data_2QKK
# 
_entry.id   2QKK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QKK         
NDB   PH0042       
RCSB  RCSB043714   
WWPDB D_1000043714 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2QK9 . unspecified 
PDB 2QKB . unspecified 
# 
_pdbx_database_status.entry_id                        2QKK 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-07-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nowotny, M.'      1 
'Gaidamakov, S.A.' 2 
'Ghirlando, R.'    3 
'Cerritelli, S.M.' 4 
'Crouch, R.J.'     5 
'Yang, W.'         6 
# 
_citation.id                        primary 
_citation.title                     
'Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            28 
_citation.page_first                264 
_citation.page_last                 276 
_citation.year                      2007 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17964265 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2007.08.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nowotny, M.'      1 
primary 'Gaidamakov, S.A.' 2 
primary 'Ghirlando, R.'    3 
primary 'Cerritelli, S.M.' 4 
primary 'Crouch, R.J.'     5 
primary 'Yang, W.'         6 
# 
_cell.entry_id           2QKK 
_cell.length_a           151.065 
_cell.length_b           176.200 
_cell.length_c           125.845 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.22 
_cell.angle_gamma        90.00 
_cell.Z_PDB              44 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QKK 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'" 4382.659  6   ?        ?     ? ? 
2 polymer     syn "5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'" 4360.840  6   ?        ?     ? ? 
3 polymer     man 'Ribonuclease H1'                                    17104.279 11  3.1.26.4 D210N 
'C-terminal domain (residues 134-286)' ? 
4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL             122.143   1   ?        ?     ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    14  ?        ?     ? ? 
6 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'               195.237   1   ?        ?     ? ? 
7 non-polymer syn 'CHLORIDE ION'                                       35.453    1   ?        ?     ? ? 
8 water       nat water                                                18.015    172 ?        ?     ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Hs-RNase HC; RNase H1; Ribonuclease H type II' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.3.1.26.4 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide      no no CGACACCUGAUUCC CGACACCUGAUUCC C,G,K,O,T,X           ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DC)(DG)' GGAATCAGGTGTCG D,H,L,P,U,Z           ? 
3 'polypeptide(L)'        no no 
;GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSM
FTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
;
;GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSM
FTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
;
A,B,E,F,I,J,M,N,R,S,W ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   C   n 
1 2   G   n 
1 3   A   n 
1 4   C   n 
1 5   A   n 
1 6   C   n 
1 7   C   n 
1 8   U   n 
1 9   G   n 
1 10  A   n 
1 11  U   n 
1 12  U   n 
1 13  C   n 
1 14  C   n 
2 1   DG  n 
2 2   DG  n 
2 3   DA  n 
2 4   DA  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DT  n 
2 11  DG  n 
2 12  DT  n 
2 13  DC  n 
2 14  DG  n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MET n 
3 5   GLY n 
3 6   ASP n 
3 7   PHE n 
3 8   VAL n 
3 9   VAL n 
3 10  VAL n 
3 11  TYR n 
3 12  THR n 
3 13  ASP n 
3 14  GLY n 
3 15  CYS n 
3 16  CYS n 
3 17  SER n 
3 18  SER n 
3 19  ASN n 
3 20  GLY n 
3 21  ARG n 
3 22  ARG n 
3 23  ARG n 
3 24  PRO n 
3 25  ARG n 
3 26  ALA n 
3 27  GLY n 
3 28  ILE n 
3 29  GLY n 
3 30  VAL n 
3 31  TYR n 
3 32  TRP n 
3 33  GLY n 
3 34  PRO n 
3 35  GLY n 
3 36  HIS n 
3 37  PRO n 
3 38  LEU n 
3 39  ASN n 
3 40  VAL n 
3 41  GLY n 
3 42  ILE n 
3 43  ARG n 
3 44  LEU n 
3 45  PRO n 
3 46  GLY n 
3 47  ARG n 
3 48  GLN n 
3 49  THR n 
3 50  ASN n 
3 51  GLN n 
3 52  ARG n 
3 53  ALA n 
3 54  GLU n 
3 55  ILE n 
3 56  HIS n 
3 57  ALA n 
3 58  ALA n 
3 59  CYS n 
3 60  LYS n 
3 61  ALA n 
3 62  ILE n 
3 63  GLU n 
3 64  GLN n 
3 65  ALA n 
3 66  LYS n 
3 67  THR n 
3 68  GLN n 
3 69  ASN n 
3 70  ILE n 
3 71  ASN n 
3 72  LYS n 
3 73  LEU n 
3 74  VAL n 
3 75  LEU n 
3 76  TYR n 
3 77  THR n 
3 78  ASN n 
3 79  SER n 
3 80  MET n 
3 81  PHE n 
3 82  THR n 
3 83  ILE n 
3 84  ASN n 
3 85  GLY n 
3 86  ILE n 
3 87  THR n 
3 88  ASN n 
3 89  TRP n 
3 90  VAL n 
3 91  GLN n 
3 92  GLY n 
3 93  TRP n 
3 94  LYS n 
3 95  LYS n 
3 96  ASN n 
3 97  GLY n 
3 98  TRP n 
3 99  LYS n 
3 100 THR n 
3 101 SER n 
3 102 ALA n 
3 103 GLY n 
3 104 LYS n 
3 105 GLU n 
3 106 VAL n 
3 107 ILE n 
3 108 ASN n 
3 109 LYS n 
3 110 GLU n 
3 111 ASP n 
3 112 PHE n 
3 113 VAL n 
3 114 ALA n 
3 115 LEU n 
3 116 GLU n 
3 117 ARG n 
3 118 LEU n 
3 119 THR n 
3 120 GLN n 
3 121 GLY n 
3 122 MET n 
3 123 ASP n 
3 124 ILE n 
3 125 GLN n 
3 126 TRP n 
3 127 MET n 
3 128 HIS n 
3 129 VAL n 
3 130 PRO n 
3 131 GLY n 
3 132 HIS n 
3 133 SER n 
3 134 GLY n 
3 135 PHE n 
3 136 ILE n 
3 137 GLY n 
3 138 ASN n 
3 139 GLU n 
3 140 GLU n 
3 141 ALA n 
3 142 ASP n 
3 143 ARG n 
3 144 LEU n 
3 145 ALA n 
3 146 ARG n 
3 147 GLU n 
3 148 GLY n 
3 149 ALA n 
3 150 LYS n 
3 151 GLN n 
3 152 SER n 
3 153 GLU n 
3 154 ASP n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RNASEH1, RNH1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP RNH1_HUMAN O60930 136 
;MGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTI
NGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
;
? 
2 1 PDB 2QKK       2QKK   ?   ? ? 
3 2 PDB 2QKK       2QKK   ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2QKK A 4 ? 154 ? O60930 136 ? 286 ? 136 286 
2  1 2QKK B 4 ? 154 ? O60930 136 ? 286 ? 136 286 
3  1 2QKK E 4 ? 154 ? O60930 136 ? 286 ? 136 286 
4  1 2QKK F 4 ? 154 ? O60930 136 ? 286 ? 136 286 
5  1 2QKK I 4 ? 154 ? O60930 136 ? 286 ? 136 286 
6  1 2QKK J 4 ? 154 ? O60930 136 ? 286 ? 136 286 
7  1 2QKK M 4 ? 154 ? O60930 136 ? 286 ? 136 286 
8  1 2QKK N 4 ? 154 ? O60930 136 ? 286 ? 136 286 
9  1 2QKK R 4 ? 154 ? O60930 136 ? 286 ? 136 286 
10 1 2QKK S 4 ? 154 ? O60930 136 ? 286 ? 136 286 
11 1 2QKK W 4 ? 154 ? O60930 136 ? 286 ? 136 286 
12 2 2QKK C 1 ? 14  ? 2QKK   1   ? 14  ? 1   14  
13 3 2QKK D 1 ? 14  ? 2QKK   15  ? 28  ? 15  28  
14 2 2QKK G 1 ? 14  ? 2QKK   1   ? 14  ? 1   14  
15 3 2QKK H 1 ? 14  ? 2QKK   15  ? 28  ? 15  28  
16 2 2QKK K 1 ? 14  ? 2QKK   1   ? 14  ? 1   14  
17 3 2QKK L 1 ? 14  ? 2QKK   15  ? 28  ? 15  28  
18 2 2QKK O 1 ? 14  ? 2QKK   1   ? 14  ? 1   14  
19 3 2QKK P 1 ? 14  ? 2QKK   15  ? 28  ? 15  28  
20 2 2QKK T 1 ? 14  ? 2QKK   1   ? 14  ? 1   14  
21 3 2QKK U 1 ? 14  ? 2QKK   15  ? 28  ? 15  28  
22 2 2QKK X 1 ? 14  ? 2QKK   1   ? 14  ? 1   14  
23 3 2QKK Z 1 ? 14  ? 2QKK   15  ? 28  ? 15  28  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2QKK GLY A 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 1  
1  2QKK SER A 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 2  
1  2QKK HIS A 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 3  
1  2QKK ASN A 78 ? UNP O60930 ASP 210 ENGINEERED       210 4  
2  2QKK GLY B 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 5  
2  2QKK SER B 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 6  
2  2QKK HIS B 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 7  
2  2QKK ASN B 78 ? UNP O60930 ASP 210 ENGINEERED       210 8  
3  2QKK GLY E 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 9  
3  2QKK SER E 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 10 
3  2QKK HIS E 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 11 
3  2QKK ASN E 78 ? UNP O60930 ASP 210 ENGINEERED       210 12 
4  2QKK GLY F 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 13 
4  2QKK SER F 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 14 
4  2QKK HIS F 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 15 
4  2QKK ASN F 78 ? UNP O60930 ASP 210 ENGINEERED       210 16 
5  2QKK GLY I 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 17 
5  2QKK SER I 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 18 
5  2QKK HIS I 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 19 
5  2QKK ASN I 78 ? UNP O60930 ASP 210 ENGINEERED       210 20 
6  2QKK GLY J 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 21 
6  2QKK SER J 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 22 
6  2QKK HIS J 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 23 
6  2QKK ASN J 78 ? UNP O60930 ASP 210 ENGINEERED       210 24 
7  2QKK GLY M 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 25 
7  2QKK SER M 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 26 
7  2QKK HIS M 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 27 
7  2QKK ASN M 78 ? UNP O60930 ASP 210 ENGINEERED       210 28 
8  2QKK GLY N 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 29 
8  2QKK SER N 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 30 
8  2QKK HIS N 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 31 
8  2QKK ASN N 78 ? UNP O60930 ASP 210 ENGINEERED       210 32 
9  2QKK GLY R 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 33 
9  2QKK SER R 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 34 
9  2QKK HIS R 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 35 
9  2QKK ASN R 78 ? UNP O60930 ASP 210 ENGINEERED       210 36 
10 2QKK GLY S 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 37 
10 2QKK SER S 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 38 
10 2QKK HIS S 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 39 
10 2QKK ASN S 78 ? UNP O60930 ASP 210 ENGINEERED       210 40 
11 2QKK GLY W 1  ? UNP O60930 ?   ?   'EXPRESSION TAG' 133 41 
11 2QKK SER W 2  ? UNP O60930 ?   ?   'EXPRESSION TAG' 134 42 
11 2QKK HIS W 3  ? UNP O60930 ?   ?   'EXPRESSION TAG' 135 43 
11 2QKK ASN W 78 ? UNP O60930 ASP 210 ENGINEERED       210 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"             ?             'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                  ?             'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?             'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?             'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?             'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"              ?             'C9 H14 N3 O8 P'  323.197 
CA  non-polymer         . 'CALCIUM ION'                            ?             'Ca 2'            40.078  
CL  non-polymer         . 'CHLORIDE ION'                           ?             'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                 ?             'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?             'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?             'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?             'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?             'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"             ?             'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                ?             'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?             'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?             'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?             'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?             'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?             'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?             'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?             'C6 H15 N2 O2 1'  147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'   ?             'C6 H13 N O4 S'   195.237 
MET 'L-peptide linking' y METHIONINE                               ?             'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?             'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?             'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?             'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?             'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?             'C11 H12 N2 O2'   204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1'   122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?             'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"               ?             'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                                   ?             'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2QKK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.46 
_exptl_crystal.density_percent_sol   64.50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'12% isopropanol, 0.2 M calcium acetate, 0.1 M MES, 0.1 M LiCl, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 isopropanol       ? ? ? 
1 2 1 'calcium acetate' ? ? ? 
1 3 1 MES               ? ? ? 
1 4 1 LiCl              ? ? ? 
1 5 2 isopropanol       ? ? ? 
1 6 2 'calcium acetate' ? ? ? 
1 7 2 MES               ? ? ? 
1 8 2 LiCl              ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-07-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
# 
_reflns.entry_id                     2QKK 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            3.20 
_reflns.d_resolution_low             30. 
_reflns.number_all                   54218 
_reflns.number_obs                   50322 
_reflns.percent_possible_obs         92.8 
_reflns.pdbx_Rmerge_I_obs            0.139 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.20 
_reflns_shell.d_res_low              3.30 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.417 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2QKK 
_refine.ls_d_res_high                            3.20 
_refine.ls_d_res_low                             30.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     54218 
_refine.ls_number_reflns_obs                     50322 
_refine.ls_number_reflns_R_free                  1752 
_refine.ls_percent_reflns_obs                    92.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2122 
_refine.ls_R_factor_R_free                       0.2685 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2KQ9 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               62.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12641 
_refine_hist.pdbx_number_atoms_nucleic_acid   3393 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             172 
_refine_hist.number_atoms_total               16241 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007383 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.47097  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.325    1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.392    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.550    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.554    2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2QKK 
_struct.title                     'Human RNase H catalytic domain mutant D210N in complex with 14-mer RNA/DNA hybrid' 
_struct.pdbx_descriptor           'Ribonuclease H1 (E.C.3.1.26.4)/RNA/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QKK 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA/RNA 
_struct_keywords.text            'RNase H; RNA/DNA hybrid, HYDROLASE-DNA-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 1 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 6 ? 
BA N N 5 ? 
CA N N 7 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 5 ? 
OA N N 8 ? 
PA N N 8 ? 
QA N N 8 ? 
RA N N 8 ? 
SA N N 8 ? 
TA N N 8 ? 
UA N N 8 ? 
VA N N 8 ? 
WA N N 8 ? 
XA N N 8 ? 
YA N N 8 ? 
ZA N N 8 ? 
AB N N 8 ? 
BB N N 8 ? 
CB N N 8 ? 
DB N N 8 ? 
EB N N 8 ? 
FB N N 8 ? 
GB N N 8 ? 
HB N N 8 ? 
IB N N 8 ? 
JB N N 8 ? 
KB N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR M 49  ? GLN M 68  ? THR A 181 GLN A 200 1 ? 20 
HELX_P HELX_P2  2  SER M 79  ? ASN M 88  ? SER A 211 ASN A 220 1 ? 10 
HELX_P HELX_P3  3  ASN M 88  ? LYS M 95  ? ASN A 220 LYS A 227 1 ? 8  
HELX_P HELX_P4  4  ASN M 108 ? GLN M 120 ? ASN A 240 GLN A 252 1 ? 13 
HELX_P HELX_P5  5  PHE M 135 ? GLY M 148 ? PHE A 267 GLY A 280 1 ? 14 
HELX_P HELX_P6  6  THR N 49  ? THR N 67  ? THR B 181 THR B 199 1 ? 19 
HELX_P HELX_P7  7  SER N 79  ? ASN N 88  ? SER B 211 ASN B 220 1 ? 10 
HELX_P HELX_P8  8  ASN N 88  ? LYS N 95  ? ASN B 220 LYS B 227 1 ? 8  
HELX_P HELX_P9  9  ASN N 108 ? THR N 119 ? ASN B 240 THR B 251 1 ? 12 
HELX_P HELX_P10 10 PHE N 135 ? ALA N 149 ? PHE B 267 ALA B 281 1 ? 15 
HELX_P HELX_P11 11 THR O 49  ? GLN O 68  ? THR E 181 GLN E 200 1 ? 20 
HELX_P HELX_P12 12 SER O 79  ? THR O 87  ? SER E 211 THR E 219 1 ? 9  
HELX_P HELX_P13 13 ASN O 88  ? ASN O 96  ? ASN E 220 ASN E 228 1 ? 9  
HELX_P HELX_P14 14 ASN O 108 ? THR O 119 ? ASN E 240 THR E 251 1 ? 12 
HELX_P HELX_P15 15 PHE O 135 ? ALA O 149 ? PHE E 267 ALA E 281 1 ? 15 
HELX_P HELX_P16 16 THR P 49  ? THR P 67  ? THR F 181 THR F 199 1 ? 19 
HELX_P HELX_P17 17 SER P 79  ? ASN P 88  ? SER F 211 ASN F 220 1 ? 10 
HELX_P HELX_P18 18 ASN P 88  ? LYS P 95  ? ASN F 220 LYS F 227 1 ? 8  
HELX_P HELX_P19 19 ASN P 108 ? GLN P 120 ? ASN F 240 GLN F 252 1 ? 13 
HELX_P HELX_P20 20 ILE P 136 ? LYS P 150 ? ILE F 268 LYS F 282 1 ? 15 
HELX_P HELX_P21 21 THR Q 49  ? THR Q 67  ? THR I 181 THR I 199 1 ? 19 
HELX_P HELX_P22 22 SER Q 79  ? THR Q 87  ? SER I 211 THR I 219 1 ? 9  
HELX_P HELX_P23 23 ASN Q 88  ? LYS Q 94  ? ASN I 220 LYS I 226 1 ? 7  
HELX_P HELX_P24 24 ASN Q 108 ? LEU Q 118 ? ASN I 240 LEU I 250 1 ? 11 
HELX_P HELX_P25 25 PHE Q 135 ? GLN Q 151 ? PHE I 267 GLN I 283 1 ? 17 
HELX_P HELX_P26 26 THR R 49  ? GLN R 51  ? THR J 181 GLN J 183 5 ? 3  
HELX_P HELX_P27 27 ARG R 52  ? GLN R 68  ? ARG J 184 GLN J 200 1 ? 17 
HELX_P HELX_P28 28 SER R 79  ? THR R 87  ? SER J 211 THR J 219 1 ? 9  
HELX_P HELX_P29 29 ASN R 88  ? LYS R 95  ? ASN J 220 LYS J 227 1 ? 8  
HELX_P HELX_P30 30 ASN R 108 ? GLN R 120 ? ASN J 240 GLN J 252 1 ? 13 
HELX_P HELX_P31 31 GLU R 139 ? LYS R 150 ? GLU J 271 LYS J 282 1 ? 12 
HELX_P HELX_P32 32 THR S 49  ? GLN S 68  ? THR M 181 GLN M 200 1 ? 20 
HELX_P HELX_P33 33 SER S 79  ? TRP S 89  ? SER M 211 TRP M 221 1 ? 11 
HELX_P HELX_P34 34 TRP S 89  ? ASN S 96  ? TRP M 221 ASN M 228 1 ? 8  
HELX_P HELX_P35 35 ASN S 108 ? GLN S 120 ? ASN M 240 GLN M 252 1 ? 13 
HELX_P HELX_P36 36 PHE S 135 ? GLY S 148 ? PHE M 267 GLY M 280 1 ? 14 
HELX_P HELX_P37 37 THR T 49  ? GLN T 68  ? THR N 181 GLN N 200 1 ? 20 
HELX_P HELX_P38 38 SER T 79  ? ASN T 88  ? SER N 211 ASN N 220 1 ? 10 
HELX_P HELX_P39 39 ASN T 88  ? GLY T 97  ? ASN N 220 GLY N 229 1 ? 10 
HELX_P HELX_P40 40 ASN T 108 ? GLN T 120 ? ASN N 240 GLN N 252 1 ? 13 
HELX_P HELX_P41 41 ILE T 136 ? ARG T 146 ? ILE N 268 ARG N 278 1 ? 11 
HELX_P HELX_P42 42 GLU T 147 ? ALA T 149 ? GLU N 279 ALA N 281 5 ? 3  
HELX_P HELX_P43 43 THR U 49  ? GLN U 68  ? THR R 181 GLN R 200 1 ? 20 
HELX_P HELX_P44 44 SER U 79  ? ASN U 88  ? SER R 211 ASN R 220 1 ? 10 
HELX_P HELX_P45 45 ASN U 88  ? GLY U 97  ? ASN R 220 GLY R 229 1 ? 10 
HELX_P HELX_P46 46 ASN U 108 ? GLN U 120 ? ASN R 240 GLN R 252 1 ? 13 
HELX_P HELX_P47 47 PHE U 135 ? GLU U 147 ? PHE R 267 GLU R 279 1 ? 13 
HELX_P HELX_P48 48 THR V 49  ? GLU V 54  ? THR S 181 GLU S 186 1 ? 6  
HELX_P HELX_P49 49 ILE V 55  ? GLN V 68  ? ILE S 187 GLN S 200 1 ? 14 
HELX_P HELX_P50 50 SER V 79  ? TRP V 89  ? SER S 211 TRP S 221 1 ? 11 
HELX_P HELX_P51 51 TRP V 89  ? GLY V 97  ? TRP S 221 GLY S 229 1 ? 9  
HELX_P HELX_P52 52 ASN V 108 ? GLN V 120 ? ASN S 240 GLN S 252 1 ? 13 
HELX_P HELX_P53 53 PHE V 135 ? ALA V 149 ? PHE S 267 ALA S 281 1 ? 15 
HELX_P HELX_P54 54 THR W 49  ? GLN W 68  ? THR W 181 GLN W 200 1 ? 20 
HELX_P HELX_P55 55 SER W 79  ? ASN W 88  ? SER W 211 ASN W 220 1 ? 10 
HELX_P HELX_P56 56 ASN W 88  ? LYS W 94  ? ASN W 220 LYS W 226 1 ? 7  
HELX_P HELX_P57 57 ASN W 108 ? GLN W 120 ? ASN W 240 GLN W 252 1 ? 13 
HELX_P HELX_P58 58 GLY W 137 ? ALA W 149 ? GLY W 269 ALA W 281 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A  A   5   "O3'" ? ? ? 1_555 Y  CA  .  CA ? ? C A   5    A CA  1001 1_555 ? ? ? ? ? ? ?              2.353 ? 
metalc2   metalc ? ? A  C   6   OP1   ? ? ? 1_555 Y  CA  .  CA ? ? C C   6    A CA  1001 1_555 ? ? ? ? ? ? ?              2.079 ? 
metalc3   metalc ? ? A  C   6   OP1   ? ? ? 1_555 Z  CA  .  CA ? ? C C   6    A CA  1002 1_555 ? ? ? ? ? ? ?              2.148 ? 
metalc4   metalc ? ? C  A   5   "O3'" ? ? ? 1_555 EA CA  .  CA ? ? G A   5    E CA  1004 1_555 ? ? ? ? ? ? ?              2.655 ? 
metalc5   metalc ? ? C  C   6   OP1   ? ? ? 1_555 EA CA  .  CA ? ? G C   6    E CA  1004 1_555 ? ? ? ? ? ? ?              2.136 ? 
metalc6   metalc ? ? C  C   6   OP1   ? ? ? 1_555 DA CA  .  CA ? ? G C   6    E CA  1003 1_555 ? ? ? ? ? ? ?              2.539 ? 
metalc7   metalc ? ? E  C   6   OP1   ? ? ? 1_555 GA CA  .  CA ? ? K C   6    I CA  1006 1_555 ? ? ? ? ? ? ?              2.187 ? 
metalc8   metalc ? ? G  A   5   "O3'" ? ? ? 1_555 JA CA  .  CA ? ? O A   5    M CA  1014 1_555 ? ? ? ? ? ? ?              2.886 ? 
metalc9   metalc ? ? G  C   6   OP1   ? ? ? 1_555 IA CA  .  CA ? ? O C   6    M CA  1010 1_555 ? ? ? ? ? ? ?              2.198 ? 
metalc10  metalc ? ? I  C   6   OP1   ? ? ? 1_555 LA CA  .  CA ? ? T C   6    R CA  1011 1_555 ? ? ? ? ? ? ?              2.038 ? 
metalc11  metalc ? ? M  ASP 13  OD1   ? ? ? 1_555 Z  CA  .  CA ? ? A ASP 145  A CA  1002 1_555 ? ? ? ? ? ? ?              2.116 ? 
metalc12  metalc ? ? M  ASP 13  OD2   ? ? ? 1_555 Y  CA  .  CA ? ? A ASP 145  A CA  1001 1_555 ? ? ? ? ? ? ?              2.604 ? 
metalc13  metalc ? ? M  ASN 78  OD1   ? ? ? 1_555 Y  CA  .  CA ? ? A ASN 210  A CA  1001 1_555 ? ? ? ? ? ? ?              2.622 ? 
metalc14  metalc ? ? M  ASP 142 OD1   ? ? ? 1_555 Z  CA  .  CA ? ? A ASP 274  A CA  1002 1_555 ? ? ? ? ? ? ?              2.469 ? 
metalc15  metalc ? ? N  ASP 13  OD1   ? ? ? 1_555 BA CA  .  CA ? ? B ASP 145  B CA  1009 1_555 ? ? ? ? ? ? ?              2.156 ? 
metalc16  metalc ? ? N  ASN 78  OD1   ? ? ? 1_555 BA CA  .  CA ? ? B ASN 210  B CA  1009 1_555 ? ? ? ? ? ? ?              2.566 ? 
metalc17  metalc ? ? N  ASP 142 OD1   ? ? ? 1_555 BA CA  .  CA ? ? B ASP 274  B CA  1009 1_555 ? ? ? ? ? ? ?              2.400 ? 
metalc18  metalc ? ? O  ASP 13  OD1   ? ? ? 1_555 DA CA  .  CA ? ? E ASP 145  E CA  1003 1_555 ? ? ? ? ? ? ?              2.798 ? 
metalc19  metalc ? ? O  ASP 13  OD2   ? ? ? 1_555 EA CA  .  CA ? ? E ASP 145  E CA  1004 1_555 ? ? ? ? ? ? ?              2.472 ? 
metalc20  metalc ? ? O  GLU 54  OE1   ? ? ? 1_555 EA CA  .  CA ? ? E GLU 186  E CA  1004 1_555 ? ? ? ? ? ? ?              2.697 ? 
metalc21  metalc ? ? O  ASN 78  OD1   ? ? ? 1_555 EA CA  .  CA ? ? E ASN 210  E CA  1004 1_555 ? ? ? ? ? ? ?              2.828 ? 
metalc22  metalc ? ? P  ASP 13  OD1   ? ? ? 1_555 FA CA  .  CA ? ? F ASP 145  F CA  1013 1_555 ? ? ? ? ? ? ?              2.043 ? 
metalc23  metalc ? ? P  ASN 78  ND2   ? ? ? 1_555 FA CA  .  CA ? ? F ASN 210  F CA  1013 1_555 ? ? ? ? ? ? ?              2.690 ? 
metalc24  metalc ? ? P  ASP 142 OD2   ? ? ? 1_555 FA CA  .  CA ? ? F ASP 274  F CA  1013 1_555 ? ? ? ? ? ? ?              2.480 ? 
metalc25  metalc ? ? Q  ASP 13  OD1   ? ? ? 1_555 GA CA  .  CA ? ? I ASP 145  I CA  1006 1_555 ? ? ? ? ? ? ?              2.383 ? 
metalc26  metalc ? ? Q  ASP 142 OD1   ? ? ? 1_555 GA CA  .  CA ? ? I ASP 274  I CA  1006 1_555 ? ? ? ? ? ? ?              2.301 ? 
metalc27  metalc ? ? R  ASP 13  OD1   ? ? ? 1_555 HA CA  .  CA ? ? J ASP 145  J CA  1008 1_555 ? ? ? ? ? ? ?              2.168 ? 
metalc28  metalc ? ? R  ASN 78  OD1   ? ? ? 1_555 HA CA  .  CA ? ? J ASN 210  J CA  1008 1_555 ? ? ? ? ? ? ?              2.445 ? 
metalc29  metalc ? ? R  ASN 78  ND2   ? ? ? 1_555 HA CA  .  CA ? ? J ASN 210  J CA  1008 1_555 ? ? ? ? ? ? ?              2.001 ? 
metalc30  metalc ? ? R  ASP 142 OD1   ? ? ? 1_555 HA CA  .  CA ? ? J ASP 274  J CA  1008 1_555 ? ? ? ? ? ? ?              2.446 ? 
metalc31  metalc ? ? S  ASP 13  OD1   ? ? ? 1_555 IA CA  .  CA ? ? M ASP 145  M CA  1010 1_555 ? ? ? ? ? ? ?              2.707 ? 
metalc32  metalc ? ? S  GLU 54  OE2   ? ? ? 1_555 JA CA  .  CA ? ? M GLU 186  M CA  1014 1_555 ? ? ? ? ? ? ?              2.195 ? 
metalc33  metalc ? ? S  ASN 78  ND2   ? ? ? 1_555 JA CA  .  CA ? ? M ASN 210  M CA  1014 1_555 ? ? ? ? ? ? ?              2.752 ? 
metalc34  metalc ? ? S  ASP 142 OD1   ? ? ? 1_555 IA CA  .  CA ? ? M ASP 274  M CA  1010 1_555 ? ? ? ? ? ? ?              2.157 ? 
metalc35  metalc ? ? T  ASP 13  OD2   ? ? ? 1_555 KA CA  .  CA ? ? N ASP 145  N CA  1005 1_555 ? ? ? ? ? ? ?              2.137 ? 
metalc36  metalc ? ? T  ASN 78  OD1   ? ? ? 1_555 KA CA  .  CA ? ? N ASN 210  N CA  1005 1_555 ? ? ? ? ? ? ?              2.675 ? 
metalc37  metalc ? ? T  ASN 78  ND2   ? ? ? 1_555 KA CA  .  CA ? ? N ASN 210  N CA  1005 1_555 ? ? ? ? ? ? ?              2.790 ? 
metalc38  metalc ? ? T  ASP 142 OD1   ? ? ? 1_555 KA CA  .  CA ? ? N ASP 274  N CA  1005 1_555 ? ? ? ? ? ? ?              2.772 ? 
metalc39  metalc ? ? U  ASP 13  OD1   ? ? ? 1_555 LA CA  .  CA ? ? R ASP 145  R CA  1011 1_555 ? ? ? ? ? ? ?              2.337 ? 
metalc40  metalc ? ? U  ASP 142 OD1   ? ? ? 1_555 LA CA  .  CA ? ? R ASP 274  R CA  1011 1_555 ? ? ? ? ? ? ?              2.206 ? 
metalc41  metalc ? ? V  ASP 13  OD1   ? ? ? 1_555 MA CA  .  CA ? ? S ASP 145  S CA  1007 1_555 ? ? ? ? ? ? ?              2.072 ? 
metalc42  metalc ? ? V  ASP 13  OD2   ? ? ? 1_555 MA CA  .  CA ? ? S ASP 145  S CA  1007 1_555 ? ? ? ? ? ? ?              2.541 ? 
metalc43  metalc ? ? V  ASN 78  OD1   ? ? ? 1_555 MA CA  .  CA ? ? S ASN 210  S CA  1007 1_555 ? ? ? ? ? ? ?              2.240 ? 
metalc44  metalc ? ? V  ASN 78  ND2   ? ? ? 1_555 MA CA  .  CA ? ? S ASN 210  S CA  1007 1_555 ? ? ? ? ? ? ?              2.205 ? 
metalc45  metalc ? ? W  ASP 13  OD1   ? ? ? 1_555 NA CA  .  CA ? ? W ASP 145  W CA  1012 1_555 ? ? ? ? ? ? ?              2.051 ? 
metalc46  metalc ? ? W  ASP 13  OD2   ? ? ? 1_555 NA CA  .  CA ? ? W ASP 145  W CA  1012 1_555 ? ? ? ? ? ? ?              2.696 ? 
metalc47  metalc ? ? W  ASN 78  OD1   ? ? ? 1_555 NA CA  .  CA ? ? W ASN 210  W CA  1012 1_555 ? ? ? ? ? ? ?              2.507 ? 
metalc48  metalc ? ? W  ASN 78  ND2   ? ? ? 1_555 NA CA  .  CA ? ? W ASN 210  W CA  1012 1_555 ? ? ? ? ? ? ?              2.427 ? 
metalc49  metalc ? ? Z  CA  .   CA    ? ? ? 1_555 AB HOH .  O  ? ? A CA  1002 A HOH 2007 1_555 ? ? ? ? ? ? ?              2.162 ? 
metalc50  metalc ? ? Z  CA  .   CA    ? ? ? 1_555 AB HOH .  O  ? ? A CA  1002 A HOH 2003 1_555 ? ? ? ? ? ? ?              2.232 ? 
metalc51  metalc ? ? Z  CA  .   CA    ? ? ? 1_555 OA HOH .  O  ? ? A CA  1002 C HOH 15   1_555 ? ? ? ? ? ? ?              2.652 ? 
metalc52  metalc ? ? BA CA  .   CA    ? ? ? 1_555 BB HOH .  O  ? ? B CA  1009 B HOH 2003 1_555 ? ? ? ? ? ? ?              2.607 ? 
metalc53  metalc ? ? BA CA  .   CA    ? ? ? 1_555 BB HOH .  O  ? ? B CA  1009 B HOH 2004 1_555 ? ? ? ? ? ? ?              2.095 ? 
metalc54  metalc ? ? BA CA  .   CA    ? ? ? 1_555 BB HOH .  O  ? ? B CA  1009 B HOH 2002 1_555 ? ? ? ? ? ? ?              2.574 ? 
metalc55  metalc ? ? IA CA  .   CA    ? ? ? 1_555 GB HOH .  O  ? ? M CA  1010 M HOH 12   1_555 ? ? ? ? ? ? ?              2.788 ? 
metalc56  metalc ? ? IA CA  .   CA    ? ? ? 1_555 UA HOH .  O  ? ? M CA  1010 O HOH 15   1_555 ? ? ? ? ? ? ?              2.810 ? 
metalc57  metalc ? ? IA CA  .   CA    ? ? ? 1_555 GB HOH .  O  ? ? M CA  1010 M HOH 11   1_555 ? ? ? ? ? ? ?              2.447 ? 
hydrog1   hydrog ? ? A  C   1   N3    ? ? ? 1_555 B  DG  14 N1 ? ? C C   1    D DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog2   hydrog ? ? A  C   1   N4    ? ? ? 1_555 B  DG  14 O6 ? ? C C   1    D DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog3   hydrog ? ? A  C   1   O2    ? ? ? 1_555 B  DG  14 N2 ? ? C C   1    D DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog4   hydrog ? ? A  G   2   N1    ? ? ? 1_555 B  DC  13 N3 ? ? C G   2    D DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog5   hydrog ? ? A  G   2   N2    ? ? ? 1_555 B  DC  13 O2 ? ? C G   2    D DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog6   hydrog ? ? A  G   2   O6    ? ? ? 1_555 B  DC  13 N4 ? ? C G   2    D DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog7   hydrog ? ? A  A   3   N1    ? ? ? 1_555 B  DT  12 N3 ? ? C A   3    D DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog8   hydrog ? ? A  A   3   N6    ? ? ? 1_555 B  DT  12 O4 ? ? C A   3    D DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog9   hydrog ? ? A  C   4   N3    ? ? ? 1_555 B  DG  11 N1 ? ? C C   4    D DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog10  hydrog ? ? A  C   4   N4    ? ? ? 1_555 B  DG  11 O6 ? ? C C   4    D DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog11  hydrog ? ? A  C   4   O2    ? ? ? 1_555 B  DG  11 N2 ? ? C C   4    D DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog12  hydrog ? ? A  A   5   N1    ? ? ? 1_555 B  DT  10 N3 ? ? C A   5    D DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog13  hydrog ? ? A  A   5   N6    ? ? ? 1_555 B  DT  10 O4 ? ? C A   5    D DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog14  hydrog ? ? A  C   6   N3    ? ? ? 1_555 B  DG  9  N1 ? ? C C   6    D DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog15  hydrog ? ? A  C   6   N4    ? ? ? 1_555 B  DG  9  O6 ? ? C C   6    D DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog16  hydrog ? ? A  C   6   O2    ? ? ? 1_555 B  DG  9  N2 ? ? C C   6    D DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog17  hydrog ? ? A  C   7   N3    ? ? ? 1_555 B  DG  8  N1 ? ? C C   7    D DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog18  hydrog ? ? A  C   7   N4    ? ? ? 1_555 B  DG  8  O6 ? ? C C   7    D DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog19  hydrog ? ? A  C   7   O2    ? ? ? 1_555 B  DG  8  N2 ? ? C C   7    D DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog20  hydrog ? ? A  U   8   N3    ? ? ? 1_555 B  DA  7  N1 ? ? C U   8    D DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog21  hydrog ? ? A  U   8   O4    ? ? ? 1_555 B  DA  7  N6 ? ? C U   8    D DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog22  hydrog ? ? A  G   9   N1    ? ? ? 1_555 B  DC  6  N3 ? ? C G   9    D DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog23  hydrog ? ? A  G   9   N2    ? ? ? 1_555 B  DC  6  O2 ? ? C G   9    D DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog24  hydrog ? ? A  G   9   O6    ? ? ? 1_555 B  DC  6  N4 ? ? C G   9    D DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog25  hydrog ? ? A  A   10  N1    ? ? ? 1_555 B  DT  5  N3 ? ? C A   10   D DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog26  hydrog ? ? A  A   10  N6    ? ? ? 1_555 B  DT  5  O4 ? ? C A   10   D DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog27  hydrog ? ? A  U   11  N3    ? ? ? 1_555 B  DA  4  N1 ? ? C U   11   D DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog28  hydrog ? ? A  U   11  O4    ? ? ? 1_555 B  DA  4  N6 ? ? C U   11   D DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog29  hydrog ? ? A  U   12  N3    ? ? ? 1_555 B  DA  3  N1 ? ? C U   12   D DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog30  hydrog ? ? A  U   12  O4    ? ? ? 1_555 B  DA  3  N6 ? ? C U   12   D DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog31  hydrog ? ? A  C   13  N3    ? ? ? 1_555 B  DG  2  N1 ? ? C C   13   D DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog32  hydrog ? ? A  C   13  N4    ? ? ? 1_555 B  DG  2  O6 ? ? C C   13   D DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog33  hydrog ? ? A  C   13  O2    ? ? ? 1_555 B  DG  2  N2 ? ? C C   13   D DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog34  hydrog ? ? A  C   14  O2    ? ? ? 1_555 B  DG  1  N2 ? ? C C   14   D DG  15   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog35  hydrog ? ? C  C   1   N3    ? ? ? 1_555 D  DG  14 N1 ? ? G C   1    H DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog36  hydrog ? ? C  C   1   N4    ? ? ? 1_555 D  DG  14 O6 ? ? G C   1    H DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog37  hydrog ? ? C  C   1   O2    ? ? ? 1_555 D  DG  14 N2 ? ? G C   1    H DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog38  hydrog ? ? C  G   2   N1    ? ? ? 1_555 D  DC  13 N3 ? ? G G   2    H DC  27   1_555 ? ? ? ? ? ? 'G-DC PAIR'    ?     ? 
hydrog39  hydrog ? ? C  A   3   N1    ? ? ? 1_555 D  DT  12 N3 ? ? G A   3    H DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog40  hydrog ? ? C  A   3   N6    ? ? ? 1_555 D  DT  12 O4 ? ? G A   3    H DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog41  hydrog ? ? C  C   4   N3    ? ? ? 1_555 D  DG  11 N1 ? ? G C   4    H DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog42  hydrog ? ? C  C   4   N4    ? ? ? 1_555 D  DG  11 O6 ? ? G C   4    H DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog43  hydrog ? ? C  C   4   O2    ? ? ? 1_555 D  DG  11 N2 ? ? G C   4    H DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog44  hydrog ? ? C  A   5   N1    ? ? ? 1_555 D  DT  10 N3 ? ? G A   5    H DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog45  hydrog ? ? C  A   5   N6    ? ? ? 1_555 D  DT  10 O4 ? ? G A   5    H DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog46  hydrog ? ? C  C   6   N3    ? ? ? 1_555 D  DG  9  N1 ? ? G C   6    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog47  hydrog ? ? C  C   6   N4    ? ? ? 1_555 D  DG  9  O6 ? ? G C   6    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog48  hydrog ? ? C  C   6   O2    ? ? ? 1_555 D  DG  9  N2 ? ? G C   6    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog49  hydrog ? ? C  C   7   N3    ? ? ? 1_555 D  DG  8  N1 ? ? G C   7    H DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog50  hydrog ? ? C  C   7   N4    ? ? ? 1_555 D  DG  8  O6 ? ? G C   7    H DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog51  hydrog ? ? C  C   7   O2    ? ? ? 1_555 D  DG  8  N2 ? ? G C   7    H DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog52  hydrog ? ? C  U   8   N3    ? ? ? 1_555 D  DA  7  N1 ? ? G U   8    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog53  hydrog ? ? C  U   8   O4    ? ? ? 1_555 D  DA  7  N6 ? ? G U   8    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog54  hydrog ? ? C  G   9   N1    ? ? ? 1_555 D  DC  6  N3 ? ? G G   9    H DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog55  hydrog ? ? C  G   9   N2    ? ? ? 1_555 D  DC  6  O2 ? ? G G   9    H DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog56  hydrog ? ? C  G   9   O6    ? ? ? 1_555 D  DC  6  N4 ? ? G G   9    H DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog57  hydrog ? ? C  A   10  N1    ? ? ? 1_555 D  DT  5  N3 ? ? G A   10   H DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog58  hydrog ? ? C  A   10  N6    ? ? ? 1_555 D  DT  5  O4 ? ? G A   10   H DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog59  hydrog ? ? C  U   11  N3    ? ? ? 1_555 D  DA  4  N1 ? ? G U   11   H DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog60  hydrog ? ? C  U   11  O4    ? ? ? 1_555 D  DA  4  N6 ? ? G U   11   H DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog61  hydrog ? ? C  U   12  N3    ? ? ? 1_555 D  DA  3  N1 ? ? G U   12   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog62  hydrog ? ? C  U   12  O4    ? ? ? 1_555 D  DA  3  N6 ? ? G U   12   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog63  hydrog ? ? C  C   13  N3    ? ? ? 1_555 D  DG  2  N1 ? ? G C   13   H DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog64  hydrog ? ? C  C   13  N4    ? ? ? 1_555 D  DG  2  O6 ? ? G C   13   H DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog65  hydrog ? ? C  C   13  O2    ? ? ? 1_555 D  DG  2  N2 ? ? G C   13   H DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog66  hydrog ? ? C  C   14  N3    ? ? ? 1_555 D  DG  1  N1 ? ? G C   14   H DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog67  hydrog ? ? C  C   14  N4    ? ? ? 1_555 D  DG  1  O6 ? ? G C   14   H DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog68  hydrog ? ? C  C   14  O2    ? ? ? 1_555 D  DG  1  N2 ? ? G C   14   H DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog69  hydrog ? ? E  C   1   N3    ? ? ? 1_555 F  DG  14 N1 ? ? K C   1    L DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog70  hydrog ? ? E  C   1   N4    ? ? ? 1_555 F  DG  14 O6 ? ? K C   1    L DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog71  hydrog ? ? E  C   1   O2    ? ? ? 1_555 F  DG  14 N2 ? ? K C   1    L DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog72  hydrog ? ? E  G   2   N1    ? ? ? 1_555 F  DC  13 N3 ? ? K G   2    L DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog73  hydrog ? ? E  G   2   N2    ? ? ? 1_555 F  DC  13 O2 ? ? K G   2    L DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog74  hydrog ? ? E  G   2   O6    ? ? ? 1_555 F  DC  13 N4 ? ? K G   2    L DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog75  hydrog ? ? E  A   3   N1    ? ? ? 1_555 F  DT  12 N3 ? ? K A   3    L DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog76  hydrog ? ? E  A   3   N6    ? ? ? 1_555 F  DT  12 O4 ? ? K A   3    L DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog77  hydrog ? ? E  C   4   N3    ? ? ? 1_555 F  DG  11 N1 ? ? K C   4    L DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog78  hydrog ? ? E  C   4   N4    ? ? ? 1_555 F  DG  11 O6 ? ? K C   4    L DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog79  hydrog ? ? E  C   4   O2    ? ? ? 1_555 F  DG  11 N2 ? ? K C   4    L DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog80  hydrog ? ? E  A   5   N1    ? ? ? 1_555 F  DT  10 N3 ? ? K A   5    L DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog81  hydrog ? ? E  A   5   N6    ? ? ? 1_555 F  DT  10 O4 ? ? K A   5    L DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog82  hydrog ? ? E  C   6   N3    ? ? ? 1_555 F  DG  9  N1 ? ? K C   6    L DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog83  hydrog ? ? E  C   6   N4    ? ? ? 1_555 F  DG  9  O6 ? ? K C   6    L DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog84  hydrog ? ? E  C   6   O2    ? ? ? 1_555 F  DG  9  N2 ? ? K C   6    L DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog85  hydrog ? ? E  C   7   N3    ? ? ? 1_555 F  DG  8  N1 ? ? K C   7    L DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog86  hydrog ? ? E  C   7   N4    ? ? ? 1_555 F  DG  8  O6 ? ? K C   7    L DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog87  hydrog ? ? E  C   7   O2    ? ? ? 1_555 F  DG  8  N2 ? ? K C   7    L DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog88  hydrog ? ? E  U   8   N3    ? ? ? 1_555 F  DA  7  N1 ? ? K U   8    L DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog89  hydrog ? ? E  U   8   O4    ? ? ? 1_555 F  DA  7  N6 ? ? K U   8    L DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog90  hydrog ? ? E  G   9   N1    ? ? ? 1_555 F  DC  6  N3 ? ? K G   9    L DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog91  hydrog ? ? E  G   9   N2    ? ? ? 1_555 F  DC  6  O2 ? ? K G   9    L DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog92  hydrog ? ? E  G   9   O6    ? ? ? 1_555 F  DC  6  N4 ? ? K G   9    L DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog93  hydrog ? ? E  A   10  N1    ? ? ? 1_555 F  DT  5  N3 ? ? K A   10   L DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog94  hydrog ? ? E  A   10  N6    ? ? ? 1_555 F  DT  5  O4 ? ? K A   10   L DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog95  hydrog ? ? E  U   11  O4    ? ? ? 1_555 F  DA  3  N6 ? ? K U   11   L DA  17   1_555 ? ? ? ? ? ? 'U-DA PAIR'    ?     ? 
hydrog96  hydrog ? ? E  U   11  N3    ? ? ? 1_555 F  DA  4  N1 ? ? K U   11   L DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog97  hydrog ? ? E  U   11  O4    ? ? ? 1_555 F  DA  4  N6 ? ? K U   11   L DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog98  hydrog ? ? E  U   12  N3    ? ? ? 1_555 F  DA  3  N1 ? ? K U   12   L DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog99  hydrog ? ? E  U   12  O4    ? ? ? 1_555 F  DA  3  N6 ? ? K U   12   L DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog100 hydrog ? ? E  C   13  O2    ? ? ? 1_555 F  DG  2  N2 ? ? K C   13   L DG  16   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog101 hydrog ? ? E  C   14  N3    ? ? ? 1_555 F  DG  1  N2 ? ? K C   14   L DG  15   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog102 hydrog ? ? G  C   1   N3    ? ? ? 1_555 H  DG  14 N1 ? ? O C   1    P DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog103 hydrog ? ? G  C   1   N4    ? ? ? 1_555 H  DG  14 O6 ? ? O C   1    P DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog104 hydrog ? ? G  C   1   O2    ? ? ? 1_555 H  DG  14 N2 ? ? O C   1    P DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog105 hydrog ? ? G  G   2   N1    ? ? ? 1_555 H  DC  13 N3 ? ? O G   2    P DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog106 hydrog ? ? G  G   2   N2    ? ? ? 1_555 H  DC  13 O2 ? ? O G   2    P DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog107 hydrog ? ? G  G   2   O6    ? ? ? 1_555 H  DC  13 N4 ? ? O G   2    P DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog108 hydrog ? ? G  A   3   N1    ? ? ? 1_555 H  DT  12 N3 ? ? O A   3    P DT  26   1_555 ? ? ? ? ? ? 'A-DT PAIR'    ?     ? 
hydrog109 hydrog ? ? G  C   4   N3    ? ? ? 1_555 H  DG  11 N1 ? ? O C   4    P DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog110 hydrog ? ? G  C   4   N4    ? ? ? 1_555 H  DG  11 O6 ? ? O C   4    P DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog111 hydrog ? ? G  C   4   O2    ? ? ? 1_555 H  DG  11 N2 ? ? O C   4    P DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog112 hydrog ? ? G  A   5   N1    ? ? ? 1_555 H  DT  10 N3 ? ? O A   5    P DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog113 hydrog ? ? G  A   5   N6    ? ? ? 1_555 H  DT  10 O4 ? ? O A   5    P DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog114 hydrog ? ? G  C   6   N3    ? ? ? 1_555 H  DG  9  N1 ? ? O C   6    P DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog115 hydrog ? ? G  C   6   N4    ? ? ? 1_555 H  DG  9  O6 ? ? O C   6    P DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog116 hydrog ? ? G  C   6   O2    ? ? ? 1_555 H  DG  9  N2 ? ? O C   6    P DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog117 hydrog ? ? G  C   7   N3    ? ? ? 1_555 H  DG  8  N1 ? ? O C   7    P DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog118 hydrog ? ? G  C   7   N4    ? ? ? 1_555 H  DG  8  O6 ? ? O C   7    P DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog119 hydrog ? ? G  C   7   O2    ? ? ? 1_555 H  DG  8  N2 ? ? O C   7    P DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog120 hydrog ? ? G  U   8   N3    ? ? ? 1_555 H  DA  7  N1 ? ? O U   8    P DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog121 hydrog ? ? G  U   8   O4    ? ? ? 1_555 H  DA  7  N6 ? ? O U   8    P DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog122 hydrog ? ? G  G   9   N1    ? ? ? 1_555 H  DC  6  N3 ? ? O G   9    P DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog123 hydrog ? ? G  G   9   N2    ? ? ? 1_555 H  DC  6  O2 ? ? O G   9    P DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog124 hydrog ? ? G  G   9   O6    ? ? ? 1_555 H  DC  6  N4 ? ? O G   9    P DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog125 hydrog ? ? G  A   10  N1    ? ? ? 1_555 H  DT  5  N3 ? ? O A   10   P DT  19   1_555 ? ? ? ? ? ? 'A-DT PAIR'    ?     ? 
hydrog126 hydrog ? ? G  U   11  N3    ? ? ? 1_555 H  DA  4  N1 ? ? O U   11   P DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog127 hydrog ? ? G  U   11  O4    ? ? ? 1_555 H  DA  4  N6 ? ? O U   11   P DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog128 hydrog ? ? G  U   12  N3    ? ? ? 1_555 H  DA  3  N1 ? ? O U   12   P DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog129 hydrog ? ? G  U   12  O4    ? ? ? 1_555 H  DA  3  N6 ? ? O U   12   P DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog130 hydrog ? ? G  C   13  N3    ? ? ? 1_555 H  DG  2  N1 ? ? O C   13   P DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog131 hydrog ? ? G  C   13  N4    ? ? ? 1_555 H  DG  2  O6 ? ? O C   13   P DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog132 hydrog ? ? G  C   13  O2    ? ? ? 1_555 H  DG  2  N2 ? ? O C   13   P DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog133 hydrog ? ? I  C   1   N3    ? ? ? 1_555 J  DG  14 N1 ? ? T C   1    U DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog134 hydrog ? ? I  C   1   N4    ? ? ? 1_555 J  DG  14 O6 ? ? T C   1    U DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog135 hydrog ? ? I  C   1   O2    ? ? ? 1_555 J  DG  14 N2 ? ? T C   1    U DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog136 hydrog ? ? I  G   2   N1    ? ? ? 1_555 J  DC  13 N3 ? ? T G   2    U DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog137 hydrog ? ? I  G   2   N2    ? ? ? 1_555 J  DC  13 O2 ? ? T G   2    U DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog138 hydrog ? ? I  G   2   O6    ? ? ? 1_555 J  DC  13 N4 ? ? T G   2    U DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog139 hydrog ? ? I  A   3   N6    ? ? ? 1_555 J  DT  12 O4 ? ? T A   3    U DT  26   1_555 ? ? ? ? ? ? 'A-DT PAIR'    ?     ? 
hydrog140 hydrog ? ? I  C   4   N3    ? ? ? 1_555 J  DG  11 N1 ? ? T C   4    U DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog141 hydrog ? ? I  C   4   N4    ? ? ? 1_555 J  DG  11 O6 ? ? T C   4    U DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog142 hydrog ? ? I  C   4   O2    ? ? ? 1_555 J  DG  11 N2 ? ? T C   4    U DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog143 hydrog ? ? I  A   5   N1    ? ? ? 1_555 J  DT  10 N3 ? ? T A   5    U DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog144 hydrog ? ? I  A   5   N6    ? ? ? 1_555 J  DT  10 O4 ? ? T A   5    U DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog145 hydrog ? ? I  C   6   O2    ? ? ? 1_555 J  DG  9  N2 ? ? T C   6    U DG  23   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog146 hydrog ? ? I  C   7   N3    ? ? ? 1_555 J  DG  8  N1 ? ? T C   7    U DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog147 hydrog ? ? I  C   7   N4    ? ? ? 1_555 J  DG  8  O6 ? ? T C   7    U DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog148 hydrog ? ? I  C   7   O2    ? ? ? 1_555 J  DG  8  N2 ? ? T C   7    U DG  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog149 hydrog ? ? I  U   8   N3    ? ? ? 1_555 J  DA  7  N1 ? ? T U   8    U DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog150 hydrog ? ? I  U   8   O4    ? ? ? 1_555 J  DA  7  N6 ? ? T U   8    U DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog151 hydrog ? ? I  G   9   N1    ? ? ? 1_555 J  DC  6  N3 ? ? T G   9    U DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog152 hydrog ? ? I  G   9   N2    ? ? ? 1_555 J  DC  6  O2 ? ? T G   9    U DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog153 hydrog ? ? I  G   9   O6    ? ? ? 1_555 J  DC  6  N4 ? ? T G   9    U DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog154 hydrog ? ? I  A   10  N1    ? ? ? 1_555 J  DT  5  N3 ? ? T A   10   U DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog155 hydrog ? ? I  A   10  N6    ? ? ? 1_555 J  DT  5  O4 ? ? T A   10   U DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog156 hydrog ? ? I  U   11  N3    ? ? ? 1_555 J  DA  4  N1 ? ? T U   11   U DA  18   1_555 ? ? ? ? ? ? 'U-DA PAIR'    ?     ? 
hydrog157 hydrog ? ? I  U   12  N3    ? ? ? 1_555 J  DA  3  N1 ? ? T U   12   U DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog158 hydrog ? ? I  U   12  O4    ? ? ? 1_555 J  DA  3  N6 ? ? T U   12   U DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog159 hydrog ? ? I  C   13  N3    ? ? ? 1_555 J  DG  2  N1 ? ? T C   13   U DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog160 hydrog ? ? I  C   13  N4    ? ? ? 1_555 J  DG  2  O6 ? ? T C   13   U DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog161 hydrog ? ? I  C   13  O2    ? ? ? 1_555 J  DG  2  N2 ? ? T C   13   U DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog162 hydrog ? ? I  C   14  O2    ? ? ? 1_555 J  DG  1  N2 ? ? T C   14   U DG  15   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog163 hydrog ? ? K  A   3   N6    ? ? ? 1_555 L  DG  11 O6 ? ? X A   3    Z DG  25   1_555 ? ? ? ? ? ? 'A-DG MISPAIR' ?     ? 
hydrog164 hydrog ? ? K  C   4   O2    ? ? ? 1_555 L  DG  11 N2 ? ? X C   4    Z DG  25   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog165 hydrog ? ? K  C   6   O2    ? ? ? 1_555 L  DG  9  N2 ? ? X C   6    Z DG  23   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog166 hydrog ? ? K  C   7   O2    ? ? ? 1_555 L  DG  8  N2 ? ? X C   7    Z DG  22   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog167 hydrog ? ? K  U   8   N3    ? ? ? 1_555 L  DA  7  N1 ? ? X U   8    Z DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog168 hydrog ? ? K  U   8   O4    ? ? ? 1_555 L  DA  7  N6 ? ? X U   8    Z DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog169 hydrog ? ? K  G   9   N1    ? ? ? 1_555 L  DC  6  N3 ? ? X G   9    Z DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog170 hydrog ? ? K  G   9   N2    ? ? ? 1_555 L  DC  6  O2 ? ? X G   9    Z DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog171 hydrog ? ? K  G   9   O6    ? ? ? 1_555 L  DC  6  N4 ? ? X G   9    Z DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog172 hydrog ? ? K  A   10  N1    ? ? ? 1_555 L  DT  5  N3 ? ? X A   10   Z DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog173 hydrog ? ? K  A   10  N6    ? ? ? 1_555 L  DT  5  O4 ? ? X A   10   Z DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog174 hydrog ? ? K  U   11  N3    ? ? ? 1_555 L  DA  4  N1 ? ? X U   11   Z DA  18   1_555 ? ? ? ? ? ? 'U-DA PAIR'    ?     ? 
hydrog175 hydrog ? ? K  U   12  N3    ? ? ? 1_555 L  DA  3  N1 ? ? X U   12   Z DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog176 hydrog ? ? K  U   12  O4    ? ? ? 1_555 L  DA  3  N6 ? ? X U   12   Z DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog177 hydrog ? ? K  C   13  O2    ? ? ? 1_555 L  DG  2  N2 ? ? X C   13   Z DG  16   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
hydrog178 hydrog ? ? K  C   14  O2    ? ? ? 1_555 L  DG  1  N2 ? ? X C   14   Z DG  15   1_555 ? ? ? ? ? ? 'C-DG PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 2 ? 
I ? 3 ? 
J ? 5 ? 
K ? 5 ? 
L ? 3 ? 
M ? 5 ? 
N ? 4 ? 
O ? 5 ? 
P ? 4 ? 
Q ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? parallel      
K 4 5 ? parallel      
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? parallel      
M 4 5 ? parallel      
N 1 2 ? anti-parallel 
N 2 3 ? parallel      
N 3 4 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? parallel      
O 4 5 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
P 3 4 ? parallel      
Q 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS M 3   ? MET M 4   ? HIS A 135 MET A 136 
A 2 PHE M 7   ? SER M 17  ? PHE A 139 SER A 149 
A 3 ARG M 25  ? TYR M 31  ? ARG A 157 TYR A 163 
B 1 HIS M 3   ? MET M 4   ? HIS A 135 MET A 136 
B 2 PHE M 7   ? SER M 17  ? PHE A 139 SER A 149 
B 3 LEU M 73  ? THR M 77  ? LEU A 205 THR A 209 
B 4 MET M 127 ? HIS M 128 ? MET A 259 HIS A 260 
C 1 ALA N 26  ? TYR N 31  ? ALA B 158 TYR B 163 
C 2 VAL N 8   ? CYS N 16  ? VAL B 140 CYS B 148 
C 3 LYS N 72  ? THR N 77  ? LYS B 204 THR B 209 
C 4 ASP N 123 ? HIS N 128 ? ASP B 255 HIS B 260 
D 1 ARG O 25  ? TYR O 31  ? ARG E 157 TYR E 163 
D 2 VAL O 10  ? SER O 17  ? VAL E 142 SER E 149 
D 3 LYS O 72  ? THR O 77  ? LYS E 204 THR E 209 
D 4 ASP O 123 ? HIS O 128 ? ASP E 255 HIS E 260 
E 1 ARG P 25  ? TYR P 31  ? ARG F 157 TYR F 163 
E 2 VAL P 8   ? SER P 17  ? VAL F 140 SER F 149 
E 3 LYS P 72  ? THR P 77  ? LYS F 204 THR F 209 
E 4 ASP P 123 ? HIS P 128 ? ASP F 255 HIS F 260 
F 1 VAL Q 30  ? TYR Q 31  ? VAL I 162 TYR I 163 
F 2 VAL Q 8   ? THR Q 12  ? VAL I 140 THR I 144 
F 3 LYS Q 72  ? THR Q 77  ? LYS I 204 THR I 209 
F 4 ASP Q 123 ? ILE Q 124 ? ASP I 255 ILE I 256 
G 1 VAL Q 30  ? TYR Q 31  ? VAL I 162 TYR I 163 
G 2 VAL Q 8   ? THR Q 12  ? VAL I 140 THR I 144 
G 3 LYS Q 72  ? THR Q 77  ? LYS I 204 THR I 209 
G 4 MET Q 127 ? HIS Q 128 ? MET I 259 HIS I 260 
H 1 CYS Q 15  ? SER Q 17  ? CYS I 147 SER I 149 
H 2 ARG Q 25  ? GLY Q 27  ? ARG I 157 GLY I 159 
I 1 CYS R 15  ? CYS R 16  ? CYS J 147 CYS J 148 
I 2 ALA R 26  ? TYR R 31  ? ALA J 158 TYR J 163 
I 3 VAL R 40  ? ARG R 43  ? VAL J 172 ARG J 175 
J 1 CYS R 15  ? CYS R 16  ? CYS J 147 CYS J 148 
J 2 ALA R 26  ? TYR R 31  ? ALA J 158 TYR J 163 
J 3 VAL R 8   ? THR R 12  ? VAL J 140 THR J 144 
J 4 LEU R 73  ? THR R 77  ? LEU J 205 THR J 209 
J 5 GLN R 125 ? HIS R 128 ? GLN J 257 HIS J 260 
K 1 VAL S 40  ? ARG S 43  ? VAL M 172 ARG M 175 
K 2 ARG S 25  ? TYR S 31  ? ARG M 157 TYR M 163 
K 3 VAL S 8   ? SER S 17  ? VAL M 140 SER M 149 
K 4 LYS S 72  ? THR S 77  ? LYS M 204 THR M 209 
K 5 ASP S 123 ? HIS S 128 ? ASP M 255 HIS M 260 
L 1 CYS T 15  ? CYS T 16  ? CYS N 147 CYS N 148 
L 2 ALA T 26  ? TYR T 31  ? ALA N 158 TYR N 163 
L 3 VAL T 40  ? ARG T 43  ? VAL N 172 ARG N 175 
M 1 CYS T 15  ? CYS T 16  ? CYS N 147 CYS N 148 
M 2 ALA T 26  ? TYR T 31  ? ALA N 158 TYR N 163 
M 3 VAL T 8   ? THR T 12  ? VAL N 140 THR N 144 
M 4 LEU T 73  ? THR T 77  ? LEU N 205 THR N 209 
M 5 TRP T 126 ? HIS T 128 ? TRP N 258 HIS N 260 
N 1 ARG U 25  ? TYR U 31  ? ARG R 157 TYR R 163 
N 2 VAL U 8   ? SER U 17  ? VAL R 140 SER R 149 
N 3 LYS U 72  ? THR U 77  ? LYS R 204 THR R 209 
N 4 ASP U 123 ? HIS U 128 ? ASP R 255 HIS R 260 
O 1 VAL V 40  ? ARG V 43  ? VAL S 172 ARG S 175 
O 2 GLY V 27  ? TYR V 31  ? GLY S 159 TYR S 163 
O 3 VAL V 9   ? THR V 12  ? VAL S 141 THR S 144 
O 4 VAL V 74  ? THR V 77  ? VAL S 206 THR S 209 
O 5 GLN V 125 ? HIS V 128 ? GLN S 257 HIS S 260 
P 1 VAL W 30  ? TYR W 31  ? VAL W 162 TYR W 163 
P 2 VAL W 8   ? THR W 12  ? VAL W 140 THR W 144 
P 3 LEU W 73  ? THR W 77  ? LEU W 205 THR W 209 
P 4 TRP W 126 ? HIS W 128 ? TRP W 258 HIS W 260 
Q 1 CYS W 15  ? CYS W 16  ? CYS W 147 CYS W 148 
Q 2 ALA W 26  ? GLY W 27  ? ALA W 158 GLY W 159 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET M 4  ? N MET A 136 O PHE M 7   ? O PHE A 139 
A 2 3 N ASP M 13 ? N ASP A 145 O GLY M 29  ? O GLY A 161 
B 1 2 N MET M 4  ? N MET A 136 O PHE M 7   ? O PHE A 139 
B 2 3 N VAL M 10 ? N VAL A 142 O TYR M 76  ? O TYR A 208 
B 3 4 N LEU M 75 ? N LEU A 207 O MET M 127 ? O MET A 259 
C 1 2 O GLY N 29 ? O GLY B 161 N ASP N 13  ? N ASP B 145 
C 2 3 N VAL N 10 ? N VAL B 142 O TYR N 76  ? O TYR B 208 
C 3 4 N LEU N 75 ? N LEU B 207 O MET N 127 ? O MET B 259 
D 1 2 O TYR O 31 ? O TYR E 163 N TYR O 11  ? N TYR E 143 
D 2 3 N VAL O 10 ? N VAL E 142 O VAL O 74  ? O VAL E 206 
D 3 4 N LEU O 75 ? N LEU E 207 O MET O 127 ? O MET E 259 
E 1 2 O TYR P 31 ? O TYR F 163 N TYR P 11  ? N TYR F 143 
E 2 3 N VAL P 10 ? N VAL F 142 O TYR P 76  ? O TYR F 208 
E 3 4 N LEU P 75 ? N LEU F 207 O MET P 127 ? O MET F 259 
F 1 2 O TYR Q 31 ? O TYR I 163 N TYR Q 11  ? N TYR I 143 
F 2 3 N VAL Q 10 ? N VAL I 142 O TYR Q 76  ? O TYR I 208 
F 3 4 N LEU Q 73 ? N LEU I 205 O ASP Q 123 ? O ASP I 255 
G 1 2 O TYR Q 31 ? O TYR I 163 N TYR Q 11  ? N TYR I 143 
G 2 3 N VAL Q 10 ? N VAL I 142 O TYR Q 76  ? O TYR I 208 
G 3 4 N LEU Q 75 ? N LEU I 207 O MET Q 127 ? O MET I 259 
H 1 2 N SER Q 17 ? N SER I 149 O ARG Q 25  ? O ARG I 157 
I 1 2 N CYS R 15 ? N CYS J 147 O GLY R 27  ? O GLY J 159 
I 2 3 N ILE R 28 ? N ILE J 160 O ILE R 42  ? O ILE J 174 
J 1 2 N CYS R 15 ? N CYS J 147 O GLY R 27  ? O GLY J 159 
J 2 3 O TYR R 31 ? O TYR J 163 N TYR R 11  ? N TYR J 143 
J 3 4 N VAL R 8  ? N VAL J 140 O VAL R 74  ? O VAL J 206 
J 4 5 N LEU R 75 ? N LEU J 207 O MET R 127 ? O MET J 259 
K 1 2 O ILE S 42 ? O ILE M 174 N ILE S 28  ? N ILE M 160 
K 2 3 O GLY S 29 ? O GLY M 161 N ASP S 13  ? N ASP M 145 
K 3 4 N VAL S 8  ? N VAL M 140 O VAL S 74  ? O VAL M 206 
K 4 5 N LEU S 75 ? N LEU M 207 O MET S 127 ? O MET M 259 
L 1 2 N CYS T 15 ? N CYS N 147 O GLY T 27  ? O GLY N 159 
L 2 3 N ILE T 28 ? N ILE N 160 O ILE T 42  ? O ILE N 174 
M 1 2 N CYS T 15 ? N CYS N 147 O GLY T 27  ? O GLY N 159 
M 2 3 O TYR T 31 ? O TYR N 163 N TYR T 11  ? N TYR N 143 
M 3 4 N THR T 12 ? N THR N 144 O TYR T 76  ? O TYR N 208 
M 4 5 N LEU T 75 ? N LEU N 207 O MET T 127 ? O MET N 259 
N 1 2 O GLY U 27 ? O GLY R 159 N CYS U 15  ? N CYS R 147 
N 2 3 N VAL U 10 ? N VAL R 142 O VAL U 74  ? O VAL R 206 
N 3 4 N LEU U 75 ? N LEU R 207 O GLN U 125 ? O GLN R 257 
O 1 2 O VAL V 40 ? O VAL S 172 N VAL V 30  ? N VAL S 162 
O 2 3 O TYR V 31 ? O TYR S 163 N TYR V 11  ? N TYR S 143 
O 3 4 N VAL V 10 ? N VAL S 142 O TYR V 76  ? O TYR S 208 
O 4 5 N LEU V 75 ? N LEU S 207 O MET V 127 ? O MET S 259 
P 1 2 O TYR W 31 ? O TYR W 163 N TYR W 11  ? N TYR W 143 
P 2 3 N VAL W 10 ? N VAL W 142 O TYR W 76  ? O TYR W 208 
P 3 4 N LEU W 75 ? N LEU W 207 O MET W 127 ? O MET W 259 
Q 1 2 N CYS W 15 ? N CYS W 147 O GLY W 27  ? O GLY W 159 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1001'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 1002'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 1009'  
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL B 2001'  
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA E 1003'  
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA E 1004'  
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA F 1013'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA I 1006'  
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA J 1008'  
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA M 1010'  
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA M 1014'  
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA N 1005'  
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA R 1011'  
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA S 1007'  
BC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA W 1012'  
BC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE TRS D 2003' 
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MES A 2002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP M  13  ? ASP A 145  . ? 1_555 ? 
2  AC1 6 GLU M  54  ? GLU A 186  . ? 1_555 ? 
3  AC1 6 ASN M  78  ? ASN A 210  . ? 1_555 ? 
4  AC1 6 CA  Z  .   ? CA  A 1002 . ? 1_555 ? 
5  AC1 6 A   A  5   ? A   C 5    . ? 1_555 ? 
6  AC1 6 C   A  6   ? C   C 6    . ? 1_555 ? 
7  AC2 7 ASP M  13  ? ASP A 145  . ? 1_555 ? 
8  AC2 7 ASP M  142 ? ASP A 274  . ? 1_555 ? 
9  AC2 7 CA  Y  .   ? CA  A 1001 . ? 1_555 ? 
10 AC2 7 HOH AB .   ? HOH A 2003 . ? 1_555 ? 
11 AC2 7 HOH AB .   ? HOH A 2007 . ? 1_555 ? 
12 AC2 7 C   A  6   ? C   C 6    . ? 1_555 ? 
13 AC2 7 HOH OA .   ? HOH C 15   . ? 1_555 ? 
14 AC3 6 ASP N  13  ? ASP B 145  . ? 1_555 ? 
15 AC3 6 ASN N  78  ? ASN B 210  . ? 1_555 ? 
16 AC3 6 ASP N  142 ? ASP B 274  . ? 1_555 ? 
17 AC3 6 HOH BB .   ? HOH B 2002 . ? 1_555 ? 
18 AC3 6 HOH BB .   ? HOH B 2003 . ? 1_555 ? 
19 AC3 6 HOH BB .   ? HOH B 2004 . ? 1_555 ? 
20 AC4 3 TYR N  11  ? TYR B 143  . ? 1_555 ? 
21 AC4 3 TYR P  11  ? TYR F 143  . ? 4_445 ? 
22 AC4 3 PHE P  135 ? PHE F 267  . ? 4_445 ? 
23 AC5 3 ASP O  13  ? ASP E 145  . ? 1_555 ? 
24 AC5 3 ASP O  142 ? ASP E 274  . ? 1_555 ? 
25 AC5 3 C   C  6   ? C   G 6    . ? 1_555 ? 
26 AC6 5 ASP O  13  ? ASP E 145  . ? 1_555 ? 
27 AC6 5 GLU O  54  ? GLU E 186  . ? 1_555 ? 
28 AC6 5 ASN O  78  ? ASN E 210  . ? 1_555 ? 
29 AC6 5 A   C  5   ? A   G 5    . ? 1_555 ? 
30 AC6 5 C   C  6   ? C   G 6    . ? 1_555 ? 
31 AC7 3 ASP P  13  ? ASP F 145  . ? 1_555 ? 
32 AC7 3 ASN P  78  ? ASN F 210  . ? 1_555 ? 
33 AC7 3 ASP P  142 ? ASP F 274  . ? 1_555 ? 
34 AC8 4 ASP Q  13  ? ASP I 145  . ? 1_555 ? 
35 AC8 4 ASP Q  142 ? ASP I 274  . ? 1_555 ? 
36 AC8 4 C   E  6   ? C   K 6    . ? 1_555 ? 
37 AC8 4 HOH SA .   ? HOH K 26   . ? 1_555 ? 
38 AC9 3 ASP R  13  ? ASP J 145  . ? 1_555 ? 
39 AC9 3 ASN R  78  ? ASN J 210  . ? 1_555 ? 
40 AC9 3 ASP R  142 ? ASP J 274  . ? 1_555 ? 
41 BC1 7 HOH GB .   ? HOH M 11   . ? 1_555 ? 
42 BC1 7 HOH GB .   ? HOH M 12   . ? 1_555 ? 
43 BC1 7 ASP S  13  ? ASP M 145  . ? 1_555 ? 
44 BC1 7 ASP S  142 ? ASP M 274  . ? 1_555 ? 
45 BC1 7 CA  JA .   ? CA  M 1014 . ? 1_555 ? 
46 BC1 7 C   G  6   ? C   O 6    . ? 1_555 ? 
47 BC1 7 HOH UA .   ? HOH O 15   . ? 1_555 ? 
48 BC2 6 ASP S  13  ? ASP M 145  . ? 1_555 ? 
49 BC2 6 GLU S  54  ? GLU M 186  . ? 1_555 ? 
50 BC2 6 ASN S  78  ? ASN M 210  . ? 1_555 ? 
51 BC2 6 CA  IA .   ? CA  M 1010 . ? 1_555 ? 
52 BC2 6 A   G  5   ? A   O 5    . ? 1_555 ? 
53 BC2 6 C   G  6   ? C   O 6    . ? 1_555 ? 
54 BC3 3 ASP T  13  ? ASP N 145  . ? 1_555 ? 
55 BC3 3 ASN T  78  ? ASN N 210  . ? 1_555 ? 
56 BC3 3 ASP T  142 ? ASP N 274  . ? 1_555 ? 
57 BC4 4 ASP U  13  ? ASP R 145  . ? 1_555 ? 
58 BC4 4 GLY U  14  ? GLY R 146  . ? 1_555 ? 
59 BC4 4 ASP U  142 ? ASP R 274  . ? 1_555 ? 
60 BC4 4 C   I  6   ? C   T 6    . ? 1_555 ? 
61 BC5 3 ASP V  13  ? ASP S 145  . ? 1_555 ? 
62 BC5 3 ASN V  78  ? ASN S 210  . ? 1_555 ? 
63 BC5 3 ASP V  142 ? ASP S 274  . ? 1_555 ? 
64 BC6 3 ASP W  13  ? ASP W 145  . ? 1_555 ? 
65 BC6 3 ASN W  78  ? ASN W 210  . ? 1_555 ? 
66 BC6 3 ASP W  142 ? ASP W 274  . ? 1_555 ? 
67 BC7 5 GLY M  134 ? GLY A 266  . ? 1_555 ? 
68 BC7 5 GLU M  139 ? GLU A 271  . ? 1_555 ? 
69 BC7 5 ASP M  154 ? ASP A 286  . ? 2_555 ? 
70 BC7 5 DA  B  3   ? DA  D 17   . ? 1_555 ? 
71 BC7 5 HOH PA .   ? HOH D 2004 . ? 1_555 ? 
72 BC8 6 THR M  87  ? THR A 219  . ? 1_555 ? 
73 BC8 6 ILE M  124 ? ILE A 256  . ? 1_555 ? 
74 BC8 6 GLN M  125 ? GLN A 257  . ? 1_555 ? 
75 BC8 6 TRP M  126 ? TRP A 258  . ? 1_555 ? 
76 BC8 6 ASN U  88  ? ASN R 220  . ? 1_555 ? 
77 BC8 6 GLN U  91  ? GLN R 223  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2QKK 
_atom_sites.fract_transf_matrix[1][1]   0.006620 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000025 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005675 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007946 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . C   A  1 1   ? -37.305  16.606  -9.043  1.00 39.34  ? 1    C   C "O5'" 1 
ATOM   2     C  "C5'" . C   A  1 1   ? -37.763  16.109  -10.299 1.00 40.12  ? 1    C   C "C5'" 1 
ATOM   3     C  "C4'" . C   A  1 1   ? -37.606  17.071  -11.458 1.00 40.59  ? 1    C   C "C4'" 1 
ATOM   4     O  "O4'" . C   A  1 1   ? -38.195  18.351  -11.120 1.00 40.38  ? 1    C   C "O4'" 1 
ATOM   5     C  "C3'" . C   A  1 1   ? -36.180  17.416  -11.846 1.00 42.40  ? 1    C   C "C3'" 1 
ATOM   6     O  "O3'" . C   A  1 1   ? -35.660  16.422  -12.719 1.00 44.78  ? 1    C   C "O3'" 1 
ATOM   7     C  "C2'" . C   A  1 1   ? -36.355  18.749  -12.565 1.00 41.60  ? 1    C   C "C2'" 1 
ATOM   8     O  "O2'" . C   A  1 1   ? -36.827  18.601  -13.886 1.00 43.95  ? 1    C   C "O2'" 1 
ATOM   9     C  "C1'" . C   A  1 1   ? -37.463  19.394  -11.740 1.00 39.66  ? 1    C   C "C1'" 1 
ATOM   10    N  N1    . C   A  1 1   ? -36.963  20.293  -10.695 1.00 38.12  ? 1    C   C N1    1 
ATOM   11    C  C2    . C   A  1 1   ? -36.414  21.524  -11.072 1.00 39.50  ? 1    C   C C2    1 
ATOM   12    O  O2    . C   A  1 1   ? -36.371  21.817  -12.286 1.00 39.72  ? 1    C   C O2    1 
ATOM   13    N  N3    . C   A  1 1   ? -35.949  22.360  -10.109 1.00 38.19  ? 1    C   C N3    1 
ATOM   14    C  C4    . C   A  1 1   ? -36.026  21.998  -8.823  1.00 38.32  ? 1    C   C C4    1 
ATOM   15    N  N4    . C   A  1 1   ? -35.544  22.832  -7.901  1.00 39.92  ? 1    C   C N4    1 
ATOM   16    C  C5    . C   A  1 1   ? -36.593  20.757  -8.421  1.00 36.40  ? 1    C   C C5    1 
ATOM   17    C  C6    . C   A  1 1   ? -37.037  19.942  -9.379  1.00 36.28  ? 1    C   C C6    1 
ATOM   18    P  P     . G   A  1 2   ? -34.107  16.033  -12.632 1.00 46.02  ? 2    G   C P     1 
ATOM   19    O  OP1   . G   A  1 2   ? -33.790  14.965  -13.628 1.00 44.99  ? 2    G   C OP1   1 
ATOM   20    O  OP2   . G   A  1 2   ? -33.821  15.819  -11.175 1.00 45.26  ? 2    G   C OP2   1 
ATOM   21    O  "O5'" . G   A  1 2   ? -33.391  17.345  -13.156 1.00 40.68  ? 2    G   C "O5'" 1 
ATOM   22    C  "C5'" . G   A  1 2   ? -33.702  17.842  -14.435 1.00 35.61  ? 2    G   C "C5'" 1 
ATOM   23    C  "C4'" . G   A  1 2   ? -33.091  19.195  -14.612 1.00 35.45  ? 2    G   C "C4'" 1 
ATOM   24    O  "O4'" . G   A  1 2   ? -33.690  20.129  -13.686 1.00 33.54  ? 2    G   C "O4'" 1 
ATOM   25    C  "C3'" . G   A  1 2   ? -31.617  19.290  -14.269 1.00 35.04  ? 2    G   C "C3'" 1 
ATOM   26    O  "O3'" . G   A  1 2   ? -30.839  18.779  -15.338 1.00 37.29  ? 2    G   C "O3'" 1 
ATOM   27    C  "C2'" . G   A  1 2   ? -31.449  20.792  -14.101 1.00 32.48  ? 2    G   C "C2'" 1 
ATOM   28    O  "O2'" . G   A  1 2   ? -31.421  21.462  -15.342 1.00 31.03  ? 2    G   C "O2'" 1 
ATOM   29    C  "C1'" . G   A  1 2   ? -32.751  21.151  -13.392 1.00 31.75  ? 2    G   C "C1'" 1 
ATOM   30    N  N9    . G   A  1 2   ? -32.608  21.246  -11.946 1.00 30.62  ? 2    G   C N9    1 
ATOM   31    C  C8    . G   A  1 2   ? -32.983  20.320  -11.001 1.00 29.29  ? 2    G   C C8    1 
ATOM   32    N  N7    . G   A  1 2   ? -32.767  20.724  -9.780  1.00 28.28  ? 2    G   C N7    1 
ATOM   33    C  C5    . G   A  1 2   ? -32.208  21.985  -9.932  1.00 28.96  ? 2    G   C C5    1 
ATOM   34    C  C6    . G   A  1 2   ? -31.773  22.910  -8.963  1.00 29.48  ? 2    G   C C6    1 
ATOM   35    O  O6    . G   A  1 2   ? -31.802  22.801  -7.737  1.00 29.70  ? 2    G   C O6    1 
ATOM   36    N  N1    . G   A  1 2   ? -31.262  24.064  -9.549  1.00 29.37  ? 2    G   C N1    1 
ATOM   37    C  C2    . G   A  1 2   ? -31.182  24.290  -10.903 1.00 29.35  ? 2    G   C C2    1 
ATOM   38    N  N2    . G   A  1 2   ? -30.661  25.465  -11.277 1.00 31.65  ? 2    G   C N2    1 
ATOM   39    N  N3    . G   A  1 2   ? -31.586  23.431  -11.819 1.00 27.61  ? 2    G   C N3    1 
ATOM   40    C  C4    . G   A  1 2   ? -32.088  22.310  -11.265 1.00 29.10  ? 2    G   C C4    1 
ATOM   41    P  P     . A   A  1 3   ? -29.344  18.267  -15.062 1.00 37.51  ? 3    A   C P     1 
ATOM   42    O  OP1   . A   A  1 3   ? -28.871  17.923  -16.428 1.00 38.97  ? 3    A   C OP1   1 
ATOM   43    O  OP2   . A   A  1 3   ? -29.293  17.238  -13.977 1.00 34.73  ? 3    A   C OP2   1 
ATOM   44    O  "O5'" . A   A  1 3   ? -28.587  19.591  -14.595 1.00 34.79  ? 3    A   C "O5'" 1 
ATOM   45    C  "C5'" . A   A  1 3   ? -28.386  20.650  -15.523 1.00 31.36  ? 3    A   C "C5'" 1 
ATOM   46    C  "C4'" . A   A  1 3   ? -27.662  21.795  -14.874 1.00 29.65  ? 3    A   C "C4'" 1 
ATOM   47    O  "O4'" . A   A  1 3   ? -28.500  22.433  -13.886 1.00 28.96  ? 3    A   C "O4'" 1 
ATOM   48    C  "C3'" . A   A  1 3   ? -26.415  21.428  -14.106 1.00 30.87  ? 3    A   C "C3'" 1 
ATOM   49    O  "O3'" . A   A  1 3   ? -25.326  21.277  -15.000 1.00 31.07  ? 3    A   C "O3'" 1 
ATOM   50    C  "C2'" . A   A  1 3   ? -26.242  22.639  -13.201 1.00 30.69  ? 3    A   C "C2'" 1 
ATOM   51    O  "O2'" . A   A  1 3   ? -25.688  23.749  -13.878 1.00 32.67  ? 3    A   C "O2'" 1 
ATOM   52    C  "C1'" . A   A  1 3   ? -27.694  22.940  -12.840 1.00 28.90  ? 3    A   C "C1'" 1 
ATOM   53    N  N9    . A   A  1 3   ? -28.101  22.272  -11.614 1.00 27.68  ? 3    A   C N9    1 
ATOM   54    C  C8    . A   A  1 3   ? -28.591  21.001  -11.478 1.00 25.87  ? 3    A   C C8    1 
ATOM   55    N  N7    . A   A  1 3   ? -28.904  20.687  -10.246 1.00 26.26  ? 3    A   C N7    1 
ATOM   56    C  C5    . A   A  1 3   ? -28.591  21.828  -9.521  1.00 26.49  ? 3    A   C C5    1 
ATOM   57    C  C6    . A   A  1 3   ? -28.698  22.138  -8.156  1.00 27.09  ? 3    A   C C6    1 
ATOM   58    N  N6    . A   A  1 3   ? -29.165  21.285  -7.243  1.00 27.86  ? 3    A   C N6    1 
ATOM   59    N  N1    . A   A  1 3   ? -28.301  23.370  -7.755  1.00 27.33  ? 3    A   C N1    1 
ATOM   60    C  C2    . A   A  1 3   ? -27.820  24.216  -8.675  1.00 27.17  ? 3    A   C C2    1 
ATOM   61    N  N3    . A   A  1 3   ? -27.665  24.035  -9.988  1.00 27.13  ? 3    A   C N3    1 
ATOM   62    C  C4    . A   A  1 3   ? -28.082  22.808  -10.349 1.00 27.32  ? 3    A   C C4    1 
ATOM   63    P  P     . C   A  1 4   ? -24.038  20.459  -14.529 1.00 29.47  ? 4    C   C P     1 
ATOM   64    O  OP1   . C   A  1 4   ? -23.181  20.283  -15.736 1.00 28.67  ? 4    C   C OP1   1 
ATOM   65    O  OP2   . C   A  1 4   ? -24.500  19.267  -13.763 1.00 24.66  ? 4    C   C OP2   1 
ATOM   66    O  "O5'" . C   A  1 4   ? -23.318  21.484  -13.544 1.00 27.57  ? 4    C   C "O5'" 1 
ATOM   67    C  "C5'" . C   A  1 4   ? -22.649  22.627  -14.065 1.00 24.76  ? 4    C   C "C5'" 1 
ATOM   68    C  "C4'" . C   A  1 4   ? -22.096  23.464  -12.942 1.00 23.66  ? 4    C   C "C4'" 1 
ATOM   69    O  "O4'" . C   A  1 4   ? -23.199  23.896  -12.117 1.00 26.18  ? 4    C   C "O4'" 1 
ATOM   70    C  "C3'" . C   A  1 4   ? -21.170  22.771  -11.957 1.00 22.69  ? 4    C   C "C3'" 1 
ATOM   71    O  "O3'" . C   A  1 4   ? -19.844  22.790  -12.450 1.00 24.36  ? 4    C   C "O3'" 1 
ATOM   72    C  "C2'" . C   A  1 4   ? -21.285  23.682  -10.749 1.00 23.32  ? 4    C   C "C2'" 1 
ATOM   73    O  "O2'" . C   A  1 4   ? -20.610  24.904  -10.958 1.00 24.94  ? 4    C   C "O2'" 1 
ATOM   74    C  "C1'" . C   A  1 4   ? -22.774  23.995  -10.770 1.00 23.40  ? 4    C   C "C1'" 1 
ATOM   75    N  N1    . C   A  1 4   ? -23.592  23.087  -9.952  1.00 20.82  ? 4    C   C N1    1 
ATOM   76    C  C2    . C   A  1 4   ? -23.893  23.478  -8.645  1.00 19.74  ? 4    C   C C2    1 
ATOM   77    O  O2    . C   A  1 4   ? -23.416  24.550  -8.220  1.00 23.15  ? 4    C   C O2    1 
ATOM   78    N  N3    . C   A  1 4   ? -24.686  22.694  -7.880  1.00 14.09  ? 4    C   C N3    1 
ATOM   79    C  C4    . C   A  1 4   ? -25.161  21.561  -8.374  1.00 10.83  ? 4    C   C C4    1 
ATOM   80    N  N4    . C   A  1 4   ? -25.949  20.838  -7.592  1.00 9.38   ? 4    C   C N4    1 
ATOM   81    C  C5    . C   A  1 4   ? -24.850  21.123  -9.700  1.00 13.31  ? 4    C   C C5    1 
ATOM   82    C  C6    . C   A  1 4   ? -24.067  21.906  -10.446 1.00 15.15  ? 4    C   C C6    1 
ATOM   83    P  P     . A   A  1 5   ? -18.710  21.907  -11.733 1.00 23.53  ? 5    A   C P     1 
ATOM   84    O  OP1   . A   A  1 5   ? -17.479  22.031  -12.560 1.00 21.08  ? 5    A   C OP1   1 
ATOM   85    O  OP2   . A   A  1 5   ? -19.257  20.570  -11.405 1.00 19.02  ? 5    A   C OP2   1 
ATOM   86    O  "O5'" . A   A  1 5   ? -18.463  22.692  -10.374 1.00 25.26  ? 5    A   C "O5'" 1 
ATOM   87    C  "C5'" . A   A  1 5   ? -18.249  22.002  -9.154  1.00 23.57  ? 5    A   C "C5'" 1 
ATOM   88    C  "C4'" . A   A  1 5   ? -18.607  22.894  -7.993  1.00 21.62  ? 5    A   C "C4'" 1 
ATOM   89    O  "O4'" . A   A  1 5   ? -20.048  23.054  -7.893  1.00 20.42  ? 5    A   C "O4'" 1 
ATOM   90    C  "C3'" . A   A  1 5   ? -18.195  22.336  -6.652  1.00 20.53  ? 5    A   C "C3'" 1 
ATOM   91    O  "O3'" . A   A  1 5   ? -16.861  22.752  -6.455  1.00 22.68  ? 5    A   C "O3'" 1 
ATOM   92    C  "C2'" . A   A  1 5   ? -19.144  23.049  -5.708  1.00 17.80  ? 5    A   C "C2'" 1 
ATOM   93    O  "O2'" . A   A  1 5   ? -18.714  24.382  -5.550  1.00 16.52  ? 5    A   C "O2'" 1 
ATOM   94    C  "C1'" . A   A  1 5   ? -20.434  23.049  -6.529  1.00 16.62  ? 5    A   C "C1'" 1 
ATOM   95    N  N9    . A   A  1 5   ? -21.309  21.895  -6.329  1.00 14.28  ? 5    A   C N9    1 
ATOM   96    C  C8    . A   A  1 5   ? -21.712  21.018  -7.302  1.00 13.47  ? 5    A   C C8    1 
ATOM   97    N  N7    . A   A  1 5   ? -22.515  20.080  -6.869  1.00 12.24  ? 5    A   C N7    1 
ATOM   98    C  C5    . A   A  1 5   ? -22.650  20.352  -5.521  1.00 10.75  ? 5    A   C C5    1 
ATOM   99    C  C6    . A   A  1 5   ? -23.369  19.715  -4.511  1.00 9.96   ? 5    A   C C6    1 
ATOM   100   N  N6    . A   A  1 5   ? -24.098  18.625  -4.709  1.00 9.90   ? 5    A   C N6    1 
ATOM   101   N  N1    . A   A  1 5   ? -23.308  20.234  -3.272  1.00 11.21  ? 5    A   C N1    1 
ATOM   102   C  C2    . A   A  1 5   ? -22.551  21.320  -3.074  1.00 13.87  ? 5    A   C C2    1 
ATOM   103   N  N3    . A   A  1 5   ? -21.810  22.006  -3.948  1.00 14.61  ? 5    A   C N3    1 
ATOM   104   C  C4    . A   A  1 5   ? -21.909  21.465  -5.170  1.00 12.96  ? 5    A   C C4    1 
ATOM   105   P  P     . C   A  1 6   ? -15.913  21.896  -5.514  1.00 22.52  ? 6    C   C P     1 
ATOM   106   O  OP1   . C   A  1 6   ? -14.665  22.673  -5.316  1.00 22.77  ? 6    C   C OP1   1 
ATOM   107   O  OP2   . C   A  1 6   ? -15.847  20.522  -6.070  1.00 23.14  ? 6    C   C OP2   1 
ATOM   108   O  "O5'" . C   A  1 6   ? -16.713  21.907  -4.147  1.00 18.70  ? 6    C   C "O5'" 1 
ATOM   109   C  "C5'" . C   A  1 6   ? -16.663  23.053  -3.326  1.00 18.44  ? 6    C   C "C5'" 1 
ATOM   110   C  "C4'" . C   A  1 6   ? -17.306  22.764  -2.005  1.00 20.08  ? 6    C   C "C4'" 1 
ATOM   111   O  "O4'" . C   A  1 6   ? -18.737  22.570  -2.180  1.00 20.40  ? 6    C   C "O4'" 1 
ATOM   112   C  "C3'" . C   A  1 6   ? -16.849  21.485  -1.344  1.00 19.31  ? 6    C   C "C3'" 1 
ATOM   113   O  "O3'" . C   A  1 6   ? -15.630  21.681  -0.653  1.00 22.82  ? 6    C   C "O3'" 1 
ATOM   114   C  "C2'" . C   A  1 6   ? -17.994  21.226  -0.388  1.00 18.16  ? 6    C   C "C2'" 1 
ATOM   115   O  "O2'" . C   A  1 6   ? -17.909  22.104  0.713   1.00 19.34  ? 6    C   C "O2'" 1 
ATOM   116   C  "C1'" . C   A  1 6   ? -19.195  21.598  -1.263  1.00 16.65  ? 6    C   C "C1'" 1 
ATOM   117   N  N1    . C   A  1 6   ? -19.702  20.450  -2.029  1.00 13.91  ? 6    C   C N1    1 
ATOM   118   C  C2    . C   A  1 6   ? -20.666  19.632  -1.436  1.00 13.69  ? 6    C   C C2    1 
ATOM   119   O  O2    . C   A  1 6   ? -21.105  19.950  -0.324  1.00 16.48  ? 6    C   C O2    1 
ATOM   120   N  N3    . C   A  1 6   ? -21.102  18.531  -2.089  1.00 9.92   ? 6    C   C N3    1 
ATOM   121   C  C4    . C   A  1 6   ? -20.623  18.246  -3.292  1.00 8.43   ? 6    C   C C4    1 
ATOM   122   N  N4    . C   A  1 6   ? -21.058  17.137  -3.881  1.00 7.68   ? 6    C   C N4    1 
ATOM   123   C  C5    . C   A  1 6   ? -19.664  19.086  -3.944  1.00 10.80  ? 6    C   C C5    1 
ATOM   124   C  C6    . C   A  1 6   ? -19.234  20.168  -3.282  1.00 10.34  ? 6    C   C C6    1 
ATOM   125   P  P     . C   A  1 7   ? -14.622  20.445  -0.478  1.00 26.77  ? 7    C   C P     1 
ATOM   126   O  OP1   . C   A  1 7   ? -13.845  20.698  0.769   1.00 28.21  ? 7    C   C OP1   1 
ATOM   127   O  OP2   . C   A  1 7   ? -13.910  20.187  -1.760  1.00 25.12  ? 7    C   C OP2   1 
ATOM   128   O  "O5'" . C   A  1 7   ? -15.596  19.221  -0.207  1.00 26.07  ? 7    C   C "O5'" 1 
ATOM   129   C  "C5'" . C   A  1 7   ? -15.421  18.402  0.936   1.00 28.96  ? 7    C   C "C5'" 1 
ATOM   130   C  "C4'" . C   A  1 7   ? -16.702  18.332  1.736   1.00 28.87  ? 7    C   C "C4'" 1 
ATOM   131   O  "O4'" . C   A  1 7   ? -17.839  18.320  0.836   1.00 27.99  ? 7    C   C "O4'" 1 
ATOM   132   C  "C3'" . C   A  1 7   ? -16.818  17.061  2.566   1.00 28.82  ? 7    C   C "C3'" 1 
ATOM   133   O  "O3'" . C   A  1 7   ? -16.245  17.234  3.854   1.00 26.62  ? 7    C   C "O3'" 1 
ATOM   134   C  "C2'" . C   A  1 7   ? -18.320  16.816  2.635   1.00 28.58  ? 7    C   C "C2'" 1 
ATOM   135   O  "O2'" . C   A  1 7   ? -18.930  17.485  3.719   1.00 30.41  ? 7    C   C "O2'" 1 
ATOM   136   C  "C1'" . C   A  1 7   ? -18.797  17.382  1.291   1.00 25.97  ? 7    C   C "C1'" 1 
ATOM   137   N  N1    . C   A  1 7   ? -19.015  16.391  0.223   1.00 21.16  ? 7    C   C N1    1 
ATOM   138   C  C2    . C   A  1 7   ? -19.954  15.398  0.426   1.00 19.30  ? 7    C   C C2    1 
ATOM   139   O  O2    . C   A  1 7   ? -20.539  15.355  1.518   1.00 18.73  ? 7    C   C O2    1 
ATOM   140   N  N3    . C   A  1 7   ? -20.207  14.512  -0.568  1.00 17.32  ? 7    C   C N3    1 
ATOM   141   C  C4    . C   A  1 7   ? -19.555  14.606  -1.727  1.00 15.08  ? 7    C   C C4    1 
ATOM   142   N  N4    . C   A  1 7   ? -19.850  13.736  -2.683  1.00 12.28  ? 7    C   C N4    1 
ATOM   143   C  C5    . C   A  1 7   ? -18.573  15.602  -1.954  1.00 15.95  ? 7    C   C C5    1 
ATOM   144   C  C6    . C   A  1 7   ? -18.329  16.463  -0.959  1.00 18.69  ? 7    C   C C6    1 
ATOM   145   P  P     . U   A  1 8   ? -15.320  16.075  4.457   1.00 26.52  ? 8    U   C P     1 
ATOM   146   O  OP1   . U   A  1 8   ? -14.673  16.589  5.695   1.00 26.20  ? 8    U   C OP1   1 
ATOM   147   O  OP2   . U   A  1 8   ? -14.481  15.598  3.333   1.00 24.06  ? 8    U   C OP2   1 
ATOM   148   O  "O5'" . U   A  1 8   ? -16.349  14.921  4.845   1.00 24.02  ? 8    U   C "O5'" 1 
ATOM   149   C  "C5'" . U   A  1 8   ? -17.212  15.065  5.968   1.00 24.30  ? 8    U   C "C5'" 1 
ATOM   150   C  "C4'" . U   A  1 8   ? -18.153  13.886  6.073   1.00 25.11  ? 8    U   C "C4'" 1 
ATOM   151   O  "O4'" . U   A  1 8   ? -19.138  13.912  5.008   1.00 26.09  ? 8    U   C "O4'" 1 
ATOM   152   C  "C3'" . U   A  1 8   ? -17.515  12.524  5.912   1.00 25.88  ? 8    U   C "C3'" 1 
ATOM   153   O  "O3'" . U   A  1 8   ? -16.877  12.132  7.103   1.00 27.27  ? 8    U   C "O3'" 1 
ATOM   154   C  "C2'" . U   A  1 8   ? -18.718  11.657  5.576   1.00 24.17  ? 8    U   C "C2'" 1 
ATOM   155   O  "O2'" . U   A  1 8   ? -19.541  11.405  6.689   1.00 23.05  ? 8    U   C "O2'" 1 
ATOM   156   C  "C1'" . U   A  1 8   ? -19.473  12.581  4.635   1.00 24.91  ? 8    U   C "C1'" 1 
ATOM   157   N  N1    . U   A  1 8   ? -19.078  12.376  3.236   1.00 26.08  ? 8    U   C N1    1 
ATOM   158   C  C2    . U   A  1 8   ? -19.654  11.322  2.563   1.00 28.72  ? 8    U   C C2    1 
ATOM   159   O  O2    . U   A  1 8   ? -20.442  10.549  3.098   1.00 31.99  ? 8    U   C O2    1 
ATOM   160   N  N3    . U   A  1 8   ? -19.277  11.202  1.245   1.00 28.11  ? 8    U   C N3    1 
ATOM   161   C  C4    . U   A  1 8   ? -18.398  12.014  0.558   1.00 26.40  ? 8    U   C C4    1 
ATOM   162   O  O4    . U   A  1 8   ? -18.219  11.836  -0.652  1.00 25.96  ? 8    U   C O4    1 
ATOM   163   C  C5    . U   A  1 8   ? -17.831  13.066  1.340   1.00 25.09  ? 8    U   C C5    1 
ATOM   164   C  C6    . U   A  1 8   ? -18.181  13.205  2.617   1.00 24.74  ? 8    U   C C6    1 
ATOM   165   P  P     . G   A  1 9   ? -15.665  11.088  7.040   1.00 29.22  ? 9    G   C P     1 
ATOM   166   O  OP1   . G   A  1 9   ? -15.243  10.932  8.460   1.00 30.06  ? 9    G   C OP1   1 
ATOM   167   O  OP2   . G   A  1 9   ? -14.675  11.512  5.998   1.00 27.16  ? 9    G   C OP2   1 
ATOM   168   O  "O5'" . G   A  1 9   ? -16.373  9.738   6.599   1.00 26.56  ? 9    G   C "O5'" 1 
ATOM   169   C  "C5'" . G   A  1 9   ? -17.487  9.283   7.337   1.00 28.90  ? 9    G   C "C5'" 1 
ATOM   170   C  "C4'" . G   A  1 9   ? -18.113  8.108   6.664   1.00 28.79  ? 9    G   C "C4'" 1 
ATOM   171   O  "O4'" . G   A  1 9   ? -18.826  8.500   5.464   1.00 29.42  ? 9    G   C "O4'" 1 
ATOM   172   C  "C3'" . G   A  1 9   ? -17.120  7.085   6.185   1.00 28.97  ? 9    G   C "C3'" 1 
ATOM   173   O  "O3'" . G   A  1 9   ? -16.705  6.354   7.328   1.00 31.18  ? 9    G   C "O3'" 1 
ATOM   174   C  "C2'" . G   A  1 9   ? -17.968  6.317   5.176   1.00 27.66  ? 9    G   C "C2'" 1 
ATOM   175   O  "O2'" . G   A  1 9   ? -18.921  5.495   5.816   1.00 28.11  ? 9    G   C "O2'" 1 
ATOM   176   C  "C1'" . G   A  1 9   ? -18.726  7.465   4.500   1.00 24.93  ? 9    G   C "C1'" 1 
ATOM   177   N  N9    . G   A  1 9   ? -18.035  8.024   3.350   1.00 19.69  ? 9    G   C N9    1 
ATOM   178   C  C8    . G   A  1 9   ? -17.222  9.131   3.350   1.00 18.21  ? 9    G   C C8    1 
ATOM   179   N  N7    . G   A  1 9   ? -16.728  9.406   2.174   1.00 17.39  ? 9    G   C N7    1 
ATOM   180   C  C5    . G   A  1 9   ? -17.248  8.421   1.345   1.00 16.17  ? 9    G   C C5    1 
ATOM   181   C  C6    . G   A  1 9   ? -17.054  8.194   -0.043  1.00 13.77  ? 9    G   C C6    1 
ATOM   182   O  O6    . G   A  1 9   ? -16.356  8.837   -0.837  1.00 10.82  ? 9    G   C O6    1 
ATOM   183   N  N1    . G   A  1 9   ? -17.768  7.082   -0.483  1.00 12.73  ? 9    G   C N1    1 
ATOM   184   C  C2    . G   A  1 9   ? -18.560  6.286   0.311   1.00 13.92  ? 9    G   C C2    1 
ATOM   185   N  N2    . G   A  1 9   ? -19.157  5.265   -0.301  1.00 14.63  ? 9    G   C N2    1 
ATOM   186   N  N3    . G   A  1 9   ? -18.748  6.481   1.610   1.00 15.49  ? 9    G   C N3    1 
ATOM   187   C  C4    . G   A  1 9   ? -18.064  7.561   2.057   1.00 17.96  ? 9    G   C C4    1 
ATOM   188   P  P     . A   A  1 10  ? -15.588  5.216   7.187   1.00 31.93  ? 10   A   C P     1 
ATOM   189   O  OP1   . A   A  1 10  ? -15.296  4.774   8.578   1.00 31.09  ? 10   A   C OP1   1 
ATOM   190   O  OP2   . A   A  1 10  ? -14.476  5.690   6.316   1.00 25.57  ? 10   A   C OP2   1 
ATOM   191   O  "O5'" . A   A  1 10  ? -16.407  4.060   6.454   1.00 31.56  ? 10   A   C "O5'" 1 
ATOM   192   C  "C5'" . A   A  1 10  ? -15.738  3.046   5.747   1.00 32.47  ? 10   A   C "C5'" 1 
ATOM   193   C  "C4'" . A   A  1 10  ? -16.602  2.495   4.639   1.00 31.47  ? 10   A   C "C4'" 1 
ATOM   194   O  "O4'" . A   A  1 10  ? -17.154  3.546   3.811   1.00 29.51  ? 10   A   C "O4'" 1 
ATOM   195   C  "C3'" . A   A  1 10  ? -15.744  1.683   3.695   1.00 32.97  ? 10   A   C "C3'" 1 
ATOM   196   O  "O3'" . A   A  1 10  ? -15.587  0.401   4.245   1.00 33.78  ? 10   A   C "O3'" 1 
ATOM   197   C  "C2'" . A   A  1 10  ? -16.482  1.758   2.372   1.00 30.77  ? 10   A   C "C2'" 1 
ATOM   198   O  "O2'" . A   A  1 10  ? -17.496  0.788   2.246   1.00 30.32  ? 10   A   C "O2'" 1 
ATOM   199   C  "C1'" . A   A  1 10  ? -17.044  3.180   2.440   1.00 30.37  ? 10   A   C "C1'" 1 
ATOM   200   N  N9    . A   A  1 10  ? -16.186  4.170   1.796   1.00 29.01  ? 10   A   C N9    1 
ATOM   201   C  C8    . A   A  1 10  ? -15.554  5.219   2.409   1.00 29.72  ? 10   A   C C8    1 
ATOM   202   N  N7    . A   A  1 10  ? -14.891  5.993   1.584   1.00 29.82  ? 10   A   C N7    1 
ATOM   203   C  C5    . A   A  1 10  ? -15.089  5.405   0.342   1.00 26.69  ? 10   A   C C5    1 
ATOM   204   C  C6    . A   A  1 10  ? -14.649  5.751   -0.950  1.00 23.62  ? 10   A   C C6    1 
ATOM   205   N  N6    . A   A  1 10  ? -13.915  6.827   -1.218  1.00 20.74  ? 10   A   C N6    1 
ATOM   206   N  N1    . A   A  1 10  ? -14.999  4.946   -1.970  1.00 23.73  ? 10   A   C N1    1 
ATOM   207   C  C2    . A   A  1 10  ? -15.753  3.874   -1.705  1.00 28.96  ? 10   A   C C2    1 
ATOM   208   N  N3    . A   A  1 10  ? -16.243  3.448   -0.532  1.00 31.19  ? 10   A   C N3    1 
ATOM   209   C  C4    . A   A  1 10  ? -15.869  4.269   0.462   1.00 28.68  ? 10   A   C C4    1 
ATOM   210   P  P     . U   A  1 11  ? -14.180  0.013   4.885   1.00 34.72  ? 11   U   C P     1 
ATOM   211   O  OP1   . U   A  1 11  ? -14.449  -0.871  6.057   1.00 34.98  ? 11   U   C OP1   1 
ATOM   212   O  OP2   . U   A  1 11  ? -13.361  1.238   5.061   1.00 33.24  ? 11   U   C OP2   1 
ATOM   213   O  "O5'" . U   A  1 11  ? -13.536  -0.825  3.707   1.00 34.23  ? 11   U   C "O5'" 1 
ATOM   214   C  "C5'" . U   A  1 11  ? -14.277  -1.872  3.114   1.00 31.61  ? 11   U   C "C5'" 1 
ATOM   215   C  "C4'" . U   A  1 11  ? -13.919  -1.996  1.668   1.00 29.26  ? 11   U   C "C4'" 1 
ATOM   216   O  "O4'" . U   A  1 11  ? -14.382  -0.835  0.939   1.00 30.80  ? 11   U   C "O4'" 1 
ATOM   217   C  "C3'" . U   A  1 11  ? -12.441  -1.951  1.373   1.00 27.97  ? 11   U   C "C3'" 1 
ATOM   218   O  "O3'" . U   A  1 11  ? -11.793  -3.147  1.755   1.00 24.62  ? 11   U   C "O3'" 1 
ATOM   219   C  "C2'" . U   A  1 11  ? -12.452  -1.693  -0.126  1.00 28.46  ? 11   U   C "C2'" 1 
ATOM   220   O  "O2'" . U   A  1 11  ? -12.810  -2.809  -0.913  1.00 31.31  ? 11   U   C "O2'" 1 
ATOM   221   C  "C1'" . U   A  1 11  ? -13.586  -0.683  -0.225  1.00 28.71  ? 11   U   C "C1'" 1 
ATOM   222   N  N1    . U   A  1 11  ? -13.066  0.683   -0.287  1.00 28.39  ? 11   U   C N1    1 
ATOM   223   C  C2    . U   A  1 11  ? -12.448  1.042   -1.464  1.00 29.26  ? 11   U   C C2    1 
ATOM   224   O  O2    . U   A  1 11  ? -12.323  0.266   -2.413  1.00 29.98  ? 11   U   C O2    1 
ATOM   225   N  N3    . U   A  1 11  ? -11.979  2.328   -1.495  1.00 25.74  ? 11   U   C N3    1 
ATOM   226   C  C4    . U   A  1 11  ? -12.068  3.259   -0.499  1.00 21.71  ? 11   U   C C4    1 
ATOM   227   O  O4    . U   A  1 11  ? -11.659  4.383   -0.715  1.00 21.82  ? 11   U   C O4    1 
ATOM   228   C  C5    . U   A  1 11  ? -12.712  2.813   0.692   1.00 22.10  ? 11   U   C C5    1 
ATOM   229   C  C6    . U   A  1 11  ? -13.179  1.568   0.758   1.00 26.24  ? 11   U   C C6    1 
ATOM   230   P  P     . U   A  1 12  ? -10.249  -3.095  2.170   1.00 23.37  ? 12   U   C P     1 
ATOM   231   O  OP1   . U   A  1 12  ? -9.986   -4.358  2.903   1.00 24.59  ? 12   U   C OP1   1 
ATOM   232   O  OP2   . U   A  1 12  ? -9.949   -1.793  2.819   1.00 23.79  ? 12   U   C OP2   1 
ATOM   233   O  "O5'" . U   A  1 12  ? -9.501   -3.121  0.767   1.00 20.44  ? 12   U   C "O5'" 1 
ATOM   234   C  "C5'" . U   A  1 12  ? -9.743   -4.180  -0.137  1.00 20.08  ? 12   U   C "C5'" 1 
ATOM   235   C  "C4'" . U   A  1 12  ? -9.315   -3.784  -1.507  1.00 20.39  ? 12   U   C "C4'" 1 
ATOM   236   O  "O4'" . U   A  1 12  ? -9.986   -2.555  -1.840  1.00 22.15  ? 12   U   C "O4'" 1 
ATOM   237   C  "C3'" . U   A  1 12  ? -7.858   -3.412  -1.649  1.00 21.82  ? 12   U   C "C3'" 1 
ATOM   238   O  "O3'" . U   A  1 12  ? -7.054   -4.560  -1.808  1.00 22.71  ? 12   U   C "O3'" 1 
ATOM   239   C  "C2'" . U   A  1 12  ? -7.885   -2.584  -2.919  1.00 22.88  ? 12   U   C "C2'" 1 
ATOM   240   O  "O2'" . U   A  1 12  ? -8.017   -3.375  -4.089  1.00 19.86  ? 12   U   C "O2'" 1 
ATOM   241   C  "C1'" . U   A  1 12  ? -9.164   -1.784  -2.698  1.00 24.10  ? 12   U   C "C1'" 1 
ATOM   242   N  N1    . U   A  1 12  ? -8.940   -0.483  -2.061  1.00 25.37  ? 12   U   C N1    1 
ATOM   243   C  C2    . U   A  1 12  ? -8.363   0.514   -2.820  1.00 27.28  ? 12   U   C C2    1 
ATOM   244   O  O2    . U   A  1 12  ? -8.016   0.340   -3.975  1.00 28.41  ? 12   U   C O2    1 
ATOM   245   N  N3    . U   A  1 12  ? -8.207   1.719   -2.176  1.00 28.16  ? 12   U   C N3    1 
ATOM   246   C  C4    . U   A  1 12  ? -8.566   2.013   -0.872  1.00 28.86  ? 12   U   C C4    1 
ATOM   247   O  O4    . U   A  1 12  ? -8.341   3.134   -0.413  1.00 27.96  ? 12   U   C O4    1 
ATOM   248   C  C5    . U   A  1 12  ? -9.152   0.920   -0.158  1.00 29.56  ? 12   U   C C5    1 
ATOM   249   C  C6    . U   A  1 12  ? -9.307   -0.264  -0.763  1.00 27.76  ? 12   U   C C6    1 
ATOM   250   P  P     . C   A  1 13  ? -5.515   -4.495  -1.386  1.00 25.24  ? 13   C   C P     1 
ATOM   251   O  OP1   . C   A  1 13  ? -4.981   -5.883  -1.555  1.00 22.88  ? 13   C   C OP1   1 
ATOM   252   O  OP2   . C   A  1 13  ? -5.418   -3.809  -0.065  1.00 23.29  ? 13   C   C OP2   1 
ATOM   253   O  "O5'" . C   A  1 13  ? -4.849   -3.538  -2.471  1.00 22.93  ? 13   C   C "O5'" 1 
ATOM   254   C  "C5'" . C   A  1 13  ? -4.763   -3.956  -3.821  1.00 26.67  ? 13   C   C "C5'" 1 
ATOM   255   C  "C4'" . C   A  1 13  ? -4.259   -2.834  -4.677  1.00 26.71  ? 13   C   C "C4'" 1 
ATOM   256   O  "O4'" . C   A  1 13  ? -5.159   -1.723  -4.511  1.00 27.50  ? 13   C   C "O4'" 1 
ATOM   257   C  "C3'" . C   A  1 13  ? -2.905   -2.282  -4.283  1.00 28.59  ? 13   C   C "C3'" 1 
ATOM   258   O  "O3'" . C   A  1 13  ? -1.876   -3.026  -4.922  1.00 30.35  ? 13   C   C "O3'" 1 
ATOM   259   C  "C2'" . C   A  1 13  ? -2.967   -0.854  -4.812  1.00 28.39  ? 13   C   C "C2'" 1 
ATOM   260   O  "O2'" . C   A  1 13  ? -2.706   -0.757  -6.195  1.00 31.61  ? 13   C   C "O2'" 1 
ATOM   261   C  "C1'" . C   A  1 13  ? -4.433   -0.511  -4.570  1.00 26.38  ? 13   C   C "C1'" 1 
ATOM   262   N  N1    . C   A  1 13  ? -4.657   0.197   -3.322  1.00 21.67  ? 13   C   C N1    1 
ATOM   263   C  C2    . C   A  1 13  ? -4.540   1.570   -3.311  1.00 19.76  ? 13   C   C C2    1 
ATOM   264   O  O2    . C   A  1 13  ? -4.198   2.139   -4.354  1.00 15.70  ? 13   C   C O2    1 
ATOM   265   N  N3    . C   A  1 13  ? -4.795   2.246   -2.170  1.00 21.54  ? 13   C   C N3    1 
ATOM   266   C  C4    . C   A  1 13  ? -5.146   1.576   -1.064  1.00 22.46  ? 13   C   C C4    1 
ATOM   267   N  N4    . C   A  1 13  ? -5.403   2.271   0.050   1.00 21.85  ? 13   C   C N4    1 
ATOM   268   C  C5    . C   A  1 13  ? -5.249   0.161   -1.050  1.00 23.64  ? 13   C   C C5    1 
ATOM   269   C  C6    . C   A  1 13  ? -4.995   -0.483  -2.190  1.00 22.69  ? 13   C   C C6    1 
ATOM   270   P  P     . C   A  1 14  ? -0.677   -3.631  -4.042  1.00 32.78  ? 14   C   C P     1 
ATOM   271   O  OP1   . C   A  1 14  ? -0.134   -4.797  -4.792  1.00 31.60  ? 14   C   C OP1   1 
ATOM   272   O  OP2   . C   A  1 14  ? -1.175   -3.799  -2.640  1.00 31.94  ? 14   C   C OP2   1 
ATOM   273   O  "O5'" . C   A  1 14  ? 0.425    -2.495  -4.041  1.00 28.17  ? 14   C   C "O5'" 1 
ATOM   274   C  "C5'" . C   A  1 14  ? 0.992    -2.085  -5.253  1.00 29.45  ? 14   C   C "C5'" 1 
ATOM   275   C  "C4'" . C   A  1 14  ? 1.158    -0.608  -5.240  1.00 32.54  ? 14   C   C "C4'" 1 
ATOM   276   O  "O4'" . C   A  1 14  ? -0.072   -0.014  -4.752  1.00 33.54  ? 14   C   C "O4'" 1 
ATOM   277   C  "C3'" . C   A  1 14  ? 2.168    -0.074  -4.249  1.00 33.81  ? 14   C   C "C3'" 1 
ATOM   278   O  "O3'" . C   A  1 14  ? 3.491    -0.329  -4.704  1.00 32.62  ? 14   C   C "O3'" 1 
ATOM   279   C  "C2'" . C   A  1 14  ? 1.746    1.389   -4.169  1.00 36.08  ? 14   C   C "C2'" 1 
ATOM   280   O  "O2'" . C   A  1 14  ? 2.093    2.134   -5.322  1.00 39.88  ? 14   C   C "O2'" 1 
ATOM   281   C  "C1'" . C   A  1 14  ? 0.226    1.247   -4.177  1.00 34.44  ? 14   C   C "C1'" 1 
ATOM   282   N  N1    . C   A  1 14  ? -0.350   1.309   -2.837  1.00 32.97  ? 14   C   C N1    1 
ATOM   283   C  C2    . C   A  1 14  ? -0.573   2.564   -2.282  1.00 33.65  ? 14   C   C C2    1 
ATOM   284   O  O2    . C   A  1 14  ? -0.174   3.566   -2.910  1.00 32.97  ? 14   C   C O2    1 
ATOM   285   N  N3    . C   A  1 14  ? -1.196   2.658   -1.076  1.00 33.23  ? 14   C   C N3    1 
ATOM   286   C  C4    . C   A  1 14  ? -1.544   1.544   -0.423  1.00 32.41  ? 14   C   C C4    1 
ATOM   287   N  N4    . C   A  1 14  ? -2.162   1.669   0.752   1.00 31.59  ? 14   C   C N4    1 
ATOM   288   C  C5    . C   A  1 14  ? -1.273   0.248   -0.949  1.00 32.94  ? 14   C   C C5    1 
ATOM   289   C  C6    . C   A  1 14  ? -0.682   0.177   -2.151  1.00 32.81  ? 14   C   C C6    1 
ATOM   290   O  "O5'" . DG  B  2 1   ? 0.774    11.764  -2.490  1.00 58.84  ? 15   DG  D "O5'" 1 
ATOM   291   C  "C5'" . DG  B  2 1   ? 0.002    12.768  -1.800  1.00 58.39  ? 15   DG  D "C5'" 1 
ATOM   292   C  "C4'" . DG  B  2 1   ? -1.387   12.408  -1.321  1.00 55.82  ? 15   DG  D "C4'" 1 
ATOM   293   O  "O4'" . DG  B  2 1   ? -1.403   11.014  -0.917  1.00 54.98  ? 15   DG  D "O4'" 1 
ATOM   294   C  "C3'" . DG  B  2 1   ? -1.892   13.159  -0.082  1.00 55.18  ? 15   DG  D "C3'" 1 
ATOM   295   O  "O3'" . DG  B  2 1   ? -2.695   14.308  -0.348  1.00 56.89  ? 15   DG  D "O3'" 1 
ATOM   296   C  "C2'" . DG  B  2 1   ? -2.610   12.110  0.759   1.00 51.41  ? 15   DG  D "C2'" 1 
ATOM   297   C  "C1'" . DG  B  2 1   ? -2.522   10.850  -0.075  1.00 51.96  ? 15   DG  D "C1'" 1 
ATOM   298   N  N9    . DG  B  2 1   ? -2.398   9.612   0.693   1.00 48.60  ? 15   DG  D N9    1 
ATOM   299   C  C8    . DG  B  2 1   ? -2.701   9.480   2.018   1.00 48.79  ? 15   DG  D C8    1 
ATOM   300   N  N7    . DG  B  2 1   ? -2.698   8.243   2.425   1.00 47.41  ? 15   DG  D N7    1 
ATOM   301   C  C5    . DG  B  2 1   ? -2.332   7.514   1.311   1.00 45.34  ? 15   DG  D C5    1 
ATOM   302   C  C6    . DG  B  2 1   ? -2.198   6.127   1.150   1.00 45.24  ? 15   DG  D C6    1 
ATOM   303   O  O6    . DG  B  2 1   ? -2.422   5.241   1.975   1.00 46.81  ? 15   DG  D O6    1 
ATOM   304   N  N1    . DG  B  2 1   ? -1.775   5.797   -0.130  1.00 42.95  ? 15   DG  D N1    1 
ATOM   305   C  C2    . DG  B  2 1   ? -1.525   6.702   -1.131  1.00 42.77  ? 15   DG  D C2    1 
ATOM   306   N  N2    . DG  B  2 1   ? -1.106   6.200   -2.297  1.00 41.30  ? 15   DG  D N2    1 
ATOM   307   N  N3    . DG  B  2 1   ? -1.672   8.010   -0.997  1.00 44.23  ? 15   DG  D N3    1 
ATOM   308   C  C4    . DG  B  2 1   ? -2.081   8.345   0.243   1.00 46.04  ? 15   DG  D C4    1 
ATOM   309   P  P     . DG  B  2 2   ? -3.714   14.319  -1.570  1.00 57.71  ? 16   DG  D P     1 
ATOM   310   O  OP1   . DG  B  2 2   ? -2.912   14.370  -2.840  1.00 54.13  ? 16   DG  D OP1   1 
ATOM   311   O  OP2   . DG  B  2 2   ? -4.706   15.382  -1.265  1.00 56.10  ? 16   DG  D OP2   1 
ATOM   312   O  "O5'" . DG  B  2 2   ? -4.457   12.923  -1.470  1.00 55.00  ? 16   DG  D "O5'" 1 
ATOM   313   C  "C5'" . DG  B  2 2   ? -5.154   12.424  -2.600  1.00 53.27  ? 16   DG  D "C5'" 1 
ATOM   314   C  "C4'" . DG  B  2 2   ? -4.185   12.145  -3.730  1.00 48.89  ? 16   DG  D "C4'" 1 
ATOM   315   O  "O4'" . DG  B  2 2   ? -3.337   11.036  -3.367  1.00 45.38  ? 16   DG  D "O4'" 1 
ATOM   316   C  "C3'" . DG  B  2 2   ? -4.902   11.718  -5.004  1.00 48.60  ? 16   DG  D "C3'" 1 
ATOM   317   O  "O3'" . DG  B  2 2   ? -4.349   12.250  -6.189  1.00 48.28  ? 16   DG  D "O3'" 1 
ATOM   318   C  "C2'" . DG  B  2 2   ? -4.802   10.211  -5.044  1.00 46.14  ? 16   DG  D "C2'" 1 
ATOM   319   C  "C1'" . DG  B  2 2   ? -3.731   9.847   -4.049  1.00 42.50  ? 16   DG  D "C1'" 1 
ATOM   320   N  N9    . DG  B  2 2   ? -4.316   8.940   -3.069  1.00 38.80  ? 16   DG  D N9    1 
ATOM   321   C  C8    . DG  B  2 2   ? -4.951   9.270   -1.893  1.00 37.38  ? 16   DG  D C8    1 
ATOM   322   N  N7    . DG  B  2 2   ? -5.350   8.227   -1.221  1.00 36.70  ? 16   DG  D N7    1 
ATOM   323   C  C5    . DG  B  2 2   ? -4.954   7.149   -2.001  1.00 35.07  ? 16   DG  D C5    1 
ATOM   324   C  C6    . DG  B  2 2   ? -5.070   5.767   -1.771  1.00 33.62  ? 16   DG  D C6    1 
ATOM   325   O  O6    . DG  B  2 2   ? -5.520   5.196   -0.784  1.00 35.61  ? 16   DG  D O6    1 
ATOM   326   N  N1    . DG  B  2 2   ? -4.563   5.025   -2.827  1.00 30.88  ? 16   DG  D N1    1 
ATOM   327   C  C2    . DG  B  2 2   ? -3.985   5.549   -3.944  1.00 31.69  ? 16   DG  D C2    1 
ATOM   328   N  N2    . DG  B  2 2   ? -3.554   4.670   -4.843  1.00 32.41  ? 16   DG  D N2    1 
ATOM   329   N  N3    . DG  B  2 2   ? -3.837   6.841   -4.161  1.00 33.62  ? 16   DG  D N3    1 
ATOM   330   C  C4    . DG  B  2 2   ? -4.341   7.577   -3.154  1.00 35.81  ? 16   DG  D C4    1 
ATOM   331   P  P     . DA  B  2 3   ? -5.242   12.209  -7.511  1.00 47.14  ? 17   DA  D P     1 
ATOM   332   O  OP1   . DA  B  2 3   ? -5.017   13.458  -8.294  1.00 47.13  ? 17   DA  D OP1   1 
ATOM   333   O  OP2   . DA  B  2 3   ? -6.624   11.857  -7.065  1.00 43.83  ? 17   DA  D OP2   1 
ATOM   334   O  "O5'" . DA  B  2 3   ? -4.702   10.950  -8.314  1.00 44.56  ? 17   DA  D "O5'" 1 
ATOM   335   C  "C5'" . DA  B  2 3   ? -5.495   10.451  -9.371  1.00 43.91  ? 17   DA  D "C5'" 1 
ATOM   336   C  "C4'" . DA  B  2 3   ? -5.579   8.942   -9.361  1.00 41.30  ? 17   DA  D "C4'" 1 
ATOM   337   O  "O4'" . DA  B  2 3   ? -5.514   8.325   -8.049  1.00 39.14  ? 17   DA  D "O4'" 1 
ATOM   338   C  "C3'" . DA  B  2 3   ? -6.912   8.510   -9.962  1.00 40.06  ? 17   DA  D "C3'" 1 
ATOM   339   O  "O3'" . DA  B  2 3   ? -6.747   7.791   -11.161 1.00 40.91  ? 17   DA  D "O3'" 1 
ATOM   340   C  "C2'" . DA  B  2 3   ? -7.575   7.656   -8.898  1.00 37.70  ? 17   DA  D "C2'" 1 
ATOM   341   C  "C1'" . DA  B  2 3   ? -6.427   7.237   -8.015  1.00 34.78  ? 17   DA  D "C1'" 1 
ATOM   342   N  N9    . DA  B  2 3   ? -6.850   7.025   -6.632  1.00 31.39  ? 17   DA  D N9    1 
ATOM   343   C  C8    . DA  B  2 3   ? -7.068   7.974   -5.672  1.00 30.91  ? 17   DA  D C8    1 
ATOM   344   N  N7    . DA  B  2 3   ? -7.459   7.486   -4.517  1.00 27.43  ? 17   DA  D N7    1 
ATOM   345   C  C5    . DA  B  2 3   ? -7.500   6.122   -4.734  1.00 27.28  ? 17   DA  D C5    1 
ATOM   346   C  C6    . DA  B  2 3   ? -7.841   5.053   -3.902  1.00 26.20  ? 17   DA  D C6    1 
ATOM   347   N  N6    . DA  B  2 3   ? -8.225   5.203   -2.641  1.00 27.23  ? 17   DA  D N6    1 
ATOM   348   N  N1    . DA  B  2 3   ? -7.779   3.809   -4.415  1.00 24.95  ? 17   DA  D N1    1 
ATOM   349   C  C2    . DA  B  2 3   ? -7.397   3.666   -5.691  1.00 28.33  ? 17   DA  D C2    1 
ATOM   350   N  N3    . DA  B  2 3   ? -7.049   4.599   -6.580  1.00 29.15  ? 17   DA  D N3    1 
ATOM   351   C  C4    . DA  B  2 3   ? -7.125   5.821   -6.031  1.00 29.23  ? 17   DA  D C4    1 
ATOM   352   P  P     . DA  B  2 4   ? -7.869   7.934   -12.288 1.00 41.88  ? 18   DA  D P     1 
ATOM   353   O  OP1   . DA  B  2 4   ? -7.197   8.105   -13.610 1.00 44.76  ? 18   DA  D OP1   1 
ATOM   354   O  OP2   . DA  B  2 4   ? -8.874   8.949   -11.832 1.00 36.49  ? 18   DA  D OP2   1 
ATOM   355   O  "O5'" . DA  B  2 4   ? -8.599   6.539   -12.180 1.00 35.97  ? 18   DA  D "O5'" 1 
ATOM   356   C  "C5'" . DA  B  2 4   ? -9.682   6.434   -11.295 1.00 31.89  ? 18   DA  D "C5'" 1 
ATOM   357   C  "C4'" . DA  B  2 4   ? -9.850   5.012   -10.854 1.00 29.28  ? 18   DA  D "C4'" 1 
ATOM   358   O  "O4'" . DA  B  2 4   ? -9.394   4.946   -9.487  1.00 27.52  ? 18   DA  D "O4'" 1 
ATOM   359   C  "C3'" . DA  B  2 4   ? -11.335  4.689   -10.822 1.00 31.94  ? 18   DA  D "C3'" 1 
ATOM   360   O  "O3'" . DA  B  2 4   ? -11.656  3.645   -11.702 1.00 34.81  ? 18   DA  D "O3'" 1 
ATOM   361   C  "C2'" . DA  B  2 4   ? -11.678  4.377   -9.378  1.00 28.91  ? 18   DA  D "C2'" 1 
ATOM   362   C  "C1'" . DA  B  2 4   ? -10.348  4.273   -8.672  1.00 23.96  ? 18   DA  D "C1'" 1 
ATOM   363   N  N9    . DA  B  2 4   ? -10.432  4.947   -7.378  1.00 14.50  ? 18   DA  D N9    1 
ATOM   364   C  C8    . DA  B  2 4   ? -10.460  6.278   -7.118  1.00 11.06  ? 18   DA  D C8    1 
ATOM   365   N  N7    . DA  B  2 4   ? -10.683  6.565   -5.861  1.00 10.53  ? 18   DA  D N7    1 
ATOM   366   C  C5    . DA  B  2 4   ? -10.783  5.329   -5.250  1.00 8.85   ? 18   DA  D C5    1 
ATOM   367   C  C6    . DA  B  2 4   ? -11.037  4.942   -3.924  1.00 7.03   ? 18   DA  D C6    1 
ATOM   368   N  N6    . DA  B  2 4   ? -11.284  5.792   -2.941  1.00 5.90   ? 18   DA  D N6    1 
ATOM   369   N  N1    . DA  B  2 4   ? -11.037  3.628   -3.642  1.00 8.44   ? 18   DA  D N1    1 
ATOM   370   C  C2    . DA  B  2 4   ? -10.804  2.763   -4.636  1.00 11.96  ? 18   DA  D C2    1 
ATOM   371   N  N3    . DA  B  2 4   ? -10.572  3.004   -5.927  1.00 12.16  ? 18   DA  D N3    1 
ATOM   372   C  C4    . DA  B  2 4   ? -10.584  4.325   -6.167  1.00 11.73  ? 18   DA  D C4    1 
ATOM   373   P  P     . DT  B  2 5   ? -12.837  3.880   -12.741 1.00 35.77  ? 19   DT  D P     1 
ATOM   374   O  OP1   . DT  B  2 5   ? -12.768  2.734   -13.684 1.00 37.02  ? 19   DT  D OP1   1 
ATOM   375   O  OP2   . DT  B  2 5   ? -12.764  5.271   -13.249 1.00 31.87  ? 19   DT  D OP2   1 
ATOM   376   O  "O5'" . DT  B  2 5   ? -14.134  3.807   -11.826 1.00 33.15  ? 19   DT  D "O5'" 1 
ATOM   377   C  "C5'" . DT  B  2 5   ? -14.433  4.855   -10.907 1.00 32.79  ? 19   DT  D "C5'" 1 
ATOM   378   C  "C4'" . DT  B  2 5   ? -15.579  4.439   -10.020 1.00 35.17  ? 19   DT  D "C4'" 1 
ATOM   379   O  "O4'" . DT  B  2 5   ? -15.059  4.199   -8.691  1.00 36.41  ? 19   DT  D "O4'" 1 
ATOM   380   C  "C3'" . DT  B  2 5   ? -16.674  5.492   -9.880  1.00 36.28  ? 19   DT  D "C3'" 1 
ATOM   381   O  "O3'" . DT  B  2 5   ? -17.918  5.029   -10.363 1.00 37.41  ? 19   DT  D "O3'" 1 
ATOM   382   C  "C2'" . DT  B  2 5   ? -16.809  5.745   -8.390  1.00 37.21  ? 19   DT  D "C2'" 1 
ATOM   383   C  "C1'" . DT  B  2 5   ? -15.910  4.739   -7.693  1.00 36.29  ? 19   DT  D "C1'" 1 
ATOM   384   N  N1    . DT  B  2 5   ? -15.070  5.459   -6.705  1.00 35.75  ? 19   DT  D N1    1 
ATOM   385   C  C2    . DT  B  2 5   ? -15.047  5.075   -5.383  1.00 35.77  ? 19   DT  D C2    1 
ATOM   386   O  O2    . DT  B  2 5   ? -15.519  4.029   -4.974  1.00 39.04  ? 19   DT  D O2    1 
ATOM   387   N  N3    . DT  B  2 5   ? -14.420  5.964   -4.550  1.00 34.89  ? 19   DT  D N3    1 
ATOM   388   C  C4    . DT  B  2 5   ? -13.781  7.130   -4.904  1.00 34.53  ? 19   DT  D C4    1 
ATOM   389   O  O4    . DT  B  2 5   ? -13.324  7.869   -4.037  1.00 36.31  ? 19   DT  D O4    1 
ATOM   390   C  C5    . DT  B  2 5   ? -13.727  7.392   -6.313  1.00 34.55  ? 19   DT  D C5    1 
ATOM   391   C  C7    . DT  B  2 5   ? -12.938  8.564   -6.803  1.00 35.36  ? 19   DT  D C7    1 
ATOM   392   C  C6    . DT  B  2 5   ? -14.375  6.562   -7.130  1.00 34.79  ? 19   DT  D C6    1 
ATOM   393   P  P     . DC  B  2 6   ? -19.175  6.022   -10.349 1.00 36.61  ? 20   DC  D P     1 
ATOM   394   O  OP1   . DC  B  2 6   ? -19.912  5.697   -11.586 1.00 36.02  ? 20   DC  D OP1   1 
ATOM   395   O  OP2   . DC  B  2 6   ? -18.711  7.409   -10.120 1.00 33.26  ? 20   DC  D OP2   1 
ATOM   396   O  "O5'" . DC  B  2 6   ? -19.989  5.524   -9.074  1.00 32.27  ? 20   DC  D "O5'" 1 
ATOM   397   C  "C5'" . DC  B  2 6   ? -20.358  4.161   -8.960  1.00 30.65  ? 20   DC  D "C5'" 1 
ATOM   398   C  "C4'" . DC  B  2 6   ? -20.907  3.877   -7.583  1.00 32.42  ? 20   DC  D "C4'" 1 
ATOM   399   O  "O4'" . DC  B  2 6   ? -19.805  3.912   -6.644  1.00 33.04  ? 20   DC  D "O4'" 1 
ATOM   400   C  "C3'" . DC  B  2 6   ? -21.921  4.906   -7.087  1.00 33.55  ? 20   DC  D "C3'" 1 
ATOM   401   O  "O3'" . DC  B  2 6   ? -23.233  4.408   -6.944  1.00 33.77  ? 20   DC  D "O3'" 1 
ATOM   402   C  "C2'" . DC  B  2 6   ? -21.468  5.270   -5.686  1.00 33.03  ? 20   DC  D "C2'" 1 
ATOM   403   C  "C1'" . DC  B  2 6   ? -20.213  4.469   -5.405  1.00 30.87  ? 20   DC  D "C1'" 1 
ATOM   404   N  N1    . DC  B  2 6   ? -19.207  5.457   -4.988  1.00 28.53  ? 20   DC  D N1    1 
ATOM   405   C  C2    . DC  B  2 6   ? -18.820  5.526   -3.639  1.00 24.81  ? 20   DC  D C2    1 
ATOM   406   O  O2    . DC  B  2 6   ? -19.145  4.612   -2.873  1.00 21.46  ? 20   DC  D O2    1 
ATOM   407   N  N3    . DC  B  2 6   ? -18.083  6.580   -3.222  1.00 23.55  ? 20   DC  D N3    1 
ATOM   408   C  C4    . DC  B  2 6   ? -17.675  7.498   -4.104  1.00 23.82  ? 20   DC  D C4    1 
ATOM   409   N  N4    . DC  B  2 6   ? -16.981  8.541   -3.650  1.00 23.16  ? 20   DC  D N4    1 
ATOM   410   C  C5    . DC  B  2 6   ? -17.966  7.389   -5.495  1.00 24.99  ? 20   DC  D C5    1 
ATOM   411   C  C6    . DC  B  2 6   ? -18.721  6.361   -5.891  1.00 25.86  ? 20   DC  D C6    1 
ATOM   412   P  P     . DA  B  2 7   ? -24.416  5.445   -6.653  1.00 32.76  ? 21   DA  D P     1 
ATOM   413   O  OP1   . DA  B  2 7   ? -25.590  4.909   -7.388  1.00 35.13  ? 21   DA  D OP1   1 
ATOM   414   O  OP2   . DA  B  2 7   ? -23.914  6.804   -6.967  1.00 29.81  ? 21   DA  D OP2   1 
ATOM   415   O  "O5'" . DA  B  2 7   ? -24.650  5.345   -5.081  1.00 29.54  ? 21   DA  D "O5'" 1 
ATOM   416   C  "C5'" . DA  B  2 7   ? -24.841  4.084   -4.448  1.00 35.06  ? 21   DA  D "C5'" 1 
ATOM   417   C  "C4'" . DA  B  2 7   ? -25.114  4.286   -2.977  1.00 37.37  ? 21   DA  D "C4'" 1 
ATOM   418   O  "O4'" . DA  B  2 7   ? -23.878  4.687   -2.323  1.00 37.88  ? 21   DA  D "O4'" 1 
ATOM   419   C  "C3'" . DA  B  2 7   ? -26.120  5.410   -2.749  1.00 38.99  ? 21   DA  D "C3'" 1 
ATOM   420   O  "O3'" . DA  B  2 7   ? -27.271  5.021   -2.020  1.00 40.12  ? 21   DA  D "O3'" 1 
ATOM   421   C  "C2'" . DA  B  2 7   ? -25.373  6.487   -1.985  1.00 39.02  ? 21   DA  D "C2'" 1 
ATOM   422   C  "C1'" . DA  B  2 7   ? -24.032  5.893   -1.587  1.00 35.83  ? 21   DA  D "C1'" 1 
ATOM   423   N  N9    . DA  B  2 7   ? -22.982  6.816   -2.014  1.00 31.45  ? 21   DA  D N9    1 
ATOM   424   C  C8    . DA  B  2 7   ? -22.687  7.155   -3.310  1.00 31.20  ? 21   DA  D C8    1 
ATOM   425   N  N7    . DA  B  2 7   ? -21.768  8.085   -3.422  1.00 28.93  ? 21   DA  D N7    1 
ATOM   426   C  C5    . DA  B  2 7   ? -21.419  8.362   -2.110  1.00 27.63  ? 21   DA  D C5    1 
ATOM   427   C  C6    . DA  B  2 7   ? -20.509  9.274   -1.550  1.00 26.48  ? 21   DA  D C6    1 
ATOM   428   N  N6    . DA  B  2 7   ? -19.766  10.112  -2.277  1.00 25.58  ? 21   DA  D N6    1 
ATOM   429   N  N1    . DA  B  2 7   ? -20.394  9.302   -0.205  1.00 23.48  ? 21   DA  D N1    1 
ATOM   430   C  C2    . DA  B  2 7   ? -21.152  8.468   0.516   1.00 25.59  ? 21   DA  D C2    1 
ATOM   431   N  N3    . DA  B  2 7   ? -22.052  7.568   0.105   1.00 27.28  ? 21   DA  D N3    1 
ATOM   432   C  C4    . DA  B  2 7   ? -22.141  7.568   -1.233  1.00 28.29  ? 21   DA  D C4    1 
ATOM   433   P  P     . DG  B  2 8   ? -28.512  6.036   -1.955  1.00 42.59  ? 22   DG  D P     1 
ATOM   434   O  OP1   . DG  B  2 8   ? -29.667  5.223   -1.487  1.00 41.96  ? 22   DG  D OP1   1 
ATOM   435   O  OP2   . DG  B  2 8   ? -28.615  6.813   -3.224  1.00 38.81  ? 22   DG  D OP2   1 
ATOM   436   O  "O5'" . DG  B  2 8   ? -28.070  7.080   -0.841  1.00 39.27  ? 22   DG  D "O5'" 1 
ATOM   437   C  "C5'" . DG  B  2 8   ? -27.811  6.650   0.484   1.00 40.47  ? 22   DG  D "C5'" 1 
ATOM   438   C  "C4'" . DG  B  2 8   ? -27.379  7.825   1.325   1.00 40.82  ? 22   DG  D "C4'" 1 
ATOM   439   O  "O4'" . DG  B  2 8   ? -26.042  8.208   0.912   1.00 41.13  ? 22   DG  D "O4'" 1 
ATOM   440   C  "C3'" . DG  B  2 8   ? -28.262  9.063   1.153   1.00 41.22  ? 22   DG  D "C3'" 1 
ATOM   441   O  "O3'" . DG  B  2 8   ? -28.849  9.488   2.384   1.00 41.00  ? 22   DG  D "O3'" 1 
ATOM   442   C  "C2'" . DG  B  2 8   ? -27.327  10.138  0.615   1.00 40.66  ? 22   DG  D "C2'" 1 
ATOM   443   C  "C1'" . DG  B  2 8   ? -25.924  9.616   0.895   1.00 37.80  ? 22   DG  D "C1'" 1 
ATOM   444   N  N9    . DG  B  2 8   ? -25.000  9.973   -0.175  1.00 32.45  ? 22   DG  D N9    1 
ATOM   445   C  C8    . DG  B  2 8   ? -25.018  9.505   -1.465  1.00 31.84  ? 22   DG  D C8    1 
ATOM   446   N  N7    . DG  B  2 8   ? -24.147  10.094  -2.238  1.00 28.98  ? 22   DG  D N7    1 
ATOM   447   C  C5    . DG  B  2 8   ? -23.503  10.992  -1.400  1.00 28.76  ? 22   DG  D C5    1 
ATOM   448   C  C6    . DG  B  2 8   ? -22.475  11.930  -1.676  1.00 27.68  ? 22   DG  D C6    1 
ATOM   449   O  O6    . DG  B  2 8   ? -21.945  12.192  -2.758  1.00 27.97  ? 22   DG  D O6    1 
ATOM   450   N  N1    . DG  B  2 8   ? -22.079  12.607  -0.529  1.00 25.43  ? 22   DG  D N1    1 
ATOM   451   C  C2    . DG  B  2 8   ? -22.609  12.411  0.720   1.00 25.95  ? 22   DG  D C2    1 
ATOM   452   N  N2    . DG  B  2 8   ? -22.066  13.120  1.696   1.00 24.05  ? 22   DG  D N2    1 
ATOM   453   N  N3    . DG  B  2 8   ? -23.594  11.568  0.988   1.00 28.12  ? 22   DG  D N3    1 
ATOM   454   C  C4    . DG  B  2 8   ? -23.989  10.895  -0.112  1.00 29.71  ? 22   DG  D C4    1 
ATOM   455   P  P     . DG  B  2 9   ? -30.070  10.545  2.353   1.00 43.13  ? 23   DG  D P     1 
ATOM   456   O  OP1   . DG  B  2 9   ? -30.852  10.299  3.593   1.00 40.31  ? 23   DG  D OP1   1 
ATOM   457   O  OP2   . DG  B  2 9   ? -30.767  10.497  1.031   1.00 39.39  ? 23   DG  D OP2   1 
ATOM   458   O  "O5'" . DG  B  2 9   ? -29.323  11.956  2.467   1.00 39.51  ? 23   DG  D "O5'" 1 
ATOM   459   C  "C5'" . DG  B  2 9   ? -28.495  12.240  3.591   1.00 37.79  ? 23   DG  D "C5'" 1 
ATOM   460   C  "C4'" . DG  B  2 9   ? -27.840  13.599  3.465   1.00 36.33  ? 23   DG  D "C4'" 1 
ATOM   461   O  "O4'" . DG  B  2 9   ? -26.612  13.505  2.694   1.00 34.45  ? 23   DG  D "O4'" 1 
ATOM   462   C  "C3'" . DG  B  2 9   ? -28.658  14.739  2.838   1.00 35.99  ? 23   DG  D "C3'" 1 
ATOM   463   O  "O3'" . DG  B  2 9   ? -28.899  15.829  3.727   1.00 36.75  ? 23   DG  D "O3'" 1 
ATOM   464   C  "C2'" . DG  B  2 9   ? -27.729  15.317  1.789   1.00 34.85  ? 23   DG  D "C2'" 1 
ATOM   465   C  "C1'" . DG  B  2 9   ? -26.360  14.776  2.143   1.00 31.14  ? 23   DG  D "C1'" 1 
ATOM   466   N  N9    . DG  B  2 9   ? -25.593  14.628  0.915   1.00 28.24  ? 23   DG  D N9    1 
ATOM   467   C  C8    . DG  B  2 9   ? -25.771  13.712  -0.097  1.00 27.60  ? 23   DG  D C8    1 
ATOM   468   N  N7    . DG  B  2 9   ? -25.069  13.990  -1.162  1.00 25.62  ? 23   DG  D N7    1 
ATOM   469   C  C5    . DG  B  2 9   ? -24.353  15.128  -0.807  1.00 26.23  ? 23   DG  D C5    1 
ATOM   470   C  C6    . DG  B  2 9   ? -23.450  15.936  -1.561  1.00 25.65  ? 23   DG  D C6    1 
ATOM   471   O  O6    . DG  B  2 9   ? -23.115  15.826  -2.740  1.00 26.37  ? 23   DG  D O6    1 
ATOM   472   N  N1    . DG  B  2 9   ? -22.944  16.981  -0.802  1.00 25.72  ? 23   DG  D N1    1 
ATOM   473   C  C2    . DG  B  2 9   ? -23.272  17.235  0.507   1.00 28.33  ? 23   DG  D C2    1 
ATOM   474   N  N2    . DG  B  2 9   ? -22.681  18.288  1.078   1.00 29.81  ? 23   DG  D N2    1 
ATOM   475   N  N3    . DG  B  2 9   ? -24.123  16.510  1.210   1.00 28.75  ? 23   DG  D N3    1 
ATOM   476   C  C4    . DG  B  2 9   ? -24.624  15.487  0.494   1.00 27.17  ? 23   DG  D C4    1 
ATOM   477   P  P     . DT  B  2 10  ? -29.922  17.003  3.286   1.00 37.61  ? 24   DT  D P     1 
ATOM   478   O  OP1   . DT  B  2 10  ? -30.901  17.144  4.396   1.00 37.53  ? 24   DT  D OP1   1 
ATOM   479   O  OP2   . DT  B  2 10  ? -30.419  16.814  1.899   1.00 35.39  ? 24   DT  D OP2   1 
ATOM   480   O  "O5'" . DT  B  2 10  ? -29.022  18.309  3.272   1.00 33.04  ? 24   DT  D "O5'" 1 
ATOM   481   C  "C5'" . DT  B  2 10  ? -28.328  18.689  4.435   1.00 31.17  ? 24   DT  D "C5'" 1 
ATOM   482   C  "C4'" . DT  B  2 10  ? -27.198  19.614  4.078   1.00 30.12  ? 24   DT  D "C4'" 1 
ATOM   483   O  "O4'" . DT  B  2 10  ? -26.456  19.027  2.985   1.00 32.20  ? 24   DT  D "O4'" 1 
ATOM   484   C  "C3'" . DT  B  2 10  ? -27.630  20.998  3.611   1.00 28.54  ? 24   DT  D "C3'" 1 
ATOM   485   O  "O3'" . DT  B  2 10  ? -26.876  21.968  4.298   1.00 29.44  ? 24   DT  D "O3'" 1 
ATOM   486   C  "C2'" . DT  B  2 10  ? -27.250  21.057  2.144   1.00 30.31  ? 24   DT  D "C2'" 1 
ATOM   487   C  "C1'" . DT  B  2 10  ? -26.148  20.020  2.030   1.00 29.90  ? 24   DT  D "C1'" 1 
ATOM   488   N  N1    . DT  B  2 10  ? -26.063  19.370  0.714   1.00 27.98  ? 24   DT  D N1    1 
ATOM   489   C  C2    . DT  B  2 10  ? -25.187  19.907  -0.177  1.00 26.73  ? 24   DT  D C2    1 
ATOM   490   O  O2    . DT  B  2 10  ? -24.446  20.819  0.108   1.00 28.96  ? 24   DT  D O2    1 
ATOM   491   N  N3    . DT  B  2 10  ? -25.198  19.330  -1.410  1.00 27.46  ? 24   DT  D N3    1 
ATOM   492   C  C4    . DT  B  2 10  ? -25.959  18.260  -1.817  1.00 28.21  ? 24   DT  D C4    1 
ATOM   493   O  O4    . DT  B  2 10  ? -25.877  17.851  -2.972  1.00 31.78  ? 24   DT  D O4    1 
ATOM   494   C  C5    . DT  B  2 10  ? -26.813  17.698  -0.812  1.00 26.25  ? 24   DT  D C5    1 
ATOM   495   C  C7    . DT  B  2 10  ? -27.602  16.479  -1.152  1.00 23.66  ? 24   DT  D C7    1 
ATOM   496   C  C6    . DT  B  2 10  ? -26.842  18.283  0.388   1.00 26.86  ? 24   DT  D C6    1 
ATOM   497   P  P     . DG  B  2 11  ? -27.348  23.489  4.248   1.00 33.35  ? 25   DG  D P     1 
ATOM   498   O  OP1   . DG  B  2 11  ? -26.791  24.121  5.474   1.00 31.01  ? 25   DG  D OP1   1 
ATOM   499   O  OP2   . DG  B  2 11  ? -28.815  23.523  3.993   1.00 30.92  ? 25   DG  D OP2   1 
ATOM   500   O  "O5'" . DG  B  2 11  ? -26.601  24.064  2.968   1.00 30.85  ? 25   DG  D "O5'" 1 
ATOM   501   C  "C5'" . DG  B  2 11  ? -25.188  24.139  2.964   1.00 30.50  ? 25   DG  D "C5'" 1 
ATOM   502   C  "C4'" . DG  B  2 11  ? -24.708  25.039  1.852   1.00 29.69  ? 25   DG  D "C4'" 1 
ATOM   503   O  "O4'" . DG  B  2 11  ? -24.587  24.293  0.618   1.00 29.62  ? 25   DG  D "O4'" 1 
ATOM   504   C  "C3'" . DG  B  2 11  ? -25.571  26.263  1.555   1.00 26.03  ? 25   DG  D "C3'" 1 
ATOM   505   O  "O3'" . DG  B  2 11  ? -24.738  27.417  1.408   1.00 23.98  ? 25   DG  D "O3'" 1 
ATOM   506   C  "C2'" . DG  B  2 11  ? -26.274  25.891  0.254   1.00 27.31  ? 25   DG  D "C2'" 1 
ATOM   507   C  "C1'" . DG  B  2 11  ? -25.282  24.944  -0.428  1.00 28.19  ? 25   DG  D "C1'" 1 
ATOM   508   N  N9    . DG  B  2 11  ? -25.844  23.883  -1.260  1.00 25.77  ? 25   DG  D N9    1 
ATOM   509   C  C8    . DG  B  2 11  ? -26.762  22.943  -0.870  1.00 24.85  ? 25   DG  D C8    1 
ATOM   510   N  N7    . DG  B  2 11  ? -27.049  22.084  -1.813  1.00 24.01  ? 25   DG  D N7    1 
ATOM   511   C  C5    . DG  B  2 11  ? -26.280  22.493  -2.898  1.00 23.00  ? 25   DG  D C5    1 
ATOM   512   C  C6    . DG  B  2 11  ? -26.167  21.947  -4.213  1.00 21.36  ? 25   DG  D C6    1 
ATOM   513   O  O6    . DG  B  2 11  ? -26.757  20.968  -4.694  1.00 22.64  ? 25   DG  D O6    1 
ATOM   514   N  N1    . DG  B  2 11  ? -25.264  22.662  -4.988  1.00 15.66  ? 25   DG  D N1    1 
ATOM   515   C  C2    . DG  B  2 11  ? -24.560  23.752  -4.553  1.00 18.39  ? 25   DG  D C2    1 
ATOM   516   N  N2    . DG  B  2 11  ? -23.724  24.304  -5.428  1.00 19.30  ? 25   DG  D N2    1 
ATOM   517   N  N3    . DG  B  2 11  ? -24.660  24.271  -3.341  1.00 20.90  ? 25   DG  D N3    1 
ATOM   518   C  C4    . DG  B  2 11  ? -25.532  23.600  -2.574  1.00 22.89  ? 25   DG  D C4    1 
ATOM   519   P  P     . DT  B  2 12  ? -25.410  28.867  1.303   1.00 26.48  ? 26   DT  D P     1 
ATOM   520   O  OP1   . DT  B  2 12  ? -24.351  29.910  1.270   1.00 25.37  ? 26   DT  D OP1   1 
ATOM   521   O  OP2   . DT  B  2 12  ? -26.494  28.965  2.308   1.00 25.10  ? 26   DT  D OP2   1 
ATOM   522   O  "O5'" . DT  B  2 12  ? -26.096  28.810  -0.128  1.00 28.15  ? 26   DT  D "O5'" 1 
ATOM   523   C  "C5'" . DT  B  2 12  ? -27.515  28.854  -0.269  1.00 27.89  ? 26   DT  D "C5'" 1 
ATOM   524   C  "C4'" . DT  B  2 12  ? -27.878  29.166  -1.700  1.00 27.48  ? 26   DT  D "C4'" 1 
ATOM   525   O  "O4'" . DT  B  2 12  ? -27.533  28.063  -2.577  1.00 29.88  ? 26   DT  D "O4'" 1 
ATOM   526   C  "C3'" . DT  B  2 12  ? -29.359  29.434  -1.907  1.00 28.28  ? 26   DT  D "C3'" 1 
ATOM   527   O  "O3'" . DT  B  2 12  ? -29.525  30.765  -2.337  1.00 29.78  ? 26   DT  D "O3'" 1 
ATOM   528   C  "C2'" . DT  B  2 12  ? -29.804  28.456  -2.982  1.00 29.10  ? 26   DT  D "C2'" 1 
ATOM   529   C  "C1'" . DT  B  2 12  ? -28.533  27.858  -3.558  1.00 28.06  ? 26   DT  D "C1'" 1 
ATOM   530   N  N1    . DT  B  2 12  ? -28.651  26.389  -3.804  1.00 26.63  ? 26   DT  D N1    1 
ATOM   531   C  C2    . DT  B  2 12  ? -28.030  25.821  -4.897  1.00 25.41  ? 26   DT  D C2    1 
ATOM   532   O  O2    . DT  B  2 12  ? -27.305  26.440  -5.652  1.00 31.14  ? 26   DT  D O2    1 
ATOM   533   N  N3    . DT  B  2 12  ? -28.287  24.491  -5.075  1.00 21.43  ? 26   DT  D N3    1 
ATOM   534   C  C4    . DT  B  2 12  ? -29.077  23.686  -4.291  1.00 22.69  ? 26   DT  D C4    1 
ATOM   535   O  O4    . DT  B  2 12  ? -29.253  22.518  -4.599  1.00 22.45  ? 26   DT  D O4    1 
ATOM   536   C  C5    . DT  B  2 12  ? -29.659  24.322  -3.143  1.00 24.49  ? 26   DT  D C5    1 
ATOM   537   C  C7    . DT  B  2 12  ? -30.514  23.509  -2.220  1.00 22.29  ? 26   DT  D C7    1 
ATOM   538   C  C6    . DT  B  2 12  ? -29.413  25.624  -2.955  1.00 26.23  ? 26   DT  D C6    1 
ATOM   539   P  P     . DC  B  2 13  ? -30.983  31.312  -2.693  1.00 28.42  ? 27   DC  D P     1 
ATOM   540   O  OP1   . DC  B  2 13  ? -30.922  32.712  -2.247  1.00 28.52  ? 27   DC  D OP1   1 
ATOM   541   O  OP2   . DC  B  2 13  ? -32.087  30.437  -2.225  1.00 27.06  ? 27   DC  D OP2   1 
ATOM   542   O  "O5'" . DC  B  2 13  ? -30.938  31.262  -4.269  1.00 27.98  ? 27   DC  D "O5'" 1 
ATOM   543   C  "C5'" . DC  B  2 13  ? -29.826  31.798  -4.944  1.00 30.44  ? 27   DC  D "C5'" 1 
ATOM   544   C  "C4'" . DC  B  2 13  ? -30.031  31.655  -6.424  1.00 32.41  ? 27   DC  D "C4'" 1 
ATOM   545   O  "O4'" . DC  B  2 13  ? -29.617  30.315  -6.774  1.00 32.08  ? 27   DC  D "O4'" 1 
ATOM   546   C  "C3'" . DC  B  2 13  ? -31.503  31.773  -6.803  1.00 34.44  ? 27   DC  D "C3'" 1 
ATOM   547   O  "O3'" . DC  B  2 13  ? -31.787  32.932  -7.561  1.00 36.87  ? 27   DC  D "O3'" 1 
ATOM   548   C  "C2'" . DC  B  2 13  ? -31.797  30.529  -7.624  1.00 34.71  ? 27   DC  D "C2'" 1 
ATOM   549   C  "C1'" . DC  B  2 13  ? -30.516  29.721  -7.676  1.00 31.27  ? 27   DC  D "C1'" 1 
ATOM   550   N  N1    . DC  B  2 13  ? -30.823  28.385  -7.169  1.00 31.01  ? 27   DC  D N1    1 
ATOM   551   C  C2    . DC  B  2 13  ? -30.421  27.266  -7.890  1.00 30.39  ? 27   DC  D C2    1 
ATOM   552   O  O2    . DC  B  2 13  ? -29.697  27.425  -8.876  1.00 32.93  ? 27   DC  D O2    1 
ATOM   553   N  N3    . DC  B  2 13  ? -30.825  26.042  -7.487  1.00 28.10  ? 27   DC  D N3    1 
ATOM   554   C  C4    . DC  B  2 13  ? -31.579  25.922  -6.394  1.00 29.92  ? 27   DC  D C4    1 
ATOM   555   N  N4    . DC  B  2 13  ? -31.995  24.718  -6.051  1.00 30.50  ? 27   DC  D N4    1 
ATOM   556   C  C5    . DC  B  2 13  ? -31.950  27.043  -5.606  1.00 32.05  ? 27   DC  D C5    1 
ATOM   557   C  C6    . DC  B  2 13  ? -31.550  28.245  -6.023  1.00 31.66  ? 27   DC  D C6    1 
ATOM   558   P  P     . DG  B  2 14  ? -33.234  33.101  -8.227  1.00 37.60  ? 28   DG  D P     1 
ATOM   559   O  OP1   . DG  B  2 14  ? -33.709  34.474  -7.939  1.00 40.76  ? 28   DG  D OP1   1 
ATOM   560   O  OP2   . DG  B  2 14  ? -34.092  31.949  -7.844  1.00 34.44  ? 28   DG  D OP2   1 
ATOM   561   O  "O5'" . DG  B  2 14  ? -32.873  33.001  -9.777  1.00 39.78  ? 28   DG  D "O5'" 1 
ATOM   562   C  "C5'" . DG  B  2 14  ? -33.890  32.867  -10.755 1.00 43.53  ? 28   DG  D "C5'" 1 
ATOM   563   C  "C4'" . DG  B  2 14  ? -33.407  31.996  -11.888 1.00 44.16  ? 28   DG  D "C4'" 1 
ATOM   564   O  "O4'" . DG  B  2 14  ? -32.914  30.772  -11.309 1.00 42.43  ? 28   DG  D "O4'" 1 
ATOM   565   C  "C3'" . DG  B  2 14  ? -34.526  31.615  -12.854 1.00 45.18  ? 28   DG  D "C3'" 1 
ATOM   566   O  "O3'" . DG  B  2 14  ? -34.545  32.250  -14.154 1.00 50.33  ? 28   DG  D "O3'" 1 
ATOM   567   C  "C2'" . DG  B  2 14  ? -34.695  30.112  -12.718 1.00 43.57  ? 28   DG  D "C2'" 1 
ATOM   568   C  "C1'" . DG  B  2 14  ? -33.535  29.629  -11.871 1.00 41.07  ? 28   DG  D "C1'" 1 
ATOM   569   N  N9    . DG  B  2 14  ? -33.974  28.794  -10.756 1.00 38.66  ? 28   DG  D N9    1 
ATOM   570   C  C8    . DG  B  2 14  ? -34.219  29.217  -9.471  1.00 38.35  ? 28   DG  D C8    1 
ATOM   571   N  N7    . DG  B  2 14  ? -34.571  28.250  -8.670  1.00 36.88  ? 28   DG  D N7    1 
ATOM   572   C  C5    . DG  B  2 14  ? -34.567  27.121  -9.475  1.00 34.59  ? 28   DG  D C5    1 
ATOM   573   C  C6    . DG  B  2 14  ? -34.849  25.789  -9.150  1.00 33.79  ? 28   DG  D C6    1 
ATOM   574   O  O6    . DG  B  2 14  ? -35.137  25.324  -8.047  1.00 34.23  ? 28   DG  D O6    1 
ATOM   575   N  N1    . DG  B  2 14  ? -34.746  24.956  -10.259 1.00 32.49  ? 28   DG  D N1    1 
ATOM   576   C  C2    . DG  B  2 14  ? -34.384  25.369  -11.520 1.00 33.26  ? 28   DG  D C2    1 
ATOM   577   N  N2    . DG  B  2 14  ? -34.315  24.413  -12.462 1.00 33.48  ? 28   DG  D N2    1 
ATOM   578   N  N3    . DG  B  2 14  ? -34.102  26.624  -11.832 1.00 32.33  ? 28   DG  D N3    1 
ATOM   579   C  C4    . DG  B  2 14  ? -34.213  27.439  -10.769 1.00 34.82  ? 28   DG  D C4    1 
ATOM   580   O  "O5'" . C   C  1 1   ? -38.648  27.947  -9.169  1.00 33.92  ? 1    C   G "O5'" 1 
ATOM   581   C  "C5'" . C   C  1 1   ? -37.829  28.307  -10.273 1.00 32.22  ? 1    C   G "C5'" 1 
ATOM   582   C  "C4'" . C   C  1 1   ? -37.992  27.278  -11.356 1.00 32.61  ? 1    C   G "C4'" 1 
ATOM   583   O  "O4'" . C   C  1 1   ? -37.491  26.005  -10.877 1.00 31.91  ? 1    C   G "O4'" 1 
ATOM   584   C  "C3'" . C   C  1 1   ? -39.435  27.001  -11.732 1.00 35.14  ? 1    C   G "C3'" 1 
ATOM   585   O  "O3'" . C   C  1 1   ? -39.870  27.950  -12.706 1.00 42.54  ? 1    C   G "O3'" 1 
ATOM   586   C  "C2'" . C   C  1 1   ? -39.352  25.583  -12.283 1.00 32.20  ? 1    C   G "C2'" 1 
ATOM   587   O  "O2'" . C   C  1 1   ? -38.823  25.566  -13.596 1.00 30.07  ? 1    C   G "O2'" 1 
ATOM   588   C  "C1'" . C   C  1 1   ? -38.325  24.951  -11.339 1.00 30.44  ? 1    C   G "C1'" 1 
ATOM   589   N  N1    . C   C  1 1   ? -38.837  24.226  -10.153 1.00 27.17  ? 1    C   G N1    1 
ATOM   590   C  C2    . C   C  1 1   ? -39.452  22.950  -10.298 1.00 26.02  ? 1    C   G C2    1 
ATOM   591   O  O2    . C   C  1 1   ? -39.630  22.474  -11.436 1.00 23.54  ? 1    C   G O2    1 
ATOM   592   N  N3    . C   C  1 1   ? -39.843  22.281  -9.184  1.00 24.35  ? 1    C   G N3    1 
ATOM   593   C  C4    . C   C  1 1   ? -39.673  22.833  -7.976  1.00 25.44  ? 1    C   G C4    1 
ATOM   594   N  N4    . C   C  1 1   ? -40.077  22.145  -6.902  1.00 23.82  ? 1    C   G N4    1 
ATOM   595   C  C5    . C   C  1 1   ? -39.084  24.122  -7.810  1.00 25.55  ? 1    C   G C5    1 
ATOM   596   C  C6    . C   C  1 1   ? -38.689  24.776  -8.911  1.00 25.66  ? 1    C   G C6    1 
ATOM   597   P  P     . G   C  1 2   ? -41.418  28.417  -12.743 1.00 48.14  ? 2    G   G P     1 
ATOM   598   O  OP1   . G   C  1 2   ? -41.512  29.523  -13.751 1.00 44.86  ? 2    G   G OP1   1 
ATOM   599   O  OP2   . G   C  1 2   ? -41.922  28.637  -11.340 1.00 45.73  ? 2    G   G OP2   1 
ATOM   600   O  "O5'" . G   C  1 2   ? -42.164  27.151  -13.356 1.00 45.58  ? 2    G   G "O5'" 1 
ATOM   601   C  "C5'" . G   C  1 2   ? -41.828  26.683  -14.657 1.00 44.67  ? 2    G   G "C5'" 1 
ATOM   602   C  "C4'" . G   C  1 2   ? -42.422  25.314  -14.895 1.00 43.51  ? 2    G   G "C4'" 1 
ATOM   603   O  "O4'" . G   C  1 2   ? -41.789  24.337  -14.028 1.00 42.73  ? 2    G   G "O4'" 1 
ATOM   604   C  "C3'" . G   C  1 2   ? -43.891  25.178  -14.560 1.00 42.49  ? 2    G   G "C3'" 1 
ATOM   605   O  "O3'" . G   C  1 2   ? -44.695  25.702  -15.599 1.00 43.45  ? 2    G   G "O3'" 1 
ATOM   606   C  "C2'" . G   C  1 2   ? -44.030  23.672  -14.396 1.00 40.52  ? 2    G   G "C2'" 1 
ATOM   607   O  "O2'" . G   C  1 2   ? -44.029  22.998  -15.638 1.00 39.06  ? 2    G   G "O2'" 1 
ATOM   608   C  "C1'" . G   C  1 2   ? -42.732  23.342  -13.661 1.00 39.27  ? 2    G   G "C1'" 1 
ATOM   609   N  N9    . G   C  1 2   ? -42.835  23.336  -12.204 1.00 36.16  ? 2    G   G N9    1 
ATOM   610   C  C8    . G   C  1 2   ? -42.411  24.323  -11.345 1.00 34.61  ? 2    G   G C8    1 
ATOM   611   N  N7    . G   C  1 2   ? -42.583  24.017  -10.086 1.00 32.26  ? 2    G   G N7    1 
ATOM   612   C  C5    . G   C  1 2   ? -43.168  22.759  -10.117 1.00 31.90  ? 2    G   G C5    1 
ATOM   613   C  C6    . G   C  1 2   ? -43.580  21.927  -9.061  1.00 30.37  ? 2    G   G C6    1 
ATOM   614   O  O6    . G   C  1 2   ? -43.507  22.144  -7.854  1.00 31.93  ? 2    G   G O6    1 
ATOM   615   N  N1    . G   C  1 2   ? -44.123  20.737  -9.527  1.00 27.15  ? 2    G   G N1    1 
ATOM   616   C  C2    . G   C  1 2   ? -44.252  20.398  -10.847 1.00 28.56  ? 2    G   G C2    1 
ATOM   617   N  N2    . G   C  1 2   ? -44.784  19.205  -11.099 1.00 29.78  ? 2    G   G N2    1 
ATOM   618   N  N3    . G   C  1 2   ? -43.880  21.171  -11.850 1.00 30.48  ? 2    G   G N3    1 
ATOM   619   C  C4    . G   C  1 2   ? -43.344  22.329  -11.415 1.00 33.36  ? 2    G   G C4    1 
ATOM   620   P  P     . A   C  1 3   ? -46.102  26.375  -15.232 1.00 45.90  ? 3    A   G P     1 
ATOM   621   O  OP1   . A   C  1 3   ? -46.608  26.967  -16.503 1.00 47.47  ? 3    A   G OP1   1 
ATOM   622   O  OP2   . A   C  1 3   ? -45.959  27.236  -14.023 1.00 44.51  ? 3    A   G OP2   1 
ATOM   623   O  "O5'" . A   C  1 3   ? -46.997  25.113  -14.856 1.00 42.57  ? 3    A   G "O5'" 1 
ATOM   624   C  "C5'" . A   C  1 3   ? -47.136  24.054  -15.790 1.00 40.45  ? 3    A   G "C5'" 1 
ATOM   625   C  "C4'" . A   C  1 3   ? -47.814  22.877  -15.158 1.00 39.07  ? 3    A   G "C4'" 1 
ATOM   626   O  "O4'" . A   C  1 3   ? -46.942  22.251  -14.189 1.00 38.97  ? 3    A   G "O4'" 1 
ATOM   627   C  "C3'" . A   C  1 3   ? -49.049  23.201  -14.356 1.00 40.38  ? 3    A   G "C3'" 1 
ATOM   628   O  "O3'" . A   C  1 3   ? -50.154  23.417  -15.218 1.00 43.07  ? 3    A   G "O3'" 1 
ATOM   629   C  "C2'" . A   C  1 3   ? -49.184  21.943  -13.513 1.00 39.86  ? 3    A   G "C2'" 1 
ATOM   630   O  "O2'" . A   C  1 3   ? -49.677  20.849  -14.256 1.00 39.77  ? 3    A   G "O2'" 1 
ATOM   631   C  "C1'" . A   C  1 3   ? -47.721  21.680  -13.154 1.00 38.85  ? 3    A   G "C1'" 1 
ATOM   632   N  N9    . A   C  1 3   ? -47.337  22.316  -11.897 1.00 39.21  ? 3    A   G N9    1 
ATOM   633   C  C8    . A   C  1 3   ? -46.843  23.584  -11.720 1.00 39.17  ? 3    A   G C8    1 
ATOM   634   N  N7    . A   C  1 3   ? -46.607  23.890  -10.466 1.00 39.68  ? 3    A   G N7    1 
ATOM   635   C  C5    . A   C  1 3   ? -46.964  22.742  -9.769  1.00 40.30  ? 3    A   G C5    1 
ATOM   636   C  C6    . A   C  1 3   ? -46.954  22.424  -8.395  1.00 40.62  ? 3    A   G C6    1 
ATOM   637   N  N6    . A   C  1 3   ? -46.561  23.274  -7.442  1.00 40.40  ? 3    A   G N6    1 
ATOM   638   N  N1    . A   C  1 3   ? -47.372  21.190  -8.030  1.00 41.07  ? 3    A   G N1    1 
ATOM   639   C  C2    . A   C  1 3   ? -47.778  20.344  -8.988  1.00 41.14  ? 3    A   G C2    1 
ATOM   640   N  N3    . A   C  1 3   ? -47.839  20.528  -10.310 1.00 40.40  ? 3    A   G N3    1 
ATOM   641   C  C4    . A   C  1 3   ? -47.412  21.762  -10.639 1.00 40.04  ? 3    A   G C4    1 
ATOM   642   P  P     . C   C  1 4   ? -51.385  24.319  -14.718 1.00 44.59  ? 4    C   G P     1 
ATOM   643   O  OP1   . C   C  1 4   ? -52.296  24.498  -15.879 1.00 46.46  ? 4    C   G OP1   1 
ATOM   644   O  OP2   . C   C  1 4   ? -50.881  25.520  -13.988 1.00 43.71  ? 4    C   G OP2   1 
ATOM   645   O  "O5'" . C   C  1 4   ? -52.117  23.351  -13.697 1.00 41.19  ? 4    C   G "O5'" 1 
ATOM   646   C  "C5'" . C   C  1 4   ? -52.640  22.118  -14.150 1.00 39.43  ? 4    C   G "C5'" 1 
ATOM   647   C  "C4'" . C   C  1 4   ? -53.125  21.317  -12.982 1.00 39.18  ? 4    C   G "C4'" 1 
ATOM   648   O  "O4'" . C   C  1 4   ? -51.995  20.989  -12.137 1.00 38.90  ? 4    C   G "O4'" 1 
ATOM   649   C  "C3'" . C   C  1 4   ? -54.036  22.076  -12.039 1.00 38.63  ? 4    C   G "C3'" 1 
ATOM   650   O  "O3'" . C   C  1 4   ? -55.362  22.131  -12.532 1.00 38.43  ? 4    C   G "O3'" 1 
ATOM   651   C  "C2'" . C   C  1 4   ? -53.916  21.252  -10.766 1.00 38.14  ? 4    C   G "C2'" 1 
ATOM   652   O  "O2'" . C   C  1 4   ? -54.707  20.086  -10.798 1.00 37.51  ? 4    C   G "O2'" 1 
ATOM   653   C  "C1'" . C   C  1 4   ? -52.431  20.881  -10.790 1.00 37.28  ? 4    C   G "C1'" 1 
ATOM   654   N  N1    . C   C  1 4   ? -51.616  21.777  -9.953  1.00 34.23  ? 4    C   G N1    1 
ATOM   655   C  C2    . C   C  1 4   ? -51.383  21.417  -8.622  1.00 32.46  ? 4    C   G C2    1 
ATOM   656   O  O2    . C   C  1 4   ? -51.811  20.328  -8.214  1.00 35.23  ? 4    C   G O2    1 
ATOM   657   N  N3    . C   C  1 4   ? -50.699  22.254  -7.822  1.00 28.28  ? 4    C   G N3    1 
ATOM   658   C  C4    . C   C  1 4   ? -50.243  23.402  -8.305  1.00 27.19  ? 4    C   G C4    1 
ATOM   659   N  N4    . C   C  1 4   ? -49.601  24.206  -7.474  1.00 28.96  ? 4    C   G N4    1 
ATOM   660   C  C5    . C   C  1 4   ? -50.431  23.779  -9.663  1.00 28.42  ? 4    C   G C5    1 
ATOM   661   C  C6    . C   C  1 4   ? -51.116  22.946  -10.447 1.00 30.58  ? 4    C   G C6    1 
ATOM   662   P  P     . A   C  1 5   ? -56.471  22.917  -11.696 1.00 37.03  ? 5    A   G P     1 
ATOM   663   O  OP1   . A   C  1 5   ? -57.766  22.721  -12.383 1.00 38.49  ? 5    A   G OP1   1 
ATOM   664   O  OP2   . A   C  1 5   ? -55.993  24.295  -11.401 1.00 35.72  ? 5    A   G OP2   1 
ATOM   665   O  "O5'" . A   C  1 5   ? -56.509  22.061  -10.365 1.00 36.10  ? 5    A   G "O5'" 1 
ATOM   666   C  "C5'" . A   C  1 5   ? -57.078  22.570  -9.185  1.00 33.27  ? 5    A   G "C5'" 1 
ATOM   667   C  "C4'" . A   C  1 5   ? -56.799  21.624  -8.060  1.00 31.17  ? 5    A   G "C4'" 1 
ATOM   668   O  "O4'" . A   C  1 5   ? -55.379  21.355  -8.012  1.00 29.83  ? 5    A   G "O4'" 1 
ATOM   669   C  "C3'" . A   C  1 5   ? -57.174  22.172  -6.703  1.00 30.45  ? 5    A   G "C3'" 1 
ATOM   670   O  "O3'" . A   C  1 5   ? -58.489  21.738  -6.425  1.00 31.35  ? 5    A   G "O3'" 1 
ATOM   671   C  "C2'" . A   C  1 5   ? -56.168  21.498  -5.791  1.00 29.33  ? 5    A   G "C2'" 1 
ATOM   672   O  "O2'" . A   C  1 5   ? -56.592  20.183  -5.495  1.00 26.01  ? 5    A   G "O2'" 1 
ATOM   673   C  "C1'" . A   C  1 5   ? -54.921  21.488  -6.684  1.00 29.13  ? 5    A   G "C1'" 1 
ATOM   674   N  N9    . A   C  1 5   ? -54.123  22.711  -6.649  1.00 27.56  ? 5    A   G N9    1 
ATOM   675   C  C8    . A   C  1 5   ? -53.901  23.536  -7.716  1.00 26.72  ? 5    A   G C8    1 
ATOM   676   N  N7    . A   C  1 5   ? -53.140  24.566  -7.441  1.00 28.04  ? 5    A   G N7    1 
ATOM   677   C  C5    . A   C  1 5   ? -52.847  24.415  -6.096  1.00 27.04  ? 5    A   G C5    1 
ATOM   678   C  C6    . A   C  1 5   ? -52.089  25.189  -5.208  1.00 26.49  ? 5    A   G C6    1 
ATOM   679   N  N6    . A   C  1 5   ? -51.477  26.322  -5.557  1.00 28.34  ? 5    A   G N6    1 
ATOM   680   N  N1    . A   C  1 5   ? -51.982  24.760  -3.933  1.00 25.23  ? 5    A   G N1    1 
ATOM   681   C  C2    . A   C  1 5   ? -52.607  23.631  -3.587  1.00 25.89  ? 5    A   G C2    1 
ATOM   682   N  N3    . A   C  1 5   ? -53.358  22.819  -4.330  1.00 27.82  ? 5    A   G N3    1 
ATOM   683   C  C4    . A   C  1 5   ? -53.441  23.273  -5.593  1.00 27.71  ? 5    A   G C4    1 
ATOM   684   P  P     . C   C  1 6   ? -59.589  22.799  -5.960  1.00 31.76  ? 6    C   G P     1 
ATOM   685   O  OP1   . C   C  1 6   ? -60.910  22.149  -6.185  1.00 34.90  ? 6    C   G OP1   1 
ATOM   686   O  OP2   . C   C  1 6   ? -59.304  24.102  -6.593  1.00 32.18  ? 6    C   G OP2   1 
ATOM   687   O  "O5'" . C   C  1 6   ? -59.308  22.931  -4.398  1.00 32.22  ? 6    C   G "O5'" 1 
ATOM   688   C  "C5'" . C   C  1 6   ? -59.217  21.765  -3.592  1.00 31.41  ? 6    C   G "C5'" 1 
ATOM   689   C  "C4'" . C   C  1 6   ? -58.426  22.039  -2.337  1.00 30.36  ? 6    C   G "C4'" 1 
ATOM   690   O  "O4'" . C   C  1 6   ? -57.011  22.224  -2.622  1.00 30.00  ? 6    C   G "O4'" 1 
ATOM   691   C  "C3'" . C   C  1 6   ? -58.795  23.289  -1.579  1.00 28.60  ? 6    C   G "C3'" 1 
ATOM   692   O  "O3'" . C   C  1 6   ? -59.946  23.047  -0.811  1.00 28.55  ? 6    C   G "O3'" 1 
ATOM   693   C  "C2'" . C   C  1 6   ? -57.583  23.448  -0.682  1.00 29.79  ? 6    C   G "C2'" 1 
ATOM   694   O  "O2'" . C   C  1 6   ? -57.639  22.517  0.378   1.00 32.08  ? 6    C   G "O2'" 1 
ATOM   695   C  "C1'" . C   C  1 6   ? -56.446  23.079  -1.641  1.00 28.82  ? 6    C   G "C1'" 1 
ATOM   696   N  N1    . C   C  1 6   ? -55.887  24.252  -2.328  1.00 27.68  ? 6    C   G N1    1 
ATOM   697   C  C2    . C   C  1 6   ? -55.100  25.170  -1.603  1.00 27.67  ? 6    C   G C2    1 
ATOM   698   O  O2    . C   C  1 6   ? -54.867  24.954  -0.398  1.00 28.53  ? 6    C   G O2    1 
ATOM   699   N  N3    . C   C  1 6   ? -54.615  26.263  -2.235  1.00 24.80  ? 6    C   G N3    1 
ATOM   700   C  C4    . C   C  1 6   ? -54.883  26.458  -3.526  1.00 25.24  ? 6    C   G C4    1 
ATOM   701   N  N4    . C   C  1 6   ? -54.407  27.556  -4.101  1.00 26.17  ? 6    C   G N4    1 
ATOM   702   C  C5    . C   C  1 6   ? -55.661  25.535  -4.286  1.00 26.64  ? 6    C   G C5    1 
ATOM   703   C  C6    . C   C  1 6   ? -56.136  24.457  -3.654  1.00 27.09  ? 6    C   G C6    1 
ATOM   704   P  P     . C   C  1 7   ? -60.959  24.251  -0.518  1.00 32.25  ? 7    C   G P     1 
ATOM   705   O  OP1   . C   C  1 7   ? -62.202  23.640  0.031   1.00 35.00  ? 7    C   G OP1   1 
ATOM   706   O  OP2   . C   C  1 7   ? -61.030  25.101  -1.737  1.00 29.18  ? 7    C   G OP2   1 
ATOM   707   O  "O5'" . C   C  1 7   ? -60.266  25.076  0.658   1.00 30.62  ? 7    C   G "O5'" 1 
ATOM   708   C  "C5'" . C   C  1 7   ? -59.247  26.009  0.358   1.00 32.88  ? 7    C   G "C5'" 1 
ATOM   709   C  "C4'" . C   C  1 7   ? -58.312  26.221  1.533   1.00 33.11  ? 7    C   G "C4'" 1 
ATOM   710   O  "O4'" . C   C  1 7   ? -56.965  26.292  0.996   1.00 32.02  ? 7    C   G "O4'" 1 
ATOM   711   C  "C3'" . C   C  1 7   ? -58.547  27.521  2.305   1.00 34.26  ? 7    C   G "C3'" 1 
ATOM   712   O  "O3'" . C   C  1 7   ? -59.303  27.296  3.508   1.00 33.24  ? 7    C   G "O3'" 1 
ATOM   713   C  "C2'" . C   C  1 7   ? -57.134  28.048  2.575   1.00 33.75  ? 7    C   G "C2'" 1 
ATOM   714   O  "O2'" . C   C  1 7   ? -56.535  27.567  3.763   1.00 36.48  ? 7    C   G "O2'" 1 
ATOM   715   C  "C1'" . C   C  1 7   ? -56.353  27.500  1.380   1.00 31.12  ? 7    C   G "C1'" 1 
ATOM   716   N  N1    . C   C  1 7   ? -56.275  28.347  0.182   1.00 29.55  ? 7    C   G N1    1 
ATOM   717   C  C2    . C   C  1 7   ? -55.354  29.393  0.146   1.00 30.66  ? 7    C   G C2    1 
ATOM   718   O  O2    . C   C  1 7   ? -54.669  29.622  1.162   1.00 33.41  ? 7    C   G O2    1 
ATOM   719   N  N3    . C   C  1 7   ? -55.234  30.129  -0.994  1.00 26.81  ? 7    C   G N3    1 
ATOM   720   C  C4    . C   C  1 7   ? -55.998  29.847  -2.050  1.00 23.26  ? 7    C   G C4    1 
ATOM   721   N  N4    . C   C  1 7   ? -55.839  30.570  -3.144  1.00 21.72  ? 7    C   G N4    1 
ATOM   722   C  C5    . C   C  1 7   ? -56.959  28.805  -2.024  1.00 24.26  ? 7    C   G C5    1 
ATOM   723   C  C6    . C   C  1 7   ? -57.070  28.093  -0.900  1.00 26.82  ? 7    C   G C6    1 
ATOM   724   P  P     . U   C  1 8   ? -60.143  28.507  4.166   1.00 33.66  ? 8    U   G P     1 
ATOM   725   O  OP1   . U   C  1 8   ? -60.669  28.113  5.504   1.00 31.42  ? 8    U   G OP1   1 
ATOM   726   O  OP2   . U   C  1 8   ? -61.085  28.984  3.110   1.00 32.80  ? 8    U   G OP2   1 
ATOM   727   O  "O5'" . U   C  1 8   ? -59.057  29.644  4.420   1.00 31.35  ? 8    U   G "O5'" 1 
ATOM   728   C  "C5'" . U   C  1 8   ? -58.202  29.592  5.555   1.00 30.31  ? 8    U   G "C5'" 1 
ATOM   729   C  "C4'" . U   C  1 8   ? -57.255  30.766  5.545   1.00 29.47  ? 8    U   G "C4'" 1 
ATOM   730   O  "O4'" . U   C  1 8   ? -56.432  30.718  4.352   1.00 29.40  ? 8    U   G "O4'" 1 
ATOM   731   C  "C3'" . U   C  1 8   ? -57.931  32.114  5.446   1.00 30.07  ? 8    U   G "C3'" 1 
ATOM   732   O  "O3'" . U   C  1 8   ? -58.372  32.523  6.726   1.00 34.95  ? 8    U   G "O3'" 1 
ATOM   733   C  "C2'" . U   C  1 8   ? -56.822  32.994  4.888   1.00 27.57  ? 8    U   G "C2'" 1 
ATOM   734   O  "O2'" . U   C  1 8   ? -55.885  33.386  5.859   1.00 26.37  ? 8    U   G "O2'" 1 
ATOM   735   C  "C1'" . U   C  1 8   ? -56.137  32.035  3.917   1.00 26.87  ? 8    U   G "C1'" 1 
ATOM   736   N  N1    . U   C  1 8   ? -56.581  32.166  2.525   1.00 23.79  ? 8    U   G N1    1 
ATOM   737   C  C2    . U   C  1 8   ? -56.081  33.216  1.773   1.00 23.55  ? 8    U   G C2    1 
ATOM   738   O  O2    . U   C  1 8   ? -55.299  34.043  2.220   1.00 24.33  ? 8    U   G O2    1 
ATOM   739   N  N3    . U   C  1 8   ? -56.528  33.261  0.475   1.00 22.47  ? 8    U   G N3    1 
ATOM   740   C  C4    . U   C  1 8   ? -57.399  32.376  -0.133  1.00 23.84  ? 8    U   G C4    1 
ATOM   741   O  O4    . U   C  1 8   ? -57.645  32.489  -1.339  1.00 22.75  ? 8    U   G O4    1 
ATOM   742   C  C5    . U   C  1 8   ? -57.874  31.330  0.722   1.00 24.97  ? 8    U   G C5    1 
ATOM   743   C  C6    . U   C  1 8   ? -57.459  31.267  1.989   1.00 23.61  ? 8    U   G C6    1 
ATOM   744   P  P     . G   C  1 9   ? -59.657  33.482  6.849   1.00 40.06  ? 9    G   G P     1 
ATOM   745   O  OP1   . G   C  1 9   ? -60.041  33.506  8.291   1.00 38.91  ? 9    G   G OP1   1 
ATOM   746   O  OP2   . G   C  1 9   ? -60.662  33.057  5.824   1.00 36.13  ? 9    G   G OP2   1 
ATOM   747   O  "O5'" . G   C  1 9   ? -59.042  34.900  6.465   1.00 35.89  ? 9    G   G "O5'" 1 
ATOM   748   C  "C5'" . G   C  1 9   ? -57.826  35.311  7.072   1.00 37.29  ? 9    G   G "C5'" 1 
ATOM   749   C  "C4'" . G   C  1 9   ? -57.172  36.403  6.273   1.00 38.64  ? 9    G   G "C4'" 1 
ATOM   750   O  "O4'" . G   C  1 9   ? -56.576  35.915  5.034   1.00 39.67  ? 9    G   G "O4'" 1 
ATOM   751   C  "C3'" . G   C  1 9   ? -58.117  37.483  5.822   1.00 37.62  ? 9    G   G "C3'" 1 
ATOM   752   O  "O3'" . G   C  1 9   ? -58.411  38.304  6.933   1.00 37.66  ? 9    G   G "O3'" 1 
ATOM   753   C  "C2'" . G   C  1 9   ? -57.309  38.149  4.707   1.00 37.54  ? 9    G   G "C2'" 1 
ATOM   754   O  "O2'" . G   C  1 9   ? -56.295  39.022  5.173   1.00 34.62  ? 9    G   G "O2'" 1 
ATOM   755   C  "C1'" . G   C  1 9   ? -56.666  36.928  4.036   1.00 35.70  ? 9    G   G "C1'" 1 
ATOM   756   N  N9    . G   C  1 9   ? -57.469  36.397  2.940   1.00 32.87  ? 9    G   G N9    1 
ATOM   757   C  C8    . G   C  1 9   ? -58.326  35.322  2.993   1.00 32.93  ? 9    G   G C8    1 
ATOM   758   N  N7    . G   C  1 9   ? -58.906  35.069  1.852   1.00 30.45  ? 9    G   G N7    1 
ATOM   759   C  C5    . G   C  1 9   ? -58.404  36.038  0.996   1.00 28.32  ? 9    G   G C5    1 
ATOM   760   C  C6    . G   C  1 9   ? -58.667  36.268  -0.367  1.00 25.95  ? 9    G   G C6    1 
ATOM   761   O  O6    . G   C  1 9   ? -59.390  35.628  -1.125  1.00 23.49  ? 9    G   G O6    1 
ATOM   762   N  N1    . G   C  1 9   ? -57.970  37.368  -0.843  1.00 26.99  ? 9    G   G N1    1 
ATOM   763   C  C2    . G   C  1 9   ? -57.105  38.136  -0.106  1.00 27.93  ? 9    G   G C2    1 
ATOM   764   N  N2    . G   C  1 9   ? -56.517  39.152  -0.760  1.00 26.70  ? 9    G   G N2    1 
ATOM   765   N  N3    . G   C  1 9   ? -56.836  37.921  1.173   1.00 28.41  ? 9    G   G N3    1 
ATOM   766   C  C4    . G   C  1 9   ? -57.519  36.867  1.656   1.00 29.69  ? 9    G   G C4    1 
ATOM   767   P  P     . A   C  1 10  ? -59.578  39.387  6.817   1.00 38.62  ? 10   A   G P     1 
ATOM   768   O  OP1   . A   C  1 10  ? -59.998  39.785  8.183   1.00 39.22  ? 10   A   G OP1   1 
ATOM   769   O  OP2   . A   C  1 10  ? -60.605  38.897  5.857   1.00 38.94  ? 10   A   G OP2   1 
ATOM   770   O  "O5'" . A   C  1 10  ? -58.813  40.603  6.142   1.00 37.96  ? 10   A   G "O5'" 1 
ATOM   771   C  "C5'" . A   C  1 10  ? -59.538  41.574  5.426   1.00 39.37  ? 10   A   G "C5'" 1 
ATOM   772   C  "C4'" . A   C  1 10  ? -58.750  42.063  4.243   1.00 37.34  ? 10   A   G "C4'" 1 
ATOM   773   O  "O4'" . A   C  1 10  ? -58.305  40.954  3.431   1.00 35.94  ? 10   A   G "O4'" 1 
ATOM   774   C  "C3'" . A   C  1 10  ? -59.635  42.852  3.313   1.00 38.00  ? 10   A   G "C3'" 1 
ATOM   775   O  "O3'" . A   C  1 10  ? -59.782  44.144  3.829   1.00 39.53  ? 10   A   G "O3'" 1 
ATOM   776   C  "C2'" . A   C  1 10  ? -58.933  42.726  1.978   1.00 36.40  ? 10   A   G "C2'" 1 
ATOM   777   O  "O2'" . A   C  1 10  ? -57.843  43.614  1.828   1.00 36.30  ? 10   A   G "O2'" 1 
ATOM   778   C  "C1'" . A   C  1 10  ? -58.466  41.275  2.060   1.00 34.91  ? 10   A   G "C1'" 1 
ATOM   779   N  N9    . A   C  1 10  ? -59.401  40.306  1.495   1.00 33.29  ? 10   A   G N9    1 
ATOM   780   C  C8    . A   C  1 10  ? -60.044  39.282  2.144   1.00 33.05  ? 10   A   G C8    1 
ATOM   781   N  N7    . A   C  1 10  ? -60.740  38.510  1.347   1.00 33.21  ? 10   A   G N7    1 
ATOM   782   C  C5    . A   C  1 10  ? -60.564  39.084  0.094   1.00 32.26  ? 10   A   G C5    1 
ATOM   783   C  C6    . A   C  1 10  ? -61.026  38.733  -1.180  1.00 31.59  ? 10   A   G C6    1 
ATOM   784   N  N6    . A   C  1 10  ? -61.786  37.673  -1.420  1.00 34.88  ? 10   A   G N6    1 
ATOM   785   N  N1    . A   C  1 10  ? -60.674  39.512  -2.217  1.00 30.31  ? 10   A   G N1    1 
ATOM   786   C  C2    . A   C  1 10  ? -59.909  40.571  -1.980  1.00 32.41  ? 10   A   G C2    1 
ATOM   787   N  N3    . A   C  1 10  ? -59.404  41.006  -0.831  1.00 33.22  ? 10   A   G N3    1 
ATOM   788   C  C4    . A   C  1 10  ? -59.769  40.204  0.178   1.00 32.61  ? 10   A   G C4    1 
ATOM   789   P  P     . U   C  1 11  ? -61.197  44.557  4.444   1.00 44.06  ? 11   U   G P     1 
ATOM   790   O  OP1   . U   C  1 11  ? -60.888  45.498  5.558   1.00 43.82  ? 11   U   G OP1   1 
ATOM   791   O  OP2   . U   C  1 11  ? -62.008  43.329  4.716   1.00 40.78  ? 11   U   G OP2   1 
ATOM   792   O  "O5'" . U   C  1 11  ? -61.838  45.342  3.218   1.00 41.91  ? 11   U   G "O5'" 1 
ATOM   793   C  "C5'" . U   C  1 11  ? -61.073  46.345  2.560   1.00 38.75  ? 11   U   G "C5'" 1 
ATOM   794   C  "C4'" . U   C  1 11  ? -61.550  46.528  1.155   1.00 35.29  ? 11   U   G "C4'" 1 
ATOM   795   O  "O4'" . U   C  1 11  ? -61.138  45.414  0.333   1.00 35.40  ? 11   U   G "O4'" 1 
ATOM   796   C  "C3'" . U   C  1 11  ? -63.044  46.505  1.005   1.00 34.26  ? 11   U   G "C3'" 1 
ATOM   797   O  "O3'" . U   C  1 11  ? -63.614  47.718  1.434   1.00 33.27  ? 11   U   G "O3'" 1 
ATOM   798   C  "C2'" . U   C  1 11  ? -63.191  46.248  -0.484  1.00 34.11  ? 11   U   G "C2'" 1 
ATOM   799   O  "O2'" . U   C  1 11  ? -62.886  47.385  -1.259  1.00 34.63  ? 11   U   G "O2'" 1 
ATOM   800   C  "C1'" . U   C  1 11  ? -62.092  45.215  -0.698  1.00 33.34  ? 11   U   G "C1'" 1 
ATOM   801   N  N1    . U   C  1 11  ? -62.577  43.834  -0.615  1.00 32.44  ? 11   U   G N1    1 
ATOM   802   C  C2    . U   C  1 11  ? -63.153  43.300  -1.740  1.00 32.57  ? 11   U   G C2    1 
ATOM   803   O  O2    . U   C  1 11  ? -63.305  43.941  -2.767  1.00 35.26  ? 11   U   G O2    1 
ATOM   804   N  N3    . U   C  1 11  ? -63.547  41.989  -1.623  1.00 30.12  ? 11   U   G N3    1 
ATOM   805   C  C4    . U   C  1 11  ? -63.430  41.185  -0.515  1.00 27.56  ? 11   U   G C4    1 
ATOM   806   O  O4    . U   C  1 11  ? -63.804  40.021  -0.573  1.00 22.94  ? 11   U   G O4    1 
ATOM   807   C  C5    . U   C  1 11  ? -62.843  41.820  0.618   1.00 30.07  ? 11   U   G C5    1 
ATOM   808   C  C6    . U   C  1 11  ? -62.449  43.096  0.533   1.00 31.88  ? 11   U   G C6    1 
ATOM   809   P  P     . U   C  1 12  ? -65.076  47.686  2.070   1.00 33.44  ? 12   U   G P     1 
ATOM   810   O  OP1   . U   C  1 12  ? -65.254  48.882  2.942   1.00 32.74  ? 12   U   G OP1   1 
ATOM   811   O  OP2   . U   C  1 12  ? -65.217  46.331  2.648   1.00 34.10  ? 12   U   G OP2   1 
ATOM   812   O  "O5'" . U   C  1 12  ? -65.994  47.793  0.778   1.00 31.97  ? 12   U   G "O5'" 1 
ATOM   813   C  "C5'" . U   C  1 12  ? -65.739  48.819  -0.172  1.00 32.83  ? 12   U   G "C5'" 1 
ATOM   814   C  "C4'" . U   C  1 12  ? -66.181  48.397  -1.547  1.00 31.76  ? 12   U   G "C4'" 1 
ATOM   815   O  "O4'" . U   C  1 12  ? -65.513  47.162  -1.891  1.00 33.38  ? 12   U   G "O4'" 1 
ATOM   816   C  "C3'" . U   C  1 12  ? -67.643  48.033  -1.707  1.00 32.13  ? 12   U   G "C3'" 1 
ATOM   817   O  "O3'" . U   C  1 12  ? -68.482  49.171  -1.802  1.00 27.36  ? 12   U   G "O3'" 1 
ATOM   818   C  "C2'" . U   C  1 12  ? -67.615  47.213  -2.988  1.00 33.95  ? 12   U   G "C2'" 1 
ATOM   819   O  "O2'" . U   C  1 12  ? -67.501  47.989  -4.168  1.00 34.69  ? 12   U   G "O2'" 1 
ATOM   820   C  "C1'" . U   C  1 12  ? -66.327  46.420  -2.784  1.00 34.68  ? 12   U   G "C1'" 1 
ATOM   821   N  N1    . U   C  1 12  ? -66.557  45.086  -2.215  1.00 34.73  ? 12   U   G N1    1 
ATOM   822   C  C2    . U   C  1 12  ? -66.997  44.110  -3.074  1.00 35.26  ? 12   U   G C2    1 
ATOM   823   O  O2    . U   C  1 12  ? -67.240  44.333  -4.239  1.00 37.43  ? 12   U   G O2    1 
ATOM   824   N  N3    . U   C  1 12  ? -67.154  42.869  -2.521  1.00 35.78  ? 12   U   G N3    1 
ATOM   825   C  C4    . U   C  1 12  ? -66.938  42.519  -1.214  1.00 37.30  ? 12   U   G C4    1 
ATOM   826   O  O4    . U   C  1 12  ? -67.169  41.365  -0.850  1.00 38.59  ? 12   U   G O4    1 
ATOM   827   C  C5    . U   C  1 12  ? -66.502  43.595  -0.376  1.00 38.04  ? 12   U   G C5    1 
ATOM   828   C  C6    . U   C  1 12  ? -66.333  44.816  -0.897  1.00 35.77  ? 12   U   G C6    1 
ATOM   829   P  P     . C   C  1 13  ? -70.005  49.061  -1.307  1.00 27.86  ? 13   C   G P     1 
ATOM   830   O  OP1   . C   C  1 13  ? -70.589  50.426  -1.433  1.00 28.60  ? 13   C   G OP1   1 
ATOM   831   O  OP2   . C   C  1 13  ? -70.118  48.329  -0.006  1.00 25.80  ? 13   C   G OP2   1 
ATOM   832   O  "O5'" . C   C  1 13  ? -70.654  48.151  -2.426  1.00 23.24  ? 13   C   G "O5'" 1 
ATOM   833   C  "C5'" . C   C  1 13  ? -70.555  48.542  -3.771  1.00 22.39  ? 13   C   G "C5'" 1 
ATOM   834   C  "C4'" . C   C  1 13  ? -71.121  47.476  -4.632  1.00 22.47  ? 13   C   G "C4'" 1 
ATOM   835   O  "O4'" . C   C  1 13  ? -70.328  46.289  -4.451  1.00 24.15  ? 13   C   G "O4'" 1 
ATOM   836   C  "C3'" . C   C  1 13  ? -72.513  47.047  -4.235  1.00 22.93  ? 13   C   G "C3'" 1 
ATOM   837   O  "O3'" . C   C  1 13  ? -73.435  47.933  -4.848  1.00 25.72  ? 13   C   G "O3'" 1 
ATOM   838   C  "C2'" . C   C  1 13  ? -72.581  45.647  -4.824  1.00 23.58  ? 13   C   G "C2'" 1 
ATOM   839   O  "O2'" . C   C  1 13  ? -72.827  45.671  -6.219  1.00 24.17  ? 13   C   G "O2'" 1 
ATOM   840   C  "C1'" . C   C  1 13  ? -71.152  45.152  -4.588  1.00 24.42  ? 13   C   G "C1'" 1 
ATOM   841   N  N1    . C   C  1 13  ? -70.948  44.305  -3.408  1.00 24.28  ? 13   C   G N1    1 
ATOM   842   C  C2    . C   C  1 13  ? -71.237  42.936  -3.499  1.00 23.12  ? 13   C   G C2    1 
ATOM   843   O  O2    . C   C  1 13  ? -71.724  42.492  -4.555  1.00 20.20  ? 13   C   G O2    1 
ATOM   844   N  N3    . C   C  1 13  ? -70.981  42.138  -2.433  1.00 22.82  ? 13   C   G N3    1 
ATOM   845   C  C4    . C   C  1 13  ? -70.476  42.664  -1.312  1.00 23.57  ? 13   C   G C4    1 
ATOM   846   N  N4    . C   C  1 13  ? -70.222  41.848  -0.299  1.00 23.89  ? 13   C   G N4    1 
ATOM   847   C  C5    . C   C  1 13  ? -70.205  44.056  -1.186  1.00 24.33  ? 13   C   G C5    1 
ATOM   848   C  C6    . C   C  1 13  ? -70.457  44.835  -2.247  1.00 24.90  ? 13   C   G C6    1 
ATOM   849   P  P     . C   C  1 14  ? -74.937  48.053  -4.285  1.00 27.78  ? 14   C   G P     1 
ATOM   850   O  OP1   . C   C  1 14  ? -75.401  49.423  -4.623  1.00 29.20  ? 14   C   G OP1   1 
ATOM   851   O  OP2   . C   C  1 14  ? -75.005  47.590  -2.870  1.00 26.88  ? 14   C   G OP2   1 
ATOM   852   O  "O5'" . C   C  1 14  ? -75.752  47.013  -5.165  1.00 23.76  ? 14   C   G "O5'" 1 
ATOM   853   C  "C5'" . C   C  1 14  ? -76.918  46.433  -4.643  1.00 26.67  ? 14   C   G "C5'" 1 
ATOM   854   C  "C4'" . C   C  1 14  ? -76.952  44.976  -4.962  1.00 30.42  ? 14   C   G "C4'" 1 
ATOM   855   O  "O4'" . C   C  1 14  ? -75.664  44.380  -4.669  1.00 33.35  ? 14   C   G "O4'" 1 
ATOM   856   C  "C3'" . C   C  1 14  ? -77.931  44.217  -4.099  1.00 32.26  ? 14   C   G "C3'" 1 
ATOM   857   O  "O3'" . C   C  1 14  ? -79.228  44.453  -4.641  1.00 32.66  ? 14   C   G "O3'" 1 
ATOM   858   C  "C2'" . C   C  1 14  ? -77.358  42.803  -4.141  1.00 33.56  ? 14   C   G "C2'" 1 
ATOM   859   O  "O2'" . C   C  1 14  ? -77.669  42.136  -5.354  1.00 34.34  ? 14   C   G "O2'" 1 
ATOM   860   C  "C1'" . C   C  1 14  ? -75.851  43.089  -4.095  1.00 32.17  ? 14   C   G "C1'" 1 
ATOM   861   N  N1    . C   C  1 14  ? -75.214  43.084  -2.754  1.00 29.21  ? 14   C   G N1    1 
ATOM   862   C  C2    . C   C  1 14  ? -74.853  41.867  -2.163  1.00 27.31  ? 14   C   G C2    1 
ATOM   863   O  O2    . C   C  1 14  ? -75.126  40.814  -2.744  1.00 27.82  ? 14   C   G O2    1 
ATOM   864   N  N3    . C   C  1 14  ? -74.213  41.872  -0.968  1.00 26.43  ? 14   C   G N3    1 
ATOM   865   C  C4    . C   C  1 14  ? -73.939  43.028  -0.364  1.00 26.83  ? 14   C   G C4    1 
ATOM   866   N  N4    . C   C  1 14  ? -73.283  42.995  0.797   1.00 25.54  ? 14   C   G N4    1 
ATOM   867   C  C5    . C   C  1 14  ? -74.320  44.276  -0.926  1.00 28.82  ? 14   C   G C5    1 
ATOM   868   C  C6    . C   C  1 14  ? -74.954  44.259  -2.108  1.00 29.72  ? 14   C   G C6    1 
ATOM   869   O  "O5'" . DG  D  2 1   ? -75.525  34.720  -2.037  1.00 57.59  ? 15   DG  H "O5'" 1 
ATOM   870   C  "C5'" . DG  D  2 1   ? -75.152  33.951  -0.874  1.00 57.19  ? 15   DG  H "C5'" 1 
ATOM   871   C  "C4'" . DG  D  2 1   ? -73.906  33.093  -0.920  1.00 54.72  ? 15   DG  H "C4'" 1 
ATOM   872   O  "O4'" . DG  D  2 1   ? -72.788  33.949  -0.641  1.00 54.45  ? 15   DG  H "O4'" 1 
ATOM   873   C  "C3'" . DG  D  2 1   ? -73.829  32.012  0.153   1.00 51.78  ? 15   DG  H "C3'" 1 
ATOM   874   O  "O3'" . DG  D  2 1   ? -73.209  30.809  -0.361  1.00 52.79  ? 15   DG  H "O3'" 1 
ATOM   875   C  "C2'" . DG  D  2 1   ? -73.212  32.716  1.356   1.00 48.19  ? 15   DG  H "C2'" 1 
ATOM   876   C  "C1'" . DG  D  2 1   ? -72.429  33.873  0.731   1.00 50.73  ? 15   DG  H "C1'" 1 
ATOM   877   N  N9    . DG  D  2 1   ? -72.593  35.223  1.276   1.00 48.42  ? 15   DG  H N9    1 
ATOM   878   C  C8    . DG  D  2 1   ? -72.160  35.699  2.492   1.00 48.90  ? 15   DG  H C8    1 
ATOM   879   N  N7    . DG  D  2 1   ? -72.307  36.992  2.617   1.00 46.42  ? 15   DG  H N7    1 
ATOM   880   C  C5    . DG  D  2 1   ? -72.906  37.388  1.429   1.00 44.58  ? 15   DG  H C5    1 
ATOM   881   C  C6    . DG  D  2 1   ? -73.278  38.671  0.977   1.00 44.17  ? 15   DG  H C6    1 
ATOM   882   O  O6    . DG  D  2 1   ? -73.126  39.755  1.540   1.00 46.13  ? 15   DG  H O6    1 
ATOM   883   N  N1    . DG  D  2 1   ? -73.868  38.624  -0.277  1.00 42.31  ? 15   DG  H N1    1 
ATOM   884   C  C2    . DG  D  2 1   ? -74.063  37.493  -1.008  1.00 41.87  ? 15   DG  H C2    1 
ATOM   885   N  N2    . DG  D  2 1   ? -74.656  37.659  -2.196  1.00 41.30  ? 15   DG  H N2    1 
ATOM   886   N  N3    . DG  D  2 1   ? -73.705  36.289  -0.608  1.00 42.41  ? 15   DG  H N3    1 
ATOM   887   C  C4    . DG  D  2 1   ? -73.133  36.308  0.611   1.00 44.64  ? 15   DG  H C4    1 
ATOM   888   P  P     . DG  D  2 2   ? -71.768  30.851  -1.108  1.00 54.40  ? 16   DG  H P     1 
ATOM   889   O  OP1   . DG  D  2 2   ? -71.538  29.478  -1.631  1.00 53.45  ? 16   DG  H OP1   1 
ATOM   890   O  OP2   . DG  D  2 2   ? -70.731  31.495  -0.242  1.00 53.39  ? 16   DG  H OP2   1 
ATOM   891   O  "O5'" . DG  D  2 2   ? -71.974  31.788  -2.375  1.00 50.10  ? 16   DG  H "O5'" 1 
ATOM   892   C  "C5'" . DG  D  2 2   ? -72.890  31.448  -3.402  1.00 46.38  ? 16   DG  H "C5'" 1 
ATOM   893   C  "C4'" . DG  D  2 2   ? -72.744  32.421  -4.548  1.00 45.79  ? 16   DG  H "C4'" 1 
ATOM   894   O  "O4'" . DG  D  2 2   ? -72.735  33.762  -3.993  1.00 43.19  ? 16   DG  H "O4'" 1 
ATOM   895   C  "C3'" . DG  D  2 2   ? -71.437  32.292  -5.333  1.00 46.41  ? 16   DG  H "C3'" 1 
ATOM   896   O  "O3'" . DG  D  2 2   ? -71.675  32.521  -6.731  1.00 47.73  ? 16   DG  H "O3'" 1 
ATOM   897   C  "C2'" . DG  D  2 2   ? -70.551  33.373  -4.739  1.00 43.75  ? 16   DG  H "C2'" 1 
ATOM   898   C  "C1'" . DG  D  2 2   ? -71.558  34.449  -4.385  1.00 41.38  ? 16   DG  H "C1'" 1 
ATOM   899   N  N9    . DG  D  2 2   ? -71.155  35.320  -3.284  1.00 38.86  ? 16   DG  H N9    1 
ATOM   900   C  C8    . DG  D  2 2   ? -70.686  34.936  -2.053  1.00 38.30  ? 16   DG  H C8    1 
ATOM   901   N  N7    . DG  D  2 2   ? -70.406  35.948  -1.273  1.00 37.53  ? 16   DG  H N7    1 
ATOM   902   C  C5    . DG  D  2 2   ? -70.713  37.067  -2.033  1.00 35.74  ? 16   DG  H C5    1 
ATOM   903   C  C6    . DG  D  2 2   ? -70.624  38.448  -1.718  1.00 33.50  ? 16   DG  H C6    1 
ATOM   904   O  O6    . DG  D  2 2   ? -70.279  38.975  -0.664  1.00 32.16  ? 16   DG  H O6    1 
ATOM   905   N  N1    . DG  D  2 2   ? -70.998  39.241  -2.789  1.00 32.74  ? 16   DG  H N1    1 
ATOM   906   C  C2    . DG  D  2 2   ? -71.416  38.773  -4.007  1.00 34.07  ? 16   DG  H C2    1 
ATOM   907   N  N2    . DG  D  2 2   ? -71.689  39.694  -4.932  1.00 34.69  ? 16   DG  H N2    1 
ATOM   908   N  N3    . DG  D  2 2   ? -71.543  37.493  -4.304  1.00 36.05  ? 16   DG  H N3    1 
ATOM   909   C  C4    . DG  D  2 2   ? -71.168  36.700  -3.280  1.00 37.36  ? 16   DG  H C4    1 
ATOM   910   P  P     . DA  D  2 3   ? -70.437  32.532  -7.759  1.00 48.98  ? 17   DA  H P     1 
ATOM   911   O  OP1   . DA  D  2 3   ? -70.908  31.928  -9.037  1.00 48.78  ? 17   DA  H OP1   1 
ATOM   912   O  OP2   . DA  D  2 3   ? -69.235  31.975  -7.073  1.00 47.05  ? 17   DA  H OP2   1 
ATOM   913   O  "O5'" . DA  D  2 3   ? -70.210  34.082  -8.014  1.00 44.78  ? 17   DA  H "O5'" 1 
ATOM   914   C  "C5'" . DA  D  2 3   ? -71.262  34.867  -8.550  1.00 42.14  ? 17   DA  H "C5'" 1 
ATOM   915   C  "C4'" . DA  D  2 3   ? -70.696  36.078  -9.247  1.00 40.24  ? 17   DA  H "C4'" 1 
ATOM   916   O  "O4'" . DA  D  2 3   ? -70.425  37.151  -8.312  1.00 39.08  ? 17   DA  H "O4'" 1 
ATOM   917   C  "C3'" . DA  D  2 3   ? -69.389  35.794  -9.971  1.00 38.22  ? 17   DA  H "C3'" 1 
ATOM   918   O  "O3'" . DA  D  2 3   ? -69.407  36.468  -11.224 1.00 39.35  ? 17   DA  H "O3'" 1 
ATOM   919   C  "C2'" . DA  D  2 3   ? -68.328  36.325  -9.019  1.00 36.94  ? 17   DA  H "C2'" 1 
ATOM   920   C  "C1'" . DA  D  2 3   ? -69.032  37.448  -8.262  1.00 36.54  ? 17   DA  H "C1'" 1 
ATOM   921   N  N9    . DA  D  2 3   ? -68.656  37.586  -6.841  1.00 33.86  ? 17   DA  H N9    1 
ATOM   922   C  C8    . DA  D  2 3   ? -68.538  36.580  -5.905  1.00 32.48  ? 17   DA  H C8    1 
ATOM   923   N  N7    . DA  D  2 3   ? -68.247  37.007  -4.698  1.00 28.58  ? 17   DA  H N7    1 
ATOM   924   C  C5    . DA  D  2 3   ? -68.156  38.381  -4.845  1.00 27.94  ? 17   DA  H C5    1 
ATOM   925   C  C6    . DA  D  2 3   ? -67.892  39.402  -3.930  1.00 27.59  ? 17   DA  H C6    1 
ATOM   926   N  N6    . DA  D  2 3   ? -67.685  39.192  -2.635  1.00 29.61  ? 17   DA  H N6    1 
ATOM   927   N  N1    . DA  D  2 3   ? -67.854  40.666  -4.391  1.00 27.70  ? 17   DA  H N1    1 
ATOM   928   C  C2    . DA  D  2 3   ? -68.082  40.879  -5.692  1.00 28.98  ? 17   DA  H C2    1 
ATOM   929   N  N3    . DA  D  2 3   ? -68.357  40.004  -6.653  1.00 30.16  ? 17   DA  H N3    1 
ATOM   930   C  C4    . DA  D  2 3   ? -68.384  38.754  -6.159  1.00 29.98  ? 17   DA  H C4    1 
ATOM   931   P  P     . DA  D  2 4   ? -68.071  36.567  -12.099 1.00 38.22  ? 18   DA  H P     1 
ATOM   932   O  OP1   . DA  D  2 4   ? -68.430  36.584  -13.537 1.00 38.44  ? 18   DA  H OP1   1 
ATOM   933   O  OP2   . DA  D  2 4   ? -67.064  35.586  -11.614 1.00 36.41  ? 18   DA  H OP2   1 
ATOM   934   O  "O5'" . DA  D  2 4   ? -67.560  38.012  -11.719 1.00 34.74  ? 18   DA  H "O5'" 1 
ATOM   935   C  "C5'" . DA  D  2 4   ? -66.192  38.220  -11.579 1.00 33.68  ? 18   DA  H "C5'" 1 
ATOM   936   C  "C4'" . DA  D  2 4   ? -65.930  39.605  -11.068 1.00 32.33  ? 18   DA  H "C4'" 1 
ATOM   937   O  "O4'" . DA  D  2 4   ? -66.301  39.682  -9.665  1.00 32.79  ? 18   DA  H "O4'" 1 
ATOM   938   C  "C3'" . DA  D  2 4   ? -64.433  39.834  -11.127 1.00 32.38  ? 18   DA  H "C3'" 1 
ATOM   939   O  "O3'" . DA  D  2 4   ? -64.098  40.947  -11.911 1.00 33.07  ? 18   DA  H "O3'" 1 
ATOM   940   C  "C2'" . DA  D  2 4   ? -63.971  39.964  -9.692  1.00 33.01  ? 18   DA  H "C2'" 1 
ATOM   941   C  "C1'" . DA  D  2 4   ? -65.232  40.252  -8.913  1.00 31.85  ? 18   DA  H "C1'" 1 
ATOM   942   N  N9    . DA  D  2 4   ? -65.156  39.595  -7.607  1.00 29.01  ? 18   DA  H N9    1 
ATOM   943   C  C8    . DA  D  2 4   ? -65.193  38.253  -7.323  1.00 27.21  ? 18   DA  H C8    1 
ATOM   944   N  N7    . DA  D  2 4   ? -65.014  37.976  -6.054  1.00 24.76  ? 18   DA  H N7    1 
ATOM   945   C  C5    . DA  D  2 4   ? -64.871  39.219  -5.460  1.00 24.07  ? 18   DA  H C5    1 
ATOM   946   C  C6    . DA  D  2 4   ? -64.668  39.609  -4.131  1.00 21.98  ? 18   DA  H C6    1 
ATOM   947   N  N6    . DA  D  2 4   ? -64.569  38.758  -3.119  1.00 18.63  ? 18   DA  H N6    1 
ATOM   948   N  N1    . DA  D  2 4   ? -64.575  40.929  -3.871  1.00 24.12  ? 18   DA  H N1    1 
ATOM   949   C  C2    . DA  D  2 4   ? -64.689  41.793  -4.887  1.00 26.27  ? 18   DA  H C2    1 
ATOM   950   N  N3    . DA  D  2 4   ? -64.888  41.549  -6.179  1.00 27.36  ? 18   DA  H N3    1 
ATOM   951   C  C4    . DA  D  2 4   ? -64.969  40.226  -6.402  1.00 27.02  ? 18   DA  H C4    1 
ATOM   952   P  P     . DT  D  2 5   ? -63.206  40.700  -13.198 1.00 33.94  ? 19   DT  H P     1 
ATOM   953   O  OP1   . DT  D  2 5   ? -63.213  41.930  -14.034 1.00 34.26  ? 19   DT  H OP1   1 
ATOM   954   O  OP2   . DT  D  2 5   ? -63.706  39.413  -13.750 1.00 31.06  ? 19   DT  H OP2   1 
ATOM   955   O  "O5'" . DT  D  2 5   ? -61.755  40.462  -12.593 1.00 32.58  ? 19   DT  H "O5'" 1 
ATOM   956   C  "C5'" . DT  D  2 5   ? -61.554  39.485  -11.585 1.00 32.12  ? 19   DT  H "C5'" 1 
ATOM   957   C  "C4'" . DT  D  2 5   ? -60.429  39.900  -10.673 1.00 33.37  ? 19   DT  H "C4'" 1 
ATOM   958   O  "O4'" . DT  D  2 5   ? -60.920  39.974  -9.307  1.00 34.23  ? 19   DT  H "O4'" 1 
ATOM   959   C  "C3'" . DT  D  2 5   ? -59.291  38.877  -10.666 1.00 34.59  ? 19   DT  H "C3'" 1 
ATOM   960   O  "O3'" . DT  D  2 5   ? -58.013  39.502  -10.612 1.00 35.89  ? 19   DT  H "O3'" 1 
ATOM   961   C  "C2'" . DT  D  2 5   ? -59.507  38.126  -9.374  1.00 35.49  ? 19   DT  H "C2'" 1 
ATOM   962   C  "C1'" . DT  D  2 5   ? -60.049  39.222  -8.483  1.00 33.18  ? 19   DT  H "C1'" 1 
ATOM   963   N  N1    . DT  D  2 5   ? -60.779  38.700  -7.301  1.00 30.07  ? 19   DT  H N1    1 
ATOM   964   C  C2    . DT  D  2 5   ? -60.840  39.494  -6.186  1.00 27.93  ? 19   DT  H C2    1 
ATOM   965   O  O2    . DT  D  2 5   ? -60.529  40.672  -6.195  1.00 29.46  ? 19   DT  H O2    1 
ATOM   966   N  N3    . DT  D  2 5   ? -61.295  38.859  -5.063  1.00 25.20  ? 19   DT  H N3    1 
ATOM   967   C  C4    . DT  D  2 5   ? -61.724  37.551  -4.966  1.00 25.59  ? 19   DT  H C4    1 
ATOM   968   O  O4    . DT  D  2 5   ? -62.025  37.080  -3.880  1.00 25.57  ? 19   DT  H O4    1 
ATOM   969   C  C5    . DT  D  2 5   ? -61.754  36.821  -6.194  1.00 24.98  ? 19   DT  H C5    1 
ATOM   970   C  C7    . DT  D  2 5   ? -62.286  35.426  -6.180  1.00 27.25  ? 19   DT  H C7    1 
ATOM   971   C  C6    . DT  D  2 5   ? -61.297  37.422  -7.294  1.00 25.83  ? 19   DT  H C6    1 
ATOM   972   P  P     . DC  D  2 6   ? -56.684  38.598  -10.717 1.00 35.13  ? 20   DC  H P     1 
ATOM   973   O  OP1   . DC  D  2 6   ? -55.974  39.044  -11.943 1.00 35.55  ? 20   DC  H OP1   1 
ATOM   974   O  OP2   . DC  D  2 6   ? -57.050  37.168  -10.554 1.00 33.24  ? 20   DC  H OP2   1 
ATOM   975   O  "O5'" . DC  D  2 6   ? -55.841  39.065  -9.459  1.00 31.64  ? 20   DC  H "O5'" 1 
ATOM   976   C  "C5'" . DC  D  2 6   ? -55.720  40.452  -9.163  1.00 32.69  ? 20   DC  H "C5'" 1 
ATOM   977   C  "C4'" . DC  D  2 6   ? -55.022  40.625  -7.840  1.00 32.52  ? 20   DC  H "C4'" 1 
ATOM   978   O  "O4'" . DC  D  2 6   ? -55.985  40.419  -6.773  1.00 31.99  ? 20   DC  H "O4'" 1 
ATOM   979   C  "C3'" . DC  D  2 6   ? -53.964  39.536  -7.686  1.00 32.91  ? 20   DC  H "C3'" 1 
ATOM   980   O  "O3'" . DC  D  2 6   ? -52.749  39.968  -7.101  1.00 32.35  ? 20   DC  H "O3'" 1 
ATOM   981   C  "C2'" . DC  D  2 6   ? -54.604  38.552  -6.741  1.00 33.12  ? 20   DC  H "C2'" 1 
ATOM   982   C  "C1'" . DC  D  2 6   ? -55.495  39.433  -5.895  1.00 29.04  ? 20   DC  H "C1'" 1 
ATOM   983   N  N1    . DC  D  2 6   ? -56.613  38.628  -5.421  1.00 24.75  ? 20   DC  H N1    1 
ATOM   984   C  C2    . DC  D  2 6   ? -56.947  38.671  -4.084  1.00 22.14  ? 20   DC  H C2    1 
ATOM   985   O  O2    . DC  D  2 6   ? -56.441  39.539  -3.374  1.00 18.84  ? 20   DC  H O2    1 
ATOM   986   N  N3    . DC  D  2 6   ? -57.828  37.776  -3.601  1.00 24.01  ? 20   DC  H N3    1 
ATOM   987   C  C4    . DC  D  2 6   ? -58.411  36.900  -4.428  1.00 24.78  ? 20   DC  H C4    1 
ATOM   988   N  N4    . DC  D  2 6   ? -59.249  36.003  -3.907  1.00 24.85  ? 20   DC  H N4    1 
ATOM   989   C  C5    . DC  D  2 6   ? -58.156  36.905  -5.824  1.00 24.53  ? 20   DC  H C5    1 
ATOM   990   C  C6    . DC  D  2 6   ? -57.263  37.784  -6.276  1.00 23.66  ? 20   DC  H C6    1 
ATOM   991   P  P     . DA  D  2 7   ? -51.494  38.971  -7.133  1.00 30.00  ? 21   DA  H P     1 
ATOM   992   O  OP1   . DA  D  2 7   ? -50.941  39.079  -8.499  1.00 30.52  ? 21   DA  H OP1   1 
ATOM   993   O  OP2   . DA  D  2 7   ? -51.910  37.645  -6.623  1.00 27.38  ? 21   DA  H OP2   1 
ATOM   994   O  "O5'" . DA  D  2 7   ? -50.468  39.609  -6.098  1.00 31.34  ? 21   DA  H "O5'" 1 
ATOM   995   C  "C5'" . DA  D  2 7   ? -50.867  40.640  -5.194  1.00 33.35  ? 21   DA  H "C5'" 1 
ATOM   996   C  "C4'" . DA  D  2 7   ? -50.563  40.213  -3.781  1.00 32.72  ? 21   DA  H "C4'" 1 
ATOM   997   O  "O4'" . DA  D  2 7   ? -51.761  39.628  -3.203  1.00 31.82  ? 21   DA  H "O4'" 1 
ATOM   998   C  "C3'" . DA  D  2 7   ? -49.511  39.109  -3.804  1.00 35.23  ? 21   DA  H "C3'" 1 
ATOM   999   O  "O3'" . DA  D  2 7   ? -48.516  39.209  -2.787  1.00 39.89  ? 21   DA  H "O3'" 1 
ATOM   1000  C  "C2'" . DA  D  2 7   ? -50.321  37.849  -3.597  1.00 34.39  ? 21   DA  H "C2'" 1 
ATOM   1001  C  "C1'" . DA  D  2 7   ? -51.470  38.325  -2.732  1.00 30.60  ? 21   DA  H "C1'" 1 
ATOM   1002  N  N9    . DA  D  2 7   ? -52.654  37.473  -2.897  1.00 27.90  ? 21   DA  H N9    1 
ATOM   1003  C  C8    . DA  D  2 7   ? -53.205  37.034  -4.081  1.00 26.44  ? 21   DA  H C8    1 
ATOM   1004  N  N7    . DA  D  2 7   ? -54.181  36.175  -3.925  1.00 23.10  ? 21   DA  H N7    1 
ATOM   1005  C  C5    . DA  D  2 7   ? -54.305  36.061  -2.550  1.00 22.03  ? 21   DA  H C5    1 
ATOM   1006  C  C6    . DA  D  2 7   ? -55.149  35.285  -1.751  1.00 21.80  ? 21   DA  H C6    1 
ATOM   1007  N  N6    . DA  D  2 7   ? -56.059  34.439  -2.250  1.00 21.30  ? 21   DA  H N6    1 
ATOM   1008  N  N1    . DA  D  2 7   ? -55.024  35.399  -0.408  1.00 20.11  ? 21   DA  H N1    1 
ATOM   1009  C  C2    . DA  D  2 7   ? -54.105  36.242  0.077   1.00 21.02  ? 21   DA  H C2    1 
ATOM   1010  N  N3    . DA  D  2 7   ? -53.246  37.024  -0.577  1.00 21.95  ? 21   DA  H N3    1 
ATOM   1011  C  C4    . DA  D  2 7   ? -53.395  36.880  -1.903  1.00 23.64  ? 21   DA  H C4    1 
ATOM   1012  P  P     . DG  D  2 8   ? -47.240  38.221  -2.849  1.00 42.45  ? 22   DG  H P     1 
ATOM   1013  O  OP1   . DG  D  2 8   ? -46.166  39.013  -3.512  1.00 40.67  ? 22   DG  H OP1   1 
ATOM   1014  O  OP2   . DG  D  2 8   ? -47.641  36.899  -3.424  1.00 37.12  ? 22   DG  H OP2   1 
ATOM   1015  O  "O5'" . DG  D  2 8   ? -46.859  37.972  -1.319  1.00 42.36  ? 22   DG  H "O5'" 1 
ATOM   1016  C  "C5'" . DG  D  2 8   ? -47.759  38.304  -0.260  1.00 42.76  ? 22   DG  H "C5'" 1 
ATOM   1017  C  "C4'" . DG  D  2 8   ? -48.176  37.053  0.480   1.00 45.32  ? 22   DG  H "C4'" 1 
ATOM   1018  O  "O4'" . DG  D  2 8   ? -49.450  36.570  -0.021  1.00 45.77  ? 22   DG  H "O4'" 1 
ATOM   1019  C  "C3'" . DG  D  2 8   ? -47.198  35.875  0.363   1.00 46.99  ? 22   DG  H "C3'" 1 
ATOM   1020  O  "O3'" . DG  D  2 8   ? -47.058  35.174  1.613   1.00 49.25  ? 22   DG  H "O3'" 1 
ATOM   1021  C  "C2'" . DG  D  2 8   ? -47.899  34.957  -0.619  1.00 46.10  ? 22   DG  H "C2'" 1 
ATOM   1022  C  "C1'" . DG  D  2 8   ? -49.332  35.170  -0.179  1.00 45.82  ? 22   DG  H "C1'" 1 
ATOM   1023  N  N9    . DG  D  2 8   ? -50.366  34.687  -1.094  1.00 44.62  ? 22   DG  H N9    1 
ATOM   1024  C  C8    . DG  D  2 8   ? -50.542  35.001  -2.422  1.00 43.61  ? 22   DG  H C8    1 
ATOM   1025  N  N7    . DG  D  2 8   ? -51.511  34.327  -2.985  1.00 41.72  ? 22   DG  H N7    1 
ATOM   1026  C  C5    . DG  D  2 8   ? -52.017  33.537  -1.962  1.00 41.82  ? 22   DG  H C5    1 
ATOM   1027  C  C6    . DG  D  2 8   ? -53.064  32.589  -1.973  1.00 41.68  ? 22   DG  H C6    1 
ATOM   1028  O  O6    . DG  D  2 8   ? -53.780  32.247  -2.920  1.00 41.51  ? 22   DG  H O6    1 
ATOM   1029  N  N1    . DG  D  2 8   ? -53.245  32.014  -0.719  1.00 40.85  ? 22   DG  H N1    1 
ATOM   1030  C  C2    . DG  D  2 8   ? -52.515  32.319  0.404   1.00 41.46  ? 22   DG  H C2    1 
ATOM   1031  N  N2    . DG  D  2 8   ? -52.856  31.675  1.527   1.00 42.01  ? 22   DG  H N2    1 
ATOM   1032  N  N3    . DG  D  2 8   ? -51.528  33.196  0.426   1.00 41.43  ? 22   DG  H N3    1 
ATOM   1033  C  C4    . DG  D  2 8   ? -51.335  33.763  -0.784  1.00 42.66  ? 22   DG  H C4    1 
ATOM   1034  P  P     . DG  D  2 9   ? -45.902  34.049  1.777   1.00 52.29  ? 23   DG  H P     1 
ATOM   1035  O  OP1   . DG  D  2 9   ? -45.178  34.359  3.039   1.00 51.26  ? 23   DG  H OP1   1 
ATOM   1036  O  OP2   . DG  D  2 9   ? -45.135  33.914  0.508   1.00 50.29  ? 23   DG  H OP2   1 
ATOM   1037  O  "O5'" . DG  D  2 9   ? -46.704  32.689  2.016   1.00 50.74  ? 23   DG  H "O5'" 1 
ATOM   1038  C  "C5'" . DG  D  2 9   ? -47.257  32.395  3.304   1.00 49.36  ? 23   DG  H "C5'" 1 
ATOM   1039  C  "C4'" . DG  D  2 9   ? -47.709  30.953  3.382   1.00 47.08  ? 23   DG  H "C4'" 1 
ATOM   1040  O  "O4'" . DG  D  2 9   ? -48.996  30.784  2.722   1.00 46.47  ? 23   DG  H "O4'" 1 
ATOM   1041  C  "C3'" . DG  D  2 9   ? -46.749  29.950  2.734   1.00 45.41  ? 23   DG  H "C3'" 1 
ATOM   1042  O  "O3'" . DG  D  2 9   ? -46.585  28.768  3.507   1.00 43.70  ? 23   DG  H "O3'" 1 
ATOM   1043  C  "C2'" . DG  D  2 9   ? -47.481  29.527  1.484   1.00 45.83  ? 23   DG  H "C2'" 1 
ATOM   1044  C  "C1'" . DG  D  2 9   ? -48.934  29.626  1.908   1.00 43.67  ? 23   DG  H "C1'" 1 
ATOM   1045  N  N9    . DG  D  2 9   ? -49.765  29.824  0.730   1.00 39.14  ? 23   DG  H N9    1 
ATOM   1046  C  C8    . DG  D  2 9   ? -49.606  30.792  -0.225  1.00 36.95  ? 23   DG  H C8    1 
ATOM   1047  N  N7    . DG  D  2 9   ? -50.353  30.601  -1.271  1.00 36.48  ? 23   DG  H N7    1 
ATOM   1048  C  C5    . DG  D  2 9   ? -51.079  29.462  -0.967  1.00 37.29  ? 23   DG  H C5    1 
ATOM   1049  C  C6    . DG  D  2 9   ? -52.013  28.745  -1.743  1.00 39.21  ? 23   DG  H C6    1 
ATOM   1050  O  O6    . DG  D  2 9   ? -52.349  28.948  -2.918  1.00 42.73  ? 23   DG  H O6    1 
ATOM   1051  N  N1    . DG  D  2 9   ? -52.554  27.674  -1.037  1.00 37.83  ? 23   DG  H N1    1 
ATOM   1052  C  C2    . DG  D  2 9   ? -52.216  27.326  0.240   1.00 36.78  ? 23   DG  H C2    1 
ATOM   1053  N  N2    . DG  D  2 9   ? -52.885  26.290  0.760   1.00 35.43  ? 23   DG  H N2    1 
ATOM   1054  N  N3    . DG  D  2 9   ? -51.299  27.957  0.958   1.00 37.57  ? 23   DG  H N3    1 
ATOM   1055  C  C4    . DG  D  2 9   ? -50.776  29.010  0.292   1.00 37.30  ? 23   DG  H C4    1 
ATOM   1056  P  P     . DT  D  2 10  ? -45.593  27.616  2.977   1.00 43.45  ? 24   DT  H P     1 
ATOM   1057  O  OP1   . DT  D  2 10  ? -44.512  27.499  3.984   1.00 43.70  ? 24   DT  H OP1   1 
ATOM   1058  O  OP2   . DT  D  2 10  ? -45.243  27.862  1.548   1.00 41.02  ? 24   DT  H OP2   1 
ATOM   1059  O  "O5'" . DT  D  2 10  ? -46.474  26.292  3.065   1.00 40.80  ? 24   DT  H "O5'" 1 
ATOM   1060  C  "C5'" . DT  D  2 10  ? -47.283  26.045  4.207   1.00 34.37  ? 24   DT  H "C5'" 1 
ATOM   1061  C  "C4'" . DT  D  2 10  ? -48.294  24.964  3.911   1.00 30.70  ? 24   DT  H "C4'" 1 
ATOM   1062  O  "O4'" . DT  D  2 10  ? -49.133  25.377  2.809   1.00 29.34  ? 24   DT  H "O4'" 1 
ATOM   1063  C  "C3'" . DT  D  2 10  ? -47.716  23.609  3.518   1.00 29.73  ? 24   DT  H "C3'" 1 
ATOM   1064  O  "O3'" . DT  D  2 10  ? -48.508  22.593  4.120   1.00 31.74  ? 24   DT  H "O3'" 1 
ATOM   1065  C  "C2'" . DT  D  2 10  ? -47.875  23.573  2.009   1.00 29.31  ? 24   DT  H "C2'" 1 
ATOM   1066  C  "C1'" . DT  D  2 10  ? -49.140  24.381  1.797   1.00 28.57  ? 24   DT  H "C1'" 1 
ATOM   1067  N  N1    . DT  D  2 10  ? -49.251  25.060  0.480   1.00 27.26  ? 24   DT  H N1    1 
ATOM   1068  C  C2    . DT  D  2 10  ? -50.203  24.608  -0.399  1.00 26.52  ? 24   DT  H C2    1 
ATOM   1069  O  O2    . DT  D  2 10  ? -50.927  23.663  -0.166  1.00 30.22  ? 24   DT  H O2    1 
ATOM   1070  N  N3    . DT  D  2 10  ? -50.279  25.299  -1.571  1.00 25.76  ? 24   DT  H N3    1 
ATOM   1071  C  C4    . DT  D  2 10  ? -49.516  26.369  -1.954  1.00 27.24  ? 24   DT  H C4    1 
ATOM   1072  O  O4    . DT  D  2 10  ? -49.716  26.900  -3.044  1.00 29.76  ? 24   DT  H O4    1 
ATOM   1073  C  C5    . DT  D  2 10  ? -48.517  26.785  -0.997  1.00 26.54  ? 24   DT  H C5    1 
ATOM   1074  C  C7    . DT  D  2 10  ? -47.623  27.932  -1.339  1.00 25.37  ? 24   DT  H C7    1 
ATOM   1075  C  C6    . DT  D  2 10  ? -48.435  26.119  0.157   1.00 26.80  ? 24   DT  H C6    1 
ATOM   1076  P  P     . DG  D  2 11  ? -48.022  21.066  4.078   1.00 32.75  ? 25   DG  H P     1 
ATOM   1077  O  OP1   . DG  D  2 11  ? -47.901  20.594  5.479   1.00 31.92  ? 25   DG  H OP1   1 
ATOM   1078  O  OP2   . DG  D  2 11  ? -46.871  20.942  3.137   1.00 28.90  ? 25   DG  H OP2   1 
ATOM   1079  O  "O5'" . DG  D  2 11  ? -49.259  20.325  3.429   1.00 31.94  ? 25   DG  H "O5'" 1 
ATOM   1080  C  "C5'" . DG  D  2 11  ? -49.819  20.845  2.246   1.00 32.77  ? 25   DG  H "C5'" 1 
ATOM   1081  C  "C4'" . DG  D  2 11  ? -50.652  19.798  1.561   1.00 32.81  ? 25   DG  H "C4'" 1 
ATOM   1082  O  "O4'" . DG  D  2 11  ? -51.058  20.378  0.309   1.00 31.47  ? 25   DG  H "O4'" 1 
ATOM   1083  C  "C3'" . DG  D  2 11  ? -49.866  18.543  1.201   1.00 33.43  ? 25   DG  H "C3'" 1 
ATOM   1084  O  "O3'" . DG  D  2 11  ? -50.746  17.411  1.153   1.00 36.01  ? 25   DG  H "O3'" 1 
ATOM   1085  C  "C2'" . DG  D  2 11  ? -49.285  18.883  -0.157  1.00 31.06  ? 25   DG  H "C2'" 1 
ATOM   1086  C  "C1'" . DG  D  2 11  ? -50.344  19.786  -0.761  1.00 30.85  ? 25   DG  H "C1'" 1 
ATOM   1087  N  N9    . DG  D  2 11  ? -49.802  20.873  -1.558  1.00 28.83  ? 25   DG  H N9    1 
ATOM   1088  C  C8    . DG  D  2 11  ? -48.939  21.851  -1.139  1.00 27.95  ? 25   DG  H C8    1 
ATOM   1089  N  N7    . DG  D  2 11  ? -48.628  22.693  -2.088  1.00 28.96  ? 25   DG  H N7    1 
ATOM   1090  C  C5    . DG  D  2 11  ? -49.325  22.232  -3.200  1.00 27.57  ? 25   DG  H C5    1 
ATOM   1091  C  C6    . DG  D  2 11  ? -49.370  22.724  -4.529  1.00 26.61  ? 25   DG  H C6    1 
ATOM   1092  O  O6    . DG  D  2 11  ? -48.783  23.705  -5.010  1.00 26.62  ? 25   DG  H O6    1 
ATOM   1093  N  N1    . DG  D  2 11  ? -50.203  21.948  -5.329  1.00 24.60  ? 25   DG  H N1    1 
ATOM   1094  C  C2    . DG  D  2 11  ? -50.904  20.853  -4.903  1.00 23.02  ? 25   DG  H C2    1 
ATOM   1095  N  N2    . DG  D  2 11  ? -51.654  20.246  -5.804  1.00 22.55  ? 25   DG  H N2    1 
ATOM   1096  N  N3    . DG  D  2 11  ? -50.869  20.388  -3.679  1.00 24.43  ? 25   DG  H N3    1 
ATOM   1097  C  C4    . DG  D  2 11  ? -50.062  21.117  -2.885  1.00 27.55  ? 25   DG  H C4    1 
ATOM   1098  P  P     . DT  D  2 12  ? -50.132  15.932  1.074   1.00 38.63  ? 26   DT  H P     1 
ATOM   1099  O  OP1   . DT  D  2 12  ? -51.232  14.941  1.006   1.00 38.37  ? 26   DT  H OP1   1 
ATOM   1100  O  OP2   . DT  D  2 12  ? -49.116  15.833  2.157   1.00 38.51  ? 26   DT  H OP2   1 
ATOM   1101  O  "O5'" . DT  D  2 12  ? -49.401  15.926  -0.339  1.00 38.11  ? 26   DT  H "O5'" 1 
ATOM   1102  C  "C5'" . DT  D  2 12  ? -47.998  15.748  -0.440  1.00 36.16  ? 26   DT  H "C5'" 1 
ATOM   1103  C  "C4'" . DT  D  2 12  ? -47.619  15.548  -1.885  1.00 36.81  ? 26   DT  H "C4'" 1 
ATOM   1104  O  "O4'" . DT  D  2 12  ? -47.915  16.752  -2.642  1.00 38.25  ? 26   DT  H "O4'" 1 
ATOM   1105  C  "C3'" . DT  D  2 12  ? -46.138  15.248  -2.123  1.00 38.89  ? 26   DT  H "C3'" 1 
ATOM   1106  O  "O3'" . DT  D  2 12  ? -46.005  14.154  -3.021  1.00 38.45  ? 26   DT  H "O3'" 1 
ATOM   1107  C  "C2'" . DT  D  2 12  ? -45.619  16.493  -2.820  1.00 39.42  ? 26   DT  H "C2'" 1 
ATOM   1108  C  "C1'" . DT  D  2 12  ? -46.850  16.983  -3.551  1.00 37.97  ? 26   DT  H "C1'" 1 
ATOM   1109  N  N1    . DT  D  2 12  ? -46.789  18.421  -3.877  1.00 36.71  ? 26   DT  H N1    1 
ATOM   1110  C  C2    . DT  D  2 12  ? -47.330  18.870  -5.069  1.00 35.85  ? 26   DT  H C2    1 
ATOM   1111  O  O2    . DT  D  2 12  ? -47.950  18.164  -5.834  1.00 38.37  ? 26   DT  H O2    1 
ATOM   1112  N  N3    . DT  D  2 12  ? -47.112  20.187  -5.334  1.00 35.53  ? 26   DT  H N3    1 
ATOM   1113  C  C4    . DT  D  2 12  ? -46.427  21.089  -4.552  1.00 37.76  ? 26   DT  H C4    1 
ATOM   1114  O  O4    . DT  D  2 12  ? -46.242  22.231  -4.963  1.00 40.34  ? 26   DT  H O4    1 
ATOM   1115  C  C5    . DT  D  2 12  ? -45.949  20.573  -3.283  1.00 37.87  ? 26   DT  H C5    1 
ATOM   1116  C  C7    . DT  D  2 12  ? -45.255  21.500  -2.332  1.00 36.84  ? 26   DT  H C7    1 
ATOM   1117  C  C6    . DT  D  2 12  ? -46.155  19.281  -3.015  1.00 36.76  ? 26   DT  H C6    1 
ATOM   1118  P  P     . DC  D  2 13  ? -44.659  13.291  -3.023  1.00 34.88  ? 27   DC  H P     1 
ATOM   1119  O  OP1   . DC  D  2 13  ? -44.885  12.103  -2.162  1.00 32.90  ? 27   DC  H OP1   1 
ATOM   1120  O  OP2   . DC  D  2 13  ? -43.538  14.212  -2.731  1.00 34.82  ? 27   DC  H OP2   1 
ATOM   1121  O  "O5'" . DC  D  2 13  ? -44.554  12.833  -4.535  1.00 32.62  ? 27   DC  H "O5'" 1 
ATOM   1122  C  "C5'" . DC  D  2 13  ? -45.715  12.744  -5.339  1.00 33.39  ? 27   DC  H "C5'" 1 
ATOM   1123  C  "C4'" . DC  D  2 13  ? -45.409  13.255  -6.722  1.00 36.59  ? 27   DC  H "C4'" 1 
ATOM   1124  O  "O4'" . DC  D  2 13  ? -45.645  14.682  -6.818  1.00 36.63  ? 27   DC  H "O4'" 1 
ATOM   1125  C  "C3'" . DC  D  2 13  ? -43.942  13.043  -7.094  1.00 39.90  ? 27   DC  H "C3'" 1 
ATOM   1126  O  "O3'" . DC  D  2 13  ? -43.793  12.486  -8.395  1.00 41.77  ? 27   DC  H "O3'" 1 
ATOM   1127  C  "C2'" . DC  D  2 13  ? -43.373  14.448  -7.101  1.00 40.74  ? 27   DC  H "C2'" 1 
ATOM   1128  C  "C1'" . DC  D  2 13  ? -44.572  15.253  -7.529  1.00 37.73  ? 27   DC  H "C1'" 1 
ATOM   1129  N  N1    . DC  D  2 13  ? -44.470  16.670  -7.174  1.00 39.78  ? 27   DC  H N1    1 
ATOM   1130  C  C2    . DC  D  2 13  ? -44.897  17.619  -8.092  1.00 40.31  ? 27   DC  H C2    1 
ATOM   1131  O  O2    . DC  D  2 13  ? -45.431  17.233  -9.135  1.00 42.65  ? 27   DC  H O2    1 
ATOM   1132  N  N3    . DC  D  2 13  ? -44.730  18.932  -7.817  1.00 39.68  ? 27   DC  H N3    1 
ATOM   1133  C  C4    . DC  D  2 13  ? -44.190  19.302  -6.656  1.00 40.10  ? 27   DC  H C4    1 
ATOM   1134  N  N4    . DC  D  2 13  ? -44.046  20.600  -6.418  1.00 39.54  ? 27   DC  H N4    1 
ATOM   1135  C  C5    . DC  D  2 13  ? -43.778  18.353  -5.683  1.00 41.04  ? 27   DC  H C5    1 
ATOM   1136  C  C6    . DC  D  2 13  ? -43.938  17.058  -5.978  1.00 41.61  ? 27   DC  H C6    1 
ATOM   1137  P  P     . DG  D  2 14  ? -42.384  11.836  -8.812  1.00 41.00  ? 28   DG  H P     1 
ATOM   1138  O  OP1   . DG  D  2 14  ? -42.232  10.569  -8.048  1.00 38.47  ? 28   DG  H OP1   1 
ATOM   1139  O  OP2   . DG  D  2 14  ? -41.327  12.896  -8.712  1.00 37.81  ? 28   DG  H OP2   1 
ATOM   1140  O  "O5'" . DG  D  2 14  ? -42.608  11.489  -10.346 1.00 40.01  ? 28   DG  H "O5'" 1 
ATOM   1141  C  "C5'" . DG  D  2 14  ? -41.649  11.863  -11.323 1.00 41.70  ? 28   DG  H "C5'" 1 
ATOM   1142  C  "C4'" . DG  D  2 14  ? -42.225  12.930  -12.218 1.00 42.59  ? 28   DG  H "C4'" 1 
ATOM   1143  O  "O4'" . DG  D  2 14  ? -42.540  14.093  -11.411 1.00 40.77  ? 28   DG  H "O4'" 1 
ATOM   1144  C  "C3'" . DG  D  2 14  ? -41.280  13.422  -13.313 1.00 44.16  ? 28   DG  H "C3'" 1 
ATOM   1145  O  "O3'" . DG  D  2 14  ? -42.106  13.752  -14.451 1.00 47.72  ? 28   DG  H "O3'" 1 
ATOM   1146  C  "C2'" . DG  D  2 14  ? -40.686  14.687  -12.710 1.00 42.91  ? 28   DG  H "C2'" 1 
ATOM   1147  C  "C1'" . DG  D  2 14  ? -41.858  15.238  -11.919 1.00 39.09  ? 28   DG  H "C1'" 1 
ATOM   1148  N  N9    . DG  D  2 14  ? -41.530  16.097  -10.784 1.00 35.54  ? 28   DG  H N9    1 
ATOM   1149  C  C8    . DG  D  2 14  ? -41.461  15.706  -9.466  1.00 35.18  ? 28   DG  H C8    1 
ATOM   1150  N  N7    . DG  D  2 14  ? -41.242  16.697  -8.644  1.00 32.53  ? 28   DG  H N7    1 
ATOM   1151  C  C5    . DG  D  2 14  ? -41.135  17.810  -9.467  1.00 31.95  ? 28   DG  H C5    1 
ATOM   1152  C  C6    . DG  D  2 14  ? -40.913  19.169  -9.134  1.00 31.85  ? 28   DG  H C6    1 
ATOM   1153  O  O6    . DG  D  2 14  ? -40.785  19.673  -8.011  1.00 32.90  ? 28   DG  H O6    1 
ATOM   1154  N  N1    . DG  D  2 14  ? -40.852  19.976  -10.269 1.00 30.18  ? 28   DG  H N1    1 
ATOM   1155  C  C2    . DG  D  2 14  ? -40.986  19.531  -11.562 1.00 28.99  ? 28   DG  H C2    1 
ATOM   1156  N  N2    . DG  D  2 14  ? -40.859  20.482  -12.515 1.00 22.28  ? 28   DG  H N2    1 
ATOM   1157  N  N3    . DG  D  2 14  ? -41.218  18.253  -11.892 1.00 29.29  ? 28   DG  H N3    1 
ATOM   1158  C  C4    . DG  D  2 14  ? -41.281  17.456  -10.798 1.00 32.20  ? 28   DG  H C4    1 
ATOM   1159  O  "O5'" . C   E  1 1   ? -70.125  63.955  -52.997 1.00 61.19  ? 1    C   K "O5'" 1 
ATOM   1160  C  "C5'" . C   E  1 1   ? -70.588  64.503  -54.236 1.00 63.22  ? 1    C   K "C5'" 1 
ATOM   1161  C  "C4'" . C   E  1 1   ? -69.583  64.397  -55.363 1.00 64.97  ? 1    C   K "C4'" 1 
ATOM   1162  O  "O4'" . C   E  1 1   ? -68.447  65.270  -55.099 1.00 64.49  ? 1    C   K "O4'" 1 
ATOM   1163  C  "C3'" . C   E  1 1   ? -68.966  63.021  -55.566 1.00 66.29  ? 1    C   K "C3'" 1 
ATOM   1164  O  "O3'" . C   E  1 1   ? -69.797  62.168  -56.354 1.00 68.75  ? 1    C   K "O3'" 1 
ATOM   1165  C  "C2'" . C   E  1 1   ? -67.660  63.365  -56.272 1.00 65.79  ? 1    C   K "C2'" 1 
ATOM   1166  O  "O2'" . C   E  1 1   ? -67.827  63.615  -57.654 1.00 67.37  ? 1    C   K "O2'" 1 
ATOM   1167  C  "C1'" . C   E  1 1   ? -67.250  64.646  -55.541 1.00 64.20  ? 1    C   K "C1'" 1 
ATOM   1168  N  N1    . C   E  1 1   ? -66.423  64.346  -54.361 1.00 62.92  ? 1    C   K N1    1 
ATOM   1169  C  C2    . C   E  1 1   ? -65.062  64.074  -54.539 1.00 62.85  ? 1    C   K C2    1 
ATOM   1170  O  O2    . C   E  1 1   ? -64.580  64.142  -55.683 1.00 62.83  ? 1    C   K O2    1 
ATOM   1171  N  N3    . C   E  1 1   ? -64.307  63.748  -53.460 1.00 62.00  ? 1    C   K N3    1 
ATOM   1172  C  C4    . C   E  1 1   ? -64.864  63.700  -52.244 1.00 60.56  ? 1    C   K C4    1 
ATOM   1173  N  N4    . C   E  1 1   ? -64.089  63.359  -51.204 1.00 58.61  ? 1    C   K N4    1 
ATOM   1174  C  C5    . C   E  1 1   ? -66.241  63.996  -52.037 1.00 60.40  ? 1    C   K C5    1 
ATOM   1175  C  C6    . C   E  1 1   ? -66.975  64.313  -53.110 1.00 61.82  ? 1    C   K C6    1 
ATOM   1176  P  P     . G   E  1 2   ? -69.611  60.570  -56.261 1.00 70.85  ? 2    G   K P     1 
ATOM   1177  O  OP1   . G   E  1 2   ? -70.443  59.924  -57.313 1.00 70.44  ? 2    G   K OP1   1 
ATOM   1178  O  OP2   . G   E  1 2   ? -69.791  60.174  -54.837 1.00 71.33  ? 2    G   K OP2   1 
ATOM   1179  O  "O5'" . G   E  1 2   ? -68.091  60.350  -56.677 1.00 69.07  ? 2    G   K "O5'" 1 
ATOM   1180  C  "C5'" . G   E  1 2   ? -67.643  60.696  -57.983 1.00 68.31  ? 2    G   K "C5'" 1 
ATOM   1181  C  "C4'" . G   E  1 2   ? -66.202  60.295  -58.160 1.00 67.77  ? 2    G   K "C4'" 1 
ATOM   1182  O  "O4'" . G   E  1 2   ? -65.356  61.093  -57.290 1.00 67.84  ? 2    G   K "O4'" 1 
ATOM   1183  C  "C3'" . G   E  1 2   ? -65.886  58.867  -57.763 1.00 66.45  ? 2    G   K "C3'" 1 
ATOM   1184  O  "O3'" . G   E  1 2   ? -66.224  57.970  -58.808 1.00 66.04  ? 2    G   K "O3'" 1 
ATOM   1185  C  "C2'" . G   E  1 2   ? -64.386  58.928  -57.506 1.00 66.14  ? 2    G   K "C2'" 1 
ATOM   1186  O  "O2'" . G   E  1 2   ? -63.625  58.844  -58.693 1.00 64.77  ? 2    G   K "O2'" 1 
ATOM   1187  C  "C1'" . G   E  1 2   ? -64.242  60.318  -56.877 1.00 66.96  ? 2    G   K "C1'" 1 
ATOM   1188  N  N9    . G   E  1 2   ? -64.221  60.298  -55.418 1.00 67.48  ? 2    G   K N9    1 
ATOM   1189  C  C8    . G   E  1 2   ? -65.227  60.679  -54.565 1.00 67.29  ? 2    G   K C8    1 
ATOM   1190  N  N7    . G   E  1 2   ? -64.906  60.548  -53.307 1.00 67.67  ? 2    G   K N7    1 
ATOM   1191  C  C5    . G   E  1 2   ? -63.611  60.053  -53.334 1.00 68.32  ? 2    G   K C5    1 
ATOM   1192  C  C6    . G   E  1 2   ? -62.735  59.719  -52.275 1.00 69.13  ? 2    G   K C6    1 
ATOM   1193  O  O6    . G   E  1 2   ? -62.936  59.794  -51.060 1.00 69.66  ? 2    G   K O6    1 
ATOM   1194  N  N1    . G   E  1 2   ? -61.512  59.254  -52.749 1.00 70.15  ? 2    G   K N1    1 
ATOM   1195  C  C2    . G   E  1 2   ? -61.176  59.125  -54.075 1.00 70.51  ? 2    G   K C2    1 
ATOM   1196  N  N2    . G   E  1 2   ? -59.946  58.657  -54.341 1.00 70.68  ? 2    G   K N2    1 
ATOM   1197  N  N3    . G   E  1 2   ? -61.987  59.433  -55.071 1.00 70.40  ? 2    G   K N3    1 
ATOM   1198  C  C4    . G   E  1 2   ? -63.177  59.889  -54.630 1.00 68.49  ? 2    G   K C4    1 
ATOM   1199  P  P     . A   E  1 3   ? -66.693  56.476  -58.449 1.00 66.54  ? 3    A   K P     1 
ATOM   1200  O  OP1   . A   E  1 3   ? -66.999  55.793  -59.735 1.00 66.87  ? 3    A   K OP1   1 
ATOM   1201  O  OP2   . A   E  1 3   ? -67.741  56.550  -57.396 1.00 66.49  ? 3    A   K OP2   1 
ATOM   1202  O  "O5'" . A   E  1 3   ? -65.365  55.829  -57.850 1.00 62.49  ? 3    A   K "O5'" 1 
ATOM   1203  C  "C5'" . A   E  1 3   ? -64.183  55.802  -58.633 1.00 58.57  ? 3    A   K "C5'" 1 
ATOM   1204  C  "C4'" . A   E  1 3   ? -63.013  55.334  -57.815 1.00 56.77  ? 3    A   K "C4'" 1 
ATOM   1205  O  "O4'" . A   E  1 3   ? -62.622  56.342  -56.857 1.00 58.41  ? 3    A   K "O4'" 1 
ATOM   1206  C  "C3'" . A   E  1 3   ? -63.243  54.120  -56.948 1.00 55.05  ? 3    A   K "C3'" 1 
ATOM   1207  O  "O3'" . A   E  1 3   ? -63.174  52.948  -57.713 1.00 55.34  ? 3    A   K "O3'" 1 
ATOM   1208  C  "C2'" . A   E  1 3   ? -62.067  54.202  -55.994 1.00 55.84  ? 3    A   K "C2'" 1 
ATOM   1209  O  "O2'" . A   E  1 3   ? -60.867  53.741  -56.575 1.00 53.53  ? 3    A   K "O2'" 1 
ATOM   1210  C  "C1'" . A   E  1 3   ? -61.998  55.710  -55.748 1.00 58.03  ? 3    A   K "C1'" 1 
ATOM   1211  N  N9    . A   E  1 3   ? -62.729  56.080  -54.539 1.00 59.45  ? 3    A   K N9    1 
ATOM   1212  C  C8    . A   E  1 3   ? -64.017  56.530  -54.433 1.00 58.45  ? 3    A   K C8    1 
ATOM   1213  N  N7    . A   E  1 3   ? -64.394  56.763  -53.203 1.00 58.52  ? 3    A   K N7    1 
ATOM   1214  C  C5    . A   E  1 3   ? -63.275  56.452  -52.447 1.00 59.31  ? 3    A   K C5    1 
ATOM   1215  C  C6    . A   E  1 3   ? -63.026  56.500  -51.072 1.00 60.03  ? 3    A   K C6    1 
ATOM   1216  N  N6    . A   E  1 3   ? -63.926  56.906  -50.175 1.00 61.26  ? 3    A   K N6    1 
ATOM   1217  N  N1    . A   E  1 3   ? -61.804  56.116  -50.639 1.00 60.84  ? 3    A   K N1    1 
ATOM   1218  C  C2    . A   E  1 3   ? -60.900  55.719  -51.541 1.00 60.68  ? 3    A   K C2    1 
ATOM   1219  N  N3    . A   E  1 3   ? -61.015  55.638  -52.862 1.00 61.37  ? 3    A   K N3    1 
ATOM   1220  C  C4    . A   E  1 3   ? -62.242  56.026  -53.256 1.00 60.16  ? 3    A   K C4    1 
ATOM   1221  P  P     . C   E  1 4   ? -63.878  51.623  -57.170 1.00 56.43  ? 4    C   K P     1 
ATOM   1222  O  OP1   . C   E  1 4   ? -63.855  50.652  -58.288 1.00 58.74  ? 4    C   K OP1   1 
ATOM   1223  O  OP2   . C   E  1 4   ? -65.172  51.984  -56.542 1.00 57.94  ? 4    C   K OP2   1 
ATOM   1224  O  "O5'" . C   E  1 4   ? -62.870  51.105  -56.060 1.00 55.54  ? 4    C   K "O5'" 1 
ATOM   1225  C  "C5'" . C   E  1 4   ? -61.604  50.604  -56.448 1.00 56.01  ? 4    C   K "C5'" 1 
ATOM   1226  C  "C4'" . C   E  1 4   ? -60.833  50.139  -55.249 1.00 55.00  ? 4    C   K "C4'" 1 
ATOM   1227  O  "O4'" . C   E  1 4   ? -60.445  51.282  -54.446 1.00 56.40  ? 4    C   K "O4'" 1 
ATOM   1228  C  "C3'" . C   E  1 4   ? -61.595  49.264  -54.280 1.00 53.37  ? 4    C   K "C3'" 1 
ATOM   1229  O  "O3'" . C   E  1 4   ? -61.641  47.928  -54.752 1.00 53.89  ? 4    C   K "O3'" 1 
ATOM   1230  C  "C2'" . C   E  1 4   ? -60.739  49.421  -53.037 1.00 53.79  ? 4    C   K "C2'" 1 
ATOM   1231  O  "O2'" . C   E  1 4   ? -59.514  48.741  -53.187 1.00 52.46  ? 4    C   K "O2'" 1 
ATOM   1232  C  "C1'" . C   E  1 4   ? -60.449  50.920  -53.077 1.00 56.48  ? 4    C   K "C1'" 1 
ATOM   1233  N  N1    . C   E  1 4   ? -61.462  51.741  -52.382 1.00 60.07  ? 4    C   K N1    1 
ATOM   1234  C  C2    . C   E  1 4   ? -61.365  51.904  -50.987 1.00 61.84  ? 4    C   K C2    1 
ATOM   1235  O  O2    . C   E  1 4   ? -60.428  51.363  -50.378 1.00 65.26  ? 4    C   K O2    1 
ATOM   1236  N  N3    . C   E  1 4   ? -62.294  52.647  -50.344 1.00 60.99  ? 4    C   K N3    1 
ATOM   1237  C  C4    . C   E  1 4   ? -63.283  53.219  -51.031 1.00 60.23  ? 4    C   K C4    1 
ATOM   1238  N  N4    . C   E  1 4   ? -64.168  53.943  -50.353 1.00 60.47  ? 4    C   K N4    1 
ATOM   1239  C  C5    . C   E  1 4   ? -63.406  53.073  -52.444 1.00 59.49  ? 4    C   K C5    1 
ATOM   1240  C  C6    . C   E  1 4   ? -62.483  52.333  -53.074 1.00 59.48  ? 4    C   K C6    1 
ATOM   1241  P  P     . A   E  1 5   ? -62.273  46.782  -53.826 1.00 55.30  ? 5    A   K P     1 
ATOM   1242  O  OP1   . A   E  1 5   ? -62.064  45.474  -54.502 1.00 54.75  ? 5    A   K OP1   1 
ATOM   1243  O  OP2   . A   E  1 5   ? -63.644  47.190  -53.421 1.00 54.32  ? 5    A   K OP2   1 
ATOM   1244  O  "O5'" . A   E  1 5   ? -61.324  46.808  -52.549 1.00 55.95  ? 5    A   K "O5'" 1 
ATOM   1245  C  "C5'" . A   E  1 5   ? -61.715  46.215  -51.320 1.00 56.06  ? 5    A   K "C5'" 1 
ATOM   1246  C  "C4'" . A   E  1 5   ? -60.910  46.801  -50.188 1.00 56.49  ? 5    A   K "C4'" 1 
ATOM   1247  O  "O4'" . A   E  1 5   ? -61.037  48.247  -50.201 1.00 56.22  ? 5    A   K "O4'" 1 
ATOM   1248  C  "C3'" . A   E  1 5   ? -61.354  46.370  -48.802 1.00 57.23  ? 5    A   K "C3'" 1 
ATOM   1249  O  "O3'" . A   E  1 5   ? -60.664  45.177  -48.457 1.00 58.61  ? 5    A   K "O3'" 1 
ATOM   1250  C  "C2'" . A   E  1 5   ? -60.902  47.539  -47.938 1.00 57.18  ? 5    A   K "C2'" 1 
ATOM   1251  O  "O2'" . A   E  1 5   ? -59.522  47.425  -47.643 1.00 58.63  ? 5    A   K "O2'" 1 
ATOM   1252  C  "C1'" . A   E  1 5   ? -61.131  48.731  -48.876 1.00 55.92  ? 5    A   K "C1'" 1 
ATOM   1253  N  N9    . A   E  1 5   ? -62.413  49.430  -48.747 1.00 55.01  ? 5    A   K N9    1 
ATOM   1254  C  C8    . A   E  1 5   ? -63.323  49.669  -49.751 1.00 53.85  ? 5    A   K C8    1 
ATOM   1255  N  N7    . A   E  1 5   ? -64.372  50.352  -49.366 1.00 53.56  ? 5    A   K N7    1 
ATOM   1256  C  C5    . A   E  1 5   ? -64.147  50.575  -48.015 1.00 55.43  ? 5    A   K C5    1 
ATOM   1257  C  C6    . A   E  1 5   ? -64.894  51.254  -47.027 1.00 54.68  ? 5    A   K C6    1 
ATOM   1258  N  N6    . A   E  1 5   ? -66.063  51.849  -47.258 1.00 54.15  ? 5    A   K N6    1 
ATOM   1259  N  N1    . A   E  1 5   ? -64.387  51.298  -45.778 1.00 54.40  ? 5    A   K N1    1 
ATOM   1260  C  C2    . A   E  1 5   ? -63.214  50.694  -45.540 1.00 55.77  ? 5    A   K C2    1 
ATOM   1261  N  N3    . A   E  1 5   ? -62.420  50.024  -46.380 1.00 56.33  ? 5    A   K N3    1 
ATOM   1262  C  C4    . A   E  1 5   ? -62.948  50.003  -47.617 1.00 55.87  ? 5    A   K C4    1 
ATOM   1263  P  P     . C   E  1 6   ? -61.393  44.059  -47.567 1.00 60.47  ? 6    C   K P     1 
ATOM   1264  O  OP1   . C   E  1 6   ? -60.375  43.005  -47.323 1.00 60.71  ? 6    C   K OP1   1 
ATOM   1265  O  OP2   . C   E  1 6   ? -62.692  43.691  -48.181 1.00 61.21  ? 6    C   K OP2   1 
ATOM   1266  O  "O5'" . C   E  1 6   ? -61.675  44.805  -46.191 1.00 60.69  ? 6    C   K "O5'" 1 
ATOM   1267  C  "C5'" . C   E  1 6   ? -60.598  45.101  -45.315 1.00 61.40  ? 6    C   K "C5'" 1 
ATOM   1268  C  "C4'" . C   E  1 6   ? -61.090  45.844  -44.103 1.00 60.21  ? 6    C   K "C4'" 1 
ATOM   1269  O  "O4'" . C   E  1 6   ? -61.558  47.165  -44.481 1.00 60.03  ? 6    C   K "O4'" 1 
ATOM   1270  C  "C3'" . C   E  1 6   ? -62.283  45.239  -43.400 1.00 59.01  ? 6    C   K "C3'" 1 
ATOM   1271  O  "O3'" . C   E  1 6   ? -61.898  44.169  -42.559 1.00 59.23  ? 6    C   K "O3'" 1 
ATOM   1272  C  "C2'" . C   E  1 6   ? -62.792  46.421  -42.594 1.00 59.29  ? 6    C   K "C2'" 1 
ATOM   1273  O  "O2'" . C   E  1 6   ? -62.023  46.630  -41.430 1.00 57.42  ? 6    C   K "O2'" 1 
ATOM   1274  C  "C1'" . C   E  1 6   ? -62.570  47.572  -43.579 1.00 59.90  ? 6    C   K "C1'" 1 
ATOM   1275  N  N1    . C   E  1 6   ? -63.775  47.877  -44.352 1.00 60.87  ? 6    C   K N1    1 
ATOM   1276  C  C2    . C   E  1 6   ? -64.805  48.571  -43.722 1.00 61.64  ? 6    C   K C2    1 
ATOM   1277  O  O2    . C   E  1 6   ? -64.652  48.920  -42.542 1.00 62.57  ? 6    C   K O2    1 
ATOM   1278  N  N3    . C   E  1 6   ? -65.935  48.847  -44.409 1.00 61.33  ? 6    C   K N3    1 
ATOM   1279  C  C4    . C   E  1 6   ? -66.051  48.461  -45.680 1.00 60.59  ? 6    C   K C4    1 
ATOM   1280  N  N4    . C   E  1 6   ? -67.182  48.755  -46.315 1.00 61.04  ? 6    C   K N4    1 
ATOM   1281  C  C5    . C   E  1 6   ? -65.009  47.758  -46.353 1.00 60.37  ? 6    C   K C5    1 
ATOM   1282  C  C6    . C   E  1 6   ? -63.897  47.488  -45.657 1.00 60.43  ? 6    C   K C6    1 
ATOM   1283  P  P     . C   E  1 7   ? -62.950  43.000  -42.262 1.00 60.06  ? 7    C   K P     1 
ATOM   1284  O  OP1   . C   E  1 7   ? -62.787  42.580  -40.847 1.00 60.52  ? 7    C   K OP1   1 
ATOM   1285  O  OP2   . C   E  1 7   ? -62.878  41.983  -43.342 1.00 59.64  ? 7    C   K OP2   1 
ATOM   1286  O  "O5'" . C   E  1 7   ? -64.338  43.755  -42.396 1.00 60.49  ? 7    C   K "O5'" 1 
ATOM   1287  C  "C5'" . C   E  1 7   ? -65.388  43.490  -41.493 1.00 63.87  ? 7    C   K "C5'" 1 
ATOM   1288  C  "C4'" . C   E  1 7   ? -65.715  44.732  -40.714 1.00 65.94  ? 7    C   K "C4'" 1 
ATOM   1289  O  "O4'" . C   E  1 7   ? -65.936  45.829  -41.632 1.00 66.13  ? 7    C   K "O4'" 1 
ATOM   1290  C  "C3'" . C   E  1 7   ? -66.986  44.625  -39.892 1.00 67.39  ? 7    C   K "C3'" 1 
ATOM   1291  O  "O3'" . C   E  1 7   ? -66.675  44.083  -38.611 1.00 68.83  ? 7    C   K "O3'" 1 
ATOM   1292  C  "C2'" . C   E  1 7   ? -67.451  46.072  -39.810 1.00 66.71  ? 7    C   K "C2'" 1 
ATOM   1293  O  "O2'" . C   E  1 7   ? -66.788  46.770  -38.782 1.00 66.39  ? 7    C   K "O2'" 1 
ATOM   1294  C  "C1'" . C   E  1 7   ? -67.011  46.621  -41.170 1.00 66.88  ? 7    C   K "C1'" 1 
ATOM   1295  N  N1    . C   E  1 7   ? -68.039  46.639  -42.224 1.00 68.29  ? 7    C   K N1    1 
ATOM   1296  C  C2    . C   E  1 7   ? -69.199  47.393  -42.028 1.00 68.00  ? 7    C   K C2    1 
ATOM   1297  O  O2    . C   E  1 7   ? -69.362  47.965  -40.946 1.00 66.73  ? 7    C   K O2    1 
ATOM   1298  N  N3    . C   E  1 7   ? -70.112  47.473  -43.026 1.00 68.85  ? 7    C   K N3    1 
ATOM   1299  C  C4    . C   E  1 7   ? -69.904  46.824  -44.177 1.00 69.64  ? 7    C   K C4    1 
ATOM   1300  N  N4    . C   E  1 7   ? -70.817  46.955  -45.148 1.00 70.33  ? 7    C   K N4    1 
ATOM   1301  C  C5    . C   E  1 7   ? -68.748  46.016  -44.388 1.00 69.13  ? 7    C   K C5    1 
ATOM   1302  C  C6    . C   E  1 7   ? -67.851  45.951  -43.393 1.00 68.84  ? 7    C   K C6    1 
ATOM   1303  P  P     . U   E  1 8   ? -67.600  42.928  -37.985 1.00 69.96  ? 8    U   K P     1 
ATOM   1304  O  OP1   . U   E  1 8   ? -66.937  42.452  -36.744 1.00 69.77  ? 8    U   K OP1   1 
ATOM   1305  O  OP2   . U   E  1 8   ? -67.917  41.958  -39.064 1.00 67.92  ? 8    U   K OP2   1 
ATOM   1306  O  "O5'" . U   E  1 8   ? -68.922  43.707  -37.563 1.00 70.15  ? 8    U   K "O5'" 1 
ATOM   1307  C  "C5'" . U   E  1 8   ? -68.885  44.645  -36.492 1.00 72.90  ? 8    U   K "C5'" 1 
ATOM   1308  C  "C4'" . U   E  1 8   ? -70.190  45.396  -36.398 1.00 74.50  ? 8    U   K "C4'" 1 
ATOM   1309  O  "O4'" . U   E  1 8   ? -70.337  46.283  -37.537 1.00 75.66  ? 8    U   K "O4'" 1 
ATOM   1310  C  "C3'" . U   E  1 8   ? -71.445  44.549  -36.464 1.00 75.19  ? 8    U   K "C3'" 1 
ATOM   1311  O  "O3'" . U   E  1 8   ? -71.741  43.923  -35.230 1.00 76.41  ? 8    U   K "O3'" 1 
ATOM   1312  C  "C2'" . U   E  1 8   ? -72.485  45.593  -36.827 1.00 75.08  ? 8    U   K "C2'" 1 
ATOM   1313  O  "O2'" . U   E  1 8   ? -72.828  46.401  -35.721 1.00 73.12  ? 8    U   K "O2'" 1 
ATOM   1314  C  "C1'" . U   E  1 8   ? -71.716  46.412  -37.862 1.00 75.75  ? 8    U   K "C1'" 1 
ATOM   1315  N  N1    . U   E  1 8   ? -71.934  45.898  -39.223 1.00 76.48  ? 8    U   K N1    1 
ATOM   1316  C  C2    . U   E  1 8   ? -72.960  46.462  -39.956 1.00 76.62  ? 8    U   K C2    1 
ATOM   1317  O  O2    . U   E  1 8   ? -73.653  47.368  -39.529 1.00 76.54  ? 8    U   K O2    1 
ATOM   1318  N  N3    . U   E  1 8   ? -73.143  45.932  -41.210 1.00 76.89  ? 8    U   K N3    1 
ATOM   1319  C  C4    . U   E  1 8   ? -72.418  44.917  -41.797 1.00 77.15  ? 8    U   K C4    1 
ATOM   1320  O  O4    . U   E  1 8   ? -72.710  44.543  -42.938 1.00 76.49  ? 8    U   K O4    1 
ATOM   1321  C  C5    . U   E  1 8   ? -71.366  44.389  -40.978 1.00 77.23  ? 8    U   K C5    1 
ATOM   1322  C  C6    . U   E  1 8   ? -71.164  44.886  -39.750 1.00 76.44  ? 8    U   K C6    1 
ATOM   1323  P  P     . G   E  1 9   ? -72.640  42.594  -35.220 1.00 76.74  ? 9    G   K P     1 
ATOM   1324  O  OP1   . G   E  1 9   ? -72.761  42.179  -33.802 1.00 77.09  ? 9    G   K OP1   1 
ATOM   1325  O  OP2   . G   E  1 9   ? -72.075  41.647  -36.217 1.00 75.53  ? 9    G   K OP2   1 
ATOM   1326  O  "O5'" . G   E  1 9   ? -74.062  43.099  -35.746 1.00 76.19  ? 9    G   K "O5'" 1 
ATOM   1327  C  "C5'" . G   E  1 9   ? -74.781  44.112  -35.037 1.00 75.34  ? 9    G   K "C5'" 1 
ATOM   1328  C  "C4'" . G   E  1 9   ? -76.097  44.423  -35.723 1.00 74.21  ? 9    G   K "C4'" 1 
ATOM   1329  O  "O4'" . G   E  1 9   ? -75.881  45.184  -36.945 1.00 73.99  ? 9    G   K "O4'" 1 
ATOM   1330  C  "C3'" . G   E  1 9   ? -76.907  43.232  -36.193 1.00 74.08  ? 9    G   K "C3'" 1 
ATOM   1331  O  "O3'" . G   E  1 9   ? -77.587  42.576  -35.133 1.00 74.88  ? 9    G   K "O3'" 1 
ATOM   1332  C  "C2'" . G   E  1 9   ? -77.839  43.882  -37.209 1.00 73.05  ? 9    G   K "C2'" 1 
ATOM   1333  O  "O2'" . G   E  1 9   ? -78.900  44.610  -36.624 1.00 71.40  ? 9    G   K "O2'" 1 
ATOM   1334  C  "C1'" . G   E  1 9   ? -76.870  44.836  -37.909 1.00 72.16  ? 9    G   K "C1'" 1 
ATOM   1335  N  N9    . G   E  1 9   ? -76.206  44.153  -39.014 1.00 70.60  ? 9    G   K N9    1 
ATOM   1336  C  C8    . G   E  1 9   ? -75.073  43.381  -38.940 1.00 70.08  ? 9    G   K C8    1 
ATOM   1337  N  N7    . G   E  1 9   ? -74.745  42.843  -40.082 1.00 69.90  ? 9    G   K N7    1 
ATOM   1338  C  C5    . G   E  1 9   ? -75.711  43.298  -40.966 1.00 69.23  ? 9    G   K C5    1 
ATOM   1339  C  C6    . G   E  1 9   ? -75.879  43.042  -42.349 1.00 68.73  ? 9    G   K C6    1 
ATOM   1340  O  O6    . G   E  1 9   ? -75.195  42.320  -43.086 1.00 67.53  ? 9    G   K O6    1 
ATOM   1341  N  N1    . G   E  1 9   ? -76.981  43.721  -42.864 1.00 69.34  ? 9    G   K N1    1 
ATOM   1342  C  C2    . G   E  1 9   ? -77.822  44.532  -42.136 1.00 69.66  ? 9    G   K C2    1 
ATOM   1343  N  N2    . G   E  1 9   ? -78.833  45.102  -42.808 1.00 67.73  ? 9    G   K N2    1 
ATOM   1344  N  N3    . G   E  1 9   ? -77.680  44.768  -40.840 1.00 70.36  ? 9    G   K N3    1 
ATOM   1345  C  C4    . G   E  1 9   ? -76.611  44.123  -40.325 1.00 69.94  ? 9    G   K C4    1 
ATOM   1346  P  P     . A   E  1 10  ? -78.212  41.120  -35.387 1.00 74.26  ? 10   A   K P     1 
ATOM   1347  O  OP1   . A   E  1 10  ? -78.508  40.491  -34.069 1.00 73.03  ? 10   A   K OP1   1 
ATOM   1348  O  OP2   . A   E  1 10  ? -77.355  40.398  -36.373 1.00 72.37  ? 10   A   K OP2   1 
ATOM   1349  O  "O5'" . A   E  1 10  ? -79.590  41.467  -36.098 1.00 72.46  ? 10   A   K "O5'" 1 
ATOM   1350  C  "C5'" . A   E  1 10  ? -80.173  40.560  -37.008 1.00 71.59  ? 10   A   K "C5'" 1 
ATOM   1351  C  "C4'" . A   E  1 10  ? -80.848  41.305  -38.128 1.00 69.93  ? 10   A   K "C4'" 1 
ATOM   1352  O  "O4'" . A   E  1 10  ? -79.864  42.000  -38.941 1.00 70.54  ? 10   A   K "O4'" 1 
ATOM   1353  C  "C3'" . A   E  1 10  ? -81.539  40.382  -39.107 1.00 68.41  ? 10   A   K "C3'" 1 
ATOM   1354  O  "O3'" . A   E  1 10  ? -82.794  40.042  -38.559 1.00 64.76  ? 10   A   K "O3'" 1 
ATOM   1355  C  "C2'" . A   E  1 10  ? -81.607  41.240  -40.360 1.00 68.35  ? 10   A   K "C2'" 1 
ATOM   1356  O  "O2'" . A   E  1 10  ? -82.633  42.213  -40.280 1.00 67.98  ? 10   A   K "O2'" 1 
ATOM   1357  C  "C1'" . A   E  1 10  ? -80.231  41.914  -40.314 1.00 68.27  ? 10   A   K "C1'" 1 
ATOM   1358  N  N9    . A   E  1 10  ? -79.184  41.162  -41.007 1.00 65.98  ? 10   A   K N9    1 
ATOM   1359  C  C8    . A   E  1 10  ? -78.099  40.540  -40.443 1.00 66.04  ? 10   A   K C8    1 
ATOM   1360  N  N7    . A   E  1 10  ? -77.328  39.929  -41.308 1.00 65.35  ? 10   A   K N7    1 
ATOM   1361  C  C5    . A   E  1 10  ? -77.945  40.163  -42.525 1.00 64.70  ? 10   A   K C5    1 
ATOM   1362  C  C6    . A   E  1 10  ? -77.623  39.775  -43.836 1.00 64.74  ? 10   A   K C6    1 
ATOM   1363  N  N6    . A   E  1 10  ? -76.554  39.036  -44.153 1.00 64.04  ? 10   A   K N6    1 
ATOM   1364  N  N1    . A   E  1 10  ? -78.448  40.177  -44.827 1.00 64.93  ? 10   A   K N1    1 
ATOM   1365  C  C2    . A   E  1 10  ? -79.516  40.923  -44.510 1.00 64.89  ? 10   A   K C2    1 
ATOM   1366  N  N3    . A   E  1 10  ? -79.922  41.352  -43.316 1.00 64.63  ? 10   A   K N3    1 
ATOM   1367  C  C4    . A   E  1 10  ? -79.086  40.929  -42.356 1.00 64.90  ? 10   A   K C4    1 
ATOM   1368  P  P     . U   E  1 11  ? -82.957  38.641  -37.808 1.00 61.16  ? 11   U   K P     1 
ATOM   1369  O  OP1   . U   E  1 11  ? -83.646  38.889  -36.520 1.00 59.38  ? 11   U   K OP1   1 
ATOM   1370  O  OP2   . U   E  1 11  ? -81.647  37.948  -37.821 1.00 60.86  ? 11   U   K OP2   1 
ATOM   1371  O  "O5'" . U   E  1 11  ? -83.933  37.874  -38.787 1.00 60.52  ? 11   U   K "O5'" 1 
ATOM   1372  C  "C5'" . U   E  1 11  ? -84.964  38.589  -39.429 1.00 59.85  ? 11   U   K "C5'" 1 
ATOM   1373  C  "C4'" . U   E  1 11  ? -85.093  38.144  -40.851 1.00 60.27  ? 11   U   K "C4'" 1 
ATOM   1374  O  "O4'" . U   E  1 11  ? -84.100  38.776  -41.695 1.00 61.10  ? 11   U   K "O4'" 1 
ATOM   1375  C  "C3'" . U   E  1 11  ? -84.835  36.678  -41.106 1.00 60.87  ? 11   U   K "C3'" 1 
ATOM   1376  O  "O3'" . U   E  1 11  ? -85.893  35.859  -40.635 1.00 62.60  ? 11   U   K "O3'" 1 
ATOM   1377  C  "C2'" . U   E  1 11  ? -84.702  36.677  -42.620 1.00 61.09  ? 11   U   K "C2'" 1 
ATOM   1378  O  "O2'" . U   E  1 11  ? -85.956  36.771  -43.256 1.00 61.00  ? 11   U   K "O2'" 1 
ATOM   1379  C  "C1'" . U   E  1 11  ? -83.908  37.968  -42.848 1.00 61.72  ? 11   U   K "C1'" 1 
ATOM   1380  N  N1    . U   E  1 11  ? -82.476  37.684  -43.003 1.00 62.89  ? 11   U   K N1    1 
ATOM   1381  C  C2    . U   E  1 11  ? -82.063  37.187  -44.228 1.00 63.77  ? 11   U   K C2    1 
ATOM   1382  O  O2    . U   E  1 11  ? -82.824  37.035  -45.170 1.00 64.54  ? 11   U   K O2    1 
ATOM   1383  N  N3    . U   E  1 11  ? -80.728  36.872  -44.308 1.00 63.31  ? 11   U   K N3    1 
ATOM   1384  C  C4    . U   E  1 11  ? -79.783  37.007  -43.312 1.00 62.89  ? 11   U   K C4    1 
ATOM   1385  O  O4    . U   E  1 11  ? -78.640  36.587  -43.504 1.00 62.70  ? 11   U   K O4    1 
ATOM   1386  C  C5    . U   E  1 11  ? -80.283  37.562  -42.084 1.00 62.88  ? 11   U   K C5    1 
ATOM   1387  C  C6    . U   E  1 11  ? -81.581  37.875  -41.975 1.00 62.55  ? 11   U   K C6    1 
ATOM   1388  P  P     . U   E  1 12  ? -85.591  34.329  -40.236 1.00 65.04  ? 12   U   K P     1 
ATOM   1389  O  OP1   . U   E  1 12  ? -86.670  33.842  -39.332 1.00 63.98  ? 12   U   K OP1   1 
ATOM   1390  O  OP2   . U   E  1 12  ? -84.168  34.238  -39.796 1.00 65.61  ? 12   U   K OP2   1 
ATOM   1391  O  "O5'" . U   E  1 12  ? -85.740  33.576  -41.629 1.00 62.86  ? 12   U   K "O5'" 1 
ATOM   1392  C  "C5'" . U   E  1 12  ? -86.779  33.938  -42.526 1.00 59.87  ? 12   U   K "C5'" 1 
ATOM   1393  C  "C4'" . U   E  1 12  ? -86.445  33.481  -43.913 1.00 57.75  ? 12   U   K "C4'" 1 
ATOM   1394  O  "O4'" . U   E  1 12  ? -85.386  34.293  -44.472 1.00 58.59  ? 12   U   K "O4'" 1 
ATOM   1395  C  "C3'" . U   E  1 12  ? -85.905  32.074  -43.974 1.00 56.89  ? 12   U   K "C3'" 1 
ATOM   1396  O  "O3'" . U   E  1 12  ? -86.983  31.165  -43.946 1.00 56.47  ? 12   U   K "O3'" 1 
ATOM   1397  C  "C2'" . U   E  1 12  ? -85.155  32.077  -45.298 1.00 57.62  ? 12   U   K "C2'" 1 
ATOM   1398  O  "O2'" . U   E  1 12  ? -85.994  31.903  -46.418 1.00 57.33  ? 12   U   K "O2'" 1 
ATOM   1399  C  "C1'" . U   E  1 12  ? -84.573  33.492  -45.312 1.00 59.20  ? 12   U   K "C1'" 1 
ATOM   1400  N  N1    . U   E  1 12  ? -83.198  33.552  -44.803 1.00 60.46  ? 12   U   K N1    1 
ATOM   1401  C  C2    . U   E  1 12  ? -82.188  33.114  -45.627 1.00 60.12  ? 12   U   K C2    1 
ATOM   1402  O  O2    . U   E  1 12  ? -82.394  32.667  -46.735 1.00 59.27  ? 12   U   K O2    1 
ATOM   1403  N  N3    . U   E  1 12  ? -80.925  33.213  -45.098 1.00 61.03  ? 12   U   K N3    1 
ATOM   1404  C  C4    . U   E  1 12  ? -80.584  33.700  -43.851 1.00 61.30  ? 12   U   K C4    1 
ATOM   1405  O  O4    . U   E  1 12  ? -79.397  33.799  -43.539 1.00 61.32  ? 12   U   K O4    1 
ATOM   1406  C  C5    . U   E  1 12  ? -81.691  34.120  -43.057 1.00 61.78  ? 12   U   K C5    1 
ATOM   1407  C  C6    . U   E  1 12  ? -82.929  34.034  -43.548 1.00 61.42  ? 12   U   K C6    1 
ATOM   1408  P  P     . C   E  1 13  ? -86.686  29.598  -43.939 1.00 57.91  ? 13   C   K P     1 
ATOM   1409  O  OP1   . C   E  1 13  ? -87.950  28.874  -43.640 1.00 59.26  ? 13   C   K OP1   1 
ATOM   1410  O  OP2   . C   E  1 13  ? -85.494  29.371  -43.085 1.00 57.67  ? 13   C   K OP2   1 
ATOM   1411  O  "O5'" . C   E  1 13  ? -86.316  29.297  -45.457 1.00 58.06  ? 13   C   K "O5'" 1 
ATOM   1412  C  "C5'" . C   E  1 13  ? -85.762  28.049  -45.826 1.00 58.38  ? 13   C   K "C5'" 1 
ATOM   1413  C  "C4'" . C   E  1 13  ? -84.835  28.222  -46.994 1.00 58.11  ? 13   C   K "C4'" 1 
ATOM   1414  O  "O4'" . C   E  1 13  ? -84.157  29.495  -46.891 1.00 58.95  ? 13   C   K "O4'" 1 
ATOM   1415  C  "C3'" . C   E  1 13  ? -83.723  27.199  -47.026 1.00 58.93  ? 13   C   K "C3'" 1 
ATOM   1416  O  "O3'" . C   E  1 13  ? -84.168  26.044  -47.696 1.00 59.99  ? 13   C   K "O3'" 1 
ATOM   1417  C  "C2'" . C   E  1 13  ? -82.650  27.922  -47.815 1.00 59.70  ? 13   C   K "C2'" 1 
ATOM   1418  O  "O2'" . C   E  1 13  ? -82.922  27.917  -49.200 1.00 60.62  ? 13   C   K "O2'" 1 
ATOM   1419  C  "C1'" . C   E  1 13  ? -82.806  29.342  -47.278 1.00 60.28  ? 13   C   K "C1'" 1 
ATOM   1420  N  N1    . C   E  1 13  ? -81.966  29.646  -46.112 1.00 62.03  ? 13   C   K N1    1 
ATOM   1421  C  C2    . C   E  1 13  ? -80.586  29.449  -46.195 1.00 63.26  ? 13   C   K C2    1 
ATOM   1422  O  O2    . C   E  1 13  ? -80.109  28.964  -47.231 1.00 63.93  ? 13   C   K O2    1 
ATOM   1423  N  N3    . C   E  1 13  ? -79.809  29.784  -45.143 1.00 63.98  ? 13   C   K N3    1 
ATOM   1424  C  C4    . C   E  1 13  ? -80.363  30.281  -44.037 1.00 64.25  ? 13   C   K C4    1 
ATOM   1425  N  N4    . C   E  1 13  ? -79.560  30.602  -43.027 1.00 65.09  ? 13   C   K N4    1 
ATOM   1426  C  C5    . C   E  1 13  ? -81.767  30.469  -43.917 1.00 63.91  ? 13   C   K C5    1 
ATOM   1427  C  C6    . C   E  1 13  ? -82.524  30.138  -44.967 1.00 63.18  ? 13   C   K C6    1 
ATOM   1428  P  P     . C   E  1 14  ? -85.098  24.998  -46.923 1.00 60.81  ? 14   C   K P     1 
ATOM   1429  O  OP1   . C   E  1 14  ? -86.477  25.247  -47.400 1.00 60.76  ? 14   C   K OP1   1 
ATOM   1430  O  OP2   . C   E  1 14  ? -84.797  25.076  -45.465 1.00 60.29  ? 14   C   K OP2   1 
ATOM   1431  O  "O5'" . C   E  1 14  ? -84.609  23.587  -47.479 1.00 61.92  ? 14   C   K "O5'" 1 
ATOM   1432  C  "C5'" . C   E  1 14  ? -83.567  22.857  -46.826 1.00 62.42  ? 14   C   K "C5'" 1 
ATOM   1433  C  "C4'" . C   E  1 14  ? -82.298  22.909  -47.641 1.00 61.81  ? 14   C   K "C4'" 1 
ATOM   1434  O  "O4'" . C   E  1 14  ? -81.857  24.289  -47.717 1.00 61.96  ? 14   C   K "O4'" 1 
ATOM   1435  C  "C3'" . C   E  1 14  ? -81.121  22.165  -47.031 1.00 61.86  ? 14   C   K "C3'" 1 
ATOM   1436  O  "O3'" . C   E  1 14  ? -81.132  20.755  -47.252 1.00 60.98  ? 14   C   K "O3'" 1 
ATOM   1437  C  "C2'" . C   E  1 14  ? -79.930  22.915  -47.608 1.00 63.56  ? 14   C   K "C2'" 1 
ATOM   1438  O  "O2'" . C   E  1 14  ? -79.598  22.561  -48.941 1.00 62.07  ? 14   C   K "O2'" 1 
ATOM   1439  C  "C1'" . C   E  1 14  ? -80.451  24.351  -47.551 1.00 64.11  ? 14   C   K "C1'" 1 
ATOM   1440  N  N1    . C   E  1 14  ? -80.179  25.008  -46.262 1.00 66.25  ? 14   C   K N1    1 
ATOM   1441  C  C2    . C   E  1 14  ? -78.863  25.344  -45.949 1.00 67.21  ? 14   C   K C2    1 
ATOM   1442  O  O2    . C   E  1 14  ? -77.963  25.032  -46.746 1.00 68.99  ? 14   C   K O2    1 
ATOM   1443  N  N3    . C   E  1 14  ? -78.602  25.998  -44.790 1.00 66.88  ? 14   C   K N3    1 
ATOM   1444  C  C4    . C   E  1 14  ? -79.600  26.311  -43.962 1.00 65.90  ? 14   C   K C4    1 
ATOM   1445  N  N4    . C   E  1 14  ? -79.299  26.994  -42.854 1.00 65.21  ? 14   C   K N4    1 
ATOM   1446  C  C5    . C   E  1 14  ? -80.949  25.948  -44.240 1.00 66.31  ? 14   C   K C5    1 
ATOM   1447  C  C6    . C   E  1 14  ? -81.192  25.302  -45.390 1.00 66.60  ? 14   C   K C6    1 
ATOM   1448  O  "O5'" . DG  F  2 1   ? -70.732  25.894  -44.345 1.00 124.94 ? 15   DG  L "O5'" 1 
ATOM   1449  C  "C5'" . DG  F  2 1   ? -69.676  26.566  -45.016 1.00 124.25 ? 15   DG  L "C5'" 1 
ATOM   1450  C  "C4'" . DG  F  2 1   ? -69.797  28.055  -44.794 1.00 123.19 ? 15   DG  L "C4'" 1 
ATOM   1451  O  "O4'" . DG  F  2 1   ? -71.159  28.314  -44.362 1.00 125.06 ? 15   DG  L "O4'" 1 
ATOM   1452  C  "C3'" . DG  F  2 1   ? -68.882  28.670  -43.728 1.00 120.56 ? 15   DG  L "C3'" 1 
ATOM   1453  O  "O3'" . DG  F  2 1   ? -67.754  29.363  -44.285 1.00 113.87 ? 15   DG  L "O3'" 1 
ATOM   1454  C  "C2'" . DG  F  2 1   ? -69.789  29.517  -42.843 1.00 122.27 ? 15   DG  L "C2'" 1 
ATOM   1455  C  "C1'" . DG  F  2 1   ? -71.211  29.335  -43.378 1.00 124.51 ? 15   DG  L "C1'" 1 
ATOM   1456  N  N9    . DG  F  2 1   ? -72.146  28.921  -42.323 1.00 124.70 ? 15   DG  L N9    1 
ATOM   1457  C  C8    . DG  F  2 1   ? -71.902  29.022  -40.975 1.00 124.65 ? 15   DG  L C8    1 
ATOM   1458  N  N7    . DG  F  2 1   ? -72.894  28.611  -40.236 1.00 124.51 ? 15   DG  L N7    1 
ATOM   1459  C  C5    . DG  F  2 1   ? -73.863  28.205  -41.144 1.00 124.69 ? 15   DG  L C5    1 
ATOM   1460  C  C6    . DG  F  2 1   ? -75.169  27.668  -40.918 1.00 124.73 ? 15   DG  L C6    1 
ATOM   1461  O  O6    . DG  F  2 1   ? -75.743  27.441  -39.839 1.00 124.89 ? 15   DG  L O6    1 
ATOM   1462  N  N1    . DG  F  2 1   ? -75.819  27.394  -42.115 1.00 123.78 ? 15   DG  L N1    1 
ATOM   1463  C  C2    . DG  F  2 1   ? -75.293  27.608  -43.366 1.00 123.26 ? 15   DG  L C2    1 
ATOM   1464  N  N2    . DG  F  2 1   ? -76.082  27.282  -44.393 1.00 122.88 ? 15   DG  L N2    1 
ATOM   1465  N  N3    . DG  F  2 1   ? -74.082  28.106  -43.594 1.00 123.49 ? 15   DG  L N3    1 
ATOM   1466  C  C4    . DG  F  2 1   ? -73.424  28.382  -42.444 1.00 124.40 ? 15   DG  L C4    1 
ATOM   1467  P  P     . DG  F  2 2   ? -67.957  30.727  -45.094 1.00 109.26 ? 16   DG  L P     1 
ATOM   1468  O  OP1   . DG  F  2 2   ? -66.686  30.994  -45.827 1.00 109.91 ? 16   DG  L OP1   1 
ATOM   1469  O  OP2   . DG  F  2 2   ? -68.519  31.768  -44.190 1.00 108.31 ? 16   DG  L OP2   1 
ATOM   1470  O  "O5'" . DG  F  2 2   ? -69.053  30.338  -46.176 1.00 104.37 ? 16   DG  L "O5'" 1 
ATOM   1471  C  "C5'" . DG  F  2 2   ? -68.845  29.243  -47.067 1.00 96.99  ? 16   DG  L "C5'" 1 
ATOM   1472  C  "C4'" . DG  F  2 2   ? -69.913  29.253  -48.127 1.00 91.99  ? 16   DG  L "C4'" 1 
ATOM   1473  O  "O4'" . DG  F  2 2   ? -71.217  29.118  -47.501 1.00 91.22  ? 16   DG  L "O4'" 1 
ATOM   1474  C  "C3'" . DG  F  2 2   ? -69.929  30.584  -48.867 1.00 89.21  ? 16   DG  L "C3'" 1 
ATOM   1475  O  "O3'" . DG  F  2 2   ? -69.927  30.369  -50.264 1.00 85.25  ? 16   DG  L "O3'" 1 
ATOM   1476  C  "C2'" . DG  F  2 2   ? -71.201  31.278  -48.406 1.00 89.13  ? 16   DG  L "C2'" 1 
ATOM   1477  C  "C1'" . DG  F  2 2   ? -72.100  30.150  -47.924 1.00 89.48  ? 16   DG  L "C1'" 1 
ATOM   1478  N  N9    . DG  F  2 2   ? -72.885  30.573  -46.766 1.00 87.96  ? 16   DG  L N9    1 
ATOM   1479  C  C8    . DG  F  2 2   ? -72.399  31.301  -45.714 1.00 88.27  ? 16   DG  L C8    1 
ATOM   1480  N  N7    . DG  F  2 2   ? -73.307  31.599  -44.828 1.00 88.32  ? 16   DG  L N7    1 
ATOM   1481  C  C5    . DG  F  2 2   ? -74.470  31.022  -45.315 1.00 87.46  ? 16   DG  L C5    1 
ATOM   1482  C  C6    . DG  F  2 2   ? -75.783  31.024  -44.777 1.00 87.32  ? 16   DG  L C6    1 
ATOM   1483  O  O6    . DG  F  2 2   ? -76.186  31.552  -43.732 1.00 87.21  ? 16   DG  L O6    1 
ATOM   1484  N  N1    . DG  F  2 2   ? -76.667  30.325  -45.588 1.00 86.48  ? 16   DG  L N1    1 
ATOM   1485  C  C2    . DG  F  2 2   ? -76.328  29.697  -46.761 1.00 86.29  ? 16   DG  L C2    1 
ATOM   1486  N  N2    . DG  F  2 2   ? -77.318  29.058  -47.388 1.00 86.30  ? 16   DG  L N2    1 
ATOM   1487  N  N3    . DG  F  2 2   ? -75.106  29.693  -47.279 1.00 86.43  ? 16   DG  L N3    1 
ATOM   1488  C  C4    . DG  F  2 2   ? -74.231  30.371  -46.508 1.00 87.05  ? 16   DG  L C4    1 
ATOM   1489  P  P     . DA  F  2 3   ? -70.150  31.610  -51.239 1.00 82.43  ? 17   DA  L P     1 
ATOM   1490  O  OP1   . DA  F  2 3   ? -69.146  31.538  -52.335 1.00 82.98  ? 17   DA  L OP1   1 
ATOM   1491  O  OP2   . DA  F  2 3   ? -70.287  32.857  -50.439 1.00 80.78  ? 17   DA  L OP2   1 
ATOM   1492  O  "O5'" . DA  F  2 3   ? -71.582  31.316  -51.824 1.00 79.17  ? 17   DA  L "O5'" 1 
ATOM   1493  C  "C5'" . DA  F  2 3   ? -72.553  32.321  -51.795 1.00 76.59  ? 17   DA  L "C5'" 1 
ATOM   1494  C  "C4'" . DA  F  2 3   ? -73.898  31.724  -52.087 1.00 74.98  ? 17   DA  L "C4'" 1 
ATOM   1495  O  "O4'" . DA  F  2 3   ? -74.473  31.260  -50.845 1.00 76.21  ? 17   DA  L "O4'" 1 
ATOM   1496  C  "C3'" . DA  F  2 3   ? -74.822  32.794  -52.630 1.00 74.03  ? 17   DA  L "C3'" 1 
ATOM   1497  O  "O3'" . DA  F  2 3   ? -75.238  32.472  -53.941 1.00 71.23  ? 17   DA  L "O3'" 1 
ATOM   1498  C  "C2'" . DA  F  2 3   ? -75.939  32.951  -51.617 1.00 75.57  ? 17   DA  L "C2'" 1 
ATOM   1499  C  "C1'" . DA  F  2 3   ? -75.748  31.841  -50.605 1.00 76.67  ? 17   DA  L "C1'" 1 
ATOM   1500  N  N9    . DA  F  2 3   ? -75.745  32.411  -49.255 1.00 77.98  ? 17   DA  L N9    1 
ATOM   1501  C  C8    . DA  F  2 3   ? -74.684  32.874  -48.513 1.00 77.47  ? 17   DA  L C8    1 
ATOM   1502  N  N7    . DA  F  2 3   ? -75.032  33.390  -47.358 1.00 76.82  ? 17   DA  L N7    1 
ATOM   1503  C  C5    . DA  F  2 3   ? -76.412  33.246  -47.334 1.00 77.91  ? 17   DA  L C5    1 
ATOM   1504  C  C6    . DA  F  2 3   ? -77.380  33.602  -46.389 1.00 78.22  ? 17   DA  L C6    1 
ATOM   1505  N  N6    . DA  F  2 3   ? -77.099  34.236  -45.244 1.00 79.01  ? 17   DA  L N6    1 
ATOM   1506  N  N1    . DA  F  2 3   ? -78.668  33.299  -46.666 1.00 77.96  ? 17   DA  L N1    1 
ATOM   1507  C  C2    . DA  F  2 3   ? -78.950  32.700  -47.826 1.00 77.36  ? 17   DA  L C2    1 
ATOM   1508  N  N3    . DA  F  2 3   ? -78.131  32.330  -48.801 1.00 77.92  ? 17   DA  L N3    1 
ATOM   1509  C  C4    . DA  F  2 3   ? -76.861  32.631  -48.488 1.00 78.16  ? 17   DA  L C4    1 
ATOM   1510  P  P     . DA  F  2 4   ? -75.233  33.630  -55.039 1.00 69.26  ? 18   DA  L P     1 
ATOM   1511  O  OP1   . DA  F  2 4   ? -75.464  33.008  -56.371 1.00 69.27  ? 18   DA  L OP1   1 
ATOM   1512  O  OP2   . DA  F  2 4   ? -74.025  34.462  -54.815 1.00 68.35  ? 18   DA  L OP2   1 
ATOM   1513  O  "O5'" . DA  F  2 4   ? -76.503  34.480  -54.593 1.00 66.46  ? 18   DA  L "O5'" 1 
ATOM   1514  C  "C5'" . DA  F  2 4   ? -77.695  33.813  -54.193 1.00 60.72  ? 18   DA  L "C5'" 1 
ATOM   1515  C  "C4'" . DA  F  2 4   ? -78.619  34.755  -53.463 1.00 57.68  ? 18   DA  L "C4'" 1 
ATOM   1516  O  "O4'" . DA  F  2 4   ? -78.441  34.687  -52.029 1.00 56.11  ? 18   DA  L "O4'" 1 
ATOM   1517  C  "C3'" . DA  F  2 4   ? -78.515  36.226  -53.854 1.00 57.17  ? 18   DA  L "C3'" 1 
ATOM   1518  O  "O3'" . DA  F  2 4   ? -79.745  36.659  -54.410 1.00 59.14  ? 18   DA  L "O3'" 1 
ATOM   1519  C  "C2'" . DA  F  2 4   ? -78.270  36.949  -52.538 1.00 56.24  ? 18   DA  L "C2'" 1 
ATOM   1520  C  "C1'" . DA  F  2 4   ? -78.735  35.955  -51.488 1.00 55.88  ? 18   DA  L "C1'" 1 
ATOM   1521  N  N9    . DA  F  2 4   ? -78.005  36.094  -50.234 1.00 54.80  ? 18   DA  L N9    1 
ATOM   1522  C  C8    . DA  F  2 4   ? -76.656  36.232  -50.104 1.00 55.18  ? 18   DA  L C8    1 
ATOM   1523  N  N7    . DA  F  2 4   ? -76.261  36.445  -48.878 1.00 53.50  ? 18   DA  L N7    1 
ATOM   1524  C  C5    . DA  F  2 4   ? -77.430  36.424  -48.144 1.00 52.78  ? 18   DA  L C5    1 
ATOM   1525  C  C6    . DA  F  2 4   ? -77.684  36.606  -46.781 1.00 53.41  ? 18   DA  L C6    1 
ATOM   1526  N  N6    . DA  F  2 4   ? -76.734  36.873  -45.879 1.00 51.76  ? 18   DA  L N6    1 
ATOM   1527  N  N1    . DA  F  2 4   ? -78.966  36.507  -46.364 1.00 54.98  ? 18   DA  L N1    1 
ATOM   1528  C  C2    . DA  F  2 4   ? -79.917  36.244  -47.273 1.00 54.99  ? 18   DA  L C2    1 
ATOM   1529  N  N3    . DA  F  2 4   ? -79.798  36.063  -48.587 1.00 55.51  ? 18   DA  L N3    1 
ATOM   1530  C  C4    . DA  F  2 4   ? -78.513  36.174  -48.963 1.00 54.29  ? 18   DA  L C4    1 
ATOM   1531  P  P     . DT  F  2 5   ? -79.778  37.971  -55.330 1.00 59.71  ? 19   DT  L P     1 
ATOM   1532  O  OP1   . DT  F  2 5   ? -80.977  37.826  -56.186 1.00 59.68  ? 19   DT  L OP1   1 
ATOM   1533  O  OP2   . DT  F  2 5   ? -78.455  38.207  -55.962 1.00 59.85  ? 19   DT  L OP2   1 
ATOM   1534  O  "O5'" . DT  F  2 5   ? -79.998  39.134  -54.270 1.00 58.83  ? 19   DT  L "O5'" 1 
ATOM   1535  C  "C5'" . DT  F  2 5   ? -78.887  39.812  -53.695 1.00 58.28  ? 19   DT  L "C5'" 1 
ATOM   1536  C  "C4'" . DT  F  2 5   ? -79.377  40.840  -52.708 1.00 59.20  ? 19   DT  L "C4'" 1 
ATOM   1537  O  "O4'" . DT  F  2 5   ? -79.392  40.240  -51.389 1.00 60.92  ? 19   DT  L "O4'" 1 
ATOM   1538  C  "C3'" . DT  F  2 5   ? -78.475  42.068  -52.615 1.00 60.19  ? 19   DT  L "C3'" 1 
ATOM   1539  O  "O3'" . DT  F  2 5   ? -79.162  43.237  -53.019 1.00 58.92  ? 19   DT  L "O3'" 1 
ATOM   1540  C  "C2'" . DT  F  2 5   ? -78.100  42.189  -51.148 1.00 62.35  ? 19   DT  L "C2'" 1 
ATOM   1541  C  "C1'" . DT  F  2 5   ? -78.939  41.162  -50.408 1.00 63.13  ? 19   DT  L "C1'" 1 
ATOM   1542  N  N1    . DT  F  2 5   ? -78.075  40.438  -49.439 1.00 65.57  ? 19   DT  L N1    1 
ATOM   1543  C  C2    . DT  F  2 5   ? -78.468  40.284  -48.124 1.00 65.84  ? 19   DT  L C2    1 
ATOM   1544  O  O2    . DT  F  2 5   ? -79.582  40.573  -47.716 1.00 66.53  ? 19   DT  L O2    1 
ATOM   1545  N  N3    . DT  F  2 5   ? -77.496  39.760  -47.297 1.00 66.35  ? 19   DT  L N3    1 
ATOM   1546  C  C4    . DT  F  2 5   ? -76.223  39.353  -47.652 1.00 67.39  ? 19   DT  L C4    1 
ATOM   1547  O  O4    . DT  F  2 5   ? -75.433  38.961  -46.788 1.00 67.83  ? 19   DT  L O4    1 
ATOM   1548  C  C5    . DT  F  2 5   ? -75.925  39.448  -49.059 1.00 67.67  ? 19   DT  L C5    1 
ATOM   1549  C  C7    . DT  F  2 5   ? -74.609  38.939  -49.556 1.00 68.29  ? 19   DT  L C7    1 
ATOM   1550  C  C6    . DT  F  2 5   ? -76.848  39.982  -49.867 1.00 67.20  ? 19   DT  L C6    1 
ATOM   1551  P  P     . DC  F  2 6   ? -78.455  44.665  -52.858 1.00 56.31  ? 20   DC  L P     1 
ATOM   1552  O  OP1   . DC  F  2 6   ? -79.008  45.466  -53.965 1.00 56.74  ? 20   DC  L OP1   1 
ATOM   1553  O  OP2   . DC  F  2 6   ? -76.983  44.538  -52.711 1.00 55.03  ? 20   DC  L OP2   1 
ATOM   1554  O  "O5'" . DC  F  2 6   ? -79.054  45.186  -51.482 1.00 56.68  ? 20   DC  L "O5'" 1 
ATOM   1555  C  "C5'" . DC  F  2 6   ? -80.461  45.171  -51.251 1.00 56.93  ? 20   DC  L "C5'" 1 
ATOM   1556  C  "C4'" . DC  F  2 6   ? -80.758  45.686  -49.862 1.00 56.80  ? 20   DC  L "C4'" 1 
ATOM   1557  O  "O4'" . DC  F  2 6   ? -80.455  44.638  -48.905 1.00 55.74  ? 20   DC  L "O4'" 1 
ATOM   1558  C  "C3'" . DC  F  2 6   ? -79.892  46.888  -49.476 1.00 57.56  ? 20   DC  L "C3'" 1 
ATOM   1559  O  "O3'" . DC  F  2 6   ? -80.624  48.082  -49.238 1.00 56.57  ? 20   DC  L "O3'" 1 
ATOM   1560  C  "C2'" . DC  F  2 6   ? -79.201  46.485  -48.185 1.00 57.09  ? 20   DC  L "C2'" 1 
ATOM   1561  C  "C1'" . DC  F  2 6   ? -79.846  45.182  -47.747 1.00 54.82  ? 20   DC  L "C1'" 1 
ATOM   1562  N  N1    . DC  F  2 6   ? -78.755  44.290  -47.341 1.00 53.59  ? 20   DC  L N1    1 
ATOM   1563  C  C2    . DC  F  2 6   ? -78.518  44.059  -45.974 1.00 52.11  ? 20   DC  L C2    1 
ATOM   1564  O  O2    . DC  F  2 6   ? -79.344  44.448  -45.147 1.00 50.73  ? 20   DC  L O2    1 
ATOM   1565  N  N3    . DC  F  2 6   ? -77.396  43.407  -45.600 1.00 51.72  ? 20   DC  L N3    1 
ATOM   1566  C  C4    . DC  F  2 6   ? -76.549  42.958  -46.528 1.00 52.17  ? 20   DC  L C4    1 
ATOM   1567  N  N4    . DC  F  2 6   ? -75.414  42.384  -46.116 1.00 53.00  ? 20   DC  L N4    1 
ATOM   1568  C  C5    . DC  F  2 6   ? -76.818  43.093  -47.923 1.00 53.32  ? 20   DC  L C5    1 
ATOM   1569  C  C6    . DC  F  2 6   ? -77.925  43.754  -48.281 1.00 52.77  ? 20   DC  L C6    1 
ATOM   1570  P  P     . DA  F  2 7   ? -79.826  49.472  -49.115 1.00 55.54  ? 21   DA  L P     1 
ATOM   1571  O  OP1   . DA  F  2 7   ? -80.571  50.465  -49.938 1.00 54.91  ? 21   DA  L OP1   1 
ATOM   1572  O  OP2   . DA  F  2 7   ? -78.383  49.223  -49.384 1.00 53.38  ? 21   DA  L OP2   1 
ATOM   1573  O  "O5'" . DA  F  2 7   ? -79.953  49.849  -47.573 1.00 57.13  ? 21   DA  L "O5'" 1 
ATOM   1574  C  "C5'" . DA  F  2 7   ? -81.215  49.835  -46.906 1.00 60.68  ? 21   DA  L "C5'" 1 
ATOM   1575  C  "C4'" . DA  F  2 7   ? -81.035  50.176  -45.445 1.00 62.44  ? 21   DA  L "C4'" 1 
ATOM   1576  O  "O4'" . DA  F  2 7   ? -80.521  49.000  -44.767 1.00 62.92  ? 21   DA  L "O4'" 1 
ATOM   1577  C  "C3'" . DA  F  2 7   ? -80.017  51.294  -45.226 1.00 64.26  ? 21   DA  L "C3'" 1 
ATOM   1578  O  "O3'" . DA  F  2 7   ? -80.580  52.497  -44.712 1.00 67.07  ? 21   DA  L "O3'" 1 
ATOM   1579  C  "C2'" . DA  F  2 7   ? -78.985  50.726  -44.265 1.00 63.13  ? 21   DA  L "C2'" 1 
ATOM   1580  C  "C1'" . DA  F  2 7   ? -79.380  49.289  -43.975 1.00 62.43  ? 21   DA  L "C1'" 1 
ATOM   1581  N  N9    . DA  F  2 7   ? -78.296  48.399  -44.407 1.00 62.91  ? 21   DA  L N9    1 
ATOM   1582  C  C8    . DA  F  2 7   ? -78.018  47.993  -45.691 1.00 62.61  ? 21   DA  L C8    1 
ATOM   1583  N  N7    . DA  F  2 7   ? -76.913  47.288  -45.800 1.00 62.47  ? 21   DA  L N7    1 
ATOM   1584  C  C5    . DA  F  2 7   ? -76.440  47.204  -44.496 1.00 61.73  ? 21   DA  L C5    1 
ATOM   1585  C  C6    . DA  F  2 7   ? -75.286  46.609  -43.936 1.00 60.09  ? 21   DA  L C6    1 
ATOM   1586  N  N6    . DA  F  2 7   ? -74.343  45.992  -44.643 1.00 59.74  ? 21   DA  L N6    1 
ATOM   1587  N  N1    . DA  F  2 7   ? -75.128  46.690  -42.604 1.00 59.91  ? 21   DA  L N1    1 
ATOM   1588  C  C2    . DA  F  2 7   ? -76.053  47.343  -41.886 1.00 61.61  ? 21   DA  L C2    1 
ATOM   1589  N  N3    . DA  F  2 7   ? -77.164  47.961  -42.292 1.00 62.08  ? 21   DA  L N3    1 
ATOM   1590  C  C4    . DA  F  2 7   ? -77.302  47.856  -43.623 1.00 62.58  ? 21   DA  L C4    1 
ATOM   1591  P  P     . DG  F  2 8   ? -79.784  53.882  -44.920 1.00 68.73  ? 22   DG  L P     1 
ATOM   1592  O  OP1   . DG  F  2 8   ? -80.756  54.990  -44.749 1.00 68.27  ? 22   DG  L OP1   1 
ATOM   1593  O  OP2   . DG  F  2 8   ? -78.988  53.799  -46.176 1.00 67.83  ? 22   DG  L OP2   1 
ATOM   1594  O  "O5'" . DG  F  2 8   ? -78.751  53.888  -43.708 1.00 69.76  ? 22   DG  L "O5'" 1 
ATOM   1595  C  "C5'" . DG  F  2 8   ? -79.180  53.641  -42.367 1.00 72.44  ? 22   DG  L "C5'" 1 
ATOM   1596  C  "C4'" . DG  F  2 8   ? -77.982  53.468  -41.461 1.00 73.97  ? 22   DG  L "C4'" 1 
ATOM   1597  O  "O4'" . DG  F  2 8   ? -77.473  52.120  -41.636 1.00 73.66  ? 22   DG  L "O4'" 1 
ATOM   1598  C  "C3'" . DG  F  2 8   ? -76.825  54.412  -41.802 1.00 75.35  ? 22   DG  L "C3'" 1 
ATOM   1599  O  "O3'" . DG  F  2 8   ? -76.519  55.381  -40.815 1.00 77.12  ? 22   DG  L "O3'" 1 
ATOM   1600  C  "C2'" . DG  F  2 8   ? -75.602  53.524  -41.930 1.00 74.63  ? 22   DG  L "C2'" 1 
ATOM   1601  C  "C1'" . DG  F  2 8   ? -76.051  52.112  -41.634 1.00 73.21  ? 22   DG  L "C1'" 1 
ATOM   1602  N  N9    . DG  F  2 8   ? -75.588  51.326  -42.769 1.00 72.17  ? 22   DG  L N9    1 
ATOM   1603  C  C8    . DG  F  2 8   ? -76.078  51.365  -44.051 1.00 71.95  ? 22   DG  L C8    1 
ATOM   1604  N  N7    . DG  F  2 8   ? -75.372  50.662  -44.893 1.00 71.26  ? 22   DG  L N7    1 
ATOM   1605  C  C5    . DG  F  2 8   ? -74.370  50.102  -44.115 1.00 70.47  ? 22   DG  L C5    1 
ATOM   1606  C  C6    . DG  F  2 8   ? -73.287  49.262  -44.477 1.00 69.77  ? 22   DG  L C6    1 
ATOM   1607  O  O6    . DG  F  2 8   ? -72.969  48.848  -45.601 1.00 68.26  ? 22   DG  L O6    1 
ATOM   1608  N  N1    . DG  F  2 8   ? -72.523  48.918  -43.368 1.00 70.04  ? 22   DG  L N1    1 
ATOM   1609  C  C2    . DG  F  2 8   ? -72.759  49.340  -42.080 1.00 70.18  ? 22   DG  L C2    1 
ATOM   1610  N  N2    . DG  F  2 8   ? -71.918  48.889  -41.147 1.00 70.92  ? 22   DG  L N2    1 
ATOM   1611  N  N3    . DG  F  2 8   ? -73.749  50.141  -41.733 1.00 70.13  ? 22   DG  L N3    1 
ATOM   1612  C  C4    . DG  F  2 8   ? -74.511  50.478  -42.792 1.00 71.03  ? 22   DG  L C4    1 
ATOM   1613  P  P     . DG  F  2 9   ? -75.481  56.552  -41.187 1.00 79.42  ? 23   DG  L P     1 
ATOM   1614  O  OP1   . DG  F  2 9   ? -75.802  57.673  -40.265 1.00 79.23  ? 23   DG  L OP1   1 
ATOM   1615  O  OP2   . DG  F  2 9   ? -75.534  56.773  -42.662 1.00 76.31  ? 23   DG  L OP2   1 
ATOM   1616  O  "O5'" . DG  F  2 9   ? -74.034  55.939  -40.865 1.00 79.28  ? 23   DG  L "O5'" 1 
ATOM   1617  C  "C5'" . DG  F  2 9   ? -73.661  55.549  -39.538 1.00 80.67  ? 23   DG  L "C5'" 1 
ATOM   1618  C  "C4'" . DG  F  2 9   ? -72.197  55.153  -39.472 1.00 81.88  ? 23   DG  L "C4'" 1 
ATOM   1619  O  "O4'" . DG  F  2 9   ? -72.013  53.805  -39.990 1.00 82.44  ? 23   DG  L "O4'" 1 
ATOM   1620  C  "C3'" . DG  F  2 9   ? -71.185  56.051  -40.203 1.00 82.33  ? 23   DG  L "C3'" 1 
ATOM   1621  O  "O3'" . DG  F  2 9   ? -70.212  56.632  -39.324 1.00 82.48  ? 23   DG  L "O3'" 1 
ATOM   1622  C  "C2'" . DG  F  2 9   ? -70.437  55.102  -41.125 1.00 83.24  ? 23   DG  L "C2'" 1 
ATOM   1623  C  "C1'" . DG  F  2 9   ? -70.744  53.700  -40.615 1.00 83.11  ? 23   DG  L "C1'" 1 
ATOM   1624  N  N9    . DG  F  2 9   ? -70.868  52.847  -41.793 1.00 83.45  ? 23   DG  L N9    1 
ATOM   1625  C  C8    . DG  F  2 9   ? -71.853  52.928  -42.743 1.00 84.08  ? 23   DG  L C8    1 
ATOM   1626  N  N7    . DG  F  2 9   ? -71.585  52.241  -43.820 1.00 84.46  ? 23   DG  L N7    1 
ATOM   1627  C  C5    . DG  F  2 9   ? -70.374  51.626  -43.544 1.00 83.87  ? 23   DG  L C5    1 
ATOM   1628  C  C6    . DG  F  2 9   ? -69.553  50.800  -44.367 1.00 83.86  ? 23   DG  L C6    1 
ATOM   1629  O  O6    . DG  F  2 9   ? -69.711  50.500  -45.561 1.00 82.80  ? 23   DG  L O6    1 
ATOM   1630  N  N1    . DG  F  2 9   ? -68.436  50.342  -43.675 1.00 83.64  ? 23   DG  L N1    1 
ATOM   1631  C  C2    . DG  F  2 9   ? -68.131  50.659  -42.370 1.00 83.87  ? 23   DG  L C2    1 
ATOM   1632  N  N2    . DG  F  2 9   ? -67.036  50.072  -41.862 1.00 82.62  ? 23   DG  L N2    1 
ATOM   1633  N  N3    . DG  F  2 9   ? -68.856  51.480  -41.613 1.00 83.91  ? 23   DG  L N3    1 
ATOM   1634  C  C4    . DG  F  2 9   ? -69.956  51.923  -42.261 1.00 83.62  ? 23   DG  L C4    1 
ATOM   1635  P  P     . DT  F  2 10  ? -69.096  57.643  -39.917 1.00 82.15  ? 24   DT  L P     1 
ATOM   1636  O  OP1   . DT  F  2 10  ? -69.042  58.833  -39.037 1.00 81.97  ? 24   DT  L OP1   1 
ATOM   1637  O  OP2   . DT  F  2 10  ? -69.301  57.829  -41.374 1.00 82.25  ? 24   DT  L OP2   1 
ATOM   1638  O  "O5'" . DT  F  2 10  ? -67.731  56.846  -39.749 1.00 82.35  ? 24   DT  L "O5'" 1 
ATOM   1639  C  "C5'" . DT  F  2 10  ? -67.414  56.180  -38.530 1.00 84.46  ? 24   DT  L "C5'" 1 
ATOM   1640  C  "C4'" . DT  F  2 10  ? -66.104  55.439  -38.675 1.00 85.31  ? 24   DT  L "C4'" 1 
ATOM   1641  O  "O4'" . DT  F  2 10  ? -66.298  54.338  -39.599 1.00 86.57  ? 24   DT  L "O4'" 1 
ATOM   1642  C  "C3'" . DT  F  2 10  ? -64.968  56.293  -39.245 1.00 85.08  ? 24   DT  L "C3'" 1 
ATOM   1643  O  "O3'" . DT  F  2 10  ? -63.800  56.254  -38.436 1.00 82.88  ? 24   DT  L "O3'" 1 
ATOM   1644  C  "C2'" . DT  F  2 10  ? -64.644  55.685  -40.602 1.00 85.84  ? 24   DT  L "C2'" 1 
ATOM   1645  C  "C1'" . DT  F  2 10  ? -65.265  54.296  -40.575 1.00 85.64  ? 24   DT  L "C1'" 1 
ATOM   1646  N  N1    . DT  F  2 10  ? -65.883  53.987  -41.878 1.00 84.49  ? 24   DT  L N1    1 
ATOM   1647  C  C2    . DT  F  2 10  ? -65.375  52.961  -42.642 1.00 84.44  ? 24   DT  L C2    1 
ATOM   1648  O  O2    . DT  F  2 10  ? -64.516  52.187  -42.245 1.00 85.05  ? 24   DT  L O2    1 
ATOM   1649  N  N3    . DT  F  2 10  ? -65.923  52.865  -43.895 1.00 84.06  ? 24   DT  L N3    1 
ATOM   1650  C  C4    . DT  F  2 10  ? -66.923  53.647  -44.428 1.00 83.47  ? 24   DT  L C4    1 
ATOM   1651  O  O4    . DT  F  2 10  ? -67.276  53.481  -45.590 1.00 85.08  ? 24   DT  L O4    1 
ATOM   1652  C  C5    . DT  F  2 10  ? -67.468  54.634  -43.538 1.00 83.09  ? 24   DT  L C5    1 
ATOM   1653  C  C7    . DT  F  2 10  ? -68.621  55.462  -44.000 1.00 83.80  ? 24   DT  L C7    1 
ATOM   1654  C  C6    . DT  F  2 10  ? -66.924  54.761  -42.327 1.00 83.29  ? 24   DT  L C6    1 
ATOM   1655  P  P     . DG  F  2 11  ? -62.560  57.195  -38.823 1.00 81.42  ? 25   DG  L P     1 
ATOM   1656  O  OP1   . DG  F  2 11  ? -61.911  57.591  -37.544 1.00 79.86  ? 25   DG  L OP1   1 
ATOM   1657  O  OP2   . DG  F  2 11  ? -63.069  58.249  -39.742 1.00 80.44  ? 25   DG  L OP2   1 
ATOM   1658  O  "O5'" . DG  F  2 11  ? -61.610  56.248  -39.698 1.00 78.86  ? 25   DG  L "O5'" 1 
ATOM   1659  C  "C5'" . DG  F  2 11  ? -61.296  54.913  -39.282 1.00 76.03  ? 25   DG  L "C5'" 1 
ATOM   1660  C  "C4'" . DG  F  2 11  ? -60.374  54.219  -40.268 1.00 75.54  ? 25   DG  L "C4'" 1 
ATOM   1661  O  "O4'" . DG  F  2 11  ? -61.111  53.711  -41.410 1.00 75.26  ? 25   DG  L "O4'" 1 
ATOM   1662  C  "C3'" . DG  F  2 11  ? -59.182  55.002  -40.830 1.00 74.54  ? 25   DG  L "C3'" 1 
ATOM   1663  O  "O3'" . DG  F  2 11  ? -57.970  54.218  -40.786 1.00 73.39  ? 25   DG  L "O3'" 1 
ATOM   1664  C  "C2'" . DG  F  2 11  ? -59.585  55.267  -42.275 1.00 74.08  ? 25   DG  L "C2'" 1 
ATOM   1665  C  "C1'" . DG  F  2 11  ? -60.453  54.062  -42.621 1.00 73.87  ? 25   DG  L "C1'" 1 
ATOM   1666  N  N9    . DG  F  2 11  ? -61.483  54.404  -43.596 1.00 73.15  ? 25   DG  L N9    1 
ATOM   1667  C  C8    . DG  F  2 11  ? -62.498  55.306  -43.403 1.00 72.80  ? 25   DG  L C8    1 
ATOM   1668  N  N7    . DG  F  2 11  ? -63.233  55.491  -44.465 1.00 71.29  ? 25   DG  L N7    1 
ATOM   1669  C  C5    . DG  F  2 11  ? -62.684  54.644  -45.416 1.00 70.53  ? 25   DG  L C5    1 
ATOM   1670  C  C6    . DG  F  2 11  ? -63.058  54.421  -46.768 1.00 69.24  ? 25   DG  L C6    1 
ATOM   1671  O  O6    . DG  F  2 11  ? -63.969  54.946  -47.410 1.00 68.21  ? 25   DG  L O6    1 
ATOM   1672  N  N1    . DG  F  2 11  ? -62.244  53.474  -47.372 1.00 68.54  ? 25   DG  L N1    1 
ATOM   1673  C  C2    . DG  F  2 11  ? -61.210  52.817  -46.756 1.00 69.17  ? 25   DG  L C2    1 
ATOM   1674  N  N2    . DG  F  2 11  ? -60.566  51.919  -47.501 1.00 69.32  ? 25   DG  L N2    1 
ATOM   1675  N  N3    . DG  F  2 11  ? -60.843  53.019  -45.497 1.00 70.61  ? 25   DG  L N3    1 
ATOM   1676  C  C4    . DG  F  2 11  ? -61.617  53.943  -44.891 1.00 71.66  ? 25   DG  L C4    1 
ATOM   1677  P  P     . DT  F  2 12  ? -56.564  54.919  -41.158 1.00 72.24  ? 26   DT  L P     1 
ATOM   1678  O  OP1   . DT  F  2 12  ? -55.558  53.852  -41.366 1.00 72.45  ? 26   DT  L OP1   1 
ATOM   1679  O  OP2   . DT  F  2 12  ? -56.259  56.029  -40.225 1.00 71.67  ? 26   DT  L OP2   1 
ATOM   1680  O  "O5'" . DT  F  2 12  ? -56.879  55.581  -42.574 1.00 73.47  ? 26   DT  L "O5'" 1 
ATOM   1681  C  "C5'" . DT  F  2 12  ? -57.005  56.993  -42.728 1.00 72.65  ? 26   DT  L "C5'" 1 
ATOM   1682  C  "C4'" . DT  F  2 12  ? -56.651  57.389  -44.143 1.00 73.11  ? 26   DT  L "C4'" 1 
ATOM   1683  O  "O4'" . DT  F  2 12  ? -57.640  56.919  -45.093 1.00 73.86  ? 26   DT  L "O4'" 1 
ATOM   1684  C  "C3'" . DT  F  2 12  ? -56.532  58.893  -44.361 1.00 73.41  ? 26   DT  L "C3'" 1 
ATOM   1685  O  "O3'" . DT  F  2 12  ? -55.250  59.191  -44.859 1.00 72.72  ? 26   DT  L "O3'" 1 
ATOM   1686  C  "C2'" . DT  F  2 12  ? -57.584  59.246  -45.402 1.00 73.81  ? 26   DT  L "C2'" 1 
ATOM   1687  C  "C1'" . DT  F  2 12  ? -57.979  57.927  -46.037 1.00 74.35  ? 26   DT  L "C1'" 1 
ATOM   1688  N  N1    . DT  F  2 12  ? -59.433  57.845  -46.265 1.00 75.52  ? 26   DT  L N1    1 
ATOM   1689  C  C2    . DT  F  2 12  ? -59.928  57.081  -47.297 1.00 74.93  ? 26   DT  L C2    1 
ATOM   1690  O  O2    . DT  F  2 12  ? -59.222  56.416  -48.034 1.00 74.60  ? 26   DT  L O2    1 
ATOM   1691  N  N3    . DT  F  2 12  ? -61.295  57.116  -47.425 1.00 75.13  ? 26   DT  L N3    1 
ATOM   1692  C  C4    . DT  F  2 12  ? -62.193  57.809  -46.630 1.00 76.87  ? 26   DT  L C4    1 
ATOM   1693  O  O4    . DT  F  2 12  ? -63.397  57.760  -46.876 1.00 77.84  ? 26   DT  L O4    1 
ATOM   1694  C  C5    . DT  F  2 12  ? -61.602  58.560  -45.548 1.00 77.57  ? 26   DT  L C5    1 
ATOM   1695  C  C7    . DT  F  2 12  ? -62.491  59.308  -44.604 1.00 77.59  ? 26   DT  L C7    1 
ATOM   1696  C  C6    . DT  F  2 12  ? -60.273  58.547  -45.430 1.00 77.43  ? 26   DT  L C6    1 
ATOM   1697  P  P     . DC  F  2 13  ? -54.894  60.694  -45.238 1.00 71.88  ? 27   DC  L P     1 
ATOM   1698  O  OP1   . DC  F  2 13  ? -53.591  60.895  -44.577 1.00 74.08  ? 27   DC  L OP1   1 
ATOM   1699  O  OP2   . DC  F  2 13  ? -56.023  61.588  -44.913 1.00 71.57  ? 27   DC  L OP2   1 
ATOM   1700  O  "O5'" . DC  F  2 13  ? -54.754  60.625  -46.822 1.00 73.38  ? 27   DC  L "O5'" 1 
ATOM   1701  C  "C5'" . DC  F  2 13  ? -53.971  59.601  -47.439 1.00 74.72  ? 27   DC  L "C5'" 1 
ATOM   1702  C  "C4'" . DC  F  2 13  ? -54.118  59.648  -48.943 1.00 75.41  ? 27   DC  L "C4'" 1 
ATOM   1703  O  "O4'" . DC  F  2 13  ? -55.306  58.899  -49.298 1.00 73.61  ? 27   DC  L "O4'" 1 
ATOM   1704  C  "C3'" . DC  F  2 13  ? -54.288  61.054  -49.529 1.00 76.45  ? 27   DC  L "C3'" 1 
ATOM   1705  O  "O3'" . DC  F  2 13  ? -53.231  61.474  -50.375 1.00 78.72  ? 27   DC  L "O3'" 1 
ATOM   1706  C  "C2'" . DC  F  2 13  ? -55.518  60.965  -50.406 1.00 75.79  ? 27   DC  L "C2'" 1 
ATOM   1707  C  "C1'" . DC  F  2 13  ? -56.027  59.544  -50.331 1.00 74.31  ? 27   DC  L "C1'" 1 
ATOM   1708  N  N1    . DC  F  2 13  ? -57.434  59.660  -49.921 1.00 74.64  ? 27   DC  L N1    1 
ATOM   1709  C  C2    . DC  F  2 13  ? -58.433  59.067  -50.697 1.00 74.54  ? 27   DC  L C2    1 
ATOM   1710  O  O2    . DC  F  2 13  ? -58.110  58.280  -51.593 1.00 74.68  ? 27   DC  L O2    1 
ATOM   1711  N  N3    . DC  F  2 13  ? -59.730  59.360  -50.436 1.00 74.09  ? 27   DC  L N3    1 
ATOM   1712  C  C4    . DC  F  2 13  ? -60.038  60.170  -49.421 1.00 73.57  ? 27   DC  L C4    1 
ATOM   1713  N  N4    . DC  F  2 13  ? -61.319  60.493  -49.243 1.00 72.64  ? 27   DC  L N4    1 
ATOM   1714  C  C5    . DC  F  2 13  ? -59.043  60.700  -48.552 1.00 74.19  ? 27   DC  L C5    1 
ATOM   1715  C  C6    . DC  F  2 13  ? -57.767  60.416  -48.831 1.00 74.72  ? 27   DC  L C6    1 
ATOM   1716  P  P     . DG  F  2 14  ? -53.334  62.907  -51.105 1.00 80.86  ? 28   DG  L P     1 
ATOM   1717  O  OP1   . DG  F  2 14  ? -52.213  63.748  -50.610 1.00 82.71  ? 28   DG  L OP1   1 
ATOM   1718  O  OP2   . DG  F  2 14  ? -54.721  63.430  -51.012 1.00 79.88  ? 28   DG  L OP2   1 
ATOM   1719  O  "O5'" . DG  F  2 14  ? -53.070  62.538  -52.630 1.00 83.25  ? 28   DG  L "O5'" 1 
ATOM   1720  C  "C5'" . DG  F  2 14  ? -53.728  63.233  -53.676 1.00 86.77  ? 28   DG  L "C5'" 1 
ATOM   1721  C  "C4'" . DG  F  2 14  ? -54.563  62.271  -54.485 1.00 89.94  ? 28   DG  L "C4'" 1 
ATOM   1722  O  "O4'" . DG  F  2 14  ? -55.582  61.707  -53.625 1.00 91.49  ? 28   DG  L "O4'" 1 
ATOM   1723  C  "C3'" . DG  F  2 14  ? -55.286  62.947  -55.648 1.00 91.11  ? 28   DG  L "C3'" 1 
ATOM   1724  O  "O3'" . DG  F  2 14  ? -54.752  62.631  -56.943 1.00 91.60  ? 28   DG  L "O3'" 1 
ATOM   1725  C  "C2'" . DG  F  2 14  ? -56.771  62.799  -55.360 1.00 92.23  ? 28   DG  L "C2'" 1 
ATOM   1726  C  "C1'" . DG  F  2 14  ? -56.874  61.813  -54.209 1.00 93.59  ? 28   DG  L "C1'" 1 
ATOM   1727  N  N9    . DG  F  2 14  ? -57.797  62.287  -53.178 1.00 95.67  ? 28   DG  L N9    1 
ATOM   1728  C  C8    . DG  F  2 14  ? -57.534  62.488  -51.844 1.00 96.30  ? 28   DG  L C8    1 
ATOM   1729  N  N7    . DG  F  2 14  ? -58.567  62.922  -51.175 1.00 96.70  ? 28   DG  L N7    1 
ATOM   1730  C  C5    . DG  F  2 14  ? -59.573  63.019  -52.125 1.00 96.98  ? 28   DG  L C5    1 
ATOM   1731  C  C6    . DG  F  2 14  ? -60.919  63.434  -51.992 1.00 97.41  ? 28   DG  L C6    1 
ATOM   1732  O  O6    . DG  F  2 14  ? -61.511  63.821  -50.975 1.00 97.91  ? 28   DG  L O6    1 
ATOM   1733  N  N1    . DG  F  2 14  ? -61.595  63.367  -53.207 1.00 96.83  ? 28   DG  L N1    1 
ATOM   1734  C  C2    . DG  F  2 14  ? -61.048  62.951  -54.395 1.00 96.11  ? 28   DG  L C2    1 
ATOM   1735  N  N2    . DG  F  2 14  ? -61.869  62.937  -55.449 1.00 95.91  ? 28   DG  L N2    1 
ATOM   1736  N  N3    . DG  F  2 14  ? -59.790  62.572  -54.535 1.00 96.70  ? 28   DG  L N3    1 
ATOM   1737  C  C4    . DG  F  2 14  ? -59.115  62.628  -53.366 1.00 96.62  ? 28   DG  L C4    1 
ATOM   1738  O  "O5'" . C   G  1 1   ? 16.750   -21.370 -52.974 1.00 80.83  ? 1    C   O "O5'" 1 
ATOM   1739  C  "C5'" . C   G  1 1   ? 17.102   -21.991 -54.208 1.00 79.34  ? 1    C   O "C5'" 1 
ATOM   1740  C  "C4'" . C   G  1 1   ? 16.052   -21.715 -55.253 1.00 78.32  ? 1    C   O "C4'" 1 
ATOM   1741  O  "O4'" . C   G  1 1   ? 14.826   -22.403 -54.897 1.00 77.84  ? 1    C   O "O4'" 1 
ATOM   1742  C  "C3'" . C   G  1 1   ? 15.632   -20.260 -55.380 1.00 78.28  ? 1    C   O "C3'" 1 
ATOM   1743  O  "O3'" . C   G  1 1   ? 16.534   -19.540 -56.215 1.00 79.22  ? 1    C   O "O3'" 1 
ATOM   1744  C  "C2'" . C   G  1 1   ? 14.253   -20.384 -56.015 1.00 78.18  ? 1    C   O "C2'" 1 
ATOM   1745  O  "O2'" . C   G  1 1   ? 14.303   -20.601 -57.411 1.00 78.81  ? 1    C   O "O2'" 1 
ATOM   1746  C  "C1'" . C   G  1 1   ? 13.710   -21.634 -55.319 1.00 77.26  ? 1    C   O "C1'" 1 
ATOM   1747  N  N1    . C   G  1 1   ? 12.885   -21.320 -54.141 1.00 75.39  ? 1    C   O N1    1 
ATOM   1748  C  C2    . C   G  1 1   ? 11.603   -20.787 -54.338 1.00 74.05  ? 1    C   O C2    1 
ATOM   1749  O  O2    . C   G  1 1   ? 11.199   -20.601 -55.498 1.00 73.07  ? 1    C   O O2    1 
ATOM   1750  N  N3    . C   G  1 1   ? 10.841   -20.488 -53.263 1.00 73.08  ? 1    C   O N3    1 
ATOM   1751  C  C4    . C   G  1 1   ? 11.310   -20.705 -52.031 1.00 73.15  ? 1    C   O C4    1 
ATOM   1752  N  N4    . C   G  1 1   ? 10.521   -20.394 -50.998 1.00 73.55  ? 1    C   O N4    1 
ATOM   1753  C  C5    . C   G  1 1   ? 12.609   -21.251 -51.803 1.00 72.70  ? 1    C   O C5    1 
ATOM   1754  C  C6    . C   G  1 1   ? 13.355   -21.540 -52.876 1.00 74.06  ? 1    C   O C6    1 
ATOM   1755  P  P     . G   G  1 2   ? 16.635   -17.936 -56.092 1.00 79.40  ? 2    G   O P     1 
ATOM   1756  O  OP1   . G   G  1 2   ? 17.719   -17.503 -57.016 1.00 78.16  ? 2    G   O OP1   1 
ATOM   1757  O  OP2   . G   G  1 2   ? 16.692   -17.562 -54.650 1.00 77.70  ? 2    G   O OP2   1 
ATOM   1758  O  "O5'" . G   G  1 2   ? 15.251   -17.413 -56.677 1.00 76.50  ? 2    G   O "O5'" 1 
ATOM   1759  C  "C5'" . G   G  1 2   ? 14.810   -17.798 -57.970 1.00 73.74  ? 2    G   O "C5'" 1 
ATOM   1760  C  "C4'" . G   G  1 2   ? 13.380   -17.374 -58.162 1.00 73.69  ? 2    G   O "C4'" 1 
ATOM   1761  O  "O4'" . G   G  1 2   ? 12.496   -18.173 -57.331 1.00 74.41  ? 2    G   O "O4'" 1 
ATOM   1762  C  "C3'" . G   G  1 2   ? 13.096   -15.965 -57.692 1.00 72.96  ? 2    G   O "C3'" 1 
ATOM   1763  O  "O3'" . G   G  1 2   ? 13.535   -15.007 -58.629 1.00 71.26  ? 2    G   O "O3'" 1 
ATOM   1764  C  "C2'" . G   G  1 2   ? 11.585   -15.979 -57.493 1.00 73.05  ? 2    G   O "C2'" 1 
ATOM   1765  O  "O2'" . G   G  1 2   ? 10.826   -15.812 -58.674 1.00 72.74  ? 2    G   O "O2'" 1 
ATOM   1766  C  "C1'" . G   G  1 2   ? 11.380   -17.384 -56.928 1.00 73.95  ? 2    G   O "C1'" 1 
ATOM   1767  N  N9    . G   G  1 2   ? 11.336   -17.360 -55.473 1.00 74.45  ? 2    G   O N9    1 
ATOM   1768  C  C8    . G   G  1 2   ? 12.348   -17.696 -54.610 1.00 75.13  ? 2    G   O C8    1 
ATOM   1769  N  N7    . G   G  1 2   ? 12.017   -17.557 -53.356 1.00 75.61  ? 2    G   O N7    1 
ATOM   1770  C  C5    . G   G  1 2   ? 10.706   -17.105 -53.395 1.00 74.51  ? 2    G   O C5    1 
ATOM   1771  C  C6    . G   G  1 2   ? 9.822    -16.780 -52.343 1.00 73.95  ? 2    G   O C6    1 
ATOM   1772  O  O6    . G   G  1 2   ? 10.025   -16.829 -51.124 1.00 74.10  ? 2    G   O O6    1 
ATOM   1773  N  N1    . G   G  1 2   ? 8.589    -16.360 -52.827 1.00 73.17  ? 2    G   O N1    1 
ATOM   1774  C  C2    . G   G  1 2   ? 8.251    -16.269 -54.153 1.00 72.85  ? 2    G   O C2    1 
ATOM   1775  N  N2    . G   G  1 2   ? 7.012    -15.843 -54.417 1.00 73.67  ? 2    G   O N2    1 
ATOM   1776  N  N3    . G   G  1 2   ? 9.067    -16.573 -55.144 1.00 72.95  ? 2    G   O N3    1 
ATOM   1777  C  C4    . G   G  1 2   ? 10.270   -16.981 -54.695 1.00 74.15  ? 2    G   O C4    1 
ATOM   1778  P  P     . A   G  1 3   ? 14.048   -13.592 -58.101 1.00 69.84  ? 3    A   O P     1 
ATOM   1779  O  OP1   . A   G  1 3   ? 14.772   -12.957 -59.228 1.00 70.56  ? 3    A   O OP1   1 
ATOM   1780  O  OP2   . A   G  1 3   ? 14.750   -13.830 -56.813 1.00 68.85  ? 3    A   O OP2   1 
ATOM   1781  O  "O5'" . A   G  1 3   ? 12.694   -12.798 -57.811 1.00 69.03  ? 3    A   O "O5'" 1 
ATOM   1782  C  "C5'" . A   G  1 3   ? 11.729   -12.612 -58.846 1.00 67.76  ? 3    A   O "C5'" 1 
ATOM   1783  C  "C4'" . A   G  1 3   ? 10.378   -12.275 -58.261 1.00 66.36  ? 3    A   O "C4'" 1 
ATOM   1784  O  "O4'" . A   G  1 3   ? 9.932    -13.367 -57.419 1.00 67.86  ? 3    A   O "O4'" 1 
ATOM   1785  C  "C3'" . A   G  1 3   ? 10.343   -11.071 -57.341 1.00 65.61  ? 3    A   O "C3'" 1 
ATOM   1786  O  "O3'" . A   G  1 3   ? 10.206   -9.873  -58.077 1.00 63.21  ? 3    A   O "O3'" 1 
ATOM   1787  C  "C2'" . A   G  1 3   ? 9.106    -11.336 -56.502 1.00 66.95  ? 3    A   O "C2'" 1 
ATOM   1788  O  "O2'" . A   G  1 3   ? 7.906    -10.966 -57.153 1.00 66.63  ? 3    A   O "O2'" 1 
ATOM   1789  C  "C1'" . A   G  1 3   ? 9.195    -12.851 -56.320 1.00 68.51  ? 3    A   O "C1'" 1 
ATOM   1790  N  N9    . A   G  1 3   ? 9.904    -13.210 -55.094 1.00 70.33  ? 3    A   O N9    1 
ATOM   1791  C  C8    . A   G  1 3   ? 11.205   -13.633 -54.960 1.00 70.53  ? 3    A   O C8    1 
ATOM   1792  N  N7    . A   G  1 3   ? 11.560   -13.863 -53.718 1.00 71.06  ? 3    A   O N7    1 
ATOM   1793  C  C5    . A   G  1 3   ? 10.416   -13.572 -52.985 1.00 71.24  ? 3    A   O C5    1 
ATOM   1794  C  C6    . A   G  1 3   ? 10.137   -13.611 -51.603 1.00 71.55  ? 3    A   O C6    1 
ATOM   1795  N  N6    . A   G  1 3   ? 11.036   -13.948 -50.672 1.00 72.22  ? 3    A   O N6    1 
ATOM   1796  N  N1    . A   G  1 3   ? 8.889    -13.278 -51.204 1.00 70.76  ? 3    A   O N1    1 
ATOM   1797  C  C2    . A   G  1 3   ? 7.996    -12.917 -52.134 1.00 70.56  ? 3    A   O C2    1 
ATOM   1798  N  N3    . A   G  1 3   ? 8.141    -12.828 -53.455 1.00 70.40  ? 3    A   O N3    1 
ATOM   1799  C  C4    . A   G  1 3   ? 9.387    -13.176 -53.820 1.00 70.74  ? 3    A   O C4    1 
ATOM   1800  P  P     . C   G  1 4   ? 10.953   -8.555  -57.563 1.00 63.08  ? 4    C   O P     1 
ATOM   1801  O  OP1   . C   G  1 4   ? 11.107   -7.644  -58.729 1.00 62.28  ? 4    C   O OP1   1 
ATOM   1802  O  OP2   . C   G  1 4   ? 12.154   -8.982  -56.792 1.00 61.94  ? 4    C   O OP2   1 
ATOM   1803  O  "O5'" . C   G  1 4   ? 9.905    -7.900  -56.561 1.00 61.28  ? 4    C   O "O5'" 1 
ATOM   1804  C  "C5'" . C   G  1 4   ? 8.809    -7.153  -57.069 1.00 59.10  ? 4    C   O "C5'" 1 
ATOM   1805  C  "C4'" . C   G  1 4   ? 7.864    -6.778  -55.958 1.00 56.91  ? 4    C   O "C4'" 1 
ATOM   1806  O  "O4'" . C   G  1 4   ? 7.420    -7.989  -55.290 1.00 56.87  ? 4    C   O "O4'" 1 
ATOM   1807  C  "C3'" . C   G  1 4   ? 8.425    -5.931  -54.828 1.00 54.28  ? 4    C   O "C3'" 1 
ATOM   1808  O  "O3'" . C   G  1 4   ? 8.467    -4.550  -55.170 1.00 50.64  ? 4    C   O "O3'" 1 
ATOM   1809  C  "C2'" . C   G  1 4   ? 7.425    -6.214  -53.714 1.00 54.70  ? 4    C   O "C2'" 1 
ATOM   1810  O  "O2'" . C   G  1 4   ? 6.205    -5.503  -53.842 1.00 53.10  ? 4    C   O "O2'" 1 
ATOM   1811  C  "C1'" . C   G  1 4   ? 7.174    -7.708  -53.923 1.00 55.32  ? 4    C   O "C1'" 1 
ATOM   1812  N  N1    . C   G  1 4   ? 8.096    -8.509  -53.116 1.00 54.83  ? 4    C   O N1    1 
ATOM   1813  C  C2    . C   G  1 4   ? 7.676    -8.921  -51.855 1.00 54.50  ? 4    C   O C2    1 
ATOM   1814  O  O2    . C   G  1 4   ? 6.524    -8.625  -51.482 1.00 54.22  ? 4    C   O O2    1 
ATOM   1815  N  N3    . C   G  1 4   ? 8.525    -9.629  -51.076 1.00 53.71  ? 4    C   O N3    1 
ATOM   1816  C  C4    . C   G  1 4   ? 9.746    -9.928  -51.521 1.00 53.20  ? 4    C   O C4    1 
ATOM   1817  N  N4    . C   G  1 4   ? 10.549   -10.618 -50.711 1.00 52.27  ? 4    C   O N4    1 
ATOM   1818  C  C5    . C   G  1 4   ? 10.195   -9.532  -52.815 1.00 53.35  ? 4    C   O C5    1 
ATOM   1819  C  C6    . C   G  1 4   ? 9.344    -8.831  -53.573 1.00 53.78  ? 4    C   O C6    1 
ATOM   1820  P  P     . A   G  1 5   ? 9.070    -3.494  -54.120 1.00 47.97  ? 5    A   O P     1 
ATOM   1821  O  OP1   . A   G  1 5   ? 9.155    -2.181  -54.796 1.00 46.05  ? 5    A   O OP1   1 
ATOM   1822  O  OP2   . A   G  1 5   ? 10.282   -4.085  -53.487 1.00 44.80  ? 5    A   O OP2   1 
ATOM   1823  O  "O5'" . A   G  1 5   ? 7.928    -3.382  -53.020 1.00 47.86  ? 5    A   O "O5'" 1 
ATOM   1824  C  "C5'" . A   G  1 5   ? 8.233    -2.973  -51.699 1.00 47.11  ? 5    A   O "C5'" 1 
ATOM   1825  C  "C4'" . A   G  1 5   ? 7.396    -3.741  -50.704 1.00 45.86  ? 5    A   O "C4'" 1 
ATOM   1826  O  "O4'" . A   G  1 5   ? 7.650    -5.168  -50.821 1.00 45.61  ? 5    A   O "O4'" 1 
ATOM   1827  C  "C3'" . A   G  1 5   ? 7.740    -3.436  -49.261 1.00 44.37  ? 5    A   O "C3'" 1 
ATOM   1828  O  "O3'" . A   G  1 5   ? 7.112    -2.233  -48.862 1.00 43.89  ? 5    A   O "O3'" 1 
ATOM   1829  C  "C2'" . A   G  1 5   ? 7.228    -4.672  -48.536 1.00 44.22  ? 5    A   O "C2'" 1 
ATOM   1830  O  "O2'" . A   G  1 5   ? 5.829    -4.681  -48.362 1.00 41.68  ? 5    A   O "O2'" 1 
ATOM   1831  C  "C1'" . A   G  1 5   ? 7.595    -5.768  -49.534 1.00 44.54  ? 5    A   O "C1'" 1 
ATOM   1832  N  N9    . A   G  1 5   ? 8.884    -6.406  -49.272 1.00 44.61  ? 5    A   O N9    1 
ATOM   1833  C  C8    . A   G  1 5   ? 9.950    -6.498  -50.133 1.00 46.16  ? 5    A   O C8    1 
ATOM   1834  N  N7    . A   G  1 5   ? 10.969   -7.166  -49.644 1.00 46.93  ? 5    A   O N7    1 
ATOM   1835  C  C5    . A   G  1 5   ? 10.548   -7.530  -48.372 1.00 44.34  ? 5    A   O C5    1 
ATOM   1836  C  C6    . A   G  1 5   ? 11.168   -8.264  -47.351 1.00 43.19  ? 5    A   O C6    1 
ATOM   1837  N  N6    . A   G  1 5   ? 12.389   -8.784  -47.454 1.00 42.25  ? 5    A   O N6    1 
ATOM   1838  N  N1    . A   G  1 5   ? 10.481   -8.452  -46.209 1.00 43.33  ? 5    A   O N1    1 
ATOM   1839  C  C2    . A   G  1 5   ? 9.252    -7.937  -46.112 1.00 43.30  ? 5    A   O C2    1 
ATOM   1840  N  N3    . A   G  1 5   ? 8.558    -7.234  -47.003 1.00 42.68  ? 5    A   O N3    1 
ATOM   1841  C  C4    . A   G  1 5   ? 9.271    -7.061  -48.125 1.00 43.68  ? 5    A   O C4    1 
ATOM   1842  P  P     . C   G  1 6   ? 7.978    -1.128  -48.100 1.00 44.04  ? 6    C   O P     1 
ATOM   1843  O  OP1   . C   G  1 6   ? 7.197    0.129   -47.981 1.00 42.18  ? 6    C   O OP1   1 
ATOM   1844  O  OP2   . C   G  1 6   ? 9.333    -1.105  -48.725 1.00 43.26  ? 6    C   O OP2   1 
ATOM   1845  O  "O5'" . C   G  1 6   ? 8.118    -1.753  -46.648 1.00 44.95  ? 6    C   O "O5'" 1 
ATOM   1846  C  "C5'" . C   G  1 6   ? 6.971    -2.182  -45.940 1.00 44.58  ? 6    C   O "C5'" 1 
ATOM   1847  C  "C4'" . C   G  1 6   ? 7.388    -2.911  -44.699 1.00 44.19  ? 6    C   O "C4'" 1 
ATOM   1848  O  "O4'" . C   G  1 6   ? 7.973    -4.188  -45.053 1.00 42.57  ? 6    C   O "O4'" 1 
ATOM   1849  C  "C3'" . C   G  1 6   ? 8.501    -2.232  -43.936 1.00 44.29  ? 6    C   O "C3'" 1 
ATOM   1850  O  "O3'" . C   G  1 6   ? 8.029    -1.121  -43.182 1.00 45.67  ? 6    C   O "O3'" 1 
ATOM   1851  C  "C2'" . C   G  1 6   ? 9.058    -3.381  -43.100 1.00 43.82  ? 6    C   O "C2'" 1 
ATOM   1852  O  "O2'" . C   G  1 6   ? 8.329    -3.660  -41.925 1.00 43.95  ? 6    C   O "O2'" 1 
ATOM   1853  C  "C1'" . C   G  1 6   ? 8.921    -4.556  -44.070 1.00 42.76  ? 6    C   O "C1'" 1 
ATOM   1854  N  N1    . C   G  1 6   ? 10.181   -4.889  -44.742 1.00 43.61  ? 6    C   O N1    1 
ATOM   1855  C  C2    . C   G  1 6   ? 11.171   -5.561  -44.011 1.00 44.03  ? 6    C   O C2    1 
ATOM   1856  O  O2    . C   G  1 6   ? 10.943   -5.855  -42.830 1.00 44.63  ? 6    C   O O2    1 
ATOM   1857  N  N3    . C   G  1 6   ? 12.344   -5.869  -44.609 1.00 42.21  ? 6    C   O N3    1 
ATOM   1858  C  C4    . C   G  1 6   ? 12.546   -5.529  -45.882 1.00 41.97  ? 6    C   O C4    1 
ATOM   1859  N  N4    . C   G  1 6   ? 13.718   -5.840  -46.431 1.00 42.54  ? 6    C   O N4    1 
ATOM   1860  C  C5    . C   G  1 6   ? 11.554   -4.850  -46.652 1.00 42.29  ? 6    C   O C5    1 
ATOM   1861  C  C6    . C   G  1 6   ? 10.396   -4.552  -46.048 1.00 42.52  ? 6    C   O C6    1 
ATOM   1862  P  P     . C   G  1 7   ? 9.050    0.069   -42.835 1.00 47.15  ? 7    C   O P     1 
ATOM   1863  O  OP1   . C   G  1 7   ? 8.586    0.747   -41.592 1.00 45.43  ? 7    C   O OP1   1 
ATOM   1864  O  OP2   . C   G  1 7   ? 9.306    0.870   -44.062 1.00 46.29  ? 7    C   O OP2   1 
ATOM   1865  O  "O5'" . C   G  1 7   ? 10.381   -0.736  -42.510 1.00 47.19  ? 7    C   O "O5'" 1 
ATOM   1866  C  "C5'" . C   G  1 7   ? 11.134   -0.462  -41.342 1.00 47.55  ? 7    C   O "C5'" 1 
ATOM   1867  C  "C4'" . C   G  1 7   ? 11.568   -1.751  -40.683 1.00 46.49  ? 7    C   O "C4'" 1 
ATOM   1868  O  "O4'" . C   G  1 7   ? 11.821   -2.768  -41.677 1.00 45.17  ? 7    C   O "O4'" 1 
ATOM   1869  C  "C3'" . C   G  1 7   ? 12.861   -1.620  -39.900 1.00 45.88  ? 7    C   O "C3'" 1 
ATOM   1870  O  "O3'" . C   G  1 7   ? 12.558   -1.212  -38.579 1.00 45.27  ? 7    C   O "O3'" 1 
ATOM   1871  C  "C2'" . C   G  1 7   ? 13.438   -3.028  -39.926 1.00 45.09  ? 7    C   O "C2'" 1 
ATOM   1872  O  "O2'" . C   G  1 7   ? 12.995   -3.794  -38.829 1.00 44.04  ? 7    C   O "O2'" 1 
ATOM   1873  C  "C1'" . C   G  1 7   ? 12.897   -3.578  -41.254 1.00 44.87  ? 7    C   O "C1'" 1 
ATOM   1874  N  N1    . C   G  1 7   ? 13.866   -3.637  -42.348 1.00 44.91  ? 7    C   O N1    1 
ATOM   1875  C  C2    . C   G  1 7   ? 14.716   -4.730  -42.426 1.00 46.65  ? 7    C   O C2    1 
ATOM   1876  O  O2    . C   G  1 7   ? 14.652   -5.594  -41.542 1.00 48.67  ? 7    C   O O2    1 
ATOM   1877  N  N3    . C   G  1 7   ? 15.585   -4.825  -43.459 1.00 47.73  ? 7    C   O N3    1 
ATOM   1878  C  C4    . C   G  1 7   ? 15.615   -3.873  -44.394 1.00 47.29  ? 7    C   O C4    1 
ATOM   1879  N  N4    . C   G  1 7   ? 16.457   -4.028  -45.423 1.00 45.66  ? 7    C   O N4    1 
ATOM   1880  C  C5    . C   G  1 7   ? 14.774   -2.725  -44.321 1.00 47.62  ? 7    C   O C5    1 
ATOM   1881  C  C6    . C   G  1 7   ? 13.922   -2.649  -43.288 1.00 46.06  ? 7    C   O C6    1 
ATOM   1882  P  P     . U   G  1 8   ? 13.467   -0.112  -37.863 1.00 44.82  ? 8    U   O P     1 
ATOM   1883  O  OP1   . U   G  1 8   ? 12.784   0.242   -36.595 1.00 45.91  ? 8    U   O OP1   1 
ATOM   1884  O  OP2   . U   G  1 8   ? 13.776   0.952   -38.851 1.00 43.32  ? 8    U   O OP2   1 
ATOM   1885  O  "O5'" . U   G  1 8   ? 14.789   -0.924  -37.521 1.00 44.54  ? 8    U   O "O5'" 1 
ATOM   1886  C  "C5'" . U   G  1 8   ? 14.788   -1.864  -36.462 1.00 46.02  ? 8    U   O "C5'" 1 
ATOM   1887  C  "C4'" . U   G  1 8   ? 16.103   -2.582  -36.411 1.00 47.82  ? 8    U   O "C4'" 1 
ATOM   1888  O  "O4'" . U   G  1 8   ? 16.215   -3.445  -37.568 1.00 49.62  ? 8    U   O "O4'" 1 
ATOM   1889  C  "C3'" . U   G  1 8   ? 17.320   -1.688  -36.534 1.00 48.89  ? 8    U   O "C3'" 1 
ATOM   1890  O  "O3'" . U   G  1 8   ? 17.678   -1.082  -35.313 1.00 49.26  ? 8    U   O "O3'" 1 
ATOM   1891  C  "C2'" . U   G  1 8   ? 18.383   -2.669  -36.991 1.00 49.27  ? 8    U   O "C2'" 1 
ATOM   1892  O  "O2'" . U   G  1 8   ? 18.917   -3.430  -35.925 1.00 47.51  ? 8    U   O "O2'" 1 
ATOM   1893  C  "C1'" . U   G  1 8   ? 17.576   -3.532  -37.962 1.00 49.26  ? 8    U   O "C1'" 1 
ATOM   1894  N  N1    . U   G  1 8   ? 17.689   -3.015  -39.328 1.00 49.17  ? 8    U   O N1    1 
ATOM   1895  C  C2    . U   G  1 8   ? 18.794   -3.394  -40.046 1.00 50.28  ? 8    U   O C2    1 
ATOM   1896  O  O2    . U   G  1 8   ? 19.645   -4.132  -39.587 1.00 51.73  ? 8    U   O O2    1 
ATOM   1897  N  N3    . U   G  1 8   ? 18.870   -2.876  -41.313 1.00 49.65  ? 8    U   O N3    1 
ATOM   1898  C  C4    . U   G  1 8   ? 17.964   -2.032  -41.910 1.00 49.77  ? 8    U   O C4    1 
ATOM   1899  O  O4    . U   G  1 8   ? 18.188   -1.617  -43.043 1.00 51.13  ? 8    U   O O4    1 
ATOM   1900  C  C5    . U   G  1 8   ? 16.838   -1.688  -41.097 1.00 49.25  ? 8    U   O C5    1 
ATOM   1901  C  C6    . U   G  1 8   ? 16.742   -2.181  -39.864 1.00 48.41  ? 8    U   O C6    1 
ATOM   1902  P  P     . G   G  1 9   ? 18.475   0.306   -35.342 1.00 50.09  ? 9    G   O P     1 
ATOM   1903  O  OP1   . G   G  1 9   ? 18.724   0.711   -33.934 1.00 51.58  ? 9    G   O OP1   1 
ATOM   1904  O  OP2   . G   G  1 9   ? 17.745   1.221   -36.265 1.00 49.10  ? 9    G   O OP2   1 
ATOM   1905  O  "O5'" . G   G  1 9   ? 19.879   -0.079  -35.980 1.00 48.21  ? 9    G   O "O5'" 1 
ATOM   1906  C  "C5'" . G   G  1 9   ? 20.729   -0.974  -35.294 1.00 48.70  ? 9    G   O "C5'" 1 
ATOM   1907  C  "C4'" . G   G  1 9   ? 21.788   -1.494  -36.216 1.00 48.84  ? 9    G   O "C4'" 1 
ATOM   1908  O  "O4'" . G   G  1 9   ? 21.157   -2.024  -37.410 1.00 49.60  ? 9    G   O "O4'" 1 
ATOM   1909  C  "C3'" . G   G  1 9   ? 22.736   -0.463  -36.784 1.00 48.54  ? 9    G   O "C3'" 1 
ATOM   1910  O  "O3'" . G   G  1 9   ? 23.742   -0.127  -35.846 1.00 49.18  ? 9    G   O "O3'" 1 
ATOM   1911  C  "C2'" . G   G  1 9   ? 23.314   -1.223  -37.965 1.00 48.90  ? 9    G   O "C2'" 1 
ATOM   1912  O  "O2'" . G   G  1 9   ? 24.265   -2.180  -37.542 1.00 48.10  ? 9    G   O "O2'" 1 
ATOM   1913  C  "C1'" . G   G  1 9   ? 22.063   -1.927  -38.498 1.00 48.87  ? 9    G   O "C1'" 1 
ATOM   1914  N  N9    . G   G  1 9   ? 21.423   -1.184  -39.578 1.00 48.21  ? 9    G   O N9    1 
ATOM   1915  C  C8    . G   G  1 9   ? 20.272   -0.436  -39.522 1.00 48.38  ? 9    G   O C8    1 
ATOM   1916  N  N7    . G   G  1 9   ? 19.979   0.141   -40.658 1.00 48.04  ? 9    G   O N7    1 
ATOM   1917  C  C5    . G   G  1 9   ? 20.996   -0.259  -41.515 1.00 48.49  ? 9    G   O C5    1 
ATOM   1918  C  C6    . G   G  1 9   ? 21.233   0.057   -42.883 1.00 48.04  ? 9    G   O C6    1 
ATOM   1919  O  O6    . G   G  1 9   ? 20.572   0.781   -43.634 1.00 48.49  ? 9    G   O O6    1 
ATOM   1920  N  N1    . G   G  1 9   ? 22.381   -0.565  -43.358 1.00 46.32  ? 9    G   O N1    1 
ATOM   1921  C  C2    . G   G  1 9   ? 23.199   -1.380  -42.620 1.00 46.31  ? 9    G   O C2    1 
ATOM   1922  N  N2    . G   G  1 9   ? 24.251   -1.895  -43.257 1.00 46.43  ? 9    G   O N2    1 
ATOM   1923  N  N3    . G   G  1 9   ? 22.998   -1.674  -41.349 1.00 47.09  ? 9    G   O N3    1 
ATOM   1924  C  C4    . G   G  1 9   ? 21.887   -1.085  -40.865 1.00 48.08  ? 9    G   O C4    1 
ATOM   1925  P  P     . A   G  1 10  ? 24.374   1.349   -35.870 1.00 50.38  ? 10   A   O P     1 
ATOM   1926  O  OP1   . A   G  1 10  ? 25.020   1.573   -34.548 1.00 50.19  ? 10   A   O OP1   1 
ATOM   1927  O  OP2   . A   G  1 10  ? 23.330   2.292   -36.344 1.00 50.30  ? 10   A   O OP2   1 
ATOM   1928  O  "O5'" . A   G  1 10  ? 25.493   1.260   -37.003 1.00 50.80  ? 10   A   O "O5'" 1 
ATOM   1929  C  "C5'" . A   G  1 10  ? 26.528   0.280   -36.936 1.00 52.45  ? 10   A   O "C5'" 1 
ATOM   1930  C  "C4'" . A   G  1 10  ? 27.326   0.277   -38.217 1.00 52.86  ? 10   A   O "C4'" 1 
ATOM   1931  O  "O4'" . A   G  1 10  ? 26.531   -0.282  -39.299 1.00 53.29  ? 10   A   O "O4'" 1 
ATOM   1932  C  "C3'" . A   G  1 10  ? 27.723   1.656   -38.709 1.00 54.03  ? 10   A   O "C3'" 1 
ATOM   1933  O  "O3'" . A   G  1 10  ? 28.912   2.101   -38.063 1.00 56.75  ? 10   A   O "O3'" 1 
ATOM   1934  C  "C2'" . A   G  1 10  ? 27.903   1.410   -40.200 1.00 53.09  ? 10   A   O "C2'" 1 
ATOM   1935  O  "O2'" . A   G  1 10  ? 29.114   0.739   -40.480 1.00 51.28  ? 10   A   O "O2'" 1 
ATOM   1936  C  "C1'" . A   G  1 10  ? 26.725   0.477   -40.483 1.00 52.59  ? 10   A   O "C1'" 1 
ATOM   1937  N  N9    . A   G  1 10  ? 25.482   1.200   -40.749 1.00 52.20  ? 10   A   O N9    1 
ATOM   1938  C  C8    . A   G  1 10  ? 24.548   1.582   -39.820 1.00 52.69  ? 10   A   O C8    1 
ATOM   1939  N  N7    . A   G  1 10  ? 23.534   2.240   -40.327 1.00 53.00  ? 10   A   O N7    1 
ATOM   1940  C  C5    . A   G  1 10  ? 23.815   2.294   -41.683 1.00 51.98  ? 10   A   O C5    1 
ATOM   1941  C  C6    . A   G  1 10  ? 23.129   2.872   -42.769 1.00 51.53  ? 10   A   O C6    1 
ATOM   1942  N  N6    . A   G  1 10  ? 21.979   3.536   -42.653 1.00 52.87  ? 10   A   O N6    1 
ATOM   1943  N  N1    . A   G  1 10  ? 23.674   2.747   -43.992 1.00 50.97  ? 10   A   O N1    1 
ATOM   1944  C  C2    . A   G  1 10  ? 24.833   2.090   -44.108 1.00 52.48  ? 10   A   O C2    1 
ATOM   1945  N  N3    . A   G  1 10  ? 25.578   1.509   -43.164 1.00 52.53  ? 10   A   O N3    1 
ATOM   1946  C  C4    . A   G  1 10  ? 25.008   1.649   -41.959 1.00 51.86  ? 10   A   O C4    1 
ATOM   1947  P  P     . U   G  1 11  ? 29.107   3.666   -37.746 1.00 57.79  ? 11   U   O P     1 
ATOM   1948  O  OP1   . U   G  1 11  ? 30.199   3.769   -36.740 1.00 58.12  ? 11   U   O OP1   1 
ATOM   1949  O  OP2   . U   G  1 11  ? 27.777   4.257   -37.450 1.00 55.90  ? 11   U   O OP2   1 
ATOM   1950  O  "O5'" . U   G  1 11  ? 29.604   4.269   -39.135 1.00 57.42  ? 11   U   O "O5'" 1 
ATOM   1951  C  "C5'" . U   G  1 11  ? 30.705   3.692   -39.834 1.00 57.51  ? 11   U   O "C5'" 1 
ATOM   1952  C  "C4'" . U   G  1 11  ? 30.836   4.306   -41.212 1.00 58.52  ? 11   U   O "C4'" 1 
ATOM   1953  O  "O4'" . U   G  1 11  ? 29.874   3.735   -42.141 1.00 58.63  ? 11   U   O "O4'" 1 
ATOM   1954  C  "C3'" . U   G  1 11  ? 30.550   5.792   -41.293 1.00 60.21  ? 11   U   O "C3'" 1 
ATOM   1955  O  "O3'" . U   G  1 11  ? 31.633   6.581   -40.844 1.00 62.57  ? 11   U   O "O3'" 1 
ATOM   1956  C  "C2'" . U   G  1 11  ? 30.308   5.979   -42.779 1.00 59.51  ? 11   U   O "C2'" 1 
ATOM   1957  O  "O2'" . U   G  1 11  ? 31.521   6.005   -43.498 1.00 59.73  ? 11   U   O "O2'" 1 
ATOM   1958  C  "C1'" . U   G  1 11  ? 29.504   4.718   -43.105 1.00 59.14  ? 11   U   O "C1'" 1 
ATOM   1959  N  N1    . U   G  1 11  ? 28.059   4.976   -42.992 1.00 59.38  ? 11   U   O N1    1 
ATOM   1960  C  C2    . U   G  1 11  ? 27.451   5.715   -44.001 1.00 59.22  ? 11   U   O C2    1 
ATOM   1961  O  O2    . U   G  1 11  ? 28.050   6.131   -44.972 1.00 59.87  ? 11   U   O O2    1 
ATOM   1962  N  N3    . U   G  1 11  ? 26.113   5.953   -43.824 1.00 59.30  ? 11   U   O N3    1 
ATOM   1963  C  C4    . U   G  1 11  ? 25.330   5.542   -42.770 1.00 59.84  ? 11   U   O C4    1 
ATOM   1964  O  O4    . U   G  1 11  ? 24.138   5.860   -42.740 1.00 59.24  ? 11   U   O O4    1 
ATOM   1965  C  C5    . U   G  1 11  ? 26.024   4.775   -41.775 1.00 59.80  ? 11   U   O C5    1 
ATOM   1966  C  C6    . U   G  1 11  ? 27.330   4.522   -41.919 1.00 58.97  ? 11   U   O C6    1 
ATOM   1967  P  P     . U   G  1 12  ? 31.364   8.095   -40.382 1.00 63.73  ? 12   U   O P     1 
ATOM   1968  O  OP1   . U   G  1 12  ? 32.581   8.482   -39.644 1.00 63.33  ? 12   U   O OP1   1 
ATOM   1969  O  OP2   . U   G  1 12  ? 30.040   8.194   -39.711 1.00 64.91  ? 12   U   O OP2   1 
ATOM   1970  O  "O5'" . U   G  1 12  ? 31.278   8.902   -41.752 1.00 61.51  ? 12   U   O "O5'" 1 
ATOM   1971  C  "C5'" . U   G  1 12  ? 32.339   8.835   -42.695 1.00 59.61  ? 12   U   O "C5'" 1 
ATOM   1972  C  "C4'" . U   G  1 12  ? 31.900   9.409   -44.018 1.00 56.88  ? 12   U   O "C4'" 1 
ATOM   1973  O  "O4'" . U   G  1 12  ? 30.803   8.613   -44.540 1.00 56.13  ? 12   U   O "O4'" 1 
ATOM   1974  C  "C3'" . U   G  1 12  ? 31.349   10.823  -43.979 1.00 54.82  ? 12   U   O "C3'" 1 
ATOM   1975  O  "O3'" . U   G  1 12  ? 32.404   11.779  -44.020 1.00 50.98  ? 12   U   O "O3'" 1 
ATOM   1976  C  "C2'" . U   G  1 12  ? 30.502   10.849  -45.243 1.00 55.20  ? 12   U   O "C2'" 1 
ATOM   1977  O  "O2'" . U   G  1 12  ? 31.294   10.965  -46.408 1.00 54.91  ? 12   U   O "O2'" 1 
ATOM   1978  C  "C1'" . U   G  1 12  ? 29.884   9.451   -45.212 1.00 55.69  ? 12   U   O "C1'" 1 
ATOM   1979  N  N1    . U   G  1 12  ? 28.605   9.377   -44.495 1.00 56.92  ? 12   U   O N1    1 
ATOM   1980  C  C2    . U   G  1 12  ? 27.460   9.713   -45.187 1.00 58.49  ? 12   U   O C2    1 
ATOM   1981  O  O2    . U   G  1 12  ? 27.479   10.091  -46.346 1.00 59.79  ? 12   U   O O2    1 
ATOM   1982  N  N3    . U   G  1 12  ? 26.288   9.592   -44.473 1.00 59.36  ? 12   U   O N3    1 
ATOM   1983  C  C4    . U   G  1 12  ? 26.151   9.177   -43.161 1.00 58.68  ? 12   U   O C4    1 
ATOM   1984  O  O4    . U   G  1 12  ? 25.020   9.057   -42.669 1.00 56.66  ? 12   U   O O4    1 
ATOM   1985  C  C5    . U   G  1 12  ? 27.391   8.865   -42.510 1.00 58.92  ? 12   U   O C5    1 
ATOM   1986  C  C6    . U   G  1 12  ? 28.546   8.975   -43.184 1.00 57.39  ? 12   U   O C6    1 
ATOM   1987  P  P     . C   G  1 13  ? 32.129   13.294  -43.546 1.00 51.29  ? 13   C   O P     1 
ATOM   1988  O  OP1   . C   G  1 13  ? 33.396   14.052  -43.753 1.00 48.83  ? 13   C   O OP1   1 
ATOM   1989  O  OP2   . C   G  1 13  ? 31.495   13.279  -42.200 1.00 52.08  ? 13   C   O OP2   1 
ATOM   1990  O  "O5'" . C   G  1 13  ? 31.033   13.841  -44.571 1.00 49.72  ? 13   C   O "O5'" 1 
ATOM   1991  C  "C5'" . C   G  1 13  ? 31.330   13.976  -45.958 1.00 50.02  ? 13   C   O "C5'" 1 
ATOM   1992  C  "C4'" . C   G  1 13  ? 30.082   14.314  -46.728 1.00 49.59  ? 13   C   O "C4'" 1 
ATOM   1993  O  "O4'" . C   G  1 13  ? 29.120   13.252  -46.546 1.00 48.49  ? 13   C   O "O4'" 1 
ATOM   1994  C  "C3'" . C   G  1 13  ? 29.371   15.571  -46.265 1.00 51.13  ? 13   C   O "C3'" 1 
ATOM   1995  O  "O3'" . C   G  1 13  ? 29.916   16.695  -46.958 1.00 54.81  ? 13   C   O "O3'" 1 
ATOM   1996  C  "C2'" . C   G  1 13  ? 27.928   15.310  -46.684 1.00 50.56  ? 13   C   O "C2'" 1 
ATOM   1997  O  "O2'" . C   G  1 13  ? 27.670   15.644  -48.032 1.00 51.27  ? 13   C   O "O2'" 1 
ATOM   1998  C  "C1'" . C   G  1 13  ? 27.815   13.793  -46.515 1.00 49.50  ? 13   C   O "C1'" 1 
ATOM   1999  N  N1    . C   G  1 13  ? 27.153   13.342  -45.278 1.00 48.61  ? 13   C   O N1    1 
ATOM   2000  C  C2    . C   G  1 13  ? 25.769   13.495  -45.149 1.00 47.29  ? 13   C   O C2    1 
ATOM   2001  O  O2    . C   G  1 13  ? 25.136   14.042  -46.058 1.00 47.02  ? 13   C   O O2    1 
ATOM   2002  N  N3    . C   G  1 13  ? 25.158   13.047  -44.032 1.00 47.60  ? 13   C   O N3    1 
ATOM   2003  C  C4    . C   G  1 13  ? 25.875   12.479  -43.061 1.00 48.24  ? 13   C   O C4    1 
ATOM   2004  N  N4    . C   G  1 13  ? 25.232   12.049  -41.976 1.00 48.69  ? 13   C   O N4    1 
ATOM   2005  C  C5    . C   G  1 13  ? 27.283   12.326  -43.158 1.00 49.40  ? 13   C   O C5    1 
ATOM   2006  C  C6    . C   G  1 13  ? 27.877   12.769  -44.274 1.00 49.97  ? 13   C   O C6    1 
ATOM   2007  P  P     . C   G  1 14  ? 30.254   18.051  -46.160 1.00 56.90  ? 14   C   O P     1 
ATOM   2008  O  OP1   . C   G  1 14  ? 31.239   18.838  -46.953 1.00 57.33  ? 14   C   O OP1   1 
ATOM   2009  O  OP2   . C   G  1 14  ? 30.575   17.673  -44.761 1.00 57.56  ? 14   C   O OP2   1 
ATOM   2010  O  "O5'" . C   G  1 14  ? 28.879   18.851  -46.151 1.00 57.36  ? 14   C   O "O5'" 1 
ATOM   2011  C  "C5'" . C   G  1 14  ? 28.273   19.263  -47.370 1.00 58.79  ? 14   C   O "C5'" 1 
ATOM   2012  C  "C4'" . C   G  1 14  ? 26.774   19.272  -47.222 1.00 60.00  ? 14   C   O "C4'" 1 
ATOM   2013  O  "O4'" . C   G  1 14  ? 26.335   17.943  -46.828 1.00 61.92  ? 14   C   O "O4'" 1 
ATOM   2014  C  "C3'" . C   G  1 14  ? 26.221   20.159  -46.120 1.00 59.71  ? 14   C   O "C3'" 1 
ATOM   2015  O  "O3'" . C   G  1 14  ? 26.224   21.547  -46.464 1.00 57.52  ? 14   C   O "O3'" 1 
ATOM   2016  C  "C2'" . C   G  1 14  ? 24.847   19.541  -45.879 1.00 60.94  ? 14   C   O "C2'" 1 
ATOM   2017  O  "O2'" . C   G  1 14  ? 23.883   19.926  -46.844 1.00 60.82  ? 14   C   O "O2'" 1 
ATOM   2018  C  "C1'" . C   G  1 14  ? 25.157   18.047  -46.039 1.00 61.24  ? 14   C   O "C1'" 1 
ATOM   2019  N  N1    . C   G  1 14  ? 25.380   17.345  -44.764 1.00 60.79  ? 14   C   O N1    1 
ATOM   2020  C  C2    . C   G  1 14  ? 24.271   16.911  -44.042 1.00 60.90  ? 14   C   O C2    1 
ATOM   2021  O  O2    . C   G  1 14  ? 23.146   17.122  -44.505 1.00 61.66  ? 14   C   O O2    1 
ATOM   2022  N  N3    . C   G  1 14  ? 24.451   16.268  -42.863 1.00 61.42  ? 14   C   O N3    1 
ATOM   2023  C  C4    . C   G  1 14  ? 25.686   16.046  -42.410 1.00 61.71  ? 14   C   O C4    1 
ATOM   2024  N  N4    . C   G  1 14  ? 25.824   15.395  -41.248 1.00 60.48  ? 14   C   O N4    1 
ATOM   2025  C  C5    . C   G  1 14  ? 26.840   16.478  -43.130 1.00 62.03  ? 14   C   O C5    1 
ATOM   2026  C  C6    . C   G  1 14  ? 26.641   17.120  -44.290 1.00 61.09  ? 14   C   O C6    1 
ATOM   2027  O  "O5'" . DG  H  2 1   ? 17.366   15.758  -42.240 1.00 107.45 ? 15   DG  P "O5'" 1 
ATOM   2028  C  "C5'" . DG  H  2 1   ? 16.311   14.980  -42.809 1.00 104.85 ? 15   DG  P "C5'" 1 
ATOM   2029  C  "C4'" . DG  H  2 1   ? 16.017   13.768  -41.958 1.00 101.85 ? 15   DG  P "C4'" 1 
ATOM   2030  O  "O4'" . DG  H  2 1   ? 17.211   13.485  -41.188 1.00 101.51 ? 15   DG  P "O4'" 1 
ATOM   2031  C  "C3'" . DG  H  2 1   ? 14.866   13.943  -40.956 1.00 99.04  ? 15   DG  P "C3'" 1 
ATOM   2032  O  "O3'" . DG  H  2 1   ? 14.020   12.786  -40.891 1.00 95.97  ? 15   DG  P "O3'" 1 
ATOM   2033  C  "C2'" . DG  H  2 1   ? 15.568   14.035  -39.612 1.00 99.81  ? 15   DG  P "C2'" 1 
ATOM   2034  C  "C1'" . DG  H  2 1   ? 16.861   13.261  -39.839 1.00 102.32 ? 15   DG  P "C1'" 1 
ATOM   2035  N  N9    . DG  H  2 1   ? 17.945   13.750  -38.992 1.00 104.12 ? 15   DG  P N9    1 
ATOM   2036  C  C8    . DG  H  2 1   ? 17.814   14.076  -37.665 1.00 105.04 ? 15   DG  P C8    1 
ATOM   2037  N  N7    . DG  H  2 1   ? 18.923   14.499  -37.125 1.00 105.48 ? 15   DG  P N7    1 
ATOM   2038  C  C5    . DG  H  2 1   ? 19.851   14.454  -38.158 1.00 104.84 ? 15   DG  P C5    1 
ATOM   2039  C  C6    . DG  H  2 1   ? 21.228   14.800  -38.167 1.00 104.93 ? 15   DG  P C6    1 
ATOM   2040  O  O6    . DG  H  2 1   ? 21.922   15.239  -37.236 1.00 105.09 ? 15   DG  P O6    1 
ATOM   2041  N  N1    . DG  H  2 1   ? 21.797   14.589  -39.417 1.00 104.10 ? 15   DG  P N1    1 
ATOM   2042  C  C2    . DG  H  2 1   ? 21.134   14.107  -40.518 1.00 103.30 ? 15   DG  P C2    1 
ATOM   2043  N  N2    . DG  H  2 1   ? 21.875   13.956  -41.626 1.00 102.73 ? 15   DG  P N2    1 
ATOM   2044  N  N3    . DG  H  2 1   ? 19.844   13.792  -40.531 1.00 102.92 ? 15   DG  P N3    1 
ATOM   2045  C  C4    . DG  H  2 1   ? 19.268   13.986  -39.322 1.00 104.00 ? 15   DG  P C4    1 
ATOM   2046  P  P     . DG  H  2 2   ? 13.763   11.874  -42.204 1.00 93.37  ? 16   DG  P P     1 
ATOM   2047  O  OP1   . DG  H  2 2   ? 12.319   11.554  -42.370 1.00 92.12  ? 16   DG  P OP1   1 
ATOM   2048  O  OP2   . DG  H  2 2   ? 14.749   10.760  -42.129 1.00 93.69  ? 16   DG  P OP2   1 
ATOM   2049  O  "O5'" . DG  H  2 2   ? 14.167   12.765  -43.456 1.00 88.97  ? 16   DG  P "O5'" 1 
ATOM   2050  C  "C5'" . DG  H  2 2   ? 14.284   12.133  -44.711 1.00 82.96  ? 16   DG  P "C5'" 1 
ATOM   2051  C  "C4'" . DG  H  2 2   ? 15.056   12.978  -45.690 1.00 79.16  ? 16   DG  P "C4'" 1 
ATOM   2052  O  "O4'" . DG  H  2 2   ? 16.284   13.457  -45.098 1.00 77.53  ? 16   DG  P "O4'" 1 
ATOM   2053  C  "C3'" . DG  H  2 2   ? 15.460   12.058  -46.825 1.00 78.50  ? 16   DG  P "C3'" 1 
ATOM   2054  O  "O3'" . DG  H  2 2   ? 15.002   12.456  -48.086 1.00 79.05  ? 16   DG  P "O3'" 1 
ATOM   2055  C  "C2'" . DG  H  2 2   ? 16.970   11.982  -46.800 1.00 77.27  ? 16   DG  P "C2'" 1 
ATOM   2056  C  "C1'" . DG  H  2 2   ? 17.421   13.052  -45.840 1.00 77.38  ? 16   DG  P "C1'" 1 
ATOM   2057  N  N9    . DG  H  2 2   ? 18.364   12.435  -44.918 1.00 77.61  ? 16   DG  P N9    1 
ATOM   2058  C  C8    . DG  H  2 2   ? 18.064   11.530  -43.933 1.00 77.83  ? 16   DG  P C8    1 
ATOM   2059  N  N7    . DG  H  2 2   ? 19.120   11.047  -43.342 1.00 78.46  ? 16   DG  P N7    1 
ATOM   2060  C  C5    . DG  H  2 2   ? 20.183   11.694  -43.957 1.00 78.93  ? 16   DG  P C5    1 
ATOM   2061  C  C6    . DG  H  2 2   ? 21.582   11.567  -43.750 1.00 79.28  ? 16   DG  P C6    1 
ATOM   2062  O  O6    . DG  H  2 2   ? 22.181   10.825  -42.964 1.00 81.10  ? 16   DG  P O6    1 
ATOM   2063  N  N1    . DG  H  2 2   ? 22.301   12.414  -44.583 1.00 78.19  ? 16   DG  P N1    1 
ATOM   2064  C  C2    . DG  H  2 2   ? 21.751   13.271  -45.497 1.00 77.92  ? 16   DG  P C2    1 
ATOM   2065  N  N2    . DG  H  2 2   ? 22.617   14.017  -46.191 1.00 78.96  ? 16   DG  P N2    1 
ATOM   2066  N  N3    . DG  H  2 2   ? 20.451   13.392  -45.711 1.00 78.37  ? 16   DG  P N3    1 
ATOM   2067  C  C4    . DG  H  2 2   ? 19.731   12.577  -44.912 1.00 78.33  ? 16   DG  P C4    1 
ATOM   2068  P  P     . DA  H  2 3   ? 15.018   11.374  -49.257 1.00 79.36  ? 17   DA  P P     1 
ATOM   2069  O  OP1   . DA  H  2 3   ? 13.661   11.229  -49.849 1.00 80.88  ? 17   DA  P OP1   1 
ATOM   2070  O  OP2   . DA  H  2 3   ? 15.708   10.169  -48.727 1.00 77.38  ? 17   DA  P OP2   1 
ATOM   2071  O  "O5'" . DA  H  2 3   ? 16.014   12.029  -50.293 1.00 78.69  ? 17   DA  P "O5'" 1 
ATOM   2072  C  "C5'" . DA  H  2 3   ? 16.891   11.195  -50.997 1.00 77.74  ? 17   DA  P "C5'" 1 
ATOM   2073  C  "C4'" . DA  H  2 3   ? 18.219   11.870  -51.214 1.00 75.24  ? 17   DA  P "C4'" 1 
ATOM   2074  O  "O4'" . DA  H  2 3   ? 18.902   12.056  -49.943 1.00 75.28  ? 17   DA  P "O4'" 1 
ATOM   2075  C  "C3'" . DA  H  2 3   ? 19.061   10.886  -52.007 1.00 73.33  ? 17   DA  P "C3'" 1 
ATOM   2076  O  "O3'" . DA  H  2 3   ? 19.360   11.278  -53.338 1.00 69.87  ? 17   DA  P "O3'" 1 
ATOM   2077  C  "C2'" . DA  H  2 3   ? 20.295   10.613  -51.171 1.00 74.43  ? 17   DA  P "C2'" 1 
ATOM   2078  C  "C1'" . DA  H  2 3   ? 20.245   11.588  -50.021 1.00 76.43  ? 17   DA  P "C1'" 1 
ATOM   2079  N  N9    . DA  H  2 3   ? 20.569   10.853  -48.796 1.00 78.57  ? 17   DA  P N9    1 
ATOM   2080  C  C8    . DA  H  2 3   ? 19.741   10.057  -48.047 1.00 78.77  ? 17   DA  P C8    1 
ATOM   2081  N  N7    . DA  H  2 3   ? 20.348   9.440   -47.059 1.00 78.78  ? 17   DA  P N7    1 
ATOM   2082  C  C5    . DA  H  2 3   ? 21.662   9.877   -47.148 1.00 79.29  ? 17   DA  P C5    1 
ATOM   2083  C  C6    . DA  H  2 3   ? 22.814   9.583   -46.390 1.00 78.74  ? 17   DA  P C6    1 
ATOM   2084  N  N6    . DA  H  2 3   ? 22.826   8.738   -45.358 1.00 78.09  ? 17   DA  P N6    1 
ATOM   2085  N  N1    . DA  H  2 3   ? 23.967   10.192  -46.738 1.00 78.86  ? 17   DA  P N1    1 
ATOM   2086  C  C2    . DA  H  2 3   ? 23.957   11.034  -47.782 1.00 80.45  ? 17   DA  P C2    1 
ATOM   2087  N  N3    . DA  H  2 3   ? 22.944   11.388  -48.576 1.00 80.85  ? 17   DA  P N3    1 
ATOM   2088  C  C4    . DA  H  2 3   ? 21.809   10.766  -48.202 1.00 80.03  ? 17   DA  P C4    1 
ATOM   2089  P  P     . DA  H  2 4   ? 19.827   10.135  -54.349 1.00 66.50  ? 18   DA  P P     1 
ATOM   2090  O  OP1   . DA  H  2 4   ? 20.591   10.707  -55.490 1.00 66.81  ? 18   DA  P OP1   1 
ATOM   2091  O  OP2   . DA  H  2 4   ? 18.700   9.201   -54.606 1.00 66.34  ? 18   DA  P OP2   1 
ATOM   2092  O  "O5'" . DA  H  2 4   ? 20.831   9.374   -53.394 1.00 66.03  ? 18   DA  P "O5'" 1 
ATOM   2093  C  "C5'" . DA  H  2 4   ? 21.360   8.126   -53.722 1.00 63.94  ? 18   DA  P "C5'" 1 
ATOM   2094  C  "C4'" . DA  H  2 4   ? 22.825   8.111   -53.379 1.00 61.92  ? 18   DA  P "C4'" 1 
ATOM   2095  O  "O4'" . DA  H  2 4   ? 23.009   8.497   -51.993 1.00 60.51  ? 18   DA  P "O4'" 1 
ATOM   2096  C  "C3'" . DA  H  2 4   ? 23.389   6.714   -53.530 1.00 62.09  ? 18   DA  P "C3'" 1 
ATOM   2097  O  "O3'" . DA  H  2 4   ? 24.415   6.666   -54.492 1.00 63.47  ? 18   DA  P "O3'" 1 
ATOM   2098  C  "C2'" . DA  H  2 4   ? 23.853   6.303   -52.146 1.00 61.27  ? 18   DA  P "C2'" 1 
ATOM   2099  C  "C1'" . DA  H  2 4   ? 23.843   7.570   -51.314 1.00 60.46  ? 18   DA  P "C1'" 1 
ATOM   2100  N  N9    . DA  H  2 4   ? 23.235   7.272   -50.018 1.00 58.30  ? 18   DA  P N9    1 
ATOM   2101  C  C8    . DA  H  2 4   ? 21.908   7.095   -49.765 1.00 57.76  ? 18   DA  P C8    1 
ATOM   2102  N  N7    . DA  H  2 4   ? 21.650   6.715   -48.542 1.00 57.47  ? 18   DA  P N7    1 
ATOM   2103  C  C5    . DA  H  2 4   ? 22.893   6.663   -47.940 1.00 56.31  ? 18   DA  P C5    1 
ATOM   2104  C  C6    . DA  H  2 4   ? 23.296   6.310   -46.648 1.00 57.46  ? 18   DA  P C6    1 
ATOM   2105  N  N6    . DA  H  2 4   ? 22.456   5.892   -45.698 1.00 57.25  ? 18   DA  P N6    1 
ATOM   2106  N  N1    . DA  H  2 4   ? 24.612   6.388   -46.359 1.00 58.82  ? 18   DA  P N1    1 
ATOM   2107  C  C2    . DA  H  2 4   ? 25.455   6.777   -47.321 1.00 58.60  ? 18   DA  P C2    1 
ATOM   2108  N  N3    . DA  H  2 4   ? 25.194   7.115   -48.578 1.00 59.05  ? 18   DA  P N3    1 
ATOM   2109  C  C4    . DA  H  2 4   ? 23.877   7.036   -48.827 1.00 57.57  ? 18   DA  P C4    1 
ATOM   2110  P  P     . DT  H  2 5   ? 24.590   5.325   -55.332 1.00 65.06  ? 19   DT  P P     1 
ATOM   2111  O  OP1   . DT  H  2 5   ? 25.811   5.502   -56.154 1.00 65.11  ? 19   DT  P OP1   1 
ATOM   2112  O  OP2   . DT  H  2 5   ? 23.302   4.959   -55.981 1.00 64.24  ? 19   DT  P OP2   1 
ATOM   2113  O  "O5'" . DT  H  2 5   ? 24.836   4.250   -54.185 1.00 64.37  ? 19   DT  P "O5'" 1 
ATOM   2114  C  "C5'" . DT  H  2 5   ? 23.743   3.543   -53.593 1.00 62.83  ? 19   DT  P "C5'" 1 
ATOM   2115  C  "C4'" . DT  H  2 5   ? 24.279   2.464   -52.684 1.00 63.10  ? 19   DT  P "C4'" 1 
ATOM   2116  O  "O4'" . DT  H  2 5   ? 24.369   2.978   -51.331 1.00 64.23  ? 19   DT  P "O4'" 1 
ATOM   2117  C  "C3'" . DT  H  2 5   ? 23.399   1.221   -52.607 1.00 62.56  ? 19   DT  P "C3'" 1 
ATOM   2118  O  "O3'" . DT  H  2 5   ? 24.066   0.085   -53.106 1.00 59.78  ? 19   DT  P "O3'" 1 
ATOM   2119  C  "C2'" . DT  H  2 5   ? 23.162   0.987   -51.129 1.00 64.29  ? 19   DT  P "C2'" 1 
ATOM   2120  C  "C1'" . DT  H  2 5   ? 24.079   1.950   -50.403 1.00 64.77  ? 19   DT  P "C1'" 1 
ATOM   2121  N  N1    . DT  H  2 5   ? 23.312   2.529   -49.285 1.00 65.95  ? 19   DT  P N1    1 
ATOM   2122  C  C2    . DT  H  2 5   ? 23.878   2.651   -48.037 1.00 65.98  ? 19   DT  P C2    1 
ATOM   2123  O  O2    . DT  H  2 5   ? 25.065   2.455   -47.815 1.00 66.56  ? 19   DT  P O2    1 
ATOM   2124  N  N3    . DT  H  2 5   ? 22.993   3.024   -47.050 1.00 65.72  ? 19   DT  P N3    1 
ATOM   2125  C  C4    . DT  H  2 5   ? 21.650   3.313   -47.198 1.00 65.61  ? 19   DT  P C4    1 
ATOM   2126  O  O4    . DT  H  2 5   ? 20.970   3.589   -46.211 1.00 67.04  ? 19   DT  P O4    1 
ATOM   2127  C  C5    . DT  H  2 5   ? 21.155   3.250   -48.552 1.00 65.23  ? 19   DT  P C5    1 
ATOM   2128  C  C7    . DT  H  2 5   ? 19.729   3.607   -48.827 1.00 66.16  ? 19   DT  P C7    1 
ATOM   2129  C  C6    . DT  H  2 5   ? 21.999   2.873   -49.509 1.00 65.02  ? 19   DT  P C6    1 
ATOM   2130  P  P     . DC  H  2 6   ? 23.279   -1.304  -53.183 1.00 57.32  ? 20   DC  P P     1 
ATOM   2131  O  OP1   . DC  H  2 6   ? 23.673   -1.863  -54.493 1.00 57.55  ? 20   DC  P OP1   1 
ATOM   2132  O  OP2   . DC  H  2 6   ? 21.837   -1.116  -52.867 1.00 56.24  ? 20   DC  P OP2   1 
ATOM   2133  O  "O5'" . DC  H  2 6   ? 23.961   -2.144  -52.022 1.00 55.15  ? 20   DC  P "O5'" 1 
ATOM   2134  C  "C5'" . DC  H  2 6   ? 25.372   -2.277  -51.996 1.00 54.80  ? 20   DC  P "C5'" 1 
ATOM   2135  C  "C4'" . DC  H  2 6   ? 25.832   -2.821  -50.668 1.00 53.49  ? 20   DC  P "C4'" 1 
ATOM   2136  O  "O4'" . DC  H  2 6   ? 25.628   -1.781  -49.680 1.00 52.71  ? 20   DC  P "O4'" 1 
ATOM   2137  C  "C3'" . DC  H  2 6   ? 25.030   -4.028  -50.193 1.00 52.80  ? 20   DC  P "C3'" 1 
ATOM   2138  O  "O3'" . DC  H  2 6   ? 25.754   -5.242  -50.166 1.00 52.09  ? 20   DC  P "O3'" 1 
ATOM   2139  C  "C2'" . DC  H  2 6   ? 24.670   -3.716  -48.756 1.00 53.99  ? 20   DC  P "C2'" 1 
ATOM   2140  C  "C1'" . DC  H  2 6   ? 25.235   -2.348  -48.449 1.00 52.93  ? 20   DC  P "C1'" 1 
ATOM   2141  N  N1    . DC  H  2 6   ? 24.116   -1.566  -47.924 1.00 53.56  ? 20   DC  P N1    1 
ATOM   2142  C  C2    . DC  H  2 6   ? 24.042   -1.345  -46.556 1.00 53.34  ? 20   DC  P C2    1 
ATOM   2143  O  O2    . DC  H  2 6   ? 24.999   -1.689  -45.853 1.00 51.87  ? 20   DC  P O2    1 
ATOM   2144  N  N3    . DC  H  2 6   ? 22.930   -0.759  -46.035 1.00 54.74  ? 20   DC  P N3    1 
ATOM   2145  C  C4    . DC  H  2 6   ? 21.935   -0.378  -46.846 1.00 54.48  ? 20   DC  P C4    1 
ATOM   2146  N  N4    . DC  H  2 6   ? 20.841   0.155   -46.295 1.00 53.65  ? 20   DC  P N4    1 
ATOM   2147  C  C5    . DC  H  2 6   ? 22.017   -0.536  -48.259 1.00 54.28  ? 20   DC  P C5    1 
ATOM   2148  C  C6    . DC  H  2 6   ? 23.121   -1.122  -48.753 1.00 54.21  ? 20   DC  P C6    1 
ATOM   2149  P  P     . DA  H  2 7   ? 24.946   -6.611  -49.928 1.00 51.94  ? 21   DA  P P     1 
ATOM   2150  O  OP1   . DA  H  2 7   ? 25.550   -7.671  -50.777 1.00 52.23  ? 21   DA  P OP1   1 
ATOM   2151  O  OP2   . DA  H  2 7   ? 23.493   -6.299  -50.053 1.00 51.28  ? 21   DA  P OP2   1 
ATOM   2152  O  "O5'" . DA  H  2 7   ? 25.201   -6.965  -48.400 1.00 49.80  ? 21   DA  P "O5'" 1 
ATOM   2153  C  "C5'" . DA  H  2 7   ? 26.493   -6.879  -47.816 1.00 50.01  ? 21   DA  P "C5'" 1 
ATOM   2154  C  "C4'" . DA  H  2 7   ? 26.413   -7.336  -46.383 1.00 50.60  ? 21   DA  P "C4'" 1 
ATOM   2155  O  "O4'" . DA  H  2 7   ? 25.769   -6.302  -45.597 1.00 48.85  ? 21   DA  P "O4'" 1 
ATOM   2156  C  "C3'" . DA  H  2 7   ? 25.532   -8.577  -46.279 1.00 52.53  ? 21   DA  P "C3'" 1 
ATOM   2157  O  "O3'" . DA  H  2 7   ? 26.083   -9.611  -45.486 1.00 56.93  ? 21   DA  P "O3'" 1 
ATOM   2158  C  "C2'" . DA  H  2 7   ? 24.239   -8.096  -45.651 1.00 51.21  ? 21   DA  P "C2'" 1 
ATOM   2159  C  "C1'" . DA  H  2 7   ? 24.568   -6.768  -44.994 1.00 48.87  ? 21   DA  P "C1'" 1 
ATOM   2160  N  N9    . DA  H  2 7   ? 23.517   -5.793  -45.294 1.00 47.80  ? 21   DA  P N9    1 
ATOM   2161  C  C8    . DA  H  2 7   ? 23.146   -5.379  -46.551 1.00 46.52  ? 21   DA  P C8    1 
ATOM   2162  N  N7    . DA  H  2 7   ? 22.151   -4.529  -46.561 1.00 44.01  ? 21   DA  P N7    1 
ATOM   2163  C  C5    . DA  H  2 7   ? 21.848   -4.360  -45.219 1.00 45.02  ? 21   DA  P C5    1 
ATOM   2164  C  C6    . DA  H  2 7   ? 20.884   -3.575  -44.564 1.00 45.32  ? 21   DA  P C6    1 
ATOM   2165  N  N6    . DA  H  2 7   ? 20.022   -2.781  -45.208 1.00 45.51  ? 21   DA  P N6    1 
ATOM   2166  N  N1    . DA  H  2 7   ? 20.838   -3.631  -43.213 1.00 44.47  ? 21   DA  P N1    1 
ATOM   2167  C  C2    . DA  H  2 7   ? 21.713   -4.423  -42.576 1.00 45.08  ? 21   DA  P C2    1 
ATOM   2168  N  N3    . DA  H  2 7   ? 22.670   -5.205  -43.080 1.00 45.33  ? 21   DA  P N3    1 
ATOM   2169  C  C4    . DA  H  2 7   ? 22.684   -5.129  -44.423 1.00 46.21  ? 21   DA  P C4    1 
ATOM   2170  P  P     . DG  H  2 8   ? 25.291   -10.996 -45.392 1.00 60.29  ? 22   DG  P P     1 
ATOM   2171  O  OP1   . DG  H  2 8   ? 26.278   -12.059 -45.083 1.00 60.92  ? 22   DG  P OP1   1 
ATOM   2172  O  OP2   . DG  H  2 8   ? 24.474   -11.087 -46.635 1.00 59.36  ? 22   DG  P OP2   1 
ATOM   2173  O  "O5'" . DG  H  2 8   ? 24.282   -10.781 -44.173 1.00 59.67  ? 22   DG  P "O5'" 1 
ATOM   2174  C  "C5'" . DG  H  2 8   ? 24.747   -10.566 -42.837 1.00 58.43  ? 22   DG  P "C5'" 1 
ATOM   2175  C  "C4'" . DG  H  2 8   ? 23.574   -10.540 -41.880 1.00 57.99  ? 22   DG  P "C4'" 1 
ATOM   2176  O  "O4'" . DG  H  2 8   ? 22.842   -9.293  -42.014 1.00 57.74  ? 22   DG  P "O4'" 1 
ATOM   2177  C  "C3'" . DG  H  2 8   ? 22.557   -11.666 -42.090 1.00 57.30  ? 22   DG  P "C3'" 1 
ATOM   2178  O  "O3'" . DG  H  2 8   ? 22.203   -12.306 -40.868 1.00 56.90  ? 22   DG  P "O3'" 1 
ATOM   2179  C  "C2'" . DG  H  2 8   ? 21.329   -10.976 -42.659 1.00 57.63  ? 22   DG  P "C2'" 1 
ATOM   2180  C  "C1'" . DG  H  2 8   ? 21.451   -9.526  -42.202 1.00 56.72  ? 22   DG  P "C1'" 1 
ATOM   2181  N  N9    . DG  H  2 8   ? 20.995   -8.636  -43.265 1.00 55.99  ? 22   DG  P N9    1 
ATOM   2182  C  C8    . DG  H  2 8   ? 21.540   -8.566  -44.517 1.00 56.23  ? 22   DG  P C8    1 
ATOM   2183  N  N7    . DG  H  2 8   ? 20.889   -7.773  -45.321 1.00 56.29  ? 22   DG  P N7    1 
ATOM   2184  C  C5    . DG  H  2 8   ? 19.853   -7.274  -44.551 1.00 54.54  ? 22   DG  P C5    1 
ATOM   2185  C  C6    . DG  H  2 8   ? 18.793   -6.393  -44.901 1.00 54.20  ? 22   DG  P C6    1 
ATOM   2186  O  O6    . DG  H  2 8   ? 18.519   -5.910  -46.018 1.00 53.68  ? 22   DG  P O6    1 
ATOM   2187  N  N1    . DG  H  2 8   ? 17.991   -6.107  -43.804 1.00 53.33  ? 22   DG  P N1    1 
ATOM   2188  C  C2    . DG  H  2 8   ? 18.165   -6.626  -42.544 1.00 53.54  ? 22   DG  P C2    1 
ATOM   2189  N  N2    . DG  H  2 8   ? 17.302   -6.206  -41.618 1.00 53.85  ? 22   DG  P N2    1 
ATOM   2190  N  N3    . DG  H  2 8   ? 19.120   -7.488  -42.217 1.00 54.05  ? 22   DG  P N3    1 
ATOM   2191  C  C4    . DG  H  2 8   ? 19.925   -7.763  -43.262 1.00 54.74  ? 22   DG  P C4    1 
ATOM   2192  P  P     . DG  H  2 9   ? 21.250   -13.596 -40.914 1.00 58.36  ? 23   DG  P P     1 
ATOM   2193  O  OP1   . DG  H  2 9   ? 21.632   -14.480 -39.782 1.00 57.58  ? 23   DG  P OP1   1 
ATOM   2194  O  OP2   . DG  H  2 9   ? 21.275   -14.125 -42.303 1.00 56.82  ? 23   DG  P OP2   1 
ATOM   2195  O  "O5'" . DG  H  2 9   ? 19.795   -13.010 -40.640 1.00 56.10  ? 23   DG  P "O5'" 1 
ATOM   2196  C  "C5'" . DG  H  2 9   ? 19.453   -12.515 -39.354 1.00 56.58  ? 23   DG  P "C5'" 1 
ATOM   2197  C  "C4'" . DG  H  2 9   ? 17.973   -12.218 -39.271 1.00 56.69  ? 23   DG  P "C4'" 1 
ATOM   2198  O  "O4'" . DG  H  2 9   ? 17.687   -10.940 -39.889 1.00 55.94  ? 23   DG  P "O4'" 1 
ATOM   2199  C  "C3'" . DG  H  2 9   ? 17.030   -13.243 -39.913 1.00 57.63  ? 23   DG  P "C3'" 1 
ATOM   2200  O  "O3'" . DG  H  2 9   ? 16.025   -13.671 -38.993 1.00 58.30  ? 23   DG  P "O3'" 1 
ATOM   2201  C  "C2'" . DG  H  2 9   ? 16.347   -12.477 -41.031 1.00 56.56  ? 23   DG  P "C2'" 1 
ATOM   2202  C  "C1'" . DG  H  2 9   ? 16.475   -11.023 -40.619 1.00 55.28  ? 23   DG  P "C1'" 1 
ATOM   2203  N  N9    . DG  H  2 9   ? 16.601   -10.206 -41.820 1.00 53.43  ? 23   DG  P N9    1 
ATOM   2204  C  C8    . DG  H  2 9   ? 17.614   -10.258 -42.747 1.00 52.56  ? 23   DG  P C8    1 
ATOM   2205  N  N7    . DG  H  2 9   ? 17.362   -9.558  -43.817 1.00 50.48  ? 23   DG  P N7    1 
ATOM   2206  C  C5    . DG  H  2 9   ? 16.124   -8.980  -43.563 1.00 50.41  ? 23   DG  P C5    1 
ATOM   2207  C  C6    . DG  H  2 9   ? 15.309   -8.161  -44.380 1.00 50.60  ? 23   DG  P C6    1 
ATOM   2208  O  O6    . DG  H  2 9   ? 15.507   -7.803  -45.546 1.00 54.09  ? 23   DG  P O6    1 
ATOM   2209  N  N1    . DG  H  2 9   ? 14.147   -7.771  -43.723 1.00 48.88  ? 23   DG  P N1    1 
ATOM   2210  C  C2    . DG  H  2 9   ? 13.806   -8.139  -42.450 1.00 49.06  ? 23   DG  P C2    1 
ATOM   2211  N  N2    . DG  H  2 9   ? 12.662   -7.645  -41.983 1.00 48.38  ? 23   DG  P N2    1 
ATOM   2212  N  N3    . DG  H  2 9   ? 14.539   -8.932  -41.688 1.00 49.91  ? 23   DG  P N3    1 
ATOM   2213  C  C4    . DG  H  2 9   ? 15.675   -9.317  -42.308 1.00 50.96  ? 23   DG  P C4    1 
ATOM   2214  P  P     . DT  H  2 10  ? 14.913   -14.748 -39.457 1.00 59.30  ? 24   DT  P P     1 
ATOM   2215  O  OP1   . DT  H  2 10  ? 15.230   -16.054 -38.796 1.00 58.43  ? 24   DT  P OP1   1 
ATOM   2216  O  OP2   . DT  H  2 10  ? 14.688   -14.720 -40.928 1.00 58.01  ? 24   DT  P OP2   1 
ATOM   2217  O  "O5'" . DT  H  2 10  ? 13.607   -14.140 -38.792 1.00 55.96  ? 24   DT  P "O5'" 1 
ATOM   2218  C  "C5'" . DT  H  2 10  ? 12.345   -14.268 -39.412 1.00 52.63  ? 24   DT  P "C5'" 1 
ATOM   2219  C  "C4'" . DT  H  2 10  ? 11.559   -12.992 -39.241 1.00 48.91  ? 24   DT  P "C4'" 1 
ATOM   2220  O  "O4'" . DT  H  2 10  ? 12.147   -11.978 -40.089 1.00 47.91  ? 24   DT  P "O4'" 1 
ATOM   2221  C  "C3'" . DT  H  2 10  ? 10.116   -13.153 -39.707 1.00 48.32  ? 24   DT  P "C3'" 1 
ATOM   2222  O  "O3'" . DT  H  2 10  ? 9.179    -12.572 -38.824 1.00 46.99  ? 24   DT  P "O3'" 1 
ATOM   2223  C  "C2'" . DT  H  2 10  ? 10.054   -12.453 -41.047 1.00 48.23  ? 24   DT  P "C2'" 1 
ATOM   2224  C  "C1'" . DT  H  2 10  ? 11.151   -11.422 -40.941 1.00 47.29  ? 24   DT  P "C1'" 1 
ATOM   2225  N  N1    . DT  H  2 10  ? 11.760   -11.138 -42.246 1.00 45.29  ? 24   DT  P N1    1 
ATOM   2226  C  C2    . DT  H  2 10  ? 11.052   -10.344 -43.123 1.00 44.29  ? 24   DT  P C2    1 
ATOM   2227  O  O2    . DT  H  2 10  ? 9.972    -9.847  -42.849 1.00 45.06  ? 24   DT  P O2    1 
ATOM   2228  N  N3    . DT  H  2 10  ? 11.653   -10.155 -44.336 1.00 42.99  ? 24   DT  P N3    1 
ATOM   2229  C  C4    . DT  H  2 10  ? 12.866   -10.658 -44.749 1.00 43.64  ? 24   DT  P C4    1 
ATOM   2230  O  O4    . DT  H  2 10  ? 13.269   -10.421 -45.881 1.00 43.68  ? 24   DT  P O4    1 
ATOM   2231  C  C5    . DT  H  2 10  ? 13.571   -11.456 -43.766 1.00 44.06  ? 24   DT  P C5    1 
ATOM   2232  C  C7    . DT  H  2 10  ? 14.921   -12.001 -44.106 1.00 42.37  ? 24   DT  P C7    1 
ATOM   2233  C  C6    . DT  H  2 10  ? 12.985   -11.660 -42.582 1.00 44.75  ? 24   DT  P C6    1 
ATOM   2234  P  P     . DG  H  2 11  ? 7.655    -13.032 -38.937 1.00 48.04  ? 25   DG  P P     1 
ATOM   2235  O  OP1   . DG  H  2 11  ? 6.946    -12.537 -37.733 1.00 47.69  ? 25   DG  P OP1   1 
ATOM   2236  O  OP2   . DG  H  2 11  ? 7.687    -14.485 -39.228 1.00 46.30  ? 25   DG  P OP2   1 
ATOM   2237  O  "O5'" . DG  H  2 11  ? 7.131    -12.294 -40.248 1.00 46.65  ? 25   DG  P "O5'" 1 
ATOM   2238  C  "C5'" . DG  H  2 11  ? 6.950    -10.879 -40.272 1.00 46.80  ? 25   DG  P "C5'" 1 
ATOM   2239  C  "C4'" . DG  H  2 11  ? 6.064    -10.489 -41.434 1.00 46.57  ? 25   DG  P "C4'" 1 
ATOM   2240  O  "O4'" . DG  H  2 11  ? 6.833    -10.196 -42.629 1.00 44.75  ? 25   DG  P "O4'" 1 
ATOM   2241  C  "C3'" . DG  H  2 11  ? 5.055    -11.567 -41.820 1.00 45.13  ? 25   DG  P "C3'" 1 
ATOM   2242  O  "O3'" . DG  H  2 11  ? 3.759    -11.018 -42.010 1.00 45.29  ? 25   DG  P "O3'" 1 
ATOM   2243  C  "C2'" . DG  H  2 11  ? 5.593    -12.118 -43.127 1.00 43.60  ? 25   DG  P "C2'" 1 
ATOM   2244  C  "C1'" . DG  H  2 11  ? 6.314    -10.922 -43.726 1.00 42.44  ? 25   DG  P "C1'" 1 
ATOM   2245  N  N9    . DG  H  2 11  ? 7.442    -11.317 -44.556 1.00 40.73  ? 25   DG  P N9    1 
ATOM   2246  C  C8    . DG  H  2 11  ? 8.435    -12.193 -44.214 1.00 39.25  ? 25   DG  P C8    1 
ATOM   2247  N  N7    . DG  H  2 11  ? 9.296    -12.391 -45.173 1.00 38.75  ? 25   DG  P N7    1 
ATOM   2248  C  C5    . DG  H  2 11  ? 8.845    -11.587 -46.210 1.00 38.22  ? 25   DG  P C5    1 
ATOM   2249  C  C6    . DG  H  2 11  ? 9.366    -11.387 -47.518 1.00 38.21  ? 25   DG  P C6    1 
ATOM   2250  O  O6    . DG  H  2 11  ? 10.371   -11.904 -48.045 1.00 38.25  ? 25   DG  P O6    1 
ATOM   2251  N  N1    . DG  H  2 11  ? 8.590    -10.483 -48.236 1.00 36.28  ? 25   DG  P N1    1 
ATOM   2252  C  C2    . DG  H  2 11  ? 7.472    -9.853  -47.755 1.00 35.45  ? 25   DG  P C2    1 
ATOM   2253  N  N2    . DG  H  2 11  ? 6.869    -9.004  -48.576 1.00 37.46  ? 25   DG  P N2    1 
ATOM   2254  N  N3    . DG  H  2 11  ? 6.982    -10.033 -46.552 1.00 36.88  ? 25   DG  P N3    1 
ATOM   2255  C  C4    . DG  H  2 11  ? 7.709    -10.908 -45.839 1.00 38.64  ? 25   DG  P C4    1 
ATOM   2256  P  P     . DT  H  2 12  ? 2.503    -12.008 -42.066 1.00 45.50  ? 26   DT  P P     1 
ATOM   2257  O  OP1   . DT  H  2 12  ? 1.280    -11.233 -41.758 1.00 46.17  ? 26   DT  P OP1   1 
ATOM   2258  O  OP2   . DT  H  2 12  ? 2.805    -13.231 -41.289 1.00 41.28  ? 26   DT  P OP2   1 
ATOM   2259  O  "O5'" . DT  H  2 12  ? 2.503    -12.477 -43.581 1.00 46.74  ? 26   DT  P "O5'" 1 
ATOM   2260  C  "C5'" . DT  H  2 12  ? 2.878    -13.808 -43.904 1.00 49.96  ? 26   DT  P "C5'" 1 
ATOM   2261  C  "C4'" . DT  H  2 12  ? 2.518    -14.119 -45.333 1.00 51.01  ? 26   DT  P "C4'" 1 
ATOM   2262  O  "O4'" . DT  H  2 12  ? 3.523    -13.553 -46.212 1.00 52.54  ? 26   DT  P "O4'" 1 
ATOM   2263  C  "C3'" . DT  H  2 12  ? 2.507    -15.619 -45.592 1.00 52.82  ? 26   DT  P "C3'" 1 
ATOM   2264  O  "O3'" . DT  H  2 12  ? 1.227    -16.030 -46.018 1.00 54.42  ? 26   DT  P "O3'" 1 
ATOM   2265  C  "C2'" . DT  H  2 12  ? 3.539    -15.860 -46.677 1.00 53.51  ? 26   DT  P "C2'" 1 
ATOM   2266  C  "C1'" . DT  H  2 12  ? 3.956    -14.492 -47.182 1.00 53.35  ? 26   DT  P "C1'" 1 
ATOM   2267  N  N1    . DT  H  2 12  ? 5.433    -14.438 -47.262 1.00 54.32  ? 26   DT  P N1    1 
ATOM   2268  C  C2    . DT  H  2 12  ? 6.076    -13.705 -48.243 1.00 54.38  ? 26   DT  P C2    1 
ATOM   2269  O  O2    . DT  H  2 12  ? 5.506    -12.929 -48.992 1.00 54.87  ? 26   DT  P O2    1 
ATOM   2270  N  N3    . DT  H  2 12  ? 7.432    -13.906 -48.298 1.00 54.42  ? 26   DT  P N3    1 
ATOM   2271  C  C4    . DT  H  2 12  ? 8.194    -14.704 -47.466 1.00 55.26  ? 26   DT  P C4    1 
ATOM   2272  O  O4    . DT  H  2 12  ? 9.399    -14.837 -47.671 1.00 55.85  ? 26   DT  P O4    1 
ATOM   2273  C  C5    . DT  H  2 12  ? 7.468    -15.348 -46.403 1.00 56.04  ? 26   DT  P C5    1 
ATOM   2274  C  C7    . DT  H  2 12  ? 8.222    -16.153 -45.392 1.00 57.69  ? 26   DT  P C7    1 
ATOM   2275  C  C6    . DT  H  2 12  ? 6.145    -15.191 -46.362 1.00 54.87  ? 26   DT  P C6    1 
ATOM   2276  P  P     . DC  H  2 13  ? 1.012    -17.526 -46.538 1.00 54.83  ? 27   DC  P P     1 
ATOM   2277  O  OP1   . DC  H  2 13  ? -0.373   -17.835 -46.115 1.00 55.19  ? 27   DC  P OP1   1 
ATOM   2278  O  OP2   . DC  H  2 13  ? 2.120    -18.439 -46.163 1.00 51.54  ? 27   DC  P OP2   1 
ATOM   2279  O  "O5'" . DC  H  2 13  ? 1.068    -17.335 -48.109 1.00 55.22  ? 27   DC  P "O5'" 1 
ATOM   2280  C  "C5'" . DC  H  2 13  ? 0.333    -16.291 -48.728 1.00 57.27  ? 27   DC  P "C5'" 1 
ATOM   2281  C  "C4'" . DC  H  2 13  ? 0.482    -16.394 -50.223 1.00 58.51  ? 27   DC  P "C4'" 1 
ATOM   2282  O  "O4'" . DC  H  2 13  ? 1.688    -15.698 -50.616 1.00 58.63  ? 27   DC  P "O4'" 1 
ATOM   2283  C  "C3'" . DC  H  2 13  ? 0.628    -17.843 -50.682 1.00 59.75  ? 27   DC  P "C3'" 1 
ATOM   2284  O  "O3'" . DC  H  2 13  ? -0.357   -18.195 -51.625 1.00 61.81  ? 27   DC  P "O3'" 1 
ATOM   2285  C  "C2'" . DC  H  2 13  ? 2.003    -17.928 -51.320 1.00 59.16  ? 27   DC  P "C2'" 1 
ATOM   2286  C  "C1'" . DC  H  2 13  ? 2.508    -16.501 -51.447 1.00 58.42  ? 27   DC  P "C1'" 1 
ATOM   2287  N  N1    . DC  H  2 13  ? 3.873    -16.466 -50.903 1.00 57.25  ? 27   DC  P N1    1 
ATOM   2288  C  C2    . DC  H  2 13  ? 4.925    -15.932 -51.663 1.00 55.15  ? 27   DC  P C2    1 
ATOM   2289  O  O2    . DC  H  2 13  ? 4.672    -15.367 -52.733 1.00 53.77  ? 27   DC  P O2    1 
ATOM   2290  N  N3    . DC  H  2 13  ? 6.190    -16.047 -51.201 1.00 54.10  ? 27   DC  P N3    1 
ATOM   2291  C  C4    . DC  H  2 13  ? 6.418    -16.643 -50.029 1.00 54.11  ? 27   DC  P C4    1 
ATOM   2292  N  N4    . DC  H  2 13  ? 7.678    -16.791 -49.637 1.00 55.31  ? 27   DC  P N4    1 
ATOM   2293  C  C5    . DC  H  2 13  ? 5.364    -17.127 -49.212 1.00 55.27  ? 27   DC  P C5    1 
ATOM   2294  C  C6    . DC  H  2 13  ? 4.120    -17.013 -49.677 1.00 56.66  ? 27   DC  P C6    1 
ATOM   2295  P  P     . DG  H  2 14  ? -0.291   -19.629 -52.328 1.00 63.08  ? 28   DG  P P     1 
ATOM   2296  O  OP1   . DG  H  2 14  ? -1.439   -20.423 -51.815 1.00 62.50  ? 28   DG  P OP1   1 
ATOM   2297  O  OP2   . DG  H  2 14  ? 1.082    -20.190 -52.231 1.00 60.08  ? 28   DG  P OP2   1 
ATOM   2298  O  "O5'" . DG  H  2 14  ? -0.541   -19.230 -53.847 1.00 65.89  ? 28   DG  P "O5'" 1 
ATOM   2299  C  "C5'" . DG  H  2 14  ? -0.037   -20.026 -54.901 1.00 72.07  ? 28   DG  P "C5'" 1 
ATOM   2300  C  "C4'" . DG  H  2 14  ? 0.857    -19.202 -55.793 1.00 74.79  ? 28   DG  P "C4'" 1 
ATOM   2301  O  "O4'" . DG  H  2 14  ? 1.974    -18.731 -55.003 1.00 75.80  ? 28   DG  P "O4'" 1 
ATOM   2302  C  "C3'" . DG  H  2 14  ? 1.439    -20.036 -56.930 1.00 76.61  ? 28   DG  P "C3'" 1 
ATOM   2303  O  "O3'" . DG  H  2 14  ? 0.828    -19.885 -58.229 1.00 78.43  ? 28   DG  P "O3'" 1 
ATOM   2304  C  "C2'" . DG  H  2 14  ? 2.943    -20.057 -56.707 1.00 77.21  ? 28   DG  P "C2'" 1 
ATOM   2305  C  "C1'" . DG  H  2 14  ? 3.218    -19.036 -55.618 1.00 77.57  ? 28   DG  P "C1'" 1 
ATOM   2306  N  N9    . DG  H  2 14  ? 4.095    -19.580 -54.585 1.00 79.25  ? 28   DG  P N9    1 
ATOM   2307  C  C8    . DG  H  2 14  ? 3.710    -20.112 -53.378 1.00 81.05  ? 28   DG  P C8    1 
ATOM   2308  N  N7    . DG  H  2 14  ? 4.713    -20.551 -52.666 1.00 81.88  ? 28   DG  P N7    1 
ATOM   2309  C  C5    . DG  H  2 14  ? 5.829    -20.289 -53.448 1.00 80.57  ? 28   DG  P C5    1 
ATOM   2310  C  C6    . DG  H  2 14  ? 7.201    -20.544 -53.197 1.00 80.68  ? 28   DG  P C6    1 
ATOM   2311  O  O6    . DG  H  2 14  ? 7.719    -21.078 -52.206 1.00 80.48  ? 28   DG  P O6    1 
ATOM   2312  N  N1    . DG  H  2 14  ? 8.000    -20.104 -54.248 1.00 80.49  ? 28   DG  P N1    1 
ATOM   2313  C  C2    . DG  H  2 14  ? 7.536    -19.492 -55.388 1.00 80.62  ? 28   DG  P C2    1 
ATOM   2314  N  N2    . DG  H  2 14  ? 8.466    -19.106 -56.269 1.00 81.44  ? 28   DG  P N2    1 
ATOM   2315  N  N3    . DG  H  2 14  ? 6.256    -19.264 -55.640 1.00 79.93  ? 28   DG  P N3    1 
ATOM   2316  C  C4    . DG  H  2 14  ? 5.465    -19.682 -54.633 1.00 79.65  ? 28   DG  P C4    1 
ATOM   2317  O  "O5'" . C   I  1 1   ? 5.084    50.834  -31.287 1.00 87.18  ? 1    C   T "O5'" 1 
ATOM   2318  C  "C5'" . C   I  1 1   ? 5.621    51.446  -30.109 1.00 86.10  ? 1    C   T "C5'" 1 
ATOM   2319  C  "C4'" . C   I  1 1   ? 4.774    51.218  -28.876 1.00 86.19  ? 1    C   T "C4'" 1 
ATOM   2320  O  "O4'" . C   I  1 1   ? 3.403    51.626  -29.142 1.00 85.32  ? 1    C   T "O4'" 1 
ATOM   2321  C  "C3'" . C   I  1 1   ? 4.641    49.772  -28.427 1.00 86.26  ? 1    C   T "C3'" 1 
ATOM   2322  O  "O3'" . C   I  1 1   ? 5.768    49.355  -27.661 1.00 87.25  ? 1    C   T "O3'" 1 
ATOM   2323  C  "C2'" . C   I  1 1   ? 3.350    49.812  -27.616 1.00 85.74  ? 1    C   T "C2'" 1 
ATOM   2324  O  "O2'" . C   I  1 1   ? 3.511    50.338  -26.311 1.00 85.10  ? 1    C   T "O2'" 1 
ATOM   2325  C  "C1'" . C   I  1 1   ? 2.504    50.764  -28.462 1.00 84.76  ? 1    C   T "C1'" 1 
ATOM   2326  N  N1    . C   I  1 1   ? 1.706    50.053  -29.472 1.00 84.28  ? 1    C   T N1    1 
ATOM   2327  C  C2    . C   I  1 1   ? 0.448    49.562  -29.113 1.00 83.92  ? 1    C   T C2    1 
ATOM   2328  O  O2    . C   I  1 1   ? 0.048    49.734  -27.953 1.00 83.67  ? 1    C   T O2    1 
ATOM   2329  N  N3    . C   I  1 1   ? -0.296   48.912  -30.037 1.00 83.49  ? 1    C   T N3    1 
ATOM   2330  C  C4    . C   I  1 1   ? 0.176    48.745  -31.277 1.00 83.51  ? 1    C   T C4    1 
ATOM   2331  N  N4    . C   I  1 1   ? -0.595   48.110  -32.162 1.00 82.37  ? 1    C   T N4    1 
ATOM   2332  C  C5    . C   I  1 1   ? 1.460    49.226  -31.666 1.00 83.55  ? 1    C   T C5    1 
ATOM   2333  C  C6    . C   I  1 1   ? 2.183    49.870  -30.741 1.00 84.07  ? 1    C   T C6    1 
ATOM   2334  P  P     . G   I  1 2   ? 6.353    47.867  -27.858 1.00 87.46  ? 2    G   T P     1 
ATOM   2335  O  OP1   . G   I  1 2   ? 7.542    47.725  -26.978 1.00 87.90  ? 2    G   T OP1   1 
ATOM   2336  O  OP2   . G   I  1 2   ? 6.488    47.618  -29.323 1.00 87.48  ? 2    G   T OP2   1 
ATOM   2337  O  "O5'" . G   I  1 2   ? 5.199    46.938  -27.269 1.00 84.50  ? 2    G   T "O5'" 1 
ATOM   2338  C  "C5'" . G   I  1 2   ? 4.704    47.156  -25.952 1.00 80.77  ? 2    G   T "C5'" 1 
ATOM   2339  C  "C4'" . G   I  1 2   ? 3.471    46.320  -25.701 1.00 77.76  ? 2    G   T "C4'" 1 
ATOM   2340  O  "O4'" . G   I  1 2   ? 2.351    46.807  -26.487 1.00 76.64  ? 2    G   T "O4'" 1 
ATOM   2341  C  "C3'" . G   I  1 2   ? 3.580    44.861  -26.089 1.00 75.70  ? 2    G   T "C3'" 1 
ATOM   2342  O  "O3'" . G   I  1 2   ? 4.269    44.134  -25.082 1.00 72.38  ? 2    G   T "O3'" 1 
ATOM   2343  C  "C2'" . G   I  1 2   ? 2.114    44.457  -26.196 1.00 75.62  ? 2    G   T "C2'" 1 
ATOM   2344  O  "O2'" . G   I  1 2   ? 1.540    44.211  -24.930 1.00 76.29  ? 2    G   T "O2'" 1 
ATOM   2345  C  "C1'" . G   I  1 2   ? 1.489    45.723  -26.793 1.00 75.64  ? 2    G   T "C1'" 1 
ATOM   2346  N  N9    . G   I  1 2   ? 1.315    45.665  -28.241 1.00 74.40  ? 2    G   T N9    1 
ATOM   2347  C  C8    . G   I  1 2   ? 2.130    46.224  -29.196 1.00 73.32  ? 2    G   T C8    1 
ATOM   2348  N  N7    . G   I  1 2   ? 1.719    45.999  -30.414 1.00 72.66  ? 2    G   T N7    1 
ATOM   2349  C  C5    . G   I  1 2   ? 0.562    45.247  -30.255 1.00 72.27  ? 2    G   T C5    1 
ATOM   2350  C  C6    . G   I  1 2   ? -0.319   44.703  -31.223 1.00 71.56  ? 2    G   T C6    1 
ATOM   2351  O  O6    . G   I  1 2   ? -0.245   44.773  -32.453 1.00 72.11  ? 2    G   T O6    1 
ATOM   2352  N  N1    . G   I  1 2   ? -1.371   44.012  -30.630 1.00 70.79  ? 2    G   T N1    1 
ATOM   2353  C  C2    . G   I  1 2   ? -1.551   43.853  -29.281 1.00 71.23  ? 2    G   T C2    1 
ATOM   2354  N  N2    . G   I  1 2   ? -2.629   43.142  -28.912 1.00 70.39  ? 2    G   T N2    1 
ATOM   2355  N  N3    . G   I  1 2   ? -0.734   44.353  -28.364 1.00 72.29  ? 2    G   T N3    1 
ATOM   2356  C  C4    . G   I  1 2   ? 0.296    45.034  -28.920 1.00 73.27  ? 2    G   T C4    1 
ATOM   2357  P  P     . A   I  1 3   ? 5.133    42.844  -25.491 1.00 70.73  ? 3    A   T P     1 
ATOM   2358  O  OP1   . A   I  1 3   ? 6.033    42.530  -24.356 1.00 71.36  ? 3    A   T OP1   1 
ATOM   2359  O  OP2   . A   I  1 3   ? 5.710    43.069  -26.842 1.00 70.60  ? 3    A   T OP2   1 
ATOM   2360  O  "O5'" . A   I  1 3   ? 4.040    41.691  -25.588 1.00 68.64  ? 3    A   T "O5'" 1 
ATOM   2361  C  "C5'" . A   I  1 3   ? 3.190    41.419  -24.482 1.00 64.48  ? 3    A   T "C5'" 1 
ATOM   2362  C  "C4'" . A   I  1 3   ? 1.946    40.696  -24.936 1.00 61.86  ? 3    A   T "C4'" 1 
ATOM   2363  O  "O4'" . A   I  1 3   ? 1.188    41.536  -25.842 1.00 63.34  ? 3    A   T "O4'" 1 
ATOM   2364  C  "C3'" . A   I  1 3   ? 2.159    39.427  -25.735 1.00 59.12  ? 3    A   T "C3'" 1 
ATOM   2365  O  "O3'" . A   I  1 3   ? 2.446    38.341  -24.875 1.00 54.12  ? 3    A   T "O3'" 1 
ATOM   2366  C  "C2'" . A   I  1 3   ? 0.811    39.266  -26.423 1.00 61.07  ? 3    A   T "C2'" 1 
ATOM   2367  O  "O2'" . A   I  1 3   ? -0.190   38.763  -25.562 1.00 60.17  ? 3    A   T "O2'" 1 
ATOM   2368  C  "C1'" . A   I  1 3   ? 0.479    40.719  -26.762 1.00 63.84  ? 3    A   T "C1'" 1 
ATOM   2369  N  N9    . A   I  1 3   ? 0.885    41.097  -28.114 1.00 66.14  ? 3    A   T N9    1 
ATOM   2370  C  C8    . A   I  1 3   ? 2.082    41.635  -28.506 1.00 66.89  ? 3    A   T C8    1 
ATOM   2371  N  N7    . A   I  1 3   ? 2.157    41.876  -29.791 1.00 67.95  ? 3    A   T N7    1 
ATOM   2372  C  C5    . A   I  1 3   ? 0.925    41.470  -30.279 1.00 67.85  ? 3    A   T C5    1 
ATOM   2373  C  C6    . A   I  1 3   ? 0.376    41.471  -31.573 1.00 69.06  ? 3    A   T C6    1 
ATOM   2374  N  N6    . A   I  1 3   ? 1.033    41.905  -32.655 1.00 68.80  ? 3    A   T N6    1 
ATOM   2375  N  N1    . A   I  1 3   ? -0.884   41.006  -31.721 1.00 69.85  ? 3    A   T N1    1 
ATOM   2376  C  C2    . A   I  1 3   ? -1.536   40.567  -30.632 1.00 70.43  ? 3    A   T C2    1 
ATOM   2377  N  N3    . A   I  1 3   ? -1.123   40.511  -29.366 1.00 69.14  ? 3    A   T N3    1 
ATOM   2378  C  C4    . A   I  1 3   ? 0.131    40.985  -29.257 1.00 67.56  ? 3    A   T C4    1 
ATOM   2379  P  P     . C   I  1 4   ? 3.449    37.199  -25.367 1.00 51.22  ? 4    C   T P     1 
ATOM   2380  O  OP1   . C   I  1 4   ? 3.662    36.261  -24.234 1.00 50.46  ? 4    C   T OP1   1 
ATOM   2381  O  OP2   . C   I  1 4   ? 4.620    37.862  -26.003 1.00 52.21  ? 4    C   T OP2   1 
ATOM   2382  O  "O5'" . C   I  1 4   ? 2.612    36.454  -26.499 1.00 49.71  ? 4    C   T "O5'" 1 
ATOM   2383  C  "C5'" . C   I  1 4   ? 1.510    35.629  -26.146 1.00 47.26  ? 4    C   T "C5'" 1 
ATOM   2384  C  "C4'" . C   I  1 4   ? 0.755    35.182  -27.374 1.00 45.65  ? 4    C   T "C4'" 1 
ATOM   2385  O  "O4'" . C   I  1 4   ? 0.220    36.338  -28.067 1.00 46.26  ? 4    C   T "O4'" 1 
ATOM   2386  C  "C3'" . C   I  1 4   ? 1.536    34.465  -28.460 1.00 44.50  ? 4    C   T "C3'" 1 
ATOM   2387  O  "O3'" . C   I  1 4   ? 1.764    33.100  -28.141 1.00 44.19  ? 4    C   T "O3'" 1 
ATOM   2388  C  "C2'" . C   I  1 4   ? 0.595    34.604  -29.646 1.00 44.63  ? 4    C   T "C2'" 1 
ATOM   2389  O  "O2'" . C   I  1 4   ? -0.463   33.665  -29.618 1.00 42.09  ? 4    C   T "O2'" 1 
ATOM   2390  C  "C1'" . C   I  1 4   ? 0.073    36.031  -29.441 1.00 45.09  ? 4    C   T "C1'" 1 
ATOM   2391  N  N1    . C   I  1 4   ? 0.867    36.986  -30.210 1.00 44.48  ? 4    C   T N1    1 
ATOM   2392  C  C2    . C   I  1 4   ? 0.512    37.222  -31.533 1.00 45.14  ? 4    C   T C2    1 
ATOM   2393  O  O2    . C   I  1 4   ? -0.491   36.656  -31.989 1.00 45.72  ? 4    C   T O2    1 
ATOM   2394  N  N3    . C   I  1 4   ? 1.264    38.053  -32.285 1.00 46.20  ? 4    C   T N3    1 
ATOM   2395  C  C4    . C   I  1 4   ? 2.338    38.640  -31.753 1.00 46.82  ? 4    C   T C4    1 
ATOM   2396  N  N4    . C   I  1 4   ? 3.074    39.429  -32.545 1.00 46.18  ? 4    C   T N4    1 
ATOM   2397  C  C5    . C   I  1 4   ? 2.708    38.438  -30.387 1.00 46.15  ? 4    C   T C5    1 
ATOM   2398  C  C6    . C   I  1 4   ? 1.948    37.612  -29.658 1.00 43.76  ? 4    C   T C6    1 
ATOM   2399  P  P     . A   I  1 5   ? 2.794    32.237  -29.025 1.00 43.92  ? 5    A   T P     1 
ATOM   2400  O  OP1   . A   I  1 5   ? 3.250    31.093  -28.199 1.00 44.51  ? 5    A   T OP1   1 
ATOM   2401  O  OP2   . A   I  1 5   ? 3.799    33.111  -29.681 1.00 41.92  ? 5    A   T OP2   1 
ATOM   2402  O  "O5'" . A   I  1 5   ? 1.873    31.672  -30.183 1.00 46.30  ? 5    A   T "O5'" 1 
ATOM   2403  C  "C5'" . A   I  1 5   ? 2.393    31.512  -31.492 1.00 48.23  ? 5    A   T "C5'" 1 
ATOM   2404  C  "C4'" . A   I  1 5   ? 1.392    31.990  -32.514 1.00 47.23  ? 5    A   T "C4'" 1 
ATOM   2405  O  "O4'" . A   I  1 5   ? 1.184    33.420  -32.381 1.00 44.91  ? 5    A   T "O4'" 1 
ATOM   2406  C  "C3'" . A   I  1 5   ? 1.874    31.835  -33.938 1.00 46.00  ? 5    A   T "C3'" 1 
ATOM   2407  O  "O3'" . A   I  1 5   ? 1.634    30.521  -34.375 1.00 49.21  ? 5    A   T "O3'" 1 
ATOM   2408  C  "C2'" . A   I  1 5   ? 1.029    32.846  -34.677 1.00 44.17  ? 5    A   T "C2'" 1 
ATOM   2409  O  "O2'" . A   I  1 5   ? -0.275   32.367  -34.916 1.00 42.66  ? 5    A   T "O2'" 1 
ATOM   2410  C  "C1'" . A   I  1 5   ? 1.005    33.986  -33.662 1.00 43.48  ? 5    A   T "C1'" 1 
ATOM   2411  N  N9    . A   I  1 5   ? 2.067    34.964  -33.876 1.00 43.13  ? 5    A   T N9    1 
ATOM   2412  C  C8    . A   I  1 5   ? 2.900    35.531  -32.946 1.00 42.96  ? 5    A   T C8    1 
ATOM   2413  N  N7    . A   I  1 5   ? 3.687    36.458  -33.440 1.00 42.61  ? 5    A   T N7    1 
ATOM   2414  C  C5    . A   I  1 5   ? 3.366    36.482  -34.791 1.00 42.17  ? 5    A   T C5    1 
ATOM   2415  C  C6    . A   I  1 5   ? 3.829    37.260  -35.859 1.00 41.45  ? 5    A   T C6    1 
ATOM   2416  N  N6    . A   I  1 5   ? 4.735    38.226  -35.735 1.00 43.08  ? 5    A   T N6    1 
ATOM   2417  N  N1    . A   I  1 5   ? 3.312    37.021  -37.077 1.00 40.68  ? 5    A   T N1    1 
ATOM   2418  C  C2    . A   I  1 5   ? 2.380    36.075  -37.203 1.00 40.72  ? 5    A   T C2    1 
ATOM   2419  N  N3    . A   I  1 5   ? 1.852    35.290  -36.279 1.00 41.46  ? 5    A   T N3    1 
ATOM   2420  C  C4    . A   I  1 5   ? 2.393    35.546  -35.077 1.00 42.52  ? 5    A   T C4    1 
ATOM   2421  P  P     . C   I  1 6   ? 2.814    29.723  -35.091 1.00 50.85  ? 6    C   T P     1 
ATOM   2422  O  OP1   . C   I  1 6   ? 2.360    28.315  -35.237 1.00 51.79  ? 6    C   T OP1   1 
ATOM   2423  O  OP2   . C   I  1 6   ? 4.062    30.022  -34.347 1.00 50.74  ? 6    C   T OP2   1 
ATOM   2424  O  "O5'" . C   I  1 6   ? 2.862    30.407  -36.528 1.00 53.16  ? 6    C   T "O5'" 1 
ATOM   2425  C  "C5'" . C   I  1 6   ? 1.723    30.324  -37.391 1.00 55.00  ? 6    C   T "C5'" 1 
ATOM   2426  C  "C4'" . C   I  1 6   ? 1.914    31.176  -38.623 1.00 53.64  ? 6    C   T "C4'" 1 
ATOM   2427  O  "O4'" . C   I  1 6   ? 1.935    32.576  -38.246 1.00 52.22  ? 6    C   T "O4'" 1 
ATOM   2428  C  "C3'" . C   I  1 6   ? 3.212    30.987  -39.388 1.00 53.82  ? 6    C   T "C3'" 1 
ATOM   2429  O  "O3'" . C   I  1 6   ? 3.158    29.871  -40.268 1.00 56.57  ? 6    C   T "O3'" 1 
ATOM   2430  C  "C2'" . C   I  1 6   ? 3.286    32.292  -40.158 1.00 52.51  ? 6    C   T "C2'" 1 
ATOM   2431  O  "O2'" . C   I  1 6   ? 2.362    32.310  -41.226 1.00 51.90  ? 6    C   T "O2'" 1 
ATOM   2432  C  "C1'" . C   I  1 6   ? 2.826    33.277  -39.090 1.00 51.52  ? 6    C   T "C1'" 1 
ATOM   2433  N  N1    . C   I  1 6   ? 3.933    33.787  -38.270 1.00 51.35  ? 6    C   T N1    1 
ATOM   2434  C  C2    . C   I  1 6   ? 4.786    34.732  -38.829 1.00 51.88  ? 6    C   T C2    1 
ATOM   2435  O  O2    . C   I  1 6   ? 4.606    35.066  -40.010 1.00 51.14  ? 6    C   T O2    1 
ATOM   2436  N  N3    . C   I  1 6   ? 5.786    35.257  -38.074 1.00 51.56  ? 6    C   T N3    1 
ATOM   2437  C  C4    . C   I  1 6   ? 5.947    34.858  -36.811 1.00 49.78  ? 6    C   T C4    1 
ATOM   2438  N  N4    . C   I  1 6   ? 6.924    35.418  -36.100 1.00 47.98  ? 6    C   T N4    1 
ATOM   2439  C  C5    . C   I  1 6   ? 5.106    33.870  -36.222 1.00 50.43  ? 6    C   T C5    1 
ATOM   2440  C  C6    . C   I  1 6   ? 4.122    33.363  -36.982 1.00 51.55  ? 6    C   T C6    1 
ATOM   2441  P  P     . C   I  1 7   ? 4.446    28.915  -40.414 1.00 57.41  ? 7    C   T P     1 
ATOM   2442  O  OP1   . C   I  1 7   ? 4.467    28.353  -41.790 1.00 59.84  ? 7    C   T OP1   1 
ATOM   2443  O  OP2   . C   I  1 7   ? 4.453    27.998  -39.247 1.00 58.99  ? 7    C   T OP2   1 
ATOM   2444  O  "O5'" . C   I  1 7   ? 5.685    29.906  -40.314 1.00 56.16  ? 7    C   T "O5'" 1 
ATOM   2445  C  "C5'" . C   I  1 7   ? 6.578    30.070  -41.409 1.00 56.48  ? 7    C   T "C5'" 1 
ATOM   2446  C  "C4'" . C   I  1 7   ? 6.333    31.399  -42.089 1.00 57.60  ? 7    C   T "C4'" 1 
ATOM   2447  O  "O4'" . C   I  1 7   ? 6.179    32.436  -41.090 1.00 58.63  ? 7    C   T "O4'" 1 
ATOM   2448  C  "C3'" . C   I  1 7   ? 7.466    31.870  -42.985 1.00 57.88  ? 7    C   T "C3'" 1 
ATOM   2449  O  "O3'" . C   I  1 7   ? 7.301    31.313  -44.288 1.00 59.20  ? 7    C   T "O3'" 1 
ATOM   2450  C  "C2'" . C   I  1 7   ? 7.319    33.393  -42.952 1.00 56.74  ? 7    C   T "C2'" 1 
ATOM   2451  O  "O2'" . C   I  1 7   ? 6.360    33.908  -43.853 1.00 55.19  ? 7    C   T "O2'" 1 
ATOM   2452  C  "C1'" . C   I  1 7   ? 6.813    33.623  -41.526 1.00 56.75  ? 7    C   T "C1'" 1 
ATOM   2453  N  N1    . C   I  1 7   ? 7.836    33.989  -40.533 1.00 56.06  ? 7    C   T N1    1 
ATOM   2454  C  C2    . C   I  1 7   ? 8.538    35.175  -40.709 1.00 56.89  ? 7    C   T C2    1 
ATOM   2455  O  O2    . C   I  1 7   ? 8.302    35.864  -41.719 1.00 57.62  ? 7    C   T O2    1 
ATOM   2456  N  N3    . C   I  1 7   ? 9.458    35.543  -39.779 1.00 56.24  ? 7    C   T N3    1 
ATOM   2457  C  C4    . C   I  1 7   ? 9.685    34.764  -38.717 1.00 54.07  ? 7    C   T C4    1 
ATOM   2458  N  N4    . C   I  1 7   ? 10.600   35.166  -37.830 1.00 53.04  ? 7    C   T N4    1 
ATOM   2459  C  C5    . C   I  1 7   ? 8.987    33.541  -38.521 1.00 52.46  ? 7    C   T C5    1 
ATOM   2460  C  C6    . C   I  1 7   ? 8.084    33.193  -39.446 1.00 53.98  ? 7    C   T C6    1 
ATOM   2461  P  P     . U   I  1 8   ? 8.546    30.600  -45.015 1.00 58.53  ? 8    U   T P     1 
ATOM   2462  O  OP1   . U   I  1 8   ? 8.092    30.113  -46.347 1.00 57.59  ? 8    U   T OP1   1 
ATOM   2463  O  OP2   . U   I  1 8   ? 9.160    29.648  -44.043 1.00 56.44  ? 8    U   T OP2   1 
ATOM   2464  O  "O5'" . U   I  1 8   ? 9.542    31.808  -45.287 1.00 57.71  ? 8    U   T "O5'" 1 
ATOM   2465  C  "C5'" . U   I  1 8   ? 9.203    32.791  -46.256 1.00 56.53  ? 8    U   T "C5'" 1 
ATOM   2466  C  "C4'" . U   I  1 8   ? 10.253   33.872  -46.311 1.00 55.64  ? 8    U   T "C4'" 1 
ATOM   2467  O  "O4'" . U   I  1 8   ? 10.145   34.756  -45.168 1.00 53.69  ? 8    U   T "O4'" 1 
ATOM   2468  C  "C3'" . U   I  1 8   ? 11.700   33.422  -46.274 1.00 54.80  ? 8    U   T "C3'" 1 
ATOM   2469  O  "O3'" . U   I  1 8   ? 12.134   32.941  -47.538 1.00 57.58  ? 8    U   T "O3'" 1 
ATOM   2470  C  "C2'" . U   I  1 8   ? 12.392   34.719  -45.907 1.00 52.87  ? 8    U   T "C2'" 1 
ATOM   2471  O  "O2'" . U   I  1 8   ? 12.437   35.591  -47.014 1.00 51.71  ? 8    U   T "O2'" 1 
ATOM   2472  C  "C1'" . U   I  1 8   ? 11.424   35.280  -44.867 1.00 52.51  ? 8    U   T "C1'" 1 
ATOM   2473  N  N1    . U   I  1 8   ? 11.781   34.862  -43.509 1.00 52.38  ? 8    U   T N1    1 
ATOM   2474  C  C2    . U   I  1 8   ? 12.812   35.532  -42.894 1.00 53.29  ? 8    U   T C2    1 
ATOM   2475  O  O2    . U   I  1 8   ? 13.448   36.420  -43.445 1.00 53.71  ? 8    U   T O2    1 
ATOM   2476  N  N3    . U   I  1 8   ? 13.081   35.123  -41.612 1.00 53.10  ? 8    U   T N3    1 
ATOM   2477  C  C4    . U   I  1 8   ? 12.443   34.125  -40.910 1.00 51.68  ? 8    U   T C4    1 
ATOM   2478  O  O4    . U   I  1 8   ? 12.739   33.935  -39.730 1.00 51.15  ? 8    U   T O4    1 
ATOM   2479  C  C5    . U   I  1 8   ? 11.406   33.461  -41.632 1.00 51.08  ? 8    U   T C5    1 
ATOM   2480  C  C6    . U   I  1 8   ? 11.115   33.846  -42.874 1.00 51.73  ? 8    U   T C6    1 
ATOM   2481  P  P     . G   I  1 9   ? 13.397   31.954  -47.611 1.00 59.61  ? 9    G   T P     1 
ATOM   2482  O  OP1   . G   I  1 9   ? 13.671   31.622  -49.035 1.00 59.62  ? 9    G   T OP1   1 
ATOM   2483  O  OP2   . G   I  1 9   ? 13.158   30.855  -46.634 1.00 59.22  ? 9    G   T OP2   1 
ATOM   2484  O  "O5'" . G   I  1 9   ? 14.583   32.880  -47.086 1.00 58.90  ? 9    G   T "O5'" 1 
ATOM   2485  C  "C5'" . G   I  1 9   ? 14.876   34.112  -47.745 1.00 57.13  ? 9    G   T "C5'" 1 
ATOM   2486  C  "C4'" . G   I  1 9   ? 15.913   34.892  -46.976 1.00 54.95  ? 9    G   T "C4'" 1 
ATOM   2487  O  "O4'" . G   I  1 9   ? 15.390   35.277  -45.679 1.00 53.50  ? 9    G   T "O4'" 1 
ATOM   2488  C  "C3'" . G   I  1 9   ? 17.164   34.118  -46.618 1.00 54.74  ? 9    G   T "C3'" 1 
ATOM   2489  O  "O3'" . G   I  1 9   ? 18.063   34.028  -47.701 1.00 54.04  ? 9    G   T "O3'" 1 
ATOM   2490  C  "C2'" . G   I  1 9   ? 17.738   34.943  -45.480 1.00 54.02  ? 9    G   T "C2'" 1 
ATOM   2491  O  "O2'" . G   I  1 9   ? 18.468   36.061  -45.936 1.00 53.02  ? 9    G   T "O2'" 1 
ATOM   2492  C  "C1'" . G   I  1 9   ? 16.460   35.372  -44.753 1.00 53.65  ? 9    G   T "C1'" 1 
ATOM   2493  N  N9    . G   I  1 9   ? 16.177   34.505  -43.614 1.00 52.36  ? 9    G   T N9    1 
ATOM   2494  C  C8    . G   I  1 9   ? 15.322   33.430  -43.562 1.00 50.88  ? 9    G   T C8    1 
ATOM   2495  N  N7    . G   I  1 9   ? 15.315   32.841  -42.395 1.00 51.47  ? 9    G   T N7    1 
ATOM   2496  C  C5    . G   I  1 9   ? 16.216   33.576  -41.630 1.00 51.62  ? 9    G   T C5    1 
ATOM   2497  C  C6    . G   I  1 9   ? 16.640   33.414  -40.270 1.00 50.85  ? 9    G   T C6    1 
ATOM   2498  O  O6    . G   I  1 9   ? 16.298   32.556  -39.447 1.00 48.30  ? 9    G   T O6    1 
ATOM   2499  N  N1    . G   I  1 9   ? 17.567   34.387  -39.906 1.00 51.20  ? 9    G   T N1    1 
ATOM   2500  C  C2    . G   I  1 9   ? 18.035   35.381  -40.729 1.00 51.46  ? 9    G   T C2    1 
ATOM   2501  N  N2    . G   I  1 9   ? 18.925   36.218  -40.193 1.00 51.34  ? 9    G   T N2    1 
ATOM   2502  N  N3    . G   I  1 9   ? 17.657   35.541  -41.988 1.00 52.74  ? 9    G   T N3    1 
ATOM   2503  C  C4    . G   I  1 9   ? 16.751   34.610  -42.368 1.00 52.43  ? 9    G   T C4    1 
ATOM   2504  P  P     . A   I  1 10  ? 19.289   33.011  -47.601 1.00 54.54  ? 10   A   T P     1 
ATOM   2505  O  OP1   . A   I  1 10  ? 19.756   32.720  -48.979 1.00 55.59  ? 10   A   T OP1   1 
ATOM   2506  O  OP2   . A   I  1 10  ? 18.914   31.887  -46.701 1.00 51.67  ? 10   A   T OP2   1 
ATOM   2507  O  "O5'" . A   I  1 10  ? 20.393   33.874  -46.853 1.00 55.30  ? 10   A   T "O5'" 1 
ATOM   2508  C  "C5'" . A   I  1 10  ? 21.437   33.231  -46.150 1.00 56.01  ? 10   A   T "C5'" 1 
ATOM   2509  C  "C4'" . A   I  1 10  ? 21.868   34.061  -44.971 1.00 55.70  ? 10   A   T "C4'" 1 
ATOM   2510  O  "O4'" . A   I  1 10  ? 20.740   34.384  -44.117 1.00 56.35  ? 10   A   T "O4'" 1 
ATOM   2511  C  "C3'" . A   I  1 10  ? 22.811   33.308  -44.061 1.00 55.70  ? 10   A   T "C3'" 1 
ATOM   2512  O  "O3'" . A   I  1 10  ? 24.102   33.398  -44.601 1.00 54.32  ? 10   A   T "O3'" 1 
ATOM   2513  C  "C2'" . A   I  1 10  ? 22.649   34.037  -42.743 1.00 56.48  ? 10   A   T "C2'" 1 
ATOM   2514  O  "O2'" . A   I  1 10  ? 23.378   35.242  -42.704 1.00 59.74  ? 10   A   T "O2'" 1 
ATOM   2515  C  "C1'" . A   I  1 10  ? 21.148   34.326  -42.758 1.00 56.85  ? 10   A   T "C1'" 1 
ATOM   2516  N  N9    . A   I  1 10  ? 20.377   33.272  -42.106 1.00 56.95  ? 10   A   T N9    1 
ATOM   2517  C  C8    . A   I  1 10  ? 19.398   32.494  -42.667 1.00 56.29  ? 10   A   T C8    1 
ATOM   2518  N  N7    . A   I  1 10  ? 18.847   31.656  -41.825 1.00 57.20  ? 10   A   T N7    1 
ATOM   2519  C  C5    . A   I  1 10  ? 19.515   31.890  -40.632 1.00 55.72  ? 10   A   T C5    1 
ATOM   2520  C  C6    . A   I  1 10  ? 19.386   31.329  -39.354 1.00 54.96  ? 10   A   T C6    1 
ATOM   2521  N  N6    . A   I  1 10  ? 18.501   30.377  -39.048 1.00 54.49  ? 10   A   T N6    1 
ATOM   2522  N  N1    . A   I  1 10  ? 20.204   31.784  -38.387 1.00 54.28  ? 10   A   T N1    1 
ATOM   2523  C  C2    . A   I  1 10  ? 21.092   32.735  -38.695 1.00 55.06  ? 10   A   T C2    1 
ATOM   2524  N  N3    . A   I  1 10  ? 21.309   33.340  -39.856 1.00 55.42  ? 10   A   T N3    1 
ATOM   2525  C  C4    . A   I  1 10  ? 20.472   32.871  -40.795 1.00 55.92  ? 10   A   T C4    1 
ATOM   2526  P  P     . U   I  1 11  ? 24.691   32.150  -45.396 1.00 55.30  ? 11   U   T P     1 
ATOM   2527  O  OP1   . U   I  1 11  ? 25.396   32.701  -46.581 1.00 53.16  ? 11   U   T OP1   1 
ATOM   2528  O  OP2   . U   I  1 11  ? 23.599   31.156  -45.581 1.00 54.50  ? 11   U   T OP2   1 
ATOM   2529  O  "O5'" . U   I  1 11  ? 25.735   31.560  -44.355 1.00 56.51  ? 11   U   T "O5'" 1 
ATOM   2530  C  "C5'" . U   I  1 11  ? 26.640   32.436  -43.698 1.00 59.24  ? 11   U   T "C5'" 1 
ATOM   2531  C  "C4'" . U   I  1 11  ? 26.840   32.013  -42.270 1.00 59.71  ? 11   U   T "C4'" 1 
ATOM   2532  O  "O4'" . U   I  1 11  ? 25.703   32.372  -41.443 1.00 62.04  ? 11   U   T "O4'" 1 
ATOM   2533  C  "C3'" . U   I  1 11  ? 26.965   30.526  -42.064 1.00 59.58  ? 11   U   T "C3'" 1 
ATOM   2534  O  "O3'" . U   I  1 11  ? 28.252   30.097  -42.438 1.00 59.04  ? 11   U   T "O3'" 1 
ATOM   2535  C  "C2'" . U   I  1 11  ? 26.711   30.415  -40.573 1.00 61.29  ? 11   U   T "C2'" 1 
ATOM   2536  O  "O2'" . U   I  1 11  ? 27.824   30.849  -39.819 1.00 61.90  ? 11   U   T "O2'" 1 
ATOM   2537  C  "C1'" . U   I  1 11  ? 25.563   31.413  -40.403 1.00 62.88  ? 11   U   T "C1'" 1 
ATOM   2538  N  N1    . U   I  1 11  ? 24.248   30.766  -40.535 1.00 64.41  ? 11   U   T N1    1 
ATOM   2539  C  C2    . U   I  1 11  ? 23.874   29.873  -39.546 1.00 64.58  ? 11   U   T C2    1 
ATOM   2540  O  O2    . U   I  1 11  ? 24.566   29.638  -38.570 1.00 63.99  ? 11   U   T O2    1 
ATOM   2541  N  N3    . U   I  1 11  ? 22.659   29.266  -39.742 1.00 65.16  ? 11   U   T N3    1 
ATOM   2542  C  C4    . U   I  1 11  ? 21.791   29.462  -40.798 1.00 65.53  ? 11   U   T C4    1 
ATOM   2543  O  O4    . U   I  1 11  ? 20.749   28.798  -40.858 1.00 66.40  ? 11   U   T O4    1 
ATOM   2544  C  C5    . U   I  1 11  ? 22.239   30.420  -41.767 1.00 64.30  ? 11   U   T C5    1 
ATOM   2545  C  C6    . U   I  1 11  ? 23.421   31.024  -41.606 1.00 64.29  ? 11   U   T C6    1 
ATOM   2546  P  P     . U   I  1 12  ? 28.419   28.679  -43.146 1.00 58.10  ? 12   U   T P     1 
ATOM   2547  O  OP1   . U   I  1 12  ? 29.574   28.761  -44.066 1.00 57.12  ? 12   U   T OP1   1 
ATOM   2548  O  OP2   . U   I  1 12  ? 27.088   28.309  -43.674 1.00 58.96  ? 12   U   T OP2   1 
ATOM   2549  O  "O5'" . U   I  1 12  ? 28.780   27.722  -41.931 1.00 57.72  ? 12   U   T "O5'" 1 
ATOM   2550  C  "C5'" . U   I  1 12  ? 29.777   28.105  -40.995 1.00 59.06  ? 12   U   T "C5'" 1 
ATOM   2551  C  "C4'" . U   I  1 12  ? 29.464   27.540  -39.634 1.00 59.79  ? 12   U   T "C4'" 1 
ATOM   2552  O  "O4'" . U   I  1 12  ? 28.178   28.040  -39.195 1.00 60.71  ? 12   U   T "O4'" 1 
ATOM   2553  C  "C3'" . U   I  1 12  ? 29.310   26.033  -39.561 1.00 60.00  ? 12   U   T "C3'" 1 
ATOM   2554  O  "O3'" . U   I  1 12  ? 30.588   25.422  -39.453 1.00 59.05  ? 12   U   T "O3'" 1 
ATOM   2555  C  "C2'" . U   I  1 12  ? 28.470   25.855  -38.300 1.00 60.73  ? 12   U   T "C2'" 1 
ATOM   2556  O  "O2'" . U   I  1 12  ? 29.216   25.939  -37.103 1.00 62.22  ? 12   U   T "O2'" 1 
ATOM   2557  C  "C1'" . U   I  1 12  ? 27.546   27.069  -38.377 1.00 62.26  ? 12   U   T "C1'" 1 
ATOM   2558  N  N1    . U   I  1 12  ? 26.227   26.774  -38.949 1.00 64.53  ? 12   U   T N1    1 
ATOM   2559  C  C2    . U   I  1 12  ? 25.335   26.062  -38.174 1.00 64.30  ? 12   U   T C2    1 
ATOM   2560  O  O2    . U   I  1 12  ? 25.609   25.655  -37.054 1.00 62.26  ? 12   U   T O2    1 
ATOM   2561  N  N3    . U   I  1 12  ? 24.112   25.841  -38.763 1.00 65.79  ? 12   U   T N3    1 
ATOM   2562  C  C4    . U   I  1 12  ? 23.706   26.246  -40.028 1.00 65.51  ? 12   U   T C4    1 
ATOM   2563  O  O4    . U   I  1 12  ? 22.564   25.987  -40.416 1.00 65.72  ? 12   U   T O4    1 
ATOM   2564  C  C5    . U   I  1 12  ? 24.693   26.965  -40.765 1.00 65.57  ? 12   U   T C5    1 
ATOM   2565  C  C6    . U   I  1 12  ? 25.889   27.200  -40.216 1.00 65.83  ? 12   U   T C6    1 
ATOM   2566  P  P     . C   I  1 13  ? 30.789   23.910  -39.955 1.00 60.17  ? 13   C   T P     1 
ATOM   2567  O  OP1   . C   I  1 13  ? 32.245   23.626  -39.887 1.00 58.77  ? 13   C   T OP1   1 
ATOM   2568  O  OP2   . C   I  1 13  ? 30.046   23.698  -41.230 1.00 58.04  ? 13   C   T OP2   1 
ATOM   2569  O  "O5'" . C   I  1 13  ? 30.074   23.036  -38.832 1.00 61.85  ? 13   C   T "O5'" 1 
ATOM   2570  C  "C5'" . C   I  1 13  ? 30.477   23.127  -37.467 1.00 62.38  ? 13   C   T "C5'" 1 
ATOM   2571  C  "C4'" . C   I  1 13  ? 29.536   22.331  -36.600 1.00 61.66  ? 13   C   T "C4'" 1 
ATOM   2572  O  "O4'" . C   I  1 13  ? 28.231   22.958  -36.559 1.00 61.63  ? 13   C   T "O4'" 1 
ATOM   2573  C  "C3'" . C   I  1 13  ? 29.269   20.931  -37.114 1.00 61.44  ? 13   C   T "C3'" 1 
ATOM   2574  O  "O3'" . C   I  1 13  ? 30.289   20.077  -36.634 1.00 62.04  ? 13   C   T "O3'" 1 
ATOM   2575  C  "C2'" . C   I  1 13  ? 27.925   20.593  -36.485 1.00 61.57  ? 13   C   T "C2'" 1 
ATOM   2576  O  "O2'" . C   I  1 13  ? 28.051   20.077  -35.179 1.00 61.53  ? 13   C   T "O2'" 1 
ATOM   2577  C  "C1'" . C   I  1 13  ? 27.231   21.959  -36.471 1.00 61.98  ? 13   C   T "C1'" 1 
ATOM   2578  N  N1    . C   I  1 13  ? 26.313   22.121  -37.602 1.00 62.63  ? 13   C   T N1    1 
ATOM   2579  C  C2    . C   I  1 13  ? 25.101   21.434  -37.580 1.00 62.45  ? 13   C   T C2    1 
ATOM   2580  O  O2    . C   I  1 13  ? 24.827   20.734  -36.595 1.00 62.08  ? 13   C   T O2    1 
ATOM   2581  N  N3    . C   I  1 13  ? 24.260   21.545  -38.632 1.00 63.24  ? 13   C   T N3    1 
ATOM   2582  C  C4    . C   I  1 13  ? 24.593   22.306  -39.677 1.00 62.68  ? 13   C   T C4    1 
ATOM   2583  N  N4    . C   I  1 13  ? 23.740   22.364  -40.704 1.00 61.93  ? 13   C   T N4    1 
ATOM   2584  C  C5    . C   I  1 13  ? 25.817   23.034  -39.718 1.00 63.09  ? 13   C   T C5    1 
ATOM   2585  C  C6    . C   I  1 13  ? 26.639   22.916  -38.666 1.00 63.27  ? 13   C   T C6    1 
ATOM   2586  P  P     . C   I  1 14  ? 30.638   18.728  -37.423 1.00 62.29  ? 14   C   T P     1 
ATOM   2587  O  OP1   . C   I  1 14  ? 32.099   18.535  -37.295 1.00 61.67  ? 14   C   T OP1   1 
ATOM   2588  O  OP2   . C   I  1 14  ? 30.016   18.792  -38.770 1.00 62.14  ? 14   C   T OP2   1 
ATOM   2589  O  "O5'" . C   I  1 14  ? 29.898   17.594  -36.588 1.00 64.00  ? 14   C   T "O5'" 1 
ATOM   2590  C  "C5'" . C   I  1 14  ? 29.455   16.408  -37.223 1.00 65.65  ? 14   C   T "C5'" 1 
ATOM   2591  C  "C4'" . C   I  1 14  ? 28.034   16.119  -36.833 1.00 66.38  ? 14   C   T "C4'" 1 
ATOM   2592  O  "O4'" . C   I  1 14  ? 27.242   17.327  -36.964 1.00 67.15  ? 14   C   T "O4'" 1 
ATOM   2593  C  "C3'" . C   I  1 14  ? 27.338   15.123  -37.739 1.00 67.65  ? 14   C   T "C3'" 1 
ATOM   2594  O  "O3'" . C   I  1 14  ? 27.796   13.769  -37.576 1.00 65.15  ? 14   C   T "O3'" 1 
ATOM   2595  C  "C2'" . C   I  1 14  ? 25.864   15.460  -37.520 1.00 69.43  ? 14   C   T "C2'" 1 
ATOM   2596  O  "O2'" . C   I  1 14  ? 25.284   14.885  -36.359 1.00 71.31  ? 14   C   T "O2'" 1 
ATOM   2597  C  "C1'" . C   I  1 14  ? 25.923   16.984  -37.364 1.00 69.74  ? 14   C   T "C1'" 1 
ATOM   2598  N  N1    . C   I  1 14  ? 25.591   17.725  -38.594 1.00 71.28  ? 14   C   T N1    1 
ATOM   2599  C  C2    . C   I  1 14  ? 24.278   17.652  -39.097 1.00 72.83  ? 14   C   T C2    1 
ATOM   2600  O  O2    . C   I  1 14  ? 23.438   16.965  -38.494 1.00 74.87  ? 14   C   T O2    1 
ATOM   2601  N  N3    . C   I  1 14  ? 23.959   18.334  -40.222 1.00 72.87  ? 14   C   T N3    1 
ATOM   2602  C  C4    . C   I  1 14  ? 24.882   19.076  -40.835 1.00 72.43  ? 14   C   T C4    1 
ATOM   2603  N  N4    . C   I  1 14  ? 24.513   19.750  -41.930 1.00 71.30  ? 14   C   T N4    1 
ATOM   2604  C  C5    . C   I  1 14  ? 26.224   19.166  -40.350 1.00 72.38  ? 14   C   T C5    1 
ATOM   2605  C  C6    . C   I  1 14  ? 26.532   18.478  -39.239 1.00 71.67  ? 14   C   T C6    1 
ATOM   2606  O  "O5'" . DG  J  2 1   ? 18.129   16.867  -40.210 1.00 93.49  ? 15   DG  U "O5'" 1 
ATOM   2607  C  "C5'" . DG  J  2 1   ? 16.770   16.679  -39.769 1.00 93.71  ? 15   DG  U "C5'" 1 
ATOM   2608  C  "C4'" . DG  J  2 1   ? 15.854   17.794  -40.221 1.00 93.02  ? 15   DG  U "C4'" 1 
ATOM   2609  O  "O4'" . DG  J  2 1   ? 16.689   18.837  -40.767 1.00 93.23  ? 15   DG  U "O4'" 1 
ATOM   2610  C  "C3'" . DG  J  2 1   ? 14.811   17.461  -41.295 1.00 91.58  ? 15   DG  U "C3'" 1 
ATOM   2611  O  "O3'" . DG  J  2 1   ? 13.456   17.719  -40.866 1.00 90.38  ? 15   DG  U "O3'" 1 
ATOM   2612  C  "C2'" . DG  J  2 1   ? 15.250   18.199  -42.552 1.00 90.77  ? 15   DG  U "C2'" 1 
ATOM   2613  C  "C1'" . DG  J  2 1   ? 16.307   19.194  -42.084 1.00 91.92  ? 15   DG  U "C1'" 1 
ATOM   2614  N  N9    . DG  J  2 1   ? 17.524   19.207  -42.894 1.00 91.27  ? 15   DG  U N9    1 
ATOM   2615  C  C8    . DG  J  2 1   ? 17.603   19.378  -44.253 1.00 92.15  ? 15   DG  U C8    1 
ATOM   2616  N  N7    . DG  J  2 1   ? 18.830   19.407  -44.697 1.00 92.04  ? 15   DG  U N7    1 
ATOM   2617  C  C5    . DG  J  2 1   ? 19.610   19.231  -43.563 1.00 90.93  ? 15   DG  U C5    1 
ATOM   2618  C  C6    . DG  J  2 1   ? 21.016   19.196  -43.420 1.00 91.26  ? 15   DG  U C6    1 
ATOM   2619  O  O6    . DG  J  2 1   ? 21.884   19.329  -44.294 1.00 91.68  ? 15   DG  U O6    1 
ATOM   2620  N  N1    . DG  J  2 1   ? 21.387   18.992  -42.096 1.00 90.31  ? 15   DG  U N1    1 
ATOM   2621  C  C2    . DG  J  2 1   ? 20.518   18.844  -41.048 1.00 88.99  ? 15   DG  U C2    1 
ATOM   2622  N  N2    . DG  J  2 1   ? 21.073   18.645  -39.850 1.00 89.05  ? 15   DG  U N2    1 
ATOM   2623  N  N3    . DG  J  2 1   ? 19.204   18.886  -41.167 1.00 88.29  ? 15   DG  U N3    1 
ATOM   2624  C  C4    . DG  J  2 1   ? 18.821   19.084  -42.444 1.00 89.90  ? 15   DG  U C4    1 
ATOM   2625  P  P     . DG  J  2 2   ? 13.059   19.106  -40.136 1.00 88.49  ? 16   DG  U P     1 
ATOM   2626  O  OP1   . DG  J  2 2   ? 11.657   18.955  -39.667 1.00 87.78  ? 16   DG  U OP1   1 
ATOM   2627  O  OP2   . DG  J  2 2   ? 13.418   20.253  -41.021 1.00 89.11  ? 16   DG  U OP2   1 
ATOM   2628  O  "O5'" . DG  J  2 2   ? 13.956   19.147  -38.819 1.00 85.56  ? 16   DG  U "O5'" 1 
ATOM   2629  C  "C5'" . DG  J  2 2   ? 13.889   18.094  -37.857 1.00 82.01  ? 16   DG  U "C5'" 1 
ATOM   2630  C  "C4'" . DG  J  2 2   ? 14.727   18.432  -36.647 1.00 80.76  ? 16   DG  U "C4'" 1 
ATOM   2631  O  "O4'" . DG  J  2 2   ? 16.137   18.483  -37.000 1.00 82.20  ? 16   DG  U "O4'" 1 
ATOM   2632  C  "C3'" . DG  J  2 2   ? 14.388   19.773  -35.997 1.00 78.99  ? 16   DG  U "C3'" 1 
ATOM   2633  O  "O3'" . DG  J  2 2   ? 14.190   19.603  -34.600 1.00 75.80  ? 16   DG  U "O3'" 1 
ATOM   2634  C  "C2'" . DG  J  2 2   ? 15.607   20.642  -36.247 1.00 80.25  ? 16   DG  U "C2'" 1 
ATOM   2635  C  "C1'" . DG  J  2 2   ? 16.744   19.658  -36.473 1.00 82.29  ? 16   DG  U "C1'" 1 
ATOM   2636  N  N9    . DG  J  2 2   ? 17.632   20.210  -37.491 1.00 83.56  ? 16   DG  U N9    1 
ATOM   2637  C  C8    . DG  J  2 2   ? 17.227   20.687  -38.712 1.00 83.37  ? 16   DG  U C8    1 
ATOM   2638  N  N7    . DG  J  2 2   ? 18.187   21.245  -39.394 1.00 83.60  ? 16   DG  U N7    1 
ATOM   2639  C  C5    . DG  J  2 2   ? 19.308   21.112  -38.586 1.00 84.19  ? 16   DG  U C5    1 
ATOM   2640  C  C6    . DG  J  2 2   ? 20.640   21.554  -38.795 1.00 83.77  ? 16   DG  U C6    1 
ATOM   2641  O  O6    . DG  J  2 2   ? 21.096   22.193  -39.753 1.00 82.78  ? 16   DG  U O6    1 
ATOM   2642  N  N1    . DG  J  2 2   ? 21.472   21.188  -37.739 1.00 83.78  ? 16   DG  U N1    1 
ATOM   2643  C  C2    . DG  J  2 2   ? 21.073   20.485  -36.622 1.00 83.67  ? 16   DG  U C2    1 
ATOM   2644  N  N2    . DG  J  2 2   ? 22.036   20.183  -35.744 1.00 82.95  ? 16   DG  U N2    1 
ATOM   2645  N  N3    . DG  J  2 2   ? 19.821   20.096  -36.396 1.00 84.39  ? 16   DG  U N3    1 
ATOM   2646  C  C4    . DG  J  2 2   ? 18.995   20.439  -37.417 1.00 84.46  ? 16   DG  U C4    1 
ATOM   2647  P  P     . DA  J  2 3   ? 14.034   20.888  -33.657 1.00 72.80  ? 17   DA  U P     1 
ATOM   2648  O  OP1   . DA  J  2 3   ? 12.778   20.717  -32.884 1.00 73.76  ? 17   DA  U OP1   1 
ATOM   2649  O  OP2   . DA  J  2 3   ? 14.259   22.140  -34.427 1.00 71.89  ? 17   DA  U OP2   1 
ATOM   2650  O  "O5'" . DA  J  2 3   ? 15.258   20.741  -32.664 1.00 70.89  ? 17   DA  U "O5'" 1 
ATOM   2651  C  "C5'" . DA  J  2 3   ? 15.888   21.895  -32.150 1.00 69.89  ? 17   DA  U "C5'" 1 
ATOM   2652  C  "C4'" . DA  J  2 3   ? 17.353   21.633  -31.898 1.00 66.76  ? 17   DA  U "C4'" 1 
ATOM   2653  O  "O4'" . DA  J  2 3   ? 18.060   21.522  -33.160 1.00 66.23  ? 17   DA  U "O4'" 1 
ATOM   2654  C  "C3'" . DA  J  2 3   ? 17.978   22.808  -31.157 1.00 65.04  ? 17   DA  U "C3'" 1 
ATOM   2655  O  "O3'" . DA  J  2 3   ? 18.599   22.414  -29.953 1.00 63.15  ? 17   DA  U "O3'" 1 
ATOM   2656  C  "C2'" . DA  J  2 3   ? 18.964   23.428  -32.122 1.00 64.77  ? 17   DA  U "C2'" 1 
ATOM   2657  C  "C1'" . DA  J  2 3   ? 19.203   22.360  -33.163 1.00 65.34  ? 17   DA  U "C1'" 1 
ATOM   2658  N  N9    . DA  J  2 3   ? 19.303   23.001  -34.467 1.00 65.66  ? 17   DA  U N9    1 
ATOM   2659  C  C8    . DA  J  2 3   ? 18.315   23.354  -35.347 1.00 65.20  ? 17   DA  U C8    1 
ATOM   2660  N  N7    . DA  J  2 3   ? 18.750   24.026  -36.387 1.00 65.93  ? 17   DA  U N7    1 
ATOM   2661  C  C5    . DA  J  2 3   ? 20.123   24.098  -36.184 1.00 66.90  ? 17   DA  U C5    1 
ATOM   2662  C  C6    . DA  J  2 3   ? 21.168   24.702  -36.916 1.00 66.46  ? 17   DA  U C6    1 
ATOM   2663  N  N6    . DA  J  2 3   ? 20.987   25.394  -38.042 1.00 65.99  ? 17   DA  U N6    1 
ATOM   2664  N  N1    . DA  J  2 3   ? 22.424   24.576  -36.434 1.00 67.03  ? 17   DA  U N1    1 
ATOM   2665  C  C2    . DA  J  2 3   ? 22.609   23.901  -35.292 1.00 68.30  ? 17   DA  U C2    1 
ATOM   2666  N  N3    . DA  J  2 3   ? 21.712   23.305  -34.511 1.00 68.51  ? 17   DA  U N3    1 
ATOM   2667  C  C4    . DA  J  2 3   ? 20.475   23.445  -35.019 1.00 67.37  ? 17   DA  U C4    1 
ATOM   2668  P  P     . DA  J  2 4   ? 18.527   23.410  -28.710 1.00 62.82  ? 18   DA  U P     1 
ATOM   2669  O  OP1   . DA  J  2 4   ? 19.063   22.719  -27.507 1.00 63.37  ? 18   DA  U OP1   1 
ATOM   2670  O  OP2   . DA  J  2 4   ? 17.152   23.973  -28.686 1.00 61.81  ? 18   DA  U OP2   1 
ATOM   2671  O  "O5'" . DA  J  2 4   ? 19.512   24.573  -29.157 1.00 61.07  ? 18   DA  U "O5'" 1 
ATOM   2672  C  "C5'" . DA  J  2 4   ? 20.882   24.297  -29.442 1.00 59.66  ? 18   DA  U "C5'" 1 
ATOM   2673  C  "C4'" . DA  J  2 4   ? 21.569   25.553  -29.918 1.00 58.09  ? 18   DA  U "C4'" 1 
ATOM   2674  O  "O4'" . DA  J  2 4   ? 21.528   25.650  -31.363 1.00 58.30  ? 18   DA  U "O4'" 1 
ATOM   2675  C  "C3'" . DA  J  2 4   ? 20.935   26.834  -29.376 1.00 56.95  ? 18   DA  U "C3'" 1 
ATOM   2676  O  "O3'" . DA  J  2 4   ? 21.883   27.639  -28.687 1.00 55.66  ? 18   DA  U "O3'" 1 
ATOM   2677  C  "C2'" . DA  J  2 4   ? 20.425   27.560  -30.610 1.00 57.57  ? 18   DA  U "C2'" 1 
ATOM   2678  C  "C1'" . DA  J  2 4   ? 21.280   26.991  -31.729 1.00 59.68  ? 18   DA  U "C1'" 1 
ATOM   2679  N  N9    . DA  J  2 4   ? 20.586   26.990  -33.013 1.00 62.19  ? 18   DA  U N9    1 
ATOM   2680  C  C8    . DA  J  2 4   ? 19.295   26.595  -33.222 1.00 63.78  ? 18   DA  U C8    1 
ATOM   2681  N  N7    . DA  J  2 4   ? 18.870   26.790  -34.445 1.00 64.19  ? 18   DA  U N7    1 
ATOM   2682  C  C5    . DA  J  2 4   ? 19.965   27.333  -35.096 1.00 64.78  ? 18   DA  U C5    1 
ATOM   2683  C  C6    . DA  J  2 4   ? 20.152   27.785  -36.415 1.00 65.72  ? 18   DA  U C6    1 
ATOM   2684  N  N6    . DA  J  2 4   ? 19.181   27.805  -37.336 1.00 66.58  ? 18   DA  U N6    1 
ATOM   2685  N  N1    . DA  J  2 4   ? 21.378   28.239  -36.754 1.00 65.39  ? 18   DA  U N1    1 
ATOM   2686  C  C2    . DA  J  2 4   ? 22.333   28.261  -35.816 1.00 64.47  ? 18   DA  U C2    1 
ATOM   2687  N  N3    . DA  J  2 4   ? 22.271   27.891  -34.537 1.00 64.44  ? 18   DA  U N3    1 
ATOM   2688  C  C4    . DA  J  2 4   ? 21.044   27.431  -34.235 1.00 64.09  ? 18   DA  U C4    1 
ATOM   2689  P  P     . DT  J  2 5   ? 21.403   29.017  -28.030 1.00 53.98  ? 19   DT  U P     1 
ATOM   2690  O  OP1   . DT  J  2 5   ? 22.479   29.510  -27.144 1.00 54.32  ? 19   DT  U OP1   1 
ATOM   2691  O  OP2   . DT  J  2 5   ? 20.042   28.832  -27.479 1.00 54.93  ? 19   DT  U OP2   1 
ATOM   2692  O  "O5'" . DT  J  2 5   ? 21.273   29.957  -29.302 1.00 52.37  ? 19   DT  U "O5'" 1 
ATOM   2693  C  "C5'" . DT  J  2 5   ? 20.083   30.681  -29.550 1.00 51.05  ? 19   DT  U "C5'" 1 
ATOM   2694  C  "C4'" . DT  J  2 5   ? 20.374   31.821  -30.489 1.00 51.32  ? 19   DT  U "C4'" 1 
ATOM   2695  O  "O4'" . DT  J  2 5   ? 20.581   31.266  -31.814 1.00 52.40  ? 19   DT  U "O4'" 1 
ATOM   2696  C  "C3'" . DT  J  2 5   ? 19.224   32.811  -30.617 1.00 51.73  ? 19   DT  U "C3'" 1 
ATOM   2697  O  "O3'" . DT  J  2 5   ? 19.558   34.073  -30.089 1.00 52.03  ? 19   DT  U "O3'" 1 
ATOM   2698  C  "C2'" . DT  J  2 5   ? 18.999   32.977  -32.108 1.00 53.53  ? 19   DT  U "C2'" 1 
ATOM   2699  C  "C1'" . DT  J  2 5   ? 20.053   32.132  -32.803 1.00 54.52  ? 19   DT  U "C1'" 1 
ATOM   2700  N  N1    . DT  J  2 5   ? 19.358   31.313  -33.814 1.00 56.64  ? 19   DT  U N1    1 
ATOM   2701  C  C2    . DT  J  2 5   ? 19.577   31.530  -35.158 1.00 56.52  ? 19   DT  U C2    1 
ATOM   2702  O  O2    . DT  J  2 5   ? 20.467   32.241  -35.585 1.00 56.43  ? 19   DT  U O2    1 
ATOM   2703  N  N3    . DT  J  2 5   ? 18.707   30.867  -35.990 1.00 57.19  ? 19   DT  U N3    1 
ATOM   2704  C  C4    . DT  J  2 5   ? 17.692   30.003  -35.619 1.00 59.02  ? 19   DT  U C4    1 
ATOM   2705  O  O4    . DT  J  2 5   ? 16.937   29.536  -36.472 1.00 59.70  ? 19   DT  U O4    1 
ATOM   2706  C  C5    . DT  J  2 5   ? 17.600   29.740  -34.200 1.00 59.44  ? 19   DT  U C5    1 
ATOM   2707  C  C7    . DT  J  2 5   ? 16.591   28.751  -33.705 1.00 60.77  ? 19   DT  U C7    1 
ATOM   2708  C  C6    . DT  J  2 5   ? 18.430   30.395  -33.385 1.00 58.46  ? 19   DT  U C6    1 
ATOM   2709  P  P     . DC  J  2 6   ? 18.420   35.193  -29.955 1.00 51.08  ? 20   DC  U P     1 
ATOM   2710  O  OP1   . DC  J  2 6   ? 18.777   35.896  -28.703 1.00 50.79  ? 20   DC  U OP1   1 
ATOM   2711  O  OP2   . DC  J  2 6   ? 17.054   34.621  -30.117 1.00 48.46  ? 20   DC  U OP2   1 
ATOM   2712  O  "O5'" . DC  J  2 6   ? 18.709   36.134  -31.204 1.00 51.89  ? 20   DC  U "O5'" 1 
ATOM   2713  C  "C5'" . DC  J  2 6   ? 20.005   36.686  -31.407 1.00 53.77  ? 20   DC  U "C5'" 1 
ATOM   2714  C  "C4'" . DC  J  2 6   ? 20.073   37.404  -32.735 1.00 55.50  ? 20   DC  U "C4'" 1 
ATOM   2715  O  "O4'" . DC  J  2 6   ? 20.209   36.412  -33.781 1.00 54.44  ? 20   DC  U "O4'" 1 
ATOM   2716  C  "C3'" . DC  J  2 6   ? 18.829   38.226  -33.071 1.00 56.49  ? 20   DC  U "C3'" 1 
ATOM   2717  O  "O3'" . DC  J  2 6   ? 19.044   39.624  -33.109 1.00 58.29  ? 20   DC  U "O3'" 1 
ATOM   2718  C  "C2'" . DC  J  2 6   ? 18.418   37.794  -34.465 1.00 55.71  ? 20   DC  U "C2'" 1 
ATOM   2719  C  "C1'" . DC  J  2 6   ? 19.389   36.715  -34.898 1.00 54.71  ? 20   DC  U "C1'" 1 
ATOM   2720  N  N1    . DC  J  2 6   ? 18.599   35.515  -35.207 1.00 55.09  ? 20   DC  U N1    1 
ATOM   2721  C  C2    . DC  J  2 6   ? 18.734   34.898  -36.450 1.00 54.63  ? 20   DC  U C2    1 
ATOM   2722  O  O2    . DC  J  2 6   ? 19.581   35.335  -37.245 1.00 53.11  ? 20   DC  U O2    1 
ATOM   2723  N  N3    . DC  J  2 6   ? 17.933   33.839  -36.752 1.00 54.83  ? 20   DC  U N3    1 
ATOM   2724  C  C4    . DC  J  2 6   ? 17.041   33.400  -35.856 1.00 53.86  ? 20   DC  U C4    1 
ATOM   2725  N  N4    . DC  J  2 6   ? 16.255   32.373  -36.190 1.00 52.62  ? 20   DC  U N4    1 
ATOM   2726  C  C5    . DC  J  2 6   ? 16.911   33.996  -34.575 1.00 54.82  ? 20   DC  U C5    1 
ATOM   2727  C  C6    . DC  J  2 6   ? 17.706   35.033  -34.291 1.00 55.12  ? 20   DC  U C6    1 
ATOM   2728  P  P     . DA  J  2 7   ? 17.780   40.586  -33.321 1.00 59.43  ? 21   DA  U P     1 
ATOM   2729  O  OP1   . DA  J  2 7   ? 17.942   41.760  -32.423 1.00 57.48  ? 21   DA  U OP1   1 
ATOM   2730  O  OP2   . DA  J  2 7   ? 16.549   39.756  -33.225 1.00 57.90  ? 21   DA  U OP2   1 
ATOM   2731  O  "O5'" . DA  J  2 7   ? 17.908   41.017  -34.846 1.00 61.48  ? 21   DA  U "O5'" 1 
ATOM   2732  C  "C5'" . DA  J  2 7   ? 19.157   41.400  -35.407 1.00 67.16  ? 21   DA  U "C5'" 1 
ATOM   2733  C  "C4'" . DA  J  2 7   ? 18.969   41.711  -36.872 1.00 71.04  ? 21   DA  U "C4'" 1 
ATOM   2734  O  "O4'" . DA  J  2 7   ? 18.817   40.446  -37.564 1.00 71.24  ? 21   DA  U "O4'" 1 
ATOM   2735  C  "C3'" . DA  J  2 7   ? 17.687   42.509  -37.124 1.00 73.18  ? 21   DA  U "C3'" 1 
ATOM   2736  O  "O3'" . DA  J  2 7   ? 17.879   43.762  -37.763 1.00 75.70  ? 21   DA  U "O3'" 1 
ATOM   2737  C  "C2'" . DA  J  2 7   ? 16.824   41.629  -38.007 1.00 72.58  ? 21   DA  U "C2'" 1 
ATOM   2738  C  "C1'" . DA  J  2 7   ? 17.678   40.446  -38.408 1.00 71.74  ? 21   DA  U "C1'" 1 
ATOM   2739  N  N9    . DA  J  2 7   ? 16.932   39.219  -38.144 1.00 71.75  ? 21   DA  U N9    1 
ATOM   2740  C  C8    . DA  J  2 7   ? 16.659   38.663  -36.919 1.00 71.49  ? 21   DA  U C8    1 
ATOM   2741  N  N7    . DA  J  2 7   ? 15.893   37.600  -36.977 1.00 71.42  ? 21   DA  U N7    1 
ATOM   2742  C  C5    . DA  J  2 7   ? 15.659   37.433  -38.336 1.00 71.01  ? 21   DA  U C5    1 
ATOM   2743  C  C6    . DA  J  2 7   ? 14.907   36.489  -39.060 1.00 70.32  ? 21   DA  U C6    1 
ATOM   2744  N  N6    . DA  J  2 7   ? 14.195   35.512  -38.490 1.00 68.88  ? 21   DA  U N6    1 
ATOM   2745  N  N1    . DA  J  2 7   ? 14.900   36.594  -40.408 1.00 69.91  ? 21   DA  U N1    1 
ATOM   2746  C  C2    . DA  J  2 7   ? 15.586   37.597  -40.978 1.00 70.64  ? 21   DA  U C2    1 
ATOM   2747  N  N3    . DA  J  2 7   ? 16.312   38.554  -40.406 1.00 71.46  ? 21   DA  U N3    1 
ATOM   2748  C  C4    . DA  J  2 7   ? 16.310   38.413  -39.068 1.00 71.83  ? 21   DA  U C4    1 
ATOM   2749  P  P     . DG  J  2 8   ? 16.703   44.853  -37.683 1.00 78.64  ? 22   DG  U P     1 
ATOM   2750  O  OP1   . DG  J  2 8   ? 17.312   46.164  -38.014 1.00 77.91  ? 22   DG  U OP1   1 
ATOM   2751  O  OP2   . DG  J  2 8   ? 15.969   44.677  -36.395 1.00 76.61  ? 22   DG  U OP2   1 
ATOM   2752  O  "O5'" . DG  J  2 8   ? 15.702   44.428  -38.843 1.00 78.36  ? 22   DG  U "O5'" 1 
ATOM   2753  C  "C5'" . DG  J  2 8   ? 16.038   44.615  -40.211 1.00 81.14  ? 22   DG  U "C5'" 1 
ATOM   2754  C  "C4'" . DG  J  2 8   ? 14.915   44.107  -41.085 1.00 82.58  ? 22   DG  U "C4'" 1 
ATOM   2755  O  "O4'" . DG  J  2 8   ? 14.867   42.666  -40.920 1.00 83.35  ? 22   DG  U "O4'" 1 
ATOM   2756  C  "C3'" . DG  J  2 8   ? 13.533   44.635  -40.683 1.00 83.77  ? 22   DG  U "C3'" 1 
ATOM   2757  O  "O3'" . DG  J  2 8   ? 12.861   45.347  -41.712 1.00 86.01  ? 22   DG  U "O3'" 1 
ATOM   2758  C  "C2'" . DG  J  2 8   ? 12.703   43.404  -40.365 1.00 83.60  ? 22   DG  U "C2'" 1 
ATOM   2759  C  "C1'" . DG  J  2 8   ? 13.526   42.212  -40.808 1.00 82.58  ? 22   DG  U "C1'" 1 
ATOM   2760  N  N9    . DG  J  2 8   ? 13.453   41.235  -39.726 1.00 80.79  ? 22   DG  U N9    1 
ATOM   2761  C  C8    . DG  J  2 8   ? 14.012   41.353  -38.480 1.00 79.68  ? 22   DG  U C8    1 
ATOM   2762  N  N7    . DG  J  2 8   ? 13.650   40.404  -37.663 1.00 79.12  ? 22   DG  U N7    1 
ATOM   2763  C  C5    . DG  J  2 8   ? 12.822   39.593  -38.425 1.00 78.48  ? 22   DG  U C5    1 
ATOM   2764  C  C6    . DG  J  2 8   ? 12.097   38.429  -38.069 1.00 78.08  ? 22   DG  U C6    1 
ATOM   2765  O  O6    . DG  J  2 8   ? 12.006   37.885  -36.964 1.00 79.75  ? 22   DG  U O6    1 
ATOM   2766  N  N1    . DG  J  2 8   ? 11.408   37.905  -39.154 1.00 76.56  ? 22   DG  U N1    1 
ATOM   2767  C  C2    . DG  J  2 8   ? 11.398   38.444  -40.415 1.00 76.26  ? 22   DG  U C2    1 
ATOM   2768  N  N2    . DG  J  2 8   ? 10.699   37.775  -41.334 1.00 76.05  ? 22   DG  U N2    1 
ATOM   2769  N  N3    . DG  J  2 8   ? 12.035   39.551  -40.751 1.00 77.30  ? 22   DG  U N3    1 
ATOM   2770  C  C4    . DG  J  2 8   ? 12.726   40.068  -39.714 1.00 78.91  ? 22   DG  U C4    1 
ATOM   2771  P  P     . DG  J  2 9   ? 11.441   46.032  -41.381 1.00 88.87  ? 23   DG  U P     1 
ATOM   2772  O  OP1   . DG  J  2 9   ? 11.276   47.201  -42.286 1.00 89.40  ? 23   DG  U OP1   1 
ATOM   2773  O  OP2   . DG  J  2 9   ? 11.336   46.223  -39.907 1.00 88.97  ? 23   DG  U OP2   1 
ATOM   2774  O  "O5'" . DG  J  2 9   ? 10.377   44.907  -41.756 1.00 85.06  ? 23   DG  U "O5'" 1 
ATOM   2775  C  "C5'" . DG  J  2 9   ? 10.373   44.302  -43.042 1.00 81.89  ? 23   DG  U "C5'" 1 
ATOM   2776  C  "C4'" . DG  J  2 9   ? 9.060    43.594  -43.268 1.00 79.60  ? 23   DG  U "C4'" 1 
ATOM   2777  O  "O4'" . DG  J  2 9   ? 9.139    42.228  -42.788 1.00 78.92  ? 23   DG  U "O4'" 1 
ATOM   2778  C  "C3'" . DG  J  2 9   ? 7.900    44.256  -42.531 1.00 78.95  ? 23   DG  U "C3'" 1 
ATOM   2779  O  "O3'" . DG  J  2 9   ? 6.865    44.629  -43.412 1.00 78.55  ? 23   DG  U "O3'" 1 
ATOM   2780  C  "C2'" . DG  J  2 9   ? 7.368    43.187  -41.593 1.00 78.63  ? 23   DG  U "C2'" 1 
ATOM   2781  C  "C1'" . DG  J  2 9   ? 7.977    41.878  -42.055 1.00 77.04  ? 23   DG  U "C1'" 1 
ATOM   2782  N  N9    . DG  J  2 9   ? 8.390    41.154  -40.858 1.00 74.59  ? 23   DG  U N9    1 
ATOM   2783  C  C8    . DG  J  2 9   ? 9.293    41.599  -39.929 1.00 74.15  ? 23   DG  U C8    1 
ATOM   2784  N  N7    . DG  J  2 9   ? 9.354    40.844  -38.870 1.00 73.34  ? 23   DG  U N7    1 
ATOM   2785  C  C5    . DG  J  2 9   ? 8.462    39.816  -39.129 1.00 73.02  ? 23   DG  U C5    1 
ATOM   2786  C  C6    . DG  J  2 9   ? 8.082    38.701  -38.326 1.00 73.51  ? 23   DG  U C6    1 
ATOM   2787  O  O6    . DG  J  2 9   ? 8.438    38.421  -37.171 1.00 73.69  ? 23   DG  U O6    1 
ATOM   2788  N  N1    . DG  J  2 9   ? 7.182    37.877  -38.993 1.00 72.42  ? 23   DG  U N1    1 
ATOM   2789  C  C2    . DG  J  2 9   ? 6.700    38.100  -40.259 1.00 72.14  ? 23   DG  U C2    1 
ATOM   2790  N  N2    . DG  J  2 9   ? 5.882    37.166  -40.749 1.00 71.93  ? 23   DG  U N2    1 
ATOM   2791  N  N3    . DG  J  2 9   ? 7.011    39.157  -40.998 1.00 72.76  ? 23   DG  U N3    1 
ATOM   2792  C  C4    . DG  J  2 9   ? 7.894    39.965  -40.376 1.00 73.01  ? 23   DG  U C4    1 
ATOM   2793  P  P     . DT  J  2 10  ? 5.478    45.161  -42.811 1.00 77.31  ? 24   DT  U P     1 
ATOM   2794  O  OP1   . DT  J  2 10  ? 5.384    46.608  -43.134 1.00 77.17  ? 24   DT  U OP1   1 
ATOM   2795  O  OP2   . DT  J  2 10  ? 5.310    44.723  -41.401 1.00 76.90  ? 24   DT  U OP2   1 
ATOM   2796  O  "O5'" . DT  J  2 10  ? 4.424    44.354  -43.681 1.00 76.76  ? 24   DT  U "O5'" 1 
ATOM   2797  C  "C5'" . DT  J  2 10  ? 3.248    43.821  -43.090 1.00 75.05  ? 24   DT  U "C5'" 1 
ATOM   2798  C  "C4'" . DT  J  2 10  ? 3.083    42.366  -43.462 1.00 71.88  ? 24   DT  U "C4'" 1 
ATOM   2799  O  "O4'" . DT  J  2 10  ? 4.031    41.570  -42.707 1.00 72.12  ? 24   DT  U "O4'" 1 
ATOM   2800  C  "C3'" . DT  J  2 10  ? 1.698    41.866  -43.070 1.00 69.78  ? 24   DT  U "C3'" 1 
ATOM   2801  O  "O3'" . DT  J  2 10  ? 1.011    41.187  -44.105 1.00 66.29  ? 24   DT  U "O3'" 1 
ATOM   2802  C  "C2'" . DT  J  2 10  ? 1.909    40.964  -41.874 1.00 70.29  ? 24   DT  U "C2'" 1 
ATOM   2803  C  "C1'" . DT  J  2 10  ? 3.364    40.566  -41.950 1.00 71.66  ? 24   DT  U "C1'" 1 
ATOM   2804  N  N1    . DT  J  2 10  ? 3.968    40.524  -40.607 1.00 72.30  ? 24   DT  U N1    1 
ATOM   2805  C  C2    . DT  J  2 10  ? 3.679    39.439  -39.807 1.00 72.40  ? 24   DT  U C2    1 
ATOM   2806  O  O2    . DT  J  2 10  ? 3.012    38.488  -40.188 1.00 71.65  ? 24   DT  U O2    1 
ATOM   2807  N  N3    . DT  J  2 10  ? 4.208    39.505  -38.539 1.00 72.82  ? 24   DT  U N3    1 
ATOM   2808  C  C4    . DT  J  2 10  ? 4.999    40.512  -38.015 1.00 73.18  ? 24   DT  U C4    1 
ATOM   2809  O  O4    . DT  J  2 10  ? 5.381    40.452  -36.843 1.00 72.02  ? 24   DT  U O4    1 
ATOM   2810  C  C5    . DT  J  2 10  ? 5.308    41.586  -38.929 1.00 73.16  ? 24   DT  U C5    1 
ATOM   2811  C  C7    . DT  J  2 10  ? 6.219    42.679  -38.473 1.00 74.23  ? 24   DT  U C7    1 
ATOM   2812  C  C6    . DT  J  2 10  ? 4.774    41.547  -40.158 1.00 72.76  ? 24   DT  U C6    1 
ATOM   2813  P  P     . DG  J  2 11  ? -0.574   41.030  -43.969 1.00 64.75  ? 25   DG  U P     1 
ATOM   2814  O  OP1   . DG  J  2 11  ? -1.138   40.419  -45.195 1.00 62.44  ? 25   DG  U OP1   1 
ATOM   2815  O  OP2   . DG  J  2 11  ? -1.101   42.328  -43.477 1.00 63.32  ? 25   DG  U OP2   1 
ATOM   2816  O  "O5'" . DG  J  2 11  ? -0.712   39.989  -42.779 1.00 63.63  ? 25   DG  U "O5'" 1 
ATOM   2817  C  "C5'" . DG  J  2 11  ? -1.129   38.661  -43.037 1.00 61.83  ? 25   DG  U "C5'" 1 
ATOM   2818  C  "C4'" . DG  J  2 11  ? -2.175   38.271  -42.028 1.00 60.41  ? 25   DG  U "C4'" 1 
ATOM   2819  O  "O4'" . DG  J  2 11  ? -1.483   37.971  -40.791 1.00 58.56  ? 25   DG  U "O4'" 1 
ATOM   2820  C  "C3'" . DG  J  2 11  ? -3.135   39.423  -41.725 1.00 60.85  ? 25   DG  U "C3'" 1 
ATOM   2821  O  "O3'" . DG  J  2 11  ? -4.468   39.215  -42.236 1.00 61.23  ? 25   DG  U "O3'" 1 
ATOM   2822  C  "C2'" . DG  J  2 11  ? -2.987   39.718  -40.237 1.00 58.33  ? 25   DG  U "C2'" 1 
ATOM   2823  C  "C1'" . DG  J  2 11  ? -2.033   38.669  -39.686 1.00 57.10  ? 25   DG  U "C1'" 1 
ATOM   2824  N  N9    . DG  J  2 11  ? -0.930   39.288  -38.957 1.00 54.69  ? 25   DG  U N9    1 
ATOM   2825  C  C8    . DG  J  2 11  ? -0.226   40.399  -39.342 1.00 53.76  ? 25   DG  U C8    1 
ATOM   2826  N  N7    . DG  J  2 11  ? 0.650    40.783  -38.456 1.00 53.63  ? 25   DG  U N7    1 
ATOM   2827  C  C5    . DG  J  2 11  ? 0.537    39.853  -37.430 1.00 52.59  ? 25   DG  U C5    1 
ATOM   2828  C  C6    . DG  J  2 11  ? 1.237    39.748  -36.185 1.00 51.74  ? 25   DG  U C6    1 
ATOM   2829  O  O6    . DG  J  2 11  ? 2.118    40.485  -35.724 1.00 52.01  ? 25   DG  U O6    1 
ATOM   2830  N  N1    . DG  J  2 11  ? 0.812    38.649  -35.455 1.00 50.22  ? 25   DG  U N1    1 
ATOM   2831  C  C2    . DG  J  2 11  ? -0.152   37.761  -35.858 1.00 50.39  ? 25   DG  U C2    1 
ATOM   2832  N  N2    . DG  J  2 11  ? -0.415   36.755  -35.022 1.00 49.67  ? 25   DG  U N2    1 
ATOM   2833  N  N3    . DG  J  2 11  ? -0.810   37.848  -37.001 1.00 52.46  ? 25   DG  U N3    1 
ATOM   2834  C  C4    . DG  J  2 11  ? -0.420   38.911  -37.732 1.00 53.32  ? 25   DG  U C4    1 
ATOM   2835  P  P     . DT  J  2 12  ? -5.450   38.154  -41.557 1.00 60.61  ? 26   DT  U P     1 
ATOM   2836  O  OP1   . DT  J  2 12  ? -4.726   36.858  -41.487 1.00 61.82  ? 26   DT  U OP1   1 
ATOM   2837  O  OP2   . DT  J  2 12  ? -6.700   38.243  -42.339 1.00 60.65  ? 26   DT  U OP2   1 
ATOM   2838  O  "O5'" . DT  J  2 12  ? -5.690   38.712  -40.085 1.00 60.70  ? 26   DT  U "O5'" 1 
ATOM   2839  C  "C5'" . DT  J  2 12  ? -5.975   40.090  -39.866 1.00 62.63  ? 26   DT  U "C5'" 1 
ATOM   2840  C  "C4'" . DT  J  2 12  ? -6.241   40.350  -38.400 1.00 64.69  ? 26   DT  U "C4'" 1 
ATOM   2841  O  "O4'" . DT  J  2 12  ? -5.027   40.190  -37.614 1.00 67.03  ? 26   DT  U "O4'" 1 
ATOM   2842  C  "C3'" . DT  J  2 12  ? -6.758   41.760  -38.102 1.00 64.44  ? 26   DT  U "C3'" 1 
ATOM   2843  O  "O3'" . DT  J  2 12  ? -7.987   41.702  -37.407 1.00 62.91  ? 26   DT  U "O3'" 1 
ATOM   2844  C  "C2'" . DT  J  2 12  ? -5.722   42.384  -37.185 1.00 65.28  ? 26   DT  U "C2'" 1 
ATOM   2845  C  "C1'" . DT  J  2 12  ? -4.951   41.204  -36.622 1.00 67.06  ? 26   DT  U "C1'" 1 
ATOM   2846  N  N1    . DT  J  2 12  ? -3.533   41.560  -36.424 1.00 68.59  ? 26   DT  U N1    1 
ATOM   2847  C  C2    . DT  J  2 12  ? -2.815   41.040  -35.362 1.00 68.67  ? 26   DT  U C2    1 
ATOM   2848  O  O2    . DT  J  2 12  ? -3.238   40.157  -34.629 1.00 68.63  ? 26   DT  U O2    1 
ATOM   2849  N  N3    . DT  J  2 12  ? -1.564   41.592  -35.205 1.00 68.16  ? 26   DT  U N3    1 
ATOM   2850  C  C4    . DT  J  2 12  ? -0.968   42.551  -36.008 1.00 68.94  ? 26   DT  U C4    1 
ATOM   2851  O  O4    . DT  J  2 12  ? 0.133    43.001  -35.715 1.00 70.05  ? 26   DT  U O4    1 
ATOM   2852  C  C5    . DT  J  2 12  ? -1.739   42.964  -37.152 1.00 69.45  ? 26   DT  U C5    1 
ATOM   2853  C  C7    . DT  J  2 12  ? -1.134   43.920  -38.130 1.00 69.20  ? 26   DT  U C7    1 
ATOM   2854  C  C6    . DT  J  2 12  ? -2.966   42.463  -37.294 1.00 69.08  ? 26   DT  U C6    1 
ATOM   2855  P  P     . DC  J  2 13  ? -8.774   43.056  -37.089 1.00 61.52  ? 27   DC  U P     1 
ATOM   2856  O  OP1   . DC  J  2 13  ? -10.119  42.843  -37.657 1.00 61.09  ? 27   DC  U OP1   1 
ATOM   2857  O  OP2   . DC  J  2 13  ? -7.989   44.257  -37.469 1.00 60.08  ? 27   DC  U OP2   1 
ATOM   2858  O  "O5'" . DC  J  2 13  ? -8.859   43.044  -35.509 1.00 62.64  ? 27   DC  U "O5'" 1 
ATOM   2859  C  "C5'" . DC  J  2 13  ? -9.230   41.865  -34.819 1.00 65.59  ? 27   DC  U "C5'" 1 
ATOM   2860  C  "C4'" . DC  J  2 13  ? -9.005   42.060  -33.342 1.00 68.29  ? 27   DC  U "C4'" 1 
ATOM   2861  O  "O4'" . DC  J  2 13  ? -7.592   41.885  -33.082 1.00 70.93  ? 27   DC  U "O4'" 1 
ATOM   2862  C  "C3'" . DC  J  2 13  ? -9.380   43.463  -32.863 1.00 69.24  ? 27   DC  U "C3'" 1 
ATOM   2863  O  "O3'" . DC  J  2 13  ? -10.328  43.436  -31.812 1.00 68.28  ? 27   DC  U "O3'" 1 
ATOM   2864  C  "C2'" . DC  J  2 13  ? -8.082   44.081  -32.372 1.00 71.13  ? 27   DC  U "C2'" 1 
ATOM   2865  C  "C1'" . DC  J  2 13  ? -7.068   42.951  -32.307 1.00 72.43  ? 27   DC  U "C1'" 1 
ATOM   2866  N  N1    . DC  J  2 13  ? -5.821   43.405  -32.946 1.00 74.06  ? 27   DC  U N1    1 
ATOM   2867  C  C2    . DC  J  2 13  ? -4.608   43.320  -32.249 1.00 74.87  ? 27   DC  U C2    1 
ATOM   2868  O  O2    . DC  J  2 13  ? -4.579   42.744  -31.150 1.00 75.12  ? 27   DC  U O2    1 
ATOM   2869  N  N3    . DC  J  2 13  ? -3.495   43.866  -32.798 1.00 75.65  ? 27   DC  U N3    1 
ATOM   2870  C  C4    . DC  J  2 13  ? -3.562   44.455  -33.998 1.00 75.61  ? 27   DC  U C4    1 
ATOM   2871  N  N4    . DC  J  2 13  ? -2.456   45.026  -34.486 1.00 75.39  ? 27   DC  U N4    1 
ATOM   2872  C  C5    . DC  J  2 13  ? -4.770   44.495  -34.749 1.00 75.71  ? 27   DC  U C5    1 
ATOM   2873  C  C6    . DC  J  2 13  ? -5.861   43.957  -34.195 1.00 74.91  ? 27   DC  U C6    1 
ATOM   2874  P  P     . DG  J  2 14  ? -10.867  44.821  -31.207 1.00 67.21  ? 28   DG  U P     1 
ATOM   2875  O  OP1   . DG  J  2 14  ? -12.316  44.881  -31.544 1.00 67.32  ? 28   DG  U OP1   1 
ATOM   2876  O  OP2   . DG  J  2 14  ? -9.980   45.940  -31.623 1.00 63.37  ? 28   DG  U OP2   1 
ATOM   2877  O  "O5'" . DG  J  2 14  ? -10.663  44.594  -29.638 1.00 69.03  ? 28   DG  U "O5'" 1 
ATOM   2878  C  "C5'" . DG  J  2 14  ? -10.593  45.694  -28.736 1.00 70.22  ? 28   DG  U "C5'" 1 
ATOM   2879  C  "C4'" . DG  J  2 14  ? -9.512   45.472  -27.705 1.00 69.97  ? 28   DG  U "C4'" 1 
ATOM   2880  O  "O4'" . DG  J  2 14  ? -8.284   45.138  -28.394 1.00 69.83  ? 28   DG  U "O4'" 1 
ATOM   2881  C  "C3'" . DG  J  2 14  ? -9.233   46.745  -26.905 1.00 71.34  ? 28   DG  U "C3'" 1 
ATOM   2882  O  "O3'" . DG  J  2 14  ? -9.834   46.988  -25.615 1.00 73.54  ? 28   DG  U "O3'" 1 
ATOM   2883  C  "C2'" . DG  J  2 14  ? -7.825   47.178  -27.281 1.00 71.14  ? 28   DG  U "C2'" 1 
ATOM   2884  C  "C1'" . DG  J  2 14  ? -7.211   45.984  -27.992 1.00 70.59  ? 28   DG  U "C1'" 1 
ATOM   2885  N  N9    . DG  J  2 14  ? -6.478   46.378  -29.195 1.00 70.21  ? 28   DG  U N9    1 
ATOM   2886  C  C8    . DG  J  2 14  ? -6.993   46.530  -30.457 1.00 70.30  ? 28   DG  U C8    1 
ATOM   2887  N  N7    . DG  J  2 14  ? -6.108   46.925  -31.330 1.00 70.29  ? 28   DG  U N7    1 
ATOM   2888  C  C5    . DG  J  2 14  ? -4.934   47.038  -30.602 1.00 70.61  ? 28   DG  U C5    1 
ATOM   2889  C  C6    . DG  J  2 14  ? -3.633   47.440  -31.013 1.00 71.92  ? 28   DG  U C6    1 
ATOM   2890  O  O6    . DG  J  2 14  ? -3.254   47.810  -32.139 1.00 72.23  ? 28   DG  U O6    1 
ATOM   2891  N  N1    . DG  J  2 14  ? -2.729   47.390  -29.955 1.00 72.05  ? 28   DG  U N1    1 
ATOM   2892  C  C2    . DG  J  2 14  ? -3.037   47.005  -28.669 1.00 71.25  ? 28   DG  U C2    1 
ATOM   2893  N  N2    . DG  J  2 14  ? -2.021   46.986  -27.797 1.00 71.58  ? 28   DG  U N2    1 
ATOM   2894  N  N3    . DG  J  2 14  ? -4.251   46.654  -28.271 1.00 70.44  ? 28   DG  U N3    1 
ATOM   2895  C  C4    . DG  J  2 14  ? -5.142   46.690  -29.282 1.00 70.08  ? 28   DG  U C4    1 
ATOM   2896  O  "O5'" . G   K  1 2   ? -61.632  -8.234  -34.468 1.00 148.67 ? 2    G   X "O5'" 1 
ATOM   2897  C  "C5'" . G   K  1 2   ? -61.382  -8.860  -33.204 1.00 150.14 ? 2    G   X "C5'" 1 
ATOM   2898  C  "C4'" . G   K  1 2   ? -60.002  -8.571  -32.649 1.00 150.91 ? 2    G   X "C4'" 1 
ATOM   2899  O  "O4'" . G   K  1 2   ? -58.994  -9.030  -33.585 1.00 151.48 ? 2    G   X "O4'" 1 
ATOM   2900  C  "C3'" . G   K  1 2   ? -59.669  -7.102  -32.426 1.00 150.94 ? 2    G   X "C3'" 1 
ATOM   2901  O  "O3'" . G   K  1 2   ? -60.148  -6.667  -31.155 1.00 150.33 ? 2    G   X "O3'" 1 
ATOM   2902  C  "C2'" . G   K  1 2   ? -58.143  -7.092  -32.476 1.00 150.95 ? 2    G   X "C2'" 1 
ATOM   2903  O  "O2'" . G   K  1 2   ? -57.545  -7.418  -31.238 1.00 150.16 ? 2    G   X "O2'" 1 
ATOM   2904  C  "C1'" . G   K  1 2   ? -57.853  -8.191  -33.504 1.00 151.42 ? 2    G   X "C1'" 1 
ATOM   2905  N  N9    . G   K  1 2   ? -57.545  -7.701  -34.843 1.00 151.83 ? 2    G   X N9    1 
ATOM   2906  C  C8    . G   K  1 2   ? -58.281  -7.897  -35.987 1.00 152.24 ? 2    G   X C8    1 
ATOM   2907  N  N7    . G   K  1 2   ? -57.741  -7.354  -37.044 1.00 152.45 ? 2    G   X N7    1 
ATOM   2908  C  C5    . G   K  1 2   ? -56.581  -6.759  -36.569 1.00 152.20 ? 2    G   X C5    1 
ATOM   2909  C  C6    . G   K  1 2   ? -55.579  -6.022  -37.253 1.00 152.33 ? 2    G   X C6    1 
ATOM   2910  O  O6    . G   K  1 2   ? -55.516  -5.734  -38.454 1.00 152.01 ? 2    G   X O6    1 
ATOM   2911  N  N1    . G   K  1 2   ? -54.573  -5.604  -36.388 1.00 152.66 ? 2    G   X N1    1 
ATOM   2912  C  C2    . G   K  1 2   ? -54.536  -5.858  -35.038 1.00 152.77 ? 2    G   X C2    1 
ATOM   2913  N  N2    . G   K  1 2   ? -53.478  -5.364  -34.374 1.00 152.90 ? 2    G   X N2    1 
ATOM   2914  N  N3    . G   K  1 2   ? -55.464  -6.542  -34.389 1.00 152.23 ? 2    G   X N3    1 
ATOM   2915  C  C4    . G   K  1 2   ? -56.449  -6.960  -35.211 1.00 152.00 ? 2    G   X C4    1 
ATOM   2916  P  P     . A   K  1 3   ? -60.717  -5.174  -30.985 1.00 149.61 ? 3    A   X P     1 
ATOM   2917  O  OP1   . A   K  1 3   ? -61.413  -5.089  -29.673 1.00 148.99 ? 3    A   X OP1   1 
ATOM   2918  O  OP2   . A   K  1 3   ? -61.448  -4.829  -32.232 1.00 149.70 ? 3    A   X OP2   1 
ATOM   2919  O  "O5'" . A   K  1 3   ? -59.411  -4.264  -30.923 1.00 148.30 ? 3    A   X "O5'" 1 
ATOM   2920  C  "C5'" . A   K  1 3   ? -58.649  -4.167  -29.727 1.00 146.37 ? 3    A   X "C5'" 1 
ATOM   2921  C  "C4'" . A   K  1 3   ? -57.394  -3.363  -29.969 1.00 144.85 ? 3    A   X "C4'" 1 
ATOM   2922  O  "O4'" . A   K  1 3   ? -56.575  -4.048  -30.953 1.00 144.01 ? 3    A   X "O4'" 1 
ATOM   2923  C  "C3'" . A   K  1 3   ? -57.588  -1.975  -30.562 1.00 144.38 ? 3    A   X "C3'" 1 
ATOM   2924  O  "O3'" . A   K  1 3   ? -57.920  -1.016  -29.557 1.00 144.55 ? 3    A   X "O3'" 1 
ATOM   2925  C  "C2'" . A   K  1 3   ? -56.219  -1.713  -31.177 1.00 143.59 ? 3    A   X "C2'" 1 
ATOM   2926  O  "O2'" . A   K  1 3   ? -55.246  -1.323  -30.231 1.00 143.31 ? 3    A   X "O2'" 1 
ATOM   2927  C  "C1'" . A   K  1 3   ? -55.870  -3.095  -31.729 1.00 143.29 ? 3    A   X "C1'" 1 
ATOM   2928  N  N9    . A   K  1 3   ? -56.271  -3.250  -33.124 1.00 142.80 ? 3    A   X N9    1 
ATOM   2929  C  C8    . A   K  1 3   ? -57.397  -3.853  -33.627 1.00 142.82 ? 3    A   X C8    1 
ATOM   2930  N  N7    . A   K  1 3   ? -57.471  -3.824  -34.935 1.00 142.67 ? 3    A   X N7    1 
ATOM   2931  C  C5    . A   K  1 3   ? -56.316  -3.157  -35.319 1.00 142.72 ? 3    A   X C5    1 
ATOM   2932  C  C6    . A   K  1 3   ? -55.799  -2.804  -36.579 1.00 142.84 ? 3    A   X C6    1 
ATOM   2933  N  N6    . A   K  1 3   ? -56.408  -3.079  -37.733 1.00 143.06 ? 3    A   X N6    1 
ATOM   2934  N  N1    . A   K  1 3   ? -54.617  -2.148  -36.612 1.00 142.86 ? 3    A   X N1    1 
ATOM   2935  C  C2    . A   K  1 3   ? -54.007  -1.870  -35.452 1.00 142.89 ? 3    A   X C2    1 
ATOM   2936  N  N3    . A   K  1 3   ? -54.393  -2.147  -34.208 1.00 142.70 ? 3    A   X N3    1 
ATOM   2937  C  C4    . A   K  1 3   ? -55.568  -2.799  -34.212 1.00 142.69 ? 3    A   X C4    1 
ATOM   2938  P  P     . C   K  1 4   ? -59.022  0.122   -29.865 1.00 143.89 ? 4    C   X P     1 
ATOM   2939  O  OP1   . C   K  1 4   ? -59.587  0.547   -28.558 1.00 143.63 ? 4    C   X OP1   1 
ATOM   2940  O  OP2   . C   K  1 4   ? -59.931  -0.378  -30.931 1.00 143.63 ? 4    C   X OP2   1 
ATOM   2941  O  "O5'" . C   K  1 4   ? -58.173  1.337   -30.453 1.00 143.08 ? 4    C   X "O5'" 1 
ATOM   2942  C  "C5'" . C   K  1 4   ? -57.114  1.914   -29.692 1.00 141.65 ? 4    C   X "C5'" 1 
ATOM   2943  C  "C4'" . C   K  1 4   ? -55.949  2.261   -30.589 1.00 140.81 ? 4    C   X "C4'" 1 
ATOM   2944  O  "O4'" . C   K  1 4   ? -55.597  1.091   -31.376 1.00 140.67 ? 4    C   X "O4'" 1 
ATOM   2945  C  "C3'" . C   K  1 4   ? -56.200  3.338   -31.633 1.00 140.44 ? 4    C   X "C3'" 1 
ATOM   2946  O  "O3'" . C   K  1 4   ? -56.029  4.640   -31.077 1.00 139.56 ? 4    C   X "O3'" 1 
ATOM   2947  C  "C2'" . C   K  1 4   ? -55.134  3.023   -32.676 1.00 140.46 ? 4    C   X "C2'" 1 
ATOM   2948  O  "O2'" . C   K  1 4   ? -53.848  3.491   -32.323 1.00 140.12 ? 4    C   X "O2'" 1 
ATOM   2949  C  "C1'" . C   K  1 4   ? -55.143  1.495   -32.658 1.00 140.90 ? 4    C   X "C1'" 1 
ATOM   2950  N  N1    . C   K  1 4   ? -56.040  0.923   -33.673 1.00 141.68 ? 4    C   X N1    1 
ATOM   2951  C  C2    . C   K  1 4   ? -55.673  1.006   -35.019 1.00 141.83 ? 4    C   X C2    1 
ATOM   2952  O  O2    . C   K  1 4   ? -54.612  1.576   -35.318 1.00 140.65 ? 4    C   X O2    1 
ATOM   2953  N  N3    . C   K  1 4   ? -56.484  0.466   -35.959 1.00 142.65 ? 4    C   X N3    1 
ATOM   2954  C  C4    . C   K  1 4   ? -57.622  -0.133  -35.595 1.00 143.14 ? 4    C   X C4    1 
ATOM   2955  N  N4    . C   K  1 4   ? -58.387  -0.663  -36.554 1.00 143.67 ? 4    C   X N4    1 
ATOM   2956  C  C5    . C   K  1 4   ? -58.025  -0.220  -34.231 1.00 142.97 ? 4    C   X C5    1 
ATOM   2957  C  C6    . C   K  1 4   ? -57.212  0.317   -33.312 1.00 142.46 ? 4    C   X C6    1 
ATOM   2958  P  P     . A   K  1 5   ? -56.823  5.890   -31.709 1.00 138.63 ? 5    A   X P     1 
ATOM   2959  O  OP1   . A   K  1 5   ? -56.756  7.020   -30.748 1.00 139.01 ? 5    A   X OP1   1 
ATOM   2960  O  OP2   . A   K  1 5   ? -58.146  5.389   -32.164 1.00 138.55 ? 5    A   X OP2   1 
ATOM   2961  O  "O5'" . A   K  1 5   ? -55.973  6.290   -32.996 1.00 137.52 ? 5    A   X "O5'" 1 
ATOM   2962  C  "C5'" . A   K  1 5   ? -56.452  7.269   -33.924 1.00 135.36 ? 5    A   X "C5'" 1 
ATOM   2963  C  "C4'" . A   K  1 5   ? -55.486  7.401   -35.081 1.00 133.72 ? 5    A   X "C4'" 1 
ATOM   2964  O  "O4'" . A   K  1 5   ? -55.114  6.067   -35.509 1.00 132.33 ? 5    A   X "O4'" 1 
ATOM   2965  C  "C3'" . A   K  1 5   ? -55.995  8.121   -36.331 1.00 132.75 ? 5    A   X "C3'" 1 
ATOM   2966  O  "O3'" . A   K  1 5   ? -55.722  9.531   -36.271 1.00 131.50 ? 5    A   X "O3'" 1 
ATOM   2967  C  "C2'" . A   K  1 5   ? -55.182  7.458   -37.441 1.00 132.34 ? 5    A   X "C2'" 1 
ATOM   2968  O  "O2'" . A   K  1 5   ? -53.908  8.052   -37.613 1.00 132.06 ? 5    A   X "O2'" 1 
ATOM   2969  C  "C1'" . A   K  1 5   ? -55.034  6.023   -36.916 1.00 131.80 ? 5    A   X "C1'" 1 
ATOM   2970  N  N9    . A   K  1 5   ? -56.062  5.094   -37.377 1.00 131.06 ? 5    A   X N9    1 
ATOM   2971  C  C8    . A   K  1 5   ? -57.086  4.566   -36.632 1.00 130.40 ? 5    A   X C8    1 
ATOM   2972  N  N7    . A   K  1 5   ? -57.870  3.761   -37.306 1.00 130.37 ? 5    A   X N7    1 
ATOM   2973  C  C5    . A   K  1 5   ? -57.325  3.756   -38.582 1.00 130.25 ? 5    A   X C5    1 
ATOM   2974  C  C6    . A   K  1 5   ? -57.698  3.098   -39.768 1.00 129.70 ? 5    A   X C6    1 
ATOM   2975  N  N6    . A   K  1 5   ? -58.751  2.283   -39.863 1.00 128.05 ? 5    A   X N6    1 
ATOM   2976  N  N1    . A   K  1 5   ? -56.940  3.308   -40.866 1.00 130.13 ? 5    A   X N1    1 
ATOM   2977  C  C2    . A   K  1 5   ? -55.880  4.125   -40.769 1.00 130.47 ? 5    A   X C2    1 
ATOM   2978  N  N3    . A   K  1 5   ? -55.430  4.799   -39.714 1.00 130.54 ? 5    A   X N3    1 
ATOM   2979  C  C4    . A   K  1 5   ? -56.207  4.570   -38.640 1.00 130.84 ? 5    A   X C4    1 
ATOM   2980  P  P     . C   K  1 6   ? -56.651  10.582  -37.076 1.00 130.07 ? 6    C   X P     1 
ATOM   2981  O  OP1   . C   K  1 6   ? -56.041  11.930  -36.904 1.00 129.54 ? 6    C   X OP1   1 
ATOM   2982  O  OP2   . C   K  1 6   ? -58.071  10.364  -36.682 1.00 129.81 ? 6    C   X OP2   1 
ATOM   2983  O  "O5'" . C   K  1 6   ? -56.479  10.186  -38.613 1.00 128.33 ? 6    C   X "O5'" 1 
ATOM   2984  C  "C5'" . C   K  1 6   ? -55.247  10.413  -39.288 1.00 125.87 ? 6    C   X "C5'" 1 
ATOM   2985  C  "C4'" . C   K  1 6   ? -55.259  9.765   -40.655 1.00 125.00 ? 6    C   X "C4'" 1 
ATOM   2986  O  "O4'" . C   K  1 6   ? -55.589  8.358   -40.522 1.00 123.98 ? 6    C   X "O4'" 1 
ATOM   2987  C  "C3'" . C   K  1 6   ? -56.276  10.273  -41.666 1.00 125.12 ? 6    C   X "C3'" 1 
ATOM   2988  O  "O3'" . C   K  1 6   ? -55.804  11.458  -42.311 1.00 126.22 ? 6    C   X "O3'" 1 
ATOM   2989  C  "C2'" . C   K  1 6   ? -56.361  9.105   -42.647 1.00 124.90 ? 6    C   X "C2'" 1 
ATOM   2990  O  "O2'" . C   K  1 6   ? -55.347  9.100   -43.636 1.00 124.80 ? 6    C   X "O2'" 1 
ATOM   2991  C  "C1'" . C   K  1 6   ? -56.203  7.901   -41.716 1.00 124.09 ? 6    C   X "C1'" 1 
ATOM   2992  N  N1    . C   K  1 6   ? -57.496  7.289   -41.379 1.00 123.71 ? 6    C   X N1    1 
ATOM   2993  C  C2    . C   K  1 6   ? -57.964  6.234   -42.169 1.00 123.61 ? 6    C   X C2    1 
ATOM   2994  O  O2    . C   K  1 6   ? -57.262  5.835   -43.115 1.00 123.30 ? 6    C   X O2    1 
ATOM   2995  N  N3    . C   K  1 6   ? -59.162  5.675   -41.880 1.00 123.18 ? 6    C   X N3    1 
ATOM   2996  C  C4    . C   K  1 6   ? -59.879  6.129   -40.849 1.00 122.72 ? 6    C   X C4    1 
ATOM   2997  N  N4    . C   K  1 6   ? -61.054  5.549   -40.600 1.00 122.51 ? 6    C   X N4    1 
ATOM   2998  C  C5    . C   K  1 6   ? -59.422  7.198   -40.027 1.00 122.72 ? 6    C   X C5    1 
ATOM   2999  C  C6    . C   K  1 6   ? -58.236  7.743   -40.324 1.00 123.29 ? 6    C   X C6    1 
ATOM   3000  P  P     . C   K  1 7   ? -56.718  12.191  -43.421 1.00 126.09 ? 7    C   X P     1 
ATOM   3001  O  OP1   . C   K  1 7   ? -55.879  12.376  -44.640 1.00 126.01 ? 7    C   X OP1   1 
ATOM   3002  O  OP2   . C   K  1 7   ? -57.380  13.371  -42.798 1.00 125.60 ? 7    C   X OP2   1 
ATOM   3003  O  "O5'" . C   K  1 7   ? -57.832  11.108  -43.768 1.00 123.73 ? 7    C   X "O5'" 1 
ATOM   3004  C  "C5'" . C   K  1 7   ? -59.033  11.474  -44.432 1.00 119.70 ? 7    C   X "C5'" 1 
ATOM   3005  C  "C4'" . C   K  1 7   ? -59.438  10.392  -45.399 1.00 116.43 ? 7    C   X "C4'" 1 
ATOM   3006  O  "O4'" . C   K  1 7   ? -59.470  9.114   -44.714 1.00 115.96 ? 7    C   X "O4'" 1 
ATOM   3007  C  "C3'" . C   K  1 7   ? -60.831  10.547  -45.977 1.00 114.44 ? 7    C   X "C3'" 1 
ATOM   3008  O  "O3'" . C   K  1 7   ? -60.800  11.406  -47.106 1.00 111.18 ? 7    C   X "O3'" 1 
ATOM   3009  C  "C2'" . C   K  1 7   ? -61.181  9.118   -46.360 1.00 114.47 ? 7    C   X "C2'" 1 
ATOM   3010  O  "O2'" . C   K  1 7   ? -60.586  8.743   -47.583 1.00 114.59 ? 7    C   X "O2'" 1 
ATOM   3011  C  "C1'" . C   K  1 7   ? -60.540  8.331   -45.213 1.00 115.38 ? 7    C   X "C1'" 1 
ATOM   3012  N  N1    . C   K  1 7   ? -61.459  8.037   -44.097 1.00 116.00 ? 7    C   X N1    1 
ATOM   3013  C  C2    . C   K  1 7   ? -62.395  7.005   -44.244 1.00 115.93 ? 7    C   X C2    1 
ATOM   3014  O  O2    . C   K  1 7   ? -62.425  6.370   -45.311 1.00 116.92 ? 7    C   X O2    1 
ATOM   3015  N  N3    . C   K  1 7   ? -63.239  6.726   -43.223 1.00 114.83 ? 7    C   X N3    1 
ATOM   3016  C  C4    . C   K  1 7   ? -63.169  7.427   -42.089 1.00 114.31 ? 7    C   X C4    1 
ATOM   3017  N  N4    . C   K  1 7   ? -64.013  7.110   -41.106 1.00 114.01 ? 7    C   X N4    1 
ATOM   3018  C  C5    . C   K  1 7   ? -62.229  8.483   -41.912 1.00 114.76 ? 7    C   X C5    1 
ATOM   3019  C  C6    . C   K  1 7   ? -61.401  8.752   -42.932 1.00 115.69 ? 7    C   X C6    1 
ATOM   3020  P  P     . U   K  1 8   ? -62.102  12.261  -47.483 1.00 108.47 ? 8    U   X P     1 
ATOM   3021  O  OP1   . U   K  1 8   ? -61.762  13.136  -48.636 1.00 108.10 ? 8    U   X OP1   1 
ATOM   3022  O  OP2   . U   K  1 8   ? -62.612  12.866  -46.224 1.00 108.18 ? 8    U   X OP2   1 
ATOM   3023  O  "O5'" . U   K  1 8   ? -63.138  11.157  -47.978 1.00 105.31 ? 8    U   X "O5'" 1 
ATOM   3024  C  "C5'" . U   K  1 8   ? -62.971  10.532  -49.244 1.00 100.26 ? 8    U   X "C5'" 1 
ATOM   3025  C  "C4'" . U   K  1 8   ? -64.136  9.622   -49.547 1.00 97.23  ? 8    U   X "C4'" 1 
ATOM   3026  O  "O4'" . U   K  1 8   ? -64.102  8.451   -48.685 1.00 96.22  ? 8    U   X "O4'" 1 
ATOM   3027  C  "C3'" . U   K  1 8   ? -65.530  10.170  -49.301 1.00 95.84  ? 8    U   X "C3'" 1 
ATOM   3028  O  "O3'" . U   K  1 8   ? -65.969  11.072  -50.307 1.00 93.80  ? 8    U   X "O3'" 1 
ATOM   3029  C  "C2'" . U   K  1 8   ? -66.341  8.884   -49.302 1.00 95.61  ? 8    U   X "C2'" 1 
ATOM   3030  O  "O2'" . U   K  1 8   ? -66.502  8.343   -50.598 1.00 96.90  ? 8    U   X "O2'" 1 
ATOM   3031  C  "C1'" . U   K  1 8   ? -65.427  7.973   -48.488 1.00 95.00  ? 8    U   X "C1'" 1 
ATOM   3032  N  N1    . U   K  1 8   ? -65.765  8.074   -47.064 1.00 93.70  ? 8    U   X N1    1 
ATOM   3033  C  C2    . U   K  1 8   ? -66.925  7.457   -46.646 1.00 93.08  ? 8    U   X C2    1 
ATOM   3034  O  O2    . U   K  1 8   ? -67.643  6.825   -47.400 1.00 92.65  ? 8    U   X O2    1 
ATOM   3035  N  N3    . U   K  1 8   ? -67.214  7.609   -45.313 1.00 93.09  ? 8    U   X N3    1 
ATOM   3036  C  C4    . U   K  1 8   ? -66.475  8.303   -44.377 1.00 93.30  ? 8    U   X C4    1 
ATOM   3037  O  O4    . U   K  1 8   ? -66.893  8.397   -43.222 1.00 93.44  ? 8    U   X O4    1 
ATOM   3038  C  C5    . U   K  1 8   ? -65.281  8.901   -44.886 1.00 93.29  ? 8    U   X C5    1 
ATOM   3039  C  C6    . U   K  1 8   ? -64.974  8.768   -46.181 1.00 93.88  ? 8    U   X C6    1 
ATOM   3040  P  P     . G   K  1 9   ? -67.232  12.027  -50.019 1.00 91.56  ? 9    G   X P     1 
ATOM   3041  O  OP1   . G   K  1 9   ? -67.505  12.780  -51.269 1.00 91.87  ? 9    G   X OP1   1 
ATOM   3042  O  OP2   . G   K  1 9   ? -66.996  12.766  -48.753 1.00 90.82  ? 9    G   X OP2   1 
ATOM   3043  O  "O5'" . G   K  1 9   ? -68.431  11.007  -49.778 1.00 90.88  ? 9    G   X "O5'" 1 
ATOM   3044  C  "C5'" . G   K  1 9   ? -68.817  10.092  -50.802 1.00 89.93  ? 9    G   X "C5'" 1 
ATOM   3045  C  "C4'" . G   K  1 9   ? -70.008  9.276   -50.362 1.00 88.37  ? 9    G   X "C4'" 1 
ATOM   3046  O  "O4'" . G   K  1 9   ? -69.651  8.425   -49.238 1.00 87.99  ? 9    G   X "O4'" 1 
ATOM   3047  C  "C3'" . G   K  1 9   ? -71.182  10.083  -49.850 1.00 87.47  ? 9    G   X "C3'" 1 
ATOM   3048  O  "O3'" . G   K  1 9   ? -71.978  10.579  -50.910 1.00 84.97  ? 9    G   X "O3'" 1 
ATOM   3049  C  "C2'" . G   K  1 9   ? -71.921  9.057   -49.006 1.00 88.19  ? 9    G   X "C2'" 1 
ATOM   3050  O  "O2'" . G   K  1 9   ? -72.690  8.159   -49.782 1.00 88.73  ? 9    G   X "O2'" 1 
ATOM   3051  C  "C1'" . G   K  1 9   ? -70.750  8.329   -48.347 1.00 88.17  ? 9    G   X "C1'" 1 
ATOM   3052  N  N9    . G   K  1 9   ? -70.367  8.973   -47.097 1.00 88.82  ? 9    G   X N9    1 
ATOM   3053  C  C8    . G   K  1 9   ? -69.491  10.020  -46.944 1.00 89.03  ? 9    G   X C8    1 
ATOM   3054  N  N7    . G   K  1 9   ? -69.348  10.389  -45.701 1.00 89.35  ? 9    G   X N7    1 
ATOM   3055  C  C5    . G   K  1 9   ? -70.178  9.532   -44.991 1.00 89.75  ? 9    G   X C5    1 
ATOM   3056  C  C6    . G   K  1 9   ? -70.439  9.452   -43.599 1.00 90.04  ? 9    G   X C6    1 
ATOM   3057  O  O6    . G   K  1 9   ? -69.970  10.144  -42.688 1.00 89.94  ? 9    G   X O6    1 
ATOM   3058  N  N1    . G   K  1 9   ? -71.355  8.444   -43.307 1.00 90.33  ? 9    G   X N1    1 
ATOM   3059  C  C2    . G   K  1 9   ? -71.950  7.621   -44.236 1.00 90.43  ? 9    G   X C2    1 
ATOM   3060  N  N2    . G   K  1 9   ? -72.828  6.721   -43.760 1.00 89.69  ? 9    G   X N2    1 
ATOM   3061  N  N3    . G   K  1 9   ? -71.707  7.682   -45.538 1.00 90.18  ? 9    G   X N3    1 
ATOM   3062  C  C4    . G   K  1 9   ? -70.818  8.654   -45.840 1.00 89.55  ? 9    G   X C4    1 
ATOM   3063  P  P     . A   K  1 10  ? -73.299  11.411  -50.564 1.00 83.29  ? 10   A   X P     1 
ATOM   3064  O  OP1   . A   K  1 10  ? -73.761  12.124  -51.781 1.00 83.71  ? 10   A   X OP1   1 
ATOM   3065  O  OP2   . A   K  1 10  ? -73.021  12.185  -49.328 1.00 82.96  ? 10   A   X OP2   1 
ATOM   3066  O  "O5'" . A   K  1 10  ? -74.345  10.267  -50.215 1.00 80.06  ? 10   A   X "O5'" 1 
ATOM   3067  C  "C5'" . A   K  1 10  ? -75.468  10.562  -49.417 1.00 76.73  ? 10   A   X "C5'" 1 
ATOM   3068  C  "C4'" . A   K  1 10  ? -75.786  9.408   -48.509 1.00 74.67  ? 10   A   X "C4'" 1 
ATOM   3069  O  "O4'" . A   K  1 10  ? -74.598  8.958   -47.807 1.00 73.17  ? 10   A   X "O4'" 1 
ATOM   3070  C  "C3'" . A   K  1 10  ? -76.747  9.815   -47.413 1.00 73.95  ? 10   A   X "C3'" 1 
ATOM   3071  O  "O3'" . A   K  1 10  ? -78.065  9.768   -47.914 1.00 73.82  ? 10   A   X "O3'" 1 
ATOM   3072  C  "C2'" . A   K  1 10  ? -76.433  8.812   -46.319 1.00 73.30  ? 10   A   X "C2'" 1 
ATOM   3073  O  "O2'" . A   K  1 10  ? -77.016  7.548   -46.551 1.00 72.67  ? 10   A   X "O2'" 1 
ATOM   3074  C  "C1'" . A   K  1 10  ? -74.909  8.743   -46.438 1.00 72.66  ? 10   A   X "C1'" 1 
ATOM   3075  N  N9    . A   K  1 10  ? -74.263  9.811   -45.679 1.00 72.14  ? 10   A   X N9    1 
ATOM   3076  C  C8    . A   K  1 10  ? -73.606  10.912  -46.178 1.00 72.20  ? 10   A   X C8    1 
ATOM   3077  N  N7    . A   K  1 10  ? -73.120  11.704  -45.253 1.00 71.47  ? 10   A   X N7    1 
ATOM   3078  C  C5    . A   K  1 10  ? -73.480  11.085  -44.064 1.00 71.59  ? 10   A   X C5    1 
ATOM   3079  C  C6    . A   K  1 10  ? -73.249  11.417  -42.719 1.00 71.07  ? 10   A   X C6    1 
ATOM   3080  N  N6    . A   K  1 10  ? -72.574  12.499  -42.332 1.00 70.22  ? 10   A   X N6    1 
ATOM   3081  N  N1    . A   K  1 10  ? -73.738  10.586  -41.774 1.00 71.60  ? 10   A   X N1    1 
ATOM   3082  C  C2    . A   K  1 10  ? -74.412  9.494   -42.166 1.00 72.48  ? 10   A   X C2    1 
ATOM   3083  N  N3    . A   K  1 10  ? -74.692  9.072   -43.399 1.00 72.15  ? 10   A   X N3    1 
ATOM   3084  C  C4    . A   K  1 10  ? -74.190  9.920   -44.312 1.00 71.97  ? 10   A   X C4    1 
ATOM   3085  P  P     . U   K  1 11  ? -78.813  11.141  -48.264 1.00 73.95  ? 11   U   X P     1 
ATOM   3086  O  OP1   . U   K  1 11  ? -79.774  10.857  -49.367 1.00 73.32  ? 11   U   X OP1   1 
ATOM   3087  O  OP2   . U   K  1 11  ? -77.785  12.203  -48.440 1.00 73.57  ? 11   U   X OP2   1 
ATOM   3088  O  "O5'" . U   K  1 11  ? -79.612  11.443  -46.922 1.00 72.19  ? 11   U   X "O5'" 1 
ATOM   3089  C  "C5'" . U   K  1 11  ? -80.479  10.460  -46.370 1.00 69.39  ? 11   U   X "C5'" 1 
ATOM   3090  C  "C4'" . U   K  1 11  ? -80.697  10.716  -44.903 1.00 67.57  ? 11   U   X "C4'" 1 
ATOM   3091  O  "O4'" . U   K  1 11  ? -79.509  10.360  -44.146 1.00 67.85  ? 11   U   X "O4'" 1 
ATOM   3092  C  "C3'" . U   K  1 11  ? -80.918  12.164  -44.517 1.00 66.86  ? 11   U   X "C3'" 1 
ATOM   3093  O  "O3'" . U   K  1 11  ? -82.226  12.618  -44.809 1.00 65.66  ? 11   U   X "O3'" 1 
ATOM   3094  C  "C2'" . U   K  1 11  ? -80.638  12.103  -43.029 1.00 66.67  ? 11   U   X "C2'" 1 
ATOM   3095  O  "O2'" . U   K  1 11  ? -81.679  11.444  -42.342 1.00 65.77  ? 11   U   X "O2'" 1 
ATOM   3096  C  "C1'" . U   K  1 11  ? -79.385  11.229  -43.025 1.00 67.22  ? 11   U   X "C1'" 1 
ATOM   3097  N  N1    . U   K  1 11  ? -78.183  12.056  -43.207 1.00 67.37  ? 11   U   X N1    1 
ATOM   3098  C  C2    . U   K  1 11  ? -77.665  12.693  -42.089 1.00 66.87  ? 11   U   X C2    1 
ATOM   3099  O  O2    . U   K  1 11  ? -78.138  12.567  -40.974 1.00 65.87  ? 11   U   X O2    1 
ATOM   3100  N  N3    . U   K  1 11  ? -76.572  13.486  -42.328 1.00 66.99  ? 11   U   X N3    1 
ATOM   3101  C  C4    . U   K  1 11  ? -75.953  13.701  -43.543 1.00 67.46  ? 11   U   X C4    1 
ATOM   3102  O  O4    . U   K  1 11  ? -75.030  14.515  -43.613 1.00 67.89  ? 11   U   X O4    1 
ATOM   3103  C  C5    . U   K  1 11  ? -76.533  12.988  -44.647 1.00 66.91  ? 11   U   X C5    1 
ATOM   3104  C  C6    . U   K  1 11  ? -77.598  12.210  -44.445 1.00 66.92  ? 11   U   X C6    1 
ATOM   3105  P  P     . U   K  1 12  ? -82.422  14.078  -45.441 1.00 64.19  ? 12   U   X P     1 
ATOM   3106  O  OP1   . U   K  1 12  ? -83.442  13.957  -46.514 1.00 63.69  ? 12   U   X OP1   1 
ATOM   3107  O  OP2   . U   K  1 12  ? -81.079  14.627  -45.763 1.00 64.60  ? 12   U   X OP2   1 
ATOM   3108  O  "O5'" . U   K  1 12  ? -83.012  14.925  -44.235 1.00 63.66  ? 12   U   X "O5'" 1 
ATOM   3109  C  "C5'" . U   K  1 12  ? -83.917  14.335  -43.319 1.00 64.40  ? 12   U   X "C5'" 1 
ATOM   3110  C  "C4'" . U   K  1 12  ? -83.540  14.703  -41.910 1.00 65.61  ? 12   U   X "C4'" 1 
ATOM   3111  O  "O4'" . U   K  1 12  ? -82.219  14.182  -41.621 1.00 66.36  ? 12   U   X "O4'" 1 
ATOM   3112  C  "C3'" . U   K  1 12  ? -83.409  16.187  -41.623 1.00 66.77  ? 12   U   X "C3'" 1 
ATOM   3113  O  "O3'" . U   K  1 12  ? -84.689  16.771  -41.396 1.00 66.19  ? 12   U   X "O3'" 1 
ATOM   3114  C  "C2'" . U   K  1 12  ? -82.523  16.189  -40.379 1.00 67.59  ? 12   U   X "C2'" 1 
ATOM   3115  O  "O2'" . U   K  1 12  ? -83.216  15.916  -39.174 1.00 68.54  ? 12   U   X "O2'" 1 
ATOM   3116  C  "C1'" . U   K  1 12  ? -81.575  15.026  -40.680 1.00 68.27  ? 12   U   X "C1'" 1 
ATOM   3117  N  N1    . U   K  1 12  ? -80.275  15.439  -41.229 1.00 69.97  ? 12   U   X N1    1 
ATOM   3118  C  C2    . U   K  1 12  ? -79.387  16.059  -40.371 1.00 70.76  ? 12   U   X C2    1 
ATOM   3119  O  O2    . U   K  1 12  ? -79.635  16.256  -39.194 1.00 71.22  ? 12   U   X O2    1 
ATOM   3120  N  N3    . U   K  1 12  ? -78.195  16.436  -40.941 1.00 71.75  ? 12   U   X N3    1 
ATOM   3121  C  C4    . U   K  1 12  ? -77.805  16.252  -42.252 1.00 72.76  ? 12   U   X C4    1 
ATOM   3122  O  O4    . U   K  1 12  ? -76.697  16.658  -42.623 1.00 72.90  ? 12   U   X O4    1 
ATOM   3123  C  C5    . U   K  1 12  ? -78.777  15.592  -43.073 1.00 72.84  ? 12   U   X C5    1 
ATOM   3124  C  C6    . U   K  1 12  ? -79.950  15.220  -42.546 1.00 71.42  ? 12   U   X C6    1 
ATOM   3125  P  P     . C   K  1 13  ? -84.868  18.367  -41.483 1.00 66.49  ? 13   C   X P     1 
ATOM   3126  O  OP1   . C   K  1 13  ? -86.320  18.615  -41.681 1.00 65.60  ? 13   C   X OP1   1 
ATOM   3127  O  OP2   . C   K  1 13  ? -83.890  18.910  -42.465 1.00 65.44  ? 13   C   X OP2   1 
ATOM   3128  O  "O5'" . C   K  1 13  ? -84.467  18.869  -40.022 1.00 66.10  ? 13   C   X "O5'" 1 
ATOM   3129  C  "C5'" . C   K  1 13  ? -84.091  20.221  -39.781 1.00 66.46  ? 13   C   X "C5'" 1 
ATOM   3130  C  "C4'" . C   K  1 13  ? -83.129  20.295  -38.615 1.00 67.17  ? 13   C   X "C4'" 1 
ATOM   3131  O  "O4'" . C   K  1 13  ? -82.092  19.297  -38.777 1.00 68.17  ? 13   C   X "O4'" 1 
ATOM   3132  C  "C3'" . C   K  1 13  ? -82.393  21.620  -38.495 1.00 67.10  ? 13   C   X "C3'" 1 
ATOM   3133  O  "O3'" . C   K  1 13  ? -83.136  22.505  -37.686 1.00 67.15  ? 13   C   X "O3'" 1 
ATOM   3134  C  "C2'" . C   K  1 13  ? -81.094  21.226  -37.808 1.00 67.90  ? 13   C   X "C2'" 1 
ATOM   3135  O  "O2'" . C   K  1 13  ? -81.215  21.109  -36.404 1.00 67.27  ? 13   C   X "O2'" 1 
ATOM   3136  C  "C1'" . C   K  1 13  ? -80.833  19.851  -38.422 1.00 69.87  ? 13   C   X "C1'" 1 
ATOM   3137  N  N1    . C   K  1 13  ? -79.984  19.877  -39.631 1.00 72.09  ? 13   C   X N1    1 
ATOM   3138  C  C2    . C   K  1 13  ? -78.695  20.406  -39.543 1.00 71.93  ? 13   C   X C2    1 
ATOM   3139  O  O2    . C   K  1 13  ? -78.309  20.867  -38.457 1.00 72.41  ? 13   C   X O2    1 
ATOM   3140  N  N3    . C   K  1 13  ? -77.904  20.403  -40.645 1.00 72.31  ? 13   C   X N3    1 
ATOM   3141  C  C4    . C   K  1 13  ? -78.361  19.903  -41.796 1.00 71.93  ? 13   C   X C4    1 
ATOM   3142  N  N4    . C   K  1 13  ? -77.546  19.908  -42.848 1.00 71.89  ? 13   C   X N4    1 
ATOM   3143  C  C5    . C   K  1 13  ? -79.673  19.372  -41.917 1.00 72.45  ? 13   C   X C5    1 
ATOM   3144  C  C6    . C   K  1 13  ? -80.445  19.379  -40.821 1.00 73.28  ? 13   C   X C6    1 
ATOM   3145  P  P     . C   K  1 14  ? -84.306  23.373  -38.339 1.00 67.13  ? 14   C   X P     1 
ATOM   3146  O  OP1   . C   K  1 14  ? -85.576  22.871  -37.781 1.00 67.09  ? 14   C   X OP1   1 
ATOM   3147  O  OP2   . C   K  1 14  ? -84.102  23.364  -39.804 1.00 66.34  ? 14   C   X OP2   1 
ATOM   3148  O  "O5'" . C   K  1 14  ? -84.042  24.833  -37.761 1.00 68.42  ? 14   C   X "O5'" 1 
ATOM   3149  C  "C5'" . C   K  1 14  ? -83.291  25.789  -38.497 1.00 70.45  ? 14   C   X "C5'" 1 
ATOM   3150  C  "C4'" . C   K  1 14  ? -81.905  25.911  -37.926 1.00 72.59  ? 14   C   X "C4'" 1 
ATOM   3151  O  "O4'" . C   K  1 14  ? -81.214  24.646  -38.099 1.00 74.57  ? 14   C   X "O4'" 1 
ATOM   3152  C  "C3'" . C   K  1 14  ? -81.014  26.915  -38.633 1.00 73.61  ? 14   C   X "C3'" 1 
ATOM   3153  O  "O3'" . C   K  1 14  ? -81.289  28.255  -38.233 1.00 73.54  ? 14   C   X "O3'" 1 
ATOM   3154  C  "C2'" . C   K  1 14  ? -79.622  26.392  -38.307 1.00 74.43  ? 14   C   X "C2'" 1 
ATOM   3155  O  "O2'" . C   K  1 14  ? -79.191  26.703  -36.998 1.00 74.14  ? 14   C   X "O2'" 1 
ATOM   3156  C  "C1'" . C   K  1 14  ? -79.851  24.886  -38.419 1.00 75.14  ? 14   C   X "C1'" 1 
ATOM   3157  N  N1    . C   K  1 14  ? -79.616  24.399  -39.783 1.00 76.44  ? 14   C   X N1    1 
ATOM   3158  C  C2    . C   K  1 14  ? -78.312  24.379  -40.274 1.00 77.05  ? 14   C   X C2    1 
ATOM   3159  O  O2    . C   K  1 14  ? -77.390  24.799  -39.546 1.00 76.83  ? 14   C   X O2    1 
ATOM   3160  N  N3    . C   K  1 14  ? -78.086  23.912  -41.531 1.00 77.48  ? 14   C   X N3    1 
ATOM   3161  C  C4    . C   K  1 14  ? -79.108  23.490  -42.283 1.00 76.64  ? 14   C   X C4    1 
ATOM   3162  N  N4    . C   K  1 14  ? -78.844  23.040  -43.513 1.00 74.72  ? 14   C   X N4    1 
ATOM   3163  C  C5    . C   K  1 14  ? -80.448  23.512  -41.806 1.00 77.39  ? 14   C   X C5    1 
ATOM   3164  C  C6    . C   K  1 14  ? -80.655  23.969  -40.562 1.00 77.30  ? 14   C   X C6    1 
ATOM   3165  O  "O5'" . DG  L  2 1   ? -69.841  27.044  -40.697 1.00 126.92 ? 15   DG  Z "O5'" 1 
ATOM   3166  C  "C5'" . DG  L  2 1   ? -69.353  26.519  -41.934 1.00 128.07 ? 15   DG  Z "C5'" 1 
ATOM   3167  C  "C4'" . DG  L  2 1   ? -69.101  25.030  -41.977 1.00 128.46 ? 15   DG  Z "C4'" 1 
ATOM   3168  O  "O4'" . DG  L  2 1   ? -70.383  24.373  -42.176 1.00 130.86 ? 15   DG  Z "O4'" 1 
ATOM   3169  C  "C3'" . DG  L  2 1   ? -68.196  24.573  -43.130 1.00 126.68 ? 15   DG  Z "C3'" 1 
ATOM   3170  O  "O3'" . DG  L  2 1   ? -66.895  24.139  -42.685 1.00 122.44 ? 15   DG  Z "O3'" 1 
ATOM   3171  C  "C2'" . DG  L  2 1   ? -69.007  23.566  -43.933 1.00 128.76 ? 15   DG  Z "C2'" 1 
ATOM   3172  C  "C1'" . DG  L  2 1   ? -70.286  23.326  -43.139 1.00 131.67 ? 15   DG  Z "C1'" 1 
ATOM   3173  N  N9    . DG  L  2 1   ? -71.481  23.350  -43.991 1.00 133.09 ? 15   DG  Z N9    1 
ATOM   3174  C  C8    . DG  L  2 1   ? -71.503  23.082  -45.342 1.00 133.31 ? 15   DG  Z C8    1 
ATOM   3175  N  N7    . DG  L  2 1   ? -72.695  23.160  -45.867 1.00 133.65 ? 15   DG  Z N7    1 
ATOM   3176  C  C5    . DG  L  2 1   ? -73.521  23.500  -44.803 1.00 133.96 ? 15   DG  Z C5    1 
ATOM   3177  C  C6    . DG  L  2 1   ? -74.927  23.718  -44.767 1.00 133.80 ? 15   DG  Z C6    1 
ATOM   3178  O  O6    . DG  L  2 1   ? -75.745  23.646  -45.694 1.00 133.51 ? 15   DG  Z O6    1 
ATOM   3179  N  N1    . DG  L  2 1   ? -75.359  24.044  -43.486 1.00 133.67 ? 15   DG  Z N1    1 
ATOM   3180  C  C2    . DG  L  2 1   ? -74.549  24.142  -42.378 1.00 133.38 ? 15   DG  Z C2    1 
ATOM   3181  N  N2    . DG  L  2 1   ? -75.157  24.462  -41.228 1.00 133.30 ? 15   DG  Z N2    1 
ATOM   3182  N  N3    . DG  L  2 1   ? -73.239  23.939  -42.395 1.00 133.28 ? 15   DG  Z N3    1 
ATOM   3183  C  C4    . DG  L  2 1   ? -72.793  23.625  -43.633 1.00 133.67 ? 15   DG  Z C4    1 
ATOM   3184  P  P     . DG  L  2 2   ? -66.638  22.619  -42.240 1.00 119.26 ? 16   DG  Z P     1 
ATOM   3185  O  OP1   . DG  L  2 2   ? -65.181  22.454  -41.981 1.00 119.86 ? 16   DG  Z OP1   1 
ATOM   3186  O  OP2   . DG  L  2 2   ? -67.302  21.728  -43.225 1.00 119.34 ? 16   DG  Z OP2   1 
ATOM   3187  O  "O5'" . DG  L  2 2   ? -67.372  22.535  -40.826 1.00 116.54 ? 16   DG  Z "O5'" 1 
ATOM   3188  C  "C5'" . DG  L  2 2   ? -67.049  23.466  -39.785 1.00 111.47 ? 16   DG  Z "C5'" 1 
ATOM   3189  C  "C4'" . DG  L  2 2   ? -67.984  23.299  -38.607 1.00 107.91 ? 16   DG  Z "C4'" 1 
ATOM   3190  O  "O4'" . DG  L  2 2   ? -69.330  23.463  -39.120 1.00 105.67 ? 16   DG  Z "O4'" 1 
ATOM   3191  C  "C3'" . DG  L  2 2   ? -67.944  21.926  -37.922 1.00 106.11 ? 16   DG  Z "C3'" 1 
ATOM   3192  O  "O3'" . DG  L  2 2   ? -67.620  21.963  -36.534 1.00 102.98 ? 16   DG  Z "O3'" 1 
ATOM   3193  C  "C2'" . DG  L  2 2   ? -69.354  21.380  -38.022 1.00 105.70 ? 16   DG  Z "C2'" 1 
ATOM   3194  C  "C1'" . DG  L  2 2   ? -70.209  22.489  -38.584 1.00 105.20 ? 16   DG  Z "C1'" 1 
ATOM   3195  N  N9    . DG  L  2 2   ? -70.926  21.859  -39.679 1.00 104.88 ? 16   DG  Z N9    1 
ATOM   3196  C  C8    . DG  L  2 2   ? -70.376  21.366  -40.835 1.00 104.47 ? 16   DG  Z C8    1 
ATOM   3197  N  N7    . DG  L  2 2   ? -71.231  20.710  -41.568 1.00 104.97 ? 16   DG  Z N7    1 
ATOM   3198  C  C5    . DG  L  2 2   ? -72.424  20.803  -40.866 1.00 105.99 ? 16   DG  Z C5    1 
ATOM   3199  C  C6    . DG  L  2 2   ? -73.707  20.261  -41.152 1.00 106.30 ? 16   DG  Z C6    1 
ATOM   3200  O  O6    . DG  L  2 2   ? -74.052  19.557  -42.108 1.00 106.83 ? 16   DG  Z O6    1 
ATOM   3201  N  N1    . DG  L  2 2   ? -74.635  20.605  -40.174 1.00 106.07 ? 16   DG  Z N1    1 
ATOM   3202  C  C2    . DG  L  2 2   ? -74.364  21.365  -39.061 1.00 106.30 ? 16   DG  Z C2    1 
ATOM   3203  N  N2    . DG  L  2 2   ? -75.395  21.604  -38.242 1.00 106.67 ? 16   DG  Z N2    1 
ATOM   3204  N  N3    . DG  L  2 2   ? -73.171  21.861  -38.775 1.00 106.19 ? 16   DG  Z N3    1 
ATOM   3205  C  C4    . DG  L  2 2   ? -72.256  21.542  -39.714 1.00 105.81 ? 16   DG  Z C4    1 
ATOM   3206  P  P     . DA  L  2 3   ? -67.500  20.571  -35.729 1.00 99.72  ? 17   DA  Z P     1 
ATOM   3207  O  OP1   . DA  L  2 3   ? -66.256  20.610  -34.919 1.00 101.38 ? 17   DA  Z OP1   1 
ATOM   3208  O  OP2   . DA  L  2 3   ? -67.738  19.426  -36.650 1.00 99.06  ? 17   DA  Z OP2   1 
ATOM   3209  O  "O5'" . DA  L  2 3   ? -68.750  20.573  -34.755 1.00 97.28  ? 17   DA  Z "O5'" 1 
ATOM   3210  C  "C5'" . DA  L  2 3   ? -69.307  19.338  -34.336 1.00 92.82  ? 17   DA  Z "C5'" 1 
ATOM   3211  C  "C4'" . DA  L  2 3   ? -70.751  19.514  -33.935 1.00 89.27  ? 17   DA  Z "C4'" 1 
ATOM   3212  O  "O4'" . DA  L  2 3   ? -71.559  19.802  -35.104 1.00 88.25  ? 17   DA  Z "O4'" 1 
ATOM   3213  C  "C3'" . DA  L  2 3   ? -71.307  18.230  -33.332 1.00 87.14  ? 17   DA  Z "C3'" 1 
ATOM   3214  O  "O3'" . DA  L  2 3   ? -71.800  18.441  -32.026 1.00 83.78  ? 17   DA  Z "O3'" 1 
ATOM   3215  C  "C2'" . DA  L  2 3   ? -72.392  17.757  -34.281 1.00 86.91  ? 17   DA  Z "C2'" 1 
ATOM   3216  C  "C1'" . DA  L  2 3   ? -72.701  18.956  -35.154 1.00 86.65  ? 17   DA  Z "C1'" 1 
ATOM   3217  N  N9    . DA  L  2 3   ? -72.900  18.534  -36.540 1.00 85.51  ? 17   DA  Z N9    1 
ATOM   3218  C  C8    . DA  L  2 3   ? -71.945  18.250  -37.482 1.00 84.13  ? 17   DA  Z C8    1 
ATOM   3219  N  N7    . DA  L  2 3   ? -72.433  17.798  -38.610 1.00 83.63  ? 17   DA  Z N7    1 
ATOM   3220  C  C5    . DA  L  2 3   ? -73.805  17.803  -38.405 1.00 84.18  ? 17   DA  Z C5    1 
ATOM   3221  C  C6    . DA  L  2 3   ? -74.883  17.415  -39.214 1.00 84.00  ? 17   DA  Z C6    1 
ATOM   3222  N  N6    . DA  L  2 3   ? -74.742  16.896  -40.436 1.00 84.01  ? 17   DA  Z N6    1 
ATOM   3223  N  N1    . DA  L  2 3   ? -76.127  17.562  -38.713 1.00 84.80  ? 17   DA  Z N1    1 
ATOM   3224  C  C2    . DA  L  2 3   ? -76.267  18.050  -37.474 1.00 85.05  ? 17   DA  Z C2    1 
ATOM   3225  N  N3    . DA  L  2 3   ? -75.332  18.431  -36.611 1.00 85.44  ? 17   DA  Z N3    1 
ATOM   3226  C  C4    . DA  L  2 3   ? -74.108  18.280  -37.144 1.00 85.21  ? 17   DA  Z C4    1 
ATOM   3227  P  P     . DA  L  2 4   ? -71.638  17.272  -30.957 1.00 81.89  ? 18   DA  Z P     1 
ATOM   3228  O  OP1   . DA  L  2 4   ? -71.905  17.864  -29.620 1.00 80.28  ? 18   DA  Z OP1   1 
ATOM   3229  O  OP2   . DA  L  2 4   ? -70.332  16.616  -31.229 1.00 80.41  ? 18   DA  Z OP2   1 
ATOM   3230  O  "O5'" . DA  L  2 4   ? -72.787  16.252  -31.384 1.00 81.57  ? 18   DA  Z "O5'" 1 
ATOM   3231  C  "C5'" . DA  L  2 4   ? -74.133  16.696  -31.584 1.00 81.29  ? 18   DA  Z "C5'" 1 
ATOM   3232  C  "C4'" . DA  L  2 4   ? -74.961  15.594  -32.205 1.00 82.17  ? 18   DA  Z "C4'" 1 
ATOM   3233  O  "O4'" . DA  L  2 4   ? -75.012  15.727  -33.651 1.00 82.00  ? 18   DA  Z "O4'" 1 
ATOM   3234  C  "C3'" . DA  L  2 4   ? -74.446  14.182  -31.913 1.00 82.82  ? 18   DA  Z "C3'" 1 
ATOM   3235  O  "O3'" . DA  L  2 4   ? -75.413  13.364  -31.259 1.00 83.07  ? 18   DA  Z "O3'" 1 
ATOM   3236  C  "C2'" . DA  L  2 4   ? -74.126  13.600  -33.282 1.00 82.52  ? 18   DA  Z "C2'" 1 
ATOM   3237  C  "C1'" . DA  L  2 4   ? -74.939  14.440  -34.246 1.00 81.91  ? 18   DA  Z "C1'" 1 
ATOM   3238  N  N9    . DA  L  2 4   ? -74.246  14.563  -35.525 1.00 81.82  ? 18   DA  Z N9    1 
ATOM   3239  C  C8    . DA  L  2 4   ? -72.902  14.764  -35.680 1.00 81.91  ? 18   DA  Z C8    1 
ATOM   3240  N  N7    . DA  L  2 4   ? -72.504  14.752  -36.926 1.00 81.81  ? 18   DA  Z N7    1 
ATOM   3241  C  C5    . DA  L  2 4   ? -73.670  14.544  -37.646 1.00 81.96  ? 18   DA  Z C5    1 
ATOM   3242  C  C6    . DA  L  2 4   ? -73.918  14.415  -39.023 1.00 82.21  ? 18   DA  Z C6    1 
ATOM   3243  N  N6    . DA  L  2 4   ? -72.962  14.439  -39.954 1.00 83.25  ? 18   DA  Z N6    1 
ATOM   3244  N  N1    . DA  L  2 4   ? -75.198  14.244  -39.418 1.00 81.95  ? 18   DA  Z N1    1 
ATOM   3245  C  C2    . DA  L  2 4   ? -76.150  14.187  -38.483 1.00 81.49  ? 18   DA  Z C2    1 
ATOM   3246  N  N3    . DA  L  2 4   ? -76.039  14.274  -37.157 1.00 82.58  ? 18   DA  Z N3    1 
ATOM   3247  C  C4    . DA  L  2 4   ? -74.757  14.454  -36.798 1.00 82.13  ? 18   DA  Z C4    1 
ATOM   3248  P  P     . DT  L  2 5   ? -74.974  11.914  -30.724 1.00 83.23  ? 19   DT  Z P     1 
ATOM   3249  O  OP1   . DT  L  2 5   ? -76.034  11.468  -29.789 1.00 83.71  ? 19   DT  Z OP1   1 
ATOM   3250  O  OP2   . DT  L  2 5   ? -73.567  11.967  -30.252 1.00 82.36  ? 19   DT  Z OP2   1 
ATOM   3251  O  "O5'" . DT  L  2 5   ? -74.968  11.034  -32.052 1.00 81.97  ? 19   DT  Z "O5'" 1 
ATOM   3252  C  "C5'" . DT  L  2 5   ? -73.735  10.708  -32.690 1.00 83.05  ? 19   DT  Z "C5'" 1 
ATOM   3253  C  "C4'" . DT  L  2 5   ? -73.950  9.653   -33.747 1.00 84.65  ? 19   DT  Z "C4'" 1 
ATOM   3254  O  "O4'" . DT  L  2 5   ? -74.115  10.308  -35.036 1.00 85.76  ? 19   DT  Z "O4'" 1 
ATOM   3255  C  "C3'" . DT  L  2 5   ? -72.737  8.737   -33.904 1.00 84.92  ? 19   DT  Z "C3'" 1 
ATOM   3256  O  "O3'" . DT  L  2 5   ? -72.990  7.412   -33.481 1.00 83.69  ? 19   DT  Z "O3'" 1 
ATOM   3257  C  "C2'" . DT  L  2 5   ? -72.431  8.712   -35.390 1.00 85.90  ? 19   DT  Z "C2'" 1 
ATOM   3258  C  "C1'" . DT  L  2 5   ? -73.527  9.517   -36.062 1.00 86.36  ? 19   DT  Z "C1'" 1 
ATOM   3259  N  N1    . DT  L  2 5   ? -72.882  10.407  -37.049 1.00 87.32  ? 19   DT  Z N1    1 
ATOM   3260  C  C2    . DT  L  2 5   ? -73.481  10.705  -38.260 1.00 87.75  ? 19   DT  Z C2    1 
ATOM   3261  O  O2    . DT  L  2 5   ? -74.612  10.355  -38.561 1.00 87.26  ? 19   DT  Z O2    1 
ATOM   3262  N  N3    . DT  L  2 5   ? -72.687  11.439  -39.119 1.00 88.46  ? 19   DT  Z N3    1 
ATOM   3263  C  C4    . DT  L  2 5   ? -71.399  11.899  -38.884 1.00 89.40  ? 19   DT  Z C4    1 
ATOM   3264  O  O4    . DT  L  2 5   ? -70.789  12.513  -39.763 1.00 89.19  ? 19   DT  Z O4    1 
ATOM   3265  C  C5    . DT  L  2 5   ? -70.868  11.592  -37.580 1.00 89.62  ? 19   DT  Z C5    1 
ATOM   3266  C  C7    . DT  L  2 5   ? -69.497  12.070  -37.221 1.00 90.86  ? 19   DT  Z C7    1 
ATOM   3267  C  C6    . DT  L  2 5   ? -71.628  10.884  -36.743 1.00 88.82  ? 19   DT  Z C6    1 
ATOM   3268  P  P     . DC  L  2 6   ? -71.820  6.320   -33.592 1.00 82.59  ? 20   DC  Z P     1 
ATOM   3269  O  OP1   . DC  L  2 6   ? -71.907  5.522   -32.348 1.00 82.11  ? 20   DC  Z OP1   1 
ATOM   3270  O  OP2   . DC  L  2 6   ? -70.533  6.967   -33.969 1.00 81.14  ? 20   DC  Z OP2   1 
ATOM   3271  O  "O5'" . DC  L  2 6   ? -72.289  5.430   -34.820 1.00 81.40  ? 20   DC  Z "O5'" 1 
ATOM   3272  C  "C5'" . DC  L  2 6   ? -73.658  5.088   -34.975 1.00 81.72  ? 20   DC  Z "C5'" 1 
ATOM   3273  C  "C4'" . DC  L  2 6   ? -73.888  4.517   -36.350 1.00 82.63  ? 20   DC  Z "C4'" 1 
ATOM   3274  O  "O4'" . DC  L  2 6   ? -73.938  5.606   -37.309 1.00 82.56  ? 20   DC  Z "O4'" 1 
ATOM   3275  C  "C3'" . DC  L  2 6   ? -72.755  3.593   -36.800 1.00 83.39  ? 20   DC  Z "C3'" 1 
ATOM   3276  O  "O3'" . DC  L  2 6   ? -73.169  2.257   -37.036 1.00 85.36  ? 20   DC  Z "O3'" 1 
ATOM   3277  C  "C2'" . DC  L  2 6   ? -72.276  4.171   -38.118 1.00 83.63  ? 20   DC  Z "C2'" 1 
ATOM   3278  C  "C1'" . DC  L  2 6   ? -73.301  5.218   -38.515 1.00 82.61  ? 20   DC  Z "C1'" 1 
ATOM   3279  N  N1    . DC  L  2 6   ? -72.568  6.376   -39.047 1.00 82.23  ? 20   DC  Z N1    1 
ATOM   3280  C  C2    . DC  L  2 6   ? -72.564  6.617   -40.434 1.00 81.23  ? 20   DC  Z C2    1 
ATOM   3281  O  O2    . DC  L  2 6   ? -73.323  5.965   -41.163 1.00 79.54  ? 20   DC  Z O2    1 
ATOM   3282  N  N3    . DC  L  2 6   ? -71.731  7.562   -40.935 1.00 81.17  ? 20   DC  Z N3    1 
ATOM   3283  C  C4    . DC  L  2 6   ? -70.951  8.267   -40.110 1.00 81.51  ? 20   DC  Z C4    1 
ATOM   3284  N  N4    . DC  L  2 6   ? -70.091  9.129   -40.642 1.00 80.44  ? 20   DC  Z N4    1 
ATOM   3285  C  C5    . DC  L  2 6   ? -71.008  8.104   -38.695 1.00 82.45  ? 20   DC  Z C5    1 
ATOM   3286  C  C6    . DC  L  2 6   ? -71.829  7.163   -38.210 1.00 82.76  ? 20   DC  Z C6    1 
ATOM   3287  P  P     . DA  L  2 7   ? -72.058  1.147   -37.376 1.00 87.01  ? 21   DA  Z P     1 
ATOM   3288  O  OP1   . DA  L  2 7   ? -72.477  -0.108  -36.700 1.00 86.97  ? 21   DA  Z OP1   1 
ATOM   3289  O  OP2   . DA  L  2 7   ? -70.720  1.721   -37.085 1.00 86.36  ? 21   DA  Z OP2   1 
ATOM   3290  O  "O5'" . DA  L  2 7   ? -72.157  0.968   -38.960 1.00 87.28  ? 21   DA  Z "O5'" 1 
ATOM   3291  C  "C5'" . DA  L  2 7   ? -73.416  0.795   -39.613 1.00 88.72  ? 21   DA  Z "C5'" 1 
ATOM   3292  C  "C4'" . DA  L  2 7   ? -73.242  0.869   -41.113 1.00 89.66  ? 21   DA  Z "C4'" 1 
ATOM   3293  O  "O4'" . DA  L  2 7   ? -72.922  2.237   -41.474 1.00 88.67  ? 21   DA  Z "O4'" 1 
ATOM   3294  C  "C3'" . DA  L  2 7   ? -72.106  -0.010  -41.641 1.00 91.17  ? 21   DA  Z "C3'" 1 
ATOM   3295  O  "O3'" . DA  L  2 7   ? -72.508  -0.915  -42.664 1.00 94.81  ? 21   DA  Z "O3'" 1 
ATOM   3296  C  "C2'" . DA  L  2 7   ? -71.085  0.952   -42.213 1.00 89.91  ? 21   DA  Z "C2'" 1 
ATOM   3297  C  "C1'" . DA  L  2 7   ? -71.765  2.304   -42.298 1.00 88.92  ? 21   DA  Z "C1'" 1 
ATOM   3298  N  N9    . DA  L  2 7   ? -70.864  3.304   -41.726 1.00 88.21  ? 21   DA  Z N9    1 
ATOM   3299  C  C8    . DA  L  2 7   ? -70.477  3.380   -40.412 1.00 87.68  ? 21   DA  Z C8    1 
ATOM   3300  N  N7    . DA  L  2 7   ? -69.587  4.312   -40.172 1.00 87.50  ? 21   DA  Z N7    1 
ATOM   3301  C  C5    . DA  L  2 7   ? -69.382  4.905   -41.410 1.00 87.33  ? 21   DA  Z C5    1 
ATOM   3302  C  C6    . DA  L  2 7   ? -68.532  5.947   -41.833 1.00 86.94  ? 21   DA  Z C6    1 
ATOM   3303  N  N6    . DA  L  2 7   ? -67.673  6.580   -41.027 1.00 86.15  ? 21   DA  Z N6    1 
ATOM   3304  N  N1    . DA  L  2 7   ? -68.584  6.308   -43.133 1.00 86.17  ? 21   DA  Z N1    1 
ATOM   3305  C  C2    . DA  L  2 7   ? -69.415  5.644   -43.949 1.00 85.87  ? 21   DA  Z C2    1 
ATOM   3306  N  N3    . DA  L  2 7   ? -70.246  4.635   -43.676 1.00 86.32  ? 21   DA  Z N3    1 
ATOM   3307  C  C4    . DA  L  2 7   ? -70.182  4.310   -42.374 1.00 87.48  ? 21   DA  Z C4    1 
ATOM   3308  P  P     . DG  L  2 8   ? -71.512  -2.106  -43.081 1.00 97.36  ? 22   DG  Z P     1 
ATOM   3309  O  OP1   . DG  L  2 8   ? -72.329  -3.197  -43.672 1.00 96.52  ? 22   DG  Z OP1   1 
ATOM   3310  O  OP2   . DG  L  2 8   ? -70.660  -2.387  -41.895 1.00 97.18  ? 22   DG  Z OP2   1 
ATOM   3311  O  "O5'" . DG  L  2 8   ? -70.563  -1.462  -44.193 1.00 99.13  ? 22   DG  Z "O5'" 1 
ATOM   3312  C  "C5'" . DG  L  2 8   ? -71.066  -1.070  -45.475 1.00 101.89 ? 22   DG  Z "C5'" 1 
ATOM   3313  C  "C4'" . DG  L  2 8   ? -69.987  -0.374  -46.278 1.00 103.32 ? 22   DG  Z "C4'" 1 
ATOM   3314  O  "O4'" . DG  L  2 8   ? -69.736  0.926   -45.682 1.00 103.06 ? 22   DG  Z "O4'" 1 
ATOM   3315  C  "C3'" . DG  L  2 8   ? -68.640  -1.105  -46.301 1.00 104.99 ? 22   DG  Z "C3'" 1 
ATOM   3316  O  "O3'" . DG  L  2 8   ? -68.199  -1.505  -47.591 1.00 108.63 ? 22   DG  Z "O3'" 1 
ATOM   3317  C  "C2'" . DG  L  2 8   ? -67.625  -0.096  -45.797 1.00 104.15 ? 22   DG  Z "C2'" 1 
ATOM   3318  C  "C1'" . DG  L  2 8   ? -68.348  1.227   -45.700 1.00 102.85 ? 22   DG  Z "C1'" 1 
ATOM   3319  N  N9    . DG  L  2 8   ? -67.973  1.771   -44.401 1.00 102.36 ? 22   DG  Z N9    1 
ATOM   3320  C  C8    . DG  L  2 8   ? -68.387  1.319   -43.173 1.00 102.42 ? 22   DG  Z C8    1 
ATOM   3321  N  N7    . DG  L  2 8   ? -67.753  1.877   -42.178 1.00 101.51 ? 22   DG  Z N7    1 
ATOM   3322  C  C5    . DG  L  2 8   ? -66.888  2.774   -42.786 1.00 100.46 ? 22   DG  Z C5    1 
ATOM   3323  C  C6    . DG  L  2 8   ? -65.920  3.638   -42.221 1.00 99.35  ? 22   DG  Z C6    1 
ATOM   3324  O  O6    . DG  L  2 8   ? -65.597  3.758   -41.033 1.00 98.52  ? 22   DG  Z O6    1 
ATOM   3325  N  N1    . DG  L  2 8   ? -65.285  4.399   -43.198 1.00 99.11  ? 22   DG  Z N1    1 
ATOM   3326  C  C2    . DG  L  2 8   ? -65.539  4.323   -44.549 1.00 99.16  ? 22   DG  Z C2    1 
ATOM   3327  N  N2    . DG  L  2 8   ? -64.849  5.161   -45.331 1.00 98.78  ? 22   DG  Z N2    1 
ATOM   3328  N  N3    . DG  L  2 8   ? -66.412  3.493   -45.092 1.00 99.50  ? 22   DG  Z N3    1 
ATOM   3329  C  C4    . DG  L  2 8   ? -67.048  2.755   -44.158 1.00 101.09 ? 22   DG  Z C4    1 
ATOM   3330  P  P     . DG  L  2 9   ? -66.926  -2.486  -47.699 1.00 112.10 ? 23   DG  Z P     1 
ATOM   3331  O  OP1   . DG  L  2 9   ? -67.085  -3.283  -48.941 1.00 111.95 ? 23   DG  Z OP1   1 
ATOM   3332  O  OP2   . DG  L  2 9   ? -66.793  -3.187  -46.386 1.00 112.12 ? 23   DG  Z OP2   1 
ATOM   3333  O  "O5'" . DG  L  2 9   ? -65.661  -1.512  -47.827 1.00 112.20 ? 23   DG  Z "O5'" 1 
ATOM   3334  C  "C5'" . DG  L  2 9   ? -65.351  -0.836  -49.049 1.00 112.53 ? 23   DG  Z "C5'" 1 
ATOM   3335  C  "C4'" . DG  L  2 9   ? -63.980  -0.194  -48.972 1.00 112.99 ? 23   DG  Z "C4'" 1 
ATOM   3336  O  "O4'" . DG  L  2 9   ? -64.072  0.944   -48.073 1.00 112.24 ? 23   DG  Z "O4'" 1 
ATOM   3337  C  "C3'" . DG  L  2 9   ? -62.830  -1.077  -48.451 1.00 113.90 ? 23   DG  Z "C3'" 1 
ATOM   3338  O  "O3'" . DG  L  2 9   ? -61.765  -1.289  -49.393 1.00 114.77 ? 23   DG  Z "O3'" 1 
ATOM   3339  C  "C2'" . DG  L  2 9   ? -62.226  -0.291  -47.300 1.00 113.26 ? 23   DG  Z "C2'" 1 
ATOM   3340  C  "C1'" . DG  L  2 9   ? -62.876  1.081   -47.323 1.00 112.02 ? 23   DG  Z "C1'" 1 
ATOM   3341  N  N9    . DG  L  2 9   ? -63.221  1.318   -45.931 1.00 111.32 ? 23   DG  Z N9    1 
ATOM   3342  C  C8    . DG  L  2 9   ? -64.186  0.661   -45.211 1.00 111.55 ? 23   DG  Z C8    1 
ATOM   3343  N  N7    . DG  L  2 9   ? -64.090  0.864   -43.927 1.00 111.81 ? 23   DG  Z N7    1 
ATOM   3344  C  C5    . DG  L  2 9   ? -63.031  1.752   -43.799 1.00 111.27 ? 23   DG  Z C5    1 
ATOM   3345  C  C6    . DG  L  2 9   ? -62.418  2.288   -42.636 1.00 111.03 ? 23   DG  Z C6    1 
ATOM   3346  O  O6    . DG  L  2 9   ? -62.655  2.025   -41.447 1.00 110.96 ? 23   DG  Z O6    1 
ATOM   3347  N  N1    . DG  L  2 9   ? -61.407  3.189   -42.963 1.00 110.47 ? 23   DG  Z N1    1 
ATOM   3348  C  C2    . DG  L  2 9   ? -61.017  3.509   -44.244 1.00 109.80 ? 23   DG  Z C2    1 
ATOM   3349  N  N2    . DG  L  2 9   ? -60.052  4.432   -44.353 1.00 108.96 ? 23   DG  Z N2    1 
ATOM   3350  N  N3    . DG  L  2 9   ? -61.543  2.970   -45.334 1.00 109.92 ? 23   DG  Z N3    1 
ATOM   3351  C  C4    . DG  L  2 9   ? -62.539  2.106   -45.038 1.00 110.97 ? 23   DG  Z C4    1 
ATOM   3352  P  P     . DT  L  2 10  ? -60.496  -2.207  -48.973 1.00 113.70 ? 24   DT  Z P     1 
ATOM   3353  O  OP1   . DT  L  2 10  ? -60.097  -2.991  -50.172 1.00 113.50 ? 24   DT  Z OP1   1 
ATOM   3354  O  OP2   . DT  L  2 10  ? -60.811  -2.917  -47.706 1.00 112.99 ? 24   DT  Z OP2   1 
ATOM   3355  O  "O5'" . DT  L  2 10  ? -59.332  -1.175  -48.606 1.00 112.56 ? 24   DT  Z "O5'" 1 
ATOM   3356  C  "C5'" . DT  L  2 10  ? -59.085  -0.006  -49.390 1.00 111.56 ? 24   DT  Z "C5'" 1 
ATOM   3357  C  "C4'" . DT  L  2 10  ? -58.091  0.899   -48.691 1.00 111.55 ? 24   DT  Z "C4'" 1 
ATOM   3358  O  "O4'" . DT  L  2 10  ? -58.661  1.376   -47.443 1.00 111.50 ? 24   DT  Z "O4'" 1 
ATOM   3359  C  "C3'" . DT  L  2 10  ? -56.741  0.261   -48.333 1.00 112.09 ? 24   DT  Z "C3'" 1 
ATOM   3360  O  "O3'" . DT  L  2 10  ? -55.632  1.048   -48.778 1.00 113.22 ? 24   DT  Z "O3'" 1 
ATOM   3361  C  "C2'" . DT  L  2 10  ? -56.717  0.223   -46.812 1.00 111.55 ? 24   DT  Z "C2'" 1 
ATOM   3362  C  "C1'" . DT  L  2 10  ? -57.700  1.307   -46.395 1.00 110.33 ? 24   DT  Z "C1'" 1 
ATOM   3363  N  N1    . DT  L  2 10  ? -58.394  0.907   -45.161 1.00 108.64 ? 24   DT  Z N1    1 
ATOM   3364  C  C2    . DT  L  2 10  ? -58.223  1.630   -43.995 1.00 107.36 ? 24   DT  Z C2    1 
ATOM   3365  O  O2    . DT  L  2 10  ? -57.657  2.708   -43.946 1.00 106.29 ? 24   DT  Z O2    1 
ATOM   3366  N  N3    . DT  L  2 10  ? -58.766  1.041   -42.883 1.00 107.17 ? 24   DT  Z N3    1 
ATOM   3367  C  C4    . DT  L  2 10  ? -59.484  -0.138  -42.831 1.00 108.21 ? 24   DT  Z C4    1 
ATOM   3368  O  O4    . DT  L  2 10  ? -59.858  -0.579  -41.749 1.00 109.30 ? 24   DT  Z O4    1 
ATOM   3369  C  C5    . DT  L  2 10  ? -59.718  -0.773  -44.108 1.00 108.38 ? 24   DT  Z C5    1 
ATOM   3370  C  C7    . DT  L  2 10  ? -60.578  -1.994  -44.169 1.00 108.39 ? 24   DT  Z C7    1 
ATOM   3371  C  C6    . DT  L  2 10  ? -59.161  -0.231  -45.189 1.00 108.34 ? 24   DT  Z C6    1 
ATOM   3372  P  P     . DG  L  2 11  ? -54.152  0.419   -48.723 1.00 112.98 ? 25   DG  Z P     1 
ATOM   3373  O  OP1   . DG  L  2 11  ? -53.435  0.885   -49.937 1.00 113.23 ? 25   DG  Z OP1   1 
ATOM   3374  O  OP2   . DG  L  2 11  ? -54.297  -1.034  -48.470 1.00 112.83 ? 25   DG  Z OP2   1 
ATOM   3375  O  "O5'" . DG  L  2 11  ? -53.488  1.038   -47.411 1.00 114.19 ? 25   DG  Z "O5'" 1 
ATOM   3376  C  "C5'" . DG  L  2 11  ? -53.100  2.410   -47.345 1.00 115.97 ? 25   DG  Z "C5'" 1 
ATOM   3377  C  "C4'" . DG  L  2 11  ? -52.595  2.756   -45.959 1.00 117.29 ? 25   DG  Z "C4'" 1 
ATOM   3378  O  "O4'" . DG  L  2 11  ? -53.680  2.574   -45.018 1.00 117.79 ? 25   DG  Z "O4'" 1 
ATOM   3379  C  "C3'" . DG  L  2 11  ? -51.418  1.926   -45.433 1.00 117.46 ? 25   DG  Z "C3'" 1 
ATOM   3380  O  "O3'" . DG  L  2 11  ? -50.087  2.459   -45.581 1.00 115.96 ? 25   DG  Z "O3'" 1 
ATOM   3381  C  "C2'" . DG  L  2 11  ? -51.853  1.418   -44.066 1.00 117.68 ? 25   DG  Z "C2'" 1 
ATOM   3382  C  "C1'" . DG  L  2 11  ? -53.204  2.065   -43.783 1.00 118.00 ? 25   DG  Z "C1'" 1 
ATOM   3383  N  N9    . DG  L  2 11  ? -54.150  1.052   -43.327 1.00 118.63 ? 25   DG  Z N9    1 
ATOM   3384  C  C8    . DG  L  2 11  ? -54.778  0.109   -44.104 1.00 118.57 ? 25   DG  Z C8    1 
ATOM   3385  N  N7    . DG  L  2 11  ? -55.474  -0.748  -43.409 1.00 118.96 ? 25   DG  Z N7    1 
ATOM   3386  C  C5    . DG  L  2 11  ? -55.318  -0.332  -42.093 1.00 118.94 ? 25   DG  Z C5    1 
ATOM   3387  C  C6    . DG  L  2 11  ? -55.820  -0.890  -40.884 1.00 118.57 ? 25   DG  Z C6    1 
ATOM   3388  O  O6    . DG  L  2 11  ? -56.499  -1.909  -40.731 1.00 118.25 ? 25   DG  Z O6    1 
ATOM   3389  N  N1    . DG  L  2 11  ? -55.439  -0.137  -39.777 1.00 118.48 ? 25   DG  Z N1    1 
ATOM   3390  C  C2    . DG  L  2 11  ? -54.666  1.002   -39.821 1.00 118.65 ? 25   DG  Z C2    1 
ATOM   3391  N  N2    . DG  L  2 11  ? -54.428  1.607   -38.649 1.00 118.09 ? 25   DG  Z N2    1 
ATOM   3392  N  N3    . DG  L  2 11  ? -54.169  1.515   -40.937 1.00 119.04 ? 25   DG  Z N3    1 
ATOM   3393  C  C4    . DG  L  2 11  ? -54.533  0.802   -42.027 1.00 119.10 ? 25   DG  Z C4    1 
ATOM   3394  N  N     . GLY M  3 1   ? 3.790    34.037  -15.462 1.00 84.77  ? 133  GLY A N     1 
ATOM   3395  C  CA    . GLY M  3 1   ? 2.451    34.433  -14.953 1.00 85.30  ? 133  GLY A CA    1 
ATOM   3396  C  C     . GLY M  3 1   ? 1.433    34.427  -16.074 1.00 85.64  ? 133  GLY A C     1 
ATOM   3397  O  O     . GLY M  3 1   ? 1.554    35.199  -17.025 1.00 86.47  ? 133  GLY A O     1 
ATOM   3398  N  N     . SER M  3 2   ? 0.430    33.558  -15.962 1.00 85.41  ? 134  SER A N     1 
ATOM   3399  C  CA    . SER M  3 2   ? -0.615   33.431  -16.973 1.00 85.02  ? 134  SER A CA    1 
ATOM   3400  C  C     . SER M  3 2   ? -1.293   34.758  -17.316 1.00 85.29  ? 134  SER A C     1 
ATOM   3401  O  O     . SER M  3 2   ? -1.758   35.492  -16.437 1.00 84.81  ? 134  SER A O     1 
ATOM   3402  C  CB    . SER M  3 2   ? -1.656   32.409  -16.521 1.00 84.67  ? 134  SER A CB    1 
ATOM   3403  N  N     . HIS M  3 3   ? -1.339   35.040  -18.616 1.00 85.64  ? 135  HIS A N     1 
ATOM   3404  C  CA    . HIS M  3 3   ? -1.928   36.252  -19.177 1.00 85.21  ? 135  HIS A CA    1 
ATOM   3405  C  C     . HIS M  3 3   ? -2.723   35.848  -20.405 1.00 83.73  ? 135  HIS A C     1 
ATOM   3406  O  O     . HIS M  3 3   ? -2.576   34.742  -20.916 1.00 83.84  ? 135  HIS A O     1 
ATOM   3407  C  CB    . HIS M  3 3   ? -0.826   37.217  -19.606 1.00 88.34  ? 135  HIS A CB    1 
ATOM   3408  C  CG    . HIS M  3 3   ? 0.138    36.625  -20.595 1.00 92.32  ? 135  HIS A CG    1 
ATOM   3409  N  ND1   . HIS M  3 3   ? 0.440    35.277  -20.623 1.00 93.65  ? 135  HIS A ND1   1 
ATOM   3410  C  CD2   . HIS M  3 3   ? 0.912    37.202  -21.547 1.00 93.03  ? 135  HIS A CD2   1 
ATOM   3411  C  CE1   . HIS M  3 3   ? 1.358    35.051  -21.547 1.00 93.73  ? 135  HIS A CE1   1 
ATOM   3412  N  NE2   . HIS M  3 3   ? 1.662    36.202  -22.122 1.00 94.07  ? 135  HIS A NE2   1 
ATOM   3413  N  N     . MET M  3 4   ? -3.560   36.749  -20.887 1.00 82.29  ? 136  MET A N     1 
ATOM   3414  C  CA    . MET M  3 4   ? -4.352   36.461  -22.066 1.00 81.10  ? 136  MET A CA    1 
ATOM   3415  C  C     . MET M  3 4   ? -4.745   37.802  -22.653 1.00 79.92  ? 136  MET A C     1 
ATOM   3416  O  O     . MET M  3 4   ? -5.828   38.321  -22.385 1.00 79.41  ? 136  MET A O     1 
ATOM   3417  C  CB    . MET M  3 4   ? -5.586   35.634  -21.690 1.00 81.77  ? 136  MET A CB    1 
ATOM   3418  C  CG    . MET M  3 4   ? -6.340   35.040  -22.877 1.00 83.86  ? 136  MET A CG    1 
ATOM   3419  S  SD    . MET M  3 4   ? -7.650   33.874  -22.386 1.00 86.86  ? 136  MET A SD    1 
ATOM   3420  C  CE    . MET M  3 4   ? -6.969   32.307  -22.917 1.00 86.25  ? 136  MET A CE    1 
ATOM   3421  N  N     . GLY M  3 5   ? -3.827   38.368  -23.432 1.00 78.88  ? 137  GLY A N     1 
ATOM   3422  C  CA    . GLY M  3 5   ? -4.055   39.651  -24.069 1.00 77.51  ? 137  GLY A CA    1 
ATOM   3423  C  C     . GLY M  3 5   ? -4.439   40.766  -23.113 1.00 76.35  ? 137  GLY A C     1 
ATOM   3424  O  O     . GLY M  3 5   ? -5.578   41.235  -23.120 1.00 78.35  ? 137  GLY A O     1 
ATOM   3425  N  N     . ASP M  3 6   ? -3.492   41.196  -22.290 1.00 73.33  ? 138  ASP A N     1 
ATOM   3426  C  CA    . ASP M  3 6   ? -3.740   42.270  -21.336 1.00 70.63  ? 138  ASP A CA    1 
ATOM   3427  C  C     . ASP M  3 6   ? -4.691   41.836  -20.215 1.00 66.91  ? 138  ASP A C     1 
ATOM   3428  O  O     . ASP M  3 6   ? -4.983   42.612  -19.298 1.00 66.84  ? 138  ASP A O     1 
ATOM   3429  C  CB    . ASP M  3 6   ? -4.304   43.502  -22.058 1.00 73.74  ? 138  ASP A CB    1 
ATOM   3430  C  CG    . ASP M  3 6   ? -4.030   44.802  -21.304 1.00 77.40  ? 138  ASP A CG    1 
ATOM   3431  O  OD1   . ASP M  3 6   ? -4.330   44.871  -20.086 1.00 79.76  ? 138  ASP A OD1   1 
ATOM   3432  O  OD2   . ASP M  3 6   ? -3.515   45.759  -21.931 1.00 78.09  ? 138  ASP A OD2   1 
ATOM   3433  N  N     . PHE M  3 7   ? -5.180   40.603  -20.290 1.00 61.52  ? 139  PHE A N     1 
ATOM   3434  C  CA    . PHE M  3 7   ? -6.064   40.077  -19.253 1.00 55.73  ? 139  PHE A CA    1 
ATOM   3435  C  C     . PHE M  3 7   ? -5.270   39.070  -18.431 1.00 51.69  ? 139  PHE A C     1 
ATOM   3436  O  O     . PHE M  3 7   ? -5.026   37.955  -18.881 1.00 52.80  ? 139  PHE A O     1 
ATOM   3437  C  CB    . PHE M  3 7   ? -7.267   39.371  -19.867 1.00 55.18  ? 139  PHE A CB    1 
ATOM   3438  C  CG    . PHE M  3 7   ? -8.391   40.280  -20.212 1.00 54.82  ? 139  PHE A CG    1 
ATOM   3439  C  CD1   . PHE M  3 7   ? -8.240   41.261  -21.176 1.00 56.21  ? 139  PHE A CD1   1 
ATOM   3440  C  CD2   . PHE M  3 7   ? -9.618   40.147  -19.582 1.00 55.92  ? 139  PHE A CD2   1 
ATOM   3441  C  CE1   . PHE M  3 7   ? -9.308   42.105  -21.516 1.00 56.99  ? 139  PHE A CE1   1 
ATOM   3442  C  CE2   . PHE M  3 7   ? -10.691  40.983  -19.913 1.00 56.52  ? 139  PHE A CE2   1 
ATOM   3443  C  CZ    . PHE M  3 7   ? -10.533  41.964  -20.883 1.00 55.52  ? 139  PHE A CZ    1 
ATOM   3444  N  N     . VAL M  3 8   ? -4.851   39.455  -17.234 1.00 45.18  ? 140  VAL A N     1 
ATOM   3445  C  CA    . VAL M  3 8   ? -4.089   38.532  -16.407 1.00 39.36  ? 140  VAL A CA    1 
ATOM   3446  C  C     . VAL M  3 8   ? -4.992   37.423  -15.901 1.00 34.90  ? 140  VAL A C     1 
ATOM   3447  O  O     . VAL M  3 8   ? -6.044   37.685  -15.338 1.00 34.53  ? 140  VAL A O     1 
ATOM   3448  C  CB    . VAL M  3 8   ? -3.482   39.235  -15.210 1.00 38.94  ? 140  VAL A CB    1 
ATOM   3449  C  CG1   . VAL M  3 8   ? -4.575   39.899  -14.416 1.00 41.26  ? 140  VAL A CG1   1 
ATOM   3450  C  CG2   . VAL M  3 8   ? -2.724   38.232  -14.359 1.00 38.93  ? 140  VAL A CG2   1 
ATOM   3451  N  N     . VAL M  3 9   ? -4.570   36.182  -16.090 1.00 30.50  ? 141  VAL A N     1 
ATOM   3452  C  CA    . VAL M  3 9   ? -5.376   35.053  -15.664 1.00 27.31  ? 141  VAL A CA    1 
ATOM   3453  C  C     . VAL M  3 9   ? -5.240   34.710  -14.192 1.00 25.32  ? 141  VAL A C     1 
ATOM   3454  O  O     . VAL M  3 9   ? -4.217   34.978  -13.573 1.00 26.90  ? 141  VAL A O     1 
ATOM   3455  C  CB    . VAL M  3 9   ? -5.044   33.818  -16.479 1.00 26.26  ? 141  VAL A CB    1 
ATOM   3456  C  CG1   . VAL M  3 9   ? -5.735   32.612  -15.895 1.00 28.05  ? 141  VAL A CG1   1 
ATOM   3457  C  CG2   . VAL M  3 9   ? -5.502   34.018  -17.892 1.00 28.30  ? 141  VAL A CG2   1 
ATOM   3458  N  N     . VAL M  3 10  ? -6.287   34.107  -13.643 1.00 21.36  ? 142  VAL A N     1 
ATOM   3459  C  CA    . VAL M  3 10  ? -6.301   33.719  -12.252 1.00 19.03  ? 142  VAL A CA    1 
ATOM   3460  C  C     . VAL M  3 10  ? -7.391   32.700  -11.971 1.00 20.63  ? 142  VAL A C     1 
ATOM   3461  O  O     . VAL M  3 10  ? -8.501   32.816  -12.467 1.00 23.00  ? 142  VAL A O     1 
ATOM   3462  C  CB    . VAL M  3 10  ? -6.557   34.912  -11.361 1.00 15.75  ? 142  VAL A CB    1 
ATOM   3463  C  CG1   . VAL M  3 10  ? -7.881   35.513  -11.714 1.00 16.35  ? 142  VAL A CG1   1 
ATOM   3464  C  CG2   . VAL M  3 10  ? -6.553   34.482  -9.910  1.00 14.99  ? 142  VAL A CG2   1 
ATOM   3465  N  N     . TYR M  3 11  ? -7.070   31.694  -11.174 1.00 21.43  ? 143  TYR A N     1 
ATOM   3466  C  CA    . TYR M  3 11  ? -8.043   30.684  -10.811 1.00 21.20  ? 143  TYR A CA    1 
ATOM   3467  C  C     . TYR M  3 11  ? -8.387   30.878  -9.349  1.00 21.49  ? 143  TYR A C     1 
ATOM   3468  O  O     . TYR M  3 11  ? -7.544   31.280  -8.556  1.00 21.81  ? 143  TYR A O     1 
ATOM   3469  C  CB    . TYR M  3 11  ? -7.455   29.309  -11.021 1.00 20.29  ? 143  TYR A CB    1 
ATOM   3470  C  CG    . TYR M  3 11  ? -7.311   28.977  -12.472 1.00 22.56  ? 143  TYR A CG    1 
ATOM   3471  C  CD1   . TYR M  3 11  ? -8.180   28.077  -13.078 1.00 25.21  ? 143  TYR A CD1   1 
ATOM   3472  C  CD2   . TYR M  3 11  ? -6.308   29.551  -13.245 1.00 22.03  ? 143  TYR A CD2   1 
ATOM   3473  C  CE1   . TYR M  3 11  ? -8.059   27.746  -14.414 1.00 25.25  ? 143  TYR A CE1   1 
ATOM   3474  C  CE2   . TYR M  3 11  ? -6.171   29.229  -14.589 1.00 24.23  ? 143  TYR A CE2   1 
ATOM   3475  C  CZ    . TYR M  3 11  ? -7.055   28.321  -15.163 1.00 27.44  ? 143  TYR A CZ    1 
ATOM   3476  O  OH    . TYR M  3 11  ? -6.948   27.972  -16.490 1.00 33.57  ? 143  TYR A OH    1 
ATOM   3477  N  N     . THR M  3 12  ? -9.632   30.622  -8.992  1.00 21.01  ? 144  THR A N     1 
ATOM   3478  C  CA    . THR M  3 12  ? -10.024  30.758  -7.606  1.00 21.67  ? 144  THR A CA    1 
ATOM   3479  C  C     . THR M  3 12  ? -10.898  29.580  -7.310  1.00 22.32  ? 144  THR A C     1 
ATOM   3480  O  O     . THR M  3 12  ? -11.460  28.973  -8.214  1.00 24.65  ? 144  THR A O     1 
ATOM   3481  C  CB    . THR M  3 12  ? -10.869  32.021  -7.330  1.00 22.20  ? 144  THR A CB    1 
ATOM   3482  O  OG1   . THR M  3 12  ? -12.268  31.708  -7.450  1.00 18.90  ? 144  THR A OG1   1 
ATOM   3483  C  CG2   . THR M  3 12  ? -10.509  33.109  -8.306  1.00 23.12  ? 144  THR A CG2   1 
ATOM   3484  N  N     . ASP M  3 13  ? -11.013  29.263  -6.034  1.00 21.61  ? 145  ASP A N     1 
ATOM   3485  C  CA    . ASP M  3 13  ? -11.848  28.174  -5.615  1.00 21.50  ? 145  ASP A CA    1 
ATOM   3486  C  C     . ASP M  3 13  ? -12.062  28.319  -4.126  1.00 22.91  ? 145  ASP A C     1 
ATOM   3487  O  O     . ASP M  3 13  ? -11.255  28.928  -3.423  1.00 22.50  ? 145  ASP A O     1 
ATOM   3488  C  CB    . ASP M  3 13  ? -11.183  26.840  -5.935  1.00 20.62  ? 145  ASP A CB    1 
ATOM   3489  C  CG    . ASP M  3 13  ? -12.080  25.660  -5.631  1.00 20.89  ? 145  ASP A CG    1 
ATOM   3490  O  OD1   . ASP M  3 13  ? -11.584  24.516  -5.685  1.00 20.47  ? 145  ASP A OD1   1 
ATOM   3491  O  OD2   . ASP M  3 13  ? -13.279  25.876  -5.341  1.00 19.55  ? 145  ASP A OD2   1 
ATOM   3492  N  N     . GLY M  3 14  ? -13.177  27.782  -3.657  1.00 24.15  ? 146  GLY A N     1 
ATOM   3493  C  CA    . GLY M  3 14  ? -13.486  27.839  -2.249  1.00 25.77  ? 146  GLY A CA    1 
ATOM   3494  C  C     . GLY M  3 14  ? -13.834  26.424  -1.862  1.00 27.24  ? 146  GLY A C     1 
ATOM   3495  O  O     . GLY M  3 14  ? -14.167  25.604  -2.720  1.00 27.10  ? 146  GLY A O     1 
ATOM   3496  N  N     . CYS M  3 15  ? -13.745  26.120  -0.578  1.00 27.97  ? 147  CYS A N     1 
ATOM   3497  C  CA    . CYS M  3 15  ? -14.075  24.789  -0.137  1.00 29.29  ? 147  CYS A CA    1 
ATOM   3498  C  C     . CYS M  3 15  ? -14.596  24.905  1.260   1.00 28.84  ? 147  CYS A C     1 
ATOM   3499  O  O     . CYS M  3 15  ? -14.244  25.834  1.992   1.00 28.23  ? 147  CYS A O     1 
ATOM   3500  C  CB    . CYS M  3 15  ? -12.840  23.893  -0.133  1.00 31.86  ? 147  CYS A CB    1 
ATOM   3501  S  SG    . CYS M  3 15  ? -11.866  24.000  1.392   1.00 36.94  ? 147  CYS A SG    1 
ATOM   3502  N  N     . CYS M  3 16  ? -15.433  23.950  1.633   1.00 28.75  ? 148  CYS A N     1 
ATOM   3503  C  CA    . CYS M  3 16  ? -15.992  23.949  2.959   1.00 29.55  ? 148  CYS A CA    1 
ATOM   3504  C  C     . CYS M  3 16  ? -16.253  22.556  3.446   1.00 30.75  ? 148  CYS A C     1 
ATOM   3505  O  O     . CYS M  3 16  ? -17.353  22.052  3.289   1.00 31.55  ? 148  CYS A O     1 
ATOM   3506  C  CB    . CYS M  3 16  ? -17.295  24.718  3.003   1.00 27.79  ? 148  CYS A CB    1 
ATOM   3507  S  SG    . CYS M  3 16  ? -18.030  24.559  4.611   1.00 28.74  ? 148  CYS A SG    1 
ATOM   3508  N  N     . SER M  3 17  ? -15.234  21.944  4.041   1.00 33.46  ? 149  SER A N     1 
ATOM   3509  C  CA    . SER M  3 17  ? -15.320  20.594  4.588   1.00 33.16  ? 149  SER A CA    1 
ATOM   3510  C  C     . SER M  3 17  ? -16.506  20.520  5.527   1.00 33.55  ? 149  SER A C     1 
ATOM   3511  O  O     . SER M  3 17  ? -16.766  21.470  6.277   1.00 32.39  ? 149  SER A O     1 
ATOM   3512  C  CB    . SER M  3 17  ? -14.040  20.261  5.353   1.00 33.44  ? 149  SER A CB    1 
ATOM   3513  O  OG    . SER M  3 17  ? -13.734  21.271  6.302   1.00 31.56  ? 149  SER A OG    1 
ATOM   3514  N  N     . SER M  3 18  ? -17.218  19.396  5.480   1.00 33.68  ? 150  SER A N     1 
ATOM   3515  C  CA    . SER M  3 18  ? -18.394  19.205  6.317   1.00 35.94  ? 150  SER A CA    1 
ATOM   3516  C  C     . SER M  3 18  ? -19.380  20.338  6.078   1.00 36.86  ? 150  SER A C     1 
ATOM   3517  O  O     . SER M  3 18  ? -19.768  21.058  6.997   1.00 37.05  ? 150  SER A O     1 
ATOM   3518  C  CB    . SER M  3 18  ? -18.004  19.165  7.790   1.00 37.56  ? 150  SER A CB    1 
ATOM   3519  O  OG    . SER M  3 18  ? -17.077  18.120  8.030   1.00 44.17  ? 150  SER A OG    1 
ATOM   3520  N  N     . ASN M  3 19  ? -19.763  20.489  4.819   1.00 37.46  ? 151  ASN A N     1 
ATOM   3521  C  CA    . ASN M  3 19  ? -20.704  21.504  4.403   1.00 38.65  ? 151  ASN A CA    1 
ATOM   3522  C  C     . ASN M  3 19  ? -22.073  20.888  4.600   1.00 39.82  ? 151  ASN A C     1 
ATOM   3523  O  O     . ASN M  3 19  ? -22.389  19.861  4.000   1.00 40.39  ? 151  ASN A O     1 
ATOM   3524  C  CB    . ASN M  3 19  ? -20.474  21.832  2.930   1.00 39.63  ? 151  ASN A CB    1 
ATOM   3525  C  CG    . ASN M  3 19  ? -21.235  23.059  2.473   1.00 41.70  ? 151  ASN A CG    1 
ATOM   3526  O  OD1   . ASN M  3 19  ? -21.392  24.026  3.230   1.00 43.22  ? 151  ASN A OD1   1 
ATOM   3527  N  ND2   . ASN M  3 19  ? -21.693  23.041  1.220   1.00 40.88  ? 151  ASN A ND2   1 
ATOM   3528  N  N     . GLY M  3 20  ? -22.879  21.510  5.455   1.00 41.22  ? 152  GLY A N     1 
ATOM   3529  C  CA    . GLY M  3 20  ? -24.211  21.002  5.724   1.00 40.79  ? 152  GLY A CA    1 
ATOM   3530  C  C     . GLY M  3 20  ? -24.169  20.033  6.885   1.00 40.76  ? 152  GLY A C     1 
ATOM   3531  O  O     . GLY M  3 20  ? -25.143  19.324  7.162   1.00 39.73  ? 152  GLY A O     1 
ATOM   3532  N  N     . ARG M  3 21  ? -23.024  19.998  7.559   1.00 40.93  ? 153  ARG A N     1 
ATOM   3533  C  CA    . ARG M  3 21  ? -22.837  19.124  8.710   1.00 42.65  ? 153  ARG A CA    1 
ATOM   3534  C  C     . ARG M  3 21  ? -22.456  19.921  9.945   1.00 43.13  ? 153  ARG A C     1 
ATOM   3535  O  O     . ARG M  3 21  ? -22.073  21.089  9.847   1.00 44.67  ? 153  ARG A O     1 
ATOM   3536  C  CB    . ARG M  3 21  ? -21.776  18.068  8.401   1.00 42.91  ? 153  ARG A CB    1 
ATOM   3537  C  CG    . ARG M  3 21  ? -22.329  16.928  7.587   1.00 42.88  ? 153  ARG A CG    1 
ATOM   3538  C  CD    . ARG M  3 21  ? -21.263  16.185  6.841   1.00 43.13  ? 153  ARG A CD    1 
ATOM   3539  N  NE    . ARG M  3 21  ? -21.780  14.893  6.428   1.00 44.63  ? 153  ARG A NE    1 
ATOM   3540  C  CZ    . ARG M  3 21  ? -22.121  13.933  7.281   1.00 45.33  ? 153  ARG A CZ    1 
ATOM   3541  N  NH1   . ARG M  3 21  ? -21.984  14.130  8.590   1.00 44.49  ? 153  ARG A NH1   1 
ATOM   3542  N  NH2   . ARG M  3 21  ? -22.615  12.786  6.826   1.00 46.19  ? 153  ARG A NH2   1 
ATOM   3543  N  N     . ARG M  3 22  ? -22.560  19.287  11.104  1.00 42.64  ? 154  ARG A N     1 
ATOM   3544  C  CA    . ARG M  3 22  ? -22.260  19.954  12.353  1.00 43.16  ? 154  ARG A CA    1 
ATOM   3545  C  C     . ARG M  3 22  ? -21.271  21.095  12.316  1.00 41.74  ? 154  ARG A C     1 
ATOM   3546  O  O     . ARG M  3 22  ? -21.678  22.255  12.391  1.00 41.93  ? 154  ARG A O     1 
ATOM   3547  C  CB    . ARG M  3 22  ? -21.831  18.940  13.390  1.00 47.05  ? 154  ARG A CB    1 
ATOM   3548  C  CG    . ARG M  3 22  ? -23.013  18.187  13.901  1.00 53.34  ? 154  ARG A CG    1 
ATOM   3549  C  CD    . ARG M  3 22  ? -22.694  17.374  15.110  1.00 58.51  ? 154  ARG A CD    1 
ATOM   3550  N  NE    . ARG M  3 22  ? -23.944  16.962  15.733  1.00 64.86  ? 154  ARG A NE    1 
ATOM   3551  C  CZ    . ARG M  3 22  ? -24.026  16.216  16.827  1.00 67.53  ? 154  ARG A CZ    1 
ATOM   3552  N  NH1   . ARG M  3 22  ? -22.915  15.790  17.426  1.00 68.01  ? 154  ARG A NH1   1 
ATOM   3553  N  NH2   . ARG M  3 22  ? -25.224  15.914  17.322  1.00 68.03  ? 154  ARG A NH2   1 
ATOM   3554  N  N     . ARG M  3 23  ? -19.982  20.790  12.200  1.00 39.30  ? 155  ARG A N     1 
ATOM   3555  C  CA    . ARG M  3 23  ? -18.982  21.857  12.191  1.00 37.63  ? 155  ARG A CA    1 
ATOM   3556  C  C     . ARG M  3 23  ? -18.324  22.104  10.834  1.00 35.69  ? 155  ARG A C     1 
ATOM   3557  O  O     . ARG M  3 23  ? -17.389  21.413  10.442  1.00 36.72  ? 155  ARG A O     1 
ATOM   3558  C  CB    . ARG M  3 23  ? -17.923  21.581  13.255  1.00 36.52  ? 155  ARG A CB    1 
ATOM   3559  N  N     . PRO M  3 24  ? -18.811  23.105  10.099  1.00 33.75  ? 156  PRO A N     1 
ATOM   3560  C  CA    . PRO M  3 24  ? -18.268  23.443  8.783   1.00 33.06  ? 156  PRO A CA    1 
ATOM   3561  C  C     . PRO M  3 24  ? -16.963  24.227  8.863   1.00 32.24  ? 156  PRO A C     1 
ATOM   3562  O  O     . PRO M  3 24  ? -16.885  25.241  9.546   1.00 33.79  ? 156  PRO A O     1 
ATOM   3563  C  CB    . PRO M  3 24  ? -19.382  24.271  8.158   1.00 33.09  ? 156  PRO A CB    1 
ATOM   3564  C  CG    . PRO M  3 24  ? -20.600  23.831  8.905   1.00 33.21  ? 156  PRO A CG    1 
ATOM   3565  C  CD    . PRO M  3 24  ? -20.103  23.766  10.299  1.00 32.62  ? 156  PRO A CD    1 
ATOM   3566  N  N     . ARG M  3 25  ? -15.948  23.752  8.154   1.00 30.50  ? 157  ARG A N     1 
ATOM   3567  C  CA    . ARG M  3 25  ? -14.642  24.399  8.118   1.00 28.92  ? 157  ARG A CA    1 
ATOM   3568  C  C     . ARG M  3 25  ? -14.512  24.838  6.656   1.00 27.76  ? 157  ARG A C     1 
ATOM   3569  O  O     . ARG M  3 25  ? -14.528  23.995  5.770   1.00 27.67  ? 157  ARG A O     1 
ATOM   3570  C  CB    . ARG M  3 25  ? -13.568  23.362  8.459   1.00 31.01  ? 157  ARG A CB    1 
ATOM   3571  C  CG    . ARG M  3 25  ? -12.418  23.850  9.312   1.00 32.79  ? 157  ARG A CG    1 
ATOM   3572  C  CD    . ARG M  3 25  ? -12.780  23.998  10.787  1.00 35.32  ? 157  ARG A CD    1 
ATOM   3573  N  NE    . ARG M  3 25  ? -11.964  25.054  11.383  1.00 39.84  ? 157  ARG A NE    1 
ATOM   3574  C  CZ    . ARG M  3 25  ? -10.633  25.074  11.352  1.00 41.54  ? 157  ARG A CZ    1 
ATOM   3575  N  NH1   . ARG M  3 25  ? -9.975   24.083  10.763  1.00 44.10  ? 157  ARG A NH1   1 
ATOM   3576  N  NH2   . ARG M  3 25  ? -9.956   26.095  11.874  1.00 41.64  ? 157  ARG A NH2   1 
ATOM   3577  N  N     . ALA M  3 26  ? -14.390  26.133  6.380   1.00 26.19  ? 158  ALA A N     1 
ATOM   3578  C  CA    . ALA M  3 26  ? -14.311  26.555  4.978   1.00 25.95  ? 158  ALA A CA    1 
ATOM   3579  C  C     . ALA M  3 26  ? -13.242  27.581  4.634   1.00 26.30  ? 158  ALA A C     1 
ATOM   3580  O  O     . ALA M  3 26  ? -13.054  28.576  5.340   1.00 27.73  ? 158  ALA A O     1 
ATOM   3581  C  CB    . ALA M  3 26  ? -15.652  27.075  4.533   1.00 26.52  ? 158  ALA A CB    1 
ATOM   3582  N  N     . GLY M  3 27  ? -12.567  27.357  3.515   1.00 24.94  ? 159  GLY A N     1 
ATOM   3583  C  CA    . GLY M  3 27  ? -11.516  28.271  3.122   1.00 23.76  ? 159  GLY A CA    1 
ATOM   3584  C  C     . GLY M  3 27  ? -11.521  28.705  1.675   1.00 23.05  ? 159  GLY A C     1 
ATOM   3585  O  O     . GLY M  3 27  ? -12.134  28.074  0.812   1.00 23.50  ? 159  GLY A O     1 
ATOM   3586  N  N     . ILE M  3 28  ? -10.808  29.792  1.420   1.00 21.50  ? 160  ILE A N     1 
ATOM   3587  C  CA    . ILE M  3 28  ? -10.711  30.365  0.095   1.00 22.21  ? 160  ILE A CA    1 
ATOM   3588  C  C     . ILE M  3 28  ? -9.343   30.064  -0.513  1.00 22.77  ? 160  ILE A C     1 
ATOM   3589  O  O     . ILE M  3 28  ? -8.358   29.897  0.199   1.00 23.33  ? 160  ILE A O     1 
ATOM   3590  C  CB    . ILE M  3 28  ? -10.938  31.889  0.176   1.00 22.50  ? 160  ILE A CB    1 
ATOM   3591  C  CG1   . ILE M  3 28  ? -9.682   32.604  0.680   1.00 23.44  ? 160  ILE A CG1   1 
ATOM   3592  C  CG2   . ILE M  3 28  ? -12.034  32.175  1.191   1.00 23.95  ? 160  ILE A CG2   1 
ATOM   3593  C  CD1   . ILE M  3 28  ? -9.881   34.096  0.982   1.00 19.46  ? 160  ILE A CD1   1 
ATOM   3594  N  N     . GLY M  3 29  ? -9.288   29.982  -1.836  1.00 23.33  ? 161  GLY A N     1 
ATOM   3595  C  CA    . GLY M  3 29  ? -8.031   29.709  -2.506  1.00 21.98  ? 161  GLY A CA    1 
ATOM   3596  C  C     . GLY M  3 29  ? -7.949   30.467  -3.814  1.00 21.51  ? 161  GLY A C     1 
ATOM   3597  O  O     . GLY M  3 29  ? -8.925   30.534  -4.552  1.00 22.92  ? 161  GLY A O     1 
ATOM   3598  N  N     . VAL M  3 30  ? -6.798   31.057  -4.103  1.00 20.38  ? 162  VAL A N     1 
ATOM   3599  C  CA    . VAL M  3 30  ? -6.628   31.797  -5.349  1.00 19.93  ? 162  VAL A CA    1 
ATOM   3600  C  C     . VAL M  3 30  ? -5.192   31.652  -5.864  1.00 19.53  ? 162  VAL A C     1 
ATOM   3601  O  O     . VAL M  3 30  ? -4.225   32.057  -5.218  1.00 17.07  ? 162  VAL A O     1 
ATOM   3602  C  CB    . VAL M  3 30  ? -7.057   33.294  -5.171  1.00 18.29  ? 162  VAL A CB    1 
ATOM   3603  C  CG1   . VAL M  3 30  ? -6.759   33.740  -3.764  1.00 20.94  ? 162  VAL A CG1   1 
ATOM   3604  C  CG2   . VAL M  3 30  ? -6.357   34.203  -6.188  1.00 16.49  ? 162  VAL A CG2   1 
ATOM   3605  N  N     . TYR M  3 31  ? -5.084   31.042  -7.040  1.00 20.61  ? 163  TYR A N     1 
ATOM   3606  C  CA    . TYR M  3 31  ? -3.809   30.770  -7.685  1.00 23.07  ? 163  TYR A CA    1 
ATOM   3607  C  C     . TYR M  3 31  ? -3.560   31.672  -8.888  1.00 24.70  ? 163  TYR A C     1 
ATOM   3608  O  O     . TYR M  3 31  ? -4.394   31.764  -9.782  1.00 24.31  ? 163  TYR A O     1 
ATOM   3609  C  CB    . TYR M  3 31  ? -3.790   29.304  -8.103  1.00 22.77  ? 163  TYR A CB    1 
ATOM   3610  C  CG    . TYR M  3 31  ? -2.568   28.837  -8.848  1.00 23.14  ? 163  TYR A CG    1 
ATOM   3611  C  CD1   . TYR M  3 31  ? -2.314   29.264  -10.140 1.00 21.99  ? 163  TYR A CD1   1 
ATOM   3612  C  CD2   . TYR M  3 31  ? -1.721   27.876  -8.294  1.00 25.48  ? 163  TYR A CD2   1 
ATOM   3613  C  CE1   . TYR M  3 31  ? -1.263   28.739  -10.870 1.00 23.80  ? 163  TYR A CE1   1 
ATOM   3614  C  CE2   . TYR M  3 31  ? -0.656   27.340  -9.022  1.00 25.02  ? 163  TYR A CE2   1 
ATOM   3615  C  CZ    . TYR M  3 31  ? -0.441   27.776  -10.311 1.00 24.10  ? 163  TYR A CZ    1 
ATOM   3616  O  OH    . TYR M  3 31  ? 0.577    27.238  -11.050 1.00 22.83  ? 163  TYR A OH    1 
ATOM   3617  N  N     . TRP M  3 32  ? -2.400   32.328  -8.896  1.00 26.60  ? 164  TRP A N     1 
ATOM   3618  C  CA    . TRP M  3 32  ? -2.022   33.230  -9.972  1.00 27.65  ? 164  TRP A CA    1 
ATOM   3619  C  C     . TRP M  3 32  ? -0.940   32.610  -10.837 1.00 29.00  ? 164  TRP A C     1 
ATOM   3620  O  O     . TRP M  3 32  ? -0.696   33.071  -11.952 1.00 31.52  ? 164  TRP A O     1 
ATOM   3621  C  CB    . TRP M  3 32  ? -1.486   34.550  -9.423  1.00 27.58  ? 164  TRP A CB    1 
ATOM   3622  C  CG    . TRP M  3 32  ? -2.435   35.311  -8.569  1.00 29.46  ? 164  TRP A CG    1 
ATOM   3623  C  CD1   . TRP M  3 32  ? -2.714   35.088  -7.253  1.00 30.55  ? 164  TRP A CD1   1 
ATOM   3624  C  CD2   . TRP M  3 32  ? -3.224   36.440  -8.960  1.00 29.40  ? 164  TRP A CD2   1 
ATOM   3625  N  NE1   . TRP M  3 32  ? -3.626   36.012  -6.797  1.00 29.90  ? 164  TRP A NE1   1 
ATOM   3626  C  CE2   . TRP M  3 32  ? -3.956   36.852  -7.828  1.00 29.79  ? 164  TRP A CE2   1 
ATOM   3627  C  CE3   . TRP M  3 32  ? -3.384   37.144  -10.159 1.00 29.92  ? 164  TRP A CE3   1 
ATOM   3628  C  CZ2   . TRP M  3 32  ? -4.833   37.940  -7.859  1.00 30.84  ? 164  TRP A CZ2   1 
ATOM   3629  C  CZ3   . TRP M  3 32  ? -4.259   38.227  -10.191 1.00 29.13  ? 164  TRP A CZ3   1 
ATOM   3630  C  CH2   . TRP M  3 32  ? -4.969   38.614  -9.050  1.00 30.51  ? 164  TRP A CH2   1 
ATOM   3631  N  N     . GLY M  3 33  ? -0.280   31.576  -10.325 1.00 27.50  ? 165  GLY A N     1 
ATOM   3632  C  CA    . GLY M  3 33  ? 0.781    30.948  -11.089 1.00 25.73  ? 165  GLY A CA    1 
ATOM   3633  C  C     . GLY M  3 33  ? 1.665    30.100  -10.196 1.00 24.96  ? 165  GLY A C     1 
ATOM   3634  O  O     . GLY M  3 33  ? 1.460    30.057  -8.984  1.00 25.55  ? 165  GLY A O     1 
ATOM   3635  N  N     . PRO M  3 34  ? 2.672    29.422  -10.762 1.00 22.63  ? 166  PRO A N     1 
ATOM   3636  C  CA    . PRO M  3 34  ? 3.559    28.584  -9.966  1.00 21.69  ? 166  PRO A CA    1 
ATOM   3637  C  C     . PRO M  3 34  ? 4.418    29.385  -8.997  1.00 21.65  ? 166  PRO A C     1 
ATOM   3638  O  O     . PRO M  3 34  ? 5.121    30.307  -9.399  1.00 19.46  ? 166  PRO A O     1 
ATOM   3639  C  CB    . PRO M  3 34  ? 4.404    27.884  -11.023 1.00 21.62  ? 166  PRO A CB    1 
ATOM   3640  C  CG    . PRO M  3 34  ? 3.575    27.946  -12.249 1.00 20.66  ? 166  PRO A CG    1 
ATOM   3641  C  CD    . PRO M  3 34  ? 3.027    29.326  -12.182 1.00 21.76  ? 166  PRO A CD    1 
ATOM   3642  N  N     . GLY M  3 35  ? 4.356    29.016  -7.720  1.00 22.68  ? 167  GLY A N     1 
ATOM   3643  C  CA    . GLY M  3 35  ? 5.144    29.694  -6.705  1.00 22.55  ? 167  GLY A CA    1 
ATOM   3644  C  C     . GLY M  3 35  ? 4.973    31.193  -6.759  1.00 22.19  ? 167  GLY A C     1 
ATOM   3645  O  O     . GLY M  3 35  ? 5.839    31.957  -6.321  1.00 19.80  ? 167  GLY A O     1 
ATOM   3646  N  N     . HIS M  3 36  ? 3.835    31.609  -7.299  1.00 23.12  ? 168  HIS A N     1 
ATOM   3647  C  CA    . HIS M  3 36  ? 3.533    33.024  -7.428  1.00 24.32  ? 168  HIS A CA    1 
ATOM   3648  C  C     . HIS M  3 36  ? 3.234    33.688  -6.070  1.00 22.59  ? 168  HIS A C     1 
ATOM   3649  O  O     . HIS M  3 36  ? 2.437    33.186  -5.266  1.00 23.78  ? 168  HIS A O     1 
ATOM   3650  C  CB    . HIS M  3 36  ? 2.376    33.205  -8.395  1.00 26.16  ? 168  HIS A CB    1 
ATOM   3651  C  CG    . HIS M  3 36  ? 2.082    34.633  -8.692  1.00 29.73  ? 168  HIS A CG    1 
ATOM   3652  N  ND1   . HIS M  3 36  ? 1.558    35.492  -7.753  1.00 31.56  ? 168  HIS A ND1   1 
ATOM   3653  C  CD2   . HIS M  3 36  ? 2.270    35.365  -9.814  1.00 31.95  ? 168  HIS A CD2   1 
ATOM   3654  C  CE1   . HIS M  3 36  ? 1.430    36.693  -8.286  1.00 33.32  ? 168  HIS A CE1   1 
ATOM   3655  N  NE2   . HIS M  3 36  ? 1.855    36.643  -9.536  1.00 32.97  ? 168  HIS A NE2   1 
ATOM   3656  N  N     . PRO M  3 37  ? 3.862    34.841  -5.813  1.00 19.32  ? 169  PRO A N     1 
ATOM   3657  C  CA    . PRO M  3 37  ? 3.740    35.628  -4.587  1.00 19.32  ? 169  PRO A CA    1 
ATOM   3658  C  C     . PRO M  3 37  ? 2.364    36.144  -4.199  1.00 20.58  ? 169  PRO A C     1 
ATOM   3659  O  O     . PRO M  3 37  ? 2.203    36.778  -3.156  1.00 21.08  ? 169  PRO A O     1 
ATOM   3660  C  CB    . PRO M  3 37  ? 4.735    36.748  -4.816  1.00 17.80  ? 169  PRO A CB    1 
ATOM   3661  C  CG    . PRO M  3 37  ? 4.592    36.980  -6.255  1.00 18.92  ? 169  PRO A CG    1 
ATOM   3662  C  CD    . PRO M  3 37  ? 4.598    35.598  -6.832  1.00 18.10  ? 169  PRO A CD    1 
ATOM   3663  N  N     . LEU M  3 38  ? 1.361    35.874  -5.013  1.00 21.96  ? 170  LEU A N     1 
ATOM   3664  C  CA    . LEU M  3 38  ? 0.033    36.351  -4.673  1.00 24.04  ? 170  LEU A CA    1 
ATOM   3665  C  C     . LEU M  3 38  ? -0.894   35.208  -4.308  1.00 26.55  ? 170  LEU A C     1 
ATOM   3666  O  O     . LEU M  3 38  ? -2.030   35.439  -3.884  1.00 27.05  ? 170  LEU A O     1 
ATOM   3667  C  CB    . LEU M  3 38  ? -0.548   37.150  -5.835  1.00 22.27  ? 170  LEU A CB    1 
ATOM   3668  C  CG    . LEU M  3 38  ? -0.932   38.591  -5.513  1.00 21.69  ? 170  LEU A CG    1 
ATOM   3669  C  CD1   . LEU M  3 38  ? -0.305   39.020  -4.194  1.00 21.65  ? 170  LEU A CD1   1 
ATOM   3670  C  CD2   . LEU M  3 38  ? -0.498   39.487  -6.663  1.00 18.80  ? 170  LEU A CD2   1 
ATOM   3671  N  N     . ASN M  3 39  ? -0.398   33.981  -4.473  1.00 26.90  ? 171  ASN A N     1 
ATOM   3672  C  CA    . ASN M  3 39  ? -1.162   32.776  -4.170  1.00 26.69  ? 171  ASN A CA    1 
ATOM   3673  C  C     . ASN M  3 39  ? -1.598   32.674  -2.724  1.00 26.56  ? 171  ASN A C     1 
ATOM   3674  O  O     . ASN M  3 39  ? -0.817   32.322  -1.853  1.00 25.74  ? 171  ASN A O     1 
ATOM   3675  C  CB    . ASN M  3 39  ? -0.350   31.547  -4.534  1.00 26.83  ? 171  ASN A CB    1 
ATOM   3676  C  CG    . ASN M  3 39  ? -0.305   31.329  -6.006  1.00 27.85  ? 171  ASN A CG    1 
ATOM   3677  O  OD1   . ASN M  3 39  ? -0.747   32.187  -6.776  1.00 29.22  ? 171  ASN A OD1   1 
ATOM   3678  N  ND2   . ASN M  3 39  ? 0.229    30.191  -6.425  1.00 27.21  ? 171  ASN A ND2   1 
ATOM   3679  N  N     . VAL M  3 40  ? -2.871   32.939  -2.485  1.00 26.48  ? 172  VAL A N     1 
ATOM   3680  C  CA    . VAL M  3 40  ? -3.388   32.897  -1.148  1.00 27.47  ? 172  VAL A CA    1 
ATOM   3681  C  C     . VAL M  3 40  ? -4.212   31.679  -0.814  1.00 27.57  ? 172  VAL A C     1 
ATOM   3682  O  O     . VAL M  3 40  ? -4.848   31.082  -1.680  1.00 26.88  ? 172  VAL A O     1 
ATOM   3683  C  CB    . VAL M  3 40  ? -4.272   34.078  -0.889  1.00 29.96  ? 172  VAL A CB    1 
ATOM   3684  C  CG1   . VAL M  3 40  ? -4.340   34.320  0.594   1.00 34.76  ? 172  VAL A CG1   1 
ATOM   3685  C  CG2   . VAL M  3 40  ? -3.750   35.288  -1.618  1.00 33.43  ? 172  VAL A CG2   1 
ATOM   3686  N  N     . GLY M  3 41  ? -4.207   31.346  0.475   1.00 28.17  ? 173  GLY A N     1 
ATOM   3687  C  CA    . GLY M  3 41  ? -4.978   30.230  0.997   1.00 26.70  ? 173  GLY A CA    1 
ATOM   3688  C  C     . GLY M  3 41  ? -5.547   30.659  2.344   1.00 25.55  ? 173  GLY A C     1 
ATOM   3689  O  O     . GLY M  3 41  ? -5.126   30.173  3.386   1.00 27.24  ? 173  GLY A O     1 
ATOM   3690  N  N     . ILE M  3 42  ? -6.509   31.571  2.329   1.00 22.52  ? 174  ILE A N     1 
ATOM   3691  C  CA    . ILE M  3 42  ? -7.104   32.078  3.557   1.00 20.75  ? 174  ILE A CA    1 
ATOM   3692  C  C     . ILE M  3 42  ? -8.305   31.317  4.074   1.00 19.82  ? 174  ILE A C     1 
ATOM   3693  O  O     . ILE M  3 42  ? -8.967   30.618  3.329   1.00 19.97  ? 174  ILE A O     1 
ATOM   3694  C  CB    . ILE M  3 42  ? -7.592   33.468  3.343   1.00 20.35  ? 174  ILE A CB    1 
ATOM   3695  C  CG1   . ILE M  3 42  ? -6.484   34.288  2.724   1.00 19.30  ? 174  ILE A CG1   1 
ATOM   3696  C  CG2   . ILE M  3 42  ? -8.086   34.056  4.652   1.00 22.10  ? 174  ILE A CG2   1 
ATOM   3697  C  CD1   . ILE M  3 42  ? -6.980   35.610  2.229   1.00 23.54  ? 174  ILE A CD1   1 
ATOM   3698  N  N     . ARG M  3 43  ? -8.601   31.471  5.357   1.00 20.00  ? 175  ARG A N     1 
ATOM   3699  C  CA    . ARG M  3 43  ? -9.786   30.831  5.908   1.00 21.05  ? 175  ARG A CA    1 
ATOM   3700  C  C     . ARG M  3 43  ? -10.914  31.851  5.806   1.00 21.38  ? 175  ARG A C     1 
ATOM   3701  O  O     . ARG M  3 43  ? -10.688  33.050  5.990   1.00 21.16  ? 175  ARG A O     1 
ATOM   3702  C  CB    . ARG M  3 43  ? -9.617   30.419  7.369   1.00 21.09  ? 175  ARG A CB    1 
ATOM   3703  C  CG    . ARG M  3 43  ? -10.896  29.839  7.889   1.00 22.13  ? 175  ARG A CG    1 
ATOM   3704  C  CD    . ARG M  3 43  ? -10.796  29.123  9.197   1.00 24.46  ? 175  ARG A CD    1 
ATOM   3705  N  NE    . ARG M  3 43  ? -12.119  28.585  9.498   1.00 28.09  ? 175  ARG A NE    1 
ATOM   3706  C  CZ    . ARG M  3 43  ? -12.467  28.014  10.645  1.00 29.78  ? 175  ARG A CZ    1 
ATOM   3707  N  NH1   . ARG M  3 43  ? -11.582  27.890  11.627  1.00 30.41  ? 175  ARG A NH1   1 
ATOM   3708  N  NH2   . ARG M  3 43  ? -13.715  27.592  10.815  1.00 30.08  ? 175  ARG A NH2   1 
ATOM   3709  N  N     . LEU M  3 44  ? -12.123  31.369  5.520   1.00 20.12  ? 176  LEU A N     1 
ATOM   3710  C  CA    . LEU M  3 44  ? -13.279  32.236  5.358   1.00 18.80  ? 176  LEU A CA    1 
ATOM   3711  C  C     . LEU M  3 44  ? -13.985  32.623  6.651   1.00 19.73  ? 176  LEU A C     1 
ATOM   3712  O  O     . LEU M  3 44  ? -14.490  31.761  7.368   1.00 19.42  ? 176  LEU A O     1 
ATOM   3713  C  CB    . LEU M  3 44  ? -14.278  31.570  4.423   1.00 18.49  ? 176  LEU A CB    1 
ATOM   3714  C  CG    . LEU M  3 44  ? -15.529  32.379  4.075   1.00 17.57  ? 176  LEU A CG    1 
ATOM   3715  C  CD1   . LEU M  3 44  ? -15.193  33.529  3.151   1.00 12.70  ? 176  LEU A CD1   1 
ATOM   3716  C  CD2   . LEU M  3 44  ? -16.531  31.443  3.418   1.00 18.31  ? 176  LEU A CD2   1 
ATOM   3717  N  N     . PRO M  3 45  ? -14.045  33.935  6.955   1.00 21.21  ? 177  PRO A N     1 
ATOM   3718  C  CA    . PRO M  3 45  ? -14.687  34.489  8.152   1.00 21.54  ? 177  PRO A CA    1 
ATOM   3719  C  C     . PRO M  3 45  ? -16.196  34.270  8.199   1.00 24.03  ? 177  PRO A C     1 
ATOM   3720  O  O     . PRO M  3 45  ? -16.831  34.087  7.162   1.00 25.37  ? 177  PRO A O     1 
ATOM   3721  C  CB    . PRO M  3 45  ? -14.338  35.967  8.069   1.00 20.41  ? 177  PRO A CB    1 
ATOM   3722  C  CG    . PRO M  3 45  ? -14.272  36.209  6.616   1.00 18.90  ? 177  PRO A CG    1 
ATOM   3723  C  CD    . PRO M  3 45  ? -13.459  35.025  6.160   1.00 19.69  ? 177  PRO A CD    1 
ATOM   3724  N  N     . GLY M  3 46  ? -16.758  34.282  9.406   1.00 25.24  ? 178  GLY A N     1 
ATOM   3725  C  CA    . GLY M  3 46  ? -18.192  34.104  9.571   1.00 26.56  ? 178  GLY A CA    1 
ATOM   3726  C  C     . GLY M  3 46  ? -18.789  32.762  9.181   1.00 28.06  ? 178  GLY A C     1 
ATOM   3727  O  O     . GLY M  3 46  ? -18.226  31.706  9.500   1.00 26.64  ? 178  GLY A O     1 
ATOM   3728  N  N     . ARG M  3 47  ? -19.942  32.823  8.500   1.00 29.68  ? 179  ARG A N     1 
ATOM   3729  C  CA    . ARG M  3 47  ? -20.696  31.642  8.031   1.00 30.82  ? 179  ARG A CA    1 
ATOM   3730  C  C     . ARG M  3 47  ? -19.850  30.657  7.262   1.00 30.90  ? 179  ARG A C     1 
ATOM   3731  O  O     . ARG M  3 47  ? -19.111  31.056  6.362   1.00 33.54  ? 179  ARG A O     1 
ATOM   3732  C  CB    . ARG M  3 47  ? -21.826  32.061  7.104   1.00 30.63  ? 179  ARG A CB    1 
ATOM   3733  C  CG    . ARG M  3 47  ? -23.182  32.138  7.749   1.00 32.58  ? 179  ARG A CG    1 
ATOM   3734  C  CD    . ARG M  3 47  ? -24.221  32.345  6.671   1.00 32.72  ? 179  ARG A CD    1 
ATOM   3735  N  NE    . ARG M  3 47  ? -24.731  31.083  6.141   1.00 31.71  ? 179  ARG A NE    1 
ATOM   3736  C  CZ    . ARG M  3 47  ? -25.092  30.894  4.874   1.00 30.96  ? 179  ARG A CZ    1 
ATOM   3737  N  NH1   . ARG M  3 47  ? -25.560  29.706  4.490   1.00 29.48  ? 179  ARG A NH1   1 
ATOM   3738  N  NH2   . ARG M  3 47  ? -24.955  31.882  3.987   1.00 28.96  ? 179  ARG A NH2   1 
ATOM   3739  N  N     . GLN M  3 48  ? -19.979  29.371  7.561   1.00 28.69  ? 180  GLN A N     1 
ATOM   3740  C  CA    . GLN M  3 48  ? -19.158  28.410  6.843   1.00 28.46  ? 180  GLN A CA    1 
ATOM   3741  C  C     . GLN M  3 48  ? -19.936  27.591  5.823   1.00 27.20  ? 180  GLN A C     1 
ATOM   3742  O  O     . GLN M  3 48  ? -20.552  26.591  6.166   1.00 28.85  ? 180  GLN A O     1 
ATOM   3743  C  CB    . GLN M  3 48  ? -18.442  27.475  7.834   1.00 28.34  ? 180  GLN A CB    1 
ATOM   3744  C  CG    . GLN M  3 48  ? -17.724  28.182  9.008   1.00 30.39  ? 180  GLN A CG    1 
ATOM   3745  C  CD    . GLN M  3 48  ? -16.343  28.774  8.672   1.00 31.52  ? 180  GLN A CD    1 
ATOM   3746  O  OE1   . GLN M  3 48  ? -15.384  28.042  8.359   1.00 30.81  ? 180  GLN A OE1   1 
ATOM   3747  N  NE2   . GLN M  3 48  ? -16.235  30.105  8.756   1.00 30.81  ? 180  GLN A NE2   1 
ATOM   3748  N  N     . THR M  3 49  ? -19.932  28.021  4.569   1.00 26.07  ? 181  THR A N     1 
ATOM   3749  C  CA    . THR M  3 49  ? -20.617  27.258  3.532   1.00 27.91  ? 181  THR A CA    1 
ATOM   3750  C  C     . THR M  3 49  ? -19.852  27.370  2.240   1.00 27.86  ? 181  THR A C     1 
ATOM   3751  O  O     . THR M  3 49  ? -19.182  28.367  1.982   1.00 27.64  ? 181  THR A O     1 
ATOM   3752  C  CB    . THR M  3 49  ? -22.073  27.733  3.247   1.00 29.60  ? 181  THR A CB    1 
ATOM   3753  O  OG1   . THR M  3 49  ? -22.059  29.005  2.580   1.00 31.61  ? 181  THR A OG1   1 
ATOM   3754  C  CG2   . THR M  3 49  ? -22.872  27.821  4.536   1.00 31.51  ? 181  THR A CG2   1 
ATOM   3755  N  N     . ASN M  3 50  ? -19.978  26.348  1.413   1.00 28.30  ? 182  ASN A N     1 
ATOM   3756  C  CA    . ASN M  3 50  ? -19.276  26.341  0.153   1.00 30.53  ? 182  ASN A CA    1 
ATOM   3757  C  C     . ASN M  3 50  ? -19.643  27.542  -0.703  1.00 30.63  ? 182  ASN A C     1 
ATOM   3758  O  O     . ASN M  3 50  ? -18.760  28.217  -1.237  1.00 32.33  ? 182  ASN A O     1 
ATOM   3759  C  CB    . ASN M  3 50  ? -19.582  25.064  -0.613  1.00 31.12  ? 182  ASN A CB    1 
ATOM   3760  C  CG    . ASN M  3 50  ? -21.018  24.975  -1.014  1.00 34.00  ? 182  ASN A CG    1 
ATOM   3761  O  OD1   . ASN M  3 50  ? -21.357  24.265  -1.954  1.00 36.96  ? 182  ASN A OD1   1 
ATOM   3762  N  ND2   . ASN M  3 50  ? -21.885  25.692  -0.300  1.00 32.84  ? 182  ASN A ND2   1 
ATOM   3763  N  N     . GLN M  3 51  ? -20.937  27.817  -0.825  1.00 30.01  ? 183  GLN A N     1 
ATOM   3764  C  CA    . GLN M  3 51  ? -21.383  28.927  -1.654  1.00 29.96  ? 183  GLN A CA    1 
ATOM   3765  C  C     . GLN M  3 51  ? -20.643  30.225  -1.411  1.00 28.24  ? 183  GLN A C     1 
ATOM   3766  O  O     . GLN M  3 51  ? -20.135  30.826  -2.353  1.00 27.11  ? 183  GLN A O     1 
ATOM   3767  C  CB    . GLN M  3 51  ? -22.898  29.157  -1.524  1.00 31.92  ? 183  GLN A CB    1 
ATOM   3768  C  CG    . GLN M  3 51  ? -23.777  28.039  -2.121  1.00 34.72  ? 183  GLN A CG    1 
ATOM   3769  C  CD    . GLN M  3 51  ? -23.426  27.655  -3.568  1.00 37.64  ? 183  GLN A CD    1 
ATOM   3770  O  OE1   . GLN M  3 51  ? -24.221  27.019  -4.257  1.00 38.12  ? 183  GLN A OE1   1 
ATOM   3771  N  NE2   . GLN M  3 51  ? -22.233  28.025  -4.021  1.00 39.77  ? 183  GLN A NE2   1 
ATOM   3772  N  N     . ARG M  3 52  ? -20.551  30.668  -0.166  1.00 27.34  ? 184  ARG A N     1 
ATOM   3773  C  CA    . ARG M  3 52  ? -19.852  31.921  0.043   1.00 28.49  ? 184  ARG A CA    1 
ATOM   3774  C  C     . ARG M  3 52  ? -18.343  31.791  -0.040  1.00 27.38  ? 184  ARG A C     1 
ATOM   3775  O  O     . ARG M  3 52  ? -17.655  32.712  -0.489  1.00 26.92  ? 184  ARG A O     1 
ATOM   3776  C  CB    . ARG M  3 52  ? -20.284  32.588  1.353   1.00 31.11  ? 184  ARG A CB    1 
ATOM   3777  C  CG    . ARG M  3 52  ? -20.251  31.745  2.602   1.00 34.44  ? 184  ARG A CG    1 
ATOM   3778  C  CD    . ARG M  3 52  ? -21.182  32.388  3.640   1.00 35.58  ? 184  ARG A CD    1 
ATOM   3779  N  NE    . ARG M  3 52  ? -21.033  33.843  3.682   1.00 34.43  ? 184  ARG A NE    1 
ATOM   3780  C  CZ    . ARG M  3 52  ? -20.112  34.491  4.387   1.00 33.56  ? 184  ARG A CZ    1 
ATOM   3781  N  NH1   . ARG M  3 52  ? -19.243  33.820  5.130   1.00 30.82  ? 184  ARG A NH1   1 
ATOM   3782  N  NH2   . ARG M  3 52  ? -20.064  35.817  4.344   1.00 34.44  ? 184  ARG A NH2   1 
ATOM   3783  N  N     . ALA M  3 53  ? -17.820  30.647  0.373   1.00 26.61  ? 185  ALA A N     1 
ATOM   3784  C  CA    . ALA M  3 53  ? -16.385  30.441  0.288   1.00 26.14  ? 185  ALA A CA    1 
ATOM   3785  C  C     . ALA M  3 53  ? -16.046  30.743  -1.153  1.00 25.95  ? 185  ALA A C     1 
ATOM   3786  O  O     . ALA M  3 53  ? -15.163  31.555  -1.460  1.00 25.36  ? 185  ALA A O     1 
ATOM   3787  C  CB    . ALA M  3 53  ? -16.046  28.998  0.599   1.00 26.48  ? 185  ALA A CB    1 
ATOM   3788  N  N     . GLU M  3 54  ? -16.808  30.081  -2.021  1.00 25.82  ? 186  GLU A N     1 
ATOM   3789  C  CA    . GLU M  3 54  ? -16.683  30.170  -3.463  1.00 24.64  ? 186  GLU A CA    1 
ATOM   3790  C  C     . GLU M  3 54  ? -16.744  31.580  -4.025  1.00 23.31  ? 186  GLU A C     1 
ATOM   3791  O  O     . GLU M  3 54  ? -15.857  31.980  -4.770  1.00 22.60  ? 186  GLU A O     1 
ATOM   3792  C  CB    . GLU M  3 54  ? -17.766  29.336  -4.120  1.00 25.53  ? 186  GLU A CB    1 
ATOM   3793  C  CG    . GLU M  3 54  ? -17.337  28.815  -5.441  1.00 29.06  ? 186  GLU A CG    1 
ATOM   3794  C  CD    . GLU M  3 54  ? -16.541  27.533  -5.320  1.00 32.47  ? 186  GLU A CD    1 
ATOM   3795  O  OE1   . GLU M  3 54  ? -17.173  26.459  -5.196  1.00 33.10  ? 186  GLU A OE1   1 
ATOM   3796  O  OE2   . GLU M  3 54  ? -15.288  27.595  -5.341  1.00 33.90  ? 186  GLU A OE2   1 
ATOM   3797  N  N     . ILE M  3 55  ? -17.784  32.335  -3.686  1.00 22.23  ? 187  ILE A N     1 
ATOM   3798  C  CA    . ILE M  3 55  ? -17.881  33.690  -4.207  1.00 22.16  ? 187  ILE A CA    1 
ATOM   3799  C  C     . ILE M  3 55  ? -16.865  34.583  -3.523  1.00 21.07  ? 187  ILE A C     1 
ATOM   3800  O  O     . ILE M  3 55  ? -16.469  35.598  -4.078  1.00 20.92  ? 187  ILE A O     1 
ATOM   3801  C  CB    . ILE M  3 55  ? -19.265  34.327  -3.993  1.00 24.22  ? 187  ILE A CB    1 
ATOM   3802  C  CG1   . ILE M  3 55  ? -19.271  35.097  -2.678  1.00 26.91  ? 187  ILE A CG1   1 
ATOM   3803  C  CG2   . ILE M  3 55  ? -20.351  33.273  -3.978  1.00 24.57  ? 187  ILE A CG2   1 
ATOM   3804  C  CD1   . ILE M  3 55  ? -19.666  36.545  -2.833  1.00 31.21  ? 187  ILE A CD1   1 
ATOM   3805  N  N     . HIS M  3 56  ? -16.453  34.230  -2.312  1.00 21.27  ? 188  HIS A N     1 
ATOM   3806  C  CA    . HIS M  3 56  ? -15.459  35.051  -1.633  1.00 21.88  ? 188  HIS A CA    1 
ATOM   3807  C  C     . HIS M  3 56  ? -14.051  34.777  -2.122  1.00 21.61  ? 188  HIS A C     1 
ATOM   3808  O  O     . HIS M  3 56  ? -13.191  35.654  -2.067  1.00 19.32  ? 188  HIS A O     1 
ATOM   3809  C  CB    . HIS M  3 56  ? -15.558  34.889  -0.132  1.00 22.85  ? 188  HIS A CB    1 
ATOM   3810  C  CG    . HIS M  3 56  ? -16.619  35.746  0.468   1.00 24.25  ? 188  HIS A CG    1 
ATOM   3811  N  ND1   . HIS M  3 56  ? -16.502  37.116  0.545   1.00 25.46  ? 188  HIS A ND1   1 
ATOM   3812  C  CD2   . HIS M  3 56  ? -17.849  35.442  0.948   1.00 25.33  ? 188  HIS A CD2   1 
ATOM   3813  C  CE1   . HIS M  3 56  ? -17.618  37.621  1.045   1.00 27.52  ? 188  HIS A CE1   1 
ATOM   3814  N  NE2   . HIS M  3 56  ? -18.452  36.627  1.298   1.00 26.24  ? 188  HIS A NE2   1 
ATOM   3815  N  N     . ALA M  3 57  ? -13.814  33.562  -2.604  1.00 22.37  ? 189  ALA A N     1 
ATOM   3816  C  CA    . ALA M  3 57  ? -12.514  33.255  -3.168  1.00 25.66  ? 189  ALA A CA    1 
ATOM   3817  C  C     . ALA M  3 57  ? -12.348  34.321  -4.261  1.00 28.98  ? 189  ALA A C     1 
ATOM   3818  O  O     . ALA M  3 57  ? -11.330  35.024  -4.322  1.00 30.54  ? 189  ALA A O     1 
ATOM   3819  C  CB    . ALA M  3 57  ? -12.519  31.878  -3.781  1.00 24.48  ? 189  ALA A CB    1 
ATOM   3820  N  N     . ALA M  3 58  ? -13.379  34.460  -5.100  1.00 30.68  ? 190  ALA A N     1 
ATOM   3821  C  CA    . ALA M  3 58  ? -13.385  35.446  -6.183  1.00 30.22  ? 190  ALA A CA    1 
ATOM   3822  C  C     . ALA M  3 58  ? -13.216  36.886  -5.678  1.00 30.06  ? 190  ALA A C     1 
ATOM   3823  O  O     . ALA M  3 58  ? -12.621  37.721  -6.367  1.00 30.30  ? 190  ALA A O     1 
ATOM   3824  C  CB    . ALA M  3 58  ? -14.657  35.329  -6.983  1.00 28.91  ? 190  ALA A CB    1 
ATOM   3825  N  N     . CYS M  3 59  ? -13.729  37.186  -4.490  1.00 28.82  ? 191  CYS A N     1 
ATOM   3826  C  CA    . CYS M  3 59  ? -13.563  38.534  -3.962  1.00 30.47  ? 191  CYS A CA    1 
ATOM   3827  C  C     . CYS M  3 59  ? -12.083  38.765  -3.697  1.00 29.49  ? 191  CYS A C     1 
ATOM   3828  O  O     . CYS M  3 59  ? -11.506  39.773  -4.100  1.00 27.61  ? 191  CYS A O     1 
ATOM   3829  C  CB    . CYS M  3 59  ? -14.331  38.711  -2.655  1.00 33.43  ? 191  CYS A CB    1 
ATOM   3830  S  SG    . CYS M  3 59  ? -16.136  38.608  -2.794  1.00 40.12  ? 191  CYS A SG    1 
ATOM   3831  N  N     . LYS M  3 60  ? -11.464  37.807  -3.024  1.00 29.79  ? 192  LYS A N     1 
ATOM   3832  C  CA    . LYS M  3 60  ? -10.059  37.940  -2.701  1.00 30.07  ? 192  LYS A CA    1 
ATOM   3833  C  C     . LYS M  3 60  ? -9.269   38.269  -3.944  1.00 30.89  ? 192  LYS A C     1 
ATOM   3834  O  O     . LYS M  3 60  ? -8.458   39.200  -3.947  1.00 30.98  ? 192  LYS A O     1 
ATOM   3835  C  CB    . LYS M  3 60  ? -9.516   36.656  -2.088  1.00 28.56  ? 192  LYS A CB    1 
ATOM   3836  C  CG    . LYS M  3 60  ? -8.078   36.796  -1.639  1.00 28.65  ? 192  LYS A CG    1 
ATOM   3837  C  CD    . LYS M  3 60  ? -7.935   37.863  -0.577  1.00 27.97  ? 192  LYS A CD    1 
ATOM   3838  C  CE    . LYS M  3 60  ? -6.468   38.190  -0.378  1.00 30.26  ? 192  LYS A CE    1 
ATOM   3839  N  NZ    . LYS M  3 60  ? -6.257   39.171  0.724   1.00 31.01  ? 192  LYS A NZ    1 
ATOM   3840  N  N     . ALA M  3 61  ? -9.514   37.500  -5.001  1.00 31.48  ? 193  ALA A N     1 
ATOM   3841  C  CA    . ALA M  3 61  ? -8.812   37.700  -6.262  1.00 31.23  ? 193  ALA A CA    1 
ATOM   3842  C  C     . ALA M  3 61  ? -8.920   39.156  -6.694  1.00 30.57  ? 193  ALA A C     1 
ATOM   3843  O  O     . ALA M  3 61  ? -7.916   39.871  -6.757  1.00 30.58  ? 193  ALA A O     1 
ATOM   3844  C  CB    . ALA M  3 61  ? -9.385   36.798  -7.321  1.00 30.39  ? 193  ALA A CB    1 
ATOM   3845  N  N     . ILE M  3 62  ? -10.138  39.596  -6.980  1.00 29.45  ? 194  ILE A N     1 
ATOM   3846  C  CA    . ILE M  3 62  ? -10.353  40.975  -7.395  1.00 29.56  ? 194  ILE A CA    1 
ATOM   3847  C  C     . ILE M  3 62  ? -9.660   41.926  -6.420  1.00 30.30  ? 194  ILE A C     1 
ATOM   3848  O  O     . ILE M  3 62  ? -8.852   42.761  -6.834  1.00 29.59  ? 194  ILE A O     1 
ATOM   3849  C  CB    . ILE M  3 62  ? -11.852  41.289  -7.463  1.00 28.66  ? 194  ILE A CB    1 
ATOM   3850  C  CG1   . ILE M  3 62  ? -12.484  40.476  -8.598  1.00 29.07  ? 194  ILE A CG1   1 
ATOM   3851  C  CG2   . ILE M  3 62  ? -12.062  42.761  -7.650  1.00 25.61  ? 194  ILE A CG2   1 
ATOM   3852  C  CD1   . ILE M  3 62  ? -13.990  40.537  -8.658  1.00 27.53  ? 194  ILE A CD1   1 
ATOM   3853  N  N     . GLU M  3 63  ? -9.961   41.779  -5.129  1.00 30.98  ? 195  GLU A N     1 
ATOM   3854  C  CA    . GLU M  3 63  ? -9.353   42.607  -4.088  1.00 30.90  ? 195  GLU A CA    1 
ATOM   3855  C  C     . GLU M  3 63  ? -7.842   42.644  -4.273  1.00 31.84  ? 195  GLU A C     1 
ATOM   3856  O  O     . GLU M  3 63  ? -7.220   43.708  -4.231  1.00 32.25  ? 195  GLU A O     1 
ATOM   3857  C  CB    . GLU M  3 63  ? -9.678   42.042  -2.713  1.00 30.51  ? 195  GLU A CB    1 
ATOM   3858  C  CG    . GLU M  3 63  ? -9.246   42.926  -1.565  1.00 32.10  ? 195  GLU A CG    1 
ATOM   3859  C  CD    . GLU M  3 63  ? -10.009  42.607  -0.291  1.00 35.54  ? 195  GLU A CD    1 
ATOM   3860  O  OE1   . GLU M  3 63  ? -9.732   41.552  0.320   1.00 37.08  ? 195  GLU A OE1   1 
ATOM   3861  O  OE2   . GLU M  3 63  ? -10.904  43.401  0.091   1.00 37.13  ? 195  GLU A OE2   1 
ATOM   3862  N  N     . GLN M  3 64  ? -7.249   41.474  -4.474  1.00 32.55  ? 196  GLN A N     1 
ATOM   3863  C  CA    . GLN M  3 64  ? -5.813   41.400  -4.690  1.00 33.37  ? 196  GLN A CA    1 
ATOM   3864  C  C     . GLN M  3 64  ? -5.454   42.238  -5.906  1.00 33.82  ? 196  GLN A C     1 
ATOM   3865  O  O     . GLN M  3 64  ? -4.798   43.265  -5.796  1.00 34.03  ? 196  GLN A O     1 
ATOM   3866  C  CB    . GLN M  3 64  ? -5.381   39.956  -4.930  1.00 32.34  ? 196  GLN A CB    1 
ATOM   3867  C  CG    . GLN M  3 64  ? -5.283   39.123  -3.672  1.00 31.11  ? 196  GLN A CG    1 
ATOM   3868  C  CD    . GLN M  3 64  ? -4.549   37.836  -3.922  1.00 29.93  ? 196  GLN A CD    1 
ATOM   3869  O  OE1   . GLN M  3 64  ? -5.080   36.930  -4.554  1.00 30.57  ? 196  GLN A OE1   1 
ATOM   3870  N  NE2   . GLN M  3 64  ? -3.309   37.754  -3.451  1.00 28.50  ? 196  GLN A NE2   1 
ATOM   3871  N  N     . ALA M  3 65  ? -5.912   41.790  -7.065  1.00 34.14  ? 197  ALA A N     1 
ATOM   3872  C  CA    . ALA M  3 65  ? -5.656   42.466  -8.324  1.00 34.79  ? 197  ALA A CA    1 
ATOM   3873  C  C     . ALA M  3 65  ? -5.655   43.986  -8.257  1.00 35.40  ? 197  ALA A C     1 
ATOM   3874  O  O     . ALA M  3 65  ? -4.705   44.630  -8.707  1.00 35.20  ? 197  ALA A O     1 
ATOM   3875  C  CB    . ALA M  3 65  ? -6.660   42.011  -9.339  1.00 35.71  ? 197  ALA A CB    1 
ATOM   3876  N  N     . LYS M  3 66  ? -6.719   44.570  -7.719  1.00 36.78  ? 198  LYS A N     1 
ATOM   3877  C  CA    . LYS M  3 66  ? -6.783   46.027  -7.635  1.00 39.12  ? 198  LYS A CA    1 
ATOM   3878  C  C     . LYS M  3 66  ? -5.456   46.543  -7.063  1.00 40.64  ? 198  LYS A C     1 
ATOM   3879  O  O     . LYS M  3 66  ? -4.802   47.418  -7.644  1.00 40.83  ? 198  LYS A O     1 
ATOM   3880  C  CB    . LYS M  3 66  ? -7.973   46.466  -6.761  1.00 36.47  ? 198  LYS A CB    1 
ATOM   3881  N  N     . THR M  3 67  ? -5.046   45.971  -5.938  1.00 42.25  ? 199  THR A N     1 
ATOM   3882  C  CA    . THR M  3 67  ? -3.804   46.367  -5.302  1.00 44.28  ? 199  THR A CA    1 
ATOM   3883  C  C     . THR M  3 67  ? -2.631   46.281  -6.272  1.00 44.30  ? 199  THR A C     1 
ATOM   3884  O  O     . THR M  3 67  ? -1.684   47.048  -6.170  1.00 44.98  ? 199  THR A O     1 
ATOM   3885  C  CB    . THR M  3 67  ? -3.491   45.472  -4.096  1.00 46.76  ? 199  THR A CB    1 
ATOM   3886  O  OG1   . THR M  3 67  ? -2.772   46.233  -3.116  1.00 49.89  ? 199  THR A OG1   1 
ATOM   3887  C  CG2   . THR M  3 67  ? -2.626   44.270  -4.525  1.00 47.68  ? 199  THR A CG2   1 
ATOM   3888  N  N     . GLN M  3 68  ? -2.676   45.331  -7.196  1.00 45.02  ? 200  GLN A N     1 
ATOM   3889  C  CA    . GLN M  3 68  ? -1.597   45.190  -8.164  1.00 46.22  ? 200  GLN A CA    1 
ATOM   3890  C  C     . GLN M  3 68  ? -1.859   46.108  -9.329  1.00 47.29  ? 200  GLN A C     1 
ATOM   3891  O  O     . GLN M  3 68  ? -1.185   46.044  -10.362 1.00 45.26  ? 200  GLN A O     1 
ATOM   3892  C  CB    . GLN M  3 68  ? -1.496   43.754  -8.660  1.00 46.50  ? 200  GLN A CB    1 
ATOM   3893  C  CG    . GLN M  3 68  ? -0.971   42.809  -7.621  1.00 46.98  ? 200  GLN A CG    1 
ATOM   3894  C  CD    . GLN M  3 68  ? 0.306    43.316  -7.023  1.00 47.98  ? 200  GLN A CD    1 
ATOM   3895  O  OE1   . GLN M  3 68  ? 0.298    44.211  -6.178  1.00 49.34  ? 200  GLN A OE1   1 
ATOM   3896  N  NE2   . GLN M  3 68  ? 1.423    42.765  -7.473  1.00 48.76  ? 200  GLN A NE2   1 
ATOM   3897  N  N     . ASN M  3 69  ? -2.858   46.962  -9.147  1.00 49.71  ? 201  ASN A N     1 
ATOM   3898  C  CA    . ASN M  3 69  ? -3.234   47.919  -10.160 1.00 52.99  ? 201  ASN A CA    1 
ATOM   3899  C  C     . ASN M  3 69  ? -3.467   47.282  -11.511 1.00 54.53  ? 201  ASN A C     1 
ATOM   3900  O  O     . ASN M  3 69  ? -2.924   47.721  -12.531 1.00 55.53  ? 201  ASN A O     1 
ATOM   3901  C  CB    . ASN M  3 69  ? -2.174   49.005  -10.266 1.00 55.28  ? 201  ASN A CB    1 
ATOM   3902  C  CG    . ASN M  3 69  ? -2.464   50.161  -9.355  1.00 58.95  ? 201  ASN A CG    1 
ATOM   3903  O  OD1   . ASN M  3 69  ? -3.491   50.825  -9.514  1.00 63.07  ? 201  ASN A OD1   1 
ATOM   3904  N  ND2   . ASN M  3 69  ? -1.580   50.412  -8.385  1.00 58.78  ? 201  ASN A ND2   1 
ATOM   3905  N  N     . ILE M  3 70  ? -4.264   46.224  -11.508 1.00 55.00  ? 202  ILE A N     1 
ATOM   3906  C  CA    . ILE M  3 70  ? -4.613   45.554  -12.740 1.00 55.72  ? 202  ILE A CA    1 
ATOM   3907  C  C     . ILE M  3 70  ? -6.131   45.725  -12.868 1.00 56.39  ? 202  ILE A C     1 
ATOM   3908  O  O     . ILE M  3 70  ? -6.877   45.462  -11.926 1.00 55.68  ? 202  ILE A O     1 
ATOM   3909  C  CB    . ILE M  3 70  ? -4.175   44.073  -12.716 1.00 55.45  ? 202  ILE A CB    1 
ATOM   3910  C  CG1   . ILE M  3 70  ? -4.895   43.310  -13.824 1.00 57.84  ? 202  ILE A CG1   1 
ATOM   3911  C  CG2   . ILE M  3 70  ? -4.394   43.485  -11.355 1.00 54.43  ? 202  ILE A CG2   1 
ATOM   3912  C  CD1   . ILE M  3 70  ? -4.731   43.943  -15.221 1.00 59.98  ? 202  ILE A CD1   1 
ATOM   3913  N  N     . ASN M  3 71  ? -6.566   46.196  -14.036 1.00 57.42  ? 203  ASN A N     1 
ATOM   3914  C  CA    . ASN M  3 71  ? -7.976   46.490  -14.318 1.00 57.61  ? 203  ASN A CA    1 
ATOM   3915  C  C     . ASN M  3 71  ? -8.825   45.434  -15.031 1.00 55.59  ? 203  ASN A C     1 
ATOM   3916  O  O     . ASN M  3 71  ? -10.055  45.508  -15.005 1.00 55.10  ? 203  ASN A O     1 
ATOM   3917  C  CB    . ASN M  3 71  ? -8.049   47.789  -15.122 1.00 61.06  ? 203  ASN A CB    1 
ATOM   3918  C  CG    . ASN M  3 71  ? -7.164   47.752  -16.373 1.00 65.18  ? 203  ASN A CG    1 
ATOM   3919  O  OD1   . ASN M  3 71  ? -6.525   46.732  -16.682 1.00 66.60  ? 203  ASN A OD1   1 
ATOM   3920  N  ND2   . ASN M  3 71  ? -7.124   48.868  -17.099 1.00 67.15  ? 203  ASN A ND2   1 
ATOM   3921  N  N     . LYS M  3 72  ? -8.190   44.471  -15.684 1.00 53.22  ? 204  LYS A N     1 
ATOM   3922  C  CA    . LYS M  3 72  ? -8.949   43.450  -16.386 1.00 52.71  ? 204  LYS A CA    1 
ATOM   3923  C  C     . LYS M  3 72  ? -8.322   42.064  -16.303 1.00 51.52  ? 204  LYS A C     1 
ATOM   3924  O  O     . LYS M  3 72  ? -7.172   41.843  -16.712 1.00 50.73  ? 204  LYS A O     1 
ATOM   3925  C  CB    . LYS M  3 72  ? -9.141   43.855  -17.845 1.00 54.96  ? 204  LYS A CB    1 
ATOM   3926  C  CG    . LYS M  3 72  ? -7.865   44.206  -18.562 1.00 58.98  ? 204  LYS A CG    1 
ATOM   3927  C  CD    . LYS M  3 72  ? -8.153   44.677  -19.973 1.00 62.32  ? 204  LYS A CD    1 
ATOM   3928  C  CE    . LYS M  3 72  ? -9.062   45.899  -19.982 1.00 65.20  ? 204  LYS A CE    1 
ATOM   3929  N  NZ    . LYS M  3 72  ? -9.454   46.270  -21.380 1.00 67.44  ? 204  LYS A NZ    1 
ATOM   3930  N  N     . LEU M  3 73  ? -9.108   41.124  -15.788 1.00 48.71  ? 205  LEU A N     1 
ATOM   3931  C  CA    . LEU M  3 73  ? -8.640   39.765  -15.608 1.00 45.35  ? 205  LEU A CA    1 
ATOM   3932  C  C     . LEU M  3 73  ? -9.670   38.731  -16.021 1.00 43.24  ? 205  LEU A C     1 
ATOM   3933  O  O     . LEU M  3 73  ? -10.871  38.998  -15.998 1.00 42.37  ? 205  LEU A O     1 
ATOM   3934  C  CB    . LEU M  3 73  ? -8.256   39.548  -14.138 1.00 44.23  ? 205  LEU A CB    1 
ATOM   3935  C  CG    . LEU M  3 73  ? -9.301   39.949  -13.089 1.00 43.66  ? 205  LEU A CG    1 
ATOM   3936  C  CD1   . LEU M  3 73  ? -8.892   39.440  -11.722 1.00 43.94  ? 205  LEU A CD1   1 
ATOM   3937  C  CD2   . LEU M  3 73  ? -9.448   41.454  -13.047 1.00 44.13  ? 205  LEU A CD2   1 
ATOM   3938  N  N     . VAL M  3 74  ? -9.173   37.557  -16.416 1.00 41.51  ? 206  VAL A N     1 
ATOM   3939  C  CA    . VAL M  3 74  ? -10.011  36.425  -16.805 1.00 38.73  ? 206  VAL A CA    1 
ATOM   3940  C  C     . VAL M  3 74  ? -9.965   35.483  -15.620 1.00 36.64  ? 206  VAL A C     1 
ATOM   3941  O  O     . VAL M  3 74  ? -9.061   34.663  -15.502 1.00 35.69  ? 206  VAL A O     1 
ATOM   3942  C  CB    . VAL M  3 74  ? -9.454   35.666  -18.016 1.00 39.27  ? 206  VAL A CB    1 
ATOM   3943  C  CG1   . VAL M  3 74  ? -10.419  34.542  -18.403 1.00 37.95  ? 206  VAL A CG1   1 
ATOM   3944  C  CG2   . VAL M  3 74  ? -9.238   36.619  -19.178 1.00 39.63  ? 206  VAL A CG2   1 
ATOM   3945  N  N     . LEU M  3 75  ? -10.952  35.619  -14.747 1.00 35.20  ? 207  LEU A N     1 
ATOM   3946  C  CA    . LEU M  3 75  ? -11.052  34.831  -13.529 1.00 33.26  ? 207  LEU A CA    1 
ATOM   3947  C  C     . LEU M  3 75  ? -11.807  33.525  -13.739 1.00 32.47  ? 207  LEU A C     1 
ATOM   3948  O  O     . LEU M  3 75  ? -12.999  33.526  -14.021 1.00 32.29  ? 207  LEU A O     1 
ATOM   3949  C  CB    . LEU M  3 75  ? -11.732  35.696  -12.460 1.00 31.94  ? 207  LEU A CB    1 
ATOM   3950  C  CG    . LEU M  3 75  ? -12.193  35.238  -11.081 1.00 30.83  ? 207  LEU A CG    1 
ATOM   3951  C  CD1   . LEU M  3 75  ? -12.547  36.474  -10.288 1.00 31.44  ? 207  LEU A CD1   1 
ATOM   3952  C  CD2   . LEU M  3 75  ? -13.403  34.335  -11.172 1.00 30.39  ? 207  LEU A CD2   1 
ATOM   3953  N  N     . TYR M  3 76  ? -11.101  32.408  -13.618 1.00 32.52  ? 208  TYR A N     1 
ATOM   3954  C  CA    . TYR M  3 76  ? -11.723  31.098  -13.771 1.00 32.14  ? 208  TYR A CA    1 
ATOM   3955  C  C     . TYR M  3 76  ? -12.255  30.610  -12.424 1.00 31.28  ? 208  TYR A C     1 
ATOM   3956  O  O     . TYR M  3 76  ? -11.780  31.020  -11.359 1.00 33.09  ? 208  TYR A O     1 
ATOM   3957  C  CB    . TYR M  3 76  ? -10.719  30.077  -14.298 1.00 31.44  ? 208  TYR A CB    1 
ATOM   3958  C  CG    . TYR M  3 76  ? -10.354  30.246  -15.745 1.00 31.88  ? 208  TYR A CG    1 
ATOM   3959  C  CD1   . TYR M  3 76  ? -9.297   31.066  -16.127 1.00 33.69  ? 208  TYR A CD1   1 
ATOM   3960  C  CD2   . TYR M  3 76  ? -11.036  29.549  -16.732 1.00 32.29  ? 208  TYR A CD2   1 
ATOM   3961  C  CE1   . TYR M  3 76  ? -8.918   31.177  -17.471 1.00 35.78  ? 208  TYR A CE1   1 
ATOM   3962  C  CE2   . TYR M  3 76  ? -10.676  29.649  -18.071 1.00 34.40  ? 208  TYR A CE2   1 
ATOM   3963  C  CZ    . TYR M  3 76  ? -9.614   30.457  -18.437 1.00 36.69  ? 208  TYR A CZ    1 
ATOM   3964  O  OH    . TYR M  3 76  ? -9.220   30.509  -19.760 1.00 39.64  ? 208  TYR A OH    1 
ATOM   3965  N  N     . THR M  3 77  ? -13.236  29.725  -12.473 1.00 27.55  ? 209  THR A N     1 
ATOM   3966  C  CA    . THR M  3 77  ? -13.806  29.177  -11.258 1.00 24.40  ? 209  THR A CA    1 
ATOM   3967  C  C     . THR M  3 77  ? -14.721  28.074  -11.688 1.00 22.49  ? 209  THR A C     1 
ATOM   3968  O  O     . THR M  3 77  ? -15.045  27.972  -12.863 1.00 22.66  ? 209  THR A O     1 
ATOM   3969  C  CB    . THR M  3 77  ? -14.623  30.213  -10.519 1.00 24.02  ? 209  THR A CB    1 
ATOM   3970  O  OG1   . THR M  3 77  ? -15.541  29.556  -9.642  1.00 25.54  ? 209  THR A OG1   1 
ATOM   3971  C  CG2   . THR M  3 77  ? -15.392  31.045  -11.494 1.00 23.97  ? 209  THR A CG2   1 
ATOM   3972  N  N     . ASN M  3 78  ? -15.126  27.225  -10.761 1.00 21.30  ? 210  ASN A N     1 
ATOM   3973  C  CA    . ASN M  3 78  ? -16.037  26.164  -11.146 1.00 23.09  ? 210  ASN A CA    1 
ATOM   3974  C  C     . ASN M  3 78  ? -17.410  26.410  -10.537 1.00 21.10  ? 210  ASN A C     1 
ATOM   3975  O  O     . ASN M  3 78  ? -18.294  25.565  -10.588 1.00 20.02  ? 210  ASN A O     1 
ATOM   3976  C  CB    . ASN M  3 78  ? -15.493  24.763  -10.769 1.00 26.50  ? 210  ASN A CB    1 
ATOM   3977  C  CG    . ASN M  3 78  ? -14.784  24.729  -9.414  1.00 28.80  ? 210  ASN A CG    1 
ATOM   3978  O  OD1   . ASN M  3 78  ? -14.904  25.652  -8.607  1.00 31.42  ? 210  ASN A OD1   1 
ATOM   3979  N  ND2   . ASN M  3 78  ? -14.050  23.646  -9.160  1.00 26.80  ? 210  ASN A ND2   1 
ATOM   3980  N  N     . SER M  3 79  ? -17.592  27.600  -9.992  1.00 19.62  ? 211  SER A N     1 
ATOM   3981  C  CA    . SER M  3 79  ? -18.860  27.933  -9.383  1.00 21.39  ? 211  SER A CA    1 
ATOM   3982  C  C     . SER M  3 79  ? -19.795  28.613  -10.343 1.00 22.78  ? 211  SER A C     1 
ATOM   3983  O  O     . SER M  3 79  ? -19.640  29.801  -10.637 1.00 24.91  ? 211  SER A O     1 
ATOM   3984  C  CB    . SER M  3 79  ? -18.667  28.863  -8.187  1.00 22.16  ? 211  SER A CB    1 
ATOM   3985  O  OG    . SER M  3 79  ? -19.919  29.242  -7.631  1.00 20.89  ? 211  SER A OG    1 
ATOM   3986  N  N     . MET M  3 80  ? -20.780  27.885  -10.839 1.00 22.75  ? 212  MET A N     1 
ATOM   3987  C  CA    . MET M  3 80  ? -21.717  28.537  -11.721 1.00 21.73  ? 212  MET A CA    1 
ATOM   3988  C  C     . MET M  3 80  ? -22.555  29.455  -10.847 1.00 19.22  ? 212  MET A C     1 
ATOM   3989  O  O     . MET M  3 80  ? -22.920  30.558  -11.236 1.00 16.08  ? 212  MET A O     1 
ATOM   3990  C  CB    . MET M  3 80  ? -22.568  27.503  -12.440 1.00 24.28  ? 212  MET A CB    1 
ATOM   3991  C  CG    . MET M  3 80  ? -21.873  26.993  -13.682 1.00 28.14  ? 212  MET A CG    1 
ATOM   3992  S  SD    . MET M  3 80  ? -21.028  28.371  -14.550 1.00 33.16  ? 212  MET A SD    1 
ATOM   3993  C  CE    . MET M  3 80  ? -22.433  29.392  -15.055 1.00 32.18  ? 212  MET A CE    1 
ATOM   3994  N  N     . PHE M  3 81  ? -22.814  29.002  -9.633  1.00 18.74  ? 213  PHE A N     1 
ATOM   3995  C  CA    . PHE M  3 81  ? -23.594  29.789  -8.713  1.00 19.80  ? 213  PHE A CA    1 
ATOM   3996  C  C     . PHE M  3 81  ? -22.992  31.164  -8.554  1.00 21.60  ? 213  PHE A C     1 
ATOM   3997  O  O     . PHE M  3 81  ? -23.706  32.124  -8.281  1.00 22.96  ? 213  PHE A O     1 
ATOM   3998  C  CB    . PHE M  3 81  ? -23.644  29.136  -7.352  1.00 20.53  ? 213  PHE A CB    1 
ATOM   3999  C  CG    . PHE M  3 81  ? -24.412  29.923  -6.352  1.00 22.72  ? 213  PHE A CG    1 
ATOM   4000  C  CD1   . PHE M  3 81  ? -25.796  29.893  -6.351  1.00 23.96  ? 213  PHE A CD1   1 
ATOM   4001  C  CD2   . PHE M  3 81  ? -23.753  30.716  -5.416  1.00 24.47  ? 213  PHE A CD2   1 
ATOM   4002  C  CE1   . PHE M  3 81  ? -26.527  30.647  -5.427  1.00 25.60  ? 213  PHE A CE1   1 
ATOM   4003  C  CE2   . PHE M  3 81  ? -24.471  31.478  -4.485  1.00 26.08  ? 213  PHE A CE2   1 
ATOM   4004  C  CZ    . PHE M  3 81  ? -25.865  31.442  -4.492  1.00 25.70  ? 213  PHE A CZ    1 
ATOM   4005  N  N     . THR M  3 82  ? -21.675  31.269  -8.699  1.00 22.12  ? 214  THR A N     1 
ATOM   4006  C  CA    . THR M  3 82  ? -21.037  32.571  -8.552  1.00 21.41  ? 214  THR A CA    1 
ATOM   4007  C  C     . THR M  3 82  ? -21.152  33.310  -9.863  1.00 22.44  ? 214  THR A C     1 
ATOM   4008  O  O     . THR M  3 82  ? -21.641  34.430  -9.916  1.00 22.72  ? 214  THR A O     1 
ATOM   4009  C  CB    . THR M  3 82  ? -19.553  32.449  -8.177  1.00 20.25  ? 214  THR A CB    1 
ATOM   4010  O  OG1   . THR M  3 82  ? -19.431  31.707  -6.959  1.00 19.10  ? 214  THR A OG1   1 
ATOM   4011  C  CG2   . THR M  3 82  ? -18.938  33.835  -7.985  1.00 17.41  ? 214  THR A CG2   1 
ATOM   4012  N  N     . ILE M  3 83  ? -20.710  32.667  -10.930 1.00 23.97  ? 215  ILE A N     1 
ATOM   4013  C  CA    . ILE M  3 83  ? -20.771  33.275  -12.243 1.00 26.21  ? 215  ILE A CA    1 
ATOM   4014  C  C     . ILE M  3 83  ? -22.198  33.741  -12.564 1.00 28.30  ? 215  ILE A C     1 
ATOM   4015  O  O     . ILE M  3 83  ? -22.419  34.911  -12.887 1.00 27.54  ? 215  ILE A O     1 
ATOM   4016  C  CB    . ILE M  3 83  ? -20.253  32.272  -13.294 1.00 24.82  ? 215  ILE A CB    1 
ATOM   4017  C  CG1   . ILE M  3 83  ? -18.727  32.329  -13.330 1.00 22.65  ? 215  ILE A CG1   1 
ATOM   4018  C  CG2   . ILE M  3 83  ? -20.852  32.561  -14.646 1.00 26.02  ? 215  ILE A CG2   1 
ATOM   4019  C  CD1   . ILE M  3 83  ? -18.102  31.202  -14.092 1.00 21.34  ? 215  ILE A CD1   1 
ATOM   4020  N  N     . ASN M  3 84  ? -23.163  32.832  -12.451 1.00 31.50  ? 216  ASN A N     1 
ATOM   4021  C  CA    . ASN M  3 84  ? -24.561  33.158  -12.728 1.00 34.19  ? 216  ASN A CA    1 
ATOM   4022  C  C     . ASN M  3 84  ? -25.051  34.291  -11.852 1.00 35.49  ? 216  ASN A C     1 
ATOM   4023  O  O     . ASN M  3 84  ? -25.861  35.114  -12.277 1.00 37.26  ? 216  ASN A O     1 
ATOM   4024  C  CB    . ASN M  3 84  ? -25.442  31.933  -12.526 1.00 34.81  ? 216  ASN A CB    1 
ATOM   4025  C  CG    . ASN M  3 84  ? -25.270  30.920  -13.636 1.00 37.80  ? 216  ASN A CG    1 
ATOM   4026  O  OD1   . ASN M  3 84  ? -25.534  29.724  -13.449 1.00 39.32  ? 216  ASN A OD1   1 
ATOM   4027  N  ND2   . ASN M  3 84  ? -24.830  31.393  -14.813 1.00 34.58  ? 216  ASN A ND2   1 
ATOM   4028  N  N     . GLY M  3 85  ? -24.563  34.342  -10.623 1.00 35.91  ? 217  GLY A N     1 
ATOM   4029  C  CA    . GLY M  3 85  ? -24.983  35.418  -9.754  1.00 35.87  ? 217  GLY A CA    1 
ATOM   4030  C  C     . GLY M  3 85  ? -24.402  36.708  -10.286 1.00 35.63  ? 217  GLY A C     1 
ATOM   4031  O  O     . GLY M  3 85  ? -25.080  37.518  -10.914 1.00 35.46  ? 217  GLY A O     1 
ATOM   4032  N  N     . ILE M  3 86  ? -23.110  36.864  -10.065 1.00 36.01  ? 218  ILE A N     1 
ATOM   4033  C  CA    . ILE M  3 86  ? -22.409  38.056  -10.471 1.00 36.82  ? 218  ILE A CA    1 
ATOM   4034  C  C     . ILE M  3 86  ? -22.767  38.580  -11.861 1.00 37.74  ? 218  ILE A C     1 
ATOM   4035  O  O     . ILE M  3 86  ? -22.804  39.791  -12.056 1.00 38.77  ? 218  ILE A O     1 
ATOM   4036  C  CB    . ILE M  3 86  ? -20.863  37.856  -10.338 1.00 36.29  ? 218  ILE A CB    1 
ATOM   4037  C  CG1   . ILE M  3 86  ? -20.195  39.193  -10.039 1.00 35.12  ? 218  ILE A CG1   1 
ATOM   4038  C  CG2   . ILE M  3 86  ? -20.269  37.315  -11.638 1.00 36.70  ? 218  ILE A CG2   1 
ATOM   4039  C  CD1   . ILE M  3 86  ? -20.951  40.041  -9.044  1.00 34.41  ? 218  ILE A CD1   1 
ATOM   4040  N  N     . THR M  3 87  ? -23.062  37.718  -12.828 1.00 37.67  ? 219  THR A N     1 
ATOM   4041  C  CA    . THR M  3 87  ? -23.367  38.275  -14.143 1.00 39.23  ? 219  THR A CA    1 
ATOM   4042  C  C     . THR M  3 87  ? -24.800  38.216  -14.636 1.00 42.07  ? 219  THR A C     1 
ATOM   4043  O  O     . THR M  3 87  ? -25.058  38.566  -15.790 1.00 43.22  ? 219  THR A O     1 
ATOM   4044  C  CB    . THR M  3 87  ? -22.497  37.673  -15.242 1.00 37.05  ? 219  THR A CB    1 
ATOM   4045  O  OG1   . THR M  3 87  ? -22.893  36.319  -15.482 1.00 35.39  ? 219  THR A OG1   1 
ATOM   4046  C  CG2   . THR M  3 87  ? -21.038  37.737  -14.841 1.00 36.95  ? 219  THR A CG2   1 
ATOM   4047  N  N     . ASN M  3 88  ? -25.732  37.792  -13.784 1.00 43.80  ? 220  ASN A N     1 
ATOM   4048  C  CA    . ASN M  3 88  ? -27.132  37.720  -14.190 1.00 44.90  ? 220  ASN A CA    1 
ATOM   4049  C  C     . ASN M  3 88  ? -28.087  37.914  -13.023 1.00 44.82  ? 220  ASN A C     1 
ATOM   4050  O  O     . ASN M  3 88  ? -28.680  38.976  -12.860 1.00 42.85  ? 220  ASN A O     1 
ATOM   4051  C  CB    . ASN M  3 88  ? -27.418  36.379  -14.881 1.00 47.01  ? 220  ASN A CB    1 
ATOM   4052  C  CG    . ASN M  3 88  ? -26.616  36.201  -16.176 1.00 51.31  ? 220  ASN A CG    1 
ATOM   4053  O  OD1   . ASN M  3 88  ? -25.697  35.379  -16.254 1.00 53.45  ? 220  ASN A OD1   1 
ATOM   4054  N  ND2   . ASN M  3 88  ? -26.961  36.984  -17.197 1.00 54.60  ? 220  ASN A ND2   1 
ATOM   4055  N  N     . TRP M  3 89  ? -28.224  36.879  -12.209 1.00 46.17  ? 221  TRP A N     1 
ATOM   4056  C  CA    . TRP M  3 89  ? -29.113  36.912  -11.056 1.00 47.49  ? 221  TRP A CA    1 
ATOM   4057  C  C     . TRP M  3 89  ? -29.074  38.218  -10.269 1.00 47.04  ? 221  TRP A C     1 
ATOM   4058  O  O     . TRP M  3 89  ? -30.113  38.756  -9.886  1.00 46.60  ? 221  TRP A O     1 
ATOM   4059  C  CB    . TRP M  3 89  ? -28.796  35.733  -10.134 1.00 48.43  ? 221  TRP A CB    1 
ATOM   4060  C  CG    . TRP M  3 89  ? -28.924  34.418  -10.830 1.00 50.17  ? 221  TRP A CG    1 
ATOM   4061  C  CD1   . TRP M  3 89  ? -29.526  34.189  -12.030 1.00 51.93  ? 221  TRP A CD1   1 
ATOM   4062  C  CD2   . TRP M  3 89  ? -28.454  33.148  -10.368 1.00 51.61  ? 221  TRP A CD2   1 
ATOM   4063  N  NE1   . TRP M  3 89  ? -29.461  32.854  -12.347 1.00 54.37  ? 221  TRP A NE1   1 
ATOM   4064  C  CE2   . TRP M  3 89  ? -28.805  32.193  -11.342 1.00 53.61  ? 221  TRP A CE2   1 
ATOM   4065  C  CE3   . TRP M  3 89  ? -27.773  32.723  -9.225  1.00 52.60  ? 221  TRP A CE3   1 
ATOM   4066  C  CZ2   . TRP M  3 89  ? -28.492  30.832  -11.209 1.00 55.37  ? 221  TRP A CZ2   1 
ATOM   4067  C  CZ3   . TRP M  3 89  ? -27.465  31.365  -9.091  1.00 54.21  ? 221  TRP A CZ3   1 
ATOM   4068  C  CH2   . TRP M  3 89  ? -27.823  30.439  -10.079 1.00 54.58  ? 221  TRP A CH2   1 
ATOM   4069  N  N     . VAL M  3 90  ? -27.877  38.731  -10.032 1.00 46.80  ? 222  VAL A N     1 
ATOM   4070  C  CA    . VAL M  3 90  ? -27.730  39.968  -9.283  1.00 47.13  ? 222  VAL A CA    1 
ATOM   4071  C  C     . VAL M  3 90  ? -28.569  41.106  -9.864  1.00 47.09  ? 222  VAL A C     1 
ATOM   4072  O  O     . VAL M  3 90  ? -29.529  41.542  -9.235  1.00 47.97  ? 222  VAL A O     1 
ATOM   4073  C  CB    . VAL M  3 90  ? -26.255  40.391  -9.227  1.00 46.95  ? 222  VAL A CB    1 
ATOM   4074  C  CG1   . VAL M  3 90  ? -25.666  40.399  -10.631 1.00 47.93  ? 222  VAL A CG1   1 
ATOM   4075  C  CG2   . VAL M  3 90  ? -26.134  41.753  -8.572  1.00 46.49  ? 222  VAL A CG2   1 
ATOM   4076  N  N     . GLN M  3 91  ? -28.202  41.575  -11.057 1.00 47.01  ? 223  GLN A N     1 
ATOM   4077  C  CA    . GLN M  3 91  ? -28.901  42.658  -11.756 1.00 46.56  ? 223  GLN A CA    1 
ATOM   4078  C  C     . GLN M  3 91  ? -30.392  42.642  -11.431 1.00 45.14  ? 223  GLN A C     1 
ATOM   4079  O  O     . GLN M  3 91  ? -30.941  43.626  -10.934 1.00 43.86  ? 223  GLN A O     1 
ATOM   4080  C  CB    . GLN M  3 91  ? -28.674  42.520  -13.271 1.00 48.74  ? 223  GLN A CB    1 
ATOM   4081  C  CG    . GLN M  3 91  ? -27.511  41.550  -13.614 1.00 53.90  ? 223  GLN A CG    1 
ATOM   4082  C  CD    . GLN M  3 91  ? -26.814  41.819  -14.958 1.00 55.08  ? 223  GLN A CD    1 
ATOM   4083  O  OE1   . GLN M  3 91  ? -27.463  41.926  -16.008 1.00 55.41  ? 223  GLN A OE1   1 
ATOM   4084  N  NE2   . GLN M  3 91  ? -25.478  41.908  -14.923 1.00 53.48  ? 223  GLN A NE2   1 
ATOM   4085  N  N     . GLY M  3 92  ? -31.042  41.516  -11.703 1.00 44.55  ? 224  GLY A N     1 
ATOM   4086  C  CA    . GLY M  3 92  ? -32.452  41.403  -11.397 1.00 43.81  ? 224  GLY A CA    1 
ATOM   4087  C  C     . GLY M  3 92  ? -32.647  41.713  -9.930  1.00 43.96  ? 224  GLY A C     1 
ATOM   4088  O  O     . GLY M  3 92  ? -33.146  42.771  -9.570  1.00 42.21  ? 224  GLY A O     1 
ATOM   4089  N  N     . TRP M  3 93  ? -32.215  40.789  -9.084  1.00 46.04  ? 225  TRP A N     1 
ATOM   4090  C  CA    . TRP M  3 93  ? -32.330  40.913  -7.626  1.00 48.90  ? 225  TRP A CA    1 
ATOM   4091  C  C     . TRP M  3 93  ? -32.333  42.316  -7.043  1.00 49.63  ? 225  TRP A C     1 
ATOM   4092  O  O     . TRP M  3 93  ? -33.050  42.599  -6.081  1.00 47.85  ? 225  TRP A O     1 
ATOM   4093  C  CB    . TRP M  3 93  ? -31.210  40.126  -6.944  1.00 49.48  ? 225  TRP A CB    1 
ATOM   4094  C  CG    . TRP M  3 93  ? -31.279  38.657  -7.166  1.00 50.25  ? 225  TRP A CG    1 
ATOM   4095  C  CD1   . TRP M  3 93  ? -32.290  37.958  -7.758  1.00 50.16  ? 225  TRP A CD1   1 
ATOM   4096  C  CD2   . TRP M  3 93  ? -30.294  37.700  -6.793  1.00 50.52  ? 225  TRP A CD2   1 
ATOM   4097  N  NE1   . TRP M  3 93  ? -31.991  36.624  -7.779  1.00 49.37  ? 225  TRP A NE1   1 
ATOM   4098  C  CE2   . TRP M  3 93  ? -30.769  36.438  -7.191  1.00 50.14  ? 225  TRP A CE2   1 
ATOM   4099  C  CE3   . TRP M  3 93  ? -29.051  37.786  -6.159  1.00 50.92  ? 225  TRP A CE3   1 
ATOM   4100  C  CZ2   . TRP M  3 93  ? -30.045  35.270  -6.974  1.00 51.23  ? 225  TRP A CZ2   1 
ATOM   4101  C  CZ3   . TRP M  3 93  ? -28.331  36.624  -5.945  1.00 50.12  ? 225  TRP A CZ3   1 
ATOM   4102  C  CH2   . TRP M  3 93  ? -28.831  35.383  -6.351  1.00 50.81  ? 225  TRP A CH2   1 
ATOM   4103  N  N     . LYS M  3 94  ? -31.508  43.181  -7.610  1.00 52.72  ? 226  LYS A N     1 
ATOM   4104  C  CA    . LYS M  3 94  ? -31.402  44.546  -7.130  1.00 56.40  ? 226  LYS A CA    1 
ATOM   4105  C  C     . LYS M  3 94  ? -32.730  45.253  -7.337  1.00 57.53  ? 226  LYS A C     1 
ATOM   4106  O  O     . LYS M  3 94  ? -33.258  45.902  -6.432  1.00 57.86  ? 226  LYS A O     1 
ATOM   4107  C  CB    . LYS M  3 94  ? -30.309  45.288  -7.893  1.00 58.69  ? 226  LYS A CB    1 
ATOM   4108  C  CG    . LYS M  3 94  ? -29.115  44.440  -8.295  1.00 61.62  ? 226  LYS A CG    1 
ATOM   4109  C  CD    . LYS M  3 94  ? -28.019  45.308  -8.912  1.00 64.49  ? 226  LYS A CD    1 
ATOM   4110  C  CE    . LYS M  3 94  ? -27.133  45.930  -7.832  1.00 66.39  ? 226  LYS A CE    1 
ATOM   4111  N  NZ    . LYS M  3 94  ? -27.879  46.375  -6.610  1.00 67.89  ? 226  LYS A NZ    1 
ATOM   4112  N  N     . LYS M  3 95  ? -33.262  45.124  -8.546  1.00 58.88  ? 227  LYS A N     1 
ATOM   4113  C  CA    . LYS M  3 95  ? -34.533  45.737  -8.897  1.00 59.29  ? 227  LYS A CA    1 
ATOM   4114  C  C     . LYS M  3 95  ? -35.724  44.970  -8.306  1.00 58.35  ? 227  LYS A C     1 
ATOM   4115  O  O     . LYS M  3 95  ? -36.652  44.658  -9.039  1.00 59.13  ? 227  LYS A O     1 
ATOM   4116  C  CB    . LYS M  3 95  ? -34.691  45.781  -10.424 1.00 60.65  ? 227  LYS A CB    1 
ATOM   4117  C  CG    . LYS M  3 95  ? -33.768  46.729  -11.185 1.00 63.72  ? 227  LYS A CG    1 
ATOM   4118  C  CD    . LYS M  3 95  ? -33.983  46.552  -12.704 1.00 66.76  ? 227  LYS A CD    1 
ATOM   4119  C  CE    . LYS M  3 95  ? -33.605  47.792  -13.542 1.00 69.33  ? 227  LYS A CE    1 
ATOM   4120  N  NZ    . LYS M  3 95  ? -32.143  48.133  -13.572 1.00 71.60  ? 227  LYS A NZ    1 
ATOM   4121  N  N     . ASN M  3 96  ? -35.708  44.648  -7.012  1.00 56.59  ? 228  ASN A N     1 
ATOM   4122  C  CA    . ASN M  3 96  ? -36.839  43.934  -6.419  1.00 56.46  ? 228  ASN A CA    1 
ATOM   4123  C  C     . ASN M  3 96  ? -36.638  43.391  -5.015  1.00 56.48  ? 228  ASN A C     1 
ATOM   4124  O  O     . ASN M  3 96  ? -37.284  42.416  -4.615  1.00 55.93  ? 228  ASN A O     1 
ATOM   4125  C  CB    . ASN M  3 96  ? -37.282  42.789  -7.318  1.00 57.56  ? 228  ASN A CB    1 
ATOM   4126  C  CG    . ASN M  3 96  ? -36.212  41.760  -7.498  1.00 59.29  ? 228  ASN A CG    1 
ATOM   4127  O  OD1   . ASN M  3 96  ? -36.090  40.824  -6.700  1.00 60.52  ? 228  ASN A OD1   1 
ATOM   4128  N  ND2   . ASN M  3 96  ? -35.408  41.928  -8.545  1.00 60.29  ? 228  ASN A ND2   1 
ATOM   4129  N  N     . GLY M  3 97  ? -35.740  44.022  -4.271  1.00 56.47  ? 229  GLY A N     1 
ATOM   4130  C  CA    . GLY M  3 97  ? -35.503  43.628  -2.894  1.00 55.24  ? 229  GLY A CA    1 
ATOM   4131  C  C     . GLY M  3 97  ? -34.722  42.358  -2.650  1.00 54.66  ? 229  GLY A C     1 
ATOM   4132  O  O     . GLY M  3 97  ? -34.737  41.837  -1.531  1.00 56.05  ? 229  GLY A O     1 
ATOM   4133  N  N     . TRP M  3 98  ? -34.032  41.854  -3.666  1.00 51.94  ? 230  TRP A N     1 
ATOM   4134  C  CA    . TRP M  3 98  ? -33.269  40.639  -3.469  1.00 49.33  ? 230  TRP A CA    1 
ATOM   4135  C  C     . TRP M  3 98  ? -34.207  39.551  -2.976  1.00 49.35  ? 230  TRP A C     1 
ATOM   4136  O  O     . TRP M  3 98  ? -34.102  39.081  -1.838  1.00 48.27  ? 230  TRP A O     1 
ATOM   4137  C  CB    . TRP M  3 98  ? -32.174  40.874  -2.433  1.00 47.42  ? 230  TRP A CB    1 
ATOM   4138  C  CG    . TRP M  3 98  ? -31.169  41.872  -2.873  1.00 45.81  ? 230  TRP A CG    1 
ATOM   4139  C  CD1   . TRP M  3 98  ? -31.341  43.217  -2.984  1.00 44.84  ? 230  TRP A CD1   1 
ATOM   4140  C  CD2   . TRP M  3 98  ? -29.847  41.597  -3.333  1.00 45.27  ? 230  TRP A CD2   1 
ATOM   4141  N  NE1   . TRP M  3 98  ? -30.207  43.801  -3.489  1.00 43.64  ? 230  TRP A NE1   1 
ATOM   4142  C  CE2   . TRP M  3 98  ? -29.274  42.826  -3.714  1.00 44.36  ? 230  TRP A CE2   1 
ATOM   4143  C  CE3   . TRP M  3 98  ? -29.091  40.426  -3.466  1.00 45.17  ? 230  TRP A CE3   1 
ATOM   4144  C  CZ2   . TRP M  3 98  ? -27.980  42.921  -4.221  1.00 45.36  ? 230  TRP A CZ2   1 
ATOM   4145  C  CZ3   . TRP M  3 98  ? -27.804  40.519  -3.971  1.00 45.28  ? 230  TRP A CZ3   1 
ATOM   4146  C  CH2   . TRP M  3 98  ? -27.261  41.758  -4.342  1.00 46.22  ? 230  TRP A CH2   1 
ATOM   4147  N  N     . LYS M  3 99  ? -35.142  39.173  -3.837  1.00 49.69  ? 231  LYS A N     1 
ATOM   4148  C  CA    . LYS M  3 99  ? -36.098  38.129  -3.515  1.00 50.73  ? 231  LYS A CA    1 
ATOM   4149  C  C     . LYS M  3 99  ? -35.913  36.992  -4.506  1.00 51.06  ? 231  LYS A C     1 
ATOM   4150  O  O     . LYS M  3 99  ? -35.882  37.204  -5.720  1.00 51.06  ? 231  LYS A O     1 
ATOM   4151  C  CB    . LYS M  3 99  ? -37.522  38.680  -3.593  1.00 52.00  ? 231  LYS A CB    1 
ATOM   4152  C  CG    . LYS M  3 99  ? -37.844  39.684  -2.498  1.00 52.61  ? 231  LYS A CG    1 
ATOM   4153  C  CD    . LYS M  3 99  ? -37.698  39.048  -1.117  1.00 52.61  ? 231  LYS A CD    1 
ATOM   4154  C  CE    . LYS M  3 99  ? -37.921  40.062  -0.010  1.00 52.95  ? 231  LYS A CE    1 
ATOM   4155  N  NZ    . LYS M  3 99  ? -36.976  41.210  -0.120  1.00 53.08  ? 231  LYS A NZ    1 
ATOM   4156  N  N     . THR M  3 100 ? -35.784  35.780  -3.992  1.00 51.29  ? 232  THR A N     1 
ATOM   4157  C  CA    . THR M  3 100 ? -35.582  34.651  -4.875  1.00 53.42  ? 232  THR A CA    1 
ATOM   4158  C  C     . THR M  3 100 ? -36.768  34.364  -5.770  1.00 52.66  ? 232  THR A C     1 
ATOM   4159  O  O     . THR M  3 100 ? -37.895  34.722  -5.466  1.00 52.07  ? 232  THR A O     1 
ATOM   4160  C  CB    . THR M  3 100 ? -35.289  33.375  -4.109  1.00 55.96  ? 232  THR A CB    1 
ATOM   4161  O  OG1   . THR M  3 100 ? -34.970  32.342  -5.050  1.00 59.17  ? 232  THR A OG1   1 
ATOM   4162  C  CG2   . THR M  3 100 ? -36.509  32.949  -3.303  1.00 55.69  ? 232  THR A CG2   1 
ATOM   4163  N  N     . SER M  3 101 ? -36.494  33.677  -6.867  1.00 53.67  ? 233  SER A N     1 
ATOM   4164  C  CA    . SER M  3 101 ? -37.514  33.315  -7.835  1.00 55.77  ? 233  SER A CA    1 
ATOM   4165  C  C     . SER M  3 101 ? -38.671  32.548  -7.216  1.00 56.15  ? 233  SER A C     1 
ATOM   4166  O  O     . SER M  3 101 ? -39.567  32.091  -7.927  1.00 56.77  ? 233  SER A O     1 
ATOM   4167  C  CB    . SER M  3 101 ? -36.898  32.466  -8.949  1.00 57.96  ? 233  SER A CB    1 
ATOM   4168  O  OG    . SER M  3 101 ? -37.873  32.080  -9.904  1.00 58.72  ? 233  SER A OG    1 
ATOM   4169  N  N     . ALA M  3 102 ? -38.654  32.385  -5.902  1.00 56.53  ? 234  ALA A N     1 
ATOM   4170  C  CA    . ALA M  3 102 ? -39.737  31.671  -5.235  1.00 57.05  ? 234  ALA A CA    1 
ATOM   4171  C  C     . ALA M  3 102 ? -40.316  32.576  -4.163  1.00 57.15  ? 234  ALA A C     1 
ATOM   4172  O  O     . ALA M  3 102 ? -41.112  32.148  -3.322  1.00 55.57  ? 234  ALA A O     1 
ATOM   4173  C  CB    . ALA M  3 102 ? -39.220  30.372  -4.622  1.00 58.58  ? 234  ALA A CB    1 
ATOM   4174  N  N     . GLY M  3 103 ? -39.885  33.833  -4.202  1.00 57.96  ? 235  GLY A N     1 
ATOM   4175  C  CA    . GLY M  3 103 ? -40.366  34.825  -3.260  1.00 59.06  ? 235  GLY A CA    1 
ATOM   4176  C  C     . GLY M  3 103 ? -39.822  34.782  -1.843  1.00 59.25  ? 235  GLY A C     1 
ATOM   4177  O  O     . GLY M  3 103 ? -40.584  34.629  -0.885  1.00 60.05  ? 235  GLY A O     1 
ATOM   4178  N  N     . LYS M  3 104 ? -38.509  34.904  -1.699  1.00 58.58  ? 236  LYS A N     1 
ATOM   4179  C  CA    . LYS M  3 104 ? -37.907  34.920  -0.376  1.00 57.97  ? 236  LYS A CA    1 
ATOM   4180  C  C     . LYS M  3 104 ? -36.460  35.382  -0.432  1.00 56.74  ? 236  LYS A C     1 
ATOM   4181  O  O     . LYS M  3 104 ? -35.744  35.149  -1.408  1.00 57.43  ? 236  LYS A O     1 
ATOM   4182  C  CB    . LYS M  3 104 ? -38.042  33.556  0.318   1.00 58.68  ? 236  LYS A CB    1 
ATOM   4183  C  CG    . LYS M  3 104 ? -37.486  32.371  -0.442  1.00 61.27  ? 236  LYS A CG    1 
ATOM   4184  C  CD    . LYS M  3 104 ? -38.439  31.163  -0.382  1.00 63.19  ? 236  LYS A CD    1 
ATOM   4185  C  CE    . LYS M  3 104 ? -38.724  30.702  1.048   1.00 63.58  ? 236  LYS A CE    1 
ATOM   4186  N  NZ    . LYS M  3 104 ? -39.587  29.482  1.103   1.00 61.98  ? 236  LYS A NZ    1 
ATOM   4187  N  N     . GLU M  3 105 ? -36.070  36.078  0.630   1.00 54.84  ? 237  GLU A N     1 
ATOM   4188  C  CA    . GLU M  3 105 ? -34.747  36.664  0.805   1.00 51.76  ? 237  GLU A CA    1 
ATOM   4189  C  C     . GLU M  3 105 ? -33.611  35.964  0.076   1.00 47.59  ? 237  GLU A C     1 
ATOM   4190  O  O     . GLU M  3 105 ? -33.323  34.801  0.361   1.00 47.49  ? 237  GLU A O     1 
ATOM   4191  C  CB    . GLU M  3 105 ? -34.430  36.727  2.300   1.00 54.49  ? 237  GLU A CB    1 
ATOM   4192  C  CG    . GLU M  3 105 ? -35.595  37.248  3.148   1.00 59.19  ? 237  GLU A CG    1 
ATOM   4193  C  CD    . GLU M  3 105 ? -35.983  38.698  2.826   1.00 62.01  ? 237  GLU A CD    1 
ATOM   4194  O  OE1   . GLU M  3 105 ? -37.027  39.161  3.352   1.00 62.21  ? 237  GLU A OE1   1 
ATOM   4195  O  OE2   . GLU M  3 105 ? -35.246  39.370  2.057   1.00 62.07  ? 237  GLU A OE2   1 
ATOM   4196  N  N     . VAL M  3 106 ? -32.974  36.671  -0.864  1.00 41.63  ? 238  VAL A N     1 
ATOM   4197  C  CA    . VAL M  3 106 ? -31.845  36.098  -1.590  1.00 36.01  ? 238  VAL A CA    1 
ATOM   4198  C  C     . VAL M  3 106 ? -30.762  35.874  -0.545  1.00 32.52  ? 238  VAL A C     1 
ATOM   4199  O  O     . VAL M  3 106 ? -30.043  36.782  -0.152  1.00 29.54  ? 238  VAL A O     1 
ATOM   4200  C  CB    . VAL M  3 106 ? -31.321  37.023  -2.727  1.00 35.33  ? 238  VAL A CB    1 
ATOM   4201  C  CG1   . VAL M  3 106 ? -29.889  36.685  -3.045  1.00 35.65  ? 238  VAL A CG1   1 
ATOM   4202  C  CG2   . VAL M  3 106 ? -32.139  36.819  -3.996  1.00 33.30  ? 238  VAL A CG2   1 
ATOM   4203  N  N     . ILE M  3 107 ? -30.676  34.625  -0.110  1.00 31.14  ? 239  ILE A N     1 
ATOM   4204  C  CA    . ILE M  3 107 ? -29.757  34.190  0.919   1.00 28.90  ? 239  ILE A CA    1 
ATOM   4205  C  C     . ILE M  3 107 ? -28.349  34.730  0.890   1.00 29.17  ? 239  ILE A C     1 
ATOM   4206  O  O     . ILE M  3 107 ? -27.841  35.187  1.921   1.00 29.56  ? 239  ILE A O     1 
ATOM   4207  C  CB    . ILE M  3 107 ? -29.634  32.674  0.952   1.00 25.97  ? 239  ILE A CB    1 
ATOM   4208  C  CG1   . ILE M  3 107 ? -31.000  32.028  0.800   1.00 23.84  ? 239  ILE A CG1   1 
ATOM   4209  C  CG2   . ILE M  3 107 ? -29.061  32.261  2.285   1.00 25.95  ? 239  ILE A CG2   1 
ATOM   4210  C  CD1   . ILE M  3 107 ? -30.949  30.547  0.870   1.00 24.08  ? 239  ILE A CD1   1 
ATOM   4211  N  N     . ASN M  3 108 ? -27.700  34.679  -0.265  1.00 27.65  ? 240  ASN A N     1 
ATOM   4212  C  CA    . ASN M  3 108 ? -26.328  35.138  -0.287  1.00 27.76  ? 240  ASN A CA    1 
ATOM   4213  C  C     . ASN M  3 108 ? -26.114  36.591  -0.698  1.00 27.66  ? 240  ASN A C     1 
ATOM   4214  O  O     . ASN M  3 108 ? -25.060  36.973  -1.218  1.00 26.20  ? 240  ASN A O     1 
ATOM   4215  C  CB    . ASN M  3 108 ? -25.486  34.158  -1.113  1.00 27.60  ? 240  ASN A CB    1 
ATOM   4216  C  CG    . ASN M  3 108 ? -25.323  32.804  -0.415  1.00 27.02  ? 240  ASN A CG    1 
ATOM   4217  O  OD1   . ASN M  3 108 ? -26.198  31.943  -0.481  1.00 28.94  ? 240  ASN A OD1   1 
ATOM   4218  N  ND2   . ASN M  3 108 ? -24.208  32.628  0.280   1.00 27.34  ? 240  ASN A ND2   1 
ATOM   4219  N  N     . LYS M  3 109 ? -27.119  37.406  -0.405  1.00 28.51  ? 241  LYS A N     1 
ATOM   4220  C  CA    . LYS M  3 109 ? -27.090  38.833  -0.713  1.00 30.93  ? 241  LYS A CA    1 
ATOM   4221  C  C     . LYS M  3 109 ? -25.783  39.485  -0.291  1.00 31.38  ? 241  LYS A C     1 
ATOM   4222  O  O     . LYS M  3 109 ? -24.978  39.888  -1.130  1.00 29.09  ? 241  LYS A O     1 
ATOM   4223  C  CB    . LYS M  3 109 ? -28.248  39.531  -0.003  1.00 31.99  ? 241  LYS A CB    1 
ATOM   4224  C  CG    . LYS M  3 109 ? -28.341  41.021  -0.242  1.00 32.74  ? 241  LYS A CG    1 
ATOM   4225  C  CD    . LYS M  3 109 ? -29.440  41.615  0.638   1.00 35.36  ? 241  LYS A CD    1 
ATOM   4226  C  CE    . LYS M  3 109 ? -29.601  43.127  0.436   1.00 34.73  ? 241  LYS A CE    1 
ATOM   4227  N  NZ    . LYS M  3 109 ? -30.678  43.702  1.303   1.00 34.06  ? 241  LYS A NZ    1 
ATOM   4228  N  N     . GLU M  3 110 ? -25.603  39.585  1.023   1.00 33.98  ? 242  GLU A N     1 
ATOM   4229  C  CA    . GLU M  3 110 ? -24.422  40.182  1.640   1.00 36.90  ? 242  GLU A CA    1 
ATOM   4230  C  C     . GLU M  3 110 ? -23.158  39.859  0.858   1.00 35.41  ? 242  GLU A C     1 
ATOM   4231  O  O     . GLU M  3 110 ? -22.331  40.728  0.582   1.00 33.01  ? 242  GLU A O     1 
ATOM   4232  C  CB    . GLU M  3 110 ? -24.296  39.675  3.088   1.00 42.37  ? 242  GLU A CB    1 
ATOM   4233  C  CG    . GLU M  3 110 ? -23.064  40.186  3.874   1.00 51.54  ? 242  GLU A CG    1 
ATOM   4234  C  CD    . GLU M  3 110 ? -22.932  39.573  5.291   1.00 55.63  ? 242  GLU A CD    1 
ATOM   4235  O  OE1   . GLU M  3 110 ? -23.790  39.881  6.161   1.00 56.67  ? 242  GLU A OE1   1 
ATOM   4236  O  OE2   . GLU M  3 110 ? -21.971  38.783  5.528   1.00 56.09  ? 242  GLU A OE2   1 
ATOM   4237  N  N     . ASP M  3 111 ? -23.030  38.597  0.485   1.00 35.95  ? 243  ASP A N     1 
ATOM   4238  C  CA    . ASP M  3 111 ? -21.870  38.139  -0.257  1.00 36.53  ? 243  ASP A CA    1 
ATOM   4239  C  C     . ASP M  3 111 ? -21.793  38.791  -1.631  1.00 35.08  ? 243  ASP A C     1 
ATOM   4240  O  O     . ASP M  3 111 ? -20.806  39.449  -1.956  1.00 33.01  ? 243  ASP A O     1 
ATOM   4241  C  CB    . ASP M  3 111 ? -21.935  36.620  -0.368  1.00 39.00  ? 243  ASP A CB    1 
ATOM   4242  C  CG    . ASP M  3 111 ? -22.105  35.955  0.995   1.00 42.90  ? 243  ASP A CG    1 
ATOM   4243  O  OD1   . ASP M  3 111 ? -21.229  36.168  1.867   1.00 45.57  ? 243  ASP A OD1   1 
ATOM   4244  O  OD2   . ASP M  3 111 ? -23.110  35.234  1.203   1.00 43.11  ? 243  ASP A OD2   1 
ATOM   4245  N  N     . PHE M  3 112 ? -22.847  38.623  -2.426  1.00 34.75  ? 244  PHE A N     1 
ATOM   4246  C  CA    . PHE M  3 112 ? -22.893  39.196  -3.768  1.00 33.95  ? 244  PHE A CA    1 
ATOM   4247  C  C     . PHE M  3 112 ? -22.710  40.692  -3.749  1.00 35.11  ? 244  PHE A C     1 
ATOM   4248  O  O     . PHE M  3 112 ? -22.005  41.247  -4.595  1.00 37.04  ? 244  PHE A O     1 
ATOM   4249  C  CB    . PHE M  3 112 ? -24.212  38.864  -4.466  1.00 30.27  ? 244  PHE A CB    1 
ATOM   4250  C  CG    . PHE M  3 112 ? -24.283  37.457  -4.961  1.00 27.51  ? 244  PHE A CG    1 
ATOM   4251  C  CD1   . PHE M  3 112 ? -23.357  36.993  -5.884  1.00 26.62  ? 244  PHE A CD1   1 
ATOM   4252  C  CD2   . PHE M  3 112 ? -25.253  36.585  -4.488  1.00 25.68  ? 244  PHE A CD2   1 
ATOM   4253  C  CE1   . PHE M  3 112 ? -23.392  35.681  -6.329  1.00 26.59  ? 244  PHE A CE1   1 
ATOM   4254  C  CE2   . PHE M  3 112 ? -25.298  35.274  -4.924  1.00 25.73  ? 244  PHE A CE2   1 
ATOM   4255  C  CZ    . PHE M  3 112 ? -24.362  34.820  -5.850  1.00 26.62  ? 244  PHE A CZ    1 
ATOM   4256  N  N     . VAL M  3 113 ? -23.347  41.356  -2.795  1.00 35.34  ? 245  VAL A N     1 
ATOM   4257  C  CA    . VAL M  3 113 ? -23.207  42.801  -2.714  1.00 35.22  ? 245  VAL A CA    1 
ATOM   4258  C  C     . VAL M  3 113 ? -21.715  43.107  -2.685  1.00 32.94  ? 245  VAL A C     1 
ATOM   4259  O  O     . VAL M  3 113 ? -21.204  43.811  -3.557  1.00 32.45  ? 245  VAL A O     1 
ATOM   4260  C  CB    . VAL M  3 113 ? -23.867  43.365  -1.447  1.00 37.61  ? 245  VAL A CB    1 
ATOM   4261  C  CG1   . VAL M  3 113 ? -23.905  44.877  -1.525  1.00 38.42  ? 245  VAL A CG1   1 
ATOM   4262  C  CG2   . VAL M  3 113 ? -25.278  42.795  -1.294  1.00 38.46  ? 245  VAL A CG2   1 
ATOM   4263  N  N     . ALA M  3 114 ? -21.018  42.558  -1.695  1.00 30.62  ? 246  ALA A N     1 
ATOM   4264  C  CA    . ALA M  3 114 ? -19.580  42.766  -1.589  1.00 29.12  ? 246  ALA A CA    1 
ATOM   4265  C  C     . ALA M  3 114 ? -18.958  42.541  -2.967  1.00 27.65  ? 246  ALA A C     1 
ATOM   4266  O  O     . ALA M  3 114 ? -18.370  43.445  -3.557  1.00 25.76  ? 246  ALA A O     1 
ATOM   4267  C  CB    . ALA M  3 114 ? -18.982  41.794  -0.575  1.00 28.25  ? 246  ALA A CB    1 
ATOM   4268  N  N     . LEU M  3 115 ? -19.119  41.330  -3.485  1.00 27.63  ? 247  LEU A N     1 
ATOM   4269  C  CA    . LEU M  3 115 ? -18.569  40.989  -4.782  1.00 27.90  ? 247  LEU A CA    1 
ATOM   4270  C  C     . LEU M  3 115 ? -18.895  42.020  -5.845  1.00 30.68  ? 247  LEU A C     1 
ATOM   4271  O  O     . LEU M  3 115 ? -18.007  42.420  -6.600  1.00 30.74  ? 247  LEU A O     1 
ATOM   4272  C  CB    . LEU M  3 115 ? -19.060  39.611  -5.225  1.00 24.45  ? 247  LEU A CB    1 
ATOM   4273  C  CG    . LEU M  3 115 ? -18.559  39.108  -6.581  1.00 22.28  ? 247  LEU A CG    1 
ATOM   4274  C  CD1   . LEU M  3 115 ? -17.073  39.254  -6.685  1.00 21.28  ? 247  LEU A CD1   1 
ATOM   4275  C  CD2   . LEU M  3 115 ? -18.952  37.663  -6.757  1.00 22.30  ? 247  LEU A CD2   1 
ATOM   4276  N  N     . GLU M  3 116 ? -20.146  42.471  -5.915  1.00 34.62  ? 248  GLU A N     1 
ATOM   4277  C  CA    . GLU M  3 116 ? -20.482  43.455  -6.942  1.00 39.59  ? 248  GLU A CA    1 
ATOM   4278  C  C     . GLU M  3 116 ? -19.737  44.755  -6.672  1.00 41.33  ? 248  GLU A C     1 
ATOM   4279  O  O     . GLU M  3 116 ? -19.268  45.417  -7.601  1.00 41.39  ? 248  GLU A O     1 
ATOM   4280  C  CB    . GLU M  3 116 ? -21.988  43.725  -7.015  1.00 41.12  ? 248  GLU A CB    1 
ATOM   4281  C  CG    . GLU M  3 116 ? -22.413  44.389  -8.341  1.00 46.31  ? 248  GLU A CG    1 
ATOM   4282  C  CD    . GLU M  3 116 ? -23.341  45.608  -8.165  1.00 50.03  ? 248  GLU A CD    1 
ATOM   4283  O  OE1   . GLU M  3 116 ? -24.493  45.438  -7.698  1.00 50.22  ? 248  GLU A OE1   1 
ATOM   4284  O  OE2   . GLU M  3 116 ? -22.914  46.742  -8.498  1.00 51.28  ? 248  GLU A OE2   1 
ATOM   4285  N  N     . ARG M  3 117 ? -19.614  45.115  -5.399  1.00 44.13  ? 249  ARG A N     1 
ATOM   4286  C  CA    . ARG M  3 117 ? -18.904  46.336  -5.047  1.00 46.60  ? 249  ARG A CA    1 
ATOM   4287  C  C     . ARG M  3 117 ? -17.531  46.308  -5.707  1.00 45.91  ? 249  ARG A C     1 
ATOM   4288  O  O     . ARG M  3 117 ? -17.041  47.339  -6.174  1.00 46.36  ? 249  ARG A O     1 
ATOM   4289  C  CB    . ARG M  3 117 ? -18.762  46.476  -3.519  1.00 50.17  ? 249  ARG A CB    1 
ATOM   4290  C  CG    . ARG M  3 117 ? -17.354  46.848  -3.048  1.00 58.18  ? 249  ARG A CG    1 
ATOM   4291  C  CD    . ARG M  3 117 ? -17.322  47.457  -1.643  1.00 64.29  ? 249  ARG A CD    1 
ATOM   4292  N  NE    . ARG M  3 117 ? -17.932  48.795  -1.596  1.00 71.15  ? 249  ARG A NE    1 
ATOM   4293  C  CZ    . ARG M  3 117 ? -17.476  49.877  -2.239  1.00 72.35  ? 249  ARG A CZ    1 
ATOM   4294  N  NH1   . ARG M  3 117 ? -16.382  49.805  -2.998  1.00 72.57  ? 249  ARG A NH1   1 
ATOM   4295  N  NH2   . ARG M  3 117 ? -18.121  51.038  -2.125  1.00 70.98  ? 249  ARG A NH2   1 
ATOM   4296  N  N     . LEU M  3 118 ? -16.923  45.125  -5.770  1.00 44.00  ? 250  LEU A N     1 
ATOM   4297  C  CA    . LEU M  3 118 ? -15.602  45.016  -6.365  1.00 43.38  ? 250  LEU A CA    1 
ATOM   4298  C  C     . LEU M  3 118 ? -15.546  44.863  -7.878  1.00 44.09  ? 250  LEU A C     1 
ATOM   4299  O  O     . LEU M  3 118 ? -14.501  45.113  -8.469  1.00 44.42  ? 250  LEU A O     1 
ATOM   4300  C  CB    . LEU M  3 118 ? -14.798  43.886  -5.722  1.00 42.82  ? 250  LEU A CB    1 
ATOM   4301  C  CG    . LEU M  3 118 ? -14.346  44.070  -4.276  1.00 41.14  ? 250  LEU A CG    1 
ATOM   4302  C  CD1   . LEU M  3 118 ? -15.472  43.638  -3.367  1.00 42.93  ? 250  LEU A CD1   1 
ATOM   4303  C  CD2   . LEU M  3 118 ? -13.107  43.238  -3.993  1.00 40.09  ? 250  LEU A CD2   1 
ATOM   4304  N  N     . THR M  3 119 ? -16.623  44.442  -8.529  1.00 44.85  ? 251  THR A N     1 
ATOM   4305  C  CA    . THR M  3 119 ? -16.533  44.344  -9.985  1.00 46.25  ? 251  THR A CA    1 
ATOM   4306  C  C     . THR M  3 119 ? -16.276  45.753  -10.526 1.00 46.39  ? 251  THR A C     1 
ATOM   4307  O  O     . THR M  3 119 ? -15.599  45.927  -11.542 1.00 46.39  ? 251  THR A O     1 
ATOM   4308  C  CB    . THR M  3 119 ? -17.831  43.800  -10.641 1.00 47.22  ? 251  THR A CB    1 
ATOM   4309  O  OG1   . THR M  3 119 ? -18.971  44.199  -9.871  1.00 48.94  ? 251  THR A OG1   1 
ATOM   4310  C  CG2   . THR M  3 119 ? -17.780  42.296  -10.768 1.00 45.93  ? 251  THR A CG2   1 
ATOM   4311  N  N     . GLN M  3 120 ? -16.811  46.747  -9.814  1.00 45.80  ? 252  GLN A N     1 
ATOM   4312  C  CA    . GLN M  3 120 ? -16.696  48.166  -10.166 1.00 45.29  ? 252  GLN A CA    1 
ATOM   4313  C  C     . GLN M  3 120 ? -15.364  48.639  -10.758 1.00 44.81  ? 252  GLN A C     1 
ATOM   4314  O  O     . GLN M  3 120 ? -14.340  48.665  -10.079 1.00 44.77  ? 252  GLN A O     1 
ATOM   4315  C  CB    . GLN M  3 120 ? -17.031  49.009  -8.937  1.00 45.61  ? 252  GLN A CB    1 
ATOM   4316  C  CG    . GLN M  3 120 ? -18.340  49.782  -9.038  1.00 48.32  ? 252  GLN A CG    1 
ATOM   4317  C  CD    . GLN M  3 120 ? -19.486  48.946  -9.584  1.00 50.20  ? 252  GLN A CD    1 
ATOM   4318  O  OE1   . GLN M  3 120 ? -19.549  48.673  -10.787 1.00 52.01  ? 252  GLN A OE1   1 
ATOM   4319  N  NE2   . GLN M  3 120 ? -20.398  48.532  -8.702  1.00 49.15  ? 252  GLN A NE2   1 
ATOM   4320  N  N     . GLY M  3 121 ? -15.389  49.029  -12.029 1.00 44.60  ? 253  GLY A N     1 
ATOM   4321  C  CA    . GLY M  3 121 ? -14.178  49.509  -12.675 1.00 46.12  ? 253  GLY A CA    1 
ATOM   4322  C  C     . GLY M  3 121 ? -13.268  48.402  -13.178 1.00 46.78  ? 253  GLY A C     1 
ATOM   4323  O  O     . GLY M  3 121 ? -12.313  48.632  -13.936 1.00 47.23  ? 253  GLY A O     1 
ATOM   4324  N  N     . MET M  3 122 ? -13.562  47.188  -12.740 1.00 46.28  ? 254  MET A N     1 
ATOM   4325  C  CA    . MET M  3 122 ? -12.797  46.022  -13.141 1.00 45.43  ? 254  MET A CA    1 
ATOM   4326  C  C     . MET M  3 122 ? -13.424  45.431  -14.390 1.00 44.23  ? 254  MET A C     1 
ATOM   4327  O  O     . MET M  3 122 ? -14.637  45.505  -14.560 1.00 46.50  ? 254  MET A O     1 
ATOM   4328  C  CB    . MET M  3 122 ? -12.840  44.986  -12.024 1.00 45.56  ? 254  MET A CB    1 
ATOM   4329  C  CG    . MET M  3 122 ? -11.922  45.290  -10.874 1.00 47.66  ? 254  MET A CG    1 
ATOM   4330  S  SD    . MET M  3 122 ? -10.214  44.981  -11.361 1.00 51.67  ? 254  MET A SD    1 
ATOM   4331  C  CE    . MET M  3 122 ? -9.457   46.652  -11.162 1.00 50.63  ? 254  MET A CE    1 
ATOM   4332  N  N     . ASP M  3 123 ? -12.624  44.869  -15.282 1.00 41.70  ? 255  ASP A N     1 
ATOM   4333  C  CA    . ASP M  3 123 ? -13.224  44.235  -16.439 1.00 41.59  ? 255  ASP A CA    1 
ATOM   4334  C  C     . ASP M  3 123 ? -13.008  42.722  -16.346 1.00 40.94  ? 255  ASP A C     1 
ATOM   4335  O  O     . ASP M  3 123 ? -12.224  42.132  -17.093 1.00 40.65  ? 255  ASP A O     1 
ATOM   4336  C  CB    . ASP M  3 123 ? -12.653  44.783  -17.741 1.00 44.13  ? 255  ASP A CB    1 
ATOM   4337  C  CG    . ASP M  3 123 ? -13.166  44.021  -18.953 1.00 47.29  ? 255  ASP A CG    1 
ATOM   4338  O  OD1   . ASP M  3 123 ? -14.293  43.478  -18.862 1.00 48.41  ? 255  ASP A OD1   1 
ATOM   4339  O  OD2   . ASP M  3 123 ? -12.457  43.965  -19.989 1.00 48.70  ? 255  ASP A OD2   1 
ATOM   4340  N  N     . ILE M  3 124 ? -13.716  42.099  -15.407 1.00 39.89  ? 256  ILE A N     1 
ATOM   4341  C  CA    . ILE M  3 124 ? -13.608  40.664  -15.186 1.00 37.44  ? 256  ILE A CA    1 
ATOM   4342  C  C     . ILE M  3 124 ? -14.227  39.887  -16.331 1.00 37.57  ? 256  ILE A C     1 
ATOM   4343  O  O     . ILE M  3 124 ? -15.289  40.240  -16.843 1.00 37.05  ? 256  ILE A O     1 
ATOM   4344  C  CB    . ILE M  3 124 ? -14.338  40.216  -13.906 1.00 35.63  ? 256  ILE A CB    1 
ATOM   4345  C  CG1   . ILE M  3 124 ? -14.275  41.307  -12.851 1.00 35.17  ? 256  ILE A CG1   1 
ATOM   4346  C  CG2   . ILE M  3 124 ? -13.688  38.968  -13.353 1.00 34.58  ? 256  ILE A CG2   1 
ATOM   4347  C  CD1   . ILE M  3 124 ? -12.893  41.608  -12.388 1.00 38.34  ? 256  ILE A CD1   1 
ATOM   4348  N  N     . GLN M  3 125 ? -13.550  38.826  -16.732 1.00 37.50  ? 257  GLN A N     1 
ATOM   4349  C  CA    . GLN M  3 125 ? -14.063  37.976  -17.778 1.00 38.43  ? 257  GLN A CA    1 
ATOM   4350  C  C     . GLN M  3 125 ? -14.282  36.623  -17.082 1.00 37.34  ? 257  GLN A C     1 
ATOM   4351  O  O     . GLN M  3 125 ? -13.425  35.736  -17.128 1.00 37.94  ? 257  GLN A O     1 
ATOM   4352  C  CB    . GLN M  3 125 ? -13.048  37.863  -18.912 1.00 40.53  ? 257  GLN A CB    1 
ATOM   4353  C  CG    . GLN M  3 125 ? -13.617  37.296  -20.197 1.00 44.68  ? 257  GLN A CG    1 
ATOM   4354  C  CD    . GLN M  3 125 ? -12.557  36.616  -21.037 1.00 49.35  ? 257  GLN A CD    1 
ATOM   4355  O  OE1   . GLN M  3 125 ? -11.558  37.230  -21.438 1.00 51.97  ? 257  GLN A OE1   1 
ATOM   4356  N  NE2   . GLN M  3 125 ? -12.762  35.334  -21.306 1.00 51.39  ? 257  GLN A NE2   1 
ATOM   4357  N  N     . TRP M  3 126 ? -15.431  36.483  -16.422 1.00 34.66  ? 258  TRP A N     1 
ATOM   4358  C  CA    . TRP M  3 126 ? -15.746  35.262  -15.693 1.00 32.49  ? 258  TRP A CA    1 
ATOM   4359  C  C     . TRP M  3 126 ? -15.780  34.028  -16.563 1.00 31.91  ? 258  TRP A C     1 
ATOM   4360  O  O     . TRP M  3 126 ? -16.612  33.898  -17.444 1.00 31.51  ? 258  TRP A O     1 
ATOM   4361  C  CB    . TRP M  3 126 ? -17.075  35.406  -14.951 1.00 30.81  ? 258  TRP A CB    1 
ATOM   4362  C  CG    . TRP M  3 126 ? -17.111  36.602  -14.051 1.00 29.40  ? 258  TRP A CG    1 
ATOM   4363  C  CD1   . TRP M  3 126 ? -17.347  37.888  -14.418 1.00 28.13  ? 258  TRP A CD1   1 
ATOM   4364  C  CD2   . TRP M  3 126 ? -16.884  36.624  -12.634 1.00 29.81  ? 258  TRP A CD2   1 
ATOM   4365  N  NE1   . TRP M  3 126 ? -17.287  38.715  -13.326 1.00 27.60  ? 258  TRP A NE1   1 
ATOM   4366  C  CE2   . TRP M  3 126 ? -17.005  37.966  -12.215 1.00 28.79  ? 258  TRP A CE2   1 
ATOM   4367  C  CE3   . TRP M  3 126 ? -16.587  35.639  -11.676 1.00 30.08  ? 258  TRP A CE3   1 
ATOM   4368  C  CZ2   . TRP M  3 126 ? -16.846  38.355  -10.873 1.00 28.70  ? 258  TRP A CZ2   1 
ATOM   4369  C  CZ3   . TRP M  3 126 ? -16.428  36.024  -10.338 1.00 28.67  ? 258  TRP A CZ3   1 
ATOM   4370  C  CH2   . TRP M  3 126 ? -16.560  37.374  -9.953  1.00 28.71  ? 258  TRP A CH2   1 
ATOM   4371  N  N     . MET M  3 127 ? -14.861  33.117  -16.300 1.00 33.27  ? 259  MET A N     1 
ATOM   4372  C  CA    . MET M  3 127 ? -14.780  31.885  -17.052 1.00 36.31  ? 259  MET A CA    1 
ATOM   4373  C  C     . MET M  3 127 ? -15.032  30.711  -16.108 1.00 37.51  ? 259  MET A C     1 
ATOM   4374  O  O     . MET M  3 127 ? -14.715  30.776  -14.917 1.00 37.53  ? 259  MET A O     1 
ATOM   4375  C  CB    . MET M  3 127 ? -13.396  31.749  -17.678 1.00 39.29  ? 259  MET A CB    1 
ATOM   4376  C  CG    . MET M  3 127 ? -13.421  31.378  -19.139 1.00 43.01  ? 259  MET A CG    1 
ATOM   4377  S  SD    . MET M  3 127 ? -13.316  32.823  -20.200 1.00 49.79  ? 259  MET A SD    1 
ATOM   4378  C  CE    . MET M  3 127 ? -15.028  33.469  -20.115 1.00 48.51  ? 259  MET A CE    1 
ATOM   4379  N  N     . HIS M  3 128 ? -15.586  29.631  -16.651 1.00 38.38  ? 260  HIS A N     1 
ATOM   4380  C  CA    . HIS M  3 128 ? -15.891  28.443  -15.865 1.00 38.96  ? 260  HIS A CA    1 
ATOM   4381  C  C     . HIS M  3 128 ? -15.032  27.249  -16.245 1.00 39.67  ? 260  HIS A C     1 
ATOM   4382  O  O     . HIS M  3 128 ? -14.902  26.926  -17.424 1.00 39.49  ? 260  HIS A O     1 
ATOM   4383  C  CB    . HIS M  3 128 ? -17.357  28.061  -16.049 1.00 40.07  ? 260  HIS A CB    1 
ATOM   4384  C  CG    . HIS M  3 128 ? -17.699  26.709  -15.510 1.00 41.09  ? 260  HIS A CG    1 
ATOM   4385  N  ND1   . HIS M  3 128 ? -18.274  26.526  -14.270 1.00 42.55  ? 260  HIS A ND1   1 
ATOM   4386  C  CD2   . HIS M  3 128 ? -17.499  25.471  -16.018 1.00 41.48  ? 260  HIS A CD2   1 
ATOM   4387  C  CE1   . HIS M  3 128 ? -18.411  25.233  -14.035 1.00 41.80  ? 260  HIS A CE1   1 
ATOM   4388  N  NE2   . HIS M  3 128 ? -17.948  24.571  -15.080 1.00 43.37  ? 260  HIS A NE2   1 
ATOM   4389  N  N     . VAL M  3 129 ? -14.451  26.600  -15.241 1.00 40.79  ? 261  VAL A N     1 
ATOM   4390  C  CA    . VAL M  3 129 ? -13.637  25.409  -15.467 1.00 42.13  ? 261  VAL A CA    1 
ATOM   4391  C  C     . VAL M  3 129 ? -14.316  24.242  -14.799 1.00 42.83  ? 261  VAL A C     1 
ATOM   4392  O  O     . VAL M  3 129 ? -14.824  24.362  -13.683 1.00 43.57  ? 261  VAL A O     1 
ATOM   4393  C  CB    . VAL M  3 129 ? -12.228  25.507  -14.877 1.00 41.06  ? 261  VAL A CB    1 
ATOM   4394  C  CG1   . VAL M  3 129 ? -11.409  26.472  -15.681 1.00 42.96  ? 261  VAL A CG1   1 
ATOM   4395  C  CG2   . VAL M  3 129 ? -12.300  25.921  -13.428 1.00 40.66  ? 261  VAL A CG2   1 
ATOM   4396  N  N     . PRO M  3 130 ? -14.321  23.091  -15.473 1.00 42.75  ? 262  PRO A N     1 
ATOM   4397  C  CA    . PRO M  3 130 ? -14.933  21.864  -14.985 1.00 44.23  ? 262  PRO A CA    1 
ATOM   4398  C  C     . PRO M  3 130 ? -14.383  21.428  -13.633 1.00 46.58  ? 262  PRO A C     1 
ATOM   4399  O  O     . PRO M  3 130 ? -13.352  21.925  -13.170 1.00 45.65  ? 262  PRO A O     1 
ATOM   4400  C  CB    . PRO M  3 130 ? -14.623  20.870  -16.093 1.00 43.67  ? 262  PRO A CB    1 
ATOM   4401  C  CG    . PRO M  3 130 ? -14.501  21.724  -17.291 1.00 43.06  ? 262  PRO A CG    1 
ATOM   4402  C  CD    . PRO M  3 130 ? -13.711  22.870  -16.788 1.00 42.98  ? 262  PRO A CD    1 
ATOM   4403  N  N     . GLY M  3 131 ? -15.098  20.494  -13.013 1.00 49.25  ? 263  GLY A N     1 
ATOM   4404  C  CA    . GLY M  3 131 ? -14.718  19.981  -11.716 1.00 51.05  ? 263  GLY A CA    1 
ATOM   4405  C  C     . GLY M  3 131 ? -13.385  19.277  -11.741 1.00 52.92  ? 263  GLY A C     1 
ATOM   4406  O  O     . GLY M  3 131 ? -12.376  19.851  -12.153 1.00 54.53  ? 263  GLY A O     1 
ATOM   4407  N  N     . HIS M  3 132 ? -13.379  18.025  -11.308 1.00 53.87  ? 264  HIS A N     1 
ATOM   4408  C  CA    . HIS M  3 132 ? -12.149  17.258  -11.254 1.00 55.14  ? 264  HIS A CA    1 
ATOM   4409  C  C     . HIS M  3 132 ? -11.682  16.819  -12.631 1.00 53.46  ? 264  HIS A C     1 
ATOM   4410  O  O     . HIS M  3 132 ? -10.967  15.829  -12.789 1.00 53.95  ? 264  HIS A O     1 
ATOM   4411  C  CB    . HIS M  3 132 ? -12.342  16.072  -10.312 1.00 58.56  ? 264  HIS A CB    1 
ATOM   4412  C  CG    . HIS M  3 132 ? -12.625  16.487  -8.902  1.00 63.09  ? 264  HIS A CG    1 
ATOM   4413  N  ND1   . HIS M  3 132 ? -13.713  17.263  -8.564  1.00 64.83  ? 264  HIS A ND1   1 
ATOM   4414  C  CD2   . HIS M  3 132 ? -11.933  16.288  -7.753  1.00 65.73  ? 264  HIS A CD2   1 
ATOM   4415  C  CE1   . HIS M  3 132 ? -13.679  17.526  -7.268  1.00 65.95  ? 264  HIS A CE1   1 
ATOM   4416  N  NE2   . HIS M  3 132 ? -12.609  16.947  -6.752  1.00 66.54  ? 264  HIS A NE2   1 
ATOM   4417  N  N     . SER M  3 133 ? -12.073  17.600  -13.623 1.00 51.03  ? 265  SER A N     1 
ATOM   4418  C  CA    . SER M  3 133 ? -11.724  17.338  -15.005 1.00 49.75  ? 265  SER A CA    1 
ATOM   4419  C  C     . SER M  3 133 ? -10.223  17.409  -15.351 1.00 46.18  ? 265  SER A C     1 
ATOM   4420  O  O     . SER M  3 133 ? -9.853   17.205  -16.510 1.00 46.07  ? 265  SER A O     1 
ATOM   4421  C  CB    . SER M  3 133 ? -12.507  18.299  -15.890 1.00 52.61  ? 265  SER A CB    1 
ATOM   4422  O  OG    . SER M  3 133 ? -12.336  19.627  -15.418 1.00 57.31  ? 265  SER A OG    1 
ATOM   4423  N  N     . GLY M  3 134 ? -9.368   17.719  -14.376 1.00 41.86  ? 266  GLY A N     1 
ATOM   4424  C  CA    . GLY M  3 134 ? -7.934   17.751  -14.645 1.00 37.35  ? 266  GLY A CA    1 
ATOM   4425  C  C     . GLY M  3 134 ? -7.227   19.058  -14.974 1.00 34.26  ? 266  GLY A C     1 
ATOM   4426  O  O     . GLY M  3 134 ? -6.029   19.072  -15.256 1.00 32.38  ? 266  GLY A O     1 
ATOM   4427  N  N     . PHE M  3 135 ? -7.947   20.165  -14.929 1.00 32.69  ? 267  PHE A N     1 
ATOM   4428  C  CA    . PHE M  3 135 ? -7.337   21.444  -15.238 1.00 31.89  ? 267  PHE A CA    1 
ATOM   4429  C  C     . PHE M  3 135 ? -6.458   21.941  -14.117 1.00 30.84  ? 267  PHE A C     1 
ATOM   4430  O  O     . PHE M  3 135 ? -6.950   22.296  -13.053 1.00 32.71  ? 267  PHE A O     1 
ATOM   4431  C  CB    . PHE M  3 135 ? -8.416   22.482  -15.534 1.00 33.40  ? 267  PHE A CB    1 
ATOM   4432  C  CG    . PHE M  3 135 ? -9.229   22.153  -16.737 1.00 35.50  ? 267  PHE A CG    1 
ATOM   4433  C  CD1   . PHE M  3 135 ? -10.164  21.128  -16.696 1.00 36.01  ? 267  PHE A CD1   1 
ATOM   4434  C  CD2   . PHE M  3 135 ? -9.011   22.815  -17.937 1.00 36.23  ? 267  PHE A CD2   1 
ATOM   4435  C  CE1   . PHE M  3 135 ? -10.870  20.760  -17.835 1.00 36.40  ? 267  PHE A CE1   1 
ATOM   4436  C  CE2   . PHE M  3 135 ? -9.710   22.455  -19.080 1.00 37.58  ? 267  PHE A CE2   1 
ATOM   4437  C  CZ    . PHE M  3 135 ? -10.645  21.422  -19.028 1.00 36.82  ? 267  PHE A CZ    1 
ATOM   4438  N  N     . ILE M  3 136 ? -5.155   21.985  -14.364 1.00 28.71  ? 268  ILE A N     1 
ATOM   4439  C  CA    . ILE M  3 136 ? -4.206   22.450  -13.361 1.00 25.29  ? 268  ILE A CA    1 
ATOM   4440  C  C     . ILE M  3 136 ? -4.658   23.660  -12.587 1.00 22.70  ? 268  ILE A C     1 
ATOM   4441  O  O     . ILE M  3 136 ? -4.894   23.590  -11.388 1.00 19.98  ? 268  ILE A O     1 
ATOM   4442  C  CB    . ILE M  3 136 ? -2.876   22.817  -13.980 1.00 25.98  ? 268  ILE A CB    1 
ATOM   4443  C  CG1   . ILE M  3 136 ? -2.148   21.558  -14.424 1.00 28.76  ? 268  ILE A CG1   1 
ATOM   4444  C  CG2   . ILE M  3 136 ? -2.036   23.533  -12.969 1.00 26.67  ? 268  ILE A CG2   1 
ATOM   4445  C  CD1   . ILE M  3 136 ? -1.961   20.565  -13.295 1.00 30.75  ? 268  ILE A CD1   1 
ATOM   4446  N  N     . GLY M  3 137 ? -4.753   24.779  -13.283 1.00 22.82  ? 269  GLY A N     1 
ATOM   4447  C  CA    . GLY M  3 137 ? -5.159   26.008  -12.633 1.00 26.37  ? 269  GLY A CA    1 
ATOM   4448  C  C     . GLY M  3 137 ? -6.203   25.816  -11.550 1.00 28.04  ? 269  GLY A C     1 
ATOM   4449  O  O     . GLY M  3 137 ? -6.086   26.336  -10.440 1.00 27.64  ? 269  GLY A O     1 
ATOM   4450  N  N     . ASN M  3 138 ? -7.240   25.061  -11.867 1.00 29.43  ? 270  ASN A N     1 
ATOM   4451  C  CA    . ASN M  3 138 ? -8.279   24.848  -10.891 1.00 31.18  ? 270  ASN A CA    1 
ATOM   4452  C  C     . ASN M  3 138 ? -7.825   23.933  -9.777  1.00 31.97  ? 270  ASN A C     1 
ATOM   4453  O  O     . ASN M  3 138 ? -8.126   24.190  -8.618  1.00 32.64  ? 270  ASN A O     1 
ATOM   4454  C  CB    . ASN M  3 138 ? -9.530   24.286  -11.556 1.00 33.37  ? 270  ASN A CB    1 
ATOM   4455  C  CG    . ASN M  3 138 ? -10.626  23.971  -10.558 1.00 34.70  ? 270  ASN A CG    1 
ATOM   4456  O  OD1   . ASN M  3 138 ? -10.875  22.802  -10.260 1.00 36.65  ? 270  ASN A OD1   1 
ATOM   4457  N  ND2   . ASN M  3 138 ? -11.280  25.012  -10.026 1.00 33.07  ? 270  ASN A ND2   1 
ATOM   4458  N  N     . GLU M  3 139 ? -7.085   22.875  -10.096 1.00 33.22  ? 271  GLU A N     1 
ATOM   4459  C  CA    . GLU M  3 139 ? -6.663   21.984  -9.024  1.00 33.80  ? 271  GLU A CA    1 
ATOM   4460  C  C     . GLU M  3 139 ? -5.657   22.606  -8.054  1.00 32.02  ? 271  GLU A C     1 
ATOM   4461  O  O     . GLU M  3 139 ? -5.605   22.241  -6.878  1.00 30.62  ? 271  GLU A O     1 
ATOM   4462  C  CB    . GLU M  3 139 ? -6.187   20.623  -9.572  1.00 36.00  ? 271  GLU A CB    1 
ATOM   4463  C  CG    . GLU M  3 139 ? -4.939   20.548  -10.431 1.00 40.66  ? 271  GLU A CG    1 
ATOM   4464  C  CD    . GLU M  3 139 ? -4.684   19.100  -10.924 1.00 44.46  ? 271  GLU A CD    1 
ATOM   4465  O  OE1   . GLU M  3 139 ? -3.542   18.777  -11.339 1.00 46.75  ? 271  GLU A OE1   1 
ATOM   4466  O  OE2   . GLU M  3 139 ? -5.634   18.277  -10.900 1.00 44.66  ? 271  GLU A OE2   1 
ATOM   4467  N  N     . GLU M  3 140 ? -4.889   23.576  -8.522  1.00 31.19  ? 272  GLU A N     1 
ATOM   4468  C  CA    . GLU M  3 140 ? -3.948   24.226  -7.631  1.00 31.69  ? 272  GLU A CA    1 
ATOM   4469  C  C     . GLU M  3 140 ? -4.715   25.197  -6.763  1.00 29.63  ? 272  GLU A C     1 
ATOM   4470  O  O     . GLU M  3 140 ? -4.377   25.413  -5.613  1.00 30.34  ? 272  GLU A O     1 
ATOM   4471  C  CB    . GLU M  3 140 ? -2.875   24.970  -8.419  1.00 36.07  ? 272  GLU A CB    1 
ATOM   4472  C  CG    . GLU M  3 140 ? -1.729   24.084  -8.920  1.00 41.48  ? 272  GLU A CG    1 
ATOM   4473  C  CD    . GLU M  3 140 ? -0.787   23.646  -7.807  1.00 44.41  ? 272  GLU A CD    1 
ATOM   4474  O  OE1   . GLU M  3 140 ? -0.017   24.497  -7.302  1.00 47.14  ? 272  GLU A OE1   1 
ATOM   4475  O  OE2   . GLU M  3 140 ? -0.823   22.453  -7.435  1.00 45.61  ? 272  GLU A OE2   1 
ATOM   4476  N  N     . ALA M  3 141 ? -5.763   25.788  -7.305  1.00 28.25  ? 273  ALA A N     1 
ATOM   4477  C  CA    . ALA M  3 141 ? -6.537   26.722  -6.510  1.00 26.94  ? 273  ALA A CA    1 
ATOM   4478  C  C     . ALA M  3 141 ? -7.341   25.942  -5.504  1.00 25.44  ? 273  ALA A C     1 
ATOM   4479  O  O     . ALA M  3 141 ? -7.603   26.425  -4.414  1.00 25.59  ? 273  ALA A O     1 
ATOM   4480  C  CB    . ALA M  3 141 ? -7.453   27.533  -7.385  1.00 30.30  ? 273  ALA A CB    1 
ATOM   4481  N  N     . ASP M  3 142 ? -7.749   24.738  -5.884  1.00 24.62  ? 274  ASP A N     1 
ATOM   4482  C  CA    . ASP M  3 142 ? -8.505   23.881  -4.979  1.00 25.43  ? 274  ASP A CA    1 
ATOM   4483  C  C     . ASP M  3 142 ? -7.527   23.564  -3.873  1.00 25.50  ? 274  ASP A C     1 
ATOM   4484  O  O     . ASP M  3 142 ? -7.811   23.750  -2.685  1.00 23.78  ? 274  ASP A O     1 
ATOM   4485  C  CB    . ASP M  3 142 ? -8.916   22.579  -5.677  1.00 26.69  ? 274  ASP A CB    1 
ATOM   4486  C  CG    . ASP M  3 142 ? -9.401   21.503  -4.697  1.00 26.33  ? 274  ASP A CG    1 
ATOM   4487  O  OD1   . ASP M  3 142 ? -10.616  21.221  -4.659  1.00 28.00  ? 274  ASP A OD1   1 
ATOM   4488  O  OD2   . ASP M  3 142 ? -8.569   20.933  -3.966  1.00 24.60  ? 274  ASP A OD2   1 
ATOM   4489  N  N     . ARG M  3 143 ? -6.359   23.084  -4.284  1.00 25.66  ? 275  ARG A N     1 
ATOM   4490  C  CA    . ARG M  3 143 ? -5.333   22.745  -3.327  1.00 26.93  ? 275  ARG A CA    1 
ATOM   4491  C  C     . ARG M  3 143 ? -5.264   23.871  -2.318  1.00 26.04  ? 275  ARG A C     1 
ATOM   4492  O  O     . ARG M  3 143 ? -5.414   23.640  -1.129  1.00 28.61  ? 275  ARG A O     1 
ATOM   4493  C  CB    . ARG M  3 143 ? -3.986   22.612  -4.012  1.00 31.05  ? 275  ARG A CB    1 
ATOM   4494  C  CG    . ARG M  3 143 ? -3.029   21.706  -3.290  1.00 36.27  ? 275  ARG A CG    1 
ATOM   4495  C  CD    . ARG M  3 143 ? -1.606   22.045  -3.651  1.00 40.27  ? 275  ARG A CD    1 
ATOM   4496  N  NE    . ARG M  3 143 ? -1.132   23.161  -2.834  1.00 45.39  ? 275  ARG A NE    1 
ATOM   4497  C  CZ    . ARG M  3 143 ? -0.799   24.356  -3.308  1.00 46.94  ? 275  ARG A CZ    1 
ATOM   4498  N  NH1   . ARG M  3 143 ? -0.891   24.603  -4.611  1.00 48.29  ? 275  ARG A NH1   1 
ATOM   4499  N  NH2   . ARG M  3 143 ? -0.359   25.298  -2.480  1.00 48.02  ? 275  ARG A NH2   1 
ATOM   4500  N  N     . LEU M  3 144 ? -5.077   25.097  -2.794  1.00 22.62  ? 276  LEU A N     1 
ATOM   4501  C  CA    . LEU M  3 144 ? -4.972   26.222  -1.888  1.00 20.98  ? 276  LEU A CA    1 
ATOM   4502  C  C     . LEU M  3 144 ? -6.172   26.425  -0.975  1.00 22.14  ? 276  LEU A C     1 
ATOM   4503  O  O     . LEU M  3 144 ? -6.021   26.551  0.241   1.00 20.91  ? 276  LEU A O     1 
ATOM   4504  C  CB    . LEU M  3 144 ? -4.688   27.505  -2.662  1.00 20.60  ? 276  LEU A CB    1 
ATOM   4505  C  CG    . LEU M  3 144 ? -3.295   27.717  -3.279  1.00 20.82  ? 276  LEU A CG    1 
ATOM   4506  C  CD1   . LEU M  3 144 ? -3.216   29.145  -3.791  1.00 21.25  ? 276  LEU A CD1   1 
ATOM   4507  C  CD2   . LEU M  3 144 ? -2.177   27.490  -2.266  1.00 19.86  ? 276  LEU A CD2   1 
ATOM   4508  N  N     . ALA M  3 145 ? -7.366   26.454  -1.551  1.00 25.14  ? 277  ALA A N     1 
ATOM   4509  C  CA    . ALA M  3 145 ? -8.576   26.661  -0.762  1.00 27.29  ? 277  ALA A CA    1 
ATOM   4510  C  C     . ALA M  3 145 ? -8.720   25.688  0.416   1.00 29.25  ? 277  ALA A C     1 
ATOM   4511  O  O     . ALA M  3 145 ? -9.395   26.016  1.391   1.00 29.05  ? 277  ALA A O     1 
ATOM   4512  C  CB    . ALA M  3 145 ? -9.806   26.587  -1.660  1.00 26.06  ? 277  ALA A CB    1 
ATOM   4513  N  N     . ARG M  3 146 ? -8.110   24.502  0.336   1.00 30.22  ? 278  ARG A N     1 
ATOM   4514  C  CA    . ARG M  3 146 ? -8.202   23.559  1.447   1.00 33.00  ? 278  ARG A CA    1 
ATOM   4515  C  C     . ARG M  3 146 ? -7.253   23.986  2.545   1.00 35.05  ? 278  ARG A C     1 
ATOM   4516  O  O     . ARG M  3 146 ? -7.630   24.076  3.708   1.00 36.79  ? 278  ARG A O     1 
ATOM   4517  C  CB    . ARG M  3 146 ? -7.820   22.152  1.031   1.00 36.42  ? 278  ARG A CB    1 
ATOM   4518  C  CG    . ARG M  3 146 ? -8.802   21.446  0.129   1.00 43.09  ? 278  ARG A CG    1 
ATOM   4519  C  CD    . ARG M  3 146 ? -8.682   19.939  0.338   1.00 47.51  ? 278  ARG A CD    1 
ATOM   4520  N  NE    . ARG M  3 146 ? -8.823   19.159  -0.892  1.00 52.41  ? 278  ARG A NE    1 
ATOM   4521  C  CZ    . ARG M  3 146 ? -9.915   19.131  -1.649  1.00 53.80  ? 278  ARG A CZ    1 
ATOM   4522  N  NH1   . ARG M  3 146 ? -10.978  19.852  -1.306  1.00 53.95  ? 278  ARG A NH1   1 
ATOM   4523  N  NH2   . ARG M  3 146 ? -9.949   18.367  -2.739  1.00 54.47  ? 278  ARG A NH2   1 
ATOM   4524  N  N     . GLU M  3 147 ? -6.008   24.242  2.167   1.00 35.47  ? 279  GLU A N     1 
ATOM   4525  C  CA    . GLU M  3 147 ? -5.004   24.671  3.119   1.00 35.94  ? 279  GLU A CA    1 
ATOM   4526  C  C     . GLU M  3 147 ? -5.490   25.924  3.824   1.00 35.39  ? 279  GLU A C     1 
ATOM   4527  O  O     . GLU M  3 147 ? -4.906   26.349  4.816   1.00 35.21  ? 279  GLU A O     1 
ATOM   4528  C  CB    . GLU M  3 147 ? -3.685   24.960  2.397   1.00 37.94  ? 279  GLU A CB    1 
ATOM   4529  C  CG    . GLU M  3 147 ? -3.034   23.727  1.781   1.00 43.61  ? 279  GLU A CG    1 
ATOM   4530  C  CD    . GLU M  3 147 ? -2.546   22.739  2.833   1.00 47.33  ? 279  GLU A CD    1 
ATOM   4531  O  OE1   . GLU M  3 147 ? -2.368   21.536  2.513   1.00 48.22  ? 279  GLU A OE1   1 
ATOM   4532  O  OE2   . GLU M  3 147 ? -2.331   23.175  3.986   1.00 49.63  ? 279  GLU A OE2   1 
ATOM   4533  N  N     . GLY M  3 148 ? -6.558   26.517  3.304   1.00 35.54  ? 280  GLY A N     1 
ATOM   4534  C  CA    . GLY M  3 148 ? -7.093   27.725  3.902   1.00 38.30  ? 280  GLY A CA    1 
ATOM   4535  C  C     . GLY M  3 148 ? -8.067   27.391  5.004   1.00 40.51  ? 280  GLY A C     1 
ATOM   4536  O  O     . GLY M  3 148 ? -8.321   28.185  5.915   1.00 39.63  ? 280  GLY A O     1 
ATOM   4537  N  N     . ALA M  3 149 ? -8.621   26.194  4.911   1.00 42.89  ? 281  ALA A N     1 
ATOM   4538  C  CA    . ALA M  3 149 ? -9.570   25.727  5.896   1.00 47.52  ? 281  ALA A CA    1 
ATOM   4539  C  C     . ALA M  3 149 ? -8.895   24.649  6.731   1.00 51.66  ? 281  ALA A C     1 
ATOM   4540  O  O     . ALA M  3 149 ? -9.565   23.871  7.406   1.00 52.82  ? 281  ALA A O     1 
ATOM   4541  C  CB    . ALA M  3 149 ? -10.785  25.163  5.197   1.00 46.02  ? 281  ALA A CB    1 
ATOM   4542  N  N     . LYS M  3 150 ? -7.564   24.611  6.689   1.00 56.29  ? 282  LYS A N     1 
ATOM   4543  C  CA    . LYS M  3 150 ? -6.807   23.597  7.417   1.00 60.11  ? 282  LYS A CA    1 
ATOM   4544  C  C     . LYS M  3 150 ? -7.237   23.412  8.856   1.00 62.46  ? 282  LYS A C     1 
ATOM   4545  O  O     . LYS M  3 150 ? -7.549   24.366  9.553   1.00 61.54  ? 282  LYS A O     1 
ATOM   4546  C  CB    . LYS M  3 150 ? -5.306   23.884  7.356   1.00 61.48  ? 282  LYS A CB    1 
ATOM   4547  C  CG    . LYS M  3 150 ? -4.476   22.940  8.222   1.00 62.16  ? 282  LYS A CG    1 
ATOM   4548  C  CD    . LYS M  3 150 ? -3.033   22.824  7.745   1.00 61.90  ? 282  LYS A CD    1 
ATOM   4549  C  CE    . LYS M  3 150 ? -2.959   22.009  6.470   1.00 62.48  ? 282  LYS A CE    1 
ATOM   4550  N  NZ    . LYS M  3 150 ? -1.561   21.622  6.122   1.00 63.62  ? 282  LYS A NZ    1 
ATOM   4551  N  N     . GLN M  3 151 ? -7.224   22.154  9.279   1.00 67.22  ? 283  GLN A N     1 
ATOM   4552  C  CA    . GLN M  3 151 ? -7.642   21.736  10.608  1.00 72.55  ? 283  GLN A CA    1 
ATOM   4553  C  C     . GLN M  3 151 ? -6.875   22.298  11.789  1.00 76.23  ? 283  GLN A C     1 
ATOM   4554  O  O     . GLN M  3 151 ? -7.404   22.311  12.898  1.00 77.71  ? 283  GLN A O     1 
ATOM   4555  C  CB    . GLN M  3 151 ? -7.636   20.217  10.683  1.00 72.71  ? 283  GLN A CB    1 
ATOM   4556  N  N     . SER M  3 152 ? -5.643   22.746  11.564  1.00 80.01  ? 284  SER A N     1 
ATOM   4557  C  CA    . SER M  3 152 ? -4.803   23.297  12.636  1.00 84.09  ? 284  SER A CA    1 
ATOM   4558  C  C     . SER M  3 152 ? -4.070   22.177  13.384  1.00 86.72  ? 284  SER A C     1 
ATOM   4559  O  O     . SER M  3 152 ? -3.095   22.429  14.091  1.00 87.43  ? 284  SER A O     1 
ATOM   4560  C  CB    . SER M  3 152 ? -5.640   24.107  13.643  1.00 83.98  ? 284  SER A CB    1 
ATOM   4561  O  OG    . SER M  3 152 ? -6.456   25.077  13.007  1.00 83.37  ? 284  SER A OG    1 
ATOM   4562  N  N     . GLU M  3 153 ? -4.558   20.948  13.235  1.00 89.43  ? 285  GLU A N     1 
ATOM   4563  C  CA    . GLU M  3 153 ? -3.951   19.782  13.875  1.00 92.03  ? 285  GLU A CA    1 
ATOM   4564  C  C     . GLU M  3 153 ? -2.447   19.791  13.559  1.00 93.33  ? 285  GLU A C     1 
ATOM   4565  O  O     . GLU M  3 153 ? -1.611   19.960  14.454  1.00 93.18  ? 285  GLU A O     1 
ATOM   4566  C  CB    . GLU M  3 153 ? -4.607   18.514  13.324  1.00 92.92  ? 285  GLU A CB    1 
ATOM   4567  C  CG    . GLU M  3 153 ? -4.150   17.216  13.953  1.00 94.71  ? 285  GLU A CG    1 
ATOM   4568  C  CD    . GLU M  3 153 ? -4.635   16.008  13.171  1.00 96.27  ? 285  GLU A CD    1 
ATOM   4569  O  OE1   . GLU M  3 153 ? -4.119   15.764  12.056  1.00 96.61  ? 285  GLU A OE1   1 
ATOM   4570  O  OE2   . GLU M  3 153 ? -5.542   15.307  13.666  1.00 98.05  ? 285  GLU A OE2   1 
ATOM   4571  N  N     . ASP M  3 154 ? -2.125   19.601  12.279  1.00 94.92  ? 286  ASP A N     1 
ATOM   4572  C  CA    . ASP M  3 154 ? -0.747   19.622  11.781  1.00 96.13  ? 286  ASP A CA    1 
ATOM   4573  C  C     . ASP M  3 154 ? -0.704   19.982  10.285  1.00 96.88  ? 286  ASP A C     1 
ATOM   4574  O  O     . ASP M  3 154 ? -0.260   19.140  9.473   1.00 97.76  ? 286  ASP A O     1 
ATOM   4575  C  CB    . ASP M  3 154 ? -0.022   18.279  12.033  1.00 95.85  ? 286  ASP A CB    1 
ATOM   4576  C  CG    . ASP M  3 154 ? -0.722   17.088  11.401  1.00 96.09  ? 286  ASP A CG    1 
ATOM   4577  O  OD1   . ASP M  3 154 ? -1.682   16.572  12.009  1.00 96.60  ? 286  ASP A OD1   1 
ATOM   4578  O  OD2   . ASP M  3 154 ? -0.312   16.664  10.298  1.00 96.16  ? 286  ASP A OD2   1 
ATOM   4579  O  OXT   . ASP M  3 154 ? -1.120   21.116  9.941   1.00 96.67  ? 286  ASP A OXT   1 
ATOM   4580  N  N     . SER N  3 2   ? -25.298  -31.924 9.289   1.00 81.40  ? 134  SER B N     1 
ATOM   4581  C  CA    . SER N  3 2   ? -26.431  -31.174 8.675   1.00 83.25  ? 134  SER B CA    1 
ATOM   4582  C  C     . SER N  3 2   ? -26.115  -30.795 7.227   1.00 85.31  ? 134  SER B C     1 
ATOM   4583  O  O     . SER N  3 2   ? -24.969  -30.498 6.895   1.00 86.44  ? 134  SER B O     1 
ATOM   4584  C  CB    . SER N  3 2   ? -26.721  -29.904 9.498   1.00 81.33  ? 134  SER B CB    1 
ATOM   4585  O  OG    . SER N  3 2   ? -27.698  -29.071 8.892   1.00 76.84  ? 134  SER B OG    1 
ATOM   4586  N  N     . HIS N  3 3   ? -27.135  -30.835 6.371   1.00 87.40  ? 135  HIS B N     1 
ATOM   4587  C  CA    . HIS N  3 3   ? -27.023  -30.458 4.957   1.00 88.95  ? 135  HIS B CA    1 
ATOM   4588  C  C     . HIS N  3 3   ? -25.824  -31.050 4.187   1.00 87.73  ? 135  HIS B C     1 
ATOM   4589  O  O     . HIS N  3 3   ? -24.792  -31.389 4.767   1.00 86.87  ? 135  HIS B O     1 
ATOM   4590  C  CB    . HIS N  3 3   ? -27.023  -28.921 4.859   1.00 92.67  ? 135  HIS B CB    1 
ATOM   4591  C  CG    . HIS N  3 3   ? -27.602  -28.382 3.583   1.00 96.20  ? 135  HIS B CG    1 
ATOM   4592  N  ND1   . HIS N  3 3   ? -26.962  -28.488 2.365   1.00 97.36  ? 135  HIS B ND1   1 
ATOM   4593  C  CD2   . HIS N  3 3   ? -28.755  -27.711 3.342   1.00 97.33  ? 135  HIS B CD2   1 
ATOM   4594  C  CE1   . HIS N  3 3   ? -27.693  -27.905 1.432   1.00 97.95  ? 135  HIS B CE1   1 
ATOM   4595  N  NE2   . HIS N  3 3   ? -28.786  -27.425 1.998   1.00 98.13  ? 135  HIS B NE2   1 
ATOM   4596  N  N     . MET N  3 4   ? -25.980  -31.145 2.866   1.00 86.59  ? 136  MET B N     1 
ATOM   4597  C  CA    . MET N  3 4   ? -24.975  -31.716 1.966   1.00 84.86  ? 136  MET B CA    1 
ATOM   4598  C  C     . MET N  3 4   ? -23.832  -30.780 1.568   1.00 82.74  ? 136  MET B C     1 
ATOM   4599  O  O     . MET N  3 4   ? -22.997  -30.442 2.398   1.00 83.15  ? 136  MET B O     1 
ATOM   4600  C  CB    . MET N  3 4   ? -25.670  -32.222 0.703   1.00 86.69  ? 136  MET B CB    1 
ATOM   4601  C  CG    . MET N  3 4   ? -25.130  -33.529 0.165   1.00 89.13  ? 136  MET B CG    1 
ATOM   4602  S  SD    . MET N  3 4   ? -23.344  -33.539 -0.071  1.00 91.05  ? 136  MET B SD    1 
ATOM   4603  C  CE    . MET N  3 4   ? -22.919  -35.165 0.658   1.00 90.46  ? 136  MET B CE    1 
ATOM   4604  N  N     . GLY N  3 5   ? -23.803  -30.387 0.291   1.00 80.74  ? 137  GLY B N     1 
ATOM   4605  C  CA    . GLY N  3 5   ? -22.770  -29.503 -0.260  1.00 78.00  ? 137  GLY B CA    1 
ATOM   4606  C  C     . GLY N  3 5   ? -23.063  -29.351 -1.748  1.00 75.72  ? 137  GLY B C     1 
ATOM   4607  O  O     . GLY N  3 5   ? -23.560  -30.304 -2.345  1.00 77.26  ? 137  GLY B O     1 
ATOM   4608  N  N     . ASP N  3 6   ? -22.743  -28.220 -2.380  1.00 72.25  ? 138  ASP B N     1 
ATOM   4609  C  CA    . ASP N  3 6   ? -23.135  -28.081 -3.788  1.00 68.88  ? 138  ASP B CA    1 
ATOM   4610  C  C     . ASP N  3 6   ? -22.372  -27.243 -4.831  1.00 65.87  ? 138  ASP B C     1 
ATOM   4611  O  O     . ASP N  3 6   ? -22.472  -27.525 -6.026  1.00 65.85  ? 138  ASP B O     1 
ATOM   4612  C  CB    . ASP N  3 6   ? -24.610  -27.635 -3.820  1.00 71.50  ? 138  ASP B CB    1 
ATOM   4613  C  CG    . ASP N  3 6   ? -25.003  -26.751 -2.606  1.00 72.58  ? 138  ASP B CG    1 
ATOM   4614  O  OD1   . ASP N  3 6   ? -24.986  -27.249 -1.456  1.00 72.47  ? 138  ASP B OD1   1 
ATOM   4615  O  OD2   . ASP N  3 6   ? -25.336  -25.558 -2.800  1.00 73.05  ? 138  ASP B OD2   1 
ATOM   4616  N  N     . PHE N  3 7   ? -21.628  -26.232 -4.385  1.00 61.48  ? 139  PHE B N     1 
ATOM   4617  C  CA    . PHE N  3 7   ? -20.890  -25.281 -5.245  1.00 55.91  ? 139  PHE B CA    1 
ATOM   4618  C  C     . PHE N  3 7   ? -19.385  -25.494 -5.432  1.00 53.70  ? 139  PHE B C     1 
ATOM   4619  O  O     . PHE N  3 7   ? -18.795  -26.449 -4.934  1.00 53.26  ? 139  PHE B O     1 
ATOM   4620  C  CB    . PHE N  3 7   ? -21.034  -23.918 -4.630  1.00 52.95  ? 139  PHE B CB    1 
ATOM   4621  C  CG    . PHE N  3 7   ? -20.681  -23.933 -3.187  1.00 49.68  ? 139  PHE B CG    1 
ATOM   4622  C  CD1   . PHE N  3 7   ? -21.579  -24.442 -2.255  1.00 47.02  ? 139  PHE B CD1   1 
ATOM   4623  C  CD2   . PHE N  3 7   ? -19.411  -23.565 -2.766  1.00 48.39  ? 139  PHE B CD2   1 
ATOM   4624  C  CE1   . PHE N  3 7   ? -21.216  -24.607 -0.943  1.00 45.88  ? 139  PHE B CE1   1 
ATOM   4625  C  CE2   . PHE N  3 7   ? -19.040  -23.728 -1.445  1.00 47.94  ? 139  PHE B CE2   1 
ATOM   4626  C  CZ    . PHE N  3 7   ? -19.949  -24.247 -0.531  1.00 46.55  ? 139  PHE B CZ    1 
ATOM   4627  N  N     . VAL N  3 8   ? -18.774  -24.546 -6.140  1.00 51.91  ? 140  VAL B N     1 
ATOM   4628  C  CA    . VAL N  3 8   ? -17.327  -24.542 -6.378  1.00 50.83  ? 140  VAL B CA    1 
ATOM   4629  C  C     . VAL N  3 8   ? -16.803  -23.161 -5.957  1.00 49.27  ? 140  VAL B C     1 
ATOM   4630  O  O     . VAL N  3 8   ? -17.515  -22.159 -6.076  1.00 50.04  ? 140  VAL B O     1 
ATOM   4631  C  CB    . VAL N  3 8   ? -16.972  -24.792 -7.866  1.00 49.95  ? 140  VAL B CB    1 
ATOM   4632  C  CG1   . VAL N  3 8   ? -17.644  -26.047 -8.338  1.00 51.16  ? 140  VAL B CG1   1 
ATOM   4633  C  CG2   . VAL N  3 8   ? -17.391  -23.620 -8.723  1.00 50.53  ? 140  VAL B CG2   1 
ATOM   4634  N  N     . VAL N  3 9   ? -15.569  -23.108 -5.461  1.00 45.59  ? 141  VAL B N     1 
ATOM   4635  C  CA    . VAL N  3 9   ? -14.987  -21.854 -5.004  1.00 40.49  ? 141  VAL B CA    1 
ATOM   4636  C  C     . VAL N  3 9   ? -14.044  -21.273 -6.029  1.00 38.51  ? 141  VAL B C     1 
ATOM   4637  O  O     . VAL N  3 9   ? -13.479  -22.004 -6.835  1.00 39.47  ? 141  VAL B O     1 
ATOM   4638  C  CB    . VAL N  3 9   ? -14.199  -22.061 -3.711  1.00 39.53  ? 141  VAL B CB    1 
ATOM   4639  C  CG1   . VAL N  3 9   ? -13.709  -20.734 -3.193  1.00 39.68  ? 141  VAL B CG1   1 
ATOM   4640  C  CG2   . VAL N  3 9   ? -15.062  -22.754 -2.686  1.00 38.19  ? 141  VAL B CG2   1 
ATOM   4641  N  N     . VAL N  3 10  ? -13.873  -19.959 -5.995  1.00 35.90  ? 142  VAL B N     1 
ATOM   4642  C  CA    . VAL N  3 10  ? -12.968  -19.292 -6.921  1.00 35.83  ? 142  VAL B CA    1 
ATOM   4643  C  C     . VAL N  3 10  ? -12.538  -17.927 -6.394  1.00 35.67  ? 142  VAL B C     1 
ATOM   4644  O  O     . VAL N  3 10  ? -13.350  -17.160 -5.866  1.00 36.96  ? 142  VAL B O     1 
ATOM   4645  C  CB    . VAL N  3 10  ? -13.614  -19.105 -8.305  1.00 35.61  ? 142  VAL B CB    1 
ATOM   4646  C  CG1   . VAL N  3 10  ? -14.942  -18.417 -8.143  1.00 38.48  ? 142  VAL B CG1   1 
ATOM   4647  C  CG2   . VAL N  3 10  ? -12.699  -18.282 -9.218  1.00 34.70  ? 142  VAL B CG2   1 
ATOM   4648  N  N     . TYR N  3 11  ? -11.255  -17.627 -6.544  1.00 33.39  ? 143  TYR B N     1 
ATOM   4649  C  CA    . TYR N  3 11  ? -10.725  -16.363 -6.086  1.00 31.78  ? 143  TYR B CA    1 
ATOM   4650  C  C     . TYR N  3 11  ? -10.447  -15.497 -7.299  1.00 31.92  ? 143  TYR B C     1 
ATOM   4651  O  O     . TYR N  3 11  ? -10.010  -16.003 -8.327  1.00 32.12  ? 143  TYR B O     1 
ATOM   4652  C  CB    . TYR N  3 11  ? -9.445   -16.615 -5.294  1.00 31.46  ? 143  TYR B CB    1 
ATOM   4653  C  CG    . TYR N  3 11  ? -9.684   -17.227 -3.926  1.00 32.17  ? 143  TYR B CG    1 
ATOM   4654  C  CD1   . TYR N  3 11  ? -9.960   -16.425 -2.817  1.00 31.55  ? 143  TYR B CD1   1 
ATOM   4655  C  CD2   . TYR N  3 11  ? -9.656   -18.609 -3.742  1.00 33.12  ? 143  TYR B CD2   1 
ATOM   4656  C  CE1   . TYR N  3 11  ? -10.201  -16.982 -1.564  1.00 31.24  ? 143  TYR B CE1   1 
ATOM   4657  C  CE2   . TYR N  3 11  ? -9.897   -19.178 -2.489  1.00 32.53  ? 143  TYR B CE2   1 
ATOM   4658  C  CZ    . TYR N  3 11  ? -10.168  -18.357 -1.407  1.00 31.90  ? 143  TYR B CZ    1 
ATOM   4659  O  OH    . TYR N  3 11  ? -10.406  -18.909 -0.169  1.00 32.13  ? 143  TYR B OH    1 
ATOM   4660  N  N     . THR N  3 12  ? -10.716  -14.198 -7.193  1.00 31.96  ? 144  THR B N     1 
ATOM   4661  C  CA    . THR N  3 12  ? -10.456  -13.286 -8.307  1.00 33.51  ? 144  THR B CA    1 
ATOM   4662  C  C     . THR N  3 12  ? -9.820   -11.964 -7.862  1.00 33.70  ? 144  THR B C     1 
ATOM   4663  O  O     . THR N  3 12  ? -10.133  -11.436 -6.782  1.00 33.30  ? 144  THR B O     1 
ATOM   4664  C  CB    . THR N  3 12  ? -11.746  -12.960 -9.083  1.00 34.53  ? 144  THR B CB    1 
ATOM   4665  O  OG1   . THR N  3 12  ? -12.562  -12.069 -8.316  1.00 36.53  ? 144  THR B OG1   1 
ATOM   4666  C  CG2   . THR N  3 12  ? -12.526  -14.228 -9.357  1.00 37.12  ? 144  THR B CG2   1 
ATOM   4667  N  N     . ASP N  3 13  ? -8.924   -11.438 -8.699  1.00 32.91  ? 145  ASP B N     1 
ATOM   4668  C  CA    . ASP N  3 13  ? -8.250   -10.174 -8.404  1.00 32.37  ? 145  ASP B CA    1 
ATOM   4669  C  C     . ASP N  3 13  ? -7.970   -9.358  -9.662  1.00 31.97  ? 145  ASP B C     1 
ATOM   4670  O  O     . ASP N  3 13  ? -7.651   -9.912  -10.719 1.00 31.15  ? 145  ASP B O     1 
ATOM   4671  C  CB    . ASP N  3 13  ? -6.929   -10.415 -7.665  1.00 31.13  ? 145  ASP B CB    1 
ATOM   4672  C  CG    . ASP N  3 13  ? -6.185   -9.120  -7.368  1.00 30.15  ? 145  ASP B CG    1 
ATOM   4673  O  OD1   . ASP N  3 13  ? -6.635   -8.346  -6.498  1.00 29.00  ? 145  ASP B OD1   1 
ATOM   4674  O  OD2   . ASP N  3 13  ? -5.149   -8.866  -8.017  1.00 30.66  ? 145  ASP B OD2   1 
ATOM   4675  N  N     . GLY N  3 14  ? -8.099   -8.038  -9.521  1.00 31.84  ? 146  GLY B N     1 
ATOM   4676  C  CA    . GLY N  3 14  ? -7.864   -7.108  -10.612 1.00 32.92  ? 146  GLY B CA    1 
ATOM   4677  C  C     . GLY N  3 14  ? -6.964   -5.999  -10.106 1.00 33.94  ? 146  GLY B C     1 
ATOM   4678  O  O     . GLY N  3 14  ? -7.251   -5.404  -9.073  1.00 33.76  ? 146  GLY B O     1 
ATOM   4679  N  N     . CYS N  3 15  ? -5.885   -5.707  -10.828 1.00 35.56  ? 147  CYS B N     1 
ATOM   4680  C  CA    . CYS N  3 15  ? -4.932   -4.688  -10.394 1.00 36.99  ? 147  CYS B CA    1 
ATOM   4681  C  C     . CYS N  3 15  ? -4.547   -3.660  -11.440 1.00 38.83  ? 147  CYS B C     1 
ATOM   4682  O  O     . CYS N  3 15  ? -4.516   -3.949  -12.634 1.00 38.82  ? 147  CYS B O     1 
ATOM   4683  C  CB    . CYS N  3 15  ? -3.651   -5.370  -9.913  1.00 37.31  ? 147  CYS B CB    1 
ATOM   4684  S  SG    . CYS N  3 15  ? -2.711   -6.224  -11.222 1.00 35.37  ? 147  CYS B SG    1 
ATOM   4685  N  N     . CYS N  3 16  ? -4.240   -2.453  -10.983 1.00 42.01  ? 148  CYS B N     1 
ATOM   4686  C  CA    . CYS N  3 16  ? -3.815   -1.409  -11.898 1.00 46.60  ? 148  CYS B CA    1 
ATOM   4687  C  C     . CYS N  3 16  ? -2.526   -0.823  -11.350 1.00 51.38  ? 148  CYS B C     1 
ATOM   4688  O  O     . CYS N  3 16  ? -2.442   -0.412  -10.189 1.00 50.09  ? 148  CYS B O     1 
ATOM   4689  C  CB    . CYS N  3 16  ? -4.882   -0.332  -12.065 1.00 45.87  ? 148  CYS B CB    1 
ATOM   4690  S  SG    . CYS N  3 16  ? -4.896   0.376   -13.744 1.00 42.50  ? 148  CYS B SG    1 
ATOM   4691  N  N     . SER N  3 17  ? -1.532   -0.799  -12.229 1.00 57.33  ? 149  SER B N     1 
ATOM   4692  C  CA    . SER N  3 17  ? -0.171   -0.375  -11.946 1.00 62.76  ? 149  SER B CA    1 
ATOM   4693  C  C     . SER N  3 17  ? 0.206    1.082   -11.826 1.00 66.43  ? 149  SER B C     1 
ATOM   4694  O  O     . SER N  3 17  ? -0.623   1.964   -11.630 1.00 67.04  ? 149  SER B O     1 
ATOM   4695  C  CB    . SER N  3 17  ? 0.745    -0.964  -13.005 1.00 64.30  ? 149  SER B CB    1 
ATOM   4696  O  OG    . SER N  3 17  ? 0.528    -0.284  -14.234 1.00 66.73  ? 149  SER B OG    1 
ATOM   4697  N  N     . SER N  3 18  ? 1.518    1.270   -11.989 1.00 71.63  ? 150  SER B N     1 
ATOM   4698  C  CA    . SER N  3 18  ? 2.251    2.534   -11.928 1.00 75.51  ? 150  SER B CA    1 
ATOM   4699  C  C     . SER N  3 18  ? 1.446    3.746   -12.361 1.00 78.62  ? 150  SER B C     1 
ATOM   4700  O  O     . SER N  3 18  ? 1.469    4.134   -13.530 1.00 77.76  ? 150  SER B O     1 
ATOM   4701  C  CB    . SER N  3 18  ? 3.525    2.420   -12.786 1.00 74.56  ? 150  SER B CB    1 
ATOM   4702  O  OG    . SER N  3 18  ? 4.645    3.019   -12.155 1.00 73.61  ? 150  SER B OG    1 
ATOM   4703  N  N     . ASN N  3 19  ? 0.734    4.343   -11.407 1.00 83.34  ? 151  ASN B N     1 
ATOM   4704  C  CA    . ASN N  3 19  ? -0.070   5.525   -11.692 1.00 87.75  ? 151  ASN B CA    1 
ATOM   4705  C  C     . ASN N  3 19  ? 0.873    6.653   -12.139 1.00 91.61  ? 151  ASN B C     1 
ATOM   4706  O  O     . ASN N  3 19  ? 1.960    6.850   -11.573 1.00 91.14  ? 151  ASN B O     1 
ATOM   4707  C  CB    . ASN N  3 19  ? -0.893   5.943   -10.451 1.00 85.11  ? 151  ASN B CB    1 
ATOM   4708  C  CG    . ASN N  3 19  ? -2.123   5.048   -10.219 1.00 81.89  ? 151  ASN B CG    1 
ATOM   4709  O  OD1   . ASN N  3 19  ? -2.855   5.212   -9.237  1.00 78.91  ? 151  ASN B OD1   1 
ATOM   4710  N  ND2   . ASN N  3 19  ? -2.351   4.108   -11.129 1.00 79.75  ? 151  ASN B ND2   1 
ATOM   4711  N  N     . GLY N  3 20  ? 0.452    7.365   -13.182 1.00 95.62  ? 152  GLY B N     1 
ATOM   4712  C  CA    . GLY N  3 20  ? 1.239    8.459   -13.725 1.00 99.63  ? 152  GLY B CA    1 
ATOM   4713  C  C     . GLY N  3 20  ? 0.977    8.642   -15.212 1.00 102.22 ? 152  GLY B C     1 
ATOM   4714  O  O     . GLY N  3 20  ? 0.105    9.416   -15.619 1.00 102.55 ? 152  GLY B O     1 
ATOM   4715  N  N     . ARG N  3 21  ? 1.740    7.921   -16.027 1.00 104.42 ? 153  ARG B N     1 
ATOM   4716  C  CA    . ARG N  3 21  ? 1.599    7.982   -17.476 1.00 106.19 ? 153  ARG B CA    1 
ATOM   4717  C  C     . ARG N  3 21  ? 2.560    6.966   -18.074 1.00 106.34 ? 153  ARG B C     1 
ATOM   4718  O  O     . ARG N  3 21  ? 2.195    6.226   -19.002 1.00 106.51 ? 153  ARG B O     1 
ATOM   4719  C  CB    . ARG N  3 21  ? 1.906    9.405   -17.984 1.00 107.46 ? 153  ARG B CB    1 
ATOM   4720  C  CG    . ARG N  3 21  ? 3.224    9.610   -18.738 1.00 108.65 ? 153  ARG B CG    1 
ATOM   4721  C  CD    . ARG N  3 21  ? 3.169    9.028   -20.151 1.00 109.93 ? 153  ARG B CD    1 
ATOM   4722  N  NE    . ARG N  3 21  ? 4.280    9.485   -20.985 1.00 110.85 ? 153  ARG B NE    1 
ATOM   4723  C  CZ    . ARG N  3 21  ? 4.491    9.087   -22.237 1.00 110.75 ? 153  ARG B CZ    1 
ATOM   4724  N  NH1   . ARG N  3 21  ? 3.668    8.213   -22.809 1.00 110.51 ? 153  ARG B NH1   1 
ATOM   4725  N  NH2   . ARG N  3 21  ? 5.516    9.575   -22.925 1.00 109.93 ? 153  ARG B NH2   1 
ATOM   4726  N  N     . ARG N  3 22  ? 3.783    6.925   -17.530 1.00 105.51 ? 154  ARG B N     1 
ATOM   4727  C  CA    . ARG N  3 22  ? 4.818    5.985   -17.990 1.00 103.77 ? 154  ARG B CA    1 
ATOM   4728  C  C     . ARG N  3 22  ? 4.106    4.668   -18.168 1.00 101.67 ? 154  ARG B C     1 
ATOM   4729  O  O     . ARG N  3 22  ? 4.480    3.844   -18.999 1.00 100.55 ? 154  ARG B O     1 
ATOM   4730  C  CB    . ARG N  3 22  ? 5.897    5.808   -16.921 1.00 105.03 ? 154  ARG B CB    1 
ATOM   4731  C  CG    . ARG N  3 22  ? 6.518    4.389   -16.832 1.00 106.40 ? 154  ARG B CG    1 
ATOM   4732  C  CD    . ARG N  3 22  ? 7.595    4.108   -17.893 1.00 107.75 ? 154  ARG B CD    1 
ATOM   4733  N  NE    . ARG N  3 22  ? 7.061    3.859   -19.234 1.00 108.99 ? 154  ARG B NE    1 
ATOM   4734  C  CZ    . ARG N  3 22  ? 7.815    3.609   -20.305 1.00 108.99 ? 154  ARG B CZ    1 
ATOM   4735  N  NH1   . ARG N  3 22  ? 9.139    3.575   -20.198 1.00 109.04 ? 154  ARG B NH1   1 
ATOM   4736  N  NH2   . ARG N  3 22  ? 7.248    3.391   -21.486 1.00 108.49 ? 154  ARG B NH2   1 
ATOM   4737  N  N     . ARG N  3 23  ? 3.056    4.487   -17.375 1.00 99.69  ? 155  ARG B N     1 
ATOM   4738  C  CA    . ARG N  3 23  ? 2.296    3.264   -17.443 1.00 97.74  ? 155  ARG B CA    1 
ATOM   4739  C  C     . ARG N  3 23  ? 0.769    3.262   -17.710 1.00 94.61  ? 155  ARG B C     1 
ATOM   4740  O  O     . ARG N  3 23  ? 0.313    3.745   -18.731 1.00 94.07  ? 155  ARG B O     1 
ATOM   4741  C  CB    . ARG N  3 23  ? 2.655    2.418   -16.190 1.00 99.95  ? 155  ARG B CB    1 
ATOM   4742  C  CG    . ARG N  3 23  ? 4.055    1.834   -16.237 1.00 101.76 ? 155  ARG B CG    1 
ATOM   4743  C  CD    . ARG N  3 23  ? 4.196    0.868   -17.405 1.00 103.21 ? 155  ARG B CD    1 
ATOM   4744  N  NE    . ARG N  3 23  ? 5.467    0.157   -17.371 1.00 104.61 ? 155  ARG B NE    1 
ATOM   4745  C  CZ    . ARG N  3 23  ? 5.802    -0.728  -16.439 1.00 105.21 ? 155  ARG B CZ    1 
ATOM   4746  N  NH1   . ARG N  3 23  ? 4.962    -1.018  -15.451 1.00 105.50 ? 155  ARG B NH1   1 
ATOM   4747  N  NH2   . ARG N  3 23  ? 6.980    -1.330  -16.503 1.00 105.03 ? 155  ARG B NH2   1 
ATOM   4748  N  N     . PRO N  3 24  ? 0.015    2.779   -16.712 1.00 91.41  ? 156  PRO B N     1 
ATOM   4749  C  CA    . PRO N  3 24  ? -1.293   2.413   -16.208 1.00 87.63  ? 156  PRO B CA    1 
ATOM   4750  C  C     . PRO N  3 24  ? -1.621   1.131   -16.927 1.00 84.10  ? 156  PRO B C     1 
ATOM   4751  O  O     . PRO N  3 24  ? -2.266   1.125   -17.982 1.00 84.21  ? 156  PRO B O     1 
ATOM   4752  C  CB    . PRO N  3 24  ? -2.125   3.615   -16.543 1.00 87.44  ? 156  PRO B CB    1 
ATOM   4753  C  CG    . PRO N  3 24  ? -1.163   4.732   -16.059 1.00 88.97  ? 156  PRO B CG    1 
ATOM   4754  C  CD    . PRO N  3 24  ? 0.233    4.084   -16.094 1.00 90.67  ? 156  PRO B CD    1 
ATOM   4755  N  N     . ARG N  3 25  ? -1.035   0.055   -16.397 1.00 79.01  ? 157  ARG B N     1 
ATOM   4756  C  CA    . ARG N  3 25  ? -1.179   -1.300  -16.903 1.00 74.32  ? 157  ARG B CA    1 
ATOM   4757  C  C     . ARG N  3 25  ? -2.055   -2.035  -15.901 1.00 70.39  ? 157  ARG B C     1 
ATOM   4758  O  O     . ARG N  3 25  ? -1.772   -2.041  -14.698 1.00 69.40  ? 157  ARG B O     1 
ATOM   4759  C  CB    . ARG N  3 25  ? 0.181    -2.005  -16.922 1.00 76.79  ? 157  ARG B CB    1 
ATOM   4760  C  CG    . ARG N  3 25  ? 1.233    -1.485  -17.878 1.00 79.72  ? 157  ARG B CG    1 
ATOM   4761  C  CD    . ARG N  3 25  ? 2.571    -2.144  -17.527 1.00 82.81  ? 157  ARG B CD    1 
ATOM   4762  N  NE    . ARG N  3 25  ? 3.623    -1.987  -18.533 1.00 86.56  ? 157  ARG B NE    1 
ATOM   4763  C  CZ    . ARG N  3 25  ? 3.699    -2.681  -19.667 1.00 87.89  ? 157  ARG B CZ    1 
ATOM   4764  N  NH1   . ARG N  3 25  ? 2.775    -3.592  -19.957 1.00 87.40  ? 157  ARG B NH1   1 
ATOM   4765  N  NH2   . ARG N  3 25  ? 4.715    -2.480  -20.503 1.00 88.23  ? 157  ARG B NH2   1 
ATOM   4766  N  N     . ALA N  3 26  ? -3.123   -2.652  -16.372 1.00 66.25  ? 158  ALA B N     1 
ATOM   4767  C  CA    . ALA N  3 26  ? -3.988   -3.382  -15.467 1.00 62.51  ? 158  ALA B CA    1 
ATOM   4768  C  C     . ALA N  3 26  ? -4.004   -4.815  -15.958 1.00 60.54  ? 158  ALA B C     1 
ATOM   4769  O  O     . ALA N  3 26  ? -3.906   -5.069  -17.164 1.00 60.46  ? 158  ALA B O     1 
ATOM   4770  C  CB    . ALA N  3 26  ? -5.378   -2.805  -15.492 1.00 62.90  ? 158  ALA B CB    1 
ATOM   4771  N  N     . GLY N  3 27  ? -4.109   -5.749  -15.021 1.00 57.27  ? 159  GLY B N     1 
ATOM   4772  C  CA    . GLY N  3 27  ? -4.129   -7.153  -15.377 1.00 53.20  ? 159  GLY B CA    1 
ATOM   4773  C  C     . GLY N  3 27  ? -5.254   -7.872  -14.670 1.00 51.25  ? 159  GLY B C     1 
ATOM   4774  O  O     . GLY N  3 27  ? -5.725   -7.438  -13.623 1.00 51.58  ? 159  GLY B O     1 
ATOM   4775  N  N     . ILE N  3 28  ? -5.699   -8.973  -15.255 1.00 48.90  ? 160  ILE B N     1 
ATOM   4776  C  CA    . ILE N  3 28  ? -6.765   -9.761  -14.672 1.00 46.06  ? 160  ILE B CA    1 
ATOM   4777  C  C     . ILE N  3 28  ? -6.072   -10.966 -14.107 1.00 43.88  ? 160  ILE B C     1 
ATOM   4778  O  O     . ILE N  3 28  ? -4.976   -11.298 -14.527 1.00 44.37  ? 160  ILE B O     1 
ATOM   4779  C  CB    . ILE N  3 28  ? -7.753   -10.260 -15.737 1.00 47.56  ? 160  ILE B CB    1 
ATOM   4780  C  CG1   . ILE N  3 28  ? -8.296   -9.088  -16.558 1.00 48.27  ? 160  ILE B CG1   1 
ATOM   4781  C  CG2   . ILE N  3 28  ? -8.891   -11.010 -15.065 1.00 47.52  ? 160  ILE B CG2   1 
ATOM   4782  C  CD1   . ILE N  3 28  ? -9.257   -8.205  -15.802 1.00 50.63  ? 160  ILE B CD1   1 
ATOM   4783  N  N     . GLY N  3 29  ? -6.703   -11.628 -13.156 1.00 42.68  ? 161  GLY B N     1 
ATOM   4784  C  CA    . GLY N  3 29  ? -6.099   -12.814 -12.588 1.00 41.89  ? 161  GLY B CA    1 
ATOM   4785  C  C     . GLY N  3 29  ? -7.165   -13.609 -11.871 1.00 42.12  ? 161  GLY B C     1 
ATOM   4786  O  O     . GLY N  3 29  ? -7.837   -13.069 -10.981 1.00 45.42  ? 161  GLY B O     1 
ATOM   4787  N  N     . VAL N  3 30  ? -7.356   -14.867 -12.259 1.00 38.49  ? 162  VAL B N     1 
ATOM   4788  C  CA    . VAL N  3 30  ? -8.350   -15.699 -11.594 1.00 35.71  ? 162  VAL B CA    1 
ATOM   4789  C  C     . VAL N  3 30  ? -7.768   -17.066 -11.261 1.00 33.59  ? 162  VAL B C     1 
ATOM   4790  O  O     . VAL N  3 30  ? -7.193   -17.741 -12.100 1.00 33.30  ? 162  VAL B O     1 
ATOM   4791  C  CB    . VAL N  3 30  ? -9.647   -15.822 -12.427 1.00 35.21  ? 162  VAL B CB    1 
ATOM   4792  C  CG1   . VAL N  3 30  ? -9.325   -15.930 -13.895 1.00 36.04  ? 162  VAL B CG1   1 
ATOM   4793  C  CG2   . VAL N  3 30  ? -10.443  -17.032 -11.963 1.00 36.18  ? 162  VAL B CG2   1 
ATOM   4794  N  N     . TYR N  3 31  ? -7.932   -17.441 -10.001 1.00 32.53  ? 163  TYR B N     1 
ATOM   4795  C  CA    . TYR N  3 31  ? -7.411   -18.673 -9.425  1.00 32.19  ? 163  TYR B CA    1 
ATOM   4796  C  C     . TYR N  3 31  ? -8.567   -19.617 -9.135  1.00 34.10  ? 163  TYR B C     1 
ATOM   4797  O  O     . TYR N  3 31  ? -9.664   -19.171 -8.810  1.00 36.80  ? 163  TYR B O     1 
ATOM   4798  C  CB    . TYR N  3 31  ? -6.686   -18.287 -8.128  1.00 31.39  ? 163  TYR B CB    1 
ATOM   4799  C  CG    . TYR N  3 31  ? -5.988   -19.371 -7.341  1.00 28.14  ? 163  TYR B CG    1 
ATOM   4800  C  CD1   . TYR N  3 31  ? -6.451   -19.745 -6.083  1.00 27.23  ? 163  TYR B CD1   1 
ATOM   4801  C  CD2   . TYR N  3 31  ? -4.825   -19.967 -7.819  1.00 26.66  ? 163  TYR B CD2   1 
ATOM   4802  C  CE1   . TYR N  3 31  ? -5.772   -20.678 -5.323  1.00 27.56  ? 163  TYR B CE1   1 
ATOM   4803  C  CE2   . TYR N  3 31  ? -4.139   -20.903 -7.068  1.00 25.82  ? 163  TYR B CE2   1 
ATOM   4804  C  CZ    . TYR N  3 31  ? -4.613   -21.253 -5.823  1.00 27.36  ? 163  TYR B CZ    1 
ATOM   4805  O  OH    . TYR N  3 31  ? -3.918   -22.169 -5.074  1.00 28.45  ? 163  TYR B OH    1 
ATOM   4806  N  N     . TRP N  3 32  ? -8.321   -20.916 -9.256  1.00 34.54  ? 164  TRP B N     1 
ATOM   4807  C  CA    . TRP N  3 32  ? -9.335   -21.926 -9.002  1.00 34.19  ? 164  TRP B CA    1 
ATOM   4808  C  C     . TRP N  3 32  ? -8.706   -22.985 -8.150  1.00 35.74  ? 164  TRP B C     1 
ATOM   4809  O  O     . TRP N  3 32  ? -9.370   -23.940 -7.753  1.00 38.52  ? 164  TRP B O     1 
ATOM   4810  C  CB    . TRP N  3 32  ? -9.784   -22.610 -10.279 1.00 33.35  ? 164  TRP B CB    1 
ATOM   4811  C  CG    . TRP N  3 32  ? -10.357  -21.721 -11.304 1.00 33.88  ? 164  TRP B CG    1 
ATOM   4812  C  CD1   . TRP N  3 32  ? -9.677   -20.982 -12.223 1.00 34.38  ? 164  TRP B CD1   1 
ATOM   4813  C  CD2   . TRP N  3 32  ? -11.746  -21.515 -11.568 1.00 33.30  ? 164  TRP B CD2   1 
ATOM   4814  N  NE1   . TRP N  3 32  ? -10.559  -20.328 -13.053 1.00 34.78  ? 164  TRP B NE1   1 
ATOM   4815  C  CE2   . TRP N  3 32  ? -11.835  -20.640 -12.672 1.00 33.36  ? 164  TRP B CE2   1 
ATOM   4816  C  CE3   . TRP N  3 32  ? -12.926  -21.990 -10.980 1.00 32.39  ? 164  TRP B CE3   1 
ATOM   4817  C  CZ2   . TRP N  3 32  ? -13.052  -20.232 -13.200 1.00 33.25  ? 164  TRP B CZ2   1 
ATOM   4818  C  CZ3   . TRP N  3 32  ? -14.135  -21.587 -11.502 1.00 31.19  ? 164  TRP B CZ3   1 
ATOM   4819  C  CH2   . TRP N  3 32  ? -14.192  -20.716 -12.603 1.00 34.17  ? 164  TRP B CH2   1 
ATOM   4820  N  N     . GLY N  3 33  ? -7.410   -22.836 -7.896  1.00 36.17  ? 165  GLY B N     1 
ATOM   4821  C  CA    . GLY N  3 33  ? -6.708   -23.818 -7.092  1.00 36.16  ? 165  GLY B CA    1 
ATOM   4822  C  C     . GLY N  3 33  ? -5.369   -24.177 -7.694  1.00 35.69  ? 165  GLY B C     1 
ATOM   4823  O  O     . GLY N  3 33  ? -5.106   -23.874 -8.862  1.00 34.69  ? 165  GLY B O     1 
ATOM   4824  N  N     . PRO N  3 34  ? -4.504   -24.850 -6.918  1.00 35.69  ? 166  PRO B N     1 
ATOM   4825  C  CA    . PRO N  3 34  ? -3.168   -25.255 -7.365  1.00 34.80  ? 166  PRO B CA    1 
ATOM   4826  C  C     . PRO N  3 34  ? -3.129   -25.925 -8.725  1.00 34.14  ? 166  PRO B C     1 
ATOM   4827  O  O     . PRO N  3 34  ? -3.862   -26.873 -8.989  1.00 32.71  ? 166  PRO B O     1 
ATOM   4828  C  CB    . PRO N  3 34  ? -2.690   -26.172 -6.244  1.00 33.65  ? 166  PRO B CB    1 
ATOM   4829  C  CG    . PRO N  3 34  ? -3.353   -25.605 -5.041  1.00 33.25  ? 166  PRO B CG    1 
ATOM   4830  C  CD    . PRO N  3 34  ? -4.756   -25.325 -5.546  1.00 35.10  ? 166  PRO B CD    1 
ATOM   4831  N  N     . GLY N  3 35  ? -2.266   -25.391 -9.581  1.00 35.79  ? 167  GLY B N     1 
ATOM   4832  C  CA    . GLY N  3 35  ? -2.075   -25.915 -10.923 1.00 38.88  ? 167  GLY B CA    1 
ATOM   4833  C  C     . GLY N  3 35  ? -3.296   -26.183 -11.778 1.00 39.91  ? 167  GLY B C     1 
ATOM   4834  O  O     . GLY N  3 35  ? -3.168   -26.641 -12.919 1.00 39.42  ? 167  GLY B O     1 
ATOM   4835  N  N     . HIS N  3 36  ? -4.473   -25.896 -11.235 1.00 41.35  ? 168  HIS B N     1 
ATOM   4836  C  CA    . HIS N  3 36  ? -5.723   -26.111 -11.946 1.00 42.24  ? 168  HIS B CA    1 
ATOM   4837  C  C     . HIS N  3 36  ? -5.704   -25.330 -13.261 1.00 41.94  ? 168  HIS B C     1 
ATOM   4838  O  O     . HIS N  3 36  ? -5.464   -24.128 -13.262 1.00 42.05  ? 168  HIS B O     1 
ATOM   4839  C  CB    . HIS N  3 36  ? -6.870   -25.659 -11.060 1.00 44.43  ? 168  HIS B CB    1 
ATOM   4840  C  CG    . HIS N  3 36  ? -8.218   -25.811 -11.683 1.00 46.14  ? 168  HIS B CG    1 
ATOM   4841  N  ND1   . HIS N  3 36  ? -8.531   -25.281 -12.918 1.00 45.80  ? 168  HIS B ND1   1 
ATOM   4842  C  CD2   . HIS N  3 36  ? -9.362   -26.352 -11.203 1.00 45.95  ? 168  HIS B CD2   1 
ATOM   4843  C  CE1   . HIS N  3 36  ? -9.812   -25.484 -13.165 1.00 46.83  ? 168  HIS B CE1   1 
ATOM   4844  N  NE2   . HIS N  3 36  ? -10.339  -26.130 -12.139 1.00 47.27  ? 168  HIS B NE2   1 
ATOM   4845  N  N     . PRO N  3 37  ? -5.977   -26.012 -14.393 1.00 41.72  ? 169  PRO B N     1 
ATOM   4846  C  CA    . PRO N  3 37  ? -6.014   -25.515 -15.776 1.00 40.97  ? 169  PRO B CA    1 
ATOM   4847  C  C     . PRO N  3 37  ? -6.655   -24.156 -16.049 1.00 41.27  ? 169  PRO B C     1 
ATOM   4848  O  O     . PRO N  3 37  ? -6.100   -23.342 -16.792 1.00 40.10  ? 169  PRO B O     1 
ATOM   4849  C  CB    . PRO N  3 37  ? -6.722   -26.641 -16.521 1.00 40.71  ? 169  PRO B CB    1 
ATOM   4850  C  CG    . PRO N  3 37  ? -7.582   -27.251 -15.475 1.00 40.44  ? 169  PRO B CG    1 
ATOM   4851  C  CD    . PRO N  3 37  ? -6.630   -27.330 -14.325 1.00 41.02  ? 169  PRO B CD    1 
ATOM   4852  N  N     . LEU N  3 38  ? -7.826   -23.915 -15.466 1.00 42.25  ? 170  LEU B N     1 
ATOM   4853  C  CA    . LEU N  3 38  ? -8.520   -22.641 -15.659 1.00 43.44  ? 170  LEU B CA    1 
ATOM   4854  C  C     . LEU N  3 38  ? -7.818   -21.454 -14.980 1.00 42.65  ? 170  LEU B C     1 
ATOM   4855  O  O     . LEU N  3 38  ? -8.151   -20.293 -15.244 1.00 41.78  ? 170  LEU B O     1 
ATOM   4856  C  CB    . LEU N  3 38  ? -9.964   -22.743 -15.165 1.00 46.47  ? 170  LEU B CB    1 
ATOM   4857  C  CG    . LEU N  3 38  ? -10.985  -23.465 -16.057 1.00 47.74  ? 170  LEU B CG    1 
ATOM   4858  C  CD1   . LEU N  3 38  ? -10.405  -24.762 -16.595 1.00 48.95  ? 170  LEU B CD1   1 
ATOM   4859  C  CD2   . LEU N  3 38  ? -12.246  -23.736 -15.241 1.00 48.18  ? 170  LEU B CD2   1 
ATOM   4860  N  N     . ASN N  3 39  ? -6.864   -21.740 -14.093 1.00 41.07  ? 171  ASN B N     1 
ATOM   4861  C  CA    . ASN N  3 39  ? -6.115   -20.670 -13.453 1.00 37.91  ? 171  ASN B CA    1 
ATOM   4862  C  C     . ASN N  3 39  ? -5.525   -19.916 -14.600 1.00 37.44  ? 171  ASN B C     1 
ATOM   4863  O  O     . ASN N  3 39  ? -4.927   -20.506 -15.499 1.00 36.81  ? 171  ASN B O     1 
ATOM   4864  C  CB    . ASN N  3 39  ? -4.983   -21.202 -12.596 1.00 36.98  ? 171  ASN B CB    1 
ATOM   4865  C  CG    . ASN N  3 39  ? -5.399   -21.426 -11.183 1.00 37.23  ? 171  ASN B CG    1 
ATOM   4866  O  OD1   . ASN N  3 39  ? -6.577   -21.351 -10.862 1.00 39.29  ? 171  ASN B OD1   1 
ATOM   4867  N  ND2   . ASN N  3 39  ? -4.438   -21.713 -10.320 1.00 38.20  ? 171  ASN B ND2   1 
ATOM   4868  N  N     . VAL N  3 40  ? -5.700   -18.607 -14.577 1.00 38.05  ? 172  VAL B N     1 
ATOM   4869  C  CA    . VAL N  3 40  ? -5.185   -17.785 -15.644 1.00 39.07  ? 172  VAL B CA    1 
ATOM   4870  C  C     . VAL N  3 40  ? -4.977   -16.372 -15.137 1.00 38.93  ? 172  VAL B C     1 
ATOM   4871  O  O     . VAL N  3 40  ? -5.667   -15.936 -14.213 1.00 39.60  ? 172  VAL B O     1 
ATOM   4872  C  CB    . VAL N  3 40  ? -6.174   -17.762 -16.809 1.00 39.55  ? 172  VAL B CB    1 
ATOM   4873  C  CG1   . VAL N  3 40  ? -7.397   -16.955 -16.423 1.00 35.62  ? 172  VAL B CG1   1 
ATOM   4874  C  CG2   . VAL N  3 40  ? -5.490   -17.216 -18.059 1.00 42.08  ? 172  VAL B CG2   1 
ATOM   4875  N  N     . GLY N  3 41  ? -4.025   -15.663 -15.735 1.00 37.93  ? 173  GLY B N     1 
ATOM   4876  C  CA    . GLY N  3 41  ? -3.770   -14.297 -15.323 1.00 38.02  ? 173  GLY B CA    1 
ATOM   4877  C  C     . GLY N  3 41  ? -3.359   -13.446 -16.500 1.00 38.83  ? 173  GLY B C     1 
ATOM   4878  O  O     . GLY N  3 41  ? -2.198   -13.104 -16.630 1.00 39.77  ? 173  GLY B O     1 
ATOM   4879  N  N     . ILE N  3 42  ? -4.305   -13.095 -17.360 1.00 40.54  ? 174  ILE B N     1 
ATOM   4880  C  CA    . ILE N  3 42  ? -4.004   -12.289 -18.538 1.00 42.83  ? 174  ILE B CA    1 
ATOM   4881  C  C     . ILE N  3 42  ? -4.057   -10.783 -18.305 1.00 43.49  ? 174  ILE B C     1 
ATOM   4882  O  O     . ILE N  3 42  ? -4.278   -10.324 -17.185 1.00 43.98  ? 174  ILE B O     1 
ATOM   4883  C  CB    . ILE N  3 42  ? -4.969   -12.619 -19.662 1.00 44.74  ? 174  ILE B CB    1 
ATOM   4884  C  CG1   . ILE N  3 42  ? -6.399   -12.572 -19.123 1.00 45.68  ? 174  ILE B CG1   1 
ATOM   4885  C  CG2   . ILE N  3 42  ? -4.633   -13.979 -20.250 1.00 46.04  ? 174  ILE B CG2   1 
ATOM   4886  C  CD1   . ILE N  3 42  ? -7.456   -12.819 -20.178 1.00 49.81  ? 174  ILE B CD1   1 
ATOM   4887  N  N     . ARG N  3 43  ? -3.846   -10.017 -19.374 1.00 44.12  ? 175  ARG B N     1 
ATOM   4888  C  CA    . ARG N  3 43  ? -3.885   -8.563  -19.284 1.00 44.70  ? 175  ARG B CA    1 
ATOM   4889  C  C     . ARG N  3 43  ? -5.268   -8.008  -19.631 1.00 45.22  ? 175  ARG B C     1 
ATOM   4890  O  O     . ARG N  3 43  ? -5.966   -8.551  -20.491 1.00 44.76  ? 175  ARG B O     1 
ATOM   4891  C  CB    . ARG N  3 43  ? -2.836   -7.924  -20.197 1.00 44.28  ? 175  ARG B CB    1 
ATOM   4892  C  CG    . ARG N  3 43  ? -2.901   -6.421  -20.112 1.00 45.26  ? 175  ARG B CG    1 
ATOM   4893  C  CD    . ARG N  3 43  ? -1.665   -5.701  -20.586 1.00 44.60  ? 175  ARG B CD    1 
ATOM   4894  N  NE    . ARG N  3 43  ? -1.768   -4.306  -20.170 1.00 46.38  ? 175  ARG B NE    1 
ATOM   4895  C  CZ    . ARG N  3 43  ? -0.858   -3.367  -20.402 1.00 48.64  ? 175  ARG B CZ    1 
ATOM   4896  N  NH1   . ARG N  3 43  ? 0.261    -3.650  -21.063 1.00 50.11  ? 175  ARG B NH1   1 
ATOM   4897  N  NH2   . ARG N  3 43  ? -1.070   -2.136  -19.959 1.00 49.99  ? 175  ARG B NH2   1 
ATOM   4898  N  N     . LEU N  3 44  ? -5.648   -6.922  -18.952 1.00 46.51  ? 176  LEU B N     1 
ATOM   4899  C  CA    . LEU N  3 44  ? -6.954   -6.273  -19.139 1.00 46.26  ? 176  LEU B CA    1 
ATOM   4900  C  C     . LEU N  3 44  ? -7.028   -5.455  -20.415 1.00 45.61  ? 176  LEU B C     1 
ATOM   4901  O  O     . LEU N  3 44  ? -6.318   -4.462  -20.579 1.00 46.40  ? 176  LEU B O     1 
ATOM   4902  C  CB    . LEU N  3 44  ? -7.296   -5.364  -17.956 1.00 45.28  ? 176  LEU B CB    1 
ATOM   4903  C  CG    . LEU N  3 44  ? -8.663   -4.694  -18.090 1.00 45.05  ? 176  LEU B CG    1 
ATOM   4904  C  CD1   . LEU N  3 44  ? -9.756   -5.722  -17.963 1.00 45.57  ? 176  LEU B CD1   1 
ATOM   4905  C  CD2   . LEU N  3 44  ? -8.828   -3.657  -17.023 1.00 46.94  ? 176  LEU B CD2   1 
ATOM   4906  N  N     . PRO N  3 45  ? -7.929   -5.843  -21.321 1.00 43.93  ? 177  PRO B N     1 
ATOM   4907  C  CA    . PRO N  3 45  ? -8.094   -5.152  -22.588 1.00 42.59  ? 177  PRO B CA    1 
ATOM   4908  C  C     . PRO N  3 45  ? -8.994   -3.934  -22.458 1.00 43.17  ? 177  PRO B C     1 
ATOM   4909  O  O     . PRO N  3 45  ? -10.184  -4.068  -22.140 1.00 43.05  ? 177  PRO B O     1 
ATOM   4910  C  CB    . PRO N  3 45  ? -8.718   -6.226  -23.447 1.00 41.91  ? 177  PRO B CB    1 
ATOM   4911  C  CG    . PRO N  3 45  ? -9.706   -6.831  -22.481 1.00 41.76  ? 177  PRO B CG    1 
ATOM   4912  C  CD    . PRO N  3 45  ? -8.920   -6.930  -21.190 1.00 42.34  ? 177  PRO B CD    1 
ATOM   4913  N  N     . GLY N  3 46  ? -8.437   -2.747  -22.687 1.00 42.77  ? 178  GLY B N     1 
ATOM   4914  C  CA    . GLY N  3 46  ? -9.270   -1.561  -22.630 1.00 43.60  ? 178  GLY B CA    1 
ATOM   4915  C  C     . GLY N  3 46  ? -8.700   -0.323  -21.992 1.00 43.90  ? 178  GLY B C     1 
ATOM   4916  O  O     . GLY N  3 46  ? -7.529   0.004   -22.173 1.00 44.74  ? 178  GLY B O     1 
ATOM   4917  N  N     . ARG N  3 47  ? -9.565   0.393   -21.280 1.00 44.59  ? 179  ARG B N     1 
ATOM   4918  C  CA    . ARG N  3 47  ? -9.174   1.599   -20.565 1.00 44.60  ? 179  ARG B CA    1 
ATOM   4919  C  C     . ARG N  3 47  ? -8.607   1.093   -19.251 1.00 44.15  ? 179  ARG B C     1 
ATOM   4920  O  O     . ARG N  3 47  ? -9.345   0.768   -18.327 1.00 44.34  ? 179  ARG B O     1 
ATOM   4921  C  CB    . ARG N  3 47  ? -10.392  2.489   -20.318 1.00 45.37  ? 179  ARG B CB    1 
ATOM   4922  C  CG    . ARG N  3 47  ? -10.318  3.259   -19.022 1.00 45.06  ? 179  ARG B CG    1 
ATOM   4923  C  CD    . ARG N  3 47  ? -11.134  4.526   -19.055 1.00 44.46  ? 179  ARG B CD    1 
ATOM   4924  N  NE    . ARG N  3 47  ? -11.459  4.952   -17.702 1.00 42.42  ? 179  ARG B NE    1 
ATOM   4925  C  CZ    . ARG N  3 47  ? -12.445  4.423   -16.992 1.00 42.52  ? 179  ARG B CZ    1 
ATOM   4926  N  NH1   . ARG N  3 47  ? -12.677  4.850   -15.762 1.00 43.91  ? 179  ARG B NH1   1 
ATOM   4927  N  NH2   . ARG N  3 47  ? -13.215  3.484   -17.527 1.00 42.50  ? 179  ARG B NH2   1 
ATOM   4928  N  N     . GLN N  3 48  ? -7.286   1.010   -19.195 1.00 43.59  ? 180  GLN B N     1 
ATOM   4929  C  CA    . GLN N  3 48  ? -6.578   0.498   -18.035 1.00 42.16  ? 180  GLN B CA    1 
ATOM   4930  C  C     . GLN N  3 48  ? -6.942   1.132   -16.709 1.00 41.31  ? 180  GLN B C     1 
ATOM   4931  O  O     . GLN N  3 48  ? -6.562   2.271   -16.447 1.00 42.85  ? 180  GLN B O     1 
ATOM   4932  C  CB    . GLN N  3 48  ? -5.081   0.651   -18.257 1.00 42.34  ? 180  GLN B CB    1 
ATOM   4933  C  CG    . GLN N  3 48  ? -4.316   -0.645  -18.170 1.00 46.21  ? 180  GLN B CG    1 
ATOM   4934  C  CD    . GLN N  3 48  ? -4.710   -1.647  -19.233 1.00 48.04  ? 180  GLN B CD    1 
ATOM   4935  O  OE1   . GLN N  3 48  ? -4.199   -2.773  -19.257 1.00 49.88  ? 180  GLN B OE1   1 
ATOM   4936  N  NE2   . GLN N  3 48  ? -5.618   -1.251  -20.120 1.00 48.04  ? 180  GLN B NE2   1 
ATOM   4937  N  N     . THR N  3 49  ? -7.687   0.407   -15.873 1.00 38.80  ? 181  THR B N     1 
ATOM   4938  C  CA    . THR N  3 49  ? -8.031   0.928   -14.553 1.00 35.40  ? 181  THR B CA    1 
ATOM   4939  C  C     . THR N  3 49  ? -8.322   -0.082  -13.479 1.00 33.29  ? 181  THR B C     1 
ATOM   4940  O  O     . THR N  3 49  ? -8.751   -1.205  -13.714 1.00 31.46  ? 181  THR B O     1 
ATOM   4941  C  CB    . THR N  3 49  ? -9.250   1.874   -14.529 1.00 35.51  ? 181  THR B CB    1 
ATOM   4942  O  OG1   . THR N  3 49  ? -10.396  1.161   -14.036 1.00 34.94  ? 181  THR B OG1   1 
ATOM   4943  C  CG2   . THR N  3 49  ? -9.533   2.428   -15.900 1.00 37.22  ? 181  THR B CG2   1 
ATOM   4944  N  N     . ASN N  3 50  ? -8.078   0.405   -12.278 1.00 32.84  ? 182  ASN B N     1 
ATOM   4945  C  CA    . ASN N  3 50  ? -8.281   -0.266  -11.018 1.00 31.06  ? 182  ASN B CA    1 
ATOM   4946  C  C     . ASN N  3 50  ? -9.616   -1.015  -10.996 1.00 30.01  ? 182  ASN B C     1 
ATOM   4947  O  O     . ASN N  3 50  ? -9.674   -2.237  -11.181 1.00 25.29  ? 182  ASN B O     1 
ATOM   4948  C  CB    . ASN N  3 50  ? -8.226   0.837   -9.955  1.00 31.94  ? 182  ASN B CB    1 
ATOM   4949  C  CG    . ASN N  3 50  ? -9.009   0.512   -8.723  1.00 33.55  ? 182  ASN B CG    1 
ATOM   4950  O  OD1   . ASN N  3 50  ? -9.862   1.305   -8.287  1.00 30.52  ? 182  ASN B OD1   1 
ATOM   4951  N  ND2   . ASN N  3 50  ? -8.724   -0.651  -8.129  1.00 34.87  ? 182  ASN B ND2   1 
ATOM   4952  N  N     . GLN N  3 51  ? -10.682  -0.249  -10.787 1.00 31.42  ? 183  GLN B N     1 
ATOM   4953  C  CA    . GLN N  3 51  ? -12.044  -0.766  -10.713 1.00 34.16  ? 183  GLN B CA    1 
ATOM   4954  C  C     . GLN N  3 51  ? -12.432  -1.668  -11.871 1.00 36.52  ? 183  GLN B C     1 
ATOM   4955  O  O     . GLN N  3 51  ? -12.846  -2.810  -11.673 1.00 36.05  ? 183  GLN B O     1 
ATOM   4956  C  CB    . GLN N  3 51  ? -13.043  0.394   -10.639 1.00 32.20  ? 183  GLN B CB    1 
ATOM   4957  C  CG    . GLN N  3 51  ? -12.889  1.297   -9.428  1.00 30.86  ? 183  GLN B CG    1 
ATOM   4958  C  CD    . GLN N  3 51  ? -13.146  0.572   -8.115  1.00 30.34  ? 183  GLN B CD    1 
ATOM   4959  O  OE1   . GLN N  3 51  ? -13.440  1.194   -7.085  1.00 29.00  ? 183  GLN B OE1   1 
ATOM   4960  N  NE2   . GLN N  3 51  ? -13.032  -0.749  -8.141  1.00 29.41  ? 183  GLN B NE2   1 
ATOM   4961  N  N     . ARG N  3 52  ? -12.301  -1.141  -13.081 1.00 39.82  ? 184  ARG B N     1 
ATOM   4962  C  CA    . ARG N  3 52  ? -12.664  -1.874  -14.283 1.00 42.82  ? 184  ARG B CA    1 
ATOM   4963  C  C     . ARG N  3 52  ? -12.087  -3.299  -14.363 1.00 43.67  ? 184  ARG B C     1 
ATOM   4964  O  O     . ARG N  3 52  ? -12.821  -4.264  -14.597 1.00 42.44  ? 184  ARG B O     1 
ATOM   4965  C  CB    . ARG N  3 52  ? -12.264  -1.040  -15.504 1.00 44.90  ? 184  ARG B CB    1 
ATOM   4966  C  CG    . ARG N  3 52  ? -12.622  -1.683  -16.817 1.00 50.08  ? 184  ARG B CG    1 
ATOM   4967  C  CD    . ARG N  3 52  ? -12.978  -0.673  -17.884 1.00 52.56  ? 184  ARG B CD    1 
ATOM   4968  N  NE    . ARG N  3 52  ? -13.171  -1.357  -19.158 1.00 57.49  ? 184  ARG B NE    1 
ATOM   4969  C  CZ    . ARG N  3 52  ? -12.171  -1.800  -19.917 1.00 60.19  ? 184  ARG B CZ    1 
ATOM   4970  N  NH1   . ARG N  3 52  ? -10.913  -1.614  -19.527 1.00 60.68  ? 184  ARG B NH1   1 
ATOM   4971  N  NH2   . ARG N  3 52  ? -12.426  -2.447  -21.052 1.00 61.32  ? 184  ARG B NH2   1 
ATOM   4972  N  N     . ALA N  3 53  ? -10.777  -3.424  -14.162 1.00 45.43  ? 185  ALA B N     1 
ATOM   4973  C  CA    . ALA N  3 53  ? -10.102  -4.719  -14.198 1.00 45.86  ? 185  ALA B CA    1 
ATOM   4974  C  C     . ALA N  3 53  ? -10.732  -5.617  -13.157 1.00 46.77  ? 185  ALA B C     1 
ATOM   4975  O  O     . ALA N  3 53  ? -11.236  -6.701  -13.462 1.00 46.44  ? 185  ALA B O     1 
ATOM   4976  C  CB    . ALA N  3 53  ? -8.625   -4.544  -13.891 1.00 45.77  ? 185  ALA B CB    1 
ATOM   4977  N  N     . GLU N  3 54  ? -10.698  -5.144  -11.918 1.00 47.85  ? 186  GLU B N     1 
ATOM   4978  C  CA    . GLU N  3 54  ? -11.269  -5.878  -10.803 1.00 49.71  ? 186  GLU B CA    1 
ATOM   4979  C  C     . GLU N  3 54  ? -12.660  -6.432  -11.118 1.00 50.20  ? 186  GLU B C     1 
ATOM   4980  O  O     . GLU N  3 54  ? -13.133  -7.340  -10.431 1.00 50.62  ? 186  GLU B O     1 
ATOM   4981  C  CB    . GLU N  3 54  ? -11.366  -4.975  -9.584  1.00 50.44  ? 186  GLU B CB    1 
ATOM   4982  C  CG    . GLU N  3 54  ? -11.545  -5.719  -8.287  1.00 51.38  ? 186  GLU B CG    1 
ATOM   4983  C  CD    . GLU N  3 54  ? -10.240  -5.881  -7.535  1.00 52.08  ? 186  GLU B CD    1 
ATOM   4984  O  OE1   . GLU N  3 54  ? -9.579   -4.849  -7.285  1.00 51.87  ? 186  GLU B OE1   1 
ATOM   4985  O  OE2   . GLU N  3 54  ? -9.880   -7.028  -7.188  1.00 53.47  ? 186  GLU B OE2   1 
ATOM   4986  N  N     . ILE N  3 55  ? -13.321  -5.893  -12.142 1.00 49.79  ? 187  ILE B N     1 
ATOM   4987  C  CA    . ILE N  3 55  ? -14.644  -6.391  -12.487 1.00 49.74  ? 187  ILE B CA    1 
ATOM   4988  C  C     . ILE N  3 55  ? -14.564  -7.478  -13.534 1.00 51.70  ? 187  ILE B C     1 
ATOM   4989  O  O     . ILE N  3 55  ? -14.988  -8.601  -13.289 1.00 52.35  ? 187  ILE B O     1 
ATOM   4990  C  CB    . ILE N  3 55  ? -15.563  -5.324  -13.053 1.00 48.11  ? 187  ILE B CB    1 
ATOM   4991  C  CG1   . ILE N  3 55  ? -15.375  -3.998  -12.334 1.00 49.60  ? 187  ILE B CG1   1 
ATOM   4992  C  CG2   . ILE N  3 55  ? -16.977  -5.755  -12.845 1.00 46.65  ? 187  ILE B CG2   1 
ATOM   4993  C  CD1   . ILE N  3 55  ? -16.334  -2.919  -12.809 1.00 48.12  ? 187  ILE B CD1   1 
ATOM   4994  N  N     . HIS N  3 56  ? -14.039  -7.138  -14.710 1.00 54.11  ? 188  HIS B N     1 
ATOM   4995  C  CA    . HIS N  3 56  ? -13.909  -8.106  -15.801 1.00 55.47  ? 188  HIS B CA    1 
ATOM   4996  C  C     . HIS N  3 56  ? -13.203  -9.342  -15.271 1.00 55.80  ? 188  HIS B C     1 
ATOM   4997  O  O     . HIS N  3 56  ? -13.390  -10.455 -15.772 1.00 55.39  ? 188  HIS B O     1 
ATOM   4998  C  CB    . HIS N  3 56  ? -13.094  -7.512  -16.943 1.00 57.30  ? 188  HIS B CB    1 
ATOM   4999  C  CG    . HIS N  3 56  ? -13.854  -6.546  -17.799 1.00 60.96  ? 188  HIS B CG    1 
ATOM   5000  N  ND1   . HIS N  3 56  ? -14.483  -6.921  -18.968 1.00 62.54  ? 188  HIS B ND1   1 
ATOM   5001  C  CD2   . HIS N  3 56  ? -14.051  -5.211  -17.678 1.00 62.20  ? 188  HIS B CD2   1 
ATOM   5002  C  CE1   . HIS N  3 56  ? -15.027  -5.858  -19.533 1.00 62.92  ? 188  HIS B CE1   1 
ATOM   5003  N  NE2   . HIS N  3 56  ? -14.780  -4.807  -18.771 1.00 62.81  ? 188  HIS B NE2   1 
ATOM   5004  N  N     . ALA N  3 57  ? -12.383  -9.132  -14.249 1.00 55.48  ? 189  ALA B N     1 
ATOM   5005  C  CA    . ALA N  3 57  ? -11.655  -10.222 -13.636 1.00 55.63  ? 189  ALA B CA    1 
ATOM   5006  C  C     . ALA N  3 57  ? -12.663  -11.139 -12.964 1.00 55.83  ? 189  ALA B C     1 
ATOM   5007  O  O     . ALA N  3 57  ? -12.328  -12.221 -12.490 1.00 57.42  ? 189  ALA B O     1 
ATOM   5008  C  CB    . ALA N  3 57  ? -10.671  -9.681  -12.623 1.00 56.24  ? 189  ALA B CB    1 
ATOM   5009  N  N     . ALA N  3 58  ? -13.908  -10.695 -12.918 1.00 55.18  ? 190  ALA B N     1 
ATOM   5010  C  CA    . ALA N  3 58  ? -14.963  -11.494 -12.325 1.00 55.11  ? 190  ALA B CA    1 
ATOM   5011  C  C     . ALA N  3 58  ? -15.756  -12.083 -13.477 1.00 54.98  ? 190  ALA B C     1 
ATOM   5012  O  O     . ALA N  3 58  ? -16.372  -13.138 -13.353 1.00 55.26  ? 190  ALA B O     1 
ATOM   5013  C  CB    . ALA N  3 58  ? -15.849  -10.633 -11.455 1.00 56.31  ? 190  ALA B CB    1 
ATOM   5014  N  N     . CYS N  3 59  ? -15.745  -11.393 -14.608 1.00 54.71  ? 191  CYS B N     1 
ATOM   5015  C  CA    . CYS N  3 59  ? -16.449  -11.903 -15.770 1.00 54.87  ? 191  CYS B CA    1 
ATOM   5016  C  C     . CYS N  3 59  ? -15.759  -13.207 -16.170 1.00 55.15  ? 191  CYS B C     1 
ATOM   5017  O  O     . CYS N  3 59  ? -16.357  -14.283 -16.095 1.00 54.31  ? 191  CYS B O     1 
ATOM   5018  C  CB    . CYS N  3 59  ? -16.393  -10.889 -16.915 1.00 55.31  ? 191  CYS B CB    1 
ATOM   5019  S  SG    . CYS N  3 59  ? -17.368  -9.398  -16.614 1.00 53.81  ? 191  CYS B SG    1 
ATOM   5020  N  N     . LYS N  3 60  ? -14.492  -13.107 -16.572 1.00 55.48  ? 192  LYS B N     1 
ATOM   5021  C  CA    . LYS N  3 60  ? -13.724  -14.285 -16.964 1.00 55.60  ? 192  LYS B CA    1 
ATOM   5022  C  C     . LYS N  3 60  ? -14.031  -15.416 -16.000 1.00 55.01  ? 192  LYS B C     1 
ATOM   5023  O  O     . LYS N  3 60  ? -14.348  -16.518 -16.418 1.00 55.54  ? 192  LYS B O     1 
ATOM   5024  C  CB    . LYS N  3 60  ? -12.223  -14.000 -16.919 1.00 56.63  ? 192  LYS B CB    1 
ATOM   5025  C  CG    . LYS N  3 60  ? -11.356  -15.067 -17.586 1.00 57.02  ? 192  LYS B CG    1 
ATOM   5026  C  CD    . LYS N  3 60  ? -11.368  -14.907 -19.104 1.00 58.57  ? 192  LYS B CD    1 
ATOM   5027  C  CE    . LYS N  3 60  ? -10.372  -15.829 -19.791 1.00 59.15  ? 192  LYS B CE    1 
ATOM   5028  N  NZ    . LYS N  3 60  ? -10.258  -15.509 -21.244 1.00 60.77  ? 192  LYS B NZ    1 
ATOM   5029  N  N     . ALA N  3 61  ? -13.939  -15.136 -14.706 1.00 54.45  ? 193  ALA B N     1 
ATOM   5030  C  CA    . ALA N  3 61  ? -14.219  -16.148 -13.706 1.00 54.73  ? 193  ALA B CA    1 
ATOM   5031  C  C     . ALA N  3 61  ? -15.472  -16.928 -14.079 1.00 55.38  ? 193  ALA B C     1 
ATOM   5032  O  O     . ALA N  3 61  ? -15.377  -18.069 -14.520 1.00 57.27  ? 193  ALA B O     1 
ATOM   5033  C  CB    . ALA N  3 61  ? -14.387  -15.512 -12.340 1.00 54.21  ? 193  ALA B CB    1 
ATOM   5034  N  N     . ILE N  3 62  ? -16.644  -16.319 -13.934 1.00 55.62  ? 194  ILE B N     1 
ATOM   5035  C  CA    . ILE N  3 62  ? -17.880  -17.030 -14.255 1.00 56.41  ? 194  ILE B CA    1 
ATOM   5036  C  C     . ILE N  3 62  ? -17.941  -17.464 -15.711 1.00 55.93  ? 194  ILE B C     1 
ATOM   5037  O  O     . ILE N  3 62  ? -18.466  -18.530 -16.031 1.00 55.12  ? 194  ILE B O     1 
ATOM   5038  C  CB    . ILE N  3 62  ? -19.131  -16.186 -13.922 1.00 56.81  ? 194  ILE B CB    1 
ATOM   5039  C  CG1   . ILE N  3 62  ? -19.114  -14.884 -14.703 1.00 57.61  ? 194  ILE B CG1   1 
ATOM   5040  C  CG2   . ILE N  3 62  ? -19.162  -15.864 -12.437 1.00 57.87  ? 194  ILE B CG2   1 
ATOM   5041  C  CD1   . ILE N  3 62  ? -20.263  -13.979 -14.344 1.00 59.36  ? 194  ILE B CD1   1 
ATOM   5042  N  N     . GLU N  3 63  ? -17.391  -16.641 -16.592 1.00 56.39  ? 195  GLU B N     1 
ATOM   5043  C  CA    . GLU N  3 63  ? -17.383  -16.958 -18.011 1.00 57.07  ? 195  GLU B CA    1 
ATOM   5044  C  C     . GLU N  3 63  ? -16.772  -18.347 -18.209 1.00 57.21  ? 195  GLU B C     1 
ATOM   5045  O  O     . GLU N  3 63  ? -17.229  -19.124 -19.052 1.00 58.45  ? 195  GLU B O     1 
ATOM   5046  C  CB    . GLU N  3 63  ? -16.575  -15.909 -18.770 1.00 57.38  ? 195  GLU B CB    1 
ATOM   5047  C  CG    . GLU N  3 63  ? -16.765  -15.959 -20.263 1.00 58.94  ? 195  GLU B CG    1 
ATOM   5048  C  CD    . GLU N  3 63  ? -16.084  -14.808 -20.966 1.00 59.64  ? 195  GLU B CD    1 
ATOM   5049  O  OE1   . GLU N  3 63  ? -14.848  -14.858 -21.155 1.00 59.86  ? 195  GLU B OE1   1 
ATOM   5050  O  OE2   . GLU N  3 63  ? -16.791  -13.843 -21.319 1.00 60.37  ? 195  GLU B OE2   1 
ATOM   5051  N  N     . GLN N  3 64  ? -15.738  -18.650 -17.427 1.00 55.66  ? 196  GLN B N     1 
ATOM   5052  C  CA    . GLN N  3 64  ? -15.081  -19.944 -17.494 1.00 54.39  ? 196  GLN B CA    1 
ATOM   5053  C  C     . GLN N  3 64  ? -15.966  -20.893 -16.739 1.00 54.71  ? 196  GLN B C     1 
ATOM   5054  O  O     . GLN N  3 64  ? -15.998  -22.086 -17.027 1.00 56.27  ? 196  GLN B O     1 
ATOM   5055  C  CB    . GLN N  3 64  ? -13.728  -19.913 -16.811 1.00 54.31  ? 196  GLN B CB    1 
ATOM   5056  C  CG    . GLN N  3 64  ? -12.767  -18.908 -17.382 1.00 55.54  ? 196  GLN B CG    1 
ATOM   5057  C  CD    . GLN N  3 64  ? -11.427  -18.976 -16.703 1.00 55.11  ? 196  GLN B CD    1 
ATOM   5058  O  OE1   . GLN N  3 64  ? -11.337  -18.876 -15.475 1.00 55.78  ? 196  GLN B OE1   1 
ATOM   5059  N  NE2   . GLN N  3 64  ? -10.371  -19.153 -17.492 1.00 54.90  ? 196  GLN B NE2   1 
ATOM   5060  N  N     . ALA N  3 65  ? -16.674  -20.358 -15.751 1.00 54.27  ? 197  ALA B N     1 
ATOM   5061  C  CA    . ALA N  3 65  ? -17.584  -21.168 -14.960 1.00 55.31  ? 197  ALA B CA    1 
ATOM   5062  C  C     . ALA N  3 65  ? -18.556  -21.787 -15.950 1.00 56.74  ? 197  ALA B C     1 
ATOM   5063  O  O     . ALA N  3 65  ? -18.964  -22.946 -15.814 1.00 56.65  ? 197  ALA B O     1 
ATOM   5064  C  CB    . ALA N  3 65  ? -18.324  -20.301 -13.965 1.00 54.19  ? 197  ALA B CB    1 
ATOM   5065  N  N     . LYS N  3 66  ? -18.906  -20.994 -16.959 1.00 58.50  ? 198  LYS B N     1 
ATOM   5066  C  CA    . LYS N  3 66  ? -19.811  -21.423 -18.019 1.00 59.99  ? 198  LYS B CA    1 
ATOM   5067  C  C     . LYS N  3 66  ? -19.173  -22.597 -18.752 1.00 60.32  ? 198  LYS B C     1 
ATOM   5068  O  O     . LYS N  3 66  ? -19.757  -23.681 -18.845 1.00 60.51  ? 198  LYS B O     1 
ATOM   5069  C  CB    . LYS N  3 66  ? -20.061  -20.266 -18.990 1.00 59.76  ? 198  LYS B CB    1 
ATOM   5070  N  N     . THR N  3 67  ? -17.964  -22.367 -19.259 1.00 60.40  ? 199  THR B N     1 
ATOM   5071  C  CA    . THR N  3 67  ? -17.206  -23.380 -19.985 1.00 61.47  ? 199  THR B CA    1 
ATOM   5072  C  C     . THR N  3 67  ? -16.842  -24.558 -19.079 1.00 62.23  ? 199  THR B C     1 
ATOM   5073  O  O     . THR N  3 67  ? -15.760  -25.139 -19.197 1.00 61.89  ? 199  THR B O     1 
ATOM   5074  C  CB    . THR N  3 67  ? -15.916  -22.770 -20.553 1.00 61.50  ? 199  THR B CB    1 
ATOM   5075  O  OG1   . THR N  3 67  ? -16.243  -21.588 -21.293 1.00 60.78  ? 199  THR B OG1   1 
ATOM   5076  C  CG2   . THR N  3 67  ? -15.208  -23.760 -21.474 1.00 62.10  ? 199  THR B CG2   1 
ATOM   5077  N  N     . GLN N  3 68  ? -17.759  -24.905 -18.182 1.00 62.89  ? 200  GLN B N     1 
ATOM   5078  C  CA    . GLN N  3 68  ? -17.560  -25.995 -17.237 1.00 64.35  ? 200  GLN B CA    1 
ATOM   5079  C  C     . GLN N  3 68  ? -18.923  -26.481 -16.788 1.00 65.01  ? 200  GLN B C     1 
ATOM   5080  O  O     . GLN N  3 68  ? -19.039  -27.372 -15.948 1.00 64.12  ? 200  GLN B O     1 
ATOM   5081  C  CB    . GLN N  3 68  ? -16.774  -25.497 -16.019 1.00 65.84  ? 200  GLN B CB    1 
ATOM   5082  C  CG    . GLN N  3 68  ? -15.332  -25.093 -16.312 1.00 67.21  ? 200  GLN B CG    1 
ATOM   5083  C  CD    . GLN N  3 68  ? -14.381  -26.283 -16.388 1.00 68.20  ? 200  GLN B CD    1 
ATOM   5084  O  OE1   . GLN N  3 68  ? -13.827  -26.720 -15.374 1.00 67.79  ? 200  GLN B OE1   1 
ATOM   5085  N  NE2   . GLN N  3 68  ? -14.197  -26.816 -17.592 1.00 67.99  ? 200  GLN B NE2   1 
ATOM   5086  N  N     . ASN N  3 69  ? -19.959  -25.880 -17.353 1.00 66.97  ? 201  ASN B N     1 
ATOM   5087  C  CA    . ASN N  3 69  ? -21.332  -26.228 -17.006 1.00 69.41  ? 201  ASN B CA    1 
ATOM   5088  C  C     . ASN N  3 69  ? -21.589  -26.158 -15.507 1.00 70.03  ? 201  ASN B C     1 
ATOM   5089  O  O     . ASN N  3 69  ? -22.433  -26.885 -14.978 1.00 71.06  ? 201  ASN B O     1 
ATOM   5090  C  CB    . ASN N  3 69  ? -21.697  -27.623 -17.523 1.00 69.42  ? 201  ASN B CB    1 
ATOM   5091  C  CG    . ASN N  3 69  ? -22.613  -27.568 -18.734 1.00 70.17  ? 201  ASN B CG    1 
ATOM   5092  O  OD1   . ASN N  3 69  ? -23.730  -27.040 -18.670 1.00 69.30  ? 201  ASN B OD1   1 
ATOM   5093  N  ND2   . ASN N  3 69  ? -22.140  -28.106 -19.851 1.00 71.40  ? 201  ASN B ND2   1 
ATOM   5094  N  N     . ILE N  3 70  ? -20.861  -25.280 -14.825 1.00 70.08  ? 202  ILE B N     1 
ATOM   5095  C  CA    . ILE N  3 70  ? -21.041  -25.120 -13.392 1.00 69.67  ? 202  ILE B CA    1 
ATOM   5096  C  C     . ILE N  3 70  ? -22.232  -24.167 -13.233 1.00 69.55  ? 202  ILE B C     1 
ATOM   5097  O  O     . ILE N  3 70  ? -22.336  -23.161 -13.941 1.00 67.58  ? 202  ILE B O     1 
ATOM   5098  C  CB    . ILE N  3 70  ? -19.735  -24.557 -12.733 1.00 69.87  ? 202  ILE B CB    1 
ATOM   5099  C  CG1   . ILE N  3 70  ? -19.682  -24.918 -11.245 1.00 69.58  ? 202  ILE B CG1   1 
ATOM   5100  C  CG2   . ILE N  3 70  ? -19.641  -23.068 -12.928 1.00 70.34  ? 202  ILE B CG2   1 
ATOM   5101  C  CD1   . ILE N  3 70  ? -20.856  -24.442 -10.433 1.00 69.56  ? 202  ILE B CD1   1 
ATOM   5102  N  N     . ASN N  3 71  ? -23.151  -24.509 -12.333 1.00 70.41  ? 203  ASN B N     1 
ATOM   5103  C  CA    . ASN N  3 71  ? -24.336  -23.681 -12.109 1.00 70.33  ? 203  ASN B CA    1 
ATOM   5104  C  C     . ASN N  3 71  ? -24.276  -22.794 -10.861 1.00 68.50  ? 203  ASN B C     1 
ATOM   5105  O  O     . ASN N  3 71  ? -25.082  -21.874 -10.718 1.00 69.12  ? 203  ASN B O     1 
ATOM   5106  C  CB    . ASN N  3 71  ? -25.618  -24.547 -12.080 1.00 71.91  ? 203  ASN B CB    1 
ATOM   5107  C  CG    . ASN N  3 71  ? -25.430  -25.882 -11.354 1.00 73.73  ? 203  ASN B CG    1 
ATOM   5108  O  OD1   . ASN N  3 71  ? -24.541  -26.030 -10.510 1.00 76.18  ? 203  ASN B OD1   1 
ATOM   5109  N  ND2   . ASN N  3 71  ? -26.282  -26.856 -11.673 1.00 72.89  ? 203  ASN B ND2   1 
ATOM   5110  N  N     . LYS N  3 72  ? -23.333  -23.053 -9.961  1.00 65.51  ? 204  LYS B N     1 
ATOM   5111  C  CA    . LYS N  3 72  ? -23.230  -22.226 -8.766  1.00 63.31  ? 204  LYS B CA    1 
ATOM   5112  C  C     . LYS N  3 72  ? -21.879  -22.262 -8.058  1.00 60.82  ? 204  LYS B C     1 
ATOM   5113  O  O     . LYS N  3 72  ? -21.391  -23.322 -7.640  1.00 60.65  ? 204  LYS B O     1 
ATOM   5114  C  CB    . LYS N  3 72  ? -24.330  -22.586 -7.774  1.00 64.28  ? 204  LYS B CB    1 
ATOM   5115  C  CG    . LYS N  3 72  ? -24.233  -23.973 -7.199  1.00 66.83  ? 204  LYS B CG    1 
ATOM   5116  C  CD    . LYS N  3 72  ? -25.405  -24.208 -6.282  1.00 70.94  ? 204  LYS B CD    1 
ATOM   5117  C  CE    . LYS N  3 72  ? -26.723  -23.976 -7.029  1.00 73.93  ? 204  LYS B CE    1 
ATOM   5118  N  NZ    . LYS N  3 72  ? -27.930  -24.023 -6.137  1.00 76.47  ? 204  LYS B NZ    1 
ATOM   5119  N  N     . LEU N  3 73  ? -21.294  -21.077 -7.899  1.00 56.26  ? 205  LEU B N     1 
ATOM   5120  C  CA    . LEU N  3 73  ? -19.993  -20.938 -7.254  1.00 49.87  ? 205  LEU B CA    1 
ATOM   5121  C  C     . LEU N  3 73  ? -19.974  -19.884 -6.149  1.00 45.74  ? 205  LEU B C     1 
ATOM   5122  O  O     . LEU N  3 73  ? -20.953  -19.170 -5.912  1.00 44.93  ? 205  LEU B O     1 
ATOM   5123  C  CB    . LEU N  3 73  ? -18.928  -20.580 -8.305  1.00 46.09  ? 205  LEU B CB    1 
ATOM   5124  C  CG    . LEU N  3 73  ? -19.061  -19.209 -8.968  1.00 41.98  ? 205  LEU B CG    1 
ATOM   5125  C  CD1   . LEU N  3 73  ? -18.182  -19.174 -10.191 1.00 40.84  ? 205  LEU B CD1   1 
ATOM   5126  C  CD2   . LEU N  3 73  ? -20.501  -18.946 -9.354  1.00 39.46  ? 205  LEU B CD2   1 
ATOM   5127  N  N     . VAL N  3 74  ? -18.834  -19.819 -5.478  1.00 40.71  ? 206  VAL B N     1 
ATOM   5128  C  CA    . VAL N  3 74  ? -18.587  -18.861 -4.426  1.00 35.51  ? 206  VAL B CA    1 
ATOM   5129  C  C     . VAL N  3 74  ? -17.407  -18.072 -4.978  1.00 33.99  ? 206  VAL B C     1 
ATOM   5130  O  O     . VAL N  3 74  ? -16.315  -18.617 -5.150  1.00 32.75  ? 206  VAL B O     1 
ATOM   5131  C  CB    . VAL N  3 74  ? -18.184  -19.564 -3.130  1.00 33.60  ? 206  VAL B CB    1 
ATOM   5132  C  CG1   . VAL N  3 74  ? -17.880  -18.555 -2.067  1.00 33.61  ? 206  VAL B CG1   1 
ATOM   5133  C  CG2   . VAL N  3 74  ? -19.288  -20.456 -2.676  1.00 31.69  ? 206  VAL B CG2   1 
ATOM   5134  N  N     . LEU N  3 75  ? -17.637  -16.802 -5.294  1.00 33.18  ? 207  LEU B N     1 
ATOM   5135  C  CA    . LEU N  3 75  ? -16.578  -15.967 -5.845  1.00 31.49  ? 207  LEU B CA    1 
ATOM   5136  C  C     . LEU N  3 75  ? -15.964  -15.058 -4.799  1.00 30.91  ? 207  LEU B C     1 
ATOM   5137  O  O     . LEU N  3 75  ? -16.639  -14.248 -4.168  1.00 29.50  ? 207  LEU B O     1 
ATOM   5138  C  CB    . LEU N  3 75  ? -17.097  -15.131 -7.013  1.00 30.13  ? 207  LEU B CB    1 
ATOM   5139  C  CG    . LEU N  3 75  ? -16.014  -14.295 -7.696  1.00 30.04  ? 207  LEU B CG    1 
ATOM   5140  C  CD1   . LEU N  3 75  ? -16.456  -13.909 -9.090  1.00 30.15  ? 207  LEU B CD1   1 
ATOM   5141  C  CD2   . LEU N  3 75  ? -15.709  -13.062 -6.860  1.00 30.29  ? 207  LEU B CD2   1 
ATOM   5142  N  N     . TYR N  3 76  ? -14.661  -15.199 -4.632  1.00 30.72  ? 208  TYR B N     1 
ATOM   5143  C  CA    . TYR N  3 76  ? -13.940  -14.405 -3.667  1.00 32.39  ? 208  TYR B CA    1 
ATOM   5144  C  C     . TYR N  3 76  ? -13.270  -13.193 -4.305  1.00 33.98  ? 208  TYR B C     1 
ATOM   5145  O  O     . TYR N  3 76  ? -12.689  -13.284 -5.392  1.00 35.90  ? 208  TYR B O     1 
ATOM   5146  C  CB    . TYR N  3 76  ? -12.893  -15.271 -2.985  1.00 31.11  ? 208  TYR B CB    1 
ATOM   5147  C  CG    . TYR N  3 76  ? -13.430  -16.113 -1.861  1.00 30.44  ? 208  TYR B CG    1 
ATOM   5148  C  CD1   . TYR N  3 76  ? -13.401  -17.501 -1.920  1.00 29.54  ? 208  TYR B CD1   1 
ATOM   5149  C  CD2   . TYR N  3 76  ? -13.923  -15.516 -0.709  1.00 30.77  ? 208  TYR B CD2   1 
ATOM   5150  C  CE1   . TYR N  3 76  ? -13.844  -18.268 -0.853  1.00 30.40  ? 208  TYR B CE1   1 
ATOM   5151  C  CE2   . TYR N  3 76  ? -14.366  -16.272 0.358   1.00 30.77  ? 208  TYR B CE2   1 
ATOM   5152  C  CZ    . TYR N  3 76  ? -14.326  -17.642 0.285   1.00 31.09  ? 208  TYR B CZ    1 
ATOM   5153  O  OH    . TYR N  3 76  ? -14.777  -18.375 1.360   1.00 33.63  ? 208  TYR B OH    1 
ATOM   5154  N  N     . THR N  3 77  ? -13.352  -12.055 -3.628  1.00 33.09  ? 209  THR B N     1 
ATOM   5155  C  CA    . THR N  3 77  ? -12.727  -10.846 -4.134  1.00 32.59  ? 209  THR B CA    1 
ATOM   5156  C  C     . THR N  3 77  ? -12.539  -9.868  -2.985  1.00 32.17  ? 209  THR B C     1 
ATOM   5157  O  O     . THR N  3 77  ? -13.203  -9.975  -1.953  1.00 31.08  ? 209  THR B O     1 
ATOM   5158  C  CB    . THR N  3 77  ? -13.584  -10.190 -5.220  1.00 31.85  ? 209  THR B CB    1 
ATOM   5159  O  OG1   . THR N  3 77  ? -12.889  -9.061  -5.764  1.00 32.00  ? 209  THR B OG1   1 
ATOM   5160  C  CG2   . THR N  3 77  ? -14.892  -9.722  -4.630  1.00 33.41  ? 209  THR B CG2   1 
ATOM   5161  N  N     . ASN N  3 78  ? -11.624  -8.922  -3.161  1.00 32.22  ? 210  ASN B N     1 
ATOM   5162  C  CA    . ASN N  3 78  ? -11.368  -7.947  -2.125  1.00 33.05  ? 210  ASN B CA    1 
ATOM   5163  C  C     . ASN N  3 78  ? -12.087  -6.655  -2.431  1.00 33.83  ? 210  ASN B C     1 
ATOM   5164  O  O     . ASN N  3 78  ? -12.250  -5.822  -1.541  1.00 33.17  ? 210  ASN B O     1 
ATOM   5165  C  CB    . ASN N  3 78  ? -9.874   -7.639  -1.997  1.00 34.83  ? 210  ASN B CB    1 
ATOM   5166  C  CG    . ASN N  3 78  ? -9.032   -8.872  -1.761  1.00 35.70  ? 210  ASN B CG    1 
ATOM   5167  O  OD1   . ASN N  3 78  ? -8.497   -9.459  -2.706  1.00 37.19  ? 210  ASN B OD1   1 
ATOM   5168  N  ND2   . ASN N  3 78  ? -8.908   -9.277  -0.498  1.00 34.57  ? 210  ASN B ND2   1 
ATOM   5169  N  N     . SER N  3 79  ? -12.515  -6.473  -3.680  1.00 34.99  ? 211  SER B N     1 
ATOM   5170  C  CA    . SER N  3 79  ? -13.193  -5.223  -4.028  1.00 37.74  ? 211  SER B CA    1 
ATOM   5171  C  C     . SER N  3 79  ? -14.696  -5.283  -3.903  1.00 39.12  ? 211  SER B C     1 
ATOM   5172  O  O     . SER N  3 79  ? -15.367  -5.944  -4.694  1.00 39.09  ? 211  SER B O     1 
ATOM   5173  C  CB    . SER N  3 79  ? -12.857  -4.780  -5.448  1.00 37.42  ? 211  SER B CB    1 
ATOM   5174  O  OG    . SER N  3 79  ? -13.625  -5.494  -6.386  1.00 36.60  ? 211  SER B OG    1 
ATOM   5175  N  N     . MET N  3 80  ? -15.234  -4.583  -2.913  1.00 41.34  ? 212  MET B N     1 
ATOM   5176  C  CA    . MET N  3 80  ? -16.669  -4.591  -2.766  1.00 43.90  ? 212  MET B CA    1 
ATOM   5177  C  C     . MET N  3 80  ? -17.286  -3.470  -3.574  1.00 44.16  ? 212  MET B C     1 
ATOM   5178  O  O     . MET N  3 80  ? -18.313  -2.904  -3.209  1.00 44.93  ? 212  MET B O     1 
ATOM   5179  C  CB    . MET N  3 80  ? -17.080  -4.510  -1.306  1.00 46.59  ? 212  MET B CB    1 
ATOM   5180  C  CG    . MET N  3 80  ? -16.710  -3.259  -0.574  1.00 48.67  ? 212  MET B CG    1 
ATOM   5181  S  SD    . MET N  3 80  ? -17.278  -3.503  1.121   1.00 55.32  ? 212  MET B SD    1 
ATOM   5182  C  CE    . MET N  3 80  ? -18.621  -4.888  0.900   1.00 49.21  ? 212  MET B CE    1 
ATOM   5183  N  N     . PHE N  3 81  ? -16.619  -3.133  -4.671  1.00 43.94  ? 213  PHE B N     1 
ATOM   5184  C  CA    . PHE N  3 81  ? -17.139  -2.140  -5.590  1.00 42.46  ? 213  PHE B CA    1 
ATOM   5185  C  C     . PHE N  3 81  ? -17.843  -3.059  -6.559  1.00 42.29  ? 213  PHE B C     1 
ATOM   5186  O  O     . PHE N  3 81  ? -19.021  -2.892  -6.864  1.00 44.17  ? 213  PHE B O     1 
ATOM   5187  C  CB    . PHE N  3 81  ? -16.028  -1.411  -6.320  1.00 41.13  ? 213  PHE B CB    1 
ATOM   5188  C  CG    . PHE N  3 81  ? -16.515  -0.559  -7.454  1.00 39.71  ? 213  PHE B CG    1 
ATOM   5189  C  CD1   . PHE N  3 81  ? -17.440  0.452   -7.238  1.00 39.92  ? 213  PHE B CD1   1 
ATOM   5190  C  CD2   . PHE N  3 81  ? -16.019  -0.739  -8.731  1.00 39.88  ? 213  PHE B CD2   1 
ATOM   5191  C  CE1   . PHE N  3 81  ? -17.861  1.279   -8.276  1.00 39.44  ? 213  PHE B CE1   1 
ATOM   5192  C  CE2   . PHE N  3 81  ? -16.432  0.082   -9.772  1.00 40.46  ? 213  PHE B CE2   1 
ATOM   5193  C  CZ    . PHE N  3 81  ? -17.357  1.097   -9.540  1.00 39.44  ? 213  PHE B CZ    1 
ATOM   5194  N  N     . THR N  3 82  ? -17.107  -4.055  -7.029  1.00 40.60  ? 214  THR B N     1 
ATOM   5195  C  CA    . THR N  3 82  ? -17.693  -5.018  -7.927  1.00 39.07  ? 214  THR B CA    1 
ATOM   5196  C  C     . THR N  3 82  ? -18.857  -5.622  -7.164  1.00 38.15  ? 214  THR B C     1 
ATOM   5197  O  O     . THR N  3 82  ? -19.992  -5.602  -7.635  1.00 38.05  ? 214  THR B O     1 
ATOM   5198  C  CB    . THR N  3 82  ? -16.701  -6.111  -8.292  1.00 38.30  ? 214  THR B CB    1 
ATOM   5199  O  OG1   . THR N  3 82  ? -15.575  -5.513  -8.944  1.00 40.10  ? 214  THR B OG1   1 
ATOM   5200  C  CG2   . THR N  3 82  ? -17.341  -7.125  -9.228  0.00 39.01  ? 214  THR B CG2   1 
ATOM   5201  N  N     . ILE N  3 83  ? -18.588  -6.124  -5.966  1.00 36.50  ? 215  ILE B N     1 
ATOM   5202  C  CA    . ILE N  3 83  ? -19.649  -6.728  -5.176  1.00 36.20  ? 215  ILE B CA    1 
ATOM   5203  C  C     . ILE N  3 83  ? -20.841  -5.789  -5.045  1.00 35.88  ? 215  ILE B C     1 
ATOM   5204  O  O     . ILE N  3 83  ? -21.892  -6.028  -5.638  1.00 35.12  ? 215  ILE B O     1 
ATOM   5205  C  CB    . ILE N  3 83  ? -19.148  -7.135  -3.768  1.00 36.88  ? 215  ILE B CB    1 
ATOM   5206  C  CG1   . ILE N  3 83  ? -18.024  -8.174  -3.904  1.00 39.47  ? 215  ILE B CG1   1 
ATOM   5207  C  CG2   . ILE N  3 83  ? -20.289  -7.730  -2.954  1.00 34.93  ? 215  ILE B CG2   1 
ATOM   5208  C  CD1   . ILE N  3 83  ? -17.422  -8.674  -2.581  1.00 39.83  ? 215  ILE B CD1   1 
ATOM   5209  N  N     . ASN N  3 84  ? -20.679  -4.718  -4.278  1.00 36.76  ? 216  ASN B N     1 
ATOM   5210  C  CA    . ASN N  3 84  ? -21.758  -3.760  -4.085  1.00 37.04  ? 216  ASN B CA    1 
ATOM   5211  C  C     . ASN N  3 84  ? -22.420  -3.447  -5.415  1.00 38.69  ? 216  ASN B C     1 
ATOM   5212  O  O     . ASN N  3 84  ? -23.641  -3.460  -5.527  1.00 39.65  ? 216  ASN B O     1 
ATOM   5213  C  CB    . ASN N  3 84  ? -21.225  -2.473  -3.447  1.00 36.16  ? 216  ASN B CB    1 
ATOM   5214  C  CG    . ASN N  3 84  ? -21.142  -2.557  -1.920  1.00 36.35  ? 216  ASN B CG    1 
ATOM   5215  O  OD1   . ASN N  3 84  ? -20.631  -1.642  -1.264  1.00 35.49  ? 216  ASN B OD1   1 
ATOM   5216  N  ND2   . ASN N  3 84  ? -21.652  -3.651  -1.349  1.00 34.57  ? 216  ASN B ND2   1 
ATOM   5217  N  N     . GLY N  3 85  ? -21.613  -3.181  -6.432  1.00 40.34  ? 217  GLY B N     1 
ATOM   5218  C  CA    . GLY N  3 85  ? -22.171  -2.884  -7.736  1.00 42.78  ? 217  GLY B CA    1 
ATOM   5219  C  C     . GLY N  3 85  ? -23.138  -3.945  -8.246  1.00 45.14  ? 217  GLY B C     1 
ATOM   5220  O  O     . GLY N  3 85  ? -24.258  -3.634  -8.647  1.00 45.19  ? 217  GLY B O     1 
ATOM   5221  N  N     . ILE N  3 86  ? -22.720  -5.205  -8.219  1.00 47.05  ? 218  ILE B N     1 
ATOM   5222  C  CA    . ILE N  3 86  ? -23.561  -6.295  -8.707  1.00 48.43  ? 218  ILE B CA    1 
ATOM   5223  C  C     . ILE N  3 86  ? -24.630  -6.720  -7.712  1.00 49.15  ? 218  ILE B C     1 
ATOM   5224  O  O     . ILE N  3 86  ? -25.732  -7.094  -8.105  1.00 50.67  ? 218  ILE B O     1 
ATOM   5225  C  CB    . ILE N  3 86  ? -22.716  -7.546  -9.055  1.00 49.43  ? 218  ILE B CB    1 
ATOM   5226  C  CG1   . ILE N  3 86  ? -23.510  -8.489  -9.956  1.00 48.75  ? 218  ILE B CG1   1 
ATOM   5227  C  CG2   . ILE N  3 86  ? -22.311  -8.278  -7.784  1.00 50.88  ? 218  ILE B CG2   1 
ATOM   5228  C  CD1   . ILE N  3 86  ? -23.644  -7.989  -11.365 1.00 49.11  ? 218  ILE B CD1   1 
ATOM   5229  N  N     . THR N  3 87  ? -24.314  -6.675  -6.427  1.00 49.33  ? 219  THR B N     1 
ATOM   5230  C  CA    . THR N  3 87  ? -25.286  -7.088  -5.427  1.00 51.13  ? 219  THR B CA    1 
ATOM   5231  C  C     . THR N  3 87  ? -26.266  -5.996  -5.028  1.00 52.40  ? 219  THR B C     1 
ATOM   5232  O  O     . THR N  3 87  ? -27.120  -6.212  -4.160  1.00 52.87  ? 219  THR B O     1 
ATOM   5233  C  CB    . THR N  3 87  ? -24.599  -7.584  -4.147  1.00 50.65  ? 219  THR B CB    1 
ATOM   5234  O  OG1   . THR N  3 87  ? -23.727  -6.567  -3.643  1.00 51.15  ? 219  THR B OG1   1 
ATOM   5235  C  CG2   . THR N  3 87  ? -23.809  -8.835  -4.430  1.00 50.79  ? 219  THR B CG2   1 
ATOM   5236  N  N     . ASN N  3 88  ? -26.177  -4.830  -5.659  1.00 53.02  ? 220  ASN B N     1 
ATOM   5237  C  CA    . ASN N  3 88  ? -27.079  -3.772  -5.253  1.00 52.89  ? 220  ASN B CA    1 
ATOM   5238  C  C     . ASN N  3 88  ? -27.286  -2.612  -6.202  1.00 51.53  ? 220  ASN B C     1 
ATOM   5239  O  O     . ASN N  3 88  ? -28.341  -2.463  -6.800  1.00 50.31  ? 220  ASN B O     1 
ATOM   5240  C  CB    . ASN N  3 88  ? -26.616  -3.236  -3.909  1.00 55.05  ? 220  ASN B CB    1 
ATOM   5241  C  CG    . ASN N  3 88  ? -27.713  -2.549  -3.169  1.00 59.88  ? 220  ASN B CG    1 
ATOM   5242  O  OD1   . ASN N  3 88  ? -28.819  -3.085  -3.040  1.00 63.69  ? 220  ASN B OD1   1 
ATOM   5243  N  ND2   . ASN N  3 88  ? -27.430  -1.357  -2.665  1.00 63.38  ? 220  ASN B ND2   1 
ATOM   5244  N  N     . TRP N  3 89  ? -26.276  -1.777  -6.338  1.00 51.10  ? 221  TRP B N     1 
ATOM   5245  C  CA    . TRP N  3 89  ? -26.416  -0.621  -7.195  1.00 52.32  ? 221  TRP B CA    1 
ATOM   5246  C  C     . TRP N  3 89  ? -26.800  -0.847  -8.654  1.00 53.62  ? 221  TRP B C     1 
ATOM   5247  O  O     . TRP N  3 89  ? -27.000  0.122   -9.379  1.00 55.25  ? 221  TRP B O     1 
ATOM   5248  C  CB    . TRP N  3 89  ? -25.148  0.222   -7.136  1.00 51.17  ? 221  TRP B CB    1 
ATOM   5249  C  CG    . TRP N  3 89  ? -24.698  0.469   -5.759  1.00 50.29  ? 221  TRP B CG    1 
ATOM   5250  C  CD1   . TRP N  3 89  ? -25.476  0.608   -4.652  1.00 50.41  ? 221  TRP B CD1   1 
ATOM   5251  C  CD2   . TRP N  3 89  ? -23.355  0.619   -5.329  1.00 51.91  ? 221  TRP B CD2   1 
ATOM   5252  N  NE1   . TRP N  3 89  ? -24.699  0.835   -3.548  1.00 50.02  ? 221  TRP B NE1   1 
ATOM   5253  C  CE2   . TRP N  3 89  ? -23.387  0.847   -3.937  1.00 52.29  ? 221  TRP B CE2   1 
ATOM   5254  C  CE3   . TRP N  3 89  ? -22.116  0.584   -5.986  1.00 53.96  ? 221  TRP B CE3   1 
ATOM   5255  C  CZ2   . TRP N  3 89  ? -22.227  1.037   -3.183  1.00 55.25  ? 221  TRP B CZ2   1 
ATOM   5256  C  CZ3   . TRP N  3 89  ? -20.959  0.773   -5.241  1.00 55.58  ? 221  TRP B CZ3   1 
ATOM   5257  C  CH2   . TRP N  3 89  ? -21.022  0.997   -3.851  1.00 57.17  ? 221  TRP B CH2   1 
ATOM   5258  N  N     . VAL N  3 90  ? -26.921  -2.087  -9.111  1.00 54.16  ? 222  VAL B N     1 
ATOM   5259  C  CA    . VAL N  3 90  ? -27.290  -2.266  -10.513 1.00 55.18  ? 222  VAL B CA    1 
ATOM   5260  C  C     . VAL N  3 90  ? -28.776  -2.097  -10.741 1.00 55.15  ? 222  VAL B C     1 
ATOM   5261  O  O     . VAL N  3 90  ? -29.178  -1.280  -11.570 1.00 54.57  ? 222  VAL B O     1 
ATOM   5262  C  CB    . VAL N  3 90  ? -26.856  -3.622  -11.058 1.00 56.13  ? 222  VAL B CB    1 
ATOM   5263  C  CG1   . VAL N  3 90  ? -25.456  -3.506  -11.653 1.00 55.87  ? 222  VAL B CG1   1 
ATOM   5264  C  CG2   . VAL N  3 90  ? -26.895  -4.656  -9.942  1.00 57.74  ? 222  VAL B CG2   1 
ATOM   5265  N  N     . GLN N  3 91  ? -29.592  -2.860  -10.015 1.00 56.33  ? 223  GLN B N     1 
ATOM   5266  C  CA    . GLN N  3 91  ? -31.042  -2.746  -10.159 1.00 57.91  ? 223  GLN B CA    1 
ATOM   5267  C  C     . GLN N  3 91  ? -31.393  -1.262  -10.152 1.00 57.58  ? 223  GLN B C     1 
ATOM   5268  O  O     . GLN N  3 91  ? -32.161  -0.783  -10.992 1.00 57.84  ? 223  GLN B O     1 
ATOM   5269  C  CB    . GLN N  3 91  ? -31.769  -3.471  -9.018  1.00 58.98  ? 223  GLN B CB    1 
ATOM   5270  C  CG    . GLN N  3 91  ? -31.120  -3.316  -7.653  1.00 62.28  ? 223  GLN B CG    1 
ATOM   5271  C  CD    . GLN N  3 91  ? -30.477  -4.613  -7.161  1.00 64.69  ? 223  GLN B CD    1 
ATOM   5272  O  OE1   . GLN N  3 91  ? -31.164  -5.529  -6.692  1.00 64.58  ? 223  GLN B OE1   1 
ATOM   5273  N  NE2   . GLN N  3 91  ? -29.153  -4.698  -7.279  1.00 66.56  ? 223  GLN B NE2   1 
ATOM   5274  N  N     . GLY N  3 92  ? -30.811  -0.535  -9.206  1.00 56.49  ? 224  GLY B N     1 
ATOM   5275  C  CA    . GLY N  3 92  ? -31.057  0.885   -9.138  1.00 55.76  ? 224  GLY B CA    1 
ATOM   5276  C  C     . GLY N  3 92  ? -30.688  1.508   -10.466 1.00 55.77  ? 224  GLY B C     1 
ATOM   5277  O  O     . GLY N  3 92  ? -31.520  2.114   -11.128 1.00 54.96  ? 224  GLY B O     1 
ATOM   5278  N  N     . TRP N  3 93  ? -29.437  1.343   -10.870 1.00 57.33  ? 225  TRP B N     1 
ATOM   5279  C  CA    . TRP N  3 93  ? -28.978  1.916   -12.127 1.00 60.24  ? 225  TRP B CA    1 
ATOM   5280  C  C     . TRP N  3 93  ? -29.876  1.546   -13.306 1.00 61.18  ? 225  TRP B C     1 
ATOM   5281  O  O     . TRP N  3 93  ? -29.962  2.291   -14.286 1.00 60.73  ? 225  TRP B O     1 
ATOM   5282  C  CB    . TRP N  3 93  ? -27.533  1.490   -12.422 1.00 61.19  ? 225  TRP B CB    1 
ATOM   5283  C  CG    . TRP N  3 93  ? -26.528  2.029   -11.444 1.00 62.32  ? 225  TRP B CG    1 
ATOM   5284  C  CD1   . TRP N  3 93  ? -26.561  3.242   -10.812 1.00 63.14  ? 225  TRP B CD1   1 
ATOM   5285  C  CD2   . TRP N  3 93  ? -25.329  1.382   -11.003 1.00 63.04  ? 225  TRP B CD2   1 
ATOM   5286  N  NE1   . TRP N  3 93  ? -25.459  3.390   -10.002 1.00 62.82  ? 225  TRP B NE1   1 
ATOM   5287  C  CE2   . TRP N  3 93  ? -24.687  2.262   -10.101 1.00 63.20  ? 225  TRP B CE2   1 
ATOM   5288  C  CE3   . TRP N  3 93  ? -24.735  0.142   -11.280 1.00 62.56  ? 225  TRP B CE3   1 
ATOM   5289  C  CZ2   . TRP N  3 93  ? -23.479  1.941   -9.476  1.00 62.63  ? 225  TRP B CZ2   1 
ATOM   5290  C  CZ3   . TRP N  3 93  ? -23.535  -0.175  -10.659 1.00 61.89  ? 225  TRP B CZ3   1 
ATOM   5291  C  CH2   . TRP N  3 93  ? -22.920  0.722   -9.766  1.00 61.86  ? 225  TRP B CH2   1 
ATOM   5292  N  N     . LYS N  3 94  ? -30.547  0.400   -13.212 1.00 62.02  ? 226  LYS B N     1 
ATOM   5293  C  CA    . LYS N  3 94  ? -31.431  -0.033  -14.288 1.00 62.83  ? 226  LYS B CA    1 
ATOM   5294  C  C     . LYS N  3 94  ? -32.728  0.762   -14.247 1.00 62.42  ? 226  LYS B C     1 
ATOM   5295  O  O     . LYS N  3 94  ? -33.425  0.873   -15.253 1.00 63.10  ? 226  LYS B O     1 
ATOM   5296  C  CB    . LYS N  3 94  ? -31.753  -1.532  -14.179 1.00 64.79  ? 226  LYS B CB    1 
ATOM   5297  C  CG    . LYS N  3 94  ? -30.531  -2.465  -14.164 1.00 66.98  ? 226  LYS B CG    1 
ATOM   5298  C  CD    . LYS N  3 94  ? -30.833  -3.838  -14.789 1.00 66.73  ? 226  LYS B CD    1 
ATOM   5299  C  CE    . LYS N  3 94  ? -30.695  -3.814  -16.326 1.00 67.75  ? 226  LYS B CE    1 
ATOM   5300  N  NZ    . LYS N  3 94  ? -31.556  -2.791  -17.006 1.00 67.37  ? 226  LYS B NZ    1 
ATOM   5301  N  N     . LYS N  3 95  ? -33.046  1.314   -13.079 1.00 60.95  ? 227  LYS B N     1 
ATOM   5302  C  CA    . LYS N  3 95  ? -34.261  2.100   -12.908 1.00 59.60  ? 227  LYS B CA    1 
ATOM   5303  C  C     . LYS N  3 95  ? -33.951  3.592   -12.849 1.00 59.63  ? 227  LYS B C     1 
ATOM   5304  O  O     . LYS N  3 95  ? -34.604  4.343   -12.124 1.00 60.13  ? 227  LYS B O     1 
ATOM   5305  C  CB    . LYS N  3 95  ? -34.977  1.683   -11.628 1.00 58.47  ? 227  LYS B CB    1 
ATOM   5306  C  CG    . LYS N  3 95  ? -35.315  0.218   -11.563 1.00 59.21  ? 227  LYS B CG    1 
ATOM   5307  C  CD    . LYS N  3 95  ? -35.751  -0.165  -10.161 1.00 61.00  ? 227  LYS B CD    1 
ATOM   5308  C  CE    . LYS N  3 95  ? -36.111  -1.642  -10.057 1.00 62.20  ? 227  LYS B CE    1 
ATOM   5309  N  NZ    . LYS N  3 95  ? -37.381  -1.956  -10.773 1.00 63.65  ? 227  LYS B NZ    1 
ATOM   5310  N  N     . ASN N  3 96  ? -32.948  4.024   -13.602 1.00 58.52  ? 228  ASN B N     1 
ATOM   5311  C  CA    . ASN N  3 96  ? -32.600  5.432   -13.614 1.00 58.60  ? 228  ASN B CA    1 
ATOM   5312  C  C     . ASN N  3 96  ? -31.693  5.762   -14.794 1.00 59.31  ? 228  ASN B C     1 
ATOM   5313  O  O     . ASN N  3 96  ? -30.973  6.761   -14.786 1.00 58.69  ? 228  ASN B O     1 
ATOM   5314  C  CB    . ASN N  3 96  ? -31.953  5.834   -12.273 1.00 59.16  ? 228  ASN B CB    1 
ATOM   5315  C  CG    . ASN N  3 96  ? -30.516  5.324   -12.112 1.00 60.31  ? 228  ASN B CG    1 
ATOM   5316  O  OD1   . ASN N  3 96  ? -30.003  4.555   -12.930 1.00 60.45  ? 228  ASN B OD1   1 
ATOM   5317  N  ND2   . ASN N  3 96  ? -29.865  5.761   -11.040 1.00 59.04  ? 228  ASN B ND2   1 
ATOM   5318  N  N     . GLY N  3 97  ? -31.747  4.923   -15.823 1.00 60.51  ? 229  GLY B N     1 
ATOM   5319  C  CA    . GLY N  3 97  ? -30.923  5.153   -16.998 1.00 62.52  ? 229  GLY B CA    1 
ATOM   5320  C  C     . GLY N  3 97  ? -29.454  5.159   -16.627 1.00 63.43  ? 229  GLY B C     1 
ATOM   5321  O  O     . GLY N  3 97  ? -28.607  5.703   -17.347 1.00 62.26  ? 229  GLY B O     1 
ATOM   5322  N  N     . TRP N  3 98  ? -29.160  4.541   -15.486 1.00 64.32  ? 230  TRP B N     1 
ATOM   5323  C  CA    . TRP N  3 98  ? -27.803  4.459   -14.994 1.00 64.57  ? 230  TRP B CA    1 
ATOM   5324  C  C     . TRP N  3 98  ? -27.268  5.847   -14.732 1.00 65.20  ? 230  TRP B C     1 
ATOM   5325  O  O     . TRP N  3 98  ? -26.484  6.400   -15.513 1.00 63.93  ? 230  TRP B O     1 
ATOM   5326  C  CB    . TRP N  3 98  ? -26.940  3.719   -16.004 1.00 65.67  ? 230  TRP B CB    1 
ATOM   5327  C  CG    . TRP N  3 98  ? -27.367  2.304   -16.110 1.00 67.76  ? 230  TRP B CG    1 
ATOM   5328  C  CD1   . TRP N  3 98  ? -28.533  1.838   -16.644 1.00 68.22  ? 230  TRP B CD1   1 
ATOM   5329  C  CD2   . TRP N  3 98  ? -26.687  1.166   -15.575 1.00 68.80  ? 230  TRP B CD2   1 
ATOM   5330  N  NE1   . TRP N  3 98  ? -28.624  0.480   -16.467 1.00 68.90  ? 230  TRP B NE1   1 
ATOM   5331  C  CE2   . TRP N  3 98  ? -27.504  0.042   -15.813 1.00 68.94  ? 230  TRP B CE2   1 
ATOM   5332  C  CE3   . TRP N  3 98  ? -25.466  0.988   -14.912 1.00 69.20  ? 230  TRP B CE3   1 
ATOM   5333  C  CZ2   . TRP N  3 98  ? -27.140  -1.242  -15.410 1.00 69.52  ? 230  TRP B CZ2   1 
ATOM   5334  C  CZ3   . TRP N  3 98  ? -25.106  -0.287  -14.513 1.00 69.97  ? 230  TRP B CZ3   1 
ATOM   5335  C  CH2   . TRP N  3 98  ? -25.941  -1.387  -14.762 1.00 70.55  ? 230  TRP B CH2   1 
ATOM   5336  N  N     . LYS N  3 99  ? -27.727  6.409   -13.620 1.00 65.89  ? 231  LYS B N     1 
ATOM   5337  C  CA    . LYS N  3 99  ? -27.318  7.735   -13.200 1.00 67.13  ? 231  LYS B CA    1 
ATOM   5338  C  C     . LYS N  3 99  ? -26.783  7.644   -11.782 1.00 67.12  ? 231  LYS B C     1 
ATOM   5339  O  O     . LYS N  3 99  ? -27.457  7.150   -10.873 1.00 66.38  ? 231  LYS B O     1 
ATOM   5340  C  CB    . LYS N  3 99  ? -28.500  8.709   -13.244 1.00 68.53  ? 231  LYS B CB    1 
ATOM   5341  C  CG    . LYS N  3 99  ? -29.121  8.899   -14.620 1.00 70.83  ? 231  LYS B CG    1 
ATOM   5342  C  CD    . LYS N  3 99  ? -28.118  9.456   -15.622 1.00 73.41  ? 231  LYS B CD    1 
ATOM   5343  C  CE    . LYS N  3 99  ? -28.724  9.585   -17.022 1.00 74.66  ? 231  LYS B CE    1 
ATOM   5344  N  NZ    . LYS N  3 99  ? -29.124  8.268   -17.604 1.00 75.72  ? 231  LYS B NZ    1 
ATOM   5345  N  N     . THR N  3 100 ? -25.555  8.113   -11.605 1.00 67.52  ? 232  THR B N     1 
ATOM   5346  C  CA    . THR N  3 100 ? -24.913  8.102   -10.303 1.00 67.33  ? 232  THR B CA    1 
ATOM   5347  C  C     . THR N  3 100 ? -25.824  8.824   -9.339  1.00 66.72  ? 232  THR B C     1 
ATOM   5348  O  O     . THR N  3 100 ? -26.551  9.731   -9.734  1.00 66.77  ? 232  THR B O     1 
ATOM   5349  C  CB    . THR N  3 100 ? -23.572  8.857   -10.332 1.00 67.43  ? 232  THR B CB    1 
ATOM   5350  O  OG1   . THR N  3 100 ? -22.871  8.627   -9.108  1.00 69.16  ? 232  THR B OG1   1 
ATOM   5351  C  CG2   . THR N  3 100 ? -23.806  10.358  -10.480 1.00 66.18  ? 232  THR B CG2   1 
ATOM   5352  N  N     . SER N  3 101 ? -25.806  8.419   -8.079  1.00 66.54  ? 233  SER B N     1 
ATOM   5353  C  CA    . SER N  3 101 ? -26.624  9.107   -7.098  1.00 66.47  ? 233  SER B CA    1 
ATOM   5354  C  C     . SER N  3 101 ? -25.942  10.446  -6.887  1.00 63.57  ? 233  SER B C     1 
ATOM   5355  O  O     . SER N  3 101 ? -25.457  10.764  -5.800  1.00 61.81  ? 233  SER B O     1 
ATOM   5356  C  CB    . SER N  3 101 ? -26.705  8.312   -5.790  1.00 70.09  ? 233  SER B CB    1 
ATOM   5357  O  OG    . SER N  3 101 ? -27.632  7.236   -5.908  1.00 73.74  ? 233  SER B OG    1 
ATOM   5358  N  N     . ALA N  3 102 ? -25.902  11.207  -7.976  1.00 61.81  ? 234  ALA B N     1 
ATOM   5359  C  CA    . ALA N  3 102 ? -25.296  12.523  -8.024  1.00 60.75  ? 234  ALA B CA    1 
ATOM   5360  C  C     . ALA N  3 102 ? -25.414  13.099  -9.442  1.00 59.92  ? 234  ALA B C     1 
ATOM   5361  O  O     . ALA N  3 102 ? -24.547  13.852  -9.893  1.00 60.19  ? 234  ALA B O     1 
ATOM   5362  C  CB    . ALA N  3 102 ? -23.835  12.441  -7.605  1.00 61.46  ? 234  ALA B CB    1 
ATOM   5363  N  N     . GLY N  3 103 ? -26.477  12.715  -10.146 1.00 58.16  ? 235  GLY B N     1 
ATOM   5364  C  CA    . GLY N  3 103 ? -26.727  13.226  -11.485 1.00 55.62  ? 235  GLY B CA    1 
ATOM   5365  C  C     . GLY N  3 103 ? -25.961  12.722  -12.696 1.00 54.77  ? 235  GLY B C     1 
ATOM   5366  O  O     . GLY N  3 103 ? -26.536  12.629  -13.778 1.00 55.14  ? 235  GLY B O     1 
ATOM   5367  N  N     . LYS N  3 104 ? -24.680  12.401  -12.545 1.00 54.23  ? 236  LYS B N     1 
ATOM   5368  C  CA    . LYS N  3 104 ? -23.875  11.939  -13.680 1.00 53.24  ? 236  LYS B CA    1 
ATOM   5369  C  C     . LYS N  3 104 ? -24.048  10.459  -14.045 1.00 52.65  ? 236  LYS B C     1 
ATOM   5370  O  O     . LYS N  3 104 ? -24.786  9.728   -13.390 1.00 52.32  ? 236  LYS B O     1 
ATOM   5371  C  CB    . LYS N  3 104 ? -22.403  12.260  -13.417 1.00 53.57  ? 236  LYS B CB    1 
ATOM   5372  C  CG    . LYS N  3 104 ? -22.173  13.722  -13.014 1.00 53.82  ? 236  LYS B CG    1 
ATOM   5373  C  CD    . LYS N  3 104 ? -20.690  14.107  -12.975 1.00 53.36  ? 236  LYS B CD    1 
ATOM   5374  C  CE    . LYS N  3 104 ? -20.491  15.582  -12.618 1.00 52.43  ? 236  LYS B CE    1 
ATOM   5375  N  NZ    . LYS N  3 104 ? -19.051  15.959  -12.634 1.00 51.60  ? 236  LYS B NZ    1 
ATOM   5376  N  N     . GLU N  3 105 ? -23.373  10.013  -15.097 1.00 52.75  ? 237  GLU B N     1 
ATOM   5377  C  CA    . GLU N  3 105 ? -23.515  8.621   -15.533 1.00 54.79  ? 237  GLU B CA    1 
ATOM   5378  C  C     . GLU N  3 105 ? -22.548  7.628   -14.886 1.00 52.81  ? 237  GLU B C     1 
ATOM   5379  O  O     . GLU N  3 105 ? -21.345  7.880   -14.844 1.00 53.37  ? 237  GLU B O     1 
ATOM   5380  C  CB    . GLU N  3 105 ? -23.376  8.532   -17.062 1.00 57.94  ? 237  GLU B CB    1 
ATOM   5381  C  CG    . GLU N  3 105 ? -24.697  8.349   -17.803 1.00 62.23  ? 237  GLU B CG    1 
ATOM   5382  C  CD    . GLU N  3 105 ? -24.654  7.200   -18.809 1.00 65.67  ? 237  GLU B CD    1 
ATOM   5383  O  OE1   . GLU N  3 105 ? -23.862  7.292   -19.779 1.00 67.62  ? 237  GLU B OE1   1 
ATOM   5384  O  OE2   . GLU N  3 105 ? -25.410  6.208   -18.625 1.00 65.94  ? 237  GLU B OE2   1 
ATOM   5385  N  N     . VAL N  3 106 ? -23.074  6.501   -14.396 1.00 49.66  ? 238  VAL B N     1 
ATOM   5386  C  CA    . VAL N  3 106 ? -22.235  5.481   -13.775 1.00 46.81  ? 238  VAL B CA    1 
ATOM   5387  C  C     . VAL N  3 106 ? -21.283  4.905   -14.811 1.00 46.66  ? 238  VAL B C     1 
ATOM   5388  O  O     . VAL N  3 106 ? -21.642  4.059   -15.622 1.00 46.28  ? 238  VAL B O     1 
ATOM   5389  C  CB    . VAL N  3 106 ? -23.079  4.358   -13.112 1.00 45.04  ? 238  VAL B CB    1 
ATOM   5390  C  CG1   . VAL N  3 106 ? -24.360  4.167   -13.852 1.00 45.44  ? 238  VAL B CG1   1 
ATOM   5391  C  CG2   . VAL N  3 106 ? -22.289  3.062   -13.062 1.00 43.45  ? 238  VAL B CG2   1 
ATOM   5392  N  N     . ILE N  3 107 ? -20.058  5.415   -14.748 1.00 47.36  ? 239  ILE B N     1 
ATOM   5393  C  CA    . ILE N  3 107 ? -18.930  5.102   -15.624 1.00 47.42  ? 239  ILE B CA    1 
ATOM   5394  C  C     . ILE N  3 107 ? -18.660  3.667   -16.006 1.00 48.03  ? 239  ILE B C     1 
ATOM   5395  O  O     . ILE N  3 107 ? -18.225  3.384   -17.129 1.00 47.49  ? 239  ILE B O     1 
ATOM   5396  C  CB    . ILE N  3 107 ? -17.628  5.626   -15.007 1.00 47.89  ? 239  ILE B CB    1 
ATOM   5397  C  CG1   . ILE N  3 107 ? -17.888  6.041   -13.558 1.00 46.42  ? 239  ILE B CG1   1 
ATOM   5398  C  CG2   . ILE N  3 107 ? -17.066  6.752   -15.847 1.00 49.08  ? 239  ILE B CG2   1 
ATOM   5399  C  CD1   . ILE N  3 107 ? -16.698  6.597   -12.859 1.00 47.14  ? 239  ILE B CD1   1 
ATOM   5400  N  N     . ASN N  3 108 ? -18.883  2.764   -15.065 1.00 48.73  ? 240  ASN B N     1 
ATOM   5401  C  CA    . ASN N  3 108 ? -18.600  1.369   -15.316 1.00 50.28  ? 240  ASN B CA    1 
ATOM   5402  C  C     . ASN N  3 108 ? -19.838  0.607   -15.689 1.00 52.22  ? 240  ASN B C     1 
ATOM   5403  O  O     . ASN N  3 108 ? -19.931  -0.594  -15.440 1.00 53.92  ? 240  ASN B O     1 
ATOM   5404  C  CB    . ASN N  3 108 ? -17.938  0.756   -14.087 1.00 49.10  ? 240  ASN B CB    1 
ATOM   5405  C  CG    . ASN N  3 108 ? -16.925  1.692   -13.458 1.00 47.89  ? 240  ASN B CG    1 
ATOM   5406  O  OD1   . ASN N  3 108 ? -17.290  2.588   -12.694 1.00 47.79  ? 240  ASN B OD1   1 
ATOM   5407  N  ND2   . ASN N  3 108 ? -15.650  1.509   -13.796 1.00 44.98  ? 240  ASN B ND2   1 
ATOM   5408  N  N     . LYS N  3 109 ? -20.794  1.317   -16.281 1.00 53.94  ? 241  LYS B N     1 
ATOM   5409  C  CA    . LYS N  3 109 ? -22.035  0.694   -16.722 1.00 55.06  ? 241  LYS B CA    1 
ATOM   5410  C  C     . LYS N  3 109 ? -21.631  -0.348  -17.756 1.00 54.95  ? 241  LYS B C     1 
ATOM   5411  O  O     . LYS N  3 109 ? -21.941  -1.532  -17.625 1.00 53.22  ? 241  LYS B O     1 
ATOM   5412  C  CB    . LYS N  3 109 ? -22.955  1.734   -17.361 1.00 55.74  ? 241  LYS B CB    1 
ATOM   5413  C  CG    . LYS N  3 109 ? -24.230  1.149   -17.947 1.00 57.69  ? 241  LYS B CG    1 
ATOM   5414  C  CD    . LYS N  3 109 ? -25.134  2.239   -18.497 1.00 59.39  ? 241  LYS B CD    1 
ATOM   5415  C  CE    . LYS N  3 109 ? -26.386  1.649   -19.122 1.00 60.93  ? 241  LYS B CE    1 
ATOM   5416  N  NZ    . LYS N  3 109 ? -27.383  2.695   -19.490 1.00 61.67  ? 241  LYS B NZ    1 
ATOM   5417  N  N     . GLU N  3 110 ? -20.917  0.113   -18.776 1.00 55.58  ? 242  GLU B N     1 
ATOM   5418  C  CA    . GLU N  3 110 ? -20.435  -0.753  -19.838 1.00 57.21  ? 242  GLU B CA    1 
ATOM   5419  C  C     . GLU N  3 110 ? -19.863  -2.026  -19.214 1.00 56.47  ? 242  GLU B C     1 
ATOM   5420  O  O     . GLU N  3 110 ? -20.005  -3.124  -19.760 1.00 57.49  ? 242  GLU B O     1 
ATOM   5421  C  CB    . GLU N  3 110 ? -19.357  -0.019  -20.635 1.00 59.61  ? 242  GLU B CB    1 
ATOM   5422  C  CG    . GLU N  3 110 ? -18.779  -0.779  -21.810 1.00 63.52  ? 242  GLU B CG    1 
ATOM   5423  C  CD    . GLU N  3 110 ? -17.673  0.007   -22.500 1.00 66.43  ? 242  GLU B CD    1 
ATOM   5424  O  OE1   . GLU N  3 110 ? -17.973  1.083   -23.072 1.00 67.97  ? 242  GLU B OE1   1 
ATOM   5425  O  OE2   . GLU N  3 110 ? -16.505  -0.445  -22.461 1.00 66.89  ? 242  GLU B OE2   1 
ATOM   5426  N  N     . ASP N  3 111 ? -19.227  -1.871  -18.057 1.00 54.66  ? 243  ASP B N     1 
ATOM   5427  C  CA    . ASP N  3 111 ? -18.640  -3.001  -17.348 1.00 51.92  ? 243  ASP B CA    1 
ATOM   5428  C  C     . ASP N  3 111 ? -19.698  -3.741  -16.552 1.00 48.82  ? 243  ASP B C     1 
ATOM   5429  O  O     . ASP N  3 111 ? -19.968  -4.906  -16.809 1.00 48.47  ? 243  ASP B O     1 
ATOM   5430  C  CB    . ASP N  3 111 ? -17.538  -2.508  -16.429 1.00 53.17  ? 243  ASP B CB    1 
ATOM   5431  C  CG    . ASP N  3 111 ? -16.554  -1.625  -17.153 1.00 55.39  ? 243  ASP B CG    1 
ATOM   5432  O  OD1   . ASP N  3 111 ? -15.901  -2.114  -18.108 1.00 55.13  ? 243  ASP B OD1   1 
ATOM   5433  O  OD2   . ASP N  3 111 ? -16.446  -0.439  -16.776 1.00 57.24  ? 243  ASP B OD2   1 
ATOM   5434  N  N     . PHE N  3 112 ? -20.306  -3.071  -15.590 1.00 46.06  ? 244  PHE B N     1 
ATOM   5435  C  CA    . PHE N  3 112 ? -21.338  -3.715  -14.803 1.00 45.56  ? 244  PHE B CA    1 
ATOM   5436  C  C     . PHE N  3 112 ? -22.421  -4.324  -15.682 1.00 47.82  ? 244  PHE B C     1 
ATOM   5437  O  O     . PHE N  3 112 ? -23.121  -5.244  -15.259 1.00 47.71  ? 244  PHE B O     1 
ATOM   5438  C  CB    . PHE N  3 112 ? -21.948  -2.722  -13.831 1.00 42.78  ? 244  PHE B CB    1 
ATOM   5439  C  CG    . PHE N  3 112 ? -21.167  -2.576  -12.560 1.00 38.12  ? 244  PHE B CG    1 
ATOM   5440  C  CD1   . PHE N  3 112 ? -21.191  -3.588  -11.600 1.00 35.16  ? 244  PHE B CD1   1 
ATOM   5441  C  CD2   . PHE N  3 112 ? -20.412  -1.430  -12.320 1.00 34.14  ? 244  PHE B CD2   1 
ATOM   5442  C  CE1   . PHE N  3 112 ? -20.478  -3.465  -10.426 1.00 32.99  ? 244  PHE B CE1   1 
ATOM   5443  C  CE2   . PHE N  3 112 ? -19.698  -1.298  -11.154 1.00 33.10  ? 244  PHE B CE2   1 
ATOM   5444  C  CZ    . PHE N  3 112 ? -19.730  -2.318  -10.199 1.00 34.38  ? 244  PHE B CZ    1 
ATOM   5445  N  N     . VAL N  3 113 ? -22.569  -3.813  -16.903 1.00 50.37  ? 245  VAL B N     1 
ATOM   5446  C  CA    . VAL N  3 113 ? -23.561  -4.370  -17.829 1.00 51.66  ? 245  VAL B CA    1 
ATOM   5447  C  C     . VAL N  3 113 ? -23.056  -5.755  -18.209 1.00 52.15  ? 245  VAL B C     1 
ATOM   5448  O  O     . VAL N  3 113 ? -23.610  -6.774  -17.783 1.00 51.74  ? 245  VAL B O     1 
ATOM   5449  C  CB    . VAL N  3 113 ? -23.715  -3.520  -19.129 1.00 51.50  ? 245  VAL B CB    1 
ATOM   5450  C  CG1   . VAL N  3 113 ? -24.322  -4.369  -20.238 1.00 50.58  ? 245  VAL B CG1   1 
ATOM   5451  C  CG2   . VAL N  3 113 ? -24.612  -2.311  -18.864 1.00 50.49  ? 245  VAL B CG2   1 
ATOM   5452  N  N     . ALA N  3 114 ? -21.989  -5.778  -19.002 1.00 52.39  ? 246  ALA B N     1 
ATOM   5453  C  CA    . ALA N  3 114 ? -21.393  -7.031  -19.425 1.00 52.87  ? 246  ALA B CA    1 
ATOM   5454  C  C     . ALA N  3 114 ? -21.356  -8.014  -18.255 1.00 53.06  ? 246  ALA B C     1 
ATOM   5455  O  O     . ALA N  3 114 ? -21.700  -9.179  -18.418 1.00 54.26  ? 246  ALA B O     1 
ATOM   5456  C  CB    . ALA N  3 114 ? -19.988  -6.789  -19.956 1.00 52.06  ? 246  ALA B CB    1 
ATOM   5457  N  N     . LEU N  3 115 ? -20.966  -7.552  -17.071 1.00 52.22  ? 247  LEU B N     1 
ATOM   5458  C  CA    . LEU N  3 115 ? -20.908  -8.454  -15.935 1.00 52.38  ? 247  LEU B CA    1 
ATOM   5459  C  C     . LEU N  3 115 ? -22.253  -9.071  -15.613 1.00 54.64  ? 247  LEU B C     1 
ATOM   5460  O  O     . LEU N  3 115 ? -22.355  -10.289 -15.484 1.00 54.43  ? 247  LEU B O     1 
ATOM   5461  C  CB    . LEU N  3 115 ? -20.402  -7.758  -14.685 1.00 51.08  ? 247  LEU B CB    1 
ATOM   5462  C  CG    . LEU N  3 115 ? -20.352  -8.789  -13.552 1.00 51.46  ? 247  LEU B CG    1 
ATOM   5463  C  CD1   . LEU N  3 115 ? -19.195  -9.736  -13.816 1.00 51.41  ? 247  LEU B CD1   1 
ATOM   5464  C  CD2   . LEU N  3 115 ? -20.193  -8.124  -12.201 1.00 51.15  ? 247  LEU B CD2   1 
ATOM   5465  N  N     . GLU N  3 116 ? -23.285  -8.240  -15.467 1.00 57.63  ? 248  GLU B N     1 
ATOM   5466  C  CA    . GLU N  3 116 ? -24.618  -8.757  -15.142 1.00 60.66  ? 248  GLU B CA    1 
ATOM   5467  C  C     . GLU N  3 116 ? -25.099  -9.758  -16.198 1.00 61.91  ? 248  GLU B C     1 
ATOM   5468  O  O     . GLU N  3 116 ? -25.918  -10.637 -15.910 1.00 61.06  ? 248  GLU B O     1 
ATOM   5469  C  CB    . GLU N  3 116 ? -25.641  -7.615  -14.987 1.00 60.94  ? 248  GLU B CB    1 
ATOM   5470  C  CG    . GLU N  3 116 ? -27.064  -8.105  -14.646 1.00 64.20  ? 248  GLU B CG    1 
ATOM   5471  C  CD    . GLU N  3 116 ? -28.027  -6.994  -14.195 1.00 65.74  ? 248  GLU B CD    1 
ATOM   5472  O  OE1   . GLU N  3 116 ? -27.952  -5.875  -14.753 1.00 67.30  ? 248  GLU B OE1   1 
ATOM   5473  O  OE2   . GLU N  3 116 ? -28.872  -7.250  -13.297 1.00 64.50  ? 248  GLU B OE2   1 
ATOM   5474  N  N     . ARG N  3 117 ? -24.584  -9.630  -17.418 1.00 63.40  ? 249  ARG B N     1 
ATOM   5475  C  CA    . ARG N  3 117 ? -24.969  -10.543 -18.479 1.00 64.96  ? 249  ARG B CA    1 
ATOM   5476  C  C     . ARG N  3 117 ? -24.645  -11.952 -18.027 1.00 64.92  ? 249  ARG B C     1 
ATOM   5477  O  O     . ARG N  3 117 ? -25.546  -12.723 -17.709 1.00 66.32  ? 249  ARG B O     1 
ATOM   5478  C  CB    . ARG N  3 117 ? -24.212  -10.240 -19.774 1.00 67.67  ? 249  ARG B CB    1 
ATOM   5479  C  CG    . ARG N  3 117 ? -24.644  -11.104 -20.958 1.00 71.62  ? 249  ARG B CG    1 
ATOM   5480  C  CD    . ARG N  3 117 ? -24.035  -10.612 -22.269 1.00 76.27  ? 249  ARG B CD    1 
ATOM   5481  N  NE    . ARG N  3 117 ? -24.941  -10.816 -23.403 1.00 81.86  ? 249  ARG B NE    1 
ATOM   5482  C  CZ    . ARG N  3 117 ? -25.180  -11.988 -23.995 1.00 84.96  ? 249  ARG B CZ    1 
ATOM   5483  N  NH1   . ARG N  3 117 ? -24.572  -13.093 -23.574 1.00 86.12  ? 249  ARG B NH1   1 
ATOM   5484  N  NH2   . ARG N  3 117 ? -26.047  -12.062 -25.004 1.00 85.55  ? 249  ARG B NH2   1 
ATOM   5485  N  N     . LEU N  3 118 ? -23.354  -12.273 -17.981 1.00 63.71  ? 250  LEU B N     1 
ATOM   5486  C  CA    . LEU N  3 118 ? -22.893  -13.595 -17.579 1.00 62.52  ? 250  LEU B CA    1 
ATOM   5487  C  C     . LEU N  3 118 ? -23.576  -14.094 -16.315 1.00 62.79  ? 250  LEU B C     1 
ATOM   5488  O  O     . LEU N  3 118 ? -23.709  -15.295 -16.104 1.00 62.78  ? 250  LEU B O     1 
ATOM   5489  C  CB    . LEU N  3 118 ? -21.377  -13.590 -17.391 1.00 61.62  ? 250  LEU B CB    1 
ATOM   5490  C  CG    . LEU N  3 118 ? -20.576  -13.324 -18.670 1.00 62.42  ? 250  LEU B CG    1 
ATOM   5491  C  CD1   . LEU N  3 118 ? -20.638  -11.847 -19.012 1.00 62.66  ? 250  LEU B CD1   1 
ATOM   5492  C  CD2   . LEU N  3 118 ? -19.132  -13.751 -18.493 1.00 62.59  ? 250  LEU B CD2   1 
ATOM   5493  N  N     . THR N  3 119 ? -24.022  -13.169 -15.479 1.00 63.62  ? 251  THR B N     1 
ATOM   5494  C  CA    . THR N  3 119 ? -24.710  -13.526 -14.247 1.00 64.77  ? 251  THR B CA    1 
ATOM   5495  C  C     . THR N  3 119 ? -26.022  -14.231 -14.581 1.00 66.06  ? 251  THR B C     1 
ATOM   5496  O  O     . THR N  3 119 ? -26.691  -14.771 -13.704 1.00 66.32  ? 251  THR B O     1 
ATOM   5497  C  CB    . THR N  3 119 ? -25.043  -12.280 -13.438 1.00 64.76  ? 251  THR B CB    1 
ATOM   5498  O  OG1   . THR N  3 119 ? -24.127  -11.234 -13.781 1.00 65.64  ? 251  THR B OG1   1 
ATOM   5499  C  CG2   . THR N  3 119 ? -24.917  -12.567 -11.972 1.00 64.50  ? 251  THR B CG2   1 
ATOM   5500  N  N     . GLN N  3 120 ? -26.384  -14.209 -15.859 1.00 67.62  ? 252  GLN B N     1 
ATOM   5501  C  CA    . GLN N  3 120 ? -27.613  -14.823 -16.342 1.00 68.86  ? 252  GLN B CA    1 
ATOM   5502  C  C     . GLN N  3 120 ? -27.688  -16.313 -16.074 1.00 69.07  ? 252  GLN B C     1 
ATOM   5503  O  O     . GLN N  3 120 ? -26.791  -17.072 -16.444 1.00 69.72  ? 252  GLN B O     1 
ATOM   5504  C  CB    . GLN N  3 120 ? -27.763  -14.568 -17.840 1.00 70.50  ? 252  GLN B CB    1 
ATOM   5505  C  CG    . GLN N  3 120 ? -29.002  -13.776 -18.196 1.00 74.50  ? 252  GLN B CG    1 
ATOM   5506  C  CD    . GLN N  3 120 ? -29.364  -12.758 -17.128 1.00 76.89  ? 252  GLN B CD    1 
ATOM   5507  O  OE1   . GLN N  3 120 ? -29.920  -13.111 -16.082 1.00 78.17  ? 252  GLN B OE1   1 
ATOM   5508  N  NE2   . GLN N  3 120 ? -29.039  -11.490 -17.378 1.00 78.06  ? 252  GLN B NE2   1 
ATOM   5509  N  N     . GLY N  3 121 ? -28.774  -16.726 -15.431 1.00 68.89  ? 253  GLY B N     1 
ATOM   5510  C  CA    . GLY N  3 121 ? -28.964  -18.131 -15.118 1.00 68.25  ? 253  GLY B CA    1 
ATOM   5511  C  C     . GLY N  3 121 ? -28.039  -18.608 -14.018 1.00 66.92  ? 253  GLY B C     1 
ATOM   5512  O  O     . GLY N  3 121 ? -28.425  -19.369 -13.132 1.00 66.79  ? 253  GLY B O     1 
ATOM   5513  N  N     . MET N  3 122 ? -26.803  -18.141 -14.080 1.00 66.24  ? 254  MET B N     1 
ATOM   5514  C  CA    . MET N  3 122 ? -25.787  -18.501 -13.110 1.00 65.98  ? 254  MET B CA    1 
ATOM   5515  C  C     . MET N  3 122 ? -26.146  -18.018 -11.703 1.00 65.19  ? 254  MET B C     1 
ATOM   5516  O  O     . MET N  3 122 ? -26.832  -17.010 -11.545 1.00 65.75  ? 254  MET B O     1 
ATOM   5517  C  CB    . MET N  3 122 ? -24.460  -17.886 -13.550 1.00 66.69  ? 254  MET B CB    1 
ATOM   5518  C  CG    . MET N  3 122 ? -23.283  -18.334 -12.748 1.00 68.60  ? 254  MET B CG    1 
ATOM   5519  S  SD    . MET N  3 122 ? -23.078  -20.095 -12.901 1.00 72.50  ? 254  MET B SD    1 
ATOM   5520  C  CE    . MET N  3 122 ? -22.404  -20.165 -14.592 1.00 73.09  ? 254  MET B CE    1 
ATOM   5521  N  N     . ASP N  3 123 ? -25.699  -18.743 -10.683 1.00 64.12  ? 255  ASP B N     1 
ATOM   5522  C  CA    . ASP N  3 123 ? -25.956  -18.329 -9.309  1.00 63.42  ? 255  ASP B CA    1 
ATOM   5523  C  C     . ASP N  3 123 ? -24.655  -18.068 -8.543  1.00 63.46  ? 255  ASP B C     1 
ATOM   5524  O  O     . ASP N  3 123 ? -24.057  -18.985 -7.970  1.00 62.91  ? 255  ASP B O     1 
ATOM   5525  C  CB    . ASP N  3 123 ? -26.769  -19.365 -8.558  1.00 63.78  ? 255  ASP B CB    1 
ATOM   5526  C  CG    . ASP N  3 123 ? -26.865  -19.043 -7.084  1.00 65.76  ? 255  ASP B CG    1 
ATOM   5527  O  OD1   . ASP N  3 123 ? -27.255  -17.910 -6.755  1.00 66.82  ? 255  ASP B OD1   1 
ATOM   5528  O  OD2   . ASP N  3 123 ? -26.544  -19.908 -6.246  1.00 68.18  ? 255  ASP B OD2   1 
ATOM   5529  N  N     . ILE N  3 124 ? -24.239  -16.802 -8.533  1.00 62.78  ? 256  ILE B N     1 
ATOM   5530  C  CA    . ILE N  3 124 ? -23.009  -16.353 -7.877  1.00 60.79  ? 256  ILE B CA    1 
ATOM   5531  C  C     . ILE N  3 124 ? -23.238  -15.930 -6.434  1.00 59.77  ? 256  ILE B C     1 
ATOM   5532  O  O     . ILE N  3 124 ? -24.168  -15.191 -6.144  1.00 60.70  ? 256  ILE B O     1 
ATOM   5533  C  CB    . ILE N  3 124 ? -22.435  -15.110 -8.576  1.00 60.94  ? 256  ILE B CB    1 
ATOM   5534  C  CG1   . ILE N  3 124 ? -22.534  -15.261 -10.088 1.00 60.29  ? 256  ILE B CG1   1 
ATOM   5535  C  CG2   . ILE N  3 124 ? -20.999  -14.885 -8.136  1.00 61.89  ? 256  ILE B CG2   1 
ATOM   5536  C  CD1   . ILE N  3 124 ? -21.665  -16.334 -10.627 1.00 61.88  ? 256  ILE B CD1   1 
ATOM   5537  N  N     . GLN N  3 125 ? -22.395  -16.382 -5.523  1.00 57.94  ? 257  GLN B N     1 
ATOM   5538  C  CA    . GLN N  3 125 ? -22.549  -15.949 -4.152  1.00 56.94  ? 257  GLN B CA    1 
ATOM   5539  C  C     . GLN N  3 125 ? -21.243  -15.228 -3.833  1.00 56.40  ? 257  GLN B C     1 
ATOM   5540  O  O     . GLN N  3 125 ? -20.251  -15.852 -3.453  1.00 56.74  ? 257  GLN B O     1 
ATOM   5541  C  CB    . GLN N  3 125 ? -22.784  -17.145 -3.234  1.00 58.16  ? 257  GLN B CB    1 
ATOM   5542  C  CG    . GLN N  3 125 ? -23.081  -16.746 -1.798  1.00 62.30  ? 257  GLN B CG    1 
ATOM   5543  C  CD    . GLN N  3 125 ? -23.929  -17.766 -1.049  1.00 64.21  ? 257  GLN B CD    1 
ATOM   5544  O  OE1   . GLN N  3 125 ? -24.112  -17.668 0.174   1.00 65.10  ? 257  GLN B OE1   1 
ATOM   5545  N  NE2   . GLN N  3 125 ? -24.464  -18.742 -1.781  1.00 64.70  ? 257  GLN B NE2   1 
ATOM   5546  N  N     . TRP N  3 126 ? -21.249  -13.906 -4.021  1.00 54.67  ? 258  TRP B N     1 
ATOM   5547  C  CA    . TRP N  3 126 ? -20.064  -13.072 -3.802  1.00 51.84  ? 258  TRP B CA    1 
ATOM   5548  C  C     . TRP N  3 126 ? -19.546  -13.031 -2.370  1.00 51.96  ? 258  TRP B C     1 
ATOM   5549  O  O     . TRP N  3 126 ? -20.305  -12.932 -1.409  1.00 51.54  ? 258  TRP B O     1 
ATOM   5550  C  CB    . TRP N  3 126 ? -20.323  -11.650 -4.297  1.00 47.70  ? 258  TRP B CB    1 
ATOM   5551  C  CG    . TRP N  3 126 ? -20.890  -11.626 -5.675  1.00 44.02  ? 258  TRP B CG    1 
ATOM   5552  C  CD1   . TRP N  3 126 ? -22.173  -11.893 -6.026  1.00 43.16  ? 258  TRP B CD1   1 
ATOM   5553  C  CD2   . TRP N  3 126 ? -20.175  -11.415 -6.900  1.00 42.78  ? 258  TRP B CD2   1 
ATOM   5554  N  NE1   . TRP N  3 126 ? -22.306  -11.870 -7.391  1.00 42.98  ? 258  TRP B NE1   1 
ATOM   5555  C  CE2   . TRP N  3 126 ? -21.093  -11.580 -7.952  1.00 41.27  ? 258  TRP B CE2   1 
ATOM   5556  C  CE3   . TRP N  3 126 ? -18.845  -11.108 -7.208  1.00 43.02  ? 258  TRP B CE3   1 
ATOM   5557  C  CZ2   . TRP N  3 126 ? -20.730  -11.451 -9.291  1.00 40.69  ? 258  TRP B CZ2   1 
ATOM   5558  C  CZ3   . TRP N  3 126 ? -18.483  -10.981 -8.546  1.00 41.96  ? 258  TRP B CZ3   1 
ATOM   5559  C  CH2   . TRP N  3 126 ? -19.426  -11.154 -9.569  1.00 40.97  ? 258  TRP B CH2   1 
ATOM   5560  N  N     . MET N  3 127 ? -18.227  -13.105 -2.248  1.00 52.14  ? 259  MET B N     1 
ATOM   5561  C  CA    . MET N  3 127 ? -17.575  -13.103 -0.954  1.00 50.76  ? 259  MET B CA    1 
ATOM   5562  C  C     . MET N  3 127 ? -16.474  -12.039 -0.923  1.00 49.41  ? 259  MET B C     1 
ATOM   5563  O  O     . MET N  3 127 ? -15.500  -12.108 -1.686  1.00 48.85  ? 259  MET B O     1 
ATOM   5564  C  CB    . MET N  3 127 ? -16.978  -14.485 -0.702  1.00 52.47  ? 259  MET B CB    1 
ATOM   5565  C  CG    . MET N  3 127 ? -17.167  -15.017 0.708   1.00 55.36  ? 259  MET B CG    1 
ATOM   5566  S  SD    . MET N  3 127 ? -18.888  -15.256 1.150   1.00 58.51  ? 259  MET B SD    1 
ATOM   5567  C  CE    . MET N  3 127 ? -19.582  -15.731 -0.443  1.00 56.98  ? 259  MET B CE    1 
ATOM   5568  N  N     . HIS N  3 128 ? -16.644  -11.049 -0.049  1.00 46.83  ? 260  HIS B N     1 
ATOM   5569  C  CA    . HIS N  3 128 ? -15.665  -9.984  0.094   1.00 43.73  ? 260  HIS B CA    1 
ATOM   5570  C  C     . HIS N  3 128 ? -14.622  -10.402 1.114   1.00 42.62  ? 260  HIS B C     1 
ATOM   5571  O  O     . HIS N  3 128 ? -14.954  -11.020 2.132   1.00 40.75  ? 260  HIS B O     1 
ATOM   5572  C  CB    . HIS N  3 128 ? -16.334  -8.694  0.556   1.00 43.54  ? 260  HIS B CB    1 
ATOM   5573  C  CG    . HIS N  3 128 ? -15.363  -7.610  0.912   1.00 44.57  ? 260  HIS B CG    1 
ATOM   5574  N  ND1   . HIS N  3 128 ? -15.175  -7.174  2.207   1.00 45.44  ? 260  HIS B ND1   1 
ATOM   5575  C  CD2   . HIS N  3 128 ? -14.510  -6.891  0.145   1.00 43.75  ? 260  HIS B CD2   1 
ATOM   5576  C  CE1   . HIS N  3 128 ? -14.249  -6.233  2.221   1.00 45.22  ? 260  HIS B CE1   1 
ATOM   5577  N  NE2   . HIS N  3 128 ? -13.829  -6.043  0.982   1.00 43.68  ? 260  HIS B NE2   1 
ATOM   5578  N  N     . VAL N  3 129 ? -13.365  -10.058 0.837   1.00 41.33  ? 261  VAL B N     1 
ATOM   5579  C  CA    . VAL N  3 129 ? -12.259  -10.400 1.728   1.00 40.97  ? 261  VAL B CA    1 
ATOM   5580  C  C     . VAL N  3 129 ? -11.357  -9.214  2.040   1.00 40.06  ? 261  VAL B C     1 
ATOM   5581  O  O     . VAL N  3 129 ? -10.627  -8.730  1.175   1.00 39.94  ? 261  VAL B O     1 
ATOM   5582  C  CB    . VAL N  3 129 ? -11.403  -11.533 1.139   1.00 41.69  ? 261  VAL B CB    1 
ATOM   5583  C  CG1   . VAL N  3 129 ? -11.830  -12.870 1.727   1.00 41.91  ? 261  VAL B CG1   1 
ATOM   5584  C  CG2   . VAL N  3 129 ? -11.559  -11.556 -0.366  1.00 42.63  ? 261  VAL B CG2   1 
ATOM   5585  N  N     . PRO N  3 130 ? -11.389  -8.745  3.296   1.00 38.68  ? 262  PRO B N     1 
ATOM   5586  C  CA    . PRO N  3 130 ? -10.591  -7.614  3.756   1.00 38.17  ? 262  PRO B CA    1 
ATOM   5587  C  C     . PRO N  3 130 ? -9.133   -7.786  3.410   1.00 39.06  ? 262  PRO B C     1 
ATOM   5588  O  O     . PRO N  3 130 ? -8.529   -8.782  3.782   1.00 37.68  ? 262  PRO B O     1 
ATOM   5589  C  CB    . PRO N  3 130 ? -10.828  -7.620  5.259   1.00 37.68  ? 262  PRO B CB    1 
ATOM   5590  C  CG    . PRO N  3 130 ? -12.206  -8.118  5.358   1.00 38.09  ? 262  PRO B CG    1 
ATOM   5591  C  CD    . PRO N  3 130 ? -12.191  -9.279  4.404   1.00 38.08  ? 262  PRO B CD    1 
ATOM   5592  N  N     . GLY N  3 131 ? -8.578   -6.805  2.705   1.00 40.41  ? 263  GLY B N     1 
ATOM   5593  C  CA    . GLY N  3 131 ? -7.180   -6.852  2.319   1.00 43.20  ? 263  GLY B CA    1 
ATOM   5594  C  C     . GLY N  3 131 ? -6.325   -7.635  3.293   1.00 44.35  ? 263  GLY B C     1 
ATOM   5595  O  O     . GLY N  3 131 ? -6.531   -7.567  4.501   1.00 43.28  ? 263  GLY B O     1 
ATOM   5596  N  N     . HIS N  3 132 ? -5.370   -8.393  2.774   1.00 46.85  ? 264  HIS B N     1 
ATOM   5597  C  CA    . HIS N  3 132 ? -4.513   -9.175  3.645   1.00 51.05  ? 264  HIS B CA    1 
ATOM   5598  C  C     . HIS N  3 132 ? -5.450   -10.046 4.459   1.00 52.79  ? 264  HIS B C     1 
ATOM   5599  O  O     . HIS N  3 132 ? -5.195   -10.362 5.616   1.00 53.01  ? 264  HIS B O     1 
ATOM   5600  C  CB    . HIS N  3 132 ? -3.741   -8.223  4.531   1.00 52.09  ? 264  HIS B CB    1 
ATOM   5601  C  CG    . HIS N  3 132 ? -3.270   -7.012  3.799   1.00 55.76  ? 264  HIS B CG    1 
ATOM   5602  N  ND1   . HIS N  3 132 ? -2.984   -5.820  4.428   1.00 57.87  ? 264  HIS B ND1   1 
ATOM   5603  C  CD2   . HIS N  3 132 ? -3.063   -6.801  2.477   1.00 57.26  ? 264  HIS B CD2   1 
ATOM   5604  C  CE1   . HIS N  3 132 ? -2.625   -4.925  3.524   1.00 58.65  ? 264  HIS B CE1   1 
ATOM   5605  N  NE2   . HIS N  3 132 ? -2.665   -5.494  2.333   1.00 58.43  ? 264  HIS B NE2   1 
ATOM   5606  N  N     . SER N  3 133 ? -6.549   -10.409 3.812   1.00 55.28  ? 265  SER B N     1 
ATOM   5607  C  CA    . SER N  3 133 ? -7.606   -11.239 4.376   1.00 58.64  ? 265  SER B CA    1 
ATOM   5608  C  C     . SER N  3 133 ? -7.078   -12.553 4.904   1.00 58.40  ? 265  SER B C     1 
ATOM   5609  O  O     . SER N  3 133 ? -5.969   -12.639 5.416   1.00 60.23  ? 265  SER B O     1 
ATOM   5610  C  CB    . SER N  3 133 ? -8.624   -11.559 3.283   1.00 62.00  ? 265  SER B CB    1 
ATOM   5611  O  OG    . SER N  3 133 ? -8.011   -12.342 2.260   1.00 62.92  ? 265  SER B OG    1 
ATOM   5612  N  N     . GLY N  3 134 ? -7.911   -13.578 4.772   1.00 56.74  ? 266  GLY B N     1 
ATOM   5613  C  CA    . GLY N  3 134 ? -7.532   -14.910 5.174   1.00 54.53  ? 266  GLY B CA    1 
ATOM   5614  C  C     . GLY N  3 134 ? -7.524   -15.698 3.881   1.00 52.93  ? 266  GLY B C     1 
ATOM   5615  O  O     . GLY N  3 134 ? -8.166   -15.302 2.908   1.00 53.09  ? 266  GLY B O     1 
ATOM   5616  N  N     . PHE N  3 135 ? -6.784   -16.797 3.864   1.00 51.44  ? 267  PHE B N     1 
ATOM   5617  C  CA    . PHE N  3 135 ? -6.684   -17.683 2.701   1.00 49.72  ? 267  PHE B CA    1 
ATOM   5618  C  C     . PHE N  3 135 ? -5.791   -17.208 1.569   1.00 48.39  ? 267  PHE B C     1 
ATOM   5619  O  O     . PHE N  3 135 ? -6.077   -16.226 0.877   1.00 45.51  ? 267  PHE B O     1 
ATOM   5620  C  CB    . PHE N  3 135 ? -8.083   -18.046 2.155   1.00 48.21  ? 267  PHE B CB    1 
ATOM   5621  C  CG    . PHE N  3 135 ? -8.817   -19.070 2.990   1.00 45.94  ? 267  PHE B CG    1 
ATOM   5622  C  CD1   . PHE N  3 135 ? -10.203  -19.119 2.993   1.00 46.23  ? 267  PHE B CD1   1 
ATOM   5623  C  CD2   . PHE N  3 135 ? -8.122   -19.949 3.814   1.00 44.42  ? 267  PHE B CD2   1 
ATOM   5624  C  CE1   . PHE N  3 135 ? -10.882  -20.018 3.814   1.00 44.29  ? 267  PHE B CE1   1 
ATOM   5625  C  CE2   . PHE N  3 135 ? -8.794   -20.846 4.632   1.00 42.87  ? 267  PHE B CE2   1 
ATOM   5626  C  CZ    . PHE N  3 135 ? -10.173  -20.880 4.635   1.00 42.42  ? 267  PHE B CZ    1 
ATOM   5627  N  N     . ILE N  3 136 ? -4.704   -17.951 1.396   1.00 48.72  ? 268  ILE B N     1 
ATOM   5628  C  CA    . ILE N  3 136 ? -3.714   -17.689 0.369   1.00 49.95  ? 268  ILE B CA    1 
ATOM   5629  C  C     . ILE N  3 136 ? -4.394   -17.511 -0.982  1.00 49.30  ? 268  ILE B C     1 
ATOM   5630  O  O     . ILE N  3 136 ? -3.899   -16.794 -1.857  1.00 48.78  ? 268  ILE B O     1 
ATOM   5631  C  CB    . ILE N  3 136 ? -2.681   -18.854 0.327   1.00 51.06  ? 268  ILE B CB    1 
ATOM   5632  C  CG1   . ILE N  3 136 ? -1.427   -18.454 1.106   1.00 52.00  ? 268  ILE B CG1   1 
ATOM   5633  C  CG2   . ILE N  3 136 ? -2.335   -19.230 -1.094  1.00 52.15  ? 268  ILE B CG2   1 
ATOM   5634  C  CD1   . ILE N  3 136 ? -1.698   -18.156 2.573   1.00 53.13  ? 268  ILE B CD1   1 
ATOM   5635  N  N     . GLY N  3 137 ? -5.541   -18.160 -1.132  1.00 49.18  ? 269  GLY B N     1 
ATOM   5636  C  CA    . GLY N  3 137 ? -6.283   -18.071 -2.374  1.00 48.59  ? 269  GLY B CA    1 
ATOM   5637  C  C     . GLY N  3 137 ? -6.223   -16.681 -2.961  1.00 47.26  ? 269  GLY B C     1 
ATOM   5638  O  O     . GLY N  3 137 ? -6.016   -16.509 -4.163  1.00 46.92  ? 269  GLY B O     1 
ATOM   5639  N  N     . ASN N  3 138 ? -6.390   -15.681 -2.108  1.00 46.22  ? 270  ASN B N     1 
ATOM   5640  C  CA    . ASN N  3 138 ? -6.353   -14.313 -2.581  1.00 46.27  ? 270  ASN B CA    1 
ATOM   5641  C  C     . ASN N  3 138 ? -4.956   -13.935 -3.048  1.00 45.87  ? 270  ASN B C     1 
ATOM   5642  O  O     . ASN N  3 138 ? -4.778   -13.519 -4.187  1.00 46.54  ? 270  ASN B O     1 
ATOM   5643  C  CB    . ASN N  3 138 ? -6.828   -13.363 -1.485  1.00 46.93  ? 270  ASN B CB    1 
ATOM   5644  C  CG    . ASN N  3 138 ? -8.177   -13.764 -0.926  1.00 47.10  ? 270  ASN B CG    1 
ATOM   5645  O  OD1   . ASN N  3 138 ? -8.285   -14.713 -0.153  1.00 47.29  ? 270  ASN B OD1   1 
ATOM   5646  N  ND2   . ASN N  3 138 ? -9.216   -13.055 -1.334  1.00 47.33  ? 270  ASN B ND2   1 
ATOM   5647  N  N     . GLU N  3 139 ? -3.956   -14.101 -2.193  1.00 44.62  ? 271  GLU B N     1 
ATOM   5648  C  CA    . GLU N  3 139 ? -2.601   -13.741 -2.587  1.00 44.85  ? 271  GLU B CA    1 
ATOM   5649  C  C     . GLU N  3 139 ? -2.191   -14.386 -3.905  1.00 44.38  ? 271  GLU B C     1 
ATOM   5650  O  O     . GLU N  3 139 ? -1.269   -13.915 -4.571  1.00 43.38  ? 271  GLU B O     1 
ATOM   5651  C  CB    . GLU N  3 139 ? -1.598   -14.134 -1.500  1.00 46.36  ? 271  GLU B CB    1 
ATOM   5652  C  CG    . GLU N  3 139 ? -0.156   -13.719 -1.812  1.00 48.24  ? 271  GLU B CG    1 
ATOM   5653  C  CD    . GLU N  3 139 ? 0.068    -12.208 -1.767  1.00 49.26  ? 271  GLU B CD    1 
ATOM   5654  O  OE1   . GLU N  3 139 ? 1.096    -11.741 -2.304  1.00 49.85  ? 271  GLU B OE1   1 
ATOM   5655  O  OE2   . GLU N  3 139 ? -0.771   -11.485 -1.184  1.00 50.64  ? 271  GLU B OE2   1 
ATOM   5656  N  N     . GLU N  3 140 ? -2.883   -15.461 -4.273  1.00 45.15  ? 272  GLU B N     1 
ATOM   5657  C  CA    . GLU N  3 140 ? -2.595   -16.195 -5.502  1.00 45.51  ? 272  GLU B CA    1 
ATOM   5658  C  C     . GLU N  3 140 ? -3.228   -15.565 -6.750  1.00 44.31  ? 272  GLU B C     1 
ATOM   5659  O  O     . GLU N  3 140 ? -2.548   -15.311 -7.745  1.00 43.75  ? 272  GLU B O     1 
ATOM   5660  C  CB    . GLU N  3 140 ? -3.049   -17.650 -5.343  1.00 47.81  ? 272  GLU B CB    1 
ATOM   5661  C  CG    . GLU N  3 140 ? -2.287   -18.410 -4.256  1.00 51.72  ? 272  GLU B CG    1 
ATOM   5662  C  CD    . GLU N  3 140 ? -1.223   -19.371 -4.806  1.00 54.97  ? 272  GLU B CD    1 
ATOM   5663  O  OE1   . GLU N  3 140 ? -0.528   -19.014 -5.784  1.00 57.60  ? 272  GLU B OE1   1 
ATOM   5664  O  OE2   . GLU N  3 140 ? -1.068   -20.485 -4.250  1.00 55.80  ? 272  GLU B OE2   1 
ATOM   5665  N  N     . ALA N  3 141 ? -4.532   -15.328 -6.714  1.00 42.86  ? 273  ALA B N     1 
ATOM   5666  C  CA    . ALA N  3 141 ? -5.174   -14.707 -7.861  1.00 42.23  ? 273  ALA B CA    1 
ATOM   5667  C  C     . ALA N  3 141 ? -4.427   -13.397 -8.006  1.00 41.84  ? 273  ALA B C     1 
ATOM   5668  O  O     . ALA N  3 141 ? -3.897   -13.062 -9.060  1.00 42.25  ? 273  ALA B O     1 
ATOM   5669  C  CB    . ALA N  3 141 ? -6.652   -14.449 -7.571  1.00 40.57  ? 273  ALA B CB    1 
ATOM   5670  N  N     . ASP N  3 142 ? -4.389   -12.685 -6.891  1.00 42.19  ? 274  ASP B N     1 
ATOM   5671  C  CA    . ASP N  3 142 ? -3.730   -11.398 -6.728  1.00 41.05  ? 274  ASP B CA    1 
ATOM   5672  C  C     . ASP N  3 142 ? -2.399   -11.389 -7.480  1.00 38.73  ? 274  ASP B C     1 
ATOM   5673  O  O     . ASP N  3 142 ? -1.995   -10.374 -8.038  1.00 34.84  ? 274  ASP B O     1 
ATOM   5674  C  CB    . ASP N  3 142 ? -3.479   -11.216 -5.226  1.00 44.77  ? 274  ASP B CB    1 
ATOM   5675  C  CG    . ASP N  3 142 ? -3.634   -9.788  -4.751  1.00 46.68  ? 274  ASP B CG    1 
ATOM   5676  O  OD1   . ASP N  3 142 ? -4.739   -9.210  -4.901  1.00 48.78  ? 274  ASP B OD1   1 
ATOM   5677  O  OD2   . ASP N  3 142 ? -2.640   -9.260  -4.198  1.00 47.56  ? 274  ASP B OD2   1 
ATOM   5678  N  N     . ARG N  3 143 ? -1.741   -12.546 -7.482  1.00 38.33  ? 275  ARG B N     1 
ATOM   5679  C  CA    . ARG N  3 143 ? -0.432   -12.733 -8.101  1.00 37.96  ? 275  ARG B CA    1 
ATOM   5680  C  C     . ARG N  3 143 ? -0.443   -12.850 -9.613  1.00 37.21  ? 275  ARG B C     1 
ATOM   5681  O  O     . ARG N  3 143 ? 0.494    -12.413 -10.287 1.00 36.82  ? 275  ARG B O     1 
ATOM   5682  C  CB    . ARG N  3 143 ? 0.222    -13.976 -7.531  1.00 39.19  ? 275  ARG B CB    1 
ATOM   5683  C  CG    . ARG N  3 143 ? 1.713    -13.893 -7.496  1.00 43.99  ? 275  ARG B CG    1 
ATOM   5684  C  CD    . ARG N  3 143 ? 2.170    -13.101 -6.285  1.00 46.81  ? 275  ARG B CD    1 
ATOM   5685  N  NE    . ARG N  3 143 ? 3.236    -13.820 -5.594  1.00 49.99  ? 275  ARG B NE    1 
ATOM   5686  C  CZ    . ARG N  3 143 ? 3.707    -13.504 -4.394  1.00 50.82  ? 275  ARG B CZ    1 
ATOM   5687  N  NH1   . ARG N  3 143 ? 3.206    -12.464 -3.740  1.00 50.69  ? 275  ARG B NH1   1 
ATOM   5688  N  NH2   . ARG N  3 143 ? 4.671    -14.240 -3.846  1.00 51.50  ? 275  ARG B NH2   1 
ATOM   5689  N  N     . LEU N  3 144 ? -1.487   -13.479 -10.140 1.00 37.18  ? 276  LEU B N     1 
ATOM   5690  C  CA    . LEU N  3 144 ? -1.639   -13.641 -11.580 1.00 35.34  ? 276  LEU B CA    1 
ATOM   5691  C  C     . LEU N  3 144 ? -1.954   -12.269 -12.148 1.00 36.10  ? 276  LEU B C     1 
ATOM   5692  O  O     . LEU N  3 144 ? -1.470   -11.897 -13.217 1.00 37.00  ? 276  LEU B O     1 
ATOM   5693  C  CB    . LEU N  3 144 ? -2.789   -14.590 -11.884 1.00 32.50  ? 276  LEU B CB    1 
ATOM   5694  C  CG    . LEU N  3 144 ? -2.632   -15.938 -11.202 1.00 30.03  ? 276  LEU B CG    1 
ATOM   5695  C  CD1   . LEU N  3 144 ? -3.871   -16.766 -11.398 1.00 30.33  ? 276  LEU B CD1   1 
ATOM   5696  C  CD2   . LEU N  3 144 ? -1.436   -16.630 -11.780 1.00 29.82  ? 276  LEU B CD2   1 
ATOM   5697  N  N     . ALA N  3 145 ? -2.772   -11.518 -11.419 1.00 35.32  ? 277  ALA B N     1 
ATOM   5698  C  CA    . ALA N  3 145 ? -3.139   -10.191 -11.856 1.00 35.46  ? 277  ALA B CA    1 
ATOM   5699  C  C     . ALA N  3 145 ? -1.873   -9.505  -12.323 1.00 35.71  ? 277  ALA B C     1 
ATOM   5700  O  O     . ALA N  3 145 ? -1.764   -9.142  -13.491 1.00 35.40  ? 277  ALA B O     1 
ATOM   5701  C  CB    . ALA N  3 145 ? -3.776   -9.414  -10.713 1.00 36.47  ? 277  ALA B CB    1 
ATOM   5702  N  N     . ARG N  3 146 ? -0.912   -9.368  -11.409 1.00 37.46  ? 278  ARG B N     1 
ATOM   5703  C  CA    . ARG N  3 146 ? 0.374    -8.723  -11.687 1.00 39.85  ? 278  ARG B CA    1 
ATOM   5704  C  C     . ARG N  3 146 ? 1.063    -9.343  -12.905 1.00 43.02  ? 278  ARG B C     1 
ATOM   5705  O  O     . ARG N  3 146 ? 1.597    -8.639  -13.770 1.00 43.27  ? 278  ARG B O     1 
ATOM   5706  C  CB    . ARG N  3 146 ? 1.306    -8.864  -10.488 1.00 38.21  ? 278  ARG B CB    1 
ATOM   5707  C  CG    . ARG N  3 146 ? 0.612    -9.118  -9.181  1.00 36.93  ? 278  ARG B CG    1 
ATOM   5708  C  CD    . ARG N  3 146 ? 0.180    -7.849  -8.502  1.00 36.13  ? 278  ARG B CD    1 
ATOM   5709  N  NE    . ARG N  3 146 ? -1.200   -7.973  -8.058  1.00 38.19  ? 278  ARG B NE    1 
ATOM   5710  C  CZ    . ARG N  3 146 ? -1.824   -7.093  -7.287  1.00 38.67  ? 278  ARG B CZ    1 
ATOM   5711  N  NH1   . ARG N  3 146 ? -1.182   -6.014  -6.853  1.00 39.37  ? 278  ARG B NH1   1 
ATOM   5712  N  NH2   . ARG N  3 146 ? -3.107   -7.273  -6.990  1.00 39.50  ? 278  ARG B NH2   1 
ATOM   5713  N  N     . GLU N  3 147 ? 1.071    -10.669 -12.958 1.00 45.68  ? 279  GLU B N     1 
ATOM   5714  C  CA    . GLU N  3 147 ? 1.686    -11.352 -14.077 1.00 48.51  ? 279  GLU B CA    1 
ATOM   5715  C  C     . GLU N  3 147 ? 0.940    -11.006 -15.353 1.00 49.37  ? 279  GLU B C     1 
ATOM   5716  O  O     . GLU N  3 147 ? 1.534    -10.876 -16.425 1.00 50.00  ? 279  GLU B O     1 
ATOM   5717  C  CB    . GLU N  3 147 ? 1.690    -12.859 -13.828 1.00 50.47  ? 279  GLU B CB    1 
ATOM   5718  C  CG    . GLU N  3 147 ? 2.845    -13.275 -12.939 1.00 53.66  ? 279  GLU B CG    1 
ATOM   5719  C  CD    . GLU N  3 147 ? 4.188    -12.867 -13.535 1.00 55.58  ? 279  GLU B CD    1 
ATOM   5720  O  OE1   . GLU N  3 147 ? 5.103    -12.525 -12.754 1.00 56.38  ? 279  GLU B OE1   1 
ATOM   5721  O  OE2   . GLU N  3 147 ? 4.327    -12.893 -14.784 1.00 55.84  ? 279  GLU B OE2   1 
ATOM   5722  N  N     . GLY N  3 148 ? -0.368   -10.838 -15.224 1.00 49.83  ? 280  GLY B N     1 
ATOM   5723  C  CA    . GLY N  3 148 ? -1.166   -10.490 -16.374 1.00 51.42  ? 280  GLY B CA    1 
ATOM   5724  C  C     . GLY N  3 148 ? -0.757   -9.123  -16.858 1.00 52.36  ? 280  GLY B C     1 
ATOM   5725  O  O     . GLY N  3 148 ? -0.368   -8.950  -18.004 1.00 52.62  ? 280  GLY B O     1 
ATOM   5726  N  N     . ALA N  3 149 ? -0.824   -8.151  -15.963 1.00 54.62  ? 281  ALA B N     1 
ATOM   5727  C  CA    . ALA N  3 149 ? -0.479   -6.774  -16.290 1.00 57.51  ? 281  ALA B CA    1 
ATOM   5728  C  C     . ALA N  3 149 ? 0.861    -6.640  -16.992 1.00 59.37  ? 281  ALA B C     1 
ATOM   5729  O  O     . ALA N  3 149 ? 1.189    -5.578  -17.520 1.00 59.66  ? 281  ALA B O     1 
ATOM   5730  C  CB    . ALA N  3 149 ? -0.486   -5.924  -15.025 1.00 57.78  ? 281  ALA B CB    1 
ATOM   5731  N  N     . LYS N  3 150 ? 1.641    -7.710  -17.002 1.00 61.76  ? 282  LYS B N     1 
ATOM   5732  C  CA    . LYS N  3 150 ? 2.938    -7.647  -17.650 1.00 64.57  ? 282  LYS B CA    1 
ATOM   5733  C  C     . LYS N  3 150 ? 2.860    -7.893  -19.162 1.00 67.18  ? 282  LYS B C     1 
ATOM   5734  O  O     . LYS N  3 150 ? 3.600    -7.282  -19.937 1.00 67.55  ? 282  LYS B O     1 
ATOM   5735  C  CB    . LYS N  3 150 ? 3.892    -8.635  -16.977 1.00 62.91  ? 282  LYS B CB    1 
ATOM   5736  C  CG    . LYS N  3 150 ? 4.040    -8.381  -15.490 1.00 60.34  ? 282  LYS B CG    1 
ATOM   5737  C  CD    . LYS N  3 150 ? 5.236    -9.103  -14.915 1.00 59.73  ? 282  LYS B CD    1 
ATOM   5738  C  CE    . LYS N  3 150 ? 5.384    -8.818  -13.432 1.00 58.42  ? 282  LYS B CE    1 
ATOM   5739  N  NZ    . LYS N  3 150 ? 6.533    -9.558  -12.865 1.00 59.05  ? 282  LYS B NZ    1 
ATOM   5740  N  N     . GLN N  3 151 ? 1.952    -8.769  -19.579 1.00 70.09  ? 283  GLN B N     1 
ATOM   5741  C  CA    . GLN N  3 151 ? 1.785    -9.088  -20.994 1.00 73.68  ? 283  GLN B CA    1 
ATOM   5742  C  C     . GLN N  3 151 ? 1.336    -7.875  -21.806 1.00 75.89  ? 283  GLN B C     1 
ATOM   5743  O  O     . GLN N  3 151 ? 0.827    -6.901  -21.254 1.00 76.94  ? 283  GLN B O     1 
ATOM   5744  C  CB    . GLN N  3 151 ? 0.756    -10.199 -21.151 1.00 74.01  ? 283  GLN B CB    1 
ATOM   5745  C  CG    . GLN N  3 151 ? 0.995    -11.376 -20.245 1.00 75.82  ? 283  GLN B CG    1 
ATOM   5746  C  CD    . GLN N  3 151 ? -0.229   -12.261 -20.132 1.00 78.11  ? 283  GLN B CD    1 
ATOM   5747  O  OE1   . GLN N  3 151 ? -0.203   -13.289 -19.449 1.00 79.38  ? 283  GLN B OE1   1 
ATOM   5748  N  NE2   . GLN N  3 151 ? -1.318   -11.864 -20.801 1.00 78.06  ? 283  GLN B NE2   1 
ATOM   5749  N  N     . SER N  3 152 ? 1.513    -7.943  -23.122 1.00 78.11  ? 284  SER B N     1 
ATOM   5750  C  CA    . SER N  3 152 ? 1.115    -6.847  -23.998 1.00 79.85  ? 284  SER B CA    1 
ATOM   5751  C  C     . SER N  3 152 ? -0.297   -7.061  -24.539 1.00 80.62  ? 284  SER B C     1 
ATOM   5752  O  O     . SER N  3 152 ? -0.847   -8.171  -24.351 1.00 80.30  ? 284  SER B O     1 
ATOM   5753  C  CB    . SER N  3 152 ? 2.091    -6.730  -25.169 1.00 81.10  ? 284  SER B CB    1 
ATOM   5754  O  OG    . SER N  3 152 ? 2.096    -7.916  -25.951 1.00 82.68  ? 284  SER B OG    1 
ATOM   5755  N  N     . HIS O  3 3   ? -74.172  9.729   -18.101 1.00 74.79  ? 135  HIS E N     1 
ATOM   5756  C  CA    . HIS O  3 3   ? -73.880  8.289   -18.378 1.00 76.57  ? 135  HIS E CA    1 
ATOM   5757  C  C     . HIS O  3 3   ? -73.931  7.982   -19.881 1.00 77.24  ? 135  HIS E C     1 
ATOM   5758  O  O     . HIS O  3 3   ? -74.965  7.535   -20.384 1.00 78.09  ? 135  HIS E O     1 
ATOM   5759  C  CB    . HIS O  3 3   ? -74.891  7.408   -17.629 1.00 75.97  ? 135  HIS E CB    1 
ATOM   5760  N  N     . MET O  3 4   ? -72.817  8.193   -20.589 1.00 78.05  ? 136  MET E N     1 
ATOM   5761  C  CA    . MET O  3 4   ? -72.771  7.960   -22.043 1.00 78.52  ? 136  MET E CA    1 
ATOM   5762  C  C     . MET O  3 4   ? -71.706  6.994   -22.578 1.00 78.04  ? 136  MET E C     1 
ATOM   5763  O  O     . MET O  3 4   ? -70.513  7.137   -22.305 1.00 77.08  ? 136  MET E O     1 
ATOM   5764  C  CB    . MET O  3 4   ? -72.644  9.299   -22.777 1.00 79.38  ? 136  MET E CB    1 
ATOM   5765  N  N     . GLY O  3 5   ? -72.163  6.027   -23.370 1.00 77.47  ? 137  GLY E N     1 
ATOM   5766  C  CA    . GLY O  3 5   ? -71.272  5.050   -23.960 1.00 77.08  ? 137  GLY E CA    1 
ATOM   5767  C  C     . GLY O  3 5   ? -71.101  3.810   -23.108 1.00 77.57  ? 137  GLY E C     1 
ATOM   5768  O  O     . GLY O  3 5   ? -70.031  3.201   -23.114 1.00 79.29  ? 137  GLY E O     1 
ATOM   5769  N  N     . ASP O  3 6   ? -72.150  3.427   -22.384 1.00 76.46  ? 138  ASP E N     1 
ATOM   5770  C  CA    . ASP O  3 6   ? -72.110  2.252   -21.505 1.00 75.14  ? 138  ASP E CA    1 
ATOM   5771  C  C     . ASP O  3 6   ? -71.246  2.579   -20.280 1.00 72.40  ? 138  ASP E C     1 
ATOM   5772  O  O     . ASP O  3 6   ? -71.087  1.770   -19.364 1.00 70.87  ? 138  ASP E O     1 
ATOM   5773  C  CB    . ASP O  3 6   ? -71.533  1.036   -22.245 1.00 77.05  ? 138  ASP E CB    1 
ATOM   5774  C  CG    . ASP O  3 6   ? -71.939  -0.286  -21.606 1.00 79.28  ? 138  ASP E CG    1 
ATOM   5775  O  OD1   . ASP O  3 6   ? -71.208  -1.288  -21.784 1.00 79.53  ? 138  ASP E OD1   1 
ATOM   5776  O  OD2   . ASP O  3 6   ? -72.998  -0.323  -20.935 1.00 80.10  ? 138  ASP E OD2   1 
ATOM   5777  N  N     . PHE O  3 7   ? -70.694  3.785   -20.288 1.00 69.96  ? 139  PHE E N     1 
ATOM   5778  C  CA    . PHE O  3 7   ? -69.857  4.279   -19.206 1.00 68.30  ? 139  PHE E CA    1 
ATOM   5779  C  C     . PHE O  3 7   ? -70.691  5.254   -18.391 1.00 66.59  ? 139  PHE E C     1 
ATOM   5780  O  O     . PHE O  3 7   ? -71.310  6.157   -18.960 1.00 67.14  ? 139  PHE E O     1 
ATOM   5781  C  CB    . PHE O  3 7   ? -68.664  5.049   -19.767 1.00 69.22  ? 139  PHE E CB    1 
ATOM   5782  C  CG    . PHE O  3 7   ? -67.502  4.195   -20.153 1.00 69.39  ? 139  PHE E CG    1 
ATOM   5783  C  CD1   . PHE O  3 7   ? -67.687  3.024   -20.871 1.00 69.90  ? 139  PHE E CD1   1 
ATOM   5784  C  CD2   . PHE O  3 7   ? -66.208  4.608   -19.857 1.00 70.11  ? 139  PHE E CD2   1 
ATOM   5785  C  CE1   . PHE O  3 7   ? -66.598  2.278   -21.295 1.00 71.13  ? 139  PHE E CE1   1 
ATOM   5786  C  CE2   . PHE O  3 7   ? -65.109  3.872   -20.276 1.00 71.31  ? 139  PHE E CE2   1 
ATOM   5787  C  CZ    . PHE O  3 7   ? -65.303  2.704   -20.999 1.00 71.61  ? 139  PHE E CZ    1 
ATOM   5788  N  N     . VAL O  3 8   ? -70.703  5.095   -17.069 1.00 63.37  ? 140  VAL E N     1 
ATOM   5789  C  CA    . VAL O  3 8   ? -71.467  6.009   -16.225 1.00 59.84  ? 140  VAL E CA    1 
ATOM   5790  C  C     . VAL O  3 8   ? -70.584  7.119   -15.642 1.00 56.48  ? 140  VAL E C     1 
ATOM   5791  O  O     . VAL O  3 8   ? -69.691  6.869   -14.836 1.00 57.14  ? 140  VAL E O     1 
ATOM   5792  C  CB    . VAL O  3 8   ? -72.202  5.245   -15.098 1.00 59.57  ? 140  VAL E CB    1 
ATOM   5793  C  CG1   . VAL O  3 8   ? -71.306  4.165   -14.528 1.00 60.67  ? 140  VAL E CG1   1 
ATOM   5794  C  CG2   . VAL O  3 8   ? -72.639  6.216   -14.020 1.00 59.40  ? 140  VAL E CG2   1 
ATOM   5795  N  N     . VAL O  3 9   ? -70.856  8.348   -16.068 1.00 52.16  ? 141  VAL E N     1 
ATOM   5796  C  CA    . VAL O  3 9   ? -70.110  9.537   -15.656 1.00 47.99  ? 141  VAL E CA    1 
ATOM   5797  C  C     . VAL O  3 9   ? -70.301  9.994   -14.217 1.00 45.86  ? 141  VAL E C     1 
ATOM   5798  O  O     . VAL O  3 9   ? -71.426  10.040  -13.729 1.00 48.83  ? 141  VAL E O     1 
ATOM   5799  C  CB    . VAL O  3 9   ? -70.481  10.711  -16.546 1.00 46.47  ? 141  VAL E CB    1 
ATOM   5800  C  CG1   . VAL O  3 9   ? -69.757  11.935  -16.095 1.00 46.93  ? 141  VAL E CG1   1 
ATOM   5801  C  CG2   . VAL O  3 9   ? -70.150  10.387  -17.984 1.00 47.41  ? 141  VAL E CG2   1 
ATOM   5802  N  N     . VAL O  3 10  ? -69.207  10.363  -13.553 1.00 41.85  ? 142  VAL E N     1 
ATOM   5803  C  CA    . VAL O  3 10  ? -69.267  10.831  -12.167 1.00 38.80  ? 142  VAL E CA    1 
ATOM   5804  C  C     . VAL O  3 10  ? -68.242  11.935  -11.895 1.00 38.30  ? 142  VAL E C     1 
ATOM   5805  O  O     . VAL O  3 10  ? -67.290  12.109  -12.655 1.00 38.31  ? 142  VAL E O     1 
ATOM   5806  C  CB    . VAL O  3 10  ? -69.040  9.660   -11.168 1.00 36.60  ? 142  VAL E CB    1 
ATOM   5807  C  CG1   . VAL O  3 10  ? -67.594  9.226   -11.163 1.00 36.02  ? 142  VAL E CG1   1 
ATOM   5808  C  CG2   . VAL O  3 10  ? -69.453  10.078  -9.789  1.00 36.51  ? 142  VAL E CG2   1 
ATOM   5809  N  N     . TYR O  3 11  ? -68.449  12.703  -10.831 1.00 38.37  ? 143  TYR E N     1 
ATOM   5810  C  CA    . TYR O  3 11  ? -67.511  13.771  -10.478 1.00 38.73  ? 143  TYR E CA    1 
ATOM   5811  C  C     . TYR O  3 11  ? -67.070  13.659  -9.040  1.00 38.17  ? 143  TYR E C     1 
ATOM   5812  O  O     . TYR O  3 11  ? -67.875  13.440  -8.125  1.00 38.16  ? 143  TYR E O     1 
ATOM   5813  C  CB    . TYR O  3 11  ? -68.111  15.160  -10.677 1.00 38.83  ? 143  TYR E CB    1 
ATOM   5814  C  CG    . TYR O  3 11  ? -68.391  15.499  -12.105 1.00 40.64  ? 143  TYR E CG    1 
ATOM   5815  C  CD1   . TYR O  3 11  ? -67.666  16.483  -12.766 1.00 42.63  ? 143  TYR E CD1   1 
ATOM   5816  C  CD2   . TYR O  3 11  ? -69.376  14.824  -12.805 1.00 41.47  ? 143  TYR E CD2   1 
ATOM   5817  C  CE1   . TYR O  3 11  ? -67.921  16.784  -14.102 1.00 44.73  ? 143  TYR E CE1   1 
ATOM   5818  C  CE2   . TYR O  3 11  ? -69.639  15.109  -14.127 1.00 44.23  ? 143  TYR E CE2   1 
ATOM   5819  C  CZ    . TYR O  3 11  ? -68.913  16.083  -14.778 1.00 46.03  ? 143  TYR E CZ    1 
ATOM   5820  O  OH    . TYR O  3 11  ? -69.179  16.321  -16.111 1.00 48.97  ? 143  TYR E OH    1 
ATOM   5821  N  N     . THR O  3 12  ? -65.773  13.806  -8.845  1.00 36.69  ? 144  THR E N     1 
ATOM   5822  C  CA    . THR O  3 12  ? -65.232  13.743  -7.515  1.00 35.63  ? 144  THR E CA    1 
ATOM   5823  C  C     . THR O  3 12  ? -64.622  15.082  -7.328  1.00 34.13  ? 144  THR E C     1 
ATOM   5824  O  O     . THR O  3 12  ? -64.492  15.856  -8.275  1.00 33.08  ? 144  THR E O     1 
ATOM   5825  C  CB    . THR O  3 12  ? -64.094  12.728  -7.377  1.00 36.74  ? 144  THR E CB    1 
ATOM   5826  O  OG1   . THR O  3 12  ? -63.070  13.041  -8.330  1.00 35.86  ? 144  THR E OG1   1 
ATOM   5827  C  CG2   . THR O  3 12  ? -64.600  11.312  -7.585  1.00 36.75  ? 144  THR E CG2   1 
ATOM   5828  N  N     . ASP O  3 13  ? -64.249  15.335  -6.089  1.00 33.28  ? 145  ASP E N     1 
ATOM   5829  C  CA    . ASP O  3 13  ? -63.597  16.554  -5.712  1.00 33.53  ? 145  ASP E CA    1 
ATOM   5830  C  C     . ASP O  3 13  ? -63.314  16.420  -4.245  1.00 33.30  ? 145  ASP E C     1 
ATOM   5831  O  O     . ASP O  3 13  ? -64.118  15.866  -3.497  1.00 32.97  ? 145  ASP E O     1 
ATOM   5832  C  CB    . ASP O  3 13  ? -64.485  17.764  -5.951  1.00 35.37  ? 145  ASP E CB    1 
ATOM   5833  C  CG    . ASP O  3 13  ? -63.733  19.064  -5.773  1.00 38.43  ? 145  ASP E CG    1 
ATOM   5834  O  OD1   . ASP O  3 13  ? -64.334  20.143  -5.944  1.00 41.12  ? 145  ASP E OD1   1 
ATOM   5835  O  OD2   . ASP O  3 13  ? -62.525  19.008  -5.464  1.00 39.80  ? 145  ASP E OD2   1 
ATOM   5836  N  N     . GLY O  3 14  ? -62.145  16.893  -3.848  1.00 33.44  ? 146  GLY E N     1 
ATOM   5837  C  CA    . GLY O  3 14  ? -61.765  16.849  -2.456  1.00 35.15  ? 146  GLY E CA    1 
ATOM   5838  C  C     . GLY O  3 14  ? -61.589  18.291  -2.054  1.00 36.48  ? 146  GLY E C     1 
ATOM   5839  O  O     . GLY O  3 14  ? -61.428  19.154  -2.908  1.00 37.02  ? 146  GLY E O     1 
ATOM   5840  N  N     . CYS O  3 15  ? -61.632  18.575  -0.767  1.00 38.39  ? 147  CYS E N     1 
ATOM   5841  C  CA    . CYS O  3 15  ? -61.455  19.947  -0.328  1.00 41.03  ? 147  CYS E CA    1 
ATOM   5842  C  C     . CYS O  3 15  ? -60.807  19.918  1.042   1.00 40.38  ? 147  CYS E C     1 
ATOM   5843  O  O     . CYS O  3 15  ? -61.020  18.980  1.824   1.00 40.03  ? 147  CYS E O     1 
ATOM   5844  C  CB    . CYS O  3 15  ? -62.810  20.662  -0.231  1.00 44.02  ? 147  CYS E CB    1 
ATOM   5845  S  SG    . CYS O  3 15  ? -63.556  20.622  1.445   1.00 50.29  ? 147  CYS E SG    1 
ATOM   5846  N  N     . CYS O  3 16  ? -60.015  20.935  1.341   1.00 38.81  ? 148  CYS E N     1 
ATOM   5847  C  CA    . CYS O  3 16  ? -59.394  20.972  2.643   1.00 38.86  ? 148  CYS E CA    1 
ATOM   5848  C  C     . CYS O  3 16  ? -59.260  22.380  3.141   1.00 38.91  ? 148  CYS E C     1 
ATOM   5849  O  O     . CYS O  3 16  ? -58.331  23.095  2.788   1.00 39.10  ? 148  CYS E O     1 
ATOM   5850  C  CB    . CYS O  3 16  ? -58.027  20.307  2.627   1.00 38.54  ? 148  CYS E CB    1 
ATOM   5851  S  SG    . CYS O  3 16  ? -57.454  20.013  4.295   1.00 37.16  ? 148  CYS E SG    1 
ATOM   5852  N  N     . SER O  3 17  ? -60.218  22.778  3.958   1.00 39.90  ? 149  SER E N     1 
ATOM   5853  C  CA    . SER O  3 17  ? -60.221  24.106  4.529   1.00 39.16  ? 149  SER E CA    1 
ATOM   5854  C  C     . SER O  3 17  ? -58.954  24.192  5.344   1.00 38.53  ? 149  SER E C     1 
ATOM   5855  O  O     . SER O  3 17  ? -58.575  23.210  5.990   1.00 37.58  ? 149  SER E O     1 
ATOM   5856  C  CB    . SER O  3 17  ? -61.443  24.266  5.427   1.00 40.21  ? 149  SER E CB    1 
ATOM   5857  O  OG    . SER O  3 17  ? -61.575  23.142  6.284   1.00 40.29  ? 149  SER E OG    1 
ATOM   5858  N  N     . SER O  3 18  ? -58.305  25.355  5.302   1.00 38.18  ? 150  SER E N     1 
ATOM   5859  C  CA    . SER O  3 18  ? -57.063  25.586  6.037   1.00 39.72  ? 150  SER E CA    1 
ATOM   5860  C  C     . SER O  3 18  ? -56.037  24.505  5.715   1.00 41.48  ? 150  SER E C     1 
ATOM   5861  O  O     . SER O  3 18  ? -55.458  23.884  6.608   1.00 41.48  ? 150  SER E O     1 
ATOM   5862  C  CB    . SER O  3 18  ? -57.329  25.627  7.548   1.00 38.92  ? 150  SER E CB    1 
ATOM   5863  O  OG    . SER O  3 18  ? -57.987  26.829  7.927   1.00 38.36  ? 150  SER E OG    1 
ATOM   5864  N  N     . ASN O  3 19  ? -55.821  24.293  4.420   1.00 43.43  ? 151  ASN E N     1 
ATOM   5865  C  CA    . ASN O  3 19  ? -54.889  23.286  3.937   1.00 44.83  ? 151  ASN E CA    1 
ATOM   5866  C  C     . ASN O  3 19  ? -53.460  23.660  4.264   1.00 47.17  ? 151  ASN E C     1 
ATOM   5867  O  O     . ASN O  3 19  ? -53.032  24.790  4.021   1.00 47.86  ? 151  ASN E O     1 
ATOM   5868  C  CB    . ASN O  3 19  ? -55.037  23.111  2.428   1.00 43.79  ? 151  ASN E CB    1 
ATOM   5869  C  CG    . ASN O  3 19  ? -54.146  22.023  1.882   1.00 44.24  ? 151  ASN E CG    1 
ATOM   5870  O  OD1   . ASN O  3 19  ? -54.166  20.882  2.358   1.00 44.77  ? 151  ASN E OD1   1 
ATOM   5871  N  ND2   . ASN O  3 19  ? -53.357  22.364  0.874   1.00 44.06  ? 151  ASN E ND2   1 
ATOM   5872  N  N     . GLY O  3 20  ? -52.725  22.696  4.810   1.00 49.73  ? 152  GLY E N     1 
ATOM   5873  C  CA    . GLY O  3 20  ? -51.343  22.934  5.176   1.00 50.03  ? 152  GLY E CA    1 
ATOM   5874  C  C     . GLY O  3 20  ? -51.306  24.080  6.155   1.00 50.82  ? 152  GLY E C     1 
ATOM   5875  O  O     . GLY O  3 20  ? -50.323  24.806  6.240   1.00 51.12  ? 152  GLY E O     1 
ATOM   5876  N  N     . ARG O  3 21  ? -52.399  24.244  6.891   1.00 52.22  ? 153  ARG E N     1 
ATOM   5877  C  CA    . ARG O  3 21  ? -52.507  25.307  7.871   1.00 53.80  ? 153  ARG E CA    1 
ATOM   5878  C  C     . ARG O  3 21  ? -52.428  24.690  9.261   1.00 54.80  ? 153  ARG E C     1 
ATOM   5879  O  O     . ARG O  3 21  ? -51.790  23.651  9.436   1.00 52.83  ? 153  ARG E O     1 
ATOM   5880  C  CB    . ARG O  3 21  ? -53.824  26.046  7.689   1.00 54.44  ? 153  ARG E CB    1 
ATOM   5881  C  CG    . ARG O  3 21  ? -53.750  27.480  8.103   1.00 56.93  ? 153  ARG E CG    1 
ATOM   5882  C  CD    . ARG O  3 21  ? -53.913  28.401  6.910   1.00 59.85  ? 153  ARG E CD    1 
ATOM   5883  N  NE    . ARG O  3 21  ? -53.355  29.716  7.207   1.00 64.04  ? 153  ARG E NE    1 
ATOM   5884  C  CZ    . ARG O  3 21  ? -53.661  30.440  8.284   1.00 66.35  ? 153  ARG E CZ    1 
ATOM   5885  N  NH1   . ARG O  3 21  ? -54.537  29.984  9.183   1.00 66.45  ? 153  ARG E NH1   1 
ATOM   5886  N  NH2   . ARG O  3 21  ? -53.069  31.615  8.477   1.00 66.02  ? 153  ARG E NH2   1 
ATOM   5887  N  N     . ARG O  3 22  ? -53.076  25.310  10.247  1.00 57.05  ? 154  ARG E N     1 
ATOM   5888  C  CA    . ARG O  3 22  ? -53.020  24.775  11.610  1.00 59.62  ? 154  ARG E CA    1 
ATOM   5889  C  C     . ARG O  3 22  ? -53.971  23.600  11.869  1.00 58.91  ? 154  ARG E C     1 
ATOM   5890  O  O     . ARG O  3 22  ? -53.536  22.449  11.940  1.00 58.42  ? 154  ARG E O     1 
ATOM   5891  C  CB    . ARG O  3 22  ? -53.261  25.886  12.656  1.00 61.60  ? 154  ARG E CB    1 
ATOM   5892  C  CG    . ARG O  3 22  ? -52.820  25.480  14.086  1.00 65.23  ? 154  ARG E CG    1 
ATOM   5893  C  CD    . ARG O  3 22  ? -52.750  26.659  15.075  1.00 68.61  ? 154  ARG E CD    1 
ATOM   5894  N  NE    . ARG O  3 22  ? -54.041  26.992  15.685  1.00 71.74  ? 154  ARG E NE    1 
ATOM   5895  C  CZ    . ARG O  3 22  ? -54.619  26.306  16.673  1.00 72.51  ? 154  ARG E CZ    1 
ATOM   5896  N  NH1   . ARG O  3 22  ? -54.028  25.234  17.191  1.00 70.94  ? 154  ARG E NH1   1 
ATOM   5897  N  NH2   . ARG O  3 22  ? -55.806  26.691  17.137  1.00 73.12  ? 154  ARG E NH2   1 
ATOM   5898  N  N     . ARG O  3 23  ? -55.262  23.894  12.006  1.00 58.14  ? 155  ARG E N     1 
ATOM   5899  C  CA    . ARG O  3 23  ? -56.271  22.871  12.280  1.00 56.79  ? 155  ARG E CA    1 
ATOM   5900  C  C     . ARG O  3 23  ? -57.101  22.617  11.013  1.00 53.56  ? 155  ARG E C     1 
ATOM   5901  O  O     . ARG O  3 23  ? -58.243  23.063  10.905  1.00 54.50  ? 155  ARG E O     1 
ATOM   5902  C  CB    . ARG O  3 23  ? -57.162  23.352  13.439  1.00 59.00  ? 155  ARG E CB    1 
ATOM   5903  C  CG    . ARG O  3 23  ? -58.122  22.323  14.019  1.00 63.73  ? 155  ARG E CG    1 
ATOM   5904  C  CD    . ARG O  3 23  ? -57.404  21.186  14.759  1.00 67.20  ? 155  ARG E CD    1 
ATOM   5905  N  NE    . ARG O  3 23  ? -58.357  20.308  15.451  1.00 71.05  ? 155  ARG E NE    1 
ATOM   5906  C  CZ    . ARG O  3 23  ? -58.930  20.583  16.624  1.00 71.84  ? 155  ARG E CZ    1 
ATOM   5907  N  NH1   . ARG O  3 23  ? -58.646  21.716  17.260  1.00 73.22  ? 155  ARG E NH1   1 
ATOM   5908  N  NH2   . ARG O  3 23  ? -59.802  19.733  17.157  1.00 70.89  ? 155  ARG E NH2   1 
ATOM   5909  N  N     . PRO O  3 24  ? -56.533  21.879  10.046  1.00 49.62  ? 156  PRO E N     1 
ATOM   5910  C  CA    . PRO O  3 24  ? -57.127  21.517  8.754   1.00 47.99  ? 156  PRO E CA    1 
ATOM   5911  C  C     . PRO O  3 24  ? -58.384  20.649  8.800   1.00 47.07  ? 156  PRO E C     1 
ATOM   5912  O  O     . PRO O  3 24  ? -58.577  19.870  9.738   1.00 47.40  ? 156  PRO E O     1 
ATOM   5913  C  CB    . PRO O  3 24  ? -55.990  20.789  8.047   1.00 47.33  ? 156  PRO E CB    1 
ATOM   5914  C  CG    . PRO O  3 24  ? -54.777  21.285  8.738   1.00 47.87  ? 156  PRO E CG    1 
ATOM   5915  C  CD    . PRO O  3 24  ? -55.194  21.295  10.156  1.00 46.56  ? 156  PRO E CD    1 
ATOM   5916  N  N     . ARG O  3 25  ? -59.228  20.778  7.774   1.00 45.41  ? 157  ARG E N     1 
ATOM   5917  C  CA    . ARG O  3 25  ? -60.454  19.981  7.677   1.00 43.41  ? 157  ARG E CA    1 
ATOM   5918  C  C     . ARG O  3 25  ? -60.704  19.513  6.245   1.00 41.09  ? 157  ARG E C     1 
ATOM   5919  O  O     . ARG O  3 25  ? -60.914  20.313  5.336   1.00 39.30  ? 157  ARG E O     1 
ATOM   5920  C  CB    . ARG O  3 25  ? -61.647  20.761  8.238   1.00 44.12  ? 157  ARG E CB    1 
ATOM   5921  C  CG    . ARG O  3 25  ? -61.614  20.808  9.765   1.00 45.70  ? 157  ARG E CG    1 
ATOM   5922  C  CD    . ARG O  3 25  ? -62.681  21.694  10.374  1.00 47.34  ? 157  ARG E CD    1 
ATOM   5923  N  NE    . ARG O  3 25  ? -63.586  20.931  11.227  1.00 49.91  ? 157  ARG E NE    1 
ATOM   5924  C  CZ    . ARG O  3 25  ? -64.566  20.162  10.766  1.00 51.28  ? 157  ARG E CZ    1 
ATOM   5925  N  NH1   . ARG O  3 25  ? -64.765  20.064  9.457   1.00 52.27  ? 157  ARG E NH1   1 
ATOM   5926  N  NH2   . ARG O  3 25  ? -65.344  19.489  11.607  1.00 51.73  ? 157  ARG E NH2   1 
ATOM   5927  N  N     . ALA O  3 26  ? -60.663  18.191  6.078   1.00 39.35  ? 158  ALA E N     1 
ATOM   5928  C  CA    . ALA O  3 26  ? -60.811  17.523  4.793   1.00 37.87  ? 158  ALA E CA    1 
ATOM   5929  C  C     . ALA O  3 26  ? -62.193  16.978  4.509   1.00 38.76  ? 158  ALA E C     1 
ATOM   5930  O  O     . ALA O  3 26  ? -62.809  16.333  5.359   1.00 39.07  ? 158  ALA E O     1 
ATOM   5931  C  CB    . ALA O  3 26  ? -59.811  16.394  4.703   1.00 35.86  ? 158  ALA E CB    1 
ATOM   5932  N  N     . GLY O  3 27  ? -62.667  17.223  3.292   1.00 39.00  ? 159  GLY E N     1 
ATOM   5933  C  CA    . GLY O  3 27  ? -63.968  16.728  2.889   1.00 39.22  ? 159  GLY E CA    1 
ATOM   5934  C  C     . GLY O  3 27  ? -63.921  16.227  1.459   1.00 39.07  ? 159  GLY E C     1 
ATOM   5935  O  O     . GLY O  3 27  ? -63.237  16.817  0.621   1.00 37.94  ? 159  GLY E O     1 
ATOM   5936  N  N     . ILE O  3 28  ? -64.627  15.135  1.177   1.00 39.42  ? 160  ILE E N     1 
ATOM   5937  C  CA    . ILE O  3 28  ? -64.655  14.597  -0.178  1.00 41.05  ? 160  ILE E CA    1 
ATOM   5938  C  C     . ILE O  3 28  ? -66.078  14.606  -0.691  1.00 41.47  ? 160  ILE E C     1 
ATOM   5939  O  O     . ILE O  3 28  ? -67.025  14.441  0.083   1.00 42.53  ? 160  ILE E O     1 
ATOM   5940  C  CB    . ILE O  3 28  ? -64.162  13.148  -0.252  1.00 42.01  ? 160  ILE E CB    1 
ATOM   5941  C  CG1   . ILE O  3 28  ? -65.110  12.248  0.534   1.00 42.55  ? 160  ILE E CG1   1 
ATOM   5942  C  CG2   . ILE O  3 28  ? -62.750  13.043  0.291   1.00 43.36  ? 160  ILE E CG2   1 
ATOM   5943  C  CD1   . ILE O  3 28  ? -65.124  10.824  0.032   1.00 43.15  ? 160  ILE E CD1   1 
ATOM   5944  N  N     . GLY O  3 29  ? -66.224  14.784  -1.999  1.00 41.08  ? 161  GLY E N     1 
ATOM   5945  C  CA    . GLY O  3 29  ? -67.545  14.813  -2.592  1.00 39.84  ? 161  GLY E CA    1 
ATOM   5946  C  C     . GLY O  3 29  ? -67.593  14.092  -3.921  1.00 39.76  ? 161  GLY E C     1 
ATOM   5947  O  O     . GLY O  3 29  ? -66.707  14.233  -4.767  1.00 40.22  ? 161  GLY E O     1 
ATOM   5948  N  N     . VAL O  3 30  ? -68.647  13.313  -4.099  1.00 39.07  ? 162  VAL E N     1 
ATOM   5949  C  CA    . VAL O  3 30  ? -68.852  12.548  -5.316  1.00 38.52  ? 162  VAL E CA    1 
ATOM   5950  C  C     . VAL O  3 30  ? -70.210  12.960  -5.860  1.00 38.97  ? 162  VAL E C     1 
ATOM   5951  O  O     . VAL O  3 30  ? -71.206  12.876  -5.148  1.00 39.01  ? 162  VAL E O     1 
ATOM   5952  C  CB    . VAL O  3 30  ? -68.894  11.048  -4.993  1.00 38.71  ? 162  VAL E CB    1 
ATOM   5953  C  CG1   . VAL O  3 30  ? -69.002  10.228  -6.272  1.00 36.79  ? 162  VAL E CG1   1 
ATOM   5954  C  CG2   . VAL O  3 30  ? -67.675  10.670  -4.155  1.00 37.70  ? 162  VAL E CG2   1 
ATOM   5955  N  N     . TYR O  3 31  ? -70.268  13.403  -7.108  1.00 39.55  ? 163  TYR E N     1 
ATOM   5956  C  CA    . TYR O  3 31  ? -71.548  13.806  -7.674  1.00 41.62  ? 163  TYR E CA    1 
ATOM   5957  C  C     . TYR O  3 31  ? -71.942  12.943  -8.857  1.00 42.60  ? 163  TYR E C     1 
ATOM   5958  O  O     . TYR O  3 31  ? -71.125  12.674  -9.735  1.00 42.74  ? 163  TYR E O     1 
ATOM   5959  C  CB    . TYR O  3 31  ? -71.491  15.270  -8.094  1.00 43.91  ? 163  TYR E CB    1 
ATOM   5960  C  CG    . TYR O  3 31  ? -72.728  15.766  -8.804  1.00 46.26  ? 163  TYR E CG    1 
ATOM   5961  C  CD1   . TYR O  3 31  ? -72.833  15.698  -10.186 1.00 47.39  ? 163  TYR E CD1   1 
ATOM   5962  C  CD2   . TYR O  3 31  ? -73.790  16.324  -8.093  1.00 48.66  ? 163  TYR E CD2   1 
ATOM   5963  C  CE1   . TYR O  3 31  ? -73.964  16.179  -10.849 1.00 49.78  ? 163  TYR E CE1   1 
ATOM   5964  C  CE2   . TYR O  3 31  ? -74.930  16.810  -8.746  1.00 49.44  ? 163  TYR E CE2   1 
ATOM   5965  C  CZ    . TYR O  3 31  ? -75.007  16.734  -10.126 1.00 49.60  ? 163  TYR E CZ    1 
ATOM   5966  O  OH    . TYR O  3 31  ? -76.113  17.217  -10.790 1.00 48.92  ? 163  TYR E OH    1 
ATOM   5967  N  N     . TRP O  3 32  ? -73.196  12.504  -8.877  1.00 43.45  ? 164  TRP E N     1 
ATOM   5968  C  CA    . TRP O  3 32  ? -73.684  11.667  -9.966  1.00 44.71  ? 164  TRP E CA    1 
ATOM   5969  C  C     . TRP O  3 32  ? -74.719  12.361  -10.843 1.00 45.65  ? 164  TRP E C     1 
ATOM   5970  O  O     . TRP O  3 32  ? -74.860  12.028  -12.018 1.00 47.33  ? 164  TRP E O     1 
ATOM   5971  C  CB    . TRP O  3 32  ? -74.297  10.395  -9.420  1.00 45.99  ? 164  TRP E CB    1 
ATOM   5972  C  CG    . TRP O  3 32  ? -73.367  9.594   -8.613  1.00 49.73  ? 164  TRP E CG    1 
ATOM   5973  C  CD1   . TRP O  3 32  ? -73.099  9.734   -7.280  1.00 51.08  ? 164  TRP E CD1   1 
ATOM   5974  C  CD2   . TRP O  3 32  ? -72.578  8.496   -9.070  1.00 51.13  ? 164  TRP E CD2   1 
ATOM   5975  N  NE1   . TRP O  3 32  ? -72.189  8.778   -6.875  1.00 51.63  ? 164  TRP E NE1   1 
ATOM   5976  C  CE2   . TRP O  3 32  ? -71.854  8.006   -7.956  1.00 51.45  ? 164  TRP E CE2   1 
ATOM   5977  C  CE3   . TRP O  3 32  ? -72.411  7.875   -10.314 1.00 51.66  ? 164  TRP E CE3   1 
ATOM   5978  C  CZ2   . TRP O  3 32  ? -70.981  6.924   -8.051  1.00 51.78  ? 164  TRP E CZ2   1 
ATOM   5979  C  CZ3   . TRP O  3 32  ? -71.543  6.801   -10.408 1.00 52.68  ? 164  TRP E CZ3   1 
ATOM   5980  C  CH2   . TRP O  3 32  ? -70.839  6.334   -9.281  1.00 52.62  ? 164  TRP E CH2   1 
ATOM   5981  N  N     . GLY O  3 33  ? -75.449  13.317  -10.274 1.00 44.97  ? 165  GLY E N     1 
ATOM   5982  C  CA    . GLY O  3 33  ? -76.464  14.022  -11.038 1.00 42.28  ? 165  GLY E CA    1 
ATOM   5983  C  C     . GLY O  3 33  ? -77.486  14.699  -10.147 1.00 40.39  ? 165  GLY E C     1 
ATOM   5984  O  O     . GLY O  3 33  ? -77.474  14.494  -8.931  1.00 40.22  ? 165  GLY E O     1 
ATOM   5985  N  N     . PRO O  3 34  ? -78.392  15.514  -10.720 1.00 38.54  ? 166  PRO E N     1 
ATOM   5986  C  CA    . PRO O  3 34  ? -79.395  16.189  -9.896  1.00 36.63  ? 166  PRO E CA    1 
ATOM   5987  C  C     . PRO O  3 34  ? -79.943  15.228  -8.864  1.00 36.31  ? 166  PRO E C     1 
ATOM   5988  O  O     . PRO O  3 34  ? -80.187  14.059  -9.169  1.00 35.23  ? 166  PRO E O     1 
ATOM   5989  C  CB    . PRO O  3 34  ? -80.441  16.607  -10.913 1.00 35.55  ? 166  PRO E CB    1 
ATOM   5990  C  CG    . PRO O  3 34  ? -79.616  16.895  -12.120 1.00 35.11  ? 166  PRO E CG    1 
ATOM   5991  C  CD    . PRO O  3 34  ? -78.654  15.741  -12.153 1.00 36.43  ? 166  PRO E CD    1 
ATOM   5992  N  N     . GLY O  3 35  ? -80.099  15.726  -7.643  1.00 36.54  ? 167  GLY E N     1 
ATOM   5993  C  CA    . GLY O  3 35  ? -80.615  14.915  -6.554  1.00 37.59  ? 167  GLY E CA    1 
ATOM   5994  C  C     . GLY O  3 35  ? -80.552  13.407  -6.731  1.00 37.91  ? 167  GLY E C     1 
ATOM   5995  O  O     . GLY O  3 35  ? -81.577  12.729  -6.615  1.00 38.41  ? 167  GLY E O     1 
ATOM   5996  N  N     . HIS O  3 36  ? -79.357  12.884  -7.008  1.00 38.26  ? 168  HIS E N     1 
ATOM   5997  C  CA    . HIS O  3 36  ? -79.137  11.446  -7.193  1.00 37.96  ? 168  HIS E CA    1 
ATOM   5998  C  C     . HIS O  3 36  ? -78.692  10.763  -5.883  1.00 38.41  ? 168  HIS E C     1 
ATOM   5999  O  O     . HIS O  3 36  ? -77.770  11.232  -5.216  1.00 39.23  ? 168  HIS E O     1 
ATOM   6000  C  CB    . HIS O  3 36  ? -78.092  11.234  -8.273  1.00 38.40  ? 168  HIS E CB    1 
ATOM   6001  C  CG    . HIS O  3 36  ? -77.602  9.829   -8.359  1.00 40.93  ? 168  HIS E CG    1 
ATOM   6002  N  ND1   . HIS O  3 36  ? -77.102  9.151   -7.267  1.00 41.21  ? 168  HIS E ND1   1 
ATOM   6003  C  CD2   . HIS O  3 36  ? -77.527  8.972   -9.404  1.00 42.34  ? 168  HIS E CD2   1 
ATOM   6004  C  CE1   . HIS O  3 36  ? -76.741  7.936   -7.635  1.00 42.42  ? 168  HIS E CE1   1 
ATOM   6005  N  NE2   . HIS O  3 36  ? -76.987  7.801   -8.927  1.00 44.62  ? 168  HIS E NE2   1 
ATOM   6006  N  N     . PRO O  3 37  ? -79.316  9.618   -5.529  1.00 38.45  ? 169  PRO E N     1 
ATOM   6007  C  CA    . PRO O  3 37  ? -79.085  8.796   -4.325  1.00 38.13  ? 169  PRO E CA    1 
ATOM   6008  C  C     . PRO O  3 37  ? -77.661  8.500   -3.828  1.00 38.45  ? 169  PRO E C     1 
ATOM   6009  O  O     . PRO O  3 37  ? -77.480  8.016   -2.713  1.00 37.52  ? 169  PRO E O     1 
ATOM   6010  C  CB    . PRO O  3 37  ? -79.859  7.519   -4.635  1.00 37.80  ? 169  PRO E CB    1 
ATOM   6011  C  CG    . PRO O  3 37  ? -79.774  7.435   -6.125  1.00 37.32  ? 169  PRO E CG    1 
ATOM   6012  C  CD    . PRO O  3 37  ? -80.087  8.847   -6.518  1.00 37.43  ? 169  PRO E CD    1 
ATOM   6013  N  N     . LEU O  3 38  ? -76.653  8.775   -4.640  1.00 39.34  ? 170  LEU E N     1 
ATOM   6014  C  CA    . LEU O  3 38  ? -75.286  8.521   -4.213  1.00 40.03  ? 170  LEU E CA    1 
ATOM   6015  C  C     . LEU O  3 38  ? -74.522  9.812   -3.931  1.00 39.10  ? 170  LEU E C     1 
ATOM   6016  O  O     . LEU O  3 38  ? -73.461  9.788   -3.321  1.00 39.15  ? 170  LEU E O     1 
ATOM   6017  C  CB    . LEU O  3 38  ? -74.549  7.700   -5.273  1.00 41.94  ? 170  LEU E CB    1 
ATOM   6018  C  CG    . LEU O  3 38  ? -74.838  6.200   -5.334  1.00 42.80  ? 170  LEU E CG    1 
ATOM   6019  C  CD1   . LEU O  3 38  ? -76.282  5.943   -4.988  1.00 44.39  ? 170  LEU E CD1   1 
ATOM   6020  C  CD2   . LEU O  3 38  ? -74.506  5.671   -6.725  1.00 43.56  ? 170  LEU E CD2   1 
ATOM   6021  N  N     . ASN O  3 39  ? -75.047  10.940  -4.377  1.00 37.00  ? 171  ASN E N     1 
ATOM   6022  C  CA    . ASN O  3 39  ? -74.363  12.187  -4.120  1.00 37.36  ? 171  ASN E CA    1 
ATOM   6023  C  C     . ASN O  3 39  ? -74.028  12.299  -2.645  1.00 38.10  ? 171  ASN E C     1 
ATOM   6024  O  O     . ASN O  3 39  ? -74.925  12.378  -1.800  1.00 38.46  ? 171  ASN E O     1 
ATOM   6025  C  CB    . ASN O  3 39  ? -75.240  13.360  -4.525  1.00 37.73  ? 171  ASN E CB    1 
ATOM   6026  C  CG    . ASN O  3 39  ? -75.489  13.398  -6.003  1.00 38.65  ? 171  ASN E CG    1 
ATOM   6027  O  OD1   . ASN O  3 39  ? -75.013  12.521  -6.740  1.00 39.65  ? 171  ASN E OD1   1 
ATOM   6028  N  ND2   . ASN O  3 39  ? -76.234  14.413  -6.459  1.00 35.91  ? 171  ASN E ND2   1 
ATOM   6029  N  N     . VAL O  3 40  ? -72.739  12.304  -2.325  1.00 38.64  ? 172  VAL E N     1 
ATOM   6030  C  CA    . VAL O  3 40  ? -72.342  12.420  -0.930  1.00 39.34  ? 172  VAL E CA    1 
ATOM   6031  C  C     . VAL O  3 40  ? -71.286  13.469  -0.647  1.00 39.92  ? 172  VAL E C     1 
ATOM   6032  O  O     . VAL O  3 40  ? -70.492  13.852  -1.515  1.00 39.86  ? 172  VAL E O     1 
ATOM   6033  C  CB    . VAL O  3 40  ? -71.830  11.087  -0.366  1.00 39.10  ? 172  VAL E CB    1 
ATOM   6034  C  CG1   . VAL O  3 40  ? -72.937  10.053  -0.417  1.00 41.42  ? 172  VAL E CG1   1 
ATOM   6035  C  CG2   . VAL O  3 40  ? -70.611  10.621  -1.139  1.00 37.39  ? 172  VAL E CG2   1 
ATOM   6036  N  N     . GLY O  3 41  ? -71.293  13.934  0.592   1.00 39.46  ? 173  GLY E N     1 
ATOM   6037  C  CA    . GLY O  3 41  ? -70.323  14.913  1.009   1.00 39.90  ? 173  GLY E CA    1 
ATOM   6038  C  C     . GLY O  3 41  ? -69.808  14.391  2.324   1.00 41.04  ? 173  GLY E C     1 
ATOM   6039  O  O     . GLY O  3 41  ? -69.981  15.034  3.355   1.00 42.76  ? 173  GLY E O     1 
ATOM   6040  N  N     . ILE O  3 42  ? -69.187  13.215  2.303   1.00 40.08  ? 174  ILE E N     1 
ATOM   6041  C  CA    . ILE O  3 42  ? -68.669  12.635  3.536   1.00 39.70  ? 174  ILE E CA    1 
ATOM   6042  C  C     . ILE O  3 42  ? -67.341  13.273  3.941   1.00 39.00  ? 174  ILE E C     1 
ATOM   6043  O  O     . ILE O  3 42  ? -66.572  13.737  3.083   1.00 38.55  ? 174  ILE E O     1 
ATOM   6044  C  CB    . ILE O  3 42  ? -68.466  11.128  3.393   1.00 40.05  ? 174  ILE E CB    1 
ATOM   6045  C  CG1   . ILE O  3 42  ? -67.227  10.856  2.554   1.00 42.08  ? 174  ILE E CG1   1 
ATOM   6046  C  CG2   . ILE O  3 42  ? -69.672  10.504  2.712   1.00 40.41  ? 174  ILE E CG2   1 
ATOM   6047  C  CD1   . ILE O  3 42  ? -66.913  9.380   2.407   1.00 45.93  ? 174  ILE E CD1   1 
ATOM   6048  N  N     . ARG O  3 43  ? -67.081  13.300  5.249   1.00 36.82  ? 175  ARG E N     1 
ATOM   6049  C  CA    . ARG O  3 43  ? -65.851  13.880  5.760   1.00 35.45  ? 175  ARG E CA    1 
ATOM   6050  C  C     . ARG O  3 43  ? -64.733  12.875  5.692   1.00 34.73  ? 175  ARG E C     1 
ATOM   6051  O  O     . ARG O  3 43  ? -64.917  11.726  6.072   1.00 34.42  ? 175  ARG E O     1 
ATOM   6052  C  CB    . ARG O  3 43  ? -65.998  14.325  7.204   1.00 35.97  ? 175  ARG E CB    1 
ATOM   6053  C  CG    . ARG O  3 43  ? -64.726  14.969  7.691   1.00 36.78  ? 175  ARG E CG    1 
ATOM   6054  C  CD    . ARG O  3 43  ? -64.854  15.582  9.053   1.00 37.88  ? 175  ARG E CD    1 
ATOM   6055  N  NE    . ARG O  3 43  ? -63.676  16.390  9.337   1.00 39.47  ? 175  ARG E NE    1 
ATOM   6056  C  CZ    . ARG O  3 43  ? -63.362  16.847  10.543  1.00 42.11  ? 175  ARG E CZ    1 
ATOM   6057  N  NH1   . ARG O  3 43  ? -64.148  16.567  11.581  1.00 41.98  ? 175  ARG E NH1   1 
ATOM   6058  N  NH2   . ARG O  3 43  ? -62.264  17.577  10.709  1.00 42.74  ? 175  ARG E NH2   1 
ATOM   6059  N  N     . LEU O  3 44  ? -63.569  13.319  5.221   1.00 35.05  ? 176  LEU E N     1 
ATOM   6060  C  CA    . LEU O  3 44  ? -62.404  12.449  5.075   1.00 33.52  ? 176  LEU E CA    1 
ATOM   6061  C  C     . LEU O  3 44  ? -61.764  12.109  6.398   1.00 32.64  ? 176  LEU E C     1 
ATOM   6062  O  O     . LEU O  3 44  ? -61.359  12.987  7.140   1.00 31.67  ? 176  LEU E O     1 
ATOM   6063  C  CB    . LEU O  3 44  ? -61.348  13.093  4.182   1.00 32.62  ? 176  LEU E CB    1 
ATOM   6064  C  CG    . LEU O  3 44  ? -60.101  12.212  4.065   1.00 33.81  ? 176  LEU E CG    1 
ATOM   6065  C  CD1   . LEU O  3 44  ? -60.462  10.930  3.328   1.00 32.43  ? 176  LEU E CD1   1 
ATOM   6066  C  CD2   . LEU O  3 44  ? -58.985  12.954  3.336   1.00 33.22  ? 176  LEU E CD2   1 
ATOM   6067  N  N     . PRO O  3 45  ? -61.654  10.817  6.707   1.00 33.81  ? 177  PRO E N     1 
ATOM   6068  C  CA    . PRO O  3 45  ? -61.042  10.433  7.974   1.00 35.03  ? 177  PRO E CA    1 
ATOM   6069  C  C     . PRO O  3 45  ? -59.513  10.438  7.875   1.00 37.15  ? 177  PRO E C     1 
ATOM   6070  O  O     . PRO O  3 45  ? -58.928  10.615  6.788   1.00 34.75  ? 177  PRO E O     1 
ATOM   6071  C  CB    . PRO O  3 45  ? -61.601  9.040   8.198   1.00 34.58  ? 177  PRO E CB    1 
ATOM   6072  C  CG    . PRO O  3 45  ? -61.590  8.491   6.795   1.00 33.77  ? 177  PRO E CG    1 
ATOM   6073  C  CD    . PRO O  3 45  ? -62.170  9.634   5.992   1.00 33.84  ? 177  PRO E CD    1 
ATOM   6074  N  N     . GLY O  3 46  ? -58.876  10.252  9.028   1.00 38.82  ? 178  GLY E N     1 
ATOM   6075  C  CA    . GLY O  3 46  ? -57.427  10.215  9.081   1.00 41.16  ? 178  GLY E CA    1 
ATOM   6076  C  C     . GLY O  3 46  ? -56.746  11.562  8.973   1.00 42.27  ? 178  GLY E C     1 
ATOM   6077  O  O     . GLY O  3 46  ? -57.270  12.564  9.480   1.00 42.87  ? 178  GLY E O     1 
ATOM   6078  N  N     . ARG O  3 47  ? -55.575  11.572  8.329   1.00 42.07  ? 179  ARG E N     1 
ATOM   6079  C  CA    . ARG O  3 47  ? -54.789  12.788  8.134   1.00 42.11  ? 179  ARG E CA    1 
ATOM   6080  C  C     . ARG O  3 47  ? -55.613  13.735  7.272   1.00 41.79  ? 179  ARG E C     1 
ATOM   6081  O  O     . ARG O  3 47  ? -56.415  13.274  6.454   1.00 44.67  ? 179  ARG E O     1 
ATOM   6082  C  CB    . ARG O  3 47  ? -53.469  12.439  7.456   1.00 42.76  ? 179  ARG E CB    1 
ATOM   6083  C  CG    . ARG O  3 47  ? -52.502  13.601  7.361   1.00 44.02  ? 179  ARG E CG    1 
ATOM   6084  C  CD    . ARG O  3 47  ? -51.069  13.140  7.085   1.00 42.57  ? 179  ARG E CD    1 
ATOM   6085  N  NE    . ARG O  3 47  ? -50.433  13.974  6.068   1.00 42.70  ? 179  ARG E NE    1 
ATOM   6086  C  CZ    . ARG O  3 47  ? -50.380  13.664  4.774   1.00 42.01  ? 179  ARG E CZ    1 
ATOM   6087  N  NH1   . ARG O  3 47  ? -49.789  14.493  3.924   1.00 41.04  ? 179  ARG E NH1   1 
ATOM   6088  N  NH2   . ARG O  3 47  ? -50.898  12.518  4.333   1.00 39.66  ? 179  ARG E NH2   1 
ATOM   6089  N  N     . GLN O  3 48  ? -55.414  15.041  7.433   1.00 38.27  ? 180  GLN E N     1 
ATOM   6090  C  CA    . GLN O  3 48  ? -56.216  16.021  6.698   1.00 37.35  ? 180  GLN E CA    1 
ATOM   6091  C  C     . GLN O  3 48  ? -55.529  16.870  5.612   1.00 37.59  ? 180  GLN E C     1 
ATOM   6092  O  O     . GLN O  3 48  ? -54.859  17.861  5.926   1.00 38.26  ? 180  GLN E O     1 
ATOM   6093  C  CB    . GLN O  3 48  ? -56.860  16.965  7.713   1.00 36.67  ? 180  GLN E CB    1 
ATOM   6094  C  CG    . GLN O  3 48  ? -58.370  17.166  7.594   1.00 38.44  ? 180  GLN E CG    1 
ATOM   6095  C  CD    . GLN O  3 48  ? -59.193  16.078  8.275   1.00 38.30  ? 180  GLN E CD    1 
ATOM   6096  O  OE1   . GLN O  3 48  ? -60.232  16.357  8.898   1.00 36.14  ? 180  GLN E OE1   1 
ATOM   6097  N  NE2   . GLN O  3 48  ? -58.739  14.831  8.153   1.00 37.78  ? 180  GLN E NE2   1 
ATOM   6098  N  N     . THR O  3 49  ? -55.698  16.518  4.338   1.00 37.00  ? 181  THR E N     1 
ATOM   6099  C  CA    . THR O  3 49  ? -55.079  17.326  3.279   1.00 37.61  ? 181  THR E CA    1 
ATOM   6100  C  C     . THR O  3 49  ? -55.747  17.231  1.924   1.00 36.90  ? 181  THR E C     1 
ATOM   6101  O  O     . THR O  3 49  ? -56.183  16.170  1.504   1.00 36.81  ? 181  THR E O     1 
ATOM   6102  C  CB    . THR O  3 49  ? -53.622  16.954  3.007   1.00 38.10  ? 181  THR E CB    1 
ATOM   6103  O  OG1   . THR O  3 49  ? -53.586  15.723  2.279   1.00 38.59  ? 181  THR E OG1   1 
ATOM   6104  C  CG2   . THR O  3 49  ? -52.846  16.804  4.288   1.00 39.61  ? 181  THR E CG2   1 
ATOM   6105  N  N     . ASN O  3 50  ? -55.785  18.351  1.224   1.00 36.72  ? 182  ASN E N     1 
ATOM   6106  C  CA    . ASN O  3 50  ? -56.370  18.396  -0.101  1.00 37.12  ? 182  ASN E CA    1 
ATOM   6107  C  C     . ASN O  3 50  ? -55.996  17.142  -0.889  1.00 36.79  ? 182  ASN E C     1 
ATOM   6108  O  O     . ASN O  3 50  ? -56.867  16.337  -1.220  1.00 36.40  ? 182  ASN E O     1 
ATOM   6109  C  CB    . ASN O  3 50  ? -55.857  19.618  -0.836  1.00 38.04  ? 182  ASN E CB    1 
ATOM   6110  C  CG    . ASN O  3 50  ? -54.352  19.650  -0.893  1.00 40.70  ? 182  ASN E CG    1 
ATOM   6111  O  OD1   . ASN O  3 50  ? -53.765  19.941  -1.934  1.00 43.07  ? 182  ASN E OD1   1 
ATOM   6112  N  ND2   . ASN O  3 50  ? -53.710  19.345  0.234   1.00 41.64  ? 182  ASN E ND2   1 
ATOM   6113  N  N     . GLN O  3 51  ? -54.702  16.983  -1.178  1.00 37.05  ? 183  GLN E N     1 
ATOM   6114  C  CA    . GLN O  3 51  ? -54.194  15.835  -1.941  1.00 37.42  ? 183  GLN E CA    1 
ATOM   6115  C  C     . GLN O  3 51  ? -54.872  14.581  -1.448  1.00 37.39  ? 183  GLN E C     1 
ATOM   6116  O  O     . GLN O  3 51  ? -55.511  13.855  -2.212  1.00 37.98  ? 183  GLN E O     1 
ATOM   6117  C  CB    . GLN O  3 51  ? -52.679  15.676  -1.766  1.00 37.20  ? 183  GLN E CB    1 
ATOM   6118  C  CG    . GLN O  3 51  ? -51.859  16.886  -2.198  1.00 40.21  ? 183  GLN E CG    1 
ATOM   6119  C  CD    . GLN O  3 51  ? -51.869  17.120  -3.708  1.00 41.25  ? 183  GLN E CD    1 
ATOM   6120  O  OE1   . GLN O  3 51  ? -52.094  18.237  -4.184  1.00 42.84  ? 183  GLN E OE1   1 
ATOM   6121  N  NE2   . GLN O  3 51  ? -51.613  16.072  -4.460  1.00 40.04  ? 183  GLN E NE2   1 
ATOM   6122  N  N     . ARG O  3 52  ? -54.725  14.338  -0.156  1.00 37.30  ? 184  ARG E N     1 
ATOM   6123  C  CA    . ARG O  3 52  ? -55.328  13.184  0.489   1.00 38.73  ? 184  ARG E CA    1 
ATOM   6124  C  C     . ARG O  3 52  ? -56.808  13.098  0.059   1.00 37.93  ? 184  ARG E C     1 
ATOM   6125  O  O     . ARG O  3 52  ? -57.229  12.144  -0.599  1.00 36.75  ? 184  ARG E O     1 
ATOM   6126  C  CB    . ARG O  3 52  ? -55.207  13.359  2.017   1.00 41.83  ? 184  ARG E CB    1 
ATOM   6127  C  CG    . ARG O  3 52  ? -55.642  12.183  2.865   1.00 43.17  ? 184  ARG E CG    1 
ATOM   6128  C  CD    . ARG O  3 52  ? -54.525  11.193  3.040   1.00 44.75  ? 184  ARG E CD    1 
ATOM   6129  N  NE    . ARG O  3 52  ? -55.047  9.895   3.449   1.00 47.03  ? 184  ARG E NE    1 
ATOM   6130  C  CZ    . ARG O  3 52  ? -55.787  9.691   4.533   1.00 48.08  ? 184  ARG E CZ    1 
ATOM   6131  N  NH1   . ARG O  3 52  ? -56.102  10.709  5.336   1.00 46.36  ? 184  ARG E NH1   1 
ATOM   6132  N  NH2   . ARG O  3 52  ? -56.214  8.460   4.806   1.00 48.30  ? 184  ARG E NH2   1 
ATOM   6133  N  N     . ALA O  3 53  ? -57.579  14.121  0.415   1.00 37.75  ? 185  ALA E N     1 
ATOM   6134  C  CA    . ALA O  3 53  ? -58.998  14.182  0.102   1.00 37.94  ? 185  ALA E CA    1 
ATOM   6135  C  C     . ALA O  3 53  ? -59.278  13.962  -1.366  1.00 39.43  ? 185  ALA E C     1 
ATOM   6136  O  O     . ALA O  3 53  ? -60.016  13.048  -1.747  1.00 39.57  ? 185  ALA E O     1 
ATOM   6137  C  CB    . ALA O  3 53  ? -59.555  15.518  0.517   1.00 36.79  ? 185  ALA E CB    1 
ATOM   6138  N  N     . GLU O  3 54  ? -58.682  14.818  -2.184  1.00 41.08  ? 186  GLU E N     1 
ATOM   6139  C  CA    . GLU O  3 54  ? -58.862  14.768  -3.623  1.00 42.67  ? 186  GLU E CA    1 
ATOM   6140  C  C     . GLU O  3 54  ? -58.810  13.354  -4.206  1.00 43.04  ? 186  GLU E C     1 
ATOM   6141  O  O     . GLU O  3 54  ? -59.577  13.032  -5.117  1.00 42.78  ? 186  GLU E O     1 
ATOM   6142  C  CB    . GLU O  3 54  ? -57.821  15.651  -4.305  1.00 42.99  ? 186  GLU E CB    1 
ATOM   6143  C  CG    . GLU O  3 54  ? -58.262  16.124  -5.660  1.00 45.55  ? 186  GLU E CG    1 
ATOM   6144  C  CD    . GLU O  3 54  ? -59.234  17.294  -5.599  1.00 48.60  ? 186  GLU E CD    1 
ATOM   6145  O  OE1   . GLU O  3 54  ? -58.785  18.429  -5.297  1.00 48.36  ? 186  GLU E OE1   1 
ATOM   6146  O  OE2   . GLU O  3 54  ? -60.446  17.073  -5.852  1.00 49.73  ? 186  GLU E OE2   1 
ATOM   6147  N  N     . ILE O  3 55  ? -57.917  12.511  -3.688  1.00 43.20  ? 187  ILE E N     1 
ATOM   6148  C  CA    . ILE O  3 55  ? -57.811  11.143  -4.186  1.00 43.45  ? 187  ILE E CA    1 
ATOM   6149  C  C     . ILE O  3 55  ? -58.896  10.240  -3.641  1.00 44.99  ? 187  ILE E C     1 
ATOM   6150  O  O     . ILE O  3 55  ? -59.606  9.586   -4.409  1.00 45.54  ? 187  ILE E O     1 
ATOM   6151  C  CB    . ILE O  3 55  ? -56.474  10.507  -3.839  1.00 42.23  ? 187  ILE E CB    1 
ATOM   6152  C  CG1   . ILE O  3 55  ? -55.368  11.233  -4.584  1.00 42.02  ? 187  ILE E CG1   1 
ATOM   6153  C  CG2   . ILE O  3 55  ? -56.481  9.032   -4.218  1.00 40.15  ? 187  ILE E CG2   1 
ATOM   6154  C  CD1   . ILE O  3 55  ? -54.032  10.586  -4.433  1.00 42.69  ? 187  ILE E CD1   1 
ATOM   6155  N  N     . HIS O  3 56  ? -59.020  10.183  -2.320  1.00 45.74  ? 188  HIS E N     1 
ATOM   6156  C  CA    . HIS O  3 56  ? -60.044  9.339   -1.740  1.00 47.89  ? 188  HIS E CA    1 
ATOM   6157  C  C     . HIS O  3 56  ? -61.416  9.648   -2.301  1.00 47.66  ? 188  HIS E C     1 
ATOM   6158  O  O     . HIS O  3 56  ? -62.280  8.767   -2.351  1.00 47.36  ? 188  HIS E O     1 
ATOM   6159  C  CB    . HIS O  3 56  ? -60.048  9.458   -0.231  1.00 51.31  ? 188  HIS E CB    1 
ATOM   6160  C  CG    . HIS O  3 56  ? -59.114  8.496   0.428   1.00 56.61  ? 188  HIS E CG    1 
ATOM   6161  N  ND1   . HIS O  3 56  ? -59.518  7.624   1.417   1.00 58.64  ? 188  HIS E ND1   1 
ATOM   6162  C  CD2   . HIS O  3 56  ? -57.803  8.239   0.209   1.00 57.35  ? 188  HIS E CD2   1 
ATOM   6163  C  CE1   . HIS O  3 56  ? -58.494  6.871   1.778   1.00 59.79  ? 188  HIS E CE1   1 
ATOM   6164  N  NE2   . HIS O  3 56  ? -57.441  7.224   1.060   1.00 59.29  ? 188  HIS E NE2   1 
ATOM   6165  N  N     . ALA O  3 57  ? -61.613  10.894  -2.727  1.00 46.30  ? 189  ALA E N     1 
ATOM   6166  C  CA    . ALA O  3 57  ? -62.878  11.290  -3.332  1.00 43.90  ? 189  ALA E CA    1 
ATOM   6167  C  C     . ALA O  3 57  ? -63.045  10.387  -4.558  1.00 42.47  ? 189  ALA E C     1 
ATOM   6168  O  O     . ALA O  3 57  ? -64.109  9.813   -4.793  1.00 41.47  ? 189  ALA E O     1 
ATOM   6169  C  CB    . ALA O  3 57  ? -62.833  12.751  -3.739  1.00 43.57  ? 189  ALA E CB    1 
ATOM   6170  N  N     . ALA O  3 58  ? -61.982  10.247  -5.335  1.00 41.31  ? 190  ALA E N     1 
ATOM   6171  C  CA    . ALA O  3 58  ? -62.047  9.374   -6.488  1.00 41.56  ? 190  ALA E CA    1 
ATOM   6172  C  C     . ALA O  3 58  ? -62.381  7.980   -5.959  1.00 41.80  ? 190  ALA E C     1 
ATOM   6173  O  O     . ALA O  3 58  ? -63.267  7.290   -6.468  1.00 41.56  ? 190  ALA E O     1 
ATOM   6174  C  CB    . ALA O  3 58  ? -60.723  9.354   -7.194  1.00 41.65  ? 190  ALA E CB    1 
ATOM   6175  N  N     . CYS O  3 59  ? -61.677  7.578   -4.913  1.00 41.58  ? 191  CYS E N     1 
ATOM   6176  C  CA    . CYS O  3 59  ? -61.903  6.266   -4.336  1.00 43.05  ? 191  CYS E CA    1 
ATOM   6177  C  C     . CYS O  3 59  ? -63.335  6.006   -3.932  1.00 41.23  ? 191  CYS E C     1 
ATOM   6178  O  O     . CYS O  3 59  ? -63.781  4.867   -3.952  1.00 39.94  ? 191  CYS E O     1 
ATOM   6179  C  CB    . CYS O  3 59  ? -60.998  6.049   -3.124  1.00 45.58  ? 191  CYS E CB    1 
ATOM   6180  S  SG    . CYS O  3 59  ? -59.266  5.757   -3.557  1.00 50.77  ? 191  CYS E SG    1 
ATOM   6181  N  N     . LYS O  3 60  ? -64.066  7.046   -3.561  1.00 41.37  ? 192  LYS E N     1 
ATOM   6182  C  CA    . LYS O  3 60  ? -65.441  6.814   -3.146  1.00 41.53  ? 192  LYS E CA    1 
ATOM   6183  C  C     . LYS O  3 60  ? -66.275  6.544   -4.354  1.00 41.81  ? 192  LYS E C     1 
ATOM   6184  O  O     . LYS O  3 60  ? -66.953  5.528   -4.426  1.00 42.19  ? 192  LYS E O     1 
ATOM   6185  C  CB    . LYS O  3 60  ? -66.035  8.000   -2.392  1.00 40.14  ? 192  LYS E CB    1 
ATOM   6186  C  CG    . LYS O  3 60  ? -67.317  7.631   -1.679  1.00 38.80  ? 192  LYS E CG    1 
ATOM   6187  C  CD    . LYS O  3 60  ? -67.072  6.469   -0.720  1.00 38.79  ? 192  LYS E CD    1 
ATOM   6188  C  CE    . LYS O  3 60  ? -68.375  5.886   -0.155  1.00 40.74  ? 192  LYS E CE    1 
ATOM   6189  N  NZ    . LYS O  3 60  ? -68.814  6.471   1.147   1.00 41.19  ? 192  LYS E NZ    1 
ATOM   6190  N  N     . ALA O  3 61  ? -66.220  7.456   -5.311  1.00 42.60  ? 193  ALA E N     1 
ATOM   6191  C  CA    . ALA O  3 61  ? -66.998  7.289   -6.520  1.00 44.75  ? 193  ALA E CA    1 
ATOM   6192  C  C     . ALA O  3 61  ? -66.919  5.839   -6.955  1.00 46.21  ? 193  ALA E C     1 
ATOM   6193  O  O     . ALA O  3 61  ? -67.925  5.138   -7.013  1.00 47.08  ? 193  ALA E O     1 
ATOM   6194  C  CB    . ALA O  3 61  ? -66.467  8.186   -7.613  1.00 44.70  ? 193  ALA E CB    1 
ATOM   6195  N  N     . ILE O  3 62  ? -65.707  5.379   -7.228  1.00 48.71  ? 194  ILE E N     1 
ATOM   6196  C  CA    . ILE O  3 62  ? -65.519  4.013   -7.683  1.00 50.42  ? 194  ILE E CA    1 
ATOM   6197  C  C     . ILE O  3 62  ? -65.980  2.958   -6.678  1.00 49.53  ? 194  ILE E C     1 
ATOM   6198  O  O     . ILE O  3 62  ? -66.582  1.964   -7.069  1.00 48.46  ? 194  ILE E O     1 
ATOM   6199  C  CB    . ILE O  3 62  ? -64.050  3.779   -8.099  1.00 52.26  ? 194  ILE E CB    1 
ATOM   6200  C  CG1   . ILE O  3 62  ? -63.811  2.291   -8.339  1.00 53.58  ? 194  ILE E CG1   1 
ATOM   6201  C  CG2   . ILE O  3 62  ? -63.111  4.380   -7.064  1.00 53.67  ? 194  ILE E CG2   1 
ATOM   6202  C  CD1   . ILE O  3 62  ? -62.459  1.989   -8.940  1.00 56.41  ? 194  ILE E CD1   1 
ATOM   6203  N  N     . GLU O  3 63  ? -65.720  3.167   -5.391  1.00 50.09  ? 195  GLU E N     1 
ATOM   6204  C  CA    . GLU O  3 63  ? -66.167  2.203   -4.389  1.00 51.30  ? 195  GLU E CA    1 
ATOM   6205  C  C     . GLU O  3 63  ? -67.689  2.045   -4.478  1.00 51.45  ? 195  GLU E C     1 
ATOM   6206  O  O     . GLU O  3 63  ? -68.236  0.978   -4.184  1.00 51.76  ? 195  GLU E O     1 
ATOM   6207  C  CB    . GLU O  3 63  ? -65.785  2.656   -2.977  1.00 52.91  ? 195  GLU E CB    1 
ATOM   6208  C  CG    . GLU O  3 63  ? -66.416  1.791   -1.885  1.00 57.27  ? 195  GLU E CG    1 
ATOM   6209  C  CD    . GLU O  3 63  ? -66.099  2.254   -0.459  1.00 60.50  ? 195  GLU E CD    1 
ATOM   6210  O  OE1   . GLU O  3 63  ? -66.796  1.791   0.480   1.00 61.21  ? 195  GLU E OE1   1 
ATOM   6211  O  OE2   . GLU O  3 63  ? -65.160  3.068   -0.270  1.00 62.42  ? 195  GLU E OE2   1 
ATOM   6212  N  N     . GLN O  3 64  ? -68.371  3.114   -4.881  1.00 50.67  ? 196  GLN E N     1 
ATOM   6213  C  CA    . GLN O  3 64  ? -69.820  3.080   -5.018  1.00 49.08  ? 196  GLN E CA    1 
ATOM   6214  C  C     . GLN O  3 64  ? -70.157  2.294   -6.276  1.00 49.47  ? 196  GLN E C     1 
ATOM   6215  O  O     . GLN O  3 64  ? -70.856  1.283   -6.227  1.00 48.58  ? 196  GLN E O     1 
ATOM   6216  C  CB    . GLN O  3 64  ? -70.380  4.493   -5.153  1.00 47.39  ? 196  GLN E CB    1 
ATOM   6217  C  CG    . GLN O  3 64  ? -69.931  5.454   -4.080  1.00 47.28  ? 196  GLN E CG    1 
ATOM   6218  C  CD    . GLN O  3 64  ? -70.691  6.770   -4.121  1.00 46.97  ? 196  GLN E CD    1 
ATOM   6219  O  OE1   . GLN O  3 64  ? -70.712  7.471   -5.139  1.00 45.88  ? 196  GLN E OE1   1 
ATOM   6220  N  NE2   . GLN O  3 64  ? -71.321  7.111   -3.009  1.00 47.31  ? 196  GLN E NE2   1 
ATOM   6221  N  N     . ALA O  3 65  ? -69.639  2.777   -7.401  1.00 50.51  ? 197  ALA E N     1 
ATOM   6222  C  CA    . ALA O  3 65  ? -69.861  2.159   -8.704  1.00 51.43  ? 197  ALA E CA    1 
ATOM   6223  C  C     . ALA O  3 65  ? -69.806  0.637   -8.614  1.00 52.22  ? 197  ALA E C     1 
ATOM   6224  O  O     . ALA O  3 65  ? -70.623  -0.068  -9.219  1.00 51.10  ? 197  ALA E O     1 
ATOM   6225  C  CB    . ALA O  3 65  ? -68.822  2.670   -9.701  1.00 49.85  ? 197  ALA E CB    1 
ATOM   6226  N  N     . LYS O  3 66  ? -68.842  0.136   -7.849  1.00 53.23  ? 198  LYS E N     1 
ATOM   6227  C  CA    . LYS O  3 66  ? -68.691  -1.300  -7.683  1.00 53.61  ? 198  LYS E CA    1 
ATOM   6228  C  C     . LYS O  3 66  ? -69.998  -1.848  -7.135  1.00 54.10  ? 198  LYS E C     1 
ATOM   6229  O  O     . LYS O  3 66  ? -70.600  -2.735  -7.732  1.00 53.93  ? 198  LYS E O     1 
ATOM   6230  C  CB    . LYS O  3 66  ? -67.537  -1.608  -6.734  1.00 53.34  ? 198  LYS E CB    1 
ATOM   6231  N  N     . THR O  3 67  ? -70.452  -1.308  -6.011  1.00 55.09  ? 199  THR E N     1 
ATOM   6232  C  CA    . THR O  3 67  ? -71.700  -1.783  -5.427  1.00 56.79  ? 199  THR E CA    1 
ATOM   6233  C  C     . THR O  3 67  ? -72.861  -1.630  -6.414  1.00 57.42  ? 199  THR E C     1 
ATOM   6234  O  O     . THR O  3 67  ? -73.830  -2.371  -6.358  1.00 57.32  ? 199  THR E O     1 
ATOM   6235  C  CB    . THR O  3 67  ? -72.045  -1.032  -4.121  1.00 56.98  ? 199  THR E CB    1 
ATOM   6236  O  OG1   . THR O  3 67  ? -72.787  -1.905  -3.262  1.00 55.89  ? 199  THR E OG1   1 
ATOM   6237  C  CG2   . THR O  3 67  ? -72.894  0.217   -4.413  1.00 56.77  ? 199  THR E CG2   1 
ATOM   6238  N  N     . GLN O  3 68  ? -72.765  -0.664  -7.318  1.00 58.94  ? 200  GLN E N     1 
ATOM   6239  C  CA    . GLN O  3 68  ? -73.820  -0.465  -8.304  1.00 60.71  ? 200  GLN E CA    1 
ATOM   6240  C  C     . GLN O  3 68  ? -73.607  -1.393  -9.485  1.00 62.29  ? 200  GLN E C     1 
ATOM   6241  O  O     . GLN O  3 68  ? -74.146  -1.170  -10.579 1.00 62.38  ? 200  GLN E O     1 
ATOM   6242  C  CB    . GLN O  3 68  ? -73.825  0.977   -8.796  1.00 60.75  ? 200  GLN E CB    1 
ATOM   6243  C  CG    . GLN O  3 68  ? -74.317  1.951   -7.767  1.00 59.67  ? 200  GLN E CG    1 
ATOM   6244  C  CD    . GLN O  3 68  ? -75.577  1.462   -7.109  1.00 58.04  ? 200  GLN E CD    1 
ATOM   6245  O  OE1   . GLN O  3 68  ? -75.526  0.651   -6.186  1.00 57.30  ? 200  GLN E OE1   1 
ATOM   6246  N  NE2   . GLN O  3 68  ? -76.719  1.933   -7.591  1.00 57.12  ? 200  GLN E NE2   1 
ATOM   6247  N  N     . ASN O  3 69  ? -72.821  -2.440  -9.250  1.00 63.52  ? 201  ASN E N     1 
ATOM   6248  C  CA    . ASN O  3 69  ? -72.496  -3.415  -10.283 1.00 63.58  ? 201  ASN E CA    1 
ATOM   6249  C  C     . ASN O  3 69  ? -72.122  -2.656  -11.545 1.00 62.42  ? 201  ASN E C     1 
ATOM   6250  O  O     . ASN O  3 69  ? -72.668  -2.876  -12.625 1.00 61.22  ? 201  ASN E O     1 
ATOM   6251  C  CB    . ASN O  3 69  ? -73.671  -4.373  -10.513 1.00 65.96  ? 201  ASN E CB    1 
ATOM   6252  C  CG    . ASN O  3 69  ? -73.964  -5.240  -9.281  1.00 68.86  ? 201  ASN E CG    1 
ATOM   6253  O  OD1   . ASN O  3 69  ? -73.103  -5.996  -8.823  1.00 70.30  ? 201  ASN E OD1   1 
ATOM   6254  N  ND2   . ASN O  3 69  ? -75.178  -5.123  -8.736  1.00 70.06  ? 201  ASN E ND2   1 
ATOM   6255  N  N     . ILE O  3 70  ? -71.185  -1.732  -11.352 1.00 61.85  ? 202  ILE E N     1 
ATOM   6256  C  CA    . ILE O  3 70  ? -70.629  -0.894  -12.402 1.00 61.23  ? 202  ILE E CA    1 
ATOM   6257  C  C     . ILE O  3 70  ? -69.210  -1.421  -12.635 1.00 61.27  ? 202  ILE E C     1 
ATOM   6258  O  O     . ILE O  3 70  ? -68.661  -2.137  -11.793 1.00 61.17  ? 202  ILE E O     1 
ATOM   6259  C  CB    . ILE O  3 70  ? -70.547  0.579   -11.944 1.00 60.26  ? 202  ILE E CB    1 
ATOM   6260  C  CG1   . ILE O  3 70  ? -71.950  1.120   -11.659 1.00 58.98  ? 202  ILE E CG1   1 
ATOM   6261  C  CG2   . ILE O  3 70  ? -69.849  1.418   -13.000 1.00 60.72  ? 202  ILE E CG2   1 
ATOM   6262  C  CD1   . ILE O  3 70  ? -72.796  1.304   -12.884 1.00 56.45  ? 202  ILE E CD1   1 
ATOM   6263  N  N     . ASN O  3 71  ? -68.617  -1.076  -13.771 1.00 61.28  ? 203  ASN E N     1 
ATOM   6264  C  CA    . ASN O  3 71  ? -67.266  -1.527  -14.080 1.00 60.97  ? 203  ASN E CA    1 
ATOM   6265  C  C     . ASN O  3 71  ? -66.546  -0.523  -14.965 1.00 60.15  ? 203  ASN E C     1 
ATOM   6266  O  O     . ASN O  3 71  ? -65.316  -0.439  -14.943 1.00 60.65  ? 203  ASN E O     1 
ATOM   6267  C  CB    . ASN O  3 71  ? -67.296  -2.898  -14.772 1.00 62.08  ? 203  ASN E CB    1 
ATOM   6268  C  CG    . ASN O  3 71  ? -68.678  -3.268  -15.288 1.00 63.87  ? 203  ASN E CG    1 
ATOM   6269  O  OD1   . ASN O  3 71  ? -69.437  -2.410  -15.740 1.00 66.39  ? 203  ASN E OD1   1 
ATOM   6270  N  ND2   . ASN O  3 71  ? -69.006  -4.555  -15.235 1.00 63.51  ? 203  ASN E ND2   1 
ATOM   6271  N  N     . LYS O  3 72  ? -67.314  0.237   -15.741 1.00 58.70  ? 204  LYS E N     1 
ATOM   6272  C  CA    . LYS O  3 72  ? -66.734  1.234   -16.631 1.00 58.09  ? 204  LYS E CA    1 
ATOM   6273  C  C     . LYS O  3 72  ? -67.436  2.579   -16.524 1.00 56.77  ? 204  LYS E C     1 
ATOM   6274  O  O     . LYS O  3 72  ? -68.540  2.773   -17.034 1.00 56.14  ? 204  LYS E O     1 
ATOM   6275  C  CB    . LYS O  3 72  ? -66.751  0.730   -18.079 1.00 59.22  ? 204  LYS E CB    1 
ATOM   6276  C  CG    . LYS O  3 72  ? -68.119  0.365   -18.616 1.00 60.64  ? 204  LYS E CG    1 
ATOM   6277  C  CD    . LYS O  3 72  ? -68.002  -0.544  -19.832 1.00 61.07  ? 204  LYS E CD    1 
ATOM   6278  C  CE    . LYS O  3 72  ? -67.451  -1.906  -19.440 1.00 61.27  ? 204  LYS E CE    1 
ATOM   6279  N  NZ    . LYS O  3 72  ? -67.337  -2.837  -20.597 1.00 62.31  ? 204  LYS E NZ    1 
ATOM   6280  N  N     . LEU O  3 73  ? -66.766  3.507   -15.848 1.00 56.02  ? 205  LEU E N     1 
ATOM   6281  C  CA    . LEU O  3 73  ? -67.281  4.852   -15.623 1.00 53.66  ? 205  LEU E CA    1 
ATOM   6282  C  C     . LEU O  3 73  ? -66.273  5.917   -16.053 1.00 52.31  ? 205  LEU E C     1 
ATOM   6283  O  O     . LEU O  3 73  ? -65.066  5.680   -16.058 1.00 51.84  ? 205  LEU E O     1 
ATOM   6284  C  CB    . LEU O  3 73  ? -67.610  5.043   -14.136 1.00 51.67  ? 205  LEU E CB    1 
ATOM   6285  C  CG    . LEU O  3 73  ? -66.467  4.870   -13.128 1.00 49.63  ? 205  LEU E CG    1 
ATOM   6286  C  CD1   . LEU O  3 73  ? -66.927  5.298   -11.749 1.00 49.91  ? 205  LEU E CD1   1 
ATOM   6287  C  CD2   . LEU O  3 73  ? -66.019  3.427   -13.092 1.00 48.95  ? 205  LEU E CD2   1 
ATOM   6288  N  N     . VAL O  3 74  ? -66.785  7.083   -16.432 1.00 50.99  ? 206  VAL E N     1 
ATOM   6289  C  CA    . VAL O  3 74  ? -65.946  8.205   -16.830 1.00 50.82  ? 206  VAL E CA    1 
ATOM   6290  C  C     . VAL O  3 74  ? -65.841  9.036   -15.567 1.00 50.65  ? 206  VAL E C     1 
ATOM   6291  O  O     . VAL O  3 74  ? -66.846  9.536   -15.074 1.00 50.92  ? 206  VAL E O     1 
ATOM   6292  C  CB    . VAL O  3 74  ? -66.606  9.052   -17.928 1.00 50.31  ? 206  VAL E CB    1 
ATOM   6293  C  CG1   . VAL O  3 74  ? -65.835  10.321  -18.116 1.00 49.97  ? 206  VAL E CG1   1 
ATOM   6294  C  CG2   . VAL O  3 74  ? -66.644  8.284   -19.228 1.00 50.11  ? 206  VAL E CG2   1 
ATOM   6295  N  N     . LEU O  3 75  ? -64.628  9.194   -15.051 1.00 50.13  ? 207  LEU E N     1 
ATOM   6296  C  CA    . LEU O  3 75  ? -64.439  9.917   -13.805 1.00 50.12  ? 207  LEU E CA    1 
ATOM   6297  C  C     . LEU O  3 75  ? -63.734  11.266  -13.953 1.00 51.58  ? 207  LEU E C     1 
ATOM   6298  O  O     . LEU O  3 75  ? -62.547  11.326  -14.260 1.00 53.73  ? 207  LEU E O     1 
ATOM   6299  C  CB    . LEU O  3 75  ? -63.687  8.994   -12.842 1.00 47.67  ? 207  LEU E CB    1 
ATOM   6300  C  CG    . LEU O  3 75  ? -63.536  9.351   -11.370 1.00 47.70  ? 207  LEU E CG    1 
ATOM   6301  C  CD1   . LEU O  3 75  ? -63.312  8.086   -10.554 1.00 46.21  ? 207  LEU E CD1   1 
ATOM   6302  C  CD2   . LEU O  3 75  ? -62.375  10.318  -11.206 1.00 48.82  ? 207  LEU E CD2   1 
ATOM   6303  N  N     . TYR O  3 76  ? -64.470  12.352  -13.732 1.00 51.60  ? 208  TYR E N     1 
ATOM   6304  C  CA    . TYR O  3 76  ? -63.896  13.687  -13.841 1.00 51.17  ? 208  TYR E CA    1 
ATOM   6305  C  C     . TYR O  3 76  ? -63.435  14.200  -12.491 1.00 50.40  ? 208  TYR E C     1 
ATOM   6306  O  O     . TYR O  3 76  ? -64.104  13.994  -11.477 1.00 51.34  ? 208  TYR E O     1 
ATOM   6307  C  CB    . TYR O  3 76  ? -64.921  14.683  -14.390 1.00 52.88  ? 208  TYR E CB    1 
ATOM   6308  C  CG    . TYR O  3 76  ? -65.311  14.485  -15.838 1.00 56.21  ? 208  TYR E CG    1 
ATOM   6309  C  CD1   . TYR O  3 76  ? -66.012  13.350  -16.253 1.00 57.37  ? 208  TYR E CD1   1 
ATOM   6310  C  CD2   . TYR O  3 76  ? -64.993  15.445  -16.799 1.00 56.39  ? 208  TYR E CD2   1 
ATOM   6311  C  CE1   . TYR O  3 76  ? -66.386  13.183  -17.593 1.00 57.33  ? 208  TYR E CE1   1 
ATOM   6312  C  CE2   . TYR O  3 76  ? -65.360  15.286  -18.138 1.00 57.40  ? 208  TYR E CE2   1 
ATOM   6313  C  CZ    . TYR O  3 76  ? -66.054  14.152  -18.528 1.00 57.50  ? 208  TYR E CZ    1 
ATOM   6314  O  OH    . TYR O  3 76  ? -66.395  13.977  -19.851 1.00 57.76  ? 208  TYR E OH    1 
ATOM   6315  N  N     . THR O  3 77  ? -62.288  14.867  -12.481 1.00 48.93  ? 209  THR E N     1 
ATOM   6316  C  CA    . THR O  3 77  ? -61.748  15.475  -11.263 1.00 46.65  ? 209  THR E CA    1 
ATOM   6317  C  C     . THR O  3 77  ? -60.753  16.505  -11.746 1.00 45.20  ? 209  THR E C     1 
ATOM   6318  O  O     . THR O  3 77  ? -60.454  16.537  -12.942 1.00 44.79  ? 209  THR E O     1 
ATOM   6319  C  CB    . THR O  3 77  ? -61.027  14.454  -10.351 1.00 46.09  ? 209  THR E CB    1 
ATOM   6320  O  OG1   . THR O  3 77  ? -60.657  15.100  -9.125  1.00 45.04  ? 209  THR E OG1   1 
ATOM   6321  C  CG2   . THR O  3 77  ? -59.783  13.899  -11.029 1.00 43.30  ? 209  THR E CG2   1 
ATOM   6322  N  N     . ASN O  3 78  ? -60.260  17.362  -10.853 1.00 43.63  ? 210  ASN E N     1 
ATOM   6323  C  CA    . ASN O  3 78  ? -59.272  18.356  -11.280 1.00 42.72  ? 210  ASN E CA    1 
ATOM   6324  C  C     . ASN O  3 78  ? -57.868  18.014  -10.829 1.00 40.90  ? 210  ASN E C     1 
ATOM   6325  O  O     . ASN O  3 78  ? -56.908  18.539  -11.382 1.00 42.19  ? 210  ASN E O     1 
ATOM   6326  C  CB    . ASN O  3 78  ? -59.600  19.763  -10.777 1.00 41.75  ? 210  ASN E CB    1 
ATOM   6327  C  CG    . ASN O  3 78  ? -60.741  19.780  -9.811  1.00 42.47  ? 210  ASN E CG    1 
ATOM   6328  O  OD1   . ASN O  3 78  ? -60.929  18.840  -9.028  1.00 41.89  ? 210  ASN E OD1   1 
ATOM   6329  N  ND2   . ASN O  3 78  ? -61.516  20.862  -9.843  1.00 42.44  ? 210  ASN E ND2   1 
ATOM   6330  N  N     . SER O  3 79  ? -57.748  17.132  -9.840  1.00 38.41  ? 211  SER E N     1 
ATOM   6331  C  CA    . SER O  3 79  ? -56.441  16.751  -9.317  1.00 36.77  ? 211  SER E CA    1 
ATOM   6332  C  C     . SER O  3 79  ? -55.594  15.923  -10.240 1.00 36.06  ? 211  SER E C     1 
ATOM   6333  O  O     . SER O  3 79  ? -55.731  14.699  -10.290 1.00 35.63  ? 211  SER E O     1 
ATOM   6334  C  CB    . SER O  3 79  ? -56.585  15.993  -8.014  1.00 35.05  ? 211  SER E CB    1 
ATOM   6335  O  OG    . SER O  3 79  ? -57.519  14.954  -8.161  1.00 35.60  ? 211  SER E OG    1 
ATOM   6336  N  N     . MET O  3 80  ? -54.700  16.592  -10.956 1.00 36.33  ? 212  MET E N     1 
ATOM   6337  C  CA    . MET O  3 80  ? -53.817  15.889  -11.860 1.00 37.51  ? 212  MET E CA    1 
ATOM   6338  C  C     . MET O  3 80  ? -53.086  14.930  -10.977 1.00 36.59  ? 212  MET E C     1 
ATOM   6339  O  O     . MET O  3 80  ? -52.998  13.731  -11.256 1.00 37.29  ? 212  MET E O     1 
ATOM   6340  C  CB    . MET O  3 80  ? -52.835  16.847  -12.506 1.00 40.54  ? 212  MET E CB    1 
ATOM   6341  C  CG    . MET O  3 80  ? -53.475  17.632  -13.608 1.00 45.69  ? 212  MET E CG    1 
ATOM   6342  S  SD    . MET O  3 80  ? -54.152  16.492  -14.839 1.00 50.72  ? 212  MET E SD    1 
ATOM   6343  C  CE    . MET O  3 80  ? -53.616  17.373  -16.390 1.00 51.28  ? 212  MET E CE    1 
ATOM   6344  N  N     . PHE O  3 81  ? -52.580  15.473  -9.883  1.00 34.54  ? 213  PHE E N     1 
ATOM   6345  C  CA    . PHE O  3 81  ? -51.865  14.666  -8.934  1.00 33.36  ? 213  PHE E CA    1 
ATOM   6346  C  C     . PHE O  3 81  ? -52.508  13.298  -8.850  1.00 34.54  ? 213  PHE E C     1 
ATOM   6347  O  O     . PHE O  3 81  ? -51.857  12.277  -9.079  1.00 36.09  ? 213  PHE E O     1 
ATOM   6348  C  CB    . PHE O  3 81  ? -51.916  15.290  -7.569  1.00 31.43  ? 213  PHE E CB    1 
ATOM   6349  C  CG    . PHE O  3 81  ? -51.214  14.494  -6.559  1.00 30.29  ? 213  PHE E CG    1 
ATOM   6350  C  CD1   . PHE O  3 81  ? -49.830  14.453  -6.549  1.00 29.45  ? 213  PHE E CD1   1 
ATOM   6351  C  CD2   . PHE O  3 81  ? -51.925  13.759  -5.628  1.00 30.43  ? 213  PHE E CD2   1 
ATOM   6352  C  CE1   . PHE O  3 81  ? -49.158  13.690  -5.628  1.00 30.34  ? 213  PHE E CE1   1 
ATOM   6353  C  CE2   . PHE O  3 81  ? -51.268  12.990  -4.695  1.00 31.86  ? 213  PHE E CE2   1 
ATOM   6354  C  CZ    . PHE O  3 81  ? -49.874  12.953  -4.692  1.00 32.31  ? 213  PHE E CZ    1 
ATOM   6355  N  N     . THR O  3 82  ? -53.796  13.280  -8.525  1.00 34.82  ? 214  THR E N     1 
ATOM   6356  C  CA    . THR O  3 82  ? -54.510  12.023  -8.420  1.00 33.82  ? 214  THR E CA    1 
ATOM   6357  C  C     . THR O  3 82  ? -54.372  11.317  -9.736  1.00 34.57  ? 214  THR E C     1 
ATOM   6358  O  O     . THR O  3 82  ? -53.799  10.225  -9.804  1.00 33.99  ? 214  THR E O     1 
ATOM   6359  C  CB    . THR O  3 82  ? -55.983  12.233  -8.147  1.00 32.59  ? 214  THR E CB    1 
ATOM   6360  O  OG1   . THR O  3 82  ? -56.124  13.016  -6.962  1.00 34.64  ? 214  THR E OG1   1 
ATOM   6361  C  CG2   . THR O  3 82  ? -56.682  10.898  -7.939  1.00 31.28  ? 214  THR E CG2   1 
ATOM   6362  N  N     . ILE O  3 83  ? -54.878  11.957  -10.787 1.00 34.63  ? 215  ILE E N     1 
ATOM   6363  C  CA    . ILE O  3 83  ? -54.813  11.365  -12.114 1.00 36.62  ? 215  ILE E CA    1 
ATOM   6364  C  C     . ILE O  3 83  ? -53.445  10.796  -12.436 1.00 37.22  ? 215  ILE E C     1 
ATOM   6365  O  O     . ILE O  3 83  ? -53.273  9.575   -12.525 1.00 36.60  ? 215  ILE E O     1 
ATOM   6366  C  CB    . ILE O  3 83  ? -55.191  12.368  -13.216 1.00 36.51  ? 215  ILE E CB    1 
ATOM   6367  C  CG1   . ILE O  3 83  ? -56.696  12.653  -13.157 1.00 36.68  ? 215  ILE E CG1   1 
ATOM   6368  C  CG2   . ILE O  3 83  ? -54.805  11.804  -14.580 1.00 35.87  ? 215  ILE E CG2   1 
ATOM   6369  C  CD1   . ILE O  3 83  ? -57.218  13.559  -14.258 1.00 35.27  ? 215  ILE E CD1   1 
ATOM   6370  N  N     . ASN O  3 84  ? -52.468  11.673  -12.608 1.00 38.87  ? 216  ASN E N     1 
ATOM   6371  C  CA    . ASN O  3 84  ? -51.142  11.203  -12.933 1.00 42.42  ? 216  ASN E CA    1 
ATOM   6372  C  C     . ASN O  3 84  ? -50.742  10.071  -12.005 1.00 45.24  ? 216  ASN E C     1 
ATOM   6373  O  O     . ASN O  3 84  ? -50.137  9.073   -12.430 1.00 46.12  ? 216  ASN E O     1 
ATOM   6374  C  CB    . ASN O  3 84  ? -50.148  12.353  -12.884 1.00 41.90  ? 216  ASN E CB    1 
ATOM   6375  C  CG    . ASN O  3 84  ? -50.231  13.225  -14.126 1.00 43.34  ? 216  ASN E CG    1 
ATOM   6376  O  OD1   . ASN O  3 84  ? -50.995  14.195  -14.184 1.00 43.35  ? 216  ASN E OD1   1 
ATOM   6377  N  ND2   . ASN O  3 84  ? -49.463  12.858  -15.146 1.00 44.27  ? 216  ASN E ND2   1 
ATOM   6378  N  N     . GLY O  3 85  ? -51.116  10.201  -10.742 1.00 47.22  ? 217  GLY E N     1 
ATOM   6379  C  CA    . GLY O  3 85  ? -50.790  9.153   -9.801  1.00 49.03  ? 217  GLY E CA    1 
ATOM   6380  C  C     . GLY O  3 85  ? -51.189  7.780   -10.317 1.00 49.82  ? 217  GLY E C     1 
ATOM   6381  O  O     . GLY O  3 85  ? -50.340  6.918   -10.528 1.00 48.84  ? 217  GLY E O     1 
ATOM   6382  N  N     . ILE O  3 86  ? -52.481  7.580   -10.551 1.00 51.94  ? 218  ILE E N     1 
ATOM   6383  C  CA    . ILE O  3 86  ? -52.953  6.278   -11.002 1.00 53.94  ? 218  ILE E CA    1 
ATOM   6384  C  C     . ILE O  3 86  ? -52.642  5.917   -12.446 1.00 55.02  ? 218  ILE E C     1 
ATOM   6385  O  O     . ILE O  3 86  ? -52.119  4.838   -12.709 1.00 55.78  ? 218  ILE E O     1 
ATOM   6386  C  CB    . ILE O  3 86  ? -54.478  6.101   -10.751 1.00 52.30  ? 218  ILE E CB    1 
ATOM   6387  C  CG1   . ILE O  3 86  ? -54.900  4.684   -11.129 1.00 51.87  ? 218  ILE E CG1   1 
ATOM   6388  C  CG2   . ILE O  3 86  ? -55.270  7.098   -11.563 1.00 52.31  ? 218  ILE E CG2   1 
ATOM   6389  C  CD1   . ILE O  3 86  ? -54.117  3.597   -10.425 1.00 52.02  ? 218  ILE E CD1   1 
ATOM   6390  N  N     . THR O  3 87  ? -52.946  6.800   -13.386 1.00 56.01  ? 219  THR E N     1 
ATOM   6391  C  CA    . THR O  3 87  ? -52.677  6.477   -14.777 1.00 58.88  ? 219  THR E CA    1 
ATOM   6392  C  C     . THR O  3 87  ? -51.206  6.600   -15.122 1.00 60.90  ? 219  THR E C     1 
ATOM   6393  O  O     . THR O  3 87  ? -50.868  6.800   -16.291 1.00 62.30  ? 219  THR E O     1 
ATOM   6394  C  CB    . THR O  3 87  ? -53.440  7.396   -15.744 1.00 59.42  ? 219  THR E CB    1 
ATOM   6395  O  OG1   . THR O  3 87  ? -52.897  8.722   -15.679 1.00 59.22  ? 219  THR E OG1   1 
ATOM   6396  C  CG2   . THR O  3 87  ? -54.908  7.428   -15.391 1.00 60.45  ? 219  THR E CG2   1 
ATOM   6397  N  N     . ASN O  3 88  ? -50.320  6.478   -14.136 1.00 62.46  ? 220  ASN E N     1 
ATOM   6398  C  CA    . ASN O  3 88  ? -48.905  6.620   -14.449 1.00 62.33  ? 220  ASN E CA    1 
ATOM   6399  C  C     . ASN O  3 88  ? -47.877  6.432   -13.335 1.00 61.31  ? 220  ASN E C     1 
ATOM   6400  O  O     . ASN O  3 88  ? -47.215  5.399   -13.255 1.00 60.80  ? 220  ASN E O     1 
ATOM   6401  C  CB    . ASN O  3 88  ? -48.701  7.982   -15.109 1.00 63.97  ? 220  ASN E CB    1 
ATOM   6402  C  CG    . ASN O  3 88  ? -47.273  8.417   -15.097 1.00 67.16  ? 220  ASN E CG    1 
ATOM   6403  O  OD1   . ASN O  3 88  ? -46.370  7.604   -14.895 1.00 69.02  ? 220  ASN E OD1   1 
ATOM   6404  N  ND2   . ASN O  3 88  ? -47.045  9.712   -15.323 1.00 69.42  ? 220  ASN E ND2   1 
ATOM   6405  N  N     . TRP O  3 89  ? -47.730  7.447   -12.495 1.00 60.51  ? 221  TRP E N     1 
ATOM   6406  C  CA    . TRP O  3 89  ? -46.753  7.419   -11.413 1.00 61.45  ? 221  TRP E CA    1 
ATOM   6407  C  C     . TRP O  3 89  ? -46.695  6.188   -10.513 1.00 62.71  ? 221  TRP E C     1 
ATOM   6408  O  O     . TRP O  3 89  ? -45.641  5.885   -9.952  1.00 62.39  ? 221  TRP E O     1 
ATOM   6409  C  CB    . TRP O  3 89  ? -46.913  8.670   -10.543 1.00 59.34  ? 221  TRP E CB    1 
ATOM   6410  C  CG    . TRP O  3 89  ? -46.691  9.925   -11.320 1.00 58.50  ? 221  TRP E CG    1 
ATOM   6411  C  CD1   . TRP O  3 89  ? -46.033  10.043  -12.513 1.00 58.02  ? 221  TRP E CD1   1 
ATOM   6412  C  CD2   . TRP O  3 89  ? -47.121  11.240  -10.971 1.00 58.29  ? 221  TRP E CD2   1 
ATOM   6413  N  NE1   . TRP O  3 89  ? -46.028  11.352  -12.930 1.00 57.71  ? 221  TRP E NE1   1 
ATOM   6414  C  CE2   . TRP O  3 89  ? -46.690  12.110  -12.002 1.00 58.53  ? 221  TRP E CE2   1 
ATOM   6415  C  CE3   . TRP O  3 89  ? -47.828  11.773  -9.891  1.00 57.57  ? 221  TRP E CE3   1 
ATOM   6416  C  CZ2   . TRP O  3 89  ? -46.947  13.483  -11.980 1.00 58.86  ? 221  TRP E CZ2   1 
ATOM   6417  C  CZ3   . TRP O  3 89  ? -48.082  13.141  -9.871  1.00 58.50  ? 221  TRP E CZ3   1 
ATOM   6418  C  CH2   . TRP O  3 89  ? -47.642  13.979  -10.910 1.00 58.30  ? 221  TRP E CH2   1 
ATOM   6419  N  N     . VAL O  3 90  ? -47.807  5.472   -10.385 1.00 65.32  ? 222  VAL E N     1 
ATOM   6420  C  CA    . VAL O  3 90  ? -47.860  4.298   -9.511  1.00 67.87  ? 222  VAL E CA    1 
ATOM   6421  C  C     . VAL O  3 90  ? -47.168  3.040   -10.057 1.00 69.09  ? 222  VAL E C     1 
ATOM   6422  O  O     . VAL O  3 90  ? -46.757  2.155   -9.287  1.00 68.45  ? 222  VAL E O     1 
ATOM   6423  C  CB    . VAL O  3 90  ? -49.323  3.959   -9.137  1.00 68.26  ? 222  VAL E CB    1 
ATOM   6424  C  CG1   . VAL O  3 90  ? -50.110  3.565   -10.391 1.00 68.60  ? 222  VAL E CG1   1 
ATOM   6425  C  CG2   . VAL O  3 90  ? -49.341  2.859   -8.081  1.00 67.72  ? 222  VAL E CG2   1 
ATOM   6426  N  N     . GLN O  3 91  ? -47.052  2.955   -11.380 1.00 70.30  ? 223  GLN E N     1 
ATOM   6427  C  CA    . GLN O  3 91  ? -46.376  1.822   -12.000 1.00 70.83  ? 223  GLN E CA    1 
ATOM   6428  C  C     . GLN O  3 91  ? -44.969  1.791   -11.410 1.00 69.22  ? 223  GLN E C     1 
ATOM   6429  O  O     . GLN O  3 91  ? -44.594  0.853   -10.701 1.00 68.13  ? 223  GLN E O     1 
ATOM   6430  C  CB    . GLN O  3 91  ? -46.295  2.018   -13.514 1.00 73.32  ? 223  GLN E CB    1 
ATOM   6431  C  CG    . GLN O  3 91  ? -47.636  1.967   -14.219 1.00 77.36  ? 223  GLN E CG    1 
ATOM   6432  C  CD    . GLN O  3 91  ? -47.515  2.295   -15.697 1.00 80.58  ? 223  GLN E CD    1 
ATOM   6433  O  OE1   . GLN O  3 91  ? -47.296  3.450   -16.071 1.00 81.58  ? 223  GLN E OE1   1 
ATOM   6434  N  NE2   . GLN O  3 91  ? -47.642  1.275   -16.547 1.00 82.07  ? 223  GLN E NE2   1 
ATOM   6435  N  N     . GLY O  3 92  ? -44.208  2.843   -11.702 1.00 67.41  ? 224  GLY E N     1 
ATOM   6436  C  CA    . GLY O  3 92  ? -42.860  2.945   -11.190 1.00 65.43  ? 224  GLY E CA    1 
ATOM   6437  C  C     . GLY O  3 92  ? -42.841  2.809   -9.683  1.00 64.04  ? 224  GLY E C     1 
ATOM   6438  O  O     . GLY O  3 92  ? -42.006  2.107   -9.124  1.00 64.14  ? 224  GLY E O     1 
ATOM   6439  N  N     . TRP O  3 93  ? -43.768  3.474   -9.010  1.00 63.62  ? 225  TRP E N     1 
ATOM   6440  C  CA    . TRP O  3 93  ? -43.799  3.389   -7.560  1.00 63.77  ? 225  TRP E CA    1 
ATOM   6441  C  C     . TRP O  3 93  ? -43.824  1.947   -7.102  1.00 62.73  ? 225  TRP E C     1 
ATOM   6442  O  O     . TRP O  3 93  ? -43.382  1.633   -6.002  1.00 61.54  ? 225  TRP E O     1 
ATOM   6443  C  CB    . TRP O  3 93  ? -44.990  4.169   -6.986  1.00 64.36  ? 225  TRP E CB    1 
ATOM   6444  C  CG    . TRP O  3 93  ? -44.793  5.671   -7.057  1.00 64.87  ? 225  TRP E CG    1 
ATOM   6445  C  CD1   . TRP O  3 93  ? -43.604  6.344   -7.163  1.00 64.52  ? 225  TRP E CD1   1 
ATOM   6446  C  CD2   . TRP O  3 93  ? -45.808  6.672   -6.996  1.00 64.89  ? 225  TRP E CD2   1 
ATOM   6447  N  NE1   . TRP O  3 93  ? -43.821  7.697   -7.173  1.00 63.59  ? 225  TRP E NE1   1 
ATOM   6448  C  CE2   . TRP O  3 93  ? -45.166  7.925   -7.071  1.00 64.21  ? 225  TRP E CE2   1 
ATOM   6449  C  CE3   . TRP O  3 93  ? -47.201  6.632   -6.885  1.00 64.66  ? 225  TRP E CE3   1 
ATOM   6450  C  CZ2   . TRP O  3 93  ? -45.867  9.121   -7.039  1.00 64.87  ? 225  TRP E CZ2   1 
ATOM   6451  C  CZ3   . TRP O  3 93  ? -47.894  7.824   -6.853  1.00 64.72  ? 225  TRP E CZ3   1 
ATOM   6452  C  CH2   . TRP O  3 93  ? -47.228  9.051   -6.930  1.00 65.04  ? 225  TRP E CH2   1 
ATOM   6453  N  N     . LYS O  3 94  ? -44.326  1.068   -7.960  1.00 62.96  ? 226  LYS E N     1 
ATOM   6454  C  CA    . LYS O  3 94  ? -44.387  -0.356  -7.646  1.00 63.37  ? 226  LYS E CA    1 
ATOM   6455  C  C     . LYS O  3 94  ? -42.990  -0.974  -7.739  1.00 62.91  ? 226  LYS E C     1 
ATOM   6456  O  O     . LYS O  3 94  ? -42.526  -1.665  -6.828  1.00 60.79  ? 226  LYS E O     1 
ATOM   6457  C  CB    . LYS O  3 94  ? -45.324  -1.072  -8.629  1.00 63.31  ? 226  LYS E CB    1 
ATOM   6458  C  CG    . LYS O  3 94  ? -46.807  -0.783  -8.437  1.00 62.92  ? 226  LYS E CG    1 
ATOM   6459  C  CD    . LYS O  3 94  ? -47.456  -1.677  -7.358  1.00 62.95  ? 226  LYS E CD    1 
ATOM   6460  C  CE    . LYS O  3 94  ? -47.026  -1.345  -5.916  1.00 61.75  ? 226  LYS E CE    1 
ATOM   6461  N  NZ    . LYS O  3 94  ? -45.660  -1.820  -5.537  1.00 60.03  ? 226  LYS E NZ    1 
ATOM   6462  N  N     . LYS O  3 95  ? -42.330  -0.691  -8.856  1.00 63.53  ? 227  LYS E N     1 
ATOM   6463  C  CA    . LYS O  3 95  ? -41.000  -1.200  -9.150  1.00 64.18  ? 227  LYS E CA    1 
ATOM   6464  C  C     . LYS O  3 95  ? -39.882  -0.457  -8.420  1.00 64.11  ? 227  LYS E C     1 
ATOM   6465  O  O     . LYS O  3 95  ? -39.087  -1.070  -7.712  1.00 64.19  ? 227  LYS E O     1 
ATOM   6466  C  CB    . LYS O  3 95  ? -40.782  -1.142  -10.664 1.00 64.55  ? 227  LYS E CB    1 
ATOM   6467  C  CG    . LYS O  3 95  ? -42.024  -1.577  -11.452 1.00 65.94  ? 227  LYS E CG    1 
ATOM   6468  C  CD    . LYS O  3 95  ? -41.802  -1.604  -12.964 1.00 67.95  ? 227  LYS E CD    1 
ATOM   6469  C  CE    . LYS O  3 95  ? -40.865  -2.738  -13.383 1.00 69.85  ? 227  LYS E CE    1 
ATOM   6470  N  NZ    . LYS O  3 95  ? -40.652  -2.808  -14.864 1.00 71.15  ? 227  LYS E NZ    1 
ATOM   6471  N  N     . ASN O  3 96  ? -39.830  0.860   -8.589  1.00 64.62  ? 228  ASN E N     1 
ATOM   6472  C  CA    . ASN O  3 96  ? -38.805  1.687   -7.957  1.00 66.01  ? 228  ASN E CA    1 
ATOM   6473  C  C     . ASN O  3 96  ? -38.792  1.518   -6.441  1.00 65.97  ? 228  ASN E C     1 
ATOM   6474  O  O     . ASN O  3 96  ? -37.904  2.030   -5.756  1.00 65.76  ? 228  ASN E O     1 
ATOM   6475  C  CB    . ASN O  3 96  ? -39.041  3.160   -8.279  1.00 67.59  ? 228  ASN E CB    1 
ATOM   6476  C  CG    . ASN O  3 96  ? -39.830  3.863   -7.197  1.00 69.89  ? 228  ASN E CG    1 
ATOM   6477  O  OD1   . ASN O  3 96  ? -39.274  4.621   -6.402  1.00 71.82  ? 228  ASN E OD1   1 
ATOM   6478  N  ND2   . ASN O  3 96  ? -41.128  3.595   -7.143  1.00 68.85  ? 228  ASN E ND2   1 
ATOM   6479  N  N     . GLY O  3 97  ? -39.788  0.818   -5.916  1.00 65.98  ? 229  GLY E N     1 
ATOM   6480  C  CA    . GLY O  3 97  ? -39.851  0.605   -4.483  1.00 66.12  ? 229  GLY E CA    1 
ATOM   6481  C  C     . GLY O  3 97  ? -40.488  1.767   -3.756  1.00 66.74  ? 229  GLY E C     1 
ATOM   6482  O  O     . GLY O  3 97  ? -40.077  2.098   -2.643  1.00 67.76  ? 229  GLY E O     1 
ATOM   6483  N  N     . TRP O  3 98  ? -41.493  2.378   -4.385  1.00 65.98  ? 230  TRP E N     1 
ATOM   6484  C  CA    . TRP O  3 98  ? -42.211  3.514   -3.814  1.00 65.16  ? 230  TRP E CA    1 
ATOM   6485  C  C     . TRP O  3 98  ? -41.279  4.622   -3.344  1.00 64.68  ? 230  TRP E C     1 
ATOM   6486  O  O     . TRP O  3 98  ? -41.138  4.857   -2.140  1.00 64.40  ? 230  TRP E O     1 
ATOM   6487  C  CB    . TRP O  3 98  ? -43.110  3.069   -2.646  1.00 66.32  ? 230  TRP E CB    1 
ATOM   6488  C  CG    . TRP O  3 98  ? -44.375  2.368   -3.087  1.00 68.28  ? 230  TRP E CG    1 
ATOM   6489  C  CD1   . TRP O  3 98  ? -44.548  1.030   -3.277  1.00 69.42  ? 230  TRP E CD1   1 
ATOM   6490  C  CD2   . TRP O  3 98  ? -45.620  2.984   -3.453  1.00 68.63  ? 230  TRP E CD2   1 
ATOM   6491  N  NE1   . TRP O  3 98  ? -45.816  0.771   -3.740  1.00 69.35  ? 230  TRP E NE1   1 
ATOM   6492  C  CE2   . TRP O  3 98  ? -46.494  1.954   -3.858  1.00 68.96  ? 230  TRP E CE2   1 
ATOM   6493  C  CE3   . TRP O  3 98  ? -46.078  4.304   -3.480  1.00 69.04  ? 230  TRP E CE3   1 
ATOM   6494  C  CZ2   . TRP O  3 98  ? -47.800  2.205   -4.286  1.00 69.83  ? 230  TRP E CZ2   1 
ATOM   6495  C  CZ3   . TRP O  3 98  ? -47.377  4.555   -3.906  1.00 69.81  ? 230  TRP E CZ3   1 
ATOM   6496  C  CH2   . TRP O  3 98  ? -48.222  3.509   -4.303  1.00 70.26  ? 230  TRP E CH2   1 
ATOM   6497  N  N     . LYS O  3 99  ? -40.651  5.300   -4.304  1.00 64.18  ? 231  LYS E N     1 
ATOM   6498  C  CA    . LYS O  3 99  ? -39.730  6.404   -4.022  1.00 63.38  ? 231  LYS E CA    1 
ATOM   6499  C  C     . LYS O  3 99  ? -39.887  7.485   -5.079  1.00 62.38  ? 231  LYS E C     1 
ATOM   6500  O  O     . LYS O  3 99  ? -40.061  7.191   -6.262  1.00 60.23  ? 231  LYS E O     1 
ATOM   6501  C  CB    . LYS O  3 99  ? -38.274  5.921   -4.032  1.00 64.43  ? 231  LYS E CB    1 
ATOM   6502  C  CG    . LYS O  3 99  ? -37.923  4.893   -2.969  1.00 65.31  ? 231  LYS E CG    1 
ATOM   6503  C  CD    . LYS O  3 99  ? -37.949  5.500   -1.582  1.00 66.15  ? 231  LYS E CD    1 
ATOM   6504  C  CE    . LYS O  3 99  ? -37.757  4.426   -0.526  1.00 66.99  ? 231  LYS E CE    1 
ATOM   6505  N  NZ    . LYS O  3 99  ? -37.856  4.993   0.848   1.00 68.23  ? 231  LYS E NZ    1 
ATOM   6506  N  N     . THR O  3 100 ? -39.813  8.738   -4.652  1.00 63.07  ? 232  THR E N     1 
ATOM   6507  C  CA    . THR O  3 100 ? -39.940  9.855   -5.581  1.00 65.49  ? 232  THR E CA    1 
ATOM   6508  C  C     . THR O  3 100 ? -38.579  10.365  -6.040  1.00 66.29  ? 232  THR E C     1 
ATOM   6509  O  O     . THR O  3 100 ? -37.607  10.308  -5.288  1.00 66.04  ? 232  THR E O     1 
ATOM   6510  C  CB    . THR O  3 100 ? -40.666  11.032  -4.945  1.00 66.03  ? 232  THR E CB    1 
ATOM   6511  O  OG1   . THR O  3 100 ? -40.991  11.987  -5.965  1.00 65.75  ? 232  THR E OG1   1 
ATOM   6512  C  CG2   . THR O  3 100 ? -39.771  11.689  -3.881  1.00 66.04  ? 232  THR E CG2   1 
ATOM   6513  N  N     . SER O  3 101 ? -38.531  10.885  -7.264  1.00 67.41  ? 233  SER E N     1 
ATOM   6514  C  CA    . SER O  3 101 ? -37.300  11.410  -7.847  1.00 69.65  ? 233  SER E CA    1 
ATOM   6515  C  C     . SER O  3 101 ? -36.159  11.699  -6.872  1.00 72.20  ? 233  SER E C     1 
ATOM   6516  O  O     . SER O  3 101 ? -35.050  11.204  -7.060  1.00 74.70  ? 233  SER E O     1 
ATOM   6517  C  CB    . SER O  3 101 ? -37.593  12.671  -8.660  1.00 68.70  ? 233  SER E CB    1 
ATOM   6518  O  OG    . SER O  3 101 ? -38.080  12.340  -9.945  1.00 67.77  ? 233  SER E OG    1 
ATOM   6519  N  N     . ALA O  3 102 ? -36.410  12.489  -5.831  1.00 73.94  ? 234  ALA E N     1 
ATOM   6520  C  CA    . ALA O  3 102 ? -35.349  12.814  -4.870  1.00 74.97  ? 234  ALA E CA    1 
ATOM   6521  C  C     . ALA O  3 102 ? -35.048  11.685  -3.872  1.00 75.27  ? 234  ALA E C     1 
ATOM   6522  O  O     . ALA O  3 102 ? -34.783  11.936  -2.693  1.00 74.99  ? 234  ALA E O     1 
ATOM   6523  C  CB    . ALA O  3 102 ? -35.705  14.101  -4.117  1.00 75.95  ? 234  ALA E CB    1 
ATOM   6524  N  N     . GLY O  3 103 ? -35.084  10.446  -4.355  1.00 75.09  ? 235  GLY E N     1 
ATOM   6525  C  CA    . GLY O  3 103 ? -34.812  9.307   -3.500  1.00 74.91  ? 235  GLY E CA    1 
ATOM   6526  C  C     . GLY O  3 103 ? -35.580  9.375   -2.197  1.00 74.81  ? 235  GLY E C     1 
ATOM   6527  O  O     . GLY O  3 103 ? -35.084  8.969   -1.145  1.00 75.38  ? 235  GLY E O     1 
ATOM   6528  N  N     . LYS O  3 104 ? -36.797  9.898   -2.263  1.00 74.35  ? 236  LYS E N     1 
ATOM   6529  C  CA    . LYS O  3 104 ? -37.623  10.007  -1.074  1.00 73.83  ? 236  LYS E CA    1 
ATOM   6530  C  C     . LYS O  3 104 ? -38.879  9.130   -1.160  1.00 72.08  ? 236  LYS E C     1 
ATOM   6531  O  O     . LYS O  3 104 ? -39.353  8.799   -2.253  1.00 70.75  ? 236  LYS E O     1 
ATOM   6532  C  CB    . LYS O  3 104 ? -37.985  11.477  -0.834  1.00 75.71  ? 236  LYS E CB    1 
ATOM   6533  C  CG    . LYS O  3 104 ? -37.009  12.211  0.098   1.00 78.71  ? 236  LYS E CG    1 
ATOM   6534  C  CD    . LYS O  3 104 ? -37.376  13.699  0.262   1.00 80.96  ? 236  LYS E CD    1 
ATOM   6535  C  CE    . LYS O  3 104 ? -36.832  14.320  1.572   1.00 81.01  ? 236  LYS E CE    1 
ATOM   6536  N  NZ    . LYS O  3 104 ? -35.344  14.402  1.681   1.00 80.59  ? 236  LYS E NZ    1 
ATOM   6537  N  N     . GLU O  3 105 ? -39.403  8.743   0.000   1.00 70.01  ? 237  GLU E N     1 
ATOM   6538  C  CA    . GLU O  3 105 ? -40.590  7.899   0.054   1.00 68.64  ? 237  GLU E CA    1 
ATOM   6539  C  C     . GLU O  3 105 ? -41.853  8.737   -0.151  1.00 65.23  ? 237  GLU E C     1 
ATOM   6540  O  O     . GLU O  3 105 ? -42.075  9.717   0.567   1.00 63.12  ? 237  GLU E O     1 
ATOM   6541  C  CB    . GLU O  3 105 ? -40.639  7.155   1.399   1.00 72.08  ? 237  GLU E CB    1 
ATOM   6542  C  CG    . GLU O  3 105 ? -41.170  5.712   1.296   1.00 77.04  ? 237  GLU E CG    1 
ATOM   6543  C  CD    . GLU O  3 105 ? -40.790  4.831   2.496   1.00 80.08  ? 237  GLU E CD    1 
ATOM   6544  O  OE1   . GLU O  3 105 ? -41.229  5.131   3.631   1.00 82.09  ? 237  GLU E OE1   1 
ATOM   6545  O  OE2   . GLU O  3 105 ? -40.052  3.834   2.302   1.00 80.64  ? 237  GLU E OE2   1 
ATOM   6546  N  N     . VAL O  3 106 ? -42.661  8.350   -1.145  1.00 61.80  ? 238  VAL E N     1 
ATOM   6547  C  CA    . VAL O  3 106 ? -43.905  9.050   -1.472  1.00 58.16  ? 238  VAL E CA    1 
ATOM   6548  C  C     . VAL O  3 106 ? -44.753  9.129   -0.214  1.00 57.82  ? 238  VAL E C     1 
ATOM   6549  O  O     . VAL O  3 106 ? -44.917  8.135   0.492   1.00 57.07  ? 238  VAL E O     1 
ATOM   6550  C  CB    . VAL O  3 106 ? -44.720  8.323   -2.577  1.00 55.75  ? 238  VAL E CB    1 
ATOM   6551  C  CG1   . VAL O  3 106 ? -43.827  7.935   -3.730  1.00 52.97  ? 238  VAL E CG1   1 
ATOM   6552  C  CG2   . VAL O  3 106 ? -45.400  7.117   -2.010  1.00 56.47  ? 238  VAL E CG2   1 
ATOM   6553  N  N     . ILE O  3 107 ? -45.294  10.308  0.072   1.00 57.38  ? 239  ILE E N     1 
ATOM   6554  C  CA    . ILE O  3 107 ? -46.084  10.468  1.280   1.00 56.58  ? 239  ILE E CA    1 
ATOM   6555  C  C     . ILE O  3 107 ? -47.464  9.864   1.137   1.00 58.55  ? 239  ILE E C     1 
ATOM   6556  O  O     . ILE O  3 107 ? -48.036  9.354   2.111   1.00 58.98  ? 239  ILE E O     1 
ATOM   6557  C  CB    . ILE O  3 107 ? -46.260  11.946  1.664   1.00 53.76  ? 239  ILE E CB    1 
ATOM   6558  C  CG1   . ILE O  3 107 ? -44.922  12.685  1.599   1.00 50.54  ? 239  ILE E CG1   1 
ATOM   6559  C  CG2   . ILE O  3 107 ? -46.845  12.036  3.067   1.00 54.41  ? 239  ILE E CG2   1 
ATOM   6560  C  CD1   . ILE O  3 107 ? -44.621  13.287  0.255   1.00 45.53  ? 239  ILE E CD1   1 
ATOM   6561  N  N     . ASN O  3 108 ? -47.987  9.915   -0.085  1.00 59.92  ? 240  ASN E N     1 
ATOM   6562  C  CA    . ASN O  3 108 ? -49.324  9.406   -0.369  1.00 61.00  ? 240  ASN E CA    1 
ATOM   6563  C  C     . ASN O  3 108 ? -49.364  7.950   -0.818  1.00 61.02  ? 240  ASN E C     1 
ATOM   6564  O  O     . ASN O  3 108 ? -50.040  7.611   -1.788  1.00 61.54  ? 240  ASN E O     1 
ATOM   6565  C  CB    . ASN O  3 108 ? -50.003  10.307  -1.412  1.00 59.75  ? 240  ASN E CB    1 
ATOM   6566  C  CG    . ASN O  3 108 ? -50.316  11.698  -0.867  1.00 59.10  ? 240  ASN E CG    1 
ATOM   6567  O  OD1   . ASN O  3 108 ? -50.294  12.678  -1.604  1.00 58.75  ? 240  ASN E OD1   1 
ATOM   6568  N  ND2   . ASN O  3 108 ? -50.619  11.783  0.429   1.00 57.70  ? 240  ASN E ND2   1 
ATOM   6569  N  N     . LYS O  3 109 ? -48.660  7.081   -0.104  1.00 60.77  ? 241  LYS E N     1 
ATOM   6570  C  CA    . LYS O  3 109 ? -48.667  5.683   -0.481  1.00 61.24  ? 241  LYS E CA    1 
ATOM   6571  C  C     . LYS O  3 109 ? -49.997  5.047   -0.097  1.00 61.49  ? 241  LYS E C     1 
ATOM   6572  O  O     . LYS O  3 109 ? -50.774  4.677   -0.978  1.00 61.16  ? 241  LYS E O     1 
ATOM   6573  C  CB    . LYS O  3 109 ? -47.510  4.934   0.178   1.00 61.73  ? 241  LYS E CB    1 
ATOM   6574  C  CG    . LYS O  3 109 ? -47.339  3.517   -0.355  1.00 62.57  ? 241  LYS E CG    1 
ATOM   6575  C  CD    . LYS O  3 109 ? -46.061  2.864   0.151   1.00 63.42  ? 241  LYS E CD    1 
ATOM   6576  C  CE    . LYS O  3 109 ? -45.919  1.435   -0.355  1.00 61.84  ? 241  LYS E CE    1 
ATOM   6577  N  NZ    . LYS O  3 109 ? -44.635  0.841   0.081   1.00 62.33  ? 241  LYS E NZ    1 
ATOM   6578  N  N     . GLU O  3 110 ? -50.266  4.934   1.206   1.00 61.66  ? 242  GLU E N     1 
ATOM   6579  C  CA    . GLU O  3 110 ? -51.518  4.333   1.677   1.00 62.22  ? 242  GLU E CA    1 
ATOM   6580  C  C     . GLU O  3 110 ? -52.619  4.583   0.655   1.00 60.99  ? 242  GLU E C     1 
ATOM   6581  O  O     . GLU O  3 110 ? -53.189  3.665   0.058   1.00 60.23  ? 242  GLU E O     1 
ATOM   6582  C  CB    . GLU O  3 110 ? -51.959  4.942   3.020   1.00 64.01  ? 242  GLU E CB    1 
ATOM   6583  C  CG    . GLU O  3 110 ? -53.409  4.556   3.409   1.00 69.30  ? 242  GLU E CG    1 
ATOM   6584  C  CD    . GLU O  3 110 ? -54.012  5.397   4.546   1.00 72.53  ? 242  GLU E CD    1 
ATOM   6585  O  OE1   . GLU O  3 110 ? -53.451  5.385   5.669   1.00 74.92  ? 242  GLU E OE1   1 
ATOM   6586  O  OE2   . GLU O  3 110 ? -55.056  6.060   4.318   1.00 72.08  ? 242  GLU E OE2   1 
ATOM   6587  N  N     . ASP O  3 111 ? -52.887  5.864   0.470   1.00 60.29  ? 243  ASP E N     1 
ATOM   6588  C  CA    . ASP O  3 111 ? -53.901  6.358   -0.436  1.00 58.71  ? 243  ASP E CA    1 
ATOM   6589  C  C     . ASP O  3 111 ? -53.771  5.783   -1.840  1.00 56.52  ? 243  ASP E C     1 
ATOM   6590  O  O     . ASP O  3 111 ? -54.618  5.018   -2.291  1.00 56.46  ? 243  ASP E O     1 
ATOM   6591  C  CB    . ASP O  3 111 ? -53.807  7.883   -0.456  1.00 60.34  ? 243  ASP E CB    1 
ATOM   6592  C  CG    . ASP O  3 111 ? -53.686  8.469   0.950   1.00 62.34  ? 243  ASP E CG    1 
ATOM   6593  O  OD1   . ASP O  3 111 ? -54.538  8.132   1.811   1.00 62.17  ? 243  ASP E OD1   1 
ATOM   6594  O  OD2   . ASP O  3 111 ? -52.740  9.256   1.195   1.00 62.43  ? 243  ASP E OD2   1 
ATOM   6595  N  N     . PHE O  3 112 ? -52.706  6.149   -2.533  1.00 54.06  ? 244  PHE E N     1 
ATOM   6596  C  CA    . PHE O  3 112 ? -52.509  5.657   -3.881  1.00 51.76  ? 244  PHE E CA    1 
ATOM   6597  C  C     . PHE O  3 112 ? -52.717  4.158   -3.999  1.00 51.67  ? 244  PHE E C     1 
ATOM   6598  O  O     . PHE O  3 112 ? -53.335  3.688   -4.954  1.00 51.45  ? 244  PHE E O     1 
ATOM   6599  C  CB    . PHE O  3 112 ? -51.126  6.053   -4.375  1.00 48.83  ? 244  PHE E CB    1 
ATOM   6600  C  CG    . PHE O  3 112 ? -51.081  7.428   -4.966  1.00 45.32  ? 244  PHE E CG    1 
ATOM   6601  C  CD1   . PHE O  3 112 ? -51.742  7.702   -6.154  1.00 44.94  ? 244  PHE E CD1   1 
ATOM   6602  C  CD2   . PHE O  3 112 ? -50.382  8.449   -4.342  1.00 43.78  ? 244  PHE E CD2   1 
ATOM   6603  C  CE1   . PHE O  3 112 ? -51.700  8.977   -6.717  1.00 44.86  ? 244  PHE E CE1   1 
ATOM   6604  C  CE2   . PHE O  3 112 ? -50.333  9.720   -4.894  1.00 42.94  ? 244  PHE E CE2   1 
ATOM   6605  C  CZ    . PHE O  3 112 ? -50.994  9.987   -6.085  1.00 42.89  ? 244  PHE E CZ    1 
ATOM   6606  N  N     . VAL O  3 113 ? -52.207  3.405   -3.032  1.00 51.95  ? 245  VAL E N     1 
ATOM   6607  C  CA    . VAL O  3 113 ? -52.379  1.954   -3.047  1.00 52.23  ? 245  VAL E CA    1 
ATOM   6608  C  C     . VAL O  3 113 ? -53.881  1.693   -3.032  1.00 51.94  ? 245  VAL E C     1 
ATOM   6609  O  O     . VAL O  3 113 ? -54.420  0.975   -3.880  1.00 52.03  ? 245  VAL E O     1 
ATOM   6610  C  CB    . VAL O  3 113 ? -51.783  1.284   -1.791  1.00 52.46  ? 245  VAL E CB    1 
ATOM   6611  C  CG1   . VAL O  3 113 ? -51.872  -0.211  -1.928  1.00 52.62  ? 245  VAL E CG1   1 
ATOM   6612  C  CG2   . VAL O  3 113 ? -50.347  1.713   -1.585  1.00 52.81  ? 245  VAL E CG2   1 
ATOM   6613  N  N     . ALA O  3 114 ? -54.543  2.296   -2.051  1.00 50.62  ? 246  ALA E N     1 
ATOM   6614  C  CA    . ALA O  3 114 ? -55.975  2.164   -1.885  1.00 49.82  ? 246  ALA E CA    1 
ATOM   6615  C  C     . ALA O  3 114 ? -56.726  2.351   -3.194  1.00 49.90  ? 246  ALA E C     1 
ATOM   6616  O  O     . ALA O  3 114 ? -57.613  1.570   -3.506  1.00 50.02  ? 246  ALA E O     1 
ATOM   6617  C  CB    . ALA O  3 114 ? -56.463  3.164   -0.861  1.00 50.05  ? 246  ALA E CB    1 
ATOM   6618  N  N     . LEU O  3 115 ? -56.390  3.380   -3.963  1.00 50.76  ? 247  LEU E N     1 
ATOM   6619  C  CA    . LEU O  3 115 ? -57.093  3.587   -5.221  1.00 52.64  ? 247  LEU E CA    1 
ATOM   6620  C  C     . LEU O  3 115 ? -56.803  2.422   -6.156  1.00 54.99  ? 247  LEU E C     1 
ATOM   6621  O  O     . LEU O  3 115 ? -57.717  1.714   -6.586  1.00 54.97  ? 247  LEU E O     1 
ATOM   6622  C  CB    . LEU O  3 115 ? -56.676  4.901   -5.886  1.00 51.13  ? 247  LEU E CB    1 
ATOM   6623  C  CG    . LEU O  3 115 ? -57.520  5.247   -7.124  1.00 51.13  ? 247  LEU E CG    1 
ATOM   6624  C  CD1   . LEU O  3 115 ? -58.977  5.421   -6.713  1.00 51.57  ? 247  LEU E CD1   1 
ATOM   6625  C  CD2   . LEU O  3 115 ? -57.023  6.516   -7.780  1.00 50.84  ? 247  LEU E CD2   1 
ATOM   6626  N  N     . GLU O  3 116 ? -55.523  2.222   -6.453  1.00 58.71  ? 248  GLU E N     1 
ATOM   6627  C  CA    . GLU O  3 116 ? -55.084  1.140   -7.336  1.00 61.77  ? 248  GLU E CA    1 
ATOM   6628  C  C     . GLU O  3 116 ? -55.923  -0.117  -7.140  1.00 61.30  ? 248  GLU E C     1 
ATOM   6629  O  O     . GLU O  3 116 ? -56.417  -0.712  -8.102  1.00 59.76  ? 248  GLU E O     1 
ATOM   6630  C  CB    . GLU O  3 116 ? -53.608  0.805   -7.071  1.00 65.04  ? 248  GLU E CB    1 
ATOM   6631  C  CG    . GLU O  3 116 ? -52.661  1.032   -8.265  1.00 70.60  ? 248  GLU E CG    1 
ATOM   6632  C  CD    . GLU O  3 116 ? -52.843  0.025   -9.406  1.00 73.96  ? 248  GLU E CD    1 
ATOM   6633  O  OE1   . GLU O  3 116 ? -52.648  -1.195  -9.168  1.00 74.41  ? 248  GLU E OE1   1 
ATOM   6634  O  OE2   . GLU O  3 116 ? -53.175  0.462   -10.539 1.00 75.18  ? 248  GLU E OE2   1 
ATOM   6635  N  N     . ARG O  3 117 ? -56.086  -0.516  -5.886  1.00 61.37  ? 249  ARG E N     1 
ATOM   6636  C  CA    . ARG O  3 117 ? -56.852  -1.709  -5.605  1.00 62.02  ? 249  ARG E CA    1 
ATOM   6637  C  C     . ARG O  3 117 ? -58.224  -1.616  -6.257  1.00 60.94  ? 249  ARG E C     1 
ATOM   6638  O  O     . ARG O  3 117 ? -58.562  -2.441  -7.100  1.00 61.98  ? 249  ARG E O     1 
ATOM   6639  C  CB    . ARG O  3 117 ? -56.970  -1.936  -4.094  1.00 63.73  ? 249  ARG E CB    1 
ATOM   6640  C  CG    . ARG O  3 117 ? -58.043  -1.131  -3.408  1.00 68.45  ? 249  ARG E CG    1 
ATOM   6641  C  CD    . ARG O  3 117 ? -57.928  -1.227  -1.897  1.00 72.40  ? 249  ARG E CD    1 
ATOM   6642  N  NE    . ARG O  3 117 ? -59.039  -0.562  -1.220  1.00 75.25  ? 249  ARG E NE    1 
ATOM   6643  C  CZ    . ARG O  3 117 ? -60.285  -1.030  -1.187  1.00 77.45  ? 249  ARG E CZ    1 
ATOM   6644  N  NH1   . ARG O  3 117 ? -60.592  -2.174  -1.793  1.00 78.41  ? 249  ARG E NH1   1 
ATOM   6645  N  NH2   . ARG O  3 117 ? -61.229  -0.353  -0.545  1.00 78.47  ? 249  ARG E NH2   1 
ATOM   6646  N  N     . LEU O  3 118 ? -59.009  -0.608  -5.912  1.00 59.18  ? 250  LEU E N     1 
ATOM   6647  C  CA    . LEU O  3 118 ? -60.325  -0.517  -6.510  1.00 58.79  ? 250  LEU E CA    1 
ATOM   6648  C  C     . LEU O  3 118 ? -60.303  -0.422  -8.035  1.00 59.63  ? 250  LEU E C     1 
ATOM   6649  O  O     . LEU O  3 118 ? -61.245  -0.873  -8.691  1.00 59.35  ? 250  LEU E O     1 
ATOM   6650  C  CB    . LEU O  3 118 ? -61.103  0.658   -5.924  1.00 57.65  ? 250  LEU E CB    1 
ATOM   6651  C  CG    . LEU O  3 118 ? -61.476  0.533   -4.450  1.00 56.36  ? 250  LEU E CG    1 
ATOM   6652  C  CD1   . LEU O  3 118 ? -60.340  1.032   -3.597  1.00 55.74  ? 250  LEU E CD1   1 
ATOM   6653  C  CD2   . LEU O  3 118 ? -62.712  1.355   -4.171  1.00 56.24  ? 250  LEU E CD2   1 
ATOM   6654  N  N     . THR O  3 119 ? -59.239  0.141   -8.608  1.00 60.76  ? 251  THR E N     1 
ATOM   6655  C  CA    . THR O  3 119 ? -59.164  0.274   -10.070 1.00 63.24  ? 251  THR E CA    1 
ATOM   6656  C  C     . THR O  3 119 ? -58.982  -1.080  -10.741 1.00 64.06  ? 251  THR E C     1 
ATOM   6657  O  O     . THR O  3 119 ? -59.006  -1.189  -11.975 1.00 63.13  ? 251  THR E O     1 
ATOM   6658  C  CB    . THR O  3 119 ? -58.000  1.196   -10.531 1.00 64.27  ? 251  THR E CB    1 
ATOM   6659  O  OG1   . THR O  3 119 ? -56.739  0.585   -10.223 1.00 65.60  ? 251  THR E OG1   1 
ATOM   6660  C  CG2   . THR O  3 119 ? -58.091  2.547   -9.849  1.00 64.59  ? 251  THR E CG2   1 
ATOM   6661  N  N     . GLN O  3 120 ? -58.796  -2.106  -9.912  1.00 65.35  ? 252  GLN E N     1 
ATOM   6662  C  CA    . GLN O  3 120 ? -58.613  -3.475  -10.383 1.00 65.51  ? 252  GLN E CA    1 
ATOM   6663  C  C     . GLN O  3 120 ? -59.964  -4.009  -10.846 1.00 64.41  ? 252  GLN E C     1 
ATOM   6664  O  O     . GLN O  3 120 ? -60.926  -4.060  -10.072 1.00 62.77  ? 252  GLN E O     1 
ATOM   6665  C  CB    . GLN O  3 120 ? -58.069  -4.356  -9.250  1.00 66.93  ? 252  GLN E CB    1 
ATOM   6666  C  CG    . GLN O  3 120 ? -56.862  -5.228  -9.612  1.00 69.08  ? 252  GLN E CG    1 
ATOM   6667  C  CD    . GLN O  3 120 ? -55.614  -4.416  -9.918  1.00 70.77  ? 252  GLN E CD    1 
ATOM   6668  O  OE1   . GLN O  3 120 ? -55.418  -3.959  -11.048 1.00 71.62  ? 252  GLN E OE1   1 
ATOM   6669  N  NE2   . GLN O  3 120 ? -54.767  -4.220  -8.904  1.00 70.46  ? 252  GLN E NE2   1 
ATOM   6670  N  N     . GLY O  3 121 ? -60.029  -4.390  -12.117 1.00 63.79  ? 253  GLY E N     1 
ATOM   6671  C  CA    . GLY O  3 121 ? -61.259  -4.916  -12.670 1.00 63.87  ? 253  GLY E CA    1 
ATOM   6672  C  C     . GLY O  3 121 ? -62.289  -3.830  -12.898 1.00 64.07  ? 253  GLY E C     1 
ATOM   6673  O  O     . GLY O  3 121 ? -63.445  -3.970  -12.501 1.00 65.03  ? 253  GLY E O     1 
ATOM   6674  N  N     . MET O  3 122 ? -61.873  -2.750  -13.551 1.00 63.44  ? 254  MET E N     1 
ATOM   6675  C  CA    . MET O  3 122 ? -62.760  -1.627  -13.829 1.00 62.94  ? 254  MET E CA    1 
ATOM   6676  C  C     . MET O  3 122 ? -62.147  -0.751  -14.897 1.00 62.82  ? 254  MET E C     1 
ATOM   6677  O  O     . MET O  3 122 ? -61.021  -0.297  -14.736 1.00 64.18  ? 254  MET E O     1 
ATOM   6678  C  CB    . MET O  3 122 ? -62.944  -0.778  -12.574 1.00 62.97  ? 254  MET E CB    1 
ATOM   6679  C  CG    . MET O  3 122 ? -63.881  -1.353  -11.545 1.00 63.55  ? 254  MET E CG    1 
ATOM   6680  S  SD    . MET O  3 122 ? -65.415  -0.417  -11.470 1.00 63.99  ? 254  MET E SD    1 
ATOM   6681  C  CE    . MET O  3 122 ? -65.920  -0.749  -9.774  1.00 64.58  ? 254  MET E CE    1 
ATOM   6682  N  N     . ASP O  3 123 ? -62.860  -0.506  -15.986 1.00 62.60  ? 255  ASP E N     1 
ATOM   6683  C  CA    . ASP O  3 123 ? -62.305  0.364   -17.012 1.00 63.64  ? 255  ASP E CA    1 
ATOM   6684  C  C     . ASP O  3 123 ? -62.745  1.786   -16.692 1.00 63.38  ? 255  ASP E C     1 
ATOM   6685  O  O     . ASP O  3 123 ? -63.910  2.138   -16.867 1.00 63.25  ? 255  ASP E O     1 
ATOM   6686  C  CB    . ASP O  3 123 ? -62.789  -0.029  -18.412 1.00 65.74  ? 255  ASP E CB    1 
ATOM   6687  C  CG    . ASP O  3 123 ? -62.137  0.814   -19.511 1.00 68.15  ? 255  ASP E CG    1 
ATOM   6688  O  OD1   . ASP O  3 123 ? -60.889  0.936   -19.511 1.00 69.96  ? 255  ASP E OD1   1 
ATOM   6689  O  OD2   . ASP O  3 123 ? -62.863  1.352   -20.375 1.00 67.60  ? 255  ASP E OD2   1 
ATOM   6690  N  N     . ILE O  3 124 ? -61.808  2.596   -16.207 1.00 62.93  ? 256  ILE E N     1 
ATOM   6691  C  CA    . ILE O  3 124 ? -62.101  3.979   -15.854 1.00 61.23  ? 256  ILE E CA    1 
ATOM   6692  C  C     . ILE O  3 124 ? -61.421  4.904   -16.836 1.00 61.91  ? 256  ILE E C     1 
ATOM   6693  O  O     . ILE O  3 124 ? -60.238  4.756   -17.123 1.00 62.86  ? 256  ILE E O     1 
ATOM   6694  C  CB    . ILE O  3 124 ? -61.576  4.337   -14.462 1.00 58.98  ? 256  ILE E CB    1 
ATOM   6695  C  CG1   . ILE O  3 124 ? -61.718  3.149   -13.519 1.00 58.51  ? 256  ILE E CG1   1 
ATOM   6696  C  CG2   . ILE O  3 124 ? -62.340  5.507   -13.922 1.00 58.77  ? 256  ILE E CG2   1 
ATOM   6697  C  CD1   . ILE O  3 124 ? -63.089  2.545   -13.504 1.00 59.05  ? 256  ILE E CD1   1 
ATOM   6698  N  N     . GLN O  3 125 ? -62.168  5.864   -17.351 1.00 62.59  ? 257  GLN E N     1 
ATOM   6699  C  CA    . GLN O  3 125 ? -61.601  6.805   -18.292 1.00 63.87  ? 257  GLN E CA    1 
ATOM   6700  C  C     . GLN O  3 125 ? -61.385  8.105   -17.521 1.00 64.01  ? 257  GLN E C     1 
ATOM   6701  O  O     . GLN O  3 125 ? -62.272  8.957   -17.503 1.00 65.34  ? 257  GLN E O     1 
ATOM   6702  C  CB    . GLN O  3 125 ? -62.579  7.005   -19.454 1.00 65.05  ? 257  GLN E CB    1 
ATOM   6703  C  CG    . GLN O  3 125 ? -61.968  7.627   -20.703 1.00 67.38  ? 257  GLN E CG    1 
ATOM   6704  C  CD    . GLN O  3 125 ? -62.858  7.467   -21.932 1.00 68.47  ? 257  GLN E CD    1 
ATOM   6705  O  OE1   . GLN O  3 125 ? -63.216  6.346   -22.315 1.00 68.02  ? 257  GLN E OE1   1 
ATOM   6706  N  NE2   . GLN O  3 125 ? -63.215  8.589   -22.559 1.00 68.15  ? 257  GLN E NE2   1 
ATOM   6707  N  N     . TRP O  3 126 ? -60.225  8.251   -16.871 1.00 62.71  ? 258  TRP E N     1 
ATOM   6708  C  CA    . TRP O  3 126 ? -59.936  9.462   -16.091 1.00 60.85  ? 258  TRP E CA    1 
ATOM   6709  C  C     . TRP O  3 126 ? -59.860  10.707  -16.965 1.00 62.47  ? 258  TRP E C     1 
ATOM   6710  O  O     . TRP O  3 126 ? -59.262  10.698  -18.037 1.00 62.15  ? 258  TRP E O     1 
ATOM   6711  C  CB    . TRP O  3 126 ? -58.638  9.319   -15.306 1.00 55.74  ? 258  TRP E CB    1 
ATOM   6712  C  CG    . TRP O  3 126 ? -58.599  8.129   -14.414 1.00 51.64  ? 258  TRP E CG    1 
ATOM   6713  C  CD1   . TRP O  3 126 ? -58.261  6.857   -14.764 1.00 49.64  ? 258  TRP E CD1   1 
ATOM   6714  C  CD2   . TRP O  3 126 ? -58.884  8.096   -13.008 1.00 50.95  ? 258  TRP E CD2   1 
ATOM   6715  N  NE1   . TRP O  3 126 ? -58.309  6.032   -13.666 1.00 48.42  ? 258  TRP E NE1   1 
ATOM   6716  C  CE2   . TRP O  3 126 ? -58.691  6.766   -12.574 1.00 49.39  ? 258  TRP E CE2   1 
ATOM   6717  C  CE3   . TRP O  3 126 ? -59.285  9.062   -12.072 1.00 50.58  ? 258  TRP E CE3   1 
ATOM   6718  C  CZ2   . TRP O  3 126 ? -58.883  6.374   -11.238 1.00 48.60  ? 258  TRP E CZ2   1 
ATOM   6719  C  CZ3   . TRP O  3 126 ? -59.475  8.669   -10.738 1.00 49.13  ? 258  TRP E CZ3   1 
ATOM   6720  C  CH2   . TRP O  3 126 ? -59.274  7.336   -10.340 1.00 47.45  ? 258  TRP E CH2   1 
ATOM   6721  N  N     . MET O  3 127 ? -60.469  11.784  -16.490 1.00 65.60  ? 259  MET E N     1 
ATOM   6722  C  CA    . MET O  3 127 ? -60.503  13.029  -17.242 1.00 69.18  ? 259  MET E CA    1 
ATOM   6723  C  C     . MET O  3 127 ? -60.396  14.248  -16.335 1.00 70.64  ? 259  MET E C     1 
ATOM   6724  O  O     . MET O  3 127 ? -61.080  14.343  -15.308 1.00 71.23  ? 259  MET E O     1 
ATOM   6725  C  CB    . MET O  3 127 ? -61.812  13.114  -18.021 1.00 70.96  ? 259  MET E CB    1 
ATOM   6726  C  CG    . MET O  3 127 ? -62.149  11.869  -18.805 1.00 72.56  ? 259  MET E CG    1 
ATOM   6727  S  SD    . MET O  3 127 ? -62.021  12.145  -20.565 1.00 74.93  ? 259  MET E SD    1 
ATOM   6728  C  CE    . MET O  3 127 ? -60.376  11.472  -20.896 1.00 74.53  ? 259  MET E CE    1 
ATOM   6729  N  N     . HIS O  3 128 ? -59.545  15.186  -16.726 1.00 71.63  ? 260  HIS E N     1 
ATOM   6730  C  CA    . HIS O  3 128 ? -59.364  16.401  -15.951 1.00 72.75  ? 260  HIS E CA    1 
ATOM   6731  C  C     . HIS O  3 128 ? -60.314  17.464  -16.475 1.00 74.53  ? 260  HIS E C     1 
ATOM   6732  O  O     . HIS O  3 128 ? -60.611  17.523  -17.672 1.00 74.57  ? 260  HIS E O     1 
ATOM   6733  C  CB    . HIS O  3 128 ? -57.916  16.899  -16.056 1.00 71.22  ? 260  HIS E CB    1 
ATOM   6734  C  CG    . HIS O  3 128 ? -57.706  18.273  -15.499 1.00 69.40  ? 260  HIS E CG    1 
ATOM   6735  N  ND1   . HIS O  3 128 ? -57.715  18.541  -14.147 1.00 69.41  ? 260  HIS E ND1   1 
ATOM   6736  C  CD2   . HIS O  3 128 ? -57.521  19.464  -16.116 1.00 69.18  ? 260  HIS E CD2   1 
ATOM   6737  C  CE1   . HIS O  3 128 ? -57.547  19.837  -13.955 1.00 69.19  ? 260  HIS E CE1   1 
ATOM   6738  N  NE2   . HIS O  3 128 ? -57.427  20.420  -15.134 1.00 69.35  ? 260  HIS E NE2   1 
ATOM   6739  N  N     . VAL O  3 129 ? -60.798  18.289  -15.557 1.00 76.65  ? 261  VAL E N     1 
ATOM   6740  C  CA    . VAL O  3 129 ? -61.701  19.375  -15.883 1.00 78.89  ? 261  VAL E CA    1 
ATOM   6741  C  C     . VAL O  3 129 ? -61.231  20.597  -15.144 1.00 81.18  ? 261  VAL E C     1 
ATOM   6742  O  O     . VAL O  3 129 ? -61.216  20.615  -13.914 1.00 81.44  ? 261  VAL E O     1 
ATOM   6743  C  CB    . VAL O  3 129 ? -63.121  19.078  -15.439 1.00 78.36  ? 261  VAL E CB    1 
ATOM   6744  C  CG1   . VAL O  3 129 ? -63.814  18.249  -16.491 1.00 79.36  ? 261  VAL E CG1   1 
ATOM   6745  C  CG2   . VAL O  3 129 ? -63.098  18.353  -14.106 1.00 77.70  ? 261  VAL E CG2   1 
ATOM   6746  N  N     . PRO O  3 130 ? -60.835  21.640  -15.885 1.00 83.78  ? 262  PRO E N     1 
ATOM   6747  C  CA    . PRO O  3 130 ? -60.354  22.886  -15.289 1.00 86.24  ? 262  PRO E CA    1 
ATOM   6748  C  C     . PRO O  3 130 ? -61.130  23.226  -14.027 1.00 88.07  ? 262  PRO E C     1 
ATOM   6749  O  O     . PRO O  3 130 ? -62.333  22.965  -13.956 1.00 87.93  ? 262  PRO E O     1 
ATOM   6750  C  CB    . PRO O  3 130 ? -60.571  23.898  -16.405 1.00 86.46  ? 262  PRO E CB    1 
ATOM   6751  C  CG    . PRO O  3 130 ? -60.246  23.086  -17.621 1.00 86.13  ? 262  PRO E CG    1 
ATOM   6752  C  CD    . PRO O  3 130 ? -60.973  21.777  -17.346 1.00 84.73  ? 262  PRO E CD    1 
ATOM   6753  N  N     . GLY O  3 131 ? -60.425  23.783  -13.038 1.00 89.93  ? 263  GLY E N     1 
ATOM   6754  C  CA    . GLY O  3 131 ? -61.033  24.156  -11.771 1.00 91.10  ? 263  GLY E CA    1 
ATOM   6755  C  C     . GLY O  3 131 ? -62.410  24.731  -12.003 1.00 91.78  ? 263  GLY E C     1 
ATOM   6756  O  O     . GLY O  3 131 ? -63.350  24.002  -12.320 1.00 92.76  ? 263  GLY E O     1 
ATOM   6757  N  N     . HIS O  3 132 ? -62.570  26.032  -11.843 1.00 91.18  ? 264  HIS E N     1 
ATOM   6758  C  CA    . HIS O  3 132 ? -63.883  26.540  -12.109 1.00 90.38  ? 264  HIS E CA    1 
ATOM   6759  C  C     . HIS O  3 132 ? -63.923  27.319  -13.389 1.00 88.54  ? 264  HIS E C     1 
ATOM   6760  O  O     . HIS O  3 132 ? -63.594  28.497  -13.442 1.00 88.08  ? 264  HIS E O     1 
ATOM   6761  C  CB    . HIS O  3 132 ? -64.429  27.313  -10.910 1.00 92.82  ? 264  HIS E CB    1 
ATOM   6762  C  CG    . HIS O  3 132 ? -65.063  26.418  -9.885  1.00 94.57  ? 264  HIS E CG    1 
ATOM   6763  N  ND1   . HIS O  3 132 ? -65.774  26.892  -8.803  1.00 95.09  ? 264  HIS E ND1   1 
ATOM   6764  C  CD2   . HIS O  3 132 ? -65.096  25.066  -9.793  1.00 94.51  ? 264  HIS E CD2   1 
ATOM   6765  C  CE1   . HIS O  3 132 ? -66.218  25.871  -8.089  1.00 94.86  ? 264  HIS E CE1   1 
ATOM   6766  N  NE2   . HIS O  3 132 ? -65.820  24.753  -8.669  1.00 95.42  ? 264  HIS E NE2   1 
ATOM   6767  N  N     . SER O  3 133 ? -64.292  26.587  -14.435 1.00 87.26  ? 265  SER E N     1 
ATOM   6768  C  CA    . SER O  3 133 ? -64.443  27.111  -15.780 1.00 86.05  ? 265  SER E CA    1 
ATOM   6769  C  C     . SER O  3 133 ? -65.908  26.881  -16.144 1.00 85.08  ? 265  SER E C     1 
ATOM   6770  O  O     . SER O  3 133 ? -66.284  26.864  -17.321 1.00 84.67  ? 265  SER E O     1 
ATOM   6771  C  CB    . SER O  3 133 ? -63.523  26.370  -16.751 1.00 86.23  ? 265  SER E CB    1 
ATOM   6772  O  OG    . SER O  3 133 ? -62.161  26.583  -16.417 1.00 85.55  ? 265  SER E OG    1 
ATOM   6773  N  N     . GLY O  3 134 ? -66.714  26.673  -15.100 1.00 84.04  ? 266  GLY E N     1 
ATOM   6774  C  CA    . GLY O  3 134 ? -68.149  26.483  -15.242 1.00 81.86  ? 266  GLY E CA    1 
ATOM   6775  C  C     . GLY O  3 134 ? -68.693  25.149  -15.710 1.00 80.23  ? 266  GLY E C     1 
ATOM   6776  O  O     . GLY O  3 134 ? -69.289  25.065  -16.780 1.00 80.74  ? 266  GLY E O     1 
ATOM   6777  N  N     . PHE O  3 135 ? -68.511  24.104  -14.915 1.00 78.20  ? 267  PHE E N     1 
ATOM   6778  C  CA    . PHE O  3 135 ? -69.025  22.793  -15.284 1.00 75.92  ? 267  PHE E CA    1 
ATOM   6779  C  C     . PHE O  3 135 ? -69.861  22.310  -14.113 1.00 73.86  ? 267  PHE E C     1 
ATOM   6780  O  O     . PHE O  3 135 ? -69.330  21.994  -13.050 1.00 74.77  ? 267  PHE E O     1 
ATOM   6781  C  CB    . PHE O  3 135 ? -67.866  21.841  -15.559 1.00 76.81  ? 267  PHE E CB    1 
ATOM   6782  C  CG    . PHE O  3 135 ? -66.885  22.369  -16.569 1.00 77.96  ? 267  PHE E CG    1 
ATOM   6783  C  CD1   . PHE O  3 135 ? -67.244  22.506  -17.908 1.00 77.69  ? 267  PHE E CD1   1 
ATOM   6784  C  CD2   . PHE O  3 135 ? -65.601  22.739  -16.180 1.00 79.01  ? 267  PHE E CD2   1 
ATOM   6785  C  CE1   . PHE O  3 135 ? -66.341  23.008  -18.842 1.00 77.39  ? 267  PHE E CE1   1 
ATOM   6786  C  CE2   . PHE O  3 135 ? -64.688  23.242  -17.110 1.00 78.92  ? 267  PHE E CE2   1 
ATOM   6787  C  CZ    . PHE O  3 135 ? -65.060  23.374  -18.442 1.00 78.12  ? 267  PHE E CZ    1 
ATOM   6788  N  N     . ILE O  3 136 ? -71.173  22.280  -14.307 1.00 70.71  ? 268  ILE E N     1 
ATOM   6789  C  CA    . ILE O  3 136 ? -72.088  21.873  -13.255 1.00 67.38  ? 268  ILE E CA    1 
ATOM   6790  C  C     . ILE O  3 136 ? -71.491  20.768  -12.389 1.00 65.22  ? 268  ILE E C     1 
ATOM   6791  O  O     . ILE O  3 136 ? -71.431  20.897  -11.165 1.00 64.30  ? 268  ILE E O     1 
ATOM   6792  C  CB    . ILE O  3 136 ? -73.430  21.407  -13.848 1.00 67.60  ? 268  ILE E CB    1 
ATOM   6793  C  CG1   . ILE O  3 136 ? -73.980  22.468  -14.798 1.00 67.64  ? 268  ILE E CG1   1 
ATOM   6794  C  CG2   . ILE O  3 136 ? -74.446  21.210  -12.739 1.00 68.88  ? 268  ILE E CG2   1 
ATOM   6795  C  CD1   . ILE O  3 136 ? -74.280  23.796  -14.124 1.00 68.70  ? 268  ILE E CD1   1 
ATOM   6796  N  N     . GLY O  3 137 ? -71.033  19.696  -13.030 1.00 63.47  ? 269  GLY E N     1 
ATOM   6797  C  CA    . GLY O  3 137 ? -70.444  18.587  -12.296 1.00 61.30  ? 269  GLY E CA    1 
ATOM   6798  C  C     . GLY O  3 137 ? -69.453  19.025  -11.228 1.00 59.39  ? 269  GLY E C     1 
ATOM   6799  O  O     . GLY O  3 137 ? -69.724  18.884  -10.032 1.00 59.89  ? 269  GLY E O     1 
ATOM   6800  N  N     . ASN O  3 138 ? -68.311  19.559  -11.659 1.00 56.21  ? 270  ASN E N     1 
ATOM   6801  C  CA    . ASN O  3 138 ? -67.282  20.019  -10.740 1.00 53.03  ? 270  ASN E CA    1 
ATOM   6802  C  C     . ASN O  3 138 ? -67.862  20.969  -9.707  1.00 52.47  ? 270  ASN E C     1 
ATOM   6803  O  O     . ASN O  3 138 ? -67.479  20.925  -8.537  1.00 52.44  ? 270  ASN E O     1 
ATOM   6804  C  CB    . ASN O  3 138 ? -66.157  20.725  -11.487 1.00 51.69  ? 270  ASN E CB    1 
ATOM   6805  C  CG    . ASN O  3 138 ? -64.947  20.958  -10.609 1.00 51.12  ? 270  ASN E CG    1 
ATOM   6806  O  OD1   . ASN O  3 138 ? -64.386  22.053  -10.571 1.00 52.25  ? 270  ASN E OD1   1 
ATOM   6807  N  ND2   . ASN O  3 138 ? -64.537  19.923  -9.893  1.00 49.37  ? 270  ASN E ND2   1 
ATOM   6808  N  N     . GLU O  3 139 ? -68.781  21.831  -10.128 1.00 51.60  ? 271  GLU E N     1 
ATOM   6809  C  CA    . GLU O  3 139 ? -69.389  22.760  -9.181  1.00 51.12  ? 271  GLU E CA    1 
ATOM   6810  C  C     . GLU O  3 139 ? -70.070  21.989  -8.062  1.00 47.25  ? 271  GLU E C     1 
ATOM   6811  O  O     . GLU O  3 139 ? -69.746  22.157  -6.889  1.00 44.69  ? 271  GLU E O     1 
ATOM   6812  C  CB    . GLU O  3 139 ? -70.429  23.661  -9.858  1.00 55.93  ? 271  GLU E CB    1 
ATOM   6813  C  CG    . GLU O  3 139 ? -69.892  24.570  -10.971 1.00 62.32  ? 271  GLU E CG    1 
ATOM   6814  C  CD    . GLU O  3 139 ? -70.715  25.863  -11.152 1.00 65.82  ? 271  GLU E CD    1 
ATOM   6815  O  OE1   . GLU O  3 139 ? -71.955  25.853  -10.924 1.00 66.06  ? 271  GLU E OE1   1 
ATOM   6816  O  OE2   . GLU O  3 139 ? -70.108  26.892  -11.536 1.00 67.73  ? 271  GLU E OE2   1 
ATOM   6817  N  N     . GLU O  3 140 ? -71.012  21.134  -8.439  1.00 44.81  ? 272  GLU E N     1 
ATOM   6818  C  CA    . GLU O  3 140 ? -71.754  20.355  -7.465  1.00 43.86  ? 272  GLU E CA    1 
ATOM   6819  C  C     . GLU O  3 140 ? -70.870  19.511  -6.572  1.00 44.21  ? 272  GLU E C     1 
ATOM   6820  O  O     . GLU O  3 140 ? -71.052  19.497  -5.361  1.00 45.33  ? 272  GLU E O     1 
ATOM   6821  C  CB    . GLU O  3 140 ? -72.796  19.479  -8.163  1.00 42.77  ? 272  GLU E CB    1 
ATOM   6822  C  CG    . GLU O  3 140 ? -73.968  20.276  -8.751  1.00 41.56  ? 272  GLU E CG    1 
ATOM   6823  C  CD    . GLU O  3 140 ? -74.823  20.986  -7.697  1.00 40.09  ? 272  GLU E CD    1 
ATOM   6824  O  OE1   . GLU O  3 140 ? -75.733  20.342  -7.127  1.00 40.72  ? 272  GLU E OE1   1 
ATOM   6825  O  OE2   . GLU O  3 140 ? -74.583  22.186  -7.438  1.00 37.18  ? 272  GLU E OE2   1 
ATOM   6826  N  N     . ALA O  3 141 ? -69.908  18.806  -7.151  1.00 44.84  ? 273  ALA E N     1 
ATOM   6827  C  CA    . ALA O  3 141 ? -69.017  17.982  -6.337  1.00 45.01  ? 273  ALA E CA    1 
ATOM   6828  C  C     . ALA O  3 141 ? -68.256  18.871  -5.360  1.00 45.03  ? 273  ALA E C     1 
ATOM   6829  O  O     . ALA O  3 141 ? -68.195  18.592  -4.163  1.00 43.48  ? 273  ALA E O     1 
ATOM   6830  C  CB    . ALA O  3 141 ? -68.052  17.235  -7.218  1.00 46.29  ? 273  ALA E CB    1 
ATOM   6831  N  N     . ASP O  3 142 ? -67.673  19.940  -5.893  1.00 45.39  ? 274  ASP E N     1 
ATOM   6832  C  CA    . ASP O  3 142 ? -66.936  20.907  -5.093  1.00 46.88  ? 274  ASP E CA    1 
ATOM   6833  C  C     . ASP O  3 142 ? -67.824  21.241  -3.898  1.00 46.41  ? 274  ASP E C     1 
ATOM   6834  O  O     . ASP O  3 142 ? -67.379  21.257  -2.748  1.00 45.22  ? 274  ASP E O     1 
ATOM   6835  C  CB    . ASP O  3 142 ? -66.684  22.168  -5.935  1.00 50.35  ? 274  ASP E CB    1 
ATOM   6836  C  CG    . ASP O  3 142 ? -65.887  23.247  -5.192  1.00 53.67  ? 274  ASP E CG    1 
ATOM   6837  O  OD1   . ASP O  3 142 ? -64.657  23.081  -5.032  1.00 55.40  ? 274  ASP E OD1   1 
ATOM   6838  O  OD2   . ASP O  3 142 ? -66.491  24.269  -4.779  1.00 54.00  ? 274  ASP E OD2   1 
ATOM   6839  N  N     . ARG O  3 143 ? -69.094  21.497  -4.196  1.00 46.29  ? 275  ARG E N     1 
ATOM   6840  C  CA    . ARG O  3 143 ? -70.084  21.836  -3.189  1.00 45.96  ? 275  ARG E CA    1 
ATOM   6841  C  C     . ARG O  3 143 ? -70.145  20.778  -2.105  1.00 43.98  ? 275  ARG E C     1 
ATOM   6842  O  O     . ARG O  3 143 ? -69.888  21.055  -0.938  1.00 44.07  ? 275  ARG E O     1 
ATOM   6843  C  CB    . ARG O  3 143 ? -71.449  21.990  -3.857  1.00 49.96  ? 275  ARG E CB    1 
ATOM   6844  C  CG    . ARG O  3 143 ? -72.648  21.907  -2.921  1.00 56.69  ? 275  ARG E CG    1 
ATOM   6845  C  CD    . ARG O  3 143 ? -73.895  22.473  -3.602  1.00 61.47  ? 275  ARG E CD    1 
ATOM   6846  N  NE    . ARG O  3 143 ? -73.675  23.860  -4.024  1.00 67.19  ? 275  ARG E NE    1 
ATOM   6847  C  CZ    . ARG O  3 143 ? -73.382  24.862  -3.194  1.00 69.10  ? 275  ARG E CZ    1 
ATOM   6848  N  NH1   . ARG O  3 143 ? -73.278  24.644  -1.886  1.00 71.09  ? 275  ARG E NH1   1 
ATOM   6849  N  NH2   . ARG O  3 143 ? -73.171  26.082  -3.669  1.00 69.66  ? 275  ARG E NH2   1 
ATOM   6850  N  N     . LEU O  3 144 ? -70.477  19.559  -2.502  1.00 41.66  ? 276  LEU E N     1 
ATOM   6851  C  CA    . LEU O  3 144 ? -70.580  18.456  -1.564  1.00 40.53  ? 276  LEU E CA    1 
ATOM   6852  C  C     . LEU O  3 144 ? -69.312  18.275  -0.723  1.00 40.81  ? 276  LEU E C     1 
ATOM   6853  O  O     . LEU O  3 144 ? -69.374  17.911  0.456   1.00 40.12  ? 276  LEU E O     1 
ATOM   6854  C  CB    . LEU O  3 144 ? -70.882  17.172  -2.331  1.00 39.55  ? 276  LEU E CB    1 
ATOM   6855  C  CG    . LEU O  3 144 ? -72.208  17.124  -3.083  1.00 36.10  ? 276  LEU E CG    1 
ATOM   6856  C  CD1   . LEU O  3 144 ? -72.229  15.926  -4.000  1.00 34.63  ? 276  LEU E CD1   1 
ATOM   6857  C  CD2   . LEU O  3 144 ? -73.347  17.057  -2.087  1.00 37.42  ? 276  LEU E CD2   1 
ATOM   6858  N  N     . ALA O  3 145 ? -68.161  18.523  -1.336  1.00 40.77  ? 277  ALA E N     1 
ATOM   6859  C  CA    . ALA O  3 145 ? -66.897  18.389  -0.630  1.00 40.16  ? 277  ALA E CA    1 
ATOM   6860  C  C     . ALA O  3 145 ? -66.861  19.359  0.536   1.00 40.04  ? 277  ALA E C     1 
ATOM   6861  O  O     . ALA O  3 145 ? -66.513  18.976  1.653   1.00 39.76  ? 277  ALA E O     1 
ATOM   6862  C  CB    . ALA O  3 145 ? -65.737  18.664  -1.569  1.00 41.41  ? 277  ALA E CB    1 
ATOM   6863  N  N     . ARG O  3 146 ? -67.212  20.618  0.283   1.00 39.47  ? 278  ARG E N     1 
ATOM   6864  C  CA    . ARG O  3 146 ? -67.203  21.593  1.360   1.00 40.00  ? 278  ARG E CA    1 
ATOM   6865  C  C     . ARG O  3 146 ? -68.102  21.049  2.420   1.00 39.63  ? 278  ARG E C     1 
ATOM   6866  O  O     . ARG O  3 146 ? -67.787  21.132  3.600   1.00 40.30  ? 278  ARG E O     1 
ATOM   6867  C  CB    . ARG O  3 146 ? -67.729  22.942  0.910   1.00 42.69  ? 278  ARG E CB    1 
ATOM   6868  C  CG    . ARG O  3 146 ? -66.947  23.543  -0.220  1.00 47.77  ? 278  ARG E CG    1 
ATOM   6869  C  CD    . ARG O  3 146 ? -66.578  24.978  0.059   1.00 50.73  ? 278  ARG E CD    1 
ATOM   6870  N  NE    . ARG O  3 146 ? -66.097  25.613  -1.160  1.00 57.54  ? 278  ARG E NE    1 
ATOM   6871  C  CZ    . ARG O  3 146 ? -65.110  25.135  -1.915  1.00 60.74  ? 278  ARG E CZ    1 
ATOM   6872  N  NH1   . ARG O  3 146 ? -64.491  24.010  -1.571  1.00 62.70  ? 278  ARG E NH1   1 
ATOM   6873  N  NH2   . ARG O  3 146 ? -64.747  25.773  -3.025  1.00 62.63  ? 278  ARG E NH2   1 
ATOM   6874  N  N     . GLU O  3 147 ? -69.222  20.478  1.986   1.00 39.96  ? 279  GLU E N     1 
ATOM   6875  C  CA    . GLU O  3 147 ? -70.185  19.889  2.902   1.00 40.40  ? 279  GLU E CA    1 
ATOM   6876  C  C     . GLU O  3 147 ? -69.547  18.747  3.655   1.00 39.52  ? 279  GLU E C     1 
ATOM   6877  O  O     . GLU O  3 147 ? -70.058  18.326  4.691   1.00 38.95  ? 279  GLU E O     1 
ATOM   6878  C  CB    . GLU O  3 147 ? -71.413  19.393  2.152   1.00 42.92  ? 279  GLU E CB    1 
ATOM   6879  C  CG    . GLU O  3 147 ? -72.373  20.511  1.778   1.00 50.76  ? 279  GLU E CG    1 
ATOM   6880  C  CD    . GLU O  3 147 ? -72.922  21.277  2.998   1.00 55.19  ? 279  GLU E CD    1 
ATOM   6881  O  OE1   . GLU O  3 147 ? -73.630  22.293  2.799   1.00 58.71  ? 279  GLU E OE1   1 
ATOM   6882  O  OE2   . GLU O  3 147 ? -72.657  20.869  4.153   1.00 57.32  ? 279  GLU E OE2   1 
ATOM   6883  N  N     . GLY O  3 148 ? -68.429  18.251  3.120   1.00 39.28  ? 280  GLY E N     1 
ATOM   6884  C  CA    . GLY O  3 148 ? -67.689  17.174  3.758   1.00 37.81  ? 280  GLY E CA    1 
ATOM   6885  C  C     . GLY O  3 148 ? -67.132  17.704  5.063   1.00 37.21  ? 280  GLY E C     1 
ATOM   6886  O  O     . GLY O  3 148 ? -67.233  17.047  6.103   1.00 36.01  ? 280  GLY E O     1 
ATOM   6887  N  N     . ALA O  3 149 ? -66.541  18.897  5.002   1.00 36.23  ? 281  ALA E N     1 
ATOM   6888  C  CA    . ALA O  3 149 ? -66.011  19.543  6.189   1.00 37.32  ? 281  ALA E CA    1 
ATOM   6889  C  C     . ALA O  3 149 ? -67.191  20.190  6.900   1.00 39.99  ? 281  ALA E C     1 
ATOM   6890  O  O     . ALA O  3 149 ? -68.238  19.563  7.069   1.00 41.06  ? 281  ALA E O     1 
ATOM   6891  C  CB    . ALA O  3 149 ? -65.021  20.585  5.805   1.00 36.98  ? 281  ALA E CB    1 
ATOM   6892  N  N     . LYS O  3 150 ? -67.034  21.445  7.306   1.00 42.52  ? 282  LYS E N     1 
ATOM   6893  C  CA    . LYS O  3 150 ? -68.108  22.163  7.993   1.00 46.19  ? 282  LYS E CA    1 
ATOM   6894  C  C     . LYS O  3 150 ? -68.193  21.771  9.466   1.00 49.22  ? 282  LYS E C     1 
ATOM   6895  O  O     . LYS O  3 150 ? -67.985  20.611  9.817   1.00 49.36  ? 282  LYS E O     1 
ATOM   6896  C  CB    . LYS O  3 150 ? -69.451  21.890  7.303   1.00 44.24  ? 282  LYS E CB    1 
ATOM   6897  N  N     . GLN O  3 151 ? -68.507  22.736  10.328  1.00 53.25  ? 283  GLN E N     1 
ATOM   6898  C  CA    . GLN O  3 151 ? -68.617  22.459  11.762  1.00 57.96  ? 283  GLN E CA    1 
ATOM   6899  C  C     . GLN O  3 151 ? -70.052  22.657  12.315  1.00 60.20  ? 283  GLN E C     1 
ATOM   6900  O  O     . GLN O  3 151 ? -70.224  22.852  13.549  1.00 61.62  ? 283  GLN E O     1 
ATOM   6901  C  CB    . GLN O  3 151 ? -67.612  23.340  12.532  1.00 58.16  ? 283  GLN E CB    1 
ATOM   6902  N  N     . GLY P  3 1   ? -47.000  73.313  10.602  1.00 84.29  ? 133  GLY F N     1 
ATOM   6903  C  CA    . GLY P  3 1   ? -48.166  74.227  10.791  1.00 85.15  ? 133  GLY F CA    1 
ATOM   6904  C  C     . GLY P  3 1   ? -48.687  74.827  9.494   1.00 85.53  ? 133  GLY F C     1 
ATOM   6905  O  O     . GLY P  3 1   ? -48.744  74.131  8.483   1.00 85.75  ? 133  GLY F O     1 
ATOM   6906  N  N     . SER P  3 2   ? -49.070  76.108  9.534   1.00 85.29  ? 134  SER F N     1 
ATOM   6907  C  CA    . SER P  3 2   ? -49.589  76.856  8.372   1.00 84.31  ? 134  SER F CA    1 
ATOM   6908  C  C     . SER P  3 2   ? -49.752  75.977  7.131   1.00 83.01  ? 134  SER F C     1 
ATOM   6909  O  O     . SER P  3 2   ? -50.678  75.174  7.059   1.00 82.63  ? 134  SER F O     1 
ATOM   6910  C  CB    . SER P  3 2   ? -48.657  78.031  8.061   1.00 85.71  ? 134  SER F CB    1 
ATOM   6911  N  N     . HIS P  3 3   ? -48.878  76.165  6.145   1.00 80.65  ? 135  HIS F N     1 
ATOM   6912  C  CA    . HIS P  3 3   ? -48.876  75.336  4.947   1.00 79.25  ? 135  HIS F CA    1 
ATOM   6913  C  C     . HIS P  3 3   ? -49.816  75.522  3.765   1.00 77.72  ? 135  HIS F C     1 
ATOM   6914  O  O     . HIS P  3 3   ? -51.030  75.647  3.892   1.00 76.72  ? 135  HIS F O     1 
ATOM   6915  C  CB    . HIS P  3 3   ? -48.937  73.877  5.370   1.00 81.11  ? 135  HIS F CB    1 
ATOM   6916  C  CG    . HIS P  3 3   ? -47.681  73.390  6.011   1.00 82.67  ? 135  HIS F CG    1 
ATOM   6917  N  ND1   . HIS P  3 3   ? -47.679  72.481  7.046   1.00 83.50  ? 135  HIS F ND1   1 
ATOM   6918  C  CD2   . HIS P  3 3   ? -46.383  73.665  5.748   1.00 84.26  ? 135  HIS F CD2   1 
ATOM   6919  C  CE1   . HIS P  3 3   ? -46.432  72.216  7.393   1.00 85.14  ? 135  HIS F CE1   1 
ATOM   6920  N  NE2   . HIS P  3 3   ? -45.626  72.921  6.619   1.00 85.87  ? 135  HIS F NE2   1 
ATOM   6921  N  N     . MET P  3 4   ? -49.165  75.470  2.610   1.00 76.49  ? 136  MET F N     1 
ATOM   6922  C  CA    . MET P  3 4   ? -49.677  75.575  1.239   1.00 77.05  ? 136  MET F CA    1 
ATOM   6923  C  C     . MET P  3 4   ? -51.176  75.520  0.870   1.00 74.74  ? 136  MET F C     1 
ATOM   6924  O  O     . MET P  3 4   ? -51.941  76.433  1.172   1.00 72.70  ? 136  MET F O     1 
ATOM   6925  C  CB    . MET P  3 4   ? -48.924  74.524  0.407   1.00 79.90  ? 136  MET F CB    1 
ATOM   6926  C  CG    . MET P  3 4   ? -47.753  73.834  1.154   1.00 83.04  ? 136  MET F CG    1 
ATOM   6927  S  SD    . MET P  3 4   ? -48.195  72.842  2.652   1.00 86.13  ? 136  MET F SD    1 
ATOM   6928  C  CE    . MET P  3 4   ? -48.048  71.153  2.036   1.00 84.83  ? 136  MET F CE    1 
ATOM   6929  N  N     . GLY P  3 5   ? -51.548  74.458  0.148   1.00 73.70  ? 137  GLY F N     1 
ATOM   6930  C  CA    . GLY P  3 5   ? -52.919  74.237  -0.290  1.00 72.50  ? 137  GLY F CA    1 
ATOM   6931  C  C     . GLY P  3 5   ? -53.107  74.151  -1.803  1.00 71.81  ? 137  GLY F C     1 
ATOM   6932  O  O     . GLY P  3 5   ? -53.091  75.186  -2.471  1.00 72.95  ? 137  GLY F O     1 
ATOM   6933  N  N     . ASP P  3 6   ? -53.291  72.943  -2.351  1.00 69.55  ? 138  ASP F N     1 
ATOM   6934  C  CA    . ASP P  3 6   ? -53.492  72.768  -3.803  1.00 67.12  ? 138  ASP F CA    1 
ATOM   6935  C  C     . ASP P  3 6   ? -53.611  71.328  -4.328  1.00 64.77  ? 138  ASP F C     1 
ATOM   6936  O  O     . ASP P  3 6   ? -52.770  70.486  -4.016  1.00 65.96  ? 138  ASP F O     1 
ATOM   6937  C  CB    . ASP P  3 6   ? -52.360  73.419  -4.590  1.00 67.83  ? 138  ASP F CB    1 
ATOM   6938  C  CG    . ASP P  3 6   ? -52.297  72.914  -6.021  1.00 68.42  ? 138  ASP F CG    1 
ATOM   6939  O  OD1   . ASP P  3 6   ? -53.014  73.458  -6.889  1.00 68.67  ? 138  ASP F OD1   1 
ATOM   6940  O  OD2   . ASP P  3 6   ? -51.545  71.948  -6.270  1.00 69.45  ? 138  ASP F OD2   1 
ATOM   6941  N  N     . PHE P  3 7   ? -54.629  71.086  -5.160  1.00 60.39  ? 139  PHE F N     1 
ATOM   6942  C  CA    . PHE P  3 7   ? -54.929  69.791  -5.801  1.00 54.75  ? 139  PHE F CA    1 
ATOM   6943  C  C     . PHE P  3 7   ? -56.428  69.749  -6.040  1.00 51.79  ? 139  PHE F C     1 
ATOM   6944  O  O     . PHE P  3 7   ? -57.166  70.534  -5.457  1.00 52.70  ? 139  PHE F O     1 
ATOM   6945  C  CB    . PHE P  3 7   ? -54.562  68.607  -4.914  1.00 53.14  ? 139  PHE F CB    1 
ATOM   6946  C  CG    . PHE P  3 7   ? -55.262  68.608  -3.599  1.00 52.63  ? 139  PHE F CG    1 
ATOM   6947  C  CD1   . PHE P  3 7   ? -54.680  69.202  -2.489  1.00 53.26  ? 139  PHE F CD1   1 
ATOM   6948  C  CD2   . PHE P  3 7   ? -56.524  68.049  -3.473  1.00 54.26  ? 139  PHE F CD2   1 
ATOM   6949  C  CE1   . PHE P  3 7   ? -55.342  69.244  -1.272  1.00 55.14  ? 139  PHE F CE1   1 
ATOM   6950  C  CE2   . PHE P  3 7   ? -57.203  68.082  -2.257  1.00 55.07  ? 139  PHE F CE2   1 
ATOM   6951  C  CZ    . PHE P  3 7   ? -56.610  68.683  -1.153  1.00 55.87  ? 139  PHE F CZ    1 
ATOM   6952  N  N     . VAL P  3 8   ? -56.891  68.836  -6.881  1.00 47.64  ? 140  VAL F N     1 
ATOM   6953  C  CA    . VAL P  3 8   ? -58.324  68.745  -7.143  1.00 43.82  ? 140  VAL F CA    1 
ATOM   6954  C  C     . VAL P  3 8   ? -58.882  67.360  -6.763  1.00 42.03  ? 140  VAL F C     1 
ATOM   6955  O  O     . VAL P  3 8   ? -58.274  66.330  -7.053  1.00 42.10  ? 140  VAL F O     1 
ATOM   6956  C  CB    . VAL P  3 8   ? -58.607  69.073  -8.618  1.00 42.14  ? 140  VAL F CB    1 
ATOM   6957  C  CG1   . VAL P  3 8   ? -57.481  68.572  -9.458  1.00 42.43  ? 140  VAL F CG1   1 
ATOM   6958  C  CG2   . VAL P  3 8   ? -59.903  68.443  -9.069  1.00 41.51  ? 140  VAL F CG2   1 
ATOM   6959  N  N     . VAL P  3 9   ? -60.036  67.344  -6.103  1.00 38.59  ? 141  VAL F N     1 
ATOM   6960  C  CA    . VAL P  3 9   ? -60.654  66.096  -5.664  1.00 35.21  ? 141  VAL F CA    1 
ATOM   6961  C  C     . VAL P  3 9   ? -61.554  65.491  -6.720  1.00 34.70  ? 141  VAL F C     1 
ATOM   6962  O  O     . VAL P  3 9   ? -61.951  66.174  -7.653  1.00 36.41  ? 141  VAL F O     1 
ATOM   6963  C  CB    . VAL P  3 9   ? -61.516  66.334  -4.449  1.00 33.96  ? 141  VAL F CB    1 
ATOM   6964  C  CG1   . VAL P  3 9   ? -61.940  65.008  -3.859  1.00 33.17  ? 141  VAL F CG1   1 
ATOM   6965  C  CG2   . VAL P  3 9   ? -60.770  67.201  -3.457  1.00 33.68  ? 141  VAL F CG2   1 
ATOM   6966  N  N     . VAL P  3 10  ? -61.887  64.213  -6.576  1.00 33.03  ? 142  VAL F N     1 
ATOM   6967  C  CA    . VAL P  3 10  ? -62.776  63.557  -7.534  1.00 31.59  ? 142  VAL F CA    1 
ATOM   6968  C  C     . VAL P  3 10  ? -63.239  62.195  -7.018  1.00 32.00  ? 142  VAL F C     1 
ATOM   6969  O  O     . VAL P  3 10  ? -62.444  61.394  -6.533  1.00 32.23  ? 142  VAL F O     1 
ATOM   6970  C  CB    . VAL P  3 10  ? -62.098  63.379  -8.933  1.00 29.45  ? 142  VAL F CB    1 
ATOM   6971  C  CG1   . VAL P  3 10  ? -61.236  62.130  -8.951  1.00 30.49  ? 142  VAL F CG1   1 
ATOM   6972  C  CG2   . VAL P  3 10  ? -63.145  63.314  -10.025 1.00 25.99  ? 142  VAL F CG2   1 
ATOM   6973  N  N     . TYR P  3 11  ? -64.535  61.936  -7.117  1.00 32.07  ? 143  TYR F N     1 
ATOM   6974  C  CA    . TYR P  3 11  ? -65.082  60.669  -6.663  1.00 32.61  ? 143  TYR F CA    1 
ATOM   6975  C  C     . TYR P  3 11  ? -65.429  59.758  -7.850  1.00 33.83  ? 143  TYR F C     1 
ATOM   6976  O  O     . TYR P  3 11  ? -66.096  60.193  -8.794  1.00 33.90  ? 143  TYR F O     1 
ATOM   6977  C  CB    . TYR P  3 11  ? -66.319  60.942  -5.810  1.00 30.90  ? 143  TYR F CB    1 
ATOM   6978  C  CG    . TYR P  3 11  ? -66.005  61.593  -4.483  1.00 31.47  ? 143  TYR F CG    1 
ATOM   6979  C  CD1   . TYR P  3 11  ? -65.986  60.851  -3.301  1.00 31.18  ? 143  TYR F CD1   1 
ATOM   6980  C  CD2   . TYR P  3 11  ? -65.710  62.950  -4.407  1.00 32.71  ? 143  TYR F CD2   1 
ATOM   6981  C  CE1   . TYR P  3 11  ? -65.679  61.448  -2.067  1.00 30.61  ? 143  TYR F CE1   1 
ATOM   6982  C  CE2   . TYR P  3 11  ? -65.401  63.558  -3.176  1.00 32.62  ? 143  TYR F CE2   1 
ATOM   6983  C  CZ    . TYR P  3 11  ? -65.387  62.803  -2.013  1.00 30.85  ? 143  TYR F CZ    1 
ATOM   6984  O  OH    . TYR P  3 11  ? -65.072  63.406  -0.812  1.00 28.63  ? 143  TYR F OH    1 
ATOM   6985  N  N     . THR P  3 12  ? -64.957  58.508  -7.813  1.00 34.22  ? 144  THR F N     1 
ATOM   6986  C  CA    . THR P  3 12  ? -65.243  57.549  -8.883  1.00 36.15  ? 144  THR F CA    1 
ATOM   6987  C  C     . THR P  3 12  ? -65.978  56.345  -8.361  1.00 37.80  ? 144  THR F C     1 
ATOM   6988  O  O     . THR P  3 12  ? -65.948  56.040  -7.168  1.00 39.53  ? 144  THR F O     1 
ATOM   6989  C  CB    . THR P  3 12  ? -63.982  56.971  -9.566  1.00 36.21  ? 144  THR F CB    1 
ATOM   6990  O  OG1   . THR P  3 12  ? -63.246  56.189  -8.623  1.00 35.41  ? 144  THR F OG1   1 
ATOM   6991  C  CG2   . THR P  3 12  ? -63.103  58.068  -10.108 1.00 38.18  ? 144  THR F CG2   1 
ATOM   6992  N  N     . ASP P  3 13  ? -66.621  55.640  -9.275  1.00 39.61  ? 145  ASP F N     1 
ATOM   6993  C  CA    . ASP P  3 13  ? -67.356  54.448  -8.910  1.00 41.53  ? 145  ASP F CA    1 
ATOM   6994  C  C     . ASP P  3 13  ? -67.932  53.775  -10.143 1.00 42.73  ? 145  ASP F C     1 
ATOM   6995  O  O     . ASP P  3 13  ? -68.493  54.420  -11.032 1.00 43.05  ? 145  ASP F O     1 
ATOM   6996  C  CB    . ASP P  3 13  ? -68.481  54.777  -7.934  1.00 41.45  ? 145  ASP F CB    1 
ATOM   6997  C  CG    . ASP P  3 13  ? -69.182  53.542  -7.439  1.00 43.81  ? 145  ASP F CG    1 
ATOM   6998  O  OD1   . ASP P  3 13  ? -68.624  52.868  -6.543  1.00 45.85  ? 145  ASP F OD1   1 
ATOM   6999  O  OD2   . ASP P  3 13  ? -70.281  53.230  -7.957  1.00 45.27  ? 145  ASP F OD2   1 
ATOM   7000  N  N     . GLY P  3 14  ? -67.760  52.463  -10.194 1.00 43.99  ? 146  GLY F N     1 
ATOM   7001  C  CA    . GLY P  3 14  ? -68.265  51.689  -11.302 1.00 44.73  ? 146  GLY F CA    1 
ATOM   7002  C  C     . GLY P  3 14  ? -69.091  50.591  -10.690 1.00 45.81  ? 146  GLY F C     1 
ATOM   7003  O  O     . GLY P  3 14  ? -68.605  49.800  -9.899  1.00 45.59  ? 146  GLY F O     1 
ATOM   7004  N  N     . CYS P  3 15  ? -70.364  50.558  -11.018 1.00 47.78  ? 147  CYS F N     1 
ATOM   7005  C  CA    . CYS P  3 15  ? -71.204  49.519  -10.482 1.00 49.94  ? 147  CYS F CA    1 
ATOM   7006  C  C     . CYS P  3 15  ? -71.297  48.456  -11.556 1.00 51.67  ? 147  CYS F C     1 
ATOM   7007  O  O     . CYS P  3 15  ? -70.770  48.622  -12.656 1.00 49.76  ? 147  CYS F O     1 
ATOM   7008  C  CB    . CYS P  3 15  ? -72.585  50.073  -10.176 1.00 49.93  ? 147  CYS F CB    1 
ATOM   7009  S  SG    . CYS P  3 15  ? -73.419  50.703  -11.638 1.00 50.66  ? 147  CYS F SG    1 
ATOM   7010  N  N     . CYS P  3 16  ? -71.977  47.369  -11.227 1.00 55.74  ? 148  CYS F N     1 
ATOM   7011  C  CA    . CYS P  3 16  ? -72.162  46.263  -12.149 1.00 60.29  ? 148  CYS F CA    1 
ATOM   7012  C  C     . CYS P  3 16  ? -72.948  45.194  -11.438 1.00 63.91  ? 148  CYS F C     1 
ATOM   7013  O  O     . CYS P  3 16  ? -72.510  44.694  -10.411 1.00 63.50  ? 148  CYS F O     1 
ATOM   7014  C  CB    . CYS P  3 16  ? -70.820  45.684  -12.570 1.00 59.95  ? 148  CYS F CB    1 
ATOM   7015  S  SG    . CYS P  3 16  ? -70.955  44.173  -13.535 1.00 59.90  ? 148  CYS F SG    1 
ATOM   7016  N  N     . SER P  3 17  ? -74.111  44.841  -11.971 1.00 70.06  ? 149  SER F N     1 
ATOM   7017  C  CA    . SER P  3 17  ? -74.906  43.812  -11.328 1.00 76.66  ? 149  SER F CA    1 
ATOM   7018  C  C     . SER P  3 17  ? -76.165  43.385  -12.083 1.00 80.72  ? 149  SER F C     1 
ATOM   7019  O  O     . SER P  3 17  ? -76.474  43.894  -13.172 1.00 80.73  ? 149  SER F O     1 
ATOM   7020  C  CB    . SER P  3 17  ? -75.284  44.264  -9.911  1.00 77.49  ? 149  SER F CB    1 
ATOM   7021  O  OG    . SER P  3 17  ? -75.637  43.156  -9.096  1.00 79.91  ? 149  SER F OG    1 
ATOM   7022  N  N     . SER P  3 18  ? -76.864  42.438  -11.452 1.00 85.31  ? 150  SER F N     1 
ATOM   7023  C  CA    . SER P  3 18  ? -78.110  41.797  -11.897 1.00 88.92  ? 150  SER F CA    1 
ATOM   7024  C  C     . SER P  3 18  ? -77.888  40.329  -11.527 1.00 91.20  ? 150  SER F C     1 
ATOM   7025  O  O     . SER P  3 18  ? -78.803  39.498  -11.581 1.00 92.09  ? 150  SER F O     1 
ATOM   7026  C  CB    . SER P  3 18  ? -78.320  41.929  -13.411 1.00 89.08  ? 150  SER F CB    1 
ATOM   7027  O  OG    . SER P  3 18  ? -79.638  41.544  -13.769 1.00 89.56  ? 150  SER F OG    1 
ATOM   7028  N  N     . ASN P  3 19  ? -76.639  40.052  -11.145 1.00 92.94  ? 151  ASN F N     1 
ATOM   7029  C  CA    . ASN P  3 19  ? -76.156  38.735  -10.731 1.00 93.58  ? 151  ASN F CA    1 
ATOM   7030  C  C     . ASN P  3 19  ? -77.275  37.846  -10.202 1.00 93.48  ? 151  ASN F C     1 
ATOM   7031  O  O     . ASN P  3 19  ? -77.549  37.837  -9.001  1.00 93.47  ? 151  ASN F O     1 
ATOM   7032  C  CB    . ASN P  3 19  ? -75.083  38.900  -9.642  1.00 94.41  ? 151  ASN F CB    1 
ATOM   7033  C  CG    . ASN P  3 19  ? -73.859  39.694  -10.117 1.00 95.10  ? 151  ASN F CG    1 
ATOM   7034  O  OD1   . ASN P  3 19  ? -73.977  40.807  -10.645 1.00 94.09  ? 151  ASN F OD1   1 
ATOM   7035  N  ND2   . ASN P  3 19  ? -72.675  39.122  -9.913  1.00 94.49  ? 151  ASN F ND2   1 
ATOM   7036  N  N     . ARG P  3 21  ? -81.439  36.751  -13.766 1.00 88.58  ? 153  ARG F N     1 
ATOM   7037  C  CA    . ARG P  3 21  ? -81.525  37.390  -15.076 1.00 88.87  ? 153  ARG F CA    1 
ATOM   7038  C  C     . ARG P  3 21  ? -80.144  37.847  -15.552 1.00 88.86  ? 153  ARG F C     1 
ATOM   7039  O  O     . ARG P  3 21  ? -79.962  39.013  -15.907 1.00 89.06  ? 153  ARG F O     1 
ATOM   7040  C  CB    . ARG P  3 21  ? -82.474  38.583  -15.002 1.00 89.11  ? 153  ARG F CB    1 
ATOM   7041  N  N     . ARG P  3 22  ? -79.186  36.920  -15.578 1.00 88.55  ? 154  ARG F N     1 
ATOM   7042  C  CA    . ARG P  3 22  ? -77.815  37.234  -15.978 1.00 88.69  ? 154  ARG F CA    1 
ATOM   7043  C  C     . ARG P  3 22  ? -77.652  38.076  -17.248 1.00 87.72  ? 154  ARG F C     1 
ATOM   7044  O  O     . ARG P  3 22  ? -77.237  37.582  -18.304 1.00 88.45  ? 154  ARG F O     1 
ATOM   7045  C  CB    . ARG P  3 22  ? -76.973  35.956  -16.125 1.00 89.72  ? 154  ARG F CB    1 
ATOM   7046  C  CG    . ARG P  3 22  ? -75.468  36.251  -16.230 1.00 90.93  ? 154  ARG F CG    1 
ATOM   7047  C  CD    . ARG P  3 22  ? -74.736  35.283  -17.147 1.00 93.10  ? 154  ARG F CD    1 
ATOM   7048  N  NE    . ARG P  3 22  ? -74.611  33.943  -16.580 1.00 95.47  ? 154  ARG F NE    1 
ATOM   7049  C  CZ    . ARG P  3 22  ? -74.100  32.901  -17.232 1.00 96.27  ? 154  ARG F CZ    1 
ATOM   7050  N  NH1   . ARG P  3 22  ? -73.664  33.039  -18.481 1.00 96.08  ? 154  ARG F NH1   1 
ATOM   7051  N  NH2   . ARG P  3 22  ? -74.024  31.719  -16.633 1.00 96.88  ? 154  ARG F NH2   1 
ATOM   7052  N  N     . ARG P  3 23  ? -77.971  39.358  -17.127 1.00 85.17  ? 155  ARG F N     1 
ATOM   7053  C  CA    . ARG P  3 23  ? -77.829  40.309  -18.217 1.00 82.49  ? 155  ARG F CA    1 
ATOM   7054  C  C     . ARG P  3 23  ? -77.020  41.409  -17.538 1.00 80.39  ? 155  ARG F C     1 
ATOM   7055  O  O     . ARG P  3 23  ? -77.396  42.578  -17.570 1.00 81.85  ? 155  ARG F O     1 
ATOM   7056  C  CB    . ARG P  3 23  ? -79.204  40.828  -18.642 1.00 82.65  ? 155  ARG F CB    1 
ATOM   7057  N  N     . PRO P  3 24  ? -75.877  41.039  -16.925 1.00 77.42  ? 156  PRO F N     1 
ATOM   7058  C  CA    . PRO P  3 24  ? -74.980  41.951  -16.206 1.00 74.17  ? 156  PRO F CA    1 
ATOM   7059  C  C     . PRO P  3 24  ? -74.627  43.227  -16.952 1.00 71.00  ? 156  PRO F C     1 
ATOM   7060  O  O     . PRO P  3 24  ? -74.130  43.188  -18.077 1.00 70.82  ? 156  PRO F O     1 
ATOM   7061  C  CB    . PRO P  3 24  ? -73.761  41.081  -15.931 1.00 74.33  ? 156  PRO F CB    1 
ATOM   7062  C  CG    . PRO P  3 24  ? -73.697  40.255  -17.154 1.00 75.35  ? 156  PRO F CG    1 
ATOM   7063  C  CD    . PRO P  3 24  ? -75.137  39.823  -17.313 1.00 76.51  ? 156  PRO F CD    1 
ATOM   7064  N  N     . ARG P  3 25  ? -74.877  44.359  -16.308 1.00 67.01  ? 157  ARG F N     1 
ATOM   7065  C  CA    . ARG P  3 25  ? -74.589  45.642  -16.916 1.00 63.74  ? 157  ARG F CA    1 
ATOM   7066  C  C     . ARG P  3 25  ? -73.736  46.519  -16.020 1.00 60.17  ? 157  ARG F C     1 
ATOM   7067  O  O     . ARG P  3 25  ? -74.063  46.741  -14.862 1.00 59.53  ? 157  ARG F O     1 
ATOM   7068  C  CB    . ARG P  3 25  ? -75.894  46.342  -17.254 1.00 65.63  ? 157  ARG F CB    1 
ATOM   7069  C  CG    . ARG P  3 25  ? -77.006  46.103  -16.252 1.00 68.39  ? 157  ARG F CG    1 
ATOM   7070  C  CD    . ARG P  3 25  ? -78.250  46.843  -16.716 1.00 70.95  ? 157  ARG F CD    1 
ATOM   7071  N  NE    . ARG P  3 25  ? -78.574  46.494  -18.100 1.00 72.27  ? 157  ARG F NE    1 
ATOM   7072  C  CZ    . ARG P  3 25  ? -78.900  47.374  -19.042 1.00 72.33  ? 157  ARG F CZ    1 
ATOM   7073  N  NH1   . ARG P  3 25  ? -78.947  48.669  -18.759 1.00 73.01  ? 157  ARG F NH1   1 
ATOM   7074  N  NH2   . ARG P  3 25  ? -79.178  46.956  -20.268 1.00 72.62  ? 157  ARG F NH2   1 
ATOM   7075  N  N     . ALA P  3 26  ? -72.641  47.024  -16.568 1.00 56.11  ? 158  ALA F N     1 
ATOM   7076  C  CA    . ALA P  3 26  ? -71.736  47.854  -15.797 1.00 52.97  ? 158  ALA F CA    1 
ATOM   7077  C  C     . ALA P  3 26  ? -71.849  49.322  -16.144 1.00 51.52  ? 158  ALA F C     1 
ATOM   7078  O  O     . ALA P  3 26  ? -72.100  49.675  -17.292 1.00 52.08  ? 158  ALA F O     1 
ATOM   7079  C  CB    . ALA P  3 26  ? -70.339  47.399  -16.022 1.00 53.82  ? 158  ALA F CB    1 
ATOM   7080  N  N     . GLY P  3 27  ? -71.641  50.175  -15.147 1.00 49.39  ? 159  GLY F N     1 
ATOM   7081  C  CA    . GLY P  3 27  ? -71.721  51.607  -15.365 1.00 47.11  ? 159  GLY F CA    1 
ATOM   7082  C  C     . GLY P  3 27  ? -70.563  52.346  -14.722 1.00 46.30  ? 159  GLY F C     1 
ATOM   7083  O  O     . GLY P  3 27  ? -69.973  51.860  -13.758 1.00 46.98  ? 159  GLY F O     1 
ATOM   7084  N  N     . ILE P  3 28  ? -70.237  53.523  -15.249 1.00 45.17  ? 160  ILE F N     1 
ATOM   7085  C  CA    . ILE P  3 28  ? -69.134  54.327  -14.725 1.00 43.72  ? 160  ILE F CA    1 
ATOM   7086  C  C     . ILE P  3 28  ? -69.658  55.666  -14.199 1.00 43.02  ? 160  ILE F C     1 
ATOM   7087  O  O     . ILE P  3 28  ? -70.675  56.164  -14.666 1.00 42.84  ? 160  ILE F O     1 
ATOM   7088  C  CB    . ILE P  3 28  ? -68.099  54.611  -15.829 1.00 43.72  ? 160  ILE F CB    1 
ATOM   7089  C  CG1   . ILE P  3 28  ? -67.844  53.351  -16.667 1.00 42.06  ? 160  ILE F CG1   1 
ATOM   7090  C  CG2   . ILE P  3 28  ? -66.809  55.089  -15.204 1.00 43.72  ? 160  ILE F CG2   1 
ATOM   7091  C  CD1   . ILE P  3 28  ? -67.072  52.281  -15.963 1.00 41.35  ? 160  ILE F CD1   1 
ATOM   7092  N  N     . GLY P  3 29  ? -68.966  56.250  -13.229 1.00 42.94  ? 161  GLY F N     1 
ATOM   7093  C  CA    . GLY P  3 29  ? -69.414  57.525  -12.689 1.00 43.55  ? 161  GLY F CA    1 
ATOM   7094  C  C     . GLY P  3 29  ? -68.306  58.387  -12.099 1.00 43.66  ? 161  GLY F C     1 
ATOM   7095  O  O     . GLY P  3 29  ? -67.504  57.914  -11.290 1.00 44.22  ? 161  GLY F O     1 
ATOM   7096  N  N     . VAL P  3 30  ? -68.265  59.659  -12.482 1.00 42.40  ? 162  VAL F N     1 
ATOM   7097  C  CA    . VAL P  3 30  ? -67.232  60.552  -11.973 1.00 42.04  ? 162  VAL F CA    1 
ATOM   7098  C  C     . VAL P  3 30  ? -67.823  61.804  -11.323 1.00 41.31  ? 162  VAL F C     1 
ATOM   7099  O  O     . VAL P  3 30  ? -68.481  62.591  -11.986 1.00 41.49  ? 162  VAL F O     1 
ATOM   7100  C  CB    . VAL P  3 30  ? -66.302  60.960  -13.110 1.00 42.77  ? 162  VAL F CB    1 
ATOM   7101  C  CG1   . VAL P  3 30  ? -65.066  61.653  -12.555 1.00 44.34  ? 162  VAL F CG1   1 
ATOM   7102  C  CG2   . VAL P  3 30  ? -65.926  59.733  -13.917 1.00 42.19  ? 162  VAL F CG2   1 
ATOM   7103  N  N     . TYR P  3 31  ? -67.586  61.996  -10.029 1.00 40.66  ? 163  TYR F N     1 
ATOM   7104  C  CA    . TYR P  3 31  ? -68.140  63.163  -9.346  1.00 41.50  ? 163  TYR F CA    1 
ATOM   7105  C  C     . TYR P  3 31  ? -67.106  64.225  -9.035  1.00 42.72  ? 163  TYR F C     1 
ATOM   7106  O  O     . TYR P  3 31  ? -66.143  63.962  -8.317  1.00 45.13  ? 163  TYR F O     1 
ATOM   7107  C  CB    . TYR P  3 31  ? -68.801  62.777  -8.024  1.00 40.57  ? 163  TYR F CB    1 
ATOM   7108  C  CG    . TYR P  3 31  ? -69.670  63.879  -7.453  1.00 39.67  ? 163  TYR F CG    1 
ATOM   7109  C  CD1   . TYR P  3 31  ? -69.894  63.987  -6.086  1.00 39.85  ? 163  TYR F CD1   1 
ATOM   7110  C  CD2   . TYR P  3 31  ? -70.324  64.772  -8.292  1.00 40.46  ? 163  TYR F CD2   1 
ATOM   7111  C  CE1   . TYR P  3 31  ? -70.756  64.955  -5.569  1.00 41.20  ? 163  TYR F CE1   1 
ATOM   7112  C  CE2   . TYR P  3 31  ? -71.188  65.738  -7.791  1.00 41.72  ? 163  TYR F CE2   1 
ATOM   7113  C  CZ    . TYR P  3 31  ? -71.408  65.825  -6.432  1.00 42.02  ? 163  TYR F CZ    1 
ATOM   7114  O  OH    . TYR P  3 31  ? -72.333  66.738  -5.956  1.00 44.10  ? 163  TYR F OH    1 
ATOM   7115  N  N     . TRP P  3 32  ? -67.325  65.433  -9.546  1.00 41.56  ? 164  TRP F N     1 
ATOM   7116  C  CA    . TRP P  3 32  ? -66.411  66.529  -9.304  1.00 40.51  ? 164  TRP F CA    1 
ATOM   7117  C  C     . TRP P  3 32  ? -67.031  67.531  -8.360  1.00 41.52  ? 164  TRP F C     1 
ATOM   7118  O  O     . TRP P  3 32  ? -66.368  68.463  -7.898  1.00 42.19  ? 164  TRP F O     1 
ATOM   7119  C  CB    . TRP P  3 32  ? -66.068  67.211  -10.606 1.00 39.14  ? 164  TRP F CB    1 
ATOM   7120  C  CG    . TRP P  3 32  ? -65.454  66.289  -11.577 1.00 38.88  ? 164  TRP F CG    1 
ATOM   7121  C  CD1   . TRP P  3 32  ? -66.102  65.453  -12.432 1.00 39.15  ? 164  TRP F CD1   1 
ATOM   7122  C  CD2   . TRP P  3 32  ? -64.053  66.106  -11.813 1.00 38.37  ? 164  TRP F CD2   1 
ATOM   7123  N  NE1   . TRP P  3 32  ? -65.191  64.761  -13.198 1.00 40.31  ? 164  TRP F NE1   1 
ATOM   7124  C  CE2   . TRP P  3 32  ? -63.926  65.145  -12.836 1.00 39.29  ? 164  TRP F CE2   1 
ATOM   7125  C  CE3   . TRP P  3 32  ? -62.894  66.663  -11.260 1.00 37.51  ? 164  TRP F CE3   1 
ATOM   7126  C  CZ2   . TRP P  3 32  ? -62.684  64.730  -13.318 1.00 38.95  ? 164  TRP F CZ2   1 
ATOM   7127  C  CZ3   . TRP P  3 32  ? -61.659  66.251  -11.739 1.00 36.06  ? 164  TRP F CZ3   1 
ATOM   7128  C  CH2   . TRP P  3 32  ? -61.565  65.295  -12.758 1.00 37.67  ? 164  TRP F CH2   1 
ATOM   7129  N  N     . GLY P  3 33  ? -68.313  67.333  -8.071  1.00 42.27  ? 165  GLY F N     1 
ATOM   7130  C  CA    . GLY P  3 33  ? -69.013  68.237  -7.176  1.00 41.95  ? 165  GLY F CA    1 
ATOM   7131  C  C     . GLY P  3 33  ? -70.320  68.732  -7.762  1.00 41.62  ? 165  GLY F C     1 
ATOM   7132  O  O     . GLY P  3 33  ? -70.505  68.732  -8.985  1.00 42.44  ? 165  GLY F O     1 
ATOM   7133  N  N     . PRO P  3 34  ? -71.244  69.189  -6.907  1.00 40.75  ? 166  PRO F N     1 
ATOM   7134  C  CA    . PRO P  3 34  ? -72.548  69.686  -7.350  1.00 39.49  ? 166  PRO F CA    1 
ATOM   7135  C  C     . PRO P  3 34  ? -72.583  70.475  -8.659  1.00 38.96  ? 166  PRO F C     1 
ATOM   7136  O  O     . PRO P  3 34  ? -71.870  71.466  -8.850  1.00 37.17  ? 166  PRO F O     1 
ATOM   7137  C  CB    . PRO P  3 34  ? -73.047  70.489  -6.145  1.00 39.22  ? 166  PRO F CB    1 
ATOM   7138  C  CG    . PRO P  3 34  ? -71.799  70.772  -5.335  1.00 39.72  ? 166  PRO F CG    1 
ATOM   7139  C  CD    . PRO P  3 34  ? -71.027  69.503  -5.485  1.00 40.48  ? 166  PRO F CD    1 
ATOM   7140  N  N     . GLY P  3 35  ? -73.423  69.982  -9.562  1.00 39.94  ? 167  GLY F N     1 
ATOM   7141  C  CA    . GLY P  3 35  ? -73.624  70.599  -10.860 1.00 40.73  ? 167  GLY F CA    1 
ATOM   7142  C  C     . GLY P  3 35  ? -72.411  70.778  -11.739 1.00 41.27  ? 167  GLY F C     1 
ATOM   7143  O  O     . GLY P  3 35  ? -72.536  71.281  -12.860 1.00 40.53  ? 167  GLY F O     1 
ATOM   7144  N  N     . HIS P  3 36  ? -71.245  70.368  -11.250 1.00 41.98  ? 168  HIS F N     1 
ATOM   7145  C  CA    . HIS P  3 36  ? -70.026  70.517  -12.022 1.00 42.40  ? 168  HIS F CA    1 
ATOM   7146  C  C     . HIS P  3 36  ? -70.193  69.911  -13.416 1.00 42.94  ? 168  HIS F C     1 
ATOM   7147  O  O     . HIS P  3 36  ? -70.853  68.893  -13.589 1.00 40.85  ? 168  HIS F O     1 
ATOM   7148  C  CB    . HIS P  3 36  ? -68.857  69.877  -11.283 1.00 43.59  ? 168  HIS F CB    1 
ATOM   7149  C  CG    . HIS P  3 36  ? -67.525  70.177  -11.896 1.00 45.42  ? 168  HIS F CG    1 
ATOM   7150  N  ND1   . HIS P  3 36  ? -67.095  69.594  -13.070 1.00 46.54  ? 168  HIS F ND1   1 
ATOM   7151  C  CD2   . HIS P  3 36  ? -66.532  71.009  -11.505 1.00 45.86  ? 168  HIS F CD2   1 
ATOM   7152  C  CE1   . HIS P  3 36  ? -65.894  70.051  -13.372 1.00 45.93  ? 168  HIS F CE1   1 
ATOM   7153  N  NE2   . HIS P  3 36  ? -65.529  70.911  -12.438 1.00 46.99  ? 168  HIS F NE2   1 
ATOM   7154  N  N     . PRO P  3 37  ? -69.603  70.559  -14.432 1.00 45.13  ? 169  PRO F N     1 
ATOM   7155  C  CA    . PRO P  3 37  ? -69.611  70.202  -15.859 1.00 46.70  ? 169  PRO F CA    1 
ATOM   7156  C  C     . PRO P  3 37  ? -69.020  68.851  -16.220 1.00 47.83  ? 169  PRO F C     1 
ATOM   7157  O  O     . PRO P  3 37  ? -69.541  68.160  -17.101 1.00 48.89  ? 169  PRO F O     1 
ATOM   7158  C  CB    . PRO P  3 37  ? -68.807  71.328  -16.509 1.00 46.44  ? 169  PRO F CB    1 
ATOM   7159  C  CG    . PRO P  3 37  ? -69.033  72.482  -15.598 1.00 47.36  ? 169  PRO F CG    1 
ATOM   7160  C  CD    . PRO P  3 37  ? -68.912  71.845  -14.231 1.00 46.15  ? 169  PRO F CD    1 
ATOM   7161  N  N     . LEU P  3 38  ? -67.924  68.490  -15.557 1.00 48.26  ? 170  LEU F N     1 
ATOM   7162  C  CA    . LEU P  3 38  ? -67.248  67.230  -15.839 1.00 49.39  ? 170  LEU F CA    1 
ATOM   7163  C  C     . LEU P  3 38  ? -67.825  65.965  -15.218 1.00 48.35  ? 170  LEU F C     1 
ATOM   7164  O  O     . LEU P  3 38  ? -67.235  64.887  -15.370 1.00 47.47  ? 170  LEU F O     1 
ATOM   7165  C  CB    . LEU P  3 38  ? -65.767  67.328  -15.473 1.00 52.50  ? 170  LEU F CB    1 
ATOM   7166  C  CG    . LEU P  3 38  ? -64.905  68.067  -16.498 1.00 55.41  ? 170  LEU F CG    1 
ATOM   7167  C  CD1   . LEU P  3 38  ? -65.127  67.461  -17.895 1.00 55.72  ? 170  LEU F CD1   1 
ATOM   7168  C  CD2   . LEU P  3 38  ? -65.265  69.543  -16.493 1.00 57.17  ? 170  LEU F CD2   1 
ATOM   7169  N  N     . ASN P  3 39  ? -68.958  66.082  -14.522 1.00 45.75  ? 171  ASN F N     1 
ATOM   7170  C  CA    . ASN P  3 39  ? -69.569  64.906  -13.929 1.00 43.85  ? 171  ASN F CA    1 
ATOM   7171  C  C     . ASN P  3 39  ? -70.054  64.028  -15.056 1.00 43.17  ? 171  ASN F C     1 
ATOM   7172  O  O     . ASN P  3 39  ? -70.643  64.504  -16.013 1.00 43.11  ? 171  ASN F O     1 
ATOM   7173  C  CB    . ASN P  3 39  ? -70.726  65.280  -13.018 1.00 44.34  ? 171  ASN F CB    1 
ATOM   7174  C  CG    . ASN P  3 39  ? -70.258  65.871  -11.715 1.00 46.19  ? 171  ASN F CG    1 
ATOM   7175  O  OD1   . ASN P  3 39  ? -69.069  65.802  -11.385 1.00 47.05  ? 171  ASN F OD1   1 
ATOM   7176  N  ND2   . ASN P  3 39  ? -71.186  66.454  -10.955 1.00 46.90  ? 171  ASN F ND2   1 
ATOM   7177  N  N     . VAL P  3 40  ? -69.793  62.737  -14.940 1.00 43.35  ? 172  VAL F N     1 
ATOM   7178  C  CA    . VAL P  3 40  ? -70.169  61.808  -15.976 1.00 43.29  ? 172  VAL F CA    1 
ATOM   7179  C  C     . VAL P  3 40  ? -70.921  60.626  -15.407 1.00 43.77  ? 172  VAL F C     1 
ATOM   7180  O  O     . VAL P  3 40  ? -70.812  60.308  -14.221 1.00 43.70  ? 172  VAL F O     1 
ATOM   7181  C  CB    . VAL P  3 40  ? -68.924  61.281  -16.685 1.00 43.63  ? 172  VAL F CB    1 
ATOM   7182  C  CG1   . VAL P  3 40  ? -69.310  60.587  -17.985 1.00 45.00  ? 172  VAL F CG1   1 
ATOM   7183  C  CG2   . VAL P  3 40  ? -67.969  62.417  -16.929 1.00 44.17  ? 172  VAL F CG2   1 
ATOM   7184  N  N     . GLY P  3 41  ? -71.676  59.974  -16.281 1.00 43.32  ? 173  GLY F N     1 
ATOM   7185  C  CA    . GLY P  3 41  ? -72.443  58.816  -15.894 1.00 42.91  ? 173  GLY F CA    1 
ATOM   7186  C  C     . GLY P  3 41  ? -72.721  58.030  -17.152 1.00 43.33  ? 173  GLY F C     1 
ATOM   7187  O  O     . GLY P  3 41  ? -73.866  57.907  -17.555 1.00 44.73  ? 173  GLY F O     1 
ATOM   7188  N  N     . ILE P  3 42  ? -71.674  57.520  -17.789 1.00 43.07  ? 174  ILE F N     1 
ATOM   7189  C  CA    . ILE P  3 42  ? -71.827  56.731  -19.010 1.00 44.02  ? 174  ILE F CA    1 
ATOM   7190  C  C     . ILE P  3 42  ? -71.838  55.249  -18.676 1.00 43.36  ? 174  ILE F C     1 
ATOM   7191  O  O     . ILE P  3 42  ? -71.769  54.878  -17.512 1.00 43.81  ? 174  ILE F O     1 
ATOM   7192  C  CB    . ILE P  3 42  ? -70.662  56.972  -19.964 1.00 46.61  ? 174  ILE F CB    1 
ATOM   7193  C  CG1   . ILE P  3 42  ? -69.346  56.688  -19.235 1.00 45.98  ? 174  ILE F CG1   1 
ATOM   7194  C  CG2   . ILE P  3 42  ? -70.701  58.406  -20.491 1.00 49.42  ? 174  ILE F CG2   1 
ATOM   7195  C  CD1   . ILE P  3 42  ? -68.122  57.056  -20.035 1.00 46.76  ? 174  ILE F CD1   1 
ATOM   7196  N  N     . ARG P  3 43  ? -71.921  54.398  -19.693 1.00 42.77  ? 175  ARG F N     1 
ATOM   7197  C  CA    . ARG P  3 43  ? -71.907  52.958  -19.449 1.00 41.71  ? 175  ARG F CA    1 
ATOM   7198  C  C     . ARG P  3 43  ? -70.611  52.288  -19.884 1.00 41.98  ? 175  ARG F C     1 
ATOM   7199  O  O     . ARG P  3 43  ? -70.077  52.565  -20.962 1.00 41.93  ? 175  ARG F O     1 
ATOM   7200  C  CB    . ARG P  3 43  ? -73.064  52.255  -20.145 1.00 40.20  ? 175  ARG F CB    1 
ATOM   7201  C  CG    . ARG P  3 43  ? -72.852  50.754  -20.169 1.00 38.79  ? 175  ARG F CG    1 
ATOM   7202  C  CD    . ARG P  3 43  ? -74.127  49.989  -20.365 1.00 38.46  ? 175  ARG F CD    1 
ATOM   7203  N  NE    . ARG P  3 43  ? -73.891  48.566  -20.178 1.00 38.81  ? 175  ARG F NE    1 
ATOM   7204  C  CZ    . ARG P  3 43  ? -74.848  47.651  -20.122 1.00 40.36  ? 175  ARG F CZ    1 
ATOM   7205  N  NH1   . ARG P  3 43  ? -76.120  48.003  -20.239 1.00 42.28  ? 175  ARG F NH1   1 
ATOM   7206  N  NH2   . ARG P  3 43  ? -74.532  46.380  -19.943 1.00 41.85  ? 175  ARG F NH2   1 
ATOM   7207  N  N     . LEU P  3 44  ? -70.130  51.378  -19.044 1.00 42.48  ? 176  LEU F N     1 
ATOM   7208  C  CA    . LEU P  3 44  ? -68.886  50.660  -19.306 1.00 42.67  ? 176  LEU F CA    1 
ATOM   7209  C  C     . LEU P  3 44  ? -68.966  49.706  -20.487 1.00 42.41  ? 176  LEU F C     1 
ATOM   7210  O  O     . LEU P  3 44  ? -69.813  48.819  -20.528 1.00 43.42  ? 176  LEU F O     1 
ATOM   7211  C  CB    . LEU P  3 44  ? -68.453  49.863  -18.074 1.00 41.27  ? 176  LEU F CB    1 
ATOM   7212  C  CG    . LEU P  3 44  ? -67.146  49.105  -18.279 1.00 40.40  ? 176  LEU F CG    1 
ATOM   7213  C  CD1   . LEU P  3 44  ? -65.996  50.089  -18.284 1.00 42.13  ? 176  LEU F CD1   1 
ATOM   7214  C  CD2   . LEU P  3 44  ? -66.952  48.099  -17.190 1.00 40.27  ? 176  LEU F CD2   1 
ATOM   7215  N  N     . PRO P  3 45  ? -68.083  49.885  -21.473 1.00 41.71  ? 177  PRO F N     1 
ATOM   7216  C  CA    . PRO P  3 45  ? -68.102  48.995  -22.631 1.00 41.39  ? 177  PRO F CA    1 
ATOM   7217  C  C     . PRO P  3 45  ? -67.262  47.753  -22.373 1.00 41.72  ? 177  PRO F C     1 
ATOM   7218  O  O     . PRO P  3 45  ? -66.430  47.721  -21.468 1.00 41.88  ? 177  PRO F O     1 
ATOM   7219  C  CB    . PRO P  3 45  ? -67.513  49.861  -23.728 1.00 41.40  ? 177  PRO F CB    1 
ATOM   7220  C  CG    . PRO P  3 45  ? -66.508  50.681  -22.976 1.00 41.50  ? 177  PRO F CG    1 
ATOM   7221  C  CD    . PRO P  3 45  ? -67.262  51.080  -21.738 1.00 40.67  ? 177  PRO F CD    1 
ATOM   7222  N  N     . GLY P  3 46  ? -67.486  46.724  -23.172 1.00 43.19  ? 178  GLY F N     1 
ATOM   7223  C  CA    . GLY P  3 46  ? -66.715  45.504  -23.015 1.00 44.20  ? 178  GLY F CA    1 
ATOM   7224  C  C     . GLY P  3 46  ? -67.244  44.598  -21.929 1.00 44.43  ? 178  GLY F C     1 
ATOM   7225  O  O     . GLY P  3 46  ? -68.373  44.765  -21.464 1.00 44.74  ? 178  GLY F O     1 
ATOM   7226  N  N     . ARG P  3 47  ? -66.421  43.636  -21.526 1.00 44.68  ? 179  ARG F N     1 
ATOM   7227  C  CA    . ARG P  3 47  ? -66.796  42.686  -20.489 1.00 44.29  ? 179  ARG F CA    1 
ATOM   7228  C  C     . ARG P  3 47  ? -67.426  43.433  -19.314 1.00 44.18  ? 179  ARG F C     1 
ATOM   7229  O  O     . ARG P  3 47  ? -66.845  44.378  -18.776 1.00 44.08  ? 179  ARG F O     1 
ATOM   7230  C  CB    . ARG P  3 47  ? -65.562  41.918  -20.040 1.00 43.59  ? 179  ARG F CB    1 
ATOM   7231  C  CG    . ARG P  3 47  ? -65.850  40.495  -19.638 1.00 42.43  ? 179  ARG F CG    1 
ATOM   7232  C  CD    . ARG P  3 47  ? -64.545  39.721  -19.586 1.00 42.23  ? 179  ARG F CD    1 
ATOM   7233  N  NE    . ARG P  3 47  ? -63.692  40.184  -18.503 1.00 38.51  ? 179  ARG F NE    1 
ATOM   7234  C  CZ    . ARG P  3 47  ? -63.901  39.876  -17.231 1.00 37.27  ? 179  ARG F CZ    1 
ATOM   7235  N  NH1   . ARG P  3 47  ? -64.933  39.096  -16.898 1.00 32.52  ? 179  ARG F NH1   1 
ATOM   7236  N  NH2   . ARG P  3 47  ? -63.086  40.357  -16.300 1.00 36.19  ? 179  ARG F NH2   1 
ATOM   7237  N  N     . GLN P  3 48  ? -68.622  43.002  -18.929 1.00 43.30  ? 180  GLN F N     1 
ATOM   7238  C  CA    . GLN P  3 48  ? -69.366  43.637  -17.848 1.00 42.42  ? 180  GLN F CA    1 
ATOM   7239  C  C     . GLN P  3 48  ? -69.040  43.115  -16.451 1.00 41.11  ? 180  GLN F C     1 
ATOM   7240  O  O     . GLN P  3 48  ? -69.671  42.176  -15.970 1.00 40.81  ? 180  GLN F O     1 
ATOM   7241  C  CB    . GLN P  3 48  ? -70.868  43.484  -18.114 1.00 43.92  ? 180  GLN F CB    1 
ATOM   7242  C  CG    . GLN P  3 48  ? -71.633  44.792  -18.263 1.00 43.49  ? 180  GLN F CG    1 
ATOM   7243  C  CD    . GLN P  3 48  ? -71.128  45.645  -19.405 1.00 44.10  ? 180  GLN F CD    1 
ATOM   7244  O  OE1   . GLN P  3 48  ? -71.910  46.306  -20.077 1.00 45.62  ? 180  GLN F OE1   1 
ATOM   7245  N  NE2   . GLN P  3 48  ? -69.817  45.649  -19.622 1.00 43.14  ? 180  GLN F NE2   1 
ATOM   7246  N  N     . THR P  3 49  ? -68.076  43.741  -15.789 1.00 39.51  ? 181  THR F N     1 
ATOM   7247  C  CA    . THR P  3 49  ? -67.691  43.313  -14.452 1.00 38.24  ? 181  THR F CA    1 
ATOM   7248  C  C     . THR P  3 49  ? -67.438  44.498  -13.533 1.00 36.06  ? 181  THR F C     1 
ATOM   7249  O  O     . THR P  3 49  ? -66.802  45.481  -13.914 1.00 33.26  ? 181  THR F O     1 
ATOM   7250  C  CB    . THR P  3 49  ? -66.415  42.471  -14.493 1.00 39.75  ? 181  THR F CB    1 
ATOM   7251  O  OG1   . THR P  3 49  ? -65.274  43.334  -14.371 1.00 41.31  ? 181  THR F OG1   1 
ATOM   7252  C  CG2   . THR P  3 49  ? -66.332  41.714  -15.818 1.00 38.91  ? 181  THR F CG2   1 
ATOM   7253  N  N     . ASN P  3 50  ? -67.924  44.383  -12.307 1.00 35.04  ? 182  ASN F N     1 
ATOM   7254  C  CA    . ASN P  3 50  ? -67.759  45.439  -11.327 1.00 35.00  ? 182  ASN F CA    1 
ATOM   7255  C  C     . ASN P  3 50  ? -66.309  45.852  -11.221 1.00 33.14  ? 182  ASN F C     1 
ATOM   7256  O  O     . ASN P  3 50  ? -65.967  47.023  -11.388 1.00 31.51  ? 182  ASN F O     1 
ATOM   7257  C  CB    . ASN P  3 50  ? -68.216  44.957  -9.953  1.00 38.59  ? 182  ASN F CB    1 
ATOM   7258  C  CG    . ASN P  3 50  ? -67.227  43.989  -9.320  1.00 42.64  ? 182  ASN F CG    1 
ATOM   7259  O  OD1   . ASN P  3 50  ? -66.848  42.981  -9.925  1.00 45.01  ? 182  ASN F OD1   1 
ATOM   7260  N  ND2   . ASN P  3 50  ? -66.801  44.294  -8.100  1.00 44.09  ? 182  ASN F ND2   1 
ATOM   7261  N  N     . GLN P  3 51  ? -65.463  44.868  -10.942 1.00 31.87  ? 183  GLN F N     1 
ATOM   7262  C  CA    . GLN P  3 51  ? -64.047  45.098  -10.754 1.00 31.71  ? 183  GLN F CA    1 
ATOM   7263  C  C     . GLN P  3 51  ? -63.446  45.993  -11.828 1.00 30.70  ? 183  GLN F C     1 
ATOM   7264  O  O     . GLN P  3 51  ? -62.902  47.043  -11.518 1.00 28.43  ? 183  GLN F O     1 
ATOM   7265  C  CB    . GLN P  3 51  ? -63.321  43.754  -10.665 1.00 32.38  ? 183  GLN F CB    1 
ATOM   7266  C  CG    . GLN P  3 51  ? -62.127  43.742  -9.695  1.00 32.83  ? 183  GLN F CG    1 
ATOM   7267  C  CD    . GLN P  3 51  ? -62.464  44.183  -8.262  1.00 30.58  ? 183  GLN F CD    1 
ATOM   7268  O  OE1   . GLN P  3 51  ? -62.155  43.476  -7.289  1.00 29.65  ? 183  GLN F OE1   1 
ATOM   7269  N  NE2   . GLN P  3 51  ? -63.072  45.357  -8.129  1.00 26.34  ? 183  GLN F NE2   1 
ATOM   7270  N  N     . ARG P  3 52  ? -63.563  45.609  -13.089 1.00 31.85  ? 184  ARG F N     1 
ATOM   7271  C  CA    . ARG P  3 52  ? -63.005  46.447  -14.138 1.00 34.86  ? 184  ARG F CA    1 
ATOM   7272  C  C     . ARG P  3 52  ? -63.784  47.742  -14.269 1.00 36.16  ? 184  ARG F C     1 
ATOM   7273  O  O     . ARG P  3 52  ? -63.211  48.802  -14.491 1.00 35.82  ? 184  ARG F O     1 
ATOM   7274  C  CB    . ARG P  3 52  ? -63.021  45.724  -15.475 1.00 36.71  ? 184  ARG F CB    1 
ATOM   7275  C  CG    . ARG P  3 52  ? -64.405  45.516  -16.050 1.00 38.78  ? 184  ARG F CG    1 
ATOM   7276  C  CD    . ARG P  3 52  ? -64.308  44.927  -17.453 1.00 40.99  ? 184  ARG F CD    1 
ATOM   7277  N  NE    . ARG P  3 52  ? -63.335  45.656  -18.261 1.00 40.25  ? 184  ARG F NE    1 
ATOM   7278  C  CZ    . ARG P  3 52  ? -63.406  45.774  -19.578 1.00 40.17  ? 184  ARG F CZ    1 
ATOM   7279  N  NH1   . ARG P  3 52  ? -64.409  45.208  -20.240 1.00 40.14  ? 184  ARG F NH1   1 
ATOM   7280  N  NH2   . ARG P  3 52  ? -62.483  46.473  -20.223 1.00 39.41  ? 184  ARG F NH2   1 
ATOM   7281  N  N     . ALA P  3 53  ? -65.102  47.647  -14.140 1.00 38.95  ? 185  ALA F N     1 
ATOM   7282  C  CA    . ALA P  3 53  ? -65.965  48.817  -14.239 1.00 39.74  ? 185  ALA F CA    1 
ATOM   7283  C  C     . ALA P  3 53  ? -65.430  49.885  -13.321 1.00 41.56  ? 185  ALA F C     1 
ATOM   7284  O  O     . ALA P  3 53  ? -65.383  51.061  -13.669 1.00 41.91  ? 185  ALA F O     1 
ATOM   7285  C  CB    . ALA P  3 53  ? -67.367  48.461  -13.829 1.00 38.90  ? 185  ALA F CB    1 
ATOM   7286  N  N     . GLU P  3 54  ? -65.020  49.461  -12.136 1.00 44.14  ? 186  GLU F N     1 
ATOM   7287  C  CA    . GLU P  3 54  ? -64.498  50.389  -11.155 1.00 46.37  ? 186  GLU F CA    1 
ATOM   7288  C  C     . GLU P  3 54  ? -63.161  50.985  -11.608 1.00 46.29  ? 186  GLU F C     1 
ATOM   7289  O  O     . GLU P  3 54  ? -62.958  52.192  -11.517 1.00 46.95  ? 186  GLU F O     1 
ATOM   7290  C  CB    . GLU P  3 54  ? -64.354  49.683  -9.803  1.00 47.79  ? 186  GLU F CB    1 
ATOM   7291  C  CG    . GLU P  3 54  ? -64.265  50.615  -8.585  1.00 50.98  ? 186  GLU F CG    1 
ATOM   7292  C  CD    . GLU P  3 54  ? -65.618  51.161  -8.102  1.00 50.87  ? 186  GLU F CD    1 
ATOM   7293  O  OE1   . GLU P  3 54  ? -66.560  50.361  -7.917  1.00 51.09  ? 186  GLU F OE1   1 
ATOM   7294  O  OE2   . GLU P  3 54  ? -65.729  52.390  -7.881  1.00 51.33  ? 186  GLU F OE2   1 
ATOM   7295  N  N     . ILE P  3 55  ? -62.253  50.163  -12.116 1.00 46.20  ? 187  ILE F N     1 
ATOM   7296  C  CA    . ILE P  3 55  ? -60.970  50.705  -12.550 1.00 47.15  ? 187  ILE F CA    1 
ATOM   7297  C  C     . ILE P  3 55  ? -61.122  51.661  -13.736 1.00 46.19  ? 187  ILE F C     1 
ATOM   7298  O  O     . ILE P  3 55  ? -60.604  52.768  -13.710 1.00 45.21  ? 187  ILE F O     1 
ATOM   7299  C  CB    . ILE P  3 55  ? -59.938  49.573  -12.880 1.00 49.08  ? 187  ILE F CB    1 
ATOM   7300  C  CG1   . ILE P  3 55  ? -59.425  49.716  -14.310 1.00 50.55  ? 187  ILE F CG1   1 
ATOM   7301  C  CG2   . ILE P  3 55  ? -60.555  48.196  -12.672 1.00 49.01  ? 187  ILE F CG2   1 
ATOM   7302  C  CD1   . ILE P  3 55  ? -58.493  48.591  -14.713 1.00 53.08  ? 187  ILE F CD1   1 
ATOM   7303  N  N     . HIS P  3 56  ? -61.836  51.243  -14.772 1.00 47.65  ? 188  HIS F N     1 
ATOM   7304  C  CA    . HIS P  3 56  ? -62.053  52.104  -15.930 1.00 49.01  ? 188  HIS F CA    1 
ATOM   7305  C  C     . HIS P  3 56  ? -62.713  53.419  -15.483 1.00 49.92  ? 188  HIS F C     1 
ATOM   7306  O  O     . HIS P  3 56  ? -62.578  54.455  -16.139 1.00 49.13  ? 188  HIS F O     1 
ATOM   7307  C  CB    . HIS P  3 56  ? -62.936  51.384  -16.950 1.00 49.17  ? 188  HIS F CB    1 
ATOM   7308  C  CG    . HIS P  3 56  ? -62.175  50.507  -17.896 1.00 50.90  ? 188  HIS F CG    1 
ATOM   7309  N  ND1   . HIS P  3 56  ? -61.547  50.995  -19.022 1.00 51.85  ? 188  HIS F ND1   1 
ATOM   7310  C  CD2   . HIS P  3 56  ? -61.926  49.175  -17.876 1.00 51.83  ? 188  HIS F CD2   1 
ATOM   7311  C  CE1   . HIS P  3 56  ? -60.947  50.002  -19.655 1.00 51.61  ? 188  HIS F CE1   1 
ATOM   7312  N  NE2   . HIS P  3 56  ? -61.160  48.887  -18.981 1.00 50.64  ? 188  HIS F NE2   1 
ATOM   7313  N  N     . ALA P  3 57  ? -63.425  53.366  -14.359 1.00 50.94  ? 189  ALA F N     1 
ATOM   7314  C  CA    . ALA P  3 57  ? -64.084  54.543  -13.808 1.00 51.30  ? 189  ALA F CA    1 
ATOM   7315  C  C     . ALA P  3 57  ? -63.030  55.570  -13.403 1.00 52.67  ? 189  ALA F C     1 
ATOM   7316  O  O     . ALA P  3 57  ? -63.196  56.770  -13.620 1.00 52.37  ? 189  ALA F O     1 
ATOM   7317  C  CB    . ALA P  3 57  ? -64.923  54.155  -12.604 1.00 50.73  ? 189  ALA F CB    1 
ATOM   7318  N  N     . ALA P  3 58  ? -61.942  55.096  -12.809 1.00 53.82  ? 190  ALA F N     1 
ATOM   7319  C  CA    . ALA P  3 58  ? -60.873  55.992  -12.407 1.00 54.92  ? 190  ALA F CA    1 
ATOM   7320  C  C     . ALA P  3 58  ? -60.101  56.447  -13.646 1.00 56.43  ? 190  ALA F C     1 
ATOM   7321  O  O     . ALA P  3 58  ? -59.436  57.483  -13.622 1.00 58.30  ? 190  ALA F O     1 
ATOM   7322  C  CB    . ALA P  3 58  ? -59.950  55.303  -11.438 1.00 54.11  ? 190  ALA F CB    1 
ATOM   7323  N  N     . CYS P  3 59  ? -60.180  55.675  -14.728 1.00 56.44  ? 191  CYS F N     1 
ATOM   7324  C  CA    . CYS P  3 59  ? -59.496  56.060  -15.961 1.00 56.66  ? 191  CYS F CA    1 
ATOM   7325  C  C     . CYS P  3 59  ? -60.140  57.347  -16.470 1.00 56.40  ? 191  CYS F C     1 
ATOM   7326  O  O     . CYS P  3 59  ? -59.469  58.361  -16.685 1.00 56.18  ? 191  CYS F O     1 
ATOM   7327  C  CB    . CYS P  3 59  ? -59.649  54.976  -17.032 1.00 57.98  ? 191  CYS F CB    1 
ATOM   7328  S  SG    . CYS P  3 59  ? -58.545  53.554  -16.895 1.00 59.71  ? 191  CYS F SG    1 
ATOM   7329  N  N     . LYS P  3 60  ? -61.458  57.282  -16.643 1.00 55.57  ? 192  LYS F N     1 
ATOM   7330  C  CA    . LYS P  3 60  ? -62.257  58.399  -17.128 1.00 54.67  ? 192  LYS F CA    1 
ATOM   7331  C  C     . LYS P  3 60  ? -62.027  59.683  -16.346 1.00 54.88  ? 192  LYS F C     1 
ATOM   7332  O  O     . LYS P  3 60  ? -62.202  60.776  -16.874 1.00 54.94  ? 192  LYS F O     1 
ATOM   7333  C  CB    . LYS P  3 60  ? -63.740  58.040  -17.060 1.00 53.76  ? 192  LYS F CB    1 
ATOM   7334  C  CG    . LYS P  3 60  ? -64.660  59.101  -17.637 1.00 52.93  ? 192  LYS F CG    1 
ATOM   7335  C  CD    . LYS P  3 60  ? -64.561  59.135  -19.153 1.00 52.79  ? 192  LYS F CD    1 
ATOM   7336  C  CE    . LYS P  3 60  ? -65.428  60.229  -19.752 1.00 52.38  ? 192  LYS F CE    1 
ATOM   7337  N  NZ    . LYS P  3 60  ? -65.464  60.125  -21.236 1.00 52.57  ? 192  LYS F NZ    1 
ATOM   7338  N  N     . ALA P  3 61  ? -61.649  59.557  -15.083 1.00 55.29  ? 193  ALA F N     1 
ATOM   7339  C  CA    . ALA P  3 61  ? -61.417  60.735  -14.264 1.00 55.60  ? 193  ALA F CA    1 
ATOM   7340  C  C     . ALA P  3 61  ? -60.129  61.453  -14.645 1.00 56.52  ? 193  ALA F C     1 
ATOM   7341  O  O     . ALA P  3 61  ? -60.160  62.629  -15.006 1.00 57.88  ? 193  ALA F O     1 
ATOM   7342  C  CB    . ALA P  3 61  ? -61.383  60.353  -12.799 1.00 54.78  ? 193  ALA F CB    1 
ATOM   7343  N  N     . ILE P  3 62  ? -58.998  60.754  -14.577 1.00 57.20  ? 194  ILE F N     1 
ATOM   7344  C  CA    . ILE P  3 62  ? -57.713  61.376  -14.899 1.00 56.90  ? 194  ILE F CA    1 
ATOM   7345  C  C     . ILE P  3 62  ? -57.711  61.790  -16.366 1.00 56.20  ? 194  ILE F C     1 
ATOM   7346  O  O     . ILE P  3 62  ? -57.067  62.762  -16.756 1.00 54.69  ? 194  ILE F O     1 
ATOM   7347  C  CB    . ILE P  3 62  ? -56.509  60.416  -14.602 1.00 57.09  ? 194  ILE F CB    1 
ATOM   7348  C  CG1   . ILE P  3 62  ? -56.089  59.673  -15.869 1.00 57.63  ? 194  ILE F CG1   1 
ATOM   7349  C  CG2   . ILE P  3 62  ? -56.873  59.425  -13.505 1.00 54.88  ? 194  ILE F CG2   1 
ATOM   7350  C  CD1   . ILE P  3 62  ? -55.208  60.507  -16.799 1.00 58.05  ? 194  ILE F CD1   1 
ATOM   7351  N  N     . GLU P  3 63  ? -58.432  61.036  -17.178 1.00 56.69  ? 195  GLU F N     1 
ATOM   7352  C  CA    . GLU P  3 63  ? -58.524  61.347  -18.586 1.00 58.76  ? 195  GLU F CA    1 
ATOM   7353  C  C     . GLU P  3 63  ? -59.063  62.769  -18.703 1.00 59.45  ? 195  GLU F C     1 
ATOM   7354  O  O     . GLU P  3 63  ? -58.542  63.584  -19.460 1.00 60.41  ? 195  GLU F O     1 
ATOM   7355  C  CB    . GLU P  3 63  ? -59.467  60.365  -19.255 1.00 60.30  ? 195  GLU F CB    1 
ATOM   7356  C  CG    . GLU P  3 63  ? -59.561  60.517  -20.742 1.00 64.50  ? 195  GLU F CG    1 
ATOM   7357  C  CD    . GLU P  3 63  ? -60.378  59.403  -21.350 1.00 68.02  ? 195  GLU F CD    1 
ATOM   7358  O  OE1   . GLU P  3 63  ? -61.536  59.227  -20.909 1.00 69.31  ? 195  GLU F OE1   1 
ATOM   7359  O  OE2   . GLU P  3 63  ? -59.866  58.703  -22.257 1.00 69.58  ? 195  GLU F OE2   1 
ATOM   7360  N  N     . GLN P  3 64  ? -60.107  63.062  -17.935 1.00 59.51  ? 196  GLN F N     1 
ATOM   7361  C  CA    . GLN P  3 64  ? -60.713  64.384  -17.933 1.00 59.47  ? 196  GLN F CA    1 
ATOM   7362  C  C     . GLN P  3 64  ? -59.725  65.397  -17.377 1.00 60.45  ? 196  GLN F C     1 
ATOM   7363  O  O     . GLN P  3 64  ? -59.626  66.522  -17.868 1.00 61.25  ? 196  GLN F O     1 
ATOM   7364  C  CB    . GLN P  3 64  ? -61.965  64.399  -17.059 1.00 59.21  ? 196  GLN F CB    1 
ATOM   7365  C  CG    . GLN P  3 64  ? -63.038  63.410  -17.465 1.00 59.46  ? 196  GLN F CG    1 
ATOM   7366  C  CD    . GLN P  3 64  ? -64.386  63.756  -16.867 1.00 59.33  ? 196  GLN F CD    1 
ATOM   7367  O  OE1   . GLN P  3 64  ? -64.542  63.832  -15.647 1.00 58.73  ? 196  GLN F OE1   1 
ATOM   7368  N  NE2   . GLN P  3 64  ? -65.370  63.977  -17.729 1.00 59.36  ? 196  GLN F NE2   1 
ATOM   7369  N  N     . ALA P  3 65  ? -59.004  64.991  -16.335 1.00 60.74  ? 197  ALA F N     1 
ATOM   7370  C  CA    . ALA P  3 65  ? -58.022  65.855  -15.694 1.00 61.19  ? 197  ALA F CA    1 
ATOM   7371  C  C     . ALA P  3 65  ? -57.001  66.359  -16.716 1.00 62.24  ? 197  ALA F C     1 
ATOM   7372  O  O     . ALA P  3 65  ? -56.607  67.529  -16.697 1.00 61.69  ? 197  ALA F O     1 
ATOM   7373  C  CB    . ALA P  3 65  ? -57.330  65.100  -14.572 1.00 60.10  ? 197  ALA F CB    1 
ATOM   7374  N  N     . LYS P  3 66  ? -56.576  65.469  -17.611 1.00 63.72  ? 198  LYS F N     1 
ATOM   7375  C  CA    . LYS P  3 66  ? -55.616  65.828  -18.654 1.00 64.89  ? 198  LYS F CA    1 
ATOM   7376  C  C     . LYS P  3 66  ? -56.237  66.969  -19.450 1.00 65.45  ? 198  LYS F C     1 
ATOM   7377  O  O     . LYS P  3 66  ? -55.620  68.016  -19.666 1.00 66.18  ? 198  LYS F O     1 
ATOM   7378  C  CB    . LYS P  3 66  ? -55.372  64.637  -19.588 1.00 64.22  ? 198  LYS F CB    1 
ATOM   7379  C  CG    . LYS P  3 66  ? -54.751  63.411  -18.936 1.00 63.13  ? 198  LYS F CG    1 
ATOM   7380  C  CD    . LYS P  3 66  ? -53.272  63.599  -18.655 1.00 62.77  ? 198  LYS F CD    1 
ATOM   7381  C  CE    . LYS P  3 66  ? -52.608  62.255  -18.399 1.00 63.25  ? 198  LYS F CE    1 
ATOM   7382  N  NZ    . LYS P  3 66  ? -52.843  61.310  -19.539 1.00 62.97  ? 198  LYS F NZ    1 
ATOM   7383  N  N     . THR P  3 67  ? -57.477  66.733  -19.870 1.00 65.69  ? 199  THR F N     1 
ATOM   7384  C  CA    . THR P  3 67  ? -58.282  67.674  -20.638 1.00 66.33  ? 199  THR F CA    1 
ATOM   7385  C  C     . THR P  3 67  ? -58.426  69.024  -19.938 1.00 66.30  ? 199  THR F C     1 
ATOM   7386  O  O     . THR P  3 67  ? -59.124  69.911  -20.414 1.00 66.15  ? 199  THR F O     1 
ATOM   7387  C  CB    . THR P  3 67  ? -59.691  67.045  -20.914 1.00 67.17  ? 199  THR F CB    1 
ATOM   7388  O  OG1   . THR P  3 67  ? -59.643  66.313  -22.146 1.00 67.56  ? 199  THR F OG1   1 
ATOM   7389  C  CG2   . THR P  3 67  ? -60.803  68.099  -20.968 1.00 65.97  ? 199  THR F CG2   1 
ATOM   7390  N  N     . GLN P  3 68  ? -57.751  69.194  -18.812 1.00 66.87  ? 200  GLN F N     1 
ATOM   7391  C  CA    . GLN P  3 68  ? -57.854  70.447  -18.085 1.00 67.88  ? 200  GLN F CA    1 
ATOM   7392  C  C     . GLN P  3 68  ? -56.555  70.741  -17.374 1.00 68.24  ? 200  GLN F C     1 
ATOM   7393  O  O     . GLN P  3 68  ? -56.546  70.963  -16.168 1.00 67.73  ? 200  GLN F O     1 
ATOM   7394  C  CB    . GLN P  3 68  ? -58.980  70.349  -17.064 1.00 68.80  ? 200  GLN F CB    1 
ATOM   7395  C  CG    . GLN P  3 68  ? -60.218  69.680  -17.607 1.00 70.59  ? 200  GLN F CG    1 
ATOM   7396  C  CD    . GLN P  3 68  ? -61.445  70.531  -17.428 1.00 72.82  ? 200  GLN F CD    1 
ATOM   7397  O  OE1   . GLN P  3 68  ? -62.490  70.268  -18.028 1.00 74.45  ? 200  GLN F OE1   1 
ATOM   7398  N  NE2   . GLN P  3 68  ? -61.334  71.561  -16.592 1.00 73.05  ? 200  GLN F NE2   1 
ATOM   7399  N  N     . ASN P  3 69  ? -55.465  70.755  -18.134 1.00 69.63  ? 201  ASN F N     1 
ATOM   7400  C  CA    . ASN P  3 69  ? -54.131  70.996  -17.595 1.00 71.18  ? 201  ASN F CA    1 
ATOM   7401  C  C     . ASN P  3 69  ? -54.045  71.119  -16.078 1.00 70.94  ? 201  ASN F C     1 
ATOM   7402  O  O     . ASN P  3 69  ? -53.651  72.147  -15.513 1.00 70.89  ? 201  ASN F O     1 
ATOM   7403  C  CB    . ASN P  3 69  ? -53.482  72.194  -18.290 1.00 72.65  ? 201  ASN F CB    1 
ATOM   7404  C  CG    . ASN P  3 69  ? -52.972  71.837  -19.686 1.00 75.58  ? 201  ASN F CG    1 
ATOM   7405  O  OD1   . ASN P  3 69  ? -53.751  71.442  -20.564 1.00 76.71  ? 201  ASN F OD1   1 
ATOM   7406  N  ND2   . ASN P  3 69  ? -51.659  71.956  -19.891 1.00 76.39  ? 201  ASN F ND2   1 
ATOM   7407  N  N     . ILE P  3 70  ? -54.443  70.021  -15.445 1.00 70.27  ? 202  ILE F N     1 
ATOM   7408  C  CA    . ILE P  3 70  ? -54.421  69.845  -14.006 1.00 69.07  ? 202  ILE F CA    1 
ATOM   7409  C  C     . ILE P  3 70  ? -53.655  68.531  -13.890 1.00 67.80  ? 202  ILE F C     1 
ATOM   7410  O  O     . ILE P  3 70  ? -54.028  67.531  -14.500 1.00 67.49  ? 202  ILE F O     1 
ATOM   7411  C  CB    . ILE P  3 70  ? -55.857  69.697  -13.426 1.00 70.16  ? 202  ILE F CB    1 
ATOM   7412  C  CG1   . ILE P  3 70  ? -55.794  69.565  -11.903 1.00 70.61  ? 202  ILE F CG1   1 
ATOM   7413  C  CG2   . ILE P  3 70  ? -56.574  68.505  -14.050 1.00 69.37  ? 202  ILE F CG2   1 
ATOM   7414  C  CD1   . ILE P  3 70  ? -55.057  68.338  -11.391 1.00 71.29  ? 202  ILE F CD1   1 
ATOM   7415  N  N     . ASN P  3 71  ? -52.575  68.530  -13.127 1.00 66.37  ? 203  ASN F N     1 
ATOM   7416  C  CA    . ASN P  3 71  ? -51.780  67.325  -13.004 1.00 65.39  ? 203  ASN F CA    1 
ATOM   7417  C  C     . ASN P  3 71  ? -51.973  66.586  -11.694 1.00 63.62  ? 203  ASN F C     1 
ATOM   7418  O  O     . ASN P  3 71  ? -52.089  65.360  -11.684 1.00 64.14  ? 203  ASN F O     1 
ATOM   7419  C  CB    . ASN P  3 71  ? -50.298  67.661  -13.190 1.00 67.59  ? 203  ASN F CB    1 
ATOM   7420  C  CG    . ASN P  3 71  ? -49.823  68.748  -12.240 1.00 69.07  ? 203  ASN F CG    1 
ATOM   7421  O  OD1   . ASN P  3 71  ? -50.529  69.128  -11.306 1.00 70.50  ? 203  ASN F OD1   1 
ATOM   7422  N  ND2   . ASN P  3 71  ? -48.615  69.247  -12.471 1.00 70.38  ? 203  ASN F ND2   1 
ATOM   7423  N  N     . LYS P  3 72  ? -52.009  67.328  -10.592 1.00 60.97  ? 204  LYS F N     1 
ATOM   7424  C  CA    . LYS P  3 72  ? -52.161  66.728  -9.273  1.00 58.81  ? 204  LYS F CA    1 
ATOM   7425  C  C     . LYS P  3 72  ? -53.593  66.749  -8.718  1.00 55.31  ? 204  LYS F C     1 
ATOM   7426  O  O     . LYS P  3 72  ? -54.178  67.815  -8.471  1.00 53.71  ? 204  LYS F O     1 
ATOM   7427  C  CB    . LYS P  3 72  ? -51.186  67.400  -8.297  1.00 61.57  ? 204  LYS F CB    1 
ATOM   7428  C  CG    . LYS P  3 72  ? -51.242  68.922  -8.321  1.00 66.10  ? 204  LYS F CG    1 
ATOM   7429  C  CD    . LYS P  3 72  ? -49.976  69.552  -7.737  1.00 69.85  ? 204  LYS F CD    1 
ATOM   7430  C  CE    . LYS P  3 72  ? -48.747  69.262  -8.610  1.00 72.78  ? 204  LYS F CE    1 
ATOM   7431  N  NZ    . LYS P  3 72  ? -47.503  69.975  -8.153  1.00 74.38  ? 204  LYS F NZ    1 
ATOM   7432  N  N     . LEU P  3 73  ? -54.146  65.549  -8.528  1.00 51.12  ? 205  LEU F N     1 
ATOM   7433  C  CA    . LEU P  3 73  ? -55.504  65.386  -8.001  1.00 46.46  ? 205  LEU F CA    1 
ATOM   7434  C  C     . LEU P  3 73  ? -55.622  64.235  -6.989  1.00 43.08  ? 205  LEU F C     1 
ATOM   7435  O  O     . LEU P  3 73  ? -54.785  63.332  -6.931  1.00 41.63  ? 205  LEU F O     1 
ATOM   7436  C  CB    . LEU P  3 73  ? -56.501  65.129  -9.141  1.00 42.96  ? 205  LEU F CB    1 
ATOM   7437  C  CG    . LEU P  3 73  ? -56.633  63.655  -9.511  1.00 39.61  ? 205  LEU F CG    1 
ATOM   7438  C  CD1   . LEU P  3 73  ? -57.601  63.466  -10.638 1.00 38.56  ? 205  LEU F CD1   1 
ATOM   7439  C  CD2   . LEU P  3 73  ? -55.271  63.143  -9.900  1.00 41.48  ? 205  LEU F CD2   1 
ATOM   7440  N  N     . VAL P  3 74  ? -56.683  64.286  -6.200  1.00 39.69  ? 206  VAL F N     1 
ATOM   7441  C  CA    . VAL P  3 74  ? -56.959  63.261  -5.221  1.00 37.00  ? 206  VAL F CA    1 
ATOM   7442  C  C     . VAL P  3 74  ? -58.115  62.433  -5.765  1.00 36.03  ? 206  VAL F C     1 
ATOM   7443  O  O     . VAL P  3 74  ? -59.098  62.985  -6.269  1.00 34.25  ? 206  VAL F O     1 
ATOM   7444  C  CB    . VAL P  3 74  ? -57.363  63.880  -3.891  1.00 36.37  ? 206  VAL F CB    1 
ATOM   7445  C  CG1   . VAL P  3 74  ? -57.893  62.806  -2.951  1.00 35.16  ? 206  VAL F CG1   1 
ATOM   7446  C  CG2   . VAL P  3 74  ? -56.173  64.581  -3.293  1.00 35.70  ? 206  VAL F CG2   1 
ATOM   7447  N  N     . LEU P  3 75  ? -57.988  61.111  -5.666  1.00 34.79  ? 207  LEU F N     1 
ATOM   7448  C  CA    . LEU P  3 75  ? -59.022  60.217  -6.160  1.00 33.14  ? 207  LEU F CA    1 
ATOM   7449  C  C     . LEU P  3 75  ? -59.669  59.348  -5.074  1.00 33.11  ? 207  LEU F C     1 
ATOM   7450  O  O     . LEU P  3 75  ? -59.025  58.514  -4.445  1.00 31.99  ? 207  LEU F O     1 
ATOM   7451  C  CB    . LEU P  3 75  ? -58.460  59.333  -7.274  1.00 31.09  ? 207  LEU F CB    1 
ATOM   7452  C  CG    . LEU P  3 75  ? -59.478  59.057  -8.383  1.00 31.19  ? 207  LEU F CG    1 
ATOM   7453  C  CD1   . LEU P  3 75  ? -58.849  58.261  -9.516  1.00 30.16  ? 207  LEU F CD1   1 
ATOM   7454  C  CD2   . LEU P  3 75  ? -60.654  58.304  -7.797  1.00 32.88  ? 207  LEU F CD2   1 
ATOM   7455  N  N     . TYR P  3 76  ? -60.962  59.567  -4.866  1.00 33.67  ? 208  TYR F N     1 
ATOM   7456  C  CA    . TYR P  3 76  ? -61.734  58.822  -3.892  1.00 33.74  ? 208  TYR F CA    1 
ATOM   7457  C  C     . TYR P  3 76  ? -62.503  57.717  -4.571  1.00 34.99  ? 208  TYR F C     1 
ATOM   7458  O  O     . TYR P  3 76  ? -63.186  57.942  -5.570  1.00 36.51  ? 208  TYR F O     1 
ATOM   7459  C  CB    . TYR P  3 76  ? -62.739  59.720  -3.213  1.00 33.43  ? 208  TYR F CB    1 
ATOM   7460  C  CG    . TYR P  3 76  ? -62.158  60.517  -2.106  1.00 34.56  ? 208  TYR F CG    1 
ATOM   7461  C  CD1   . TYR P  3 76  ? -62.030  61.895  -2.207  1.00 34.86  ? 208  TYR F CD1   1 
ATOM   7462  C  CD2   . TYR P  3 76  ? -61.762  59.898  -0.931  1.00 35.65  ? 208  TYR F CD2   1 
ATOM   7463  C  CE1   . TYR P  3 76  ? -61.523  62.639  -1.152  1.00 35.88  ? 208  TYR F CE1   1 
ATOM   7464  C  CE2   . TYR P  3 76  ? -61.257  60.632  0.130   1.00 36.16  ? 208  TYR F CE2   1 
ATOM   7465  C  CZ    . TYR P  3 76  ? -61.142  61.997  0.015   1.00 35.61  ? 208  TYR F CZ    1 
ATOM   7466  O  OH    . TYR P  3 76  ? -60.661  62.712  1.080   1.00 36.99  ? 208  TYR F OH    1 
ATOM   7467  N  N     . THR P  3 77  ? -62.394  56.524  -4.010  1.00 34.87  ? 209  THR F N     1 
ATOM   7468  C  CA    . THR P  3 77  ? -63.086  55.350  -4.510  1.00 34.54  ? 209  THR F CA    1 
ATOM   7469  C  C     . THR P  3 77  ? -63.066  54.363  -3.364  1.00 36.16  ? 209  THR F C     1 
ATOM   7470  O  O     . THR P  3 77  ? -62.323  54.550  -2.385  1.00 36.84  ? 209  THR F O     1 
ATOM   7471  C  CB    . THR P  3 77  ? -62.367  54.723  -5.703  1.00 33.18  ? 209  THR F CB    1 
ATOM   7472  O  OG1   . THR P  3 77  ? -62.729  53.340  -5.800  1.00 32.89  ? 209  THR F OG1   1 
ATOM   7473  C  CG2   . THR P  3 77  ? -60.881  54.846  -5.543  1.00 30.91  ? 209  THR F CG2   1 
ATOM   7474  N  N     . ASN P  3 78  ? -63.880  53.319  -3.456  1.00 35.60  ? 210  ASN F N     1 
ATOM   7475  C  CA    . ASN P  3 78  ? -63.881  52.347  -2.384  1.00 34.32  ? 210  ASN F CA    1 
ATOM   7476  C  C     . ASN P  3 78  ? -63.436  50.976  -2.847  1.00 34.53  ? 210  ASN F C     1 
ATOM   7477  O  O     . ASN P  3 78  ? -63.662  49.987  -2.152  1.00 34.93  ? 210  ASN F O     1 
ATOM   7478  C  CB    . ASN P  3 78  ? -65.256  52.241  -1.694  1.00 32.66  ? 210  ASN F CB    1 
ATOM   7479  C  CG    . ASN P  3 78  ? -66.303  53.167  -2.276  1.00 29.92  ? 210  ASN F CG    1 
ATOM   7480  O  OD1   . ASN P  3 78  ? -67.216  53.589  -1.565  1.00 25.68  ? 210  ASN F OD1   1 
ATOM   7481  N  ND2   . ASN P  3 78  ? -66.199  53.466  -3.573  1.00 31.10  ? 210  ASN F ND2   1 
ATOM   7482  N  N     . SER P  3 79  ? -62.796  50.895  -4.008  1.00 34.93  ? 211  SER F N     1 
ATOM   7483  C  CA    . SER P  3 79  ? -62.356  49.586  -4.454  1.00 37.45  ? 211  SER F CA    1 
ATOM   7484  C  C     . SER P  3 79  ? -60.877  49.364  -4.177  1.00 39.42  ? 211  SER F C     1 
ATOM   7485  O  O     . SER P  3 79  ? -60.012  49.659  -5.012  1.00 41.39  ? 211  SER F O     1 
ATOM   7486  C  CB    . SER P  3 79  ? -62.667  49.363  -5.940  1.00 35.43  ? 211  SER F CB    1 
ATOM   7487  O  OG    . SER P  3 79  ? -61.748  50.018  -6.780  1.00 36.69  ? 211  SER F OG    1 
ATOM   7488  N  N     . MET P  3 80  ? -60.594  48.849  -2.983  1.00 40.19  ? 212  MET F N     1 
ATOM   7489  C  CA    . MET P  3 80  ? -59.231  48.549  -2.589  1.00 40.38  ? 212  MET F CA    1 
ATOM   7490  C  C     . MET P  3 80  ? -58.535  47.901  -3.764  1.00 39.77  ? 212  MET F C     1 
ATOM   7491  O  O     . MET P  3 80  ? -57.378  48.205  -4.051  1.00 39.12  ? 212  MET F O     1 
ATOM   7492  C  CB    . MET P  3 80  ? -59.223  47.606  -1.397  1.00 42.32  ? 212  MET F CB    1 
ATOM   7493  C  CG    . MET P  3 80  ? -59.022  48.321  -0.083  1.00 45.81  ? 212  MET F CG    1 
ATOM   7494  S  SD    . MET P  3 80  ? -57.280  48.690  0.221   1.00 51.28  ? 212  MET F SD    1 
ATOM   7495  C  CE    . MET P  3 80  ? -56.943  50.042  -0.889  1.00 49.03  ? 212  MET F CE    1 
ATOM   7496  N  N     . PHE P  3 81  ? -59.252  47.018  -4.452  1.00 38.51  ? 213  PHE F N     1 
ATOM   7497  C  CA    . PHE P  3 81  ? -58.687  46.360  -5.615  1.00 37.86  ? 213  PHE F CA    1 
ATOM   7498  C  C     . PHE P  3 81  ? -58.027  47.396  -6.519  1.00 38.33  ? 213  PHE F C     1 
ATOM   7499  O  O     . PHE P  3 81  ? -56.800  47.423  -6.638  1.00 39.71  ? 213  PHE F O     1 
ATOM   7500  C  CB    . PHE P  3 81  ? -59.758  45.634  -6.410  1.00 36.86  ? 213  PHE F CB    1 
ATOM   7501  C  CG    . PHE P  3 81  ? -59.209  44.775  -7.502  1.00 34.60  ? 213  PHE F CG    1 
ATOM   7502  C  CD1   . PHE P  3 81  ? -58.608  43.557  -7.204  1.00 36.27  ? 213  PHE F CD1   1 
ATOM   7503  C  CD2   . PHE P  3 81  ? -59.271  45.186  -8.821  1.00 33.43  ? 213  PHE F CD2   1 
ATOM   7504  C  CE1   . PHE P  3 81  ? -58.073  42.752  -8.209  1.00 36.88  ? 213  PHE F CE1   1 
ATOM   7505  C  CE2   . PHE P  3 81  ? -58.741  44.395  -9.840  1.00 35.45  ? 213  PHE F CE2   1 
ATOM   7506  C  CZ    . PHE P  3 81  ? -58.138  43.172  -9.533  1.00 36.91  ? 213  PHE F CZ    1 
ATOM   7507  N  N     . THR P  3 82  ? -58.825  48.253  -7.150  1.00 37.23  ? 214  THR F N     1 
ATOM   7508  C  CA    . THR P  3 82  ? -58.252  49.264  -8.033  1.00 37.63  ? 214  THR F CA    1 
ATOM   7509  C  C     . THR P  3 82  ? -57.023  49.919  -7.403  1.00 38.58  ? 214  THR F C     1 
ATOM   7510  O  O     . THR P  3 82  ? -55.925  49.860  -7.975  1.00 39.45  ? 214  THR F O     1 
ATOM   7511  C  CB    . THR P  3 82  ? -59.267  50.370  -8.400  1.00 37.78  ? 214  THR F CB    1 
ATOM   7512  O  OG1   . THR P  3 82  ? -60.137  49.903  -9.436  1.00 37.08  ? 214  THR F OG1   1 
ATOM   7513  C  CG2   . THR P  3 82  ? -58.547  51.611  -8.898  1.00 37.59  ? 214  THR F CG2   1 
ATOM   7514  N  N     . ILE P  3 83  ? -57.187  50.533  -6.232  1.00 36.92  ? 215  ILE F N     1 
ATOM   7515  C  CA    . ILE P  3 83  ? -56.041  51.169  -5.594  1.00 36.81  ? 215  ILE F CA    1 
ATOM   7516  C  C     . ILE P  3 83  ? -54.856  50.216  -5.486  1.00 37.55  ? 215  ILE F C     1 
ATOM   7517  O  O     . ILE P  3 83  ? -53.834  50.414  -6.143  1.00 35.94  ? 215  ILE F O     1 
ATOM   7518  C  CB    . ILE P  3 83  ? -56.379  51.689  -4.200  1.00 35.94  ? 215  ILE F CB    1 
ATOM   7519  C  CG1   . ILE P  3 83  ? -57.316  52.887  -4.331  1.00 37.37  ? 215  ILE F CG1   1 
ATOM   7520  C  CG2   . ILE P  3 83  ? -55.105  52.088  -3.468  1.00 34.18  ? 215  ILE F CG2   1 
ATOM   7521  C  CD1   . ILE P  3 83  ? -57.655  53.591  -3.023  1.00 38.77  ? 215  ILE F CD1   1 
ATOM   7522  N  N     . ASN P  3 84  ? -55.005  49.181  -4.664  1.00 39.38  ? 216  ASN F N     1 
ATOM   7523  C  CA    . ASN P  3 84  ? -53.954  48.187  -4.466  1.00 41.36  ? 216  ASN F CA    1 
ATOM   7524  C  C     . ASN P  3 84  ? -53.284  47.819  -5.769  1.00 42.82  ? 216  ASN F C     1 
ATOM   7525  O  O     . ASN P  3 84  ? -52.066  47.652  -5.822  1.00 43.42  ? 216  ASN F O     1 
ATOM   7526  C  CB    . ASN P  3 84  ? -54.521  46.927  -3.816  1.00 42.11  ? 216  ASN F CB    1 
ATOM   7527  C  CG    . ASN P  3 84  ? -54.429  46.962  -2.300  1.00 44.73  ? 216  ASN F CG    1 
ATOM   7528  O  OD1   . ASN P  3 84  ? -55.112  46.198  -1.600  1.00 45.90  ? 216  ASN F OD1   1 
ATOM   7529  N  ND2   . ASN P  3 84  ? -53.571  47.846  -1.778  1.00 43.76  ? 216  ASN F ND2   1 
ATOM   7530  N  N     . GLY P  3 85  ? -54.079  47.689  -6.823  1.00 44.15  ? 217  GLY F N     1 
ATOM   7531  C  CA    . GLY P  3 85  ? -53.510  47.346  -8.109  1.00 45.64  ? 217  GLY F CA    1 
ATOM   7532  C  C     . GLY P  3 85  ? -52.568  48.429  -8.599  1.00 46.98  ? 217  GLY F C     1 
ATOM   7533  O  O     . GLY P  3 85  ? -51.349  48.292  -8.544  1.00 46.63  ? 217  GLY F O     1 
ATOM   7534  N  N     . ILE P  3 86  ? -53.147  49.529  -9.050  1.00 48.28  ? 218  ILE F N     1 
ATOM   7535  C  CA    . ILE P  3 86  ? -52.392  50.646  -9.589  1.00 50.02  ? 218  ILE F CA    1 
ATOM   7536  C  C     . ILE P  3 86  ? -51.209  51.166  -8.762  1.00 50.94  ? 218  ILE F C     1 
ATOM   7537  O  O     . ILE P  3 86  ? -50.457  52.020  -9.235  1.00 51.47  ? 218  ILE F O     1 
ATOM   7538  C  CB    . ILE P  3 86  ? -53.346  51.830  -9.889  1.00 50.60  ? 218  ILE F CB    1 
ATOM   7539  C  CG1   . ILE P  3 86  ? -52.631  52.879  -10.743 1.00 51.34  ? 218  ILE F CG1   1 
ATOM   7540  C  CG2   . ILE P  3 86  ? -53.827  52.452  -8.586  1.00 49.98  ? 218  ILE F CG2   1 
ATOM   7541  C  CD1   . ILE P  3 86  ? -51.967  52.312  -11.992 1.00 50.54  ? 218  ILE F CD1   1 
ATOM   7542  N  N     . THR P  3 87  ? -51.010  50.665  -7.549  1.00 51.23  ? 219  THR F N     1 
ATOM   7543  C  CA    . THR P  3 87  ? -49.903  51.181  -6.754  1.00 52.45  ? 219  THR F CA    1 
ATOM   7544  C  C     . THR P  3 87  ? -48.862  50.162  -6.301  1.00 53.83  ? 219  THR F C     1 
ATOM   7545  O  O     . THR P  3 87  ? -47.774  50.541  -5.853  1.00 54.11  ? 219  THR F O     1 
ATOM   7546  C  CB    . THR P  3 87  ? -50.430  51.928  -5.528  1.00 52.23  ? 219  THR F CB    1 
ATOM   7547  O  OG1   . THR P  3 87  ? -51.046  51.000  -4.633  1.00 53.88  ? 219  THR F OG1   1 
ATOM   7548  C  CG2   . THR P  3 87  ? -51.467  52.958  -5.949  1.00 52.07  ? 219  THR F CG2   1 
ATOM   7549  N  N     . ASN P  3 88  ? -49.195  48.877  -6.418  1.00 55.22  ? 220  ASN F N     1 
ATOM   7550  C  CA    . ASN P  3 88  ? -48.286  47.799  -6.030  1.00 56.29  ? 220  ASN F CA    1 
ATOM   7551  C  C     . ASN P  3 88  ? -48.221  46.722  -7.070  1.00 55.96  ? 220  ASN F C     1 
ATOM   7552  O  O     . ASN P  3 88  ? -47.288  46.644  -7.860  1.00 56.75  ? 220  ASN F O     1 
ATOM   7553  C  CB    . ASN P  3 88  ? -48.725  47.143  -4.730  1.00 57.71  ? 220  ASN F CB    1 
ATOM   7554  C  CG    . ASN P  3 88  ? -48.130  47.808  -3.522  1.00 61.07  ? 220  ASN F CG    1 
ATOM   7555  O  OD1   . ASN P  3 88  ? -48.553  48.899  -3.121  1.00 62.32  ? 220  ASN F OD1   1 
ATOM   7556  N  ND2   . ASN P  3 88  ? -47.123  47.162  -2.935  1.00 62.17  ? 220  ASN F ND2   1 
ATOM   7557  N  N     . TRP P  3 89  ? -49.240  45.883  -7.052  1.00 56.00  ? 221  TRP F N     1 
ATOM   7558  C  CA    . TRP P  3 89  ? -49.337  44.766  -7.970  1.00 57.16  ? 221  TRP F CA    1 
ATOM   7559  C  C     . TRP P  3 89  ? -49.064  45.120  -9.426  1.00 57.75  ? 221  TRP F C     1 
ATOM   7560  O  O     . TRP P  3 89  ? -48.708  44.252  -10.215 1.00 57.27  ? 221  TRP F O     1 
ATOM   7561  C  CB    . TRP P  3 89  ? -50.716  44.117  -7.852  1.00 56.75  ? 221  TRP F CB    1 
ATOM   7562  C  CG    . TRP P  3 89  ? -51.215  43.966  -6.439  1.00 55.37  ? 221  TRP F CG    1 
ATOM   7563  C  CD1   . TRP P  3 89  ? -50.471  43.941  -5.289  1.00 54.03  ? 221  TRP F CD1   1 
ATOM   7564  C  CD2   . TRP P  3 89  ? -52.573  43.803  -6.040  1.00 54.84  ? 221  TRP F CD2   1 
ATOM   7565  N  NE1   . TRP P  3 89  ? -51.287  43.773  -4.202  1.00 53.37  ? 221  TRP F NE1   1 
ATOM   7566  C  CE2   . TRP P  3 89  ? -52.584  43.686  -4.635  1.00 54.82  ? 221  TRP F CE2   1 
ATOM   7567  C  CE3   . TRP P  3 89  ? -53.785  43.745  -6.735  1.00 56.13  ? 221  TRP F CE3   1 
ATOM   7568  C  CZ2   . TRP P  3 89  ? -53.764  43.516  -3.912  1.00 57.23  ? 221  TRP F CZ2   1 
ATOM   7569  C  CZ3   . TRP P  3 89  ? -54.959  43.575  -6.017  1.00 58.34  ? 221  TRP F CZ3   1 
ATOM   7570  C  CH2   . TRP P  3 89  ? -54.941  43.464  -4.617  1.00 58.72  ? 221  TRP F CH2   1 
ATOM   7571  N  N     . VAL P  3 90  ? -49.223  46.387  -9.786  1.00 60.01  ? 222  VAL F N     1 
ATOM   7572  C  CA    . VAL P  3 90  ? -48.988  46.800  -11.165 1.00 62.09  ? 222  VAL F CA    1 
ATOM   7573  C  C     . VAL P  3 90  ? -47.527  46.695  -11.518 1.00 62.57  ? 222  VAL F C     1 
ATOM   7574  O  O     . VAL P  3 90  ? -47.171  46.045  -12.495 1.00 63.94  ? 222  VAL F O     1 
ATOM   7575  C  CB    . VAL P  3 90  ? -49.435  48.236  -11.416 1.00 62.81  ? 222  VAL F CB    1 
ATOM   7576  C  CG1   . VAL P  3 90  ? -50.964  48.305  -11.464 1.00 63.69  ? 222  VAL F CG1   1 
ATOM   7577  C  CG2   . VAL P  3 90  ? -48.884  49.136  -10.318 1.00 64.49  ? 222  VAL F CG2   1 
ATOM   7578  N  N     . GLN P  3 91  ? -46.674  47.334  -10.731 1.00 62.87  ? 223  GLN F N     1 
ATOM   7579  C  CA    . GLN P  3 91  ? -45.256  47.266  -11.013 1.00 64.42  ? 223  GLN F CA    1 
ATOM   7580  C  C     . GLN P  3 91  ? -44.808  45.804  -11.014 1.00 64.53  ? 223  GLN F C     1 
ATOM   7581  O  O     . GLN P  3 91  ? -44.031  45.379  -11.872 1.00 65.04  ? 223  GLN F O     1 
ATOM   7582  C  CB    . GLN P  3 91  ? -44.473  48.093  -9.988  1.00 66.58  ? 223  GLN F CB    1 
ATOM   7583  C  CG    . GLN P  3 91  ? -45.001  48.019  -8.562  1.00 69.84  ? 223  GLN F CG    1 
ATOM   7584  C  CD    . GLN P  3 91  ? -44.423  49.111  -7.666  1.00 71.94  ? 223  GLN F CD    1 
ATOM   7585  O  OE1   . GLN P  3 91  ? -43.207  49.187  -7.460  1.00 72.88  ? 223  GLN F OE1   1 
ATOM   7586  N  NE2   . GLN P  3 91  ? -45.297  49.968  -7.133  1.00 72.47  ? 223  GLN F NE2   1 
ATOM   7587  N  N     . GLY P  3 92  ? -45.317  45.023  -10.069 1.00 63.77  ? 224  GLY F N     1 
ATOM   7588  C  CA    . GLY P  3 92  ? -44.944  43.625  -10.020 1.00 62.90  ? 224  GLY F CA    1 
ATOM   7589  C  C     . GLY P  3 92  ? -45.193  42.907  -11.337 1.00 62.96  ? 224  GLY F C     1 
ATOM   7590  O  O     . GLY P  3 92  ? -44.289  42.283  -11.889 1.00 62.75  ? 224  GLY F O     1 
ATOM   7591  N  N     . TRP P  3 93  ? -46.418  42.997  -11.848 1.00 63.21  ? 225  TRP F N     1 
ATOM   7592  C  CA    . TRP P  3 93  ? -46.782  42.327  -13.092 1.00 64.02  ? 225  TRP F CA    1 
ATOM   7593  C  C     . TRP P  3 93  ? -45.926  42.799  -14.250 1.00 65.69  ? 225  TRP F C     1 
ATOM   7594  O  O     . TRP P  3 93  ? -45.738  42.069  -15.224 1.00 65.83  ? 225  TRP F O     1 
ATOM   7595  C  CB    . TRP P  3 93  ? -48.256  42.570  -13.432 1.00 63.05  ? 225  TRP F CB    1 
ATOM   7596  C  CG    . TRP P  3 93  ? -49.214  42.226  -12.332 1.00 62.02  ? 225  TRP F CG    1 
ATOM   7597  C  CD1   . TRP P  3 93  ? -49.200  41.110  -11.548 1.00 62.17  ? 225  TRP F CD1   1 
ATOM   7598  C  CD2   . TRP P  3 93  ? -50.353  42.990  -11.919 1.00 61.50  ? 225  TRP F CD2   1 
ATOM   7599  N  NE1   . TRP P  3 93  ? -50.258  41.131  -10.670 1.00 61.55  ? 225  TRP F NE1   1 
ATOM   7600  C  CE2   . TRP P  3 93  ? -50.982  42.274  -10.878 1.00 61.23  ? 225  TRP F CE2   1 
ATOM   7601  C  CE3   . TRP P  3 93  ? -50.902  44.211  -12.326 1.00 61.07  ? 225  TRP F CE3   1 
ATOM   7602  C  CZ2   . TRP P  3 93  ? -52.131  42.737  -10.242 1.00 60.20  ? 225  TRP F CZ2   1 
ATOM   7603  C  CZ3   . TRP P  3 93  ? -52.045  44.671  -11.690 1.00 60.07  ? 225  TRP F CZ3   1 
ATOM   7604  C  CH2   . TRP P  3 93  ? -52.645  43.935  -10.660 1.00 60.07  ? 225  TRP F CH2   1 
ATOM   7605  N  N     . LYS P  3 94  ? -45.417  44.025  -14.141 1.00 67.49  ? 226  LYS F N     1 
ATOM   7606  C  CA    . LYS P  3 94  ? -44.575  44.612  -15.182 1.00 69.64  ? 226  LYS F CA    1 
ATOM   7607  C  C     . LYS P  3 94  ? -43.188  43.965  -15.230 1.00 69.75  ? 226  LYS F C     1 
ATOM   7608  O  O     . LYS P  3 94  ? -42.536  43.969  -16.279 1.00 70.99  ? 226  LYS F O     1 
ATOM   7609  C  CB    . LYS P  3 94  ? -44.402  46.121  -14.959 1.00 71.87  ? 226  LYS F CB    1 
ATOM   7610  C  CG    . LYS P  3 94  ? -45.677  46.951  -15.039 1.00 74.17  ? 226  LYS F CG    1 
ATOM   7611  C  CD    . LYS P  3 94  ? -45.489  48.158  -15.951 1.00 75.73  ? 226  LYS F CD    1 
ATOM   7612  C  CE    . LYS P  3 94  ? -45.606  47.746  -17.415 1.00 78.23  ? 226  LYS F CE    1 
ATOM   7613  N  NZ    . LYS P  3 94  ? -44.769  46.546  -17.746 1.00 80.49  ? 226  LYS F NZ    1 
ATOM   7614  N  N     . LYS P  3 95  ? -42.740  43.424  -14.096 1.00 68.38  ? 227  LYS F N     1 
ATOM   7615  C  CA    . LYS P  3 95  ? -41.430  42.774  -14.007 1.00 66.69  ? 227  LYS F CA    1 
ATOM   7616  C  C     . LYS P  3 95  ? -41.529  41.247  -13.928 1.00 65.47  ? 227  LYS F C     1 
ATOM   7617  O  O     . LYS P  3 95  ? -40.550  40.577  -13.596 1.00 65.20  ? 227  LYS F O     1 
ATOM   7618  C  CB    . LYS P  3 95  ? -40.680  43.277  -12.773 1.00 66.21  ? 227  LYS F CB    1 
ATOM   7619  C  CG    . LYS P  3 95  ? -40.344  44.761  -12.781 1.00 66.72  ? 227  LYS F CG    1 
ATOM   7620  C  CD    . LYS P  3 95  ? -40.334  45.316  -11.360 1.00 66.68  ? 227  LYS F CD    1 
ATOM   7621  C  CE    . LYS P  3 95  ? -39.572  44.402  -10.404 1.00 65.49  ? 227  LYS F CE    1 
ATOM   7622  N  NZ    . LYS P  3 95  ? -39.824  44.741  -8.977  1.00 64.62  ? 227  LYS F NZ    1 
ATOM   7623  N  N     . ASN P  3 96  ? -42.698  40.694  -14.237 1.00 63.85  ? 228  ASN F N     1 
ATOM   7624  C  CA    . ASN P  3 96  ? -42.863  39.253  -14.150 1.00 62.90  ? 228  ASN F CA    1 
ATOM   7625  C  C     . ASN P  3 96  ? -43.755  38.668  -15.235 1.00 61.99  ? 228  ASN F C     1 
ATOM   7626  O  O     . ASN P  3 96  ? -44.099  37.488  -15.204 1.00 60.74  ? 228  ASN F O     1 
ATOM   7627  C  CB    . ASN P  3 96  ? -43.401  38.881  -12.761 1.00 63.66  ? 228  ASN F CB    1 
ATOM   7628  C  CG    . ASN P  3 96  ? -44.898  38.659  -12.751 1.00 63.80  ? 228  ASN F CG    1 
ATOM   7629  O  OD1   . ASN P  3 96  ? -45.674  39.528  -13.158 1.00 63.58  ? 228  ASN F OD1   1 
ATOM   7630  N  ND2   . ASN P  3 96  ? -45.313  37.484  -12.281 1.00 63.16  ? 228  ASN F ND2   1 
ATOM   7631  N  N     . GLY P  3 97  ? -44.141  39.493  -16.194 1.00 61.87  ? 229  GLY F N     1 
ATOM   7632  C  CA    . GLY P  3 97  ? -44.962  38.987  -17.278 1.00 63.00  ? 229  GLY F CA    1 
ATOM   7633  C  C     . GLY P  3 97  ? -46.453  38.895  -17.028 1.00 63.28  ? 229  GLY F C     1 
ATOM   7634  O  O     . GLY P  3 97  ? -47.163  38.175  -17.739 1.00 62.96  ? 229  GLY F O     1 
ATOM   7635  N  N     . TRP P  3 98  ? -46.932  39.620  -16.023 1.00 63.34  ? 230  TRP F N     1 
ATOM   7636  C  CA    . TRP P  3 98  ? -48.356  39.627  -15.700 1.00 62.91  ? 230  TRP F CA    1 
ATOM   7637  C  C     . TRP P  3 98  ? -48.933  38.251  -15.392 1.00 62.11  ? 230  TRP F C     1 
ATOM   7638  O  O     . TRP P  3 98  ? -49.906  37.816  -16.011 1.00 61.99  ? 230  TRP F O     1 
ATOM   7639  C  CB    . TRP P  3 98  ? -49.150  40.277  -16.840 1.00 62.69  ? 230  TRP F CB    1 
ATOM   7640  C  CG    . TRP P  3 98  ? -48.855  41.731  -16.974 1.00 61.62  ? 230  TRP F CG    1 
ATOM   7641  C  CD1   . TRP P  3 98  ? -47.700  42.288  -17.421 1.00 61.51  ? 230  TRP F CD1   1 
ATOM   7642  C  CD2   . TRP P  3 98  ? -49.708  42.818  -16.597 1.00 61.37  ? 230  TRP F CD2   1 
ATOM   7643  N  NE1   . TRP P  3 98  ? -47.773  43.654  -17.344 1.00 61.99  ? 230  TRP F NE1   1 
ATOM   7644  C  CE2   . TRP P  3 98  ? -48.998  44.007  -16.843 1.00 61.14  ? 230  TRP F CE2   1 
ATOM   7645  C  CE3   . TRP P  3 98  ? -51.006  42.902  -16.073 1.00 61.28  ? 230  TRP F CE3   1 
ATOM   7646  C  CZ2   . TRP P  3 98  ? -49.540  45.267  -16.587 1.00 60.47  ? 230  TRP F CZ2   1 
ATOM   7647  C  CZ3   . TRP P  3 98  ? -51.544  44.151  -15.820 1.00 60.39  ? 230  TRP F CZ3   1 
ATOM   7648  C  CH2   . TRP P  3 98  ? -50.810  45.319  -16.078 1.00 60.88  ? 230  TRP F CH2   1 
ATOM   7649  N  N     . LYS P  3 99  ? -48.313  37.576  -14.431 1.00 61.15  ? 231  LYS F N     1 
ATOM   7650  C  CA    . LYS P  3 99  ? -48.749  36.263  -13.987 1.00 60.26  ? 231  LYS F CA    1 
ATOM   7651  C  C     . LYS P  3 99  ? -49.183  36.499  -12.551 1.00 59.26  ? 231  LYS F C     1 
ATOM   7652  O  O     . LYS P  3 99  ? -48.577  37.300  -11.838 1.00 58.64  ? 231  LYS F O     1 
ATOM   7653  C  CB    . LYS P  3 99  ? -47.585  35.270  -14.003 1.00 61.84  ? 231  LYS F CB    1 
ATOM   7654  C  CG    . LYS P  3 99  ? -46.741  35.284  -15.273 1.00 63.84  ? 231  LYS F CG    1 
ATOM   7655  C  CD    . LYS P  3 99  ? -45.493  34.420  -15.101 1.00 65.70  ? 231  LYS F CD    1 
ATOM   7656  C  CE    . LYS P  3 99  ? -44.487  34.646  -16.222 1.00 66.00  ? 231  LYS F CE    1 
ATOM   7657  N  NZ    . LYS P  3 99  ? -43.218  33.890  -15.995 1.00 66.62  ? 231  LYS F NZ    1 
ATOM   7658  N  N     . THR P  3 100 ? -50.223  35.813  -12.112 1.00 58.00  ? 232  THR F N     1 
ATOM   7659  C  CA    . THR P  3 100 ? -50.670  36.011  -10.750 1.00 57.23  ? 232  THR F CA    1 
ATOM   7660  C  C     . THR P  3 100 ? -49.955  35.057  -9.799  1.00 56.55  ? 232  THR F C     1 
ATOM   7661  O  O     . THR P  3 100 ? -49.113  34.266  -10.215 1.00 55.94  ? 232  THR F O     1 
ATOM   7662  C  CB    . THR P  3 100 ? -52.179  35.804  -10.645 1.00 57.29  ? 232  THR F CB    1 
ATOM   7663  O  OG1   . THR P  3 100 ? -52.653  36.402  -9.434  1.00 59.08  ? 232  THR F OG1   1 
ATOM   7664  C  CG2   . THR P  3 100 ? -52.515  34.320  -10.656 1.00 55.83  ? 232  THR F CG2   1 
ATOM   7665  N  N     . SER P  3 101 ? -50.280  35.148  -8.517  1.00 56.72  ? 233  SER F N     1 
ATOM   7666  C  CA    . SER P  3 101 ? -49.679  34.272  -7.522  1.00 57.19  ? 233  SER F CA    1 
ATOM   7667  C  C     . SER P  3 101 ? -49.962  32.828  -7.897  1.00 57.66  ? 233  SER F C     1 
ATOM   7668  O  O     . SER P  3 101 ? -49.295  31.912  -7.422  1.00 58.48  ? 233  SER F O     1 
ATOM   7669  C  CB    . SER P  3 101 ? -50.259  34.557  -6.139  1.00 56.60  ? 233  SER F CB    1 
ATOM   7670  O  OG    . SER P  3 101 ? -49.834  35.825  -5.685  1.00 57.54  ? 233  SER F OG    1 
ATOM   7671  N  N     . ALA P  3 102 ? -50.968  32.636  -8.744  1.00 57.31  ? 234  ALA F N     1 
ATOM   7672  C  CA    . ALA P  3 102 ? -51.345  31.308  -9.210  1.00 56.32  ? 234  ALA F CA    1 
ATOM   7673  C  C     . ALA P  3 102 ? -50.651  31.090  -10.545 1.00 55.57  ? 234  ALA F C     1 
ATOM   7674  O  O     . ALA P  3 102 ? -50.905  30.113  -11.245 1.00 54.15  ? 234  ALA F O     1 
ATOM   7675  C  CB    . ALA P  3 102 ? -52.859  31.218  -9.381  1.00 57.59  ? 234  ALA F CB    1 
ATOM   7676  N  N     . GLY P  3 103 ? -49.773  32.022  -10.889 1.00 55.37  ? 235  GLY F N     1 
ATOM   7677  C  CA    . GLY P  3 103 ? -49.048  31.923  -12.135 1.00 57.64  ? 235  GLY F CA    1 
ATOM   7678  C  C     . GLY P  3 103 ? -49.938  32.082  -13.351 1.00 59.79  ? 235  GLY F C     1 
ATOM   7679  O  O     . GLY P  3 103 ? -49.484  31.869  -14.481 1.00 59.92  ? 235  GLY F O     1 
ATOM   7680  N  N     . LYS P  3 104 ? -51.200  32.450  -13.127 1.00 61.38  ? 236  LYS F N     1 
ATOM   7681  C  CA    . LYS P  3 104 ? -52.153  32.648  -14.221 1.00 62.31  ? 236  LYS F CA    1 
ATOM   7682  C  C     . LYS P  3 104 ? -52.107  34.099  -14.724 1.00 62.86  ? 236  LYS F C     1 
ATOM   7683  O  O     . LYS P  3 104 ? -51.679  35.002  -13.994 1.00 62.13  ? 236  LYS F O     1 
ATOM   7684  C  CB    . LYS P  3 104 ? -53.566  32.285  -13.757 1.00 62.56  ? 236  LYS F CB    1 
ATOM   7685  C  CG    . LYS P  3 104 ? -53.765  30.804  -13.451 1.00 64.68  ? 236  LYS F CG    1 
ATOM   7686  C  CD    . LYS P  3 104 ? -55.224  30.494  -13.093 1.00 66.68  ? 236  LYS F CD    1 
ATOM   7687  C  CE    . LYS P  3 104 ? -55.522  28.986  -13.091 1.00 67.90  ? 236  LYS F CE    1 
ATOM   7688  N  NZ    . LYS P  3 104 ? -54.809  28.211  -12.023 1.00 68.14  ? 236  LYS F NZ    1 
ATOM   7689  N  N     . GLU P  3 105 ? -52.538  34.315  -15.969 1.00 63.33  ? 237  GLU F N     1 
ATOM   7690  C  CA    . GLU P  3 105 ? -52.525  35.653  -16.566 1.00 63.84  ? 237  GLU F CA    1 
ATOM   7691  C  C     . GLU P  3 105 ? -53.544  36.547  -15.883 1.00 61.81  ? 237  GLU F C     1 
ATOM   7692  O  O     . GLU P  3 105 ? -54.733  36.248  -15.927 1.00 61.28  ? 237  GLU F O     1 
ATOM   7693  C  CB    . GLU P  3 105 ? -52.838  35.575  -18.066 1.00 67.06  ? 237  GLU F CB    1 
ATOM   7694  C  CG    . GLU P  3 105 ? -51.822  36.311  -18.948 1.00 72.98  ? 237  GLU F CG    1 
ATOM   7695  C  CD    . GLU P  3 105 ? -52.155  36.255  -20.444 1.00 76.84  ? 237  GLU F CD    1 
ATOM   7696  O  OE1   . GLU P  3 105 ? -52.374  35.139  -20.977 1.00 78.37  ? 237  GLU F OE1   1 
ATOM   7697  O  OE2   . GLU P  3 105 ? -52.186  37.330  -21.090 1.00 78.21  ? 237  GLU F OE2   1 
ATOM   7698  N  N     . VAL P  3 106 ? -53.082  37.637  -15.258 1.00 59.91  ? 238  VAL F N     1 
ATOM   7699  C  CA    . VAL P  3 106 ? -53.986  38.555  -14.566 1.00 57.51  ? 238  VAL F CA    1 
ATOM   7700  C  C     . VAL P  3 106 ? -55.064  39.008  -15.541 1.00 57.35  ? 238  VAL F C     1 
ATOM   7701  O  O     . VAL P  3 106 ? -54.797  39.524  -16.629 1.00 56.28  ? 238  VAL F O     1 
ATOM   7702  C  CB    . VAL P  3 106 ? -53.242  39.776  -13.936 1.00 55.74  ? 238  VAL F CB    1 
ATOM   7703  C  CG1   . VAL P  3 106 ? -51.789  39.425  -13.698 1.00 54.80  ? 238  VAL F CG1   1 
ATOM   7704  C  CG2   . VAL P  3 106 ? -53.385  41.007  -14.790 1.00 55.42  ? 238  VAL F CG2   1 
ATOM   7705  N  N     . ILE P  3 107 ? -56.293  38.765  -15.120 1.00 57.33  ? 239  ILE F N     1 
ATOM   7706  C  CA    . ILE P  3 107 ? -57.487  39.041  -15.888 1.00 57.90  ? 239  ILE F CA    1 
ATOM   7707  C  C     . ILE P  3 107 ? -57.675  40.492  -16.299 1.00 58.21  ? 239  ILE F C     1 
ATOM   7708  O  O     . ILE P  3 107 ? -58.162  40.789  -17.393 1.00 58.39  ? 239  ILE F O     1 
ATOM   7709  C  CB    . ILE P  3 107 ? -58.694  38.542  -15.088 1.00 57.88  ? 239  ILE F CB    1 
ATOM   7710  C  CG1   . ILE P  3 107 ? -58.182  37.924  -13.777 1.00 55.97  ? 239  ILE F CG1   1 
ATOM   7711  C  CG2   . ILE P  3 107 ? -59.488  37.524  -15.911 1.00 58.43  ? 239  ILE F CG2   1 
ATOM   7712  C  CD1   . ILE P  3 107 ? -59.085  36.903  -13.146 1.00 56.21  ? 239  ILE F CD1   1 
ATOM   7713  N  N     . ASN P  3 108 ? -57.270  41.400  -15.430 1.00 57.57  ? 240  ASN F N     1 
ATOM   7714  C  CA    . ASN P  3 108 ? -57.428  42.806  -15.727 1.00 57.34  ? 240  ASN F CA    1 
ATOM   7715  C  C     . ASN P  3 108 ? -56.103  43.418  -16.157 1.00 58.05  ? 240  ASN F C     1 
ATOM   7716  O  O     . ASN P  3 108 ? -55.720  44.500  -15.709 1.00 57.97  ? 240  ASN F O     1 
ATOM   7717  C  CB    . ASN P  3 108 ? -57.989  43.498  -14.496 1.00 57.13  ? 240  ASN F CB    1 
ATOM   7718  C  CG    . ASN P  3 108 ? -59.024  42.649  -13.794 1.00 56.02  ? 240  ASN F CG    1 
ATOM   7719  O  OD1   . ASN P  3 108 ? -58.686  41.756  -13.012 1.00 54.51  ? 240  ASN F OD1   1 
ATOM   7720  N  ND2   . ASN P  3 108 ? -60.295  42.903  -14.090 1.00 55.48  ? 240  ASN F ND2   1 
ATOM   7721  N  N     . LYS P  3 109 ? -55.411  42.696  -17.035 1.00 59.02  ? 241  LYS F N     1 
ATOM   7722  C  CA    . LYS P  3 109 ? -54.116  43.108  -17.588 1.00 58.63  ? 241  LYS F CA    1 
ATOM   7723  C  C     . LYS P  3 109 ? -54.405  44.366  -18.398 1.00 57.11  ? 241  LYS F C     1 
ATOM   7724  O  O     . LYS P  3 109 ? -54.068  45.491  -18.009 1.00 55.56  ? 241  LYS F O     1 
ATOM   7725  C  CB    . LYS P  3 109 ? -53.604  41.996  -18.516 1.00 60.14  ? 241  LYS F CB    1 
ATOM   7726  C  CG    . LYS P  3 109 ? -52.103  41.950  -18.788 1.00 61.80  ? 241  LYS F CG    1 
ATOM   7727  C  CD    . LYS P  3 109 ? -51.572  43.160  -19.547 1.00 62.05  ? 241  LYS F CD    1 
ATOM   7728  C  CE    . LYS P  3 109 ? -50.113  42.942  -19.948 1.00 60.84  ? 241  LYS F CE    1 
ATOM   7729  N  NZ    . LYS P  3 109 ? -49.948  41.762  -20.851 1.00 59.42  ? 241  LYS F NZ    1 
ATOM   7730  N  N     . GLU P  3 110 ? -55.046  44.130  -19.535 1.00 55.80  ? 242  GLU F N     1 
ATOM   7731  C  CA    . GLU P  3 110 ? -55.469  45.168  -20.451 1.00 54.87  ? 242  GLU F CA    1 
ATOM   7732  C  C     . GLU P  3 110 ? -55.928  46.348  -19.600 1.00 51.56  ? 242  GLU F C     1 
ATOM   7733  O  O     . GLU P  3 110 ? -55.261  47.379  -19.531 1.00 51.02  ? 242  GLU F O     1 
ATOM   7734  C  CB    . GLU P  3 110 ? -56.617  44.598  -21.286 1.00 58.69  ? 242  GLU F CB    1 
ATOM   7735  C  CG    . GLU P  3 110 ? -57.199  45.474  -22.377 1.00 63.55  ? 242  GLU F CG    1 
ATOM   7736  C  CD    . GLU P  3 110 ? -58.236  44.713  -23.212 1.00 66.99  ? 242  GLU F CD    1 
ATOM   7737  O  OE1   . GLU P  3 110 ? -57.828  43.850  -24.032 1.00 67.11  ? 242  GLU F OE1   1 
ATOM   7738  O  OE2   . GLU P  3 110 ? -59.457  44.963  -23.033 1.00 68.89  ? 242  GLU F OE2   1 
ATOM   7739  N  N     . ASP P  3 111 ? -57.053  46.165  -18.924 1.00 47.72  ? 243  ASP F N     1 
ATOM   7740  C  CA    . ASP P  3 111 ? -57.621  47.190  -18.066 1.00 45.68  ? 243  ASP F CA    1 
ATOM   7741  C  C     . ASP P  3 111 ? -56.592  47.963  -17.235 1.00 42.63  ? 243  ASP F C     1 
ATOM   7742  O  O     . ASP P  3 111 ? -56.497  49.181  -17.315 1.00 39.49  ? 243  ASP F O     1 
ATOM   7743  C  CB    . ASP P  3 111 ? -58.647  46.547  -17.137 1.00 49.42  ? 243  ASP F CB    1 
ATOM   7744  C  CG    . ASP P  3 111 ? -59.672  45.713  -17.888 1.00 53.35  ? 243  ASP F CG    1 
ATOM   7745  O  OD1   . ASP P  3 111 ? -60.482  46.301  -18.644 1.00 54.71  ? 243  ASP F OD1   1 
ATOM   7746  O  OD2   . ASP P  3 111 ? -59.661  44.468  -17.722 1.00 54.69  ? 243  ASP F OD2   1 
ATOM   7747  N  N     . PHE P  3 112 ? -55.816  47.264  -16.428 1.00 41.85  ? 244  PHE F N     1 
ATOM   7748  C  CA    . PHE P  3 112 ? -54.839  47.957  -15.609 1.00 43.81  ? 244  PHE F CA    1 
ATOM   7749  C  C     . PHE P  3 112 ? -53.780  48.702  -16.413 1.00 47.24  ? 244  PHE F C     1 
ATOM   7750  O  O     . PHE P  3 112 ? -53.349  49.797  -16.022 1.00 48.43  ? 244  PHE F O     1 
ATOM   7751  C  CB    . PHE P  3 112 ? -54.163  46.986  -14.648 1.00 41.60  ? 244  PHE F CB    1 
ATOM   7752  C  CG    . PHE P  3 112 ? -54.708  47.041  -13.251 1.00 38.50  ? 244  PHE F CG    1 
ATOM   7753  C  CD1   . PHE P  3 112 ? -54.502  48.163  -12.458 1.00 36.69  ? 244  PHE F CD1   1 
ATOM   7754  C  CD2   . PHE P  3 112 ? -55.436  45.974  -12.730 1.00 36.41  ? 244  PHE F CD2   1 
ATOM   7755  C  CE1   . PHE P  3 112 ? -55.007  48.224  -11.161 1.00 36.19  ? 244  PHE F CE1   1 
ATOM   7756  C  CE2   . PHE P  3 112 ? -55.942  46.026  -11.441 1.00 35.75  ? 244  PHE F CE2   1 
ATOM   7757  C  CZ    . PHE P  3 112 ? -55.729  47.159  -10.651 1.00 35.18  ? 244  PHE F CZ    1 
ATOM   7758  N  N     . VAL P  3 113 ? -53.348  48.124  -17.531 1.00 48.77  ? 245  VAL F N     1 
ATOM   7759  C  CA    . VAL P  3 113 ? -52.336  48.780  -18.360 1.00 49.73  ? 245  VAL F CA    1 
ATOM   7760  C  C     . VAL P  3 113 ? -52.764  50.206  -18.714 1.00 50.73  ? 245  VAL F C     1 
ATOM   7761  O  O     . VAL P  3 113 ? -52.049  51.182  -18.440 1.00 50.34  ? 245  VAL F O     1 
ATOM   7762  C  CB    . VAL P  3 113 ? -52.120  48.020  -19.667 1.00 49.44  ? 245  VAL F CB    1 
ATOM   7763  C  CG1   . VAL P  3 113 ? -51.103  48.751  -20.521 1.00 49.50  ? 245  VAL F CG1   1 
ATOM   7764  C  CG2   . VAL P  3 113 ? -51.667  46.599  -19.369 1.00 50.96  ? 245  VAL F CG2   1 
ATOM   7765  N  N     . ALA P  3 114 ? -53.948  50.290  -19.320 1.00 51.26  ? 246  ALA F N     1 
ATOM   7766  C  CA    . ALA P  3 114 ? -54.564  51.536  -19.769 1.00 50.19  ? 246  ALA F CA    1 
ATOM   7767  C  C     . ALA P  3 114 ? -54.755  52.592  -18.687 1.00 49.10  ? 246  ALA F C     1 
ATOM   7768  O  O     . ALA P  3 114 ? -54.930  53.767  -18.999 1.00 47.90  ? 246  ALA F O     1 
ATOM   7769  C  CB    . ALA P  3 114 ? -55.898  51.226  -20.431 1.00 50.62  ? 246  ALA F CB    1 
ATOM   7770  N  N     . LEU P  3 115 ? -54.755  52.184  -17.423 1.00 48.62  ? 247  LEU F N     1 
ATOM   7771  C  CA    . LEU P  3 115 ? -54.888  53.165  -16.361 1.00 49.49  ? 247  LEU F CA    1 
ATOM   7772  C  C     . LEU P  3 115 ? -53.512  53.784  -16.168 1.00 51.62  ? 247  LEU F C     1 
ATOM   7773  O  O     . LEU P  3 115 ? -53.352  55.005  -16.224 1.00 51.05  ? 247  LEU F O     1 
ATOM   7774  C  CB    . LEU P  3 115 ? -55.343  52.520  -15.053 1.00 47.08  ? 247  LEU F CB    1 
ATOM   7775  C  CG    . LEU P  3 115 ? -55.330  53.477  -13.853 1.00 45.03  ? 247  LEU F CG    1 
ATOM   7776  C  CD1   . LEU P  3 115 ? -56.295  54.621  -14.085 1.00 43.67  ? 247  LEU F CD1   1 
ATOM   7777  C  CD2   . LEU P  3 115 ? -55.707  52.733  -12.596 1.00 44.32  ? 247  LEU F CD2   1 
ATOM   7778  N  N     . GLU P  3 116 ? -52.514  52.928  -15.964 1.00 54.70  ? 248  GLU F N     1 
ATOM   7779  C  CA    . GLU P  3 116 ? -51.143  53.388  -15.757 1.00 57.90  ? 248  GLU F CA    1 
ATOM   7780  C  C     . GLU P  3 116 ? -50.758  54.384  -16.832 1.00 58.69  ? 248  GLU F C     1 
ATOM   7781  O  O     . GLU P  3 116 ? -50.170  55.430  -16.542 1.00 58.80  ? 248  GLU F O     1 
ATOM   7782  C  CB    . GLU P  3 116 ? -50.159  52.211  -15.785 1.00 59.85  ? 248  GLU F CB    1 
ATOM   7783  C  CG    . GLU P  3 116 ? -48.743  52.587  -15.336 1.00 61.69  ? 248  GLU F CG    1 
ATOM   7784  C  CD    . GLU P  3 116 ? -47.806  51.397  -15.258 0.00 61.23  ? 248  GLU F CD    1 
ATOM   7785  O  OE1   . GLU P  3 116 ? -48.113  50.443  -14.512 0.00 61.47  ? 248  GLU F OE1   1 
ATOM   7786  O  OE2   . GLU P  3 116 ? -46.758  51.418  -15.938 0.00 61.47  ? 248  GLU F OE2   1 
ATOM   7787  N  N     . ARG P  3 117 ? -51.088  54.053  -18.076 1.00 59.64  ? 249  ARG F N     1 
ATOM   7788  C  CA    . ARG P  3 117 ? -50.770  54.937  -19.181 1.00 60.41  ? 249  ARG F CA    1 
ATOM   7789  C  C     . ARG P  3 117 ? -51.174  56.344  -18.802 1.00 59.56  ? 249  ARG F C     1 
ATOM   7790  O  O     . ARG P  3 117 ? -50.379  57.277  -18.890 1.00 60.32  ? 249  ARG F O     1 
ATOM   7791  C  CB    . ARG P  3 117 ? -51.508  54.528  -20.461 1.00 62.71  ? 249  ARG F CB    1 
ATOM   7792  C  CG    . ARG P  3 117 ? -51.039  55.321  -21.682 1.00 65.72  ? 249  ARG F CG    1 
ATOM   7793  C  CD    . ARG P  3 117 ? -49.506  55.392  -21.652 1.00 70.90  ? 249  ARG F CD    1 
ATOM   7794  N  NE    . ARG P  3 117 ? -48.875  55.997  -22.824 1.00 72.40  ? 249  ARG F NE    1 
ATOM   7795  C  CZ    . ARG P  3 117 ? -47.559  56.000  -23.026 1.00 72.82  ? 249  ARG F CZ    1 
ATOM   7796  N  NH1   . ARG P  3 117 ? -46.749  55.432  -22.134 1.00 71.96  ? 249  ARG F NH1   1 
ATOM   7797  N  NH2   . ARG P  3 117 ? -47.054  56.560  -24.120 1.00 73.74  ? 249  ARG F NH2   1 
ATOM   7798  N  N     . LEU P  3 118 ? -52.416  56.491  -18.366 1.00 58.17  ? 250  LEU F N     1 
ATOM   7799  C  CA    . LEU P  3 118 ? -52.908  57.794  -17.979 1.00 57.55  ? 250  LEU F CA    1 
ATOM   7800  C  C     . LEU P  3 118 ? -52.208  58.261  -16.715 1.00 57.71  ? 250  LEU F C     1 
ATOM   7801  O  O     . LEU P  3 118 ? -51.951  59.450  -16.544 1.00 58.25  ? 250  LEU F O     1 
ATOM   7802  C  CB    . LEU P  3 118 ? -54.420  57.740  -17.791 1.00 55.66  ? 250  LEU F CB    1 
ATOM   7803  C  CG    . LEU P  3 118 ? -55.228  57.841  -19.091 1.00 54.06  ? 250  LEU F CG    1 
ATOM   7804  C  CD1   . LEU P  3 118 ? -54.899  56.674  -19.999 1.00 54.46  ? 250  LEU F CD1   1 
ATOM   7805  C  CD2   . LEU P  3 118 ? -56.707  57.856  -18.778 1.00 53.79  ? 250  LEU F CD2   1 
ATOM   7806  N  N     . THR P  3 119 ? -51.882  57.320  -15.841 1.00 58.19  ? 251  THR F N     1 
ATOM   7807  C  CA    . THR P  3 119 ? -51.193  57.650  -14.603 1.00 59.45  ? 251  THR F CA    1 
ATOM   7808  C  C     . THR P  3 119 ? -49.979  58.491  -14.971 1.00 60.08  ? 251  THR F C     1 
ATOM   7809  O  O     . THR P  3 119 ? -49.616  59.428  -14.258 1.00 60.91  ? 251  THR F O     1 
ATOM   7810  C  CB    . THR P  3 119 ? -50.696  56.376  -13.880 1.00 60.36  ? 251  THR F CB    1 
ATOM   7811  O  OG1   . THR P  3 119 ? -51.773  55.440  -13.765 1.00 61.68  ? 251  THR F OG1   1 
ATOM   7812  C  CG2   . THR P  3 119 ? -50.184  56.708  -12.485 1.00 60.53  ? 251  THR F CG2   1 
ATOM   7813  N  N     . GLN P  3 120 ? -49.368  58.153  -16.102 1.00 60.43  ? 252  GLN F N     1 
ATOM   7814  C  CA    . GLN P  3 120 ? -48.178  58.840  -16.591 1.00 60.95  ? 252  GLN F CA    1 
ATOM   7815  C  C     . GLN P  3 120 ? -48.270  60.352  -16.645 1.00 60.48  ? 252  GLN F C     1 
ATOM   7816  O  O     . GLN P  3 120 ? -49.238  60.923  -17.150 1.00 59.75  ? 252  GLN F O     1 
ATOM   7817  C  CB    . GLN P  3 120 ? -47.808  58.317  -17.976 1.00 63.25  ? 252  GLN F CB    1 
ATOM   7818  C  CG    . GLN P  3 120 ? -47.563  56.826  -17.998 1.00 66.53  ? 252  GLN F CG    1 
ATOM   7819  C  CD    . GLN P  3 120 ? -46.384  56.426  -17.134 1.00 68.66  ? 252  GLN F CD    1 
ATOM   7820  O  OE1   . GLN P  3 120 ? -46.043  57.113  -16.162 1.00 68.19  ? 252  GLN F OE1   1 
ATOM   7821  N  NE2   . GLN P  3 120 ? -45.759  55.300  -17.475 1.00 70.26  ? 252  GLN F NE2   1 
ATOM   7822  N  N     . GLY P  3 121 ? -47.236  60.994  -16.120 1.00 60.58  ? 253  GLY F N     1 
ATOM   7823  C  CA    . GLY P  3 121 ? -47.185  62.442  -16.122 1.00 61.09  ? 253  GLY F CA    1 
ATOM   7824  C  C     . GLY P  3 121 ? -48.164  63.085  -15.168 1.00 60.73  ? 253  GLY F C     1 
ATOM   7825  O  O     . GLY P  3 121 ? -48.552  64.240  -15.350 1.00 61.05  ? 253  GLY F O     1 
ATOM   7826  N  N     . MET P  3 122 ? -48.564  62.344  -14.143 1.00 60.26  ? 254  MET F N     1 
ATOM   7827  C  CA    . MET P  3 122 ? -49.506  62.882  -13.180 1.00 59.42  ? 254  MET F CA    1 
ATOM   7828  C  C     . MET P  3 122 ? -49.246  62.421  -11.760 1.00 57.87  ? 254  MET F C     1 
ATOM   7829  O  O     . MET P  3 122 ? -48.682  61.345  -11.527 1.00 57.73  ? 254  MET F O     1 
ATOM   7830  C  CB    . MET P  3 122 ? -50.926  62.496  -13.569 1.00 60.82  ? 254  MET F CB    1 
ATOM   7831  C  CG    . MET P  3 122 ? -51.280  62.810  -14.997 1.00 63.59  ? 254  MET F CG    1 
ATOM   7832  S  SD    . MET P  3 122 ? -53.039  63.100  -15.114 1.00 68.15  ? 254  MET F SD    1 
ATOM   7833  C  CE    . MET P  3 122 ? -53.101  64.867  -14.826 1.00 66.61  ? 254  MET F CE    1 
ATOM   7834  N  N     . ASP P  3 123 ? -49.663  63.252  -10.814 1.00 55.53  ? 255  ASP F N     1 
ATOM   7835  C  CA    . ASP P  3 123 ? -49.512  62.936  -9.410  1.00 54.20  ? 255  ASP F CA    1 
ATOM   7836  C  C     . ASP P  3 123 ? -50.881  62.627  -8.810  1.00 53.20  ? 255  ASP F C     1 
ATOM   7837  O  O     . ASP P  3 123 ? -51.535  63.483  -8.212  1.00 52.59  ? 255  ASP F O     1 
ATOM   7838  C  CB    . ASP P  3 123 ? -48.854  64.093  -8.670  1.00 55.74  ? 255  ASP F CB    1 
ATOM   7839  C  CG    . ASP P  3 123 ? -48.903  63.917  -7.165  1.00 58.63  ? 255  ASP F CG    1 
ATOM   7840  O  OD1   . ASP P  3 123 ? -49.923  64.302  -6.551  1.00 60.89  ? 255  ASP F OD1   1 
ATOM   7841  O  OD2   . ASP P  3 123 ? -47.930  63.381  -6.593  1.00 60.12  ? 255  ASP F OD2   1 
ATOM   7842  N  N     . ILE P  3 124 ? -51.315  61.387  -8.999  1.00 51.27  ? 256  ILE F N     1 
ATOM   7843  C  CA    . ILE P  3 124 ? -52.585  60.929  -8.480  1.00 49.62  ? 256  ILE F CA    1 
ATOM   7844  C  C     . ILE P  3 124 ? -52.375  60.486  -7.041  1.00 50.27  ? 256  ILE F C     1 
ATOM   7845  O  O     . ILE P  3 124 ? -51.299  60.042  -6.666  1.00 51.28  ? 256  ILE F O     1 
ATOM   7846  C  CB    . ILE P  3 124 ? -53.078  59.725  -9.261  1.00 48.62  ? 256  ILE F CB    1 
ATOM   7847  C  CG1   . ILE P  3 124 ? -52.998  60.013  -10.755 1.00 49.15  ? 256  ILE F CG1   1 
ATOM   7848  C  CG2   . ILE P  3 124 ? -54.495  59.395  -8.854  1.00 49.44  ? 256  ILE F CG2   1 
ATOM   7849  C  CD1   . ILE P  3 124 ? -53.275  58.794  -11.637 1.00 50.23  ? 256  ILE F CD1   1 
ATOM   7850  N  N     . GLN P  3 125 ? -53.399  60.603  -6.219  1.00 50.36  ? 257  GLN F N     1 
ATOM   7851  C  CA    . GLN P  3 125 ? -53.254  60.171  -4.850  1.00 50.40  ? 257  GLN F CA    1 
ATOM   7852  C  C     . GLN P  3 125 ? -54.521  59.424  -4.492  1.00 50.53  ? 257  GLN F C     1 
ATOM   7853  O  O     . GLN P  3 125 ? -55.485  60.013  -3.991  1.00 50.68  ? 257  GLN F O     1 
ATOM   7854  C  CB    . GLN P  3 125 ? -53.055  61.374  -3.941  1.00 51.70  ? 257  GLN F CB    1 
ATOM   7855  C  CG    . GLN P  3 125 ? -52.336  61.016  -2.674  1.00 55.62  ? 257  GLN F CG    1 
ATOM   7856  C  CD    . GLN P  3 125 ? -51.786  62.218  -1.965  1.00 58.64  ? 257  GLN F CD    1 
ATOM   7857  O  OE1   . GLN P  3 125 ? -51.255  63.137  -2.599  1.00 60.42  ? 257  GLN F OE1   1 
ATOM   7858  N  NE2   . GLN P  3 125 ? -51.885  62.219  -0.636  1.00 60.79  ? 257  GLN F NE2   1 
ATOM   7859  N  N     . TRP P  3 126 ? -54.509  58.120  -4.756  1.00 49.75  ? 258  TRP F N     1 
ATOM   7860  C  CA    . TRP P  3 126 ? -55.663  57.261  -4.508  1.00 49.12  ? 258  TRP F CA    1 
ATOM   7861  C  C     . TRP P  3 126 ? -56.178  57.244  -3.078  1.00 49.24  ? 258  TRP F C     1 
ATOM   7862  O  O     . TRP P  3 126 ? -55.423  57.192  -2.116  1.00 49.39  ? 258  TRP F O     1 
ATOM   7863  C  CB    . TRP P  3 126 ? -55.354  55.856  -4.995  1.00 47.71  ? 258  TRP F CB    1 
ATOM   7864  C  CG    . TRP P  3 126 ? -54.890  55.900  -6.397  1.00 47.33  ? 258  TRP F CG    1 
ATOM   7865  C  CD1   . TRP P  3 126 ? -53.655  56.264  -6.835  1.00 47.81  ? 258  TRP F CD1   1 
ATOM   7866  C  CD2   . TRP P  3 126 ? -55.679  55.671  -7.565  1.00 47.46  ? 258  TRP F CD2   1 
ATOM   7867  N  NE1   . TRP P  3 126 ? -53.623  56.282  -8.205  1.00 48.08  ? 258  TRP F NE1   1 
ATOM   7868  C  CE2   . TRP P  3 126 ? -54.854  55.920  -8.680  1.00 47.66  ? 258  TRP F CE2   1 
ATOM   7869  C  CE3   . TRP P  3 126 ? -57.005  55.280  -7.777  1.00 47.44  ? 258  TRP F CE3   1 
ATOM   7870  C  CZ2   . TRP P  3 126 ? -55.311  55.792  -9.995  1.00 48.18  ? 258  TRP F CZ2   1 
ATOM   7871  C  CZ3   . TRP P  3 126 ? -57.461  55.153  -9.082  1.00 48.47  ? 258  TRP F CZ3   1 
ATOM   7872  C  CH2   . TRP P  3 126 ? -56.612  55.409  -10.177 1.00 48.40  ? 258  TRP F CH2   1 
ATOM   7873  N  N     . MET P  3 127 ? -57.491  57.279  -2.954  1.00 49.85  ? 259  MET F N     1 
ATOM   7874  C  CA    . MET P  3 127 ? -58.111  57.324  -1.655  1.00 50.94  ? 259  MET F CA    1 
ATOM   7875  C  C     . MET P  3 127 ? -59.159  56.240  -1.515  1.00 50.74  ? 259  MET F C     1 
ATOM   7876  O  O     . MET P  3 127 ? -60.141  56.221  -2.255  1.00 52.42  ? 259  MET F O     1 
ATOM   7877  C  CB    . MET P  3 127 ? -58.759  58.691  -1.483  1.00 53.23  ? 259  MET F CB    1 
ATOM   7878  C  CG    . MET P  3 127 ? -58.415  59.393  -0.194  1.00 56.57  ? 259  MET F CG    1 
ATOM   7879  S  SD    . MET P  3 127 ? -56.660  59.571  0.035   1.00 59.43  ? 259  MET F SD    1 
ATOM   7880  C  CE    . MET P  3 127 ? -56.526  59.138  1.794   1.00 60.37  ? 259  MET F CE    1 
ATOM   7881  N  N     . HIS P  3 128 ? -58.957  55.333  -0.571  1.00 49.25  ? 260  HIS F N     1 
ATOM   7882  C  CA    . HIS P  3 128 ? -59.933  54.280  -0.358  1.00 47.88  ? 260  HIS F CA    1 
ATOM   7883  C  C     . HIS P  3 128 ? -60.983  54.830  0.580   1.00 46.50  ? 260  HIS F C     1 
ATOM   7884  O  O     . HIS P  3 128 ? -60.688  55.688  1.410   1.00 45.59  ? 260  HIS F O     1 
ATOM   7885  C  CB    . HIS P  3 128 ? -59.294  53.065  0.295   1.00 49.94  ? 260  HIS F CB    1 
ATOM   7886  C  CG    . HIS P  3 128 ? -60.265  51.971  0.606   1.00 52.01  ? 260  HIS F CG    1 
ATOM   7887  N  ND1   . HIS P  3 128 ? -60.853  51.197  -0.372  1.00 53.96  ? 260  HIS F ND1   1 
ATOM   7888  C  CD2   . HIS P  3 128 ? -60.762  51.528  1.786   1.00 53.09  ? 260  HIS F CD2   1 
ATOM   7889  C  CE1   . HIS P  3 128 ? -61.670  50.324  0.191   1.00 54.22  ? 260  HIS F CE1   1 
ATOM   7890  N  NE2   . HIS P  3 128 ? -61.633  50.504  1.500   1.00 54.65  ? 260  HIS F NE2   1 
ATOM   7891  N  N     . VAL P  3 129 ? -62.205  54.336  0.461   1.00 44.65  ? 261  VAL F N     1 
ATOM   7892  C  CA    . VAL P  3 129 ? -63.253  54.809  1.337   1.00 44.41  ? 261  VAL F CA    1 
ATOM   7893  C  C     . VAL P  3 129 ? -64.161  53.697  1.813   1.00 44.04  ? 261  VAL F C     1 
ATOM   7894  O  O     . VAL P  3 129 ? -65.046  53.241  1.090   1.00 44.34  ? 261  VAL F O     1 
ATOM   7895  C  CB    . VAL P  3 129 ? -64.100  55.861  0.657   1.00 44.69  ? 261  VAL F CB    1 
ATOM   7896  C  CG1   . VAL P  3 129 ? -63.273  57.113  0.418   1.00 45.42  ? 261  VAL F CG1   1 
ATOM   7897  C  CG2   . VAL P  3 129 ? -64.631  55.305  -0.639  1.00 45.59  ? 261  VAL F CG2   1 
ATOM   7898  N  N     . PRO P  3 130 ? -63.957  53.257  3.054   1.00 43.07  ? 262  PRO F N     1 
ATOM   7899  C  CA    . PRO P  3 130 ? -64.737  52.196  3.674   1.00 43.87  ? 262  PRO F CA    1 
ATOM   7900  C  C     . PRO P  3 130 ? -66.210  52.177  3.236   1.00 45.52  ? 262  PRO F C     1 
ATOM   7901  O  O     . PRO P  3 130 ? -66.888  53.219  3.158   1.00 44.41  ? 262  PRO F O     1 
ATOM   7902  C  CB    . PRO P  3 130 ? -64.553  52.475  5.159   1.00 43.16  ? 262  PRO F CB    1 
ATOM   7903  C  CG    . PRO P  3 130 ? -63.143  52.949  5.214   1.00 42.57  ? 262  PRO F CG    1 
ATOM   7904  C  CD    . PRO P  3 130 ? -63.034  53.867  4.024   1.00 42.67  ? 262  PRO F CD    1 
ATOM   7905  N  N     . GLY P  3 131 ? -66.662  50.955  2.947   1.00 46.95  ? 263  GLY F N     1 
ATOM   7906  C  CA    . GLY P  3 131 ? -68.020  50.648  2.514   1.00 47.24  ? 263  GLY F CA    1 
ATOM   7907  C  C     . GLY P  3 131 ? -69.104  51.709  2.559   1.00 47.05  ? 263  GLY F C     1 
ATOM   7908  O  O     . GLY P  3 131 ? -69.726  51.994  1.550   1.00 48.02  ? 263  GLY F O     1 
ATOM   7909  N  N     . HIS P  3 132 ? -69.396  52.279  3.709   1.00 45.79  ? 264  HIS F N     1 
ATOM   7910  C  CA    . HIS P  3 132 ? -70.409  53.294  3.678   1.00 45.19  ? 264  HIS F CA    1 
ATOM   7911  C  C     . HIS P  3 132 ? -69.962  54.372  4.576   1.00 45.94  ? 264  HIS F C     1 
ATOM   7912  O  O     . HIS P  3 132 ? -70.107  54.264  5.769   1.00 45.51  ? 264  HIS F O     1 
ATOM   7913  C  CB    . HIS P  3 132 ? -71.754  52.786  4.154   1.00 44.01  ? 264  HIS F CB    1 
ATOM   7914  C  CG    . HIS P  3 132 ? -72.216  51.551  3.466   1.00 45.27  ? 264  HIS F CG    1 
ATOM   7915  N  ND1   . HIS P  3 132 ? -72.418  50.372  4.146   1.00 45.11  ? 264  HIS F ND1   1 
ATOM   7916  C  CD2   . HIS P  3 132 ? -72.557  51.311  2.179   1.00 45.68  ? 264  HIS F CD2   1 
ATOM   7917  C  CE1   . HIS P  3 132 ? -72.866  49.453  3.309   1.00 44.73  ? 264  HIS F CE1   1 
ATOM   7918  N  NE2   . HIS P  3 132 ? -72.959  49.997  2.110   1.00 45.09  ? 264  HIS F NE2   1 
ATOM   7919  N  N     . SER P  3 133 ? -69.416  55.425  4.002   1.00 47.46  ? 265  SER F N     1 
ATOM   7920  C  CA    . SER P  3 133 ? -68.967  56.524  4.824   1.00 50.12  ? 265  SER F CA    1 
ATOM   7921  C  C     . SER P  3 133 ? -68.068  57.460  4.043   1.00 50.91  ? 265  SER F C     1 
ATOM   7922  O  O     . SER P  3 133 ? -67.814  57.224  2.872   1.00 52.74  ? 265  SER F O     1 
ATOM   7923  C  CB    . SER P  3 133 ? -68.211  55.975  6.036   1.00 50.47  ? 265  SER F CB    1 
ATOM   7924  O  OG    . SER P  3 133 ? -66.871  55.633  5.665   1.00 50.28  ? 265  SER F OG    1 
ATOM   7925  N  N     . GLY P  3 134 ? -67.556  58.495  4.699   1.00 50.59  ? 266  GLY F N     1 
ATOM   7926  C  CA    . GLY P  3 134 ? -66.679  59.401  3.998   1.00 49.80  ? 266  GLY F CA    1 
ATOM   7927  C  C     . GLY P  3 134 ? -67.423  60.671  3.725   1.00 48.87  ? 266  GLY F C     1 
ATOM   7928  O  O     . GLY P  3 134 ? -67.748  61.365  4.666   1.00 50.31  ? 266  GLY F O     1 
ATOM   7929  N  N     . PHE P  3 135 ? -67.658  61.014  2.469   1.00 46.63  ? 267  PHE F N     1 
ATOM   7930  C  CA    . PHE P  3 135 ? -68.394  62.228  2.197   1.00 45.14  ? 267  PHE F CA    1 
ATOM   7931  C  C     . PHE P  3 135 ? -69.401  61.832  1.169   1.00 43.73  ? 267  PHE F C     1 
ATOM   7932  O  O     . PHE P  3 135 ? -69.171  60.909  0.435   1.00 44.09  ? 267  PHE F O     1 
ATOM   7933  C  CB    . PHE P  3 135 ? -67.510  63.324  1.614   1.00 46.06  ? 267  PHE F CB    1 
ATOM   7934  C  CG    . PHE P  3 135 ? -66.694  64.076  2.625   1.00 48.40  ? 267  PHE F CG    1 
ATOM   7935  C  CD1   . PHE P  3 135 ? -67.188  64.328  3.878   1.00 48.91  ? 267  PHE F CD1   1 
ATOM   7936  C  CD2   . PHE P  3 135 ? -65.440  64.565  2.300   1.00 49.78  ? 267  PHE F CD2   1 
ATOM   7937  C  CE1   . PHE P  3 135 ? -66.467  65.024  4.771   1.00 50.00  ? 267  PHE F CE1   1 
ATOM   7938  C  CE2   . PHE P  3 135 ? -64.712  65.275  3.225   1.00 50.00  ? 267  PHE F CE2   1 
ATOM   7939  C  CZ    . PHE P  3 135 ? -65.227  65.494  4.436   1.00 49.51  ? 267  PHE F CZ    1 
ATOM   7940  N  N     . ILE P  3 136 ? -70.514  62.549  1.123   1.00 42.23  ? 268  ILE F N     1 
ATOM   7941  C  CA    . ILE P  3 136 ? -71.605  62.276  0.202   1.00 41.84  ? 268  ILE F CA    1 
ATOM   7942  C  C     . ILE P  3 136 ? -71.075  61.994  -1.191  1.00 42.12  ? 268  ILE F C     1 
ATOM   7943  O  O     . ILE P  3 136 ? -71.552  61.090  -1.865  1.00 42.12  ? 268  ILE F O     1 
ATOM   7944  C  CB    . ILE P  3 136 ? -72.585  63.456  0.120   1.00 42.11  ? 268  ILE F CB    1 
ATOM   7945  C  CG1   . ILE P  3 136 ? -73.193  63.714  1.495   1.00 43.21  ? 268  ILE F CG1   1 
ATOM   7946  C  CG2   . ILE P  3 136 ? -73.712  63.115  -0.857  1.00 42.18  ? 268  ILE F CG2   1 
ATOM   7947  C  CD1   . ILE P  3 136 ? -73.734  65.131  1.630   1.00 44.28  ? 268  ILE F CD1   1 
ATOM   7948  N  N     . GLY P  3 137 ? -70.088  62.780  -1.615  1.00 42.10  ? 269  GLY F N     1 
ATOM   7949  C  CA    . GLY P  3 137 ? -69.500  62.623  -2.935  1.00 41.88  ? 269  GLY F CA    1 
ATOM   7950  C  C     . GLY P  3 137 ? -69.407  61.184  -3.408  1.00 41.57  ? 269  GLY F C     1 
ATOM   7951  O  O     . GLY P  3 137 ? -69.504  60.891  -4.610  1.00 42.07  ? 269  GLY F O     1 
ATOM   7952  N  N     . ASN P  3 138 ? -69.223  60.266  -2.475  1.00 39.83  ? 270  ASN F N     1 
ATOM   7953  C  CA    . ASN P  3 138 ? -69.137  58.888  -2.876  1.00 40.21  ? 270  ASN F CA    1 
ATOM   7954  C  C     . ASN P  3 138 ? -70.497  58.341  -3.274  1.00 41.40  ? 270  ASN F C     1 
ATOM   7955  O  O     . ASN P  3 138 ? -70.578  57.555  -4.207  1.00 42.45  ? 270  ASN F O     1 
ATOM   7956  C  CB    . ASN P  3 138 ? -68.541  58.073  -1.758  1.00 40.08  ? 270  ASN F CB    1 
ATOM   7957  C  CG    . ASN P  3 138 ? -67.132  58.485  -1.457  1.00 41.12  ? 270  ASN F CG    1 
ATOM   7958  O  OD1   . ASN P  3 138 ? -66.224  58.264  -2.265  1.00 41.32  ? 270  ASN F OD1   1 
ATOM   7959  N  ND2   . ASN P  3 138 ? -66.931  59.103  -0.296  1.00 41.58  ? 270  ASN F ND2   1 
ATOM   7960  N  N     . GLU P  3 139 ? -71.563  58.745  -2.585  1.00 41.92  ? 271  GLU F N     1 
ATOM   7961  C  CA    . GLU P  3 139 ? -72.894  58.256  -2.934  1.00 42.66  ? 271  GLU F CA    1 
ATOM   7962  C  C     . GLU P  3 139 ? -73.298  58.823  -4.288  1.00 42.64  ? 271  GLU F C     1 
ATOM   7963  O  O     . GLU P  3 139 ? -73.900  58.130  -5.107  1.00 42.15  ? 271  GLU F O     1 
ATOM   7964  C  CB    . GLU P  3 139 ? -73.916  58.663  -1.874  1.00 44.98  ? 271  GLU F CB    1 
ATOM   7965  C  CG    . GLU P  3 139 ? -75.322  58.110  -2.113  1.00 49.19  ? 271  GLU F CG    1 
ATOM   7966  C  CD    . GLU P  3 139 ? -75.488  56.647  -1.688  1.00 53.27  ? 271  GLU F CD    1 
ATOM   7967  O  OE1   . GLU P  3 139 ? -76.602  56.099  -1.873  1.00 53.93  ? 271  GLU F OE1   1 
ATOM   7968  O  OE2   . GLU P  3 139 ? -74.515  56.046  -1.161  1.00 55.13  ? 271  GLU F OE2   1 
ATOM   7969  N  N     . GLU P  3 140 ? -72.961  60.089  -4.523  1.00 43.53  ? 272  GLU F N     1 
ATOM   7970  C  CA    . GLU P  3 140 ? -73.282  60.737  -5.790  1.00 44.16  ? 272  GLU F CA    1 
ATOM   7971  C  C     . GLU P  3 140 ? -72.683  59.941  -6.937  1.00 43.64  ? 272  GLU F C     1 
ATOM   7972  O  O     . GLU P  3 140 ? -73.381  59.549  -7.870  1.00 42.69  ? 272  GLU F O     1 
ATOM   7973  C  CB    . GLU P  3 140 ? -72.742  62.160  -5.803  1.00 45.18  ? 272  GLU F CB    1 
ATOM   7974  C  CG    . GLU P  3 140 ? -73.539  63.128  -4.931  1.00 50.39  ? 272  GLU F CG    1 
ATOM   7975  C  CD    . GLU P  3 140 ? -74.780  63.690  -5.632  1.00 52.94  ? 272  GLU F CD    1 
ATOM   7976  O  OE1   . GLU P  3 140 ? -75.486  64.535  -5.017  1.00 51.05  ? 272  GLU F OE1   1 
ATOM   7977  O  OE2   . GLU P  3 140 ? -75.038  63.287  -6.798  1.00 55.04  ? 272  GLU F OE2   1 
ATOM   7978  N  N     . ALA P  3 141 ? -71.383  59.694  -6.862  1.00 43.06  ? 273  ALA F N     1 
ATOM   7979  C  CA    . ALA P  3 141 ? -70.739  58.924  -7.904  1.00 43.37  ? 273  ALA F CA    1 
ATOM   7980  C  C     . ALA P  3 141 ? -71.574  57.674  -8.114  1.00 44.38  ? 273  ALA F C     1 
ATOM   7981  O  O     . ALA P  3 141 ? -71.937  57.352  -9.241  1.00 44.62  ? 273  ALA F O     1 
ATOM   7982  C  CB    . ALA P  3 141 ? -69.344  58.551  -7.491  1.00 42.40  ? 273  ALA F CB    1 
ATOM   7983  N  N     . ASP P  3 142 ? -71.886  56.986  -7.016  1.00 46.07  ? 274  ASP F N     1 
ATOM   7984  C  CA    . ASP P  3 142 ? -72.683  55.762  -7.060  1.00 47.99  ? 274  ASP F CA    1 
ATOM   7985  C  C     . ASP P  3 142 ? -73.937  56.011  -7.882  1.00 48.89  ? 274  ASP F C     1 
ATOM   7986  O  O     . ASP P  3 142 ? -74.168  55.328  -8.878  1.00 50.30  ? 274  ASP F O     1 
ATOM   7987  C  CB    . ASP P  3 142 ? -73.109  55.308  -5.650  1.00 50.46  ? 274  ASP F CB    1 
ATOM   7988  C  CG    . ASP P  3 142 ? -71.962  54.712  -4.827  1.00 51.57  ? 274  ASP F CG    1 
ATOM   7989  O  OD1   . ASP P  3 142 ? -72.213  54.355  -3.648  1.00 50.63  ? 274  ASP F OD1   1 
ATOM   7990  O  OD2   . ASP P  3 142 ? -70.828  54.598  -5.347  1.00 53.03  ? 274  ASP F OD2   1 
ATOM   7991  N  N     . ARG P  3 143 ? -74.745  56.985  -7.462  1.00 48.57  ? 275  ARG F N     1 
ATOM   7992  C  CA    . ARG P  3 143 ? -75.982  57.308  -8.170  1.00 48.28  ? 275  ARG F CA    1 
ATOM   7993  C  C     . ARG P  3 143 ? -75.695  57.394  -9.669  1.00 45.64  ? 275  ARG F C     1 
ATOM   7994  O  O     . ARG P  3 143 ? -76.325  56.728  -10.484 1.00 45.63  ? 275  ARG F O     1 
ATOM   7995  C  CB    . ARG P  3 143 ? -76.539  58.658  -7.703  1.00 52.52  ? 275  ARG F CB    1 
ATOM   7996  C  CG    . ARG P  3 143 ? -76.774  58.834  -6.194  1.00 58.24  ? 275  ARG F CG    1 
ATOM   7997  C  CD    . ARG P  3 143 ? -78.265  58.816  -5.828  1.00 61.79  ? 275  ARG F CD    1 
ATOM   7998  N  NE    . ARG P  3 143 ? -78.794  57.502  -6.101  1.00 68.58  ? 275  ARG F NE    1 
ATOM   7999  C  CZ    . ARG P  3 143 ? -78.375  56.414  -5.470  1.00 73.92  ? 275  ARG F CZ    1 
ATOM   8000  N  NH1   . ARG P  3 143 ? -77.446  56.524  -4.524  1.00 74.81  ? 275  ARG F NH1   1 
ATOM   8001  N  NH2   . ARG P  3 143 ? -78.821  55.213  -5.829  1.00 77.50  ? 275  ARG F NH2   1 
ATOM   8002  N  N     . LEU P  3 144 ? -74.723  58.218  -10.022 1.00 42.62  ? 276  LEU F N     1 
ATOM   8003  C  CA    . LEU P  3 144 ? -74.351  58.411  -11.410 1.00 40.86  ? 276  LEU F CA    1 
ATOM   8004  C  C     . LEU P  3 144 ? -73.941  57.149  -12.114 1.00 41.81  ? 276  LEU F C     1 
ATOM   8005  O  O     . LEU P  3 144 ? -74.313  56.924  -13.262 1.00 42.35  ? 276  LEU F O     1 
ATOM   8006  C  CB    . LEU P  3 144 ? -73.208  59.401  -11.501 1.00 38.80  ? 276  LEU F CB    1 
ATOM   8007  C  CG    . LEU P  3 144 ? -73.651  60.822  -11.231 1.00 35.87  ? 276  LEU F CG    1 
ATOM   8008  C  CD1   . LEU P  3 144 ? -72.780  61.449  -10.149 1.00 35.32  ? 276  LEU F CD1   1 
ATOM   8009  C  CD2   . LEU P  3 144 ? -73.620  61.571  -12.551 1.00 33.00  ? 276  LEU F CD2   1 
ATOM   8010  N  N     . ALA P  3 145 ? -73.144  56.341  -11.430 1.00 43.04  ? 277  ALA F N     1 
ATOM   8011  C  CA    . ALA P  3 145 ? -72.658  55.101  -12.003 1.00 44.42  ? 277  ALA F CA    1 
ATOM   8012  C  C     . ALA P  3 145 ? -73.805  54.262  -12.540 1.00 45.07  ? 277  ALA F C     1 
ATOM   8013  O  O     . ALA P  3 145 ? -73.837  53.940  -13.728 1.00 45.31  ? 277  ALA F O     1 
ATOM   8014  C  CB    . ALA P  3 145 ? -71.870  54.316  -10.962 1.00 45.17  ? 277  ALA F CB    1 
ATOM   8015  N  N     . ARG P  3 146 ? -74.753  53.926  -11.670 1.00 45.51  ? 278  ARG F N     1 
ATOM   8016  C  CA    . ARG P  3 146 ? -75.884  53.103  -12.072 1.00 46.86  ? 278  ARG F CA    1 
ATOM   8017  C  C     . ARG P  3 146 ? -76.818  53.782  -13.058 1.00 48.29  ? 278  ARG F C     1 
ATOM   8018  O  O     . ARG P  3 146 ? -77.637  53.128  -13.697 1.00 48.25  ? 278  ARG F O     1 
ATOM   8019  C  CB    . ARG P  3 146 ? -76.641  52.623  -10.839 1.00 45.40  ? 278  ARG F CB    1 
ATOM   8020  C  CG    . ARG P  3 146 ? -76.432  53.488  -9.619  1.00 46.13  ? 278  ARG F CG    1 
ATOM   8021  C  CD    . ARG P  3 146 ? -76.168  52.643  -8.381  1.00 45.40  ? 278  ARG F CD    1 
ATOM   8022  N  NE    . ARG P  3 146 ? -74.825  52.071  -8.381  1.00 44.98  ? 278  ARG F NE    1 
ATOM   8023  C  CZ    . ARG P  3 146 ? -74.314  51.365  -7.376  1.00 44.63  ? 278  ARG F CZ    1 
ATOM   8024  N  NH1   . ARG P  3 146 ? -75.045  51.142  -6.291  1.00 44.00  ? 278  ARG F NH1   1 
ATOM   8025  N  NH2   . ARG P  3 146 ? -73.068  50.908  -7.444  1.00 42.20  ? 278  ARG F NH2   1 
ATOM   8026  N  N     . GLU P  3 147 ? -76.696  55.095  -13.185 1.00 51.23  ? 279  GLU F N     1 
ATOM   8027  C  CA    . GLU P  3 147 ? -77.510  55.818  -14.149 1.00 54.90  ? 279  GLU F CA    1 
ATOM   8028  C  C     . GLU P  3 147 ? -76.888  55.541  -15.506 1.00 57.44  ? 279  GLU F C     1 
ATOM   8029  O  O     . GLU P  3 147 ? -77.584  55.398  -16.514 1.00 57.99  ? 279  GLU F O     1 
ATOM   8030  C  CB    . GLU P  3 147 ? -77.474  57.319  -13.876 1.00 55.16  ? 279  GLU F CB    1 
ATOM   8031  C  CG    . GLU P  3 147 ? -78.449  57.776  -12.816 1.00 58.66  ? 279  GLU F CG    1 
ATOM   8032  C  CD    . GLU P  3 147 ? -79.895  57.665  -13.264 1.00 60.18  ? 279  GLU F CD    1 
ATOM   8033  O  OE1   . GLU P  3 147 ? -80.792  57.917  -12.431 1.00 62.04  ? 279  GLU F OE1   1 
ATOM   8034  O  OE2   . GLU P  3 147 ? -80.136  57.333  -14.447 1.00 60.70  ? 279  GLU F OE2   1 
ATOM   8035  N  N     . GLY P  3 148 ? -75.559  55.466  -15.513 1.00 59.99  ? 280  GLY F N     1 
ATOM   8036  C  CA    . GLY P  3 148 ? -74.833  55.210  -16.741 1.00 62.46  ? 280  GLY F CA    1 
ATOM   8037  C  C     . GLY P  3 148 ? -74.991  53.773  -17.182 1.00 64.52  ? 280  GLY F C     1 
ATOM   8038  O  O     . GLY P  3 148 ? -74.843  53.454  -18.362 1.00 64.76  ? 280  GLY F O     1 
ATOM   8039  N  N     . ALA P  3 149 ? -75.299  52.904  -16.225 1.00 66.33  ? 281  ALA F N     1 
ATOM   8040  C  CA    . ALA P  3 149 ? -75.476  51.486  -16.505 1.00 68.24  ? 281  ALA F CA    1 
ATOM   8041  C  C     . ALA P  3 149 ? -76.729  51.227  -17.336 1.00 69.96  ? 281  ALA F C     1 
ATOM   8042  O  O     . ALA P  3 149 ? -76.773  50.285  -18.131 1.00 69.61  ? 281  ALA F O     1 
ATOM   8043  C  CB    . ALA P  3 149 ? -75.545  50.708  -15.199 1.00 68.19  ? 281  ALA F CB    1 
ATOM   8044  N  N     . LYS P  3 150 ? -77.746  52.066  -17.154 1.00 71.62  ? 282  LYS F N     1 
ATOM   8045  C  CA    . LYS P  3 150 ? -78.990  51.908  -17.892 1.00 72.98  ? 282  LYS F CA    1 
ATOM   8046  C  C     . LYS P  3 150 ? -78.823  52.298  -19.362 1.00 74.93  ? 282  LYS F C     1 
ATOM   8047  O  O     . LYS P  3 150 ? -79.627  51.911  -20.211 1.00 74.68  ? 282  LYS F O     1 
ATOM   8048  C  CB    . LYS P  3 150 ? -80.092  52.752  -17.257 1.00 71.66  ? 282  LYS F CB    1 
ATOM   8049  C  CG    . LYS P  3 150 ? -80.177  52.656  -15.748 1.00 70.03  ? 282  LYS F CG    1 
ATOM   8050  C  CD    . LYS P  3 150 ? -81.561  53.087  -15.284 1.00 69.71  ? 282  LYS F CD    1 
ATOM   8051  C  CE    . LYS P  3 150 ? -81.587  53.500  -13.822 1.00 68.56  ? 282  LYS F CE    1 
ATOM   8052  N  NZ    . LYS P  3 150 ? -81.177  54.917  -13.640 1.00 67.02  ? 282  LYS F NZ    1 
ATOM   8053  N  N     . GLN P  3 151 ? -77.785  53.070  -19.665 1.00 77.33  ? 283  GLN F N     1 
ATOM   8054  C  CA    . GLN P  3 151 ? -77.544  53.473  -21.040 1.00 80.80  ? 283  GLN F CA    1 
ATOM   8055  C  C     . GLN P  3 151 ? -77.293  52.233  -21.877 1.00 83.56  ? 283  GLN F C     1 
ATOM   8056  O  O     . GLN P  3 151 ? -76.731  51.259  -21.386 1.00 84.27  ? 283  GLN F O     1 
ATOM   8057  C  CB    . GLN P  3 151 ? -76.330  54.385  -21.135 1.00 80.85  ? 283  GLN F CB    1 
ATOM   8058  C  CG    . GLN P  3 151 ? -76.537  55.779  -20.595 1.00 81.44  ? 283  GLN F CG    1 
ATOM   8059  C  CD    . GLN P  3 151 ? -75.387  56.691  -20.974 1.00 82.74  ? 283  GLN F CD    1 
ATOM   8060  O  OE1   . GLN P  3 151 ? -75.412  57.891  -20.693 1.00 83.61  ? 283  GLN F OE1   1 
ATOM   8061  N  NE2   . GLN P  3 151 ? -74.366  56.123  -21.622 1.00 82.03  ? 283  GLN F NE2   1 
ATOM   8062  N  N     . SER P  3 152 ? -77.709  52.268  -23.138 1.00 87.10  ? 284  SER F N     1 
ATOM   8063  C  CA    . SER P  3 152 ? -77.514  51.135  -24.036 1.00 90.59  ? 284  SER F CA    1 
ATOM   8064  C  C     . SER P  3 152 ? -76.033  50.991  -24.384 1.00 92.52  ? 284  SER F C     1 
ATOM   8065  O  O     . SER P  3 152 ? -75.313  51.989  -24.486 1.00 92.23  ? 284  SER F O     1 
ATOM   8066  C  CB    . SER P  3 152 ? -78.351  51.323  -25.310 1.00 91.02  ? 284  SER F CB    1 
ATOM   8067  O  OG    . SER P  3 152 ? -78.184  52.623  -25.856 1.00 91.70  ? 284  SER F OG    1 
ATOM   8068  N  N     . GLU P  3 153 ? -75.578  49.751  -24.552 1.00 95.23  ? 285  GLU F N     1 
ATOM   8069  C  CA    . GLU P  3 153 ? -74.176  49.494  -24.880 1.00 98.43  ? 285  GLU F CA    1 
ATOM   8070  C  C     . GLU P  3 153 ? -73.787  50.091  -26.231 1.00 99.15  ? 285  GLU F C     1 
ATOM   8071  O  O     . GLU P  3 153 ? -74.706  50.368  -27.034 1.00 100.10 ? 285  GLU F O     1 
ATOM   8072  C  CB    . GLU P  3 153 ? -73.897  47.982  -24.881 1.00 99.77  ? 285  GLU F CB    1 
ATOM   8073  C  CG    . GLU P  3 153 ? -73.108  47.490  -23.662 1.00 102.69 ? 285  GLU F CG    1 
ATOM   8074  C  CD    . GLU P  3 153 ? -71.643  47.171  -23.974 1.00 104.42 ? 285  GLU F CD    1 
ATOM   8075  O  OE1   . GLU P  3 153 ? -71.391  46.211  -24.739 1.00 105.38 ? 285  GLU F OE1   1 
ATOM   8076  O  OE2   . GLU P  3 153 ? -70.746  47.877  -23.455 1.00 104.62 ? 285  GLU F OE2   1 
ATOM   8077  N  N     . MET Q  3 4   ? -46.219  29.701  -59.545 1.00 108.61 ? 136  MET I N     1 
ATOM   8078  C  CA    . MET Q  3 4   ? -45.118  29.298  -60.473 1.00 108.52 ? 136  MET I CA    1 
ATOM   8079  C  C     . MET Q  3 4   ? -44.974  30.275  -61.647 1.00 108.27 ? 136  MET I C     1 
ATOM   8080  O  O     . MET Q  3 4   ? -45.623  30.118  -62.691 1.00 108.24 ? 136  MET I O     1 
ATOM   8081  C  CB    . MET Q  3 4   ? -45.370  27.881  -60.995 1.00 107.98 ? 136  MET I CB    1 
ATOM   8082  N  N     . GLY Q  3 5   ? -44.119  31.281  -61.468 1.00 107.32 ? 137  GLY I N     1 
ATOM   8083  C  CA    . GLY Q  3 5   ? -43.896  32.265  -62.512 1.00 105.41 ? 137  GLY I CA    1 
ATOM   8084  C  C     . GLY Q  3 5   ? -42.679  33.131  -62.248 1.00 104.37 ? 137  GLY I C     1 
ATOM   8085  O  O     . GLY Q  3 5   ? -42.802  34.351  -62.160 1.00 103.97 ? 137  GLY I O     1 
ATOM   8086  N  N     . ASP Q  3 6   ? -41.512  32.499  -62.117 1.00 103.43 ? 138  ASP I N     1 
ATOM   8087  C  CA    . ASP Q  3 6   ? -40.247  33.200  -61.866 1.00 102.82 ? 138  ASP I CA    1 
ATOM   8088  C  C     . ASP Q  3 6   ? -40.163  33.841  -60.481 1.00 102.26 ? 138  ASP I C     1 
ATOM   8089  O  O     . ASP Q  3 6   ? -39.239  33.562  -59.714 1.00 101.16 ? 138  ASP I O     1 
ATOM   8090  C  CB    . ASP Q  3 6   ? -40.011  34.256  -62.945 1.00 103.26 ? 138  ASP I CB    1 
ATOM   8091  C  CG    . ASP Q  3 6   ? -39.816  33.645  -64.316 1.00 103.59 ? 138  ASP I CG    1 
ATOM   8092  O  OD1   . ASP Q  3 6   ? -40.706  32.886  -64.759 1.00 103.20 ? 138  ASP I OD1   1 
ATOM   8093  O  OD2   . ASP Q  3 6   ? -38.773  33.922  -64.946 1.00 104.04 ? 138  ASP I OD2   1 
ATOM   8094  N  N     . PHE Q  3 7   ? -41.114  34.721  -60.178 1.00 102.08 ? 139  PHE I N     1 
ATOM   8095  C  CA    . PHE Q  3 7   ? -41.178  35.373  -58.871 1.00 101.45 ? 139  PHE I CA    1 
ATOM   8096  C  C     . PHE Q  3 7   ? -42.061  34.433  -58.038 1.00 101.13 ? 139  PHE I C     1 
ATOM   8097  O  O     . PHE Q  3 7   ? -42.640  33.483  -58.574 1.00 101.70 ? 139  PHE I O     1 
ATOM   8098  C  CB    . PHE Q  3 7   ? -41.877  36.740  -58.956 1.00 101.14 ? 139  PHE I CB    1 
ATOM   8099  C  CG    . PHE Q  3 7   ? -41.266  37.709  -59.938 1.00 100.90 ? 139  PHE I CG    1 
ATOM   8100  C  CD1   . PHE Q  3 7   ? -41.015  37.340  -61.256 1.00 101.43 ? 139  PHE I CD1   1 
ATOM   8101  C  CD2   . PHE Q  3 7   ? -41.023  39.026  -59.559 1.00 100.92 ? 139  PHE I CD2   1 
ATOM   8102  C  CE1   . PHE Q  3 7   ? -40.537  38.274  -62.185 1.00 101.74 ? 139  PHE I CE1   1 
ATOM   8103  C  CE2   . PHE Q  3 7   ? -40.546  39.967  -60.479 1.00 101.35 ? 139  PHE I CE2   1 
ATOM   8104  C  CZ    . PHE Q  3 7   ? -40.303  39.590  -61.795 1.00 101.32 ? 139  PHE I CZ    1 
ATOM   8105  N  N     . VAL Q  3 8   ? -42.180  34.688  -56.740 1.00 100.07 ? 140  VAL I N     1 
ATOM   8106  C  CA    . VAL Q  3 8   ? -43.020  33.840  -55.901 1.00 99.02  ? 140  VAL I CA    1 
ATOM   8107  C  C     . VAL Q  3 8   ? -44.316  34.558  -55.538 1.00 98.13  ? 140  VAL I C     1 
ATOM   8108  O  O     . VAL Q  3 8   ? -44.308  35.570  -54.829 1.00 98.09  ? 140  VAL I O     1 
ATOM   8109  C  CB    . VAL Q  3 8   ? -42.280  33.417  -54.619 1.00 99.44  ? 140  VAL I CB    1 
ATOM   8110  C  CG1   . VAL Q  3 8   ? -43.246  32.748  -53.649 1.00 100.21 ? 140  VAL I CG1   1 
ATOM   8111  C  CG2   . VAL Q  3 8   ? -41.160  32.457  -54.977 1.00 99.11  ? 140  VAL I CG2   1 
ATOM   8112  N  N     . VAL Q  3 9   ? -45.430  34.023  -56.033 1.00 96.71  ? 141  VAL I N     1 
ATOM   8113  C  CA    . VAL Q  3 9   ? -46.747  34.604  -55.787 1.00 94.88  ? 141  VAL I CA    1 
ATOM   8114  C  C     . VAL Q  3 9   ? -47.117  34.598  -54.306 1.00 93.13  ? 141  VAL I C     1 
ATOM   8115  O  O     . VAL Q  3 9   ? -46.895  33.614  -53.595 1.00 92.28  ? 141  VAL I O     1 
ATOM   8116  C  CB    . VAL Q  3 9   ? -47.850  33.864  -56.597 1.00 95.15  ? 141  VAL I CB    1 
ATOM   8117  C  CG1   . VAL Q  3 9   ? -49.209  34.508  -56.343 1.00 94.92  ? 141  VAL I CG1   1 
ATOM   8118  C  CG2   . VAL Q  3 9   ? -47.518  33.899  -58.092 1.00 94.97  ? 141  VAL I CG2   1 
ATOM   8119  N  N     . VAL Q  3 10  ? -47.686  35.713  -53.859 1.00 91.59  ? 142  VAL I N     1 
ATOM   8120  C  CA    . VAL Q  3 10  ? -48.094  35.888  -52.474 1.00 90.15  ? 142  VAL I CA    1 
ATOM   8121  C  C     . VAL Q  3 10  ? -49.344  36.755  -52.378 1.00 89.50  ? 142  VAL I C     1 
ATOM   8122  O  O     . VAL Q  3 10  ? -49.486  37.745  -53.105 1.00 89.07  ? 142  VAL I O     1 
ATOM   8123  C  CB    . VAL Q  3 10  ? -46.984  36.567  -51.663 1.00 90.31  ? 142  VAL I CB    1 
ATOM   8124  C  CG1   . VAL Q  3 10  ? -46.638  37.910  -52.292 1.00 90.80  ? 142  VAL I CG1   1 
ATOM   8125  C  CG2   . VAL Q  3 10  ? -47.431  36.758  -50.226 1.00 90.00  ? 142  VAL I CG2   1 
ATOM   8126  N  N     . TYR Q  3 11  ? -50.244  36.376  -51.473 1.00 88.45  ? 143  TYR I N     1 
ATOM   8127  C  CA    . TYR Q  3 11  ? -51.486  37.110  -51.254 1.00 86.76  ? 143  TYR I CA    1 
ATOM   8128  C  C     . TYR Q  3 11  ? -51.486  37.717  -49.858 1.00 84.44  ? 143  TYR I C     1 
ATOM   8129  O  O     . TYR Q  3 11  ? -51.014  37.111  -48.899 1.00 83.30  ? 143  TYR I O     1 
ATOM   8130  C  CB    . TYR Q  3 11  ? -52.695  36.184  -51.434 1.00 88.01  ? 143  TYR I CB    1 
ATOM   8131  C  CG    . TYR Q  3 11  ? -52.949  35.778  -52.877 1.00 89.42  ? 143  TYR I CG    1 
ATOM   8132  C  CD1   . TYR Q  3 11  ? -54.004  36.339  -53.614 1.00 89.58  ? 143  TYR I CD1   1 
ATOM   8133  C  CD2   . TYR Q  3 11  ? -52.111  34.860  -53.519 1.00 89.63  ? 143  TYR I CD2   1 
ATOM   8134  C  CE1   . TYR Q  3 11  ? -54.214  35.995  -54.956 1.00 90.04  ? 143  TYR I CE1   1 
ATOM   8135  C  CE2   . TYR Q  3 11  ? -52.307  34.513  -54.858 1.00 90.59  ? 143  TYR I CE2   1 
ATOM   8136  C  CZ    . TYR Q  3 11  ? -53.356  35.082  -55.571 1.00 90.87  ? 143  TYR I CZ    1 
ATOM   8137  O  OH    . TYR Q  3 11  ? -53.521  34.741  -56.896 1.00 90.50  ? 143  TYR I OH    1 
ATOM   8138  N  N     . THR Q  3 12  ? -52.011  38.926  -49.754 1.00 82.91  ? 144  THR I N     1 
ATOM   8139  C  CA    . THR Q  3 12  ? -52.053  39.620  -48.481 1.00 82.11  ? 144  THR I CA    1 
ATOM   8140  C  C     . THR Q  3 12  ? -53.327  40.447  -48.360 1.00 81.44  ? 144  THR I C     1 
ATOM   8141  O  O     . THR Q  3 12  ? -53.631  41.272  -49.221 1.00 81.72  ? 144  THR I O     1 
ATOM   8142  C  CB    . THR Q  3 12  ? -50.841  40.553  -48.340 1.00 82.81  ? 144  THR I CB    1 
ATOM   8143  O  OG1   . THR Q  3 12  ? -50.910  41.588  -49.333 1.00 82.12  ? 144  THR I OG1   1 
ATOM   8144  C  CG2   . THR Q  3 12  ? -49.552  39.769  -48.525 1.00 83.03  ? 144  THR I CG2   1 
ATOM   8145  N  N     . ASP Q  3 13  ? -54.072  40.229  -47.286 1.00 80.08  ? 145  ASP I N     1 
ATOM   8146  C  CA    . ASP Q  3 13  ? -55.305  40.965  -47.078 1.00 78.68  ? 145  ASP I CA    1 
ATOM   8147  C  C     . ASP Q  3 13  ? -55.420  41.413  -45.636 1.00 77.87  ? 145  ASP I C     1 
ATOM   8148  O  O     . ASP Q  3 13  ? -55.655  40.602  -44.748 1.00 78.11  ? 145  ASP I O     1 
ATOM   8149  C  CB    . ASP Q  3 13  ? -56.506  40.089  -47.428 1.00 79.08  ? 145  ASP I CB    1 
ATOM   8150  C  CG    . ASP Q  3 13  ? -57.820  40.828  -47.294 1.00 79.61  ? 145  ASP I CG    1 
ATOM   8151  O  OD1   . ASP Q  3 13  ? -58.883  40.175  -47.396 1.00 79.18  ? 145  ASP I OD1   1 
ATOM   8152  O  OD2   . ASP Q  3 13  ? -57.787  42.063  -47.093 1.00 79.84  ? 145  ASP I OD2   1 
ATOM   8153  N  N     . GLY Q  3 14  ? -55.244  42.704  -45.396 1.00 76.94  ? 146  GLY I N     1 
ATOM   8154  C  CA    . GLY Q  3 14  ? -55.366  43.193  -44.039 1.00 76.28  ? 146  GLY I CA    1 
ATOM   8155  C  C     . GLY Q  3 14  ? -56.838  43.235  -43.686 1.00 75.91  ? 146  GLY I C     1 
ATOM   8156  O  O     . GLY Q  3 14  ? -57.662  43.555  -44.537 1.00 76.15  ? 146  GLY I O     1 
ATOM   8157  N  N     . CYS Q  3 15  ? -57.179  42.905  -42.447 1.00 75.85  ? 147  CYS I N     1 
ATOM   8158  C  CA    . CYS Q  3 15  ? -58.574  42.926  -42.018 1.00 75.83  ? 147  CYS I CA    1 
ATOM   8159  C  C     . CYS Q  3 15  ? -58.697  43.663  -40.690 1.00 75.42  ? 147  CYS I C     1 
ATOM   8160  O  O     . CYS Q  3 15  ? -57.755  43.687  -39.898 1.00 76.11  ? 147  CYS I O     1 
ATOM   8161  C  CB    . CYS Q  3 15  ? -59.097  41.504  -41.851 1.00 76.22  ? 147  CYS I CB    1 
ATOM   8162  S  SG    . CYS Q  3 15  ? -58.487  40.689  -40.374 1.00 77.26  ? 147  CYS I SG    1 
ATOM   8163  N  N     . CYS Q  3 16  ? -59.855  44.260  -40.439 1.00 74.45  ? 148  CYS I N     1 
ATOM   8164  C  CA    . CYS Q  3 16  ? -60.053  44.994  -39.198 1.00 74.06  ? 148  CYS I CA    1 
ATOM   8165  C  C     . CYS Q  3 16  ? -61.493  44.955  -38.764 1.00 74.06  ? 148  CYS I C     1 
ATOM   8166  O  O     . CYS Q  3 16  ? -62.333  45.648  -39.325 1.00 74.46  ? 148  CYS I O     1 
ATOM   8167  C  CB    . CYS Q  3 16  ? -59.625  46.456  -39.363 1.00 74.58  ? 148  CYS I CB    1 
ATOM   8168  S  SG    . CYS Q  3 16  ? -59.923  47.530  -37.919 1.00 72.38  ? 148  CYS I SG    1 
ATOM   8169  N  N     . SER Q  3 17  ? -61.781  44.144  -37.759 1.00 74.03  ? 149  SER I N     1 
ATOM   8170  C  CA    . SER Q  3 17  ? -63.138  44.053  -37.265 1.00 73.55  ? 149  SER I CA    1 
ATOM   8171  C  C     . SER Q  3 17  ? -63.442  45.302  -36.459 1.00 73.82  ? 149  SER I C     1 
ATOM   8172  O  O     . SER Q  3 17  ? -62.550  45.925  -35.885 1.00 72.41  ? 149  SER I O     1 
ATOM   8173  C  CB    . SER Q  3 17  ? -63.300  42.801  -36.413 1.00 73.07  ? 149  SER I CB    1 
ATOM   8174  O  OG    . SER Q  3 17  ? -62.998  41.653  -37.190 1.00 73.28  ? 149  SER I OG    1 
ATOM   8175  N  N     . SER Q  3 18  ? -64.711  45.674  -36.433 1.00 75.44  ? 150  SER I N     1 
ATOM   8176  C  CA    . SER Q  3 18  ? -65.126  46.861  -35.712 1.00 77.16  ? 150  SER I CA    1 
ATOM   8177  C  C     . SER Q  3 18  ? -64.351  48.074  -36.212 1.00 76.99  ? 150  SER I C     1 
ATOM   8178  O  O     . SER Q  3 18  ? -64.097  49.017  -35.465 1.00 77.02  ? 150  SER I O     1 
ATOM   8179  C  CB    . SER Q  3 18  ? -64.918  46.667  -34.208 1.00 78.48  ? 150  SER I CB    1 
ATOM   8180  O  OG    . SER Q  3 18  ? -65.774  45.651  -33.705 1.00 78.98  ? 150  SER I OG    1 
ATOM   8181  N  N     . ASN Q  3 19  ? -63.969  48.032  -37.484 1.00 77.48  ? 151  ASN I N     1 
ATOM   8182  C  CA    . ASN Q  3 19  ? -63.260  49.141  -38.108 1.00 79.32  ? 151  ASN I CA    1 
ATOM   8183  C  C     . ASN Q  3 19  ? -64.130  50.358  -37.808 1.00 80.23  ? 151  ASN I C     1 
ATOM   8184  O  O     . ASN Q  3 19  ? -65.303  50.400  -38.177 1.00 79.39  ? 151  ASN I O     1 
ATOM   8185  C  CB    . ASN Q  3 19  ? -63.141  48.905  -39.619 1.00 80.20  ? 151  ASN I CB    1 
ATOM   8186  C  CG    . ASN Q  3 19  ? -62.210  49.895  -40.298 1.00 80.77  ? 151  ASN I CG    1 
ATOM   8187  O  OD1   . ASN Q  3 19  ? -61.142  50.215  -39.770 1.00 81.59  ? 151  ASN I OD1   1 
ATOM   8188  N  ND2   . ASN Q  3 19  ? -62.601  50.371  -41.480 1.00 79.63  ? 151  ASN I ND2   1 
ATOM   8189  N  N     . GLY Q  3 20  ? -63.551  51.350  -37.143 1.00 81.93  ? 152  GLY I N     1 
ATOM   8190  C  CA    . GLY Q  3 20  ? -64.327  52.505  -36.747 1.00 83.77  ? 152  GLY I CA    1 
ATOM   8191  C  C     . GLY Q  3 20  ? -64.835  52.005  -35.412 1.00 85.81  ? 152  GLY I C     1 
ATOM   8192  O  O     . GLY Q  3 20  ? -64.040  51.821  -34.487 1.00 86.01  ? 152  GLY I O     1 
ATOM   8193  N  N     . ARG Q  3 21  ? -66.134  51.739  -35.314 1.00 87.45  ? 153  ARG I N     1 
ATOM   8194  C  CA    . ARG Q  3 21  ? -66.719  51.221  -34.079 1.00 89.54  ? 153  ARG I CA    1 
ATOM   8195  C  C     . ARG Q  3 21  ? -66.092  51.800  -32.800 1.00 91.87  ? 153  ARG I C     1 
ATOM   8196  O  O     . ARG Q  3 21  ? -65.899  53.018  -32.699 1.00 92.91  ? 153  ARG I O     1 
ATOM   8197  C  CB    . ARG Q  3 21  ? -66.627  49.688  -34.070 1.00 87.86  ? 153  ARG I CB    1 
ATOM   8198  C  CG    . ARG Q  3 21  ? -67.752  49.013  -34.830 1.00 86.01  ? 153  ARG I CG    1 
ATOM   8199  C  CD    . ARG Q  3 21  ? -69.067  49.429  -34.209 1.00 85.75  ? 153  ARG I CD    1 
ATOM   8200  N  NE    . ARG Q  3 21  ? -70.235  48.954  -34.934 1.00 84.75  ? 153  ARG I NE    1 
ATOM   8201  C  CZ    . ARG Q  3 21  ? -71.480  49.265  -34.593 1.00 84.80  ? 153  ARG I CZ    1 
ATOM   8202  N  NH1   . ARG Q  3 21  ? -71.705  50.044  -33.543 1.00 84.20  ? 153  ARG I NH1   1 
ATOM   8203  N  NH2   . ARG Q  3 21  ? -72.498  48.804  -35.300 1.00 85.79  ? 153  ARG I NH2   1 
ATOM   8204  N  N     . ARG Q  3 22  ? -65.778  50.937  -31.829 1.00 93.11  ? 154  ARG I N     1 
ATOM   8205  C  CA    . ARG Q  3 22  ? -65.188  51.390  -30.562 1.00 93.25  ? 154  ARG I CA    1 
ATOM   8206  C  C     . ARG Q  3 22  ? -64.031  50.526  -30.056 1.00 93.21  ? 154  ARG I C     1 
ATOM   8207  O  O     . ARG Q  3 22  ? -63.077  51.045  -29.473 1.00 93.37  ? 154  ARG I O     1 
ATOM   8208  C  CB    . ARG Q  3 22  ? -66.274  51.481  -29.480 1.00 92.76  ? 154  ARG I CB    1 
ATOM   8209  N  N     . ARG Q  3 23  ? -64.119  49.215  -30.264 1.00 92.74  ? 155  ARG I N     1 
ATOM   8210  C  CA    . ARG Q  3 23  ? -63.070  48.299  -29.821 1.00 92.73  ? 155  ARG I CA    1 
ATOM   8211  C  C     . ARG Q  3 23  ? -62.604  47.431  -30.981 1.00 91.98  ? 155  ARG I C     1 
ATOM   8212  O  O     . ARG Q  3 23  ? -62.683  46.201  -30.918 1.00 91.79  ? 155  ARG I O     1 
ATOM   8213  C  CB    . ARG Q  3 23  ? -63.584  47.406  -28.687 1.00 94.29  ? 155  ARG I CB    1 
ATOM   8214  C  CG    . ARG Q  3 23  ? -63.868  48.133  -27.368 1.00 96.44  ? 155  ARG I CG    1 
ATOM   8215  C  CD    . ARG Q  3 23  ? -62.577  48.556  -26.646 1.00 97.22  ? 155  ARG I CD    1 
ATOM   8216  N  NE    . ARG Q  3 23  ? -62.833  49.211  -25.358 1.00 97.72  ? 155  ARG I NE    1 
ATOM   8217  C  CZ    . ARG Q  3 23  ? -63.363  48.616  -24.288 1.00 97.41  ? 155  ARG I CZ    1 
ATOM   8218  N  NH1   . ARG Q  3 23  ? -63.704  47.334  -24.328 1.00 97.84  ? 155  ARG I NH1   1 
ATOM   8219  N  NH2   . ARG Q  3 23  ? -63.561  49.308  -23.173 1.00 96.89  ? 155  ARG I NH2   1 
ATOM   8220  N  N     . PRO Q  3 24  ? -62.098  48.064  -32.056 1.00 91.12  ? 156  PRO I N     1 
ATOM   8221  C  CA    . PRO Q  3 24  ? -61.614  47.362  -33.247 1.00 89.90  ? 156  PRO I CA    1 
ATOM   8222  C  C     . PRO Q  3 24  ? -60.571  46.287  -32.982 1.00 88.98  ? 156  PRO I C     1 
ATOM   8223  O  O     . PRO Q  3 24  ? -60.049  46.167  -31.879 1.00 88.81  ? 156  PRO I O     1 
ATOM   8224  C  CB    . PRO Q  3 24  ? -61.083  48.497  -34.124 1.00 90.02  ? 156  PRO I CB    1 
ATOM   8225  C  CG    . PRO Q  3 24  ? -60.691  49.545  -33.134 1.00 89.82  ? 156  PRO I CG    1 
ATOM   8226  C  CD    . PRO Q  3 24  ? -61.842  49.511  -32.173 1.00 90.45  ? 156  PRO I CD    1 
ATOM   8227  N  N     . ARG Q  3 25  ? -60.284  45.504  -34.014 1.00 88.85  ? 157  ARG I N     1 
ATOM   8228  C  CA    . ARG Q  3 25  ? -59.311  44.423  -33.931 1.00 89.33  ? 157  ARG I CA    1 
ATOM   8229  C  C     . ARG Q  3 25  ? -58.679  44.217  -35.312 1.00 89.71  ? 157  ARG I C     1 
ATOM   8230  O  O     . ARG Q  3 25  ? -59.342  43.736  -36.234 1.00 90.62  ? 157  ARG I O     1 
ATOM   8231  C  CB    . ARG Q  3 25  ? -60.008  43.136  -33.487 1.00 89.57  ? 157  ARG I CB    1 
ATOM   8232  C  CG    . ARG Q  3 25  ? -59.419  42.503  -32.249 1.00 90.98  ? 157  ARG I CG    1 
ATOM   8233  C  CD    . ARG Q  3 25  ? -59.917  43.161  -30.972 1.00 91.86  ? 157  ARG I CD    1 
ATOM   8234  N  NE    . ARG Q  3 25  ? -59.023  42.896  -29.843 1.00 92.98  ? 157  ARG I NE    1 
ATOM   8235  C  CZ    . ARG Q  3 25  ? -58.664  41.683  -29.427 1.00 92.82  ? 157  ARG I CZ    1 
ATOM   8236  N  NH1   . ARG Q  3 25  ? -59.124  40.597  -30.042 1.00 92.53  ? 157  ARG I NH1   1 
ATOM   8237  N  NH2   . ARG Q  3 25  ? -57.834  41.560  -28.399 1.00 91.89  ? 157  ARG I NH2   1 
ATOM   8238  N  N     . ALA Q  3 26  ? -57.404  44.581  -35.456 1.00 89.30  ? 158  ALA I N     1 
ATOM   8239  C  CA    . ALA Q  3 26  ? -56.692  44.444  -36.733 1.00 87.90  ? 158  ALA I CA    1 
ATOM   8240  C  C     . ALA Q  3 26  ? -56.208  43.021  -36.984 1.00 86.97  ? 158  ALA I C     1 
ATOM   8241  O  O     . ALA Q  3 26  ? -56.310  42.160  -36.112 1.00 87.73  ? 158  ALA I O     1 
ATOM   8242  C  CB    . ALA Q  3 26  ? -55.515  45.399  -36.777 1.00 87.59  ? 158  ALA I CB    1 
ATOM   8243  N  N     . GLY Q  3 27  ? -55.677  42.773  -38.174 1.00 85.53  ? 159  GLY I N     1 
ATOM   8244  C  CA    . GLY Q  3 27  ? -55.207  41.436  -38.470 1.00 85.08  ? 159  GLY I CA    1 
ATOM   8245  C  C     . GLY Q  3 27  ? -54.544  41.283  -39.817 1.00 84.54  ? 159  GLY I C     1 
ATOM   8246  O  O     . GLY Q  3 27  ? -55.204  41.274  -40.853 1.00 84.33  ? 159  GLY I O     1 
ATOM   8247  N  N     . ILE Q  3 28  ? -53.224  41.159  -39.799 1.00 84.62  ? 160  ILE I N     1 
ATOM   8248  C  CA    . ILE Q  3 28  ? -52.467  40.993  -41.024 1.00 85.05  ? 160  ILE I CA    1 
ATOM   8249  C  C     . ILE Q  3 28  ? -52.467  39.526  -41.403 1.00 85.37  ? 160  ILE I C     1 
ATOM   8250  O  O     . ILE Q  3 28  ? -52.540  38.653  -40.535 1.00 85.02  ? 160  ILE I O     1 
ATOM   8251  C  CB    . ILE Q  3 28  ? -51.010  41.444  -40.849 1.00 85.57  ? 160  ILE I CB    1 
ATOM   8252  C  CG1   . ILE Q  3 28  ? -50.970  42.907  -40.410 1.00 86.18  ? 160  ILE I CG1   1 
ATOM   8253  C  CG2   . ILE Q  3 28  ? -50.246  41.257  -42.154 1.00 85.71  ? 160  ILE I CG2   1 
ATOM   8254  C  CD1   . ILE Q  3 28  ? -51.595  43.864  -41.400 1.00 87.11  ? 160  ILE I CD1   1 
ATOM   8255  N  N     . GLY Q  3 29  ? -52.381  39.264  -42.702 1.00 85.92  ? 161  GLY I N     1 
ATOM   8256  C  CA    . GLY Q  3 29  ? -52.367  37.896  -43.177 1.00 86.77  ? 161  GLY I CA    1 
ATOM   8257  C  C     . GLY Q  3 29  ? -51.665  37.767  -44.511 1.00 87.42  ? 161  GLY I C     1 
ATOM   8258  O  O     . GLY Q  3 29  ? -51.543  38.737  -45.261 1.00 87.70  ? 161  GLY I O     1 
ATOM   8259  N  N     . VAL Q  3 30  ? -51.196  36.562  -44.806 1.00 88.12  ? 162  VAL I N     1 
ATOM   8260  C  CA    . VAL Q  3 30  ? -50.510  36.306  -46.062 1.00 88.82  ? 162  VAL I CA    1 
ATOM   8261  C  C     . VAL Q  3 30  ? -50.396  34.809  -46.342 1.00 89.73  ? 162  VAL I C     1 
ATOM   8262  O  O     . VAL Q  3 30  ? -49.684  34.082  -45.653 1.00 89.71  ? 162  VAL I O     1 
ATOM   8263  C  CB    . VAL Q  3 30  ? -49.114  36.967  -46.068 1.00 87.76  ? 162  VAL I CB    1 
ATOM   8264  C  CG1   . VAL Q  3 30  ? -48.416  36.722  -44.744 1.00 87.89  ? 162  VAL I CG1   1 
ATOM   8265  C  CG2   . VAL Q  3 30  ? -48.291  36.428  -47.213 1.00 86.67  ? 162  VAL I CG2   1 
ATOM   8266  N  N     . TYR Q  3 31  ? -51.128  34.364  -47.357 1.00 91.09  ? 163  TYR I N     1 
ATOM   8267  C  CA    . TYR Q  3 31  ? -51.152  32.967  -47.775 1.00 92.92  ? 163  TYR I CA    1 
ATOM   8268  C  C     . TYR Q  3 31  ? -50.237  32.827  -48.989 1.00 93.55  ? 163  TYR I C     1 
ATOM   8269  O  O     . TYR Q  3 31  ? -50.442  33.489  -50.005 1.00 94.21  ? 163  TYR I O     1 
ATOM   8270  C  CB    . TYR Q  3 31  ? -52.609  32.577  -48.095 1.00 94.07  ? 163  TYR I CB    1 
ATOM   8271  C  CG    . TYR Q  3 31  ? -52.851  31.318  -48.924 1.00 95.53  ? 163  TYR I CG    1 
ATOM   8272  C  CD1   . TYR Q  3 31  ? -52.787  31.351  -50.323 1.00 96.51  ? 163  TYR I CD1   1 
ATOM   8273  C  CD2   . TYR Q  3 31  ? -53.238  30.121  -48.317 1.00 95.79  ? 163  TYR I CD2   1 
ATOM   8274  C  CE1   . TYR Q  3 31  ? -53.110  30.228  -51.095 1.00 96.53  ? 163  TYR I CE1   1 
ATOM   8275  C  CE2   . TYR Q  3 31  ? -53.563  28.991  -49.081 1.00 96.67  ? 163  TYR I CE2   1 
ATOM   8276  C  CZ    . TYR Q  3 31  ? -53.500  29.055  -50.468 1.00 97.01  ? 163  TYR I CZ    1 
ATOM   8277  O  OH    . TYR Q  3 31  ? -53.840  27.955  -51.227 1.00 97.34  ? 163  TYR I OH    1 
ATOM   8278  N  N     . TRP Q  3 32  ? -49.213  31.986  -48.872 1.00 93.89  ? 164  TRP I N     1 
ATOM   8279  C  CA    . TRP Q  3 32  ? -48.272  31.788  -49.969 1.00 95.14  ? 164  TRP I CA    1 
ATOM   8280  C  C     . TRP Q  3 32  ? -48.694  30.620  -50.845 1.00 96.34  ? 164  TRP I C     1 
ATOM   8281  O  O     . TRP Q  3 32  ? -48.722  30.721  -52.077 1.00 96.22  ? 164  TRP I O     1 
ATOM   8282  C  CB    . TRP Q  3 32  ? -46.859  31.534  -49.425 1.00 95.13  ? 164  TRP I CB    1 
ATOM   8283  C  CG    . TRP Q  3 32  ? -46.306  32.667  -48.606 1.00 95.66  ? 164  TRP I CG    1 
ATOM   8284  C  CD1   . TRP Q  3 32  ? -46.712  33.050  -47.363 1.00 96.37  ? 164  TRP I CD1   1 
ATOM   8285  C  CD2   . TRP Q  3 32  ? -45.257  33.574  -48.981 1.00 95.80  ? 164  TRP I CD2   1 
ATOM   8286  N  NE1   . TRP Q  3 32  ? -45.982  34.136  -46.936 1.00 96.26  ? 164  TRP I NE1   1 
ATOM   8287  C  CE2   . TRP Q  3 32  ? -45.084  34.479  -47.910 1.00 95.58  ? 164  TRP I CE2   1 
ATOM   8288  C  CE3   . TRP Q  3 32  ? -44.449  33.711  -50.118 1.00 96.09  ? 164  TRP I CE3   1 
ATOM   8289  C  CZ2   . TRP Q  3 32  ? -44.137  35.506  -47.940 1.00 94.97  ? 164  TRP I CZ2   1 
ATOM   8290  C  CZ3   . TRP Q  3 32  ? -43.508  34.735  -50.149 1.00 95.59  ? 164  TRP I CZ3   1 
ATOM   8291  C  CH2   . TRP Q  3 32  ? -43.362  35.619  -49.063 1.00 95.19  ? 164  TRP I CH2   1 
ATOM   8292  N  N     . GLY Q  3 33  ? -49.014  29.507  -50.193 1.00 97.40  ? 165  GLY I N     1 
ATOM   8293  C  CA    . GLY Q  3 33  ? -49.431  28.315  -50.903 1.00 98.39  ? 165  GLY I CA    1 
ATOM   8294  C  C     . GLY Q  3 33  ? -50.256  27.415  -50.006 1.00 98.85  ? 165  GLY I C     1 
ATOM   8295  O  O     . GLY Q  3 33  ? -50.294  27.622  -48.794 1.00 98.23  ? 165  GLY I O     1 
ATOM   8296  N  N     . PRO Q  3 34  ? -50.929  26.402  -50.569 1.00 99.75  ? 166  PRO I N     1 
ATOM   8297  C  CA    . PRO Q  3 34  ? -51.741  25.505  -49.749 1.00 100.92 ? 166  PRO I CA    1 
ATOM   8298  C  C     . PRO Q  3 34  ? -50.881  24.711  -48.769 1.00 102.36 ? 166  PRO I C     1 
ATOM   8299  O  O     . PRO Q  3 34  ? -50.263  23.714  -49.147 1.00 102.76 ? 166  PRO I O     1 
ATOM   8300  C  CB    . PRO Q  3 34  ? -52.417  24.620  -50.790 1.00 100.62 ? 166  PRO I CB    1 
ATOM   8301  C  CG    . PRO Q  3 34  ? -51.372  24.522  -51.854 1.00 99.99  ? 166  PRO I CG    1 
ATOM   8302  C  CD    . PRO Q  3 34  ? -50.903  25.949  -51.971 1.00 100.00 ? 166  PRO I CD    1 
ATOM   8303  N  N     . GLY Q  3 35  ? -50.845  25.160  -47.515 1.00 103.45 ? 167  GLY I N     1 
ATOM   8304  C  CA    . GLY Q  3 35  ? -50.057  24.480  -46.499 1.00 104.69 ? 167  GLY I CA    1 
ATOM   8305  C  C     . GLY Q  3 35  ? -48.592  24.878  -46.528 1.00 105.62 ? 167  GLY I C     1 
ATOM   8306  O  O     . GLY Q  3 35  ? -47.711  24.101  -46.144 1.00 105.21 ? 167  GLY I O     1 
ATOM   8307  N  N     . HIS Q  3 36  ? -48.340  26.100  -46.987 1.00 106.74 ? 168  HIS I N     1 
ATOM   8308  C  CA    . HIS Q  3 36  ? -46.988  26.645  -47.087 1.00 107.83 ? 168  HIS I CA    1 
ATOM   8309  C  C     . HIS Q  3 36  ? -46.570  27.209  -45.722 1.00 107.74 ? 168  HIS I C     1 
ATOM   8310  O  O     . HIS Q  3 36  ? -47.190  28.141  -45.205 1.00 108.35 ? 168  HIS I O     1 
ATOM   8311  C  CB    . HIS Q  3 36  ? -46.961  27.747  -48.157 1.00 108.57 ? 168  HIS I CB    1 
ATOM   8312  C  CG    . HIS Q  3 36  ? -45.586  28.121  -48.616 1.00 109.36 ? 168  HIS I CG    1 
ATOM   8313  N  ND1   . HIS Q  3 36  ? -44.643  28.675  -47.777 1.00 110.15 ? 168  HIS I ND1   1 
ATOM   8314  C  CD2   . HIS Q  3 36  ? -44.998  28.025  -49.832 1.00 109.74 ? 168  HIS I CD2   1 
ATOM   8315  C  CE1   . HIS Q  3 36  ? -43.533  28.903  -48.456 1.00 110.62 ? 168  HIS I CE1   1 
ATOM   8316  N  NE2   . HIS Q  3 36  ? -43.722  28.518  -49.706 1.00 110.46 ? 168  HIS I NE2   1 
ATOM   8317  N  N     . PRO Q  3 37  ? -45.515  26.640  -45.119 1.00 107.11 ? 169  PRO I N     1 
ATOM   8318  C  CA    . PRO Q  3 37  ? -45.011  27.076  -43.812 1.00 105.95 ? 169  PRO I CA    1 
ATOM   8319  C  C     . PRO Q  3 37  ? -44.874  28.594  -43.665 1.00 104.55 ? 169  PRO I C     1 
ATOM   8320  O  O     . PRO Q  3 37  ? -44.636  29.103  -42.569 1.00 104.43 ? 169  PRO I O     1 
ATOM   8321  C  CB    . PRO Q  3 37  ? -43.668  26.359  -43.715 1.00 106.83 ? 169  PRO I CB    1 
ATOM   8322  C  CG    . PRO Q  3 37  ? -43.940  25.066  -44.428 1.00 107.06 ? 169  PRO I CG    1 
ATOM   8323  C  CD    . PRO Q  3 37  ? -44.698  25.532  -45.652 1.00 107.10 ? 169  PRO I CD    1 
ATOM   8324  N  N     . LEU Q  3 38  ? -45.032  29.311  -44.770 1.00 102.85 ? 170  LEU I N     1 
ATOM   8325  C  CA    . LEU Q  3 38  ? -44.919  30.762  -44.762 1.00 101.78 ? 170  LEU I CA    1 
ATOM   8326  C  C     . LEU Q  3 38  ? -46.210  31.502  -44.385 1.00 100.83 ? 170  LEU I C     1 
ATOM   8327  O  O     . LEU Q  3 38  ? -46.159  32.655  -43.950 1.00 101.09 ? 170  LEU I O     1 
ATOM   8328  C  CB    . LEU Q  3 38  ? -44.428  31.243  -46.130 1.00 102.46 ? 170  LEU I CB    1 
ATOM   8329  C  CG    . LEU Q  3 38  ? -42.964  31.667  -46.286 1.00 102.85 ? 170  LEU I CG    1 
ATOM   8330  C  CD1   . LEU Q  3 38  ? -42.738  32.955  -45.499 1.00 102.71 ? 170  LEU I CD1   1 
ATOM   8331  C  CD2   . LEU Q  3 38  ? -42.028  30.550  -45.825 1.00 102.41 ? 170  LEU I CD2   1 
ATOM   8332  N  N     . ASN Q  3 39  ? -47.360  30.850  -44.549 1.00 98.88  ? 171  ASN I N     1 
ATOM   8333  C  CA    . ASN Q  3 39  ? -48.643  31.472  -44.219 1.00 96.76  ? 171  ASN I CA    1 
ATOM   8334  C  C     . ASN Q  3 39  ? -48.624  32.164  -42.866 1.00 94.98  ? 171  ASN I C     1 
ATOM   8335  O  O     . ASN Q  3 39  ? -48.079  31.641  -41.898 1.00 94.95  ? 171  ASN I O     1 
ATOM   8336  C  CB    . ASN Q  3 39  ? -49.758  30.431  -44.243 1.00 98.08  ? 171  ASN I CB    1 
ATOM   8337  C  CG    . ASN Q  3 39  ? -50.240  30.132  -45.646 1.00 99.46  ? 171  ASN I CG    1 
ATOM   8338  O  OD1   . ASN Q  3 39  ? -49.449  29.785  -46.526 1.00 100.05 ? 171  ASN I OD1   1 
ATOM   8339  N  ND2   . ASN Q  3 39  ? -51.547  30.267  -45.866 1.00 99.79  ? 171  ASN I ND2   1 
ATOM   8340  N  N     . VAL Q  3 40  ? -49.236  33.338  -42.796 1.00 93.15  ? 172  VAL I N     1 
ATOM   8341  C  CA    . VAL Q  3 40  ? -49.251  34.098  -41.556 1.00 91.54  ? 172  VAL I CA    1 
ATOM   8342  C  C     . VAL Q  3 40  ? -50.642  34.560  -41.145 1.00 89.84  ? 172  VAL I C     1 
ATOM   8343  O  O     . VAL Q  3 40  ? -51.512  34.774  -41.985 1.00 90.04  ? 172  VAL I O     1 
ATOM   8344  C  CB    . VAL Q  3 40  ? -48.350  35.344  -41.673 1.00 91.97  ? 172  VAL I CB    1 
ATOM   8345  C  CG1   . VAL Q  3 40  ? -48.235  36.030  -40.324 1.00 92.24  ? 172  VAL I CG1   1 
ATOM   8346  C  CG2   . VAL Q  3 40  ? -46.979  34.948  -42.202 1.00 91.68  ? 172  VAL I CG2   1 
ATOM   8347  N  N     . GLY Q  3 41  ? -50.834  34.717  -39.840 1.00 87.72  ? 173  GLY I N     1 
ATOM   8348  C  CA    . GLY Q  3 41  ? -52.108  35.169  -39.319 1.00 85.35  ? 173  GLY I CA    1 
ATOM   8349  C  C     . GLY Q  3 41  ? -51.858  36.093  -38.147 1.00 83.52  ? 173  GLY I C     1 
ATOM   8350  O  O     . GLY Q  3 41  ? -52.749  36.373  -37.349 1.00 83.22  ? 173  GLY I O     1 
ATOM   8351  N  N     . ILE Q  3 42  ? -50.626  36.571  -38.050 1.00 82.11  ? 174  ILE I N     1 
ATOM   8352  C  CA    . ILE Q  3 42  ? -50.236  37.462  -36.969 1.00 80.86  ? 174  ILE I CA    1 
ATOM   8353  C  C     . ILE Q  3 42  ? -51.254  38.562  -36.724 1.00 79.62  ? 174  ILE I C     1 
ATOM   8354  O  O     . ILE Q  3 42  ? -51.898  39.053  -37.649 1.00 79.69  ? 174  ILE I O     1 
ATOM   8355  C  CB    . ILE Q  3 42  ? -48.873  38.137  -37.254 1.00 81.20  ? 174  ILE I CB    1 
ATOM   8356  C  CG1   . ILE Q  3 42  ? -48.933  38.867  -38.599 1.00 81.09  ? 174  ILE I CG1   1 
ATOM   8357  C  CG2   . ILE Q  3 42  ? -47.748  37.099  -37.228 1.00 80.80  ? 174  ILE I CG2   1 
ATOM   8358  C  CD1   . ILE Q  3 42  ? -47.666  39.627  -38.944 1.00 81.06  ? 174  ILE I CD1   1 
ATOM   8359  N  N     . ARG Q  3 43  ? -51.388  38.935  -35.458 1.00 78.26  ? 175  ARG I N     1 
ATOM   8360  C  CA    . ARG Q  3 43  ? -52.292  39.995  -35.038 1.00 77.16  ? 175  ARG I CA    1 
ATOM   8361  C  C     . ARG Q  3 43  ? -51.569  41.333  -35.219 1.00 76.69  ? 175  ARG I C     1 
ATOM   8362  O  O     . ARG Q  3 43  ? -50.428  41.491  -34.785 1.00 76.26  ? 175  ARG I O     1 
ATOM   8363  C  CB    . ARG Q  3 43  ? -52.674  39.775  -33.564 1.00 76.34  ? 175  ARG I CB    1 
ATOM   8364  C  CG    . ARG Q  3 43  ? -53.098  41.023  -32.788 1.00 74.54  ? 175  ARG I CG    1 
ATOM   8365  C  CD    . ARG Q  3 43  ? -54.161  41.806  -33.524 1.00 73.35  ? 175  ARG I CD    1 
ATOM   8366  N  NE    . ARG Q  3 43  ? -54.764  42.842  -32.694 1.00 72.11  ? 175  ARG I NE    1 
ATOM   8367  C  CZ    . ARG Q  3 43  ? -55.659  42.605  -31.741 1.00 72.20  ? 175  ARG I CZ    1 
ATOM   8368  N  NH1   . ARG Q  3 43  ? -56.056  41.362  -31.493 1.00 71.09  ? 175  ARG I NH1   1 
ATOM   8369  N  NH2   . ARG Q  3 43  ? -56.170  43.613  -31.047 1.00 72.24  ? 175  ARG I NH2   1 
ATOM   8370  N  N     . LEU Q  3 44  ? -52.217  42.296  -35.867 1.00 76.20  ? 176  LEU I N     1 
ATOM   8371  C  CA    . LEU Q  3 44  ? -51.572  43.589  -36.062 1.00 76.01  ? 176  LEU I CA    1 
ATOM   8372  C  C     . LEU Q  3 44  ? -51.519  44.416  -34.782 1.00 75.74  ? 176  LEU I C     1 
ATOM   8373  O  O     . LEU Q  3 44  ? -52.546  44.720  -34.167 1.00 76.01  ? 176  LEU I O     1 
ATOM   8374  C  CB    . LEU Q  3 44  ? -52.265  44.413  -37.153 1.00 76.02  ? 176  LEU I CB    1 
ATOM   8375  C  CG    . LEU Q  3 44  ? -51.531  45.739  -37.424 1.00 75.65  ? 176  LEU I CG    1 
ATOM   8376  C  CD1   . LEU Q  3 44  ? -50.171  45.438  -38.040 1.00 76.51  ? 176  LEU I CD1   1 
ATOM   8377  C  CD2   . LEU Q  3 44  ? -52.329  46.631  -38.349 1.00 75.23  ? 176  LEU I CD2   1 
ATOM   8378  N  N     . PRO Q  3 45  ? -50.305  44.790  -34.366 1.00 75.31  ? 177  PRO I N     1 
ATOM   8379  C  CA    . PRO Q  3 45  ? -50.055  45.589  -33.165 1.00 74.86  ? 177  PRO I CA    1 
ATOM   8380  C  C     . PRO Q  3 45  ? -50.233  47.084  -33.418 1.00 73.96  ? 177  PRO I C     1 
ATOM   8381  O  O     . PRO Q  3 45  ? -50.389  47.511  -34.560 1.00 73.59  ? 177  PRO I O     1 
ATOM   8382  C  CB    . PRO Q  3 45  ? -48.615  45.234  -32.829 1.00 75.98  ? 177  PRO I CB    1 
ATOM   8383  C  CG    . PRO Q  3 45  ? -48.005  45.066  -34.197 1.00 75.27  ? 177  PRO I CG    1 
ATOM   8384  C  CD    . PRO Q  3 45  ? -49.045  44.250  -34.912 1.00 74.84  ? 177  PRO I CD    1 
ATOM   8385  N  N     . GLY Q  3 46  ? -50.200  47.873  -32.349 1.00 73.72  ? 178  GLY I N     1 
ATOM   8386  C  CA    . GLY Q  3 46  ? -50.351  49.314  -32.484 1.00 74.14  ? 178  GLY I CA    1 
ATOM   8387  C  C     . GLY Q  3 46  ? -51.684  49.736  -33.080 1.00 73.88  ? 178  GLY I C     1 
ATOM   8388  O  O     . GLY Q  3 46  ? -52.504  48.884  -33.417 1.00 74.90  ? 178  GLY I O     1 
ATOM   8389  N  N     . ARG Q  3 47  ? -51.893  51.047  -33.210 1.00 72.44  ? 179  ARG I N     1 
ATOM   8390  C  CA    . ARG Q  3 47  ? -53.126  51.619  -33.763 1.00 70.94  ? 179  ARG I CA    1 
ATOM   8391  C  C     . ARG Q  3 47  ? -53.918  50.660  -34.660 1.00 68.99  ? 179  ARG I C     1 
ATOM   8392  O  O     . ARG Q  3 47  ? -53.388  50.112  -35.626 1.00 68.20  ? 179  ARG I O     1 
ATOM   8393  C  CB    . ARG Q  3 47  ? -52.794  52.889  -34.538 1.00 72.26  ? 179  ARG I CB    1 
ATOM   8394  C  CG    . ARG Q  3 47  ? -54.010  53.657  -34.972 1.00 73.37  ? 179  ARG I CG    1 
ATOM   8395  C  CD    . ARG Q  3 47  ? -53.617  54.801  -35.866 1.00 74.29  ? 179  ARG I CD    1 
ATOM   8396  N  NE    . ARG Q  3 47  ? -54.795  55.437  -36.435 1.00 75.72  ? 179  ARG I NE    1 
ATOM   8397  C  CZ    . ARG Q  3 47  ? -54.754  56.416  -37.328 1.00 76.68  ? 179  ARG I CZ    1 
ATOM   8398  N  NH1   . ARG Q  3 47  ? -55.884  56.936  -37.792 1.00 78.27  ? 179  ARG I NH1   1 
ATOM   8399  N  NH2   . ARG Q  3 47  ? -53.584  56.873  -37.754 1.00 76.95  ? 179  ARG I NH2   1 
ATOM   8400  N  N     . GLN Q  3 48  ? -55.198  50.487  -34.345 1.00 67.65  ? 180  GLN I N     1 
ATOM   8401  C  CA    . GLN Q  3 48  ? -56.063  49.564  -35.074 1.00 65.95  ? 180  GLN I CA    1 
ATOM   8402  C  C     . GLN Q  3 48  ? -57.034  50.220  -36.050 1.00 65.33  ? 180  GLN I C     1 
ATOM   8403  O  O     . GLN Q  3 48  ? -58.000  50.876  -35.639 1.00 64.78  ? 180  GLN I O     1 
ATOM   8404  C  CB    . GLN Q  3 48  ? -56.862  48.726  -34.073 1.00 65.91  ? 180  GLN I CB    1 
ATOM   8405  C  CG    . GLN Q  3 48  ? -56.770  47.212  -34.239 1.00 66.65  ? 180  GLN I CG    1 
ATOM   8406  C  CD    . GLN Q  3 48  ? -55.447  46.622  -33.763 1.00 67.58  ? 180  GLN I CD    1 
ATOM   8407  O  OE1   . GLN Q  3 48  ? -55.357  45.431  -33.461 1.00 67.47  ? 180  GLN I OE1   1 
ATOM   8408  N  NE2   . GLN Q  3 48  ? -54.415  47.449  -33.706 1.00 67.66  ? 180  GLN I NE2   1 
ATOM   8409  N  N     . THR Q  3 49  ? -56.757  50.043  -37.342 1.00 64.25  ? 181  THR I N     1 
ATOM   8410  C  CA    . THR Q  3 49  ? -57.605  50.557  -38.420 1.00 62.98  ? 181  THR I CA    1 
ATOM   8411  C  C     . THR Q  3 49  ? -57.419  49.643  -39.621 1.00 61.50  ? 181  THR I C     1 
ATOM   8412  O  O     . THR Q  3 49  ? -56.343  49.072  -39.826 1.00 60.49  ? 181  THR I O     1 
ATOM   8413  C  CB    . THR Q  3 49  ? -57.264  52.010  -38.871 1.00 63.44  ? 181  THR I CB    1 
ATOM   8414  O  OG1   . THR Q  3 49  ? -56.187  51.985  -39.813 1.00 63.20  ? 181  THR I OG1   1 
ATOM   8415  C  CG2   . THR Q  3 49  ? -56.898  52.884  -37.676 1.00 65.26  ? 181  THR I CG2   1 
ATOM   8416  N  N     . ASN Q  3 50  ? -58.479  49.524  -40.414 1.00 59.96  ? 182  ASN I N     1 
ATOM   8417  C  CA    . ASN Q  3 50  ? -58.490  48.666  -41.582 1.00 57.53  ? 182  ASN I CA    1 
ATOM   8418  C  C     . ASN Q  3 50  ? -57.317  48.832  -42.517 1.00 58.14  ? 182  ASN I C     1 
ATOM   8419  O  O     . ASN Q  3 50  ? -56.502  47.922  -42.654 1.00 58.26  ? 182  ASN I O     1 
ATOM   8420  C  CB    . ASN Q  3 50  ? -59.783  48.851  -42.374 1.00 54.87  ? 182  ASN I CB    1 
ATOM   8421  C  CG    . ASN Q  3 50  ? -59.797  50.124  -43.186 1.00 52.80  ? 182  ASN I CG    1 
ATOM   8422  O  OD1   . ASN Q  3 50  ? -60.327  50.146  -44.291 1.00 52.27  ? 182  ASN I OD1   1 
ATOM   8423  N  ND2   . ASN Q  3 50  ? -59.229  51.195  -42.640 1.00 50.77  ? 182  ASN I ND2   1 
ATOM   8424  N  N     . GLN Q  3 51  ? -57.204  49.982  -43.167 1.00 58.78  ? 183  GLN I N     1 
ATOM   8425  C  CA    . GLN Q  3 51  ? -56.105  50.115  -44.092 1.00 60.02  ? 183  GLN I CA    1 
ATOM   8426  C  C     . GLN Q  3 51  ? -54.730  50.132  -43.467 1.00 61.53  ? 183  GLN I C     1 
ATOM   8427  O  O     . GLN Q  3 51  ? -53.747  49.961  -44.177 1.00 63.52  ? 183  GLN I O     1 
ATOM   8428  C  CB    . GLN Q  3 51  ? -56.298  51.291  -45.065 1.00 57.94  ? 183  GLN I CB    1 
ATOM   8429  C  CG    . GLN Q  3 51  ? -56.654  52.639  -44.514 1.00 54.38  ? 183  GLN I CG    1 
ATOM   8430  C  CD    . GLN Q  3 51  ? -57.268  53.530  -45.604 1.00 53.43  ? 183  GLN I CD    1 
ATOM   8431  O  OE1   . GLN Q  3 51  ? -57.385  54.737  -45.443 1.00 53.13  ? 183  GLN I OE1   1 
ATOM   8432  N  NE2   . GLN Q  3 51  ? -57.671  52.922  -46.713 1.00 50.92  ? 183  GLN I NE2   1 
ATOM   8433  N  N     . ARG Q  3 52  ? -54.622  50.315  -42.157 1.00 62.02  ? 184  ARG I N     1 
ATOM   8434  C  CA    . ARG Q  3 52  ? -53.285  50.254  -41.601 1.00 62.71  ? 184  ARG I CA    1 
ATOM   8435  C  C     . ARG Q  3 52  ? -52.893  48.812  -41.832 1.00 62.76  ? 184  ARG I C     1 
ATOM   8436  O  O     . ARG Q  3 52  ? -51.816  48.520  -42.339 1.00 64.61  ? 184  ARG I O     1 
ATOM   8437  C  CB    . ARG Q  3 52  ? -53.257  50.592  -40.117 1.00 63.79  ? 184  ARG I CB    1 
ATOM   8438  C  CG    . ARG Q  3 52  ? -53.123  52.080  -39.876 1.00 67.88  ? 184  ARG I CG    1 
ATOM   8439  C  CD    . ARG Q  3 52  ? -52.758  52.417  -38.435 1.00 72.62  ? 184  ARG I CD    1 
ATOM   8440  N  NE    . ARG Q  3 52  ? -51.336  52.226  -38.138 1.00 77.74  ? 184  ARG I NE    1 
ATOM   8441  C  CZ    . ARG Q  3 52  ? -50.755  51.050  -37.903 1.00 79.51  ? 184  ARG I CZ    1 
ATOM   8442  N  NH1   . ARG Q  3 52  ? -51.466  49.927  -37.922 1.00 80.18  ? 184  ARG I NH1   1 
ATOM   8443  N  NH2   . ARG Q  3 52  ? -49.453  50.995  -37.645 1.00 79.84  ? 184  ARG I NH2   1 
ATOM   8444  N  N     . ALA Q  3 53  ? -53.791  47.899  -41.503 1.00 62.36  ? 185  ALA I N     1 
ATOM   8445  C  CA    . ALA Q  3 53  ? -53.498  46.492  -41.719 1.00 63.05  ? 185  ALA I CA    1 
ATOM   8446  C  C     . ALA Q  3 53  ? -53.218  46.244  -43.196 1.00 63.40  ? 185  ALA I C     1 
ATOM   8447  O  O     . ALA Q  3 53  ? -52.144  45.777  -43.566 1.00 62.09  ? 185  ALA I O     1 
ATOM   8448  C  CB    . ALA Q  3 53  ? -54.676  45.633  -41.272 1.00 63.91  ? 185  ALA I CB    1 
ATOM   8449  N  N     . GLU Q  3 54  ? -54.197  46.587  -44.029 1.00 65.06  ? 186  GLU I N     1 
ATOM   8450  C  CA    . GLU Q  3 54  ? -54.117  46.383  -45.471 1.00 66.08  ? 186  GLU I CA    1 
ATOM   8451  C  C     . GLU Q  3 54  ? -52.773  46.737  -46.093 1.00 66.83  ? 186  GLU I C     1 
ATOM   8452  O  O     . GLU Q  3 54  ? -52.420  46.184  -47.135 1.00 67.10  ? 186  GLU I O     1 
ATOM   8453  C  CB    . GLU Q  3 54  ? -55.244  47.147  -46.184 1.00 65.72  ? 186  GLU I CB    1 
ATOM   8454  C  CG    . GLU Q  3 54  ? -55.613  46.559  -47.556 1.00 65.53  ? 186  GLU I CG    1 
ATOM   8455  C  CD    . GLU Q  3 54  ? -56.276  45.172  -47.488 1.00 65.02  ? 186  GLU I CD    1 
ATOM   8456  O  OE1   . GLU Q  3 54  ? -57.522  45.098  -47.327 1.00 61.33  ? 186  GLU I OE1   1 
ATOM   8457  O  OE2   . GLU Q  3 54  ? -55.543  44.157  -47.594 1.00 63.97  ? 186  GLU I OE2   1 
ATOM   8458  N  N     . ILE Q  3 55  ? -52.021  47.647  -45.476 1.00 67.61  ? 187  ILE I N     1 
ATOM   8459  C  CA    . ILE Q  3 55  ? -50.714  47.992  -46.026 1.00 69.05  ? 187  ILE I CA    1 
ATOM   8460  C  C     . ILE Q  3 55  ? -49.618  47.319  -45.220 1.00 70.34  ? 187  ILE I C     1 
ATOM   8461  O  O     . ILE Q  3 55  ? -48.583  46.938  -45.764 1.00 70.63  ? 187  ILE I O     1 
ATOM   8462  C  CB    . ILE Q  3 55  ? -50.458  49.520  -46.067 1.00 68.39  ? 187  ILE I CB    1 
ATOM   8463  C  CG1   . ILE Q  3 55  ? -49.441  49.931  -45.011 1.00 67.14  ? 187  ILE I CG1   1 
ATOM   8464  C  CG2   . ILE Q  3 55  ? -51.749  50.268  -45.866 1.00 69.26  ? 187  ILE I CG2   1 
ATOM   8465  C  CD1   . ILE Q  3 55  ? -49.051  51.376  -45.134 1.00 68.17  ? 187  ILE I CD1   1 
ATOM   8466  N  N     . HIS Q  3 56  ? -49.846  47.166  -43.921 1.00 71.52  ? 188  HIS I N     1 
ATOM   8467  C  CA    . HIS Q  3 56  ? -48.863  46.504  -43.076 1.00 72.94  ? 188  HIS I CA    1 
ATOM   8468  C  C     . HIS Q  3 56  ? -48.863  45.028  -43.402 1.00 73.77  ? 188  HIS I C     1 
ATOM   8469  O  O     . HIS Q  3 56  ? -48.103  44.241  -42.835 1.00 73.67  ? 188  HIS I O     1 
ATOM   8470  C  CB    . HIS Q  3 56  ? -49.178  46.736  -41.606 1.00 72.48  ? 188  HIS I CB    1 
ATOM   8471  C  CG    . HIS Q  3 56  ? -48.419  47.880  -41.025 1.00 73.21  ? 188  HIS I CG    1 
ATOM   8472  N  ND1   . HIS Q  3 56  ? -47.252  47.709  -40.315 1.00 74.20  ? 188  HIS I ND1   1 
ATOM   8473  C  CD2   . HIS Q  3 56  ? -48.602  49.217  -41.134 1.00 73.80  ? 188  HIS I CD2   1 
ATOM   8474  C  CE1   . HIS Q  3 56  ? -46.747  48.892  -40.011 1.00 74.49  ? 188  HIS I CE1   1 
ATOM   8475  N  NE2   . HIS Q  3 56  ? -47.548  49.823  -40.498 1.00 74.44  ? 188  HIS I NE2   1 
ATOM   8476  N  N     . ALA Q  3 57  ? -49.735  44.672  -44.336 1.00 74.88  ? 189  ALA I N     1 
ATOM   8477  C  CA    . ALA Q  3 57  ? -49.856  43.308  -44.797 1.00 76.47  ? 189  ALA I CA    1 
ATOM   8478  C  C     . ALA Q  3 57  ? -48.777  43.149  -45.846 1.00 77.47  ? 189  ALA I C     1 
ATOM   8479  O  O     . ALA Q  3 57  ? -48.084  42.133  -45.894 1.00 78.12  ? 189  ALA I O     1 
ATOM   8480  C  CB    . ALA Q  3 57  ? -51.223  43.085  -45.410 1.00 77.33  ? 189  ALA I CB    1 
ATOM   8481  N  N     . ALA Q  3 58  ? -48.638  44.171  -46.686 1.00 78.20  ? 190  ALA I N     1 
ATOM   8482  C  CA    . ALA Q  3 58  ? -47.626  44.158  -47.732 1.00 79.58  ? 190  ALA I CA    1 
ATOM   8483  C  C     . ALA Q  3 58  ? -46.300  43.834  -47.059 1.00 80.72  ? 190  ALA I C     1 
ATOM   8484  O  O     . ALA Q  3 58  ? -45.525  42.998  -47.530 1.00 80.18  ? 190  ALA I O     1 
ATOM   8485  C  CB    . ALA Q  3 58  ? -47.555  45.523  -48.406 1.00 78.49  ? 190  ALA I CB    1 
ATOM   8486  N  N     . CYS Q  3 59  ? -46.072  44.500  -45.934 1.00 82.38  ? 191  CYS I N     1 
ATOM   8487  C  CA    . CYS Q  3 59  ? -44.862  44.333  -45.149 1.00 83.88  ? 191  CYS I CA    1 
ATOM   8488  C  C     . CYS Q  3 59  ? -44.552  42.870  -44.878 1.00 85.16  ? 191  CYS I C     1 
ATOM   8489  O  O     . CYS Q  3 59  ? -43.757  42.261  -45.592 1.00 84.81  ? 191  CYS I O     1 
ATOM   8490  C  CB    . CYS Q  3 59  ? -44.999  45.094  -43.830 1.00 83.80  ? 191  CYS I CB    1 
ATOM   8491  S  SG    . CYS Q  3 59  ? -45.304  46.869  -44.054 1.00 84.47  ? 191  CYS I SG    1 
ATOM   8492  N  N     . LYS Q  3 60  ? -45.186  42.311  -43.850 1.00 87.61  ? 192  LYS I N     1 
ATOM   8493  C  CA    . LYS Q  3 60  ? -44.967  40.916  -43.472 1.00 90.12  ? 192  LYS I CA    1 
ATOM   8494  C  C     . LYS Q  3 60  ? -44.513  40.093  -44.661 1.00 91.57  ? 192  LYS I C     1 
ATOM   8495  O  O     . LYS Q  3 60  ? -43.500  39.397  -44.599 1.00 91.13  ? 192  LYS I O     1 
ATOM   8496  C  CB    . LYS Q  3 60  ? -46.244  40.296  -42.903 1.00 90.39  ? 192  LYS I CB    1 
ATOM   8497  C  CG    . LYS Q  3 60  ? -46.000  38.957  -42.218 1.00 91.05  ? 192  LYS I CG    1 
ATOM   8498  C  CD    . LYS Q  3 60  ? -44.983  39.138  -41.094 1.00 91.98  ? 192  LYS I CD    1 
ATOM   8499  C  CE    . LYS Q  3 60  ? -44.783  37.880  -40.274 1.00 91.86  ? 192  LYS I CE    1 
ATOM   8500  N  NZ    . LYS Q  3 60  ? -43.765  38.107  -39.209 1.00 91.94  ? 192  LYS I NZ    1 
ATOM   8501  N  N     . ALA Q  3 61  ? -45.276  40.187  -45.745 1.00 93.76  ? 193  ALA I N     1 
ATOM   8502  C  CA    . ALA Q  3 61  ? -44.965  39.466  -46.966 1.00 95.67  ? 193  ALA I CA    1 
ATOM   8503  C  C     . ALA Q  3 61  ? -43.516  39.738  -47.346 1.00 97.04  ? 193  ALA I C     1 
ATOM   8504  O  O     . ALA Q  3 61  ? -42.641  38.902  -47.117 1.00 97.71  ? 193  ALA I O     1 
ATOM   8505  C  CB    . ALA Q  3 61  ? -45.902  39.907  -48.090 1.00 95.30  ? 193  ALA I CB    1 
ATOM   8506  N  N     . ILE Q  3 62  ? -43.257  40.915  -47.906 1.00 98.21  ? 194  ILE I N     1 
ATOM   8507  C  CA    . ILE Q  3 62  ? -41.905  41.261  -48.317 1.00 99.53  ? 194  ILE I CA    1 
ATOM   8508  C  C     . ILE Q  3 62  ? -40.887  41.037  -47.208 1.00 100.15 ? 194  ILE I C     1 
ATOM   8509  O  O     . ILE Q  3 62  ? -39.811  40.500  -47.462 1.00 100.56 ? 194  ILE I O     1 
ATOM   8510  C  CB    . ILE Q  3 62  ? -41.820  42.722  -48.806 1.00 99.89  ? 194  ILE I CB    1 
ATOM   8511  C  CG1   . ILE Q  3 62  ? -42.196  43.680  -47.680 1.00 101.08 ? 194  ILE I CG1   1 
ATOM   8512  C  CG2   . ILE Q  3 62  ? -42.747  42.922  -49.994 1.00 100.16 ? 194  ILE I CG2   1 
ATOM   8513  C  CD1   . ILE Q  3 62  ? -42.356  45.115  -48.139 1.00 101.84 ? 194  ILE I CD1   1 
ATOM   8514  N  N     . GLU Q  3 63  ? -41.221  41.427  -45.981 1.00 101.06 ? 195  GLU I N     1 
ATOM   8515  C  CA    . GLU Q  3 63  ? -40.295  41.239  -44.867 1.00 102.31 ? 195  GLU I CA    1 
ATOM   8516  C  C     . GLU Q  3 63  ? -39.886  39.769  -44.769 1.00 102.54 ? 195  GLU I C     1 
ATOM   8517  O  O     . GLU Q  3 63  ? -38.704  39.451  -44.618 1.00 102.25 ? 195  GLU I O     1 
ATOM   8518  C  CB    . GLU Q  3 63  ? -40.928  41.688  -43.548 1.00 102.94 ? 195  GLU I CB    1 
ATOM   8519  C  CG    . GLU Q  3 63  ? -39.969  41.624  -42.364 1.00 103.72 ? 195  GLU I CG    1 
ATOM   8520  C  CD    . GLU Q  3 63  ? -40.600  42.081  -41.061 1.00 104.28 ? 195  GLU I CD    1 
ATOM   8521  O  OE1   . GLU Q  3 63  ? -41.563  41.429  -40.600 1.00 104.74 ? 195  GLU I OE1   1 
ATOM   8522  O  OE2   . GLU Q  3 63  ? -40.130  43.093  -40.497 1.00 104.78 ? 195  GLU I OE2   1 
ATOM   8523  N  N     . GLN Q  3 64  ? -40.867  38.876  -44.853 1.00 102.80 ? 196  GLN I N     1 
ATOM   8524  C  CA    . GLN Q  3 64  ? -40.588  37.448  -44.798 1.00 103.53 ? 196  GLN I CA    1 
ATOM   8525  C  C     . GLN Q  3 64  ? -39.668  37.091  -45.955 1.00 103.35 ? 196  GLN I C     1 
ATOM   8526  O  O     . GLN Q  3 64  ? -38.707  36.344  -45.795 1.00 103.46 ? 196  GLN I O     1 
ATOM   8527  C  CB    . GLN Q  3 64  ? -41.880  36.635  -44.927 1.00 104.79 ? 196  GLN I CB    1 
ATOM   8528  C  CG    . GLN Q  3 64  ? -42.788  36.667  -43.710 1.00 106.85 ? 196  GLN I CG    1 
ATOM   8529  C  CD    . GLN Q  3 64  ? -44.029  35.804  -43.887 1.00 107.21 ? 196  GLN I CD    1 
ATOM   8530  O  OE1   . GLN Q  3 64  ? -44.908  36.120  -44.687 1.00 107.54 ? 196  GLN I OE1   1 
ATOM   8531  N  NE2   . GLN Q  3 64  ? -44.098  34.704  -43.144 1.00 107.64 ? 196  GLN I NE2   1 
ATOM   8532  N  N     . ALA Q  3 65  ? -39.977  37.642  -47.122 1.00 103.09 ? 197  ALA I N     1 
ATOM   8533  C  CA    . ALA Q  3 65  ? -39.217  37.391  -48.338 1.00 103.27 ? 197  ALA I CA    1 
ATOM   8534  C  C     . ALA Q  3 65  ? -37.743  37.780  -48.241 1.00 103.86 ? 197  ALA I C     1 
ATOM   8535  O  O     . ALA Q  3 65  ? -36.862  37.010  -48.629 1.00 103.21 ? 197  ALA I O     1 
ATOM   8536  C  CB    . ALA Q  3 65  ? -39.871  38.123  -49.498 1.00 103.05 ? 197  ALA I CB    1 
ATOM   8537  N  N     . LYS Q  3 66  ? -37.483  38.982  -47.735 1.00 104.61 ? 198  LYS I N     1 
ATOM   8538  C  CA    . LYS Q  3 66  ? -36.121  39.480  -47.595 1.00 105.36 ? 198  LYS I CA    1 
ATOM   8539  C  C     . LYS Q  3 66  ? -35.261  38.481  -46.832 1.00 106.26 ? 198  LYS I C     1 
ATOM   8540  O  O     . LYS Q  3 66  ? -34.146  38.163  -47.249 1.00 106.26 ? 198  LYS I O     1 
ATOM   8541  C  CB    . LYS Q  3 66  ? -36.130  40.826  -46.874 1.00 104.66 ? 198  LYS I CB    1 
ATOM   8542  N  N     . THR Q  3 67  ? -35.791  37.983  -45.719 1.00 107.51 ? 199  THR I N     1 
ATOM   8543  C  CA    . THR Q  3 67  ? -35.077  37.020  -44.882 1.00 108.58 ? 199  THR I CA    1 
ATOM   8544  C  C     . THR Q  3 67  ? -34.847  35.674  -45.577 1.00 108.52 ? 199  THR I C     1 
ATOM   8545  O  O     . THR Q  3 67  ? -34.055  34.851  -45.111 1.00 108.00 ? 199  THR I O     1 
ATOM   8546  C  CB    . THR Q  3 67  ? -35.827  36.780  -43.538 1.00 109.23 ? 199  THR I CB    1 
ATOM   8547  O  OG1   . THR Q  3 67  ? -37.192  36.431  -43.800 1.00 109.58 ? 199  THR I OG1   1 
ATOM   8548  C  CG2   . THR Q  3 67  ? -35.781  38.034  -42.660 1.00 108.75 ? 199  THR I CG2   1 
ATOM   8549  N  N     . GLN Q  3 68  ? -35.536  35.457  -46.694 1.00 108.97 ? 200  GLN I N     1 
ATOM   8550  C  CA    . GLN Q  3 68  ? -35.395  34.215  -47.449 1.00 109.23 ? 200  GLN I CA    1 
ATOM   8551  C  C     . GLN Q  3 68  ? -34.736  34.506  -48.791 1.00 109.53 ? 200  GLN I C     1 
ATOM   8552  O  O     . GLN Q  3 68  ? -34.906  33.762  -49.762 1.00 109.62 ? 200  GLN I O     1 
ATOM   8553  C  CB    . GLN Q  3 68  ? -36.762  33.570  -47.666 1.00 108.65 ? 200  GLN I CB    1 
ATOM   8554  C  CG    . GLN Q  3 68  ? -37.751  33.846  -46.546 1.00 108.71 ? 200  GLN I CG    1 
ATOM   8555  C  CD    . GLN Q  3 68  ? -37.190  33.583  -45.156 1.00 108.41 ? 200  GLN I CD    1 
ATOM   8556  O  OE1   . GLN Q  3 68  ? -37.833  33.891  -44.153 1.00 108.30 ? 200  GLN I OE1   1 
ATOM   8557  N  NE2   . GLN Q  3 68  ? -35.993  33.011  -45.090 1.00 108.11 ? 200  GLN I NE2   1 
ATOM   8558  N  N     . ASN Q  3 69  ? -33.986  35.604  -48.821 1.00 109.28 ? 201  ASN I N     1 
ATOM   8559  C  CA    . ASN Q  3 69  ? -33.264  36.058  -50.004 1.00 108.49 ? 201  ASN I CA    1 
ATOM   8560  C  C     . ASN Q  3 69  ? -33.956  35.756  -51.325 1.00 107.74 ? 201  ASN I C     1 
ATOM   8561  O  O     . ASN Q  3 69  ? -33.343  35.234  -52.256 1.00 107.95 ? 201  ASN I O     1 
ATOM   8562  C  CB    . ASN Q  3 69  ? -31.855  35.468  -50.009 1.00 108.45 ? 201  ASN I CB    1 
ATOM   8563  C  CG    . ASN Q  3 69  ? -31.056  35.870  -48.787 1.00 109.16 ? 201  ASN I CG    1 
ATOM   8564  O  OD1   . ASN Q  3 69  ? -29.858  35.604  -48.703 1.00 110.19 ? 201  ASN I OD1   1 
ATOM   8565  N  ND2   . ASN Q  3 69  ? -31.718  36.512  -47.827 1.00 108.78 ? 201  ASN I ND2   1 
ATOM   8566  N  N     . ILE Q  3 70  ? -35.240  36.082  -51.400 1.00 106.43 ? 202  ILE I N     1 
ATOM   8567  C  CA    . ILE Q  3 70  ? -35.999  35.871  -52.620 1.00 105.17 ? 202  ILE I CA    1 
ATOM   8568  C  C     . ILE Q  3 70  ? -36.062  37.218  -53.329 1.00 104.30 ? 202  ILE I C     1 
ATOM   8569  O  O     . ILE Q  3 70  ? -36.845  38.093  -52.967 1.00 104.50 ? 202  ILE I O     1 
ATOM   8570  C  CB    . ILE Q  3 70  ? -37.414  35.367  -52.311 1.00 105.29 ? 202  ILE I CB    1 
ATOM   8571  C  CG1   . ILE Q  3 70  ? -38.253  35.339  -53.589 1.00 105.23 ? 202  ILE I CG1   1 
ATOM   8572  C  CG2   . ILE Q  3 70  ? -38.039  36.228  -51.242 1.00 105.15 ? 202  ILE I CG2   1 
ATOM   8573  C  CD1   . ILE Q  3 70  ? -37.715  34.403  -54.652 1.00 105.78 ? 202  ILE I CD1   1 
ATOM   8574  N  N     . ASN Q  3 71  ? -35.212  37.366  -54.338 1.00 103.15 ? 203  ASN I N     1 
ATOM   8575  C  CA    . ASN Q  3 71  ? -35.084  38.593  -55.122 1.00 101.88 ? 203  ASN I CA    1 
ATOM   8576  C  C     . ASN Q  3 71  ? -36.349  39.374  -55.524 1.00 101.06 ? 203  ASN I C     1 
ATOM   8577  O  O     . ASN Q  3 71  ? -36.357  40.606  -55.472 1.00 100.83 ? 203  ASN I O     1 
ATOM   8578  C  CB    . ASN Q  3 71  ? -34.252  38.291  -56.380 1.00 101.31 ? 203  ASN I CB    1 
ATOM   8579  C  CG    . ASN Q  3 71  ? -34.932  37.295  -57.314 1.00 100.46 ? 203  ASN I CG    1 
ATOM   8580  O  OD1   . ASN Q  3 71  ? -35.828  36.554  -56.905 1.00 100.84 ? 203  ASN I OD1   1 
ATOM   8581  N  ND2   . ASN Q  3 71  ? -34.499  37.267  -58.569 1.00 98.18  ? 203  ASN I ND2   1 
ATOM   8582  N  N     . LYS Q  3 72  ? -37.416  38.682  -55.912 1.00 99.72  ? 204  LYS I N     1 
ATOM   8583  C  CA    . LYS Q  3 72  ? -38.616  39.382  -56.361 1.00 98.40  ? 204  LYS I CA    1 
ATOM   8584  C  C     . LYS Q  3 72  ? -39.918  38.592  -56.222 1.00 97.81  ? 204  LYS I C     1 
ATOM   8585  O  O     . LYS Q  3 72  ? -39.901  37.363  -56.141 1.00 98.36  ? 204  LYS I O     1 
ATOM   8586  C  CB    . LYS Q  3 72  ? -38.404  39.782  -57.818 1.00 98.25  ? 204  LYS I CB    1 
ATOM   8587  C  CG    . LYS Q  3 72  ? -37.790  38.653  -58.651 1.00 98.42  ? 204  LYS I CG    1 
ATOM   8588  C  CD    . LYS Q  3 72  ? -37.252  39.146  -59.995 1.00 98.70  ? 204  LYS I CD    1 
ATOM   8589  C  CE    . LYS Q  3 72  ? -36.530  38.032  -60.754 1.00 97.80  ? 204  LYS I CE    1 
ATOM   8590  N  NZ    . LYS Q  3 72  ? -36.002  38.484  -62.075 1.00 96.42  ? 204  LYS I NZ    1 
ATOM   8591  N  N     . LEU Q  3 73  ? -41.047  39.300  -56.209 1.00 96.36  ? 205  LEU I N     1 
ATOM   8592  C  CA    . LEU Q  3 73  ? -42.350  38.648  -56.078 1.00 94.98  ? 205  LEU I CA    1 
ATOM   8593  C  C     . LEU Q  3 73  ? -43.550  39.436  -56.616 1.00 93.61  ? 205  LEU I C     1 
ATOM   8594  O  O     . LEU Q  3 73  ? -43.462  40.636  -56.892 1.00 93.13  ? 205  LEU I O     1 
ATOM   8595  C  CB    . LEU Q  3 73  ? -42.611  38.279  -54.616 1.00 95.27  ? 205  LEU I CB    1 
ATOM   8596  C  CG    . LEU Q  3 73  ? -42.561  39.419  -53.601 1.00 95.61  ? 205  LEU I CG    1 
ATOM   8597  C  CD1   . LEU Q  3 73  ? -43.124  38.940  -52.276 1.00 96.12  ? 205  LEU I CD1   1 
ATOM   8598  C  CD2   . LEU Q  3 73  ? -41.129  39.898  -53.435 1.00 95.64  ? 205  LEU I CD2   1 
ATOM   8599  N  N     . VAL Q  3 74  ? -44.671  38.725  -56.753 1.00 91.81  ? 206  VAL I N     1 
ATOM   8600  C  CA    . VAL Q  3 74  ? -45.929  39.272  -57.257 1.00 89.80  ? 206  VAL I CA    1 
ATOM   8601  C  C     . VAL Q  3 74  ? -46.949  39.351  -56.130 1.00 88.78  ? 206  VAL I C     1 
ATOM   8602  O  O     . VAL Q  3 74  ? -47.743  38.434  -55.933 1.00 89.26  ? 206  VAL I O     1 
ATOM   8603  C  CB    . VAL Q  3 74  ? -46.510  38.373  -58.353 1.00 89.17  ? 206  VAL I CB    1 
ATOM   8604  C  CG1   . VAL Q  3 74  ? -47.838  38.925  -58.827 1.00 89.90  ? 206  VAL I CG1   1 
ATOM   8605  C  CG2   . VAL Q  3 74  ? -45.536  38.270  -59.498 1.00 89.10  ? 206  VAL I CG2   1 
ATOM   8606  N  N     . LEU Q  3 75  ? -46.940  40.457  -55.402 1.00 87.19  ? 207  LEU I N     1 
ATOM   8607  C  CA    . LEU Q  3 75  ? -47.847  40.625  -54.280 1.00 85.28  ? 207  LEU I CA    1 
ATOM   8608  C  C     . LEU Q  3 75  ? -49.262  41.023  -54.690 1.00 83.91  ? 207  LEU I C     1 
ATOM   8609  O  O     . LEU Q  3 75  ? -49.486  42.097  -55.243 1.00 83.73  ? 207  LEU I O     1 
ATOM   8610  C  CB    . LEU Q  3 75  ? -47.261  41.654  -53.312 1.00 85.36  ? 207  LEU I CB    1 
ATOM   8611  C  CG    . LEU Q  3 75  ? -47.850  41.716  -51.905 1.00 85.29  ? 207  LEU I CG    1 
ATOM   8612  C  CD1   . LEU Q  3 75  ? -46.867  42.409  -50.982 1.00 85.43  ? 207  LEU I CD1   1 
ATOM   8613  C  CD2   . LEU Q  3 75  ? -49.183  42.437  -51.929 1.00 85.39  ? 207  LEU I CD2   1 
ATOM   8614  N  N     . TYR Q  3 76  ? -50.214  40.141  -54.412 1.00 82.33  ? 208  TYR I N     1 
ATOM   8615  C  CA    . TYR Q  3 76  ? -51.612  40.392  -54.726 1.00 81.34  ? 208  TYR I CA    1 
ATOM   8616  C  C     . TYR Q  3 76  ? -52.326  41.005  -53.517 1.00 79.68  ? 208  TYR I C     1 
ATOM   8617  O  O     . TYR Q  3 76  ? -52.638  40.292  -52.565 1.00 79.46  ? 208  TYR I O     1 
ATOM   8618  C  CB    . TYR Q  3 76  ? -52.328  39.083  -55.088 1.00 83.46  ? 208  TYR I CB    1 
ATOM   8619  C  CG    . TYR Q  3 76  ? -52.232  38.632  -56.537 1.00 85.15  ? 208  TYR I CG    1 
ATOM   8620  C  CD1   . TYR Q  3 76  ? -51.160  37.860  -56.987 1.00 85.98  ? 208  TYR I CD1   1 
ATOM   8621  C  CD2   . TYR Q  3 76  ? -53.238  38.956  -57.452 1.00 85.58  ? 208  TYR I CD2   1 
ATOM   8622  C  CE1   . TYR Q  3 76  ? -51.099  37.420  -58.317 1.00 86.79  ? 208  TYR I CE1   1 
ATOM   8623  C  CE2   . TYR Q  3 76  ? -53.187  38.525  -58.773 1.00 86.18  ? 208  TYR I CE2   1 
ATOM   8624  C  CZ    . TYR Q  3 76  ? -52.118  37.760  -59.200 1.00 86.82  ? 208  TYR I CZ    1 
ATOM   8625  O  OH    . TYR Q  3 76  ? -52.074  37.344  -60.509 1.00 87.39  ? 208  TYR I OH    1 
ATOM   8626  N  N     . THR Q  3 77  ? -52.579  42.313  -53.543 1.00 77.77  ? 209  THR I N     1 
ATOM   8627  C  CA    . THR Q  3 77  ? -53.295  42.964  -52.439 1.00 76.45  ? 209  THR I CA    1 
ATOM   8628  C  C     . THR Q  3 77  ? -54.675  43.332  -52.934 1.00 75.37  ? 209  THR I C     1 
ATOM   8629  O  O     . THR Q  3 77  ? -55.005  43.090  -54.092 1.00 75.92  ? 209  THR I O     1 
ATOM   8630  C  CB    . THR Q  3 77  ? -52.636  44.279  -51.955 1.00 76.97  ? 209  THR I CB    1 
ATOM   8631  O  OG1   . THR Q  3 77  ? -53.261  44.702  -50.735 1.00 76.57  ? 209  THR I OG1   1 
ATOM   8632  C  CG2   . THR Q  3 77  ? -52.833  45.390  -52.978 1.00 77.51  ? 209  THR I CG2   1 
ATOM   8633  N  N     . ASN Q  3 78  ? -55.476  43.934  -52.065 1.00 73.87  ? 210  ASN I N     1 
ATOM   8634  C  CA    . ASN Q  3 78  ? -56.817  44.326  -52.453 1.00 72.91  ? 210  ASN I CA    1 
ATOM   8635  C  C     . ASN Q  3 78  ? -57.145  45.711  -51.947 1.00 71.82  ? 210  ASN I C     1 
ATOM   8636  O  O     . ASN Q  3 78  ? -58.249  45.947  -51.474 1.00 71.42  ? 210  ASN I O     1 
ATOM   8637  C  CB    . ASN Q  3 78  ? -57.843  43.323  -51.924 1.00 73.76  ? 210  ASN I CB    1 
ATOM   8638  C  CG    . ASN Q  3 78  ? -57.748  43.131  -50.428 1.00 75.73  ? 210  ASN I CG    1 
ATOM   8639  O  OD1   . ASN Q  3 78  ? -56.695  42.767  -49.906 1.00 78.28  ? 210  ASN I OD1   1 
ATOM   8640  N  ND2   . ASN Q  3 78  ? -58.848  43.373  -49.727 1.00 76.13  ? 210  ASN I ND2   1 
ATOM   8641  N  N     . SER Q  3 79  ? -56.185  46.627  -52.047 1.00 71.23  ? 211  SER I N     1 
ATOM   8642  C  CA    . SER Q  3 79  ? -56.399  48.001  -51.603 1.00 70.81  ? 211  SER I CA    1 
ATOM   8643  C  C     . SER Q  3 79  ? -55.699  49.022  -52.478 1.00 69.84  ? 211  SER I C     1 
ATOM   8644  O  O     . SER Q  3 79  ? -54.487  49.197  -52.402 1.00 69.27  ? 211  SER I O     1 
ATOM   8645  C  CB    . SER Q  3 79  ? -55.925  48.180  -50.166 1.00 71.33  ? 211  SER I CB    1 
ATOM   8646  O  OG    . SER Q  3 79  ? -54.590  47.743  -50.027 1.00 72.39  ? 211  SER I OG    1 
ATOM   8647  N  N     . MET Q  3 80  ? -56.472  49.707  -53.307 1.00 69.39  ? 212  MET I N     1 
ATOM   8648  C  CA    . MET Q  3 80  ? -55.900  50.713  -54.178 1.00 69.34  ? 212  MET I CA    1 
ATOM   8649  C  C     . MET Q  3 80  ? -55.333  51.848  -53.346 1.00 68.56  ? 212  MET I C     1 
ATOM   8650  O  O     . MET Q  3 80  ? -54.783  52.803  -53.886 1.00 68.93  ? 212  MET I O     1 
ATOM   8651  C  CB    . MET Q  3 80  ? -56.957  51.257  -55.133 1.00 71.39  ? 212  MET I CB    1 
ATOM   8652  C  CG    . MET Q  3 80  ? -57.414  50.265  -56.192 1.00 73.76  ? 212  MET I CG    1 
ATOM   8653  S  SD    . MET Q  3 80  ? -56.079  49.736  -57.298 1.00 75.71  ? 212  MET I SD    1 
ATOM   8654  C  CE    . MET Q  3 80  ? -55.892  51.210  -58.414 1.00 74.40  ? 212  MET I CE    1 
ATOM   8655  N  N     . PHE Q  3 81  ? -55.480  51.751  -52.028 1.00 67.56  ? 213  PHE I N     1 
ATOM   8656  C  CA    . PHE Q  3 81  ? -54.953  52.780  -51.140 1.00 65.37  ? 213  PHE I CA    1 
ATOM   8657  C  C     . PHE Q  3 81  ? -53.488  52.478  -50.894 1.00 63.85  ? 213  PHE I C     1 
ATOM   8658  O  O     . PHE Q  3 81  ? -52.628  53.347  -51.029 1.00 62.84  ? 213  PHE I O     1 
ATOM   8659  C  CB    . PHE Q  3 81  ? -55.694  52.783  -49.809 1.00 65.54  ? 213  PHE I CB    1 
ATOM   8660  C  CG    . PHE Q  3 81  ? -55.128  53.751  -48.811 1.00 64.90  ? 213  PHE I CG    1 
ATOM   8661  C  CD1   . PHE Q  3 81  ? -55.274  55.121  -48.992 1.00 64.19  ? 213  PHE I CD1   1 
ATOM   8662  C  CD2   . PHE Q  3 81  ? -54.426  53.294  -47.697 1.00 64.96  ? 213  PHE I CD2   1 
ATOM   8663  C  CE1   . PHE Q  3 81  ? -54.730  56.026  -48.076 1.00 63.82  ? 213  PHE I CE1   1 
ATOM   8664  C  CE2   . PHE Q  3 81  ? -53.877  54.192  -46.774 1.00 64.06  ? 213  PHE I CE2   1 
ATOM   8665  C  CZ    . PHE Q  3 81  ? -54.030  55.560  -46.966 1.00 63.17  ? 213  PHE I CZ    1 
ATOM   8666  N  N     . THR Q  3 82  ? -53.214  51.233  -50.526 1.00 62.48  ? 214  THR I N     1 
ATOM   8667  C  CA    . THR Q  3 82  ? -51.851  50.794  -50.275 1.00 62.75  ? 214  THR I CA    1 
ATOM   8668  C  C     . THR Q  3 82  ? -51.027  50.935  -51.549 1.00 62.82  ? 214  THR I C     1 
ATOM   8669  O  O     . THR Q  3 82  ? -49.881  51.393  -51.513 1.00 62.72  ? 214  THR I O     1 
ATOM   8670  C  CB    . THR Q  3 82  ? -51.826  49.326  -49.845 1.00 63.03  ? 214  THR I CB    1 
ATOM   8671  O  OG1   . THR Q  3 82  ? -52.636  49.162  -48.675 1.00 66.07  ? 214  THR I OG1   1 
ATOM   8672  C  CG2   . THR Q  3 82  ? -50.413  48.880  -49.555 1.00 61.16  ? 214  THR I CG2   1 
ATOM   8673  N  N     . ILE Q  3 83  ? -51.632  50.539  -52.670 1.00 62.35  ? 215  ILE I N     1 
ATOM   8674  C  CA    . ILE Q  3 83  ? -50.999  50.594  -53.985 1.00 61.37  ? 215  ILE I CA    1 
ATOM   8675  C  C     . ILE Q  3 83  ? -50.798  52.014  -54.511 1.00 61.61  ? 215  ILE I C     1 
ATOM   8676  O  O     . ILE Q  3 83  ? -49.669  52.429  -54.747 1.00 61.42  ? 215  ILE I O     1 
ATOM   8677  C  CB    . ILE Q  3 83  ? -51.814  49.794  -55.019 1.00 60.63  ? 215  ILE I CB    1 
ATOM   8678  C  CG1   . ILE Q  3 83  ? -51.695  48.303  -54.724 1.00 59.59  ? 215  ILE I CG1   1 
ATOM   8679  C  CG2   . ILE Q  3 83  ? -51.317  50.083  -56.427 1.00 61.07  ? 215  ILE I CG2   1 
ATOM   8680  C  CD1   . ILE Q  3 83  ? -52.428  47.435  -55.718 1.00 59.43  ? 215  ILE I CD1   1 
ATOM   8681  N  N     . ASN Q  3 84  ? -51.880  52.759  -54.708 1.00 62.35  ? 216  ASN I N     1 
ATOM   8682  C  CA    . ASN Q  3 84  ? -51.745  54.125  -55.205 1.00 64.52  ? 216  ASN I CA    1 
ATOM   8683  C  C     . ASN Q  3 84  ? -50.879  54.979  -54.279 1.00 65.58  ? 216  ASN I C     1 
ATOM   8684  O  O     . ASN Q  3 84  ? -50.598  56.142  -54.575 1.00 65.66  ? 216  ASN I O     1 
ATOM   8685  C  CB    . ASN Q  3 84  ? -53.118  54.787  -55.384 1.00 65.42  ? 216  ASN I CB    1 
ATOM   8686  C  CG    . ASN Q  3 84  ? -53.793  54.401  -56.696 1.00 67.29  ? 216  ASN I CG    1 
ATOM   8687  O  OD1   . ASN Q  3 84  ? -54.854  54.925  -57.040 1.00 68.38  ? 216  ASN I OD1   1 
ATOM   8688  N  ND2   . ASN Q  3 84  ? -53.179  53.481  -57.433 1.00 68.42  ? 216  ASN I ND2   1 
ATOM   8689  N  N     . GLY Q  3 85  ? -50.456  54.399  -53.159 1.00 66.52  ? 217  GLY I N     1 
ATOM   8690  C  CA    . GLY Q  3 85  ? -49.623  55.132  -52.222 1.00 66.89  ? 217  GLY I CA    1 
ATOM   8691  C  C     . GLY Q  3 85  ? -48.160  54.797  -52.402 1.00 66.92  ? 217  GLY I C     1 
ATOM   8692  O  O     . GLY Q  3 85  ? -47.329  55.676  -52.632 1.00 65.48  ? 217  GLY I O     1 
ATOM   8693  N  N     . ILE Q  3 86  ? -47.854  53.508  -52.303 1.00 68.16  ? 218  ILE I N     1 
ATOM   8694  C  CA    . ILE Q  3 86  ? -46.490  53.019  -52.450 1.00 69.80  ? 218  ILE I CA    1 
ATOM   8695  C  C     . ILE Q  3 86  ? -45.932  53.315  -53.843 1.00 70.96  ? 218  ILE I C     1 
ATOM   8696  O  O     . ILE Q  3 86  ? -44.784  53.727  -53.977 1.00 71.59  ? 218  ILE I O     1 
ATOM   8697  C  CB    . ILE Q  3 86  ? -46.420  51.483  -52.180 1.00 69.34  ? 218  ILE I CB    1 
ATOM   8698  C  CG1   . ILE Q  3 86  ? -45.026  51.092  -51.692 1.00 69.12  ? 218  ILE I CG1   1 
ATOM   8699  C  CG2   . ILE Q  3 86  ? -46.721  50.701  -53.444 1.00 69.03  ? 218  ILE I CG2   1 
ATOM   8700  C  CD1   . ILE Q  3 86  ? -44.657  51.670  -50.343 1.00 68.83  ? 218  ILE I CD1   1 
ATOM   8701  N  N     . THR Q  3 87  ? -46.754  53.128  -54.874 1.00 72.73  ? 219  THR I N     1 
ATOM   8702  C  CA    . THR Q  3 87  ? -46.327  53.352  -56.253 1.00 74.35  ? 219  THR I CA    1 
ATOM   8703  C  C     . THR Q  3 87  ? -46.618  54.740  -56.815 1.00 75.99  ? 219  THR I C     1 
ATOM   8704  O  O     . THR Q  3 87  ? -46.326  55.000  -57.979 1.00 76.66  ? 219  THR I O     1 
ATOM   8705  C  CB    . THR Q  3 87  ? -46.982  52.339  -57.218 1.00 74.09  ? 219  THR I CB    1 
ATOM   8706  O  OG1   . THR Q  3 87  ? -48.371  52.652  -57.376 1.00 73.77  ? 219  THR I OG1   1 
ATOM   8707  C  CG2   . THR Q  3 87  ? -46.851  50.930  -56.680 1.00 74.24  ? 219  THR I CG2   1 
ATOM   8708  N  N     . ASN Q  3 88  ? -47.182  55.634  -56.013 1.00 77.78  ? 220  ASN I N     1 
ATOM   8709  C  CA    . ASN Q  3 88  ? -47.497  56.962  -56.522 1.00 80.14  ? 220  ASN I CA    1 
ATOM   8710  C  C     . ASN Q  3 88  ? -47.375  58.079  -55.506 1.00 81.51  ? 220  ASN I C     1 
ATOM   8711  O  O     . ASN Q  3 88  ? -46.462  58.898  -55.574 1.00 81.46  ? 220  ASN I O     1 
ATOM   8712  C  CB    . ASN Q  3 88  ? -48.920  56.986  -57.093 1.00 81.83  ? 220  ASN I CB    1 
ATOM   8713  C  CG    . ASN Q  3 88  ? -48.963  56.737  -58.591 1.00 83.33  ? 220  ASN I CG    1 
ATOM   8714  O  OD1   . ASN Q  3 88  ? -48.344  57.468  -59.367 1.00 84.79  ? 220  ASN I OD1   1 
ATOM   8715  N  ND2   . ASN Q  3 88  ? -49.704  55.708  -59.007 1.00 83.07  ? 220  ASN I ND2   1 
ATOM   8716  N  N     . TRP Q  3 89  ? -48.315  58.106  -54.570 1.00 83.62  ? 221  TRP I N     1 
ATOM   8717  C  CA    . TRP Q  3 89  ? -48.370  59.139  -53.547 1.00 85.33  ? 221  TRP I CA    1 
ATOM   8718  C  C     . TRP Q  3 89  ? -47.083  59.403  -52.776 1.00 86.40  ? 221  TRP I C     1 
ATOM   8719  O  O     . TRP Q  3 89  ? -46.653  60.552  -52.666 1.00 86.89  ? 221  TRP I O     1 
ATOM   8720  C  CB    . TRP Q  3 89  ? -49.507  58.832  -52.576 1.00 85.61  ? 221  TRP I CB    1 
ATOM   8721  C  CG    . TRP Q  3 89  ? -50.852  58.805  -53.241 1.00 86.62  ? 221  TRP I CG    1 
ATOM   8722  C  CD1   . TRP Q  3 89  ? -51.239  59.519  -54.342 1.00 87.10  ? 221  TRP I CD1   1 
ATOM   8723  C  CD2   . TRP Q  3 89  ? -52.004  58.070  -52.818 1.00 87.02  ? 221  TRP I CD2   1 
ATOM   8724  N  NE1   . TRP Q  3 89  ? -52.561  59.275  -54.627 1.00 87.95  ? 221  TRP I NE1   1 
ATOM   8725  C  CE2   . TRP Q  3 89  ? -53.055  58.389  -53.707 1.00 87.57  ? 221  TRP I CE2   1 
ATOM   8726  C  CE3   . TRP Q  3 89  ? -52.251  57.175  -51.772 1.00 86.95  ? 221  TRP I CE3   1 
ATOM   8727  C  CZ2   . TRP Q  3 89  ? -54.330  57.845  -53.580 1.00 87.77  ? 221  TRP I CZ2   1 
ATOM   8728  C  CZ3   . TRP Q  3 89  ? -53.519  56.633  -51.647 1.00 87.76  ? 221  TRP I CZ3   1 
ATOM   8729  C  CH2   . TRP Q  3 89  ? -54.543  56.970  -52.547 1.00 88.25  ? 221  TRP I CH2   1 
ATOM   8730  N  N     . VAL Q  3 90  ? -46.474  58.348  -52.243 1.00 87.57  ? 222  VAL I N     1 
ATOM   8731  C  CA    . VAL Q  3 90  ? -45.235  58.479  -51.477 1.00 88.47  ? 222  VAL I CA    1 
ATOM   8732  C  C     . VAL Q  3 90  ? -44.227  59.438  -52.104 1.00 88.62  ? 222  VAL I C     1 
ATOM   8733  O  O     . VAL Q  3 90  ? -43.646  60.275  -51.415 1.00 88.54  ? 222  VAL I O     1 
ATOM   8734  C  CB    . VAL Q  3 90  ? -44.556  57.111  -51.294 1.00 89.02  ? 222  VAL I CB    1 
ATOM   8735  C  CG1   . VAL Q  3 90  ? -45.451  56.204  -50.469 1.00 90.13  ? 222  VAL I CG1   1 
ATOM   8736  C  CG2   . VAL Q  3 90  ? -44.272  56.480  -52.651 1.00 89.36  ? 222  VAL I CG2   1 
ATOM   8737  N  N     . GLN Q  3 91  ? -44.024  59.314  -53.411 1.00 89.55  ? 223  GLN I N     1 
ATOM   8738  C  CA    . GLN Q  3 91  ? -43.083  60.169  -54.130 1.00 90.19  ? 223  GLN I CA    1 
ATOM   8739  C  C     . GLN Q  3 91  ? -43.434  61.626  -53.921 1.00 89.68  ? 223  GLN I C     1 
ATOM   8740  O  O     . GLN Q  3 91  ? -42.676  62.377  -53.308 1.00 89.71  ? 223  GLN I O     1 
ATOM   8741  C  CB    . GLN Q  3 91  ? -43.115  59.863  -55.626 1.00 90.88  ? 223  GLN I CB    1 
ATOM   8742  C  CG    . GLN Q  3 91  ? -42.875  58.404  -55.960 1.00 92.63  ? 223  GLN I CG    1 
ATOM   8743  C  CD    . GLN Q  3 91  ? -42.781  58.171  -57.446 1.00 93.18  ? 223  GLN I CD    1 
ATOM   8744  O  OE1   . GLN Q  3 91  ? -43.705  58.490  -58.192 1.00 94.06  ? 223  GLN I OE1   1 
ATOM   8745  N  NE2   . GLN Q  3 91  ? -41.658  57.614  -57.890 1.00 93.71  ? 223  GLN I NE2   1 
ATOM   8746  N  N     . GLY Q  3 92  ? -44.589  62.020  -54.444 1.00 89.04  ? 224  GLY I N     1 
ATOM   8747  C  CA    . GLY Q  3 92  ? -45.022  63.392  -54.298 1.00 88.75  ? 224  GLY I CA    1 
ATOM   8748  C  C     . GLY Q  3 92  ? -44.882  63.876  -52.870 1.00 88.11  ? 224  GLY I C     1 
ATOM   8749  O  O     . GLY Q  3 92  ? -44.548  65.034  -52.631 1.00 87.73  ? 224  GLY I O     1 
ATOM   8750  N  N     . TRP Q  3 93  ? -45.110  62.975  -51.919 1.00 88.04  ? 225  TRP I N     1 
ATOM   8751  C  CA    . TRP Q  3 93  ? -45.036  63.319  -50.507 1.00 88.12  ? 225  TRP I CA    1 
ATOM   8752  C  C     . TRP Q  3 93  ? -43.649  63.590  -49.956 1.00 88.44  ? 225  TRP I C     1 
ATOM   8753  O  O     . TRP Q  3 93  ? -43.482  64.494  -49.134 1.00 87.99  ? 225  TRP I O     1 
ATOM   8754  C  CB    . TRP Q  3 93  ? -45.724  62.241  -49.671 1.00 87.62  ? 225  TRP I CB    1 
ATOM   8755  C  CG    . TRP Q  3 93  ? -47.203  62.202  -49.897 1.00 87.60  ? 225  TRP I CG    1 
ATOM   8756  C  CD1   . TRP Q  3 93  ? -47.980  63.193  -50.437 1.00 87.99  ? 225  TRP I CD1   1 
ATOM   8757  C  CD2   . TRP Q  3 93  ? -48.091  61.136  -49.566 1.00 87.00  ? 225  TRP I CD2   1 
ATOM   8758  N  NE1   . TRP Q  3 93  ? -49.294  62.805  -50.461 1.00 87.09  ? 225  TRP I NE1   1 
ATOM   8759  C  CE2   . TRP Q  3 93  ? -49.391  61.545  -49.932 1.00 86.78  ? 225  TRP I CE2   1 
ATOM   8760  C  CE3   . TRP Q  3 93  ? -47.916  59.872  -48.993 1.00 87.24  ? 225  TRP I CE3   1 
ATOM   8761  C  CZ2   . TRP Q  3 93  ? -50.508  60.735  -49.745 1.00 86.67  ? 225  TRP I CZ2   1 
ATOM   8762  C  CZ3   . TRP Q  3 93  ? -49.030  59.066  -48.807 1.00 87.36  ? 225  TRP I CZ3   1 
ATOM   8763  C  CH2   . TRP Q  3 93  ? -50.309  59.502  -49.183 1.00 87.03  ? 225  TRP I CH2   1 
ATOM   8764  N  N     . LYS Q  3 94  ? -42.658  62.814  -50.391 1.00 89.30  ? 226  LYS I N     1 
ATOM   8765  C  CA    . LYS Q  3 94  ? -41.288  63.017  -49.921 1.00 90.39  ? 226  LYS I CA    1 
ATOM   8766  C  C     . LYS Q  3 94  ? -40.727  64.287  -50.540 1.00 91.00  ? 226  LYS I C     1 
ATOM   8767  O  O     . LYS Q  3 94  ? -39.594  64.310  -51.020 1.00 90.47  ? 226  LYS I O     1 
ATOM   8768  C  CB    . LYS Q  3 94  ? -40.391  61.838  -50.303 1.00 90.26  ? 226  LYS I CB    1 
ATOM   8769  C  CG    . LYS Q  3 94  ? -40.760  60.521  -49.649 1.00 90.64  ? 226  LYS I CG    1 
ATOM   8770  C  CD    . LYS Q  3 94  ? -39.514  59.727  -49.240 1.00 91.06  ? 226  LYS I CD    1 
ATOM   8771  C  CE    . LYS Q  3 94  ? -39.114  59.990  -47.779 1.00 90.20  ? 226  LYS I CE    1 
ATOM   8772  N  NZ    . LYS Q  3 94  ? -38.853  61.423  -47.467 1.00 88.76  ? 226  LYS I NZ    1 
ATOM   8773  N  N     . LYS Q  3 95  ? -41.539  65.339  -50.524 1.00 92.35  ? 227  LYS I N     1 
ATOM   8774  C  CA    . LYS Q  3 95  ? -41.170  66.628  -51.096 1.00 93.71  ? 227  LYS I CA    1 
ATOM   8775  C  C     . LYS Q  3 95  ? -42.023  67.726  -50.450 1.00 94.36  ? 227  LYS I C     1 
ATOM   8776  O  O     . LYS Q  3 95  ? -41.517  68.545  -49.679 1.00 94.87  ? 227  LYS I O     1 
ATOM   8777  C  CB    . LYS Q  3 95  ? -41.397  66.605  -52.617 1.00 93.71  ? 227  LYS I CB    1 
ATOM   8778  C  CG    . LYS Q  3 95  ? -40.721  65.435  -53.338 1.00 92.75  ? 227  LYS I CG    1 
ATOM   8779  C  CD    . LYS Q  3 95  ? -41.091  65.372  -54.811 1.00 92.75  ? 227  LYS I CD    1 
ATOM   8780  C  CE    . LYS Q  3 95  ? -40.496  64.133  -55.469 1.00 92.99  ? 227  LYS I CE    1 
ATOM   8781  N  NZ    . LYS Q  3 95  ? -40.726  64.107  -56.941 1.00 92.92  ? 227  LYS I NZ    1 
ATOM   8782  N  N     . ASN Q  3 96  ? -43.318  67.727  -50.761 1.00 94.77  ? 228  ASN I N     1 
ATOM   8783  C  CA    . ASN Q  3 96  ? -44.246  68.708  -50.209 1.00 94.77  ? 228  ASN I CA    1 
ATOM   8784  C  C     . ASN Q  3 96  ? -44.309  68.562  -48.689 1.00 94.99  ? 228  ASN I C     1 
ATOM   8785  O  O     . ASN Q  3 96  ? -45.065  69.265  -48.014 1.00 93.91  ? 228  ASN I O     1 
ATOM   8786  C  CB    . ASN Q  3 96  ? -45.635  68.521  -50.831 1.00 94.93  ? 228  ASN I CB    1 
ATOM   8787  C  CG    . ASN Q  3 96  ? -46.264  67.183  -50.477 1.00 94.99  ? 228  ASN I CG    1 
ATOM   8788  O  OD1   . ASN Q  3 96  ? -47.084  67.091  -49.571 1.00 95.69  ? 228  ASN I OD1   1 
ATOM   8789  N  ND2   . ASN Q  3 96  ? -45.877  66.143  -51.189 1.00 94.50  ? 228  ASN I ND2   1 
ATOM   8790  N  N     . GLY Q  3 97  ? -43.504  67.640  -48.167 1.00 95.93  ? 229  GLY I N     1 
ATOM   8791  C  CA    . GLY Q  3 97  ? -43.437  67.408  -46.734 1.00 97.31  ? 229  GLY I CA    1 
ATOM   8792  C  C     . GLY Q  3 97  ? -44.514  66.508  -46.157 1.00 98.22  ? 229  GLY I C     1 
ATOM   8793  O  O     . GLY Q  3 97  ? -44.744  66.516  -44.944 1.00 98.57  ? 229  GLY I O     1 
ATOM   8794  N  N     . TRP Q  3 98  ? -45.165  65.729  -47.018 1.00 98.24  ? 230  TRP I N     1 
ATOM   8795  C  CA    . TRP Q  3 98  ? -46.237  64.820  -46.606 1.00 98.08  ? 230  TRP I CA    1 
ATOM   8796  C  C     . TRP Q  3 98  ? -47.554  65.557  -46.348 1.00 97.59  ? 230  TRP I C     1 
ATOM   8797  O  O     . TRP Q  3 98  ? -48.215  65.353  -45.327 1.00 96.57  ? 230  TRP I O     1 
ATOM   8798  C  CB    . TRP Q  3 98  ? -45.833  64.025  -45.354 1.00 98.56  ? 230  TRP I CB    1 
ATOM   8799  C  CG    . TRP Q  3 98  ? -44.606  63.174  -45.538 1.00 98.70  ? 230  TRP I CG    1 
ATOM   8800  C  CD1   . TRP Q  3 98  ? -43.308  63.580  -45.447 1.00 98.73  ? 230  TRP I CD1   1 
ATOM   8801  C  CD2   . TRP Q  3 98  ? -44.567  61.777  -45.870 1.00 98.59  ? 230  TRP I CD2   1 
ATOM   8802  N  NE1   . TRP Q  3 98  ? -42.462  62.525  -45.700 1.00 98.80  ? 230  TRP I NE1   1 
ATOM   8803  C  CE2   . TRP Q  3 98  ? -43.209  61.407  -45.962 1.00 98.13  ? 230  TRP I CE2   1 
ATOM   8804  C  CE3   . TRP Q  3 98  ? -45.549  60.802  -46.098 1.00 98.52  ? 230  TRP I CE3   1 
ATOM   8805  C  CZ2   . TRP Q  3 98  ? -42.806  60.104  -46.274 1.00 97.60  ? 230  TRP I CZ2   1 
ATOM   8806  C  CZ3   . TRP Q  3 98  ? -45.145  59.504  -46.409 1.00 97.97  ? 230  TRP I CZ3   1 
ATOM   8807  C  CH2   . TRP Q  3 98  ? -43.787  59.170  -46.493 1.00 97.30  ? 230  TRP I CH2   1 
ATOM   8808  N  N     . LYS Q  3 99  ? -47.930  66.413  -47.292 1.00 97.76  ? 231  LYS I N     1 
ATOM   8809  C  CA    . LYS Q  3 99  ? -49.161  67.181  -47.188 1.00 97.99  ? 231  LYS I CA    1 
ATOM   8810  C  C     . LYS Q  3 99  ? -50.218  66.623  -48.137 1.00 98.09  ? 231  LYS I C     1 
ATOM   8811  O  O     . LYS Q  3 99  ? -49.971  66.441  -49.334 1.00 98.39  ? 231  LYS I O     1 
ATOM   8812  C  CB    . LYS Q  3 99  ? -48.893  68.653  -47.510 1.00 97.14  ? 231  LYS I CB    1 
ATOM   8813  N  N     . THR Q  3 100 ? -51.394  66.335  -47.591 1.00 97.58  ? 232  THR I N     1 
ATOM   8814  C  CA    . THR Q  3 100 ? -52.483  65.827  -48.402 1.00 96.77  ? 232  THR I CA    1 
ATOM   8815  C  C     . THR Q  3 100 ? -52.754  66.878  -49.461 1.00 96.47  ? 232  THR I C     1 
ATOM   8816  O  O     . THR Q  3 100 ? -52.495  68.059  -49.238 1.00 96.50  ? 232  THR I O     1 
ATOM   8817  C  CB    . THR Q  3 100 ? -53.755  65.632  -47.564 1.00 96.86  ? 232  THR I CB    1 
ATOM   8818  O  OG1   . THR Q  3 100 ? -54.868  65.383  -48.431 1.00 98.14  ? 232  THR I OG1   1 
ATOM   8819  C  CG2   . THR Q  3 100 ? -54.040  66.860  -46.751 1.00 96.11  ? 232  THR I CG2   1 
ATOM   8820  N  N     . SER Q  3 101 ? -53.261  66.460  -50.615 1.00 96.40  ? 233  SER I N     1 
ATOM   8821  C  CA    . SER Q  3 101 ? -53.569  67.407  -51.678 1.00 96.32  ? 233  SER I CA    1 
ATOM   8822  C  C     . SER Q  3 101 ? -54.619  68.384  -51.151 1.00 96.03  ? 233  SER I C     1 
ATOM   8823  O  O     . SER Q  3 101 ? -55.137  69.217  -51.890 1.00 95.69  ? 233  SER I O     1 
ATOM   8824  C  CB    . SER Q  3 101 ? -54.098  66.670  -52.900 1.00 96.45  ? 233  SER I CB    1 
ATOM   8825  N  N     . ALA Q  3 102 ? -54.918  68.266  -49.859 1.00 96.10  ? 234  ALA I N     1 
ATOM   8826  C  CA    . ALA Q  3 102 ? -55.898  69.113  -49.190 1.00 96.07  ? 234  ALA I CA    1 
ATOM   8827  C  C     . ALA Q  3 102 ? -55.311  69.768  -47.936 1.00 96.27  ? 234  ALA I C     1 
ATOM   8828  O  O     . ALA Q  3 102 ? -56.046  70.128  -47.012 1.00 96.04  ? 234  ALA I O     1 
ATOM   8829  C  CB    . ALA Q  3 102 ? -57.121  68.283  -48.817 1.00 95.62  ? 234  ALA I CB    1 
ATOM   8830  N  N     . GLY Q  3 103 ? -53.987  69.915  -47.906 1.00 96.41  ? 235  GLY I N     1 
ATOM   8831  C  CA    . GLY Q  3 103 ? -53.326  70.526  -46.762 1.00 95.75  ? 235  GLY I CA    1 
ATOM   8832  C  C     . GLY Q  3 103 ? -53.644  69.865  -45.428 1.00 95.24  ? 235  GLY I C     1 
ATOM   8833  O  O     . GLY Q  3 103 ? -54.612  70.233  -44.754 1.00 95.55  ? 235  GLY I O     1 
ATOM   8834  N  N     . LYS Q  3 104 ? -52.828  68.885  -45.048 1.00 93.79  ? 236  LYS I N     1 
ATOM   8835  C  CA    . LYS Q  3 104 ? -53.010  68.167  -43.789 1.00 92.06  ? 236  LYS I CA    1 
ATOM   8836  C  C     . LYS Q  3 104 ? -51.925  67.118  -43.621 1.00 90.59  ? 236  LYS I C     1 
ATOM   8837  O  O     . LYS Q  3 104 ? -51.357  66.630  -44.598 1.00 90.17  ? 236  LYS I O     1 
ATOM   8838  C  CB    . LYS Q  3 104 ? -54.388  67.509  -43.740 1.00 92.19  ? 236  LYS I CB    1 
ATOM   8839  N  N     . GLU Q  3 105 ? -51.643  66.777  -42.371 1.00 89.29  ? 237  GLU I N     1 
ATOM   8840  C  CA    . GLU Q  3 105 ? -50.619  65.792  -42.050 1.00 88.53  ? 237  GLU I CA    1 
ATOM   8841  C  C     . GLU Q  3 105 ? -51.086  64.418  -42.534 1.00 87.13  ? 237  GLU I C     1 
ATOM   8842  O  O     . GLU Q  3 105 ? -52.215  64.021  -42.240 1.00 86.99  ? 237  GLU I O     1 
ATOM   8843  C  CB    . GLU Q  3 105 ? -50.406  65.752  -40.528 1.00 89.86  ? 237  GLU I CB    1 
ATOM   8844  C  CG    . GLU Q  3 105 ? -50.694  67.077  -39.796 1.00 90.65  ? 237  GLU I CG    1 
ATOM   8845  C  CD    . GLU Q  3 105 ? -49.542  68.081  -39.848 1.00 91.25  ? 237  GLU I CD    1 
ATOM   8846  O  OE1   . GLU Q  3 105 ? -49.771  69.256  -39.478 1.00 90.05  ? 237  GLU I OE1   1 
ATOM   8847  O  OE2   . GLU Q  3 105 ? -48.415  67.698  -40.243 1.00 90.84  ? 237  GLU I OE2   1 
ATOM   8848  N  N     . VAL Q  3 106 ? -50.249  63.690  -43.277 1.00 85.23  ? 238  VAL I N     1 
ATOM   8849  C  CA    . VAL Q  3 106 ? -50.672  62.362  -43.729 1.00 83.54  ? 238  VAL I CA    1 
ATOM   8850  C  C     . VAL Q  3 106 ? -50.843  61.526  -42.468 1.00 82.64  ? 238  VAL I C     1 
ATOM   8851  O  O     . VAL Q  3 106 ? -50.091  61.678  -41.502 1.00 82.71  ? 238  VAL I O     1 
ATOM   8852  C  CB    . VAL Q  3 106 ? -49.652  61.676  -44.699 1.00 82.61  ? 238  VAL I CB    1 
ATOM   8853  C  CG1   . VAL Q  3 106 ? -49.250  62.642  -45.795 1.00 81.76  ? 238  VAL I CG1   1 
ATOM   8854  C  CG2   . VAL Q  3 106 ? -48.449  61.161  -43.945 1.00 82.83  ? 238  VAL I CG2   1 
ATOM   8855  N  N     . ILE Q  3 107 ? -51.836  60.649  -42.469 1.00 81.36  ? 239  ILE I N     1 
ATOM   8856  C  CA    . ILE Q  3 107 ? -52.105  59.862  -41.288 1.00 80.90  ? 239  ILE I CA    1 
ATOM   8857  C  C     . ILE Q  3 107 ? -51.463  58.491  -41.278 1.00 80.01  ? 239  ILE I C     1 
ATOM   8858  O  O     . ILE Q  3 107 ? -51.571  57.752  -40.303 1.00 80.41  ? 239  ILE I O     1 
ATOM   8859  C  CB    . ILE Q  3 107 ? -53.630  59.767  -41.066 1.00 82.05  ? 239  ILE I CB    1 
ATOM   8860  C  CG1   . ILE Q  3 107 ? -54.179  61.176  -40.812 1.00 82.43  ? 239  ILE I CG1   1 
ATOM   8861  C  CG2   . ILE Q  3 107 ? -53.955  58.869  -39.880 1.00 82.52  ? 239  ILE I CG2   1 
ATOM   8862  C  CD1   . ILE Q  3 107 ? -55.643  61.224  -40.436 1.00 83.52  ? 239  ILE I CD1   1 
ATOM   8863  N  N     . ASN Q  3 108 ? -50.763  58.146  -42.342 1.00 79.26  ? 240  ASN I N     1 
ATOM   8864  C  CA    . ASN Q  3 108 ? -50.126  56.846  -42.352 1.00 79.16  ? 240  ASN I CA    1 
ATOM   8865  C  C     . ASN Q  3 108 ? -48.658  56.945  -42.705 1.00 79.60  ? 240  ASN I C     1 
ATOM   8866  O  O     . ASN Q  3 108 ? -48.068  55.987  -43.204 1.00 79.79  ? 240  ASN I O     1 
ATOM   8867  C  CB    . ASN Q  3 108 ? -50.854  55.924  -43.320 1.00 78.76  ? 240  ASN I CB    1 
ATOM   8868  C  CG    . ASN Q  3 108 ? -52.345  55.932  -43.099 1.00 78.46  ? 240  ASN I CG    1 
ATOM   8869  O  OD1   . ASN Q  3 108 ? -53.061  56.780  -43.639 1.00 78.33  ? 240  ASN I OD1   1 
ATOM   8870  N  ND2   . ASN Q  3 108 ? -52.825  55.001  -42.280 1.00 78.01  ? 240  ASN I ND2   1 
ATOM   8871  N  N     . LYS Q  3 109 ? -48.070  58.108  -42.434 1.00 79.91  ? 241  LYS I N     1 
ATOM   8872  C  CA    . LYS Q  3 109 ? -46.655  58.337  -42.724 1.00 79.69  ? 241  LYS I CA    1 
ATOM   8873  C  C     . LYS Q  3 109 ? -45.858  57.128  -42.274 1.00 78.99  ? 241  LYS I C     1 
ATOM   8874  O  O     . LYS Q  3 109 ? -45.323  56.377  -43.088 1.00 77.89  ? 241  LYS I O     1 
ATOM   8875  C  CB    . LYS Q  3 109 ? -46.160  59.582  -41.998 1.00 79.09  ? 241  LYS I CB    1 
ATOM   8876  N  N     . GLU Q  3 110 ? -45.803  56.938  -40.963 1.00 78.89  ? 242  GLU I N     1 
ATOM   8877  C  CA    . GLU Q  3 110 ? -45.078  55.825  -40.386 1.00 79.67  ? 242  GLU I CA    1 
ATOM   8878  C  C     . GLU Q  3 110 ? -45.459  54.513  -41.060 1.00 80.27  ? 242  GLU I C     1 
ATOM   8879  O  O     . GLU Q  3 110 ? -44.745  53.518  -40.934 1.00 81.11  ? 242  GLU I O     1 
ATOM   8880  C  CB    . GLU Q  3 110 ? -45.351  55.748  -38.889 1.00 79.46  ? 242  GLU I CB    1 
ATOM   8881  N  N     . ASP Q  3 111 ? -46.579  54.501  -41.773 1.00 80.19  ? 243  ASP I N     1 
ATOM   8882  C  CA    . ASP Q  3 111 ? -47.007  53.282  -42.443 1.00 81.05  ? 243  ASP I CA    1 
ATOM   8883  C  C     . ASP Q  3 111 ? -46.279  53.081  -43.763 1.00 81.65  ? 243  ASP I C     1 
ATOM   8884  O  O     . ASP Q  3 111 ? -45.662  52.040  -43.991 1.00 81.38  ? 243  ASP I O     1 
ATOM   8885  C  CB    . ASP Q  3 111 ? -48.515  53.303  -42.676 1.00 81.41  ? 243  ASP I CB    1 
ATOM   8886  C  CG    . ASP Q  3 111 ? -49.301  53.126  -41.397 1.00 82.22  ? 243  ASP I CG    1 
ATOM   8887  O  OD1   . ASP Q  3 111 ? -49.072  52.117  -40.698 1.00 81.30  ? 243  ASP I OD1   1 
ATOM   8888  O  OD2   . ASP Q  3 111 ? -50.150  53.993  -41.094 1.00 83.75  ? 243  ASP I OD2   1 
ATOM   8889  N  N     . PHE Q  3 112 ? -46.349  54.081  -44.631 1.00 82.50  ? 244  PHE I N     1 
ATOM   8890  C  CA    . PHE Q  3 112 ? -45.688  54.001  -45.926 1.00 83.82  ? 244  PHE I CA    1 
ATOM   8891  C  C     . PHE Q  3 112 ? -44.167  54.108  -45.780 1.00 84.49  ? 244  PHE I C     1 
ATOM   8892  O  O     . PHE Q  3 112 ? -43.416  53.468  -46.519 1.00 84.67  ? 244  PHE I O     1 
ATOM   8893  C  CB    . PHE Q  3 112 ? -46.217  55.103  -46.847 1.00 83.72  ? 244  PHE I CB    1 
ATOM   8894  C  CG    . PHE Q  3 112 ? -47.660  54.927  -47.229 1.00 83.54  ? 244  PHE I CG    1 
ATOM   8895  C  CD1   . PHE Q  3 112 ? -48.053  53.862  -48.030 1.00 83.97  ? 244  PHE I CD1   1 
ATOM   8896  C  CD2   . PHE Q  3 112 ? -48.628  55.814  -46.776 1.00 83.32  ? 244  PHE I CD2   1 
ATOM   8897  C  CE1   . PHE Q  3 112 ? -49.391  53.682  -48.376 1.00 84.02  ? 244  PHE I CE1   1 
ATOM   8898  C  CE2   . PHE Q  3 112 ? -49.965  55.643  -47.115 1.00 83.13  ? 244  PHE I CE2   1 
ATOM   8899  C  CZ    . PHE Q  3 112 ? -50.347  54.575  -47.915 1.00 83.52  ? 244  PHE I CZ    1 
ATOM   8900  N  N     . VAL Q  3 113 ? -43.718  54.912  -44.821 1.00 84.93  ? 245  VAL I N     1 
ATOM   8901  C  CA    . VAL Q  3 113 ? -42.291  55.087  -44.576 1.00 84.71  ? 245  VAL I CA    1 
ATOM   8902  C  C     . VAL Q  3 113 ? -41.690  53.770  -44.109 1.00 85.24  ? 245  VAL I C     1 
ATOM   8903  O  O     . VAL Q  3 113 ? -40.482  53.550  -44.206 1.00 85.47  ? 245  VAL I O     1 
ATOM   8904  C  CB    . VAL Q  3 113 ? -42.037  56.138  -43.491 1.00 84.25  ? 245  VAL I CB    1 
ATOM   8905  C  CG1   . VAL Q  3 113 ? -40.548  56.336  -43.303 1.00 84.24  ? 245  VAL I CG1   1 
ATOM   8906  C  CG2   . VAL Q  3 113 ? -42.707  57.444  -43.872 1.00 85.18  ? 245  VAL I CG2   1 
ATOM   8907  N  N     . ALA Q  3 114 ? -42.549  52.899  -43.596 1.00 85.78  ? 246  ALA I N     1 
ATOM   8908  C  CA    . ALA Q  3 114 ? -42.127  51.597  -43.110 1.00 86.61  ? 246  ALA I CA    1 
ATOM   8909  C  C     . ALA Q  3 114 ? -42.033  50.619  -44.269 1.00 87.46  ? 246  ALA I C     1 
ATOM   8910  O  O     . ALA Q  3 114 ? -41.062  49.870  -44.382 1.00 87.06  ? 246  ALA I O     1 
ATOM   8911  C  CB    . ALA Q  3 114 ? -43.117  51.086  -42.079 1.00 86.97  ? 246  ALA I CB    1 
ATOM   8912  N  N     . LEU Q  3 115 ? -43.049  50.637  -45.128 1.00 88.85  ? 247  LEU I N     1 
ATOM   8913  C  CA    . LEU Q  3 115 ? -43.105  49.750  -46.286 1.00 89.70  ? 247  LEU I CA    1 
ATOM   8914  C  C     . LEU Q  3 115 ? -41.990  50.051  -47.287 1.00 90.42  ? 247  LEU I C     1 
ATOM   8915  O  O     . LEU Q  3 115 ? -41.279  49.144  -47.728 1.00 89.92  ? 247  LEU I O     1 
ATOM   8916  C  CB    . LEU Q  3 115 ? -44.465  49.872  -46.985 1.00 89.01  ? 247  LEU I CB    1 
ATOM   8917  C  CG    . LEU Q  3 115 ? -44.747  48.823  -48.065 1.00 88.84  ? 247  LEU I CG    1 
ATOM   8918  C  CD1   . LEU Q  3 115 ? -44.856  47.448  -47.424 1.00 88.10  ? 247  LEU I CD1   1 
ATOM   8919  C  CD2   . LEU Q  3 115 ? -46.026  49.158  -48.799 1.00 88.66  ? 247  LEU I CD2   1 
ATOM   8920  N  N     . GLU Q  3 116 ? -41.832  51.323  -47.638 1.00 91.65  ? 248  GLU I N     1 
ATOM   8921  C  CA    . GLU Q  3 116 ? -40.803  51.708  -48.594 1.00 93.63  ? 248  GLU I CA    1 
ATOM   8922  C  C     . GLU Q  3 116 ? -39.442  51.126  -48.244 1.00 94.50  ? 248  GLU I C     1 
ATOM   8923  O  O     . GLU Q  3 116 ? -38.722  50.653  -49.120 1.00 94.58  ? 248  GLU I O     1 
ATOM   8924  C  CB    . GLU Q  3 116 ? -40.669  53.224  -48.684 1.00 94.23  ? 248  GLU I CB    1 
ATOM   8925  C  CG    . GLU Q  3 116 ? -39.725  53.640  -49.796 1.00 96.06  ? 248  GLU I CG    1 
ATOM   8926  C  CD    . GLU Q  3 116 ? -39.152  55.024  -49.602 1.00 97.15  ? 248  GLU I CD    1 
ATOM   8927  O  OE1   . GLU Q  3 116 ? -39.940  55.993  -49.527 1.00 96.52  ? 248  GLU I OE1   1 
ATOM   8928  O  OE2   . GLU Q  3 116 ? -37.907  55.135  -49.531 1.00 98.30  ? 248  GLU I OE2   1 
ATOM   8929  N  N     . ARG Q  3 117 ? -39.081  51.173  -46.967 1.00 95.72  ? 249  ARG I N     1 
ATOM   8930  C  CA    . ARG Q  3 117 ? -37.793  50.640  -46.541 1.00 96.28  ? 249  ARG I CA    1 
ATOM   8931  C  C     . ARG Q  3 117 ? -37.696  49.186  -46.978 1.00 96.19  ? 249  ARG I C     1 
ATOM   8932  O  O     . ARG Q  3 117 ? -36.680  48.757  -47.519 1.00 96.46  ? 249  ARG I O     1 
ATOM   8933  C  CB    . ARG Q  3 117 ? -37.635  50.740  -45.020 1.00 96.53  ? 249  ARG I CB    1 
ATOM   8934  C  CG    . ARG Q  3 117 ? -36.217  50.468  -44.546 0.00 96.67  ? 249  ARG I CG    1 
ATOM   8935  C  CD    . ARG Q  3 117 ? -36.105  50.511  -43.032 0.00 96.86  ? 249  ARG I CD    1 
ATOM   8936  N  NE    . ARG Q  3 117 ? -34.717  50.409  -42.589 0.00 97.03  ? 249  ARG I NE    1 
ATOM   8937  C  CZ    . ARG Q  3 117 ? -33.908  49.393  -42.877 0.00 97.12  ? 249  ARG I CZ    1 
ATOM   8938  N  NH1   . ARG Q  3 117 ? -34.343  48.379  -43.612 0.00 97.18  ? 249  ARG I NH1   1 
ATOM   8939  N  NH2   . ARG Q  3 117 ? -32.659  49.393  -42.430 0.00 97.18  ? 249  ARG I NH2   1 
ATOM   8940  N  N     . LEU Q  3 118 ? -38.761  48.428  -46.749 1.00 96.47  ? 250  LEU I N     1 
ATOM   8941  C  CA    . LEU Q  3 118 ? -38.768  47.029  -47.138 1.00 97.25  ? 250  LEU I CA    1 
ATOM   8942  C  C     . LEU Q  3 118 ? -38.892  46.902  -48.653 1.00 97.91  ? 250  LEU I C     1 
ATOM   8943  O  O     . LEU Q  3 118 ? -39.005  45.799  -49.186 1.00 97.99  ? 250  LEU I O     1 
ATOM   8944  C  CB    . LEU Q  3 118 ? -39.914  46.280  -46.447 1.00 97.20  ? 250  LEU I CB    1 
ATOM   8945  C  CG    . LEU Q  3 118 ? -39.777  45.990  -44.948 1.00 97.02  ? 250  LEU I CG    1 
ATOM   8946  C  CD1   . LEU Q  3 118 ? -39.906  47.283  -44.153 1.00 96.86  ? 250  LEU I CD1   1 
ATOM   8947  C  CD2   . LEU Q  3 118 ? -40.844  44.994  -44.521 1.00 96.21  ? 250  LEU I CD2   1 
ATOM   8948  N  N     . THR Q  3 119 ? -38.869  48.041  -49.341 1.00 98.68  ? 251  THR I N     1 
ATOM   8949  C  CA    . THR Q  3 119 ? -38.960  48.063  -50.802 1.00 99.40  ? 251  THR I CA    1 
ATOM   8950  C  C     . THR Q  3 119 ? -37.546  48.034  -51.385 1.00 99.26  ? 251  THR I C     1 
ATOM   8951  O  O     . THR Q  3 119 ? -37.311  47.492  -52.467 1.00 98.60  ? 251  THR I O     1 
ATOM   8952  C  CB    . THR Q  3 119 ? -39.675  49.343  -51.303 1.00 99.64  ? 251  THR I CB    1 
ATOM   8953  O  OG1   . THR Q  3 119 ? -40.901  49.514  -50.584 1.00 99.38  ? 251  THR I OG1   1 
ATOM   8954  C  CG2   . THR Q  3 119 ? -39.981  49.246  -52.795 1.00 99.83  ? 251  THR I CG2   1 
ATOM   8955  N  N     . GLN Q  3 120 ? -36.607  48.620  -50.651 1.00 99.47  ? 252  GLN I N     1 
ATOM   8956  C  CA    . GLN Q  3 120 ? -35.223  48.668  -51.082 1.00 100.19 ? 252  GLN I CA    1 
ATOM   8957  C  C     . GLN Q  3 120 ? -34.628  47.283  -51.216 1.00 100.87 ? 252  GLN I C     1 
ATOM   8958  O  O     . GLN Q  3 120 ? -34.740  46.450  -50.312 1.00 100.44 ? 252  GLN I O     1 
ATOM   8959  C  CB    . GLN Q  3 120 ? -34.393  49.496  -50.105 1.00 100.59 ? 252  GLN I CB    1 
ATOM   8960  C  CG    . GLN Q  3 120 ? -34.811  50.948  -50.059 1.00 101.32 ? 252  GLN I CG    1 
ATOM   8961  C  CD    . GLN Q  3 120 ? -35.250  51.458  -51.422 1.00 101.94 ? 252  GLN I CD    1 
ATOM   8962  O  OE1   . GLN Q  3 120 ? -34.622  51.156  -52.442 1.00 102.35 ? 252  GLN I OE1   1 
ATOM   8963  N  NE2   . GLN Q  3 120 ? -36.330  52.240  -51.447 1.00 101.73 ? 252  GLN I NE2   1 
ATOM   8964  N  N     . GLY Q  3 121 ? -33.984  47.050  -52.354 1.00 101.68 ? 253  GLY I N     1 
ATOM   8965  C  CA    . GLY Q  3 121 ? -33.382  45.760  -52.608 1.00 102.53 ? 253  GLY I CA    1 
ATOM   8966  C  C     . GLY Q  3 121 ? -34.466  44.783  -53.008 1.00 103.39 ? 253  GLY I C     1 
ATOM   8967  O  O     . GLY Q  3 121 ? -34.225  43.577  -53.067 1.00 103.63 ? 253  GLY I O     1 
ATOM   8968  N  N     . MET Q  3 122 ? -35.661  45.311  -53.282 1.00 103.90 ? 254  MET I N     1 
ATOM   8969  C  CA    . MET Q  3 122 ? -36.810  44.494  -53.681 1.00 104.00 ? 254  MET I CA    1 
ATOM   8970  C  C     . MET Q  3 122 ? -37.321  44.793  -55.092 1.00 104.28 ? 254  MET I C     1 
ATOM   8971  O  O     . MET Q  3 122 ? -37.137  45.894  -55.615 1.00 104.25 ? 254  MET I O     1 
ATOM   8972  C  CB    . MET Q  3 122 ? -37.963  44.672  -52.688 1.00 103.16 ? 254  MET I CB    1 
ATOM   8973  C  CG    . MET Q  3 122 ? -37.765  43.978  -51.352 1.00 103.00 ? 254  MET I CG    1 
ATOM   8974  S  SD    . MET Q  3 122 ? -37.575  42.182  -51.504 1.00 102.51 ? 254  MET I SD    1 
ATOM   8975  C  CE    . MET Q  3 122 ? -36.197  41.892  -50.342 1.00 103.34 ? 254  MET I CE    1 
ATOM   8976  N  N     . ASP Q  3 123 ? -37.969  43.795  -55.690 1.00 104.63 ? 255  ASP I N     1 
ATOM   8977  C  CA    . ASP Q  3 123 ? -38.531  43.894  -57.037 1.00 104.94 ? 255  ASP I CA    1 
ATOM   8978  C  C     . ASP Q  3 123 ? -39.980  43.390  -57.003 1.00 104.77 ? 255  ASP I C     1 
ATOM   8979  O  O     . ASP Q  3 123 ? -40.265  42.243  -57.354 1.00 104.97 ? 255  ASP I O     1 
ATOM   8980  C  CB    . ASP Q  3 123 ? -37.703  43.045  -58.009 1.00 105.10 ? 255  ASP I CB    1 
ATOM   8981  C  CG    . ASP Q  3 123 ? -38.125  43.231  -59.453 1.00 105.35 ? 255  ASP I CG    1 
ATOM   8982  O  OD1   . ASP Q  3 123 ? -37.966  44.354  -59.975 1.00 105.35 ? 255  ASP I OD1   1 
ATOM   8983  O  OD2   . ASP Q  3 123 ? -38.615  42.259  -60.066 1.00 105.34 ? 255  ASP I OD2   1 
ATOM   8984  N  N     . ILE Q  3 124 ? -40.890  44.266  -56.588 1.00 104.56 ? 256  ILE I N     1 
ATOM   8985  C  CA    . ILE Q  3 124 ? -42.304  43.927  -56.460 1.00 104.30 ? 256  ILE I CA    1 
ATOM   8986  C  C     . ILE Q  3 124 ? -43.165  44.187  -57.685 1.00 103.79 ? 256  ILE I C     1 
ATOM   8987  O  O     . ILE Q  3 124 ? -43.022  45.206  -58.361 1.00 103.67 ? 256  ILE I O     1 
ATOM   8988  C  CB    . ILE Q  3 124 ? -42.951  44.706  -55.286 1.00 104.98 ? 256  ILE I CB    1 
ATOM   8989  C  CG1   . ILE Q  3 124 ? -42.143  44.482  -54.006 1.00 105.67 ? 256  ILE I CG1   1 
ATOM   8990  C  CG2   . ILE Q  3 124 ? -44.405  44.279  -55.099 1.00 104.49 ? 256  ILE I CG2   1 
ATOM   8991  C  CD1   . ILE Q  3 124 ? -41.973  43.030  -53.627 1.00 106.33 ? 256  ILE I CD1   1 
ATOM   8992  N  N     . GLN Q  3 125 ? -44.068  43.251  -57.954 1.00 103.34 ? 257  GLN I N     1 
ATOM   8993  C  CA    . GLN Q  3 125 ? -45.007  43.386  -59.054 1.00 103.45 ? 257  GLN I CA    1 
ATOM   8994  C  C     . GLN Q  3 125 ? -46.385  43.492  -58.406 1.00 102.87 ? 257  GLN I C     1 
ATOM   8995  O  O     . GLN Q  3 125 ? -47.050  42.480  -58.177 1.00 103.30 ? 257  GLN I O     1 
ATOM   8996  C  CB    . GLN Q  3 125 ? -44.966  42.168  -59.972 1.00 104.34 ? 257  GLN I CB    1 
ATOM   8997  C  CG    . GLN Q  3 125 ? -45.891  42.310  -61.173 1.00 106.75 ? 257  GLN I CG    1 
ATOM   8998  C  CD    . GLN Q  3 125 ? -45.858  41.107  -62.095 1.00 108.20 ? 257  GLN I CD    1 
ATOM   8999  O  OE1   . GLN Q  3 125 ? -44.791  40.674  -62.533 1.00 109.09 ? 257  GLN I OE1   1 
ATOM   9000  N  NE2   . GLN Q  3 125 ? -47.034  40.567  -62.406 1.00 109.18 ? 257  GLN I NE2   1 
ATOM   9001  N  N     . TRP Q  3 126 ? -46.798  44.719  -58.100 1.00 101.52 ? 258  TRP I N     1 
ATOM   9002  C  CA    . TRP Q  3 126 ? -48.083  44.971  -57.458 1.00 99.53  ? 258  TRP I CA    1 
ATOM   9003  C  C     . TRP Q  3 126 ? -49.286  44.594  -58.311 1.00 99.74  ? 258  TRP I C     1 
ATOM   9004  O  O     . TRP Q  3 126 ? -49.481  45.125  -59.404 1.00 99.33  ? 258  TRP I O     1 
ATOM   9005  C  CB    . TRP Q  3 126 ? -48.188  46.439  -57.058 1.00 97.81  ? 258  TRP I CB    1 
ATOM   9006  C  CG    . TRP Q  3 126 ? -47.197  46.848  -56.013 1.00 96.32  ? 258  TRP I CG    1 
ATOM   9007  C  CD1   . TRP Q  3 126 ? -46.105  47.643  -56.187 1.00 95.36  ? 258  TRP I CD1   1 
ATOM   9008  C  CD2   . TRP Q  3 126 ? -47.230  46.509  -54.620 1.00 95.74  ? 258  TRP I CD2   1 
ATOM   9009  N  NE1   . TRP Q  3 126 ? -45.457  47.827  -54.990 1.00 94.48  ? 258  TRP I NE1   1 
ATOM   9010  C  CE2   . TRP Q  3 126 ? -46.127  47.142  -54.012 1.00 94.84  ? 258  TRP I CE2   1 
ATOM   9011  C  CE3   . TRP Q  3 126 ? -48.086  45.733  -53.828 1.00 95.44  ? 258  TRP I CE3   1 
ATOM   9012  C  CZ2   . TRP Q  3 126 ? -45.857  47.025  -52.645 1.00 94.65  ? 258  TRP I CZ2   1 
ATOM   9013  C  CZ3   . TRP Q  3 126 ? -47.816  45.617  -52.468 1.00 94.55  ? 258  TRP I CZ3   1 
ATOM   9014  C  CH2   . TRP Q  3 126 ? -46.710  46.262  -51.893 1.00 94.32  ? 258  TRP I CH2   1 
ATOM   9015  N  N     . MET Q  3 127 ? -50.092  43.675  -57.790 1.00 100.27 ? 259  MET I N     1 
ATOM   9016  C  CA    . MET Q  3 127 ? -51.288  43.202  -58.475 1.00 100.58 ? 259  MET I CA    1 
ATOM   9017  C  C     . MET Q  3 127 ? -52.482  43.404  -57.544 1.00 100.64 ? 259  MET I C     1 
ATOM   9018  O  O     . MET Q  3 127 ? -52.474  42.938  -56.404 1.00 100.82 ? 259  MET I O     1 
ATOM   9019  C  CB    . MET Q  3 127 ? -51.148  41.714  -58.813 1.00 100.83 ? 259  MET I CB    1 
ATOM   9020  C  CG    . MET Q  3 127 ? -51.792  41.293  -60.129 1.00 101.35 ? 259  MET I CG    1 
ATOM   9021  S  SD    . MET Q  3 127 ? -50.721  41.590  -61.555 1.00 102.27 ? 259  MET I SD    1 
ATOM   9022  C  CE    . MET Q  3 127 ? -51.239  43.235  -62.061 1.00 101.72 ? 259  MET I CE    1 
ATOM   9023  N  N     . HIS Q  3 128 ? -53.502  44.101  -58.029 1.00 100.54 ? 260  HIS I N     1 
ATOM   9024  C  CA    . HIS Q  3 128 ? -54.692  44.362  -57.233 1.00 101.37 ? 260  HIS I CA    1 
ATOM   9025  C  C     . HIS Q  3 128 ? -55.832  43.424  -57.599 1.00 102.68 ? 260  HIS I C     1 
ATOM   9026  O  O     . HIS Q  3 128 ? -56.503  43.623  -58.609 1.00 102.81 ? 260  HIS I O     1 
ATOM   9027  C  CB    . HIS Q  3 128 ? -55.144  45.811  -57.427 1.00 100.55 ? 260  HIS I CB    1 
ATOM   9028  C  CG    . HIS Q  3 128 ? -56.484  46.115  -56.831 1.00 99.84  ? 260  HIS I CG    1 
ATOM   9029  N  ND1   . HIS Q  3 128 ? -57.643  45.501  -57.253 1.00 99.60  ? 260  HIS I ND1   1 
ATOM   9030  C  CD2   . HIS Q  3 128 ? -56.849  46.966  -55.843 1.00 99.54  ? 260  HIS I CD2   1 
ATOM   9031  C  CE1   . HIS Q  3 128 ? -58.663  45.960  -56.550 1.00 99.46  ? 260  HIS I CE1   1 
ATOM   9032  N  NE2   . HIS Q  3 128 ? -58.208  46.851  -55.688 1.00 99.13  ? 260  HIS I NE2   1 
ATOM   9033  N  N     . VAL Q  3 129 ? -56.056  42.402  -56.781 1.00 104.59 ? 261  VAL I N     1 
ATOM   9034  C  CA    . VAL Q  3 129 ? -57.142  41.472  -57.052 1.00 106.91 ? 261  VAL I CA    1 
ATOM   9035  C  C     . VAL Q  3 129 ? -58.453  42.228  -56.927 1.00 108.40 ? 261  VAL I C     1 
ATOM   9036  O  O     . VAL Q  3 129 ? -58.617  43.060  -56.033 1.00 108.31 ? 261  VAL I O     1 
ATOM   9037  C  CB    . VAL Q  3 129 ? -57.185  40.290  -56.046 1.00 107.01 ? 261  VAL I CB    1 
ATOM   9038  C  CG1   . VAL Q  3 129 ? -55.840  39.619  -55.974 1.00 107.64 ? 261  VAL I CG1   1 
ATOM   9039  C  CG2   . VAL Q  3 129 ? -57.618  40.776  -54.671 1.00 106.66 ? 261  VAL I CG2   1 
ATOM   9040  N  N     . PRO Q  3 130 ? -59.402  41.965  -57.834 1.00 110.19 ? 262  PRO I N     1 
ATOM   9041  C  CA    . PRO Q  3 130 ? -60.686  42.661  -57.750 1.00 111.62 ? 262  PRO I CA    1 
ATOM   9042  C  C     . PRO Q  3 130 ? -61.312  42.430  -56.375 1.00 113.20 ? 262  PRO I C     1 
ATOM   9043  O  O     . PRO Q  3 130 ? -60.697  41.821  -55.499 1.00 113.39 ? 262  PRO I O     1 
ATOM   9044  C  CB    . PRO Q  3 130 ? -61.488  42.018  -58.874 1.00 111.75 ? 262  PRO I CB    1 
ATOM   9045  C  CG    . PRO Q  3 130 ? -60.427  41.757  -59.914 1.00 111.01 ? 262  PRO I CG    1 
ATOM   9046  C  CD    . PRO Q  3 130 ? -59.301  41.185  -59.081 1.00 110.44 ? 262  PRO I CD    1 
ATOM   9047  N  N     . GLY Q  3 131 ? -62.530  42.918  -56.184 1.00 115.04 ? 263  GLY I N     1 
ATOM   9048  C  CA    . GLY Q  3 131 ? -63.193  42.737  -54.907 1.00 116.96 ? 263  GLY I CA    1 
ATOM   9049  C  C     . GLY Q  3 131 ? -63.466  41.270  -54.653 1.00 118.13 ? 263  GLY I C     1 
ATOM   9050  O  O     . GLY Q  3 131 ? -62.538  40.477  -54.481 1.00 118.20 ? 263  GLY I O     1 
ATOM   9051  N  N     . HIS Q  3 132 ? -64.743  40.905  -54.629 1.00 119.19 ? 264  HIS I N     1 
ATOM   9052  C  CA    . HIS Q  3 132 ? -65.132  39.520  -54.406 1.00 120.24 ? 264  HIS I CA    1 
ATOM   9053  C  C     . HIS Q  3 132 ? -65.143  38.748  -55.719 1.00 120.84 ? 264  HIS I C     1 
ATOM   9054  O  O     . HIS Q  3 132 ? -66.131  38.084  -56.047 1.00 121.48 ? 264  HIS I O     1 
ATOM   9055  C  CB    . HIS Q  3 132 ? -66.514  39.454  -53.750 1.00 120.46 ? 264  HIS I CB    1 
ATOM   9056  C  CG    . HIS Q  3 132 ? -66.514  39.849  -52.306 1.00 121.53 ? 264  HIS I CG    1 
ATOM   9057  N  ND1   . HIS Q  3 132 ? -67.669  39.949  -51.561 1.00 122.10 ? 264  HIS I ND1   1 
ATOM   9058  C  CD2   . HIS Q  3 132 ? -65.496  40.149  -51.464 1.00 121.91 ? 264  HIS I CD2   1 
ATOM   9059  C  CE1   . HIS Q  3 132 ? -67.363  40.293  -50.322 1.00 122.32 ? 264  HIS I CE1   1 
ATOM   9060  N  NE2   . HIS Q  3 132 ? -66.051  40.420  -50.237 1.00 122.22 ? 264  HIS I NE2   1 
ATOM   9061  N  N     . SER Q  3 133 ? -64.043  38.843  -56.466 1.00 120.83 ? 265  SER I N     1 
ATOM   9062  C  CA    . SER Q  3 133 ? -63.917  38.147  -57.744 1.00 120.28 ? 265  SER I CA    1 
ATOM   9063  C  C     . SER Q  3 133 ? -64.222  36.660  -57.553 1.00 119.91 ? 265  SER I C     1 
ATOM   9064  O  O     . SER Q  3 133 ? -65.144  36.130  -58.174 1.00 120.46 ? 265  SER I O     1 
ATOM   9065  C  CB    . SER Q  3 133 ? -62.506  38.332  -58.325 1.00 119.94 ? 265  SER I CB    1 
ATOM   9066  O  OG    . SER Q  3 133 ? -61.514  37.718  -57.518 1.00 119.75 ? 265  SER I OG    1 
ATOM   9067  N  N     . GLY Q  3 134 ? -63.453  35.992  -56.692 1.00 118.88 ? 266  GLY I N     1 
ATOM   9068  C  CA    . GLY Q  3 134 ? -63.693  34.582  -56.436 1.00 117.01 ? 266  GLY I CA    1 
ATOM   9069  C  C     . GLY Q  3 134 ? -62.489  33.657  -56.435 1.00 115.95 ? 266  GLY I C     1 
ATOM   9070  O  O     . GLY Q  3 134 ? -62.648  32.446  -56.596 1.00 115.41 ? 266  GLY I O     1 
ATOM   9071  N  N     . PHE Q  3 135 ? -61.288  34.204  -56.251 1.00 115.30 ? 267  PHE I N     1 
ATOM   9072  C  CA    . PHE Q  3 135 ? -60.086  33.371  -56.234 1.00 114.30 ? 267  PHE I CA    1 
ATOM   9073  C  C     . PHE Q  3 135 ? -59.601  33.036  -54.824 1.00 113.52 ? 267  PHE I C     1 
ATOM   9074  O  O     . PHE Q  3 135 ? -59.712  33.844  -53.900 1.00 113.78 ? 267  PHE I O     1 
ATOM   9075  C  CB    . PHE Q  3 135 ? -58.945  34.031  -57.021 1.00 113.86 ? 267  PHE I CB    1 
ATOM   9076  C  CG    . PHE Q  3 135 ? -57.697  33.186  -57.092 1.00 113.47 ? 267  PHE I CG    1 
ATOM   9077  C  CD1   . PHE Q  3 135 ? -56.822  33.115  -56.013 1.00 113.08 ? 267  PHE I CD1   1 
ATOM   9078  C  CD2   . PHE Q  3 135 ? -57.427  32.416  -58.218 1.00 113.56 ? 267  PHE I CD2   1 
ATOM   9079  C  CE1   . PHE Q  3 135 ? -55.705  32.287  -56.049 1.00 112.97 ? 267  PHE I CE1   1 
ATOM   9080  C  CE2   . PHE Q  3 135 ? -56.310  31.583  -58.264 1.00 113.34 ? 267  PHE I CE2   1 
ATOM   9081  C  CZ    . PHE Q  3 135 ? -55.448  31.520  -57.176 1.00 113.15 ? 267  PHE I CZ    1 
ATOM   9082  N  N     . ILE Q  3 136 ? -59.048  31.834  -54.685 1.00 111.95 ? 268  ILE I N     1 
ATOM   9083  C  CA    . ILE Q  3 136 ? -58.530  31.326  -53.418 1.00 110.24 ? 268  ILE I CA    1 
ATOM   9084  C  C     . ILE Q  3 136 ? -57.737  32.349  -52.610 1.00 109.10 ? 268  ILE I C     1 
ATOM   9085  O  O     . ILE Q  3 136 ? -58.171  32.789  -51.548 1.00 107.58 ? 268  ILE I O     1 
ATOM   9086  C  CB    . ILE Q  3 136 ? -57.623  30.108  -53.664 1.00 110.08 ? 268  ILE I CB    1 
ATOM   9087  C  CG1   . ILE Q  3 136 ? -58.303  29.161  -54.653 1.00 110.46 ? 268  ILE I CG1   1 
ATOM   9088  C  CG2   . ILE Q  3 136 ? -57.312  29.405  -52.349 1.00 109.83 ? 268  ILE I CG2   1 
ATOM   9089  C  CD1   . ILE Q  3 136 ? -59.721  28.764  -54.271 1.00 110.87 ? 268  ILE I CD1   1 
ATOM   9090  N  N     . GLY Q  3 137 ? -56.563  32.699  -53.126 1.00 108.69 ? 269  GLY I N     1 
ATOM   9091  C  CA    . GLY Q  3 137 ? -55.693  33.655  -52.469 1.00 107.54 ? 269  GLY I CA    1 
ATOM   9092  C  C     . GLY Q  3 137 ? -56.385  34.603  -51.516 1.00 106.86 ? 269  GLY I C     1 
ATOM   9093  O  O     . GLY Q  3 137 ? -56.383  34.379  -50.306 1.00 106.43 ? 269  GLY I O     1 
ATOM   9094  N  N     . ASN Q  3 138 ? -56.986  35.659  -52.054 1.00 106.35 ? 270  ASN I N     1 
ATOM   9095  C  CA    . ASN Q  3 138 ? -57.660  36.639  -51.216 1.00 106.39 ? 270  ASN I CA    1 
ATOM   9096  C  C     . ASN Q  3 138 ? -58.539  35.977  -50.160 1.00 106.42 ? 270  ASN I C     1 
ATOM   9097  O  O     . ASN Q  3 138 ? -58.776  36.555  -49.103 1.00 106.52 ? 270  ASN I O     1 
ATOM   9098  C  CB    . ASN Q  3 138 ? -58.504  37.594  -52.066 1.00 106.98 ? 270  ASN I CB    1 
ATOM   9099  C  CG    . ASN Q  3 138 ? -59.052  38.766  -51.258 1.00 107.58 ? 270  ASN I CG    1 
ATOM   9100  O  OD1   . ASN Q  3 138 ? -59.784  38.581  -50.283 1.00 107.34 ? 270  ASN I OD1   1 
ATOM   9101  N  ND2   . ASN Q  3 138 ? -58.696  39.982  -51.663 1.00 108.10 ? 270  ASN I ND2   1 
ATOM   9102  N  N     . GLU Q  3 139 ? -59.021  34.769  -50.439 1.00 106.03 ? 271  GLU I N     1 
ATOM   9103  C  CA    . GLU Q  3 139 ? -59.865  34.069  -49.478 1.00 105.10 ? 271  GLU I CA    1 
ATOM   9104  C  C     . GLU Q  3 139 ? -59.049  33.642  -48.278 1.00 103.91 ? 271  GLU I C     1 
ATOM   9105  O  O     . GLU Q  3 139 ? -59.208  34.190  -47.189 1.00 104.03 ? 271  GLU I O     1 
ATOM   9106  C  CB    . GLU Q  3 139 ? -60.536  32.845  -50.112 1.00 105.79 ? 271  GLU I CB    1 
ATOM   9107  C  CG    . GLU Q  3 139 ? -61.627  33.211  -51.110 1.00 108.24 ? 271  GLU I CG    1 
ATOM   9108  C  CD    . GLU Q  3 139 ? -62.569  32.062  -51.429 1.00 109.10 ? 271  GLU I CD    1 
ATOM   9109  O  OE1   . GLU Q  3 139 ? -63.216  31.537  -50.496 1.00 110.09 ? 271  GLU I OE1   1 
ATOM   9110  O  OE2   . GLU Q  3 139 ? -62.671  31.691  -52.618 1.00 110.12 ? 271  GLU I OE2   1 
ATOM   9111  N  N     . GLU Q  3 140 ? -58.171  32.667  -48.483 1.00 102.85 ? 272  GLU I N     1 
ATOM   9112  C  CA    . GLU Q  3 140 ? -57.322  32.164  -47.408 1.00 101.71 ? 272  GLU I CA    1 
ATOM   9113  C  C     . GLU Q  3 140 ? -56.628  33.331  -46.704 1.00 100.63 ? 272  GLU I C     1 
ATOM   9114  O  O     . GLU Q  3 140 ? -56.461  33.329  -45.485 1.00 99.89  ? 272  GLU I O     1 
ATOM   9115  C  CB    . GLU Q  3 140 ? -56.276  31.194  -47.969 1.00 102.26 ? 272  GLU I CB    1 
ATOM   9116  C  CG    . GLU Q  3 140 ? -56.835  30.063  -48.840 1.00 101.47 ? 272  GLU I CG    1 
ATOM   9117  C  CD    . GLU Q  3 140 ? -57.827  29.185  -48.104 1.00 101.09 ? 272  GLU I CD    1 
ATOM   9118  O  OE1   . GLU Q  3 140 ? -57.510  28.745  -46.980 1.00 101.03 ? 272  GLU I OE1   1 
ATOM   9119  O  OE2   . GLU Q  3 140 ? -58.921  28.930  -48.652 1.00 100.40 ? 272  GLU I OE2   1 
ATOM   9120  N  N     . ALA Q  3 141 ? -56.218  34.325  -47.481 1.00 99.74  ? 273  ALA I N     1 
ATOM   9121  C  CA    . ALA Q  3 141 ? -55.574  35.494  -46.910 1.00 99.26  ? 273  ALA I CA    1 
ATOM   9122  C  C     . ALA Q  3 141 ? -56.624  36.157  -46.033 1.00 99.29  ? 273  ALA I C     1 
ATOM   9123  O  O     . ALA Q  3 141 ? -56.391  36.419  -44.856 1.00 99.15  ? 273  ALA I O     1 
ATOM   9124  C  CB    . ALA Q  3 141 ? -55.135  36.438  -48.011 1.00 99.09  ? 273  ALA I CB    1 
ATOM   9125  N  N     . ASP Q  3 142 ? -57.791  36.407  -46.620 1.00 99.70  ? 274  ASP I N     1 
ATOM   9126  C  CA    . ASP Q  3 142 ? -58.907  37.028  -45.916 1.00 99.94  ? 274  ASP I CA    1 
ATOM   9127  C  C     . ASP Q  3 142 ? -59.324  36.167  -44.731 1.00 99.66  ? 274  ASP I C     1 
ATOM   9128  O  O     . ASP Q  3 142 ? -60.123  36.588  -43.899 1.00 99.68  ? 274  ASP I O     1 
ATOM   9129  C  CB    . ASP Q  3 142 ? -60.098  37.204  -46.865 1.00 100.70 ? 274  ASP I CB    1 
ATOM   9130  C  CG    . ASP Q  3 142 ? -61.271  37.915  -46.214 1.00 101.87 ? 274  ASP I CG    1 
ATOM   9131  O  OD1   . ASP Q  3 142 ? -61.072  39.037  -45.700 1.00 102.28 ? 274  ASP I OD1   1 
ATOM   9132  O  OD2   . ASP Q  3 142 ? -62.393  37.358  -46.222 1.00 102.06 ? 274  ASP I OD2   1 
ATOM   9133  N  N     . ARG Q  3 143 ? -58.783  34.956  -44.659 1.00 99.55  ? 275  ARG I N     1 
ATOM   9134  C  CA    . ARG Q  3 143 ? -59.110  34.047  -43.568 1.00 99.49  ? 275  ARG I CA    1 
ATOM   9135  C  C     . ARG Q  3 143 ? -58.137  34.287  -42.420 1.00 100.36 ? 275  ARG I C     1 
ATOM   9136  O  O     . ARG Q  3 143 ? -58.521  34.744  -41.340 1.00 99.88  ? 275  ARG I O     1 
ATOM   9137  C  CB    . ARG Q  3 143 ? -59.005  32.592  -44.042 1.00 97.91  ? 275  ARG I CB    1 
ATOM   9138  C  CG    . ARG Q  3 143 ? -59.826  31.609  -43.224 1.00 95.68  ? 275  ARG I CG    1 
ATOM   9139  C  CD    . ARG Q  3 143 ? -59.675  30.172  -43.709 1.00 93.56  ? 275  ARG I CD    1 
ATOM   9140  N  NE    . ARG Q  3 143 ? -58.457  29.538  -43.209 1.00 92.05  ? 275  ARG I NE    1 
ATOM   9141  C  CZ    . ARG Q  3 143 ? -57.254  29.645  -43.768 1.00 91.41  ? 275  ARG I CZ    1 
ATOM   9142  N  NH1   . ARG Q  3 143 ? -57.084  30.366  -44.869 1.00 90.63  ? 275  ARG I NH1   1 
ATOM   9143  N  NH2   . ARG Q  3 143 ? -56.215  29.032  -43.216 1.00 90.63  ? 275  ARG I NH2   1 
ATOM   9144  N  N     . LEU Q  3 144 ? -56.871  33.979  -42.678 1.00 101.68 ? 276  LEU I N     1 
ATOM   9145  C  CA    . LEU Q  3 144 ? -55.806  34.143  -41.699 1.00 102.82 ? 276  LEU I CA    1 
ATOM   9146  C  C     . LEU Q  3 144 ? -55.891  35.515  -41.046 1.00 103.50 ? 276  LEU I C     1 
ATOM   9147  O  O     . LEU Q  3 144 ? -55.923  35.632  -39.823 1.00 103.30 ? 276  LEU I O     1 
ATOM   9148  C  CB    . LEU Q  3 144 ? -54.447  33.973  -42.383 1.00 103.07 ? 276  LEU I CB    1 
ATOM   9149  C  CG    . LEU Q  3 144 ? -54.194  32.624  -43.069 1.00 103.53 ? 276  LEU I CG    1 
ATOM   9150  C  CD1   . LEU Q  3 144 ? -53.011  32.729  -44.023 1.00 103.53 ? 276  LEU I CD1   1 
ATOM   9151  C  CD2   . LEU Q  3 144 ? -53.949  31.554  -42.013 1.00 103.47 ? 276  LEU I CD2   1 
ATOM   9152  N  N     . ALA Q  3 145 ? -55.936  36.549  -41.876 1.00 105.02 ? 277  ALA I N     1 
ATOM   9153  C  CA    . ALA Q  3 145 ? -56.010  37.918  -41.392 1.00 107.11 ? 277  ALA I CA    1 
ATOM   9154  C  C     . ALA Q  3 145 ? -56.972  38.027  -40.226 1.00 108.66 ? 277  ALA I C     1 
ATOM   9155  O  O     . ALA Q  3 145 ? -56.628  38.561  -39.170 1.00 108.57 ? 277  ALA I O     1 
ATOM   9156  C  CB    . ALA Q  3 145 ? -56.455  38.842  -42.513 1.00 106.81 ? 277  ALA I CB    1 
ATOM   9157  N  N     . ARG Q  3 146 ? -58.179  37.508  -40.426 1.00 110.81 ? 278  ARG I N     1 
ATOM   9158  C  CA    . ARG Q  3 146 ? -59.218  37.558  -39.406 1.00 112.79 ? 278  ARG I CA    1 
ATOM   9159  C  C     . ARG Q  3 146 ? -58.753  36.940  -38.087 1.00 114.36 ? 278  ARG I C     1 
ATOM   9160  O  O     . ARG Q  3 146 ? -58.952  37.523  -37.019 1.00 114.88 ? 278  ARG I O     1 
ATOM   9161  C  CB    . ARG Q  3 146 ? -60.484  36.851  -39.912 1.00 112.22 ? 278  ARG I CB    1 
ATOM   9162  C  CG    . ARG Q  3 146 ? -61.766  37.250  -39.178 1.00 111.96 ? 278  ARG I CG    1 
ATOM   9163  C  CD    . ARG Q  3 146 ? -62.098  38.741  -39.337 1.00 111.42 ? 278  ARG I CD    1 
ATOM   9164  N  NE    . ARG Q  3 146 ? -62.996  39.039  -40.459 1.00 110.47 ? 278  ARG I NE    1 
ATOM   9165  C  CZ    . ARG Q  3 146 ? -62.702  38.860  -41.745 1.00 109.52 ? 278  ARG I CZ    1 
ATOM   9166  N  NH1   . ARG Q  3 146 ? -61.524  38.374  -42.102 1.00 109.79 ? 278  ARG I NH1   1 
ATOM   9167  N  NH2   . ARG Q  3 146 ? -63.585  39.179  -42.681 1.00 108.28 ? 278  ARG I NH2   1 
ATOM   9168  N  N     . GLU Q  3 147 ? -58.125  35.770  -38.164 1.00 115.48 ? 279  GLU I N     1 
ATOM   9169  C  CA    . GLU Q  3 147 ? -57.638  35.087  -36.971 1.00 116.41 ? 279  GLU I CA    1 
ATOM   9170  C  C     . GLU Q  3 147 ? -56.765  36.002  -36.129 1.00 117.04 ? 279  GLU I C     1 
ATOM   9171  O  O     . GLU Q  3 147 ? -56.766  35.920  -34.899 1.00 116.66 ? 279  GLU I O     1 
ATOM   9172  C  CB    . GLU Q  3 147 ? -56.847  33.841  -37.364 1.00 116.91 ? 279  GLU I CB    1 
ATOM   9173  C  CG    . GLU Q  3 147 ? -57.654  32.853  -38.181 1.00 119.03 ? 279  GLU I CG    1 
ATOM   9174  C  CD    . GLU Q  3 147 ? -58.942  32.447  -37.487 1.00 120.38 ? 279  GLU I CD    1 
ATOM   9175  O  OE1   . GLU Q  3 147 ? -59.743  31.704  -38.098 1.00 120.49 ? 279  GLU I OE1   1 
ATOM   9176  O  OE2   . GLU Q  3 147 ? -59.151  32.870  -36.328 1.00 121.08 ? 279  GLU I OE2   1 
ATOM   9177  N  N     . GLY Q  3 148 ? -56.027  36.875  -36.805 1.00 117.89 ? 280  GLY I N     1 
ATOM   9178  C  CA    . GLY Q  3 148 ? -55.149  37.799  -36.116 1.00 119.42 ? 280  GLY I CA    1 
ATOM   9179  C  C     . GLY Q  3 148 ? -55.897  38.688  -35.148 1.00 120.57 ? 280  GLY I C     1 
ATOM   9180  O  O     . GLY Q  3 148 ? -55.400  38.998  -34.067 1.00 121.27 ? 280  GLY I O     1 
ATOM   9181  N  N     . ALA Q  3 149 ? -57.099  39.097  -35.530 1.00 121.43 ? 281  ALA I N     1 
ATOM   9182  C  CA    . ALA Q  3 149 ? -57.905  39.963  -34.682 1.00 122.82 ? 281  ALA I CA    1 
ATOM   9183  C  C     . ALA Q  3 149 ? -58.458  39.219  -33.470 1.00 123.88 ? 281  ALA I C     1 
ATOM   9184  O  O     . ALA Q  3 149 ? -58.934  39.832  -32.514 1.00 123.67 ? 281  ALA I O     1 
ATOM   9185  C  CB    . ALA Q  3 149 ? -59.042  40.557  -35.492 1.00 123.03 ? 281  ALA I CB    1 
ATOM   9186  N  N     . LYS Q  3 150 ? -58.397  37.893  -33.509 1.00 125.04 ? 282  LYS I N     1 
ATOM   9187  C  CA    . LYS Q  3 150 ? -58.902  37.095  -32.403 1.00 126.17 ? 282  LYS I CA    1 
ATOM   9188  C  C     . LYS Q  3 150 ? -57.814  36.800  -31.383 1.00 126.70 ? 282  LYS I C     1 
ATOM   9189  O  O     . LYS Q  3 150 ? -58.093  36.297  -30.297 1.00 127.12 ? 282  LYS I O     1 
ATOM   9190  C  CB    . LYS Q  3 150 ? -59.519  35.797  -32.927 1.00 126.63 ? 282  LYS I CB    1 
ATOM   9191  C  CG    . LYS Q  3 150 ? -60.788  36.029  -33.737 1.00 127.71 ? 282  LYS I CG    1 
ATOM   9192  C  CD    . LYS Q  3 150 ? -61.359  34.738  -34.299 1.00 128.66 ? 282  LYS I CD    1 
ATOM   9193  C  CE    . LYS Q  3 150 ? -62.586  35.010  -35.164 1.00 128.92 ? 282  LYS I CE    1 
ATOM   9194  N  NZ    . LYS Q  3 150 ? -63.139  33.768  -35.784 1.00 129.05 ? 282  LYS I NZ    1 
ATOM   9195  N  N     . GLN Q  3 151 ? -56.572  37.122  -31.731 1.00 127.13 ? 283  GLN I N     1 
ATOM   9196  C  CA    . GLN Q  3 151 ? -55.456  36.901  -30.822 1.00 127.53 ? 283  GLN I CA    1 
ATOM   9197  C  C     . GLN Q  3 151 ? -55.441  37.945  -29.709 1.00 128.07 ? 283  GLN I C     1 
ATOM   9198  O  O     . GLN Q  3 151 ? -56.408  38.069  -28.954 1.00 128.11 ? 283  GLN I O     1 
ATOM   9199  C  CB    . GLN Q  3 151 ? -54.133  36.940  -31.581 1.00 127.22 ? 283  GLN I CB    1 
ATOM   9200  C  CG    . GLN Q  3 151 ? -53.896  35.731  -32.453 1.00 127.73 ? 283  GLN I CG    1 
ATOM   9201  C  CD    . GLN Q  3 151 ? -52.474  35.669  -32.963 1.00 128.55 ? 283  GLN I CD    1 
ATOM   9202  O  OE1   . GLN Q  3 151 ? -52.071  34.692  -33.598 1.00 128.68 ? 283  GLN I OE1   1 
ATOM   9203  N  NE2   . GLN Q  3 151 ? -51.701  36.717  -32.687 1.00 128.67 ? 283  GLN I NE2   1 
ATOM   9204  N  N     . SER Q  3 152 ? -54.344  38.695  -29.611 1.00 128.49 ? 284  SER I N     1 
ATOM   9205  C  CA    . SER Q  3 152 ? -54.207  39.722  -28.580 1.00 128.80 ? 284  SER I CA    1 
ATOM   9206  C  C     . SER Q  3 152 ? -52.872  40.476  -28.623 1.00 128.22 ? 284  SER I C     1 
ATOM   9207  O  O     . SER Q  3 152 ? -52.880  41.696  -28.343 1.00 127.22 ? 284  SER I O     1 
ATOM   9208  C  CB    . SER Q  3 152 ? -54.419  39.096  -27.193 1.00 129.77 ? 284  SER I CB    1 
ATOM   9209  O  OG    . SER Q  3 152 ? -54.043  37.727  -27.177 1.00 130.81 ? 284  SER I OG    1 
ATOM   9210  N  N     . SER R  3 2   ? -115.673 44.186  -31.879 1.00 85.05  ? 134  SER J N     1 
ATOM   9211  C  CA    . SER R  3 2   ? -115.731 45.621  -32.272 1.00 86.89  ? 134  SER J CA    1 
ATOM   9212  C  C     . SER R  3 2   ? -116.203 45.781  -33.716 1.00 87.90  ? 134  SER J C     1 
ATOM   9213  O  O     . SER R  3 2   ? -117.382 46.020  -33.971 1.00 88.31  ? 134  SER J O     1 
ATOM   9214  C  CB    . SER R  3 2   ? -114.356 46.268  -32.092 1.00 85.75  ? 134  SER J CB    1 
ATOM   9215  N  N     . HIS R  3 3   ? -115.279 45.648  -34.661 1.00 90.01  ? 135  HIS J N     1 
ATOM   9216  C  CA    . HIS R  3 3   ? -115.605 45.781  -36.079 1.00 91.23  ? 135  HIS J CA    1 
ATOM   9217  C  C     . HIS R  3 3   ? -115.765 44.428  -36.759 1.00 91.22  ? 135  HIS J C     1 
ATOM   9218  O  O     . HIS R  3 3   ? -116.430 43.533  -36.250 1.00 92.26  ? 135  HIS J O     1 
ATOM   9219  C  CB    . HIS R  3 3   ? -114.508 46.572  -36.810 1.00 92.28  ? 135  HIS J CB    1 
ATOM   9220  C  CG    . HIS R  3 3   ? -114.931 47.941  -37.249 1.00 93.23  ? 135  HIS J CG    1 
ATOM   9221  N  ND1   . HIS R  3 3   ? -114.120 48.761  -38.004 1.00 93.21  ? 135  HIS J ND1   1 
ATOM   9222  C  CD2   . HIS R  3 3   ? -116.073 48.636  -37.033 1.00 93.52  ? 135  HIS J CD2   1 
ATOM   9223  C  CE1   . HIS R  3 3   ? -114.744 49.904  -38.233 1.00 93.41  ? 135  HIS J CE1   1 
ATOM   9224  N  NE2   . HIS R  3 3   ? -115.930 49.854  -37.654 1.00 93.66  ? 135  HIS J NE2   1 
ATOM   9225  N  N     . MET R  3 4   ? -115.137 44.316  -37.922 1.00 90.89  ? 136  MET J N     1 
ATOM   9226  C  CA    . MET R  3 4   ? -115.130 43.131  -38.771 1.00 90.35  ? 136  MET J CA    1 
ATOM   9227  C  C     . MET R  3 4   ? -114.754 43.723  -40.120 1.00 89.70  ? 136  MET J C     1 
ATOM   9228  O  O     . MET R  3 4   ? -115.411 44.650  -40.598 1.00 89.66  ? 136  MET J O     1 
ATOM   9229  C  CB    . MET R  3 4   ? -116.513 42.464  -38.849 1.00 90.97  ? 136  MET J CB    1 
ATOM   9230  C  CG    . MET R  3 4   ? -117.597 43.266  -39.571 1.00 92.05  ? 136  MET J CG    1 
ATOM   9231  S  SD    . MET R  3 4   ? -118.313 42.407  -41.014 1.00 93.81  ? 136  MET J SD    1 
ATOM   9232  C  CE    . MET R  3 4   ? -119.849 41.757  -40.339 1.00 92.80  ? 136  MET J CE    1 
ATOM   9233  N  N     . GLY R  3 5   ? -113.684 43.218  -40.723 1.00 88.56  ? 137  GLY J N     1 
ATOM   9234  C  CA    . GLY R  3 5   ? -113.266 43.766  -41.997 1.00 86.03  ? 137  GLY J CA    1 
ATOM   9235  C  C     . GLY R  3 5   ? -113.369 42.831  -43.182 1.00 84.29  ? 137  GLY J C     1 
ATOM   9236  O  O     . GLY R  3 5   ? -113.996 41.767  -43.130 1.00 83.68  ? 137  GLY J O     1 
ATOM   9237  N  N     . ASP R  3 6   ? -112.758 43.268  -44.274 1.00 82.09  ? 138  ASP J N     1 
ATOM   9238  C  CA    . ASP R  3 6   ? -112.718 42.502  -45.505 1.00 78.98  ? 138  ASP J CA    1 
ATOM   9239  C  C     . ASP R  3 6   ? -111.284 42.584  -45.991 1.00 76.20  ? 138  ASP J C     1 
ATOM   9240  O  O     . ASP R  3 6   ? -110.626 43.615  -45.843 1.00 76.67  ? 138  ASP J O     1 
ATOM   9241  C  CB    . ASP R  3 6   ? -113.667 43.092  -46.553 1.00 79.61  ? 138  ASP J CB    1 
ATOM   9242  C  CG    . ASP R  3 6   ? -113.373 44.550  -46.858 1.00 80.34  ? 138  ASP J CG    1 
ATOM   9243  O  OD1   . ASP R  3 6   ? -112.243 44.855  -47.292 1.00 80.72  ? 138  ASP J OD1   1 
ATOM   9244  O  OD2   . ASP R  3 6   ? -114.277 45.393  -46.666 1.00 80.90  ? 138  ASP J OD2   1 
ATOM   9245  N  N     . PHE R  3 7   ? -110.804 41.477  -46.538 1.00 72.03  ? 139  PHE J N     1 
ATOM   9246  C  CA    . PHE R  3 7   ? -109.454 41.364  -47.059 1.00 67.67  ? 139  PHE J CA    1 
ATOM   9247  C  C     . PHE R  3 7   ? -109.191 39.887  -47.093 1.00 65.44  ? 139  PHE J C     1 
ATOM   9248  O  O     . PHE R  3 7   ? -109.534 39.175  -46.153 1.00 64.29  ? 139  PHE J O     1 
ATOM   9249  C  CB    . PHE R  3 7   ? -108.425 42.021  -46.136 1.00 66.15  ? 139  PHE J CB    1 
ATOM   9250  C  CG    . PHE R  3 7   ? -108.302 41.355  -44.804 1.00 64.37  ? 139  PHE J CG    1 
ATOM   9251  C  CD1   . PHE R  3 7   ? -109.226 41.599  -43.805 1.00 63.88  ? 139  PHE J CD1   1 
ATOM   9252  C  CD2   . PHE R  3 7   ? -107.276 40.456  -44.559 1.00 64.71  ? 139  PHE J CD2   1 
ATOM   9253  C  CE1   . PHE R  3 7   ? -109.129 40.955  -42.581 1.00 64.48  ? 139  PHE J CE1   1 
ATOM   9254  C  CE2   . PHE R  3 7   ? -107.169 39.804  -43.334 1.00 63.98  ? 139  PHE J CE2   1 
ATOM   9255  C  CZ    . PHE R  3 7   ? -108.096 40.053  -42.345 1.00 63.91  ? 139  PHE J CZ    1 
ATOM   9256  N  N     . VAL R  3 8   ? -108.597 39.419  -48.177 1.00 63.87  ? 140  VAL J N     1 
ATOM   9257  C  CA    . VAL R  3 8   ? -108.288 38.009  -48.275 1.00 63.19  ? 140  VAL J CA    1 
ATOM   9258  C  C     . VAL R  3 8   ? -106.860 37.795  -47.761 1.00 62.35  ? 140  VAL J C     1 
ATOM   9259  O  O     . VAL R  3 8   ? -106.096 38.750  -47.574 1.00 62.36  ? 140  VAL J O     1 
ATOM   9260  C  CB    . VAL R  3 8   ? -108.420 37.515  -49.731 1.00 62.91  ? 140  VAL J CB    1 
ATOM   9261  C  CG1   . VAL R  3 8   ? -109.713 38.031  -50.325 1.00 62.15  ? 140  VAL J CG1   1 
ATOM   9262  C  CG2   . VAL R  3 8   ? -107.236 37.970  -50.556 1.00 65.00  ? 140  VAL J CG2   1 
ATOM   9263  N  N     . VAL R  3 9   ? -106.507 36.546  -47.506 1.00 60.58  ? 141  VAL J N     1 
ATOM   9264  C  CA    . VAL R  3 9   ? -105.176 36.242  -47.024 1.00 58.47  ? 141  VAL J CA    1 
ATOM   9265  C  C     . VAL R  3 9   ? -104.501 35.305  -48.005 1.00 58.51  ? 141  VAL J C     1 
ATOM   9266  O  O     . VAL R  3 9   ? -105.157 34.462  -48.620 1.00 58.78  ? 141  VAL J O     1 
ATOM   9267  C  CB    . VAL R  3 9   ? -105.230 35.583  -45.641 1.00 56.50  ? 141  VAL J CB    1 
ATOM   9268  C  CG1   . VAL R  3 9   ? -103.867 35.064  -45.253 1.00 55.45  ? 141  VAL J CG1   1 
ATOM   9269  C  CG2   . VAL R  3 9   ? -105.695 36.588  -44.632 1.00 55.92  ? 141  VAL J CG2   1 
ATOM   9270  N  N     . VAL R  3 10  ? -103.193 35.473  -48.161 1.00 58.15  ? 142  VAL J N     1 
ATOM   9271  C  CA    . VAL R  3 10  ? -102.414 34.634  -49.057 1.00 57.37  ? 142  VAL J CA    1 
ATOM   9272  C  C     . VAL R  3 10  ? -100.982 34.475  -48.525 1.00 58.37  ? 142  VAL J C     1 
ATOM   9273  O  O     . VAL R  3 10  ? -100.391 35.403  -47.964 1.00 56.83  ? 142  VAL J O     1 
ATOM   9274  C  CB    . VAL R  3 10  ? -102.417 35.211  -50.520 1.00 55.83  ? 142  VAL J CB    1 
ATOM   9275  C  CG1   . VAL R  3 10  ? -101.600 36.482  -50.594 1.00 54.39  ? 142  VAL J CG1   1 
ATOM   9276  C  CG2   . VAL R  3 10  ? -101.904 34.169  -51.503 1.00 52.86  ? 142  VAL J CG2   1 
ATOM   9277  N  N     . TYR R  3 11  ? -100.447 33.272  -48.684 1.00 60.09  ? 143  TYR J N     1 
ATOM   9278  C  CA    . TYR R  3 11  ? -99.099  32.953  -48.241 1.00 62.38  ? 143  TYR J CA    1 
ATOM   9279  C  C     . TYR R  3 11  ? -98.149  32.819  -49.441 1.00 62.89  ? 143  TYR J C     1 
ATOM   9280  O  O     . TYR R  3 11  ? -98.504  32.210  -50.458 1.00 63.09  ? 143  TYR J O     1 
ATOM   9281  C  CB    . TYR R  3 11  ? -99.128  31.639  -47.459 1.00 64.54  ? 143  TYR J CB    1 
ATOM   9282  C  CG    . TYR R  3 11  ? -99.712  31.742  -46.066 1.00 66.41  ? 143  TYR J CG    1 
ATOM   9283  C  CD1   . TYR R  3 11  ? -98.882  31.867  -44.953 1.00 67.48  ? 143  TYR J CD1   1 
ATOM   9284  C  CD2   . TYR R  3 11  ? -101.087 31.700  -45.855 1.00 66.50  ? 143  TYR J CD2   1 
ATOM   9285  C  CE1   . TYR R  3 11  ? -99.406  31.945  -43.658 1.00 68.23  ? 143  TYR J CE1   1 
ATOM   9286  C  CE2   . TYR R  3 11  ? -101.622 31.779  -44.560 1.00 67.92  ? 143  TYR J CE2   1 
ATOM   9287  C  CZ    . TYR R  3 11  ? -100.773 31.902  -43.465 1.00 68.17  ? 143  TYR J CZ    1 
ATOM   9288  O  OH    . TYR R  3 11  ? -101.281 31.993  -42.181 1.00 68.03  ? 143  TYR J OH    1 
ATOM   9289  N  N     . THR R  3 12  ? -96.948  33.386  -49.324 1.00 62.58  ? 144  THR J N     1 
ATOM   9290  C  CA    . THR R  3 12  ? -95.959  33.301  -50.402 1.00 62.57  ? 144  THR J CA    1 
ATOM   9291  C  C     . THR R  3 12  ? -94.584  32.824  -49.919 1.00 63.13  ? 144  THR J C     1 
ATOM   9292  O  O     . THR R  3 12  ? -94.207  33.029  -48.762 1.00 64.20  ? 144  THR J O     1 
ATOM   9293  C  CB    . THR R  3 12  ? -95.767  34.653  -51.106 1.00 61.46  ? 144  THR J CB    1 
ATOM   9294  O  OG1   . THR R  3 12  ? -95.377  35.640  -50.145 1.00 60.97  ? 144  THR J OG1   1 
ATOM   9295  C  CG2   . THR R  3 12  ? -97.047  35.080  -51.790 1.00 60.91  ? 144  THR J CG2   1 
ATOM   9296  N  N     . ASP R  3 13  ? -93.843  32.179  -50.818 1.00 62.41  ? 145  ASP J N     1 
ATOM   9297  C  CA    . ASP R  3 13  ? -92.509  31.680  -50.509 1.00 60.28  ? 145  ASP J CA    1 
ATOM   9298  C  C     . ASP R  3 13  ? -91.748  31.321  -51.769 1.00 60.08  ? 145  ASP J C     1 
ATOM   9299  O  O     . ASP R  3 13  ? -92.249  30.593  -52.633 1.00 59.04  ? 145  ASP J O     1 
ATOM   9300  C  CB    . ASP R  3 13  ? -92.567  30.444  -49.619 1.00 59.65  ? 145  ASP J CB    1 
ATOM   9301  C  CG    . ASP R  3 13  ? -91.203  29.801  -49.436 1.00 59.08  ? 145  ASP J CG    1 
ATOM   9302  O  OD1   . ASP R  3 13  ? -90.371  30.385  -48.706 1.00 58.27  ? 145  ASP J OD1   1 
ATOM   9303  O  OD2   . ASP R  3 13  ? -90.961  28.722  -50.031 1.00 56.26  ? 145  ASP J OD2   1 
ATOM   9304  N  N     . GLY R  3 14  ? -90.529  31.842  -51.852 1.00 60.26  ? 146  GLY J N     1 
ATOM   9305  C  CA    . GLY R  3 14  ? -89.657  31.585  -52.981 1.00 60.88  ? 146  GLY J CA    1 
ATOM   9306  C  C     . GLY R  3 14  ? -88.466  30.754  -52.537 1.00 61.31  ? 146  GLY J C     1 
ATOM   9307  O  O     . GLY R  3 14  ? -87.689  31.164  -51.673 1.00 61.22  ? 146  GLY J O     1 
ATOM   9308  N  N     . CYS R  3 15  ? -88.334  29.572  -53.126 1.00 61.94  ? 147  CYS J N     1 
ATOM   9309  C  CA    . CYS R  3 15  ? -87.252  28.656  -52.807 1.00 62.82  ? 147  CYS J CA    1 
ATOM   9310  C  C     . CYS R  3 15  ? -86.227  28.792  -53.902 1.00 63.88  ? 147  CYS J C     1 
ATOM   9311  O  O     . CYS R  3 15  ? -86.548  29.250  -54.994 1.00 63.65  ? 147  CYS J O     1 
ATOM   9312  C  CB    . CYS R  3 15  ? -87.763  27.224  -52.809 1.00 62.70  ? 147  CYS J CB    1 
ATOM   9313  S  SG    . CYS R  3 15  ? -88.353  26.710  -54.443 1.00 62.83  ? 147  CYS J SG    1 
ATOM   9314  N  N     . CYS R  3 16  ? -84.999  28.381  -53.616 1.00 65.63  ? 148  CYS J N     1 
ATOM   9315  C  CA    . CYS R  3 16  ? -83.939  28.449  -54.604 1.00 67.51  ? 148  CYS J CA    1 
ATOM   9316  C  C     . CYS R  3 16  ? -82.838  27.476  -54.241 1.00 69.43  ? 148  CYS J C     1 
ATOM   9317  O  O     . CYS R  3 16  ? -81.920  27.814  -53.514 1.00 69.43  ? 148  CYS J O     1 
ATOM   9318  C  CB    . CYS R  3 16  ? -83.377  29.859  -54.683 1.00 66.63  ? 148  CYS J CB    1 
ATOM   9319  S  SG    . CYS R  3 16  ? -82.289  30.056  -56.076 1.00 67.02  ? 148  CYS J SG    1 
ATOM   9320  N  N     . SER R  3 17  ? -82.936  26.259  -54.755 1.00 73.55  ? 149  SER J N     1 
ATOM   9321  C  CA    . SER R  3 17  ? -81.954  25.228  -54.459 1.00 78.06  ? 149  SER J CA    1 
ATOM   9322  C  C     . SER R  3 17  ? -80.641  25.340  -55.213 1.00 80.92  ? 149  SER J C     1 
ATOM   9323  O  O     . SER R  3 17  ? -80.594  25.165  -56.435 1.00 81.86  ? 149  SER J O     1 
ATOM   9324  C  CB    . SER R  3 17  ? -82.550  23.851  -54.727 1.00 79.00  ? 149  SER J CB    1 
ATOM   9325  O  OG    . SER R  3 17  ? -81.529  22.869  -54.739 1.00 81.60  ? 149  SER J OG    1 
ATOM   9326  N  N     . SER R  3 18  ? -79.574  25.612  -54.468 1.00 83.88  ? 150  SER J N     1 
ATOM   9327  C  CA    . SER R  3 18  ? -78.234  25.730  -55.035 1.00 86.83  ? 150  SER J CA    1 
ATOM   9328  C  C     . SER R  3 18  ? -77.457  24.440  -54.724 1.00 88.48  ? 150  SER J C     1 
ATOM   9329  O  O     . SER R  3 18  ? -76.260  24.469  -54.422 1.00 88.65  ? 150  SER J O     1 
ATOM   9330  C  CB    . SER R  3 18  ? -77.522  26.957  -54.440 1.00 86.99  ? 150  SER J CB    1 
ATOM   9331  O  OG    . SER R  3 18  ? -77.664  27.011  -53.027 1.00 86.50  ? 150  SER J OG    1 
ATOM   9332  N  N     . ASN R  3 19  ? -78.159  23.312  -54.825 1.00 90.21  ? 151  ASN J N     1 
ATOM   9333  C  CA    . ASN R  3 19  ? -77.598  21.995  -54.532 1.00 92.38  ? 151  ASN J CA    1 
ATOM   9334  C  C     . ASN R  3 19  ? -76.628  21.385  -55.541 1.00 93.83  ? 151  ASN J C     1 
ATOM   9335  O  O     . ASN R  3 19  ? -76.904  21.322  -56.746 1.00 93.65  ? 151  ASN J O     1 
ATOM   9336  C  CB    . ASN R  3 19  ? -78.730  21.005  -54.258 1.00 92.11  ? 151  ASN J CB    1 
ATOM   9337  C  CG    . ASN R  3 19  ? -79.428  21.275  -52.939 1.00 92.35  ? 151  ASN J CG    1 
ATOM   9338  O  OD1   . ASN R  3 19  ? -80.320  20.530  -52.532 1.00 92.85  ? 151  ASN J OD1   1 
ATOM   9339  N  ND2   . ASN R  3 19  ? -79.021  22.346  -52.260 1.00 92.59  ? 151  ASN J ND2   1 
ATOM   9340  N  N     . GLY R  3 20  ? -75.498  20.914  -55.005 1.00 95.22  ? 152  GLY J N     1 
ATOM   9341  C  CA    . GLY R  3 20  ? -74.447  20.305  -55.801 1.00 95.44  ? 152  GLY J CA    1 
ATOM   9342  C  C     . GLY R  3 20  ? -73.823  21.290  -56.774 1.00 96.02  ? 152  GLY J C     1 
ATOM   9343  O  O     . GLY R  3 20  ? -73.641  22.476  -56.466 1.00 95.81  ? 152  GLY J O     1 
ATOM   9344  N  N     . ARG R  3 21  ? -73.478  20.782  -57.952 1.00 95.84  ? 153  ARG J N     1 
ATOM   9345  C  CA    . ARG R  3 21  ? -72.901  21.590  -59.020 1.00 95.17  ? 153  ARG J CA    1 
ATOM   9346  C  C     . ARG R  3 21  ? -73.867  21.445  -60.196 1.00 94.18  ? 153  ARG J C     1 
ATOM   9347  O  O     . ARG R  3 21  ? -73.500  21.635  -61.360 1.00 94.20  ? 153  ARG J O     1 
ATOM   9348  C  CB    . ARG R  3 21  ? -71.513  21.065  -59.395 1.00 95.41  ? 153  ARG J CB    1 
ATOM   9349  N  N     . ARG R  3 22  ? -75.109  21.095  -59.863 1.00 92.11  ? 154  ARG J N     1 
ATOM   9350  C  CA    . ARG R  3 22  ? -76.157  20.902  -60.851 1.00 89.78  ? 154  ARG J CA    1 
ATOM   9351  C  C     . ARG R  3 22  ? -76.736  22.255  -61.212 1.00 88.04  ? 154  ARG J C     1 
ATOM   9352  O  O     . ARG R  3 22  ? -77.510  22.368  -62.163 1.00 88.42  ? 154  ARG J O     1 
ATOM   9353  C  CB    . ARG R  3 22  ? -77.269  20.016  -60.287 1.00 90.78  ? 154  ARG J CB    1 
ATOM   9354  C  CG    . ARG R  3 22  ? -76.791  18.826  -59.466 1.00 91.93  ? 154  ARG J CG    1 
ATOM   9355  C  CD    . ARG R  3 22  ? -77.923  17.824  -59.250 1.00 93.01  ? 154  ARG J CD    1 
ATOM   9356  N  NE    . ARG R  3 22  ? -78.250  17.116  -60.488 1.00 93.70  ? 154  ARG J NE    1 
ATOM   9357  C  CZ    . ARG R  3 22  ? -79.481  16.955  -60.968 1.00 94.01  ? 154  ARG J CZ    1 
ATOM   9358  N  NH1   . ARG R  3 22  ? -80.530  17.453  -60.319 1.00 93.35  ? 154  ARG J NH1   1 
ATOM   9359  N  NH2   . ARG R  3 22  ? -79.661  16.299  -62.109 1.00 93.54  ? 154  ARG J NH2   1 
ATOM   9360  N  N     . ARG R  3 23  ? -76.363  23.266  -60.429 1.00 85.07  ? 155  ARG J N     1 
ATOM   9361  C  CA    . ARG R  3 23  ? -76.805  24.650  -60.614 1.00 83.42  ? 155  ARG J CA    1 
ATOM   9362  C  C     . ARG R  3 23  ? -78.116  24.946  -59.872 1.00 83.00  ? 155  ARG J C     1 
ATOM   9363  O  O     . ARG R  3 23  ? -78.886  24.035  -59.550 1.00 84.03  ? 155  ARG J O     1 
ATOM   9364  C  CB    . ARG R  3 23  ? -76.936  24.986  -62.114 1.00 81.88  ? 155  ARG J CB    1 
ATOM   9365  C  CG    . ARG R  3 23  ? -78.332  24.892  -62.690 1.00 80.65  ? 155  ARG J CG    1 
ATOM   9366  C  CD    . ARG R  3 23  ? -78.282  24.646  -64.185 1.00 80.61  ? 155  ARG J CD    1 
ATOM   9367  N  NE    . ARG R  3 23  ? -77.474  25.632  -64.903 1.00 81.02  ? 155  ARG J NE    1 
ATOM   9368  C  CZ    . ARG R  3 23  ? -77.343  25.665  -66.229 1.00 81.84  ? 155  ARG J CZ    1 
ATOM   9369  N  NH1   . ARG R  3 23  ? -77.970  24.767  -66.982 1.00 81.56  ? 155  ARG J NH1   1 
ATOM   9370  N  NH2   . ARG R  3 23  ? -76.584  26.591  -66.808 1.00 81.94  ? 155  ARG J NH2   1 
ATOM   9371  N  N     . PRO R  3 24  ? -78.378  26.234  -59.585 1.00 81.21  ? 156  PRO J N     1 
ATOM   9372  C  CA    . PRO R  3 24  ? -79.575  26.698  -58.878 1.00 79.06  ? 156  PRO J CA    1 
ATOM   9373  C  C     . PRO R  3 24  ? -80.901  26.252  -59.461 1.00 77.38  ? 156  PRO J C     1 
ATOM   9374  O  O     . PRO R  3 24  ? -80.969  25.703  -60.561 1.00 77.98  ? 156  PRO J O     1 
ATOM   9375  C  CB    . PRO R  3 24  ? -79.436  28.213  -58.921 1.00 79.11  ? 156  PRO J CB    1 
ATOM   9376  C  CG    . PRO R  3 24  ? -77.969  28.404  -58.898 1.00 80.67  ? 156  PRO J CG    1 
ATOM   9377  C  CD    . PRO R  3 24  ? -77.495  27.373  -59.886 1.00 81.06  ? 156  PRO J CD    1 
ATOM   9378  N  N     . ARG R  3 25  ? -81.951  26.518  -58.691 1.00 75.00  ? 157  ARG J N     1 
ATOM   9379  C  CA    . ARG R  3 25  ? -83.329  26.207  -59.046 1.00 71.47  ? 157  ARG J CA    1 
ATOM   9380  C  C     . ARG R  3 25  ? -84.209  26.952  -58.057 1.00 69.55  ? 157  ARG J C     1 
ATOM   9381  O  O     . ARG R  3 25  ? -83.966  26.906  -56.858 1.00 69.68  ? 157  ARG J O     1 
ATOM   9382  C  CB    . ARG R  3 25  ? -83.588  24.703  -58.964 1.00 70.17  ? 157  ARG J CB    1 
ATOM   9383  C  CG    . ARG R  3 25  ? -83.502  24.017  -60.313 1.00 70.17  ? 157  ARG J CG    1 
ATOM   9384  C  CD    . ARG R  3 25  ? -84.035  22.596  -60.281 1.00 70.75  ? 157  ARG J CD    1 
ATOM   9385  N  NE    . ARG R  3 25  ? -84.312  22.109  -61.631 1.00 71.77  ? 157  ARG J NE    1 
ATOM   9386  C  CZ    . ARG R  3 25  ? -84.963  20.982  -61.913 1.00 73.00  ? 157  ARG J CZ    1 
ATOM   9387  N  NH1   . ARG R  3 25  ? -85.415  20.195  -60.940 1.00 72.61  ? 157  ARG J NH1   1 
ATOM   9388  N  NH2   . ARG R  3 25  ? -85.183  20.652  -63.181 1.00 73.39  ? 157  ARG J NH2   1 
ATOM   9389  N  N     . ALA R  3 26  ? -85.220  27.651  -58.557 1.00 67.33  ? 158  ALA J N     1 
ATOM   9390  C  CA    . ALA R  3 26  ? -86.101  28.418  -57.686 1.00 66.19  ? 158  ALA J CA    1 
ATOM   9391  C  C     . ALA R  3 26  ? -87.563  28.243  -58.068 1.00 65.23  ? 158  ALA J C     1 
ATOM   9392  O  O     . ALA R  3 26  ? -87.879  28.018  -59.232 1.00 65.10  ? 158  ALA J O     1 
ATOM   9393  C  CB    . ALA R  3 26  ? -85.720  29.894  -57.739 1.00 65.78  ? 158  ALA J CB    1 
ATOM   9394  N  N     . GLY R  3 27  ? -88.455  28.358  -57.089 1.00 63.67  ? 159  GLY J N     1 
ATOM   9395  C  CA    . GLY R  3 27  ? -89.863  28.195  -57.384 1.00 63.22  ? 159  GLY J CA    1 
ATOM   9396  C  C     . GLY R  3 27  ? -90.779  29.297  -56.884 1.00 63.72  ? 159  GLY J C     1 
ATOM   9397  O  O     . GLY R  3 27  ? -90.461  30.012  -55.938 1.00 64.07  ? 159  GLY J O     1 
ATOM   9398  N  N     . ILE R  3 28  ? -91.924  29.438  -57.542 1.00 63.61  ? 160  ILE J N     1 
ATOM   9399  C  CA    . ILE R  3 28  ? -92.919  30.426  -57.162 1.00 63.55  ? 160  ILE J CA    1 
ATOM   9400  C  C     . ILE R  3 28  ? -93.919  29.696  -56.273 1.00 64.40  ? 160  ILE J C     1 
ATOM   9401  O  O     . ILE R  3 28  ? -94.354  28.593  -56.605 1.00 64.46  ? 160  ILE J O     1 
ATOM   9402  C  CB    . ILE R  3 28  ? -93.648  30.986  -58.408 1.00 63.33  ? 160  ILE J CB    1 
ATOM   9403  C  CG1   . ILE R  3 28  ? -92.725  31.936  -59.166 1.00 62.84  ? 160  ILE J CG1   1 
ATOM   9404  C  CG2   . ILE R  3 28  ? -94.920  31.714  -58.003 1.00 63.05  ? 160  ILE J CG2   1 
ATOM   9405  C  CD1   . ILE R  3 28  ? -92.303  33.154  -58.359 1.00 63.32  ? 160  ILE J CD1   1 
ATOM   9406  N  N     . GLY R  3 29  ? -94.269  30.298  -55.138 1.00 65.09  ? 161  GLY J N     1 
ATOM   9407  C  CA    . GLY R  3 29  ? -95.218  29.664  -54.239 1.00 64.10  ? 161  GLY J CA    1 
ATOM   9408  C  C     . GLY R  3 29  ? -96.309  30.585  -53.727 1.00 63.46  ? 161  GLY J C     1 
ATOM   9409  O  O     . GLY R  3 29  ? -96.028  31.608  -53.103 1.00 63.17  ? 161  GLY J O     1 
ATOM   9410  N  N     . VAL R  3 30  ? -97.558  30.227  -54.000 1.00 63.36  ? 162  VAL J N     1 
ATOM   9411  C  CA    . VAL R  3 30  ? -98.693  31.021  -53.537 1.00 64.10  ? 162  VAL J CA    1 
ATOM   9412  C  C     . VAL R  3 30  ? -99.842  30.108  -53.059 1.00 63.87  ? 162  VAL J C     1 
ATOM   9413  O  O     . VAL R  3 30  ? -100.337 29.240  -53.800 1.00 62.68  ? 162  VAL J O     1 
ATOM   9414  C  CB    . VAL R  3 30  ? -99.177  32.002  -54.641 1.00 64.10  ? 162  VAL J CB    1 
ATOM   9415  C  CG1   . VAL R  3 30  ? -99.490  31.247  -55.910 1.00 65.97  ? 162  VAL J CG1   1 
ATOM   9416  C  CG2   . VAL R  3 30  ? -100.392 32.766  -54.163 1.00 64.14  ? 162  VAL J CG2   1 
ATOM   9417  N  N     . TYR R  3 31  ? -100.235 30.315  -51.800 1.00 63.17  ? 163  TYR J N     1 
ATOM   9418  C  CA    . TYR R  3 31  ? -101.282 29.535  -51.135 1.00 61.32  ? 163  TYR J CA    1 
ATOM   9419  C  C     . TYR R  3 31  ? -102.379 30.441  -50.594 1.00 59.73  ? 163  TYR J C     1 
ATOM   9420  O  O     . TYR R  3 31  ? -102.109 31.324  -49.782 1.00 58.95  ? 163  TYR J O     1 
ATOM   9421  C  CB    . TYR R  3 31  ? -100.654 28.722  -49.988 1.00 61.32  ? 163  TYR J CB    1 
ATOM   9422  C  CG    . TYR R  3 31  ? -101.618 27.921  -49.133 1.00 61.75  ? 163  TYR J CG    1 
ATOM   9423  C  CD1   . TYR R  3 31  ? -102.028 28.387  -47.882 1.00 62.66  ? 163  TYR J CD1   1 
ATOM   9424  C  CD2   . TYR R  3 31  ? -102.110 26.688  -49.565 1.00 62.18  ? 163  TYR J CD2   1 
ATOM   9425  C  CE1   . TYR R  3 31  ? -102.909 27.635  -47.075 1.00 62.43  ? 163  TYR J CE1   1 
ATOM   9426  C  CE2   . TYR R  3 31  ? -102.992 25.929  -48.768 1.00 61.86  ? 163  TYR J CE2   1 
ATOM   9427  C  CZ    . TYR R  3 31  ? -103.384 26.407  -47.525 1.00 61.48  ? 163  TYR J CZ    1 
ATOM   9428  O  OH    . TYR R  3 31  ? -104.220 25.655  -46.725 1.00 58.77  ? 163  TYR J OH    1 
ATOM   9429  N  N     . TRP R  3 32  ? -103.610 30.209  -51.049 1.00 58.49  ? 164  TRP J N     1 
ATOM   9430  C  CA    . TRP R  3 32  ? -104.774 30.989  -50.629 1.00 57.87  ? 164  TRP J CA    1 
ATOM   9431  C  C     . TRP R  3 32  ? -105.658 30.238  -49.634 1.00 57.25  ? 164  TRP J C     1 
ATOM   9432  O  O     . TRP R  3 32  ? -106.459 30.835  -48.911 1.00 56.39  ? 164  TRP J O     1 
ATOM   9433  C  CB    . TRP R  3 32  ? -105.614 31.353  -51.845 1.00 58.10  ? 164  TRP J CB    1 
ATOM   9434  C  CG    . TRP R  3 32  ? -104.856 32.076  -52.874 1.00 59.46  ? 164  TRP J CG    1 
ATOM   9435  C  CD1   . TRP R  3 32  ? -104.049 31.537  -53.828 1.00 60.71  ? 164  TRP J CD1   1 
ATOM   9436  C  CD2   . TRP R  3 32  ? -104.780 33.496  -53.035 1.00 59.78  ? 164  TRP J CD2   1 
ATOM   9437  N  NE1   . TRP R  3 32  ? -103.469 32.537  -54.578 1.00 61.60  ? 164  TRP J NE1   1 
ATOM   9438  C  CE2   . TRP R  3 32  ? -103.902 33.749  -54.107 1.00 60.68  ? 164  TRP J CE2   1 
ATOM   9439  C  CE3   . TRP R  3 32  ? -105.368 34.579  -52.373 1.00 59.77  ? 164  TRP J CE3   1 
ATOM   9440  C  CZ2   . TRP R  3 32  ? -103.597 35.043  -54.532 1.00 61.17  ? 164  TRP J CZ2   1 
ATOM   9441  C  CZ3   . TRP R  3 32  ? -105.066 35.864  -52.795 1.00 59.89  ? 164  TRP J CZ3   1 
ATOM   9442  C  CH2   . TRP R  3 32  ? -104.189 36.085  -53.863 1.00 60.85  ? 164  TRP J CH2   1 
ATOM   9443  N  N     . GLY R  3 33  ? -105.513 28.921  -49.623 1.00 57.07  ? 165  GLY J N     1 
ATOM   9444  C  CA    . GLY R  3 33  ? -106.297 28.087  -48.739 1.00 57.07  ? 165  GLY J CA    1 
ATOM   9445  C  C     . GLY R  3 33  ? -106.302 26.659  -49.248 1.00 57.34  ? 165  GLY J C     1 
ATOM   9446  O  O     . GLY R  3 33  ? -105.915 26.409  -50.387 1.00 56.98  ? 165  GLY J O     1 
ATOM   9447  N  N     . PRO R  3 34  ? -106.726 25.691  -48.424 1.00 58.03  ? 166  PRO J N     1 
ATOM   9448  C  CA    . PRO R  3 34  ? -106.750 24.300  -48.871 1.00 57.65  ? 166  PRO J CA    1 
ATOM   9449  C  C     . PRO R  3 34  ? -107.528 24.152  -50.163 1.00 57.75  ? 166  PRO J C     1 
ATOM   9450  O  O     . PRO R  3 34  ? -108.468 24.909  -50.424 1.00 56.98  ? 166  PRO J O     1 
ATOM   9451  C  CB    . PRO R  3 34  ? -107.426 23.583  -47.710 1.00 57.46  ? 166  PRO J CB    1 
ATOM   9452  C  CG    . PRO R  3 34  ? -106.970 24.372  -46.523 1.00 58.12  ? 166  PRO J CG    1 
ATOM   9453  C  CD    . PRO R  3 34  ? -107.140 25.793  -47.012 1.00 58.62  ? 166  PRO J CD    1 
ATOM   9454  N  N     . GLY R  3 35  ? -107.118 23.178  -50.968 1.00 58.55  ? 167  GLY J N     1 
ATOM   9455  C  CA    . GLY R  3 35  ? -107.779 22.906  -52.234 1.00 60.09  ? 167  GLY J CA    1 
ATOM   9456  C  C     . GLY R  3 35  ? -108.082 24.112  -53.102 1.00 60.14  ? 167  GLY J C     1 
ATOM   9457  O  O     . GLY R  3 35  ? -108.632 23.970  -54.200 1.00 60.65  ? 167  GLY J O     1 
ATOM   9458  N  N     . HIS R  3 36  ? -107.713 25.293  -52.619 1.00 59.58  ? 168  HIS J N     1 
ATOM   9459  C  CA    . HIS R  3 36  ? -107.955 26.531  -53.337 1.00 59.75  ? 168  HIS J CA    1 
ATOM   9460  C  C     . HIS R  3 36  ? -107.553 26.411  -54.809 1.00 59.92  ? 168  HIS J C     1 
ATOM   9461  O  O     . HIS R  3 36  ? -106.546 25.781  -55.137 1.00 58.98  ? 168  HIS J O     1 
ATOM   9462  C  CB    . HIS R  3 36  ? -107.186 27.661  -52.666 1.00 59.96  ? 168  HIS J CB    1 
ATOM   9463  C  CG    . HIS R  3 36  ? -107.881 28.978  -52.735 1.00 59.99  ? 168  HIS J CG    1 
ATOM   9464  N  ND1   . HIS R  3 36  ? -108.075 29.654  -53.918 1.00 61.16  ? 168  HIS J ND1   1 
ATOM   9465  C  CD2   . HIS R  3 36  ? -108.458 29.730  -51.770 1.00 60.76  ? 168  HIS J CD2   1 
ATOM   9466  C  CE1   . HIS R  3 36  ? -108.745 30.767  -53.679 1.00 61.83  ? 168  HIS J CE1   1 
ATOM   9467  N  NE2   . HIS R  3 36  ? -108.990 30.838  -52.384 1.00 61.22  ? 168  HIS J NE2   1 
ATOM   9468  N  N     . PRO R  3 37  ? -108.350 27.009  -55.714 1.00 59.71  ? 169  PRO J N     1 
ATOM   9469  C  CA    . PRO R  3 37  ? -108.115 26.989  -57.157 1.00 59.80  ? 169  PRO J CA    1 
ATOM   9470  C  C     . PRO R  3 37  ? -107.094 28.010  -57.662 1.00 60.68  ? 169  PRO J C     1 
ATOM   9471  O  O     . PRO R  3 37  ? -106.681 27.956  -58.820 1.00 60.05  ? 169  PRO J O     1 
ATOM   9472  C  CB    . PRO R  3 37  ? -109.501 27.242  -57.716 1.00 59.56  ? 169  PRO J CB    1 
ATOM   9473  C  CG    . PRO R  3 37  ? -110.032 28.240  -56.750 1.00 59.30  ? 169  PRO J CG    1 
ATOM   9474  C  CD    . PRO R  3 37  ? -109.659 27.620  -55.421 1.00 59.68  ? 169  PRO J CD    1 
ATOM   9475  N  N     . LEU R  3 38  ? -106.697 28.950  -56.812 1.00 62.10  ? 170  LEU J N     1 
ATOM   9476  C  CA    . LEU R  3 38  ? -105.704 29.942  -57.221 1.00 64.21  ? 170  LEU J CA    1 
ATOM   9477  C  C     . LEU R  3 38  ? -104.302 29.527  -56.802 1.00 65.30  ? 170  LEU J C     1 
ATOM   9478  O  O     . LEU R  3 38  ? -103.331 30.160  -57.212 1.00 66.39  ? 170  LEU J O     1 
ATOM   9479  C  CB    . LEU R  3 38  ? -105.993 31.320  -56.616 1.00 63.96  ? 170  LEU J CB    1 
ATOM   9480  C  CG    . LEU R  3 38  ? -107.134 32.153  -57.190 1.00 65.11  ? 170  LEU J CG    1 
ATOM   9481  C  CD1   . LEU R  3 38  ? -108.438 31.379  -57.066 1.00 66.77  ? 170  LEU J CD1   1 
ATOM   9482  C  CD2   . LEU R  3 38  ? -107.221 33.481  -56.444 1.00 64.74  ? 170  LEU J CD2   1 
ATOM   9483  N  N     . ASN R  3 39  ? -104.194 28.483  -55.979 1.00 65.66  ? 171  ASN J N     1 
ATOM   9484  C  CA    . ASN R  3 39  ? -102.891 28.016  -55.505 1.00 65.50  ? 171  ASN J CA    1 
ATOM   9485  C  C     . ASN R  3 39  ? -102.002 27.635  -56.673 1.00 66.46  ? 171  ASN J C     1 
ATOM   9486  O  O     . ASN R  3 39  ? -102.446 26.964  -57.612 1.00 66.90  ? 171  ASN J O     1 
ATOM   9487  C  CB    . ASN R  3 39  ? -103.058 26.836  -54.551 1.00 64.01  ? 171  ASN J CB    1 
ATOM   9488  C  CG    . ASN R  3 39  ? -103.425 27.276  -53.150 1.00 63.26  ? 171  ASN J CG    1 
ATOM   9489  O  OD1   . ASN R  3 39  ? -103.788 28.434  -52.924 1.00 63.00  ? 171  ASN J OD1   1 
ATOM   9490  N  ND2   . ASN R  3 39  ? -103.338 26.354  -52.201 1.00 61.36  ? 171  ASN J ND2   1 
ATOM   9491  N  N     . VAL R  3 40  ? -100.746 28.075  -56.613 1.00 66.71  ? 172  VAL J N     1 
ATOM   9492  C  CA    . VAL R  3 40  ? -99.806  27.815  -57.690 1.00 65.71  ? 172  VAL J CA    1 
ATOM   9493  C  C     . VAL R  3 40  ? -98.400  27.493  -57.257 1.00 65.27  ? 172  VAL J C     1 
ATOM   9494  O  O     . VAL R  3 40  ? -97.874  28.055  -56.291 1.00 64.09  ? 172  VAL J O     1 
ATOM   9495  C  CB    . VAL R  3 40  ? -99.702  29.011  -58.660 1.00 65.78  ? 172  VAL J CB    1 
ATOM   9496  C  CG1   . VAL R  3 40  ? -98.739  28.682  -59.790 1.00 65.86  ? 172  VAL J CG1   1 
ATOM   9497  C  CG2   . VAL R  3 40  ? -101.068 29.352  -59.220 1.00 67.41  ? 172  VAL J CG2   1 
ATOM   9498  N  N     . GLY R  3 41  ? -97.808  26.584  -58.022 1.00 65.72  ? 173  GLY J N     1 
ATOM   9499  C  CA    . GLY R  3 41  ? -96.443  26.145  -57.819 1.00 65.57  ? 173  GLY J CA    1 
ATOM   9500  C  C     . GLY R  3 41  ? -95.814  26.087  -59.200 1.00 65.13  ? 173  GLY J C     1 
ATOM   9501  O  O     . GLY R  3 41  ? -95.822  25.041  -59.848 1.00 66.07  ? 173  GLY J O     1 
ATOM   9502  N  N     . ILE R  3 42  ? -95.295  27.222  -59.661 1.00 63.96  ? 174  ILE J N     1 
ATOM   9503  C  CA    . ILE R  3 42  ? -94.657  27.325  -60.972 1.00 62.53  ? 174  ILE J CA    1 
ATOM   9504  C  C     . ILE R  3 42  ? -93.183  27.688  -60.818 1.00 62.21  ? 174  ILE J C     1 
ATOM   9505  O  O     . ILE R  3 42  ? -92.803  28.344  -59.845 1.00 62.51  ? 174  ILE J O     1 
ATOM   9506  C  CB    . ILE R  3 42  ? -95.340  28.395  -61.806 1.00 62.02  ? 174  ILE J CB    1 
ATOM   9507  C  CG1   . ILE R  3 42  ? -95.542  29.642  -60.950 1.00 62.65  ? 174  ILE J CG1   1 
ATOM   9508  C  CG2   . ILE R  3 42  ? -96.660  27.879  -62.321 1.00 63.58  ? 174  ILE J CG2   1 
ATOM   9509  C  CD1   . ILE R  3 42  ? -96.560  30.622  -61.499 1.00 64.50  ? 174  ILE J CD1   1 
ATOM   9510  N  N     . ARG R  3 43  ? -92.353  27.269  -61.774 1.00 60.59  ? 175  ARG J N     1 
ATOM   9511  C  CA    . ARG R  3 43  ? -90.924  27.560  -61.701 1.00 58.16  ? 175  ARG J CA    1 
ATOM   9512  C  C     . ARG R  3 43  ? -90.573  28.971  -62.162 1.00 55.41  ? 175  ARG J C     1 
ATOM   9513  O  O     . ARG R  3 43  ? -90.992  29.420  -63.228 1.00 53.48  ? 175  ARG J O     1 
ATOM   9514  C  CB    . ARG R  3 43  ? -90.105  26.539  -62.504 1.00 59.84  ? 175  ARG J CB    1 
ATOM   9515  C  CG    . ARG R  3 43  ? -88.607  26.672  -62.227 1.00 62.58  ? 175  ARG J CG    1 
ATOM   9516  C  CD    . ARG R  3 43  ? -87.725  25.655  -62.940 1.00 64.51  ? 175  ARG J CD    1 
ATOM   9517  N  NE    . ARG R  3 43  ? -86.311  25.916  -62.650 1.00 65.71  ? 175  ARG J NE    1 
ATOM   9518  C  CZ    . ARG R  3 43  ? -85.286  25.197  -63.106 1.00 66.38  ? 175  ARG J CZ    1 
ATOM   9519  N  NH1   . ARG R  3 43  ? -85.488  24.142  -63.894 1.00 66.11  ? 175  ARG J NH1   1 
ATOM   9520  N  NH2   . ARG R  3 43  ? -84.047  25.544  -62.770 1.00 66.23  ? 175  ARG J NH2   1 
ATOM   9521  N  N     . LEU R  3 44  ? -89.786  29.654  -61.337 1.00 53.17  ? 176  LEU J N     1 
ATOM   9522  C  CA    . LEU R  3 44  ? -89.356  31.019  -61.602 1.00 52.40  ? 176  LEU J CA    1 
ATOM   9523  C  C     . LEU R  3 44  ? -88.481  31.175  -62.829 1.00 53.72  ? 176  LEU J C     1 
ATOM   9524  O  O     . LEU R  3 44  ? -87.483  30.480  -62.999 1.00 55.21  ? 176  LEU J O     1 
ATOM   9525  C  CB    . LEU R  3 44  ? -88.592  31.578  -60.403 1.00 49.44  ? 176  LEU J CB    1 
ATOM   9526  C  CG    . LEU R  3 44  ? -87.976  32.961  -60.624 1.00 47.43  ? 176  LEU J CG    1 
ATOM   9527  C  CD1   . LEU R  3 44  ? -89.067  33.990  -60.801 1.00 47.66  ? 176  LEU J CD1   1 
ATOM   9528  C  CD2   . LEU R  3 44  ? -87.118  33.325  -59.450 1.00 47.59  ? 176  LEU J CD2   1 
ATOM   9529  N  N     . PRO R  3 45  ? -88.847  32.096  -63.713 1.00 54.51  ? 177  PRO J N     1 
ATOM   9530  C  CA    . PRO R  3 45  ? -88.012  32.275  -64.902 1.00 55.83  ? 177  PRO J CA    1 
ATOM   9531  C  C     . PRO R  3 45  ? -86.894  33.320  -64.717 1.00 56.16  ? 177  PRO J C     1 
ATOM   9532  O  O     . PRO R  3 45  ? -87.061  34.308  -63.999 1.00 56.06  ? 177  PRO J O     1 
ATOM   9533  C  CB    . PRO R  3 45  ? -89.027  32.686  -65.964 1.00 56.60  ? 177  PRO J CB    1 
ATOM   9534  C  CG    . PRO R  3 45  ? -90.054  33.454  -65.158 1.00 55.79  ? 177  PRO J CG    1 
ATOM   9535  C  CD    . PRO R  3 45  ? -90.215  32.599  -63.934 1.00 53.98  ? 177  PRO J CD    1 
ATOM   9536  N  N     . GLY R  3 46  ? -85.753  33.089  -65.358 1.00 56.25  ? 178  GLY J N     1 
ATOM   9537  C  CA    . GLY R  3 46  ? -84.662  34.042  -65.269 1.00 57.57  ? 178  GLY J CA    1 
ATOM   9538  C  C     . GLY R  3 46  ? -83.521  33.670  -64.349 1.00 58.64  ? 178  GLY J C     1 
ATOM   9539  O  O     . GLY R  3 46  ? -83.108  32.511  -64.299 1.00 58.55  ? 178  GLY J O     1 
ATOM   9540  N  N     . ARG R  3 47  ? -82.988  34.666  -63.643 1.00 59.50  ? 179  ARG J N     1 
ATOM   9541  C  CA    . ARG R  3 47  ? -81.893  34.429  -62.706 1.00 60.77  ? 179  ARG J CA    1 
ATOM   9542  C  C     . ARG R  3 47  ? -82.434  33.520  -61.608 1.00 61.95  ? 179  ARG J C     1 
ATOM   9543  O  O     . ARG R  3 47  ? -83.521  33.763  -61.090 1.00 62.59  ? 179  ARG J O     1 
ATOM   9544  C  CB    . ARG R  3 47  ? -81.431  35.733  -62.046 1.00 60.23  ? 179  ARG J CB    1 
ATOM   9545  C  CG    . ARG R  3 47  ? -80.626  36.710  -62.881 1.00 59.09  ? 179  ARG J CG    1 
ATOM   9546  C  CD    . ARG R  3 47  ? -80.094  37.813  -61.956 1.00 58.40  ? 179  ARG J CD    1 
ATOM   9547  N  NE    . ARG R  3 47  ? -79.160  37.274  -60.958 1.00 58.65  ? 179  ARG J NE    1 
ATOM   9548  C  CZ    . ARG R  3 47  ? -79.063  37.685  -59.690 1.00 57.03  ? 179  ARG J CZ    1 
ATOM   9549  N  NH1   . ARG R  3 47  ? -78.172  37.124  -58.878 1.00 54.68  ? 179  ARG J NH1   1 
ATOM   9550  N  NH2   . ARG R  3 47  ? -79.861  38.642  -59.226 1.00 55.75  ? 179  ARG J NH2   1 
ATOM   9551  N  N     . GLN R  3 48  ? -81.682  32.491  -61.238 1.00 63.15  ? 180  GLN J N     1 
ATOM   9552  C  CA    . GLN R  3 48  ? -82.128  31.582  -60.185 1.00 64.69  ? 180  GLN J CA    1 
ATOM   9553  C  C     . GLN R  3 48  ? -81.522  31.942  -58.818 1.00 64.71  ? 180  GLN J C     1 
ATOM   9554  O  O     . GLN R  3 48  ? -80.533  31.342  -58.392 1.00 63.98  ? 180  GLN J O     1 
ATOM   9555  C  CB    . GLN R  3 48  ? -81.749  30.142  -60.539 1.00 66.28  ? 180  GLN J CB    1 
ATOM   9556  C  CG    . GLN R  3 48  ? -82.138  29.719  -61.944 1.00 69.25  ? 180  GLN J CG    1 
ATOM   9557  C  CD    . GLN R  3 48  ? -83.634  29.708  -62.167 1.00 70.36  ? 180  GLN J CD    1 
ATOM   9558  O  OE1   . GLN R  3 48  ? -84.369  29.004  -61.474 1.00 71.89  ? 180  GLN J OE1   1 
ATOM   9559  N  NE2   . GLN R  3 48  ? -84.095  30.482  -63.147 1.00 71.30  ? 180  GLN J NE2   1 
ATOM   9560  N  N     . THR R  3 49  ? -82.107  32.911  -58.123 1.00 64.67  ? 181  THR J N     1 
ATOM   9561  C  CA    . THR R  3 49  ? -81.559  33.267  -56.827 1.00 65.60  ? 181  THR J CA    1 
ATOM   9562  C  C     . THR R  3 49  ? -82.546  33.276  -55.682 1.00 65.94  ? 181  THR J C     1 
ATOM   9563  O  O     . THR R  3 49  ? -83.760  33.395  -55.860 1.00 65.97  ? 181  THR J O     1 
ATOM   9564  C  CB    . THR R  3 49  ? -80.885  34.653  -56.825 1.00 66.37  ? 181  THR J CB    1 
ATOM   9565  O  OG1   . THR R  3 49  ? -81.882  35.669  -56.985 1.00 66.74  ? 181  THR J OG1   1 
ATOM   9566  C  CG2   . THR R  3 49  ? -79.848  34.752  -57.927 1.00 66.51  ? 181  THR J CG2   1 
ATOM   9567  N  N     . ASN R  3 50  ? -81.966  33.154  -54.498 1.00 65.93  ? 182  ASN J N     1 
ATOM   9568  C  CA    . ASN R  3 50  ? -82.658  33.170  -53.231 1.00 66.11  ? 182  ASN J CA    1 
ATOM   9569  C  C     . ASN R  3 50  ? -83.670  34.298  -53.225 1.00 66.23  ? 182  ASN J C     1 
ATOM   9570  O  O     . ASN R  3 50  ? -84.828  34.111  -53.586 1.00 65.48  ? 182  ASN J O     1 
ATOM   9571  C  CB    . ASN R  3 50  ? -81.612  33.383  -52.125 1.00 67.40  ? 182  ASN J CB    1 
ATOM   9572  C  CG    . ASN R  3 50  ? -82.198  33.938  -50.833 1.00 67.73  ? 182  ASN J CG    1 
ATOM   9573  O  OD1   . ASN R  3 50  ? -81.477  34.527  -50.019 1.00 67.25  ? 182  ASN J OD1   1 
ATOM   9574  N  ND2   . ASN R  3 50  ? -83.498  33.745  -50.632 1.00 68.54  ? 182  ASN J ND2   1 
ATOM   9575  N  N     . GLN R  3 51  ? -83.201  35.479  -52.834 1.00 67.39  ? 183  GLN J N     1 
ATOM   9576  C  CA    . GLN R  3 51  ? -84.043  36.663  -52.718 1.00 68.21  ? 183  GLN J CA    1 
ATOM   9577  C  C     . GLN R  3 51  ? -84.664  37.197  -53.992 1.00 66.96  ? 183  GLN J C     1 
ATOM   9578  O  O     . GLN R  3 51  ? -84.990  38.377  -54.047 1.00 67.81  ? 183  GLN J O     1 
ATOM   9579  C  CB    . GLN R  3 51  ? -83.262  37.799  -52.057 1.00 69.29  ? 183  GLN J CB    1 
ATOM   9580  C  CG    . GLN R  3 51  ? -82.577  37.402  -50.771 1.00 73.77  ? 183  GLN J CG    1 
ATOM   9581  C  CD    . GLN R  3 51  ? -82.178  38.601  -49.944 1.00 77.26  ? 183  GLN J CD    1 
ATOM   9582  O  OE1   . GLN R  3 51  ? -81.651  39.584  -50.473 1.00 80.17  ? 183  GLN J OE1   1 
ATOM   9583  N  NE2   . GLN R  3 51  ? -82.420  38.531  -48.633 1.00 77.96  ? 183  GLN J NE2   1 
ATOM   9584  N  N     . ARG R  3 52  ? -84.829  36.360  -55.013 1.00 65.33  ? 184  ARG J N     1 
ATOM   9585  C  CA    . ARG R  3 52  ? -85.436  36.827  -56.258 1.00 62.75  ? 184  ARG J CA    1 
ATOM   9586  C  C     . ARG R  3 52  ? -86.695  36.051  -56.537 1.00 61.43  ? 184  ARG J C     1 
ATOM   9587  O  O     . ARG R  3 52  ? -87.588  36.526  -57.232 1.00 59.77  ? 184  ARG J O     1 
ATOM   9588  C  CB    . ARG R  3 52  ? -84.481  36.676  -57.450 1.00 62.48  ? 184  ARG J CB    1 
ATOM   9589  C  CG    . ARG R  3 52  ? -85.113  37.128  -58.764 1.00 61.09  ? 184  ARG J CG    1 
ATOM   9590  C  CD    . ARG R  3 52  ? -84.137  37.238  -59.934 1.00 58.87  ? 184  ARG J CD    1 
ATOM   9591  N  NE    . ARG R  3 52  ? -84.828  37.752  -61.121 1.00 58.38  ? 184  ARG J NE    1 
ATOM   9592  C  CZ    . ARG R  3 52  ? -85.569  37.019  -61.953 1.00 57.35  ? 184  ARG J CZ    1 
ATOM   9593  N  NH1   . ARG R  3 52  ? -85.717  35.717  -61.754 1.00 56.78  ? 184  ARG J NH1   1 
ATOM   9594  N  NH2   . ARG R  3 52  ? -86.202  37.598  -62.967 1.00 55.92  ? 184  ARG J NH2   1 
ATOM   9595  N  N     . ALA R  3 53  ? -86.748  34.843  -55.995 1.00 61.23  ? 185  ALA J N     1 
ATOM   9596  C  CA    . ALA R  3 53  ? -87.900  33.981  -56.174 1.00 61.52  ? 185  ALA J CA    1 
ATOM   9597  C  C     . ALA R  3 53  ? -88.990  34.425  -55.211 1.00 62.33  ? 185  ALA J C     1 
ATOM   9598  O  O     . ALA R  3 53  ? -90.106  34.762  -55.613 1.00 61.98  ? 185  ALA J O     1 
ATOM   9599  C  CB    . ALA R  3 53  ? -87.510  32.545  -55.898 1.00 59.89  ? 185  ALA J CB    1 
ATOM   9600  N  N     . GLU R  3 54  ? -88.639  34.428  -53.932 1.00 63.48  ? 186  GLU J N     1 
ATOM   9601  C  CA    . GLU R  3 54  ? -89.548  34.818  -52.866 1.00 64.32  ? 186  GLU J CA    1 
ATOM   9602  C  C     . GLU R  3 54  ? -90.332  36.047  -53.295 1.00 63.27  ? 186  GLU J C     1 
ATOM   9603  O  O     . GLU R  3 54  ? -91.567  36.061  -53.312 1.00 63.64  ? 186  GLU J O     1 
ATOM   9604  C  CB    . GLU R  3 54  ? -88.745  35.144  -51.599 1.00 65.49  ? 186  GLU J CB    1 
ATOM   9605  C  CG    . GLU R  3 54  ? -89.554  35.175  -50.304 1.00 68.22  ? 186  GLU J CG    1 
ATOM   9606  C  CD    . GLU R  3 54  ? -89.702  33.800  -49.653 1.00 70.54  ? 186  GLU J CD    1 
ATOM   9607  O  OE1   . GLU R  3 54  ? -88.683  33.072  -49.575 1.00 71.07  ? 186  GLU J OE1   1 
ATOM   9608  O  OE2   . GLU R  3 54  ? -90.825  33.454  -49.207 1.00 70.14  ? 186  GLU J OE2   1 
ATOM   9609  N  N     . ILE R  3 55  ? -89.588  37.077  -53.655 1.00 61.60  ? 187  ILE J N     1 
ATOM   9610  C  CA    . ILE R  3 55  ? -90.178  38.331  -54.058 1.00 60.61  ? 187  ILE J CA    1 
ATOM   9611  C  C     . ILE R  3 55  ? -91.101  38.201  -55.261 1.00 60.27  ? 187  ILE J C     1 
ATOM   9612  O  O     . ILE R  3 55  ? -92.181  38.773  -55.269 1.00 61.03  ? 187  ILE J O     1 
ATOM   9613  C  CB    . ILE R  3 55  ? -89.067  39.349  -54.331 1.00 59.96  ? 187  ILE J CB    1 
ATOM   9614  C  CG1   . ILE R  3 55  ? -89.656  40.664  -54.810 1.00 58.67  ? 187  ILE J CG1   1 
ATOM   9615  C  CG2   . ILE R  3 55  ? -88.080  38.772  -55.322 1.00 60.87  ? 187  ILE J CG2   1 
ATOM   9616  C  CD1   . ILE R  3 55  ? -88.607  41.727  -54.963 1.00 58.78  ? 187  ILE J CD1   1 
ATOM   9617  N  N     . HIS R  3 56  ? -90.702  37.436  -56.269 1.00 60.05  ? 188  HIS J N     1 
ATOM   9618  C  CA    . HIS R  3 56  ? -91.545  37.289  -57.453 1.00 59.36  ? 188  HIS J CA    1 
ATOM   9619  C  C     . HIS R  3 56  ? -92.809  36.508  -57.175 1.00 57.78  ? 188  HIS J C     1 
ATOM   9620  O  O     . HIS R  3 56  ? -93.729  36.476  -57.991 1.00 56.13  ? 188  HIS J O     1 
ATOM   9621  C  CB    . HIS R  3 56  ? -90.766  36.629  -58.584 1.00 61.57  ? 188  HIS J CB    1 
ATOM   9622  C  CG    . HIS R  3 56  ? -90.490  37.553  -59.728 1.00 63.83  ? 188  HIS J CG    1 
ATOM   9623  N  ND1   . HIS R  3 56  ? -91.448  37.885  -60.664 1.00 65.91  ? 188  HIS J ND1   1 
ATOM   9624  C  CD2   . HIS R  3 56  ? -89.381  38.257  -60.058 1.00 63.54  ? 188  HIS J CD2   1 
ATOM   9625  C  CE1   . HIS R  3 56  ? -90.940  38.753  -61.521 1.00 65.55  ? 188  HIS J CE1   1 
ATOM   9626  N  NE2   . HIS R  3 56  ? -89.688  38.995  -61.175 1.00 64.49  ? 188  HIS J NE2   1 
ATOM   9627  N  N     . ALA R  3 57  ? -92.842  35.876  -56.011 1.00 57.44  ? 189  ALA J N     1 
ATOM   9628  C  CA    . ALA R  3 57  ? -93.996  35.103  -55.604 1.00 57.00  ? 189  ALA J CA    1 
ATOM   9629  C  C     . ALA R  3 57  ? -95.001  36.101  -55.078 1.00 56.61  ? 189  ALA J C     1 
ATOM   9630  O  O     . ALA R  3 57  ? -96.190  36.011  -55.367 1.00 56.99  ? 189  ALA J O     1 
ATOM   9631  C  CB    . ALA R  3 57  ? -93.613  34.108  -54.514 1.00 57.40  ? 189  ALA J CB    1 
ATOM   9632  N  N     . ALA R  3 58  ? -94.525  37.062  -54.301 1.00 56.50  ? 190  ALA J N     1 
ATOM   9633  C  CA    . ALA R  3 58  ? -95.428  38.066  -53.774 1.00 57.82  ? 190  ALA J CA    1 
ATOM   9634  C  C     . ALA R  3 58  ? -96.151  38.648  -54.979 1.00 58.66  ? 190  ALA J C     1 
ATOM   9635  O  O     . ALA R  3 58  ? -97.340  38.972  -54.918 1.00 59.20  ? 190  ALA J O     1 
ATOM   9636  C  CB    . ALA R  3 58  ? -94.653  39.150  -53.052 1.00 57.80  ? 190  ALA J CB    1 
ATOM   9637  N  N     . CYS R  3 59  ? -95.416  38.751  -56.081 1.00 58.96  ? 191  CYS J N     1 
ATOM   9638  C  CA    . CYS R  3 59  ? -95.954  39.284  -57.319 1.00 59.38  ? 191  CYS J CA    1 
ATOM   9639  C  C     . CYS R  3 59  ? -97.117  38.440  -57.826 1.00 60.27  ? 191  CYS J C     1 
ATOM   9640  O  O     . CYS R  3 59  ? -98.267  38.869  -57.744 1.00 60.08  ? 191  CYS J O     1 
ATOM   9641  C  CB    . CYS R  3 59  ? -94.848  39.367  -58.370 1.00 59.71  ? 191  CYS J CB    1 
ATOM   9642  S  SG    . CYS R  3 59  ? -93.586  40.613  -57.992 1.00 58.72  ? 191  CYS J SG    1 
ATOM   9643  N  N     . LYS R  3 60  ? -96.829  37.245  -58.338 1.00 61.33  ? 192  LYS J N     1 
ATOM   9644  C  CA    . LYS R  3 60  ? -97.888  36.362  -58.839 1.00 62.89  ? 192  LYS J CA    1 
ATOM   9645  C  C     . LYS R  3 60  ? -99.108  36.437  -57.920 1.00 63.18  ? 192  LYS J C     1 
ATOM   9646  O  O     . LYS R  3 60  ? -100.253 36.471  -58.378 1.00 63.30  ? 192  LYS J O     1 
ATOM   9647  C  CB    . LYS R  3 60  ? -97.402  34.913  -58.902 1.00 63.24  ? 192  LYS J CB    1 
ATOM   9648  C  CG    . LYS R  3 60  ? -98.379  33.969  -59.583 1.00 63.98  ? 192  LYS J CG    1 
ATOM   9649  C  CD    . LYS R  3 60  ? -98.605  34.391  -61.030 1.00 66.08  ? 192  LYS J CD    1 
ATOM   9650  C  CE    . LYS R  3 60  ? -99.455  33.383  -61.790 1.00 68.24  ? 192  LYS J CE    1 
ATOM   9651  N  NZ    . LYS R  3 60  ? -99.611  33.755  -63.231 1.00 68.34  ? 192  LYS J NZ    1 
ATOM   9652  N  N     . ALA R  3 61  ? -98.841  36.466  -56.617 1.00 62.76  ? 193  ALA J N     1 
ATOM   9653  C  CA    . ALA R  3 61  ? -99.883  36.551  -55.607 1.00 61.41  ? 193  ALA J CA    1 
ATOM   9654  C  C     . ALA R  3 61  ? -100.707 37.816  -55.811 1.00 60.57  ? 193  ALA J C     1 
ATOM   9655  O  O     . ALA R  3 61  ? -101.896 37.753  -56.111 1.00 60.55  ? 193  ALA J O     1 
ATOM   9656  C  CB    . ALA R  3 61  ? -99.252  36.561  -54.225 1.00 61.57  ? 193  ALA J CB    1 
ATOM   9657  N  N     . ILE R  3 62  ? -100.062 38.965  -55.650 1.00 59.57  ? 194  ILE J N     1 
ATOM   9658  C  CA    . ILE R  3 62  ? -100.728 40.247  -55.809 1.00 59.72  ? 194  ILE J CA    1 
ATOM   9659  C  C     . ILE R  3 62  ? -101.239 40.436  -57.238 1.00 60.44  ? 194  ILE J C     1 
ATOM   9660  O  O     . ILE R  3 62  ? -101.977 41.372  -57.535 1.00 60.65  ? 194  ILE J O     1 
ATOM   9661  C  CB    . ILE R  3 62  ? -99.768  41.391  -55.431 1.00 59.00  ? 194  ILE J CB    1 
ATOM   9662  C  CG1   . ILE R  3 62  ? -100.399 42.742  -55.745 1.00 59.30  ? 194  ILE J CG1   1 
ATOM   9663  C  CG2   . ILE R  3 62  ? -98.468  41.235  -56.165 1.00 59.54  ? 194  ILE J CG2   1 
ATOM   9664  C  CD1   . ILE R  3 62  ? -99.481  43.912  -55.469 1.00 60.61  ? 194  ILE J CD1   1 
ATOM   9665  N  N     . GLU R  3 63  ? -100.841 39.537  -58.125 1.00 61.70  ? 195  GLU J N     1 
ATOM   9666  C  CA    . GLU R  3 63  ? -101.269 39.592  -59.515 1.00 62.58  ? 195  GLU J CA    1 
ATOM   9667  C  C     . GLU R  3 63  ? -102.660 39.004  -59.544 1.00 61.33  ? 195  GLU J C     1 
ATOM   9668  O  O     . GLU R  3 63  ? -103.627 39.660  -59.913 1.00 61.11  ? 195  GLU J O     1 
ATOM   9669  C  CB    . GLU R  3 63  ? -100.336 38.747  -60.364 1.00 65.76  ? 195  GLU J CB    1 
ATOM   9670  C  CG    . GLU R  3 63  ? -100.731 38.613  -61.805 1.00 71.17  ? 195  GLU J CG    1 
ATOM   9671  C  CD    . GLU R  3 63  ? -99.820  37.647  -62.533 1.00 75.22  ? 195  GLU J CD    1 
ATOM   9672  O  OE1   . GLU R  3 63  ? -98.583  37.865  -62.506 1.00 76.11  ? 195  GLU J OE1   1 
ATOM   9673  O  OE2   . GLU R  3 63  ? -100.344 36.669  -63.120 1.00 77.73  ? 195  GLU J OE2   1 
ATOM   9674  N  N     . GLN R  3 64  ? -102.743 37.746  -59.143 1.00 60.48  ? 196  GLN J N     1 
ATOM   9675  C  CA    . GLN R  3 64  ? -104.010 37.057  -59.083 1.00 60.32  ? 196  GLN J CA    1 
ATOM   9676  C  C     . GLN R  3 64  ? -104.934 37.948  -58.275 1.00 60.12  ? 196  GLN J C     1 
ATOM   9677  O  O     . GLN R  3 64  ? -106.078 38.173  -58.645 1.00 61.12  ? 196  GLN J O     1 
ATOM   9678  C  CB    . GLN R  3 64  ? -103.850 35.731  -58.355 1.00 60.38  ? 196  GLN J CB    1 
ATOM   9679  C  CG    . GLN R  3 64  ? -102.652 34.925  -58.790 1.00 61.98  ? 196  GLN J CG    1 
ATOM   9680  C  CD    . GLN R  3 64  ? -102.525 33.624  -58.021 1.00 63.17  ? 196  GLN J CD    1 
ATOM   9681  O  OE1   . GLN R  3 64  ? -102.450 33.615  -56.787 1.00 62.67  ? 196  GLN J OE1   1 
ATOM   9682  N  NE2   . GLN R  3 64  ? -102.500 32.513  -58.748 1.00 63.76  ? 196  GLN J NE2   1 
ATOM   9683  N  N     . ALA R  3 65  ? -104.414 38.459  -57.167 1.00 59.88  ? 197  ALA J N     1 
ATOM   9684  C  CA    . ALA R  3 65  ? -105.180 39.317  -56.277 1.00 59.30  ? 197  ALA J CA    1 
ATOM   9685  C  C     . ALA R  3 65  ? -106.033 40.314  -57.038 1.00 58.99  ? 197  ALA J C     1 
ATOM   9686  O  O     . ALA R  3 65  ? -107.177 40.567  -56.675 1.00 59.91  ? 197  ALA J O     1 
ATOM   9687  C  CB    . ALA R  3 65  ? -104.247 40.051  -55.342 1.00 59.83  ? 197  ALA J CB    1 
ATOM   9688  N  N     . LYS R  3 66  ? -105.481 40.877  -58.100 1.00 58.14  ? 198  LYS J N     1 
ATOM   9689  C  CA    . LYS R  3 66  ? -106.224 41.848  -58.873 1.00 58.08  ? 198  LYS J CA    1 
ATOM   9690  C  C     . LYS R  3 66  ? -107.244 41.217  -59.799 1.00 58.37  ? 198  LYS J C     1 
ATOM   9691  O  O     . LYS R  3 66  ? -108.088 41.908  -60.358 1.00 58.51  ? 198  LYS J O     1 
ATOM   9692  C  CB    . LYS R  3 66  ? -105.266 42.722  -59.675 1.00 58.93  ? 198  LYS J CB    1 
ATOM   9693  C  CG    . LYS R  3 66  ? -104.484 43.708  -58.827 1.00 59.36  ? 198  LYS J CG    1 
ATOM   9694  C  CD    . LYS R  3 66  ? -103.635 44.612  -59.691 1.00 59.60  ? 198  LYS J CD    1 
ATOM   9695  C  CE    . LYS R  3 66  ? -102.970 45.684  -58.866 1.00 59.90  ? 198  LYS J CE    1 
ATOM   9696  N  NZ    . LYS R  3 66  ? -102.088 46.525  -59.720 1.00 61.95  ? 198  LYS J NZ    1 
ATOM   9697  N  N     . THR R  3 67  ? -107.180 39.904  -59.963 1.00 59.39  ? 199  THR J N     1 
ATOM   9698  C  CA    . THR R  3 67  ? -108.127 39.231  -60.839 1.00 61.78  ? 199  THR J CA    1 
ATOM   9699  C  C     . THR R  3 67  ? -109.370 38.777  -60.080 1.00 63.56  ? 199  THR J C     1 
ATOM   9700  O  O     . THR R  3 67  ? -110.333 38.323  -60.683 1.00 63.59  ? 199  THR J O     1 
ATOM   9701  C  CB    . THR R  3 67  ? -107.501 38.008  -61.510 1.00 61.66  ? 199  THR J CB    1 
ATOM   9702  O  OG1   . THR R  3 67  ? -107.559 36.894  -60.612 1.00 62.84  ? 199  THR J OG1   1 
ATOM   9703  C  CG2   . THR R  3 67  ? -106.052 38.285  -61.870 1.00 62.04  ? 199  THR J CG2   1 
ATOM   9704  N  N     . GLN R  3 68  ? -109.338 38.877  -58.756 1.00 66.31  ? 200  GLN J N     1 
ATOM   9705  C  CA    . GLN R  3 68  ? -110.482 38.505  -57.929 1.00 69.65  ? 200  GLN J CA    1 
ATOM   9706  C  C     . GLN R  3 68  ? -111.044 39.823  -57.427 1.00 72.68  ? 200  GLN J C     1 
ATOM   9707  O  O     . GLN R  3 68  ? -111.982 39.872  -56.621 1.00 73.48  ? 200  GLN J O     1 
ATOM   9708  C  CB    . GLN R  3 68  ? -110.037 37.660  -56.739 1.00 69.73  ? 200  GLN J CB    1 
ATOM   9709  C  CG    . GLN R  3 68  ? -109.198 36.469  -57.112 1.00 71.72  ? 200  GLN J CG    1 
ATOM   9710  C  CD    . GLN R  3 68  ? -109.886 35.580  -58.117 1.00 73.80  ? 200  GLN J CD    1 
ATOM   9711  O  OE1   . GLN R  3 68  ? -110.095 34.394  -57.867 1.00 75.62  ? 200  GLN J OE1   1 
ATOM   9712  N  NE2   . GLN R  3 68  ? -110.245 36.147  -59.267 1.00 73.60  ? 200  GLN J NE2   1 
ATOM   9713  N  N     . ASN R  3 69  ? -110.448 40.893  -57.938 1.00 75.38  ? 201  ASN J N     1 
ATOM   9714  C  CA    . ASN R  3 69  ? -110.804 42.255  -57.576 1.00 77.62  ? 201  ASN J CA    1 
ATOM   9715  C  C     . ASN R  3 69  ? -110.578 42.457  -56.090 1.00 78.19  ? 201  ASN J C     1 
ATOM   9716  O  O     . ASN R  3 69  ? -111.362 43.134  -55.417 1.00 78.98  ? 201  ASN J O     1 
ATOM   9717  C  CB    . ASN R  3 69  ? -112.263 42.578  -57.920 1.00 78.36  ? 201  ASN J CB    1 
ATOM   9718  C  CG    . ASN R  3 69  ? -112.576 44.067  -57.770 1.00 79.20  ? 201  ASN J CG    1 
ATOM   9719  O  OD1   . ASN R  3 69  ? -113.724 44.487  -57.891 1.00 80.41  ? 201  ASN J OD1   1 
ATOM   9720  N  ND2   . ASN R  3 69  ? -111.545 44.871  -57.509 1.00 78.83  ? 201  ASN J ND2   1 
ATOM   9721  N  N     . ILE R  3 70  ? -109.515 41.851  -55.572 1.00 77.99  ? 202  ILE J N     1 
ATOM   9722  C  CA    . ILE R  3 70  ? -109.205 42.016  -54.164 1.00 78.61  ? 202  ILE J CA    1 
ATOM   9723  C  C     . ILE R  3 70  ? -108.486 43.372  -54.070 1.00 77.97  ? 202  ILE J C     1 
ATOM   9724  O  O     . ILE R  3 70  ? -107.441 43.599  -54.686 1.00 78.18  ? 202  ILE J O     1 
ATOM   9725  C  CB    . ILE R  3 70  ? -108.341 40.820  -53.619 1.00 79.10  ? 202  ILE J CB    1 
ATOM   9726  C  CG1   . ILE R  3 70  ? -108.808 40.455  -52.204 1.00 78.88  ? 202  ILE J CG1   1 
ATOM   9727  C  CG2   . ILE R  3 70  ? -106.853 41.160  -53.617 1.00 79.96  ? 202  ILE J CG2   1 
ATOM   9728  C  CD1   . ILE R  3 70  ? -108.872 41.627  -51.229 1.00 78.94  ? 202  ILE J CD1   1 
ATOM   9729  N  N     . ASN R  3 71  ? -109.088 44.289  -53.329 1.00 76.65  ? 203  ASN J N     1 
ATOM   9730  C  CA    . ASN R  3 71  ? -108.539 45.623  -53.186 1.00 75.25  ? 203  ASN J CA    1 
ATOM   9731  C  C     . ASN R  3 71  ? -107.633 45.719  -51.982 1.00 73.61  ? 203  ASN J C     1 
ATOM   9732  O  O     . ASN R  3 71  ? -106.857 46.667  -51.862 1.00 73.88  ? 203  ASN J O     1 
ATOM   9733  C  CB    . ASN R  3 71  ? -109.678 46.633  -53.043 1.00 76.67  ? 203  ASN J CB    1 
ATOM   9734  C  CG    . ASN R  3 71  ? -110.648 46.268  -51.916 1.00 78.53  ? 203  ASN J CG    1 
ATOM   9735  O  OD1   . ASN R  3 71  ? -110.458 45.269  -51.207 1.00 78.69  ? 203  ASN J OD1   1 
ATOM   9736  N  ND2   . ASN R  3 71  ? -111.693 47.078  -51.751 1.00 78.75  ? 203  ASN J ND2   1 
ATOM   9737  N  N     . LYS R  3 72  ? -107.724 44.740  -51.090 1.00 71.10  ? 204  LYS J N     1 
ATOM   9738  C  CA    . LYS R  3 72  ? -106.917 44.773  -49.881 1.00 69.43  ? 204  LYS J CA    1 
ATOM   9739  C  C     . LYS R  3 72  ? -106.662 43.392  -49.318 1.00 67.63  ? 204  LYS J C     1 
ATOM   9740  O  O     . LYS R  3 72  ? -107.561 42.763  -48.775 1.00 67.39  ? 204  LYS J O     1 
ATOM   9741  C  CB    . LYS R  3 72  ? -107.618 45.639  -48.833 1.00 70.56  ? 204  LYS J CB    1 
ATOM   9742  C  CG    . LYS R  3 72  ? -109.068 45.239  -48.581 1.00 71.30  ? 204  LYS J CG    1 
ATOM   9743  C  CD    . LYS R  3 72  ? -109.827 46.262  -47.732 1.00 71.94  ? 204  LYS J CD    1 
ATOM   9744  C  CE    . LYS R  3 72  ? -110.262 47.483  -48.540 1.00 72.11  ? 204  LYS J CE    1 
ATOM   9745  N  NZ    . LYS R  3 72  ? -111.226 48.344  -47.783 1.00 70.32  ? 204  LYS J NZ    1 
ATOM   9746  N  N     . LEU R  3 73  ? -105.428 42.921  -49.437 1.00 66.06  ? 205  LEU J N     1 
ATOM   9747  C  CA    . LEU R  3 73  ? -105.101 41.600  -48.925 1.00 63.84  ? 205  LEU J CA    1 
ATOM   9748  C  C     . LEU R  3 73  ? -103.954 41.639  -47.942 1.00 62.02  ? 205  LEU J C     1 
ATOM   9749  O  O     . LEU R  3 73  ? -103.177 42.590  -47.899 1.00 61.28  ? 205  LEU J O     1 
ATOM   9750  C  CB    . LEU R  3 73  ? -104.719 40.650  -50.058 1.00 63.51  ? 205  LEU J CB    1 
ATOM   9751  C  CG    . LEU R  3 73  ? -103.227 40.644  -50.396 1.00 63.13  ? 205  LEU J CG    1 
ATOM   9752  C  CD1   . LEU R  3 73  ? -102.929 39.493  -51.333 1.00 63.67  ? 205  LEU J CD1   1 
ATOM   9753  C  CD2   . LEU R  3 73  ? -102.824 41.979  -51.007 1.00 63.48  ? 205  LEU J CD2   1 
ATOM   9754  N  N     . VAL R  3 74  ? -103.862 40.575  -47.162 1.00 60.21  ? 206  VAL J N     1 
ATOM   9755  C  CA    . VAL R  3 74  ? -102.817 40.420  -46.178 1.00 59.44  ? 206  VAL J CA    1 
ATOM   9756  C  C     . VAL R  3 74  ? -101.900 39.349  -46.747 1.00 59.64  ? 206  VAL J C     1 
ATOM   9757  O  O     . VAL R  3 74  ? -102.358 38.256  -47.080 1.00 60.21  ? 206  VAL J O     1 
ATOM   9758  C  CB    . VAL R  3 74  ? -103.414 39.970  -44.829 1.00 59.14  ? 206  VAL J CB    1 
ATOM   9759  C  CG1   . VAL R  3 74  ? -102.335 39.444  -43.909 1.00 58.59  ? 206  VAL J CG1   1 
ATOM   9760  C  CG2   . VAL R  3 74  ? -104.106 41.140  -44.175 1.00 59.21  ? 206  VAL J CG2   1 
ATOM   9761  N  N     . LEU R  3 75  ? -100.610 39.664  -46.863 1.00 59.43  ? 207  LEU J N     1 
ATOM   9762  C  CA    . LEU R  3 75  ? -99.632  38.727  -47.417 1.00 58.35  ? 207  LEU J CA    1 
ATOM   9763  C  C     . LEU R  3 75  ? -98.606  38.211  -46.403 1.00 57.67  ? 207  LEU J C     1 
ATOM   9764  O  O     . LEU R  3 75  ? -97.771  38.964  -45.901 1.00 55.53  ? 207  LEU J O     1 
ATOM   9765  C  CB    . LEU R  3 75  ? -98.919  39.391  -48.594 1.00 58.07  ? 207  LEU J CB    1 
ATOM   9766  C  CG    . LEU R  3 75  ? -98.262  38.462  -49.606 1.00 57.65  ? 207  LEU J CG    1 
ATOM   9767  C  CD1   . LEU R  3 75  ? -98.032  39.215  -50.903 1.00 57.17  ? 207  LEU J CD1   1 
ATOM   9768  C  CD2   . LEU R  3 75  ? -96.965  37.911  -49.033 1.00 58.27  ? 207  LEU J CD2   1 
ATOM   9769  N  N     . TYR R  3 76  ? -98.686  36.916  -46.115 1.00 58.74  ? 208  TYR J N     1 
ATOM   9770  C  CA    . TYR R  3 76  ? -97.788  36.254  -45.170 1.00 60.81  ? 208  TYR J CA    1 
ATOM   9771  C  C     . TYR R  3 76  ? -96.585  35.681  -45.892 1.00 61.81  ? 208  TYR J C     1 
ATOM   9772  O  O     . TYR R  3 76  ? -96.728  34.860  -46.801 1.00 62.67  ? 208  TYR J O     1 
ATOM   9773  C  CB    . TYR R  3 76  ? -98.512  35.113  -44.459 1.00 61.75  ? 208  TYR J CB    1 
ATOM   9774  C  CG    . TYR R  3 76  ? -99.370  35.542  -43.300 1.00 62.48  ? 208  TYR J CG    1 
ATOM   9775  C  CD1   . TYR R  3 76  ? -100.216 36.640  -43.406 1.00 62.63  ? 208  TYR J CD1   1 
ATOM   9776  C  CD2   . TYR R  3 76  ? -99.325  34.854  -42.090 1.00 62.55  ? 208  TYR J CD2   1 
ATOM   9777  C  CE1   . TYR R  3 76  ? -100.985 37.046  -42.346 1.00 63.41  ? 208  TYR J CE1   1 
ATOM   9778  C  CE2   . TYR R  3 76  ? -100.092 35.251  -41.022 1.00 64.01  ? 208  TYR J CE2   1 
ATOM   9779  C  CZ    . TYR R  3 76  ? -100.920 36.353  -41.156 1.00 64.64  ? 208  TYR J CZ    1 
ATOM   9780  O  OH    . TYR R  3 76  ? -101.673 36.777  -40.088 1.00 67.36  ? 208  TYR J OH    1 
ATOM   9781  N  N     . THR R  3 77  ? -95.398  36.107  -45.483 1.00 62.11  ? 209  THR J N     1 
ATOM   9782  C  CA    . THR R  3 77  ? -94.172  35.625  -46.106 1.00 62.24  ? 209  THR J CA    1 
ATOM   9783  C  C     . THR R  3 77  ? -93.012  35.731  -45.127 1.00 61.28  ? 209  THR J C     1 
ATOM   9784  O  O     . THR R  3 77  ? -92.948  36.655  -44.308 1.00 60.94  ? 209  THR J O     1 
ATOM   9785  C  CB    . THR R  3 77  ? -93.832  36.416  -47.416 1.00 62.85  ? 209  THR J CB    1 
ATOM   9786  O  OG1   . THR R  3 77  ? -92.764  35.753  -48.107 1.00 64.69  ? 209  THR J OG1   1 
ATOM   9787  C  CG2   . THR R  3 77  ? -93.404  37.853  -47.107 1.00 61.34  ? 209  THR J CG2   1 
ATOM   9788  N  N     . ASN R  3 78  ? -92.101  34.773  -45.214 1.00 59.51  ? 210  ASN J N     1 
ATOM   9789  C  CA    . ASN R  3 78  ? -90.953  34.746  -44.333 1.00 58.35  ? 210  ASN J CA    1 
ATOM   9790  C  C     . ASN R  3 78  ? -89.755  35.481  -44.922 1.00 57.64  ? 210  ASN J C     1 
ATOM   9791  O  O     . ASN R  3 78  ? -88.631  35.284  -44.475 1.00 58.21  ? 210  ASN J O     1 
ATOM   9792  C  CB    . ASN R  3 78  ? -90.592  33.294  -44.025 1.00 58.04  ? 210  ASN J CB    1 
ATOM   9793  C  CG    . ASN R  3 78  ? -91.109  32.338  -45.079 1.00 58.97  ? 210  ASN J CG    1 
ATOM   9794  O  OD1   . ASN R  3 78  ? -92.300  32.018  -45.113 1.00 58.55  ? 210  ASN J OD1   1 
ATOM   9795  N  ND2   . ASN R  3 78  ? -90.219  31.888  -45.959 1.00 58.63  ? 210  ASN J ND2   1 
ATOM   9796  N  N     . SER R  3 79  ? -89.992  36.343  -45.907 1.00 56.62  ? 211  SER J N     1 
ATOM   9797  C  CA    . SER R  3 79  ? -88.900  37.083  -46.540 1.00 55.81  ? 211  SER J CA    1 
ATOM   9798  C  C     . SER R  3 79  ? -88.766  38.522  -46.067 1.00 56.44  ? 211  SER J C     1 
ATOM   9799  O  O     . SER R  3 79  ? -89.199  39.438  -46.763 1.00 56.82  ? 211  SER J O     1 
ATOM   9800  C  CB    . SER R  3 79  ? -89.078  37.088  -48.054 1.00 54.43  ? 211  SER J CB    1 
ATOM   9801  O  OG    . SER R  3 79  ? -88.040  37.813  -48.683 1.00 52.81  ? 211  SER J OG    1 
ATOM   9802  N  N     . MET R  3 80  ? -88.154  38.728  -44.902 1.00 57.21  ? 212  MET J N     1 
ATOM   9803  C  CA    . MET R  3 80  ? -87.983  40.079  -44.366 1.00 57.29  ? 212  MET J CA    1 
ATOM   9804  C  C     . MET R  3 80  ? -87.426  41.016  -45.426 1.00 56.56  ? 212  MET J C     1 
ATOM   9805  O  O     . MET R  3 80  ? -87.853  42.166  -45.531 1.00 55.50  ? 212  MET J O     1 
ATOM   9806  C  CB    . MET R  3 80  ? -87.059  40.062  -43.150 1.00 58.80  ? 212  MET J CB    1 
ATOM   9807  C  CG    . MET R  3 80  ? -87.740  40.507  -41.856 1.00 62.02  ? 212  MET J CG    1 
ATOM   9808  S  SD    . MET R  3 80  ? -88.159  42.276  -41.788 1.00 67.32  ? 212  MET J SD    1 
ATOM   9809  C  CE    . MET R  3 80  ? -89.814  42.318  -42.535 1.00 65.35  ? 212  MET J CE    1 
ATOM   9810  N  N     . PHE R  3 81  ? -86.484  40.501  -46.213 1.00 56.00  ? 213  PHE J N     1 
ATOM   9811  C  CA    . PHE R  3 81  ? -85.843  41.253  -47.292 1.00 55.07  ? 213  PHE J CA    1 
ATOM   9812  C  C     . PHE R  3 81  ? -86.879  41.856  -48.233 1.00 54.80  ? 213  PHE J C     1 
ATOM   9813  O  O     . PHE R  3 81  ? -86.837  43.046  -48.541 1.00 55.25  ? 213  PHE J O     1 
ATOM   9814  C  CB    . PHE R  3 81  ? -84.915  40.330  -48.088 1.00 54.38  ? 213  PHE J CB    1 
ATOM   9815  C  CG    . PHE R  3 81  ? -84.290  40.975  -49.300 1.00 54.03  ? 213  PHE J CG    1 
ATOM   9816  C  CD1   . PHE R  3 81  ? -83.232  41.869  -49.169 1.00 53.61  ? 213  PHE J CD1   1 
ATOM   9817  C  CD2   . PHE R  3 81  ? -84.750  40.668  -50.582 1.00 54.17  ? 213  PHE J CD2   1 
ATOM   9818  C  CE1   . PHE R  3 81  ? -82.636  42.445  -50.298 1.00 52.47  ? 213  PHE J CE1   1 
ATOM   9819  C  CE2   . PHE R  3 81  ? -84.163  41.239  -51.713 1.00 53.07  ? 213  PHE J CE2   1 
ATOM   9820  C  CZ    . PHE R  3 81  ? -83.102  42.130  -51.567 1.00 52.39  ? 213  PHE J CZ    1 
ATOM   9821  N  N     . THR R  3 82  ? -87.809  41.031  -48.695 1.00 54.37  ? 214  THR J N     1 
ATOM   9822  C  CA    . THR R  3 82  ? -88.835  41.516  -49.601 1.00 53.48  ? 214  THR J CA    1 
ATOM   9823  C  C     . THR R  3 82  ? -89.594  42.631  -48.909 1.00 53.31  ? 214  THR J C     1 
ATOM   9824  O  O     . THR R  3 82  ? -89.523  43.781  -49.329 1.00 53.27  ? 214  THR J O     1 
ATOM   9825  C  CB    . THR R  3 82  ? -89.834  40.407  -49.997 1.00 52.60  ? 214  THR J CB    1 
ATOM   9826  O  OG1   . THR R  3 82  ? -89.125  39.251  -50.464 1.00 51.64  ? 214  THR J OG1   1 
ATOM   9827  C  CG2   . THR R  3 82  ? -90.736  40.897  -51.107 1.00 52.04  ? 214  THR J CG2   1 
ATOM   9828  N  N     . ILE R  3 83  ? -90.299  42.281  -47.836 1.00 53.86  ? 215  ILE J N     1 
ATOM   9829  C  CA    . ILE R  3 83  ? -91.092  43.239  -47.070 1.00 55.13  ? 215  ILE J CA    1 
ATOM   9830  C  C     . ILE R  3 83  ? -90.319  44.523  -46.774 1.00 56.54  ? 215  ILE J C     1 
ATOM   9831  O  O     . ILE R  3 83  ? -90.753  45.619  -47.151 1.00 56.28  ? 215  ILE J O     1 
ATOM   9832  C  CB    . ILE R  3 83  ? -91.576  42.620  -45.741 1.00 54.37  ? 215  ILE J CB    1 
ATOM   9833  C  CG1   . ILE R  3 83  ? -92.460  41.406  -46.030 0.00 54.63  ? 215  ILE J CG1   1 
ATOM   9834  C  CG2   . ILE R  3 83  ? -92.342  43.657  -44.929 0.00 54.65  ? 215  ILE J CG2   1 
ATOM   9835  C  CD1   . ILE R  3 83  ? -92.985  40.714  -44.792 0.00 54.53  ? 215  ILE J CD1   1 
ATOM   9836  N  N     . ASN R  3 84  ? -89.176  44.392  -46.102 1.00 57.94  ? 216  ASN J N     1 
ATOM   9837  C  CA    . ASN R  3 84  ? -88.347  45.558  -45.780 1.00 58.29  ? 216  ASN J CA    1 
ATOM   9838  C  C     . ASN R  3 84  ? -87.917  46.252  -47.074 1.00 57.41  ? 216  ASN J C     1 
ATOM   9839  O  O     . ASN R  3 84  ? -87.356  47.342  -47.048 1.00 57.88  ? 216  ASN J O     1 
ATOM   9840  C  CB    . ASN R  3 84  ? -87.107  45.139  -44.964 1.00 58.14  ? 216  ASN J CB    1 
ATOM   9841  C  CG    . ASN R  3 84  ? -87.175  45.586  -43.492 1.00 59.01  ? 216  ASN J CG    1 
ATOM   9842  O  OD1   . ASN R  3 84  ? -86.385  45.134  -42.660 1.00 58.48  ? 216  ASN J OD1   1 
ATOM   9843  N  ND2   . ASN R  3 84  ? -88.112  46.483  -43.177 1.00 60.55  ? 216  ASN J ND2   1 
ATOM   9844  N  N     . GLY R  3 85  ? -88.200  45.622  -48.207 1.00 56.53  ? 217  GLY J N     1 
ATOM   9845  C  CA    . GLY R  3 85  ? -87.829  46.208  -49.474 1.00 56.30  ? 217  GLY J CA    1 
ATOM   9846  C  C     . GLY R  3 85  ? -88.925  47.037  -50.110 1.00 57.01  ? 217  GLY J C     1 
ATOM   9847  O  O     . GLY R  3 85  ? -88.677  48.153  -50.564 1.00 56.91  ? 217  GLY J O     1 
ATOM   9848  N  N     . ILE R  3 86  ? -90.142  46.502  -50.127 1.00 58.06  ? 218  ILE J N     1 
ATOM   9849  C  CA    . ILE R  3 86  ? -91.288  47.173  -50.748 1.00 58.45  ? 218  ILE J CA    1 
ATOM   9850  C  C     . ILE R  3 86  ? -92.028  48.153  -49.825 1.00 59.37  ? 218  ILE J C     1 
ATOM   9851  O  O     . ILE R  3 86  ? -92.966  48.841  -50.245 1.00 58.64  ? 218  ILE J O     1 
ATOM   9852  C  CB    . ILE R  3 86  ? -92.293  46.116  -51.284 1.00 56.83  ? 218  ILE J CB    1 
ATOM   9853  C  CG1   . ILE R  3 86  ? -93.287  46.771  -52.240 1.00 56.55  ? 218  ILE J CG1   1 
ATOM   9854  C  CG2   . ILE R  3 86  ? -93.019  45.456  -50.128 1.00 55.54  ? 218  ILE J CG2   1 
ATOM   9855  C  CD1   . ILE R  3 86  ? -92.648  47.359  -53.480 1.00 54.99  ? 218  ILE J CD1   1 
ATOM   9856  N  N     . THR R  3 87  ? -91.583  48.225  -48.574 1.00 60.46  ? 219  THR J N     1 
ATOM   9857  C  CA    . THR R  3 87  ? -92.194  49.100  -47.579 1.00 61.02  ? 219  THR J CA    1 
ATOM   9858  C  C     . THR R  3 87  ? -91.244  50.174  -47.058 1.00 62.39  ? 219  THR J C     1 
ATOM   9859  O  O     . THR R  3 87  ? -91.675  51.114  -46.382 1.00 62.89  ? 219  THR J O     1 
ATOM   9860  C  CB    . THR R  3 87  ? -92.645  48.291  -46.377 1.00 60.24  ? 219  THR J CB    1 
ATOM   9861  O  OG1   . THR R  3 87  ? -91.518  47.578  -45.847 1.00 58.63  ? 219  THR J OG1   1 
ATOM   9862  C  CG2   . THR R  3 87  ? -93.723  47.305  -46.778 1.00 60.87  ? 219  THR J CG2   1 
ATOM   9863  N  N     . ASN R  3 88  ? -89.956  50.026  -47.366 1.00 63.24  ? 220  ASN J N     1 
ATOM   9864  C  CA    . ASN R  3 88  ? -88.943  50.9