data_2QDC
# 
_entry.id   2QDC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QDC         
RCSB  RCSB043455   
WWPDB D_1000043455 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1zc0 . unspecified 
PDB 2gp0 . unspecified 
PDB 2hvl . unspecified 
# 
_pdbx_database_status.entry_id                        2QDC 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-20 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Critton, D.A.' 1 
'Tortajada, A.' 2 
'Page, R.'      3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of substrate recognition by hematopoietic tyrosine phosphatase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            47 
_citation.page_first                13336 
_citation.page_last                 13345 
_citation.year                      2008 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19053285 
_citation.pdbx_database_id_DOI      10.1021/bi801724n 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Critton, D.A.' 1 
primary 'Tortajada, A.' 2 
primary 'Stetson, G.'   3 
primary 'Peti, W.'      4 
primary 'Page, R.'      5 
# 
_cell.entry_id           2QDC 
_cell.length_a           127.258 
_cell.length_b           127.258 
_cell.length_c           59.560 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QDC 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tyrosine-protein phosphatase non-receptor type 7' 35291.980 1   3.1.3.48 D236A 
'Catalytic domain (residues 65-360)' ? 
2 non-polymer syn 'PHOSPHATE ION'                                    94.971    2   ?        ?     ? ? 
3 non-polymer syn GLYCEROL                                           92.094    2   ?        ?     ? ? 
4 water       nat water                                              18.015    230 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein-tyrosine phosphatase LC-PTP, Hematopoietic protein-tyrosine phosphatase, HEPTP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPAHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPAHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  MET n 
1 14  ASN n 
1 15  THR n 
1 16  PRO n 
1 17  ARG n 
1 18  GLU n 
1 19  VAL n 
1 20  THR n 
1 21  LEU n 
1 22  HIS n 
1 23  PHE n 
1 24  LEU n 
1 25  ARG n 
1 26  THR n 
1 27  ALA n 
1 28  GLY n 
1 29  HIS n 
1 30  PRO n 
1 31  LEU n 
1 32  THR n 
1 33  ARG n 
1 34  TRP n 
1 35  ALA n 
1 36  LEU n 
1 37  GLN n 
1 38  ARG n 
1 39  GLN n 
1 40  PRO n 
1 41  PRO n 
1 42  SER n 
1 43  PRO n 
1 44  LYS n 
1 45  GLN n 
1 46  LEU n 
1 47  GLU n 
1 48  GLU n 
1 49  GLU n 
1 50  PHE n 
1 51  LEU n 
1 52  LYS n 
1 53  ILE n 
1 54  PRO n 
1 55  SER n 
1 56  ASN n 
1 57  PHE n 
1 58  VAL n 
1 59  SER n 
1 60  PRO n 
1 61  GLU n 
1 62  ASP n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  PRO n 
1 67  GLY n 
1 68  HIS n 
1 69  ALA n 
1 70  SER n 
1 71  LYS n 
1 72  ASP n 
1 73  ARG n 
1 74  TYR n 
1 75  LYS n 
1 76  THR n 
1 77  ILE n 
1 78  LEU n 
1 79  PRO n 
1 80  ASN n 
1 81  PRO n 
1 82  GLN n 
1 83  SER n 
1 84  ARG n 
1 85  VAL n 
1 86  CYS n 
1 87  LEU n 
1 88  GLY n 
1 89  ARG n 
1 90  ALA n 
1 91  GLN n 
1 92  SER n 
1 93  GLN n 
1 94  GLU n 
1 95  ASP n 
1 96  GLY n 
1 97  ASP n 
1 98  TYR n 
1 99  ILE n 
1 100 ASN n 
1 101 ALA n 
1 102 ASN n 
1 103 TYR n 
1 104 ILE n 
1 105 ARG n 
1 106 GLY n 
1 107 TYR n 
1 108 ASP n 
1 109 GLY n 
1 110 LYS n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 TYR n 
1 115 ILE n 
1 116 ALA n 
1 117 THR n 
1 118 GLN n 
1 119 GLY n 
1 120 PRO n 
1 121 MET n 
1 122 PRO n 
1 123 ASN n 
1 124 THR n 
1 125 VAL n 
1 126 SER n 
1 127 ASP n 
1 128 PHE n 
1 129 TRP n 
1 130 GLU n 
1 131 MET n 
1 132 VAL n 
1 133 TRP n 
1 134 GLN n 
1 135 GLU n 
1 136 GLU n 
1 137 VAL n 
1 138 SER n 
1 139 LEU n 
1 140 ILE n 
1 141 VAL n 
1 142 MET n 
1 143 LEU n 
1 144 THR n 
1 145 GLN n 
1 146 LEU n 
1 147 ARG n 
1 148 GLU n 
1 149 GLY n 
1 150 LYS n 
1 151 GLU n 
1 152 LYS n 
1 153 CYS n 
1 154 VAL n 
1 155 HIS n 
1 156 TYR n 
1 157 TRP n 
1 158 PRO n 
1 159 THR n 
1 160 GLU n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 TYR n 
1 165 GLY n 
1 166 PRO n 
1 167 PHE n 
1 168 GLN n 
1 169 ILE n 
1 170 ARG n 
1 171 ILE n 
1 172 GLN n 
1 173 ASP n 
1 174 MET n 
1 175 LYS n 
1 176 GLU n 
1 177 CYS n 
1 178 PRO n 
1 179 GLU n 
1 180 TYR n 
1 181 THR n 
1 182 VAL n 
1 183 ARG n 
1 184 GLN n 
1 185 LEU n 
1 186 THR n 
1 187 ILE n 
1 188 GLN n 
1 189 TYR n 
1 190 GLN n 
1 191 GLU n 
1 192 GLU n 
1 193 ARG n 
1 194 ARG n 
1 195 SER n 
1 196 VAL n 
1 197 LYS n 
1 198 HIS n 
1 199 ILE n 
1 200 LEU n 
1 201 PHE n 
1 202 SER n 
1 203 ALA n 
1 204 TRP n 
1 205 PRO n 
1 206 ALA n 
1 207 HIS n 
1 208 GLN n 
1 209 THR n 
1 210 PRO n 
1 211 GLU n 
1 212 SER n 
1 213 ALA n 
1 214 GLY n 
1 215 PRO n 
1 216 LEU n 
1 217 LEU n 
1 218 ARG n 
1 219 LEU n 
1 220 VAL n 
1 221 ALA n 
1 222 GLU n 
1 223 VAL n 
1 224 GLU n 
1 225 GLU n 
1 226 SER n 
1 227 PRO n 
1 228 GLU n 
1 229 THR n 
1 230 ALA n 
1 231 ALA n 
1 232 HIS n 
1 233 PRO n 
1 234 GLY n 
1 235 PRO n 
1 236 ILE n 
1 237 VAL n 
1 238 VAL n 
1 239 HIS n 
1 240 CYS n 
1 241 SER n 
1 242 ALA n 
1 243 GLY n 
1 244 ILE n 
1 245 GLY n 
1 246 ARG n 
1 247 THR n 
1 248 GLY n 
1 249 CYS n 
1 250 PHE n 
1 251 ILE n 
1 252 ALA n 
1 253 THR n 
1 254 ARG n 
1 255 ILE n 
1 256 GLY n 
1 257 CYS n 
1 258 GLN n 
1 259 GLN n 
1 260 LEU n 
1 261 LYS n 
1 262 ALA n 
1 263 ARG n 
1 264 GLY n 
1 265 GLU n 
1 266 VAL n 
1 267 ASP n 
1 268 ILE n 
1 269 LEU n 
1 270 GLY n 
1 271 ILE n 
1 272 VAL n 
1 273 CYS n 
1 274 GLN n 
1 275 LEU n 
1 276 ARG n 
1 277 LEU n 
1 278 ASP n 
1 279 ARG n 
1 280 GLY n 
1 281 GLY n 
1 282 MET n 
1 283 ILE n 
1 284 GLN n 
1 285 THR n 
1 286 ALA n 
1 287 GLU n 
1 288 GLN n 
1 289 TYR n 
1 290 GLN n 
1 291 PHE n 
1 292 LEU n 
1 293 HIS n 
1 294 HIS n 
1 295 THR n 
1 296 LEU n 
1 297 ALA n 
1 298 LEU n 
1 299 TYR n 
1 300 ALA n 
1 301 GLY n 
1 302 GLN n 
1 303 LEU n 
1 304 PRO n 
1 305 GLU n 
1 306 GLU n 
1 307 PRO n 
1 308 SER n 
1 309 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PTPN7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pBAD 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTN7_HUMAN 
_struct_ref.pdbx_db_accession          P35236 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQ
EDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQD
MKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIAT
RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_struct_ref.pdbx_align_begin           65 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2QDC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 309 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35236 
_struct_ref_seq.db_align_beg                  65 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  360 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       44 
_struct_ref_seq.pdbx_auth_seq_align_end       339 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2QDC MET A 1   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -12 1  
1 2QDC GLY A 2   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -11 2  
1 2QDC SER A 3   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -10 3  
1 2QDC ASP A 4   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -9  4  
1 2QDC LYS A 5   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -8  5  
1 2QDC ILE A 6   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -7  6  
1 2QDC HIS A 7   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -6  7  
1 2QDC HIS A 8   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -5  8  
1 2QDC HIS A 9   ? UNP P35236 ?   ?   'LEADER SEQUENCE' -4  9  
1 2QDC HIS A 10  ? UNP P35236 ?   ?   'LEADER SEQUENCE' -3  10 
1 2QDC HIS A 11  ? UNP P35236 ?   ?   'LEADER SEQUENCE' -2  11 
1 2QDC HIS A 12  ? UNP P35236 ?   ?   'LEADER SEQUENCE' -1  12 
1 2QDC MET A 13  ? UNP P35236 ?   ?   'LEADER SEQUENCE' 0   13 
1 2QDC ALA A 206 ? UNP P35236 ASP 257 ENGINEERED        236 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?                               'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2QDC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.19 
_exptl_crystal.density_percent_sol   70.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'0.1 M ACETIC ACID, 2.0 M SODIUM/POTASSIUM PHOSPHATE, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2006-09-09 
_diffrn_detector.details                'Si(111) CHANNEL CUT MONOCHROMATOR, OXFORD DANFYSIK TOROIDAL FOCUSING MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) CHANNEL CUT MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X6A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X6A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     2QDC 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   37288 
_reflns.number_all                   37340 
_reflns.percent_possible_obs         99.900 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.100 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.800 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   99.10 
_reflns_shell.Rmerge_I_obs           0.442 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        2.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2QDC 
_refine.ls_number_reflns_obs                     35415 
_refine.ls_number_reflns_all                     35454 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.89 
_refine.ls_R_factor_obs                          0.16419 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16276 
_refine.ls_R_factor_R_free                       0.19046 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1861 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.944 
_refine.B_iso_mean                               28.788 
_refine.aniso_B[1][1]                            0.06 
_refine.aniso_B[2][2]                            0.06 
_refine.aniso_B[3][3]                            -0.09 
_refine.aniso_B[1][2]                            0.03 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1ZC0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.104 
_refine.pdbx_overall_ESU_R_Free                  0.103 
_refine.overall_SU_ML                            0.068 
_refine.overall_SU_B                             4.537 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2234 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             230 
_refine_hist.number_atoms_total               2486 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 2328 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.363  1.968  ? 3166 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.378  5.000  ? 282  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.883 23.679 ? 106  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.582 15.000 ? 382  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.809 15.000 ? 17   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.093  0.200  ? 345  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 1773 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.199  0.200  ? 1045 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 1562 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.145  0.200  ? 203  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.198  0.200  ? 38   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.185  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.955  3.000  ? 1482 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.804  5.000  ? 2312 'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.330  8.000  ? 987  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.144  11.000 ? 854  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.051 
_refine_ls_shell.number_reflns_R_work             2554 
_refine_ls_shell.R_factor_R_work                  0.224 
_refine_ls_shell.percent_reflns_obs               98.79 
_refine_ls_shell.R_factor_R_free                  0.246 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2QDC 
_struct.title                     'Crystal structure of the HePTP catalytic domain D236A mutant' 
_struct.pdbx_descriptor           'Tyrosine-protein phosphatase non-receptor type 7 (E.C.3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QDC 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HePTP, human hematopoietic tyrosine phosphatase catalytic domain mutant, LC-PTP, PTPN7, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 15  ? ALA A 27  ? THR A 45  ALA A 57  1 ? 13 
HELX_P HELX_P2  2  ARG A 33  ? GLN A 39  ? ARG A 63  GLN A 69  1 ? 7  
HELX_P HELX_P3  3  SER A 42  ? ILE A 53  ? SER A 72  ILE A 83  1 ? 12 
HELX_P HELX_P4  4  SER A 59  ? LEU A 63  ? SER A 89  LEU A 93  5 ? 5  
HELX_P HELX_P5  5  GLY A 67  ? ASP A 72  ? GLY A 97  ASP A 102 5 ? 6  
HELX_P HELX_P6  6  ASN A 80  ? GLN A 82  ? ASN A 110 GLN A 112 5 ? 3  
HELX_P HELX_P7  7  GLY A 106 ? LYS A 110 ? GLY A 136 LYS A 140 5 ? 5  
HELX_P HELX_P8  8  MET A 121 ? ASN A 123 ? MET A 151 ASN A 153 5 ? 3  
HELX_P HELX_P9  9  THR A 124 ? GLU A 136 ? THR A 154 GLU A 166 1 ? 13 
HELX_P HELX_P10 10 SER A 212 ? GLU A 225 ? SER A 242 GLU A 255 1 ? 14 
HELX_P HELX_P11 11 ILE A 244 ? GLY A 264 ? ILE A 274 GLY A 294 1 ? 21 
HELX_P HELX_P12 12 ILE A 268 ? ARG A 279 ? ILE A 298 ARG A 309 1 ? 12 
HELX_P HELX_P13 13 THR A 285 ? GLN A 302 ? THR A 315 GLN A 332 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PRO A 30  ? THR A 32  ? PRO A 60  THR A 62  
A 2 GLU A 265 ? ASP A 267 ? GLU A 295 ASP A 297 
B 1 ARG A 84  ? CYS A 86  ? ARG A 114 CYS A 116 
B 2 TYR A 98  ? ILE A 104 ? TYR A 128 ILE A 134 
B 3 TYR A 114 ? GLN A 118 ? TYR A 144 GLN A 148 
B 4 ILE A 236 ? CYS A 240 ? ILE A 266 CYS A 270 
B 5 LEU A 139 ? LEU A 143 ? LEU A 169 LEU A 173 
B 6 GLU A 192 ? PHE A 201 ? GLU A 222 PHE A 231 
B 7 TYR A 180 ? TYR A 189 ? TYR A 210 TYR A 219 
B 8 PHE A 167 ? GLU A 176 ? PHE A 197 GLU A 206 
B 9 GLU A 161 ? TYR A 164 ? GLU A 191 TYR A 194 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 31  ? N LEU A 61  O VAL A 266 ? O VAL A 296 
B 1 2 N VAL A 85  ? N VAL A 115 O ALA A 101 ? O ALA A 131 
B 2 3 N ILE A 104 ? N ILE A 134 O TYR A 114 ? O TYR A 144 
B 3 4 N ILE A 115 ? N ILE A 145 O VAL A 238 ? O VAL A 268 
B 4 5 O VAL A 237 ? O VAL A 267 N VAL A 141 ? N VAL A 171 
B 5 6 N MET A 142 ? N MET A 172 O ILE A 199 ? O ILE A 229 
B 6 7 O HIS A 198 ? O HIS A 228 N ARG A 183 ? N ARG A 213 
B 7 8 O GLN A 184 ? O GLN A 214 N GLN A 172 ? N GLN A 202 
B 8 9 O ILE A 169 ? O ILE A 199 N GLU A 162 ? N GLU A 192 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PO4 A 436' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PO4 A 437' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 501' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 CYS A 240 ? CYS A 270 . ? 1_555 ? 
2  AC1 10 SER A 241 ? SER A 271 . ? 1_555 ? 
3  AC1 10 ALA A 242 ? ALA A 272 . ? 1_555 ? 
4  AC1 10 GLY A 243 ? GLY A 273 . ? 1_555 ? 
5  AC1 10 ILE A 244 ? ILE A 274 . ? 1_555 ? 
6  AC1 10 GLY A 245 ? GLY A 275 . ? 1_555 ? 
7  AC1 10 ARG A 246 ? ARG A 276 . ? 1_555 ? 
8  AC1 10 GLN A 284 ? GLN A 314 . ? 1_555 ? 
9  AC1 10 HOH F .   ? HOH A 503 . ? 1_555 ? 
10 AC1 10 HOH F .   ? HOH A 701 . ? 1_555 ? 
11 AC2 7  THR A 144 ? THR A 174 . ? 1_555 ? 
12 AC2 7  GLN A 145 ? GLN A 175 . ? 1_555 ? 
13 AC2 7  SER A 241 ? SER A 271 . ? 1_555 ? 
14 AC2 7  ARG A 246 ? ARG A 276 . ? 1_555 ? 
15 AC2 7  HOH F .   ? HOH A 527 . ? 1_555 ? 
16 AC2 7  HOH F .   ? HOH A 533 . ? 1_555 ? 
17 AC2 7  HOH F .   ? HOH A 645 . ? 1_555 ? 
18 AC3 8  GLN A 82  ? GLN A 112 . ? 1_555 ? 
19 AC3 8  GLU A 192 ? GLU A 222 . ? 4_665 ? 
20 AC3 8  ARG A 193 ? ARG A 223 . ? 4_665 ? 
21 AC3 8  ARG A 194 ? ARG A 224 . ? 4_665 ? 
22 AC3 8  HOH F .   ? HOH A 632 . ? 4_665 ? 
23 AC3 8  HOH F .   ? HOH A 716 . ? 1_555 ? 
24 AC3 8  HOH F .   ? HOH A 728 . ? 1_555 ? 
25 AC3 8  HOH F .   ? HOH A 729 . ? 1_555 ? 
26 AC4 10 GLN A 82  ? GLN A 112 . ? 1_555 ? 
27 AC4 10 SER A 83  ? SER A 113 . ? 1_555 ? 
28 AC4 10 TYR A 103 ? TYR A 133 . ? 1_555 ? 
29 AC4 10 GLU A 111 ? GLU A 141 . ? 1_555 ? 
30 AC4 10 HOH F .   ? HOH A 526 . ? 1_555 ? 
31 AC4 10 HOH F .   ? HOH A 531 . ? 1_555 ? 
32 AC4 10 HOH F .   ? HOH A 571 . ? 1_555 ? 
33 AC4 10 HOH F .   ? HOH A 647 . ? 4_665 ? 
34 AC4 10 HOH F .   ? HOH A 716 . ? 1_555 ? 
35 AC4 10 HOH F .   ? HOH A 728 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2QDC 
_atom_sites.fract_transf_matrix[1][1]   0.007858 
_atom_sites.fract_transf_matrix[1][2]   0.004537 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009074 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016790 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 15  ? 43.756 49.940 40.003  1.00 60.90 ? 45  THR A N   1 
ATOM   2    C CA  . THR A 1 15  ? 42.718 49.995 38.935  1.00 61.28 ? 45  THR A CA  1 
ATOM   3    C C   . THR A 1 15  ? 43.289 49.372 37.669  1.00 60.00 ? 45  THR A C   1 
ATOM   4    O O   . THR A 1 15  ? 43.948 50.063 36.891  1.00 60.58 ? 45  THR A O   1 
ATOM   5    C CB  . THR A 1 15  ? 42.322 51.446 38.618  1.00 61.68 ? 45  THR A CB  1 
ATOM   6    O OG1 . THR A 1 15  ? 42.589 52.281 39.752  1.00 64.84 ? 45  THR A OG1 1 
ATOM   7    C CG2 . THR A 1 15  ? 40.851 51.535 38.217  1.00 63.93 ? 45  THR A CG2 1 
ATOM   8    N N   . PRO A 1 16  ? 43.050 48.062 37.459  1.00 58.65 ? 46  PRO A N   1 
ATOM   9    C CA  . PRO A 1 16  ? 43.658 47.349 36.327  1.00 55.79 ? 46  PRO A CA  1 
ATOM   10   C C   . PRO A 1 16  ? 43.316 47.953 34.968  1.00 52.93 ? 46  PRO A C   1 
ATOM   11   O O   . PRO A 1 16  ? 44.145 47.899 34.053  1.00 52.78 ? 46  PRO A O   1 
ATOM   12   C CB  . PRO A 1 16  ? 43.087 45.931 36.450  1.00 56.36 ? 46  PRO A CB  1 
ATOM   13   C CG  . PRO A 1 16  ? 42.734 45.802 37.909  1.00 60.10 ? 46  PRO A CG  1 
ATOM   14   C CD  . PRO A 1 16  ? 42.212 47.166 38.277  1.00 58.89 ? 46  PRO A CD  1 
ATOM   15   N N   . ARG A 1 17  ? 42.118 48.526 34.842  1.00 48.21 ? 47  ARG A N   1 
ATOM   16   C CA  . ARG A 1 17  ? 41.695 49.177 33.603  1.00 44.78 ? 47  ARG A CA  1 
ATOM   17   C C   . ARG A 1 17  ? 42.524 50.438 33.363  1.00 39.89 ? 47  ARG A C   1 
ATOM   18   O O   . ARG A 1 17  ? 43.090 50.621 32.282  1.00 36.05 ? 47  ARG A O   1 
ATOM   19   C CB  . ARG A 1 17  ? 40.208 49.540 33.676  1.00 46.45 ? 47  ARG A CB  1 
ATOM   20   C CG  . ARG A 1 17  ? 39.374 49.364 32.400  1.00 53.76 ? 47  ARG A CG  1 
ATOM   21   C CD  . ARG A 1 17  ? 40.156 49.503 31.117  1.00 60.77 ? 47  ARG A CD  1 
ATOM   22   N NE  . ARG A 1 17  ? 40.632 48.198 30.664  1.00 71.92 ? 47  ARG A NE  1 
ATOM   23   C CZ  . ARG A 1 17  ? 40.462 47.713 29.436  1.00 74.17 ? 47  ARG A CZ  1 
ATOM   24   N NH1 . ARG A 1 17  ? 39.845 48.436 28.494  1.00 73.30 ? 47  ARG A NH1 1 
ATOM   25   N NH2 . ARG A 1 17  ? 40.930 46.504 29.145  1.00 71.94 ? 47  ARG A NH2 1 
ATOM   26   N N   . GLU A 1 18  ? 42.601 51.297 34.379  1.00 35.58 ? 48  GLU A N   1 
ATOM   27   C CA  . GLU A 1 18  ? 43.341 52.554 34.271  1.00 33.31 ? 48  GLU A CA  1 
ATOM   28   C C   . GLU A 1 18  ? 44.833 52.312 34.051  1.00 31.38 ? 48  GLU A C   1 
ATOM   29   O O   . GLU A 1 18  ? 45.468 53.042 33.292  1.00 28.89 ? 48  GLU A O   1 
ATOM   30   C CB  . GLU A 1 18  ? 43.116 53.447 35.496  1.00 32.48 ? 48  GLU A CB  1 
ATOM   31   C CG  . GLU A 1 18  ? 41.733 54.084 35.534  1.00 37.17 ? 48  GLU A CG  1 
ATOM   32   N N   . VAL A 1 19  ? 45.370 51.297 34.730  1.00 29.10 ? 49  VAL A N   1 
ATOM   33   C CA  . VAL A 1 19  ? 46.752 50.864 34.572  1.00 30.50 ? 49  VAL A CA  1 
ATOM   34   C C   . VAL A 1 19  ? 47.040 50.432 33.130  1.00 29.11 ? 49  VAL A C   1 
ATOM   35   O O   . VAL A 1 19  ? 48.034 50.864 32.552  1.00 31.03 ? 49  VAL A O   1 
ATOM   36   C CB  . VAL A 1 19  ? 47.121 49.752 35.608  1.00 30.96 ? 49  VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 19  ? 48.379 48.965 35.202  1.00 34.93 ? 49  VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 19  ? 47.304 50.365 36.996  1.00 30.51 ? 49  VAL A CG2 1 
ATOM   39   N N   . THR A 1 20  ? 46.168 49.592 32.568  1.00 28.72 ? 50  THR A N   1 
ATOM   40   C CA  . THR A 1 20  ? 46.254 49.139 31.171  1.00 27.82 ? 50  THR A CA  1 
ATOM   41   C C   . THR A 1 20  ? 46.252 50.327 30.214  1.00 25.97 ? 50  THR A C   1 
ATOM   42   O O   . THR A 1 20  ? 47.155 50.469 29.390  1.00 23.46 ? 50  THR A O   1 
ATOM   43   C CB  . THR A 1 20  ? 45.082 48.167 30.829  1.00 28.92 ? 50  THR A CB  1 
ATOM   44   O OG1 . THR A 1 20  ? 45.327 46.909 31.457  1.00 36.87 ? 50  THR A OG1 1 
ATOM   45   C CG2 . THR A 1 20  ? 44.921 47.936 29.305  1.00 25.73 ? 50  THR A CG2 1 
ATOM   46   N N   . LEU A 1 21  ? 45.252 51.190 30.352  1.00 21.90 ? 51  LEU A N   1 
ATOM   47   C CA  . LEU A 1 21  ? 45.070 52.318 29.440  1.00 22.62 ? 51  LEU A CA  1 
ATOM   48   C C   . LEU A 1 21  ? 46.243 53.272 29.543  1.00 21.42 ? 51  LEU A C   1 
ATOM   49   O O   . LEU A 1 21  ? 46.675 53.796 28.543  1.00 22.79 ? 51  LEU A O   1 
ATOM   50   C CB  . LEU A 1 21  ? 43.741 53.039 29.702  1.00 20.36 ? 51  LEU A CB  1 
ATOM   51   C CG  . LEU A 1 21  ? 42.469 52.276 29.357  1.00 22.12 ? 51  LEU A CG  1 
ATOM   52   C CD1 . LEU A 1 21  ? 41.217 53.075 29.826  1.00 23.76 ? 51  LEU A CD1 1 
ATOM   53   C CD2 . LEU A 1 21  ? 42.380 51.929 27.866  1.00 24.35 ? 51  LEU A CD2 1 
ATOM   54   N N   . HIS A 1 22  ? 46.769 53.479 30.750  1.00 23.86 ? 52  HIS A N   1 
ATOM   55   C CA  . HIS A 1 22  ? 47.882 54.404 30.924  1.00 24.25 ? 52  HIS A CA  1 
ATOM   56   C C   . HIS A 1 22  ? 49.145 53.910 30.207  1.00 24.20 ? 52  HIS A C   1 
ATOM   57   O O   . HIS A 1 22  ? 49.810 54.691 29.518  1.00 22.29 ? 52  HIS A O   1 
ATOM   58   C CB  . HIS A 1 22  ? 48.169 54.687 32.397  1.00 26.71 ? 52  HIS A CB  1 
ATOM   59   C CG  . HIS A 1 22  ? 49.309 55.633 32.605  1.00 28.92 ? 52  HIS A CG  1 
ATOM   60   N ND1 . HIS A 1 22  ? 49.210 56.982 32.338  1.00 34.55 ? 52  HIS A ND1 1 
ATOM   61   C CD2 . HIS A 1 22  ? 50.582 55.421 33.015  1.00 32.24 ? 52  HIS A CD2 1 
ATOM   62   C CE1 . HIS A 1 22  ? 50.371 57.561 32.583  1.00 36.10 ? 52  HIS A CE1 1 
ATOM   63   N NE2 . HIS A 1 22  ? 51.220 56.637 32.992  1.00 33.59 ? 52  HIS A NE2 1 
ATOM   64   N N   . PHE A 1 23  ? 49.468 52.624 30.385  1.00 22.24 ? 53  PHE A N   1 
ATOM   65   C CA  . PHE A 1 23  ? 50.555 51.982 29.655  1.00 22.15 ? 53  PHE A CA  1 
ATOM   66   C C   . PHE A 1 23  ? 50.398 52.147 28.152  1.00 22.50 ? 53  PHE A C   1 
ATOM   67   O O   . PHE A 1 23  ? 51.332 52.586 27.474  1.00 24.22 ? 53  PHE A O   1 
ATOM   68   C CB  . PHE A 1 23  ? 50.668 50.486 29.994  1.00 24.06 ? 53  PHE A CB  1 
ATOM   69   C CG  . PHE A 1 23  ? 51.872 49.811 29.356  1.00 23.95 ? 53  PHE A CG  1 
ATOM   70   C CD1 . PHE A 1 23  ? 53.066 49.692 30.062  1.00 30.50 ? 53  PHE A CD1 1 
ATOM   71   C CD2 . PHE A 1 23  ? 51.820 49.354 28.037  1.00 25.02 ? 53  PHE A CD2 1 
ATOM   72   C CE1 . PHE A 1 23  ? 54.187 49.086 29.473  1.00 35.43 ? 53  PHE A CE1 1 
ATOM   73   C CE2 . PHE A 1 23  ? 52.935 48.745 27.434  1.00 30.14 ? 53  PHE A CE2 1 
ATOM   74   C CZ  . PHE A 1 23  ? 54.122 48.619 28.165  1.00 28.13 ? 53  PHE A CZ  1 
ATOM   75   N N   . LEU A 1 24  ? 49.233 51.776 27.622  1.00 20.21 ? 54  LEU A N   1 
ATOM   76   C CA  . LEU A 1 24  ? 49.042 51.780 26.168  1.00 20.63 ? 54  LEU A CA  1 
ATOM   77   C C   . LEU A 1 24  ? 49.113 53.190 25.577  1.00 22.08 ? 54  LEU A C   1 
ATOM   78   O O   . LEU A 1 24  ? 49.595 53.370 24.446  1.00 21.55 ? 54  LEU A O   1 
ATOM   79   C CB  . LEU A 1 24  ? 47.739 51.076 25.778  1.00 19.10 ? 54  LEU A CB  1 
ATOM   80   C CG  . LEU A 1 24  ? 47.609 49.576 26.123  1.00 19.97 ? 54  LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 24  ? 46.145 49.175 25.977  1.00 21.19 ? 54  LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 24  ? 48.522 48.692 25.223  1.00 16.17 ? 54  LEU A CD2 1 
ATOM   83   N N   . ARG A 1 25  ? 48.657 54.183 26.352  1.00 21.59 ? 55  ARG A N   1 
ATOM   84   C CA  . ARG A 1 25  ? 48.664 55.570 25.888  1.00 22.38 ? 55  ARG A CA  1 
ATOM   85   C C   . ARG A 1 25  ? 50.035 56.241 26.002  1.00 23.37 ? 55  ARG A C   1 
ATOM   86   O O   . ARG A 1 25  ? 50.272 57.271 25.360  1.00 24.85 ? 55  ARG A O   1 
ATOM   87   C CB  . ARG A 1 25  ? 47.615 56.399 26.639  1.00 18.98 ? 55  ARG A CB  1 
ATOM   88   C CG  . ARG A 1 25  ? 46.233 56.026 26.210  1.00 20.35 ? 55  ARG A CG  1 
ATOM   89   C CD  . ARG A 1 25  ? 45.141 56.684 27.048  1.00 21.55 ? 55  ARG A CD  1 
ATOM   90   N NE  . ARG A 1 25  ? 43.850 56.386 26.436  1.00 23.00 ? 55  ARG A NE  1 
ATOM   91   C CZ  . ARG A 1 25  ? 42.682 56.372 27.083  1.00 23.84 ? 55  ARG A CZ  1 
ATOM   92   N NH1 . ARG A 1 25  ? 42.625 56.636 28.367  1.00 19.85 ? 55  ARG A NH1 1 
ATOM   93   N NH2 . ARG A 1 25  ? 41.561 56.108 26.427  1.00 23.90 ? 55  ARG A NH2 1 
ATOM   94   N N   . THR A 1 26  ? 50.922 55.678 26.817  1.00 21.32 ? 56  THR A N   1 
ATOM   95   C CA  . THR A 1 26  ? 52.222 56.318 27.070  1.00 22.58 ? 56  THR A CA  1 
ATOM   96   C C   . THR A 1 26  ? 53.472 55.511 26.701  1.00 23.18 ? 56  THR A C   1 
ATOM   97   O O   . THR A 1 26  ? 54.533 56.099 26.531  1.00 24.30 ? 56  THR A O   1 
ATOM   98   C CB  . THR A 1 26  ? 52.358 56.799 28.542  1.00 23.44 ? 56  THR A CB  1 
ATOM   99   O OG1 . THR A 1 26  ? 52.365 55.673 29.426  1.00 25.68 ? 56  THR A OG1 1 
ATOM   100  C CG2 . THR A 1 26  ? 51.232 57.750 28.916  1.00 24.57 ? 56  THR A CG2 1 
ATOM   101  N N   . ALA A 1 27  ? 53.373 54.190 26.578  1.00 21.10 ? 57  ALA A N   1 
ATOM   102  C CA  . ALA A 1 27  ? 54.567 53.384 26.308  1.00 22.35 ? 57  ALA A CA  1 
ATOM   103  C C   . ALA A 1 27  ? 55.155 53.702 24.934  1.00 22.88 ? 57  ALA A C   1 
ATOM   104  O O   . ALA A 1 27  ? 54.420 54.006 23.994  1.00 23.04 ? 57  ALA A O   1 
ATOM   105  C CB  . ALA A 1 27  ? 54.260 51.878 26.415  1.00 22.78 ? 57  ALA A CB  1 
ATOM   106  N N   . GLY A 1 28  ? 56.477 53.629 24.824  1.00 23.17 ? 58  GLY A N   1 
ATOM   107  C CA  . GLY A 1 28  ? 57.144 53.826 23.540  1.00 23.52 ? 58  GLY A CA  1 
ATOM   108  C C   . GLY A 1 28  ? 58.611 53.454 23.575  1.00 25.85 ? 58  GLY A C   1 
ATOM   109  O O   . GLY A 1 28  ? 59.256 53.472 24.633  1.00 25.38 ? 58  GLY A O   1 
ATOM   110  N N   . HIS A 1 29  ? 59.154 53.107 22.417  1.00 25.03 ? 59  HIS A N   1 
ATOM   111  C CA  . HIS A 1 29  ? 60.568 52.746 22.326  1.00 24.08 ? 59  HIS A CA  1 
ATOM   112  C C   . HIS A 1 29  ? 61.033 53.187 20.935  1.00 23.72 ? 59  HIS A C   1 
ATOM   113  O O   . HIS A 1 29  ? 61.160 52.358 20.030  1.00 23.66 ? 59  HIS A O   1 
ATOM   114  C CB  . HIS A 1 29  ? 60.738 51.230 22.551  1.00 27.32 ? 59  HIS A CB  1 
ATOM   115  C CG  . HIS A 1 29  ? 62.164 50.762 22.595  1.00 33.62 ? 59  HIS A CG  1 
ATOM   116  N ND1 . HIS A 1 29  ? 62.513 49.482 22.984  1.00 37.77 ? 59  HIS A ND1 1 
ATOM   117  C CD2 . HIS A 1 29  ? 63.327 51.393 22.290  1.00 35.68 ? 59  HIS A CD2 1 
ATOM   118  C CE1 . HIS A 1 29  ? 63.827 49.348 22.918  1.00 38.67 ? 59  HIS A CE1 1 
ATOM   119  N NE2 . HIS A 1 29  ? 64.343 50.491 22.496  1.00 31.08 ? 59  HIS A NE2 1 
ATOM   120  N N   . PRO A 1 30  ? 61.247 54.505 20.745  1.00 25.09 ? 60  PRO A N   1 
ATOM   121  C CA  . PRO A 1 30  ? 61.633 54.975 19.415  1.00 25.91 ? 60  PRO A CA  1 
ATOM   122  C C   . PRO A 1 30  ? 62.940 54.333 18.954  1.00 24.24 ? 60  PRO A C   1 
ATOM   123  O O   . PRO A 1 30  ? 63.887 54.198 19.744  1.00 20.93 ? 60  PRO A O   1 
ATOM   124  C CB  . PRO A 1 30  ? 61.794 56.495 19.607  1.00 28.96 ? 60  PRO A CB  1 
ATOM   125  C CG  . PRO A 1 30  ? 60.960 56.817 20.812  1.00 28.31 ? 60  PRO A CG  1 
ATOM   126  C CD  . PRO A 1 30  ? 61.126 55.623 21.711  1.00 24.95 ? 60  PRO A CD  1 
ATOM   127  N N   . LEU A 1 31  ? 62.958 53.881 17.702  1.00 22.01 ? 61  LEU A N   1 
ATOM   128  C CA  . LEU A 1 31  ? 64.163 53.324 17.104  1.00 23.28 ? 61  LEU A CA  1 
ATOM   129  C C   . LEU A 1 31  ? 64.486 54.115 15.850  1.00 24.85 ? 61  LEU A C   1 
ATOM   130  O O   . LEU A 1 31  ? 63.667 54.191 14.928  1.00 25.92 ? 61  LEU A O   1 
ATOM   131  C CB  . LEU A 1 31  ? 63.956 51.841 16.736  1.00 20.26 ? 61  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 31  ? 63.622 50.861 17.865  1.00 25.23 ? 61  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 31  ? 63.176 49.522 17.272  1.00 25.14 ? 61  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 31  ? 64.809 50.649 18.800  1.00 25.13 ? 61  LEU A CD2 1 
ATOM   135  N N   . THR A 1 32  ? 65.674 54.708 15.803  1.00 24.87 ? 62  THR A N   1 
ATOM   136  C CA  . THR A 1 32  ? 66.081 55.380 14.583  1.00 26.18 ? 62  THR A CA  1 
ATOM   137  C C   . THR A 1 32  ? 66.296 54.321 13.531  1.00 26.36 ? 62  THR A C   1 
ATOM   138  O O   . THR A 1 32  ? 66.491 53.142 13.847  1.00 27.13 ? 62  THR A O   1 
ATOM   139  C CB  . THR A 1 32  ? 67.387 56.173 14.722  1.00 24.04 ? 62  THR A CB  1 
ATOM   140  O OG1 . THR A 1 32  ? 68.437 55.277 15.099  1.00 25.02 ? 62  THR A OG1 1 
ATOM   141  C CG2 . THR A 1 32  ? 67.237 57.305 15.740  1.00 24.76 ? 62  THR A CG2 1 
ATOM   142  N N   . ARG A 1 33  ? 66.243 54.747 12.282  1.00 27.70 ? 63  ARG A N   1 
ATOM   143  C CA  . ARG A 1 33  ? 66.579 53.891 11.165  1.00 29.52 ? 63  ARG A CA  1 
ATOM   144  C C   . ARG A 1 33  ? 67.918 53.153 11.405  1.00 29.73 ? 63  ARG A C   1 
ATOM   145  O O   . ARG A 1 33  ? 67.997 51.938 11.202  1.00 29.24 ? 63  ARG A O   1 
ATOM   146  C CB  . ARG A 1 33  ? 66.590 54.716 9.875   1.00 30.26 ? 63  ARG A CB  1 
ATOM   147  C CG  . ARG A 1 33  ? 66.878 53.907 8.650   1.00 40.55 ? 63  ARG A CG  1 
ATOM   148  C CD  . ARG A 1 33  ? 67.196 54.783 7.456   1.00 48.68 ? 63  ARG A CD  1 
ATOM   149  N NE  . ARG A 1 33  ? 67.955 54.030 6.460   1.00 46.33 ? 63  ARG A NE  1 
ATOM   150  C CZ  . ARG A 1 33  ? 68.146 54.426 5.207   1.00 53.52 ? 63  ARG A CZ  1 
ATOM   151  N NH1 . ARG A 1 33  ? 67.630 55.580 4.776   1.00 51.44 ? 63  ARG A NH1 1 
ATOM   152  N NH2 . ARG A 1 33  ? 68.852 53.659 4.384   1.00 51.89 ? 63  ARG A NH2 1 
ATOM   153  N N   . TRP A 1 34  ? 68.946 53.862 11.887  1.00 27.25 ? 64  TRP A N   1 
ATOM   154  C CA  . TRP A 1 34  ? 70.242 53.226 12.199  1.00 27.53 ? 64  TRP A CA  1 
ATOM   155  C C   . TRP A 1 34  ? 70.146 52.121 13.254  1.00 28.16 ? 64  TRP A C   1 
ATOM   156  O O   . TRP A 1 34  ? 70.652 51.003 13.043  1.00 26.71 ? 64  TRP A O   1 
ATOM   157  C CB  . TRP A 1 34  ? 71.323 54.253 12.615  1.00 30.76 ? 64  TRP A CB  1 
ATOM   158  C CG  . TRP A 1 34  ? 72.661 53.584 12.897  1.00 37.08 ? 64  TRP A CG  1 
ATOM   159  C CD1 . TRP A 1 34  ? 73.639 53.266 11.981  1.00 41.55 ? 64  TRP A CD1 1 
ATOM   160  C CD2 . TRP A 1 34  ? 73.140 53.112 14.168  1.00 38.33 ? 64  TRP A CD2 1 
ATOM   161  N NE1 . TRP A 1 34  ? 74.696 52.643 12.610  1.00 41.18 ? 64  TRP A NE1 1 
ATOM   162  C CE2 . TRP A 1 34  ? 74.414 52.530 13.948  1.00 41.98 ? 64  TRP A CE2 1 
ATOM   163  C CE3 . TRP A 1 34  ? 72.614 53.124 15.471  1.00 38.14 ? 64  TRP A CE3 1 
ATOM   164  C CZ2 . TRP A 1 34  ? 75.173 51.972 14.986  1.00 39.95 ? 64  TRP A CZ2 1 
ATOM   165  C CZ3 . TRP A 1 34  ? 73.367 52.567 16.501  1.00 38.43 ? 64  TRP A CZ3 1 
ATOM   166  C CH2 . TRP A 1 34  ? 74.631 51.997 16.251  1.00 39.72 ? 64  TRP A CH2 1 
ATOM   167  N N   . ALA A 1 35  ? 69.519 52.441 14.391  1.00 24.57 ? 65  ALA A N   1 
ATOM   168  C CA  . ALA A 1 35  ? 69.377 51.501 15.497  1.00 24.52 ? 65  ALA A CA  1 
ATOM   169  C C   . ALA A 1 35  ? 68.574 50.268 15.045  1.00 24.82 ? 65  ALA A C   1 
ATOM   170  O O   . ALA A 1 35  ? 68.944 49.130 15.327  1.00 24.47 ? 65  ALA A O   1 
ATOM   171  C CB  . ALA A 1 35  ? 68.699 52.179 16.671  1.00 23.71 ? 65  ALA A CB  1 
ATOM   172  N N   . LEU A 1 36  ? 67.500 50.502 14.300  1.00 22.39 ? 66  LEU A N   1 
ATOM   173  C CA  . LEU A 1 36  ? 66.695 49.413 13.782  1.00 25.90 ? 66  LEU A CA  1 
ATOM   174  C C   . LEU A 1 36  ? 67.516 48.404 12.957  1.00 27.05 ? 66  LEU A C   1 
ATOM   175  O O   . LEU A 1 36  ? 67.384 47.178 13.138  1.00 27.55 ? 66  LEU A O   1 
ATOM   176  C CB  . LEU A 1 36  ? 65.531 49.990 12.975  1.00 27.24 ? 66  LEU A CB  1 
ATOM   177  C CG  . LEU A 1 36  ? 64.527 49.016 12.381  1.00 29.29 ? 66  LEU A CG  1 
ATOM   178  C CD1 . LEU A 1 36  ? 63.788 48.271 13.469  1.00 23.00 ? 66  LEU A CD1 1 
ATOM   179  C CD2 . LEU A 1 36  ? 63.586 49.806 11.486  1.00 25.91 ? 66  LEU A CD2 1 
ATOM   180  N N   . GLN A 1 37  ? 68.363 48.928 12.075  1.00 27.09 ? 67  GLN A N   1 
ATOM   181  C CA  . GLN A 1 37  ? 69.201 48.127 11.172  1.00 28.79 ? 67  GLN A CA  1 
ATOM   182  C C   . GLN A 1 37  ? 70.470 47.569 11.814  1.00 30.18 ? 67  GLN A C   1 
ATOM   183  O O   . GLN A 1 37  ? 70.902 46.449 11.481  1.00 29.16 ? 67  GLN A O   1 
ATOM   184  C CB  . GLN A 1 37  ? 69.620 48.969 9.960   1.00 28.82 ? 67  GLN A CB  1 
ATOM   185  C CG  . GLN A 1 37  ? 68.497 49.284 8.997   1.00 27.31 ? 67  GLN A CG  1 
ATOM   186  C CD  . GLN A 1 37  ? 68.933 50.199 7.868   1.00 30.88 ? 67  GLN A CD  1 
ATOM   187  O OE1 . GLN A 1 37  ? 69.015 51.414 8.036   1.00 36.35 ? 67  GLN A OE1 1 
ATOM   188  N NE2 . GLN A 1 37  ? 69.200 49.620 6.700   1.00 29.78 ? 67  GLN A NE2 1 
ATOM   189  N N   . ARG A 1 38  ? 71.060 48.334 12.736  1.00 27.85 ? 68  ARG A N   1 
ATOM   190  C CA  . ARG A 1 38  ? 72.397 48.032 13.232  1.00 29.39 ? 68  ARG A CA  1 
ATOM   191  C C   . ARG A 1 38  ? 72.495 47.659 14.709  1.00 31.15 ? 68  ARG A C   1 
ATOM   192  O O   . ARG A 1 38  ? 73.417 46.957 15.112  1.00 32.35 ? 68  ARG A O   1 
ATOM   193  C CB  . ARG A 1 38  ? 73.335 49.208 12.931  1.00 27.71 ? 68  ARG A CB  1 
ATOM   194  C CG  . ARG A 1 38  ? 73.421 49.545 11.435  1.00 30.96 ? 68  ARG A CG  1 
ATOM   195  C CD  . ARG A 1 38  ? 73.898 48.321 10.667  1.00 41.41 ? 68  ARG A CD  1 
ATOM   196  N NE  . ARG A 1 38  ? 73.840 48.455 9.209   1.00 44.93 ? 68  ARG A NE  1 
ATOM   197  C CZ  . ARG A 1 38  ? 74.061 47.448 8.362   1.00 45.72 ? 68  ARG A CZ  1 
ATOM   198  N NH1 . ARG A 1 38  ? 74.341 46.223 8.822   1.00 35.21 ? 68  ARG A NH1 1 
ATOM   199  N NH2 . ARG A 1 38  ? 73.990 47.661 7.051   1.00 43.54 ? 68  ARG A NH2 1 
ATOM   200  N N   . GLN A 1 39  ? 71.574 48.149 15.527  1.00 29.86 ? 69  GLN A N   1 
ATOM   201  C CA  . GLN A 1 39  ? 71.688 47.923 16.961  1.00 32.65 ? 69  GLN A CA  1 
ATOM   202  C C   . GLN A 1 39  ? 70.298 47.752 17.562  1.00 29.69 ? 69  GLN A C   1 
ATOM   203  O O   . GLN A 1 39  ? 69.943 48.480 18.479  1.00 26.58 ? 69  GLN A O   1 
ATOM   204  C CB  . GLN A 1 39  ? 72.420 49.109 17.610  1.00 31.87 ? 69  GLN A CB  1 
ATOM   205  C CG  . GLN A 1 39  ? 73.131 48.793 18.930  1.00 40.83 ? 69  GLN A CG  1 
ATOM   206  C CD  . GLN A 1 39  ? 73.872 50.012 19.490  1.00 41.34 ? 69  GLN A CD  1 
ATOM   207  O OE1 . GLN A 1 39  ? 73.251 50.960 19.997  1.00 55.65 ? 69  GLN A OE1 1 
ATOM   208  N NE2 . GLN A 1 39  ? 75.198 49.999 19.379  1.00 49.59 ? 69  GLN A NE2 1 
ATOM   209  N N   . PRO A 1 40  ? 69.495 46.804 17.024  1.00 28.76 ? 70  PRO A N   1 
ATOM   210  C CA  . PRO A 1 40  ? 68.114 46.690 17.480  1.00 27.79 ? 70  PRO A CA  1 
ATOM   211  C C   . PRO A 1 40  ? 68.065 46.097 18.889  1.00 28.20 ? 70  PRO A C   1 
ATOM   212  O O   . PRO A 1 40  ? 69.083 45.599 19.374  1.00 26.29 ? 70  PRO A O   1 
ATOM   213  C CB  . PRO A 1 40  ? 67.503 45.727 16.459  1.00 29.11 ? 70  PRO A CB  1 
ATOM   214  C CG  . PRO A 1 40  ? 68.666 44.822 16.081  1.00 28.49 ? 70  PRO A CG  1 
ATOM   215  C CD  . PRO A 1 40  ? 69.813 45.791 15.993  1.00 29.55 ? 70  PRO A CD  1 
ATOM   216  N N   . PRO A 1 41  ? 66.898 46.166 19.564  1.00 26.29 ? 71  PRO A N   1 
ATOM   217  C CA  . PRO A 1 41  ? 66.858 45.481 20.862  1.00 27.23 ? 71  PRO A CA  1 
ATOM   218  C C   . PRO A 1 41  ? 67.129 43.976 20.663  1.00 25.27 ? 71  PRO A C   1 
ATOM   219  O O   . PRO A 1 41  ? 66.857 43.447 19.577  1.00 25.98 ? 71  PRO A O   1 
ATOM   220  C CB  . PRO A 1 41  ? 65.434 45.758 21.376  1.00 27.44 ? 71  PRO A CB  1 
ATOM   221  C CG  . PRO A 1 41  ? 64.966 46.988 20.584  1.00 30.34 ? 71  PRO A CG  1 
ATOM   222  C CD  . PRO A 1 41  ? 65.623 46.831 19.231  1.00 26.14 ? 71  PRO A CD  1 
ATOM   223  N N   . SER A 1 42  ? 67.722 43.327 21.664  1.00 24.73 ? 72  SER A N   1 
ATOM   224  C CA  . SER A 1 42  ? 68.107 41.912 21.559  1.00 23.91 ? 72  SER A CA  1 
ATOM   225  C C   . SER A 1 42  ? 66.834 41.058 21.490  1.00 22.19 ? 72  SER A C   1 
ATOM   226  O O   . SER A 1 42  ? 65.761 41.543 21.886  1.00 20.11 ? 72  SER A O   1 
ATOM   227  C CB  . SER A 1 42  ? 68.942 41.511 22.776  1.00 24.26 ? 72  SER A CB  1 
ATOM   228  O OG  . SER A 1 42  ? 68.120 41.408 23.920  1.00 27.26 ? 72  SER A OG  1 
ATOM   229  N N   . PRO A 1 43  ? 66.931 39.810 20.971  1.00 21.94 ? 73  PRO A N   1 
ATOM   230  C CA  . PRO A 1 43  ? 65.736 38.948 20.971  1.00 20.70 ? 73  PRO A CA  1 
ATOM   231  C C   . PRO A 1 43  ? 65.123 38.812 22.388  1.00 19.53 ? 73  PRO A C   1 
ATOM   232  O O   . PRO A 1 43  ? 63.902 38.867 22.521  1.00 17.74 ? 73  PRO A O   1 
ATOM   233  C CB  . PRO A 1 43  ? 66.292 37.611 20.468  1.00 20.88 ? 73  PRO A CB  1 
ATOM   234  C CG  . PRO A 1 43  ? 67.387 38.051 19.510  1.00 22.87 ? 73  PRO A CG  1 
ATOM   235  C CD  . PRO A 1 43  ? 68.079 39.134 20.315  1.00 20.67 ? 73  PRO A CD  1 
ATOM   236  N N   . LYS A 1 44  ? 65.957 38.682 23.431  1.00 18.40 ? 74  LYS A N   1 
ATOM   237  C CA  . LYS A 1 44  ? 65.406 38.628 24.799  1.00 21.30 ? 74  LYS A CA  1 
ATOM   238  C C   . LYS A 1 44  ? 64.675 39.907 25.194  1.00 22.00 ? 74  LYS A C   1 
ATOM   239  O O   . LYS A 1 44  ? 63.587 39.859 25.760  1.00 22.25 ? 74  LYS A O   1 
ATOM   240  C CB  . LYS A 1 44  ? 66.466 38.279 25.836  1.00 25.07 ? 74  LYS A CB  1 
ATOM   241  C CG  . LYS A 1 44  ? 65.919 38.075 27.279  1.00 25.12 ? 74  LYS A CG  1 
ATOM   242  C CD  . LYS A 1 44  ? 65.167 36.732 27.449  1.00 27.34 ? 74  LYS A CD  1 
ATOM   243  C CE  . LYS A 1 44  ? 64.531 36.603 28.858  1.00 29.74 ? 74  LYS A CE  1 
ATOM   244  N NZ  . LYS A 1 44  ? 65.522 36.361 29.916  1.00 27.12 ? 74  LYS A NZ  1 
ATOM   245  N N   . GLN A 1 45  ? 65.259 41.059 24.894  1.00 20.59 ? 75  GLN A N   1 
ATOM   246  C CA  . GLN A 1 45  ? 64.590 42.330 25.218  1.00 22.69 ? 75  GLN A CA  1 
ATOM   247  C C   . GLN A 1 45  ? 63.240 42.461 24.515  1.00 19.44 ? 75  GLN A C   1 
ATOM   248  O O   . GLN A 1 45  ? 62.277 42.952 25.093  1.00 20.36 ? 75  GLN A O   1 
ATOM   249  C CB  . GLN A 1 45  ? 65.478 43.521 24.850  1.00 20.07 ? 75  GLN A CB  1 
ATOM   250  C CG  . GLN A 1 45  ? 66.701 43.691 25.749  1.00 26.97 ? 75  GLN A CG  1 
ATOM   251  C CD  . GLN A 1 45  ? 67.687 44.764 25.246  1.00 32.08 ? 75  GLN A CD  1 
ATOM   252  O OE1 . GLN A 1 45  ? 67.924 44.919 24.041  1.00 33.10 ? 75  GLN A OE1 1 
ATOM   253  N NE2 . GLN A 1 45  ? 68.277 45.492 26.184  1.00 46.49 ? 75  GLN A NE2 1 
ATOM   254  N N   . LEU A 1 46  ? 63.168 42.041 23.260  1.00 16.92 ? 76  LEU A N   1 
ATOM   255  C CA  . LEU A 1 46  ? 61.890 42.085 22.515  1.00 17.46 ? 76  LEU A CA  1 
ATOM   256  C C   . LEU A 1 46  ? 60.839 41.143 23.079  1.00 17.44 ? 76  LEU A C   1 
ATOM   257  O O   . LEU A 1 46  ? 59.658 41.483 23.089  1.00 16.68 ? 76  LEU A O   1 
ATOM   258  C CB  . LEU A 1 46  ? 62.103 41.801 21.018  1.00 17.04 ? 76  LEU A CB  1 
ATOM   259  C CG  . LEU A 1 46  ? 62.935 42.878 20.275  1.00 19.26 ? 76  LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 46  ? 63.061 42.469 18.813  1.00 21.14 ? 76  LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 46  ? 62.302 44.289 20.394  1.00 19.66 ? 76  LEU A CD2 1 
ATOM   262  N N   . GLU A 1 47  ? 61.264 39.961 23.534  1.00 17.86 ? 77  GLU A N   1 
ATOM   263  C CA  . GLU A 1 47  ? 60.339 39.025 24.203  1.00 19.32 ? 77  GLU A CA  1 
ATOM   264  C C   . GLU A 1 47  ? 59.751 39.637 25.480  1.00 18.43 ? 77  GLU A C   1 
ATOM   265  O O   . GLU A 1 47  ? 58.542 39.569 25.713  1.00 16.32 ? 77  GLU A O   1 
ATOM   266  C CB  . GLU A 1 47  ? 61.066 37.716 24.554  1.00 16.81 ? 77  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 47  ? 61.444 36.885 23.324  1.00 18.64 ? 77  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 47  ? 62.125 35.580 23.677  1.00 20.97 ? 77  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 47  ? 62.591 35.410 24.837  1.00 19.90 ? 77  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 47  ? 62.179 34.715 22.779  1.00 20.32 ? 77  GLU A OE2 1 
ATOM   271  N N   . GLU A 1 48  ? 60.619 40.186 26.330  1.00 19.52 ? 78  GLU A N   1 
ATOM   272  C CA  . GLU A 1 48  ? 60.178 40.808 27.578  1.00 21.71 ? 78  GLU A CA  1 
ATOM   273  C C   . GLU A 1 48  ? 59.303 42.029 27.317  1.00 20.43 ? 78  GLU A C   1 
ATOM   274  O O   . GLU A 1 48  ? 58.293 42.237 27.994  1.00 19.12 ? 78  GLU A O   1 
ATOM   275  C CB  . GLU A 1 48  ? 61.404 41.161 28.450  1.00 24.07 ? 78  GLU A CB  1 
ATOM   276  C CG  . GLU A 1 48  ? 62.009 39.908 29.078  1.00 24.51 ? 78  GLU A CG  1 
ATOM   277  C CD  . GLU A 1 48  ? 63.271 40.157 29.892  1.00 31.76 ? 78  GLU A CD  1 
ATOM   278  O OE1 . GLU A 1 48  ? 63.969 41.168 29.655  1.00 51.03 ? 78  GLU A OE1 1 
ATOM   279  O OE2 . GLU A 1 48  ? 63.583 39.319 30.753  1.00 39.44 ? 78  GLU A OE2 1 
ATOM   280  N N   . GLU A 1 49  ? 59.659 42.810 26.300  1.00 19.29 ? 79  GLU A N   1 
ATOM   281  C CA  . GLU A 1 49  ? 58.868 43.989 25.927  1.00 18.48 ? 79  GLU A CA  1 
ATOM   282  C C   . GLU A 1 49  ? 57.473 43.580 25.446  1.00 20.37 ? 79  GLU A C   1 
ATOM   283  O O   . GLU A 1 49  ? 56.458 44.139 25.882  1.00 18.11 ? 79  GLU A O   1 
ATOM   284  C CB  . GLU A 1 49  ? 59.614 44.785 24.849  1.00 20.32 ? 79  GLU A CB  1 
ATOM   285  C CG  . GLU A 1 49  ? 58.898 46.055 24.372  1.00 18.52 ? 79  GLU A CG  1 
ATOM   286  C CD  . GLU A 1 49  ? 59.804 46.873 23.475  1.00 27.53 ? 79  GLU A CD  1 
ATOM   287  O OE1 . GLU A 1 49  ? 60.684 47.583 24.008  1.00 25.06 ? 79  GLU A OE1 1 
ATOM   288  O OE2 . GLU A 1 49  ? 59.641 46.801 22.240  1.00 23.70 ? 79  GLU A OE2 1 
ATOM   289  N N   . PHE A 1 50  ? 57.417 42.592 24.558  1.00 18.57 ? 80  PHE A N   1 
ATOM   290  C CA  . PHE A 1 50  ? 56.128 42.115 24.082  1.00 18.40 ? 80  PHE A CA  1 
ATOM   291  C C   . PHE A 1 50  ? 55.224 41.614 25.218  1.00 20.74 ? 80  PHE A C   1 
ATOM   292  O O   . PHE A 1 50  ? 54.029 41.945 25.255  1.00 18.78 ? 80  PHE A O   1 
ATOM   293  C CB  . PHE A 1 50  ? 56.303 41.010 23.014  1.00 19.37 ? 80  PHE A CB  1 
ATOM   294  C CG  . PHE A 1 50  ? 54.994 40.557 22.420  1.00 17.77 ? 80  PHE A CG  1 
ATOM   295  C CD1 . PHE A 1 50  ? 54.319 41.370 21.531  1.00 15.66 ? 80  PHE A CD1 1 
ATOM   296  C CD2 . PHE A 1 50  ? 54.411 39.348 22.824  1.00 19.36 ? 80  PHE A CD2 1 
ATOM   297  C CE1 . PHE A 1 50  ? 53.069 40.974 20.989  1.00 18.58 ? 80  PHE A CE1 1 
ATOM   298  C CE2 . PHE A 1 50  ? 53.188 38.949 22.312  1.00 23.24 ? 80  PHE A CE2 1 
ATOM   299  C CZ  . PHE A 1 50  ? 52.520 39.754 21.382  1.00 20.04 ? 80  PHE A CZ  1 
ATOM   300  N N   . LEU A 1 51  ? 55.788 40.828 26.143  1.00 19.86 ? 81  LEU A N   1 
ATOM   301  C CA  . LEU A 1 51  ? 55.016 40.282 27.261  1.00 22.25 ? 81  LEU A CA  1 
ATOM   302  C C   . LEU A 1 51  ? 54.427 41.364 28.168  1.00 22.59 ? 81  LEU A C   1 
ATOM   303  O O   . LEU A 1 51  ? 53.392 41.145 28.799  1.00 21.80 ? 81  LEU A O   1 
ATOM   304  C CB  . LEU A 1 51  ? 55.881 39.314 28.106  1.00 21.81 ? 81  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 51  ? 56.111 37.908 27.538  1.00 25.78 ? 81  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 51  ? 57.151 37.152 28.343  1.00 24.39 ? 81  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 51  ? 54.818 37.109 27.490  1.00 29.37 ? 81  LEU A CD2 1 
ATOM   308  N N   . LYS A 1 52  ? 55.083 42.525 28.220  1.00 21.96 ? 82  LYS A N   1 
ATOM   309  C CA  . LYS A 1 52  ? 54.613 43.665 29.013  1.00 23.87 ? 82  LYS A CA  1 
ATOM   310  C C   . LYS A 1 52  ? 53.426 44.424 28.424  1.00 22.88 ? 82  LYS A C   1 
ATOM   311  O O   . LYS A 1 52  ? 52.755 45.153 29.145  1.00 22.86 ? 82  LYS A O   1 
ATOM   312  C CB  . LYS A 1 52  ? 55.749 44.664 29.239  1.00 26.20 ? 82  LYS A CB  1 
ATOM   313  C CG  . LYS A 1 52  ? 56.804 44.220 30.256  1.00 33.63 ? 82  LYS A CG  1 
ATOM   314  C CD  . LYS A 1 52  ? 57.895 45.297 30.377  1.00 33.30 ? 82  LYS A CD  1 
ATOM   315  C CE  . LYS A 1 52  ? 58.900 44.980 31.501  1.00 47.68 ? 82  LYS A CE  1 
ATOM   316  N NZ  . LYS A 1 52  ? 60.224 44.427 31.045  1.00 44.18 ? 82  LYS A NZ  1 
ATOM   317  N N   . ILE A 1 53  ? 53.169 44.275 27.126  1.00 20.56 ? 83  ILE A N   1 
ATOM   318  C CA  . ILE A 1 53  ? 52.072 44.988 26.478  1.00 19.10 ? 83  ILE A CA  1 
ATOM   319  C C   . ILE A 1 53  ? 50.730 44.363 26.887  1.00 20.95 ? 83  ILE A C   1 
ATOM   320  O O   . ILE A 1 53  ? 50.508 43.173 26.651  1.00 19.88 ? 83  ILE A O   1 
ATOM   321  C CB  . ILE A 1 53  ? 52.197 44.985 24.933  1.00 19.84 ? 83  ILE A CB  1 
ATOM   322  C CG1 . ILE A 1 53  ? 53.621 45.376 24.486  1.00 19.70 ? 83  ILE A CG1 1 
ATOM   323  C CG2 . ILE A 1 53  ? 51.100 45.906 24.312  1.00 17.18 ? 83  ILE A CG2 1 
ATOM   324  C CD1 . ILE A 1 53  ? 53.858 45.244 22.968  1.00 19.26 ? 83  ILE A CD1 1 
ATOM   325  N N   . PRO A 1 54  ? 49.845 45.157 27.535  1.00 21.72 ? 84  PRO A N   1 
ATOM   326  C CA  . PRO A 1 54  ? 48.524 44.641 27.915  1.00 21.75 ? 84  PRO A CA  1 
ATOM   327  C C   . PRO A 1 54  ? 47.727 44.230 26.679  1.00 21.05 ? 84  PRO A C   1 
ATOM   328  O O   . PRO A 1 54  ? 47.895 44.806 25.597  1.00 19.58 ? 84  PRO A O   1 
ATOM   329  C CB  . PRO A 1 54  ? 47.855 45.850 28.608  1.00 21.36 ? 84  PRO A CB  1 
ATOM   330  C CG  . PRO A 1 54  ? 48.967 46.698 29.067  1.00 21.65 ? 84  PRO A CG  1 
ATOM   331  C CD  . PRO A 1 54  ? 50.027 46.553 27.978  1.00 21.95 ? 84  PRO A CD  1 
ATOM   332  N N   . SER A 1 55  ? 46.890 43.216 26.834  1.00 21.53 ? 85  SER A N   1 
ATOM   333  C CA  . SER A 1 55  ? 46.063 42.726 25.728  1.00 22.62 ? 85  SER A CA  1 
ATOM   334  C C   . SER A 1 55  ? 44.984 43.734 25.351  1.00 23.00 ? 85  SER A C   1 
ATOM   335  O O   . SER A 1 55  ? 44.675 43.913 24.171  1.00 22.92 ? 85  SER A O   1 
ATOM   336  C CB  . SER A 1 55  ? 45.386 41.433 26.136  1.00 22.36 ? 85  SER A CB  1 
ATOM   337  O OG  . SER A 1 55  ? 44.389 41.716 27.110  1.00 26.05 ? 85  SER A OG  1 
ATOM   338  N N   . ASN A 1 56  ? 44.407 44.374 26.367  1.00 22.99 ? 86  ASN A N   1 
ATOM   339  C CA  . ASN A 1 56  ? 43.221 45.222 26.202  1.00 23.68 ? 86  ASN A CA  1 
ATOM   340  C C   . ASN A 1 56  ? 42.021 44.457 25.666  1.00 22.45 ? 86  ASN A C   1 
ATOM   341  O O   . ASN A 1 56  ? 41.148 45.030 25.019  1.00 22.70 ? 86  ASN A O   1 
ATOM   342  C CB  . ASN A 1 56  ? 43.501 46.493 25.357  1.00 22.97 ? 86  ASN A CB  1 
ATOM   343  C CG  . ASN A 1 56  ? 42.483 47.610 25.629  1.00 28.52 ? 86  ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 56  ? 42.024 47.778 26.761  1.00 23.05 ? 86  ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 56  ? 42.119 48.359 24.594  1.00 22.33 ? 86  ASN A ND2 1 
ATOM   346  N N   . PHE A 1 57  ? 41.970 43.161 25.953  1.00 22.78 ? 87  PHE A N   1 
ATOM   347  C CA  . PHE A 1 57  ? 40.788 42.364 25.634  1.00 24.63 ? 87  PHE A CA  1 
ATOM   348  C C   . PHE A 1 57  ? 39.604 42.829 26.465  1.00 23.92 ? 87  PHE A C   1 
ATOM   349  O O   . PHE A 1 57  ? 39.738 43.120 27.655  1.00 23.08 ? 87  PHE A O   1 
ATOM   350  C CB  . PHE A 1 57  ? 41.037 40.879 25.911  1.00 24.91 ? 87  PHE A CB  1 
ATOM   351  C CG  . PHE A 1 57  ? 41.787 40.170 24.807  1.00 29.74 ? 87  PHE A CG  1 
ATOM   352  C CD1 . PHE A 1 57  ? 41.398 40.309 23.480  1.00 30.08 ? 87  PHE A CD1 1 
ATOM   353  C CD2 . PHE A 1 57  ? 42.841 39.317 25.109  1.00 33.52 ? 87  PHE A CD2 1 
ATOM   354  C CE1 . PHE A 1 57  ? 42.078 39.640 22.469  1.00 27.79 ? 87  PHE A CE1 1 
ATOM   355  C CE2 . PHE A 1 57  ? 43.525 38.646 24.096  1.00 29.43 ? 87  PHE A CE2 1 
ATOM   356  C CZ  . PHE A 1 57  ? 43.129 38.802 22.789  1.00 28.75 ? 87  PHE A CZ  1 
ATOM   357  N N   . VAL A 1 58  ? 38.444 42.899 25.834  1.00 26.15 ? 88  VAL A N   1 
ATOM   358  C CA  . VAL A 1 58  ? 37.221 43.222 26.543  1.00 27.27 ? 88  VAL A CA  1 
ATOM   359  C C   . VAL A 1 58  ? 36.570 41.914 26.994  1.00 29.31 ? 88  VAL A C   1 
ATOM   360  O O   . VAL A 1 58  ? 36.572 40.917 26.260  1.00 29.07 ? 88  VAL A O   1 
ATOM   361  C CB  . VAL A 1 58  ? 36.267 44.136 25.699  1.00 30.01 ? 88  VAL A CB  1 
ATOM   362  C CG1 A VAL A 1 58  ? 35.452 43.327 24.694  0.50 26.23 ? 88  VAL A CG1 1 
ATOM   363  C CG1 B VAL A 1 58  ? 36.779 45.580 25.703  0.50 27.66 ? 88  VAL A CG1 1 
ATOM   364  C CG2 A VAL A 1 58  ? 35.359 44.932 26.590  0.50 25.82 ? 88  VAL A CG2 1 
ATOM   365  C CG2 B VAL A 1 58  ? 36.097 43.604 24.276  0.50 23.07 ? 88  VAL A CG2 1 
ATOM   366  N N   . SER A 1 59  ? 36.066 41.913 28.220  1.00 31.15 ? 89  SER A N   1 
ATOM   367  C CA  . SER A 1 59  ? 35.398 40.743 28.769  1.00 35.88 ? 89  SER A CA  1 
ATOM   368  C C   . SER A 1 59  ? 33.944 40.703 28.278  1.00 37.19 ? 89  SER A C   1 
ATOM   369  O O   . SER A 1 59  ? 33.389 41.748 27.902  1.00 35.51 ? 89  SER A O   1 
ATOM   370  C CB  . SER A 1 59  ? 35.486 40.753 30.299  1.00 37.17 ? 89  SER A CB  1 
ATOM   371  O OG  . SER A 1 59  ? 34.807 41.874 30.838  1.00 45.94 ? 89  SER A OG  1 
ATOM   372  N N   . PRO A 1 60  ? 33.333 39.496 28.230  1.00 40.04 ? 90  PRO A N   1 
ATOM   373  C CA  . PRO A 1 60  ? 31.950 39.389 27.749  1.00 41.75 ? 90  PRO A CA  1 
ATOM   374  C C   . PRO A 1 60  ? 30.974 40.267 28.534  1.00 42.62 ? 90  PRO A C   1 
ATOM   375  O O   . PRO A 1 60  ? 29.966 40.697 27.979  1.00 42.71 ? 90  PRO A O   1 
ATOM   376  C CB  . PRO A 1 60  ? 31.626 37.902 27.936  1.00 42.45 ? 90  PRO A CB  1 
ATOM   377  C CG  . PRO A 1 60  ? 32.942 37.224 27.884  1.00 41.93 ? 90  PRO A CG  1 
ATOM   378  C CD  . PRO A 1 60  ? 33.886 38.171 28.576  1.00 41.20 ? 90  PRO A CD  1 
ATOM   379  N N   . GLU A 1 61  ? 31.297 40.547 29.797  1.00 45.46 ? 91  GLU A N   1 
ATOM   380  C CA  . GLU A 1 61  ? 30.507 41.437 30.655  1.00 49.11 ? 91  GLU A CA  1 
ATOM   381  C C   . GLU A 1 61  ? 30.502 42.896 30.154  1.00 51.18 ? 91  GLU A C   1 
ATOM   382  O O   . GLU A 1 61  ? 29.509 43.606 30.325  1.00 50.60 ? 91  GLU A O   1 
ATOM   383  C CB  . GLU A 1 61  ? 31.007 41.366 32.107  1.00 50.34 ? 91  GLU A CB  1 
ATOM   384  C CG  . GLU A 1 61  ? 31.436 39.968 32.572  1.00 50.84 ? 91  GLU A CG  1 
ATOM   385  N N   . ASP A 1 62  ? 31.599 43.327 29.522  1.00 52.52 ? 92  ASP A N   1 
ATOM   386  C CA  . ASP A 1 62  ? 31.736 44.704 29.010  1.00 55.34 ? 92  ASP A CA  1 
ATOM   387  C C   . ASP A 1 62  ? 31.024 44.960 27.669  1.00 55.27 ? 92  ASP A C   1 
ATOM   388  O O   . ASP A 1 62  ? 31.037 46.086 27.166  1.00 55.72 ? 92  ASP A O   1 
ATOM   389  C CB  . ASP A 1 62  ? 33.211 45.109 28.865  1.00 57.67 ? 92  ASP A CB  1 
ATOM   390  C CG  . ASP A 1 62  ? 34.031 44.898 30.133  1.00 62.72 ? 92  ASP A CG  1 
ATOM   391  O OD1 . ASP A 1 62  ? 33.474 44.957 31.250  1.00 66.06 ? 92  ASP A OD1 1 
ATOM   392  O OD2 . ASP A 1 62  ? 35.262 44.686 29.994  1.00 73.00 ? 92  ASP A OD2 1 
ATOM   393  N N   . LEU A 1 63  ? 30.434 43.916 27.085  1.00 55.61 ? 93  LEU A N   1 
ATOM   394  C CA  . LEU A 1 63  ? 29.530 44.051 25.933  1.00 54.69 ? 93  LEU A CA  1 
ATOM   395  C C   . LEU A 1 63  ? 28.132 43.588 26.312  1.00 56.07 ? 93  LEU A C   1 
ATOM   396  O O   . LEU A 1 63  ? 27.952 42.446 26.746  1.00 56.23 ? 93  LEU A O   1 
ATOM   397  C CB  . LEU A 1 63  ? 29.983 43.161 24.776  1.00 54.24 ? 93  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 63  ? 31.085 43.452 23.774  1.00 48.49 ? 93  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 63  ? 31.101 42.265 22.827  1.00 40.72 ? 93  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 63  ? 30.863 44.758 23.006  1.00 38.20 ? 93  LEU A CD2 1 
ATOM   401  N N   . ASP A 1 64  ? 27.137 44.453 26.144  1.00 56.59 ? 94  ASP A N   1 
ATOM   402  C CA  . ASP A 1 64  ? 25.766 44.017 26.324  1.00 57.70 ? 94  ASP A CA  1 
ATOM   403  C C   . ASP A 1 64  ? 25.095 43.937 24.967  1.00 56.61 ? 94  ASP A C   1 
ATOM   404  O O   . ASP A 1 64  ? 24.223 44.740 24.626  1.00 57.24 ? 94  ASP A O   1 
ATOM   405  C CB  . ASP A 1 64  ? 24.986 44.911 27.299  1.00 59.61 ? 94  ASP A CB  1 
ATOM   406  C CG  . ASP A 1 64  ? 23.715 44.239 27.817  1.00 64.35 ? 94  ASP A CG  1 
ATOM   407  O OD1 . ASP A 1 64  ? 23.777 43.039 28.175  1.00 68.15 ? 94  ASP A OD1 1 
ATOM   408  O OD2 . ASP A 1 64  ? 22.659 44.912 27.872  1.00 68.95 ? 94  ASP A OD2 1 
ATOM   409  N N   . ILE A 1 65  ? 25.532 42.962 24.182  1.00 54.75 ? 95  ILE A N   1 
ATOM   410  C CA  . ILE A 1 65  ? 24.953 42.734 22.871  1.00 53.12 ? 95  ILE A CA  1 
ATOM   411  C C   . ILE A 1 65  ? 24.455 41.297 22.862  1.00 53.94 ? 95  ILE A C   1 
ATOM   412  O O   . ILE A 1 65  ? 25.249 40.367 22.698  1.00 54.11 ? 95  ILE A O   1 
ATOM   413  C CB  . ILE A 1 65  ? 25.964 43.009 21.731  1.00 50.93 ? 95  ILE A CB  1 
ATOM   414  C CG1 . ILE A 1 65  ? 26.585 44.401 21.899  1.00 47.47 ? 95  ILE A CG1 1 
ATOM   415  C CG2 . ILE A 1 65  ? 25.281 42.867 20.373  1.00 48.49 ? 95  ILE A CG2 1 
ATOM   416  C CD1 . ILE A 1 65  ? 27.921 44.586 21.213  1.00 48.04 ? 95  ILE A CD1 1 
ATOM   417  N N   . PRO A 1 66  ? 23.136 41.109 23.067  1.00 53.60 ? 96  PRO A N   1 
ATOM   418  C CA  . PRO A 1 66  ? 22.617 39.758 23.233  1.00 52.68 ? 96  PRO A CA  1 
ATOM   419  C C   . PRO A 1 66  ? 22.700 38.982 21.927  1.00 50.48 ? 96  PRO A C   1 
ATOM   420  O O   . PRO A 1 66  ? 22.351 39.506 20.862  1.00 50.67 ? 96  PRO A O   1 
ATOM   421  C CB  . PRO A 1 66  ? 21.145 39.978 23.650  1.00 53.93 ? 96  PRO A CB  1 
ATOM   422  C CG  . PRO A 1 66  ? 21.033 41.442 23.996  1.00 55.45 ? 96  PRO A CG  1 
ATOM   423  C CD  . PRO A 1 66  ? 22.067 42.121 23.141  1.00 54.50 ? 96  PRO A CD  1 
ATOM   424  N N   . GLY A 1 67  ? 23.182 37.747 22.015  1.00 47.84 ? 97  GLY A N   1 
ATOM   425  C CA  . GLY A 1 67  ? 23.285 36.884 20.846  1.00 44.82 ? 97  GLY A CA  1 
ATOM   426  C C   . GLY A 1 67  ? 24.470 37.224 19.964  1.00 42.02 ? 97  GLY A C   1 
ATOM   427  O O   . GLY A 1 67  ? 24.530 36.782 18.815  1.00 43.30 ? 97  GLY A O   1 
ATOM   428  N N   . HIS A 1 68  ? 25.409 38.008 20.494  1.00 37.25 ? 98  HIS A N   1 
ATOM   429  C CA  . HIS A 1 68  ? 26.627 38.336 19.752  1.00 35.07 ? 98  HIS A CA  1 
ATOM   430  C C   . HIS A 1 68  ? 27.477 37.074 19.569  1.00 33.59 ? 98  HIS A C   1 
ATOM   431  O O   . HIS A 1 68  ? 28.122 36.918 18.540  1.00 32.86 ? 98  HIS A O   1 
ATOM   432  C CB  . HIS A 1 68  ? 27.420 39.496 20.406  1.00 32.81 ? 98  HIS A CB  1 
ATOM   433  C CG  . HIS A 1 68  ? 28.192 39.111 21.636  1.00 34.26 ? 98  HIS A CG  1 
ATOM   434  N ND1 . HIS A 1 68  ? 29.456 38.564 21.582  1.00 32.97 ? 98  HIS A ND1 1 
ATOM   435  C CD2 . HIS A 1 68  ? 27.887 39.209 22.953  1.00 35.38 ? 98  HIS A CD2 1 
ATOM   436  C CE1 . HIS A 1 68  ? 29.888 38.324 22.808  1.00 35.72 ? 98  HIS A CE1 1 
ATOM   437  N NE2 . HIS A 1 68  ? 28.954 38.708 23.660  1.00 40.83 ? 98  HIS A NE2 1 
ATOM   438  N N   . ALA A 1 69  ? 27.443 36.166 20.552  1.00 31.83 ? 99  ALA A N   1 
ATOM   439  C CA  . ALA A 1 69  ? 28.277 34.955 20.546  1.00 31.33 ? 99  ALA A CA  1 
ATOM   440  C C   . ALA A 1 69  ? 28.129 34.095 19.286  1.00 30.60 ? 99  ALA A C   1 
ATOM   441  O O   . ALA A 1 69  ? 29.111 33.498 18.824  1.00 31.01 ? 99  ALA A O   1 
ATOM   442  C CB  . ALA A 1 69  ? 28.037 34.110 21.807  1.00 31.97 ? 99  ALA A CB  1 
ATOM   443  N N   . SER A 1 70  ? 26.919 34.051 18.725  1.00 29.38 ? 100 SER A N   1 
ATOM   444  C CA  . SER A 1 70  ? 26.661 33.297 17.490  1.00 29.60 ? 100 SER A CA  1 
ATOM   445  C C   . SER A 1 70  ? 27.335 33.924 16.261  1.00 27.60 ? 100 SER A C   1 
ATOM   446  O O   . SER A 1 70  ? 27.426 33.295 15.203  1.00 26.38 ? 100 SER A O   1 
ATOM   447  C CB  . SER A 1 70  ? 25.151 33.105 17.256  1.00 31.57 ? 100 SER A CB  1 
ATOM   448  O OG  . SER A 1 70  ? 24.526 34.321 16.881  1.00 35.79 ? 100 SER A OG  1 
ATOM   449  N N   . LYS A 1 71  ? 27.823 35.156 16.417  1.00 24.69 ? 101 LYS A N   1 
ATOM   450  C CA  . LYS A 1 71  ? 28.503 35.883 15.341  1.00 24.67 ? 101 LYS A CA  1 
ATOM   451  C C   . LYS A 1 71  ? 29.998 36.080 15.618  1.00 23.25 ? 101 LYS A C   1 
ATOM   452  O O   . LYS A 1 71  ? 30.659 36.837 14.913  1.00 22.87 ? 101 LYS A O   1 
ATOM   453  C CB  . LYS A 1 71  ? 27.822 37.235 15.109  1.00 24.68 ? 101 LYS A CB  1 
ATOM   454  C CG  . LYS A 1 71  ? 26.364 37.090 14.682  1.00 26.54 ? 101 LYS A CG  1 
ATOM   455  C CD  . LYS A 1 71  ? 25.573 38.326 14.957  1.00 33.23 ? 101 LYS A CD  1 
ATOM   456  C CE  . LYS A 1 71  ? 24.118 38.131 14.522  1.00 44.15 ? 101 LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 71  ? 23.998 38.166 13.019  1.00 49.64 ? 101 LYS A NZ  1 
ATOM   458  N N   . ASP A 1 72  ? 30.502 35.415 16.658  1.00 23.62 ? 102 ASP A N   1 
ATOM   459  C CA  . ASP A 1 72  ? 31.937 35.398 16.995  1.00 24.29 ? 102 ASP A CA  1 
ATOM   460  C C   . ASP A 1 72  ? 32.507 34.038 16.666  1.00 25.89 ? 102 ASP A C   1 
ATOM   461  O O   . ASP A 1 72  ? 31.899 33.014 16.992  1.00 22.65 ? 102 ASP A O   1 
ATOM   462  C CB  . ASP A 1 72  ? 32.133 35.645 18.488  1.00 24.07 ? 102 ASP A CB  1 
ATOM   463  C CG  . ASP A 1 72  ? 31.651 37.008 18.910  1.00 25.92 ? 102 ASP A CG  1 
ATOM   464  O OD1 . ASP A 1 72  ? 31.766 37.957 18.098  1.00 23.64 ? 102 ASP A OD1 1 
ATOM   465  O OD2 . ASP A 1 72  ? 31.148 37.128 20.045  1.00 26.00 ? 102 ASP A OD2 1 
ATOM   466  N N   . ARG A 1 73  ? 33.669 34.012 16.025  1.00 24.23 ? 103 ARG A N   1 
ATOM   467  C CA  . ARG A 1 73  ? 34.368 32.740 15.819  1.00 26.99 ? 103 ARG A CA  1 
ATOM   468  C C   . ARG A 1 73  ? 34.966 32.206 17.131  1.00 26.05 ? 103 ARG A C   1 
ATOM   469  O O   . ARG A 1 73  ? 34.981 30.992 17.381  1.00 25.25 ? 103 ARG A O   1 
ATOM   470  C CB  . ARG A 1 73  ? 35.434 32.851 14.716  1.00 24.57 ? 103 ARG A CB  1 
ATOM   471  C CG  . ARG A 1 73  ? 36.083 31.497 14.381  1.00 31.79 ? 103 ARG A CG  1 
ATOM   472  C CD  . ARG A 1 73  ? 36.949 31.550 13.116  1.00 28.96 ? 103 ARG A CD  1 
ATOM   473  N NE  . ARG A 1 73  ? 36.146 31.483 11.893  1.00 29.79 ? 103 ARG A NE  1 
ATOM   474  C CZ  . ARG A 1 73  ? 35.886 32.528 11.119  1.00 31.15 ? 103 ARG A CZ  1 
ATOM   475  N NH1 . ARG A 1 73  ? 36.379 33.721 11.420  1.00 23.39 ? 103 ARG A NH1 1 
ATOM   476  N NH2 . ARG A 1 73  ? 35.150 32.373 10.032  1.00 28.98 ? 103 ARG A NH2 1 
ATOM   477  N N   . TYR A 1 74  ? 35.439 33.123 17.969  1.00 27.22 ? 104 TYR A N   1 
ATOM   478  C CA  . TYR A 1 74  ? 36.108 32.773 19.219  1.00 28.41 ? 104 TYR A CA  1 
ATOM   479  C C   . TYR A 1 74  ? 35.466 33.490 20.390  1.00 31.26 ? 104 TYR A C   1 
ATOM   480  O O   . TYR A 1 74  ? 35.131 34.672 20.312  1.00 31.18 ? 104 TYR A O   1 
ATOM   481  C CB  . TYR A 1 74  ? 37.612 33.108 19.151  1.00 27.05 ? 104 TYR A CB  1 
ATOM   482  C CG  . TYR A 1 74  ? 38.294 32.431 17.984  1.00 29.02 ? 104 TYR A CG  1 
ATOM   483  C CD1 . TYR A 1 74  ? 38.566 31.051 18.001  1.00 33.31 ? 104 TYR A CD1 1 
ATOM   484  C CD2 . TYR A 1 74  ? 38.621 33.152 16.839  1.00 29.17 ? 104 TYR A CD2 1 
ATOM   485  C CE1 . TYR A 1 74  ? 39.174 30.426 16.904  1.00 30.69 ? 104 TYR A CE1 1 
ATOM   486  C CE2 . TYR A 1 74  ? 39.218 32.538 15.748  1.00 26.69 ? 104 TYR A CE2 1 
ATOM   487  C CZ  . TYR A 1 74  ? 39.499 31.189 15.783  1.00 31.37 ? 104 TYR A CZ  1 
ATOM   488  O OH  . TYR A 1 74  ? 40.091 30.627 14.682  1.00 31.14 ? 104 TYR A OH  1 
ATOM   489  N N   . LYS A 1 75  ? 35.340 32.759 21.487  1.00 31.80 ? 105 LYS A N   1 
ATOM   490  C CA  . LYS A 1 75  ? 34.653 33.210 22.694  1.00 34.98 ? 105 LYS A CA  1 
ATOM   491  C C   . LYS A 1 75  ? 35.274 34.473 23.300  1.00 31.77 ? 105 LYS A C   1 
ATOM   492  O O   . LYS A 1 75  ? 34.561 35.372 23.723  1.00 33.56 ? 105 LYS A O   1 
ATOM   493  C CB  . LYS A 1 75  ? 34.673 32.065 23.729  1.00 35.17 ? 105 LYS A CB  1 
ATOM   494  C CG  . LYS A 1 75  ? 33.549 32.078 24.745  1.00 42.96 ? 105 LYS A CG  1 
ATOM   495  C CD  . LYS A 1 75  ? 33.676 30.888 25.704  1.00 38.75 ? 105 LYS A CD  1 
ATOM   496  N N   . THR A 1 76  ? 36.601 34.541 23.319  1.00 29.37 ? 106 THR A N   1 
ATOM   497  C CA  . THR A 1 76  ? 37.321 35.587 24.053  1.00 28.15 ? 106 THR A CA  1 
ATOM   498  C C   . THR A 1 76  ? 37.899 36.707 23.182  1.00 27.84 ? 106 THR A C   1 
ATOM   499  O O   . THR A 1 76  ? 38.591 37.602 23.679  1.00 28.59 ? 106 THR A O   1 
ATOM   500  C CB  . THR A 1 76  ? 38.469 34.964 24.896  1.00 30.62 ? 106 THR A CB  1 
ATOM   501  O OG1 . THR A 1 76  ? 39.413 34.346 24.015  1.00 36.63 ? 106 THR A OG1 1 
ATOM   502  C CG2 . THR A 1 76  ? 37.914 33.915 25.857  1.00 30.38 ? 106 THR A CG2 1 
ATOM   503  N N   . ILE A 1 77  ? 37.636 36.659 21.883  1.00 25.19 ? 107 ILE A N   1 
ATOM   504  C CA  . ILE A 1 77  ? 38.118 37.700 20.975  1.00 24.50 ? 107 ILE A CA  1 
ATOM   505  C C   . ILE A 1 77  ? 36.906 38.523 20.514  1.00 24.74 ? 107 ILE A C   1 
ATOM   506  O O   . ILE A 1 77  ? 36.077 38.087 19.698  1.00 26.18 ? 107 ILE A O   1 
ATOM   507  C CB  . ILE A 1 77  ? 39.003 37.114 19.846  1.00 24.71 ? 107 ILE A CB  1 
ATOM   508  C CG1 . ILE A 1 77  ? 40.271 36.479 20.467  1.00 26.06 ? 107 ILE A CG1 1 
ATOM   509  C CG2 . ILE A 1 77  ? 39.414 38.205 18.843  1.00 24.58 ? 107 ILE A CG2 1 
ATOM   510  C CD1 . ILE A 1 77  ? 40.994 35.506 19.589  1.00 27.10 ? 107 ILE A CD1 1 
ATOM   511  N N   . LEU A 1 78  ? 36.781 39.697 21.120  1.00 25.42 ? 108 LEU A N   1 
ATOM   512  C CA  . LEU A 1 78  ? 35.573 40.512 21.033  1.00 23.83 ? 108 LEU A CA  1 
ATOM   513  C C   . LEU A 1 78  ? 35.925 41.931 20.624  1.00 22.54 ? 108 LEU A C   1 
ATOM   514  O O   . LEU A 1 78  ? 37.028 42.389 20.929  1.00 25.03 ? 108 LEU A O   1 
ATOM   515  C CB  . LEU A 1 78  ? 34.870 40.511 22.399  1.00 23.89 ? 108 LEU A CB  1 
ATOM   516  C CG  . LEU A 1 78  ? 34.344 39.161 22.889  1.00 24.75 ? 108 LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 78  ? 33.779 39.292 24.305  1.00 23.45 ? 108 LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 78  ? 33.295 38.596 21.925  1.00 25.56 ? 108 LEU A CD2 1 
ATOM   519  N N   . PRO A 1 79  ? 35.012 42.628 19.922  1.00 22.06 ? 109 PRO A N   1 
ATOM   520  C CA  . PRO A 1 79  ? 35.355 43.983 19.492  1.00 21.56 ? 109 PRO A CA  1 
ATOM   521  C C   . PRO A 1 79  ? 35.197 44.983 20.646  1.00 23.96 ? 109 PRO A C   1 
ATOM   522  O O   . PRO A 1 79  ? 34.126 45.057 21.254  1.00 22.89 ? 109 PRO A O   1 
ATOM   523  C CB  . PRO A 1 79  ? 34.319 44.274 18.388  1.00 20.62 ? 109 PRO A CB  1 
ATOM   524  C CG  . PRO A 1 79  ? 33.142 43.473 18.742  1.00 20.04 ? 109 PRO A CG  1 
ATOM   525  C CD  . PRO A 1 79  ? 33.652 42.240 19.484  1.00 22.62 ? 109 PRO A CD  1 
ATOM   526  N N   . ASN A 1 80  ? 36.253 45.729 20.956  1.00 23.32 ? 110 ASN A N   1 
ATOM   527  C CA  . ASN A 1 80  ? 36.164 46.765 21.985  1.00 24.52 ? 110 ASN A CA  1 
ATOM   528  C C   . ASN A 1 80  ? 35.038 47.747 21.632  1.00 24.59 ? 110 ASN A C   1 
ATOM   529  O O   . ASN A 1 80  ? 35.004 48.249 20.511  1.00 23.20 ? 110 ASN A O   1 
ATOM   530  C CB  . ASN A 1 80  ? 37.495 47.501 22.104  1.00 23.02 ? 110 ASN A CB  1 
ATOM   531  C CG  . ASN A 1 80  ? 38.624 46.568 22.433  1.00 24.72 ? 110 ASN A CG  1 
ATOM   532  O OD1 . ASN A 1 80  ? 38.880 45.613 21.700  1.00 22.47 ? 110 ASN A OD1 1 
ATOM   533  N ND2 . ASN A 1 80  ? 39.277 46.798 23.570  1.00 24.12 ? 110 ASN A ND2 1 
ATOM   534  N N   . PRO A 1 81  ? 34.132 48.027 22.594  1.00 25.89 ? 111 PRO A N   1 
ATOM   535  C CA  . PRO A 1 81  ? 32.950 48.854 22.329  1.00 25.88 ? 111 PRO A CA  1 
ATOM   536  C C   . PRO A 1 81  ? 33.260 50.225 21.756  1.00 26.32 ? 111 PRO A C   1 
ATOM   537  O O   . PRO A 1 81  ? 32.508 50.718 20.927  1.00 25.99 ? 111 PRO A O   1 
ATOM   538  C CB  . PRO A 1 81  ? 32.303 49.017 23.719  1.00 27.47 ? 111 PRO A CB  1 
ATOM   539  C CG  . PRO A 1 81  ? 32.813 47.873 24.520  1.00 26.98 ? 111 PRO A CG  1 
ATOM   540  C CD  . PRO A 1 81  ? 34.181 47.556 23.997  1.00 24.96 ? 111 PRO A CD  1 
ATOM   541  N N   . GLN A 1 82  ? 34.352 50.839 22.199  1.00 26.11 ? 112 GLN A N   1 
ATOM   542  C CA  . GLN A 1 82  ? 34.656 52.217 21.827  1.00 27.49 ? 112 GLN A CA  1 
ATOM   543  C C   . GLN A 1 82  ? 34.943 52.407 20.326  1.00 27.14 ? 112 GLN A C   1 
ATOM   544  O O   . GLN A 1 82  ? 34.738 53.487 19.786  1.00 27.37 ? 112 GLN A O   1 
ATOM   545  C CB  . GLN A 1 82  ? 35.819 52.746 22.681  1.00 30.78 ? 112 GLN A CB  1 
ATOM   546  C CG  . GLN A 1 82  ? 35.600 52.662 24.224  1.00 33.81 ? 112 GLN A CG  1 
ATOM   547  C CD  . GLN A 1 82  ? 35.845 51.255 24.853  1.00 41.81 ? 112 GLN A CD  1 
ATOM   548  O OE1 . GLN A 1 82  ? 36.330 50.329 24.201  1.00 35.09 ? 112 GLN A OE1 1 
ATOM   549  N NE2 . GLN A 1 82  ? 35.486 51.111 26.127  1.00 42.61 ? 112 GLN A NE2 1 
ATOM   550  N N   . SER A 1 83  ? 35.422 51.357 19.655  1.00 24.45 ? 113 SER A N   1 
ATOM   551  C CA  . SER A 1 83  ? 35.830 51.436 18.253  1.00 23.59 ? 113 SER A CA  1 
ATOM   552  C C   . SER A 1 83  ? 35.123 50.384 17.389  1.00 22.77 ? 113 SER A C   1 
ATOM   553  O O   . SER A 1 83  ? 35.473 50.164 16.234  1.00 20.63 ? 113 SER A O   1 
ATOM   554  C CB  . SER A 1 83  ? 37.352 51.245 18.159  1.00 22.29 ? 113 SER A CB  1 
ATOM   555  O OG  . SER A 1 83  ? 37.724 50.027 18.771  1.00 20.90 ? 113 SER A OG  1 
ATOM   556  N N   . ARG A 1 84  ? 34.136 49.727 17.971  1.00 23.71 ? 114 ARG A N   1 
ATOM   557  C CA  . ARG A 1 84  ? 33.365 48.684 17.314  1.00 23.77 ? 114 ARG A CA  1 
ATOM   558  C C   . ARG A 1 84  ? 32.600 49.257 16.107  1.00 23.19 ? 114 ARG A C   1 
ATOM   559  O O   . ARG A 1 84  ? 32.066 50.376 16.174  1.00 23.27 ? 114 ARG A O   1 
ATOM   560  C CB  . ARG A 1 84  ? 32.407 48.109 18.357  1.00 26.42 ? 114 ARG A CB  1 
ATOM   561  C CG  . ARG A 1 84  ? 31.342 47.183 17.875  1.00 27.07 ? 114 ARG A CG  1 
ATOM   562  C CD  . ARG A 1 84  ? 30.557 46.621 19.070  1.00 24.14 ? 114 ARG A CD  1 
ATOM   563  N NE  . ARG A 1 84  ? 29.410 47.431 19.500  1.00 26.33 ? 114 ARG A NE  1 
ATOM   564  C CZ  . ARG A 1 84  ? 28.177 47.323 18.998  1.00 29.22 ? 114 ARG A CZ  1 
ATOM   565  N NH1 . ARG A 1 84  ? 27.922 46.469 18.001  1.00 24.50 ? 114 ARG A NH1 1 
ATOM   566  N NH2 . ARG A 1 84  ? 27.190 48.082 19.479  1.00 29.82 ? 114 ARG A NH2 1 
ATOM   567  N N   . VAL A 1 85  ? 32.567 48.498 15.008  1.00 22.93 ? 115 VAL A N   1 
ATOM   568  C CA  . VAL A 1 85  ? 31.810 48.892 13.818  1.00 22.38 ? 115 VAL A CA  1 
ATOM   569  C C   . VAL A 1 85  ? 30.359 48.483 14.042  1.00 23.51 ? 115 VAL A C   1 
ATOM   570  O O   . VAL A 1 85  ? 30.066 47.302 14.232  1.00 23.99 ? 115 VAL A O   1 
ATOM   571  C CB  . VAL A 1 85  ? 32.361 48.264 12.495  1.00 22.77 ? 115 VAL A CB  1 
ATOM   572  C CG1 . VAL A 1 85  ? 31.527 48.763 11.288  1.00 22.95 ? 115 VAL A CG1 1 
ATOM   573  C CG2 . VAL A 1 85  ? 33.839 48.609 12.291  1.00 19.26 ? 115 VAL A CG2 1 
ATOM   574  N N   . CYS A 1 86  ? 29.458 49.462 14.057  1.00 21.77 ? 116 CYS A N   1 
ATOM   575  C CA  . CYS A 1 86  ? 28.045 49.184 14.318  1.00 24.47 ? 116 CYS A CA  1 
ATOM   576  C C   . CYS A 1 86  ? 27.291 49.184 13.004  1.00 24.31 ? 116 CYS A C   1 
ATOM   577  O O   . CYS A 1 86  ? 27.464 50.091 12.184  1.00 24.96 ? 116 CYS A O   1 
ATOM   578  C CB  . CYS A 1 86  ? 27.447 50.229 15.261  1.00 25.00 ? 116 CYS A CB  1 
ATOM   579  S SG  . CYS A 1 86  ? 28.310 50.305 16.850  1.00 30.48 ? 116 CYS A SG  1 
ATOM   580  N N   . LEU A 1 87  ? 26.490 48.152 12.783  1.00 22.10 ? 117 LEU A N   1 
ATOM   581  C CA  . LEU A 1 87  ? 25.758 48.047 11.527  1.00 25.16 ? 117 LEU A CA  1 
ATOM   582  C C   . LEU A 1 87  ? 24.424 48.775 11.663  1.00 26.98 ? 117 LEU A C   1 
ATOM   583  O O   . LEU A 1 87  ? 23.625 48.416 12.508  1.00 25.70 ? 117 LEU A O   1 
ATOM   584  C CB  . LEU A 1 87  ? 25.564 46.580 11.132  1.00 24.30 ? 117 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 87  ? 26.868 45.797 10.939  1.00 29.30 ? 117 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 87  ? 26.561 44.339 10.658  1.00 25.56 ? 117 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 87  ? 27.730 46.413 9.830   1.00 25.16 ? 117 LEU A CD2 1 
ATOM   588  N N   . GLY A 1 88  ? 24.236 49.825 10.867  1.00 27.41 ? 118 GLY A N   1 
ATOM   589  C CA  . GLY A 1 88  ? 23.040 50.666 10.917  1.00 30.40 ? 118 GLY A CA  1 
ATOM   590  C C   . GLY A 1 88  ? 21.822 50.055 10.231  1.00 32.19 ? 118 GLY A C   1 
ATOM   591  O O   . GLY A 1 88  ? 20.679 50.484 10.474  1.00 30.25 ? 118 GLY A O   1 
ATOM   592  N N   . ARG A 1 89  ? 22.075 49.051 9.382   1.00 31.52 ? 119 ARG A N   1 
ATOM   593  C CA  . ARG A 1 89  ? 21.031 48.274 8.712   1.00 32.69 ? 119 ARG A CA  1 
ATOM   594  C C   . ARG A 1 89  ? 20.209 49.131 7.732   1.00 35.20 ? 119 ARG A C   1 
ATOM   595  O O   . ARG A 1 89  ? 19.005 48.915 7.569   1.00 33.97 ? 119 ARG A O   1 
ATOM   596  C CB  . ARG A 1 89  ? 20.100 47.602 9.742   1.00 31.59 ? 119 ARG A CB  1 
ATOM   597  C CG  . ARG A 1 89  ? 20.799 46.785 10.816  1.00 31.80 ? 119 ARG A CG  1 
ATOM   598  C CD  . ARG A 1 89  ? 21.584 45.645 10.224  1.00 33.39 ? 119 ARG A CD  1 
ATOM   599  N NE  . ARG A 1 89  ? 22.004 44.720 11.267  1.00 36.10 ? 119 ARG A NE  1 
ATOM   600  C CZ  . ARG A 1 89  ? 22.710 43.612 11.066  1.00 35.71 ? 119 ARG A CZ  1 
ATOM   601  N NH1 . ARG A 1 89  ? 23.099 43.260 9.847   1.00 29.78 ? 119 ARG A NH1 1 
ATOM   602  N NH2 . ARG A 1 89  ? 23.014 42.849 12.098  1.00 30.48 ? 119 ARG A NH2 1 
ATOM   603  N N   . ALA A 1 90  ? 20.852 50.100 7.083   1.00 37.06 ? 120 ALA A N   1 
ATOM   604  C CA  . ALA A 1 90  ? 20.134 50.981 6.155   1.00 39.40 ? 120 ALA A CA  1 
ATOM   605  C C   . ALA A 1 90  ? 19.631 50.215 4.920   1.00 42.30 ? 120 ALA A C   1 
ATOM   606  O O   . ALA A 1 90  ? 18.650 50.605 4.291   1.00 42.10 ? 120 ALA A O   1 
ATOM   607  C CB  . ALA A 1 90  ? 21.012 52.147 5.748   1.00 39.43 ? 120 ALA A CB  1 
ATOM   608  N N   . GLN A 1 91  ? 20.303 49.108 4.610   1.00 44.47 ? 121 GLN A N   1 
ATOM   609  C CA  . GLN A 1 91  ? 20.026 48.291 3.426   1.00 45.62 ? 121 GLN A CA  1 
ATOM   610  C C   . GLN A 1 91  ? 19.248 47.004 3.730   1.00 47.47 ? 121 GLN A C   1 
ATOM   611  O O   . GLN A 1 91  ? 18.822 46.300 2.807   1.00 48.39 ? 121 GLN A O   1 
ATOM   612  C CB  . GLN A 1 91  ? 21.344 47.937 2.729   1.00 44.05 ? 121 GLN A CB  1 
ATOM   613  C CG  . GLN A 1 91  ? 21.896 49.046 1.845   1.00 43.51 ? 121 GLN A CG  1 
ATOM   614  C CD  . GLN A 1 91  ? 22.315 50.270 2.620   1.00 37.95 ? 121 GLN A CD  1 
ATOM   615  O OE1 . GLN A 1 91  ? 23.194 50.195 3.480   1.00 42.90 ? 121 GLN A OE1 1 
ATOM   616  N NE2 . GLN A 1 91  ? 21.693 51.413 2.317   1.00 38.68 ? 121 GLN A NE2 1 
ATOM   617  N N   . SER A 1 92  ? 19.060 46.704 5.016   1.00 48.09 ? 122 SER A N   1 
ATOM   618  C CA  . SER A 1 92  ? 18.444 45.439 5.424   1.00 48.67 ? 122 SER A CA  1 
ATOM   619  C C   . SER A 1 92  ? 17.422 45.587 6.564   1.00 50.26 ? 122 SER A C   1 
ATOM   620  O O   . SER A 1 92  ? 17.242 46.672 7.135   1.00 50.03 ? 122 SER A O   1 
ATOM   621  C CB  . SER A 1 92  ? 19.529 44.395 5.775   1.00 48.05 ? 122 SER A CB  1 
ATOM   622  O OG  . SER A 1 92  ? 20.062 44.586 7.076   1.00 38.52 ? 122 SER A OG  1 
ATOM   623  N N   . GLN A 1 93  ? 16.746 44.489 6.881   1.00 52.12 ? 123 GLN A N   1 
ATOM   624  C CA  . GLN A 1 93  ? 15.821 44.473 8.005   1.00 54.86 ? 123 GLN A CA  1 
ATOM   625  C C   . GLN A 1 93  ? 16.356 43.629 9.174   1.00 56.37 ? 123 GLN A C   1 
ATOM   626  O O   . GLN A 1 93  ? 15.590 43.252 10.071  1.00 57.52 ? 123 GLN A O   1 
ATOM   627  C CB  . GLN A 1 93  ? 14.428 44.004 7.551   1.00 54.78 ? 123 GLN A CB  1 
ATOM   628  N N   . GLU A 1 94  ? 17.670 43.360 9.173   1.00 56.76 ? 124 GLU A N   1 
ATOM   629  C CA  . GLU A 1 94  ? 18.306 42.513 10.202  1.00 56.69 ? 124 GLU A CA  1 
ATOM   630  C C   . GLU A 1 94  ? 18.176 43.084 11.619  1.00 55.75 ? 124 GLU A C   1 
ATOM   631  O O   . GLU A 1 94  ? 18.226 44.302 11.813  1.00 54.47 ? 124 GLU A O   1 
ATOM   632  C CB  . GLU A 1 94  ? 19.779 42.216 9.867   1.00 57.47 ? 124 GLU A CB  1 
ATOM   633  C CG  . GLU A 1 94  ? 20.025 41.342 8.623   1.00 59.60 ? 124 GLU A CG  1 
ATOM   634  C CD  . GLU A 1 94  ? 19.191 40.058 8.591   1.00 66.92 ? 124 GLU A CD  1 
ATOM   635  O OE1 . GLU A 1 94  ? 18.760 39.669 7.484   1.00 68.16 ? 124 GLU A OE1 1 
ATOM   636  O OE2 . GLU A 1 94  ? 18.958 39.440 9.657   1.00 68.45 ? 124 GLU A OE2 1 
ATOM   637  N N   . ASP A 1 95  ? 18.027 42.193 12.600  1.00 56.00 ? 125 ASP A N   1 
ATOM   638  C CA  . ASP A 1 95  ? 17.565 42.580 13.939  1.00 56.75 ? 125 ASP A CA  1 
ATOM   639  C C   . ASP A 1 95  ? 18.675 42.764 14.989  1.00 56.02 ? 125 ASP A C   1 
ATOM   640  O O   . ASP A 1 95  ? 18.545 42.281 16.127  1.00 57.28 ? 125 ASP A O   1 
ATOM   641  C CB  . ASP A 1 95  ? 16.480 41.601 14.444  1.00 58.05 ? 125 ASP A CB  1 
ATOM   642  N N   . GLY A 1 96  ? 19.744 43.468 14.601  1.00 51.78 ? 126 GLY A N   1 
ATOM   643  C CA  . GLY A 1 96  ? 20.836 43.858 15.507  1.00 48.36 ? 126 GLY A CA  1 
ATOM   644  C C   . GLY A 1 96  ? 21.804 44.827 14.829  1.00 45.01 ? 126 GLY A C   1 
ATOM   645  O O   . GLY A 1 96  ? 21.547 45.287 13.718  1.00 47.87 ? 126 GLY A O   1 
ATOM   646  N N   . ASP A 1 97  ? 22.910 45.153 15.491  1.00 38.54 ? 127 ASP A N   1 
ATOM   647  C CA  . ASP A 1 97  ? 23.924 46.027 14.890  1.00 33.51 ? 127 ASP A CA  1 
ATOM   648  C C   . ASP A 1 97  ? 25.325 45.391 14.885  1.00 29.82 ? 127 ASP A C   1 
ATOM   649  O O   . ASP A 1 97  ? 26.310 46.049 14.559  1.00 28.76 ? 127 ASP A O   1 
ATOM   650  C CB  . ASP A 1 97  ? 23.955 47.401 15.584  1.00 31.54 ? 127 ASP A CB  1 
ATOM   651  C CG  . ASP A 1 97  ? 24.601 47.373 16.988  1.00 36.27 ? 127 ASP A CG  1 
ATOM   652  O OD1 . ASP A 1 97  ? 25.013 46.296 17.521  1.00 27.82 ? 127 ASP A OD1 1 
ATOM   653  O OD2 . ASP A 1 97  ? 24.696 48.472 17.571  1.00 37.88 ? 127 ASP A OD2 1 
ATOM   654  N N   . TYR A 1 98  ? 25.393 44.108 15.215  1.00 27.42 ? 128 TYR A N   1 
ATOM   655  C CA  . TYR A 1 98  ? 26.665 43.512 15.626  1.00 25.13 ? 128 TYR A CA  1 
ATOM   656  C C   . TYR A 1 98  ? 27.478 42.844 14.531  1.00 24.89 ? 128 TYR A C   1 
ATOM   657  O O   . TYR A 1 98  ? 26.975 42.001 13.770  1.00 24.46 ? 128 TYR A O   1 
ATOM   658  C CB  . TYR A 1 98  ? 26.467 42.531 16.786  1.00 24.84 ? 128 TYR A CB  1 
ATOM   659  C CG  . TYR A 1 98  ? 27.782 41.940 17.297  1.00 21.37 ? 128 TYR A CG  1 
ATOM   660  C CD1 . TYR A 1 98  ? 28.602 42.656 18.166  1.00 20.85 ? 128 TYR A CD1 1 
ATOM   661  C CD2 . TYR A 1 98  ? 28.208 40.674 16.882  1.00 23.44 ? 128 TYR A CD2 1 
ATOM   662  C CE1 . TYR A 1 98  ? 29.817 42.105 18.653  1.00 23.70 ? 128 TYR A CE1 1 
ATOM   663  C CE2 . TYR A 1 98  ? 29.424 40.119 17.345  1.00 25.74 ? 128 TYR A CE2 1 
ATOM   664  C CZ  . TYR A 1 98  ? 30.216 40.844 18.225  1.00 23.55 ? 128 TYR A CZ  1 
ATOM   665  O OH  . TYR A 1 98  ? 31.399 40.294 18.684  1.00 26.31 ? 128 TYR A OH  1 
ATOM   666  N N   . ILE A 1 99  ? 28.757 43.219 14.494  1.00 24.90 ? 129 ILE A N   1 
ATOM   667  C CA  . ILE A 1 99  ? 29.779 42.504 13.750  1.00 22.81 ? 129 ILE A CA  1 
ATOM   668  C C   . ILE A 1 99  ? 31.080 42.551 14.563  1.00 22.94 ? 129 ILE A C   1 
ATOM   669  O O   . ILE A 1 99  ? 31.364 43.551 15.225  1.00 22.90 ? 129 ILE A O   1 
ATOM   670  C CB  . ILE A 1 99  ? 29.968 43.063 12.292  1.00 24.06 ? 129 ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 99  ? 30.950 42.178 11.503  1.00 21.86 ? 129 ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 99  ? 30.336 44.565 12.291  1.00 21.94 ? 129 ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 99  ? 30.896 42.358 9.968   1.00 20.48 ? 129 ILE A CD1 1 
ATOM   674  N N   . ASN A 1 100 ? 31.830 41.451 14.564  1.00 21.56 ? 130 ASN A N   1 
ATOM   675  C CA  . ASN A 1 100 ? 33.114 41.420 15.251  1.00 21.96 ? 130 ASN A CA  1 
ATOM   676  C C   . ASN A 1 100 ? 34.185 42.130 14.383  1.00 22.83 ? 130 ASN A C   1 
ATOM   677  O O   . ASN A 1 100 ? 34.871 41.501 13.573  1.00 24.40 ? 130 ASN A O   1 
ATOM   678  C CB  . ASN A 1 100 ? 33.499 39.983 15.600  1.00 21.64 ? 130 ASN A CB  1 
ATOM   679  C CG  . ASN A 1 100 ? 34.667 39.899 16.595  1.00 19.50 ? 130 ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 100 ? 35.625 40.675 16.539  1.00 24.53 ? 130 ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 100 ? 34.576 38.948 17.501  1.00 20.17 ? 130 ASN A ND2 1 
ATOM   682  N N   . ALA A 1 101 ? 34.278 43.447 14.550  1.00 21.01 ? 131 ALA A N   1 
ATOM   683  C CA  . ALA A 1 101 ? 35.103 44.323 13.729  1.00 21.68 ? 131 ALA A CA  1 
ATOM   684  C C   . ALA A 1 101 ? 35.313 45.614 14.483  1.00 21.46 ? 131 ALA A C   1 
ATOM   685  O O   . ALA A 1 101 ? 34.408 46.060 15.196  1.00 19.77 ? 131 ALA A O   1 
ATOM   686  C CB  . ALA A 1 101 ? 34.385 44.641 12.435  1.00 20.22 ? 131 ALA A CB  1 
ATOM   687  N N   . ASN A 1 102 ? 36.489 46.220 14.310  1.00 20.69 ? 132 ASN A N   1 
ATOM   688  C CA  . ASN A 1 102 ? 36.803 47.507 14.927  1.00 21.55 ? 132 ASN A CA  1 
ATOM   689  C C   . ASN A 1 102 ? 37.423 48.427 13.915  1.00 21.21 ? 132 ASN A C   1 
ATOM   690  O O   . ASN A 1 102 ? 38.217 47.977 13.063  1.00 20.01 ? 132 ASN A O   1 
ATOM   691  C CB  . ASN A 1 102 ? 37.794 47.366 16.091  1.00 19.51 ? 132 ASN A CB  1 
ATOM   692  C CG  . ASN A 1 102 ? 37.207 46.638 17.269  1.00 19.17 ? 132 ASN A CG  1 
ATOM   693  O OD1 . ASN A 1 102 ? 37.276 45.410 17.336  1.00 21.22 ? 132 ASN A OD1 1 
ATOM   694  N ND2 . ASN A 1 102 ? 36.630 47.391 18.227  1.00 17.49 ? 132 ASN A ND2 1 
ATOM   695  N N   . TYR A 1 103 ? 37.090 49.710 14.020  1.00 21.16 ? 133 TYR A N   1 
ATOM   696  C CA  . TYR A 1 103 ? 37.880 50.744 13.325  1.00 22.04 ? 133 TYR A CA  1 
ATOM   697  C C   . TYR A 1 103 ? 39.290 50.771 13.906  1.00 21.66 ? 133 TYR A C   1 
ATOM   698  O O   . TYR A 1 103 ? 39.451 50.673 15.125  1.00 19.31 ? 133 TYR A O   1 
ATOM   699  C CB  . TYR A 1 103 ? 37.258 52.121 13.494  1.00 21.51 ? 133 TYR A CB  1 
ATOM   700  C CG  . TYR A 1 103 ? 35.834 52.241 12.979  1.00 24.02 ? 133 TYR A CG  1 
ATOM   701  C CD1 . TYR A 1 103 ? 35.567 52.240 11.599  1.00 22.09 ? 133 TYR A CD1 1 
ATOM   702  C CD2 . TYR A 1 103 ? 34.761 52.365 13.870  1.00 19.91 ? 133 TYR A CD2 1 
ATOM   703  C CE1 . TYR A 1 103 ? 34.258 52.353 11.119  1.00 22.38 ? 133 TYR A CE1 1 
ATOM   704  C CE2 . TYR A 1 103 ? 33.451 52.479 13.403  1.00 21.99 ? 133 TYR A CE2 1 
ATOM   705  C CZ  . TYR A 1 103 ? 33.212 52.478 12.021  1.00 24.31 ? 133 TYR A CZ  1 
ATOM   706  O OH  . TYR A 1 103 ? 31.919 52.603 11.565  1.00 27.49 ? 133 TYR A OH  1 
ATOM   707  N N   . ILE A 1 104 ? 40.293 50.927 13.038  1.00 20.52 ? 134 ILE A N   1 
ATOM   708  C CA  . ILE A 1 104 ? 41.692 51.006 13.457  1.00 21.46 ? 134 ILE A CA  1 
ATOM   709  C C   . ILE A 1 104 ? 42.301 52.313 12.941  1.00 22.60 ? 134 ILE A C   1 
ATOM   710  O O   . ILE A 1 104 ? 42.217 52.611 11.747  1.00 21.30 ? 134 ILE A O   1 
ATOM   711  C CB  . ILE A 1 104 ? 42.539 49.802 12.918  1.00 20.62 ? 134 ILE A CB  1 
ATOM   712  C CG1 . ILE A 1 104 ? 41.888 48.443 13.235  1.00 20.20 ? 134 ILE A CG1 1 
ATOM   713  C CG2 . ILE A 1 104 ? 44.010 49.868 13.427  1.00 18.71 ? 134 ILE A CG2 1 
ATOM   714  C CD1 . ILE A 1 104 ? 41.739 48.073 14.741  1.00 17.43 ? 134 ILE A CD1 1 
ATOM   715  N N   . ARG A 1 105 ? 42.948 53.065 13.829  1.00 19.95 ? 135 ARG A N   1 
ATOM   716  C CA  . ARG A 1 105 ? 43.684 54.277 13.429  1.00 20.87 ? 135 ARG A CA  1 
ATOM   717  C C   . ARG A 1 105 ? 44.948 53.928 12.626  1.00 24.10 ? 135 ARG A C   1 
ATOM   718  O O   . ARG A 1 105 ? 45.576 52.872 12.842  1.00 21.78 ? 135 ARG A O   1 
ATOM   719  C CB  . ARG A 1 105 ? 44.048 55.146 14.653  1.00 20.26 ? 135 ARG A CB  1 
ATOM   720  C CG  . ARG A 1 105 ? 42.827 55.727 15.385  1.00 17.82 ? 135 ARG A CG  1 
ATOM   721  C CD  . ARG A 1 105 ? 43.173 56.332 16.756  1.00 20.09 ? 135 ARG A CD  1 
ATOM   722  N NE  . ARG A 1 105 ? 43.617 55.243 17.635  1.00 19.26 ? 135 ARG A NE  1 
ATOM   723  C CZ  . ARG A 1 105 ? 44.709 55.273 18.382  1.00 20.50 ? 135 ARG A CZ  1 
ATOM   724  N NH1 . ARG A 1 105 ? 45.449 56.373 18.455  1.00 20.83 ? 135 ARG A NH1 1 
ATOM   725  N NH2 . ARG A 1 105 ? 45.013 54.222 19.125  1.00 22.92 ? 135 ARG A NH2 1 
ATOM   726  N N   . GLY A 1 106 ? 45.315 54.815 11.705  1.00 22.87 ? 136 GLY A N   1 
ATOM   727  C CA  . GLY A 1 106 ? 46.547 54.638 10.948  1.00 21.12 ? 136 GLY A CA  1 
ATOM   728  C C   . GLY A 1 106 ? 47.689 55.526 11.404  1.00 22.76 ? 136 GLY A C   1 
ATOM   729  O O   . GLY A 1 106 ? 47.795 55.907 12.581  1.00 20.88 ? 136 GLY A O   1 
ATOM   730  N N   . TYR A 1 107 ? 48.553 55.853 10.452  1.00 22.20 ? 137 TYR A N   1 
ATOM   731  C CA  . TYR A 1 107 ? 49.721 56.676 10.687  1.00 23.89 ? 137 TYR A CA  1 
ATOM   732  C C   . TYR A 1 107 ? 49.344 57.978 11.401  1.00 25.07 ? 137 TYR A C   1 
ATOM   733  O O   . TYR A 1 107 ? 48.390 58.634 11.021  1.00 25.03 ? 137 TYR A O   1 
ATOM   734  C CB  . TYR A 1 107 ? 50.439 56.979 9.351   1.00 26.68 ? 137 TYR A CB  1 
ATOM   735  C CG  . TYR A 1 107 ? 51.564 57.957 9.514   1.00 25.54 ? 137 TYR A CG  1 
ATOM   736  C CD1 . TYR A 1 107 ? 52.745 57.577 10.134  1.00 26.78 ? 137 TYR A CD1 1 
ATOM   737  C CD2 . TYR A 1 107 ? 51.425 59.281 9.095   1.00 35.33 ? 137 TYR A CD2 1 
ATOM   738  C CE1 . TYR A 1 107 ? 53.788 58.491 10.311  1.00 29.07 ? 137 TYR A CE1 1 
ATOM   739  C CE2 . TYR A 1 107 ? 52.451 60.198 9.273   1.00 32.65 ? 137 TYR A CE2 1 
ATOM   740  C CZ  . TYR A 1 107 ? 53.634 59.785 9.871   1.00 24.71 ? 137 TYR A CZ  1 
ATOM   741  O OH  . TYR A 1 107 ? 54.647 60.691 10.067  1.00 31.01 ? 137 TYR A OH  1 
ATOM   742  N N   . ASP A 1 108 ? 50.077 58.310 12.464  1.00 27.46 ? 138 ASP A N   1 
ATOM   743  C CA  . ASP A 1 108 ? 49.847 59.541 13.238  1.00 29.40 ? 138 ASP A CA  1 
ATOM   744  C C   . ASP A 1 108 ? 48.446 59.618 13.889  1.00 29.31 ? 138 ASP A C   1 
ATOM   745  O O   . ASP A 1 108 ? 47.949 60.715 14.162  1.00 28.80 ? 138 ASP A O   1 
ATOM   746  C CB  . ASP A 1 108 ? 50.083 60.775 12.346  1.00 31.77 ? 138 ASP A CB  1 
ATOM   747  C CG  . ASP A 1 108 ? 50.964 61.828 13.012  1.00 42.51 ? 138 ASP A CG  1 
ATOM   748  O OD1 . ASP A 1 108 ? 52.173 61.563 13.193  1.00 56.82 ? 138 ASP A OD1 1 
ATOM   749  O OD2 . ASP A 1 108 ? 50.462 62.928 13.327  1.00 48.06 ? 138 ASP A OD2 1 
ATOM   750  N N   . GLY A 1 109 ? 47.816 58.468 14.136  1.00 27.02 ? 139 GLY A N   1 
ATOM   751  C CA  . GLY A 1 109 ? 46.481 58.439 14.761  1.00 24.36 ? 139 GLY A CA  1 
ATOM   752  C C   . GLY A 1 109 ? 45.333 58.812 13.830  1.00 25.08 ? 139 GLY A C   1 
ATOM   753  O O   . GLY A 1 109 ? 44.216 59.097 14.286  1.00 20.95 ? 139 GLY A O   1 
ATOM   754  N N   . LYS A 1 110 ? 45.574 58.811 12.519  1.00 22.05 ? 140 LYS A N   1 
ATOM   755  C CA  . LYS A 1 110 ? 44.500 59.134 11.581  1.00 22.02 ? 140 LYS A CA  1 
ATOM   756  C C   . LYS A 1 110 ? 43.332 58.159 11.760  1.00 21.51 ? 140 LYS A C   1 
ATOM   757  O O   . LYS A 1 110 ? 43.541 56.965 11.734  1.00 20.85 ? 140 LYS A O   1 
ATOM   758  C CB  . LYS A 1 110 ? 45.018 59.087 10.140  1.00 23.13 ? 140 LYS A CB  1 
ATOM   759  C CG  . LYS A 1 110 ? 43.990 59.505 9.112   1.00 25.47 ? 140 LYS A CG  1 
ATOM   760  C CD  . LYS A 1 110 ? 44.601 59.381 7.716   1.00 33.46 ? 140 LYS A CD  1 
ATOM   761  C CE  . LYS A 1 110 ? 43.616 59.798 6.661   1.00 37.49 ? 140 LYS A CE  1 
ATOM   762  N NZ  . LYS A 1 110 ? 43.103 61.167 6.961   1.00 50.44 ? 140 LYS A NZ  1 
ATOM   763  N N   . GLU A 1 111 ? 42.103 58.665 11.886  1.00 19.14 ? 141 GLU A N   1 
ATOM   764  C CA  . GLU A 1 111 ? 40.981 57.810 12.257  1.00 21.65 ? 141 GLU A CA  1 
ATOM   765  C C   . GLU A 1 111 ? 40.458 56.962 11.107  1.00 21.83 ? 141 GLU A C   1 
ATOM   766  O O   . GLU A 1 111 ? 40.464 57.400 9.950   1.00 19.69 ? 141 GLU A O   1 
ATOM   767  C CB  . GLU A 1 111 ? 39.856 58.642 12.876  1.00 22.35 ? 141 GLU A CB  1 
ATOM   768  C CG  . GLU A 1 111 ? 40.112 59.016 14.318  1.00 24.75 ? 141 GLU A CG  1 
ATOM   769  C CD  . GLU A 1 111 ? 39.085 60.002 14.890  1.00 29.37 ? 141 GLU A CD  1 
ATOM   770  O OE1 . GLU A 1 111 ? 38.046 60.279 14.236  1.00 33.31 ? 141 GLU A OE1 1 
ATOM   771  O OE2 . GLU A 1 111 ? 39.344 60.508 16.004  1.00 32.83 ? 141 GLU A OE2 1 
ATOM   772  N N   . LYS A 1 112 ? 40.044 55.736 11.434  1.00 18.87 ? 142 LYS A N   1 
ATOM   773  C CA  . LYS A 1 112 ? 39.286 54.862 10.527  1.00 20.87 ? 142 LYS A CA  1 
ATOM   774  C C   . LYS A 1 112 ? 40.049 54.550 9.240   1.00 20.77 ? 142 LYS A C   1 
ATOM   775  O O   . LYS A 1 112 ? 39.453 54.469 8.153   1.00 21.25 ? 142 LYS A O   1 
ATOM   776  C CB  . LYS A 1 112 ? 37.888 55.459 10.209  1.00 21.92 ? 142 LYS A CB  1 
ATOM   777  C CG  . LYS A 1 112 ? 36.972 55.568 11.453  1.00 23.70 ? 142 LYS A CG  1 
ATOM   778  C CD  . LYS A 1 112 ? 35.543 55.958 11.085  1.00 24.13 ? 142 LYS A CD  1 
ATOM   779  C CE  . LYS A 1 112 ? 34.653 56.081 12.352  1.00 22.95 ? 142 LYS A CE  1 
ATOM   780  N NZ  . LYS A 1 112 ? 33.251 56.361 11.907  1.00 28.97 ? 142 LYS A NZ  1 
ATOM   781  N N   . VAL A 1 113 ? 41.367 54.406 9.340   1.00 20.96 ? 143 VAL A N   1 
ATOM   782  C CA  . VAL A 1 113 ? 42.163 54.027 8.165   1.00 20.85 ? 143 VAL A CA  1 
ATOM   783  C C   . VAL A 1 113 ? 41.883 52.579 7.782   1.00 20.27 ? 143 VAL A C   1 
ATOM   784  O O   . VAL A 1 113 ? 41.863 52.245 6.584   1.00 20.47 ? 143 VAL A O   1 
ATOM   785  C CB  . VAL A 1 113 ? 43.679 54.292 8.374   1.00 19.62 ? 143 VAL A CB  1 
ATOM   786  C CG1 . VAL A 1 113 ? 44.491 53.866 7.148   1.00 19.65 ? 143 VAL A CG1 1 
ATOM   787  C CG2 . VAL A 1 113 ? 43.903 55.786 8.627   1.00 20.77 ? 143 VAL A CG2 1 
ATOM   788  N N   . TYR A 1 114 ? 41.684 51.727 8.795   1.00 20.49 ? 144 TYR A N   1 
ATOM   789  C CA  . TYR A 1 114 ? 41.396 50.294 8.592   1.00 18.47 ? 144 TYR A CA  1 
ATOM   790  C C   . TYR A 1 114 ? 40.184 49.878 9.379   1.00 19.36 ? 144 TYR A C   1 
ATOM   791  O O   . TYR A 1 114 ? 39.747 50.561 10.316  1.00 20.88 ? 144 TYR A O   1 
ATOM   792  C CB  . TYR A 1 114 ? 42.568 49.355 9.045   1.00 19.48 ? 144 TYR A CB  1 
ATOM   793  C CG  . TYR A 1 114 ? 43.934 49.846 8.615   1.00 19.26 ? 144 TYR A CG  1 
ATOM   794  C CD1 . TYR A 1 114 ? 44.476 49.442 7.402   1.00 21.45 ? 144 TYR A CD1 1 
ATOM   795  C CD2 . TYR A 1 114 ? 44.637 50.777 9.390   1.00 17.94 ? 144 TYR A CD2 1 
ATOM   796  C CE1 . TYR A 1 114 ? 45.712 49.930 6.957   1.00 22.22 ? 144 TYR A CE1 1 
ATOM   797  C CE2 . TYR A 1 114 ? 45.881 51.276 8.956   1.00 17.09 ? 144 TYR A CE2 1 
ATOM   798  C CZ  . TYR A 1 114 ? 46.411 50.826 7.743   1.00 20.19 ? 144 TYR A CZ  1 
ATOM   799  O OH  . TYR A 1 114 ? 47.633 51.296 7.283   1.00 23.89 ? 144 TYR A OH  1 
ATOM   800  N N   . ILE A 1 115 ? 39.654 48.719 9.015   1.00 19.99 ? 145 ILE A N   1 
ATOM   801  C CA  . ILE A 1 115 ? 38.740 47.998 9.891   1.00 19.87 ? 145 ILE A CA  1 
ATOM   802  C C   . ILE A 1 115 ? 39.362 46.638 10.006  1.00 21.72 ? 145 ILE A C   1 
ATOM   803  O O   . ILE A 1 115 ? 39.618 46.001 8.984   1.00 22.30 ? 145 ILE A O   1 
ATOM   804  C CB  . ILE A 1 115 ? 37.301 47.856 9.281   1.00 21.80 ? 145 ILE A CB  1 
ATOM   805  C CG1 . ILE A 1 115 ? 36.531 49.182 9.414   1.00 21.86 ? 145 ILE A CG1 1 
ATOM   806  C CG2 . ILE A 1 115 ? 36.526 46.698 9.974   1.00 21.33 ? 145 ILE A CG2 1 
ATOM   807  C CD1 . ILE A 1 115 ? 35.235 49.239 8.619   1.00 19.09 ? 145 ILE A CD1 1 
ATOM   808  N N   . ALA A 1 116 ? 39.643 46.200 11.238  1.00 23.07 ? 146 ALA A N   1 
ATOM   809  C CA  . ALA A 1 116 ? 40.148 44.856 11.441  1.00 21.03 ? 146 ALA A CA  1 
ATOM   810  C C   . ALA A 1 116 ? 38.954 44.020 11.871  1.00 21.40 ? 146 ALA A C   1 
ATOM   811  O O   . ALA A 1 116 ? 38.185 44.430 12.756  1.00 22.15 ? 146 ALA A O   1 
ATOM   812  C CB  . ALA A 1 116 ? 41.239 44.835 12.519  1.00 19.84 ? 146 ALA A CB  1 
ATOM   813  N N   . THR A 1 117 ? 38.800 42.848 11.257  1.00 19.99 ? 147 THR A N   1 
ATOM   814  C CA  . THR A 1 117 ? 37.651 41.990 11.530  1.00 20.93 ? 147 THR A CA  1 
ATOM   815  C C   . THR A 1 117 ? 38.087 40.537 11.347  1.00 21.35 ? 147 THR A C   1 
ATOM   816  O O   . THR A 1 117 ? 39.115 40.271 10.717  1.00 21.30 ? 147 THR A O   1 
ATOM   817  C CB  . THR A 1 117 ? 36.420 42.385 10.603  1.00 20.41 ? 147 THR A CB  1 
ATOM   818  O OG1 . THR A 1 117 ? 35.235 41.663 11.021  1.00 20.56 ? 147 THR A OG1 1 
ATOM   819  C CG2 . THR A 1 117 ? 36.702 42.074 9.148   1.00 18.58 ? 147 THR A CG2 1 
ATOM   820  N N   . GLN A 1 118 ? 37.339 39.610 11.933  1.00 21.02 ? 148 GLN A N   1 
ATOM   821  C CA  . GLN A 1 118 ? 37.512 38.182 11.670  1.00 21.76 ? 148 GLN A CA  1 
ATOM   822  C C   . GLN A 1 118 ? 37.036 37.866 10.246  1.00 23.40 ? 148 GLN A C   1 
ATOM   823  O O   . GLN A 1 118 ? 36.205 38.605 9.675   1.00 23.60 ? 148 GLN A O   1 
ATOM   824  C CB  . GLN A 1 118 ? 36.712 37.366 12.695  1.00 21.72 ? 148 GLN A CB  1 
ATOM   825  C CG  . GLN A 1 118 ? 35.150 37.470 12.510  1.00 18.87 ? 148 GLN A CG  1 
ATOM   826  C CD  . GLN A 1 118 ? 34.334 36.748 13.574  1.00 22.13 ? 148 GLN A CD  1 
ATOM   827  O OE1 . GLN A 1 118 ? 34.835 36.382 14.634  1.00 20.26 ? 148 GLN A OE1 1 
ATOM   828  N NE2 . GLN A 1 118 ? 33.056 36.554 13.294  1.00 20.36 ? 148 GLN A NE2 1 
ATOM   829  N N   . GLY A 1 119 ? 37.533 36.773 9.671   1.00 22.38 ? 149 GLY A N   1 
ATOM   830  C CA  . GLY A 1 119 ? 36.950 36.245 8.424   1.00 23.59 ? 149 GLY A CA  1 
ATOM   831  C C   . GLY A 1 119 ? 35.470 35.933 8.658   1.00 24.07 ? 149 GLY A C   1 
ATOM   832  O O   . GLY A 1 119 ? 35.097 35.413 9.717   1.00 24.07 ? 149 GLY A O   1 
ATOM   833  N N   . PRO A 1 120 ? 34.603 36.262 7.688   1.00 24.01 ? 150 PRO A N   1 
ATOM   834  C CA  . PRO A 1 120 ? 33.159 35.971 7.861   1.00 24.88 ? 150 PRO A CA  1 
ATOM   835  C C   . PRO A 1 120 ? 32.837 34.499 8.172   1.00 24.50 ? 150 PRO A C   1 
ATOM   836  O O   . PRO A 1 120 ? 33.512 33.607 7.676   1.00 23.14 ? 150 PRO A O   1 
ATOM   837  C CB  . PRO A 1 120 ? 32.542 36.360 6.502   1.00 26.67 ? 150 PRO A CB  1 
ATOM   838  C CG  . PRO A 1 120 ? 33.546 37.201 5.821   1.00 24.09 ? 150 PRO A CG  1 
ATOM   839  C CD  . PRO A 1 120 ? 34.902 36.949 6.417   1.00 22.87 ? 150 PRO A CD  1 
ATOM   840  N N   . MET A 1 121 ? 31.834 34.264 9.016   1.00 24.89 ? 151 MET A N   1 
ATOM   841  C CA  . MET A 1 121 ? 31.298 32.914 9.235   1.00 28.46 ? 151 MET A CA  1 
ATOM   842  C C   . MET A 1 121 ? 30.138 32.713 8.249   1.00 27.00 ? 151 MET A C   1 
ATOM   843  O O   . MET A 1 121 ? 29.652 33.688 7.683   1.00 24.22 ? 151 MET A O   1 
ATOM   844  C CB  . MET A 1 121 ? 30.814 32.760 10.680  1.00 27.59 ? 151 MET A CB  1 
ATOM   845  C CG  . MET A 1 121 ? 31.893 33.053 11.741  1.00 30.32 ? 151 MET A CG  1 
ATOM   846  S SD  . MET A 1 121 ? 31.205 33.164 13.418  1.00 39.35 ? 151 MET A SD  1 
ATOM   847  C CE  . MET A 1 121 ? 31.103 31.432 13.786  1.00 47.39 ? 151 MET A CE  1 
ATOM   848  N N   . PRO A 1 122 ? 29.705 31.455 8.007   1.00 27.13 ? 152 PRO A N   1 
ATOM   849  C CA  . PRO A 1 122 ? 28.595 31.318 7.062   1.00 27.63 ? 152 PRO A CA  1 
ATOM   850  C C   . PRO A 1 122 ? 27.395 32.245 7.372   1.00 26.65 ? 152 PRO A C   1 
ATOM   851  O O   . PRO A 1 122 ? 26.782 32.782 6.450   1.00 30.55 ? 152 PRO A O   1 
ATOM   852  C CB  . PRO A 1 122 ? 28.234 29.830 7.175   1.00 27.00 ? 152 PRO A CB  1 
ATOM   853  C CG  . PRO A 1 122 ? 29.527 29.177 7.502   1.00 28.98 ? 152 PRO A CG  1 
ATOM   854  C CD  . PRO A 1 122 ? 30.191 30.139 8.467   1.00 27.27 ? 152 PRO A CD  1 
ATOM   855  N N   . ASN A 1 123 ? 27.104 32.454 8.656   1.00 25.91 ? 153 ASN A N   1 
ATOM   856  C CA  . ASN A 1 123 ? 25.997 33.303 9.093   1.00 26.17 ? 153 ASN A CA  1 
ATOM   857  C C   . ASN A 1 123 ? 26.302 34.805 9.214   1.00 25.68 ? 153 ASN A C   1 
ATOM   858  O O   . ASN A 1 123 ? 25.422 35.580 9.591   1.00 23.52 ? 153 ASN A O   1 
ATOM   859  C CB  . ASN A 1 123 ? 25.425 32.783 10.424  1.00 25.95 ? 153 ASN A CB  1 
ATOM   860  C CG  . ASN A 1 123 ? 26.435 32.850 11.558  1.00 29.44 ? 153 ASN A CG  1 
ATOM   861  O OD1 . ASN A 1 123 ? 27.557 32.369 11.428  1.00 27.81 ? 153 ASN A OD1 1 
ATOM   862  N ND2 . ASN A 1 123 ? 26.030 33.431 12.683  1.00 28.30 ? 153 ASN A ND2 1 
ATOM   863  N N   . THR A 1 124 ? 27.545 35.214 8.926   1.00 26.40 ? 154 THR A N   1 
ATOM   864  C CA  . THR A 1 124 ? 27.893 36.635 8.971   1.00 24.28 ? 154 THR A CA  1 
ATOM   865  C C   . THR A 1 124 ? 28.389 37.183 7.640   1.00 24.36 ? 154 THR A C   1 
ATOM   866  O O   . THR A 1 124 ? 28.866 38.320 7.586   1.00 22.95 ? 154 THR A O   1 
ATOM   867  C CB  . THR A 1 124 ? 28.949 36.978 10.071  1.00 23.60 ? 154 THR A CB  1 
ATOM   868  O OG1 . THR A 1 124 ? 30.233 36.447 9.714   1.00 26.40 ? 154 THR A OG1 1 
ATOM   869  C CG2 . THR A 1 124 ? 28.526 36.478 11.430  1.00 22.42 ? 154 THR A CG2 1 
ATOM   870  N N   . VAL A 1 125 ? 28.278 36.395 6.570   1.00 24.89 ? 155 VAL A N   1 
ATOM   871  C CA  . VAL A 1 125 ? 28.658 36.872 5.219   1.00 23.84 ? 155 VAL A CA  1 
ATOM   872  C C   . VAL A 1 125 ? 27.845 38.117 4.798   1.00 26.78 ? 155 VAL A C   1 
ATOM   873  O O   . VAL A 1 125 ? 28.409 39.094 4.277   1.00 25.34 ? 155 VAL A O   1 
ATOM   874  C CB  . VAL A 1 125 ? 28.540 35.740 4.149   1.00 25.12 ? 155 VAL A CB  1 
ATOM   875  C CG1 . VAL A 1 125 ? 28.730 36.283 2.734   1.00 24.05 ? 155 VAL A CG1 1 
ATOM   876  C CG2 . VAL A 1 125 ? 29.559 34.623 4.431   1.00 20.04 ? 155 VAL A CG2 1 
ATOM   877  N N   . SER A 1 126 ? 26.527 38.096 5.036   1.00 25.82 ? 156 SER A N   1 
ATOM   878  C CA  . SER A 1 126 ? 25.688 39.253 4.681   1.00 26.26 ? 156 SER A CA  1 
ATOM   879  C C   . SER A 1 126 ? 26.066 40.472 5.520   1.00 23.36 ? 156 SER A C   1 
ATOM   880  O O   . SER A 1 126 ? 26.132 41.570 4.995   1.00 21.60 ? 156 SER A O   1 
ATOM   881  C CB  . SER A 1 126 ? 24.187 38.939 4.839   1.00 29.15 ? 156 SER A CB  1 
ATOM   882  O OG  . SER A 1 126 ? 23.827 37.830 4.027   1.00 34.94 ? 156 SER A OG  1 
ATOM   883  N N   . ASP A 1 127 ? 26.300 40.263 6.822   1.00 22.85 ? 157 ASP A N   1 
ATOM   884  C CA  . ASP A 1 127 ? 26.798 41.307 7.722   1.00 22.12 ? 157 ASP A CA  1 
ATOM   885  C C   . ASP A 1 127 ? 28.105 41.940 7.199   1.00 22.04 ? 157 ASP A C   1 
ATOM   886  O O   . ASP A 1 127 ? 28.265 43.167 7.206   1.00 23.51 ? 157 ASP A O   1 
ATOM   887  C CB  . ASP A 1 127 ? 27.051 40.721 9.117   1.00 22.13 ? 157 ASP A CB  1 
ATOM   888  C CG  . ASP A 1 127 ? 25.781 40.289 9.821   1.00 24.96 ? 157 ASP A CG  1 
ATOM   889  O OD1 . ASP A 1 127 ? 24.708 40.786 9.476   1.00 24.18 ? 157 ASP A OD1 1 
ATOM   890  O OD2 . ASP A 1 127 ? 25.861 39.463 10.742  1.00 25.60 ? 157 ASP A OD2 1 
ATOM   891  N N   . PHE A 1 128 ? 29.051 41.090 6.801   1.00 22.64 ? 158 PHE A N   1 
ATOM   892  C CA  . PHE A 1 128 ? 30.314 41.536 6.210   1.00 22.40 ? 158 PHE A CA  1 
ATOM   893  C C   . PHE A 1 128 ? 30.107 42.449 4.986   1.00 22.55 ? 158 PHE A C   1 
ATOM   894  O O   . PHE A 1 128 ? 30.680 43.522 4.931   1.00 21.55 ? 158 PHE A O   1 
ATOM   895  C CB  . PHE A 1 128 ? 31.188 40.345 5.836   1.00 21.60 ? 158 PHE A CB  1 
ATOM   896  C CG  . PHE A 1 128 ? 32.520 40.727 5.222   1.00 25.45 ? 158 PHE A CG  1 
ATOM   897  C CD1 . PHE A 1 128 ? 33.628 40.965 6.036   1.00 21.38 ? 158 PHE A CD1 1 
ATOM   898  C CD2 . PHE A 1 128 ? 32.663 40.846 3.835   1.00 21.46 ? 158 PHE A CD2 1 
ATOM   899  C CE1 . PHE A 1 128 ? 34.866 41.303 5.482   1.00 23.23 ? 158 PHE A CE1 1 
ATOM   900  C CE2 . PHE A 1 128 ? 33.897 41.187 3.270   1.00 19.86 ? 158 PHE A CE2 1 
ATOM   901  C CZ  . PHE A 1 128 ? 35.002 41.426 4.101   1.00 21.88 ? 158 PHE A CZ  1 
ATOM   902  N N   . TRP A 1 129 ? 29.306 42.019 4.006   1.00 22.18 ? 159 TRP A N   1 
ATOM   903  C CA  . TRP A 1 129 ? 29.023 42.870 2.838   1.00 22.59 ? 159 TRP A CA  1 
ATOM   904  C C   . TRP A 1 129 ? 28.250 44.152 3.203   1.00 22.13 ? 159 TRP A C   1 
ATOM   905  O O   . TRP A 1 129 ? 28.498 45.216 2.629   1.00 23.01 ? 159 TRP A O   1 
ATOM   906  C CB  . TRP A 1 129 ? 28.339 42.076 1.705   1.00 23.71 ? 159 TRP A CB  1 
ATOM   907  C CG  . TRP A 1 129 ? 29.301 41.076 1.052   1.00 24.32 ? 159 TRP A CG  1 
ATOM   908  C CD1 . TRP A 1 129 ? 29.177 39.719 1.021   1.00 25.80 ? 159 TRP A CD1 1 
ATOM   909  C CD2 . TRP A 1 129 ? 30.534 41.383 0.372   1.00 22.44 ? 159 TRP A CD2 1 
ATOM   910  N NE1 . TRP A 1 129 ? 30.259 39.154 0.368   1.00 22.65 ? 159 TRP A NE1 1 
ATOM   911  C CE2 . TRP A 1 129 ? 31.098 40.155 -0.051  1.00 22.58 ? 159 TRP A CE2 1 
ATOM   912  C CE3 . TRP A 1 129 ? 31.215 42.582 0.079   1.00 20.97 ? 159 TRP A CE3 1 
ATOM   913  C CZ2 . TRP A 1 129 ? 32.318 40.083 -0.758  1.00 25.96 ? 159 TRP A CZ2 1 
ATOM   914  C CZ3 . TRP A 1 129 ? 32.428 42.515 -0.631  1.00 25.71 ? 159 TRP A CZ3 1 
ATOM   915  C CH2 . TRP A 1 129 ? 32.966 41.264 -1.040  1.00 25.32 ? 159 TRP A CH2 1 
ATOM   916  N N   . GLU A 1 130 ? 27.344 44.061 4.181   1.00 21.93 ? 160 GLU A N   1 
ATOM   917  C CA  . GLU A 1 130 ? 26.684 45.266 4.717   1.00 23.62 ? 160 GLU A CA  1 
ATOM   918  C C   . GLU A 1 130 ? 27.678 46.285 5.272   1.00 20.58 ? 160 GLU A C   1 
ATOM   919  O O   . GLU A 1 130 ? 27.516 47.486 5.086   1.00 20.33 ? 160 GLU A O   1 
ATOM   920  C CB  . GLU A 1 130 ? 25.718 44.910 5.849   1.00 24.91 ? 160 GLU A CB  1 
ATOM   921  C CG  . GLU A 1 130 ? 24.336 44.545 5.410   1.00 35.18 ? 160 GLU A CG  1 
ATOM   922  C CD  . GLU A 1 130 ? 23.410 44.307 6.598   1.00 44.01 ? 160 GLU A CD  1 
ATOM   923  O OE1 . GLU A 1 130 ? 22.729 43.257 6.604   1.00 51.05 ? 160 GLU A OE1 1 
ATOM   924  O OE2 . GLU A 1 130 ? 23.386 45.155 7.525   1.00 40.73 ? 160 GLU A OE2 1 
ATOM   925  N N   . MET A 1 131 ? 28.659 45.804 6.033   1.00 21.20 ? 161 MET A N   1 
ATOM   926  C CA  . MET A 1 131 ? 29.732 46.659 6.529   1.00 21.62 ? 161 MET A CA  1 
ATOM   927  C C   . MET A 1 131 ? 30.534 47.283 5.388   1.00 21.35 ? 161 MET A C   1 
ATOM   928  O O   . MET A 1 131 ? 30.837 48.472 5.426   1.00 23.06 ? 161 MET A O   1 
ATOM   929  C CB  . MET A 1 131 ? 30.684 45.861 7.429   1.00 21.22 ? 161 MET A CB  1 
ATOM   930  C CG  . MET A 1 131 ? 31.829 46.676 7.981   1.00 22.07 ? 161 MET A CG  1 
ATOM   931  S SD  . MET A 1 131 ? 32.804 45.736 9.179   1.00 24.40 ? 161 MET A SD  1 
ATOM   932  C CE  . MET A 1 131 ? 33.681 44.601 8.121   1.00 20.31 ? 161 MET A CE  1 
ATOM   933  N N   . VAL A 1 132 ? 30.899 46.473 4.401   1.00 20.80 ? 162 VAL A N   1 
ATOM   934  C CA  . VAL A 1 132 ? 31.643 46.954 3.221   1.00 20.48 ? 162 VAL A CA  1 
ATOM   935  C C   . VAL A 1 132 ? 30.840 48.106 2.553   1.00 22.04 ? 162 VAL A C   1 
ATOM   936  O O   . VAL A 1 132 ? 31.403 49.158 2.216   1.00 21.86 ? 162 VAL A O   1 
ATOM   937  C CB  . VAL A 1 132 ? 31.910 45.783 2.224   1.00 22.61 ? 162 VAL A CB  1 
ATOM   938  C CG1 . VAL A 1 132 ? 32.292 46.295 0.824   1.00 22.09 ? 162 VAL A CG1 1 
ATOM   939  C CG2 . VAL A 1 132 ? 33.033 44.840 2.740   1.00 20.79 ? 162 VAL A CG2 1 
ATOM   940  N N   . TRP A 1 133 ? 29.526 47.914 2.385   1.00 20.48 ? 163 TRP A N   1 
ATOM   941  C CA  . TRP A 1 133 ? 28.683 48.977 1.783   1.00 21.14 ? 163 TRP A CA  1 
ATOM   942  C C   . TRP A 1 133 ? 28.613 50.218 2.675   1.00 20.27 ? 163 TRP A C   1 
ATOM   943  O O   . TRP A 1 133 ? 28.920 51.331 2.244   1.00 21.62 ? 163 TRP A O   1 
ATOM   944  C CB  . TRP A 1 133 ? 27.251 48.480 1.520   1.00 18.24 ? 163 TRP A CB  1 
ATOM   945  C CG  . TRP A 1 133 ? 26.447 49.473 0.717   1.00 19.88 ? 163 TRP A CG  1 
ATOM   946  C CD1 . TRP A 1 133 ? 25.574 50.404 1.190   1.00 22.54 ? 163 TRP A CD1 1 
ATOM   947  C CD2 . TRP A 1 133 ? 26.470 49.622 -0.715  1.00 21.07 ? 163 TRP A CD2 1 
ATOM   948  N NE1 . TRP A 1 133 ? 25.044 51.139 0.134   1.00 19.88 ? 163 TRP A NE1 1 
ATOM   949  C CE2 . TRP A 1 133 ? 25.584 50.676 -1.041  1.00 23.42 ? 163 TRP A CE2 1 
ATOM   950  C CE3 . TRP A 1 133 ? 27.173 48.976 -1.747  1.00 20.09 ? 163 TRP A CE3 1 
ATOM   951  C CZ2 . TRP A 1 133 ? 25.350 51.080 -2.372  1.00 20.28 ? 163 TRP A CZ2 1 
ATOM   952  C CZ3 . TRP A 1 133 ? 26.951 49.376 -3.069  1.00 20.66 ? 163 TRP A CZ3 1 
ATOM   953  C CH2 . TRP A 1 133 ? 26.037 50.425 -3.363  1.00 18.80 ? 163 TRP A CH2 1 
ATOM   954  N N   . GLN A 1 134 ? 28.214 50.009 3.926   1.00 22.74 ? 164 GLN A N   1 
ATOM   955  C CA  . GLN A 1 134 ? 27.977 51.104 4.866   1.00 24.60 ? 164 GLN A CA  1 
ATOM   956  C C   . GLN A 1 134 ? 29.231 51.971 5.027   1.00 24.78 ? 164 GLN A C   1 
ATOM   957  O O   . GLN A 1 134 ? 29.148 53.197 5.120   1.00 21.75 ? 164 GLN A O   1 
ATOM   958  C CB  . GLN A 1 134 ? 27.526 50.541 6.219   1.00 24.55 ? 164 GLN A CB  1 
ATOM   959  C CG  . GLN A 1 134 ? 27.636 51.502 7.384   1.00 30.70 ? 164 GLN A CG  1 
ATOM   960  C CD  . GLN A 1 134 ? 27.272 50.839 8.698   1.00 26.95 ? 164 GLN A CD  1 
ATOM   961  O OE1 . GLN A 1 134 ? 26.136 50.412 8.881   1.00 29.27 ? 164 GLN A OE1 1 
ATOM   962  N NE2 . GLN A 1 134 ? 28.247 50.727 9.606   1.00 26.65 ? 164 GLN A NE2 1 
ATOM   963  N N   . GLU A 1 135 ? 30.388 51.316 5.045   1.00 23.78 ? 165 GLU A N   1 
ATOM   964  C CA  . GLU A 1 135 ? 31.652 51.998 5.319   1.00 24.29 ? 165 GLU A CA  1 
ATOM   965  C C   . GLU A 1 135 ? 32.369 52.477 4.064   1.00 24.95 ? 165 GLU A C   1 
ATOM   966  O O   . GLU A 1 135 ? 33.427 53.104 4.163   1.00 26.30 ? 165 GLU A O   1 
ATOM   967  C CB  . GLU A 1 135 ? 32.575 51.115 6.172   1.00 22.80 ? 165 GLU A CB  1 
ATOM   968  C CG  . GLU A 1 135 ? 31.997 50.777 7.535   1.00 22.09 ? 165 GLU A CG  1 
ATOM   969  C CD  . GLU A 1 135 ? 31.847 51.990 8.436   1.00 28.40 ? 165 GLU A CD  1 
ATOM   970  O OE1 . GLU A 1 135 ? 32.670 52.922 8.377   1.00 32.53 ? 165 GLU A OE1 1 
ATOM   971  O OE2 . GLU A 1 135 ? 30.874 52.020 9.199   1.00 32.93 ? 165 GLU A OE2 1 
ATOM   972  N N   . GLU A 1 136 ? 31.783 52.213 2.891   1.00 24.24 ? 166 GLU A N   1 
ATOM   973  C CA  . GLU A 1 136 ? 32.363 52.637 1.617   1.00 25.09 ? 166 GLU A CA  1 
ATOM   974  C C   . GLU A 1 136 ? 33.774 52.058 1.431   1.00 24.64 ? 166 GLU A C   1 
ATOM   975  O O   . GLU A 1 136 ? 34.700 52.736 0.983   1.00 22.81 ? 166 GLU A O   1 
ATOM   976  C CB  . GLU A 1 136 ? 32.335 54.164 1.478   1.00 26.59 ? 166 GLU A CB  1 
ATOM   977  C CG  . GLU A 1 136 ? 30.921 54.730 1.566   1.00 32.34 ? 166 GLU A CG  1 
ATOM   978  C CD  . GLU A 1 136 ? 30.854 56.253 1.425   1.00 33.30 ? 166 GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 136 ? 31.537 56.805 0.537   1.00 51.65 ? 166 GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 136 ? 30.098 56.887 2.191   1.00 44.60 ? 166 GLU A OE2 1 
ATOM   981  N N   . VAL A 1 137 ? 33.910 50.780 1.783   1.00 23.10 ? 167 VAL A N   1 
ATOM   982  C CA  . VAL A 1 137 ? 35.160 50.044 1.619   1.00 23.01 ? 167 VAL A CA  1 
ATOM   983  C C   . VAL A 1 137 ? 35.399 49.795 0.125   1.00 24.25 ? 167 VAL A C   1 
ATOM   984  O O   . VAL A 1 137 ? 34.492 49.373 -0.586  1.00 25.63 ? 167 VAL A O   1 
ATOM   985  C CB  . VAL A 1 137 ? 35.095 48.717 2.416   1.00 19.24 ? 167 VAL A CB  1 
ATOM   986  C CG1 . VAL A 1 137 ? 36.263 47.769 2.068   1.00 21.28 ? 167 VAL A CG1 1 
ATOM   987  C CG2 . VAL A 1 137 ? 35.012 49.026 3.942   1.00 19.02 ? 167 VAL A CG2 1 
ATOM   988  N N   . SER A 1 138 ? 36.613 50.083 -0.338  1.00 24.20 ? 168 SER A N   1 
ATOM   989  C CA  . SER A 1 138 ? 37.017 49.770 -1.708  1.00 22.06 ? 168 SER A CA  1 
ATOM   990  C C   . SER A 1 138 ? 38.225 48.812 -1.761  1.00 22.58 ? 168 SER A C   1 
ATOM   991  O O   . SER A 1 138 ? 38.630 48.380 -2.836  1.00 20.42 ? 168 SER A O   1 
ATOM   992  C CB  . SER A 1 138 ? 37.314 51.061 -2.468  1.00 25.01 ? 168 SER A CB  1 
ATOM   993  O OG  . SER A 1 138 ? 38.375 51.741 -1.842  1.00 27.37 ? 168 SER A OG  1 
ATOM   994  N N   . LEU A 1 139 ? 38.777 48.454 -0.598  1.00 22.26 ? 169 LEU A N   1 
ATOM   995  C CA  . LEU A 1 139 ? 39.909 47.509 -0.559  1.00 22.98 ? 169 LEU A CA  1 
ATOM   996  C C   . LEU A 1 139 ? 39.791 46.548 0.622   1.00 21.95 ? 169 LEU A C   1 
ATOM   997  O O   . LEU A 1 139 ? 39.556 46.980 1.761   1.00 21.56 ? 169 LEU A O   1 
ATOM   998  C CB  . LEU A 1 139 ? 41.244 48.265 -0.521  1.00 22.86 ? 169 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 139 ? 42.518 47.411 -0.436  1.00 27.97 ? 169 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 139 ? 42.730 46.592 -1.726  1.00 25.28 ? 169 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 139 ? 43.705 48.326 -0.185  1.00 24.72 ? 169 LEU A CD2 1 
ATOM   1002 N N   . ILE A 1 140 ? 39.910 45.247 0.332   1.00 21.34 ? 170 ILE A N   1 
ATOM   1003 C CA  . ILE A 1 140 ? 39.884 44.195 1.359   1.00 21.34 ? 170 ILE A CA  1 
ATOM   1004 C C   . ILE A 1 140 ? 41.180 43.417 1.236   1.00 22.19 ? 170 ILE A C   1 
ATOM   1005 O O   . ILE A 1 140 ? 41.554 43.004 0.130   1.00 21.40 ? 170 ILE A O   1 
ATOM   1006 C CB  . ILE A 1 140 ? 38.673 43.179 1.197   1.00 20.57 ? 170 ILE A CB  1 
ATOM   1007 C CG1 . ILE A 1 140 ? 37.315 43.897 1.223   1.00 19.89 ? 170 ILE A CG1 1 
ATOM   1008 C CG2 . ILE A 1 140 ? 38.724 42.042 2.271   1.00 19.77 ? 170 ILE A CG2 1 
ATOM   1009 C CD1 . ILE A 1 140 ? 36.162 43.043 0.592   1.00 21.13 ? 170 ILE A CD1 1 
ATOM   1010 N N   . VAL A 1 141 ? 41.848 43.230 2.374   1.00 21.56 ? 171 VAL A N   1 
ATOM   1011 C CA  . VAL A 1 141 ? 43.082 42.452 2.469   1.00 20.49 ? 171 VAL A CA  1 
ATOM   1012 C C   . VAL A 1 141 ? 42.769 41.228 3.314   1.00 21.96 ? 171 VAL A C   1 
ATOM   1013 O O   . VAL A 1 141 ? 42.393 41.345 4.481   1.00 20.78 ? 171 VAL A O   1 
ATOM   1014 C CB  . VAL A 1 141 ? 44.227 43.292 3.122   1.00 20.34 ? 171 VAL A CB  1 
ATOM   1015 C CG1 . VAL A 1 141 ? 45.481 42.473 3.273   1.00 20.05 ? 171 VAL A CG1 1 
ATOM   1016 C CG2 . VAL A 1 141 ? 44.504 44.574 2.293   1.00 21.04 ? 171 VAL A CG2 1 
ATOM   1017 N N   . MET A 1 142 ? 42.898 40.056 2.712   1.00 21.68 ? 172 MET A N   1 
ATOM   1018 C CA  . MET A 1 142 ? 42.610 38.811 3.398   1.00 23.60 ? 172 MET A CA  1 
ATOM   1019 C C   . MET A 1 142 ? 43.921 38.049 3.647   1.00 24.36 ? 172 MET A C   1 
ATOM   1020 O O   . MET A 1 142 ? 44.684 37.806 2.710   1.00 22.56 ? 172 MET A O   1 
ATOM   1021 C CB  . MET A 1 142 ? 41.642 37.988 2.534   1.00 23.69 ? 172 MET A CB  1 
ATOM   1022 C CG  . MET A 1 142 ? 41.451 36.565 2.995   1.00 26.90 ? 172 MET A CG  1 
ATOM   1023 S SD  . MET A 1 142 ? 40.116 35.791 2.077   1.00 27.73 ? 172 MET A SD  1 
ATOM   1024 C CE  . MET A 1 142 ? 40.377 34.100 2.586   1.00 27.63 ? 172 MET A CE  1 
ATOM   1025 N N   . LEU A 1 143 ? 44.182 37.689 4.906   1.00 20.87 ? 173 LEU A N   1 
ATOM   1026 C CA  . LEU A 1 143 ? 45.402 36.978 5.278   1.00 20.67 ? 173 LEU A CA  1 
ATOM   1027 C C   . LEU A 1 143 ? 45.040 35.568 5.723   1.00 21.59 ? 173 LEU A C   1 
ATOM   1028 O O   . LEU A 1 143 ? 44.214 35.384 6.628   1.00 21.77 ? 173 LEU A O   1 
ATOM   1029 C CB  . LEU A 1 143 ? 46.121 37.734 6.414   1.00 19.64 ? 173 LEU A CB  1 
ATOM   1030 C CG  . LEU A 1 143 ? 46.207 39.243 6.106   1.00 23.20 ? 173 LEU A CG  1 
ATOM   1031 C CD1 . LEU A 1 143 ? 46.506 40.075 7.336   1.00 26.90 ? 173 LEU A CD1 1 
ATOM   1032 C CD2 . LEU A 1 143 ? 47.221 39.507 4.958   1.00 17.32 ? 173 LEU A CD2 1 
ATOM   1033 N N   . THR A 1 144 ? 45.675 34.572 5.112   1.00 21.86 ? 174 THR A N   1 
ATOM   1034 C CA  . THR A 1 144 ? 45.247 33.188 5.306   1.00 22.63 ? 174 THR A CA  1 
ATOM   1035 C C   . THR A 1 144 ? 46.388 32.198 5.043   1.00 23.71 ? 174 THR A C   1 
ATOM   1036 O O   . THR A 1 144 ? 47.440 32.584 4.544   1.00 22.62 ? 174 THR A O   1 
ATOM   1037 C CB  . THR A 1 144 ? 43.987 32.867 4.424   1.00 26.75 ? 174 THR A CB  1 
ATOM   1038 O OG1 . THR A 1 144 ? 43.370 31.661 4.879   1.00 28.45 ? 174 THR A OG1 1 
ATOM   1039 C CG2 . THR A 1 144 ? 44.340 32.725 2.945   1.00 21.88 ? 174 THR A CG2 1 
ATOM   1040 N N   . GLN A 1 145 ? 46.179 30.938 5.414   1.00 27.37 ? 175 GLN A N   1 
ATOM   1041 C CA  . GLN A 1 145 ? 47.028 29.818 4.961   1.00 31.88 ? 175 GLN A CA  1 
ATOM   1042 C C   . GLN A 1 145 ? 46.191 28.863 4.095   1.00 35.70 ? 175 GLN A C   1 
ATOM   1043 O O   . GLN A 1 145 ? 45.001 28.703 4.333   1.00 37.59 ? 175 GLN A O   1 
ATOM   1044 C CB  . GLN A 1 145 ? 47.613 29.070 6.172   1.00 31.39 ? 175 GLN A CB  1 
ATOM   1045 C CG  . GLN A 1 145 ? 48.480 27.777 5.861   1.00 33.76 ? 175 GLN A CG  1 
ATOM   1046 C CD  A GLN A 1 145 ? 49.680 28.020 4.941   0.75 42.31 ? 175 GLN A CD  1 
ATOM   1047 C CD  B GLN A 1 145 ? 48.167 26.607 6.769   0.25 34.07 ? 175 GLN A CD  1 
ATOM   1048 O OE1 A GLN A 1 145 ? 50.492 28.912 5.168   0.75 44.37 ? 175 GLN A OE1 1 
ATOM   1049 O OE1 B GLN A 1 145 ? 47.059 26.501 7.299   0.25 38.01 ? 175 GLN A OE1 1 
ATOM   1050 N NE2 A GLN A 1 145 ? 49.802 27.197 3.906   0.75 50.25 ? 175 GLN A NE2 1 
ATOM   1051 N NE2 B GLN A 1 145 ? 49.139 25.711 6.942   0.25 39.42 ? 175 GLN A NE2 1 
ATOM   1052 N N   . LEU A 1 146 ? 46.809 28.244 3.091   1.00 41.97 ? 176 LEU A N   1 
ATOM   1053 C CA  . LEU A 1 146 ? 46.178 27.166 2.284   1.00 45.81 ? 176 LEU A CA  1 
ATOM   1054 C C   . LEU A 1 146 ? 45.482 26.086 3.115   1.00 47.50 ? 176 LEU A C   1 
ATOM   1055 O O   . LEU A 1 146 ? 44.260 25.920 3.024   1.00 50.19 ? 176 LEU A O   1 
ATOM   1056 C CB  . LEU A 1 146 ? 47.212 26.492 1.369   1.00 45.99 ? 176 LEU A CB  1 
ATOM   1057 N N   . VAL A 1 154 ? 35.614 31.088 5.068   1.00 54.79 ? 184 VAL A N   1 
ATOM   1058 C CA  . VAL A 1 154 ? 34.624 30.831 4.004   1.00 53.75 ? 184 VAL A CA  1 
ATOM   1059 C C   . VAL A 1 154 ? 34.921 31.612 2.707   1.00 52.53 ? 184 VAL A C   1 
ATOM   1060 O O   . VAL A 1 154 ? 35.619 32.632 2.738   1.00 52.17 ? 184 VAL A O   1 
ATOM   1061 C CB  . VAL A 1 154 ? 33.148 31.081 4.480   1.00 54.75 ? 184 VAL A CB  1 
ATOM   1062 C CG1 . VAL A 1 154 ? 32.902 30.448 5.852   1.00 55.59 ? 184 VAL A CG1 1 
ATOM   1063 C CG2 . VAL A 1 154 ? 32.797 32.564 4.490   1.00 51.57 ? 184 VAL A CG2 1 
ATOM   1064 N N   . HIS A 1 155 ? 34.415 31.107 1.578   1.00 51.34 ? 185 HIS A N   1 
ATOM   1065 C CA  . HIS A 1 155 ? 34.479 31.815 0.292   1.00 50.21 ? 185 HIS A CA  1 
ATOM   1066 C C   . HIS A 1 155 ? 33.280 32.754 0.199   1.00 45.19 ? 185 HIS A C   1 
ATOM   1067 O O   . HIS A 1 155 ? 32.236 32.398 -0.345  1.00 45.81 ? 185 HIS A O   1 
ATOM   1068 C CB  . HIS A 1 155 ? 34.465 30.835 -0.891  1.00 53.39 ? 185 HIS A CB  1 
ATOM   1069 C CG  . HIS A 1 155 ? 35.819 30.308 -1.265  1.00 66.13 ? 185 HIS A CG  1 
ATOM   1070 N ND1 . HIS A 1 155 ? 36.362 29.168 -0.700  1.00 76.07 ? 185 HIS A ND1 1 
ATOM   1071 C CD2 . HIS A 1 155 ? 36.735 30.758 -2.159  1.00 74.79 ? 185 HIS A CD2 1 
ATOM   1072 C CE1 . HIS A 1 155 ? 37.556 28.945 -1.222  1.00 78.84 ? 185 HIS A CE1 1 
ATOM   1073 N NE2 . HIS A 1 155 ? 37.807 29.896 -2.109  1.00 80.38 ? 185 HIS A NE2 1 
ATOM   1074 N N   . TYR A 1 156 ? 33.441 33.954 0.742   1.00 38.27 ? 186 TYR A N   1 
ATOM   1075 C CA  . TYR A 1 156 ? 32.348 34.906 0.851   1.00 34.83 ? 186 TYR A CA  1 
ATOM   1076 C C   . TYR A 1 156 ? 32.218 35.780 -0.407  1.00 33.63 ? 186 TYR A C   1 
ATOM   1077 O O   . TYR A 1 156 ? 31.352 36.647 -0.474  1.00 32.93 ? 186 TYR A O   1 
ATOM   1078 C CB  . TYR A 1 156 ? 32.538 35.767 2.106   1.00 32.71 ? 186 TYR A CB  1 
ATOM   1079 C CG  . TYR A 1 156 ? 33.825 36.570 2.097   1.00 28.60 ? 186 TYR A CG  1 
ATOM   1080 C CD1 . TYR A 1 156 ? 34.974 36.092 2.736   1.00 28.69 ? 186 TYR A CD1 1 
ATOM   1081 C CD2 . TYR A 1 156 ? 33.898 37.794 1.434   1.00 25.49 ? 186 TYR A CD2 1 
ATOM   1082 C CE1 . TYR A 1 156 ? 36.169 36.836 2.730   1.00 26.27 ? 186 TYR A CE1 1 
ATOM   1083 C CE2 . TYR A 1 156 ? 35.087 38.541 1.409   1.00 25.61 ? 186 TYR A CE2 1 
ATOM   1084 C CZ  . TYR A 1 156 ? 36.209 38.053 2.059   1.00 27.09 ? 186 TYR A CZ  1 
ATOM   1085 O OH  . TYR A 1 156 ? 37.376 38.780 2.042   1.00 27.35 ? 186 TYR A OH  1 
ATOM   1086 N N   . TRP A 1 157 ? 33.096 35.558 -1.383  1.00 32.58 ? 187 TRP A N   1 
ATOM   1087 C CA  . TRP A 1 157 ? 33.029 36.223 -2.686  1.00 32.61 ? 187 TRP A CA  1 
ATOM   1088 C C   . TRP A 1 157 ? 32.642 35.146 -3.721  1.00 33.87 ? 187 TRP A C   1 
ATOM   1089 O O   . TRP A 1 157 ? 32.880 33.949 -3.494  1.00 33.71 ? 187 TRP A O   1 
ATOM   1090 C CB  . TRP A 1 157 ? 34.374 36.887 -3.035  1.00 32.87 ? 187 TRP A CB  1 
ATOM   1091 C CG  . TRP A 1 157 ? 35.492 35.888 -3.174  1.00 32.36 ? 187 TRP A CG  1 
ATOM   1092 C CD1 . TRP A 1 157 ? 35.871 35.232 -4.319  1.00 36.02 ? 187 TRP A CD1 1 
ATOM   1093 C CD2 . TRP A 1 157 ? 36.329 35.379 -2.126  1.00 35.10 ? 187 TRP A CD2 1 
ATOM   1094 N NE1 . TRP A 1 157 ? 36.898 34.355 -4.047  1.00 32.34 ? 187 TRP A NE1 1 
ATOM   1095 C CE2 . TRP A 1 157 ? 37.204 34.429 -2.711  1.00 34.56 ? 187 TRP A CE2 1 
ATOM   1096 C CE3 . TRP A 1 157 ? 36.430 35.633 -0.752  1.00 32.14 ? 187 TRP A CE3 1 
ATOM   1097 C CZ2 . TRP A 1 157 ? 38.167 33.742 -1.968  1.00 30.06 ? 187 TRP A CZ2 1 
ATOM   1098 C CZ3 . TRP A 1 157 ? 37.375 34.943 -0.017  1.00 32.16 ? 187 TRP A CZ3 1 
ATOM   1099 C CH2 . TRP A 1 157 ? 38.234 34.006 -0.627  1.00 33.59 ? 187 TRP A CH2 1 
ATOM   1100 N N   . PRO A 1 158 ? 32.034 35.554 -4.847  1.00 33.66 ? 188 PRO A N   1 
ATOM   1101 C CA  . PRO A 1 158 ? 31.538 34.547 -5.777  1.00 34.17 ? 188 PRO A CA  1 
ATOM   1102 C C   . PRO A 1 158 ? 32.559 34.091 -6.818  1.00 34.11 ? 188 PRO A C   1 
ATOM   1103 O O   . PRO A 1 158 ? 33.582 34.747 -7.035  1.00 33.59 ? 188 PRO A O   1 
ATOM   1104 C CB  . PRO A 1 158 ? 30.401 35.288 -6.476  1.00 33.47 ? 188 PRO A CB  1 
ATOM   1105 C CG  . PRO A 1 158 ? 30.906 36.675 -6.567  1.00 33.46 ? 188 PRO A CG  1 
ATOM   1106 C CD  . PRO A 1 158 ? 31.727 36.918 -5.323  1.00 33.70 ? 188 PRO A CD  1 
ATOM   1107 N N   . THR A 1 159 ? 32.250 32.979 -7.472  1.00 37.00 ? 189 THR A N   1 
ATOM   1108 C CA  . THR A 1 159 ? 33.012 32.522 -8.629  1.00 38.93 ? 189 THR A CA  1 
ATOM   1109 C C   . THR A 1 159 ? 32.772 33.447 -9.839  1.00 38.13 ? 189 THR A C   1 
ATOM   1110 O O   . THR A 1 159 ? 33.725 33.853 -10.516 1.00 37.41 ? 189 THR A O   1 
ATOM   1111 C CB  . THR A 1 159 ? 32.695 31.027 -8.930  1.00 40.90 ? 189 THR A CB  1 
ATOM   1112 O OG1 . THR A 1 159 ? 33.457 30.209 -8.030  1.00 44.22 ? 189 THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 159 ? 33.034 30.644 -10.370 1.00 38.90 ? 189 THR A CG2 1 
ATOM   1114 N N   . GLU A 1 160 ? 31.508 33.788 -10.092 1.00 37.30 ? 190 GLU A N   1 
ATOM   1115 C CA  . GLU A 1 160 ? 31.154 34.739 -11.143 1.00 38.16 ? 190 GLU A CA  1 
ATOM   1116 C C   . GLU A 1 160 ? 30.276 35.881 -10.596 1.00 36.26 ? 190 GLU A C   1 
ATOM   1117 O O   . GLU A 1 160 ? 30.653 37.055 -10.652 1.00 34.11 ? 190 GLU A O   1 
ATOM   1118 C CB  . GLU A 1 160 ? 30.472 34.015 -12.326 1.00 37.62 ? 190 GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 160 ? 29.683 34.948 -13.271 1.00 44.16 ? 190 GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 160 ? 29.039 34.217 -14.453 1.00 43.89 ? 190 GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 160 ? 27.861 34.524 -14.771 1.00 49.61 ? 190 GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 160 ? 29.711 33.352 -15.066 1.00 53.61 ? 190 GLU A OE2 1 
ATOM   1123 N N   . GLU A 1 161 ? 29.113 35.518 -10.064 1.00 34.54 ? 191 GLU A N   1 
ATOM   1124 C CA  . GLU A 1 161 ? 28.117 36.467 -9.611  1.00 36.19 ? 191 GLU A CA  1 
ATOM   1125 C C   . GLU A 1 161 ? 27.269 35.787 -8.550  1.00 35.99 ? 191 GLU A C   1 
ATOM   1126 O O   . GLU A 1 161 ? 26.889 34.626 -8.705  1.00 37.72 ? 191 GLU A O   1 
ATOM   1127 C CB  . GLU A 1 161 ? 27.235 36.906 -10.789 1.00 35.35 ? 191 GLU A CB  1 
ATOM   1128 C CG  . GLU A 1 161 ? 26.068 37.817 -10.430 1.00 41.98 ? 191 GLU A CG  1 
ATOM   1129 C CD  . GLU A 1 161 ? 25.524 38.555 -11.643 1.00 49.80 ? 191 GLU A CD  1 
ATOM   1130 O OE1 . GLU A 1 161 ? 25.547 37.982 -12.754 1.00 60.36 ? 191 GLU A OE1 1 
ATOM   1131 O OE2 . GLU A 1 161 ? 25.080 39.713 -11.501 1.00 54.25 ? 191 GLU A OE2 1 
ATOM   1132 N N   . GLU A 1 162 ? 26.988 36.501 -7.469  1.00 33.53 ? 192 GLU A N   1 
ATOM   1133 C CA  . GLU A 1 162 ? 26.103 35.993 -6.429  1.00 34.73 ? 192 GLU A CA  1 
ATOM   1134 C C   . GLU A 1 162 ? 25.479 37.146 -5.654  1.00 33.58 ? 192 GLU A C   1 
ATOM   1135 O O   . GLU A 1 162 ? 26.023 38.250 -5.613  1.00 32.84 ? 192 GLU A O   1 
ATOM   1136 C CB  . GLU A 1 162 ? 26.857 35.005 -5.513  1.00 36.58 ? 192 GLU A CB  1 
ATOM   1137 C CG  . GLU A 1 162 ? 26.280 34.783 -4.112  1.00 47.11 ? 192 GLU A CG  1 
ATOM   1138 C CD  . GLU A 1 162 ? 25.124 33.779 -4.021  1.00 63.42 ? 192 GLU A CD  1 
ATOM   1139 O OE1 . GLU A 1 162 ? 24.959 33.193 -2.915  1.00 67.11 ? 192 GLU A OE1 1 
ATOM   1140 O OE2 . GLU A 1 162 ? 24.382 33.586 -5.019  1.00 65.10 ? 192 GLU A OE2 1 
ATOM   1141 N N   . THR A 1 163 ? 24.327 36.880 -5.055  1.00 33.41 ? 193 THR A N   1 
ATOM   1142 C CA  . THR A 1 163 ? 23.627 37.856 -4.247  1.00 35.77 ? 193 THR A CA  1 
ATOM   1143 C C   . THR A 1 163 ? 23.804 37.510 -2.763  1.00 35.52 ? 193 THR A C   1 
ATOM   1144 O O   . THR A 1 163 ? 23.612 36.361 -2.366  1.00 36.57 ? 193 THR A O   1 
ATOM   1145 C CB  . THR A 1 163 ? 22.141 37.897 -4.661  1.00 36.57 ? 193 THR A CB  1 
ATOM   1146 O OG1 . THR A 1 163 ? 22.041 38.493 -5.961  1.00 43.04 ? 193 THR A OG1 1 
ATOM   1147 C CG2 . THR A 1 163 ? 21.308 38.709 -3.685  1.00 42.84 ? 193 THR A CG2 1 
ATOM   1148 N N   . TYR A 1 164 ? 24.209 38.494 -1.959  1.00 32.40 ? 194 TYR A N   1 
ATOM   1149 C CA  . TYR A 1 164 ? 24.328 38.335 -0.508  1.00 30.53 ? 194 TYR A CA  1 
ATOM   1150 C C   . TYR A 1 164 ? 23.457 39.363 0.188   1.00 31.63 ? 194 TYR A C   1 
ATOM   1151 O O   . TYR A 1 164 ? 23.803 40.545 0.251   1.00 32.08 ? 194 TYR A O   1 
ATOM   1152 C CB  . TYR A 1 164 ? 25.781 38.500 -0.051  1.00 29.06 ? 194 TYR A CB  1 
ATOM   1153 C CG  . TYR A 1 164 ? 26.758 37.622 -0.800  1.00 28.24 ? 194 TYR A CG  1 
ATOM   1154 C CD1 . TYR A 1 164 ? 27.103 36.366 -0.317  1.00 30.74 ? 194 TYR A CD1 1 
ATOM   1155 C CD2 . TYR A 1 164 ? 27.314 38.039 -2.007  1.00 32.52 ? 194 TYR A CD2 1 
ATOM   1156 C CE1 . TYR A 1 164 ? 27.997 35.550 -1.003  1.00 30.18 ? 194 TYR A CE1 1 
ATOM   1157 C CE2 . TYR A 1 164 ? 28.205 37.239 -2.699  1.00 29.56 ? 194 TYR A CE2 1 
ATOM   1158 C CZ  . TYR A 1 164 ? 28.539 35.996 -2.184  1.00 28.30 ? 194 TYR A CZ  1 
ATOM   1159 O OH  . TYR A 1 164 ? 29.411 35.204 -2.864  1.00 29.67 ? 194 TYR A OH  1 
ATOM   1160 N N   . GLY A 1 165 ? 22.328 38.910 0.717   1.00 32.87 ? 195 GLY A N   1 
ATOM   1161 C CA  . GLY A 1 165 ? 21.327 39.818 1.242   1.00 32.29 ? 195 GLY A CA  1 
ATOM   1162 C C   . GLY A 1 165 ? 20.866 40.694 0.089   1.00 33.23 ? 195 GLY A C   1 
ATOM   1163 O O   . GLY A 1 165 ? 20.539 40.183 -0.989  1.00 33.87 ? 195 GLY A O   1 
ATOM   1164 N N   . PRO A 1 166 ? 20.857 42.025 0.297   1.00 32.58 ? 196 PRO A N   1 
ATOM   1165 C CA  . PRO A 1 166 ? 20.434 42.951 -0.747  1.00 31.78 ? 196 PRO A CA  1 
ATOM   1166 C C   . PRO A 1 166 ? 21.510 43.278 -1.791  1.00 30.38 ? 196 PRO A C   1 
ATOM   1167 O O   . PRO A 1 166 ? 21.234 44.025 -2.738  1.00 29.67 ? 196 PRO A O   1 
ATOM   1168 C CB  . PRO A 1 166 ? 20.084 44.209 0.048   1.00 32.99 ? 196 PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 166 ? 21.045 44.199 1.167   1.00 30.77 ? 196 PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 166 ? 21.227 42.733 1.537   1.00 32.66 ? 196 PRO A CD  1 
ATOM   1171 N N   . PHE A 1 167 ? 22.718 42.748 -1.615  1.00 27.74 ? 197 PHE A N   1 
ATOM   1172 C CA  . PHE A 1 167 ? 23.854 43.097 -2.476  1.00 28.79 ? 197 PHE A CA  1 
ATOM   1173 C C   . PHE A 1 167 ? 24.123 42.087 -3.572  1.00 30.26 ? 197 PHE A C   1 
ATOM   1174 O O   . PHE A 1 167 ? 24.119 40.878 -3.322  1.00 31.73 ? 197 PHE A O   1 
ATOM   1175 C CB  . PHE A 1 167 ? 25.130 43.332 -1.649  1.00 25.70 ? 197 PHE A CB  1 
ATOM   1176 C CG  . PHE A 1 167 ? 24.944 44.328 -0.561  1.00 27.97 ? 197 PHE A CG  1 
ATOM   1177 C CD1 . PHE A 1 167 ? 24.744 45.676 -0.863  1.00 23.78 ? 197 PHE A CD1 1 
ATOM   1178 C CD2 . PHE A 1 167 ? 24.926 43.923 0.765   1.00 23.76 ? 197 PHE A CD2 1 
ATOM   1179 C CE1 . PHE A 1 167 ? 24.540 46.603 0.141   1.00 29.31 ? 197 PHE A CE1 1 
ATOM   1180 C CE2 . PHE A 1 167 ? 24.694 44.846 1.786   1.00 25.58 ? 197 PHE A CE2 1 
ATOM   1181 C CZ  . PHE A 1 167 ? 24.517 46.184 1.481   1.00 28.94 ? 197 PHE A CZ  1 
ATOM   1182 N N   . GLN A 1 168 ? 24.361 42.586 -4.784  1.00 29.43 ? 198 GLN A N   1 
ATOM   1183 C CA  . GLN A 1 168 ? 24.874 41.745 -5.845  1.00 28.83 ? 198 GLN A CA  1 
ATOM   1184 C C   . GLN A 1 168 ? 26.375 41.927 -6.023  1.00 27.57 ? 198 GLN A C   1 
ATOM   1185 O O   . GLN A 1 168 ? 26.858 43.043 -6.245  1.00 25.92 ? 198 GLN A O   1 
ATOM   1186 C CB  . GLN A 1 168 ? 24.165 42.017 -7.158  1.00 29.53 ? 198 GLN A CB  1 
ATOM   1187 C CG  . GLN A 1 168 ? 24.764 41.229 -8.288  1.00 36.67 ? 198 GLN A CG  1 
ATOM   1188 C CD  . GLN A 1 168 ? 23.847 41.134 -9.459  1.00 47.87 ? 198 GLN A CD  1 
ATOM   1189 O OE1 . GLN A 1 168 ? 23.141 40.137 -9.615  1.00 55.75 ? 198 GLN A OE1 1 
ATOM   1190 N NE2 . GLN A 1 168 ? 23.841 42.167 -10.302 1.00 49.77 ? 198 GLN A NE2 1 
ATOM   1191 N N   . ILE A 1 169 ? 27.108 40.818 -5.952  1.00 26.60 ? 199 ILE A N   1 
ATOM   1192 C CA  . ILE A 1 169 ? 28.561 40.856 -6.059  1.00 26.28 ? 199 ILE A CA  1 
ATOM   1193 C C   . ILE A 1 169 ? 28.983 40.151 -7.335  1.00 26.68 ? 199 ILE A C   1 
ATOM   1194 O O   . ILE A 1 169 ? 28.542 39.027 -7.608  1.00 25.63 ? 199 ILE A O   1 
ATOM   1195 C CB  . ILE A 1 169 ? 29.254 40.210 -4.828  1.00 27.34 ? 199 ILE A CB  1 
ATOM   1196 C CG1 . ILE A 1 169 ? 28.674 40.763 -3.513  1.00 31.62 ? 199 ILE A CG1 1 
ATOM   1197 C CG2 . ILE A 1 169 ? 30.796 40.347 -4.912  1.00 27.80 ? 199 ILE A CG2 1 
ATOM   1198 C CD1 . ILE A 1 169 ? 29.354 41.983 -2.986  1.00 34.98 ? 199 ILE A CD1 1 
ATOM   1199 N N   . ARG A 1 170 ? 29.838 40.811 -8.109  1.00 26.28 ? 200 ARG A N   1 
ATOM   1200 C CA  . ARG A 1 170 ? 30.373 40.237 -9.343  1.00 29.48 ? 200 ARG A CA  1 
ATOM   1201 C C   . ARG A 1 170 ? 31.889 40.324 -9.346  1.00 29.80 ? 200 ARG A C   1 
ATOM   1202 O O   . ARG A 1 170 ? 32.445 41.291 -8.847  1.00 29.68 ? 200 ARG A O   1 
ATOM   1203 C CB  . ARG A 1 170 ? 29.828 40.986 -10.567 1.00 28.22 ? 200 ARG A CB  1 
ATOM   1204 C CG  . ARG A 1 170 ? 28.347 40.755 -10.839 1.00 33.44 ? 200 ARG A CG  1 
ATOM   1205 C CD  . ARG A 1 170 ? 27.836 41.565 -12.048 1.00 32.01 ? 200 ARG A CD  1 
ATOM   1206 N N   . ILE A 1 171 ? 32.559 39.321 -9.912  1.00 30.58 ? 201 ILE A N   1 
ATOM   1207 C CA  . ILE A 1 171 ? 33.997 39.426 -10.136 1.00 31.04 ? 201 ILE A CA  1 
ATOM   1208 C C   . ILE A 1 171 ? 34.284 39.870 -11.574 1.00 30.87 ? 201 ILE A C   1 
ATOM   1209 O O   . ILE A 1 171 ? 33.805 39.263 -12.544 1.00 30.63 ? 201 ILE A O   1 
ATOM   1210 C CB  . ILE A 1 171 ? 34.808 38.150 -9.644  1.00 33.32 ? 201 ILE A CB  1 
ATOM   1211 C CG1 . ILE A 1 171 ? 36.145 38.010 -10.366 1.00 30.79 ? 201 ILE A CG1 1 
ATOM   1212 C CG2 . ILE A 1 171 ? 34.000 36.887 -9.775  1.00 33.62 ? 201 ILE A CG2 1 
ATOM   1213 C CD1 . ILE A 1 171 ? 37.188 37.289 -9.554  1.00 39.88 ? 201 ILE A CD1 1 
ATOM   1214 N N   . GLN A 1 172 ? 35.021 40.968 -11.696 1.00 31.17 ? 202 GLN A N   1 
ATOM   1215 C CA  . GLN A 1 172 ? 35.383 41.535 -12.997 1.00 34.45 ? 202 GLN A CA  1 
ATOM   1216 C C   . GLN A 1 172 ? 36.719 40.984 -13.497 1.00 35.85 ? 202 GLN A C   1 
ATOM   1217 O O   . GLN A 1 172 ? 36.887 40.752 -14.690 1.00 36.42 ? 202 GLN A O   1 
ATOM   1218 C CB  . GLN A 1 172 ? 35.441 43.066 -12.937 1.00 35.89 ? 202 GLN A CB  1 
ATOM   1219 C CG  . GLN A 1 172 ? 34.252 43.728 -12.218 1.00 36.93 ? 202 GLN A CG  1 
ATOM   1220 N N   . ASP A 1 173 ? 37.667 40.780 -12.583 1.00 36.96 ? 203 ASP A N   1 
ATOM   1221 C CA  . ASP A 1 173 ? 38.995 40.267 -12.942 1.00 37.79 ? 203 ASP A CA  1 
ATOM   1222 C C   . ASP A 1 173 ? 39.643 39.502 -11.789 1.00 36.47 ? 203 ASP A C   1 
ATOM   1223 O O   . ASP A 1 173 ? 39.357 39.758 -10.614 1.00 32.20 ? 203 ASP A O   1 
ATOM   1224 C CB  . ASP A 1 173 ? 39.924 41.397 -13.412 1.00 39.37 ? 203 ASP A CB  1 
ATOM   1225 C CG  . ASP A 1 173 ? 41.234 40.870 -14.015 1.00 48.76 ? 203 ASP A CG  1 
ATOM   1226 O OD1 . ASP A 1 173 ? 42.318 41.162 -13.450 1.00 55.74 ? 203 ASP A OD1 1 
ATOM   1227 O OD2 . ASP A 1 173 ? 41.180 40.139 -15.034 1.00 49.70 ? 203 ASP A OD2 1 
ATOM   1228 N N   . MET A 1 174 ? 40.501 38.546 -12.144 1.00 36.50 ? 204 MET A N   1 
ATOM   1229 C CA  . MET A 1 174 ? 41.288 37.785 -11.178 1.00 37.27 ? 204 MET A CA  1 
ATOM   1230 C C   . MET A 1 174 ? 42.718 37.650 -11.709 1.00 36.96 ? 204 MET A C   1 
ATOM   1231 O O   . MET A 1 174 ? 42.936 37.125 -12.808 1.00 35.20 ? 204 MET A O   1 
ATOM   1232 C CB  . MET A 1 174 ? 40.639 36.419 -10.920 1.00 37.13 ? 204 MET A CB  1 
ATOM   1233 C CG  . MET A 1 174 ? 41.216 35.653 -9.735  1.00 39.34 ? 204 MET A CG  1 
ATOM   1234 S SD  A MET A 1 174 ? 40.457 34.052 -9.384  0.50 41.26 ? 204 MET A SD  1 
ATOM   1235 S SD  B MET A 1 174 ? 42.388 34.379 -10.197 0.50 47.46 ? 204 MET A SD  1 
ATOM   1236 C CE  A MET A 1 174 ? 40.946 33.082 -10.813 0.50 45.79 ? 204 MET A CE  1 
ATOM   1237 C CE  B MET A 1 174 ? 42.006 33.141 -8.957  0.50 42.24 ? 204 MET A CE  1 
ATOM   1238 N N   . LYS A 1 175 ? 43.679 38.153 -10.933 1.00 36.52 ? 205 LYS A N   1 
ATOM   1239 C CA  . LYS A 1 175 ? 45.095 38.152 -11.300 1.00 37.24 ? 205 LYS A CA  1 
ATOM   1240 C C   . LYS A 1 175 ? 45.939 37.455 -10.215 1.00 36.95 ? 205 LYS A C   1 
ATOM   1241 O O   . LYS A 1 175 ? 45.913 37.849 -9.049  1.00 31.97 ? 205 LYS A O   1 
ATOM   1242 C CB  . LYS A 1 175 ? 45.562 39.598 -11.490 1.00 38.26 ? 205 LYS A CB  1 
ATOM   1243 C CG  . LYS A 1 175 ? 47.007 39.777 -11.903 1.00 41.20 ? 205 LYS A CG  1 
ATOM   1244 C CD  . LYS A 1 175 ? 47.507 41.174 -11.520 1.00 49.30 ? 205 LYS A CD  1 
ATOM   1245 N N   . GLU A 1 176 ? 46.683 36.428 -10.612 1.00 36.78 ? 206 GLU A N   1 
ATOM   1246 C CA  . GLU A 1 176 ? 47.576 35.717 -9.698  1.00 39.43 ? 206 GLU A CA  1 
ATOM   1247 C C   . GLU A 1 176 ? 48.977 36.312 -9.735  1.00 41.04 ? 206 GLU A C   1 
ATOM   1248 O O   . GLU A 1 176 ? 49.653 36.283 -10.757 1.00 42.52 ? 206 GLU A O   1 
ATOM   1249 C CB  . GLU A 1 176 ? 47.612 34.213 -10.013 1.00 39.05 ? 206 GLU A CB  1 
ATOM   1250 C CG  . GLU A 1 176 ? 46.328 33.469 -9.658  1.00 39.42 ? 206 GLU A CG  1 
ATOM   1251 N N   . CYS A 1 177 ? 49.397 36.865 -8.605  1.00 42.23 ? 207 CYS A N   1 
ATOM   1252 C CA  . CYS A 1 177 ? 50.731 37.415 -8.424  1.00 41.13 ? 207 CYS A CA  1 
ATOM   1253 C C   . CYS A 1 177 ? 51.552 36.352 -7.666  1.00 42.05 ? 207 CYS A C   1 
ATOM   1254 O O   . CYS A 1 177 ? 50.964 35.395 -7.144  1.00 40.18 ? 207 CYS A O   1 
ATOM   1255 C CB  . CYS A 1 177 ? 50.607 38.738 -7.662  1.00 42.20 ? 207 CYS A CB  1 
ATOM   1256 S SG  A CYS A 1 177 ? 49.686 40.025 -8.523  0.50 33.46 ? 207 CYS A SG  1 
ATOM   1257 S SG  B CYS A 1 177 ? 52.112 39.578 -7.164  0.50 46.79 ? 207 CYS A SG  1 
ATOM   1258 N N   . PRO A 1 178 ? 52.907 36.472 -7.640  1.00 44.03 ? 208 PRO A N   1 
ATOM   1259 C CA  . PRO A 1 178 ? 53.701 35.423 -6.972  1.00 42.44 ? 208 PRO A CA  1 
ATOM   1260 C C   . PRO A 1 178 ? 53.225 35.084 -5.555  1.00 40.39 ? 208 PRO A C   1 
ATOM   1261 O O   . PRO A 1 178 ? 53.201 33.910 -5.185  1.00 39.48 ? 208 PRO A O   1 
ATOM   1262 C CB  . PRO A 1 178 ? 55.117 36.021 -6.934  1.00 43.54 ? 208 PRO A CB  1 
ATOM   1263 C CG  . PRO A 1 178 ? 55.181 36.902 -8.119  1.00 43.57 ? 208 PRO A CG  1 
ATOM   1264 C CD  . PRO A 1 178 ? 53.785 37.505 -8.235  1.00 45.56 ? 208 PRO A CD  1 
ATOM   1265 N N   . GLU A 1 179 ? 52.807 36.098 -4.794  1.00 35.65 ? 209 GLU A N   1 
ATOM   1266 C CA  . GLU A 1 179 ? 52.551 35.923 -3.370  1.00 32.18 ? 209 GLU A CA  1 
ATOM   1267 C C   . GLU A 1 179 ? 51.117 36.231 -2.919  1.00 29.76 ? 209 GLU A C   1 
ATOM   1268 O O   . GLU A 1 179 ? 50.775 36.055 -1.757  1.00 27.99 ? 209 GLU A O   1 
ATOM   1269 C CB  . GLU A 1 179 ? 53.565 36.747 -2.581  1.00 31.84 ? 209 GLU A CB  1 
ATOM   1270 C CG  . GLU A 1 179 ? 55.010 36.214 -2.750  1.00 34.81 ? 209 GLU A CG  1 
ATOM   1271 C CD  . GLU A 1 179 ? 56.007 37.293 -3.137  1.00 35.80 ? 209 GLU A CD  1 
ATOM   1272 O OE1 . GLU A 1 179 ? 55.611 38.478 -3.272  1.00 26.73 ? 209 GLU A OE1 1 
ATOM   1273 O OE2 . GLU A 1 179 ? 57.196 36.952 -3.288  1.00 30.34 ? 209 GLU A OE2 1 
ATOM   1274 N N   . TYR A 1 180 ? 50.281 36.679 -3.846  1.00 27.96 ? 210 TYR A N   1 
ATOM   1275 C CA  . TYR A 1 180 ? 48.898 37.004 -3.521  1.00 27.55 ? 210 TYR A CA  1 
ATOM   1276 C C   . TYR A 1 180 ? 48.065 37.014 -4.790  1.00 26.27 ? 210 TYR A C   1 
ATOM   1277 O O   . TYR A 1 180 ? 48.610 37.035 -5.903  1.00 27.26 ? 210 TYR A O   1 
ATOM   1278 C CB  . TYR A 1 180 ? 48.788 38.325 -2.733  1.00 26.99 ? 210 TYR A CB  1 
ATOM   1279 C CG  . TYR A 1 180 ? 49.523 39.492 -3.369  1.00 29.06 ? 210 TYR A CG  1 
ATOM   1280 C CD1 . TYR A 1 180 ? 48.960 40.183 -4.440  1.00 24.54 ? 210 TYR A CD1 1 
ATOM   1281 C CD2 . TYR A 1 180 ? 50.779 39.902 -2.900  1.00 27.60 ? 210 TYR A CD2 1 
ATOM   1282 C CE1 . TYR A 1 180 ? 49.614 41.230 -5.031  1.00 27.74 ? 210 TYR A CE1 1 
ATOM   1283 C CE2 . TYR A 1 180 ? 51.460 40.963 -3.503  1.00 27.27 ? 210 TYR A CE2 1 
ATOM   1284 C CZ  . TYR A 1 180 ? 50.864 41.619 -4.564  1.00 28.66 ? 210 TYR A CZ  1 
ATOM   1285 O OH  . TYR A 1 180 ? 51.492 42.673 -5.175  1.00 31.82 ? 210 TYR A OH  1 
ATOM   1286 N N   . THR A 1 181 ? 46.753 36.934 -4.613  1.00 24.98 ? 211 THR A N   1 
ATOM   1287 C CA  . THR A 1 181 ? 45.803 36.966 -5.713  1.00 25.72 ? 211 THR A CA  1 
ATOM   1288 C C   . THR A 1 181 ? 44.993 38.243 -5.571  1.00 25.19 ? 211 THR A C   1 
ATOM   1289 O O   . THR A 1 181 ? 44.425 38.512 -4.505  1.00 21.22 ? 211 THR A O   1 
ATOM   1290 C CB  . THR A 1 181 ? 44.882 35.714 -5.694  1.00 26.79 ? 211 THR A CB  1 
ATOM   1291 O OG1 . THR A 1 181 ? 45.686 34.534 -5.787  1.00 32.98 ? 211 THR A OG1 1 
ATOM   1292 C CG2 . THR A 1 181 ? 43.872 35.723 -6.864  1.00 23.19 ? 211 THR A CG2 1 
ATOM   1293 N N   . VAL A 1 182 ? 44.940 39.025 -6.652  1.00 24.48 ? 212 VAL A N   1 
ATOM   1294 C CA  . VAL A 1 182 ? 44.130 40.235 -6.697  1.00 24.45 ? 212 VAL A CA  1 
ATOM   1295 C C   . VAL A 1 182 ? 42.834 39.969 -7.474  1.00 25.29 ? 212 VAL A C   1 
ATOM   1296 O O   . VAL A 1 182 ? 42.868 39.540 -8.630  1.00 22.80 ? 212 VAL A O   1 
ATOM   1297 C CB  . VAL A 1 182 ? 44.904 41.413 -7.339  1.00 26.68 ? 212 VAL A CB  1 
ATOM   1298 C CG1 . VAL A 1 182 ? 44.016 42.647 -7.438  1.00 24.30 ? 212 VAL A CG1 1 
ATOM   1299 C CG2 . VAL A 1 182 ? 46.164 41.725 -6.525  1.00 25.36 ? 212 VAL A CG2 1 
ATOM   1300 N N   . ARG A 1 183 ? 41.693 40.182 -6.822  1.00 24.37 ? 213 ARG A N   1 
ATOM   1301 C CA  . ARG A 1 183 ? 40.404 40.116 -7.502  1.00 24.16 ? 213 ARG A CA  1 
ATOM   1302 C C   . ARG A 1 183 ? 39.806 41.510 -7.575  1.00 26.22 ? 213 ARG A C   1 
ATOM   1303 O O   . ARG A 1 183 ? 39.812 42.255 -6.592  1.00 26.31 ? 213 ARG A O   1 
ATOM   1304 C CB  . ARG A 1 183 ? 39.426 39.170 -6.784  1.00 24.23 ? 213 ARG A CB  1 
ATOM   1305 C CG  . ARG A 1 183 ? 39.758 37.691 -6.943  1.00 26.99 ? 213 ARG A CG  1 
ATOM   1306 C CD  . ARG A 1 183 ? 38.947 36.825 -5.986  1.00 26.02 ? 213 ARG A CD  1 
ATOM   1307 N NE  . ARG A 1 183 ? 39.167 35.392 -6.195  1.00 31.43 ? 213 ARG A NE  1 
ATOM   1308 C CZ  . ARG A 1 183 ? 40.089 34.649 -5.578  1.00 33.93 ? 213 ARG A CZ  1 
ATOM   1309 N NH1 . ARG A 1 183 ? 40.929 35.179 -4.695  1.00 28.48 ? 213 ARG A NH1 1 
ATOM   1310 N NH2 . ARG A 1 183 ? 40.180 33.356 -5.861  1.00 36.79 ? 213 ARG A NH2 1 
ATOM   1311 N N   . GLN A 1 184 ? 39.281 41.865 -8.742  1.00 25.95 ? 214 GLN A N   1 
ATOM   1312 C CA  . GLN A 1 184 ? 38.472 43.075 -8.864  1.00 25.95 ? 214 GLN A CA  1 
ATOM   1313 C C   . GLN A 1 184 ? 37.009 42.667 -8.831  1.00 25.86 ? 214 GLN A C   1 
ATOM   1314 O O   . GLN A 1 184 ? 36.554 41.891 -9.677  1.00 26.06 ? 214 GLN A O   1 
ATOM   1315 C CB  . GLN A 1 184 ? 38.801 43.830 -10.152 1.00 25.31 ? 214 GLN A CB  1 
ATOM   1316 C CG  . GLN A 1 184 ? 40.204 44.423 -10.178 1.00 32.19 ? 214 GLN A CG  1 
ATOM   1317 C CD  . GLN A 1 184 ? 40.360 45.622 -9.246  1.00 35.79 ? 214 GLN A CD  1 
ATOM   1318 O OE1 . GLN A 1 184 ? 39.377 46.204 -8.776  1.00 33.38 ? 214 GLN A OE1 1 
ATOM   1319 N NE2 . GLN A 1 184 ? 41.607 46.002 -8.988  1.00 35.71 ? 214 GLN A NE2 1 
ATOM   1320 N N   . LEU A 1 185 ? 36.290 43.184 -7.837  1.00 25.25 ? 215 LEU A N   1 
ATOM   1321 C CA  . LEU A 1 185 ? 34.882 42.865 -7.624  1.00 25.20 ? 215 LEU A CA  1 
ATOM   1322 C C   . LEU A 1 185 ? 34.067 44.152 -7.778  1.00 25.11 ? 215 LEU A C   1 
ATOM   1323 O O   . LEU A 1 185 ? 34.604 45.263 -7.705  1.00 23.72 ? 215 LEU A O   1 
ATOM   1324 C CB  . LEU A 1 185 ? 34.639 42.288 -6.211  1.00 25.67 ? 215 LEU A CB  1 
ATOM   1325 C CG  . LEU A 1 185 ? 35.530 41.184 -5.598  1.00 30.76 ? 215 LEU A CG  1 
ATOM   1326 C CD1 . LEU A 1 185 ? 35.198 40.974 -4.125  1.00 30.98 ? 215 LEU A CD1 1 
ATOM   1327 C CD2 . LEU A 1 185 ? 35.405 39.861 -6.356  1.00 26.26 ? 215 LEU A CD2 1 
ATOM   1328 N N   . THR A 1 186 ? 32.774 43.990 -8.006  1.00 24.24 ? 216 THR A N   1 
ATOM   1329 C CA  . THR A 1 186 ? 31.834 45.098 -7.849  1.00 25.58 ? 216 THR A CA  1 
ATOM   1330 C C   . THR A 1 186 ? 30.745 44.675 -6.870  1.00 24.29 ? 216 THR A C   1 
ATOM   1331 O O   . THR A 1 186 ? 30.382 43.489 -6.782  1.00 23.73 ? 216 THR A O   1 
ATOM   1332 C CB  . THR A 1 186 ? 31.212 45.573 -9.196  1.00 25.60 ? 216 THR A CB  1 
ATOM   1333 O OG1 . THR A 1 186 ? 30.608 44.465 -9.880  1.00 25.32 ? 216 THR A OG1 1 
ATOM   1334 C CG2 . THR A 1 186 ? 32.267 46.227 -10.101 1.00 24.12 ? 216 THR A CG2 1 
ATOM   1335 N N   . ILE A 1 187 ? 30.250 45.644 -6.112  1.00 22.82 ? 217 ILE A N   1 
ATOM   1336 C CA  . ILE A 1 187 ? 29.113 45.432 -5.247  1.00 21.04 ? 217 ILE A CA  1 
ATOM   1337 C C   . ILE A 1 187 ? 28.019 46.420 -5.642  1.00 20.85 ? 217 ILE A C   1 
ATOM   1338 O O   . ILE A 1 187 ? 28.282 47.621 -5.830  1.00 18.62 ? 217 ILE A O   1 
ATOM   1339 C CB  . ILE A 1 187 ? 29.504 45.580 -3.743  1.00 20.99 ? 217 ILE A CB  1 
ATOM   1340 C CG1 . ILE A 1 187 ? 28.281 45.393 -2.828  1.00 21.41 ? 217 ILE A CG1 1 
ATOM   1341 C CG2 . ILE A 1 187 ? 30.210 46.917 -3.494  1.00 21.10 ? 217 ILE A CG2 1 
ATOM   1342 C CD1 . ILE A 1 187 ? 28.614 45.214 -1.315  1.00 18.46 ? 217 ILE A CD1 1 
ATOM   1343 N N   . GLN A 1 188 ? 26.796 45.914 -5.787  1.00 21.51 ? 218 GLN A N   1 
ATOM   1344 C CA  . GLN A 1 188 ? 25.688 46.747 -6.246  1.00 21.30 ? 218 GLN A CA  1 
ATOM   1345 C C   . GLN A 1 188 ? 24.509 46.639 -5.298  1.00 22.08 ? 218 GLN A C   1 
ATOM   1346 O O   . GLN A 1 188 ? 24.132 45.537 -4.894  1.00 23.46 ? 218 GLN A O   1 
ATOM   1347 C CB  . GLN A 1 188 ? 25.243 46.380 -7.676  1.00 20.64 ? 218 GLN A CB  1 
ATOM   1348 C CG  . GLN A 1 188 ? 24.113 47.317 -8.225  1.00 17.62 ? 218 GLN A CG  1 
ATOM   1349 C CD  . GLN A 1 188 ? 23.944 47.290 -9.737  1.00 21.04 ? 218 GLN A CD  1 
ATOM   1350 O OE1 . GLN A 1 188 ? 24.658 46.590 -10.448 1.00 21.82 ? 218 GLN A OE1 1 
ATOM   1351 N NE2 . GLN A 1 188 ? 22.978 48.078 -10.239 1.00 15.95 ? 218 GLN A NE2 1 
ATOM   1352 N N   . TYR A 1 189 ? 23.941 47.795 -4.964  1.00 21.43 ? 219 TYR A N   1 
ATOM   1353 C CA  . TYR A 1 189 ? 22.704 47.889 -4.225  1.00 22.05 ? 219 TYR A CA  1 
ATOM   1354 C C   . TYR A 1 189 ? 21.814 48.862 -4.982  1.00 23.54 ? 219 TYR A C   1 
ATOM   1355 O O   . TYR A 1 189 ? 22.199 50.012 -5.197  1.00 24.59 ? 219 TYR A O   1 
ATOM   1356 C CB  . TYR A 1 189 ? 22.954 48.384 -2.782  1.00 21.28 ? 219 TYR A CB  1 
ATOM   1357 C CG  . TYR A 1 189 ? 21.658 48.617 -2.038  1.00 26.47 ? 219 TYR A CG  1 
ATOM   1358 C CD1 . TYR A 1 189 ? 20.921 47.541 -1.546  1.00 32.35 ? 219 TYR A CD1 1 
ATOM   1359 C CD2 . TYR A 1 189 ? 21.141 49.910 -1.867  1.00 24.85 ? 219 TYR A CD2 1 
ATOM   1360 C CE1 . TYR A 1 189 ? 19.706 47.735 -0.889  1.00 33.48 ? 219 TYR A CE1 1 
ATOM   1361 C CE2 . TYR A 1 189 ? 19.932 50.120 -1.202  1.00 28.09 ? 219 TYR A CE2 1 
ATOM   1362 C CZ  . TYR A 1 189 ? 19.220 49.016 -0.713  1.00 31.27 ? 219 TYR A CZ  1 
ATOM   1363 O OH  . TYR A 1 189 ? 18.020 49.174 -0.058  1.00 31.30 ? 219 TYR A OH  1 
ATOM   1364 N N   . GLN A 1 190 ? 20.623 48.414 -5.380  1.00 25.14 ? 220 GLN A N   1 
ATOM   1365 C CA  . GLN A 1 190 ? 19.737 49.217 -6.228  1.00 23.81 ? 220 GLN A CA  1 
ATOM   1366 C C   . GLN A 1 190 ? 20.491 49.730 -7.475  1.00 22.89 ? 220 GLN A C   1 
ATOM   1367 O O   . GLN A 1 190 ? 21.098 48.939 -8.203  1.00 22.85 ? 220 GLN A O   1 
ATOM   1368 C CB  . GLN A 1 190 ? 19.100 50.373 -5.434  1.00 26.29 ? 220 GLN A CB  1 
ATOM   1369 C CG  . GLN A 1 190 ? 18.266 49.948 -4.229  1.00 28.45 ? 220 GLN A CG  1 
ATOM   1370 C CD  . GLN A 1 190 ? 16.888 49.469 -4.613  1.00 34.63 ? 220 GLN A CD  1 
ATOM   1371 O OE1 . GLN A 1 190 ? 15.996 50.265 -4.857  1.00 44.03 ? 220 GLN A OE1 1 
ATOM   1372 N NE2 . GLN A 1 190 ? 16.708 48.158 -4.660  1.00 46.06 ? 220 GLN A NE2 1 
ATOM   1373 N N   . GLU A 1 191 ? 20.473 51.047 -7.691  1.00 19.82 ? 221 GLU A N   1 
ATOM   1374 C CA  . GLU A 1 191 ? 21.099 51.676 -8.863  1.00 17.49 ? 221 GLU A CA  1 
ATOM   1375 C C   . GLU A 1 191 ? 22.620 51.802 -8.759  1.00 18.39 ? 221 GLU A C   1 
ATOM   1376 O O   . GLU A 1 191 ? 23.308 51.975 -9.766  1.00 19.99 ? 221 GLU A O   1 
ATOM   1377 C CB  . GLU A 1 191 ? 20.444 53.055 -9.123  1.00 17.04 ? 221 GLU A CB  1 
ATOM   1378 C CG  . GLU A 1 191 ? 20.987 54.265 -8.314  1.00 20.46 ? 221 GLU A CG  1 
ATOM   1379 C CD  . GLU A 1 191 ? 20.757 54.194 -6.800  1.00 19.87 ? 221 GLU A CD  1 
ATOM   1380 O OE1 . GLU A 1 191 ? 19.813 53.510 -6.340  1.00 19.24 ? 221 GLU A OE1 1 
ATOM   1381 O OE2 . GLU A 1 191 ? 21.516 54.860 -6.058  1.00 22.54 ? 221 GLU A OE2 1 
ATOM   1382 N N   . GLU A 1 192 ? 23.156 51.685 -7.547  1.00 16.95 ? 222 GLU A N   1 
ATOM   1383 C CA  . GLU A 1 192 ? 24.536 52.076 -7.298  1.00 19.98 ? 222 GLU A CA  1 
ATOM   1384 C C   . GLU A 1 192 ? 25.465 50.860 -7.277  1.00 19.70 ? 222 GLU A C   1 
ATOM   1385 O O   . GLU A 1 192 ? 25.242 49.921 -6.512  1.00 21.02 ? 222 GLU A O   1 
ATOM   1386 C CB  . GLU A 1 192 ? 24.622 52.851 -5.967  1.00 18.77 ? 222 GLU A CB  1 
ATOM   1387 C CG  . GLU A 1 192 ? 25.991 53.479 -5.732  1.00 21.37 ? 222 GLU A CG  1 
ATOM   1388 C CD  . GLU A 1 192 ? 26.111 54.219 -4.398  1.00 24.82 ? 222 GLU A CD  1 
ATOM   1389 O OE1 . GLU A 1 192 ? 25.084 54.649 -3.824  1.00 28.67 ? 222 GLU A OE1 1 
ATOM   1390 O OE2 . GLU A 1 192 ? 27.263 54.369 -3.924  1.00 26.32 ? 222 GLU A OE2 1 
ATOM   1391 N N   . ARG A 1 193 ? 26.512 50.895 -8.099  1.00 19.74 ? 223 ARG A N   1 
ATOM   1392 C CA  . ARG A 1 193 ? 27.506 49.820 -8.136  1.00 19.84 ? 223 ARG A CA  1 
ATOM   1393 C C   . ARG A 1 193 ? 28.895 50.409 -7.893  1.00 21.94 ? 223 ARG A C   1 
ATOM   1394 O O   . ARG A 1 193 ? 29.250 51.422 -8.502  1.00 19.97 ? 223 ARG A O   1 
ATOM   1395 C CB  . ARG A 1 193 ? 27.462 49.106 -9.504  1.00 20.82 ? 223 ARG A CB  1 
ATOM   1396 C CG  . ARG A 1 193 ? 28.422 47.899 -9.614  1.00 19.72 ? 223 ARG A CG  1 
ATOM   1397 C CD  . ARG A 1 193 ? 28.234 47.105 -10.920 1.00 18.00 ? 223 ARG A CD  1 
ATOM   1398 N NE  . ARG A 1 193 ? 28.439 47.912 -12.125 1.00 17.66 ? 223 ARG A NE  1 
ATOM   1399 C CZ  . ARG A 1 193 ? 27.461 48.382 -12.892 1.00 23.17 ? 223 ARG A CZ  1 
ATOM   1400 N NH1 . ARG A 1 193 ? 26.193 48.116 -12.596 1.00 22.99 ? 223 ARG A NH1 1 
ATOM   1401 N NH2 . ARG A 1 193 ? 27.750 49.105 -13.968 1.00 19.10 ? 223 ARG A NH2 1 
ATOM   1402 N N   . ARG A 1 194 ? 29.676 49.761 -7.029  1.00 20.69 ? 224 ARG A N   1 
ATOM   1403 C CA  . ARG A 1 194 ? 30.981 50.260 -6.577  1.00 22.04 ? 224 ARG A CA  1 
ATOM   1404 C C   . ARG A 1 194 ? 32.040 49.213 -6.854  1.00 22.85 ? 224 ARG A C   1 
ATOM   1405 O O   . ARG A 1 194 ? 31.744 48.028 -6.819  1.00 23.51 ? 224 ARG A O   1 
ATOM   1406 C CB  . ARG A 1 194 ? 30.972 50.519 -5.063  1.00 21.82 ? 224 ARG A CB  1 
ATOM   1407 C CG  . ARG A 1 194 ? 29.901 51.488 -4.585  1.00 24.11 ? 224 ARG A CG  1 
ATOM   1408 C CD  . ARG A 1 194 ? 29.961 51.600 -3.074  1.00 23.42 ? 224 ARG A CD  1 
ATOM   1409 N NE  . ARG A 1 194 ? 28.956 52.528 -2.556  1.00 19.01 ? 224 ARG A NE  1 
ATOM   1410 C CZ  . ARG A 1 194 ? 28.659 52.638 -1.268  1.00 18.10 ? 224 ARG A CZ  1 
ATOM   1411 N NH1 . ARG A 1 194 ? 29.297 51.872 -0.386  1.00 17.24 ? 224 ARG A NH1 1 
ATOM   1412 N NH2 . ARG A 1 194 ? 27.720 53.494 -0.859  1.00 17.89 ? 224 ARG A NH2 1 
ATOM   1413 N N   . SER A 1 195 ? 33.264 49.647 -7.141  1.00 23.69 ? 225 SER A N   1 
ATOM   1414 C CA  . SER A 1 195 ? 34.401 48.721 -7.250  1.00 25.56 ? 225 SER A CA  1 
ATOM   1415 C C   . SER A 1 195 ? 35.042 48.375 -5.896  1.00 25.15 ? 225 SER A C   1 
ATOM   1416 O O   . SER A 1 195 ? 35.112 49.208 -4.994  1.00 24.82 ? 225 SER A O   1 
ATOM   1417 C CB  . SER A 1 195 ? 35.453 49.294 -8.193  1.00 27.75 ? 225 SER A CB  1 
ATOM   1418 O OG  . SER A 1 195 ? 34.839 49.640 -9.416  1.00 34.51 ? 225 SER A OG  1 
ATOM   1419 N N   . VAL A 1 196 ? 35.490 47.127 -5.751  1.00 25.35 ? 226 VAL A N   1 
ATOM   1420 C CA  . VAL A 1 196 ? 36.185 46.709 -4.535  1.00 25.05 ? 226 VAL A CA  1 
ATOM   1421 C C   . VAL A 1 196 ? 37.337 45.838 -5.002  1.00 25.49 ? 226 VAL A C   1 
ATOM   1422 O O   . VAL A 1 196 ? 37.125 44.832 -5.680  1.00 27.16 ? 226 VAL A O   1 
ATOM   1423 C CB  . VAL A 1 196 ? 35.271 45.925 -3.527  1.00 25.12 ? 226 VAL A CB  1 
ATOM   1424 C CG1 . VAL A 1 196 ? 36.058 45.479 -2.259  1.00 23.20 ? 226 VAL A CG1 1 
ATOM   1425 C CG2 . VAL A 1 196 ? 34.062 46.751 -3.090  1.00 23.86 ? 226 VAL A CG2 1 
ATOM   1426 N N   . LYS A 1 197 ? 38.554 46.244 -4.660  1.00 23.99 ? 227 LYS A N   1 
ATOM   1427 C CA  . LYS A 1 197 ? 39.740 45.405 -4.878  1.00 23.78 ? 227 LYS A CA  1 
ATOM   1428 C C   . LYS A 1 197 ? 39.927 44.450 -3.692  1.00 22.79 ? 227 LYS A C   1 
ATOM   1429 O O   . LYS A 1 197 ? 39.878 44.855 -2.535  1.00 26.67 ? 227 LYS A O   1 
ATOM   1430 C CB  . LYS A 1 197 ? 40.972 46.298 -5.074  1.00 23.59 ? 227 LYS A CB  1 
ATOM   1431 C CG  . LYS A 1 197 ? 42.284 45.546 -5.364  1.00 25.62 ? 227 LYS A CG  1 
ATOM   1432 C CD  . LYS A 1 197 ? 43.416 46.545 -5.548  1.00 26.02 ? 227 LYS A CD  1 
ATOM   1433 C CE  . LYS A 1 197 ? 44.763 45.891 -5.758  1.00 30.08 ? 227 LYS A CE  1 
ATOM   1434 N NZ  . LYS A 1 197 ? 45.787 46.945 -6.051  1.00 25.76 ? 227 LYS A NZ  1 
ATOM   1435 N N   . HIS A 1 198 ? 40.121 43.176 -3.985  1.00 22.85 ? 228 HIS A N   1 
ATOM   1436 C CA  . HIS A 1 198 ? 40.290 42.161 -2.959  1.00 22.00 ? 228 HIS A CA  1 
ATOM   1437 C C   . HIS A 1 198 ? 41.666 41.500 -3.151  1.00 22.49 ? 228 HIS A C   1 
ATOM   1438 O O   . HIS A 1 198 ? 41.992 41.027 -4.250  1.00 22.50 ? 228 HIS A O   1 
ATOM   1439 C CB  . HIS A 1 198 ? 39.158 41.133 -3.113  1.00 23.74 ? 228 HIS A CB  1 
ATOM   1440 C CG  . HIS A 1 198 ? 39.129 40.083 -2.047  1.00 22.37 ? 228 HIS A CG  1 
ATOM   1441 N ND1 . HIS A 1 198 ? 39.891 38.934 -2.110  1.00 23.22 ? 228 HIS A ND1 1 
ATOM   1442 C CD2 . HIS A 1 198 ? 38.414 40.002 -0.900  1.00 21.37 ? 228 HIS A CD2 1 
ATOM   1443 C CE1 . HIS A 1 198 ? 39.662 38.197 -1.037  1.00 21.69 ? 228 HIS A CE1 1 
ATOM   1444 N NE2 . HIS A 1 198 ? 38.769 38.824 -0.285  1.00 22.06 ? 228 HIS A NE2 1 
ATOM   1445 N N   . ILE A 1 199 ? 42.479 41.495 -2.100  1.00 19.67 ? 229 ILE A N   1 
ATOM   1446 C CA  . ILE A 1 199 ? 43.812 40.866 -2.139  1.00 21.71 ? 229 ILE A CA  1 
ATOM   1447 C C   . ILE A 1 199 ? 43.844 39.716 -1.139  1.00 22.62 ? 229 ILE A C   1 
ATOM   1448 O O   . ILE A 1 199 ? 43.590 39.911 0.072   1.00 22.88 ? 229 ILE A O   1 
ATOM   1449 C CB  . ILE A 1 199 ? 44.953 41.855 -1.788  1.00 22.70 ? 229 ILE A CB  1 
ATOM   1450 C CG1 . ILE A 1 199 ? 44.880 43.127 -2.655  1.00 20.45 ? 229 ILE A CG1 1 
ATOM   1451 C CG2 . ILE A 1 199 ? 46.327 41.181 -2.001  1.00 18.81 ? 229 ILE A CG2 1 
ATOM   1452 C CD1 . ILE A 1 199 ? 45.755 44.285 -2.117  1.00 22.97 ? 229 ILE A CD1 1 
ATOM   1453 N N   . LEU A 1 200 ? 44.119 38.522 -1.647  1.00 19.72 ? 230 LEU A N   1 
ATOM   1454 C CA  . LEU A 1 200 ? 44.198 37.352 -0.800  1.00 23.22 ? 230 LEU A CA  1 
ATOM   1455 C C   . LEU A 1 200 ? 45.668 36.937 -0.729  1.00 23.32 ? 230 LEU A C   1 
ATOM   1456 O O   . LEU A 1 200 ? 46.254 36.546 -1.732  1.00 23.48 ? 230 LEU A O   1 
ATOM   1457 C CB  . LEU A 1 200 ? 43.322 36.233 -1.370  1.00 24.54 ? 230 LEU A CB  1 
ATOM   1458 C CG  . LEU A 1 200 ? 43.079 34.997 -0.484  1.00 27.44 ? 230 LEU A CG  1 
ATOM   1459 C CD1 . LEU A 1 200 ? 41.943 34.169 -1.063  1.00 25.67 ? 230 LEU A CD1 1 
ATOM   1460 C CD2 . LEU A 1 200 ? 44.327 34.141 -0.360  1.00 25.47 ? 230 LEU A CD2 1 
ATOM   1461 N N   . PHE A 1 201 ? 46.250 37.063 0.461   1.00 23.10 ? 231 PHE A N   1 
ATOM   1462 C CA  . PHE A 1 201 ? 47.634 36.694 0.722   1.00 23.11 ? 231 PHE A CA  1 
ATOM   1463 C C   . PHE A 1 201 ? 47.575 35.367 1.475   1.00 23.32 ? 231 PHE A C   1 
ATOM   1464 O O   . PHE A 1 201 ? 47.074 35.306 2.599   1.00 24.48 ? 231 PHE A O   1 
ATOM   1465 C CB  . PHE A 1 201 ? 48.290 37.776 1.585   1.00 21.07 ? 231 PHE A CB  1 
ATOM   1466 C CG  . PHE A 1 201 ? 49.773 37.576 1.839   1.00 23.81 ? 231 PHE A CG  1 
ATOM   1467 C CD1 . PHE A 1 201 ? 50.730 38.190 1.007   1.00 25.67 ? 231 PHE A CD1 1 
ATOM   1468 C CD2 . PHE A 1 201 ? 50.217 36.842 2.946   1.00 21.82 ? 231 PHE A CD2 1 
ATOM   1469 C CE1 . PHE A 1 201 ? 52.104 38.047 1.255   1.00 24.98 ? 231 PHE A CE1 1 
ATOM   1470 C CE2 . PHE A 1 201 ? 51.588 36.679 3.214   1.00 24.04 ? 231 PHE A CE2 1 
ATOM   1471 C CZ  . PHE A 1 201 ? 52.544 37.294 2.372   1.00 24.83 ? 231 PHE A CZ  1 
ATOM   1472 N N   . SER A 1 202 ? 48.050 34.302 0.850   1.00 21.91 ? 232 SER A N   1 
ATOM   1473 C CA  . SER A 1 202 ? 48.059 33.014 1.511   1.00 26.40 ? 232 SER A CA  1 
ATOM   1474 C C   . SER A 1 202 ? 49.455 32.709 2.098   1.00 27.61 ? 232 SER A C   1 
ATOM   1475 O O   . SER A 1 202 ? 50.283 33.607 2.222   1.00 31.37 ? 232 SER A O   1 
ATOM   1476 C CB  . SER A 1 202 ? 47.552 31.911 0.590   1.00 28.24 ? 232 SER A CB  1 
ATOM   1477 O OG  A SER A 1 202 ? 48.279 31.898 -0.627  0.50 26.21 ? 232 SER A OG  1 
ATOM   1478 O OG  B SER A 1 202 ? 47.709 30.659 1.251   0.50 32.22 ? 232 SER A OG  1 
ATOM   1479 N N   . ALA A 1 203 ? 49.709 31.463 2.472   1.00 28.81 ? 233 ALA A N   1 
ATOM   1480 C CA  . ALA A 1 203 ? 50.978 31.102 3.132   1.00 27.51 ? 233 ALA A CA  1 
ATOM   1481 C C   . ALA A 1 203 ? 51.266 31.961 4.385   1.00 26.51 ? 233 ALA A C   1 
ATOM   1482 O O   . ALA A 1 203 ? 52.406 32.325 4.638   1.00 24.61 ? 233 ALA A O   1 
ATOM   1483 C CB  . ALA A 1 203 ? 52.166 31.153 2.125   1.00 27.94 ? 233 ALA A CB  1 
ATOM   1484 N N   . TRP A 1 204 ? 50.226 32.297 5.156   1.00 24.32 ? 234 TRP A N   1 
ATOM   1485 C CA  . TRP A 1 204 ? 50.429 32.958 6.452   1.00 21.17 ? 234 TRP A CA  1 
ATOM   1486 C C   . TRP A 1 204 ? 49.558 32.279 7.518   1.00 21.90 ? 234 TRP A C   1 
ATOM   1487 O O   . TRP A 1 204 ? 48.402 32.666 7.703   1.00 22.18 ? 234 TRP A O   1 
ATOM   1488 C CB  . TRP A 1 204 ? 50.064 34.444 6.375   1.00 20.55 ? 234 TRP A CB  1 
ATOM   1489 C CG  . TRP A 1 204 ? 50.621 35.276 7.517   1.00 20.61 ? 234 TRP A CG  1 
ATOM   1490 C CD1 . TRP A 1 204 ? 51.170 34.818 8.692   1.00 17.99 ? 234 TRP A CD1 1 
ATOM   1491 C CD2 . TRP A 1 204 ? 50.672 36.703 7.583   1.00 18.93 ? 234 TRP A CD2 1 
ATOM   1492 N NE1 . TRP A 1 204 ? 51.565 35.887 9.476   1.00 19.14 ? 234 TRP A NE1 1 
ATOM   1493 C CE2 . TRP A 1 204 ? 51.268 37.049 8.821   1.00 19.79 ? 234 TRP A CE2 1 
ATOM   1494 C CE3 . TRP A 1 204 ? 50.283 37.733 6.703   1.00 20.04 ? 234 TRP A CE3 1 
ATOM   1495 C CZ2 . TRP A 1 204 ? 51.485 38.377 9.205   1.00 19.93 ? 234 TRP A CZ2 1 
ATOM   1496 C CZ3 . TRP A 1 204 ? 50.492 39.051 7.089   1.00 18.71 ? 234 TRP A CZ3 1 
ATOM   1497 C CH2 . TRP A 1 204 ? 51.099 39.362 8.323   1.00 22.70 ? 234 TRP A CH2 1 
ATOM   1498 N N   . PRO A 1 205 ? 50.104 31.267 8.205   1.00 23.19 ? 235 PRO A N   1 
ATOM   1499 C CA  . PRO A 1 205 ? 49.316 30.559 9.220   1.00 23.75 ? 235 PRO A CA  1 
ATOM   1500 C C   . PRO A 1 205 ? 49.093 31.420 10.464  1.00 20.96 ? 235 PRO A C   1 
ATOM   1501 O O   . PRO A 1 205 ? 49.949 32.230 10.818  1.00 20.78 ? 235 PRO A O   1 
ATOM   1502 C CB  . PRO A 1 205 ? 50.197 29.336 9.564   1.00 23.33 ? 235 PRO A CB  1 
ATOM   1503 C CG  . PRO A 1 205 ? 51.214 29.245 8.464   1.00 27.78 ? 235 PRO A CG  1 
ATOM   1504 C CD  . PRO A 1 205 ? 51.442 30.678 8.047   1.00 22.45 ? 235 PRO A CD  1 
ATOM   1505 N N   . ALA A 1 206 ? 47.951 31.241 11.113  1.00 22.36 ? 236 ALA A N   1 
ATOM   1506 C CA  . ALA A 1 206 ? 47.665 31.891 12.392  1.00 21.67 ? 236 ALA A CA  1 
ATOM   1507 C C   . ALA A 1 206 ? 48.791 31.554 13.377  1.00 22.39 ? 236 ALA A C   1 
ATOM   1508 O O   . ALA A 1 206 ? 49.387 30.474 13.299  1.00 20.39 ? 236 ALA A O   1 
ATOM   1509 C CB  . ALA A 1 206 ? 46.305 31.412 12.931  1.00 21.56 ? 236 ALA A CB  1 
ATOM   1510 N N   . HIS A 1 207 ? 49.102 32.497 14.271  1.00 21.22 ? 237 HIS A N   1 
ATOM   1511 C CA  . HIS A 1 207 ? 50.152 32.346 15.285  1.00 19.66 ? 237 HIS A CA  1 
ATOM   1512 C C   . HIS A 1 207 ? 51.563 32.151 14.742  1.00 21.94 ? 237 HIS A C   1 
ATOM   1513 O O   . HIS A 1 207 ? 52.447 31.744 15.489  1.00 20.97 ? 237 HIS A O   1 
ATOM   1514 C CB  . HIS A 1 207 ? 49.812 31.228 16.313  1.00 21.82 ? 237 HIS A CB  1 
ATOM   1515 C CG  . HIS A 1 207 ? 48.504 31.461 16.993  1.00 27.28 ? 237 HIS A CG  1 
ATOM   1516 N ND1 . HIS A 1 207 ? 47.337 30.863 16.572  1.00 27.14 ? 237 HIS A ND1 1 
ATOM   1517 C CD2 . HIS A 1 207 ? 48.161 32.308 17.993  1.00 26.83 ? 237 HIS A CD2 1 
ATOM   1518 C CE1 . HIS A 1 207 ? 46.333 31.306 17.308  1.00 28.71 ? 237 HIS A CE1 1 
ATOM   1519 N NE2 . HIS A 1 207 ? 46.808 32.172 18.185  1.00 33.92 ? 237 HIS A NE2 1 
ATOM   1520 N N   . GLN A 1 208 ? 51.756 32.431 13.455  1.00 22.29 ? 238 GLN A N   1 
ATOM   1521 C CA  . GLN A 1 208 ? 53.079 32.330 12.827  1.00 23.40 ? 238 GLN A CA  1 
ATOM   1522 C C   . GLN A 1 208 ? 53.366 33.599 12.025  1.00 20.46 ? 238 GLN A C   1 
ATOM   1523 O O   . GLN A 1 208 ? 52.557 34.526 12.004  1.00 20.40 ? 238 GLN A O   1 
ATOM   1524 C CB  . GLN A 1 208 ? 53.099 31.110 11.898  1.00 22.91 ? 238 GLN A CB  1 
ATOM   1525 C CG  . GLN A 1 208 ? 52.930 29.741 12.629  1.00 27.54 ? 238 GLN A CG  1 
ATOM   1526 C CD  . GLN A 1 208 ? 53.124 28.573 11.692  1.00 31.13 ? 238 GLN A CD  1 
ATOM   1527 O OE1 . GLN A 1 208 ? 54.003 28.606 10.821  1.00 38.95 ? 238 GLN A OE1 1 
ATOM   1528 N NE2 . GLN A 1 208 ? 52.298 27.529 11.851  1.00 38.78 ? 238 GLN A NE2 1 
ATOM   1529 N N   . THR A 1 209 ? 54.530 33.649 11.389  1.00 20.41 ? 239 THR A N   1 
ATOM   1530 C CA  . THR A 1 209 ? 54.891 34.773 10.549  1.00 21.65 ? 239 THR A CA  1 
ATOM   1531 C C   . THR A 1 209 ? 54.821 34.326 9.082   1.00 23.49 ? 239 THR A C   1 
ATOM   1532 O O   . THR A 1 209 ? 54.762 33.118 8.800   1.00 22.04 ? 239 THR A O   1 
ATOM   1533 C CB  . THR A 1 209 ? 56.325 35.273 10.854  1.00 23.84 ? 239 THR A CB  1 
ATOM   1534 O OG1 . THR A 1 209 ? 57.258 34.285 10.409  1.00 25.54 ? 239 THR A OG1 1 
ATOM   1535 C CG2 . THR A 1 209 ? 56.529 35.527 12.358  1.00 24.51 ? 239 THR A CG2 1 
ATOM   1536 N N   . PRO A 1 210 ? 54.846 35.295 8.142   1.00 21.40 ? 240 PRO A N   1 
ATOM   1537 C CA  . PRO A 1 210 ? 55.048 34.896 6.747   1.00 22.68 ? 240 PRO A CA  1 
ATOM   1538 C C   . PRO A 1 210 ? 56.390 34.188 6.556   1.00 23.05 ? 240 PRO A C   1 
ATOM   1539 O O   . PRO A 1 210 ? 57.265 34.211 7.444   1.00 20.30 ? 240 PRO A O   1 
ATOM   1540 C CB  . PRO A 1 210 ? 54.998 36.227 5.975   1.00 24.66 ? 240 PRO A CB  1 
ATOM   1541 C CG  . PRO A 1 210 ? 54.388 37.239 6.931   1.00 24.48 ? 240 PRO A CG  1 
ATOM   1542 C CD  . PRO A 1 210 ? 54.716 36.751 8.316   1.00 20.46 ? 240 PRO A CD  1 
ATOM   1543 N N   . GLU A 1 211 ? 56.550 33.564 5.397   1.00 22.11 ? 241 GLU A N   1 
ATOM   1544 C CA  . GLU A 1 211 ? 57.734 32.809 5.070   1.00 25.52 ? 241 GLU A CA  1 
ATOM   1545 C C   . GLU A 1 211 ? 58.975 33.712 5.131   1.00 22.13 ? 241 GLU A C   1 
ATOM   1546 O O   . GLU A 1 211 ? 60.021 33.305 5.628   1.00 24.95 ? 241 GLU A O   1 
ATOM   1547 C CB  . GLU A 1 211 ? 57.553 32.152 3.685   1.00 25.01 ? 241 GLU A CB  1 
ATOM   1548 C CG  . GLU A 1 211 ? 56.721 30.809 3.771   1.00 37.40 ? 241 GLU A CG  1 
ATOM   1549 C CD  . GLU A 1 211 ? 56.084 30.327 2.443   1.00 37.55 ? 241 GLU A CD  1 
ATOM   1550 O OE1 . GLU A 1 211 ? 56.339 30.923 1.364   1.00 56.43 ? 241 GLU A OE1 1 
ATOM   1551 O OE2 . GLU A 1 211 ? 55.310 29.330 2.486   1.00 52.22 ? 241 GLU A OE2 1 
ATOM   1552 N N   . SER A 1 212 ? 58.830 34.946 4.665   1.00 21.09 ? 242 SER A N   1 
ATOM   1553 C CA  . SER A 1 212 ? 59.921 35.948 4.758   1.00 19.97 ? 242 SER A CA  1 
ATOM   1554 C C   . SER A 1 212 ? 59.272 37.330 4.657   1.00 19.36 ? 242 SER A C   1 
ATOM   1555 O O   . SER A 1 212 ? 58.061 37.437 4.398   1.00 21.23 ? 242 SER A O   1 
ATOM   1556 C CB  . SER A 1 212 ? 60.975 35.703 3.665   1.00 17.63 ? 242 SER A CB  1 
ATOM   1557 O OG  . SER A 1 212 ? 60.440 35.864 2.361   1.00 19.82 ? 242 SER A OG  1 
ATOM   1558 N N   . ALA A 1 213 ? 60.050 38.385 4.883   1.00 19.52 ? 243 ALA A N   1 
ATOM   1559 C CA  . ALA A 1 213 ? 59.487 39.732 4.915   1.00 22.09 ? 243 ALA A CA  1 
ATOM   1560 C C   . ALA A 1 213 ? 59.189 40.296 3.507   1.00 20.48 ? 243 ALA A C   1 
ATOM   1561 O O   . ALA A 1 213 ? 58.264 41.068 3.347   1.00 21.95 ? 243 ALA A O   1 
ATOM   1562 C CB  . ALA A 1 213 ? 60.395 40.679 5.705   1.00 20.20 ? 243 ALA A CB  1 
ATOM   1563 N N   . GLY A 1 214 ? 59.968 39.905 2.509   1.00 21.33 ? 244 GLY A N   1 
ATOM   1564 C CA  . GLY A 1 214 ? 59.769 40.365 1.115   1.00 20.55 ? 244 GLY A CA  1 
ATOM   1565 C C   . GLY A 1 214 ? 58.321 40.344 0.618   1.00 19.58 ? 244 GLY A C   1 
ATOM   1566 O O   . GLY A 1 214 ? 57.800 41.373 0.158   1.00 18.82 ? 244 GLY A O   1 
ATOM   1567 N N   . PRO A 1 215 ? 57.670 39.162 0.644   1.00 20.37 ? 245 PRO A N   1 
ATOM   1568 C CA  . PRO A 1 215 ? 56.265 39.076 0.223   1.00 20.19 ? 245 PRO A CA  1 
ATOM   1569 C C   . PRO A 1 215 ? 55.344 39.999 1.001   1.00 20.56 ? 245 PRO A C   1 
ATOM   1570 O O   . PRO A 1 215 ? 54.432 40.583 0.404   1.00 20.21 ? 245 PRO A O   1 
ATOM   1571 C CB  . PRO A 1 215 ? 55.901 37.604 0.482   1.00 18.23 ? 245 PRO A CB  1 
ATOM   1572 C CG  . PRO A 1 215 ? 57.185 36.894 0.341   1.00 21.75 ? 245 PRO A CG  1 
ATOM   1573 C CD  . PRO A 1 215 ? 58.216 37.833 0.958   1.00 19.46 ? 245 PRO A CD  1 
ATOM   1574 N N   . LEU A 1 216 ? 55.570 40.141 2.313   1.00 19.56 ? 246 LEU A N   1 
ATOM   1575 C CA  . LEU A 1 216 ? 54.754 41.037 3.107   1.00 19.88 ? 246 LEU A CA  1 
ATOM   1576 C C   . LEU A 1 216 ? 54.936 42.492 2.684   1.00 20.17 ? 246 LEU A C   1 
ATOM   1577 O O   . LEU A 1 216 ? 53.959 43.236 2.595   1.00 21.26 ? 246 LEU A O   1 
ATOM   1578 C CB  . LEU A 1 216 ? 55.051 40.872 4.610   1.00 19.72 ? 246 LEU A CB  1 
ATOM   1579 C CG  . LEU A 1 216 ? 54.343 41.835 5.570   1.00 23.64 ? 246 LEU A CG  1 
ATOM   1580 C CD1 . LEU A 1 216 ? 52.837 41.748 5.386   1.00 21.49 ? 246 LEU A CD1 1 
ATOM   1581 C CD2 . LEU A 1 216 ? 54.704 41.518 7.038   1.00 20.53 ? 246 LEU A CD2 1 
ATOM   1582 N N   . LEU A 1 217 ? 56.185 42.911 2.470   1.00 18.44 ? 247 LEU A N   1 
ATOM   1583 C CA  . LEU A 1 217 ? 56.444 44.271 1.986   1.00 19.34 ? 247 LEU A CA  1 
ATOM   1584 C C   . LEU A 1 217 ? 55.854 44.474 0.579   1.00 20.38 ? 247 LEU A C   1 
ATOM   1585 O O   . LEU A 1 217 ? 55.347 45.544 0.277   1.00 21.27 ? 247 LEU A O   1 
ATOM   1586 C CB  . LEU A 1 217 ? 57.949 44.604 2.015   1.00 19.18 ? 247 LEU A CB  1 
ATOM   1587 C CG  . LEU A 1 217 ? 58.546 44.748 3.430   1.00 20.55 ? 247 LEU A CG  1 
ATOM   1588 C CD1 . LEU A 1 217 ? 60.065 44.917 3.328   1.00 22.61 ? 247 LEU A CD1 1 
ATOM   1589 C CD2 . LEU A 1 217 ? 57.907 45.928 4.223   1.00 19.03 ? 247 LEU A CD2 1 
ATOM   1590 N N   . ARG A 1 218 ? 55.881 43.447 -0.272  1.00 19.85 ? 248 ARG A N   1 
ATOM   1591 C CA  . ARG A 1 218 ? 55.193 43.573 -1.581  1.00 21.08 ? 248 ARG A CA  1 
ATOM   1592 C C   . ARG A 1 218 ? 53.671 43.673 -1.432  1.00 21.58 ? 248 ARG A C   1 
ATOM   1593 O O   . ARG A 1 218 ? 52.993 44.354 -2.215  1.00 19.56 ? 248 ARG A O   1 
ATOM   1594 C CB  . ARG A 1 218 ? 55.615 42.459 -2.542  1.00 22.55 ? 248 ARG A CB  1 
ATOM   1595 C CG  . ARG A 1 218 ? 57.036 42.664 -3.089  1.00 19.96 ? 248 ARG A CG  1 
ATOM   1596 C CD  . ARG A 1 218 ? 57.393 41.582 -4.125  1.00 25.11 ? 248 ARG A CD  1 
ATOM   1597 N NE  . ARG A 1 218 ? 57.740 40.285 -3.529  1.00 25.48 ? 248 ARG A NE  1 
ATOM   1598 C CZ  . ARG A 1 218 ? 58.919 39.995 -2.967  1.00 30.62 ? 248 ARG A CZ  1 
ATOM   1599 N NH1 . ARG A 1 218 ? 59.887 40.909 -2.890  1.00 30.26 ? 248 ARG A NH1 1 
ATOM   1600 N NH2 . ARG A 1 218 ? 59.134 38.781 -2.472  1.00 24.24 ? 248 ARG A NH2 1 
ATOM   1601 N N   . LEU A 1 219 ? 53.125 43.044 -0.397  1.00 21.08 ? 249 LEU A N   1 
ATOM   1602 C CA  . LEU A 1 219 ? 51.697 43.197 -0.117  1.00 21.63 ? 249 LEU A CA  1 
ATOM   1603 C C   . LEU A 1 219 ? 51.373 44.621 0.346   1.00 21.89 ? 249 LEU A C   1 
ATOM   1604 O O   . LEU A 1 219 ? 50.399 45.239 -0.106  1.00 20.77 ? 249 LEU A O   1 
ATOM   1605 C CB  . LEU A 1 219 ? 51.213 42.137 0.900   1.00 20.53 ? 249 LEU A CB  1 
ATOM   1606 C CG  . LEU A 1 219 ? 49.769 42.307 1.401   1.00 25.27 ? 249 LEU A CG  1 
ATOM   1607 C CD1 . LEU A 1 219 ? 48.773 42.033 0.266   1.00 25.02 ? 249 LEU A CD1 1 
ATOM   1608 C CD2 . LEU A 1 219 ? 49.489 41.385 2.574   1.00 21.34 ? 249 LEU A CD2 1 
ATOM   1609 N N   . VAL A 1 220 ? 52.202 45.153 1.242   1.00 21.74 ? 250 VAL A N   1 
ATOM   1610 C CA  . VAL A 1 220 ? 52.044 46.527 1.709   1.00 21.20 ? 250 VAL A CA  1 
ATOM   1611 C C   . VAL A 1 220 ? 52.099 47.491 0.509   1.00 25.07 ? 250 VAL A C   1 
ATOM   1612 O O   . VAL A 1 220 ? 51.244 48.365 0.404   1.00 24.73 ? 250 VAL A O   1 
ATOM   1613 C CB  . VAL A 1 220 ? 53.070 46.883 2.812   1.00 23.70 ? 250 VAL A CB  1 
ATOM   1614 C CG1 . VAL A 1 220 ? 53.028 48.374 3.167   1.00 23.73 ? 250 VAL A CG1 1 
ATOM   1615 C CG2 . VAL A 1 220 ? 52.804 46.011 4.074   1.00 19.78 ? 250 VAL A CG2 1 
ATOM   1616 N N   . ALA A 1 221 ? 53.081 47.318 -0.381  1.00 23.92 ? 251 ALA A N   1 
ATOM   1617 C CA  . ALA A 1 221 ? 53.170 48.119 -1.626  1.00 26.07 ? 251 ALA A CA  1 
ATOM   1618 C C   . ALA A 1 221 ? 51.938 47.969 -2.537  1.00 25.90 ? 251 ALA A C   1 
ATOM   1619 O O   . ALA A 1 221 ? 51.433 48.967 -3.093  1.00 25.50 ? 251 ALA A O   1 
ATOM   1620 C CB  . ALA A 1 221 ? 54.456 47.786 -2.392  1.00 25.37 ? 251 ALA A CB  1 
ATOM   1621 N N   . GLU A 1 222 ? 51.448 46.738 -2.699  1.00 25.23 ? 252 GLU A N   1 
ATOM   1622 C CA  . GLU A 1 222 ? 50.202 46.508 -3.459  1.00 26.28 ? 252 GLU A CA  1 
ATOM   1623 C C   . GLU A 1 222 ? 49.057 47.385 -2.931  1.00 29.47 ? 252 GLU A C   1 
ATOM   1624 O O   . GLU A 1 222 ? 48.311 48.005 -3.705  1.00 27.74 ? 252 GLU A O   1 
ATOM   1625 C CB  . GLU A 1 222 ? 49.789 45.033 -3.433  1.00 26.28 ? 252 GLU A CB  1 
ATOM   1626 C CG  . GLU A 1 222 ? 48.561 44.717 -4.323  1.00 28.86 ? 252 GLU A CG  1 
ATOM   1627 C CD  . GLU A 1 222 ? 48.809 44.917 -5.836  1.00 32.96 ? 252 GLU A CD  1 
ATOM   1628 O OE1 . GLU A 1 222 ? 49.903 44.587 -6.325  1.00 30.24 ? 252 GLU A OE1 1 
ATOM   1629 O OE2 . GLU A 1 222 ? 47.893 45.398 -6.537  1.00 28.97 ? 252 GLU A OE2 1 
ATOM   1630 N N   . VAL A 1 223 ? 48.943 47.443 -1.603  1.00 28.88 ? 253 VAL A N   1 
ATOM   1631 C CA  . VAL A 1 223 ? 47.946 48.257 -0.932  1.00 28.59 ? 253 VAL A CA  1 
ATOM   1632 C C   . VAL A 1 223 ? 48.152 49.757 -1.182  1.00 32.27 ? 253 VAL A C   1 
ATOM   1633 O O   . VAL A 1 223 ? 47.191 50.443 -1.514  1.00 31.28 ? 253 VAL A O   1 
ATOM   1634 C CB  . VAL A 1 223 ? 47.889 47.902 0.590   1.00 26.00 ? 253 VAL A CB  1 
ATOM   1635 C CG1 . VAL A 1 223 ? 47.171 48.972 1.412   1.00 26.84 ? 253 VAL A CG1 1 
ATOM   1636 C CG2 . VAL A 1 223 ? 47.236 46.546 0.770   1.00 27.56 ? 253 VAL A CG2 1 
ATOM   1637 N N   . GLU A 1 224 ? 49.387 50.252 -1.030  1.00 35.20 ? 254 GLU A N   1 
ATOM   1638 C CA  . GLU A 1 224 ? 49.709 51.681 -1.250  1.00 41.22 ? 254 GLU A CA  1 
ATOM   1639 C C   . GLU A 1 224 ? 49.350 52.112 -2.653  1.00 43.55 ? 254 GLU A C   1 
ATOM   1640 O O   . GLU A 1 224 ? 48.796 53.183 -2.865  1.00 44.02 ? 254 GLU A O   1 
ATOM   1641 C CB  . GLU A 1 224 ? 51.206 51.972 -1.055  1.00 40.15 ? 254 GLU A CB  1 
ATOM   1642 C CG  . GLU A 1 224 ? 51.737 51.694 0.333   1.00 44.94 ? 254 GLU A CG  1 
ATOM   1643 C CD  . GLU A 1 224 ? 51.346 52.747 1.363   1.00 55.66 ? 254 GLU A CD  1 
ATOM   1644 O OE1 . GLU A 1 224 ? 50.677 53.766 1.020   1.00 48.70 ? 254 GLU A OE1 1 
ATOM   1645 O OE2 . GLU A 1 224 ? 51.723 52.536 2.537   1.00 50.87 ? 254 GLU A OE2 1 
ATOM   1646 N N   . GLU A 1 225 ? 49.689 51.252 -3.603  1.00 46.16 ? 255 GLU A N   1 
ATOM   1647 C CA  . GLU A 1 225 ? 49.536 51.518 -5.016  1.00 49.33 ? 255 GLU A CA  1 
ATOM   1648 C C   . GLU A 1 225 ? 48.091 51.466 -5.491  1.00 49.44 ? 255 GLU A C   1 
ATOM   1649 O O   . GLU A 1 225 ? 47.806 51.835 -6.626  1.00 49.55 ? 255 GLU A O   1 
ATOM   1650 C CB  . GLU A 1 225 ? 50.396 50.541 -5.820  1.00 48.37 ? 255 GLU A CB  1 
ATOM   1651 C CG  . GLU A 1 225 ? 51.895 50.744 -5.601  1.00 53.32 ? 255 GLU A CG  1 
ATOM   1652 C CD  . GLU A 1 225 ? 52.756 49.673 -6.278  1.00 54.71 ? 255 GLU A CD  1 
ATOM   1653 O OE1 . GLU A 1 225 ? 52.203 48.808 -7.004  1.00 63.19 ? 255 GLU A OE1 1 
ATOM   1654 O OE2 . GLU A 1 225 ? 53.994 49.701 -6.084  1.00 57.92 ? 255 GLU A OE2 1 
ATOM   1655 N N   . SER A 1 226 ? 47.184 51.013 -4.628  1.00 50.04 ? 256 SER A N   1 
ATOM   1656 C CA  . SER A 1 226 ? 45.773 50.916 -4.991  1.00 52.07 ? 256 SER A CA  1 
ATOM   1657 C C   . SER A 1 226 ? 45.190 52.321 -5.204  1.00 56.04 ? 256 SER A C   1 
ATOM   1658 O O   . SER A 1 226 ? 45.321 53.189 -4.331  1.00 53.79 ? 256 SER A O   1 
ATOM   1659 C CB  . SER A 1 226 ? 44.984 50.126 -3.942  1.00 50.67 ? 256 SER A CB  1 
ATOM   1660 O OG  . SER A 1 226 ? 45.511 48.813 -3.816  1.00 46.86 ? 256 SER A OG  1 
ATOM   1661 N N   . PRO A 1 227 ? 44.601 52.564 -6.394  1.00 61.01 ? 257 PRO A N   1 
ATOM   1662 C CA  . PRO A 1 227 ? 43.991 53.860 -6.684  1.00 64.91 ? 257 PRO A CA  1 
ATOM   1663 C C   . PRO A 1 227 ? 42.859 54.177 -5.711  1.00 68.94 ? 257 PRO A C   1 
ATOM   1664 O O   . PRO A 1 227 ? 42.028 53.307 -5.426  1.00 69.23 ? 257 PRO A O   1 
ATOM   1665 C CB  . PRO A 1 227 ? 43.450 53.681 -8.110  1.00 65.54 ? 257 PRO A CB  1 
ATOM   1666 C CG  . PRO A 1 227 ? 44.289 52.590 -8.700  1.00 64.32 ? 257 PRO A CG  1 
ATOM   1667 C CD  . PRO A 1 227 ? 44.511 51.650 -7.550  1.00 62.30 ? 257 PRO A CD  1 
ATOM   1668 N N   . GLU A 1 228 ? 42.861 55.400 -5.177  1.00 72.92 ? 258 GLU A N   1 
ATOM   1669 C CA  . GLU A 1 228 ? 41.785 55.870 -4.303  1.00 76.45 ? 258 GLU A CA  1 
ATOM   1670 C C   . GLU A 1 228 ? 40.891 56.837 -5.077  1.00 78.38 ? 258 GLU A C   1 
ATOM   1671 O O   . GLU A 1 228 ? 41.326 57.928 -5.461  1.00 79.20 ? 258 GLU A O   1 
ATOM   1672 C CB  . GLU A 1 228 ? 42.341 56.524 -3.028  1.00 76.79 ? 258 GLU A CB  1 
ATOM   1673 N N   . THR A 1 229 ? 39.650 56.416 -5.322  1.00 80.27 ? 259 THR A N   1 
ATOM   1674 C CA  . THR A 1 229 ? 38.680 57.220 -6.076  1.00 81.35 ? 259 THR A CA  1 
ATOM   1675 C C   . THR A 1 229 ? 37.927 58.213 -5.181  1.00 81.45 ? 259 THR A C   1 
ATOM   1676 O O   . THR A 1 229 ? 37.757 59.379 -5.552  1.00 81.67 ? 259 THR A O   1 
ATOM   1677 C CB  . THR A 1 229 ? 37.656 56.330 -6.835  1.00 81.58 ? 259 THR A CB  1 
ATOM   1678 N N   . ALA A 1 230 ? 37.503 57.742 -4.006  1.00 80.75 ? 260 ALA A N   1 
ATOM   1679 C CA  . ALA A 1 230 ? 36.646 58.500 -3.083  1.00 80.04 ? 260 ALA A CA  1 
ATOM   1680 C C   . ALA A 1 230 ? 37.216 59.854 -2.638  1.00 79.16 ? 260 ALA A C   1 
ATOM   1681 O O   . ALA A 1 230 ? 38.437 60.049 -2.608  1.00 79.30 ? 260 ALA A O   1 
ATOM   1682 C CB  . ALA A 1 230 ? 36.287 57.638 -1.859  1.00 80.09 ? 260 ALA A CB  1 
ATOM   1683 N N   . ALA A 1 231 ? 36.310 60.782 -2.310  1.00 77.81 ? 261 ALA A N   1 
ATOM   1684 C CA  . ALA A 1 231 ? 36.669 62.103 -1.774  1.00 75.99 ? 261 ALA A CA  1 
ATOM   1685 C C   . ALA A 1 231 ? 37.215 61.992 -0.348  1.00 74.02 ? 261 ALA A C   1 
ATOM   1686 O O   . ALA A 1 231 ? 38.219 62.631 -0.006  1.00 74.87 ? 261 ALA A O   1 
ATOM   1687 C CB  . ALA A 1 231 ? 35.474 63.041 -1.814  1.00 76.01 ? 261 ALA A CB  1 
ATOM   1688 N N   . HIS A 1 232 ? 36.534 61.189 0.471   1.00 69.95 ? 262 HIS A N   1 
ATOM   1689 C CA  . HIS A 1 232 ? 37.029 60.791 1.787   1.00 65.84 ? 262 HIS A CA  1 
ATOM   1690 C C   . HIS A 1 232 ? 37.152 59.254 1.822   1.00 61.35 ? 262 HIS A C   1 
ATOM   1691 O O   . HIS A 1 232 ? 36.167 58.557 2.113   1.00 62.18 ? 262 HIS A O   1 
ATOM   1692 C CB  . HIS A 1 232 ? 36.098 61.308 2.893   1.00 67.06 ? 262 HIS A CB  1 
ATOM   1693 N N   . PRO A 1 233 ? 38.357 58.721 1.508   1.00 55.70 ? 263 PRO A N   1 
ATOM   1694 C CA  . PRO A 1 233 ? 38.553 57.266 1.381   1.00 51.06 ? 263 PRO A CA  1 
ATOM   1695 C C   . PRO A 1 233 ? 37.986 56.475 2.573   1.00 45.14 ? 263 PRO A C   1 
ATOM   1696 O O   . PRO A 1 233 ? 38.117 56.903 3.731   1.00 45.23 ? 263 PRO A O   1 
ATOM   1697 C CB  . PRO A 1 233 ? 40.078 57.113 1.312   1.00 50.89 ? 263 PRO A CB  1 
ATOM   1698 C CG  . PRO A 1 233 ? 40.556 58.407 0.767   1.00 55.39 ? 263 PRO A CG  1 
ATOM   1699 C CD  . PRO A 1 233 ? 39.608 59.466 1.266   1.00 55.51 ? 263 PRO A CD  1 
ATOM   1700 N N   . GLY A 1 234 ? 37.341 55.348 2.289   1.00 37.26 ? 264 GLY A N   1 
ATOM   1701 C CA  . GLY A 1 234 ? 36.829 54.501 3.353   1.00 32.03 ? 264 GLY A CA  1 
ATOM   1702 C C   . GLY A 1 234 ? 37.962 53.698 3.990   1.00 26.81 ? 264 GLY A C   1 
ATOM   1703 O O   . GLY A 1 234 ? 39.104 53.693 3.483   1.00 27.04 ? 264 GLY A O   1 
ATOM   1704 N N   . PRO A 1 235 ? 37.653 53.004 5.090   1.00 25.67 ? 265 PRO A N   1 
ATOM   1705 C CA  . PRO A 1 235 ? 38.617 52.125 5.736   1.00 24.39 ? 265 PRO A CA  1 
ATOM   1706 C C   . PRO A 1 235 ? 39.008 50.984 4.822   1.00 24.58 ? 265 PRO A C   1 
ATOM   1707 O O   . PRO A 1 235 ? 38.168 50.481 4.064   1.00 23.36 ? 265 PRO A O   1 
ATOM   1708 C CB  . PRO A 1 235 ? 37.832 51.528 6.894   1.00 25.43 ? 265 PRO A CB  1 
ATOM   1709 C CG  . PRO A 1 235 ? 36.642 52.409 7.093   1.00 27.37 ? 265 PRO A CG  1 
ATOM   1710 C CD  . PRO A 1 235 ? 36.345 53.014 5.783   1.00 22.42 ? 265 PRO A CD  1 
ATOM   1711 N N   . ILE A 1 236 ? 40.269 50.576 4.909   1.00 23.02 ? 266 ILE A N   1 
ATOM   1712 C CA  . ILE A 1 236 ? 40.720 49.333 4.286   1.00 23.31 ? 266 ILE A CA  1 
ATOM   1713 C C   . ILE A 1 236 ? 40.323 48.190 5.231   1.00 21.85 ? 266 ILE A C   1 
ATOM   1714 O O   . ILE A 1 236 ? 40.692 48.194 6.401   1.00 22.05 ? 266 ILE A O   1 
ATOM   1715 C CB  . ILE A 1 236 ? 42.252 49.345 4.068   1.00 22.08 ? 266 ILE A CB  1 
ATOM   1716 C CG1 . ILE A 1 236 ? 42.678 50.531 3.184   1.00 21.92 ? 266 ILE A CG1 1 
ATOM   1717 C CG2 . ILE A 1 236 ? 42.747 47.989 3.523   1.00 21.88 ? 266 ILE A CG2 1 
ATOM   1718 C CD1 . ILE A 1 236 ? 44.199 50.839 3.245   1.00 25.23 ? 266 ILE A CD1 1 
ATOM   1719 N N   . VAL A 1 237 ? 39.540 47.231 4.748   1.00 20.88 ? 267 VAL A N   1 
ATOM   1720 C CA  . VAL A 1 237 ? 39.238 46.049 5.564   1.00 20.65 ? 267 VAL A CA  1 
ATOM   1721 C C   . VAL A 1 237 ? 40.431 45.080 5.534   1.00 20.06 ? 267 VAL A C   1 
ATOM   1722 O O   . VAL A 1 237 ? 40.954 44.747 4.463   1.00 21.44 ? 267 VAL A O   1 
ATOM   1723 C CB  . VAL A 1 237 ? 37.932 45.364 5.114   1.00 21.10 ? 267 VAL A CB  1 
ATOM   1724 C CG1 . VAL A 1 237 ? 37.755 43.990 5.780   1.00 18.85 ? 267 VAL A CG1 1 
ATOM   1725 C CG2 . VAL A 1 237 ? 36.728 46.269 5.492   1.00 18.70 ? 267 VAL A CG2 1 
ATOM   1726 N N   . VAL A 1 238 ? 40.870 44.652 6.715   1.00 19.12 ? 268 VAL A N   1 
ATOM   1727 C CA  . VAL A 1 238 ? 41.921 43.646 6.812   1.00 19.02 ? 268 VAL A CA  1 
ATOM   1728 C C   . VAL A 1 238 ? 41.353 42.545 7.681   1.00 19.10 ? 268 VAL A C   1 
ATOM   1729 O O   . VAL A 1 238 ? 40.838 42.824 8.762   1.00 19.98 ? 268 VAL A O   1 
ATOM   1730 C CB  . VAL A 1 238 ? 43.184 44.199 7.499   1.00 18.27 ? 268 VAL A CB  1 
ATOM   1731 C CG1 . VAL A 1 238 ? 44.318 43.150 7.448   1.00 19.34 ? 268 VAL A CG1 1 
ATOM   1732 C CG2 . VAL A 1 238 ? 43.630 45.542 6.852   1.00 17.73 ? 268 VAL A CG2 1 
ATOM   1733 N N   . HIS A 1 239 ? 41.418 41.302 7.218   1.00 20.15 ? 269 HIS A N   1 
ATOM   1734 C CA  . HIS A 1 239 ? 40.864 40.203 8.016   1.00 20.33 ? 269 HIS A CA  1 
ATOM   1735 C C   . HIS A 1 239 ? 41.672 38.920 7.968   1.00 20.73 ? 269 HIS A C   1 
ATOM   1736 O O   . HIS A 1 239 ? 42.442 38.665 7.034   1.00 22.00 ? 269 HIS A O   1 
ATOM   1737 C CB  . HIS A 1 239 ? 39.365 39.942 7.687   1.00 19.04 ? 269 HIS A CB  1 
ATOM   1738 C CG  . HIS A 1 239 ? 39.120 39.239 6.388   1.00 20.89 ? 269 HIS A CG  1 
ATOM   1739 N ND1 . HIS A 1 239 ? 39.274 37.877 6.232   1.00 24.10 ? 269 HIS A ND1 1 
ATOM   1740 C CD2 . HIS A 1 239 ? 38.711 39.712 5.183   1.00 21.83 ? 269 HIS A CD2 1 
ATOM   1741 C CE1 . HIS A 1 239 ? 38.954 37.537 4.994   1.00 23.02 ? 269 HIS A CE1 1 
ATOM   1742 N NE2 . HIS A 1 239 ? 38.607 38.632 4.338   1.00 23.98 ? 269 HIS A NE2 1 
ATOM   1743 N N   . CYS A 1 240 ? 41.491 38.122 9.009   1.00 20.29 ? 270 CYS A N   1 
ATOM   1744 C CA  . CYS A 1 240 ? 42.059 36.792 9.097   1.00 21.55 ? 270 CYS A CA  1 
ATOM   1745 C C   . CYS A 1 240 ? 41.130 36.072 10.076  1.00 22.37 ? 270 CYS A C   1 
ATOM   1746 O O   . CYS A 1 240 ? 40.167 36.677 10.563  1.00 23.52 ? 270 CYS A O   1 
ATOM   1747 C CB  . CYS A 1 240 ? 43.500 36.843 9.625   1.00 20.03 ? 270 CYS A CB  1 
ATOM   1748 S SG  . CYS A 1 240 ? 43.667 37.630 11.230  1.00 22.25 ? 270 CYS A SG  1 
ATOM   1749 N N   . SER A 1 241 ? 41.396 34.803 10.361  1.00 21.12 ? 271 SER A N   1 
ATOM   1750 C CA  . SER A 1 241 ? 40.455 33.965 11.125  1.00 21.54 ? 271 SER A CA  1 
ATOM   1751 C C   . SER A 1 241 ? 39.946 34.623 12.416  1.00 22.35 ? 271 SER A C   1 
ATOM   1752 O O   . SER A 1 241 ? 38.743 34.719 12.624  1.00 21.64 ? 271 SER A O   1 
ATOM   1753 C CB  . SER A 1 241 ? 41.113 32.618 11.460  1.00 23.05 ? 271 SER A CB  1 
ATOM   1754 O OG  A SER A 1 241 ? 41.284 31.871 10.275  0.50 25.44 ? 271 SER A OG  1 
ATOM   1755 O OG  B SER A 1 241 ? 40.206 31.736 12.102  0.50 24.77 ? 271 SER A OG  1 
ATOM   1756 N N   . ALA A 1 242 ? 40.867 35.048 13.284  1.00 20.33 ? 272 ALA A N   1 
ATOM   1757 C CA  . ALA A 1 242 ? 40.470 35.709 14.545  1.00 22.53 ? 272 ALA A CA  1 
ATOM   1758 C C   . ALA A 1 242 ? 40.390 37.233 14.424  1.00 22.74 ? 272 ALA A C   1 
ATOM   1759 O O   . ALA A 1 242 ? 39.724 37.901 15.221  1.00 24.00 ? 272 ALA A O   1 
ATOM   1760 C CB  . ALA A 1 242 ? 41.420 35.294 15.692  1.00 20.47 ? 272 ALA A CB  1 
ATOM   1761 N N   . GLY A 1 243 ? 41.057 37.785 13.411  1.00 20.35 ? 273 GLY A N   1 
ATOM   1762 C CA  . GLY A 1 243 ? 41.067 39.207 13.177  1.00 19.27 ? 273 GLY A CA  1 
ATOM   1763 C C   . GLY A 1 243 ? 42.005 40.008 14.058  1.00 20.49 ? 273 GLY A C   1 
ATOM   1764 O O   . GLY A 1 243 ? 41.859 41.208 14.140  1.00 19.24 ? 273 GLY A O   1 
ATOM   1765 N N   . ILE A 1 244 ? 42.979 39.375 14.719  1.00 18.90 ? 274 ILE A N   1 
ATOM   1766 C CA  . ILE A 1 244 ? 43.908 40.159 15.564  1.00 19.50 ? 274 ILE A CA  1 
ATOM   1767 C C   . ILE A 1 244 ? 45.407 39.906 15.342  1.00 19.67 ? 274 ILE A C   1 
ATOM   1768 O O   . ILE A 1 244 ? 46.210 40.816 15.479  1.00 20.94 ? 274 ILE A O   1 
ATOM   1769 C CB  . ILE A 1 244 ? 43.577 40.002 17.102  1.00 21.38 ? 274 ILE A CB  1 
ATOM   1770 C CG1 . ILE A 1 244 ? 43.524 38.514 17.517  1.00 19.63 ? 274 ILE A CG1 1 
ATOM   1771 C CG2 . ILE A 1 244 ? 42.233 40.661 17.438  1.00 19.47 ? 274 ILE A CG2 1 
ATOM   1772 C CD1 . ILE A 1 244 ? 43.580 38.277 19.041  1.00 21.69 ? 274 ILE A CD1 1 
ATOM   1773 N N   . GLY A 1 245 ? 45.798 38.663 15.065  1.00 19.31 ? 275 GLY A N   1 
ATOM   1774 C CA  . GLY A 1 245 ? 47.225 38.330 15.000  1.00 19.24 ? 275 GLY A CA  1 
ATOM   1775 C C   . GLY A 1 245 ? 47.810 38.792 13.683  1.00 19.89 ? 275 GLY A C   1 
ATOM   1776 O O   . GLY A 1 245 ? 48.619 39.716 13.639  1.00 19.99 ? 275 GLY A O   1 
ATOM   1777 N N   . ARG A 1 246 ? 47.368 38.165 12.601  1.00 20.11 ? 276 ARG A N   1 
ATOM   1778 C CA  . ARG A 1 246 ? 47.858 38.512 11.265  1.00 21.24 ? 276 ARG A CA  1 
ATOM   1779 C C   . ARG A 1 246 ? 47.406 39.908 10.808  1.00 23.06 ? 276 ARG A C   1 
ATOM   1780 O O   . ARG A 1 246 ? 48.191 40.635 10.195  1.00 19.70 ? 276 ARG A O   1 
ATOM   1781 C CB  . ARG A 1 246 ? 47.522 37.417 10.242  1.00 21.20 ? 276 ARG A CB  1 
ATOM   1782 C CG  . ARG A 1 246 ? 48.239 36.074 10.542  1.00 18.71 ? 276 ARG A CG  1 
ATOM   1783 C CD  . ARG A 1 246 ? 47.569 34.928 9.803   1.00 19.34 ? 276 ARG A CD  1 
ATOM   1784 N NE  . ARG A 1 246 ? 46.310 34.515 10.445  1.00 18.66 ? 276 ARG A NE  1 
ATOM   1785 C CZ  . ARG A 1 246 ? 45.527 33.551 9.986   1.00 21.82 ? 276 ARG A CZ  1 
ATOM   1786 N NH1 . ARG A 1 246 ? 45.886 32.879 8.883   1.00 16.43 ? 276 ARG A NH1 1 
ATOM   1787 N NH2 . ARG A 1 246 ? 44.397 33.247 10.639  1.00 17.25 ? 276 ARG A NH2 1 
ATOM   1788 N N   . THR A 1 247 ? 46.168 40.298 11.121  1.00 22.30 ? 277 THR A N   1 
ATOM   1789 C CA  . THR A 1 247 ? 45.715 41.667 10.847  1.00 20.65 ? 277 THR A CA  1 
ATOM   1790 C C   . THR A 1 247 ? 46.615 42.687 11.565  1.00 20.66 ? 277 THR A C   1 
ATOM   1791 O O   . THR A 1 247 ? 47.013 43.673 10.973  1.00 20.86 ? 277 THR A O   1 
ATOM   1792 C CB  . THR A 1 247 ? 44.250 41.889 11.305  1.00 21.89 ? 277 THR A CB  1 
ATOM   1793 O OG1 A THR A 1 247 ? 44.166 41.666 12.717  0.50 13.45 ? 277 THR A OG1 1 
ATOM   1794 O OG1 B THR A 1 247 ? 43.371 41.113 10.474  0.50 23.71 ? 277 THR A OG1 1 
ATOM   1795 C CG2 A THR A 1 247 ? 43.282 40.992 10.538  0.50 21.16 ? 277 THR A CG2 1 
ATOM   1796 C CG2 B THR A 1 247 ? 43.850 43.307 11.175  0.50 22.20 ? 277 THR A CG2 1 
ATOM   1797 N N   . GLY A 1 248 ? 46.906 42.453 12.852  1.00 19.55 ? 278 GLY A N   1 
ATOM   1798 C CA  . GLY A 1 248 ? 47.787 43.339 13.611  1.00 20.23 ? 278 GLY A CA  1 
ATOM   1799 C C   . GLY A 1 248 ? 49.174 43.433 13.000  1.00 20.75 ? 278 GLY A C   1 
ATOM   1800 O O   . GLY A 1 248 ? 49.729 44.525 12.870  1.00 19.65 ? 278 GLY A O   1 
ATOM   1801 N N   . CYS A 1 249 ? 49.734 42.297 12.591  1.00 20.04 ? 279 CYS A N   1 
ATOM   1802 C CA  . CYS A 1 249 ? 51.055 42.299 11.936  1.00 19.09 ? 279 CYS A CA  1 
ATOM   1803 C C   . CYS A 1 249 ? 51.044 43.107 10.648  1.00 21.46 ? 279 CYS A C   1 
ATOM   1804 O O   . CYS A 1 249 ? 51.966 43.889 10.404  1.00 19.74 ? 279 CYS A O   1 
ATOM   1805 C CB  . CYS A 1 249 ? 51.517 40.872 11.615  1.00 19.07 ? 279 CYS A CB  1 
ATOM   1806 S SG  . CYS A 1 249 ? 51.895 39.904 13.106  1.00 21.88 ? 279 CYS A SG  1 
ATOM   1807 N N   . PHE A 1 250 ? 50.004 42.924 9.832   1.00 19.44 ? 280 PHE A N   1 
ATOM   1808 C CA  . PHE A 1 250 ? 49.934 43.629 8.562   1.00 19.78 ? 280 PHE A CA  1 
ATOM   1809 C C   . PHE A 1 250 ? 49.794 45.139 8.791   1.00 18.53 ? 280 PHE A C   1 
ATOM   1810 O O   . PHE A 1 250 ? 50.516 45.951 8.173   1.00 18.85 ? 280 PHE A O   1 
ATOM   1811 C CB  . PHE A 1 250 ? 48.751 43.152 7.680   1.00 17.94 ? 280 PHE A CB  1 
ATOM   1812 C CG  . PHE A 1 250 ? 48.538 44.046 6.470   1.00 23.06 ? 280 PHE A CG  1 
ATOM   1813 C CD1 . PHE A 1 250 ? 49.355 43.918 5.351   1.00 25.01 ? 280 PHE A CD1 1 
ATOM   1814 C CD2 . PHE A 1 250 ? 47.592 45.082 6.505   1.00 23.80 ? 280 PHE A CD2 1 
ATOM   1815 C CE1 . PHE A 1 250 ? 49.217 44.781 4.256   1.00 25.60 ? 280 PHE A CE1 1 
ATOM   1816 C CE2 . PHE A 1 250 ? 47.457 45.953 5.432   1.00 24.16 ? 280 PHE A CE2 1 
ATOM   1817 C CZ  . PHE A 1 250 ? 48.270 45.788 4.295   1.00 25.39 ? 280 PHE A CZ  1 
ATOM   1818 N N   . ILE A 1 251 ? 48.876 45.527 9.674   1.00 18.06 ? 281 ILE A N   1 
ATOM   1819 C CA  . ILE A 1 251 ? 48.638 46.959 9.883   1.00 18.54 ? 281 ILE A CA  1 
ATOM   1820 C C   . ILE A 1 251 ? 49.866 47.604 10.541  1.00 20.33 ? 281 ILE A C   1 
ATOM   1821 O O   . ILE A 1 251 ? 50.272 48.703 10.143  1.00 19.00 ? 281 ILE A O   1 
ATOM   1822 C CB  . ILE A 1 251 ? 47.352 47.223 10.681  1.00 18.09 ? 281 ILE A CB  1 
ATOM   1823 C CG1 . ILE A 1 251 ? 46.130 46.837 9.835   1.00 19.05 ? 281 ILE A CG1 1 
ATOM   1824 C CG2 . ILE A 1 251 ? 47.283 48.701 11.112  1.00 16.68 ? 281 ILE A CG2 1 
ATOM   1825 C CD1 . ILE A 1 251 ? 44.798 46.750 10.684  1.00 19.72 ? 281 ILE A CD1 1 
ATOM   1826 N N   . ALA A 1 252 ? 50.445 46.939 11.549  1.00 18.83 ? 282 ALA A N   1 
ATOM   1827 C CA  . ALA A 1 252 ? 51.666 47.467 12.186  1.00 19.80 ? 282 ALA A CA  1 
ATOM   1828 C C   . ALA A 1 252 ? 52.808 47.632 11.187  1.00 17.81 ? 282 ALA A C   1 
ATOM   1829 O O   . ALA A 1 252 ? 53.585 48.585 11.283  1.00 19.70 ? 282 ALA A O   1 
ATOM   1830 C CB  . ALA A 1 252 ? 52.116 46.595 13.347  1.00 19.43 ? 282 ALA A CB  1 
ATOM   1831 N N   . THR A 1 253 ? 52.925 46.689 10.256  1.00 17.51 ? 283 THR A N   1 
ATOM   1832 C CA  . THR A 1 253 ? 53.950 46.777 9.214   1.00 17.85 ? 283 THR A CA  1 
ATOM   1833 C C   . THR A 1 253 ? 53.739 48.035 8.358   1.00 18.38 ? 283 THR A C   1 
ATOM   1834 O O   . THR A 1 253 ? 54.672 48.822 8.145   1.00 17.87 ? 283 THR A O   1 
ATOM   1835 C CB  . THR A 1 253 ? 54.029 45.500 8.359   1.00 19.20 ? 283 THR A CB  1 
ATOM   1836 O OG1 . THR A 1 253 ? 54.395 44.395 9.212   1.00 21.32 ? 283 THR A OG1 1 
ATOM   1837 C CG2 . THR A 1 253 ? 55.114 45.663 7.283   1.00 16.72 ? 283 THR A CG2 1 
ATOM   1838 N N   . ARG A 1 254 ? 52.513 48.269 7.915   1.00 20.12 ? 284 ARG A N   1 
ATOM   1839 C CA  . ARG A 1 254 ? 52.279 49.417 7.037   1.00 20.09 ? 284 ARG A CA  1 
ATOM   1840 C C   . ARG A 1 254 ? 52.524 50.736 7.778   1.00 19.26 ? 284 ARG A C   1 
ATOM   1841 O O   . ARG A 1 254 ? 53.155 51.644 7.244   1.00 19.79 ? 284 ARG A O   1 
ATOM   1842 C CB  . ARG A 1 254 ? 50.858 49.407 6.456   1.00 19.47 ? 284 ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 254 ? 50.644 50.650 5.530   1.00 24.20 ? 284 ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 254 ? 49.508 50.476 4.594   1.00 27.49 ? 284 ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 254 ? 49.395 51.627 3.685   1.00 25.19 ? 284 ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 254 ? 48.393 52.498 3.686   1.00 27.49 ? 284 ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 254 ? 47.402 52.395 4.572   1.00 21.41 ? 284 ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 254 ? 48.390 53.494 2.804   1.00 24.41 ? 284 ARG A NH2 1 
ATOM   1849 N N   . ILE A 1 255 ? 52.009 50.847 9.005   1.00 19.16 ? 285 ILE A N   1 
ATOM   1850 C CA  . ILE A 1 255 ? 52.229 52.059 9.811   1.00 20.30 ? 285 ILE A CA  1 
ATOM   1851 C C   . ILE A 1 255 ? 53.719 52.279 10.089  1.00 21.62 ? 285 ILE A C   1 
ATOM   1852 O O   . ILE A 1 255 ? 54.206 53.411 9.982   1.00 21.57 ? 285 ILE A O   1 
ATOM   1853 C CB  . ILE A 1 255 ? 51.452 52.008 11.143  1.00 19.84 ? 285 ILE A CB  1 
ATOM   1854 C CG1 . ILE A 1 255 ? 49.930 51.961 10.877  1.00 18.96 ? 285 ILE A CG1 1 
ATOM   1855 C CG2 . ILE A 1 255 ? 51.787 53.222 12.002  1.00 21.00 ? 285 ILE A CG2 1 
ATOM   1856 C CD1 . ILE A 1 255 ? 49.065 51.742 12.203  1.00 20.25 ? 285 ILE A CD1 1 
ATOM   1857 N N   . GLY A 1 256 ? 54.438 51.199 10.437  1.00 19.69 ? 286 GLY A N   1 
ATOM   1858 C CA  . GLY A 1 256 ? 55.908 51.263 10.616  1.00 17.34 ? 286 GLY A CA  1 
ATOM   1859 C C   . GLY A 1 256 ? 56.643 51.771 9.384   1.00 17.92 ? 286 GLY A C   1 
ATOM   1860 O O   . GLY A 1 256 ? 57.571 52.589 9.485   1.00 17.80 ? 286 GLY A O   1 
ATOM   1861 N N   . CYS A 1 257 ? 56.233 51.305 8.208   1.00 18.17 ? 287 CYS A N   1 
ATOM   1862 C CA  . CYS A 1 257 ? 56.845 51.776 6.960   1.00 17.63 ? 287 CYS A CA  1 
ATOM   1863 C C   . CYS A 1 257 ? 56.582 53.261 6.768   1.00 18.69 ? 287 CYS A C   1 
ATOM   1864 O O   . CYS A 1 257 ? 57.463 54.006 6.347   1.00 19.23 ? 287 CYS A O   1 
ATOM   1865 C CB  . CYS A 1 257 ? 56.290 51.011 5.752   1.00 20.09 ? 287 CYS A CB  1 
ATOM   1866 S SG  . CYS A 1 257 ? 56.824 49.260 5.700   1.00 22.42 ? 287 CYS A SG  1 
ATOM   1867 N N   . GLN A 1 258 ? 55.359 53.682 7.077   1.00 19.15 ? 288 GLN A N   1 
ATOM   1868 C CA  . GLN A 1 258 ? 54.969 55.083 6.935   1.00 20.24 ? 288 GLN A CA  1 
ATOM   1869 C C   . GLN A 1 258 ? 55.776 55.983 7.858   1.00 20.22 ? 288 GLN A C   1 
ATOM   1870 O O   . GLN A 1 258 ? 56.232 57.074 7.459   1.00 21.36 ? 288 GLN A O   1 
ATOM   1871 C CB  . GLN A 1 258 ? 53.476 55.228 7.195   1.00 20.12 ? 288 GLN A CB  1 
ATOM   1872 C CG  . GLN A 1 258 ? 52.615 54.651 6.091   1.00 19.75 ? 288 GLN A CG  1 
ATOM   1873 C CD  . GLN A 1 258 ? 51.161 54.660 6.483   1.00 22.40 ? 288 GLN A CD  1 
ATOM   1874 O OE1 . GLN A 1 258 ? 50.799 54.125 7.520   1.00 25.79 ? 288 GLN A OE1 1 
ATOM   1875 N NE2 . GLN A 1 258 ? 50.326 55.313 5.681   1.00 23.62 ? 288 GLN A NE2 1 
ATOM   1876 N N   . GLN A 1 259 ? 55.976 55.517 9.087   1.00 19.46 ? 289 GLN A N   1 
ATOM   1877 C CA  . GLN A 1 259 ? 56.828 56.219 10.053  1.00 22.02 ? 289 GLN A CA  1 
ATOM   1878 C C   . GLN A 1 259 ? 58.278 56.301 9.577   1.00 22.15 ? 289 GLN A C   1 
ATOM   1879 O O   . GLN A 1 259 ? 58.902 57.359 9.652   1.00 21.41 ? 289 GLN A O   1 
ATOM   1880 C CB  . GLN A 1 259 ? 56.778 55.555 11.429  1.00 22.11 ? 289 GLN A CB  1 
ATOM   1881 C CG  . GLN A 1 259 ? 55.424 55.736 12.153  1.00 24.53 ? 289 GLN A CG  1 
ATOM   1882 C CD  . GLN A 1 259 ? 55.487 55.331 13.616  1.00 25.66 ? 289 GLN A CD  1 
ATOM   1883 O OE1 . GLN A 1 259 ? 56.577 55.099 14.150  1.00 22.90 ? 289 GLN A OE1 1 
ATOM   1884 N NE2 . GLN A 1 259 ? 54.318 55.260 14.284  1.00 19.41 ? 289 GLN A NE2 1 
ATOM   1885 N N   . LEU A 1 260 ? 58.824 55.186 9.084   1.00 20.31 ? 290 LEU A N   1 
ATOM   1886 C CA  . LEU A 1 260 ? 60.206 55.219 8.622   1.00 21.17 ? 290 LEU A CA  1 
ATOM   1887 C C   . LEU A 1 260 ? 60.369 56.183 7.455   1.00 19.96 ? 290 LEU A C   1 
ATOM   1888 O O   . LEU A 1 260 ? 61.328 56.937 7.406   1.00 20.75 ? 290 LEU A O   1 
ATOM   1889 C CB  . LEU A 1 260 ? 60.711 53.811 8.242   1.00 19.99 ? 290 LEU A CB  1 
ATOM   1890 C CG  . LEU A 1 260 ? 61.162 52.919 9.394   1.00 22.27 ? 290 LEU A CG  1 
ATOM   1891 C CD1 . LEU A 1 260 ? 61.363 51.469 8.887   1.00 23.32 ? 290 LEU A CD1 1 
ATOM   1892 C CD2 . LEU A 1 260 ? 62.448 53.471 9.991   1.00 18.54 ? 290 LEU A CD2 1 
ATOM   1893 N N   . LYS A 1 261 ? 59.432 56.144 6.515   1.00 21.43 ? 291 LYS A N   1 
ATOM   1894 C CA  . LYS A 1 261 ? 59.515 56.960 5.304   1.00 22.63 ? 291 LYS A CA  1 
ATOM   1895 C C   . LYS A 1 261 ? 59.376 58.453 5.648   1.00 24.50 ? 291 LYS A C   1 
ATOM   1896 O O   . LYS A 1 261 ? 60.123 59.295 5.116   1.00 24.58 ? 291 LYS A O   1 
ATOM   1897 C CB  . LYS A 1 261 ? 58.430 56.545 4.302   1.00 22.36 ? 291 LYS A CB  1 
ATOM   1898 C CG  . LYS A 1 261 ? 58.518 57.311 2.982   1.00 25.97 ? 291 LYS A CG  1 
ATOM   1899 C CD  . LYS A 1 261 ? 57.592 56.784 1.914   1.00 30.10 ? 291 LYS A CD  1 
ATOM   1900 C CE  . LYS A 1 261 ? 57.765 57.618 0.647   1.00 39.41 ? 291 LYS A CE  1 
ATOM   1901 N NZ  . LYS A 1 261 ? 56.868 57.196 -0.461  1.00 47.78 ? 291 LYS A NZ  1 
ATOM   1902 N N   . ALA A 1 262 ? 58.441 58.776 6.545   1.00 22.91 ? 292 ALA A N   1 
ATOM   1903 C CA  . ALA A 1 262 ? 58.192 60.176 6.919   1.00 24.31 ? 292 ALA A CA  1 
ATOM   1904 C C   . ALA A 1 262 ? 59.212 60.729 7.897   1.00 25.29 ? 292 ALA A C   1 
ATOM   1905 O O   . ALA A 1 262 ? 59.638 61.862 7.738   1.00 25.78 ? 292 ALA A O   1 
ATOM   1906 C CB  . ALA A 1 262 ? 56.812 60.362 7.458   1.00 25.46 ? 292 ALA A CB  1 
ATOM   1907 N N   . ARG A 1 263 ? 59.626 59.935 8.882   1.00 27.06 ? 293 ARG A N   1 
ATOM   1908 C CA  . ARG A 1 263 ? 60.456 60.454 9.978   1.00 29.68 ? 293 ARG A CA  1 
ATOM   1909 C C   . ARG A 1 263 ? 61.857 59.872 10.100  1.00 26.87 ? 293 ARG A C   1 
ATOM   1910 O O   . ARG A 1 263 ? 62.656 60.377 10.880  1.00 26.42 ? 293 ARG A O   1 
ATOM   1911 C CB  . ARG A 1 263 ? 59.749 60.275 11.328  1.00 30.16 ? 293 ARG A CB  1 
ATOM   1912 C CG  . ARG A 1 263 ? 58.247 60.537 11.347  1.00 39.88 ? 293 ARG A CG  1 
ATOM   1913 C CD  . ARG A 1 263 ? 57.763 60.627 12.798  1.00 40.15 ? 293 ARG A CD  1 
ATOM   1914 N NE  . ARG A 1 263 ? 56.673 59.703 13.138  1.00 55.92 ? 293 ARG A NE  1 
ATOM   1915 C CZ  . ARG A 1 263 ? 55.410 60.067 13.367  1.00 57.32 ? 293 ARG A CZ  1 
ATOM   1916 N NH1 . ARG A 1 263 ? 55.042 61.342 13.267  1.00 61.29 ? 293 ARG A NH1 1 
ATOM   1917 N NH2 . ARG A 1 263 ? 54.508 59.153 13.696  1.00 53.82 ? 293 ARG A NH2 1 
ATOM   1918 N N   . GLY A 1 264 ? 62.150 58.779 9.396   1.00 25.85 ? 294 GLY A N   1 
ATOM   1919 C CA  . GLY A 1 264 ? 63.458 58.131 9.536   1.00 24.72 ? 294 GLY A CA  1 
ATOM   1920 C C   . GLY A 1 264 ? 63.672 57.448 10.879  1.00 25.25 ? 294 GLY A C   1 
ATOM   1921 O O   . GLY A 1 264 ? 64.810 57.190 11.278  1.00 23.59 ? 294 GLY A O   1 
ATOM   1922 N N   . GLU A 1 265 ? 62.568 57.170 11.578  1.00 23.11 ? 295 GLU A N   1 
ATOM   1923 C CA  . GLU A 1 265 ? 62.582 56.427 12.826  1.00 27.58 ? 295 GLU A CA  1 
ATOM   1924 C C   . GLU A 1 265 ? 61.223 55.765 12.989  1.00 24.65 ? 295 GLU A C   1 
ATOM   1925 O O   . GLU A 1 265 ? 60.253 56.158 12.339  1.00 24.38 ? 295 GLU A O   1 
ATOM   1926 C CB  . GLU A 1 265 ? 62.928 57.321 14.039  1.00 26.56 ? 295 GLU A CB  1 
ATOM   1927 C CG  . GLU A 1 265 ? 61.890 58.351 14.382  1.00 33.67 ? 295 GLU A CG  1 
ATOM   1928 C CD  . GLU A 1 265 ? 62.209 59.158 15.658  1.00 35.77 ? 295 GLU A CD  1 
ATOM   1929 O OE1 . GLU A 1 265 ? 63.100 58.772 16.455  1.00 46.24 ? 295 GLU A OE1 1 
ATOM   1930 O OE2 . GLU A 1 265 ? 61.539 60.198 15.849  1.00 53.43 ? 295 GLU A OE2 1 
ATOM   1931 N N   . VAL A 1 266 ? 61.158 54.735 13.830  1.00 23.79 ? 296 VAL A N   1 
ATOM   1932 C CA  . VAL A 1 266 ? 59.902 54.030 14.051  1.00 22.38 ? 296 VAL A CA  1 
ATOM   1933 C C   . VAL A 1 266 ? 59.773 53.696 15.543  1.00 24.81 ? 296 VAL A C   1 
ATOM   1934 O O   . VAL A 1 266 ? 60.757 53.359 16.194  1.00 24.55 ? 296 VAL A O   1 
ATOM   1935 C CB  . VAL A 1 266 ? 59.767 52.763 13.122  1.00 23.36 ? 296 VAL A CB  1 
ATOM   1936 C CG1 . VAL A 1 266 ? 60.882 51.748 13.371  1.00 19.98 ? 296 VAL A CG1 1 
ATOM   1937 C CG2 . VAL A 1 266 ? 58.392 52.080 13.283  1.00 19.76 ? 296 VAL A CG2 1 
ATOM   1938 N N   . ASP A 1 267 ? 58.567 53.844 16.092  1.00 23.95 ? 297 ASP A N   1 
ATOM   1939 C CA  . ASP A 1 267 ? 58.313 53.410 17.466  1.00 21.80 ? 297 ASP A CA  1 
ATOM   1940 C C   . ASP A 1 267 ? 57.377 52.190 17.387  1.00 20.25 ? 297 ASP A C   1 
ATOM   1941 O O   . ASP A 1 267 ? 56.158 52.310 17.334  1.00 18.80 ? 297 ASP A O   1 
ATOM   1942 C CB  . ASP A 1 267 ? 57.746 54.590 18.286  1.00 22.92 ? 297 ASP A CB  1 
ATOM   1943 C CG  . ASP A 1 267 ? 57.490 54.231 19.750  1.00 24.00 ? 297 ASP A CG  1 
ATOM   1944 O OD1 . ASP A 1 267 ? 57.633 53.049 20.151  1.00 22.74 ? 297 ASP A OD1 1 
ATOM   1945 O OD2 . ASP A 1 267 ? 57.133 55.148 20.504  1.00 27.07 ? 297 ASP A OD2 1 
ATOM   1946 N N   . ILE A 1 268 ? 57.971 51.003 17.341  1.00 18.69 ? 298 ILE A N   1 
ATOM   1947 C CA  . ILE A 1 268 ? 57.199 49.783 17.123  1.00 19.46 ? 298 ILE A CA  1 
ATOM   1948 C C   . ILE A 1 268 ? 56.350 49.455 18.349  1.00 19.48 ? 298 ILE A C   1 
ATOM   1949 O O   . ILE A 1 268 ? 55.200 49.057 18.213  1.00 19.44 ? 298 ILE A O   1 
ATOM   1950 C CB  . ILE A 1 268 ? 58.114 48.610 16.751  1.00 16.77 ? 298 ILE A CB  1 
ATOM   1951 C CG1 . ILE A 1 268 ? 58.769 48.907 15.392  1.00 18.18 ? 298 ILE A CG1 1 
ATOM   1952 C CG2 . ILE A 1 268 ? 57.311 47.298 16.664  1.00 17.52 ? 298 ILE A CG2 1 
ATOM   1953 C CD1 . ILE A 1 268 ? 59.893 47.979 14.992  1.00 18.09 ? 298 ILE A CD1 1 
ATOM   1954 N N   . LEU A 1 269 ? 56.930 49.614 19.539  1.00 17.74 ? 299 LEU A N   1 
ATOM   1955 C CA  . LEU A 1 269 ? 56.186 49.445 20.767  1.00 18.71 ? 299 LEU A CA  1 
ATOM   1956 C C   . LEU A 1 269 ? 54.938 50.358 20.798  1.00 19.69 ? 299 LEU A C   1 
ATOM   1957 O O   . LEU A 1 269 ? 53.836 49.902 21.137  1.00 20.29 ? 299 LEU A O   1 
ATOM   1958 C CB  . LEU A 1 269 ? 57.108 49.681 21.982  1.00 18.94 ? 299 LEU A CB  1 
ATOM   1959 C CG  . LEU A 1 269 ? 56.471 49.666 23.386  1.00 22.09 ? 299 LEU A CG  1 
ATOM   1960 C CD1 . LEU A 1 269 ? 55.730 48.335 23.629  1.00 19.86 ? 299 LEU A CD1 1 
ATOM   1961 C CD2 . LEU A 1 269 ? 57.533 49.877 24.463  1.00 18.21 ? 299 LEU A CD2 1 
ATOM   1962 N N   . GLY A 1 270 ? 55.106 51.631 20.431  1.00 18.29 ? 300 GLY A N   1 
ATOM   1963 C CA  . GLY A 1 270 ? 53.994 52.577 20.405  1.00 18.59 ? 300 GLY A CA  1 
ATOM   1964 C C   . GLY A 1 270 ? 52.947 52.152 19.389  1.00 18.49 ? 300 GLY A C   1 
ATOM   1965 O O   . GLY A 1 270 ? 51.758 52.202 19.670  1.00 19.05 ? 300 GLY A O   1 
ATOM   1966 N N   . ILE A 1 271 ? 53.380 51.721 18.203  1.00 18.72 ? 301 ILE A N   1 
ATOM   1967 C CA  . ILE A 1 271 ? 52.441 51.238 17.181  1.00 20.06 ? 301 ILE A CA  1 
ATOM   1968 C C   . ILE A 1 271 ? 51.541 50.107 17.707  1.00 19.70 ? 301 ILE A C   1 
ATOM   1969 O O   . ILE A 1 271 ? 50.322 50.155 17.529  1.00 18.76 ? 301 ILE A O   1 
ATOM   1970 C CB  . ILE A 1 271 ? 53.168 50.771 15.866  1.00 20.77 ? 301 ILE A CB  1 
ATOM   1971 C CG1 . ILE A 1 271 ? 53.717 51.983 15.102  1.00 21.66 ? 301 ILE A CG1 1 
ATOM   1972 C CG2 . ILE A 1 271 ? 52.200 49.937 14.979  1.00 19.05 ? 301 ILE A CG2 1 
ATOM   1973 C CD1 . ILE A 1 271 ? 54.797 51.664 14.044  1.00 23.37 ? 301 ILE A CD1 1 
ATOM   1974 N N   . VAL A 1 272 ? 52.149 49.090 18.332  1.00 18.88 ? 302 VAL A N   1 
ATOM   1975 C CA  . VAL A 1 272 ? 51.401 47.953 18.870  1.00 18.59 ? 302 VAL A CA  1 
ATOM   1976 C C   . VAL A 1 272 ? 50.452 48.383 19.994  1.00 20.76 ? 302 VAL A C   1 
ATOM   1977 O O   . VAL A 1 272 ? 49.284 47.960 20.025  1.00 20.32 ? 302 VAL A O   1 
ATOM   1978 C CB  . VAL A 1 272 ? 52.335 46.773 19.275  1.00 17.27 ? 302 VAL A CB  1 
ATOM   1979 C CG1 . VAL A 1 272 ? 51.523 45.624 19.873  1.00 19.39 ? 302 VAL A CG1 1 
ATOM   1980 C CG2 . VAL A 1 272 ? 53.103 46.267 18.015  1.00 19.50 ? 302 VAL A CG2 1 
ATOM   1981 N N   . CYS A 1 273 ? 50.926 49.264 20.875  1.00 21.19 ? 303 CYS A N   1 
ATOM   1982 C CA  . CYS A 1 273 ? 50.071 49.809 21.945  1.00 21.03 ? 303 CYS A CA  1 
ATOM   1983 C C   . CYS A 1 273 ? 48.842 50.514 21.368  1.00 21.15 ? 303 CYS A C   1 
ATOM   1984 O O   . CYS A 1 273 ? 47.735 50.327 21.860  1.00 17.95 ? 303 CYS A O   1 
ATOM   1985 C CB  . CYS A 1 273 ? 50.857 50.778 22.835  1.00 20.16 ? 303 CYS A CB  1 
ATOM   1986 S SG  . CYS A 1 273 ? 52.031 49.976 23.931  1.00 23.49 ? 303 CYS A SG  1 
ATOM   1987 N N   . GLN A 1 274 ? 49.036 51.316 20.326  1.00 19.35 ? 304 GLN A N   1 
ATOM   1988 C CA  . GLN A 1 274 ? 47.898 52.038 19.707  1.00 19.70 ? 304 GLN A CA  1 
ATOM   1989 C C   . GLN A 1 274 ? 46.913 51.087 19.028  1.00 20.21 ? 304 GLN A C   1 
ATOM   1990 O O   . GLN A 1 274 ? 45.698 51.305 19.067  1.00 20.34 ? 304 GLN A O   1 
ATOM   1991 C CB  . GLN A 1 274 ? 48.390 53.099 18.714  1.00 21.19 ? 304 GLN A CB  1 
ATOM   1992 C CG  . GLN A 1 274 ? 49.214 54.243 19.321  1.00 20.10 ? 304 GLN A CG  1 
ATOM   1993 C CD  . GLN A 1 274 ? 48.548 54.978 20.478  1.00 28.42 ? 304 GLN A CD  1 
ATOM   1994 O OE1 . GLN A 1 274 ? 47.350 55.282 20.458  1.00 22.67 ? 304 GLN A OE1 1 
ATOM   1995 N NE2 . GLN A 1 274 ? 49.346 55.310 21.480  1.00 30.35 ? 304 GLN A NE2 1 
ATOM   1996 N N   . LEU A 1 275 ? 47.439 50.043 18.388  1.00 18.89 ? 305 LEU A N   1 
ATOM   1997 C CA  . LEU A 1 275 ? 46.606 49.002 17.803  1.00 19.80 ? 305 LEU A CA  1 
ATOM   1998 C C   . LEU A 1 275 ? 45.734 48.305 18.866  1.00 21.02 ? 305 LEU A C   1 
ATOM   1999 O O   . LEU A 1 275 ? 44.567 48.073 18.618  1.00 21.44 ? 305 LEU A O   1 
ATOM   2000 C CB  . LEU A 1 275 ? 47.455 47.959 17.066  1.00 19.20 ? 305 LEU A CB  1 
ATOM   2001 C CG  . LEU A 1 275 ? 48.122 48.401 15.750  1.00 20.67 ? 305 LEU A CG  1 
ATOM   2002 C CD1 . LEU A 1 275 ? 48.922 47.221 15.179  1.00 22.15 ? 305 LEU A CD1 1 
ATOM   2003 C CD2 . LEU A 1 275 ? 47.039 48.892 14.761  1.00 21.86 ? 305 LEU A CD2 1 
ATOM   2004 N N   . ARG A 1 276 ? 46.318 47.982 20.026  1.00 18.21 ? 306 ARG A N   1 
ATOM   2005 C CA  . ARG A 1 276 ? 45.591 47.364 21.144  1.00 21.18 ? 306 ARG A CA  1 
ATOM   2006 C C   . ARG A 1 276 ? 44.504 48.261 21.743  1.00 18.77 ? 306 ARG A C   1 
ATOM   2007 O O   . ARG A 1 276 ? 43.488 47.759 22.241  1.00 21.00 ? 306 ARG A O   1 
ATOM   2008 C CB  . ARG A 1 276 ? 46.565 46.938 22.231  1.00 19.93 ? 306 ARG A CB  1 
ATOM   2009 C CG  . ARG A 1 276 ? 47.626 45.926 21.750  1.00 24.93 ? 306 ARG A CG  1 
ATOM   2010 C CD  . ARG A 1 276 ? 47.404 44.586 22.306  1.00 23.89 ? 306 ARG A CD  1 
ATOM   2011 N NE  . ARG A 1 276 ? 48.297 43.566 21.755  1.00 21.00 ? 306 ARG A NE  1 
ATOM   2012 C CZ  . ARG A 1 276 ? 49.132 42.827 22.469  1.00 18.63 ? 306 ARG A CZ  1 
ATOM   2013 N NH1 . ARG A 1 276 ? 49.233 43.000 23.796  1.00 19.47 ? 306 ARG A NH1 1 
ATOM   2014 N NH2 . ARG A 1 276 ? 49.870 41.906 21.850  1.00 21.42 ? 306 ARG A NH2 1 
ATOM   2015 N N   . LEU A 1 277 ? 44.717 49.580 21.723  1.00 17.46 ? 307 LEU A N   1 
ATOM   2016 C CA  . LEU A 1 277 ? 43.647 50.515 22.079  1.00 20.10 ? 307 LEU A CA  1 
ATOM   2017 C C   . LEU A 1 277 ? 42.449 50.397 21.135  1.00 21.32 ? 307 LEU A C   1 
ATOM   2018 O O   . LEU A 1 277 ? 41.281 50.484 21.582  1.00 21.14 ? 307 LEU A O   1 
ATOM   2019 C CB  . LEU A 1 277 ? 44.147 51.973 22.123  1.00 19.73 ? 307 LEU A CB  1 
ATOM   2020 C CG  . LEU A 1 277 ? 45.077 52.247 23.313  1.00 20.10 ? 307 LEU A CG  1 
ATOM   2021 C CD1 . LEU A 1 277 ? 45.788 53.571 23.091  1.00 17.63 ? 307 LEU A CD1 1 
ATOM   2022 C CD2 . LEU A 1 277 ? 44.295 52.247 24.614  1.00 17.10 ? 307 LEU A CD2 1 
ATOM   2023 N N   . ASP A 1 278 ? 42.736 50.164 19.854  1.00 20.09 ? 308 ASP A N   1 
ATOM   2024 C CA  . ASP A 1 278 ? 41.716 50.032 18.800  1.00 21.62 ? 308 ASP A CA  1 
ATOM   2025 C C   . ASP A 1 278 ? 41.011 48.673 18.776  1.00 22.62 ? 308 ASP A C   1 
ATOM   2026 O O   . ASP A 1 278 ? 39.812 48.607 18.529  1.00 21.79 ? 308 ASP A O   1 
ATOM   2027 C CB  . ASP A 1 278 ? 42.310 50.325 17.411  1.00 21.01 ? 308 ASP A CB  1 
ATOM   2028 C CG  . ASP A 1 278 ? 42.937 51.718 17.308  1.00 29.57 ? 308 ASP A CG  1 
ATOM   2029 O OD1 . ASP A 1 278 ? 42.616 52.578 18.145  1.00 24.62 ? 308 ASP A OD1 1 
ATOM   2030 O OD2 . ASP A 1 278 ? 43.762 51.951 16.388  1.00 23.21 ? 308 ASP A OD2 1 
ATOM   2031 N N   . ARG A 1 279 ? 41.756 47.600 19.049  1.00 21.65 ? 309 ARG A N   1 
ATOM   2032 C CA  . ARG A 1 279 ? 41.193 46.252 19.091  1.00 21.35 ? 309 ARG A CA  1 
ATOM   2033 C C   . ARG A 1 279 ? 42.093 45.387 19.961  1.00 20.77 ? 309 ARG A C   1 
ATOM   2034 O O   . ARG A 1 279 ? 43.286 45.233 19.680  1.00 19.94 ? 309 ARG A O   1 
ATOM   2035 C CB  . ARG A 1 279 ? 41.065 45.673 17.670  1.00 20.45 ? 309 ARG A CB  1 
ATOM   2036 C CG  . ARG A 1 279 ? 40.583 44.189 17.577  1.00 20.51 ? 309 ARG A CG  1 
ATOM   2037 C CD  . ARG A 1 279 ? 40.219 43.898 16.106  1.00 20.03 ? 309 ARG A CD  1 
ATOM   2038 N NE  . ARG A 1 279 ? 39.823 42.504 15.857  1.00 19.97 ? 309 ARG A NE  1 
ATOM   2039 C CZ  . ARG A 1 279 ? 38.596 42.000 16.005  1.00 26.71 ? 309 ARG A CZ  1 
ATOM   2040 N NH1 . ARG A 1 279 ? 37.578 42.754 16.416  1.00 22.19 ? 309 ARG A NH1 1 
ATOM   2041 N NH2 . ARG A 1 279 ? 38.385 40.714 15.735  1.00 22.92 ? 309 ARG A NH2 1 
ATOM   2042 N N   . GLY A 1 280 ? 41.522 44.835 21.028  1.00 20.23 ? 310 GLY A N   1 
ATOM   2043 C CA  . GLY A 1 280 ? 42.305 44.032 21.970  1.00 19.23 ? 310 GLY A CA  1 
ATOM   2044 C C   . GLY A 1 280 ? 43.038 42.895 21.278  1.00 21.55 ? 310 GLY A C   1 
ATOM   2045 O O   . GLY A 1 280 ? 42.511 42.290 20.332  1.00 21.19 ? 310 GLY A O   1 
ATOM   2046 N N   . GLY A 1 281 ? 44.273 42.651 21.726  1.00 20.84 ? 311 GLY A N   1 
ATOM   2047 C CA  . GLY A 1 281 ? 45.059 41.484 21.322  1.00 21.50 ? 311 GLY A CA  1 
ATOM   2048 C C   . GLY A 1 281 ? 45.792 41.543 19.982  1.00 22.03 ? 311 GLY A C   1 
ATOM   2049 O O   . GLY A 1 281 ? 46.391 40.543 19.580  1.00 19.12 ? 311 GLY A O   1 
ATOM   2050 N N   . MET A 1 282 ? 45.753 42.688 19.290  1.00 20.49 ? 312 MET A N   1 
ATOM   2051 C CA  . MET A 1 282 ? 46.430 42.828 17.985  1.00 19.90 ? 312 MET A CA  1 
ATOM   2052 C C   . MET A 1 282 ? 47.922 42.477 18.111  1.00 20.73 ? 312 MET A C   1 
ATOM   2053 O O   . MET A 1 282 ? 48.594 43.010 18.995  1.00 19.89 ? 312 MET A O   1 
ATOM   2054 C CB  . MET A 1 282 ? 46.286 44.261 17.472  1.00 19.70 ? 312 MET A CB  1 
ATOM   2055 C CG  . MET A 1 282 ? 44.821 44.700 17.194  1.00 21.68 ? 312 MET A CG  1 
ATOM   2056 S SD  . MET A 1 282 ? 44.262 44.064 15.602  1.00 28.65 ? 312 MET A SD  1 
ATOM   2057 C CE  . MET A 1 282 ? 44.772 45.354 14.498  1.00 24.78 ? 312 MET A CE  1 
ATOM   2058 N N   . ILE A 1 283 ? 48.396 41.603 17.210  1.00 18.60 ? 313 ILE A N   1 
ATOM   2059 C CA  . ILE A 1 283 ? 49.709 40.911 17.232  1.00 18.62 ? 313 ILE A CA  1 
ATOM   2060 C C   . ILE A 1 283 ? 49.747 39.901 18.380  1.00 20.83 ? 313 ILE A C   1 
ATOM   2061 O O   . ILE A 1 283 ? 49.777 40.280 19.555  1.00 20.18 ? 313 ILE A O   1 
ATOM   2062 C CB  . ILE A 1 283 ? 50.937 41.861 17.274  1.00 18.12 ? 313 ILE A CB  1 
ATOM   2063 C CG1 . ILE A 1 283 ? 50.837 42.899 16.127  1.00 20.19 ? 313 ILE A CG1 1 
ATOM   2064 C CG2 . ILE A 1 283 ? 52.266 41.030 17.244  1.00 17.53 ? 313 ILE A CG2 1 
ATOM   2065 C CD1 . ILE A 1 283 ? 52.138 43.483 15.740  1.00 26.41 ? 313 ILE A CD1 1 
ATOM   2066 N N   . GLN A 1 284 ? 49.707 38.618 18.042  1.00 19.96 ? 314 GLN A N   1 
ATOM   2067 C CA  . GLN A 1 284 ? 49.511 37.590 19.078  1.00 20.04 ? 314 GLN A CA  1 
ATOM   2068 C C   . GLN A 1 284 ? 50.777 37.046 19.729  1.00 21.57 ? 314 GLN A C   1 
ATOM   2069 O O   . GLN A 1 284 ? 50.753 36.602 20.880  1.00 19.49 ? 314 GLN A O   1 
ATOM   2070 C CB  . GLN A 1 284 ? 48.657 36.433 18.506  1.00 17.94 ? 314 GLN A CB  1 
ATOM   2071 C CG  . GLN A 1 284 ? 47.149 36.832 18.329  1.00 20.73 ? 314 GLN A CG  1 
ATOM   2072 C CD  . GLN A 1 284 ? 46.334 35.671 17.814  1.00 23.77 ? 314 GLN A CD  1 
ATOM   2073 O OE1 . GLN A 1 284 ? 46.599 35.162 16.724  1.00 25.97 ? 314 GLN A OE1 1 
ATOM   2074 N NE2 . GLN A 1 284 ? 45.375 35.202 18.620  1.00 24.59 ? 314 GLN A NE2 1 
ATOM   2075 N N   . THR A 1 285 ? 51.891 37.021 18.996  1.00 19.82 ? 315 THR A N   1 
ATOM   2076 C CA  . THR A 1 285 ? 53.037 36.282 19.544  1.00 19.29 ? 315 THR A CA  1 
ATOM   2077 C C   . THR A 1 285 ? 54.305 37.124 19.549  1.00 20.69 ? 315 THR A C   1 
ATOM   2078 O O   . THR A 1 285 ? 54.455 38.020 18.712  1.00 19.22 ? 315 THR A O   1 
ATOM   2079 C CB  . THR A 1 285 ? 53.321 34.971 18.763  1.00 20.84 ? 315 THR A CB  1 
ATOM   2080 O OG1 . THR A 1 285 ? 53.984 35.285 17.533  1.00 19.09 ? 315 THR A OG1 1 
ATOM   2081 C CG2 . THR A 1 285 ? 52.023 34.152 18.477  1.00 19.50 ? 315 THR A CG2 1 
ATOM   2082 N N   . ALA A 1 286 ? 55.229 36.816 20.472  1.00 18.05 ? 316 ALA A N   1 
ATOM   2083 C CA  . ALA A 1 286 ? 56.536 37.486 20.497  1.00 18.96 ? 316 ALA A CA  1 
ATOM   2084 C C   . ALA A 1 286 ? 57.293 37.286 19.189  1.00 18.03 ? 316 ALA A C   1 
ATOM   2085 O O   . ALA A 1 286 ? 57.989 38.194 18.722  1.00 18.11 ? 316 ALA A O   1 
ATOM   2086 C CB  . ALA A 1 286 ? 57.401 37.002 21.686  1.00 17.21 ? 316 ALA A CB  1 
ATOM   2087 N N   . GLU A 1 287 ? 57.151 36.109 18.575  1.00 17.91 ? 317 GLU A N   1 
ATOM   2088 C CA  . GLU A 1 287 ? 57.779 35.874 17.268  1.00 20.63 ? 317 GLU A CA  1 
ATOM   2089 C C   . GLU A 1 287 ? 57.264 36.823 16.159  1.00 19.28 ? 317 GLU A C   1 
ATOM   2090 O O   . GLU A 1 287 ? 58.034 37.307 15.310  1.00 17.20 ? 317 GLU A O   1 
ATOM   2091 C CB  . GLU A 1 287 ? 57.585 34.416 16.841  1.00 18.58 ? 317 GLU A CB  1 
ATOM   2092 C CG  . GLU A 1 287 ? 58.329 34.077 15.556  1.00 27.08 ? 317 GLU A CG  1 
ATOM   2093 C CD  . GLU A 1 287 ? 58.020 32.680 15.015  1.00 31.80 ? 317 GLU A CD  1 
ATOM   2094 O OE1 . GLU A 1 287 ? 56.889 32.147 15.216  1.00 37.20 ? 317 GLU A OE1 1 
ATOM   2095 O OE2 . GLU A 1 287 ? 58.923 32.125 14.359  1.00 43.89 ? 317 GLU A OE2 1 
ATOM   2096 N N   . GLN A 1 288 ? 55.957 37.057 16.131  1.00 20.24 ? 318 GLN A N   1 
ATOM   2097 C CA  . GLN A 1 288 ? 55.399 38.080 15.233  1.00 18.47 ? 318 GLN A CA  1 
ATOM   2098 C C   . GLN A 1 288 ? 55.967 39.482 15.514  1.00 19.14 ? 318 GLN A C   1 
ATOM   2099 O O   . GLN A 1 288 ? 56.280 40.228 14.589  1.00 19.35 ? 318 GLN A O   1 
ATOM   2100 C CB  . GLN A 1 288 ? 53.878 38.084 15.339  1.00 17.48 ? 318 GLN A CB  1 
ATOM   2101 C CG  . GLN A 1 288 ? 53.232 36.823 14.711  1.00 16.73 ? 318 GLN A CG  1 
ATOM   2102 C CD  . GLN A 1 288 ? 51.746 36.722 14.978  1.00 20.67 ? 318 GLN A CD  1 
ATOM   2103 O OE1 . GLN A 1 288 ? 51.222 37.358 15.898  1.00 20.14 ? 318 GLN A OE1 1 
ATOM   2104 N NE2 . GLN A 1 288 ? 51.053 35.907 14.177  1.00 17.89 ? 318 GLN A NE2 1 
ATOM   2105 N N   . TYR A 1 289 ? 56.090 39.847 16.792  1.00 19.17 ? 319 TYR A N   1 
ATOM   2106 C CA  . TYR A 1 289 ? 56.649 41.144 17.191  1.00 18.46 ? 319 TYR A CA  1 
ATOM   2107 C C   . TYR A 1 289 ? 58.106 41.314 16.756  1.00 20.41 ? 319 TYR A C   1 
ATOM   2108 O O   . TYR A 1 289 ? 58.517 42.373 16.279  1.00 21.17 ? 319 TYR A O   1 
ATOM   2109 C CB  . TYR A 1 289 ? 56.539 41.251 18.712  1.00 19.92 ? 319 TYR A CB  1 
ATOM   2110 C CG  . TYR A 1 289 ? 56.817 42.624 19.290  1.00 21.27 ? 319 TYR A CG  1 
ATOM   2111 C CD1 . TYR A 1 289 ? 55.944 43.705 19.036  1.00 19.72 ? 319 TYR A CD1 1 
ATOM   2112 C CD2 . TYR A 1 289 ? 57.928 42.835 20.119  1.00 21.60 ? 319 TYR A CD2 1 
ATOM   2113 C CE1 . TYR A 1 289 ? 56.184 44.973 19.602  1.00 19.88 ? 319 TYR A CE1 1 
ATOM   2114 C CE2 . TYR A 1 289 ? 58.181 44.098 20.679  1.00 18.65 ? 319 TYR A CE2 1 
ATOM   2115 C CZ  . TYR A 1 289 ? 57.306 45.154 20.409  1.00 20.56 ? 319 TYR A CZ  1 
ATOM   2116 O OH  . TYR A 1 289 ? 57.548 46.379 20.973  1.00 19.64 ? 319 TYR A OH  1 
ATOM   2117 N N   . GLN A 1 290 ? 58.884 40.255 16.909  1.00 17.97 ? 320 GLN A N   1 
ATOM   2118 C CA  . GLN A 1 290 ? 60.264 40.230 16.436  1.00 20.57 ? 320 GLN A CA  1 
ATOM   2119 C C   . GLN A 1 290 ? 60.337 40.301 14.913  1.00 19.47 ? 320 GLN A C   1 
ATOM   2120 O O   . GLN A 1 290 ? 61.202 40.960 14.363  1.00 20.17 ? 320 GLN A O   1 
ATOM   2121 C CB  . GLN A 1 290 ? 60.937 38.949 16.927  1.00 21.23 ? 320 GLN A CB  1 
ATOM   2122 C CG  . GLN A 1 290 ? 61.177 38.996 18.450  1.00 22.56 ? 320 GLN A CG  1 
ATOM   2123 C CD  . GLN A 1 290 ? 61.717 37.679 18.990  1.00 32.45 ? 320 GLN A CD  1 
ATOM   2124 O OE1 . GLN A 1 290 ? 61.203 36.621 18.674  1.00 35.64 ? 320 GLN A OE1 1 
ATOM   2125 N NE2 . GLN A 1 290 ? 62.727 37.751 19.826  1.00 27.36 ? 320 GLN A NE2 1 
ATOM   2126 N N   . PHE A 1 291 ? 59.406 39.625 14.247  1.00 18.30 ? 321 PHE A N   1 
ATOM   2127 C CA  . PHE A 1 291 ? 59.354 39.625 12.782  1.00 18.99 ? 321 PHE A CA  1 
ATOM   2128 C C   . PHE A 1 291 ? 59.039 41.032 12.253  1.00 19.14 ? 321 PHE A C   1 
ATOM   2129 O O   . PHE A 1 291 ? 59.531 41.418 11.188  1.00 18.60 ? 321 PHE A O   1 
ATOM   2130 C CB  . PHE A 1 291 ? 58.344 38.583 12.281  1.00 19.08 ? 321 PHE A CB  1 
ATOM   2131 C CG  . PHE A 1 291 ? 58.341 38.399 10.764  1.00 20.69 ? 321 PHE A CG  1 
ATOM   2132 C CD1 . PHE A 1 291 ? 59.226 37.505 10.158  1.00 24.80 ? 321 PHE A CD1 1 
ATOM   2133 C CD2 . PHE A 1 291 ? 57.467 39.126 9.966   1.00 21.53 ? 321 PHE A CD2 1 
ATOM   2134 C CE1 . PHE A 1 291 ? 59.241 37.337 8.784   1.00 27.39 ? 321 PHE A CE1 1 
ATOM   2135 C CE2 . PHE A 1 291 ? 57.480 38.961 8.570   1.00 18.29 ? 321 PHE A CE2 1 
ATOM   2136 C CZ  . PHE A 1 291 ? 58.360 38.069 7.998   1.00 18.74 ? 321 PHE A CZ  1 
ATOM   2137 N N   . LEU A 1 292 ? 58.211 41.782 12.989  1.00 19.21 ? 322 LEU A N   1 
ATOM   2138 C CA  . LEU A 1 292 ? 57.930 43.194 12.659  1.00 18.68 ? 322 LEU A CA  1 
ATOM   2139 C C   . LEU A 1 292 ? 59.210 44.007 12.645  1.00 18.17 ? 322 LEU A C   1 
ATOM   2140 O O   . LEU A 1 292 ? 59.426 44.827 11.750  1.00 18.38 ? 322 LEU A O   1 
ATOM   2141 C CB  . LEU A 1 292 ? 56.990 43.806 13.706  1.00 18.44 ? 322 LEU A CB  1 
ATOM   2142 C CG  A LEU A 1 292 ? 55.479 43.654 13.761  0.50 20.50 ? 322 LEU A CG  1 
ATOM   2143 C CG  B LEU A 1 292 ? 56.392 45.196 13.516  0.50 15.62 ? 322 LEU A CG  1 
ATOM   2144 C CD1 A LEU A 1 292 ? 54.977 44.465 14.947  0.50 20.62 ? 322 LEU A CD1 1 
ATOM   2145 C CD1 B LEU A 1 292 ? 55.805 45.360 12.127  0.50 12.10 ? 322 LEU A CD1 1 
ATOM   2146 C CD2 A LEU A 1 292 ? 54.839 44.159 12.484  0.50 23.06 ? 322 LEU A CD2 1 
ATOM   2147 C CD2 B LEU A 1 292 ? 55.294 45.388 14.544  0.50 14.74 ? 322 LEU A CD2 1 
ATOM   2148 N N   . HIS A 1 293 ? 60.076 43.791 13.638  1.00 17.21 ? 323 HIS A N   1 
ATOM   2149 C CA  . HIS A 1 293 ? 61.388 44.457 13.657  1.00 15.40 ? 323 HIS A CA  1 
ATOM   2150 C C   . HIS A 1 293 ? 62.277 44.079 12.457  1.00 19.47 ? 323 HIS A C   1 
ATOM   2151 O O   . HIS A 1 293 ? 62.923 44.943 11.849  1.00 19.80 ? 323 HIS A O   1 
ATOM   2152 C CB  . HIS A 1 293 ? 62.123 44.155 14.978  1.00 17.41 ? 323 HIS A CB  1 
ATOM   2153 C CG  . HIS A 1 293 ? 61.522 44.845 16.173  1.00 18.29 ? 323 HIS A CG  1 
ATOM   2154 N ND1 . HIS A 1 293 ? 60.326 44.453 16.746  1.00 18.71 ? 323 HIS A ND1 1 
ATOM   2155 C CD2 . HIS A 1 293 ? 61.959 45.906 16.898  1.00 17.47 ? 323 HIS A CD2 1 
ATOM   2156 C CE1 . HIS A 1 293 ? 60.058 45.240 17.777  1.00 21.16 ? 323 HIS A CE1 1 
ATOM   2157 N NE2 . HIS A 1 293 ? 61.031 46.130 17.890  1.00 18.55 ? 323 HIS A NE2 1 
ATOM   2158 N N   . HIS A 1 294 ? 62.328 42.781 12.142  1.00 16.69 ? 324 HIS A N   1 
ATOM   2159 C CA  . HIS A 1 294 ? 63.068 42.277 10.997  1.00 18.51 ? 324 HIS A CA  1 
ATOM   2160 C C   . HIS A 1 294 ? 62.556 42.895 9.681   1.00 18.11 ? 324 HIS A C   1 
ATOM   2161 O O   . HIS A 1 294 ? 63.349 43.333 8.831   1.00 17.90 ? 324 HIS A O   1 
ATOM   2162 C CB  . HIS A 1 294 ? 62.896 40.757 10.943  1.00 17.73 ? 324 HIS A CB  1 
ATOM   2163 C CG  . HIS A 1 294 ? 63.397 40.136 9.669   1.00 20.30 ? 324 HIS A CG  1 
ATOM   2164 N ND1 . HIS A 1 294 ? 64.730 39.870 9.447   1.00 20.38 ? 324 HIS A ND1 1 
ATOM   2165 C CD2 . HIS A 1 294 ? 62.741 39.724 8.556   1.00 21.94 ? 324 HIS A CD2 1 
ATOM   2166 C CE1 . HIS A 1 294 ? 64.876 39.300 8.261   1.00 22.47 ? 324 HIS A CE1 1 
ATOM   2167 N NE2 . HIS A 1 294 ? 63.682 39.202 7.699   1.00 19.88 ? 324 HIS A NE2 1 
ATOM   2168 N N   . THR A 1 295 ? 61.231 42.888 9.522   1.00 18.19 ? 325 THR A N   1 
ATOM   2169 C CA  . THR A 1 295 ? 60.549 43.430 8.337   1.00 20.12 ? 325 THR A CA  1 
ATOM   2170 C C   . THR A 1 295 ? 60.848 44.929 8.145   1.00 19.03 ? 325 THR A C   1 
ATOM   2171 O O   . THR A 1 295 ? 61.144 45.383 7.045   1.00 17.82 ? 325 THR A O   1 
ATOM   2172 C CB  . THR A 1 295 ? 58.997 43.216 8.438   1.00 19.43 ? 325 THR A CB  1 
ATOM   2173 O OG1 . THR A 1 295 ? 58.736 41.800 8.531   1.00 21.30 ? 325 THR A OG1 1 
ATOM   2174 C CG2 . THR A 1 295 ? 58.292 43.775 7.181   1.00 16.00 ? 325 THR A CG2 1 
ATOM   2175 N N   . LEU A 1 296 ? 60.782 45.693 9.229   1.00 18.41 ? 326 LEU A N   1 
ATOM   2176 C CA  . LEU A 1 296 ? 61.012 47.133 9.128   1.00 18.93 ? 326 LEU A CA  1 
ATOM   2177 C C   . LEU A 1 296 ? 62.473 47.482 8.913   1.00 20.41 ? 326 LEU A C   1 
ATOM   2178 O O   . LEU A 1 296 ? 62.767 48.467 8.232   1.00 21.18 ? 326 LEU A O   1 
ATOM   2179 C CB  . LEU A 1 296 ? 60.380 47.885 10.322  1.00 17.67 ? 326 LEU A CB  1 
ATOM   2180 C CG  . LEU A 1 296 ? 58.845 47.759 10.334  1.00 22.94 ? 326 LEU A CG  1 
ATOM   2181 C CD1 . LEU A 1 296 ? 58.236 48.206 11.677  1.00 20.82 ? 326 LEU A CD1 1 
ATOM   2182 C CD2 . LEU A 1 296 ? 58.175 48.482 9.150   1.00 21.65 ? 326 LEU A CD2 1 
ATOM   2183 N N   . ALA A 1 297 ? 63.387 46.687 9.485   1.00 18.78 ? 327 ALA A N   1 
ATOM   2184 C CA  . ALA A 1 297 ? 64.822 46.827 9.204   1.00 19.40 ? 327 ALA A CA  1 
ATOM   2185 C C   . ALA A 1 297 ? 65.122 46.611 7.711   1.00 20.29 ? 327 ALA A C   1 
ATOM   2186 O O   . ALA A 1 297 ? 65.937 47.334 7.117   1.00 20.57 ? 327 ALA A O   1 
ATOM   2187 C CB  . ALA A 1 297 ? 65.643 45.861 10.066  1.00 19.77 ? 327 ALA A CB  1 
ATOM   2188 N N   . LEU A 1 298 ? 64.441 45.638 7.107   1.00 18.23 ? 328 LEU A N   1 
ATOM   2189 C CA  . LEU A 1 298 ? 64.535 45.403 5.650   1.00 20.48 ? 328 LEU A CA  1 
ATOM   2190 C C   . LEU A 1 298 ? 63.960 46.571 4.828   1.00 19.97 ? 328 LEU A C   1 
ATOM   2191 O O   . LEU A 1 298 ? 64.606 47.047 3.886   1.00 21.56 ? 328 LEU A O   1 
ATOM   2192 C CB  . LEU A 1 298 ? 63.812 44.094 5.284   1.00 19.62 ? 328 LEU A CB  1 
ATOM   2193 C CG  A LEU A 1 298 ? 64.492 43.139 4.313   0.50 25.99 ? 328 LEU A CG  1 
ATOM   2194 C CG  B LEU A 1 298 ? 64.489 42.844 5.805   0.50 13.77 ? 328 LEU A CG  1 
ATOM   2195 C CD1 A LEU A 1 298 ? 65.715 42.508 4.955   0.50 25.42 ? 328 LEU A CD1 1 
ATOM   2196 C CD1 B LEU A 1 298 ? 63.658 41.649 5.439   0.50 19.32 ? 328 LEU A CD1 1 
ATOM   2197 C CD2 A LEU A 1 298 ? 63.502 42.063 3.912   0.50 23.29 ? 328 LEU A CD2 1 
ATOM   2198 C CD2 B LEU A 1 298 ? 65.870 42.698 5.208   0.50 19.25 ? 328 LEU A CD2 1 
ATOM   2199 N N   . TYR A 1 299 ? 62.766 47.048 5.195   1.00 19.27 ? 329 TYR A N   1 
ATOM   2200 C CA  . TYR A 1 299 ? 62.173 48.221 4.531   1.00 20.42 ? 329 TYR A CA  1 
ATOM   2201 C C   . TYR A 1 299 ? 63.087 49.447 4.597   1.00 20.82 ? 329 TYR A C   1 
ATOM   2202 O O   . TYR A 1 299 ? 63.192 50.204 3.627   1.00 20.60 ? 329 TYR A O   1 
ATOM   2203 C CB  . TYR A 1 299 ? 60.782 48.552 5.102   1.00 19.33 ? 329 TYR A CB  1 
ATOM   2204 C CG  . TYR A 1 299 ? 60.119 49.750 4.436   1.00 20.37 ? 329 TYR A CG  1 
ATOM   2205 C CD1 . TYR A 1 299 ? 59.536 49.631 3.165   1.00 22.80 ? 329 TYR A CD1 1 
ATOM   2206 C CD2 . TYR A 1 299 ? 60.062 50.984 5.076   1.00 19.95 ? 329 TYR A CD2 1 
ATOM   2207 C CE1 . TYR A 1 299 ? 58.922 50.716 2.553   1.00 24.42 ? 329 TYR A CE1 1 
ATOM   2208 C CE2 . TYR A 1 299 ? 59.463 52.088 4.470   1.00 23.13 ? 329 TYR A CE2 1 
ATOM   2209 C CZ  . TYR A 1 299 ? 58.894 51.944 3.217   1.00 22.48 ? 329 TYR A CZ  1 
ATOM   2210 O OH  . TYR A 1 299 ? 58.296 53.015 2.629   1.00 28.29 ? 329 TYR A OH  1 
ATOM   2211 N N   . ALA A 1 300 ? 63.757 49.644 5.733   1.00 19.06 ? 330 ALA A N   1 
ATOM   2212 C CA  . ALA A 1 300 ? 64.665 50.786 5.904   1.00 22.15 ? 330 ALA A CA  1 
ATOM   2213 C C   . ALA A 1 300 ? 65.751 50.856 4.839   1.00 20.40 ? 330 ALA A C   1 
ATOM   2214 O O   . ALA A 1 300 ? 66.164 51.958 4.426   1.00 19.97 ? 330 ALA A O   1 
ATOM   2215 C CB  . ALA A 1 300 ? 65.291 50.777 7.333   1.00 22.75 ? 330 ALA A CB  1 
ATOM   2216 N N   . GLY A 1 301 ? 66.221 49.692 4.380   1.00 19.01 ? 331 GLY A N   1 
ATOM   2217 C CA  . GLY A 1 301 ? 67.275 49.640 3.364   1.00 17.84 ? 331 GLY A CA  1 
ATOM   2218 C C   . GLY A 1 301 ? 66.810 50.170 2.020   1.00 17.37 ? 331 GLY A C   1 
ATOM   2219 O O   . GLY A 1 301 ? 67.617 50.567 1.181   1.00 18.14 ? 331 GLY A O   1 
ATOM   2220 N N   . GLN A 1 302 ? 65.503 50.182 1.820   1.00 18.01 ? 332 GLN A N   1 
ATOM   2221 C CA  . GLN A 1 302 ? 64.912 50.623 0.546   1.00 23.34 ? 332 GLN A CA  1 
ATOM   2222 C C   . GLN A 1 302 ? 64.671 52.125 0.489   1.00 22.92 ? 332 GLN A C   1 
ATOM   2223 O O   . GLN A 1 302 ? 64.356 52.660 -0.569  1.00 23.78 ? 332 GLN A O   1 
ATOM   2224 C CB  . GLN A 1 302 ? 63.584 49.897 0.299   1.00 25.96 ? 332 GLN A CB  1 
ATOM   2225 C CG  . GLN A 1 302 ? 63.728 48.373 0.166   1.00 35.84 ? 332 GLN A CG  1 
ATOM   2226 C CD  . GLN A 1 302 ? 62.407 47.650 0.351   1.00 46.70 ? 332 GLN A CD  1 
ATOM   2227 O OE1 . GLN A 1 302 ? 61.331 48.232 0.200   1.00 40.99 ? 332 GLN A OE1 1 
ATOM   2228 N NE2 . GLN A 1 302 ? 62.486 46.372 0.692   1.00 57.85 ? 332 GLN A NE2 1 
ATOM   2229 N N   . LEU A 1 303 ? 64.814 52.808 1.619   1.00 22.25 ? 333 LEU A N   1 
ATOM   2230 C CA  . LEU A 1 303 ? 64.551 54.246 1.663   1.00 24.57 ? 333 LEU A CA  1 
ATOM   2231 C C   . LEU A 1 303 ? 65.742 55.081 1.166   1.00 28.65 ? 333 LEU A C   1 
ATOM   2232 O O   . LEU A 1 303 ? 66.896 54.700 1.356   1.00 30.36 ? 333 LEU A O   1 
ATOM   2233 C CB  . LEU A 1 303 ? 64.203 54.657 3.094   1.00 22.79 ? 333 LEU A CB  1 
ATOM   2234 C CG  . LEU A 1 303 ? 62.897 54.099 3.678   1.00 26.51 ? 333 LEU A CG  1 
ATOM   2235 C CD1 . LEU A 1 303 ? 62.842 54.342 5.167   1.00 30.66 ? 333 LEU A CD1 1 
ATOM   2236 C CD2 . LEU A 1 303 ? 61.689 54.702 2.991   1.00 26.50 ? 333 LEU A CD2 1 
ATOM   2237 N N   . PRO A 1 304 ? 65.474 56.247 0.563   1.00 34.68 ? 334 PRO A N   1 
ATOM   2238 C CA  . PRO A 1 304 ? 66.578 57.245 0.400   1.00 38.74 ? 334 PRO A CA  1 
ATOM   2239 C C   . PRO A 1 304 ? 66.985 57.646 1.845   1.00 42.72 ? 334 PRO A C   1 
ATOM   2240 O O   . PRO A 1 304 ? 66.079 57.884 2.624   1.00 44.33 ? 334 PRO A O   1 
ATOM   2241 C CB  . PRO A 1 304 ? 65.890 58.401 -0.324  1.00 38.25 ? 334 PRO A CB  1 
ATOM   2242 C CG  . PRO A 1 304 ? 64.573 57.851 -0.849  1.00 38.18 ? 334 PRO A CG  1 
ATOM   2243 C CD  . PRO A 1 304 ? 64.173 56.726 0.054   1.00 34.77 ? 334 PRO A CD  1 
ATOM   2244 N N   . GLU A 1 305 ? 68.261 57.764 2.269   1.00 47.84 ? 335 GLU A N   1 
ATOM   2245 C CA  . GLU A 1 305 ? 69.445 58.459 1.650   1.00 48.52 ? 335 GLU A CA  1 
ATOM   2246 C C   . GLU A 1 305 ? 69.397 60.003 1.372   1.00 48.81 ? 335 GLU A C   1 
ATOM   2247 O O   . GLU A 1 305 ? 68.346 60.578 1.087   1.00 48.58 ? 335 GLU A O   1 
ATOM   2248 C CB  . GLU A 1 305 ? 70.207 57.639 0.555   1.00 50.06 ? 335 GLU A CB  1 
ATOM   2249 C CG  . GLU A 1 305 ? 69.991 58.085 -0.891  1.00 46.30 ? 335 GLU A CG  1 
ATOM   2250 C CD  . GLU A 1 305 ? 69.926 56.908 -1.859  1.00 44.17 ? 335 GLU A CD  1 
ATOM   2251 O OE1 . GLU A 1 305 ? 70.480 55.837 -1.542  1.00 39.50 ? 335 GLU A OE1 1 
ATOM   2252 O OE2 . GLU A 1 305 ? 69.289 57.050 -2.926  1.00 48.54 ? 335 GLU A OE2 1 
HETATM 2253 P P   . PO4 B 2 .   ? 44.666 35.344 13.842  1.00 19.10 ? 436 PO4 A P   1 
HETATM 2254 O O1  . PO4 B 2 .   ? 44.930 34.342 14.957  1.00 19.48 ? 436 PO4 A O1  1 
HETATM 2255 O O2  . PO4 B 2 .   ? 43.668 34.768 12.918  1.00 19.39 ? 436 PO4 A O2  1 
HETATM 2256 O O3  . PO4 B 2 .   ? 45.959 35.588 13.091  1.00 17.60 ? 436 PO4 A O3  1 
HETATM 2257 O O4  . PO4 B 2 .   ? 44.174 36.614 14.508  1.00 17.90 ? 436 PO4 A O4  1 
HETATM 2258 P P   . PO4 C 2 .   ? 43.362 30.386 8.225   0.75 32.50 ? 437 PO4 A P   1 
HETATM 2259 O O1  . PO4 C 2 .   ? 44.801 30.632 7.908   0.75 34.41 ? 437 PO4 A O1  1 
HETATM 2260 O O2  . PO4 C 2 .   ? 42.512 31.189 7.279   0.75 24.60 ? 437 PO4 A O2  1 
HETATM 2261 O O3  . PO4 C 2 .   ? 43.066 28.910 8.008   0.75 32.56 ? 437 PO4 A O3  1 
HETATM 2262 O O4  . PO4 C 2 .   ? 43.114 30.750 9.666   0.75 35.23 ? 437 PO4 A O4  1 
HETATM 2263 C C1  . GOL D 3 .   ? 32.483 55.843 20.784  1.00 59.85 ? 501 GOL A C1  1 
HETATM 2264 O O1  . GOL D 3 .   ? 32.570 55.283 19.485  1.00 49.88 ? 501 GOL A O1  1 
HETATM 2265 C C2  . GOL D 3 .   ? 33.833 55.644 21.465  1.00 52.29 ? 501 GOL A C2  1 
HETATM 2266 O O2  . GOL D 3 .   ? 34.786 56.370 20.727  1.00 44.58 ? 501 GOL A O2  1 
HETATM 2267 C C3  . GOL D 3 .   ? 33.816 56.088 22.927  1.00 51.82 ? 501 GOL A C3  1 
HETATM 2268 O O3  . GOL D 3 .   ? 33.834 55.007 23.834  1.00 40.94 ? 501 GOL A O3  1 
HETATM 2269 C C1  . GOL E 3 .   ? 36.843 56.469 15.471  1.00 42.20 ? 502 GOL A C1  1 
HETATM 2270 O O1  . GOL E 3 .   ? 38.182 56.648 15.879  1.00 46.03 ? 502 GOL A O1  1 
HETATM 2271 C C2  . GOL E 3 .   ? 36.236 55.135 15.940  1.00 46.68 ? 502 GOL A C2  1 
HETATM 2272 O O2  . GOL E 3 .   ? 37.093 54.429 16.819  1.00 40.01 ? 502 GOL A O2  1 
HETATM 2273 C C3  . GOL E 3 .   ? 34.899 55.420 16.634  1.00 45.58 ? 502 GOL A C3  1 
HETATM 2274 O O3  . GOL E 3 .   ? 34.036 54.304 16.625  1.00 45.02 ? 502 GOL A O3  1 
HETATM 2275 O O   . HOH F 4 .   ? 48.150 35.019 14.492  1.00 14.66 ? 503 HOH A O   1 
HETATM 2276 O O   . HOH F 4 .   ? 47.420 56.176 7.087   1.00 20.23 ? 504 HOH A O   1 
HETATM 2277 O O   . HOH F 4 .   ? 46.357 52.425 15.518  1.00 19.07 ? 505 HOH A O   1 
HETATM 2278 O O   . HOH F 4 .   ? 29.659 45.442 16.095  1.00 27.67 ? 506 HOH A O   1 
HETATM 2279 O O   . HOH F 4 .   ? 59.854 50.038 19.334  1.00 19.29 ? 507 HOH A O   1 
HETATM 2280 O O   . HOH F 4 .   ? 47.538 55.007 15.264  1.00 21.87 ? 508 HOH A O   1 
HETATM 2281 O O   . HOH F 4 .   ? 61.148 47.851 20.159  1.00 18.94 ? 509 HOH A O   1 
HETATM 2282 O O   . HOH F 4 .   ? 38.758 50.681 1.441   1.00 22.19 ? 510 HOH A O   1 
HETATM 2283 O O   . HOH F 4 .   ? 66.835 45.745 2.654   1.00 18.56 ? 511 HOH A O   1 
HETATM 2284 O O   . HOH F 4 .   ? 51.754 56.343 13.835  1.00 22.30 ? 512 HOH A O   1 
HETATM 2285 O O   . HOH F 4 .   ? 48.291 53.746 8.149   1.00 19.64 ? 513 HOH A O   1 
HETATM 2286 O O   . HOH F 4 .   ? 39.828 41.549 20.442  1.00 24.18 ? 514 HOH A O   1 
HETATM 2287 O O   . HOH F 4 .   ? 56.046 42.384 10.013  1.00 19.69 ? 515 HOH A O   1 
HETATM 2288 O O   . HOH F 4 .   ? 49.221 51.846 15.594  1.00 20.41 ? 516 HOH A O   1 
HETATM 2289 O O   . HOH F 4 .   ? 44.202 44.248 29.258  1.00 25.40 ? 517 HOH A O   1 
HETATM 2290 O O   . HOH F 4 .   ? 63.852 35.000 20.589  1.00 21.99 ? 518 HOH A O   1 
HETATM 2291 O O   . HOH F 4 .   ? 68.657 37.709 23.405  1.00 23.65 ? 519 HOH A O   1 
HETATM 2292 O O   . HOH F 4 .   ? 31.374 49.773 -0.622  1.00 20.93 ? 520 HOH A O   1 
HETATM 2293 O O   . HOH F 4 .   ? 41.794 53.939 4.519   1.00 24.86 ? 521 HOH A O   1 
HETATM 2294 O O   . HOH F 4 .   ? 35.670 35.941 17.855  1.00 26.56 ? 522 HOH A O   1 
HETATM 2295 O O   . HOH F 4 .   ? 50.391 54.305 15.617  1.00 21.85 ? 523 HOH A O   1 
HETATM 2296 O O   . HOH F 4 .   ? 59.346 33.847 1.026   1.00 25.13 ? 524 HOH A O   1 
HETATM 2297 O O   . HOH F 4 .   ? 41.597 37.903 -4.151  1.00 22.42 ? 525 HOH A O   1 
HETATM 2298 O O   . HOH F 4 .   ? 39.554 54.990 13.985  1.00 19.30 ? 526 HOH A O   1 
HETATM 2299 O O   . HOH F 4 .   ? 46.076 29.284 9.971   1.00 25.77 ? 527 HOH A O   1 
HETATM 2300 O O   . HOH F 4 .   ? 54.573 33.176 16.121  1.00 29.15 ? 528 HOH A O   1 
HETATM 2301 O O   . HOH F 4 .   ? 39.912 35.042 7.011   1.00 27.00 ? 529 HOH A O   1 
HETATM 2302 O O   . HOH F 4 .   ? 30.552 39.070 13.312  1.00 25.43 ? 530 HOH A O   1 
HETATM 2303 O O   . HOH F 4 .   ? 39.815 53.183 16.206  1.00 25.59 ? 531 HOH A O   1 
HETATM 2304 O O   . HOH F 4 .   ? 60.418 36.273 14.160  1.00 25.60 ? 532 HOH A O   1 
HETATM 2305 O O   . HOH F 4 .   ? 42.341 33.759 7.774   1.00 22.17 ? 533 HOH A O   1 
HETATM 2306 O O   . HOH F 4 .   ? 40.516 51.042 24.153  1.00 25.51 ? 534 HOH A O   1 
HETATM 2307 O O   . HOH F 4 .   ? 64.506 44.583 0.208   1.00 23.39 ? 535 HOH A O   1 
HETATM 2308 O O   . HOH F 4 .   ? 28.020 39.783 12.341  1.00 27.35 ? 536 HOH A O   1 
HETATM 2309 O O   . HOH F 4 .   ? 38.796 43.208 23.031  1.00 29.67 ? 537 HOH A O   1 
HETATM 2310 O O   . HOH F 4 .   ? 51.918 54.461 23.303  1.00 25.23 ? 538 HOH A O   1 
HETATM 2311 O O   . HOH F 4 .   ? 46.268 57.027 22.330  1.00 23.80 ? 539 HOH A O   1 
HETATM 2312 O O   . HOH F 4 .   ? 54.970 58.063 5.187   1.00 26.40 ? 540 HOH A O   1 
HETATM 2313 O O   . HOH F 4 .   ? 66.454 40.165 11.530  1.00 25.27 ? 541 HOH A O   1 
HETATM 2314 O O   . HOH F 4 .   ? 63.861 35.008 32.212  1.00 30.80 ? 542 HOH A O   1 
HETATM 2315 O O   . HOH F 4 .   ? 29.936 52.209 13.549  1.00 26.58 ? 543 HOH A O   1 
HETATM 2316 O O   . HOH F 4 .   ? 33.726 39.725 9.657   1.00 23.65 ? 544 HOH A O   1 
HETATM 2317 O O   . HOH F 4 .   ? 46.870 38.598 21.484  1.00 25.71 ? 545 HOH A O   1 
HETATM 2318 O O   . HOH F 4 .   ? 37.937 56.089 6.467   1.00 26.67 ? 546 HOH A O   1 
HETATM 2319 O O   . HOH F 4 .   ? 60.345 34.617 20.726  1.00 26.06 ? 547 HOH A O   1 
HETATM 2320 O O   . HOH F 4 .   ? 28.053 43.967 -8.711  1.00 26.09 ? 548 HOH A O   1 
HETATM 2321 O O   . HOH F 4 .   ? 41.644 61.527 11.843  1.00 27.00 ? 549 HOH A O   1 
HETATM 2322 O O   . HOH F 4 .   ? 38.618 50.864 21.230  1.00 26.37 ? 550 HOH A O   1 
HETATM 2323 O O   . HOH F 4 .   ? 66.631 41.591 17.785  1.00 22.97 ? 551 HOH A O   1 
HETATM 2324 O O   . HOH F 4 .   ? 24.942 37.704 7.950   1.00 37.15 ? 552 HOH A O   1 
HETATM 2325 O O   . HOH F 4 .   ? 64.739 39.510 17.501  1.00 26.26 ? 553 HOH A O   1 
HETATM 2326 O O   . HOH F 4 .   ? 54.478 54.766 17.259  1.00 29.06 ? 554 HOH A O   1 
HETATM 2327 O O   . HOH F 4 .   ? 46.351 42.416 29.849  1.00 30.35 ? 555 HOH A O   1 
HETATM 2328 O O   . HOH F 4 .   ? 40.119 56.590 29.767  1.00 29.43 ? 556 HOH A O   1 
HETATM 2329 O O   . HOH F 4 .   ? 56.459 31.420 12.188  1.00 27.70 ? 557 HOH A O   1 
HETATM 2330 O O   . HOH F 4 .   ? 57.788 52.747 27.306  1.00 30.48 ? 558 HOH A O   1 
HETATM 2331 O O   . HOH F 4 .   ? 68.099 46.746 4.934   1.00 33.43 ? 559 HOH A O   1 
HETATM 2332 O O   . HOH F 4 .   ? 55.070 40.593 11.982  1.00 19.24 ? 560 HOH A O   1 
HETATM 2333 O O   . HOH F 4 .   ? 27.301 53.837 2.093   1.00 27.79 ? 561 HOH A O   1 
HETATM 2334 O O   . HOH F 4 .   ? 42.252 56.561 5.204   1.00 28.21 ? 562 HOH A O   1 
HETATM 2335 O O   . HOH F 4 .   ? 23.667 56.575 -6.166  1.00 32.56 ? 563 HOH A O   1 
HETATM 2336 O O   . HOH F 4 .   ? 52.168 55.082 17.509  1.00 28.36 ? 564 HOH A O   1 
HETATM 2337 O O   . HOH F 4 .   ? 25.897 44.120 -10.311 1.00 33.37 ? 565 HOH A O   1 
HETATM 2338 O O   . HOH F 4 .   ? 54.852 55.703 21.771  1.00 26.12 ? 566 HOH A O   1 
HETATM 2339 O O   . HOH F 4 .   ? 36.040 33.258 6.733   1.00 37.65 ? 567 HOH A O   1 
HETATM 2340 O O   . HOH F 4 .   ? 62.770 44.803 27.000  1.00 26.89 ? 568 HOH A O   1 
HETATM 2341 O O   . HOH F 4 .   ? 56.459 48.087 0.952   1.00 24.76 ? 569 HOH A O   1 
HETATM 2342 O O   . HOH F 4 .   ? 63.710 40.665 15.114  1.00 26.37 ? 570 HOH A O   1 
HETATM 2343 O O   . HOH F 4 .   ? 32.309 52.667 17.191  1.00 31.82 ? 571 HOH A O   1 
HETATM 2344 O O   . HOH F 4 .   ? 69.278 56.790 11.639  1.00 35.42 ? 572 HOH A O   1 
HETATM 2345 O O   . HOH F 4 .   ? 45.502 36.280 21.492  1.00 21.71 ? 573 HOH A O   1 
HETATM 2346 O O   . HOH F 4 .   ? 22.429 47.403 5.790   1.00 39.47 ? 574 HOH A O   1 
HETATM 2347 O O   . HOH F 4 .   ? 51.785 34.470 0.209   1.00 26.62 ? 575 HOH A O   1 
HETATM 2348 O O   . HOH F 4 .   ? 45.687 54.486 3.567   1.00 29.69 ? 576 HOH A O   1 
HETATM 2349 O O   . HOH F 4 .   ? 32.507 55.330 9.493   1.00 35.90 ? 577 HOH A O   1 
HETATM 2350 O O   . HOH F 4 .   ? 51.523 40.998 24.667  1.00 32.21 ? 578 HOH A O   1 
HETATM 2351 O O   . HOH F 4 .   ? 48.899 27.915 12.749  1.00 34.45 ? 579 HOH A O   1 
HETATM 2352 O O   . HOH F 4 .   ? 38.334 33.144 8.474   1.00 38.01 ? 580 HOH A O   1 
HETATM 2353 O O   . HOH F 4 .   ? 40.419 53.601 19.036  1.00 28.73 ? 581 HOH A O   1 
HETATM 2354 O O   . HOH F 4 .   ? 58.222 41.061 30.374  1.00 36.65 ? 582 HOH A O   1 
HETATM 2355 O O   . HOH F 4 .   ? 55.564 53.805 3.476   1.00 32.44 ? 583 HOH A O   1 
HETATM 2356 O O   . HOH F 4 .   ? 54.157 37.949 11.471  1.00 28.49 ? 584 HOH A O   1 
HETATM 2357 O O   . HOH F 4 .   ? 38.921 53.543 21.247  1.00 40.31 ? 585 HOH A O   1 
HETATM 2358 O O   . HOH F 4 .   ? 48.670 57.955 23.275  1.00 31.38 ? 586 HOH A O   1 
HETATM 2359 O O   . HOH F 4 .   ? 41.464 55.663 32.709  1.00 41.07 ? 587 HOH A O   1 
HETATM 2360 O O   . HOH F 4 .   ? 52.241 55.567 20.335  1.00 32.54 ? 588 HOH A O   1 
HETATM 2361 O O   . HOH F 4 .   ? 67.095 54.557 18.518  1.00 36.22 ? 589 HOH A O   1 
HETATM 2362 O O   . HOH F 4 .   ? 54.006 44.999 -4.764  1.00 31.06 ? 590 HOH A O   1 
HETATM 2363 O O   . HOH F 4 .   ? 33.662 29.870 9.652   1.00 35.94 ? 591 HOH A O   1 
HETATM 2364 O O   . HOH F 4 .   ? 44.666 57.086 30.441  1.00 32.47 ? 592 HOH A O   1 
HETATM 2365 O O   . HOH F 4 .   ? 69.775 52.063 1.863   1.00 36.83 ? 593 HOH A O   1 
HETATM 2366 O O   . HOH F 4 .   ? 37.284 36.947 16.050  1.00 34.91 ? 594 HOH A O   1 
HETATM 2367 O O   . HOH F 4 .   ? 25.254 35.285 5.959   1.00 36.87 ? 595 HOH A O   1 
HETATM 2368 O O   . HOH F 4 .   ? 33.504 52.516 -7.033  1.00 37.81 ? 596 HOH A O   1 
HETATM 2369 O O   . HOH F 4 .   ? 44.627 59.286 17.672  1.00 40.02 ? 597 HOH A O   1 
HETATM 2370 O O   . HOH F 4 .   ? 31.732 35.202 21.809  1.00 36.58 ? 598 HOH A O   1 
HETATM 2371 O O   . HOH F 4 .   ? 59.932 34.157 12.522  1.00 41.49 ? 599 HOH A O   1 
HETATM 2372 O O   . HOH F 4 .   ? 48.643 56.779 16.871  1.00 36.19 ? 600 HOH A O   1 
HETATM 2373 O O   . HOH F 4 .   ? 62.190 35.302 15.850  1.00 37.31 ? 601 HOH A O   1 
HETATM 2374 O O   . HOH F 4 .   ? 65.432 42.815 15.473  1.00 33.70 ? 602 HOH A O   1 
HETATM 2375 O O   . HOH F 4 .   ? 52.757 45.999 31.509  1.00 36.31 ? 603 HOH A O   1 
HETATM 2376 O O   . HOH F 4 .   ? 36.564 46.250 -9.241  1.00 38.18 ? 604 HOH A O   1 
HETATM 2377 O O   . HOH F 4 .   ? 69.038 41.087 16.985  1.00 35.54 ? 605 HOH A O   1 
HETATM 2378 O O   . HOH F 4 .   ? 38.699 49.219 25.108  1.00 37.61 ? 606 HOH A O   1 
HETATM 2379 O O   . HOH F 4 .   ? 50.536 47.261 32.613  1.00 40.67 ? 607 HOH A O   1 
HETATM 2380 O O   . HOH F 4 .   ? 54.731 57.882 23.252  1.00 42.56 ? 608 HOH A O   1 
HETATM 2381 O O   . HOH F 4 .   ? 62.473 42.991 0.672   1.00 35.17 ? 609 HOH A O   1 
HETATM 2382 O O   . HOH F 4 .   ? 53.858 39.091 -5.064  1.00 46.38 ? 610 HOH A O   1 
HETATM 2383 O O   . HOH F 4 .   ? 65.572 45.000 13.821  1.00 36.01 ? 611 HOH A O   1 
HETATM 2384 O O   . HOH F 4 .   ? 52.251 57.307 23.216  1.00 31.23 ? 612 HOH A O   1 
HETATM 2385 O O   . HOH F 4 .   ? 69.486 40.925 26.092  1.00 41.01 ? 613 HOH A O   1 
HETATM 2386 O O   . HOH F 4 .   ? 60.320 48.456 26.557  1.00 38.23 ? 614 HOH A O   1 
HETATM 2387 O O   . HOH F 4 .   ? 38.118 40.212 23.758  1.00 33.62 ? 615 HOH A O   1 
HETATM 2388 O O   . HOH F 4 .   ? 60.124 34.638 -1.461  1.00 38.19 ? 616 HOH A O   1 
HETATM 2389 O O   . HOH F 4 .   ? 44.176 39.665 28.960  1.00 39.28 ? 617 HOH A O   1 
HETATM 2390 O O   . HOH F 4 .   ? 54.953 57.337 17.790  1.00 43.82 ? 618 HOH A O   1 
HETATM 2391 O O   . HOH F 4 .   ? 37.487 34.316 4.824   1.00 38.16 ? 619 HOH A O   1 
HETATM 2392 O O   . HOH F 4 .   ? 24.999 35.624 2.941   1.00 38.98 ? 620 HOH A O   1 
HETATM 2393 O O   . HOH F 4 .   ? 36.292 59.167 12.506  1.00 41.07 ? 621 HOH A O   1 
HETATM 2394 O O   . HOH F 4 .   ? 72.579 47.375 4.348   1.00 35.55 ? 622 HOH A O   1 
HETATM 2395 O O   . HOH F 4 .   ? 54.163 56.311 3.134   1.00 35.96 ? 623 HOH A O   1 
HETATM 2396 O O   . HOH F 4 .   ? 42.597 32.698 -4.383  1.00 46.59 ? 624 HOH A O   1 
HETATM 2397 O O   . HOH F 4 .   ? 40.221 52.985 0.965   1.00 36.62 ? 625 HOH A O   1 
HETATM 2398 O O   . HOH F 4 .   ? 47.056 58.253 30.106  1.00 41.98 ? 626 HOH A O   1 
HETATM 2399 O O   . HOH F 4 .   ? 25.345 55.347 -1.173  1.00 40.25 ? 627 HOH A O   1 
HETATM 2400 O O   . HOH F 4 .   ? 33.667 50.386 -2.901  1.00 38.94 ? 628 HOH A O   1 
HETATM 2401 O O   . HOH F 4 .   ? 54.413 34.678 1.101   1.00 31.27 ? 629 HOH A O   1 
HETATM 2402 O O   . HOH F 4 .   ? 39.355 49.780 -5.277  1.00 40.36 ? 630 HOH A O   1 
HETATM 2403 O O   . HOH F 4 .   ? 24.419 41.059 13.312  1.00 40.65 ? 631 HOH A O   1 
HETATM 2404 O O   . HOH F 4 .   ? 26.630 52.837 -10.250 1.00 41.67 ? 632 HOH A O   1 
HETATM 2405 O O   . HOH F 4 .   ? 57.689 34.370 -2.896  1.00 38.73 ? 633 HOH A O   1 
HETATM 2406 O O   . HOH F 4 .   ? 49.042 37.399 22.783  1.00 38.33 ? 634 HOH A O   1 
HETATM 2407 O O   . HOH F 4 .   ? 44.253 55.487 32.663  1.00 35.17 ? 635 HOH A O   1 
HETATM 2408 O O   . HOH F 4 .   ? 74.342 49.338 4.095   1.00 36.11 ? 636 HOH A O   1 
HETATM 2409 O O   . HOH F 4 .   ? 33.473 55.314 5.631   1.00 40.46 ? 637 HOH A O   1 
HETATM 2410 O O   . HOH F 4 .   ? 62.392 40.328 -1.678  1.00 40.28 ? 638 HOH A O   1 
HETATM 2411 O O   . HOH F 4 .   ? 16.528 48.844 8.541   1.00 44.45 ? 639 HOH A O   1 
HETATM 2412 O O   . HOH F 4 .   ? 54.304 33.858 3.484   1.00 36.16 ? 640 HOH A O   1 
HETATM 2413 O O   . HOH F 4 .   ? 29.175 32.545 -9.247  1.00 38.39 ? 641 HOH A O   1 
HETATM 2414 O O   . HOH F 4 .   ? 30.035 31.301 17.721  1.00 43.18 ? 642 HOH A O   1 
HETATM 2415 O O   . HOH F 4 .   ? 50.365 51.757 33.712  1.00 44.51 ? 643 HOH A O   1 
HETATM 2416 O O   . HOH F 4 .   ? 22.436 50.822 -12.089 1.00 37.49 ? 644 HOH A O   1 
HETATM 2417 O O   . HOH F 4 .   ? 43.023 29.815 12.172  1.00 41.59 ? 645 HOH A O   1 
HETATM 2418 O O   . HOH F 4 .   ? 52.168 38.787 28.719  1.00 44.37 ? 646 HOH A O   1 
HETATM 2419 O O   . HOH F 4 .   ? 23.855 53.913 -11.519 1.00 41.24 ? 647 HOH A O   1 
HETATM 2420 O O   . HOH F 4 .   ? 67.081 42.630 12.481  1.00 39.67 ? 648 HOH A O   1 
HETATM 2421 O O   . HOH F 4 .   ? 48.052 43.635 31.839  1.00 46.22 ? 649 HOH A O   1 
HETATM 2422 O O   . HOH F 4 .   ? 29.328 54.403 9.574   1.00 43.34 ? 650 HOH A O   1 
HETATM 2423 O O   . HOH F 4 .   ? 56.514 46.185 -4.679  1.00 35.87 ? 651 HOH A O   1 
HETATM 2424 O O   . HOH F 4 .   ? 30.081 32.893 -1.924  1.00 44.83 ? 652 HOH A O   1 
HETATM 2425 O O   . HOH F 4 .   ? 60.783 45.634 28.504  1.00 44.21 ? 653 HOH A O   1 
HETATM 2426 O O   . HOH F 4 .   ? 45.613 52.615 -0.656  1.00 43.66 ? 654 HOH A O   1 
HETATM 2427 O O   . HOH F 4 .   ? 60.167 43.472 -0.555  1.00 42.88 ? 655 HOH A O   1 
HETATM 2428 O O   . HOH F 4 .   ? 57.554 31.576 9.394   1.00 44.35 ? 656 HOH A O   1 
HETATM 2429 O O   . HOH F 4 .   ? 37.022 59.632 9.845   1.00 42.77 ? 657 HOH A O   1 
HETATM 2430 O O   . HOH F 4 .   ? 42.472 41.725 -10.715 1.00 39.76 ? 658 HOH A O   1 
HETATM 2431 O O   . HOH F 4 .   ? 41.379 36.418 24.471  1.00 40.11 ? 659 HOH A O   1 
HETATM 2432 O O   . HOH F 4 .   ? 52.224 58.444 15.705  1.00 50.75 ? 660 HOH A O   1 
HETATM 2433 O O   . HOH F 4 .   ? 49.000 33.977 -1.740  1.00 45.09 ? 661 HOH A O   1 
HETATM 2434 O O   . HOH F 4 .   ? 51.366 55.910 2.943   1.00 40.72 ? 662 HOH A O   1 
HETATM 2435 O O   . HOH F 4 .   ? 23.699 51.281 7.479   1.00 38.24 ? 663 HOH A O   1 
HETATM 2436 O O   . HOH F 4 .   ? 57.998 57.364 15.023  1.00 43.21 ? 664 HOH A O   1 
HETATM 2437 O O   . HOH F 4 .   ? 47.737 58.406 8.003   1.00 61.65 ? 665 HOH A O   1 
HETATM 2438 O O   . HOH F 4 .   ? 70.291 36.427 21.214  1.00 40.10 ? 666 HOH A O   1 
HETATM 2439 O O   . HOH F 4 .   ? 53.955 29.152 5.366   1.00 45.85 ? 667 HOH A O   1 
HETATM 2440 O O   . HOH F 4 .   ? 74.783 44.968 11.203  1.00 50.80 ? 668 HOH A O   1 
HETATM 2441 O O   . HOH F 4 .   ? 25.404 35.665 23.126  1.00 56.43 ? 669 HOH A O   1 
HETATM 2442 O O   . HOH F 4 .   ? 54.160 51.955 2.828   1.00 37.33 ? 670 HOH A O   1 
HETATM 2443 O O   . HOH F 4 .   ? 59.404 57.779 17.101  1.00 45.98 ? 671 HOH A O   1 
HETATM 2444 O O   . HOH F 4 .   ? 63.490 58.215 6.004   1.00 35.11 ? 672 HOH A O   1 
HETATM 2445 O O   . HOH F 4 .   ? 53.319 29.480 16.685  1.00 36.84 ? 673 HOH A O   1 
HETATM 2446 O O   . HOH F 4 .   ? 73.412 50.897 8.328   1.00 52.72 ? 674 HOH A O   1 
HETATM 2447 O O   . HOH F 4 .   ? 23.186 41.398 15.896  1.00 48.84 ? 675 HOH A O   1 
HETATM 2448 O O   . HOH F 4 .   ? 42.324 48.636 -8.466  1.00 38.43 ? 676 HOH A O   1 
HETATM 2449 O O   . HOH F 4 .   ? 70.604 51.011 4.614   1.00 39.52 ? 677 HOH A O   1 
HETATM 2450 O O   . HOH F 4 .   ? 70.557 46.895 6.581   1.00 44.00 ? 678 HOH A O   1 
HETATM 2451 O O   . HOH F 4 .   ? 55.238 50.654 0.866   1.00 38.08 ? 679 HOH A O   1 
HETATM 2452 O O   . HOH F 4 .   ? 40.630 57.721 7.197   1.00 40.37 ? 680 HOH A O   1 
HETATM 2453 O O   . HOH F 4 .   ? 47.278 33.471 -3.507  1.00 45.89 ? 681 HOH A O   1 
HETATM 2454 O O   . HOH F 4 .   ? 17.367 50.645 -8.982  1.00 37.26 ? 682 HOH A O   1 
HETATM 2455 O O   . HOH F 4 .   ? 21.590 44.362 -6.091  1.00 41.23 ? 683 HOH A O   1 
HETATM 2456 O O   . HOH F 4 .   ? 67.947 52.590 20.003  1.00 38.50 ? 684 HOH A O   1 
HETATM 2457 O O   . HOH F 4 .   ? 60.390 50.336 -0.722  1.00 43.89 ? 685 HOH A O   1 
HETATM 2458 O O   . HOH F 4 .   ? 57.222 57.797 19.422  1.00 43.53 ? 686 HOH A O   1 
HETATM 2459 O O   . HOH F 4 .   ? 24.499 51.461 4.947   1.00 40.62 ? 687 HOH A O   1 
HETATM 2460 O O   . HOH F 4 .   ? 54.844 30.821 7.248   1.00 54.32 ? 688 HOH A O   1 
HETATM 2461 O O   . HOH F 4 .   ? 62.782 53.781 -2.366  1.00 48.15 ? 689 HOH A O   1 
HETATM 2462 O O   . HOH F 4 .   ? 41.820 43.226 29.376  1.00 45.35 ? 690 HOH A O   1 
HETATM 2463 O O   . HOH F 4 .   ? 27.735 56.612 -2.416  1.00 47.29 ? 691 HOH A O   1 
HETATM 2464 O O   . HOH F 4 .   ? 45.128 48.242 -8.478  1.00 41.55 ? 692 HOH A O   1 
HETATM 2465 O O   . HOH F 4 .   ? 51.290 27.602 15.492  1.00 50.57 ? 693 HOH A O   1 
HETATM 2466 O O   . HOH F 4 .   ? 20.261 41.607 -5.551  1.00 43.58 ? 694 HOH A O   1 
HETATM 2467 O O   . HOH F 4 .   ? 30.512 53.766 15.572  1.00 40.85 ? 695 HOH A O   1 
HETATM 2468 O O   . HOH F 4 .   ? 37.166 31.812 -5.865  1.00 50.45 ? 696 HOH A O   1 
HETATM 2469 O O   . HOH F 4 .   ? 31.703 56.015 14.220  1.00 48.15 ? 697 HOH A O   1 
HETATM 2470 O O   . HOH F 4 .   ? 61.261 36.881 -1.650  1.00 38.53 ? 698 HOH A O   1 
HETATM 2471 O O   . HOH F 4 .   ? 41.281 62.593 16.776  1.00 47.14 ? 699 HOH A O   1 
HETATM 2472 O O   . HOH F 4 .   ? 31.945 38.142 10.903  1.00 26.65 ? 700 HOH A O   1 
HETATM 2473 O O   . HOH F 4 .   ? 43.183 32.043 14.676  1.00 28.92 ? 701 HOH A O   1 
HETATM 2474 O O   . HOH F 4 .   ? 46.848 28.587 15.470  1.00 45.22 ? 702 HOH A O   1 
HETATM 2475 O O   . HOH F 4 .   ? 46.993 27.190 9.351   1.00 41.57 ? 703 HOH A O   1 
HETATM 2476 O O   . HOH F 4 .   ? 24.287 47.771 8.031   1.00 40.85 ? 704 HOH A O   1 
HETATM 2477 O O   . HOH F 4 .   ? 60.415 43.540 -3.438  1.00 41.75 ? 705 HOH A O   1 
HETATM 2478 O O   . HOH F 4 .   ? 26.889 44.294 -12.922 1.00 44.33 ? 706 HOH A O   1 
HETATM 2479 O O   . HOH F 4 .   ? 38.637 51.135 35.961  1.00 51.88 ? 707 HOH A O   1 
HETATM 2480 O O   . HOH F 4 .   ? 24.640 48.057 4.744   1.00 41.89 ? 708 HOH A O   1 
HETATM 2481 O O   . HOH F 4 .   ? 22.190 44.293 -8.596  1.00 42.85 ? 709 HOH A O   1 
HETATM 2482 O O   . HOH F 4 .   ? 38.833 30.922 9.234   1.00 46.27 ? 710 HOH A O   1 
HETATM 2483 O O   . HOH F 4 .   ? 45.206 29.410 0.426   1.00 56.31 ? 711 HOH A O   1 
HETATM 2484 O O   . HOH F 4 .   ? 48.134 46.311 32.534  1.00 45.62 ? 712 HOH A O   1 
HETATM 2485 O O   . HOH F 4 .   ? 36.808 34.410 -7.853  1.00 43.27 ? 713 HOH A O   1 
HETATM 2486 O O   . HOH F 4 .   ? 66.332 41.930 28.715  1.00 48.80 ? 714 HOH A O   1 
HETATM 2487 O O   . HOH F 4 .   ? 52.241 46.265 -6.363  1.00 42.02 ? 715 HOH A O   1 
HETATM 2488 O O   . HOH F 4 .   ? 34.361 57.806 18.381  1.00 47.34 ? 716 HOH A O   1 
HETATM 2489 O O   . HOH F 4 .   ? 23.222 44.532 18.332  1.00 46.12 ? 717 HOH A O   1 
HETATM 2490 O O   . HOH F 4 .   ? 49.181 28.628 2.066   1.00 52.34 ? 718 HOH A O   1 
HETATM 2491 O O   . HOH F 4 .   ? 70.439 55.939 16.912  1.00 47.01 ? 719 HOH A O   1 
HETATM 2492 O O   . HOH F 4 .   ? 54.357 62.970 8.724   1.00 43.52 ? 720 HOH A O   1 
HETATM 2493 O O   . HOH F 4 .   ? 56.453 33.244 -0.002  1.00 41.19 ? 721 HOH A O   1 
HETATM 2494 O O   . HOH F 4 .   ? 21.397 48.910 13.810  1.00 42.65 ? 722 HOH A O   1 
HETATM 2495 O O   . HOH F 4 .   ? 68.537 44.542 11.805  1.00 36.15 ? 723 HOH A O   1 
HETATM 2496 O O   . HOH F 4 .   ? 43.382 54.412 2.471   1.00 34.93 ? 724 HOH A O   1 
HETATM 2497 O O   . HOH F 4 .   ? 61.524 36.652 33.083  1.00 44.30 ? 725 HOH A O   1 
HETATM 2498 O O   . HOH F 4 .   ? 54.703 42.926 -6.290  1.00 43.25 ? 726 HOH A O   1 
HETATM 2499 O O   . HOH F 4 .   ? 23.863 50.605 16.813  1.00 41.87 ? 727 HOH A O   1 
HETATM 2500 O O   . HOH F 4 .   ? 37.165 55.092 19.837  1.00 43.58 ? 728 HOH A O   1 
HETATM 2501 O O   . HOH F 4 .   ? 31.495 53.259 19.967  1.00 45.06 ? 729 HOH A O   1 
HETATM 2502 O O   . HOH F 4 .   ? 43.544 35.240 23.241  1.00 34.21 ? 730 HOH A O   1 
HETATM 2503 O O   . HOH F 4 .   ? 30.725 50.585 -14.917 1.00 51.63 ? 731 HOH A O   1 
HETATM 2504 O O   . HOH F 4 .   ? 33.408 59.311 11.221  1.00 47.43 ? 732 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -12 ?   ?   ?   A . n 
A 1 2   GLY 2   -11 ?   ?   ?   A . n 
A 1 3   SER 3   -10 ?   ?   ?   A . n 
A 1 4   ASP 4   -9  ?   ?   ?   A . n 
A 1 5   LYS 5   -8  ?   ?   ?   A . n 
A 1 6   ILE 6   -7  ?   ?   ?   A . n 
A 1 7   HIS 7   -6  ?   ?   ?   A . n 
A 1 8   HIS 8   -5  ?   ?   ?   A . n 
A 1 9   HIS 9   -4  ?   ?   ?   A . n 
A 1 10  HIS 10  -3  ?   ?   ?   A . n 
A 1 11  HIS 11  -2  ?   ?   ?   A . n 
A 1 12  HIS 12  -1  ?   ?   ?   A . n 
A 1 13  MET 13  0   ?   ?   ?   A . n 
A 1 14  ASN 14  44  ?   ?   ?   A . n 
A 1 15  THR 15  45  45  THR THR A . n 
A 1 16  PRO 16  46  46  PRO PRO A . n 
A 1 17  ARG 17  47  47  ARG ARG A . n 
A 1 18  GLU 18  48  48  GLU GLU A . n 
A 1 19  VAL 19  49  49  VAL VAL A . n 
A 1 20  THR 20  50  50  THR THR A . n 
A 1 21  LEU 21  51  51  LEU LEU A . n 
A 1 22  HIS 22  52  52  HIS HIS A . n 
A 1 23  PHE 23  53  53  PHE PHE A . n 
A 1 24  LEU 24  54  54  LEU LEU A . n 
A 1 25  ARG 25  55  55  ARG ARG A . n 
A 1 26  THR 26  56  56  THR THR A . n 
A 1 27  ALA 27  57  57  ALA ALA A . n 
A 1 28  GLY 28  58  58  GLY GLY A . n 
A 1 29  HIS 29  59  59  HIS HIS A . n 
A 1 30  PRO 30  60  60  PRO PRO A . n 
A 1 31  LEU 31  61  61  LEU LEU A . n 
A 1 32  THR 32  62  62  THR THR A . n 
A 1 33  ARG 33  63  63  ARG ARG A . n 
A 1 34  TRP 34  64  64  TRP TRP A . n 
A 1 35  ALA 35  65  65  ALA ALA A . n 
A 1 36  LEU 36  66  66  LEU LEU A . n 
A 1 37  GLN 37  67  67  GLN GLN A . n 
A 1 38  ARG 38  68  68  ARG ARG A . n 
A 1 39  GLN 39  69  69  GLN GLN A . n 
A 1 40  PRO 40  70  70  PRO PRO A . n 
A 1 41  PRO 41  71  71  PRO PRO A . n 
A 1 42  SER 42  72  72  SER SER A . n 
A 1 43  PRO 43  73  73  PRO PRO A . n 
A 1 44  LYS 44  74  74  LYS LYS A . n 
A 1 45  GLN 45  75  75  GLN GLN A . n 
A 1 46  LEU 46  76  76  LEU LEU A . n 
A 1 47  GLU 47  77  77  GLU GLU A . n 
A 1 48  GLU 48  78  78  GLU GLU A . n 
A 1 49  GLU 49  79  79  GLU GLU A . n 
A 1 50  PHE 50  80  80  PHE PHE A . n 
A 1 51  LEU 51  81  81  LEU LEU A . n 
A 1 52  LYS 52  82  82  LYS LYS A . n 
A 1 53  ILE 53  83  83  ILE ILE A . n 
A 1 54  PRO 54  84  84  PRO PRO A . n 
A 1 55  SER 55  85  85  SER SER A . n 
A 1 56  ASN 56  86  86  ASN ASN A . n 
A 1 57  PHE 57  87  87  PHE PHE A . n 
A 1 58  VAL 58  88  88  VAL VAL A . n 
A 1 59  SER 59  89  89  SER SER A . n 
A 1 60  PRO 60  90  90  PRO PRO A . n 
A 1 61  GLU 61  91  91  GLU GLU A . n 
A 1 62  ASP 62  92  92  ASP ASP A . n 
A 1 63  LEU 63  93  93  LEU LEU A . n 
A 1 64  ASP 64  94  94  ASP ASP A . n 
A 1 65  ILE 65  95  95  ILE ILE A . n 
A 1 66  PRO 66  96  96  PRO PRO A . n 
A 1 67  GLY 67  97  97  GLY GLY A . n 
A 1 68  HIS 68  98  98  HIS HIS A . n 
A 1 69  ALA 69  99  99  ALA ALA A . n 
A 1 70  SER 70  100 100 SER SER A . n 
A 1 71  LYS 71  101 101 LYS LYS A . n 
A 1 72  ASP 72  102 102 ASP ASP A . n 
A 1 73  ARG 73  103 103 ARG ARG A . n 
A 1 74  TYR 74  104 104 TYR TYR A . n 
A 1 75  LYS 75  105 105 LYS LYS A . n 
A 1 76  THR 76  106 106 THR THR A . n 
A 1 77  ILE 77  107 107 ILE ILE A . n 
A 1 78  LEU 78  108 108 LEU LEU A . n 
A 1 79  PRO 79  109 109 PRO PRO A . n 
A 1 80  ASN 80  110 110 ASN ASN A . n 
A 1 81  PRO 81  111 111 PRO PRO A . n 
A 1 82  GLN 82  112 112 GLN GLN A . n 
A 1 83  SER 83  113 113 SER SER A . n 
A 1 84  ARG 84  114 114 ARG ARG A . n 
A 1 85  VAL 85  115 115 VAL VAL A . n 
A 1 86  CYS 86  116 116 CYS CYS A . n 
A 1 87  LEU 87  117 117 LEU LEU A . n 
A 1 88  GLY 88  118 118 GLY GLY A . n 
A 1 89  ARG 89  119 119 ARG ARG A . n 
A 1 90  ALA 90  120 120 ALA ALA A . n 
A 1 91  GLN 91  121 121 GLN GLN A . n 
A 1 92  SER 92  122 122 SER SER A . n 
A 1 93  GLN 93  123 123 GLN GLN A . n 
A 1 94  GLU 94  124 124 GLU GLU A . n 
A 1 95  ASP 95  125 125 ASP ASP A . n 
A 1 96  GLY 96  126 126 GLY GLY A . n 
A 1 97  ASP 97  127 127 ASP ASP A . n 
A 1 98  TYR 98  128 128 TYR TYR A . n 
A 1 99  ILE 99  129 129 ILE ILE A . n 
A 1 100 ASN 100 130 130 ASN ASN A . n 
A 1 101 ALA 101 131 131 ALA ALA A . n 
A 1 102 ASN 102 132 132 ASN ASN A . n 
A 1 103 TYR 103 133 133 TYR TYR A . n 
A 1 104 ILE 104 134 134 ILE ILE A . n 
A 1 105 ARG 105 135 135 ARG ARG A . n 
A 1 106 GLY 106 136 136 GLY GLY A . n 
A 1 107 TYR 107 137 137 TYR TYR A . n 
A 1 108 ASP 108 138 138 ASP ASP A . n 
A 1 109 GLY 109 139 139 GLY GLY A . n 
A 1 110 LYS 110 140 140 LYS LYS A . n 
A 1 111 GLU 111 141 141 GLU GLU A . n 
A 1 112 LYS 112 142 142 LYS LYS A . n 
A 1 113 VAL 113 143 143 VAL VAL A . n 
A 1 114 TYR 114 144 144 TYR TYR A . n 
A 1 115 ILE 115 145 145 ILE ILE A . n 
A 1 116 ALA 116 146 146 ALA ALA A . n 
A 1 117 THR 117 147 147 THR THR A . n 
A 1 118 GLN 118 148 148 GLN GLN A . n 
A 1 119 GLY 119 149 149 GLY GLY A . n 
A 1 120 PRO 120 150 150 PRO PRO A . n 
A 1 121 MET 121 151 151 MET MET A . n 
A 1 122 PRO 122 152 152 PRO PRO A . n 
A 1 123 ASN 123 153 153 ASN ASN A . n 
A 1 124 THR 124 154 154 THR THR A . n 
A 1 125 VAL 125 155 155 VAL VAL A . n 
A 1 126 SER 126 156 156 SER SER A . n 
A 1 127 ASP 127 157 157 ASP ASP A . n 
A 1 128 PHE 128 158 158 PHE PHE A . n 
A 1 129 TRP 129 159 159 TRP TRP A . n 
A 1 130 GLU 130 160 160 GLU GLU A . n 
A 1 131 MET 131 161 161 MET MET A . n 
A 1 132 VAL 132 162 162 VAL VAL A . n 
A 1 133 TRP 133 163 163 TRP TRP A . n 
A 1 134 GLN 134 164 164 GLN GLN A . n 
A 1 135 GLU 135 165 165 GLU GLU A . n 
A 1 136 GLU 136 166 166 GLU GLU A . n 
A 1 137 VAL 137 167 167 VAL VAL A . n 
A 1 138 SER 138 168 168 SER SER A . n 
A 1 139 LEU 139 169 169 LEU LEU A . n 
A 1 140 ILE 140 170 170 ILE ILE A . n 
A 1 141 VAL 141 171 171 VAL VAL A . n 
A 1 142 MET 142 172 172 MET MET A . n 
A 1 143 LEU 143 173 173 LEU LEU A . n 
A 1 144 THR 144 174 174 THR THR A . n 
A 1 145 GLN 145 175 175 GLN GLN A . n 
A 1 146 LEU 146 176 176 LEU LEU A . n 
A 1 147 ARG 147 177 ?   ?   ?   A . n 
A 1 148 GLU 148 178 ?   ?   ?   A . n 
A 1 149 GLY 149 179 ?   ?   ?   A . n 
A 1 150 LYS 150 180 ?   ?   ?   A . n 
A 1 151 GLU 151 181 ?   ?   ?   A . n 
A 1 152 LYS 152 182 ?   ?   ?   A . n 
A 1 153 CYS 153 183 ?   ?   ?   A . n 
A 1 154 VAL 154 184 184 VAL VAL A . n 
A 1 155 HIS 155 185 185 HIS HIS A . n 
A 1 156 TYR 156 186 186 TYR TYR A . n 
A 1 157 TRP 157 187 187 TRP TRP A . n 
A 1 158 PRO 158 188 188 PRO PRO A . n 
A 1 159 THR 159 189 189 THR THR A . n 
A 1 160 GLU 160 190 190 GLU GLU A . n 
A 1 161 GLU 161 191 191 GLU GLU A . n 
A 1 162 GLU 162 192 192 GLU GLU A . n 
A 1 163 THR 163 193 193 THR THR A . n 
A 1 164 TYR 164 194 194 TYR TYR A . n 
A 1 165 GLY 165 195 195 GLY GLY A . n 
A 1 166 PRO 166 196 196 PRO PRO A . n 
A 1 167 PHE 167 197 197 PHE PHE A . n 
A 1 168 GLN 168 198 198 GLN GLN A . n 
A 1 169 ILE 169 199 199 ILE ILE A . n 
A 1 170 ARG 170 200 200 ARG ARG A . n 
A 1 171 ILE 171 201 201 ILE ILE A . n 
A 1 172 GLN 172 202 202 GLN GLN A . n 
A 1 173 ASP 173 203 203 ASP ASP A . n 
A 1 174 MET 174 204 204 MET MET A . n 
A 1 175 LYS 175 205 205 LYS LYS A . n 
A 1 176 GLU 176 206 206 GLU GLU A . n 
A 1 177 CYS 177 207 207 CYS CYS A . n 
A 1 178 PRO 178 208 208 PRO PRO A . n 
A 1 179 GLU 179 209 209 GLU GLU A . n 
A 1 180 TYR 180 210 210 TYR TYR A . n 
A 1 181 THR 181 211 211 THR THR A . n 
A 1 182 VAL 182 212 212 VAL VAL A . n 
A 1 183 ARG 183 213 213 ARG ARG A . n 
A 1 184 GLN 184 214 214 GLN GLN A . n 
A 1 185 LEU 185 215 215 LEU LEU A . n 
A 1 186 THR 186 216 216 THR THR A . n 
A 1 187 ILE 187 217 217 ILE ILE A . n 
A 1 188 GLN 188 218 218 GLN GLN A . n 
A 1 189 TYR 189 219 219 TYR TYR A . n 
A 1 190 GLN 190 220 220 GLN GLN A . n 
A 1 191 GLU 191 221 221 GLU GLU A . n 
A 1 192 GLU 192 222 222 GLU GLU A . n 
A 1 193 ARG 193 223 223 ARG ARG A . n 
A 1 194 ARG 194 224 224 ARG ARG A . n 
A 1 195 SER 195 225 225 SER SER A . n 
A 1 196 VAL 196 226 226 VAL VAL A . n 
A 1 197 LYS 197 227 227 LYS LYS A . n 
A 1 198 HIS 198 228 228 HIS HIS A . n 
A 1 199 ILE 199 229 229 ILE ILE A . n 
A 1 200 LEU 200 230 230 LEU LEU A . n 
A 1 201 PHE 201 231 231 PHE PHE A . n 
A 1 202 SER 202 232 232 SER SER A . n 
A 1 203 ALA 203 233 233 ALA ALA A . n 
A 1 204 TRP 204 234 234 TRP TRP A . n 
A 1 205 PRO 205 235 235 PRO PRO A . n 
A 1 206 ALA 206 236 236 ALA ALA A . n 
A 1 207 HIS 207 237 237 HIS HIS A . n 
A 1 208 GLN 208 238 238 GLN GLN A . n 
A 1 209 THR 209 239 239 THR THR A . n 
A 1 210 PRO 210 240 240 PRO PRO A . n 
A 1 211 GLU 211 241 241 GLU GLU A . n 
A 1 212 SER 212 242 242 SER SER A . n 
A 1 213 ALA 213 243 243 ALA ALA A . n 
A 1 214 GLY 214 244 244 GLY GLY A . n 
A 1 215 PRO 215 245 245 PRO PRO A . n 
A 1 216 LEU 216 246 246 LEU LEU A . n 
A 1 217 LEU 217 247 247 LEU LEU A . n 
A 1 218 ARG 218 248 248 ARG ARG A . n 
A 1 219 LEU 219 249 249 LEU LEU A . n 
A 1 220 VAL 220 250 250 VAL VAL A . n 
A 1 221 ALA 221 251 251 ALA ALA A . n 
A 1 222 GLU 222 252 252 GLU GLU A . n 
A 1 223 VAL 223 253 253 VAL VAL A . n 
A 1 224 GLU 224 254 254 GLU GLU A . n 
A 1 225 GLU 225 255 255 GLU GLU A . n 
A 1 226 SER 226 256 256 SER SER A . n 
A 1 227 PRO 227 257 257 PRO PRO A . n 
A 1 228 GLU 228 258 258 GLU GLU A . n 
A 1 229 THR 229 259 259 THR THR A . n 
A 1 230 ALA 230 260 260 ALA ALA A . n 
A 1 231 ALA 231 261 261 ALA ALA A . n 
A 1 232 HIS 232 262 262 HIS HIS A . n 
A 1 233 PRO 233 263 263 PRO PRO A . n 
A 1 234 GLY 234 264 264 GLY GLY A . n 
A 1 235 PRO 235 265 265 PRO PRO A . n 
A 1 236 ILE 236 266 266 ILE ILE A . n 
A 1 237 VAL 237 267 267 VAL VAL A . n 
A 1 238 VAL 238 268 268 VAL VAL A . n 
A 1 239 HIS 239 269 269 HIS HIS A . n 
A 1 240 CYS 240 270 270 CYS CYS A . n 
A 1 241 SER 241 271 271 SER SER A . n 
A 1 242 ALA 242 272 272 ALA ALA A . n 
A 1 243 GLY 243 273 273 GLY GLY A . n 
A 1 244 ILE 244 274 274 ILE ILE A . n 
A 1 245 GLY 245 275 275 GLY GLY A . n 
A 1 246 ARG 246 276 276 ARG ARG A . n 
A 1 247 THR 247 277 277 THR THR A . n 
A 1 248 GLY 248 278 278 GLY GLY A . n 
A 1 249 CYS 249 279 279 CYS CYS A . n 
A 1 250 PHE 250 280 280 PHE PHE A . n 
A 1 251 ILE 251 281 281 ILE ILE A . n 
A 1 252 ALA 252 282 282 ALA ALA A . n 
A 1 253 THR 253 283 283 THR THR A . n 
A 1 254 ARG 254 284 284 ARG ARG A . n 
A 1 255 ILE 255 285 285 ILE ILE A . n 
A 1 256 GLY 256 286 286 GLY GLY A . n 
A 1 257 CYS 257 287 287 CYS CYS A . n 
A 1 258 GLN 258 288 288 GLN GLN A . n 
A 1 259 GLN 259 289 289 GLN GLN A . n 
A 1 260 LEU 260 290 290 LEU LEU A . n 
A 1 261 LYS 261 291 291 LYS LYS A . n 
A 1 262 ALA 262 292 292 ALA ALA A . n 
A 1 263 ARG 263 293 293 ARG ARG A . n 
A 1 264 GLY 264 294 294 GLY GLY A . n 
A 1 265 GLU 265 295 295 GLU GLU A . n 
A 1 266 VAL 266 296 296 VAL VAL A . n 
A 1 267 ASP 267 297 297 ASP ASP A . n 
A 1 268 ILE 268 298 298 ILE ILE A . n 
A 1 269 LEU 269 299 299 LEU LEU A . n 
A 1 270 GLY 270 300 300 GLY GLY A . n 
A 1 271 ILE 271 301 301 ILE ILE A . n 
A 1 272 VAL 272 302 302 VAL VAL A . n 
A 1 273 CYS 273 303 303 CYS CYS A . n 
A 1 274 GLN 274 304 304 GLN GLN A . n 
A 1 275 LEU 275 305 305 LEU LEU A . n 
A 1 276 ARG 276 306 306 ARG ARG A . n 
A 1 277 LEU 277 307 307 LEU LEU A . n 
A 1 278 ASP 278 308 308 ASP ASP A . n 
A 1 279 ARG 279 309 309 ARG ARG A . n 
A 1 280 GLY 280 310 310 GLY GLY A . n 
A 1 281 GLY 281 311 311 GLY GLY A . n 
A 1 282 MET 282 312 312 MET MET A . n 
A 1 283 ILE 283 313 313 ILE ILE A . n 
A 1 284 GLN 284 314 314 GLN GLN A . n 
A 1 285 THR 285 315 315 THR THR A . n 
A 1 286 ALA 286 316 316 ALA ALA A . n 
A 1 287 GLU 287 317 317 GLU GLU A . n 
A 1 288 GLN 288 318 318 GLN GLN A . n 
A 1 289 TYR 289 319 319 TYR TYR A . n 
A 1 290 GLN 290 320 320 GLN GLN A . n 
A 1 291 PHE 291 321 321 PHE PHE A . n 
A 1 292 LEU 292 322 322 LEU LEU A . n 
A 1 293 HIS 293 323 323 HIS HIS A . n 
A 1 294 HIS 294 324 324 HIS HIS A . n 
A 1 295 THR 295 325 325 THR THR A . n 
A 1 296 LEU 296 326 326 LEU LEU A . n 
A 1 297 ALA 297 327 327 ALA ALA A . n 
A 1 298 LEU 298 328 328 LEU LEU A . n 
A 1 299 TYR 299 329 329 TYR TYR A . n 
A 1 300 ALA 300 330 330 ALA ALA A . n 
A 1 301 GLY 301 331 331 GLY GLY A . n 
A 1 302 GLN 302 332 332 GLN GLN A . n 
A 1 303 LEU 303 333 333 LEU LEU A . n 
A 1 304 PRO 304 334 334 PRO PRO A . n 
A 1 305 GLU 305 335 335 GLU GLU A . n 
A 1 306 GLU 306 336 ?   ?   ?   A . n 
A 1 307 PRO 307 337 ?   ?   ?   A . n 
A 1 308 SER 308 338 ?   ?   ?   A . n 
A 1 309 PRO 309 339 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   436 436 PO4 PO4 A . 
C 2 PO4 1   437 437 PO4 PO4 A . 
D 3 GOL 1   501 501 GOL GOL A . 
E 3 GOL 1   502 502 GOL GOL A . 
F 4 HOH 1   503 1   HOH HOH A . 
F 4 HOH 2   504 2   HOH HOH A . 
F 4 HOH 3   505 3   HOH HOH A . 
F 4 HOH 4   506 4   HOH HOH A . 
F 4 HOH 5   507 5   HOH HOH A . 
F 4 HOH 6   508 6   HOH HOH A . 
F 4 HOH 7   509 7   HOH HOH A . 
F 4 HOH 8   510 8   HOH HOH A . 
F 4 HOH 9   511 9   HOH HOH A . 
F 4 HOH 10  512 10  HOH HOH A . 
F 4 HOH 11  513 11  HOH HOH A . 
F 4 HOH 12  514 12  HOH HOH A . 
F 4 HOH 13  515 13  HOH HOH A . 
F 4 HOH 14  516 14  HOH HOH A . 
F 4 HOH 15  517 15  HOH HOH A . 
F 4 HOH 16  518 16  HOH HOH A . 
F 4 HOH 17  519 17  HOH HOH A . 
F 4 HOH 18  520 18  HOH HOH A . 
F 4 HOH 19  521 19  HOH HOH A . 
F 4 HOH 20  522 20  HOH HOH A . 
F 4 HOH 21  523 21  HOH HOH A . 
F 4 HOH 22  524 22  HOH HOH A . 
F 4 HOH 23  525 23  HOH HOH A . 
F 4 HOH 24  526 24  HOH HOH A . 
F 4 HOH 25  527 25  HOH HOH A . 
F 4 HOH 26  528 26  HOH HOH A . 
F 4 HOH 27  529 27  HOH HOH A . 
F 4 HOH 28  530 28  HOH HOH A . 
F 4 HOH 29  531 29  HOH HOH A . 
F 4 HOH 30  532 30  HOH HOH A . 
F 4 HOH 31  533 31  HOH HOH A . 
F 4 HOH 32  534 32  HOH HOH A . 
F 4 HOH 33  535 33  HOH HOH A . 
F 4 HOH 34  536 34  HOH HOH A . 
F 4 HOH 35  537 35  HOH HOH A . 
F 4 HOH 36  538 36  HOH HOH A . 
F 4 HOH 37  539 37  HOH HOH A . 
F 4 HOH 38  540 38  HOH HOH A . 
F 4 HOH 39  541 39  HOH HOH A . 
F 4 HOH 40  542 40  HOH HOH A . 
F 4 HOH 41  543 41  HOH HOH A . 
F 4 HOH 42  544 42  HOH HOH A . 
F 4 HOH 43  545 43  HOH HOH A . 
F 4 HOH 44  546 44  HOH HOH A . 
F 4 HOH 45  547 45  HOH HOH A . 
F 4 HOH 46  548 46  HOH HOH A . 
F 4 HOH 47  549 47  HOH HOH A . 
F 4 HOH 48  550 48  HOH HOH A . 
F 4 HOH 49  551 49  HOH HOH A . 
F 4 HOH 50  552 50  HOH HOH A . 
F 4 HOH 51  553 51  HOH HOH A . 
F 4 HOH 52  554 52  HOH HOH A . 
F 4 HOH 53  555 53  HOH HOH A . 
F 4 HOH 54  556 54  HOH HOH A . 
F 4 HOH 55  557 55  HOH HOH A . 
F 4 HOH 56  558 56  HOH HOH A . 
F 4 HOH 57  559 57  HOH HOH A . 
F 4 HOH 58  560 58  HOH HOH A . 
F 4 HOH 59  561 59  HOH HOH A . 
F 4 HOH 60  562 60  HOH HOH A . 
F 4 HOH 61  563 61  HOH HOH A . 
F 4 HOH 62  564 62  HOH HOH A . 
F 4 HOH 63  565 63  HOH HOH A . 
F 4 HOH 64  566 64  HOH HOH A . 
F 4 HOH 65  567 65  HOH HOH A . 
F 4 HOH 66  568 66  HOH HOH A . 
F 4 HOH 67  569 67  HOH HOH A . 
F 4 HOH 68  570 68  HOH HOH A . 
F 4 HOH 69  571 69  HOH HOH A . 
F 4 HOH 70  572 70  HOH HOH A . 
F 4 HOH 71  573 71  HOH HOH A . 
F 4 HOH 72  574 72  HOH HOH A . 
F 4 HOH 73  575 73  HOH HOH A . 
F 4 HOH 74  576 74  HOH HOH A . 
F 4 HOH 75  577 75  HOH HOH A . 
F 4 HOH 76  578 76  HOH HOH A . 
F 4 HOH 77  579 77  HOH HOH A . 
F 4 HOH 78  580 78  HOH HOH A . 
F 4 HOH 79  581 79  HOH HOH A . 
F 4 HOH 80  582 80  HOH HOH A . 
F 4 HOH 81  583 81  HOH HOH A . 
F 4 HOH 82  584 82  HOH HOH A . 
F 4 HOH 83  585 83  HOH HOH A . 
F 4 HOH 84  586 84  HOH HOH A . 
F 4 HOH 85  587 85  HOH HOH A . 
F 4 HOH 86  588 86  HOH HOH A . 
F 4 HOH 87  589 87  HOH HOH A . 
F 4 HOH 88  590 88  HOH HOH A . 
F 4 HOH 89  591 89  HOH HOH A . 
F 4 HOH 90  592 90  HOH HOH A . 
F 4 HOH 91  593 91  HOH HOH A . 
F 4 HOH 92  594 92  HOH HOH A . 
F 4 HOH 93  595 93  HOH HOH A . 
F 4 HOH 94  596 94  HOH HOH A . 
F 4 HOH 95  597 95  HOH HOH A . 
F 4 HOH 96  598 96  HOH HOH A . 
F 4 HOH 97  599 97  HOH HOH A . 
F 4 HOH 98  600 98  HOH HOH A . 
F 4 HOH 99  601 99  HOH HOH A . 
F 4 HOH 100 602 100 HOH HOH A . 
F 4 HOH 101 603 101 HOH HOH A . 
F 4 HOH 102 604 102 HOH HOH A . 
F 4 HOH 103 605 103 HOH HOH A . 
F 4 HOH 104 606 104 HOH HOH A . 
F 4 HOH 105 607 105 HOH HOH A . 
F 4 HOH 106 608 106 HOH HOH A . 
F 4 HOH 107 609 107 HOH HOH A . 
F 4 HOH 108 610 108 HOH HOH A . 
F 4 HOH 109 611 109 HOH HOH A . 
F 4 HOH 110 612 110 HOH HOH A . 
F 4 HOH 111 613 111 HOH HOH A . 
F 4 HOH 112 614 112 HOH HOH A . 
F 4 HOH 113 615 113 HOH HOH A . 
F 4 HOH 114 616 114 HOH HOH A . 
F 4 HOH 115 617 115 HOH HOH A . 
F 4 HOH 116 618 116 HOH HOH A . 
F 4 HOH 117 619 117 HOH HOH A . 
F 4 HOH 118 620 118 HOH HOH A . 
F 4 HOH 119 621 119 HOH HOH A . 
F 4 HOH 120 622 120 HOH HOH A . 
F 4 HOH 121 623 121 HOH HOH A . 
F 4 HOH 122 624 122 HOH HOH A . 
F 4 HOH 123 625 123 HOH HOH A . 
F 4 HOH 124 626 124 HOH HOH A . 
F 4 HOH 125 627 125 HOH HOH A . 
F 4 HOH 126 628 126 HOH HOH A . 
F 4 HOH 127 629 127 HOH HOH A . 
F 4 HOH 128 630 128 HOH HOH A . 
F 4 HOH 129 631 129 HOH HOH A . 
F 4 HOH 130 632 130 HOH HOH A . 
F 4 HOH 131 633 131 HOH HOH A . 
F 4 HOH 132 634 132 HOH HOH A . 
F 4 HOH 133 635 133 HOH HOH A . 
F 4 HOH 134 636 134 HOH HOH A . 
F 4 HOH 135 637 135 HOH HOH A . 
F 4 HOH 136 638 136 HOH HOH A . 
F 4 HOH 137 639 137 HOH HOH A . 
F 4 HOH 138 640 138 HOH HOH A . 
F 4 HOH 139 641 139 HOH HOH A . 
F 4 HOH 140 642 140 HOH HOH A . 
F 4 HOH 141 643 141 HOH HOH A . 
F 4 HOH 142 644 142 HOH HOH A . 
F 4 HOH 143 645 143 HOH HOH A . 
F 4 HOH 144 646 144 HOH HOH A . 
F 4 HOH 145 647 145 HOH HOH A . 
F 4 HOH 146 648 146 HOH HOH A . 
F 4 HOH 147 649 147 HOH HOH A . 
F 4 HOH 148 650 148 HOH HOH A . 
F 4 HOH 149 651 149 HOH HOH A . 
F 4 HOH 150 652 150 HOH HOH A . 
F 4 HOH 151 653 151 HOH HOH A . 
F 4 HOH 152 654 152 HOH HOH A . 
F 4 HOH 153 655 153 HOH HOH A . 
F 4 HOH 154 656 154 HOH HOH A . 
F 4 HOH 155 657 155 HOH HOH A . 
F 4 HOH 156 658 156 HOH HOH A . 
F 4 HOH 157 659 157 HOH HOH A . 
F 4 HOH 158 660 158 HOH HOH A . 
F 4 HOH 159 661 159 HOH HOH A . 
F 4 HOH 160 662 160 HOH HOH A . 
F 4 HOH 161 663 161 HOH HOH A . 
F 4 HOH 162 664 162 HOH HOH A . 
F 4 HOH 163 665 163 HOH HOH A . 
F 4 HOH 164 666 164 HOH HOH A . 
F 4 HOH 165 667 165 HOH HOH A . 
F 4 HOH 166 668 166 HOH HOH A . 
F 4 HOH 167 669 167 HOH HOH A . 
F 4 HOH 168 670 168 HOH HOH A . 
F 4 HOH 169 671 169 HOH HOH A . 
F 4 HOH 170 672 170 HOH HOH A . 
F 4 HOH 171 673 171 HOH HOH A . 
F 4 HOH 172 674 172 HOH HOH A . 
F 4 HOH 173 675 173 HOH HOH A . 
F 4 HOH 174 676 174 HOH HOH A . 
F 4 HOH 175 677 175 HOH HOH A . 
F 4 HOH 176 678 176 HOH HOH A . 
F 4 HOH 177 679 177 HOH HOH A . 
F 4 HOH 178 680 178 HOH HOH A . 
F 4 HOH 179 681 179 HOH HOH A . 
F 4 HOH 180 682 180 HOH HOH A . 
F 4 HOH 181 683 181 HOH HOH A . 
F 4 HOH 182 684 182 HOH HOH A . 
F 4 HOH 183 685 183 HOH HOH A . 
F 4 HOH 184 686 184 HOH HOH A . 
F 4 HOH 185 687 185 HOH HOH A . 
F 4 HOH 186 688 186 HOH HOH A . 
F 4 HOH 187 689 187 HOH HOH A . 
F 4 HOH 188 690 188 HOH HOH A . 
F 4 HOH 189 691 189 HOH HOH A . 
F 4 HOH 190 692 190 HOH HOH A . 
F 4 HOH 191 693 191 HOH HOH A . 
F 4 HOH 192 694 192 HOH HOH A . 
F 4 HOH 193 695 193 HOH HOH A . 
F 4 HOH 194 696 194 HOH HOH A . 
F 4 HOH 195 697 195 HOH HOH A . 
F 4 HOH 196 698 196 HOH HOH A . 
F 4 HOH 197 699 197 HOH HOH A . 
F 4 HOH 198 700 198 HOH HOH A . 
F 4 HOH 199 701 199 HOH HOH A . 
F 4 HOH 200 702 200 HOH HOH A . 
F 4 HOH 201 703 201 HOH HOH A . 
F 4 HOH 202 704 202 HOH HOH A . 
F 4 HOH 203 705 203 HOH HOH A . 
F 4 HOH 204 706 204 HOH HOH A . 
F 4 HOH 205 707 205 HOH HOH A . 
F 4 HOH 206 708 206 HOH HOH A . 
F 4 HOH 207 709 207 HOH HOH A . 
F 4 HOH 208 710 208 HOH HOH A . 
F 4 HOH 209 711 209 HOH HOH A . 
F 4 HOH 210 712 210 HOH HOH A . 
F 4 HOH 211 713 211 HOH HOH A . 
F 4 HOH 212 714 212 HOH HOH A . 
F 4 HOH 213 715 213 HOH HOH A . 
F 4 HOH 214 716 214 HOH HOH A . 
F 4 HOH 215 717 215 HOH HOH A . 
F 4 HOH 216 718 216 HOH HOH A . 
F 4 HOH 217 719 217 HOH HOH A . 
F 4 HOH 218 720 218 HOH HOH A . 
F 4 HOH 219 721 219 HOH HOH A . 
F 4 HOH 220 722 220 HOH HOH A . 
F 4 HOH 221 723 221 HOH HOH A . 
F 4 HOH 222 724 222 HOH HOH A . 
F 4 HOH 223 725 223 HOH HOH A . 
F 4 HOH 224 726 224 HOH HOH A . 
F 4 HOH 225 727 225 HOH HOH A . 
F 4 HOH 226 728 226 HOH HOH A . 
F 4 HOH 227 729 227 HOH HOH A . 
F 4 HOH 228 730 228 HOH HOH A . 
F 4 HOH 229 731 229 HOH HOH A . 
F 4 HOH 230 732 230 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-24 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         43.9300 
_pdbx_refine_tls.origin_y         44.7060 
_pdbx_refine_tls.origin_z         9.8360 
_pdbx_refine_tls.T[1][1]          -0.0727 
_pdbx_refine_tls.T[2][2]          -0.0472 
_pdbx_refine_tls.T[3][3]          -0.0676 
_pdbx_refine_tls.T[1][2]          0.0415 
_pdbx_refine_tls.T[1][3]          0.0350 
_pdbx_refine_tls.T[2][3]          0.0391 
_pdbx_refine_tls.L[1][1]          1.8238 
_pdbx_refine_tls.L[2][2]          0.9481 
_pdbx_refine_tls.L[3][3]          0.9289 
_pdbx_refine_tls.L[1][2]          -0.6103 
_pdbx_refine_tls.L[1][3]          0.6828 
_pdbx_refine_tls.L[2][3]          -0.0375 
_pdbx_refine_tls.S[1][1]          0.0871 
_pdbx_refine_tls.S[1][2]          -0.0310 
_pdbx_refine_tls.S[1][3]          -0.0985 
_pdbx_refine_tls.S[2][1]          -0.0416 
_pdbx_refine_tls.S[2][2]          0.0359 
_pdbx_refine_tls.S[2][3]          0.0286 
_pdbx_refine_tls.S[3][1]          -0.0940 
_pdbx_refine_tls.S[3][2]          -0.1447 
_pdbx_refine_tls.S[3][3]          -0.1231 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     45 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    15 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     335 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    305 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
_pdbx_phasing_MR.entry_id                     2QDC 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           34.140 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        34.140 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .     ?                other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC      .     ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
HKL-2000    .     ?                ?       ?                    ?                           'data collection' ? ?          ? 6 
HKL-2000    .     ?                ?       ?                    ?                           'data reduction'  ? ?          ? 7 
HKL-2000    .     ?                ?       ?                    ?                           'data scaling'    ? ?          ? 8 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    175 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    703 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 69  ? ? -144.92 54.61   
2 1 ASP A 94  ? ? -107.69 69.47   
3 1 ASP A 125 ? ? -98.65  45.81   
4 1 GLU A 190 ? ? -126.43 -60.38  
5 1 GLN A 220 ? ? 51.56   -125.32 
6 1 ILE A 313 ? ? 68.68   108.58  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    334 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    335 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            47.15 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 48  ? CD  ? A GLU 18  CD  
2  1 Y 1 A GLU 48  ? OE1 ? A GLU 18  OE1 
3  1 Y 1 A GLU 48  ? OE2 ? A GLU 18  OE2 
4  1 Y 1 A GLU 91  ? CD  ? A GLU 61  CD  
5  1 Y 1 A GLU 91  ? OE1 ? A GLU 61  OE1 
6  1 Y 1 A GLU 91  ? OE2 ? A GLU 61  OE2 
7  1 Y 1 A LYS 105 ? CE  ? A LYS 75  CE  
8  1 Y 1 A LYS 105 ? NZ  ? A LYS 75  NZ  
9  1 Y 1 A GLN 123 ? CG  ? A GLN 93  CG  
10 1 Y 1 A GLN 123 ? CD  ? A GLN 93  CD  
11 1 Y 1 A GLN 123 ? OE1 ? A GLN 93  OE1 
12 1 Y 1 A GLN 123 ? NE2 ? A GLN 93  NE2 
13 1 Y 1 A ASP 125 ? CG  ? A ASP 95  CG  
14 1 Y 1 A ASP 125 ? OD1 ? A ASP 95  OD1 
15 1 Y 1 A ASP 125 ? OD2 ? A ASP 95  OD2 
16 1 Y 1 A LEU 176 ? CG  ? A LEU 146 CG  
17 1 Y 1 A LEU 176 ? CD1 ? A LEU 146 CD1 
18 1 Y 1 A LEU 176 ? CD2 ? A LEU 146 CD2 
19 1 Y 1 A ARG 200 ? NE  ? A ARG 170 NE  
20 1 Y 1 A ARG 200 ? CZ  ? A ARG 170 CZ  
21 1 Y 1 A ARG 200 ? NH1 ? A ARG 170 NH1 
22 1 Y 1 A ARG 200 ? NH2 ? A ARG 170 NH2 
23 1 Y 1 A GLN 202 ? CD  ? A GLN 172 CD  
24 1 Y 1 A GLN 202 ? OE1 ? A GLN 172 OE1 
25 1 Y 1 A GLN 202 ? NE2 ? A GLN 172 NE2 
26 1 Y 1 A LYS 205 ? CE  ? A LYS 175 CE  
27 1 Y 1 A LYS 205 ? NZ  ? A LYS 175 NZ  
28 1 Y 1 A GLU 206 ? CD  ? A GLU 176 CD  
29 1 Y 1 A GLU 206 ? OE1 ? A GLU 176 OE1 
30 1 Y 1 A GLU 206 ? OE2 ? A GLU 176 OE2 
31 1 Y 1 A GLU 258 ? CG  ? A GLU 228 CG  
32 1 Y 1 A GLU 258 ? CD  ? A GLU 228 CD  
33 1 Y 1 A GLU 258 ? OE1 ? A GLU 228 OE1 
34 1 Y 1 A GLU 258 ? OE2 ? A GLU 228 OE2 
35 1 Y 1 A THR 259 ? OG1 ? A THR 229 OG1 
36 1 Y 1 A THR 259 ? CG2 ? A THR 229 CG2 
37 1 Y 1 A HIS 262 ? CG  ? A HIS 232 CG  
38 1 Y 1 A HIS 262 ? ND1 ? A HIS 232 ND1 
39 1 Y 1 A HIS 262 ? CD2 ? A HIS 232 CD2 
40 1 Y 1 A HIS 262 ? CE1 ? A HIS 232 CE1 
41 1 Y 1 A HIS 262 ? NE2 ? A HIS 232 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -12 ? A MET 1   
2  1 Y 1 A GLY -11 ? A GLY 2   
3  1 Y 1 A SER -10 ? A SER 3   
4  1 Y 1 A ASP -9  ? A ASP 4   
5  1 Y 1 A LYS -8  ? A LYS 5   
6  1 Y 1 A ILE -7  ? A ILE 6   
7  1 Y 1 A HIS -6  ? A HIS 7   
8  1 Y 1 A HIS -5  ? A HIS 8   
9  1 Y 1 A HIS -4  ? A HIS 9   
10 1 Y 1 A HIS -3  ? A HIS 10  
11 1 Y 1 A HIS -2  ? A HIS 11  
12 1 Y 1 A HIS -1  ? A HIS 12  
13 1 Y 1 A MET 0   ? A MET 13  
14 1 Y 1 A ASN 44  ? A ASN 14  
15 1 Y 1 A ARG 177 ? A ARG 147 
16 1 Y 1 A GLU 178 ? A GLU 148 
17 1 Y 1 A GLY 179 ? A GLY 149 
18 1 Y 1 A LYS 180 ? A LYS 150 
19 1 Y 1 A GLU 181 ? A GLU 151 
20 1 Y 1 A LYS 182 ? A LYS 152 
21 1 Y 1 A CYS 183 ? A CYS 153 
22 1 Y 1 A GLU 336 ? A GLU 306 
23 1 Y 1 A PRO 337 ? A PRO 307 
24 1 Y 1 A SER 338 ? A SER 308 
25 1 Y 1 A PRO 339 ? A PRO 309 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 GLYCEROL        GOL 
4 water           HOH 
#