0.0021  38  ALA A C   
183  O  O   . ALA A 38  ? 0.2211 0.2422 0.2315 -0.0073 0.0084  0.0101  38  ALA A O   
184  C  CB  . ALA A 38  ? 0.2519 0.2473 0.2472 -0.0116 0.0001  -0.0021 38  ALA A CB  
185  N  N   . LEU A 39  ? 0.2061 0.2197 0.2204 -0.0109 0.0024  0.0042  39  LEU A N   
186  C  CA  . LEU A 39  ? 0.2021 0.2177 0.2139 -0.0085 0.0020  -0.0008 39  LEU A CA  
187  C  C   . LEU A 39  ? 0.2044 0.2137 0.2042 -0.0060 0.0028  0.0027  39  LEU A C   
188  O  O   . LEU A 39  ? 0.1971 0.2140 0.1864 -0.0096 0.0039  0.0012  39  LEU A O   
189  C  CB  . LEU A 39  ? 0.2014 0.2130 0.2095 -0.0080 0.0020  -0.0005 39  LEU A CB  
190  C  CG  . LEU A 39  ? 0.1855 0.2199 0.2065 -0.0038 0.0083  -0.0050 39  LEU A CG  
191  C  CD1 . LEU A 39  ? 0.1963 0.2135 0.2176 -0.0232 0.0089  -0.0048 39  LEU A CD1 
192  C  CD2 . LEU A 39  ? 0.1617 0.2255 0.1791 -0.0003 0.0100  -0.0054 39  LEU A CD2 
193  N  N   . THR A 40  ? 0.2001 0.2142 0.2119 -0.0053 0.0038  -0.0002 40  THR A N   
194  C  CA  . THR A 40  ? 0.2022 0.2141 0.2075 -0.0053 0.0034  0.0002  40  THR A CA  
195  C  C   . THR A 40  ? 0.2130 0.2211 0.2111 0.0015  0.0042  -0.0019 40  THR A C   
196  O  O   . THR A 40  ? 0.2368 0.2445 0.2281 0.0186  0.0015  0.0031  40  THR A O   
197  C  CB  . THR A 40  ? 0.2126 0.2121 0.2145 -0.0034 0.0102  0.0039  40  THR A CB  
198  O  OG1 A THR A 40  ? 0.1717 0.1838 0.2181 0.0018  0.0072  0.0065  40  THR A OG1 
199  O  OG1 B THR A 40  ? 0.2113 0.2067 0.1992 -0.0043 0.0053  0.0005  40  THR A OG1 
200  C  CG2 A THR A 40  ? 0.1865 0.1946 0.1935 -0.0088 0.0080  0.0082  40  THR A CG2 
201  C  CG2 B THR A 40  ? 0.2346 0.2209 0.2250 -0.0058 0.0058  -0.0040 40  THR A CG2 
202  N  N   . GLY A 41  ? 0.2014 0.2187 0.2055 -0.0016 -0.0020 0.0000  41  GLY A N   
203  C  CA  . GLY A 41  ? 0.2013 0.2186 0.2064 -0.0058 -0.0025 -0.0030 41  GLY A CA  
204  C  C   . GLY A 41  ? 0.1942 0.2173 0.2014 -0.0060 -0.0082 -0.0044 41  GLY A C   
205  O  O   . GLY A 41  ? 0.1800 0.2156 0.2036 -0.0082 -0.0108 -0.0078 41  GLY A O   
206  N  N   . THR A 42  ? 0.1910 0.2164 0.2048 -0.0072 -0.0087 -0.0038 42  THR A N   
207  C  CA  . THR A 42  ? 0.2017 0.2135 0.2068 -0.0055 -0.0106 -0.0007 42  THR A CA  
208  C  C   . THR A 42  ? 0.1923 0.2088 0.2008 -0.0061 -0.0131 -0.0047 42  THR A C   
209  O  O   . THR A 42  ? 0.2032 0.2106 0.1994 -0.0089 -0.0151 -0.0027 42  THR A O   
210  C  CB  . THR A 42  ? 0.2114 0.2148 0.2095 -0.0080 -0.0110 -0.0026 42  THR A CB  
211  O  OG1 . THR A 42  ? 0.2196 0.2284 0.2137 -0.0039 -0.0325 0.0000  42  THR A OG1 
212  C  CG2 . THR A 42  ? 0.2078 0.2304 0.2226 -0.0240 -0.0228 -0.0051 42  THR A CG2 
213  N  N   . TYR A 43  ? 0.1960 0.2012 0.1897 -0.0042 -0.0123 -0.0024 43  TYR A N   
214  C  CA  . TYR A 43  ? 0.1926 0.2046 0.1922 -0.0023 -0.0078 0.0001  43  TYR A CA  
215  C  C   . TYR A 43  ? 0.2012 0.2126 0.2011 -0.0037 -0.0101 0.0000  43  TYR A C   
216  O  O   . TYR A 43  ? 0.2075 0.2123 0.1890 0.0004  -0.0095 -0.0007 43  TYR A O   
217  C  CB  . TYR A 43  ? 0.1937 0.1979 0.1896 -0.0005 -0.0074 -0.0004 43  TYR A CB  
218  C  CG  . TYR A 43  ? 0.1762 0.1938 0.1790 0.0006  -0.0135 -0.0017 43  TYR A CG  
219  C  CD1 . TYR A 43  ? 0.1714 0.1928 0.1749 0.0052  -0.0091 -0.0033 43  TYR A CD1 
220  C  CD2 . TYR A 43  ? 0.1697 0.1875 0.1813 0.0083  -0.0098 -0.0032 43  TYR A CD2 
221  C  CE1 . TYR A 43  ? 0.1790 0.1940 0.1626 0.0002  -0.0074 -0.0049 43  TYR A CE1 
222  C  CE2 . TYR A 43  ? 0.1730 0.1922 0.1696 0.0057  -0.0142 0.0036  43  TYR A CE2 
223  C  CZ  . TYR A 43  ? 0.1730 0.1946 0.1699 0.0071  -0.0084 -0.0042 43  TYR A CZ  
224  O  OH  . TYR A 43  ? 0.1961 0.1982 0.1639 0.0040  -0.0159 0.0016  43  TYR A OH  
225  N  N   . GLU A 44  ? 0.2074 0.2187 0.2053 -0.0010 -0.0107 0.0010  44  GLU A N   
226  C  CA  . GLU A 44  ? 0.2142 0.2233 0.2097 -0.0015 -0.0083 0.0049  44  GLU A CA  
227  C  C   . GLU A 44  ? 0.2113 0.2165 0.2006 -0.0004 -0.0116 0.0042  44  GLU A C   
228  O  O   . GLU A 44  ? 0.2130 0.2239 0.2047 -0.0041 -0.0092 0.0014  44  GLU A O   
229  C  CB  . GLU A 44  ? 0.2125 0.2191 0.2135 -0.0033 -0.0105 -0.0015 44  GLU A CB  
230  C  CG  . GLU A 44  ? 0.2288 0.2443 0.2280 0.0000  -0.0100 0.0045  44  GLU A CG  
231  C  CD  . GLU A 44  ? 0.2485 0.2874 0.2511 0.0063  -0.0155 0.0138  44  GLU A CD  
232  O  OE1 . GLU A 44  ? 0.3387 0.3615 0.2817 0.0030  -0.0284 0.0294  44  GLU A OE1 
233  O  OE2 . GLU A 44  ? 0.2544 0.3583 0.2906 -0.0021 -0.0231 0.0261  44  GLU A OE2 
234  N  N   . SER A 45  ? 0.2230 0.2192 0.1985 -0.0007 -0.0110 0.0021  45  SER A N   
235  C  CA  . SER A 45  ? 0.2196 0.2221 0.1982 -0.0007 -0.0097 0.0055  45  SER A CA  
236  C  C   . SER A 45  ? 0.2308 0.2221 0.2070 0.0032  -0.0140 0.0054  45  SER A C   
237  O  O   . SER A 45  ? 0.2569 0.2399 0.2107 0.0082  -0.0149 0.0093  45  SER A O   
238  C  CB  . SER A 45  ? 0.2209 0.2168 0.1973 0.0018  -0.0094 0.0043  45  SER A CB  
239  O  OG  . SER A 45  ? 0.1948 0.2241 0.1749 -0.0020 -0.0246 0.0133  45  SER A OG  
240  N  N   . ALA A 46  ? 0.2291 0.2251 0.2086 0.0074  -0.0148 0.0093  46  ALA A N   
241  C  CA  . ALA A 46  ? 0.2325 0.2262 0.2104 0.0040  -0.0121 0.0096  46  ALA A CA  
242  C  C   . ALA A 46  ? 0.2328 0.2276 0.2144 0.0067  -0.0097 0.0127  46  ALA A C   
243  O  O   . ALA A 46  ? 0.2430 0.2508 0.2134 0.0169  -0.0210 0.0164  46  ALA A O   
244  C  CB  . ALA A 46  ? 0.2413 0.2262 0.2207 0.0107  -0.0099 0.0122  46  ALA A CB  
245  N  N   . VAL A 47  ? 0.2301 0.2278 0.2095 0.0007  -0.0140 0.0091  47  VAL A N   
246  C  CA  . VAL A 47  ? 0.2290 0.2219 0.2081 0.0018  -0.0132 0.0054  47  VAL A CA  
247  C  C   . VAL A 47  ? 0.2254 0.2178 0.2070 -0.0024 -0.0106 0.0025  47  VAL A C   
248  O  O   . VAL A 47  ? 0.2338 0.2121 0.1932 0.0034  -0.0192 0.0074  47  VAL A O   
249  C  CB  . VAL A 47  ? 0.2311 0.2156 0.2107 0.0024  -0.0114 0.0030  47  VAL A CB  
250  C  CG1 . VAL A 47  ? 0.2319 0.2217 0.2297 0.0080  -0.0173 0.0025  47  VAL A CG1 
251  C  CG2 . VAL A 47  ? 0.2332 0.2110 0.1941 0.0065  -0.0138 0.0033  47  VAL A CG2 
252  N  N   . GLY A 48  ? 0.2264 0.2186 0.2036 -0.0043 -0.0121 0.0026  48  GLY A N   
253  C  CA  . GLY A 48  ? 0.2316 0.2218 0.2100 -0.0025 -0.0085 0.0015  48  GLY A CA  
254  C  C   . GLY A 48  ? 0.2338 0.2234 0.2150 -0.0033 -0.0083 0.0000  48  GLY A C   
255  O  O   . GLY A 48  ? 0.2447 0.2210 0.2173 -0.0074 -0.0169 0.0031  48  GLY A O   
256  N  N   . ASN A 49  ? 0.2481 0.2365 0.2185 -0.0021 -0.0088 -0.0005 49  ASN A N   
257  C  CA  . ASN A 49  ? 0.2498 0.2350 0.2264 -0.0030 -0.0071 -0.0002 49  ASN A CA  
258  C  C   . ASN A 49  ? 0.2505 0.2381 0.2278 -0.0046 -0.0056 -0.0009 49  ASN A C   
259  O  O   . ASN A 49  ? 0.2466 0.2315 0.2251 0.0005  -0.0098 -0.0068 49  ASN A O   
260  C  CB  . ASN A 49  ? 0.2560 0.2422 0.2294 -0.0050 -0.0053 -0.0006 49  ASN A CB  
261  C  CG  . ASN A 49  ? 0.2639 0.2523 0.2313 -0.0002 -0.0020 -0.0021 49  ASN A CG  
262  O  OD1 . ASN A 49  ? 0.2967 0.2754 0.2364 0.0000  -0.0115 -0.0159 49  ASN A OD1 
263  N  ND2 . ASN A 49  ? 0.2880 0.2576 0.2715 0.0129  0.0066  0.0031  49  ASN A ND2 
264  N  N   . ALA A 50  ? 0.2490 0.2412 0.2210 -0.0064 -0.0094 0.0015  50  ALA A N   
265  C  CA  . ALA A 50  ? 0.2559 0.2466 0.2301 -0.0048 -0.0051 0.0013  50  ALA A CA  
266  C  C   . ALA A 50  ? 0.2579 0.2491 0.2306 -0.0052 -0.0043 0.0040  50  ALA A C   
267  O  O   . ALA A 50  ? 0.2647 0.2429 0.2426 -0.0081 -0.0053 0.0035  50  ALA A O   
268  C  CB  . ALA A 50  ? 0.2494 0.2458 0.2213 -0.0073 -0.0038 -0.0035 50  ALA A CB  
269  N  N   . GLU A 51  ? 0.2619 0.2536 0.2350 -0.0076 -0.0076 0.0052  51  GLU A N   
270  C  CA  . GLU A 51  ? 0.2699 0.2685 0.2489 -0.0040 -0.0052 0.0066  51  GLU A CA  
271  C  C   . GLU A 51  ? 0.2577 0.2629 0.2392 -0.0044 -0.0104 0.0070  51  GLU A C   
272  O  O   . GLU A 51  ? 0.2453 0.2509 0.2376 -0.0090 -0.0173 0.0078  51  GLU A O   
273  C  CB  . GLU A 51  ? 0.2819 0.2845 0.2536 -0.0040 -0.0053 0.0076  51  GLU A CB  
274  C  CG  . GLU A 51  ? 0.3128 0.3015 0.2777 -0.0029 -0.0038 0.0068  51  GLU A CG  
275  C  CD  . GLU A 51  ? 0.3174 0.3168 0.2812 -0.0030 -0.0082 0.0039  51  GLU A CD  
276  O  OE1 . GLU A 51  ? 0.3733 0.4025 0.3478 -0.0112 -0.0263 0.0081  51  GLU A OE1 
277  O  OE2 . GLU A 51  ? 0.3531 0.3743 0.3462 -0.0047 0.0008  -0.0048 51  GLU A OE2 
278  N  N   . SER A 52  ? 0.2590 0.2687 0.2365 -0.0028 -0.0094 0.0092  52  SER A N   
279  C  CA  . SER A 52  ? 0.2600 0.2682 0.2383 -0.0027 -0.0089 0.0099  52  SER A CA  
280  C  C   . SER A 52  ? 0.2539 0.2658 0.2342 -0.0041 -0.0107 0.0088  52  SER A C   
281  O  O   . SER A 52  ? 0.2557 0.2676 0.2295 -0.0037 -0.0146 0.0156  52  SER A O   
282  C  CB  . SER A 52  ? 0.2627 0.2818 0.2407 -0.0058 -0.0108 0.0087  52  SER A CB  
283  O  OG  . SER A 52  ? 0.2836 0.3322 0.2696 -0.0171 -0.0213 0.0128  52  SER A OG  
284  N  N   . ARG A 53  ? 0.2534 0.2586 0.2355 -0.0044 -0.0106 0.0095  53  ARG A N   
285  C  CA  . ARG A 53  ? 0.2516 0.2575 0.2332 -0.0021 -0.0081 0.0050  53  ARG A CA  
286  C  C   . ARG A 53  ? 0.2353 0.2433 0.2172 -0.0043 -0.0080 0.0030  53  ARG A C   
287  O  O   . ARG A 53  ? 0.2337 0.2489 0.2045 -0.0096 -0.0125 0.0072  53  ARG A O   
288  C  CB  . ARG A 53  ? 0.2590 0.2691 0.2456 -0.0061 -0.0085 0.0025  53  ARG A CB  
289  C  CG  . ARG A 53  ? 0.2794 0.2780 0.2708 0.0009  -0.0075 -0.0055 53  ARG A CG  
290  C  CD  . ARG A 53  ? 0.3035 0.3176 0.3174 0.0000  0.0043  0.0043  53  ARG A CD  
291  N  NE  A ARG A 53  ? 0.3090 0.3116 0.3132 0.0021  0.0034  -0.0046 53  ARG A NE  
292  N  NE  B ARG A 53  ? 0.3421 0.3404 0.3340 0.0007  -0.0028 -0.0080 53  ARG A NE  
293  C  CZ  A ARG A 53  ? 0.3283 0.3420 0.3411 0.0008  0.0030  -0.0043 53  ARG A CZ  
294  C  CZ  B ARG A 53  ? 0.3629 0.3567 0.3502 0.0024  -0.0036 0.0000  53  ARG A CZ  
295  N  NH1 A ARG A 53  ? 0.3300 0.3462 0.3440 0.0017  0.0057  -0.0039 53  ARG A NH1 
296  N  NH1 B ARG A 53  ? 0.3767 0.3662 0.3573 0.0000  -0.0038 -0.0052 53  ARG A NH1 
297  N  NH2 A ARG A 53  ? 0.3467 0.3480 0.3583 -0.0022 0.0036  -0.0081 53  ARG A NH2 
298  N  NH2 B ARG A 53  ? 0.3671 0.3538 0.3488 0.0037  -0.0077 -0.0003 53  ARG A NH2 
299  N  N   . TYR A 54  ? 0.2154 0.2278 0.2007 -0.0045 -0.0077 0.0026  54  TYR A N   
300  C  CA  . TYR A 54  ? 0.2112 0.2137 0.1898 -0.0094 -0.0055 0.0046  54  TYR A CA  
301  C  C   . TYR A 54  ? 0.1970 0.2046 0.1779 -0.0075 -0.0067 0.0007  54  TYR A C   
302  O  O   . TYR A 54  ? 0.1957 0.2133 0.1769 -0.0115 -0.0040 0.0027  54  TYR A O   
303  C  CB  . TYR A 54  ? 0.2019 0.2066 0.1893 -0.0048 -0.0085 0.0055  54  TYR A CB  
304  C  CG  . TYR A 54  ? 0.1969 0.1892 0.1831 -0.0102 -0.0048 -0.0009 54  TYR A CG  
305  C  CD1 . TYR A 54  ? 0.1716 0.2000 0.1839 -0.0228 -0.0088 -0.0039 54  TYR A CD1 
306  C  CD2 . TYR A 54  ? 0.1906 0.1947 0.1809 0.0046  -0.0048 -0.0009 54  TYR A CD2 
307  C  CE1 . TYR A 54  ? 0.2175 0.2138 0.1892 -0.0086 -0.0150 0.0049  54  TYR A CE1 
308  C  CE2 . TYR A 54  ? 0.1984 0.1917 0.1786 -0.0019 -0.0112 0.0042  54  TYR A CE2 
309  C  CZ  . TYR A 54  ? 0.1917 0.1996 0.1796 -0.0036 -0.0081 0.0038  54  TYR A CZ  
310  O  OH  . TYR A 54  ? 0.2129 0.2148 0.1846 -0.0015 -0.0073 0.0055  54  TYR A OH  
311  N  N   . VAL A 55  ? 0.2016 0.2026 0.1700 -0.0096 -0.0068 0.0002  55  VAL A N   
312  C  CA  . VAL A 55  ? 0.1974 0.1990 0.1770 -0.0099 -0.0113 0.0028  55  VAL A CA  
313  C  C   . VAL A 55  ? 0.1910 0.1965 0.1787 -0.0088 -0.0106 0.0036  55  VAL A C   
314  O  O   . VAL A 55  ? 0.1850 0.2149 0.1745 -0.0103 -0.0178 0.0007  55  VAL A O   
315  C  CB  . VAL A 55  ? 0.1920 0.1971 0.1764 -0.0029 -0.0134 -0.0009 55  VAL A CB  
316  C  CG1 . VAL A 55  ? 0.2047 0.2135 0.1995 -0.0114 -0.0049 0.0071  55  VAL A CG1 
317  C  CG2 . VAL A 55  ? 0.1993 0.1883 0.1759 -0.0201 -0.0119 -0.0060 55  VAL A CG2 
318  N  N   . LEU A 56  ? 0.1843 0.2002 0.1764 -0.0077 -0.0092 0.0035  56  LEU A N   
319  C  CA  . LEU A 56  ? 0.1896 0.2060 0.1810 -0.0064 -0.0082 0.0022  56  LEU A CA  
320  C  C   . LEU A 56  ? 0.1866 0.2086 0.1834 -0.0083 -0.0098 0.0034  56  LEU A C   
321  O  O   . LEU A 56  ? 0.1774 0.2209 0.1820 -0.0164 -0.0221 0.0083  56  LEU A O   
322  C  CB  . LEU A 56  ? 0.1913 0.2100 0.1832 -0.0067 -0.0058 0.0061  56  LEU A CB  
323  C  CG  . LEU A 56  ? 0.2043 0.2123 0.1856 -0.0010 -0.0004 0.0004  56  LEU A CG  
324  C  CD1 . LEU A 56  ? 0.1831 0.2280 0.1621 0.0014  -0.0052 0.0007  56  LEU A CD1 
325  C  CD2 . LEU A 56  ? 0.2152 0.2142 0.2104 0.0038  -0.0008 0.0016  56  LEU A CD2 
326  N  N   . THR A 57  ? 0.1853 0.2105 0.1770 -0.0105 -0.0123 0.0042  57  THR A N   
327  C  CA  . THR A 57  ? 0.1827 0.2001 0.1753 -0.0099 -0.0049 0.0003  57  THR A CA  
328  C  C   . THR A 57  ? 0.1809 0.1918 0.1665 -0.0111 -0.0045 0.0000  57  THR A C   
329  O  O   . THR A 57  ? 0.1633 0.1943 0.1620 -0.0118 -0.0141 -0.0023 57  THR A O   
330  C  CB  . THR A 57  ? 0.1897 0.2013 0.1792 -0.0049 -0.0028 0.0006  57  THR A CB  
331  O  OG1 . THR A 57  ? 0.2474 0.2537 0.2122 -0.0083 -0.0158 -0.0005 57  THR A OG1 
332  C  CG2 . THR A 57  ? 0.1700 0.1711 0.1921 -0.0026 -0.0012 -0.0077 57  THR A CG2 
333  N  N   . GLY A 58  ? 0.1731 0.1908 0.1663 -0.0106 -0.0005 -0.0022 58  GLY A N   
334  C  CA  . GLY A 58  ? 0.1737 0.1884 0.1641 -0.0105 0.0003  0.0011  58  GLY A CA  
335  C  C   . GLY A 58  ? 0.1755 0.1885 0.1660 -0.0103 0.0031  0.0021  58  GLY A C   
336  O  O   . GLY A 58  ? 0.1755 0.1820 0.1680 -0.0196 0.0019  0.0096  58  GLY A O   
337  N  N   . ARG A 59  ? 0.1808 0.1942 0.1603 -0.0138 0.0056  0.0053  59  ARG A N   
338  C  CA  . ARG A 59  ? 0.1798 0.1948 0.1640 -0.0072 0.0079  0.0042  59  ARG A CA  
339  C  C   . ARG A 59  ? 0.1900 0.1937 0.1697 -0.0063 0.0099  0.0065  59  ARG A C   
340  O  O   . ARG A 59  ? 0.1976 0.1939 0.1681 -0.0199 0.0198  -0.0014 59  ARG A O   
341  C  CB  . ARG A 59  ? 0.1851 0.1904 0.1699 -0.0050 0.0111  0.0053  59  ARG A CB  
342  C  CG  . ARG A 59  ? 0.1684 0.1910 0.1656 0.0017  0.0065  0.0061  59  ARG A CG  
343  C  CD  . ARG A 59  ? 0.1957 0.1996 0.2069 0.0033  0.0109  0.0035  59  ARG A CD  
344  N  NE  . ARG A 59  ? 0.2079 0.2073 0.1953 -0.0158 0.0083  0.0150  59  ARG A NE  
345  C  CZ  . ARG A 59  ? 0.2034 0.2159 0.2222 -0.0047 0.0050  0.0137  59  ARG A CZ  
346  N  NH1 . ARG A 59  ? 0.2342 0.2418 0.2212 -0.0101 0.0030  0.0112  59  ARG A NH1 
347  N  NH2 . ARG A 59  ? 0.2136 0.2444 0.2283 -0.0156 0.0046  0.0130  59  ARG A NH2 
348  N  N   . TYR A 60  ? 0.1889 0.1971 0.1812 -0.0055 0.0152  0.0056  60  TYR A N   
349  C  CA  . TYR A 60  ? 0.1906 0.2069 0.1762 -0.0049 0.0083  0.0041  60  TYR A CA  
350  C  C   . TYR A 60  ? 0.2006 0.2097 0.1809 -0.0030 0.0071  0.0067  60  TYR A C   
351  O  O   . TYR A 60  ? 0.2057 0.2130 0.1616 0.0007  0.0087  0.0054  60  TYR A O   
352  C  CB  . TYR A 60  ? 0.2020 0.2141 0.1882 -0.0024 0.0073  0.0066  60  TYR A CB  
353  C  CG  . TYR A 60  ? 0.1864 0.2182 0.2032 -0.0072 0.0006  0.0054  60  TYR A CG  
354  C  CD1 . TYR A 60  ? 0.2206 0.2266 0.2364 -0.0071 0.0014  0.0158  60  TYR A CD1 
355  C  CD2 . TYR A 60  ? 0.1907 0.2094 0.2021 -0.0222 -0.0041 -0.0081 60  TYR A CD2 
356  C  CE1 . TYR A 60  ? 0.2152 0.2542 0.2381 -0.0008 0.0113  0.0094  60  TYR A CE1 
357  C  CE2 . TYR A 60  ? 0.1895 0.2322 0.1979 -0.0045 0.0189  -0.0079 60  TYR A CE2 
358  C  CZ  . TYR A 60  ? 0.2031 0.2440 0.2231 -0.0102 0.0152  -0.0024 60  TYR A CZ  
359  O  OH  . TYR A 60  ? 0.2140 0.2596 0.2376 -0.0242 0.0165  0.0077  60  TYR A OH  
360  N  N   . ASP A 61  ? 0.2084 0.2199 0.1797 -0.0004 0.0066  0.0062  61  ASP A N   
361  C  CA  . ASP A 61  ? 0.2094 0.2239 0.1874 -0.0004 0.0074  0.0069  61  ASP A CA  
362  C  C   . ASP A 61  ? 0.2175 0.2330 0.1970 0.0003  0.0102  0.0051  61  ASP A C   
363  O  O   . ASP A 61  ? 0.2127 0.2372 0.2001 0.0008  0.0231  0.0140  61  ASP A O   
364  C  CB  . ASP A 61  ? 0.2144 0.2208 0.1812 0.0017  0.0064  0.0082  61  ASP A CB  
365  C  CG  . ASP A 61  ? 0.2132 0.2219 0.1851 -0.0040 0.0082  0.0033  61  ASP A CG  
366  O  OD1 . ASP A 61  ? 0.2451 0.2455 0.1661 -0.0166 0.0207  0.0342  61  ASP A OD1 
367  O  OD2 . ASP A 61  ? 0.2164 0.2712 0.1633 -0.0133 0.0065  -0.0038 61  ASP A OD2 
368  N  N   . SER A 62  ? 0.2222 0.2490 0.2191 -0.0009 0.0129  0.0061  62  SER A N   
369  C  CA  . SER A 62  ? 0.2314 0.2636 0.2299 -0.0029 0.0111  0.0048  62  SER A CA  
370  C  C   . SER A 62  ? 0.2449 0.2839 0.2412 -0.0013 0.0142  0.0018  62  SER A C   
371  O  O   . SER A 62  ? 0.2451 0.3221 0.2409 -0.0056 0.0260  0.0010  62  SER A O   
372  C  CB  . SER A 62  ? 0.2353 0.2661 0.2419 -0.0034 0.0115  0.0047  62  SER A CB  
373  O  OG  . SER A 62  ? 0.2582 0.2608 0.2881 -0.0188 0.0032  0.0159  62  SER A OG  
374  N  N   . ALA A 63  ? 0.2536 0.2833 0.2386 -0.0048 0.0144  0.0000  63  ALA A N   
375  C  CA  . ALA A 63  ? 0.2681 0.2884 0.2503 0.0004  0.0105  -0.0007 63  ALA A CA  
376  C  C   . ALA A 63  ? 0.2757 0.2908 0.2562 0.0005  0.0118  -0.0006 63  ALA A C   
377  O  O   . ALA A 63  ? 0.2691 0.2951 0.2448 0.0019  0.0214  -0.0007 63  ALA A O   
378  C  CB  . ALA A 63  ? 0.2707 0.2866 0.2493 -0.0020 0.0124  -0.0006 63  ALA A CB  
379  N  N   . PRO A 64  ? 0.2889 0.2979 0.2751 0.0011  0.0092  -0.0018 64  PRO A N   
380  C  CA  . PRO A 64  ? 0.3040 0.3025 0.2855 0.0009  0.0082  -0.0004 64  PRO A CA  
381  C  C   . PRO A 64  ? 0.3151 0.3094 0.2928 0.0003  0.0088  -0.0038 64  PRO A C   
382  O  O   . PRO A 64  ? 0.3156 0.3105 0.2906 -0.0033 0.0118  -0.0058 64  PRO A O   
383  C  CB  . PRO A 64  ? 0.3024 0.3008 0.2889 0.0013  0.0078  0.0005  64  PRO A CB  
384  C  CG  . PRO A 64  ? 0.3036 0.3022 0.2912 0.0012  0.0068  0.0039  64  PRO A CG  
385  C  CD  . PRO A 64  ? 0.2958 0.2970 0.2786 0.0036  0.0098  -0.0011 64  PRO A CD  
386  N  N   . ALA A 65  ? 0.3235 0.3224 0.3007 -0.0010 0.0091  -0.0040 65  ALA A N   
387  C  CA  . ALA A 65  ? 0.3380 0.3333 0.3147 -0.0003 0.0074  -0.0046 65  ALA A CA  
388  C  C   . ALA A 65  ? 0.3477 0.3415 0.3282 0.0027  0.0083  -0.0044 65  ALA A C   
389  O  O   . ALA A 65  ? 0.3474 0.3378 0.3301 0.0079  0.0139  -0.0090 65  ALA A O   
390  C  CB  . ALA A 65  ? 0.3375 0.3339 0.3119 -0.0001 0.0077  -0.0037 65  ALA A CB  
391  N  N   . THR A 66  ? 0.3651 0.3581 0.3441 0.0025  0.0113  -0.0043 66  THR A N   
392  C  CA  . THR A 66  ? 0.3714 0.3678 0.3552 0.0022  0.0117  -0.0022 66  THR A CA  
393  C  C   . THR A 66  ? 0.3797 0.3753 0.3636 0.0012  0.0134  -0.0046 66  THR A C   
394  O  O   . THR A 66  ? 0.3963 0.3921 0.3780 0.0043  0.0202  -0.0055 66  THR A O   
395  C  CB  . THR A 66  ? 0.3784 0.3782 0.3643 0.0010  0.0115  -0.0012 66  THR A CB  
396  O  OG1 . THR A 66  ? 0.4132 0.3990 0.3725 0.0051  0.0129  0.0074  66  THR A OG1 
397  C  CG2 . THR A 66  ? 0.3979 0.3896 0.3823 -0.0043 0.0105  -0.0024 66  THR A CG2 
398  N  N   . ASP A 67  ? 0.3776 0.3735 0.3579 -0.0012 0.0135  -0.0047 67  ASP A N   
399  C  CA  . ASP A 67  ? 0.3709 0.3635 0.3434 0.0007  0.0104  -0.0019 67  ASP A CA  
400  C  C   . ASP A 67  ? 0.3671 0.3589 0.3418 -0.0018 0.0082  -0.0029 67  ASP A C   
401  O  O   . ASP A 67  ? 0.3943 0.3692 0.3451 -0.0063 0.0107  -0.0030 67  ASP A O   
402  C  CB  . ASP A 67  ? 0.3762 0.3688 0.3483 -0.0009 0.0099  -0.0023 67  ASP A CB  
403  C  CG  . ASP A 67  ? 0.3852 0.3818 0.3632 0.0008  0.0070  -0.0069 67  ASP A CG  
404  O  OD1 . ASP A 67  ? 0.3963 0.3700 0.3359 -0.0014 0.0142  -0.0030 67  ASP A OD1 
405  O  OD2 . ASP A 67  ? 0.4123 0.4459 0.4032 0.0043  0.0044  -0.0149 67  ASP A OD2 
406  N  N   . GLY A 68  ? 0.3497 0.3424 0.3209 0.0044  0.0130  -0.0025 68  GLY A N   
407  C  CA  . GLY A 68  ? 0.3328 0.3311 0.3116 0.0073  0.0150  -0.0073 68  GLY A CA  
408  C  C   . GLY A 68  ? 0.3203 0.3186 0.2956 0.0079  0.0139  -0.0032 68  GLY A C   
409  O  O   . GLY A 68  ? 0.3309 0.3204 0.2976 0.0165  0.0208  -0.0025 68  GLY A O   
410  N  N   . SER A 69  ? 0.2937 0.2991 0.2723 0.0024  0.0113  -0.0093 69  SER A N   
411  C  CA  . SER A 69  ? 0.2751 0.2875 0.2651 0.0000  0.0059  -0.0087 69  SER A CA  
412  C  C   . SER A 69  ? 0.2481 0.2649 0.2460 0.0016  0.0089  -0.0083 69  SER A C   
413  O  O   . SER A 69  ? 0.2451 0.2652 0.2408 -0.0028 0.0137  -0.0184 69  SER A O   
414  C  CB  . SER A 69  ? 0.2758 0.2964 0.2706 0.0036  0.0027  -0.0137 69  SER A CB  
415  O  OG  . SER A 69  ? 0.3083 0.3606 0.3199 -0.0016 -0.0065 -0.0101 69  SER A OG  
416  N  N   . GLY A 70  ? 0.2263 0.2467 0.2331 0.0011  0.0048  -0.0086 70  GLY A N   
417  C  CA  . GLY A 70  ? 0.2155 0.2329 0.2210 0.0023  0.0081  -0.0051 70  GLY A CA  
418  C  C   . GLY A 70  ? 0.2015 0.2247 0.2033 0.0018  0.0090  -0.0058 70  GLY A C   
419  O  O   . GLY A 70  ? 0.2026 0.2166 0.1853 0.0002  0.0125  -0.0073 70  GLY A O   
420  N  N   . THR A 71  ? 0.1865 0.2172 0.1886 0.0017  0.0138  -0.0049 71  THR A N   
421  C  CA  . THR A 71  ? 0.1856 0.2105 0.1788 0.0040  0.0131  -0.0024 71  THR A CA  
422  C  C   . THR A 71  ? 0.1804 0.2042 0.1801 0.0027  0.0094  -0.0021 71  THR A C   
423  O  O   . THR A 71  ? 0.1841 0.1921 0.1700 0.0043  0.0047  0.0050  71  THR A O   
424  C  CB  . THR A 71  ? 0.1845 0.2110 0.1842 0.0042  0.0186  -0.0062 71  THR A CB  
425  O  OG1 . THR A 71  ? 0.2008 0.2336 0.1933 0.0143  0.0400  -0.0054 71  THR A OG1 
426  C  CG2 . THR A 71  ? 0.1946 0.2156 0.2024 0.0010  0.0143  0.0000  71  THR A CG2 
427  N  N   . ALA A 72  ? 0.1770 0.1914 0.1691 0.0064  0.0074  -0.0009 72  ALA A N   
428  C  CA  . ALA A 72  ? 0.1725 0.1905 0.1687 0.0027  0.0081  0.0020  72  ALA A CA  
429  C  C   . ALA A 72  ? 0.1733 0.1873 0.1647 0.0022  0.0065  0.0035  72  ALA A C   
430  O  O   . ALA A 72  ? 0.1893 0.1963 0.1500 -0.0033 0.0101  0.0000  72  ALA A O   
431  C  CB  . ALA A 72  ? 0.1768 0.1923 0.1764 0.0056  0.0067  0.0040  72  ALA A CB  
432  N  N   . LEU A 73  ? 0.1717 0.1865 0.1655 -0.0006 0.0068  -0.0014 73  LEU A N   
433  C  CA  . LEU A 73  ? 0.1721 0.1913 0.1731 -0.0025 0.0063  0.0004  73  LEU A CA  
434  C  C   . LEU A 73  ? 0.1797 0.1879 0.1637 -0.0094 0.0074  -0.0007 73  LEU A C   
435  O  O   . LEU A 73  ? 0.1813 0.1980 0.1619 -0.0234 0.0078  -0.0060 73  LEU A O   
436  C  CB  . LEU A 73  ? 0.1637 0.1932 0.1804 0.0026  0.0096  -0.0033 73  LEU A CB  
437  C  CG  . LEU A 73  ? 0.1882 0.2398 0.2438 0.0143  -0.0020 0.0052  73  LEU A CG  
438  C  CD1 . LEU A 73  ? 0.2001 0.2867 0.3006 0.0155  0.0067  0.0142  73  LEU A CD1 
439  C  CD2 . LEU A 73  ? 0.2507 0.2738 0.3062 0.0043  -0.0091 -0.0069 73  LEU A CD2 
440  N  N   . GLY A 74  ? 0.1709 0.1759 0.1536 -0.0078 0.0005  0.0020  74  GLY A N   
441  C  CA  . GLY A 74  ? 0.1636 0.1714 0.1596 -0.0023 0.0010  -0.0018 74  GLY A CA  
442  C  C   . GLY A 74  ? 0.1586 0.1660 0.1534 0.0018  0.0012  -0.0018 74  GLY A C   
443  O  O   . GLY A 74  ? 0.1715 0.1664 0.1471 -0.0068 0.0085  -0.0101 74  GLY A O   
444  N  N   . TRP A 75  ? 0.1555 0.1651 0.1545 -0.0002 0.0051  -0.0010 75  TRP A N   
445  C  CA  . TRP A 75  ? 0.1609 0.1690 0.1525 -0.0004 0.0015  -0.0019 75  TRP A CA  
446  C  C   . TRP A 75  ? 0.1596 0.1679 0.1490 -0.0037 0.0014  -0.0002 75  TRP A C   
447  O  O   . TRP A 75  ? 0.1566 0.1562 0.1354 -0.0042 -0.0062 0.0007  75  TRP A O   
448  C  CB  . TRP A 75  ? 0.1620 0.1739 0.1678 -0.0038 0.0002  -0.0068 75  TRP A CB  
449  C  CG  . TRP A 75  ? 0.1608 0.1841 0.1696 0.0067  -0.0022 0.0000  75  TRP A CG  
450  C  CD1 . TRP A 75  ? 0.1980 0.1860 0.1891 0.0040  -0.0006 -0.0007 75  TRP A CD1 
451  C  CD2 . TRP A 75  ? 0.1609 0.1822 0.1746 -0.0003 -0.0040 0.0008  75  TRP A CD2 
452  N  NE1 . TRP A 75  ? 0.1814 0.1948 0.1866 0.0051  0.0053  0.0082  75  TRP A NE1 
453  C  CE2 . TRP A 75  ? 0.1621 0.1753 0.1801 0.0022  -0.0131 -0.0051 75  TRP A CE2 
454  C  CE3 . TRP A 75  ? 0.1567 0.1781 0.1831 0.0044  -0.0117 0.0019  75  TRP A CE3 
455  C  CZ2 . TRP A 75  ? 0.1683 0.1870 0.1890 -0.0038 -0.0020 0.0060  75  TRP A CZ2 
456  C  CZ3 . TRP A 75  ? 0.1868 0.1928 0.1899 0.0039  -0.0069 -0.0056 75  TRP A CZ3 
457  C  CH2 . TRP A 75  ? 0.1844 0.1771 0.1950 -0.0010 -0.0008 -0.0005 75  TRP A CH2 
458  N  N   . THR A 76  ? 0.1651 0.1646 0.1515 -0.0064 0.0011  -0.0018 76  THR A N   
459  C  CA  . THR A 76  ? 0.1646 0.1620 0.1456 -0.0039 -0.0004 -0.0014 76  THR A CA  
460  C  C   . THR A 76  ? 0.1647 0.1696 0.1560 -0.0067 -0.0016 -0.0012 76  THR A C   
461  O  O   . THR A 76  ? 0.1742 0.1866 0.1526 -0.0161 -0.0078 0.0012  76  THR A O   
462  C  CB  . THR A 76  ? 0.1628 0.1787 0.1528 0.0000  0.0023  0.0062  76  THR A CB  
463  O  OG1 . THR A 76  ? 0.1660 0.1902 0.1435 0.0001  -0.0093 0.0078  76  THR A OG1 
464  C  CG2 . THR A 76  ? 0.1826 0.1804 0.1401 0.0030  0.0039  -0.0088 76  THR A CG2 
465  N  N   . VAL A 77  ? 0.1698 0.1651 0.1471 -0.0132 -0.0060 -0.0012 77  VAL A N   
466  C  CA  . VAL A 77  ? 0.1716 0.1748 0.1588 -0.0078 -0.0082 -0.0022 77  VAL A CA  
467  C  C   . VAL A 77  ? 0.1667 0.1760 0.1547 -0.0109 -0.0059 -0.0013 77  VAL A C   
468  O  O   . VAL A 77  ? 0.1703 0.1905 0.1629 -0.0143 -0.0038 -0.0071 77  VAL A O   
469  C  CB  . VAL A 77  ? 0.1706 0.1690 0.1520 -0.0068 -0.0092 -0.0006 77  VAL A CB  
470  C  CG1 . VAL A 77  ? 0.1616 0.1887 0.1578 -0.0120 -0.0195 -0.0046 77  VAL A CG1 
471  C  CG2 . VAL A 77  ? 0.1722 0.1886 0.1673 0.0035  -0.0072 -0.0014 77  VAL A CG2 
472  N  N   . ALA A 78  ? 0.1636 0.1707 0.1645 -0.0110 -0.0066 -0.0049 78  ALA A N   
473  C  CA  . ALA A 78  ? 0.1744 0.1768 0.1585 -0.0101 -0.0081 -0.0005 78  ALA A CA  
474  C  C   . ALA A 78  ? 0.1791 0.1805 0.1678 -0.0081 -0.0090 0.0010  78  ALA A C   
475  O  O   . ALA A 78  ? 0.1694 0.1720 0.1452 -0.0154 -0.0092 0.0082  78  ALA A O   
476  C  CB  . ALA A 78  ? 0.1804 0.1792 0.1656 -0.0048 -0.0134 -0.0065 78  ALA A CB  
477  N  N   . TRP A 79  ? 0.1853 0.1867 0.1662 -0.0087 -0.0051 0.0029  79  TRP A N   
478  C  CA  . TRP A 79  ? 0.1958 0.1898 0.1727 -0.0060 -0.0077 -0.0012 79  TRP A CA  
479  C  C   . TRP A 79  ? 0.2101 0.1985 0.1789 -0.0054 -0.0079 -0.0027 79  TRP A C   
480  O  O   . TRP A 79  ? 0.2119 0.1926 0.1568 -0.0098 -0.0103 -0.0080 79  TRP A O   
481  C  CB  . TRP A 79  ? 0.1977 0.1871 0.1722 -0.0020 -0.0045 -0.0051 79  TRP A CB  
482  C  CG  . TRP A 79  ? 0.1924 0.1824 0.1711 -0.0031 -0.0076 -0.0032 79  TRP A CG  
483  C  CD1 . TRP A 79  ? 0.1849 0.1789 0.1726 -0.0047 -0.0021 -0.0043 79  TRP A CD1 
484  C  CD2 . TRP A 79  ? 0.1908 0.1810 0.1832 -0.0029 -0.0086 -0.0161 79  TRP A CD2 
485  N  NE1 . TRP A 79  ? 0.1830 0.1749 0.1653 -0.0024 -0.0080 -0.0153 79  TRP A NE1 
486  C  CE2 . TRP A 79  ? 0.1846 0.1782 0.1648 0.0008  -0.0099 -0.0084 79  TRP A CE2 
487  C  CE3 . TRP A 79  ? 0.1872 0.1817 0.1698 -0.0023 -0.0027 -0.0098 79  TRP A CE3 
488  C  CZ2 . TRP A 79  ? 0.1857 0.1889 0.1699 -0.0003 0.0005  0.0008  79  TRP A CZ2 
489  C  CZ3 . TRP A 79  ? 0.1927 0.1899 0.1854 0.0011  -0.0076 -0.0059 79  TRP A CZ3 
490  C  CH2 . TRP A 79  ? 0.1828 0.1815 0.1734 -0.0032 -0.0083 -0.0031 79  TRP A CH2 
491  N  N   . LYS A 80  ? 0.2159 0.2115 0.1885 -0.0143 -0.0110 -0.0045 80  LYS A N   
492  C  CA  . LYS A 80  ? 0.2203 0.2180 0.1945 -0.0086 -0.0092 -0.0063 80  LYS A CA  
493  C  C   . LYS A 80  ? 0.2195 0.2133 0.1933 -0.0100 -0.0099 -0.0041 80  LYS A C   
494  O  O   . LYS A 80  ? 0.2145 0.2033 0.1756 -0.0107 -0.0104 -0.0019 80  LYS A O   
495  C  CB  . LYS A 80  ? 0.2345 0.2248 0.2063 -0.0105 -0.0085 -0.0075 80  LYS A CB  
496  C  CG  . LYS A 80  ? 0.2440 0.2275 0.2094 -0.0029 -0.0138 -0.0096 80  LYS A CG  
497  C  CD  . LYS A 80  ? 0.2655 0.2403 0.2406 -0.0019 -0.0039 -0.0084 80  LYS A CD  
498  C  CE  . LYS A 80  ? 0.2943 0.2546 0.2769 -0.0093 -0.0089 -0.0112 80  LYS A CE  
499  N  NZ  . LYS A 80  ? 0.3124 0.2883 0.3261 -0.0099 -0.0001 -0.0198 80  LYS A NZ  
500  N  N   . ASN A 81  ? 0.2226 0.2148 0.1940 -0.0087 -0.0127 0.0000  81  ASN A N   
501  C  CA  . ASN A 81  ? 0.2205 0.2240 0.1993 -0.0063 -0.0131 -0.0029 81  ASN A CA  
502  C  C   . ASN A 81  ? 0.2335 0.2296 0.2075 -0.0082 -0.0113 -0.0084 81  ASN A C   
503  O  O   . ASN A 81  ? 0.2413 0.2329 0.1883 -0.0185 -0.0228 -0.0097 81  ASN A O   
504  C  CB  . ASN A 81  ? 0.2208 0.2235 0.2008 -0.0080 -0.0098 -0.0032 81  ASN A CB  
505  C  CG  . ASN A 81  ? 0.2024 0.2177 0.2041 -0.0045 -0.0114 -0.0020 81  ASN A CG  
506  O  OD1 . ASN A 81  ? 0.2367 0.2144 0.1680 0.0059  -0.0201 0.0098  81  ASN A OD1 
507  N  ND2 . ASN A 81  ? 0.1857 0.2132 0.1938 -0.0072 -0.0275 -0.0082 81  ASN A ND2 
508  N  N   . ASN A 82  ? 0.2472 0.2515 0.2146 -0.0079 -0.0179 -0.0083 82  ASN A N   
509  C  CA  . ASN A 82  ? 0.2639 0.2657 0.2327 -0.0065 -0.0141 -0.0082 82  ASN A CA  
510  C  C   . ASN A 82  ? 0.2756 0.2754 0.2342 -0.0048 -0.0131 -0.0069 82  ASN A C   
511  O  O   . ASN A 82  ? 0.3127 0.2919 0.2415 -0.0045 -0.0176 -0.0190 82  ASN A O   
512  C  CB  . ASN A 82  ? 0.2724 0.2831 0.2479 -0.0071 -0.0125 -0.0054 82  ASN A CB  
513  C  CG  . ASN A 82  ? 0.3198 0.3111 0.3038 -0.0078 -0.0088 -0.0012 82  ASN A CG  
514  O  OD1 . ASN A 82  ? 0.3788 0.3608 0.3763 0.0042  -0.0162 0.0007  82  ASN A OD1 
515  N  ND2 . ASN A 82  ? 0.3524 0.3839 0.3624 -0.0135 0.0050  -0.0031 82  ASN A ND2 
516  N  N   . TYR A 83  ? 0.2708 0.2755 0.2333 -0.0039 -0.0153 -0.0044 83  TYR A N   
517  C  CA  . TYR A 83  ? 0.2674 0.2771 0.2396 -0.0034 -0.0117 -0.0011 83  TYR A CA  
518  C  C   . TYR A 83  ? 0.2640 0.2745 0.2337 -0.0016 -0.0104 0.0000  83  TYR A C   
519  O  O   . TYR A 83  ? 0.2658 0.2698 0.2125 -0.0043 -0.0173 0.0041  83  TYR A O   
520  C  CB  . TYR A 83  ? 0.2887 0.2930 0.2565 -0.0002 -0.0073 -0.0010 83  TYR A CB  
521  C  CG  . TYR A 83  ? 0.2863 0.3119 0.2746 0.0000  -0.0104 -0.0005 83  TYR A CG  
522  C  CD1 . TYR A 83  ? 0.2977 0.3444 0.3065 0.0026  -0.0111 -0.0022 83  TYR A CD1 
523  C  CD2 . TYR A 83  ? 0.2848 0.3171 0.2805 -0.0010 -0.0098 -0.0051 83  TYR A CD2 
524  C  CE1 . TYR A 83  ? 0.3040 0.3588 0.3202 0.0007  -0.0015 0.0010  83  TYR A CE1 
525  C  CE2 . TYR A 83  ? 0.2940 0.3365 0.2859 0.0021  -0.0042 -0.0010 83  TYR A CE2 
526  C  CZ  . TYR A 83  ? 0.2976 0.3627 0.3044 0.0000  -0.0033 -0.0036 83  TYR A CZ  
527  O  OH  . TYR A 83  ? 0.2973 0.3805 0.3267 0.0024  -0.0098 -0.0102 83  TYR A OH  
528  N  N   . ARG A 84  ? 0.2518 0.2676 0.2201 -0.0040 -0.0135 0.0015  84  ARG A N   
529  C  CA  . ARG A 84  ? 0.2542 0.2653 0.2353 -0.0012 -0.0118 0.0016  84  ARG A CA  
530  C  C   . ARG A 84  ? 0.2356 0.2545 0.2173 -0.0032 -0.0144 0.0000  84  ARG A C   
531  O  O   . ARG A 84  ? 0.2250 0.2513 0.2117 -0.0036 -0.0217 0.0049  84  ARG A O   
532  C  CB  . ARG A 84  ? 0.2583 0.2693 0.2453 -0.0023 -0.0132 -0.0015 84  ARG A CB  
533  C  CG  . ARG A 84  ? 0.2898 0.2813 0.2815 0.0000  -0.0102 0.0015  84  ARG A CG  
534  C  CD  . ARG A 84  ? 0.3058 0.2962 0.2996 -0.0060 -0.0043 -0.0017 84  ARG A CD  
535  N  NE  . ARG A 84  ? 0.3443 0.3398 0.3317 0.0039  -0.0134 0.0032  84  ARG A NE  
536  C  CZ  . ARG A 84  ? 0.3484 0.3416 0.3239 -0.0080 0.0006  0.0071  84  ARG A CZ  
537  N  NH1 . ARG A 84  ? 0.3562 0.3493 0.3459 -0.0082 -0.0047 0.0105  84  ARG A NH1 
538  N  NH2 . ARG A 84  ? 0.3606 0.3634 0.3305 -0.0092 -0.0078 0.0097  84  ARG A NH2 
539  N  N   . ASN A 85  ? 0.2317 0.2486 0.2048 0.0014  -0.0140 0.0002  85  ASN A N   
540  C  CA  . ASN A 85  ? 0.2259 0.2416 0.2024 -0.0028 -0.0086 0.0013  85  ASN A CA  
541  C  C   . ASN A 85  ? 0.2112 0.2336 0.1926 -0.0020 -0.0051 0.0015  85  ASN A C   
542  O  O   . ASN A 85  ? 0.2171 0.2523 0.1806 -0.0153 -0.0030 0.0027  85  ASN A O   
543  C  CB  . ASN A 85  ? 0.2274 0.2394 0.1983 -0.0025 -0.0104 0.0042  85  ASN A CB  
544  C  CG  . ASN A 85  ? 0.2340 0.2394 0.2088 0.0014  -0.0153 -0.0003 85  ASN A CG  
545  O  OD1 . ASN A 85  ? 0.2412 0.2279 0.1958 -0.0149 -0.0065 -0.0014 85  ASN A OD1 
546  N  ND2 . ASN A 85  ? 0.2503 0.2224 0.2112 -0.0018 -0.0200 0.0072  85  ASN A ND2 
547  N  N   . ALA A 86  ? 0.2092 0.2315 0.1847 -0.0074 -0.0009 0.0011  86  ALA A N   
548  C  CA  . ALA A 86  ? 0.2073 0.2253 0.1872 -0.0029 -0.0058 0.0008  86  ALA A CA  
549  C  C   . ALA A 86  ? 0.2058 0.2205 0.1797 -0.0053 -0.0075 0.0020  86  ALA A C   
550  O  O   . ALA A 86  ? 0.2060 0.2227 0.1761 -0.0113 -0.0135 0.0057  86  ALA A O   
551  C  CB  . ALA A 86  ? 0.2012 0.2275 0.1953 -0.0040 -0.0051 -0.0002 86  ALA A CB  
552  N  N   . HIS A 87  ? 0.2042 0.2142 0.1777 -0.0015 -0.0081 -0.0074 87  HIS A N   
553  C  CA  . HIS A 87  ? 0.2043 0.2123 0.1754 -0.0008 -0.0056 -0.0075 87  HIS A CA  
554  C  C   . HIS A 87  ? 0.1967 0.2055 0.1652 -0.0012 -0.0061 -0.0096 87  HIS A C   
555  O  O   . HIS A 87  ? 0.1977 0.2146 0.1480 0.0033  -0.0032 -0.0176 87  HIS A O   
556  C  CB  . HIS A 87  ? 0.2155 0.2198 0.1878 0.0028  -0.0029 -0.0088 87  HIS A CB  
557  C  CG  . HIS A 87  ? 0.2305 0.2416 0.2014 -0.0030 -0.0083 -0.0103 87  HIS A CG  
558  N  ND1 . HIS A 87  ? 0.2237 0.2256 0.2042 -0.0064 0.0028  -0.0113 87  HIS A ND1 
559  C  CD2 . HIS A 87  ? 0.2596 0.2493 0.2121 -0.0085 0.0037  0.0011  87  HIS A CD2 
560  C  CE1 . HIS A 87  ? 0.2597 0.2370 0.2220 -0.0093 0.0003  -0.0044 87  HIS A CE1 
561  N  NE2 . HIS A 87  ? 0.2587 0.2451 0.1944 -0.0092 -0.0003 -0.0054 87  HIS A NE2 
562  N  N   . SER A 88  ? 0.1953 0.1969 0.1620 0.0009  -0.0046 -0.0095 88  SER A N   
563  C  CA  . SER A 88  ? 0.1877 0.1871 0.1611 -0.0052 -0.0063 -0.0086 88  SER A CA  
564  C  C   . SER A 88  ? 0.1842 0.1871 0.1557 -0.0072 -0.0033 -0.0076 88  SER A C   
565  O  O   . SER A 88  ? 0.1846 0.1999 0.1464 -0.0138 0.0026  -0.0221 88  SER A O   
566  C  CB  . SER A 88  ? 0.2009 0.1890 0.1620 -0.0040 -0.0091 -0.0052 88  SER A CB  
567  O  OG  . SER A 88  ? 0.2001 0.1844 0.1740 -0.0069 -0.0128 -0.0047 88  SER A OG  
568  N  N   . ALA A 89  ? 0.1708 0.1779 0.1541 -0.0102 -0.0015 -0.0092 89  ALA A N   
569  C  CA  . ALA A 89  ? 0.1752 0.1685 0.1501 -0.0041 -0.0021 -0.0069 89  ALA A CA  
570  C  C   . ALA A 89  ? 0.1709 0.1682 0.1467 -0.0051 -0.0006 -0.0069 89  ALA A C   
571  O  O   . ALA A 89  ? 0.1860 0.1697 0.1507 -0.0199 -0.0013 -0.0193 89  ALA A O   
572  C  CB  . ALA A 89  ? 0.1832 0.1616 0.1539 -0.0027 0.0052  -0.0041 89  ALA A CB  
573  N  N   . THR A 90  ? 0.1600 0.1578 0.1469 -0.0029 -0.0027 -0.0038 90  THR A N   
574  C  CA  . THR A 90  ? 0.1556 0.1539 0.1398 0.0000  -0.0010 0.0000  90  THR A CA  
575  C  C   . THR A 90  ? 0.1509 0.1503 0.1429 0.0009  -0.0016 0.0014  90  THR A C   
576  O  O   . THR A 90  ? 0.1638 0.1657 0.1414 -0.0048 0.0032  0.0036  90  THR A O   
577  C  CB  . THR A 90  ? 0.1609 0.1498 0.1412 0.0023  -0.0002 0.0006  90  THR A CB  
578  O  OG1 . THR A 90  ? 0.1749 0.1786 0.1184 -0.0035 0.0020  0.0063  90  THR A OG1 
579  C  CG2 . THR A 90  ? 0.1676 0.1573 0.1531 -0.0042 -0.0030 -0.0100 90  THR A CG2 
580  N  N   . THR A 91  ? 0.1480 0.1504 0.1376 -0.0018 0.0000  -0.0016 91  THR A N   
581  C  CA  . THR A 91  ? 0.1473 0.1471 0.1390 -0.0033 -0.0006 0.0013  91  THR A CA  
582  C  C   . THR A 91  ? 0.1534 0.1551 0.1377 -0.0041 -0.0052 0.0020  91  THR A C   
583  O  O   . THR A 91  ? 0.1617 0.1500 0.1595 -0.0040 0.0006  -0.0138 91  THR A O   
584  C  CB  . THR A 91  ? 0.1458 0.1486 0.1455 -0.0063 0.0021  -0.0060 91  THR A CB  
585  O  OG1 . THR A 91  ? 0.1302 0.1682 0.1618 0.0002  -0.0243 -0.0017 91  THR A OG1 
586  C  CG2 . THR A 91  ? 0.1745 0.1406 0.1680 -0.0076 -0.0010 -0.0071 91  THR A CG2 
587  N  N   . TRP A 92  ? 0.1503 0.1500 0.1396 -0.0005 -0.0059 0.0020  92  TRP A N   
588  C  CA  . TRP A 92  ? 0.1539 0.1593 0.1508 0.0039  -0.0016 0.0021  92  TRP A CA  
589  C  C   . TRP A 92  ? 0.1478 0.1596 0.1501 0.0017  0.0006  0.0036  92  TRP A C   
590  O  O   . TRP A 92  ? 0.1463 0.1567 0.1525 -0.0089 -0.0027 0.0099  92  TRP A O   
591  C  CB  . TRP A 92  ? 0.1561 0.1639 0.1549 0.0011  -0.0055 0.0040  92  TRP A CB  
592  C  CG  . TRP A 92  ? 0.1537 0.1650 0.1487 -0.0023 0.0010  0.0067  92  TRP A CG  
593  C  CD1 . TRP A 92  ? 0.1771 0.1793 0.1583 0.0024  -0.0024 -0.0064 92  TRP A CD1 
594  C  CD2 . TRP A 92  ? 0.1481 0.1649 0.1605 -0.0104 -0.0039 0.0006  92  TRP A CD2 
595  N  NE1 . TRP A 92  ? 0.1629 0.1687 0.1592 0.0031  -0.0079 0.0093  92  TRP A NE1 
596  C  CE2 . TRP A 92  ? 0.1726 0.1744 0.1555 -0.0144 -0.0058 -0.0052 92  TRP A CE2 
597  C  CE3 . TRP A 92  ? 0.1727 0.1681 0.1562 0.0058  -0.0124 -0.0016 92  TRP A CE3 
598  C  CZ2 . TRP A 92  ? 0.1820 0.1730 0.1517 0.0026  -0.0061 0.0055  92  TRP A CZ2 
599  C  CZ3 . TRP A 92  ? 0.1783 0.1730 0.1536 0.0045  0.0026  0.0003  92  TRP A CZ3 
600  C  CH2 . TRP A 92  ? 0.1727 0.1736 0.1548 -0.0032 -0.0093 0.0018  92  TRP A CH2 
601  N  N   . SER A 93  ? 0.1467 0.1655 0.1586 -0.0005 0.0042  0.0025  93  SER A N   
602  C  CA  . SER A 93  ? 0.1568 0.1685 0.1601 0.0036  0.0012  0.0004  93  SER A CA  
603  C  C   . SER A 93  ? 0.1635 0.1640 0.1602 0.0029  0.0048  0.0004  93  SER A C   
604  O  O   . SER A 93  ? 0.1749 0.1495 0.1605 0.0029  0.0107  -0.0122 93  SER A O   
605  C  CB  . SER A 93  ? 0.1546 0.1749 0.1670 0.0020  0.0018  0.0031  93  SER A CB  
606  O  OG  . SER A 93  ? 0.1555 0.1827 0.1642 0.0093  -0.0039 -0.0068 93  SER A OG  
607  N  N   . GLY A 94  ? 0.1714 0.1629 0.1629 0.0040  0.0025  -0.0037 94  GLY A N   
608  C  CA  . GLY A 94  ? 0.1681 0.1743 0.1579 0.0065  0.0077  -0.0027 94  GLY A CA  
609  C  C   . GLY A 94  ? 0.1727 0.1803 0.1661 0.0025  0.0092  -0.0010 94  GLY A C   
610  O  O   . GLY A 94  ? 0.1738 0.1862 0.1540 0.0032  0.0171  -0.0091 94  GLY A O   
611  N  N   . GLN A 95  ? 0.1774 0.1870 0.1686 0.0035  0.0093  -0.0006 95  GLN A N   
612  C  CA  . GLN A 95  ? 0.1808 0.2034 0.1860 0.0061  0.0066  -0.0032 95  GLN A CA  
613  C  C   . GLN A 95  ? 0.1853 0.2046 0.1912 0.0068  0.0032  -0.0021 95  GLN A C   
614  O  O   . GLN A 95  ? 0.1733 0.2020 0.1838 0.0073  0.0061  0.0021  95  GLN A O   
615  C  CB  . GLN A 95  ? 0.1820 0.2101 0.1855 0.0066  0.0074  -0.0038 95  GLN A CB  
616  C  CG  . GLN A 95  ? 0.2051 0.2136 0.1922 0.0008  -0.0015 -0.0054 95  GLN A CG  
617  C  CD  . GLN A 95  ? 0.1999 0.2216 0.1961 0.0028  -0.0015 -0.0039 95  GLN A CD  
618  O  OE1 . GLN A 95  ? 0.2288 0.2477 0.1915 -0.0095 -0.0051 -0.0052 95  GLN A OE1 
619  N  NE2 . GLN A 95  ? 0.1994 0.2284 0.1999 -0.0045 0.0104  -0.0104 95  GLN A NE2 
620  N  N   . TYR A 96  ? 0.1884 0.2117 0.1966 0.0057  0.0083  -0.0012 96  TYR A N   
621  C  CA  . TYR A 96  ? 0.1999 0.2261 0.2138 0.0068  0.0041  -0.0014 96  TYR A CA  
622  C  C   . TYR A 96  ? 0.2069 0.2326 0.2245 0.0057  0.0036  -0.0039 96  TYR A C   
623  O  O   . TYR A 96  ? 0.1960 0.2353 0.2234 0.0162  0.0118  -0.0093 96  TYR A O   
624  C  CB  . TYR A 96  ? 0.1974 0.2387 0.2194 0.0021  0.0047  -0.0005 96  TYR A CB  
625  C  CG  . TYR A 96  ? 0.2010 0.2359 0.2116 0.0083  0.0070  -0.0075 96  TYR A CG  
626  C  CD1 . TYR A 96  ? 0.1982 0.2547 0.2252 0.0090  0.0070  -0.0007 96  TYR A CD1 
627  C  CD2 . TYR A 96  ? 0.2052 0.2565 0.2236 0.0050  0.0017  0.0107  96  TYR A CD2 
628  C  CE1 . TYR A 96  ? 0.2068 0.2714 0.2506 0.0121  0.0092  -0.0021 96  TYR A CE1 
629  C  CE2 . TYR A 96  ? 0.2161 0.2749 0.2351 0.0047  0.0124  0.0040  96  TYR A CE2 
630  C  CZ  . TYR A 96  ? 0.1960 0.2707 0.2403 0.0079  0.0079  0.0013  96  TYR A CZ  
631  O  OH  . TYR A 96  ? 0.2135 0.3023 0.2856 0.0137  0.0221  -0.0125 96  TYR A OH  
632  N  N   . VAL A 97  ? 0.2285 0.2449 0.2431 0.0093  0.0041  -0.0081 97  VAL A N   
633  C  CA  . VAL A 97  ? 0.2594 0.2663 0.2717 0.0104  0.0000  -0.0084 97  VAL A CA  
634  C  C   . VAL A 97  ? 0.2695 0.2828 0.2879 0.0116  0.0034  -0.0072 97  VAL A C   
635  O  O   . VAL A 97  ? 0.2550 0.2836 0.2897 0.0278  0.0040  -0.0033 97  VAL A O   
636  C  CB  . VAL A 97  ? 0.2513 0.2671 0.2702 0.0119  0.0013  -0.0109 97  VAL A CB  
637  C  CG1 . VAL A 97  ? 0.2953 0.2740 0.2848 0.0060  -0.0125 -0.0169 97  VAL A CG1 
638  C  CG2 . VAL A 97  ? 0.2598 0.2830 0.2966 0.0084  -0.0061 -0.0177 97  VAL A CG2 
639  N  N   . GLY A 98  ? 0.2986 0.3085 0.3139 0.0094  0.0030  -0.0010 98  GLY A N   
640  C  CA  . GLY A 98  ? 0.3174 0.3308 0.3368 0.0054  0.0058  -0.0036 98  GLY A CA  
641  C  C   . GLY A 98  ? 0.3405 0.3455 0.3605 0.0076  0.0059  -0.0052 98  GLY A C   
642  O  O   . GLY A 98  ? 0.3516 0.3473 0.3752 0.0088  0.0123  -0.0095 98  GLY A O   
643  N  N   . GLY A 99  ? 0.3634 0.3689 0.3852 0.0083  0.0026  -0.0051 99  GLY A N   
644  C  CA  . GLY A 99  ? 0.3701 0.3729 0.3880 0.0100  0.0040  -0.0050 99  GLY A CA  
645  C  C   . GLY A 99  ? 0.3818 0.3858 0.3999 0.0100  0.0006  -0.0048 99  GLY A C   
646  O  O   . GLY A 99  ? 0.3923 0.4039 0.4177 0.0140  0.0030  -0.0049 99  GLY A O   
647  N  N   . ALA A 100 ? 0.3887 0.3934 0.4104 0.0117  0.0017  -0.0041 100 ALA A N   
648  C  CA  . ALA A 100 ? 0.3844 0.3869 0.3997 0.0106  0.0017  -0.0017 100 ALA A CA  
649  C  C   . ALA A 100 ? 0.3876 0.3898 0.4061 0.0110  -0.0013 -0.0048 100 ALA A C   
650  O  O   . ALA A 100 ? 0.4013 0.4068 0.4244 0.0160  -0.0062 -0.0073 100 ALA A O   
651  C  CB  . ALA A 100 ? 0.3945 0.3915 0.4100 0.0103  0.0013  -0.0048 100 ALA A CB  
652  N  N   . GLU A 101 ? 0.3726 0.3755 0.3919 0.0088  0.0012  -0.0029 101 GLU A N   
653  C  CA  . GLU A 101 ? 0.3594 0.3583 0.3759 0.0125  -0.0009 -0.0025 101 GLU A CA  
654  C  C   . GLU A 101 ? 0.3417 0.3437 0.3614 0.0109  0.0011  -0.0044 101 GLU A C   
655  O  O   . GLU A 101 ? 0.3499 0.3460 0.3696 0.0129  -0.0042 -0.0089 101 GLU A O   
656  C  CB  . GLU A 101 ? 0.3691 0.3687 0.3851 0.0076  0.0001  -0.0021 101 GLU A CB  
657  C  CG  . GLU A 101 ? 0.3749 0.3716 0.3818 0.0084  0.0012  -0.0011 101 GLU A CG  
658  C  CD  . GLU A 101 ? 0.3813 0.3724 0.3877 0.0066  0.0013  -0.0007 101 GLU A CD  
659  O  OE1 . GLU A 101 ? 0.4152 0.3982 0.4035 0.0008  0.0030  -0.0071 101 GLU A OE1 
660  O  OE2 . GLU A 101 ? 0.4148 0.3997 0.3908 0.0050  0.0028  0.0026  101 GLU A OE2 
661  N  N   . ALA A 102 ? 0.3101 0.3220 0.3306 0.0178  0.0028  -0.0034 102 ALA A N   
662  C  CA  . ALA A 102 ? 0.2895 0.3064 0.3089 0.0146  0.0055  -0.0032 102 ALA A CA  
663  C  C   . ALA A 102 ? 0.2666 0.2822 0.2860 0.0175  0.0040  -0.0026 102 ALA A C   
664  O  O   . ALA A 102 ? 0.2375 0.2720 0.2887 0.0310  0.0074  -0.0076 102 ALA A O   
665  C  CB  . ALA A 102 ? 0.2932 0.3042 0.3076 0.0108  0.0089  -0.0036 102 ALA A CB  
666  N  N   . ARG A 103 ? 0.2429 0.2666 0.2623 0.0173  0.0047  -0.0024 103 ARG A N   
667  C  CA  . ARG A 103 ? 0.2466 0.2581 0.2624 0.0123  0.0029  -0.0020 103 ARG A CA  
668  C  C   . ARG A 103 ? 0.2196 0.2425 0.2392 0.0121  0.0028  -0.0024 103 ARG A C   
669  O  O   . ARG A 103 ? 0.2171 0.2492 0.2297 0.0189  0.0115  -0.0027 103 ARG A O   
670  C  CB  . ARG A 103 ? 0.2544 0.2640 0.2709 0.0071  0.0058  -0.0026 103 ARG A CB  
671  C  CG  . ARG A 103 ? 0.2720 0.2698 0.2863 0.0068  0.0006  0.0011  103 ARG A CG  
672  C  CD  . ARG A 103 ? 0.2825 0.2845 0.2923 0.0009  0.0004  -0.0001 103 ARG A CD  
673  N  NE  . ARG A 103 ? 0.3082 0.3128 0.3142 0.0037  0.0001  -0.0006 103 ARG A NE  
674  C  CZ  . ARG A 103 ? 0.3235 0.3285 0.3230 0.0035  -0.0015 0.0000  103 ARG A CZ  
675  N  NH1 . ARG A 103 ? 0.3042 0.3162 0.3236 0.0078  0.0013  0.0060  103 ARG A NH1 
676  N  NH2 . ARG A 103 ? 0.3331 0.3527 0.3532 0.0013  -0.0054 -0.0024 103 ARG A NH2 
677  N  N   . ILE A 104 ? 0.1926 0.2221 0.2160 0.0123  -0.0003 -0.0023 104 ILE A N   
678  C  CA  . ILE A 104 ? 0.1973 0.2170 0.2130 0.0103  -0.0005 -0.0006 104 ILE A CA  
679  C  C   . ILE A 104 ? 0.1838 0.2064 0.1974 0.0113  -0.0002 -0.0021 104 ILE A C   
680  O  O   . ILE A 104 ? 0.1794 0.2198 0.1957 0.0143  0.0005  0.0109  104 ILE A O   
681  C  CB  . ILE A 104 ? 0.1892 0.2113 0.2078 0.0095  0.0002  0.0016  104 ILE A CB  
682  C  CG1 . ILE A 104 ? 0.1961 0.2217 0.2290 0.0031  -0.0085 0.0030  104 ILE A CG1 
683  C  CG2 . ILE A 104 ? 0.1932 0.2193 0.2136 0.0138  0.0013  -0.0041 104 ILE A CG2 
684  C  CD1 . ILE A 104 ? 0.2128 0.2242 0.2294 0.0063  0.0000  -0.0050 104 ILE A CD1 
685  N  N   . ASN A 105 ? 0.1836 0.2054 0.1931 0.0133  0.0013  -0.0006 105 ASN A N   
686  C  CA  . ASN A 105 ? 0.1781 0.1929 0.1902 0.0142  -0.0008 -0.0033 105 ASN A CA  
687  C  C   . ASN A 105 ? 0.1666 0.1880 0.1847 0.0109  -0.0025 0.0023  105 ASN A C   
688  O  O   . ASN A 105 ? 0.1601 0.2004 0.1824 0.0154  -0.0065 0.0078  105 ASN A O   
689  C  CB  . ASN A 105 ? 0.1911 0.2050 0.1997 0.0189  -0.0059 -0.0037 105 ASN A CB  
690  C  CG  . ASN A 105 ? 0.2263 0.2167 0.2253 0.0251  -0.0077 -0.0104 105 ASN A CG  
691  O  OD1 . ASN A 105 ? 0.2877 0.2475 0.2676 0.0446  -0.0095 0.0039  105 ASN A OD1 
692  N  ND2 . ASN A 105 ? 0.2568 0.2796 0.2577 0.0211  0.0016  -0.0136 105 ASN A ND2 
693  N  N   . THR A 106 ? 0.1632 0.1734 0.1714 0.0127  -0.0039 0.0013  106 THR A N   
694  C  CA  . THR A 106 ? 0.1604 0.1745 0.1653 0.0068  0.0009  -0.0013 106 THR A CA  
695  C  C   . THR A 106 ? 0.1552 0.1638 0.1543 0.0028  -0.0006 -0.0041 106 THR A C   
696  O  O   . THR A 106 ? 0.1435 0.1664 0.1494 0.0118  0.0122  0.0030  106 THR A O   
697  C  CB  . THR A 106 ? 0.1556 0.1695 0.1692 0.0044  -0.0014 -0.0011 106 THR A CB  
698  O  OG1 . THR A 106 ? 0.1570 0.1783 0.1693 -0.0080 0.0047  -0.0019 106 THR A OG1 
699  C  CG2 . THR A 106 ? 0.1649 0.1899 0.1812 0.0003  -0.0048 -0.0035 106 THR A CG2 
700  N  N   . GLN A 107 ? 0.1591 0.1633 0.1494 0.0024  0.0027  -0.0017 107 GLN A N   
701  C  CA  . GLN A 107 ? 0.1658 0.1693 0.1571 0.0014  0.0008  -0.0044 107 GLN A CA  
702  C  C   . GLN A 107 ? 0.1627 0.1583 0.1476 0.0022  0.0014  -0.0037 107 GLN A C   
703  O  O   . GLN A 107 ? 0.1605 0.1614 0.1430 0.0064  0.0136  -0.0126 107 GLN A O   
704  C  CB  . GLN A 107 ? 0.1776 0.1785 0.1751 -0.0010 -0.0001 -0.0063 107 GLN A CB  
705  C  CG  A GLN A 107 ? 0.1842 0.1884 0.1708 -0.0015 -0.0030 -0.0122 107 GLN A CG  
706  C  CG  B GLN A 107 ? 0.2101 0.2050 0.1927 0.0012  -0.0014 -0.0133 107 GLN A CG  
707  C  CD  A GLN A 107 ? 0.1651 0.1787 0.1672 -0.0029 -0.0026 -0.0069 107 GLN A CD  
708  C  CD  B GLN A 107 ? 0.2257 0.2214 0.2248 -0.0038 -0.0037 0.0043  107 GLN A CD  
709  O  OE1 A GLN A 107 ? 0.2055 0.1948 0.1765 0.0015  -0.0091 -0.0010 107 GLN A OE1 
710  O  OE1 B GLN A 107 ? 0.2447 0.2516 0.2289 -0.0018 -0.0012 -0.0271 107 GLN A OE1 
711  N  NE2 A GLN A 107 ? 0.1647 0.1589 0.1755 -0.0017 -0.0038 0.0035  107 GLN A NE2 
712  N  NE2 B GLN A 107 ? 0.2748 0.2432 0.2262 0.0066  -0.0146 -0.0150 107 GLN A NE2 
713  N  N   . TRP A 108 ? 0.1478 0.1504 0.1506 0.0031  0.0055  -0.0035 108 TRP A N   
714  C  CA  . TRP A 108 ? 0.1570 0.1541 0.1456 0.0019  -0.0017 -0.0024 108 TRP A CA  
715  C  C   . TRP A 108 ? 0.1540 0.1535 0.1351 -0.0031 -0.0013 0.0001  108 TRP A C   
716  O  O   . TRP A 108 ? 0.1669 0.1620 0.1373 -0.0137 0.0024  -0.0011 108 TRP A O   
717  C  CB  . TRP A 108 ? 0.1578 0.1554 0.1540 0.0012  -0.0009 -0.0029 108 TRP A CB  
718  C  CG  . TRP A 108 ? 0.1642 0.1644 0.1487 0.0018  -0.0046 0.0007  108 TRP A CG  
719  C  CD1 . TRP A 108 ? 0.1746 0.1728 0.1589 0.0032  0.0016  0.0055  108 TRP A CD1 
720  C  CD2 . TRP A 108 ? 0.1548 0.1474 0.1551 -0.0042 -0.0100 0.0078  108 TRP A CD2 
721  N  NE1 . TRP A 108 ? 0.1784 0.1748 0.1669 0.0132  0.0021  0.0128  108 TRP A NE1 
722  C  CE2 . TRP A 108 ? 0.1602 0.1558 0.1600 0.0096  -0.0022 0.0008  108 TRP A CE2 
723  C  CE3 . TRP A 108 ? 0.1741 0.1650 0.1547 -0.0010 -0.0043 0.0047  108 TRP A CE3 
724  C  CZ2 . TRP A 108 ? 0.1690 0.1454 0.1619 0.0097  -0.0058 0.0007  108 TRP A CZ2 
725  C  CZ3 . TRP A 108 ? 0.1733 0.1661 0.1540 0.0027  0.0037  0.0024  108 TRP A CZ3 
726  C  CH2 . TRP A 108 ? 0.1685 0.1674 0.1526 0.0002  0.0020  0.0033  108 TRP A CH2 
727  N  N   . LEU A 109 ? 0.1546 0.1490 0.1434 -0.0012 -0.0007 0.0021  109 LEU A N   
728  C  CA  . LEU A 109 ? 0.1528 0.1546 0.1462 0.0014  -0.0017 0.0005  109 LEU A CA  
729  C  C   . LEU A 109 ? 0.1543 0.1547 0.1575 -0.0010 -0.0053 -0.0029 109 LEU A C   
730  O  O   . LEU A 109 ? 0.1669 0.1599 0.1571 -0.0109 -0.0051 -0.0077 109 LEU A O   
731  C  CB  . LEU A 109 ? 0.1588 0.1603 0.1548 0.0044  -0.0017 0.0011  109 LEU A CB  
732  C  CG  . LEU A 109 ? 0.1603 0.1662 0.1553 0.0062  -0.0073 0.0066  109 LEU A CG  
733  C  CD1 . LEU A 109 ? 0.1769 0.1512 0.1483 0.0111  -0.0045 0.0035  109 LEU A CD1 
734  C  CD2 . LEU A 109 ? 0.1748 0.1939 0.1765 -0.0051 -0.0013 -0.0015 109 LEU A CD2 
735  N  N   . LEU A 110 ? 0.1509 0.1503 0.1511 -0.0055 0.0034  -0.0065 110 LEU A N   
736  C  CA  . LEU A 110 ? 0.1567 0.1630 0.1574 0.0000  0.0008  -0.0030 110 LEU A CA  
737  C  C   . LEU A 110 ? 0.1631 0.1654 0.1566 -0.0034 0.0027  -0.0080 110 LEU A C   
738  O  O   . LEU A 110 ? 0.1485 0.1640 0.1759 -0.0025 0.0074  -0.0104 110 LEU A O   
739  C  CB  . LEU A 110 ? 0.1646 0.1702 0.1613 -0.0045 0.0027  -0.0001 110 LEU A CB  
740  C  CG  . LEU A 110 ? 0.1735 0.1721 0.1626 0.0059  -0.0005 0.0028  110 LEU A CG  
741  C  CD1 . LEU A 110 ? 0.1928 0.1970 0.1874 0.0304  -0.0218 0.0063  110 LEU A CD1 
742  C  CD2 . LEU A 110 ? 0.1938 0.2078 0.1682 0.0003  -0.0010 -0.0020 110 LEU A CD2 
743  N  N   . THR A 111 ? 0.1683 0.1713 0.1700 -0.0017 0.0022  -0.0043 111 THR A N   
744  C  CA  . THR A 111 ? 0.1729 0.1735 0.1639 0.0025  -0.0005 -0.0096 111 THR A CA  
745  C  C   . THR A 111 ? 0.1811 0.1803 0.1750 -0.0010 -0.0012 -0.0075 111 THR A C   
746  O  O   . THR A 111 ? 0.1713 0.1875 0.1696 -0.0077 -0.0001 -0.0160 111 THR A O   
747  C  CB  . THR A 111 ? 0.1741 0.1751 0.1656 0.0028  0.0047  -0.0078 111 THR A CB  
748  O  OG1 . THR A 111 ? 0.1732 0.1763 0.1448 0.0181  -0.0158 -0.0132 111 THR A OG1 
749  C  CG2 . THR A 111 ? 0.1738 0.1914 0.1790 0.0088  0.0060  -0.0095 111 THR A CG2 
750  N  N   . LYS A 112 ? 0.1913 0.1813 0.1734 -0.0026 0.0028  -0.0093 112 LYS A N   
751  C  CA  . LYS A 112 ? 0.2046 0.1955 0.1843 0.0015  0.0032  -0.0067 112 LYS A CA  
752  C  C   . LYS A 112 ? 0.2013 0.1956 0.1853 0.0056  0.0020  -0.0094 112 LYS A C   
753  O  O   . LYS A 112 ? 0.1936 0.1943 0.1901 0.0046  0.0135  -0.0232 112 LYS A O   
754  C  CB  . LYS A 112 ? 0.2269 0.2171 0.1943 0.0038  -0.0002 -0.0067 112 LYS A CB  
755  C  CG  . LYS A 112 ? 0.2288 0.2176 0.2120 0.0018  0.0001  -0.0019 112 LYS A CG  
756  C  CD  . LYS A 112 ? 0.2298 0.2241 0.2121 0.0018  0.0074  0.0028  112 LYS A CD  
757  C  CE  . LYS A 112 ? 0.2396 0.2400 0.2287 -0.0019 0.0012  0.0054  112 LYS A CE  
758  N  NZ  . LYS A 112 ? 0.2701 0.2420 0.2561 -0.0002 0.0038  0.0141  112 LYS A NZ  
759  N  N   . GLY A 113 ? 0.2018 0.2050 0.1968 0.0050  0.0032  -0.0095 113 GLY A N   
760  C  CA  . GLY A 113 ? 0.2202 0.2102 0.2062 0.0077  0.0016  -0.0061 113 GLY A CA  
761  C  C   . GLY A 113 ? 0.2277 0.2177 0.2089 0.0098  0.0049  -0.0030 113 GLY A C   
762  O  O   . GLY A 113 ? 0.2405 0.2476 0.2076 0.0208  0.0027  -0.0024 113 GLY A O   
763  N  N   . THR A 114 ? 0.2327 0.2236 0.2131 0.0047  0.0068  -0.0044 114 THR A N   
764  C  CA  . THR A 114 ? 0.2384 0.2325 0.2223 0.0060  0.0090  -0.0059 114 THR A CA  
765  C  C   . THR A 114 ? 0.2492 0.2377 0.2282 0.0063  0.0136  -0.0078 114 THR A C   
766  O  O   . THR A 114 ? 0.2536 0.2291 0.2160 0.0065  0.0204  -0.0162 114 THR A O   
767  C  CB  . THR A 114 ? 0.2315 0.2215 0.2185 0.0056  0.0118  -0.0011 114 THR A CB  
768  O  OG1 . THR A 114 ? 0.2270 0.2239 0.2002 0.0011  0.0073  -0.0190 114 THR A OG1 
769  C  CG2 . THR A 114 ? 0.2250 0.2055 0.2067 0.0026  0.0073  -0.0113 114 THR A CG2 
770  N  N   . THR A 115 ? 0.2508 0.2490 0.2393 -0.0013 0.0161  -0.0052 115 THR A N   
771  C  CA  . THR A 115 ? 0.2657 0.2626 0.2531 0.0017  0.0168  -0.0075 115 THR A CA  
772  C  C   . THR A 115 ? 0.2619 0.2649 0.2630 0.0021  0.0115  -0.0038 115 THR A C   
773  O  O   . THR A 115 ? 0.2505 0.2547 0.2517 0.0066  0.0143  -0.0104 115 THR A O   
774  C  CB  . THR A 115 ? 0.2681 0.2729 0.2559 -0.0008 0.0208  -0.0042 115 THR A CB  
775  O  OG1 . THR A 115 ? 0.3132 0.2806 0.2639 -0.0009 0.0440  -0.0154 115 THR A OG1 
776  C  CG2 . THR A 115 ? 0.2946 0.2984 0.2681 -0.0010 0.0172  -0.0116 115 THR A CG2 
777  N  N   . GLU A 116 ? 0.2714 0.2706 0.2756 0.0026  0.0115  -0.0074 116 GLU A N   
778  C  CA  . GLU A 116 ? 0.2816 0.2808 0.2867 0.0054  0.0093  -0.0058 116 GLU A CA  
779  C  C   . GLU A 116 ? 0.2788 0.2769 0.2827 0.0033  0.0099  -0.0082 116 GLU A C   
780  O  O   . GLU A 116 ? 0.2786 0.2836 0.2823 0.0064  0.0149  -0.0170 116 GLU A O   
781  C  CB  . GLU A 116 ? 0.2875 0.2861 0.3005 0.0074  0.0032  -0.0040 116 GLU A CB  
782  C  CG  . GLU A 116 ? 0.3028 0.2907 0.3065 0.0047  0.0030  0.0014  116 GLU A CG  
783  C  CD  . GLU A 116 ? 0.3096 0.3016 0.3203 0.0081  0.0014  -0.0035 116 GLU A CD  
784  O  OE1 . GLU A 116 ? 0.3386 0.3093 0.3626 0.0006  0.0049  0.0032  116 GLU A OE1 
785  O  OE2 . GLU A 116 ? 0.3389 0.3565 0.3668 0.0092  -0.0083 -0.0046 116 GLU A OE2 
786  N  N   . ALA A 117 ? 0.2803 0.2729 0.2839 0.0041  0.0187  -0.0119 117 ALA A N   
787  C  CA  . ALA A 117 ? 0.2750 0.2724 0.2751 0.0024  0.0175  -0.0096 117 ALA A CA  
788  C  C   . ALA A 117 ? 0.2728 0.2657 0.2736 -0.0019 0.0189  -0.0115 117 ALA A C   
789  O  O   . ALA A 117 ? 0.2782 0.2813 0.2946 -0.0050 0.0354  -0.0200 117 ALA A O   
790  C  CB  . ALA A 117 ? 0.2886 0.2828 0.2838 0.0010  0.0207  -0.0145 117 ALA A CB  
791  N  N   . ASN A 118 ? 0.2571 0.2481 0.2503 -0.0030 0.0199  -0.0088 118 ASN A N   
792  C  CA  . ASN A 118 ? 0.2519 0.2429 0.2355 -0.0021 0.0194  -0.0016 118 ASN A CA  
793  C  C   . ASN A 118 ? 0.2456 0.2299 0.2175 0.0033  0.0156  -0.0002 118 ASN A C   
794  O  O   . ASN A 118 ? 0.2312 0.2140 0.1934 0.0091  0.0198  0.0018  118 ASN A O   
795  C  CB  . ASN A 118 ? 0.2641 0.2402 0.2299 -0.0031 0.0185  -0.0009 118 ASN A CB  
796  C  CG  . ASN A 118 ? 0.2846 0.2800 0.2491 -0.0093 0.0199  -0.0017 118 ASN A CG  
797  O  OD1 . ASN A 118 ? 0.3225 0.2669 0.2569 -0.0171 0.0434  -0.0014 118 ASN A OD1 
798  N  ND2 . ASN A 118 ? 0.3324 0.3027 0.2640 -0.0166 0.0110  -0.0083 118 ASN A ND2 
799  N  N   . ALA A 119 ? 0.2332 0.2206 0.2142 0.0086  0.0141  -0.0019 119 ALA A N   
800  C  CA  . ALA A 119 ? 0.2230 0.2140 0.2137 0.0014  0.0104  -0.0014 119 ALA A CA  
801  C  C   . ALA A 119 ? 0.2122 0.2054 0.2121 -0.0009 0.0081  -0.0001 119 ALA A C   
802  O  O   . ALA A 119 ? 0.2155 0.2028 0.2067 -0.0068 0.0076  -0.0082 119 ALA A O   
803  C  CB  . ALA A 119 ? 0.2321 0.2117 0.2179 0.0062  0.0086  0.0038  119 ALA A CB  
804  N  N   . TRP A 120 ? 0.2069 0.2016 0.2142 -0.0011 0.0021  -0.0031 120 TRP A N   
805  C  CA  . TRP A 120 ? 0.2004 0.1992 0.2033 0.0006  0.0057  -0.0029 120 TRP A CA  
806  C  C   . TRP A 120 ? 0.1925 0.1919 0.2006 -0.0017 0.0092  -0.0031 120 TRP A C   
807  O  O   . TRP A 120 ? 0.1903 0.1957 0.1946 -0.0032 0.0131  -0.0152 120 TRP A O   
808  C  CB  . TRP A 120 ? 0.2046 0.1965 0.2132 -0.0023 0.0042  -0.0027 120 TRP A CB  
809  C  CG  . TRP A 120 ? 0.1973 0.1993 0.2037 -0.0073 0.0060  -0.0067 120 TRP A CG  
810  C  CD1 . TRP A 120 ? 0.2073 0.2061 0.2129 -0.0005 0.0084  -0.0009 120 TRP A CD1 
811  C  CD2 . TRP A 120 ? 0.2152 0.1980 0.2061 -0.0022 0.0126  -0.0044 120 TRP A CD2 
812  N  NE1 . TRP A 120 ? 0.2121 0.2098 0.2118 -0.0046 0.0180  0.0013  120 TRP A NE1 
813  C  CE2 . TRP A 120 ? 0.2176 0.1999 0.2103 -0.0086 0.0096  -0.0008 120 TRP A CE2 
814  C  CE3 . TRP A 120 ? 0.2157 0.2095 0.2193 -0.0001 0.0128  -0.0056 120 TRP A CE3 
815  C  CZ2 . TRP A 120 ? 0.2231 0.2151 0.2120 -0.0029 0.0039  -0.0034 120 TRP A CZ2 
816  C  CZ3 . TRP A 120 ? 0.2098 0.2044 0.2017 -0.0010 0.0109  -0.0032 120 TRP A CZ3 
817  C  CH2 . TRP A 120 ? 0.2181 0.2078 0.2132 -0.0030 0.0034  0.0001  120 TRP A CH2 
818  N  N   . LYS A 121 ? 0.1879 0.1836 0.1927 -0.0012 0.0107  -0.0067 121 LYS A N   
819  C  CA  . LYS A 121 ? 0.2040 0.1986 0.2040 -0.0012 0.0030  -0.0001 121 LYS A CA  
820  C  C   . LYS A 121 ? 0.1958 0.1891 0.1982 0.0013  0.0027  -0.0005 121 LYS A C   
821  O  O   . LYS A 121 ? 0.1961 0.1925 0.2009 -0.0058 -0.0051 0.0054  121 LYS A O   
822  C  CB  . LYS A 121 ? 0.2179 0.2075 0.2179 -0.0025 0.0016  0.0008  121 LYS A CB  
823  C  CG  . LYS A 121 ? 0.2387 0.2209 0.2190 -0.0026 0.0099  0.0011  121 LYS A CG  
824  C  CD  . LYS A 121 ? 0.2507 0.2368 0.2312 0.0021  0.0007  0.0074  121 LYS A CD  
825  C  CE  . LYS A 121 ? 0.2860 0.2634 0.2425 0.0025  0.0055  0.0043  121 LYS A CE  
826  N  NZ  . LYS A 121 ? 0.3323 0.2929 0.2559 -0.0009 0.0109  0.0167  121 LYS A NZ  
827  N  N   . SER A 122 ? 0.1814 0.1833 0.1827 0.0043  0.0055  -0.0010 122 SER A N   
828  C  CA  . SER A 122 ? 0.1837 0.1780 0.1762 0.0043  0.0032  -0.0033 122 SER A CA  
829  C  C   . SER A 122 ? 0.1707 0.1694 0.1690 0.0054  0.0024  -0.0069 122 SER A C   
830  O  O   . SER A 122 ? 0.1702 0.1656 0.1806 -0.0028 0.0043  -0.0277 122 SER A O   
831  C  CB  . SER A 122 ? 0.1843 0.1759 0.1849 0.0057  0.0003  -0.0070 122 SER A CB  
832  O  OG  . SER A 122 ? 0.2169 0.1920 0.1870 0.0159  0.0027  0.0104  122 SER A OG  
833  N  N   . THR A 123 ? 0.1652 0.1558 0.1557 0.0040  0.0035  -0.0031 123 THR A N   
834  C  CA  . THR A 123 ? 0.1697 0.1533 0.1540 0.0044  0.0025  -0.0016 123 THR A CA  
835  C  C   . THR A 123 ? 0.1772 0.1567 0.1537 0.0016  0.0013  0.0016  123 THR A C   
836  O  O   . THR A 123 ? 0.1876 0.1609 0.1576 -0.0004 -0.0128 0.0032  123 THR A O   
837  C  CB  . THR A 123 ? 0.1740 0.1462 0.1513 0.0032  0.0094  0.0001  123 THR A CB  
838  O  OG1 . THR A 123 ? 0.1973 0.1559 0.1662 0.0268  0.0181  0.0228  123 THR A OG1 
839  C  CG2 . THR A 123 ? 0.1678 0.1621 0.1473 0.0081  0.0086  -0.0067 123 THR A CG2 
840  N  N   . LEU A 124 ? 0.1768 0.1643 0.1530 0.0013  0.0016  -0.0057 124 LEU A N   
841  C  CA  . LEU A 124 ? 0.1739 0.1581 0.1560 0.0003  0.0052  0.0018  124 LEU A CA  
842  C  C   . LEU A 124 ? 0.1706 0.1598 0.1556 -0.0021 0.0047  -0.0003 124 LEU A C   
843  O  O   . LEU A 124 ? 0.1701 0.1554 0.1572 -0.0016 0.0157  0.0048  124 LEU A O   
844  C  CB  . LEU A 124 ? 0.1861 0.1735 0.1617 -0.0034 0.0053  -0.0017 124 LEU A CB  
845  C  CG  . LEU A 124 ? 0.2127 0.1881 0.1753 0.0000  0.0026  0.0031  124 LEU A CG  
846  C  CD1 . LEU A 124 ? 0.2291 0.2270 0.2020 -0.0087 -0.0156 -0.0022 124 LEU A CD1 
847  C  CD2 . LEU A 124 ? 0.2369 0.2169 0.1794 -0.0232 -0.0037 0.0069  124 LEU A CD2 
848  N  N   . VAL A 125 ? 0.1607 0.1602 0.1500 0.0009  0.0082  0.0027  125 VAL A N   
849  C  CA  . VAL A 125 ? 0.1571 0.1551 0.1521 0.0023  0.0056  0.0002  125 VAL A CA  
850  C  C   . VAL A 125 ? 0.1466 0.1490 0.1459 0.0045  0.0045  0.0027  125 VAL A C   
851  O  O   . VAL A 125 ? 0.1453 0.1476 0.1552 0.0043  0.0135  0.0045  125 VAL A O   
852  C  CB  . VAL A 125 ? 0.1518 0.1581 0.1590 0.0067  0.0048  0.0046  125 VAL A CB  
853  C  CG1 . VAL A 125 ? 0.1378 0.1818 0.1841 -0.0054 0.0130  0.0028  125 VAL A CG1 
854  C  CG2 . VAL A 125 ? 0.1487 0.1783 0.1436 -0.0027 0.0019  -0.0023 125 VAL A CG2 
855  N  N   . GLY A 126 ? 0.1487 0.1469 0.1502 0.0032  0.0033  0.0075  126 GLY A N   
856  C  CA  . GLY A 126 ? 0.1533 0.1558 0.1548 0.0036  0.0063  -0.0006 126 GLY A CA  
857  C  C   . GLY A 126 ? 0.1587 0.1568 0.1529 0.0058  0.0041  0.0005  126 GLY A C   
858  O  O   . GLY A 126 ? 0.1702 0.1513 0.1457 0.0080  0.0156  -0.0007 126 GLY A O   
859  N  N   . HIS A 127 ? 0.1559 0.1712 0.1607 0.0096  0.0008  0.0028  127 HIS A N   
860  C  CA  . HIS A 127 ? 0.1539 0.1691 0.1622 0.0069  0.0002  0.0051  127 HIS A CA  
861  C  C   . HIS A 127 ? 0.1533 0.1760 0.1697 0.0065  -0.0033 0.0086  127 HIS A C   
862  O  O   . HIS A 127 ? 0.1536 0.1784 0.1770 0.0014  -0.0106 0.0152  127 HIS A O   
863  C  CB  . HIS A 127 ? 0.1654 0.1827 0.1736 0.0083  -0.0008 0.0004  127 HIS A CB  
864  C  CG  . HIS A 127 ? 0.1906 0.1788 0.1885 -0.0047 -0.0070 -0.0086 127 HIS A CG  
865  N  ND1 . HIS A 127 ? 0.2326 0.2073 0.2177 0.0054  -0.0138 -0.0166 127 HIS A ND1 
866  C  CD2 . HIS A 127 ? 0.2091 0.1949 0.2063 -0.0078 -0.0083 -0.0115 127 HIS A CD2 
867  C  CE1 . HIS A 127 ? 0.2352 0.2026 0.2396 0.0050  0.0005  -0.0070 127 HIS A CE1 
868  N  NE2 . HIS A 127 ? 0.2235 0.2053 0.2429 -0.0087 -0.0098 -0.0090 127 HIS A NE2 
869  N  N   . ASP A 128 ? 0.1517 0.1792 0.1672 0.0066  -0.0061 0.0000  128 ASP A N   
870  C  CA  . ASP A 128 ? 0.1588 0.1867 0.1749 0.0083  -0.0007 0.0026  128 ASP A CA  
871  C  C   . ASP A 128 ? 0.1675 0.1925 0.1799 0.0083  0.0006  0.0007  128 ASP A C   
872  O  O   . ASP A 128 ? 0.1484 0.1921 0.1758 0.0111  0.0030  0.0038  128 ASP A O   
873  C  CB  . ASP A 128 ? 0.1571 0.1873 0.1663 0.0051  0.0013  0.0033  128 ASP A CB  
874  C  CG  . ASP A 128 ? 0.1639 0.1775 0.1709 0.0074  -0.0025 0.0002  128 ASP A CG  
875  O  OD1 . ASP A 128 ? 0.1834 0.1920 0.1685 0.0130  0.0076  0.0070  128 ASP A OD1 
876  O  OD2 . ASP A 128 ? 0.1674 0.1839 0.1551 0.0150  -0.0173 0.0058  128 ASP A OD2 
877  N  N   . THR A 129 ? 0.1757 0.1988 0.1942 0.0091  0.0000  -0.0004 129 THR A N   
878  C  CA  . THR A 129 ? 0.1817 0.2099 0.2060 0.0060  -0.0028 -0.0038 129 THR A CA  
879  C  C   . THR A 129 ? 0.1782 0.2046 0.2003 0.0080  -0.0072 -0.0054 129 THR A C   
880  O  O   . THR A 129 ? 0.1797 0.2070 0.2095 -0.0002 -0.0176 -0.0014 129 THR A O   
881  C  CB  . THR A 129 ? 0.1975 0.2258 0.2243 0.0050  -0.0006 -0.0099 129 THR A CB  
882  O  OG1 . THR A 129 ? 0.2593 0.3107 0.3112 -0.0055 -0.0109 -0.0099 129 THR A OG1 
883  C  CG2 . THR A 129 ? 0.1971 0.2164 0.2168 0.0125  0.0052  -0.0108 129 THR A CG2 
884  N  N   . PHE A 130 ? 0.1782 0.2050 0.1893 0.0088  -0.0062 -0.0087 130 PHE A N   
885  C  CA  . PHE A 130 ? 0.1874 0.2165 0.2049 0.0043  -0.0034 -0.0061 130 PHE A CA  
886  C  C   . PHE A 130 ? 0.1991 0.2287 0.2151 0.0081  -0.0029 -0.0087 130 PHE A C   
887  O  O   . PHE A 130 ? 0.1867 0.2348 0.2143 0.0189  -0.0024 -0.0045 130 PHE A O   
888  C  CB  . PHE A 130 ? 0.1826 0.2081 0.1927 0.0077  -0.0039 -0.0065 130 PHE A CB  
889  C  CG  . PHE A 130 ? 0.1752 0.2005 0.1743 0.0054  -0.0095 -0.0035 130 PHE A CG  
890  C  CD1 . PHE A 130 ? 0.1729 0.2024 0.1943 0.0072  -0.0020 -0.0031 130 PHE A CD1 
891  C  CD2 . PHE A 130 ? 0.1787 0.1981 0.1856 0.0026  -0.0128 -0.0035 130 PHE A CD2 
892  C  CE1 . PHE A 130 ? 0.1775 0.2006 0.1817 0.0101  -0.0044 0.0005  130 PHE A CE1 
893  C  CE2 . PHE A 130 ? 0.1694 0.1943 0.1721 0.0013  -0.0173 -0.0020 130 PHE A CE2 
894  C  CZ  . PHE A 130 ? 0.1743 0.1894 0.1893 0.0164  -0.0058 -0.0049 130 PHE A CZ  
895  N  N   . THR A 131 ? 0.2119 0.2462 0.2370 0.0039  -0.0020 -0.0085 131 THR A N   
896  C  CA  . THR A 131 ? 0.2291 0.2655 0.2671 0.0062  -0.0046 -0.0077 131 THR A CA  
897  C  C   . THR A 131 ? 0.2416 0.2851 0.2843 0.0014  -0.0047 -0.0104 131 THR A C   
898  O  O   . THR A 131 ? 0.1879 0.2737 0.2685 0.0117  -0.0149 -0.0150 131 THR A O   
899  C  CB  . THR A 131 ? 0.2316 0.2672 0.2707 -0.0015 -0.0019 -0.0072 131 THR A CB  
900  O  OG1 . THR A 131 ? 0.2712 0.2852 0.3171 0.0001  -0.0254 0.0127  131 THR A OG1 
901  C  CG2 . THR A 131 ? 0.2373 0.2594 0.2756 -0.0035 -0.0023 -0.0051 131 THR A CG2 
902  N  N   . LYS A 132 ? 0.2679 0.3179 0.3134 0.0053  0.0000  -0.0139 132 LYS A N   
903  C  CA  . LYS A 132 ? 0.3049 0.3455 0.3421 -0.0023 -0.0021 -0.0095 132 LYS A CA  
904  C  C   . LYS A 132 ? 0.3349 0.3675 0.3649 0.0033  -0.0043 -0.0073 132 LYS A C   
905  O  O   . LYS A 132 ? 0.3272 0.3825 0.3717 0.0048  -0.0075 -0.0102 132 LYS A O   
906  C  CB  . LYS A 132 ? 0.3077 0.3490 0.3445 -0.0014 0.0000  -0.0096 132 LYS A CB  
907  C  CG  . LYS A 132 ? 0.3462 0.3739 0.3689 -0.0010 0.0057  0.0015  132 LYS A CG  
908  C  CD  . LYS A 132 ? 0.3691 0.3829 0.3860 0.0049  0.0008  -0.0017 132 LYS A CD  
909  C  CE  . LYS A 132 ? 0.3975 0.3850 0.4017 -0.0005 -0.0049 0.0034  132 LYS A CE  
910  N  NZ  . LYS A 132 ? 0.4121 0.3912 0.3914 0.0042  0.0000  -0.0037 132 LYS A NZ  
911  N  N   . VAL A 133 ? 0.3703 0.3894 0.3914 0.0028  -0.0052 -0.0018 133 VAL A N   
912  C  CA  . VAL A 133 ? 0.4025 0.4097 0.4135 0.0030  -0.0041 0.0012  133 VAL A CA  
913  C  C   . VAL A 133 ? 0.4215 0.4272 0.4334 -0.0001 -0.0021 0.0027  133 VAL A C   
914  O  O   . VAL A 133 ? 0.4383 0.4417 0.4517 0.0007  -0.0075 0.0028  133 VAL A O   
915  C  CB  . VAL A 133 ? 0.4102 0.4126 0.4173 0.0022  -0.0004 0.0012  133 VAL A CB  
916  C  CG1 . VAL A 133 ? 0.4303 0.4272 0.4246 0.0058  0.0028  -0.0008 133 VAL A CG1 
917  C  CG2 . VAL A 133 ? 0.4200 0.4277 0.4305 0.0001  -0.0059 -0.0005 133 VAL A CG2 
918  N  N   . LYS A 134 ? 0.4467 0.4503 0.4506 -0.0013 -0.0022 0.0015  134 LYS A N   
919  C  CA  . LYS A 134 ? 0.4496 0.4561 0.4522 -0.0009 -0.0006 0.0016  134 LYS A CA  
920  C  C   . LYS A 134 ? 0.4626 0.4650 0.4616 -0.0001 -0.0026 0.0000  134 LYS A C   
921  O  O   . LYS A 134 ? 0.4775 0.4798 0.4721 0.0022  -0.0073 0.0006  134 LYS A O   
922  C  CB  . LYS A 134 ? 0.4643 0.4664 0.4655 -0.0015 -0.0013 0.0000  134 LYS A CB  
923  C  CG  . LYS A 134 ? 0.4631 0.4720 0.4734 -0.0032 0.0031  0.0014  134 LYS A CG  
924  C  CD  . LYS A 134 ? 0.4809 0.4860 0.4932 0.0014  0.0035  -0.0016 134 LYS A CD  
925  C  CE  . LYS A 134 ? 0.4868 0.4957 0.5016 -0.0007 0.0036  0.0022  134 LYS A CE  
926  N  NZ  . LYS A 134 ? 0.5144 0.5112 0.5278 0.0038  -0.0027 0.0070  134 LYS A NZ  
927  O  O56 . KYS B .   ? 0.1920 0.1880 0.1810 0.0105  -0.0138 -0.0011 400 KYS A O56 
928  C  C54 . KYS B .   ? 0.1843 0.1839 0.1697 0.0004  -0.0057 0.0034  400 KYS A C54 
929  N  N55 . KYS B .   ? 0.1990 0.1850 0.1542 -0.0021 -0.0142 0.0012  400 KYS A N55 
930  C  C50 . KYS B .   ? 0.1886 0.1637 0.1629 -0.0023 -0.0085 0.0024  400 KYS A C50 
931  C  C51 . KYS B .   ? 0.2034 0.1926 0.1757 0.0004  -0.0078 0.0015  400 KYS A C51 
932  S  S52 . KYS B .   ? 0.1965 0.1770 0.1581 0.0005  -0.0224 -0.0020 400 KYS A S52 
933  N  N53 . KYS B .   ? 0.1932 0.1814 0.1538 0.0080  -0.0053 0.0075  400 KYS A N53 
934  C  C49 . KYS B .   ? 0.1917 0.1716 0.1659 -0.0034 -0.0070 0.0034  400 KYS A C49 
935  C  C48 . KYS B .   ? 0.1829 0.1726 0.1755 -0.0099 -0.0060 -0.0026 400 KYS A C48 
936  C  C47 . KYS B .   ? 0.1784 0.1766 0.1580 -0.0024 -0.0064 -0.0028 400 KYS A C47 
937  C  C46 . KYS B .   ? 0.1625 0.1847 0.1758 -0.0046 -0.0131 -0.0021 400 KYS A C46 
938  C  C45 . KYS B .   ? 0.1809 0.1977 0.1698 -0.0027 -0.0036 0.0053  400 KYS A C45 
939  C  C40 . KYS B .   ? 0.2088 0.1937 0.1611 0.0001  -0.0058 -0.0082 400 KYS A C40 
940  C  C39 . KYS B .   ? 0.2043 0.2116 0.1692 -0.0150 -0.0074 -0.0075 400 KYS A C39 
941  O  O41 . KYS B .   ? 0.2566 0.2048 0.1845 -0.0039 -0.0039 -0.0071 400 KYS A O41 
942  N  N19 A KYS B .   ? 0.2476 0.2316 0.2120 0.0097  -0.0033 0.0016  400 KYS A N19 
943  N  N19 B KYS B .   ? 0.2066 0.2125 0.1990 -0.0016 0.0008  -0.0018 400 KYS A N19 
944  C  C21 A KYS B .   ? 0.2485 0.2482 0.2366 0.0022  -0.0035 0.0054  400 KYS A C21 
945  C  C21 B KYS B .   ? 0.2197 0.2205 0.2148 0.0056  -0.0095 0.0012  400 KYS A C21 
946  C  C22 A KYS B .   ? 0.2639 0.2537 0.2462 0.0069  -0.0085 -0.0050 400 KYS A C22 
947  C  C22 B KYS B .   ? 0.2544 0.2221 0.2312 0.0087  -0.0261 -0.0041 400 KYS A C22 
948  C  C23 A KYS B .   ? 0.2391 0.2434 0.2437 -0.0046 0.0023  0.0023  400 KYS A C23 
949  C  C23 B KYS B .   ? 0.1703 0.2128 0.1968 -0.0095 0.0210  -0.0025 400 KYS A C23 
950  C  C20 A KYS B .   ? 0.2584 0.2628 0.2409 0.0042  -0.0028 0.0014  400 KYS A C20 
951  C  C20 B KYS B .   ? 0.2300 0.2278 0.2147 0.0092  -0.0091 -0.0069 400 KYS A C20 
952  C  C24 A KYS B .   ? 0.2367 0.2457 0.2471 -0.0049 0.0039  0.0039  400 KYS A C24 
953  C  C24 B KYS B .   ? 0.1858 0.2005 0.2113 -0.0089 0.0126  -0.0039 400 KYS A C24 
954  C  C33 A KYS B .   ? 0.2637 0.2655 0.2531 0.0025  -0.0024 -0.0036 400 KYS A C33 
955  C  C33 B KYS B .   ? 0.2507 0.2359 0.2313 0.0083  -0.0170 -0.0003 400 KYS A C33 
956  S  S30 A KYS B .   ? 0.2498 0.2599 0.2625 -0.0153 0.0096  0.0014  400 KYS A S30 
957  S  S30 B KYS B .   ? 0.0989 0.1892 0.1953 -0.0501 0.0418  0.0134  400 KYS A S30 
958  O  O31 A KYS B .   ? 0.2660 0.2718 0.2674 -0.0041 0.0018  -0.0003 400 KYS A O31 
959  O  O31 B KYS B .   ? 0.2097 0.2426 0.2316 -0.0018 0.0145  0.0072  400 KYS A O31 
960  O  O31 C KYS B .   ? 0.2720 0.2836 0.2839 -0.0026 0.0032  0.0047  400 KYS A O31 
961  O  O32 A KYS B .   ? 0.2732 0.2757 0.2569 -0.0076 0.0035  -0.0010 400 KYS A O32 
962  O  O32 B KYS B .   ? 0.1964 0.2187 0.2226 -0.0106 0.0005  0.0037  400 KYS A O32 
963  O  O32 C KYS B .   ? 0.2595 0.2698 0.2516 -0.0048 0.0054  0.0029  400 KYS A O32 
964  N  N26 A KYS B .   ? 0.3580 0.3631 0.3465 0.0056  -0.0076 -0.0009 400 KYS A N26 
965  N  N26 B KYS B .   ? 0.1868 0.2199 0.2231 -0.0092 0.0053  -0.0049 400 KYS A N26 
966  N  N26 C KYS B .   ? 0.2811 0.2857 0.2837 -0.0028 0.0010  0.0014  400 KYS A N26 
967  RU RU1 A KYS B .   ? 0.3968 0.3864 0.3801 -0.0086 -0.0052 0.0054  400 KYS A RU1 
968  CL CL2 A KYS B .   ? 0.3977 0.3905 0.3842 -0.0015 -0.0024 0.0039  400 KYS A CL2 
969  C  C6  A KYS B .   ? 0.3850 0.3838 0.3770 -0.0037 -0.0015 0.0031  400 KYS A C6  
970  C  C7  A KYS B .   ? 0.3842 0.3813 0.3762 -0.0030 -0.0008 0.0023  400 KYS A C7  
971  C  C8  A KYS B .   ? 0.3779 0.3768 0.3726 -0.0051 -0.0003 0.0030  400 KYS A C8  
972  C  C9  A KYS B .   ? 0.3799 0.3765 0.3734 -0.0049 0.0000  0.0045  400 KYS A C9  
973  C  C10 A KYS B .   ? 0.3838 0.3773 0.3726 -0.0043 -0.0004 0.0056  400 KYS A C10 
974  C  C5  A KYS B .   ? 0.3866 0.3842 0.3767 -0.0043 -0.0005 0.0011  400 KYS A C5  
975  C  C28 A KYS B .   ? 0.3630 0.3604 0.3577 -0.0011 -0.0016 -0.0006 400 KYS A C28 
976  C  C29 A KYS B .   ? 0.3744 0.3739 0.3669 -0.0005 -0.0011 0.0009  400 KYS A C29 
977  N  N27 A KYS B .   ? 0.3813 0.3813 0.3755 -0.0029 -0.0004 0.0029  400 KYS A N27 
978  O  O   . HOH C .   ? 0.2232 0.2298 0.1808 -0.0215 -0.0036 -0.0339 401 HOH A O   
979  O  O   . HOH C .   ? 0.1939 0.1820 0.1907 0.0013  -0.0225 -0.0064 402 HOH A O   
980  O  O   . HOH C .   ? 0.1667 0.1668 0.1537 -0.0079 -0.0106 0.0105  403 HOH A O   
981  O  O   . HOH C .   ? 0.1819 0.2325 0.1728 0.0081  -0.0016 0.0147  404 HOH A O   
982  O  O   . HOH C .   ? 0.2006 0.2205 0.1699 -0.0102 -0.0150 0.0121  405 HOH A O   
983  O  O   . HOH C .   ? 0.2572 0.2195 0.2438 0.0012  -0.0202 -0.0134 406 HOH A O   
984  O  O   . HOH C .   ? 0.2887 0.2770 0.3196 0.0206  0.0016  0.0074  407 HOH A O   
985  O  O   . HOH C .   ? 0.1827 0.2293 0.2040 -0.0269 0.0221  0.0116  408 HOH A O   
986  O  O   . HOH C .   ? 0.3241 0.2879 0.2988 -0.0035 0.0228  0.0171  409 HOH A O   
987  O  O   . HOH C .   ? 0.2572 0.2769 0.2461 -0.0255 -0.0632 0.0024  410 HOH A O   
988  O  O   . HOH C .   ? 0.2496 0.2203 0.2155 -0.0053 0.0170  0.0005  411 HOH A O   
989  O  O   . HOH C .   ? 0.2298 0.2290 0.1903 -0.0195 -0.0014 -0.0179 412 HOH A O   
990  O  O   . HOH C .   ? 0.3007 0.2532 0.2182 -0.0067 -0.0047 0.0014  413 HOH A O   
991  O  O   . HOH C .   ? 0.2710 0.2827 0.2947 0.0420  0.0083  0.0244  414 HOH A O   
992  O  O   . HOH C .   ? 0.2271 0.3063 0.2866 0.0303  -0.0208 -0.0122 415 HOH A O   
993  O  O   . HOH C .   ? 0.2083 0.2977 0.2172 -0.0239 -0.0103 0.0603  416 HOH A O   
994  O  O   . HOH C .   ? 0.3481 0.3176 0.2082 -0.0137 0.0072  0.0227  417 HOH A O   
995  O  O   . HOH C .   ? 0.2746 0.2443 0.2517 -0.0269 -0.0147 -0.0016 418 HOH A O   
996  O  O   . HOH C .   ? 0.3322 0.3215 0.3117 -0.0354 -0.0270 -0.0133 419 HOH A O   
997  O  O   . HOH C .   ? 0.2545 0.3277 0.2017 -0.0106 -0.0220 0.0049  420 HOH A O   
998  O  O   . HOH C .   ? 0.2743 0.2393 0.2399 0.0068  -0.0076 0.0157  421 HOH A O   
999  O  O   . HOH C .   ? 0.2952 0.3577 0.2950 0.0164  0.0183  0.0024  422 HOH A O   
1000 O  O   . HOH C .   ? 0.3056 0.3321 0.3791 -0.0322 -0.0228 -0.0206 423 HOH A O   
1001 O  O   . HOH C .   ? 0.2482 0.3771 0.3735 0.0072  -0.0144 -0.0091 424 HOH A O   
1002 O  O   . HOH C .   ? 0.3119 0.3198 0.2948 -0.0153 -0.0246 0.0067  425 HOH A O   
1003 O  O   . HOH C .   ? 0.3221 0.3508 0.2970 -0.0075 0.0042  0.0241  426 HOH A O   
1004 O  O   . HOH C .   ? 0.3525 0.3761 0.4222 0.0177  0.0436  -0.0470 427 HOH A O   
1005 O  O   . HOH C .   ? 0.2797 0.2576 0.2125 0.0148  0.0283  -0.0148 428 HOH A O   
1006 O  O   . HOH C .   ? 0.1933 0.2024 0.1992 0.0188  0.0158  0.0174  429 HOH A O   
1007 O  O   . HOH C .   ? 0.2586 0.2195 0.2956 0.0334  -0.0006 -0.0056 430 HOH A O   
1008 O  O   . HOH C .   ? 0.2769 0.3122 0.2054 -0.0088 0.0231  -0.0008 431 HOH A O   
1009 O  O   . HOH C .   ? 0.3254 0.3136 0.2611 -0.0234 -0.0105 -0.0010 432 HOH A O   
1010 O  O   . HOH C .   ? 0.2770 0.2391 0.2221 -0.0001 0.0168  0.0250  433 HOH A O   
1011 O  O   . HOH C .   ? 0.2425 0.2561 0.2918 0.0302  0.0047  -0.0052 434 HOH A O   
1012 O  O   . HOH C .   ? 0.2792 0.3128 0.2542 0.0140  -0.0482 0.0036  435 HOH A O   
1013 O  O   . HOH C .   ? 0.3225 0.3655 0.3754 -0.0176 0.0156  -0.0382 436 HOH A O   
1014 O  O   . HOH C .   ? 0.3569 0.3354 0.3572 -0.0364 -0.0266 -0.0097 437 HOH A O   
1015 O  O   . HOH C .   ? 0.3153 0.3857 0.3574 -0.0053 0.0243  -0.0211 438 HOH A O   
1016 O  O   . HOH C .   ? 0.4292 0.4082 0.4114 -0.0039 -0.0038 -0.0081 439 HOH A O   
1017 O  O   . HOH C .   ? 0.4275 0.3784 0.4278 0.0434  -0.0099 0.0099  440 HOH A O   
1018 O  O   . HOH C .   ? 0.4152 0.3854 0.3328 -0.0422 0.0495  -0.0067 441 HOH A O   
1019 O  O   . HOH C .   ? 0.4028 0.4523 0.4276 0.0096  0.0101  0.0034  442 HOH A O   
1020 O  O   . HOH C .   ? 0.3843 0.4011 0.3791 0.0015  0.0390  0.0016  443 HOH A O   
1021 O  O   . HOH C .   ? 0.4942 0.5231 0.3928 -0.0044 -0.0090 -0.0144 444 HOH A O   
1022 O  O   . HOH C .   ? 0.3289 0.3260 0.3664 0.0060  0.0000  0.0000  445 HOH A O   
1023 O  O   . HOH C .   ? 0.2826 0.3677 0.3884 0.0038  0.0044  -0.0467 446 HOH A O   
1024 O  O   . HOH C .   ? 0.3767 0.3776 0.3722 0.0142  -0.0115 0.0173  447 HOH A O   
1025 O  O   . HOH C .   ? 0.3922 0.4638 0.3733 -0.0207 -0.0259 0.0071  448 HOH A O   
1026 O  O   . HOH C .   ? 0.3891 0.4403 0.3890 -0.0174 -0.0249 0.0074  449 HOH A O   
1027 O  O   . HOH C .   ? 0.3983 0.4245 0.3641 -0.0352 0.0113  0.0028  450 HOH A O   
1028 O  O   . HOH C .   ? 0.3683 0.3199 0.2982 0.0478  -0.0621 -0.0098 451 HOH A O   
1029 O  O   . HOH C .   ? 0.4271 0.3546 0.3407 -0.0006 0.0049  -0.0248 452 HOH A O   
1030 O  O   . HOH C .   ? 0.7637 0.7580 0.7617 -0.0038 0.0040  0.0037  453 HOH A O   
1031 O  O   . HOH C .   ? 0.4797 0.4854 0.4468 -0.0141 -0.0176 -0.0021 454 HOH A O   
1032 O  O   . HOH C .   ? 0.4854 0.4823 0.4834 -0.0263 0.0020  -0.0096 455 HOH A O   
1033 O  O   . HOH C .   ? 0.4199 0.3696 0.4064 0.0004  -0.0105 -0.0018 456 HOH A O   
1034 O  O   . HOH C .   ? 0.3893 0.4274 0.4346 -0.0146 0.0028  0.0063  457 HOH A O   
1035 O  O   . HOH C .   ? 0.4114 0.4860 0.3940 -0.0139 -0.0198 0.0117  458 HOH A O   
1036 O  O   . HOH C .   ? 0.4388 0.4494 0.4365 -0.0223 -0.0188 -0.0077 459 HOH A O   
1037 O  O   . HOH C .   ? 0.4621 0.4929 0.4558 0.0014  0.0035  0.0283  460 HOH A O   
1038 O  O   . HOH C .   ? 0.4204 0.4191 0.4339 -0.0140 0.0236  -0.0158 461 HOH A O   
1039 O  O   . HOH C .   ? 0.3346 0.2930 0.3070 -0.0044 -0.0157 0.0038  462 HOH A O   
1040 O  O   . HOH C .   ? 0.9579 0.9488 0.9458 0.0017  -0.0034 -0.0008 463 HOH A O   
1041 O  O   . HOH C .   ? 0.2222 0.2015 0.2275 0.0009  -0.0057 -0.0070 464 HOH A O   
1042 O  O   . HOH C .   ? 0.2223 0.1995 0.2606 0.0081  -0.0069 0.0247  465 HOH A O   
1043 O  O   . HOH C .   ? 0.3870 0.3916 0.3864 0.0089  0.0028  -0.0080 466 HOH A O   
1044 O  O   . HOH C .   ? 0.4150 0.4024 0.3626 -0.0072 -0.0106 0.0052  467 HOH A O   
1045 O  O   . HOH C .   ? 0.4868 0.4544 0.4831 0.0150  -0.0030 -0.0097 468 HOH A O   
1046 O  O   . HOH C .   ? 0.6272 0.6306 0.6346 0.0010  -0.0055 -0.0009 469 HOH A O   
1047 O  O   . HOH C .   ? 0.4023 0.4232 0.4137 -0.0101 -0.0155 0.0219  470 HOH A O   
1048 O  O   . HOH C .   ? 0.3647 0.4248 0.4601 -0.0194 -0.0064 -0.0221 471 HOH A O   
1049 O  O   . HOH C .   ? 0.4847 0.5305 0.4813 -0.0042 0.0024  -0.0108 472 HOH A O   
1050 O  O   . HOH C .   ? 0.3091 0.3682 0.3693 0.0149  0.0036  -0.0035 473 HOH A O   
1051 O  O   . HOH C .   ? 0.4328 0.4467 0.4351 -0.0079 -0.0031 -0.0006 474 HOH A O   
1052 O  O   . HOH C .   ? 0.4069 0.4131 0.4060 0.0049  -0.0085 -0.0020 475 HOH A O   
1053 O  O   . HOH C .   ? 0.4394 0.4871 0.4782 0.0046  0.0163  0.0195  476 HOH A O   
1054 O  O   . HOH C .   ? 0.3352 0.4097 0.3870 -0.0453 -0.0002 -0.0118 477 HOH A O   
1055 O  O   . HOH C .   ? 0.4852 0.4448 0.4583 -0.0064 -0.0284 0.0004  478 HOH A O   
1056 O  O   . HOH C .   ? 0.4482 0.3355 0.3174 0.0058  -0.0261 0.0244  479 HOH A O   
1057 O  O   . HOH C .   ? 0.4404 0.3605 0.3465 -0.0045 -0.0091 0.0516  480 HOH A O   
1058 O  O   . HOH C .   ? 0.3673 0.4151 0.3594 -0.0032 0.0203  -0.0112 481 HOH A O   
1059 O  O   . HOH C .   ? 0.4251 0.3555 0.3945 0.0019  -0.0289 -0.0180 482 HOH A O   
1060 O  O   . HOH C .   ? 0.3949 0.3288 0.3630 -0.0213 0.0018  -0.0145 483 HOH A O   
1061 O  O   . HOH C .   ? 0.5164 0.4527 0.5147 -0.0231 -0.0203 0.0063  484 HOH A O   
1062 O  O   . HOH C .   ? 0.3832 0.4173 0.3891 0.0095  0.0038  -0.0157 485 HOH A O   
1063 O  O   . HOH C .   ? 0.4631 0.4616 0.4423 -0.0120 -0.0073 0.0021  486 HOH A O   
1064 O  O   . HOH C .   ? 0.4388 0.4603 0.3892 0.0066  0.0307  -0.0146 487 HOH A O   
1065 O  O   . HOH C .   ? 0.6004 0.5891 0.6089 -0.0025 -0.0106 0.0081  488 HOH A O   
1066 O  O   . HOH C .   ? 0.4587 0.5119 0.4655 0.0080  -0.0118 0.0332  489 HOH A O   
1067 O  O   . HOH C .   ? 0.4789 0.4348 0.4350 0.0012  -0.0003 0.0143  490 HOH A O   
1068 O  O   . HOH C .   ? 0.3500 0.3198 0.3201 0.0066  -0.0032 0.0112  491 HOH A O   
1069 O  O   . HOH C .   ? 0.4847 0.4156 0.3766 0.0199  -0.0055 0.0156  492 HOH A O   
1070 O  O   . HOH C .   ? 0.5319 0.5020 0.5067 0.0035  -0.0029 -0.0091 493 HOH A O   
1071 O  O   . HOH C .   ? 0.5698 0.5594 0.5564 0.0050  -0.0017 -0.0122 494 HOH A O   
1072 O  O   . HOH C .   ? 0.4690 0.4699 0.4264 -0.0191 0.0066  -0.0169 495 HOH A O   
1073 O  O   . HOH C .   ? 0.4772 0.4738 0.4517 -0.0038 -0.0134 -0.0025 496 HOH A O   
1074 O  O   . HOH C .   ? 0.4901 0.4619 0.4952 -0.0062 0.0073  -0.0047 497 HOH A O   
1075 O  O   . HOH C .   ? 0.5805 0.5903 0.5473 0.0016  0.0024  0.0008  498 HOH A O   
1076 O  O   . HOH C .   ? 0.4757 0.4656 0.5115 0.0067  -0.0046 -0.0012 499 HOH A O   
1077 O  O   . HOH C .   ? 0.5107 0.5508 0.5300 -0.0207 0.0057  -0.0041 500 HOH A O   
1078 O  O   . HOH C .   ? 0.3882 0.4445 0.4699 -0.0174 0.0148  -0.0097 501 HOH A O   
1079 O  O   . HOH C .   ? 0.3823 0.3592 0.3865 -0.0115 -0.0019 0.0103  502 HOH A O   
1080 O  O   . HOH C .   ? 0.6032 0.6006 0.6309 0.0042  0.0026  -0.0014 503 HOH A O   
1081 O  O   . HOH C .   ? 0.4610 0.4529 0.5046 0.0031  -0.0007 -0.0011 504 HOH A O   
1082 O  O   . HOH C .   ? 0.3520 0.3476 0.3466 0.0009  0.0002  0.0078  505 HOH A O   
1083 O  O   . HOH C .   ? 0.4953 0.4356 0.4197 -0.0013 -0.0174 -0.0122 506 HOH A O   
1084 O  O   . HOH C .   ? 0.4007 0.4133 0.4061 -0.0004 -0.0056 -0.0064 507 HOH A O   
1085 O  O   . HOH C .   ? 0.3191 0.2944 0.2872 -0.0022 0.0042  -0.0116 508 HOH A O   
1086 O  O   . HOH C .   ? 0.6676 0.6566 0.6585 0.0005  -0.0029 0.0030  509 HOH A O   
1087 O  O   . HOH C .   ? 0.6713 0.6850 0.6873 -0.0059 0.0105  -0.0031 510 HOH A O   
1088 O  O   . HOH C .   ? 0.3998 0.4036 0.3907 0.0148  0.0062  0.0024  511 HOH A O   
1089 O  O   . HOH C .   ? 0.2263 0.2090 0.1495 0.0108  0.0154  0.0086  512 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   MET 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   GLN 8   8   ?   ?   ?   A . n 
A 1 9   GLN 9   9   ?   ?   ?   A . n 
A 1 10  MET 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  ARG 12  12  ?   ?   ?   A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  TRP 21  21  21  TRP TRP A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  TRP 75  75  75  TRP TRP A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  TRP 79  79  79  TRP TRP A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  TRP 92  92  92  TRP TRP A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 TRP 108 108 108 TRP TRP A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 HIS 127 127 127 HIS HIS A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 PRO 135 135 ?   ?   ?   A . n 
A 1 136 SER 136 136 ?   ?   ?   A . n 
A 1 137 ALA 137 137 ?   ?   ?   A . n 
A 1 138 ALA 138 138 ?   ?   ?   A . n 
A 1 139 SER 139 139 ?   ?   ?   A . n 
A 1 140 ILE 140 140 ?   ?   ?   A . n 
A 1 141 ASP 141 141 ?   ?   ?   A . n 
A 1 142 ALA 142 142 ?   ?   ?   A . n 
A 1 143 ALA 143 143 ?   ?   ?   A . n 
A 1 144 LYS 144 144 ?   ?   ?   A . n 
A 1 145 LYS 145 145 ?   ?   ?   A . n 
A 1 146 ALA 146 146 ?   ?   ?   A . n 
A 1 147 GLY 147 147 ?   ?   ?   A . n 
A 1 148 VAL 148 148 ?   ?   ?   A . n 
A 1 149 ASN 149 149 ?   ?   ?   A . n 
A 1 150 ASN 150 150 ?   ?   ?   A . n 
A 1 151 GLY 151 151 ?   ?   ?   A . n 
A 1 152 ASN 152 152 ?   ?   ?   A . n 
A 1 153 PRO 153 153 ?   ?   ?   A . n 
A 1 154 LEU 154 154 ?   ?   ?   A . n 
A 1 155 ASP 155 155 ?   ?   ?   A . n 
A 1 156 ALA 156 156 ?   ?   ?   A . n 
A 1 157 VAL 157 157 ?   ?   ?   A . n 
A 1 158 GLN 158 158 ?   ?   ?   A . n 
A 1 159 GLN 159 159 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 KYS 1   400 400 KYS KYS A . 
C 3 HOH 1   401 402 HOH HOH A . 
C 3 HOH 2   402 403 HOH HOH A . 
C 3 HOH 3   403 404 HOH HOH A . 
C 3 HOH 4   404 405 HOH HOH A . 
C 3 HOH 5   405 406 HOH HOH A . 
C 3 HOH 6   406 407 HOH HOH A . 
C 3 HOH 7   407 408 HOH HOH A . 
C 3 HOH 8   408 409 HOH HOH A . 
C 3 HOH 9   409 410 HOH HOH A . 
C 3 HOH 10  410 411 HOH HOH A . 
C 3 HOH 11  411 412 HOH HOH A . 
C 3 HOH 12  412 413 HOH HOH A . 
C 3 HOH 13  413 414 HOH HOH A . 
C 3 HOH 14  414 415 HOH HOH A . 
C 3 HOH 15  415 416 HOH HOH A . 
C 3 HOH 16  416 417 HOH HOH A . 
C 3 HOH 17  417 418 HOH HOH A . 
C 3 HOH 18  418 419 HOH HOH A . 
C 3 HOH 19  419 420 HOH HOH A . 
C 3 HOH 20  420 421 HOH HOH A . 
C 3 HOH 21  421 422 HOH HOH A . 
C 3 HOH 22  422 423 HOH HOH A . 
C 3 HOH 23  423 424 HOH HOH A . 
C 3 HOH 24  424 425 HOH HOH A . 
C 3 HOH 25  425 426 HOH HOH A . 
C 3 HOH 26  426 427 HOH HOH A . 
C 3 HOH 27  427 428 HOH HOH A . 
C 3 HOH 28  428 429 HOH HOH A . 
C 3 HOH 29  429 430 HOH HOH A . 
C 3 HOH 30  430 431 HOH HOH A . 
C 3 HOH 31  431 432 HOH HOH A . 
C 3 HOH 32  432 433 HOH HOH A . 
C 3 HOH 33  433 434 HOH HOH A . 
C 3 HOH 34  434 435 HOH HOH A . 
C 3 HOH 35  435 436 HOH HOH A . 
C 3 HOH 36  436 437 HOH HOH A . 
C 3 HOH 37  437 438 HOH HOH A . 
C 3 HOH 38  438 439 HOH HOH A . 
C 3 HOH 39  439 440 HOH HOH A . 
C 3 HOH 40  440 441 HOH HOH A . 
C 3 HOH 41  441 442 HOH HOH A . 
C 3 HOH 42  442 443 HOH HOH A . 
C 3 HOH 43  443 444 HOH HOH A . 
C 3 HOH 44  444 445 HOH HOH A . 
C 3 HOH 45  445 446 HOH HOH A . 
C 3 HOH 46  446 447 HOH HOH A . 
C 3 HOH 47  447 448 HOH HOH A . 
C 3 HOH 48  448 449 HOH HOH A . 
C 3 HOH 49  449 450 HOH HOH A . 
C 3 HOH 50  450 451 HOH HOH A . 
C 3 HOH 51  451 452 HOH HOH A . 
C 3 HOH 52  452 453 HOH HOH A . 
C 3 HOH 53  453 454 HOH HOH A . 
C 3 HOH 54  454 455 HOH HOH A . 
C 3 HOH 55  455 456 HOH HOH A . 
C 3 HOH 56  456 457 HOH HOH A . 
C 3 HOH 57  457 458 HOH HOH A . 
C 3 HOH 58  458 459 HOH HOH A . 
C 3 HOH 59  459 460 HOH HOH A . 
C 3 HOH 60  460 461 HOH HOH A . 
C 3 HOH 61  461 462 HOH HOH A . 
C 3 HOH 62  462 463 HOH HOH A . 
C 3 HOH 63  463 464 HOH HOH A . 
C 3 HOH 64  464 465 HOH HOH A . 
C 3 HOH 65  465 466 HOH HOH A . 
C 3 HOH 66  466 467 HOH HOH A . 
C 3 HOH 67  467 468 HOH HOH A . 
C 3 HOH 68  468 469 HOH HOH A . 
C 3 HOH 69  469 470 HOH HOH A . 
C 3 HOH 70  470 471 HOH HOH A . 
C 3 HOH 71  471 472 HOH HOH A . 
C 3 HOH 72  472 473 HOH HOH A . 
C 3 HOH 73  473 474 HOH HOH A . 
C 3 HOH 74  474 475 HOH HOH A . 
C 3 HOH 75  475 476 HOH HOH A . 
C 3 HOH 76  476 477 HOH HOH A . 
C 3 HOH 77  477 478 HOH HOH A . 
C 3 HOH 78  478 479 HOH HOH A . 
C 3 HOH 79  479 480 HOH HOH A . 
C 3 HOH 80  480 481 HOH HOH A . 
C 3 HOH 81  481 482 HOH HOH A . 
C 3 HOH 82  482 483 HOH HOH A . 
C 3 HOH 83  483 484 HOH HOH A . 
C 3 HOH 84  484 485 HOH HOH A . 
C 3 HOH 85  485 486 HOH HOH A . 
C 3 HOH 86  486 487 HOH HOH A . 
C 3 HOH 87  487 488 HOH HOH A . 
C 3 HOH 88  488 489 HOH HOH A . 
C 3 HOH 89  489 490 HOH HOH A . 
C 3 HOH 90  490 491 HOH HOH A . 
C 3 HOH 91  491 492 HOH HOH A . 
C 3 HOH 92  492 493 HOH HOH A . 
C 3 HOH 93  493 494 HOH HOH A . 
C 3 HOH 94  494 495 HOH HOH A . 
C 3 HOH 95  495 496 HOH HOH A . 
C 3 HOH 96  496 497 HOH HOH A . 
C 3 HOH 97  497 498 HOH HOH A . 
C 3 HOH 98  498 499 HOH HOH A . 
C 3 HOH 99  499 500 HOH HOH A . 
C 3 HOH 100 500 501 HOH HOH A . 
C 3 HOH 101 501 502 HOH HOH A . 
C 3 HOH 102 502 503 HOH HOH A . 
C 3 HOH 103 503 504 HOH HOH A . 
C 3 HOH 104 504 505 HOH HOH A . 
C 3 HOH 105 505 506 HOH HOH A . 
C 3 HOH 106 506 507 HOH HOH A . 
C 3 HOH 107 507 508 HOH HOH A . 
C 3 HOH 108 508 509 HOH HOH A . 
C 3 HOH 109 509 510 HOH HOH A . 
C 3 HOH 110 510 511 HOH HOH A . 
C 3 HOH 111 511 512 HOH HOH A . 
C 3 HOH 112 512 513 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13440 ? 
1 MORE         -99   ? 
1 'SSA (A^2)'  17990 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 8_665  -y+1,-x+1,-z 0.0000000000  -1.0000000000 0.0000000000 57.6510000000 -1.0000000000 
0.0000000000  0.0000000000 57.6510000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
3 'crystal symmetry operation' 10_665 -x+1,-y+1,z  -1.0000000000 0.0000000000  0.0000000000 57.6510000000 0.0000000000  
-1.0000000000 0.0000000000 57.6510000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
4 'crystal symmetry operation' 15_555 y,x,-z       0.0000000000  1.0000000000  0.0000000000 0.0000000000  1.0000000000  
0.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 403 ? C HOH . 
2 1 A HOH 445 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-04-29 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'      
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO        .        ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK    .        ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC       5.2.0019 ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT  2.000    'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
CrystalClear .        ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000     .        ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
HKL-2000     .        ?                ?       ?                    ?                        'data scaling'    ? ?          ? 7 
MOLREP       .        ?                ?       ?                    ?                        phasing           ? ?          ? 8 
# 
_pdbx_database_remark.id     600 
_pdbx_database_remark.text   
;HETEROGEN 
The ligand KYS has considerable molecular motion and 
disorder. The Ruthenium metal is not modeled in 
confomer B. The SO2N group attached to the linker has 
rotational disorder and has been modeled as conformer C.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 52  ? ? 64.89   -159.11 
2 1 TRP A 79  ? ? -85.67  48.45   
3 1 GLU A 101 ? ? -116.60 78.29   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A MET 4   ? A MET 4   
5  1 Y 1 A THR 5   ? A THR 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A GLY 7   ? A GLY 7   
8  1 Y 1 A GLN 8   ? A GLN 8   
9  1 Y 1 A GLN 9   ? A GLN 9   
10 1 Y 1 A MET 10  ? A MET 10  
11 1 Y 1 A GLY 11  ? A GLY 11  
12 1 Y 1 A ARG 12  ? A ARG 12  
13 1 Y 1 A PRO 135 ? A PRO 135 
14 1 Y 1 A SER 136 ? A SER 136 
15 1 Y 1 A ALA 137 ? A ALA 137 
16 1 Y 1 A ALA 138 ? A ALA 138 
17 1 Y 1 A SER 139 ? A SER 139 
18 1 Y 1 A ILE 140 ? A ILE 140 
19 1 Y 1 A ASP 141 ? A ASP 141 
20 1 Y 1 A ALA 142 ? A ALA 142 
21 1 Y 1 A ALA 143 ? A ALA 143 
22 1 Y 1 A LYS 144 ? A LYS 144 
23 1 Y 1 A LYS 145 ? A LYS 145 
24 1 Y 1 A ALA 146 ? A ALA 146 
25 1 Y 1 A GLY 147 ? A GLY 147 
26 1 Y 1 A VAL 148 ? A VAL 148 
27 1 Y 1 A ASN 149 ? A ASN 149 
28 1 Y 1 A ASN 150 ? A ASN 150 
29 1 Y 1 A GLY 151 ? A GLY 151 
30 1 Y 1 A ASN 152 ? A ASN 152 
31 1 Y 1 A PRO 153 ? A PRO 153 
32 1 Y 1 A LEU 154 ? A LEU 154 
33 1 Y 1 A ASP 155 ? A ASP 155 
34 1 Y 1 A ALA 156 ? A ALA 156 
35 1 Y 1 A VAL 157 ? A VAL 157 
36 1 Y 1 A GLN 158 ? A GLN 158 
37 1 Y 1 A GLN 159 ? A GLN 159 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;N-(4-{[(2-AMINOETHYL)AMINO]SULFONYL}PHENYL)-5-[(3AS,4S,6AR)-2-OXOHEXAHYDRO-1H-THIENO[3,4-D]IMIDAZOL-4-YL]PENTANAMIDE-(1,2,3,4,5,6-ETA)-BENZENE-CHLORO-RUTHENIUM(III)
;
KYS 
3 water HOH 
#