data_2QLR
# 
_entry.id   2QLR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QLR         
RCSB  RCSB043757   
WWPDB D_1000043757 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2QLR 
_pdbx_database_status.recvd_initial_deposition_date   2007-07-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Han, Q.'      1 
'Robinson, R.' 2 
'Li, J.'       3 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Kynurenine Aminotransferase II' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                3567 
_citation.page_last                 3573 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18056995 
_citation.pdbx_database_id_DOI      10.1074/jbc.M708358200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Han, Q.'      1 
primary 'Robinson, H.' 2 
primary 'Li, J.'       3 
# 
_cell.entry_id           2QLR 
_cell.length_a           109.505 
_cell.length_b           70.975 
_cell.length_c           121.133 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.10 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QLR 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kynurenine/alpha-aminoadipate aminotransferase mitochondrial' 47628.551 4   '2.6.1.7, 2.6.1.39' ? ? ? 
2 non-polymer syn GLYCEROL                                                       92.094    12  ?                   ? ? ? 
3 water       nat water                                                          18.015    714 ?                   ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;KAT/AadAT, Kynurenine--oxoglutarate transaminase II, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, 2-aminoadipate transaminase, 2- aminoadipate aminotransferase, Alpha-aminoadipate aminotransferase, AadAT
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFS(LLP)IISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFM
AHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSP
YLRASFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   ALA n 
1 5   ARG n 
1 6   PHE n 
1 7   ILE n 
1 8   THR n 
1 9   ALA n 
1 10  ALA n 
1 11  SER n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  PRO n 
1 19  ILE n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  THR n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  SER n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  SER n 
1 33  MET n 
1 34  ILE n 
1 35  SER n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  GLY n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  PRO n 
1 44  ASN n 
1 45  MET n 
1 46  PHE n 
1 47  PRO n 
1 48  PHE n 
1 49  LYS n 
1 50  THR n 
1 51  ALA n 
1 52  VAL n 
1 53  ILE n 
1 54  THR n 
1 55  VAL n 
1 56  GLU n 
1 57  ASN n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  ILE n 
1 62  GLN n 
1 63  PHE n 
1 64  GLY n 
1 65  GLU n 
1 66  GLU n 
1 67  MET n 
1 68  MET n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  LEU n 
1 73  GLN n 
1 74  TYR n 
1 75  SER n 
1 76  PRO n 
1 77  SER n 
1 78  ALA n 
1 79  GLY n 
1 80  ILE n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  LYS n 
1 89  GLN n 
1 90  LEU n 
1 91  GLN n 
1 92  ILE n 
1 93  LYS n 
1 94  LEU n 
1 95  HIS n 
1 96  ASN n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 TYR n 
1 103 PRO n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLY n 
1 108 GLN n 
1 109 MET n 
1 110 ASP n 
1 111 LEU n 
1 112 CYS n 
1 113 VAL n 
1 114 THR n 
1 115 SER n 
1 116 GLY n 
1 117 SER n 
1 118 GLN n 
1 119 GLN n 
1 120 GLY n 
1 121 LEU n 
1 122 CYS n 
1 123 LYS n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 MET n 
1 128 ILE n 
1 129 ILE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLY n 
1 133 ASP n 
1 134 ASN n 
1 135 VAL n 
1 136 LEU n 
1 137 LEU n 
1 138 ASP n 
1 139 GLU n 
1 140 PRO n 
1 141 ALA n 
1 142 TYR n 
1 143 SER n 
1 144 GLY n 
1 145 THR n 
1 146 LEU n 
1 147 GLN n 
1 148 SER n 
1 149 LEU n 
1 150 HIS n 
1 151 PRO n 
1 152 LEU n 
1 153 GLY n 
1 154 CYS n 
1 155 ASN n 
1 156 ILE n 
1 157 ILE n 
1 158 ASN n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 GLU n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 ASP n 
1 170 SER n 
1 171 LEU n 
1 172 ARG n 
1 173 ASP n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ARG n 
1 178 TRP n 
1 179 LYS n 
1 180 PRO n 
1 181 GLU n 
1 182 ASP n 
1 183 ALA n 
1 184 LYS n 
1 185 ASN n 
1 186 PRO n 
1 187 GLN n 
1 188 LYS n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 PHE n 
1 194 LEU n 
1 195 TYR n 
1 196 THR n 
1 197 VAL n 
1 198 PRO n 
1 199 ASN n 
1 200 GLY n 
1 201 ASN n 
1 202 ASN n 
1 203 PRO n 
1 204 THR n 
1 205 GLY n 
1 206 ASN n 
1 207 SER n 
1 208 LEU n 
1 209 THR n 
1 210 SER n 
1 211 GLU n 
1 212 ARG n 
1 213 LYS n 
1 214 LYS n 
1 215 GLU n 
1 216 ILE n 
1 217 TYR n 
1 218 GLU n 
1 219 LEU n 
1 220 ALA n 
1 221 ARG n 
1 222 LYS n 
1 223 TYR n 
1 224 ASP n 
1 225 PHE n 
1 226 LEU n 
1 227 ILE n 
1 228 ILE n 
1 229 GLU n 
1 230 ASP n 
1 231 ASP n 
1 232 PRO n 
1 233 TYR n 
1 234 TYR n 
1 235 PHE n 
1 236 LEU n 
1 237 GLN n 
1 238 PHE n 
1 239 ASN n 
1 240 LYS n 
1 241 PHE n 
1 242 ARG n 
1 243 VAL n 
1 244 PRO n 
1 245 THR n 
1 246 PHE n 
1 247 LEU n 
1 248 SER n 
1 249 MET n 
1 250 ASP n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ARG n 
1 255 VAL n 
1 256 ILE n 
1 257 ARG n 
1 258 ALA n 
1 259 ASP n 
1 260 SER n 
1 261 PHE n 
1 262 SER n 
1 263 LLP n 
1 264 ILE n 
1 265 ILE n 
1 266 SER n 
1 267 SER n 
1 268 GLY n 
1 269 LEU n 
1 270 ARG n 
1 271 ILE n 
1 272 GLY n 
1 273 PHE n 
1 274 LEU n 
1 275 THR n 
1 276 GLY n 
1 277 PRO n 
1 278 LYS n 
1 279 PRO n 
1 280 LEU n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 LEU n 
1 287 HIS n 
1 288 ILE n 
1 289 GLN n 
1 290 VAL n 
1 291 SER n 
1 292 THR n 
1 293 LEU n 
1 294 HIS n 
1 295 PRO n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 ASN n 
1 300 GLN n 
1 301 LEU n 
1 302 MET n 
1 303 ILE n 
1 304 SER n 
1 305 GLN n 
1 306 LEU n 
1 307 LEU n 
1 308 HIS n 
1 309 GLU n 
1 310 TRP n 
1 311 GLY n 
1 312 GLU n 
1 313 GLU n 
1 314 GLY n 
1 315 PHE n 
1 316 MET n 
1 317 ALA n 
1 318 HIS n 
1 319 VAL n 
1 320 ASP n 
1 321 ARG n 
1 322 VAL n 
1 323 ILE n 
1 324 ASP n 
1 325 PHE n 
1 326 TYR n 
1 327 SER n 
1 328 ASN n 
1 329 GLN n 
1 330 LYS n 
1 331 ASP n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 ALA n 
1 337 ALA n 
1 338 ASP n 
1 339 LYS n 
1 340 TRP n 
1 341 LEU n 
1 342 THR n 
1 343 GLY n 
1 344 LEU n 
1 345 ALA n 
1 346 GLU n 
1 347 TRP n 
1 348 HIS n 
1 349 VAL n 
1 350 PRO n 
1 351 ALA n 
1 352 ALA n 
1 353 GLY n 
1 354 MET n 
1 355 PHE n 
1 356 LEU n 
1 357 TRP n 
1 358 ILE n 
1 359 LYS n 
1 360 VAL n 
1 361 LYS n 
1 362 GLY n 
1 363 ILE n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 ILE n 
1 371 GLU n 
1 372 GLU n 
1 373 LYS n 
1 374 ALA n 
1 375 VAL n 
1 376 LYS n 
1 377 MET n 
1 378 GLY n 
1 379 VAL n 
1 380 LEU n 
1 381 MET n 
1 382 LEU n 
1 383 PRO n 
1 384 GLY n 
1 385 ASN n 
1 386 ALA n 
1 387 PHE n 
1 388 TYR n 
1 389 VAL n 
1 390 ASP n 
1 391 SER n 
1 392 SER n 
1 393 ALA n 
1 394 PRO n 
1 395 SER n 
1 396 PRO n 
1 397 TYR n 
1 398 LEU n 
1 399 ARG n 
1 400 ALA n 
1 401 SER n 
1 402 PHE n 
1 403 SER n 
1 404 SER n 
1 405 ALA n 
1 406 SER n 
1 407 PRO n 
1 408 GLU n 
1 409 GLN n 
1 410 MET n 
1 411 ASP n 
1 412 VAL n 
1 413 ALA n 
1 414 PHE n 
1 415 GLN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 GLN n 
1 420 LEU n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'AADAT, KAT2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTYB 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AADAT_HUMAN 
_struct_ref.pdbx_db_accession          Q8N5Z0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGI
PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVA
SDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVD
RVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRA
SFSSASPEQMDVAFQVLAQLIKESL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2QLR A 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
2 1 2QLR B 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
3 1 2QLR C 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
4 1 2QLR D 1 ? 425 ? Q8N5Z0 1 ? 425 ? 1 425 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
?                                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
?                                      'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                                      'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                                                                                
'GLYCERIN; PROPANE-1,2,3-TRIOL'        'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                   
?                                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                                      'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                                      'C6 H13 N O2'     131.173 
LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' 
"N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                                      'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                                      'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                                      'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
?                                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                                      'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2QLR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '100 mM HEPES, 15% PEG 10000, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-06-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0809 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0809 
# 
_reflns.entry_id                     2QLR 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.15 
_reflns.d_resolution_low             30.11 
_reflns.number_all                   ? 
_reflns.number_obs                   96642 
_reflns.percent_possible_obs         92.2 
_reflns.pdbx_Rmerge_I_obs            0.119 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   75.8 
_reflns_shell.Rmerge_I_obs           0.422 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2QLR 
_refine.ls_number_reflns_obs                     74517 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.11 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    96.35 
_refine.ls_R_factor_obs                          0.24295 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24228 
_refine.ls_R_factor_R_free                       0.25601 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3883 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.928 
_refine.correlation_coeff_Fo_to_Fc_free          0.927 
_refine.B_iso_mean                               37.588 
_refine.aniso_B[1][1]                            -0.57 
_refine.aniso_B[2][2]                            0.34 
_refine.aniso_B[3][3]                            0.29 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.15 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1X0M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.250 
_refine.pdbx_overall_ESU_R_Free                  0.264 
_refine.overall_SU_ML                            0.136 
_refine.overall_SU_B                             5.227 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13390 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             714 
_refine_hist.number_atoms_total               14176 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        30.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.022 ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.982 ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.00  ? ? ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 25.58 ? ? ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.2   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.359 
_refine_ls_shell.number_reflns_R_work             5608 
_refine_ls_shell.R_factor_R_work                  0.207 
_refine_ls_shell.percent_reflns_obs               99.68 
_refine_ls_shell.R_factor_R_free                  0.219 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             296 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2QLR 
_struct.title                     'Crystal structure of human kynurenine aminotransferase II' 
_struct.pdbx_descriptor           'Kynurenine/alpha-aminoadipate aminotransferase mitochondrial (E.C.2.6.1.7, 2.6.1.39)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QLR 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;ALPHA & BETA PROTEIN, PLP-DEPENDENT TRANSFERASE, Aminotransferase, Mitochondrion, Multifunctional enzyme, Pyridoxal phosphate, Transit peptide, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 2   ? ILE A 7   ? ASN A 2   ILE A 7   5 ? 6  
HELX_P HELX_P2  2  THR A 8   ? ALA A 13  ? THR A 8   ALA A 13  1 ? 6  
HELX_P HELX_P3  3  ASN A 42  ? PHE A 46  ? ASN A 42  PHE A 46  5 ? 5  
HELX_P HELX_P4  4  GLY A 64  ? LEU A 72  ? GLY A 64  LEU A 72  1 ? 9  
HELX_P HELX_P5  5  ILE A 80  ? ASN A 96  ? ILE A 80  ASN A 96  1 ? 17 
HELX_P HELX_P6  6  PRO A 103 ? GLY A 107 ? PRO A 103 GLY A 107 5 ? 5  
HELX_P HELX_P7  7  GLY A 116 ? ILE A 129 ? GLY A 116 ILE A 129 1 ? 14 
HELX_P HELX_P8  8  TYR A 142 ? HIS A 150 ? TYR A 142 HIS A 150 1 ? 9  
HELX_P HELX_P9  9  PRO A 151 ? GLY A 153 ? PRO A 151 GLY A 153 5 ? 3  
HELX_P HELX_P10 10 VAL A 167 ? SER A 176 ? VAL A 167 SER A 176 1 ? 10 
HELX_P HELX_P11 11 GLU A 181 ? ASN A 189 ? GLU A 181 ASN A 189 5 ? 9  
HELX_P HELX_P12 12 THR A 209 ? TYR A 223 ? THR A 209 TYR A 223 1 ? 15 
HELX_P HELX_P13 13 TYR A 233 ? GLN A 237 ? TYR A 233 GLN A 237 5 ? 5  
HELX_P HELX_P14 14 LYS A 278 ? SER A 291 ? LYS A 278 SER A 291 1 ? 14 
HELX_P HELX_P15 15 SER A 296 ? LEU A 341 ? SER A 296 LEU A 341 1 ? 46 
HELX_P HELX_P16 16 VAL A 366 ? GLU A 372 ? VAL A 366 GLU A 372 1 ? 7  
HELX_P HELX_P17 17 GLU A 372 ? MET A 377 ? GLU A 372 MET A 377 1 ? 6  
HELX_P HELX_P18 18 ASN A 385 ? TYR A 388 ? ASN A 385 TYR A 388 5 ? 4  
HELX_P HELX_P19 19 SER A 406 ? GLU A 423 ? SER A 406 GLU A 423 1 ? 18 
HELX_P HELX_P20 20 ASN B 2   ? ILE B 7   ? ASN B 2   ILE B 7   5 ? 6  
HELX_P HELX_P21 21 THR B 8   ? ARG B 14  ? THR B 8   ARG B 14  1 ? 7  
HELX_P HELX_P22 22 ARG B 20  ? ARG B 28  ? ARG B 20  ARG B 28  5 ? 9  
HELX_P HELX_P23 23 ASN B 42  ? PHE B 46  ? ASN B 42  PHE B 46  5 ? 5  
HELX_P HELX_P24 24 GLY B 64  ? LEU B 72  ? GLY B 64  LEU B 72  1 ? 9  
HELX_P HELX_P25 25 ILE B 80  ? ASN B 96  ? ILE B 80  ASN B 96  1 ? 17 
HELX_P HELX_P26 26 GLY B 116 ? ILE B 129 ? GLY B 116 ILE B 129 1 ? 14 
HELX_P HELX_P27 27 TYR B 142 ? HIS B 150 ? TYR B 142 HIS B 150 1 ? 9  
HELX_P HELX_P28 28 PRO B 151 ? GLY B 153 ? PRO B 151 GLY B 153 5 ? 3  
HELX_P HELX_P29 29 VAL B 167 ? SER B 176 ? VAL B 167 SER B 176 1 ? 10 
HELX_P HELX_P30 30 ARG B 177 ? TRP B 178 ? ARG B 177 TRP B 178 5 ? 2  
HELX_P HELX_P31 31 LYS B 179 ? ASN B 185 ? LYS B 179 ASN B 185 5 ? 7  
HELX_P HELX_P32 32 THR B 209 ? TYR B 223 ? THR B 209 TYR B 223 1 ? 15 
HELX_P HELX_P33 33 TYR B 233 ? GLN B 237 ? TYR B 233 GLN B 237 5 ? 5  
HELX_P HELX_P34 34 PHE B 246 ? ASP B 250 ? PHE B 246 ASP B 250 5 ? 5  
HELX_P HELX_P35 35 LYS B 278 ? GLN B 289 ? LYS B 278 GLN B 289 1 ? 12 
HELX_P HELX_P36 36 SER B 296 ? THR B 342 ? SER B 296 THR B 342 1 ? 47 
HELX_P HELX_P37 37 VAL B 366 ? GLU B 372 ? VAL B 366 GLU B 372 1 ? 7  
HELX_P HELX_P38 38 GLU B 372 ? MET B 377 ? GLU B 372 MET B 377 1 ? 6  
HELX_P HELX_P39 39 ASN B 385 ? TYR B 388 ? ASN B 385 TYR B 388 5 ? 4  
HELX_P HELX_P40 40 SER B 406 ? GLU B 423 ? SER B 406 GLU B 423 1 ? 18 
HELX_P HELX_P41 41 ASN C 2   ? ILE C 7   ? ASN C 2   ILE C 7   5 ? 6  
HELX_P HELX_P42 42 THR C 8   ? ARG C 14  ? THR C 8   ARG C 14  1 ? 7  
HELX_P HELX_P43 43 ASN C 42  ? PHE C 46  ? ASN C 42  PHE C 46  5 ? 5  
HELX_P HELX_P44 44 GLY C 64  ? LEU C 72  ? GLY C 64  LEU C 72  1 ? 9  
HELX_P HELX_P45 45 ILE C 80  ? ASN C 96  ? ILE C 80  ASN C 96  1 ? 17 
HELX_P HELX_P46 46 PRO C 103 ? GLY C 107 ? PRO C 103 GLY C 107 5 ? 5  
HELX_P HELX_P47 47 GLY C 116 ? ILE C 129 ? GLY C 116 ILE C 129 1 ? 14 
HELX_P HELX_P48 48 TYR C 142 ? HIS C 150 ? TYR C 142 HIS C 150 1 ? 9  
HELX_P HELX_P49 49 PRO C 151 ? GLY C 153 ? PRO C 151 GLY C 153 5 ? 3  
HELX_P HELX_P50 50 VAL C 167 ? SER C 176 ? VAL C 167 SER C 176 1 ? 10 
HELX_P HELX_P51 51 ARG C 177 ? TRP C 178 ? ARG C 177 TRP C 178 5 ? 2  
HELX_P HELX_P52 52 LYS C 179 ? ASN C 185 ? LYS C 179 ASN C 185 5 ? 7  
HELX_P HELX_P53 53 THR C 209 ? ASP C 224 ? THR C 209 ASP C 224 1 ? 16 
HELX_P HELX_P54 54 TYR C 233 ? GLN C 237 ? TYR C 233 GLN C 237 5 ? 5  
HELX_P HELX_P55 55 LYS C 278 ? GLN C 289 ? LYS C 278 GLN C 289 1 ? 12 
HELX_P HELX_P56 56 SER C 296 ? LEU C 341 ? SER C 296 LEU C 341 1 ? 46 
HELX_P HELX_P57 57 VAL C 366 ? GLU C 372 ? VAL C 366 GLU C 372 1 ? 7  
HELX_P HELX_P58 58 ALA C 374 ? MET C 377 ? ALA C 374 MET C 377 5 ? 4  
HELX_P HELX_P59 59 ASN C 385 ? TYR C 388 ? ASN C 385 TYR C 388 5 ? 4  
HELX_P HELX_P60 60 SER C 406 ? LEU C 425 ? SER C 406 LEU C 425 1 ? 20 
HELX_P HELX_P61 61 ASN D 2   ? ILE D 7   ? ASN D 2   ILE D 7   5 ? 6  
HELX_P HELX_P62 62 THR D 8   ? ALA D 13  ? THR D 8   ALA D 13  1 ? 6  
HELX_P HELX_P63 63 ASN D 42  ? PHE D 46  ? ASN D 42  PHE D 46  5 ? 5  
HELX_P HELX_P64 64 GLY D 64  ? LEU D 72  ? GLY D 64  LEU D 72  1 ? 9  
HELX_P HELX_P65 65 ILE D 80  ? ASN D 96  ? ILE D 80  ASN D 96  1 ? 17 
HELX_P HELX_P66 66 GLY D 116 ? ILE D 129 ? GLY D 116 ILE D 129 1 ? 14 
HELX_P HELX_P67 67 TYR D 142 ? HIS D 150 ? TYR D 142 HIS D 150 1 ? 9  
HELX_P HELX_P68 68 PRO D 151 ? GLY D 153 ? PRO D 151 GLY D 153 5 ? 3  
HELX_P HELX_P69 69 VAL D 167 ? SER D 176 ? VAL D 167 SER D 176 1 ? 10 
HELX_P HELX_P70 70 GLU D 181 ? ASN D 189 ? GLU D 181 ASN D 189 5 ? 9  
HELX_P HELX_P71 71 THR D 209 ? TYR D 223 ? THR D 209 TYR D 223 1 ? 15 
HELX_P HELX_P72 72 TYR D 233 ? GLN D 237 ? TYR D 233 GLN D 237 5 ? 5  
HELX_P HELX_P73 73 THR D 245 ? ASP D 250 ? THR D 245 ASP D 250 5 ? 6  
HELX_P HELX_P74 74 LYS D 278 ? GLN D 289 ? LYS D 278 GLN D 289 1 ? 12 
HELX_P HELX_P75 75 SER D 296 ? THR D 342 ? SER D 296 THR D 342 1 ? 47 
HELX_P HELX_P76 76 VAL D 366 ? GLU D 372 ? VAL D 366 GLU D 372 1 ? 7  
HELX_P HELX_P77 77 GLU D 372 ? MET D 377 ? GLU D 372 MET D 377 1 ? 6  
HELX_P HELX_P78 78 ASN D 385 ? TYR D 388 ? ASN D 385 TYR D 388 5 ? 4  
HELX_P HELX_P79 79 SER D 406 ? LEU D 425 ? SER D 406 LEU D 425 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 262 C ? ? ? 1_555 A LLP 263 N ? ? A SER 262 A LLP 263 1_555 ? ? ? ? ? ? ? 1.359 ? 
covale2 covale ? ? A LLP 263 C ? ? ? 1_555 A ILE 264 N ? ? A LLP 263 A ILE 264 1_555 ? ? ? ? ? ? ? 1.350 ? 
covale3 covale ? ? B SER 262 C ? ? ? 1_555 B LLP 263 N ? ? B SER 262 B LLP 263 1_555 ? ? ? ? ? ? ? 1.359 ? 
covale4 covale ? ? B LLP 263 C ? ? ? 1_555 B ILE 264 N ? ? B LLP 263 B ILE 264 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale5 covale ? ? C SER 262 C ? ? ? 1_555 C LLP 263 N ? ? C SER 262 C LLP 263 1_555 ? ? ? ? ? ? ? 1.354 ? 
covale6 covale ? ? C LLP 263 C ? ? ? 1_555 C ILE 264 N ? ? C LLP 263 C ILE 264 1_555 ? ? ? ? ? ? ? 1.361 ? 
covale7 covale ? ? D SER 262 C ? ? ? 1_555 D LLP 263 N ? ? D SER 262 D LLP 263 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale8 covale ? ? D LLP 263 C ? ? ? 1_555 D ILE 264 N ? ? D LLP 263 D ILE 264 1_555 ? ? ? ? ? ? ? 1.341 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 139 A . ? GLU 139 A PRO 140 A ? PRO 140 A 1 -4.90  
2 ASN 202 A . ? ASN 202 A PRO 203 A ? PRO 203 A 1 16.64  
3 GLU 139 B . ? GLU 139 B PRO 140 B ? PRO 140 B 1 11.52  
4 GLU 139 C . ? GLU 139 C PRO 140 C ? PRO 140 C 1 7.87   
5 GLU 139 D . ? GLU 139 D PRO 140 D ? PRO 140 D 1 -16.87 
6 ASN 202 D . ? ASN 202 D PRO 203 D ? PRO 203 D 1 23.83  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 7 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 7 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 7 ? 
Q ? 2 ? 
R ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? parallel      
P 4 5 ? parallel      
P 5 6 ? parallel      
P 6 7 ? parallel      
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 34  ? SER A 35  ? ILE A 34  SER A 35  
A 2 VAL B 379 ? LEU B 380 ? VAL B 379 LEU B 380 
B 1 PHE A 48  ? VAL A 55  ? PHE A 48  VAL A 55  
B 2 PHE B 48  ? VAL B 55  ? PHE B 48  VAL B 55  
B 3 ILE B 61  ? PHE B 63  ? ILE B 61  PHE B 63  
C 1 MET A 109 ? THR A 114 ? MET A 109 THR A 114 
C 2 GLY A 272 ? PRO A 277 ? GLY A 272 PRO A 277 
C 3 VAL A 255 ? SER A 260 ? VAL A 255 SER A 260 
C 4 LEU A 226 ? ASP A 230 ? LEU A 226 ASP A 230 
C 5 PHE A 193 ? THR A 196 ? PHE A 193 THR A 196 
C 6 ASN A 134 ? LEU A 137 ? ASN A 134 LEU A 137 
C 7 ASN A 155 ? ASN A 158 ? ASN A 155 ASN A 158 
D 1 SER A 161 ? ASP A 162 ? SER A 161 ASP A 162 
D 2 GLY A 165 ? ILE A 166 ? GLY A 165 ILE A 166 
E 1 ALA A 345 ? TRP A 347 ? ALA A 345 TRP A 347 
E 2 PHE A 355 ? VAL A 360 ? PHE A 355 VAL A 360 
E 3 TYR A 397 ? SER A 401 ? TYR A 397 SER A 401 
E 4 LEU A 382 ? PRO A 383 ? LEU A 382 PRO A 383 
F 1 VAL A 379 ? LEU A 380 ? VAL A 379 LEU A 380 
F 2 ILE B 34  ? SER B 35  ? ILE B 34  SER B 35  
G 1 MET B 109 ? THR B 114 ? MET B 109 THR B 114 
G 2 GLY B 272 ? PRO B 277 ? GLY B 272 PRO B 277 
G 3 VAL B 255 ? SER B 260 ? VAL B 255 SER B 260 
G 4 LEU B 226 ? ASP B 230 ? LEU B 226 ASP B 230 
G 5 PHE B 193 ? THR B 196 ? PHE B 193 THR B 196 
G 6 ASN B 134 ? LEU B 137 ? ASN B 134 LEU B 137 
G 7 ASN B 155 ? ASN B 158 ? ASN B 155 ASN B 158 
H 1 SER B 161 ? ASP B 162 ? SER B 161 ASP B 162 
H 2 GLY B 165 ? ILE B 166 ? GLY B 165 ILE B 166 
I 1 ALA B 345 ? GLU B 346 ? ALA B 345 GLU B 346 
I 2 PHE B 355 ? VAL B 360 ? PHE B 355 VAL B 360 
I 3 TYR B 397 ? SER B 401 ? TYR B 397 SER B 401 
I 4 LEU B 382 ? PRO B 383 ? LEU B 382 PRO B 383 
J 1 ILE C 34  ? SER C 35  ? ILE C 34  SER C 35  
J 2 VAL D 379 ? LEU D 380 ? VAL D 379 LEU D 380 
K 1 ILE C 61  ? PHE C 63  ? ILE C 61  PHE C 63  
K 2 PHE C 48  ? VAL C 55  ? PHE C 48  VAL C 55  
K 3 PHE D 48  ? VAL D 55  ? PHE D 48  VAL D 55  
K 4 ILE D 61  ? PHE D 63  ? ILE D 61  PHE D 63  
L 1 MET C 109 ? THR C 114 ? MET C 109 THR C 114 
L 2 GLY C 272 ? PRO C 277 ? GLY C 272 PRO C 277 
L 3 VAL C 255 ? SER C 260 ? VAL C 255 SER C 260 
L 4 LEU C 226 ? ASP C 230 ? LEU C 226 ASP C 230 
L 5 PHE C 193 ? THR C 196 ? PHE C 193 THR C 196 
L 6 ASN C 134 ? ASP C 138 ? ASN C 134 ASP C 138 
L 7 ASN C 155 ? VAL C 159 ? ASN C 155 VAL C 159 
M 1 SER C 161 ? ASP C 162 ? SER C 161 ASP C 162 
M 2 GLY C 165 ? ILE C 166 ? GLY C 165 ILE C 166 
N 1 ALA C 345 ? GLU C 346 ? ALA C 345 GLU C 346 
N 2 PHE C 355 ? VAL C 360 ? PHE C 355 VAL C 360 
N 3 TYR C 397 ? SER C 401 ? TYR C 397 SER C 401 
N 4 LEU C 382 ? PRO C 383 ? LEU C 382 PRO C 383 
O 1 VAL C 379 ? LEU C 380 ? VAL C 379 LEU C 380 
O 2 ILE D 34  ? SER D 35  ? ILE D 34  SER D 35  
P 1 MET D 109 ? THR D 114 ? MET D 109 THR D 114 
P 2 GLY D 272 ? PRO D 277 ? GLY D 272 PRO D 277 
P 3 VAL D 255 ? SER D 260 ? VAL D 255 SER D 260 
P 4 LEU D 226 ? ASP D 231 ? LEU D 226 ASP D 231 
P 5 PHE D 193 ? THR D 196 ? PHE D 193 THR D 196 
P 6 ASN D 134 ? LEU D 137 ? ASN D 134 LEU D 137 
P 7 ASN D 155 ? ASN D 158 ? ASN D 155 ASN D 158 
Q 1 SER D 161 ? ASP D 162 ? SER D 161 ASP D 162 
Q 2 GLY D 165 ? ILE D 166 ? GLY D 165 ILE D 166 
R 1 ALA D 345 ? TRP D 347 ? ALA D 345 TRP D 347 
R 2 PHE D 355 ? VAL D 360 ? PHE D 355 VAL D 360 
R 3 TYR D 397 ? SER D 401 ? TYR D 397 SER D 401 
R 4 LEU D 382 ? PRO D 383 ? LEU D 382 PRO D 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 34  ? N ILE A 34  O LEU B 380 ? O LEU B 380 
B 1 2 N THR A 54  ? N THR A 54  O LYS B 49  ? O LYS B 49  
B 2 3 N ILE B 53  ? N ILE B 53  O ILE B 61  ? O ILE B 61  
C 1 2 N ASP A 110 ? N ASP A 110 O GLY A 276 ? O GLY A 276 
C 2 3 O THR A 275 ? O THR A 275 N ARG A 257 ? N ARG A 257 
C 3 4 O ILE A 256 ? O ILE A 256 N GLU A 229 ? N GLU A 229 
C 4 5 O ILE A 228 ? O ILE A 228 N LEU A 194 ? N LEU A 194 
C 5 6 O PHE A 193 ? O PHE A 193 N LEU A 136 ? N LEU A 136 
C 6 7 N VAL A 135 ? N VAL A 135 O ILE A 157 ? O ILE A 157 
D 1 2 N ASP A 162 ? N ASP A 162 O GLY A 165 ? O GLY A 165 
E 1 2 N GLU A 346 ? N GLU A 346 O LYS A 359 ? O LYS A 359 
E 2 3 N LEU A 356 ? N LEU A 356 O ALA A 400 ? O ALA A 400 
E 3 4 O ARG A 399 ? O ARG A 399 N LEU A 382 ? N LEU A 382 
F 1 2 N LEU A 380 ? N LEU A 380 O ILE B 34  ? O ILE B 34  
G 1 2 N CYS B 112 ? N CYS B 112 O LEU B 274 ? O LEU B 274 
G 2 3 O THR B 275 ? O THR B 275 N ARG B 257 ? N ARG B 257 
G 3 4 O ILE B 256 ? O ILE B 256 N ILE B 227 ? N ILE B 227 
G 4 5 O ILE B 228 ? O ILE B 228 N LEU B 194 ? N LEU B 194 
G 5 6 O TYR B 195 ? O TYR B 195 N LEU B 136 ? N LEU B 136 
G 6 7 N VAL B 135 ? N VAL B 135 O ILE B 157 ? O ILE B 157 
H 1 2 N ASP B 162 ? N ASP B 162 O GLY B 165 ? O GLY B 165 
I 1 2 N GLU B 346 ? N GLU B 346 O LYS B 359 ? O LYS B 359 
I 2 3 N LEU B 356 ? N LEU B 356 O ALA B 400 ? O ALA B 400 
I 3 4 O ARG B 399 ? O ARG B 399 N LEU B 382 ? N LEU B 382 
J 1 2 N ILE C 34  ? N ILE C 34  O LEU D 380 ? O LEU D 380 
K 1 2 O ILE C 61  ? O ILE C 61  N ILE C 53  ? N ILE C 53  
K 2 3 N VAL C 52  ? N VAL C 52  O VAL D 52  ? O VAL D 52  
K 3 4 N ILE D 53  ? N ILE D 53  O ILE D 61  ? O ILE D 61  
L 1 2 N THR C 114 ? N THR C 114 O GLY C 272 ? O GLY C 272 
L 2 3 O THR C 275 ? O THR C 275 N ARG C 257 ? N ARG C 257 
L 3 4 O ILE C 256 ? O ILE C 256 N GLU C 229 ? N GLU C 229 
L 4 5 O ILE C 228 ? O ILE C 228 N LEU C 194 ? N LEU C 194 
L 5 6 O TYR C 195 ? O TYR C 195 N LEU C 136 ? N LEU C 136 
L 6 7 N VAL C 135 ? N VAL C 135 O ILE C 157 ? O ILE C 157 
M 1 2 N ASP C 162 ? N ASP C 162 O GLY C 165 ? O GLY C 165 
N 1 2 N GLU C 346 ? N GLU C 346 O LYS C 359 ? O LYS C 359 
N 2 3 N LEU C 356 ? N LEU C 356 O ALA C 400 ? O ALA C 400 
N 3 4 O ARG C 399 ? O ARG C 399 N LEU C 382 ? N LEU C 382 
O 1 2 N LEU C 380 ? N LEU C 380 O ILE D 34  ? O ILE D 34  
P 1 2 N CYS D 112 ? N CYS D 112 O LEU D 274 ? O LEU D 274 
P 2 3 O PHE D 273 ? O PHE D 273 N ASP D 259 ? N ASP D 259 
P 3 4 O ILE D 256 ? O ILE D 256 N GLU D 229 ? N GLU D 229 
P 4 5 O ILE D 228 ? O ILE D 228 N LEU D 194 ? N LEU D 194 
P 5 6 O TYR D 195 ? O TYR D 195 N LEU D 136 ? N LEU D 136 
P 6 7 N VAL D 135 ? N VAL D 135 O ILE D 157 ? O ILE D 157 
Q 1 2 N ASP D 162 ? N ASP D 162 O GLY D 165 ? O GLY D 165 
R 1 2 N GLU D 346 ? N GLU D 346 O LYS D 359 ? O LYS D 359 
R 2 3 N LEU D 356 ? N LEU D 356 O ALA D 400 ? O ALA D 400 
R 3 4 O ARG D 399 ? O ARG D 399 N LEU D 382 ? N LEU D 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL B 426' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL D 426' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL C 427' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL A 426' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL D 427' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL C 428' 
AC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL D 428' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 427' 
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL C 429' 
BC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL D 429' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL C 430' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ASN B 328 ? ASN B 328 . ? 1_555 ? 
2  AC1 2 ASP B 331 ? ASP B 331 . ? 1_555 ? 
3  AC2 4 SER C 404 ? SER C 404 . ? 1_555 ? 
4  AC2 4 MET D 33  ? MET D 33  . ? 1_555 ? 
5  AC2 4 ILE D 34  ? ILE D 34  . ? 1_555 ? 
6  AC2 4 SER D 35  ? SER D 35  . ? 1_555 ? 
7  AC3 6 ASN C 57  ? ASN C 57  . ? 1_555 ? 
8  AC3 6 TRP C 310 ? TRP C 310 . ? 1_555 ? 
9  AC3 6 GLY C 314 ? GLY C 314 . ? 1_555 ? 
10 AC3 6 HIS C 318 ? HIS C 318 . ? 1_555 ? 
11 AC3 6 ARG C 321 ? ARG C 321 . ? 1_555 ? 
12 AC3 6 HOH S .   ? HOH C 562 . ? 1_555 ? 
13 AC4 2 THR A 21  ? THR A 21  . ? 1_555 ? 
14 AC4 2 ILE A 25  ? ILE A 25  . ? 1_555 ? 
15 AC5 4 GLY D 64  ? GLY D 64  . ? 1_555 ? 
16 AC5 4 GLU D 65  ? GLU D 65  . ? 1_555 ? 
17 AC5 4 GLU D 66  ? GLU D 66  . ? 1_555 ? 
18 AC5 4 MET D 67  ? MET D 67  . ? 1_555 ? 
19 AC6 7 PHE C 325 ? PHE C 325 . ? 1_555 ? 
20 AC6 7 GLN C 329 ? GLN C 329 . ? 1_555 ? 
21 AC6 7 SER C 404 ? SER C 404 . ? 1_555 ? 
22 AC6 7 ALA C 405 ? ALA C 405 . ? 1_555 ? 
23 AC6 7 SER C 406 ? SER C 406 . ? 1_555 ? 
24 AC6 7 PRO C 407 ? PRO C 407 . ? 1_555 ? 
25 AC6 7 ASN D 42  ? ASN D 42  . ? 1_555 ? 
26 AC7 9 ASP D 138 ? ASP D 138 . ? 1_555 ? 
27 AC7 9 ASP D 162 ? ASP D 162 . ? 1_555 ? 
28 AC7 9 GLY D 165 ? GLY D 165 . ? 1_555 ? 
29 AC7 9 VAL D 197 ? VAL D 197 . ? 1_555 ? 
30 AC7 9 ASN D 201 ? ASN D 201 . ? 1_555 ? 
31 AC7 9 THR D 204 ? THR D 204 . ? 1_555 ? 
32 AC7 9 ASN D 206 ? ASN D 206 . ? 1_555 ? 
33 AC7 9 HOH T .   ? HOH D 567 . ? 1_555 ? 
34 AC7 9 HOH T .   ? HOH D 572 . ? 1_555 ? 
35 AC8 3 ASP A 162 ? ASP A 162 . ? 1_555 ? 
36 AC8 3 GLU A 163 ? GLU A 163 . ? 1_555 ? 
37 AC8 3 HIS A 348 ? HIS A 348 . ? 1_555 ? 
38 AC9 2 SER C 391 ? SER C 391 . ? 1_555 ? 
39 AC9 2 HOH T .   ? HOH D 449 . ? 1_555 ? 
40 BC1 9 THR D 8   ? THR D 8   . ? 1_555 ? 
41 BC1 9 SER D 11  ? SER D 11  . ? 1_555 ? 
42 BC1 9 ARG D 14  ? ARG D 14  . ? 1_555 ? 
43 BC1 9 LYS D 123 ? LYS D 123 . ? 1_555 ? 
44 BC1 9 GLU D 126 ? GLU D 126 . ? 1_555 ? 
45 BC1 9 MET D 127 ? MET D 127 . ? 1_555 ? 
46 BC1 9 HIS D 287 ? HIS D 287 . ? 1_555 ? 
47 BC1 9 HOH T .   ? HOH D 480 . ? 1_555 ? 
48 BC1 9 HOH T .   ? HOH D 556 . ? 1_555 ? 
49 BC2 6 ASN C 44  ? ASN C 44  . ? 1_555 ? 
50 BC2 6 MET C 45  ? MET C 45  . ? 1_555 ? 
51 BC2 6 PHE C 46  ? PHE C 46  . ? 1_555 ? 
52 BC2 6 LYS C 49  ? LYS C 49  . ? 1_555 ? 
53 BC2 6 HOH S .   ? HOH C 542 . ? 1_555 ? 
54 BC2 6 GLU D 56  ? GLU D 56  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2QLR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2QLR 
_atom_sites.fract_transf_matrix[1][1]   0.009132 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001792 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014089 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008413 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . MET A 1 1   ? 20.122  25.265  -23.873 1.00 52.23 ? 1   MET A N     1 
ATOM   2     C CA    . MET A 1 1   ? 18.812  25.637  -24.499 1.00 52.32 ? 1   MET A CA    1 
ATOM   3     C C     . MET A 1 1   ? 18.274  24.460  -25.340 1.00 49.49 ? 1   MET A C     1 
ATOM   4     O O     . MET A 1 1   ? 17.156  24.038  -25.123 1.00 50.44 ? 1   MET A O     1 
ATOM   5     C CB    . MET A 1 1   ? 18.922  26.976  -25.296 1.00 53.05 ? 1   MET A CB    1 
ATOM   6     C CG    . MET A 1 1   ? 17.605  27.645  -25.785 1.00 52.61 ? 1   MET A CG    1 
ATOM   7     S SD    . MET A 1 1   ? 17.561  29.462  -25.436 1.00 58.99 ? 1   MET A SD    1 
ATOM   8     C CE    . MET A 1 1   ? 15.947  29.960  -26.063 1.00 56.13 ? 1   MET A CE    1 
ATOM   9     N N     . ASN A 1 2   ? 19.056  23.930  -26.282 1.00 46.59 ? 2   ASN A N     1 
ATOM   10    C CA    . ASN A 1 2   ? 18.721  22.673  -27.004 1.00 43.61 ? 2   ASN A CA    1 
ATOM   11    C C     . ASN A 1 2   ? 19.371  21.461  -26.276 1.00 41.95 ? 2   ASN A C     1 
ATOM   12    O O     . ASN A 1 2   ? 20.519  21.070  -26.549 1.00 40.70 ? 2   ASN A O     1 
ATOM   13    C CB    . ASN A 1 2   ? 19.182  22.758  -28.489 1.00 42.98 ? 2   ASN A CB    1 
ATOM   14    C CG    . ASN A 1 2   ? 18.800  21.539  -29.315 1.00 42.38 ? 2   ASN A CG    1 
ATOM   15    O OD1   . ASN A 1 2   ? 17.901  20.795  -28.952 1.00 46.67 ? 2   ASN A OD1   1 
ATOM   16    N ND2   . ASN A 1 2   ? 19.460  21.354  -30.473 1.00 41.01 ? 2   ASN A ND2   1 
ATOM   17    N N     . TYR A 1 3   ? 18.635  20.893  -25.335 1.00 39.84 ? 3   TYR A N     1 
ATOM   18    C CA    . TYR A 1 3   ? 19.222  19.924  -24.452 1.00 38.59 ? 3   TYR A CA    1 
ATOM   19    C C     . TYR A 1 3   ? 19.311  18.595  -25.192 1.00 38.87 ? 3   TYR A C     1 
ATOM   20    O O     . TYR A 1 3   ? 20.296  17.841  -24.994 1.00 38.52 ? 3   TYR A O     1 
ATOM   21    C CB    . TYR A 1 3   ? 18.529  19.849  -23.030 1.00 37.25 ? 3   TYR A CB    1 
ATOM   22    C CG    . TYR A 1 3   ? 18.948  20.945  -22.025 1.00 33.96 ? 3   TYR A CG    1 
ATOM   23    C CD1   . TYR A 1 3   ? 17.999  21.806  -21.477 1.00 38.16 ? 3   TYR A CD1   1 
ATOM   24    C CD2   . TYR A 1 3   ? 20.296  21.151  -21.659 1.00 34.18 ? 3   TYR A CD2   1 
ATOM   25    C CE1   . TYR A 1 3   ? 18.364  22.879  -20.581 1.00 34.81 ? 3   TYR A CE1   1 
ATOM   26    C CE2   . TYR A 1 3   ? 20.674  22.230  -20.745 1.00 31.95 ? 3   TYR A CE2   1 
ATOM   27    C CZ    . TYR A 1 3   ? 19.682  23.061  -20.212 1.00 33.86 ? 3   TYR A CZ    1 
ATOM   28    O OH    . TYR A 1 3   ? 19.993  24.114  -19.323 1.00 33.12 ? 3   TYR A OH    1 
ATOM   29    N N     . ALA A 1 4   ? 18.323  18.311  -26.053 1.00 38.39 ? 4   ALA A N     1 
ATOM   30    C CA    . ALA A 1 4   ? 18.443  17.148  -26.994 1.00 39.41 ? 4   ALA A CA    1 
ATOM   31    C C     . ALA A 1 4   ? 19.806  16.965  -27.705 1.00 40.66 ? 4   ALA A C     1 
ATOM   32    O O     . ALA A 1 4   ? 20.199  15.817  -28.042 1.00 41.56 ? 4   ALA A O     1 
ATOM   33    C CB    . ALA A 1 4   ? 17.277  17.100  -28.053 1.00 36.82 ? 4   ALA A CB    1 
ATOM   34    N N     . ARG A 1 5   ? 20.546  18.056  -27.954 1.00 41.86 ? 5   ARG A N     1 
ATOM   35    C CA    . ARG A 1 5   ? 21.838  17.869  -28.645 1.00 42.37 ? 5   ARG A CA    1 
ATOM   36    C C     . ARG A 1 5   ? 22.984  17.293  -27.761 1.00 42.25 ? 5   ARG A C     1 
ATOM   37    O O     . ARG A 1 5   ? 23.974  16.742  -28.282 1.00 41.29 ? 5   ARG A O     1 
ATOM   38    C CB    . ARG A 1 5   ? 22.250  19.069  -29.515 1.00 41.12 ? 5   ARG A CB    1 
ATOM   39    C CG    . ARG A 1 5   ? 22.426  20.386  -28.837 1.00 44.93 ? 5   ARG A CG    1 
ATOM   40    C CD    . ARG A 1 5   ? 23.032  21.448  -29.792 1.00 44.14 ? 5   ARG A CD    1 
ATOM   41    N NE    . ARG A 1 5   ? 24.502  21.367  -29.840 1.00 44.86 ? 5   ARG A NE    1 
ATOM   42    C CZ    . ARG A 1 5   ? 25.309  22.310  -29.360 1.00 41.70 ? 5   ARG A CZ    1 
ATOM   43    N NH1   . ARG A 1 5   ? 26.621  22.178  -29.426 1.00 39.95 ? 5   ARG A NH1   1 
ATOM   44    N NH2   . ARG A 1 5   ? 24.792  23.406  -28.826 1.00 47.23 ? 5   ARG A NH2   1 
ATOM   45    N N     . PHE A 1 6   ? 22.806  17.391  -26.430 1.00 41.66 ? 6   PHE A N     1 
ATOM   46    C CA    . PHE A 1 6   ? 23.763  16.891  -25.466 1.00 40.07 ? 6   PHE A CA    1 
ATOM   47    C C     . PHE A 1 6   ? 23.360  15.537  -24.817 1.00 40.90 ? 6   PHE A C     1 
ATOM   48    O O     . PHE A 1 6   ? 23.896  15.155  -23.739 1.00 41.45 ? 6   PHE A O     1 
ATOM   49    C CB    . PHE A 1 6   ? 23.935  17.926  -24.377 1.00 39.91 ? 6   PHE A CB    1 
ATOM   50    C CG    . PHE A 1 6   ? 24.296  19.280  -24.885 1.00 37.16 ? 6   PHE A CG    1 
ATOM   51    C CD1   . PHE A 1 6   ? 23.340  20.279  -24.923 1.00 34.41 ? 6   PHE A CD1   1 
ATOM   52    C CD2   . PHE A 1 6   ? 25.584  19.553  -25.338 1.00 35.12 ? 6   PHE A CD2   1 
ATOM   53    C CE1   . PHE A 1 6   ? 23.662  21.606  -25.363 1.00 37.81 ? 6   PHE A CE1   1 
ATOM   54    C CE2   . PHE A 1 6   ? 25.908  20.829  -25.832 1.00 39.72 ? 6   PHE A CE2   1 
ATOM   55    C CZ    . PHE A 1 6   ? 24.932  21.885  -25.817 1.00 34.45 ? 6   PHE A CZ    1 
ATOM   56    N N     . ILE A 1 7   ? 22.411  14.839  -25.453 1.00 38.54 ? 7   ILE A N     1 
ATOM   57    C CA    . ILE A 1 7   ? 21.857  13.593  -24.946 1.00 36.73 ? 7   ILE A CA    1 
ATOM   58    C C     . ILE A 1 7   ? 21.862  12.579  -26.104 1.00 34.53 ? 7   ILE A C     1 
ATOM   59    O O     . ILE A 1 7   ? 21.227  12.781  -27.093 1.00 34.25 ? 7   ILE A O     1 
ATOM   60    C CB    . ILE A 1 7   ? 20.378  13.794  -24.424 1.00 37.86 ? 7   ILE A CB    1 
ATOM   61    C CG1   . ILE A 1 7   ? 20.337  14.515  -23.095 1.00 32.93 ? 7   ILE A CG1   1 
ATOM   62    C CG2   . ILE A 1 7   ? 19.682  12.530  -24.186 1.00 34.80 ? 7   ILE A CG2   1 
ATOM   63    C CD1   . ILE A 1 7   ? 18.948  15.108  -22.866 1.00 29.92 ? 7   ILE A CD1   1 
ATOM   64    N N     . THR A 1 8   ? 22.619  11.515  -25.930 1.00 33.69 ? 8   THR A N     1 
ATOM   65    C CA    . THR A 1 8   ? 22.761  10.302  -26.797 1.00 31.32 ? 8   THR A CA    1 
ATOM   66    C C     . THR A 1 8   ? 21.362  9.664   -27.162 1.00 30.76 ? 8   THR A C     1 
ATOM   67    O O     . THR A 1 8   ? 20.365  9.869   -26.460 1.00 28.94 ? 8   THR A O     1 
ATOM   68    C CB    . THR A 1 8   ? 23.759  9.409   -25.942 1.00 31.28 ? 8   THR A CB    1 
ATOM   69    O OG1   . THR A 1 8   ? 25.111  9.397   -26.456 1.00 28.56 ? 8   THR A OG1   1 
ATOM   70    C CG2   . THR A 1 8   ? 23.269  8.066   -25.638 1.00 31.40 ? 8   THR A CG2   1 
ATOM   71    N N     . ALA A 1 9   ? 21.248  8.957   -28.301 1.00 32.07 ? 9   ALA A N     1 
ATOM   72    C CA    . ALA A 1 9   ? 20.065  8.024   -28.547 1.00 31.64 ? 9   ALA A CA    1 
ATOM   73    C C     . ALA A 1 9   ? 19.881  7.034   -27.402 1.00 30.39 ? 9   ALA A C     1 
ATOM   74    O O     . ALA A 1 9   ? 18.783  6.735   -27.069 1.00 32.04 ? 9   ALA A O     1 
ATOM   75    C CB    . ALA A 1 9   ? 20.183  7.188   -29.865 1.00 31.38 ? 9   ALA A CB    1 
ATOM   76    N N     . ALA A 1 10  ? 20.964  6.478   -26.884 1.00 30.94 ? 10  ALA A N     1 
ATOM   77    C CA    . ALA A 1 10  ? 20.922  5.567   -25.720 1.00 31.28 ? 10  ALA A CA    1 
ATOM   78    C C     . ALA A 1 10  ? 20.288  6.207   -24.499 1.00 30.88 ? 10  ALA A C     1 
ATOM   79    O O     . ALA A 1 10  ? 19.270  5.764   -24.060 1.00 32.74 ? 10  ALA A O     1 
ATOM   80    C CB    . ALA A 1 10  ? 22.307  5.082   -25.391 1.00 30.47 ? 10  ALA A CB    1 
ATOM   81    N N     . SER A 1 11  ? 20.856  7.289   -24.010 1.00 31.77 ? 11  SER A N     1 
ATOM   82    C CA    . SER A 1 11  ? 20.299  8.061   -22.869 1.00 32.25 ? 11  SER A CA    1 
ATOM   83    C C     . SER A 1 11  ? 18.866  8.621   -23.051 1.00 32.40 ? 11  SER A C     1 
ATOM   84    O O     . SER A 1 11  ? 18.039  8.456   -22.151 1.00 31.33 ? 11  SER A O     1 
ATOM   85    C CB    . SER A 1 11  ? 21.294  9.148   -22.414 1.00 31.38 ? 11  SER A CB    1 
ATOM   86    O OG    . SER A 1 11  ? 20.638  9.923   -21.454 1.00 31.47 ? 11  SER A OG    1 
ATOM   87    N N     . ALA A 1 12  ? 18.601  9.272   -24.205 1.00 32.84 ? 12  ALA A N     1 
ATOM   88    C CA    . ALA A 1 12  ? 17.250  9.652   -24.700 1.00 32.94 ? 12  ALA A CA    1 
ATOM   89    C C     . ALA A 1 12  ? 16.160  8.555   -24.631 1.00 32.93 ? 12  ALA A C     1 
ATOM   90    O O     . ALA A 1 12  ? 14.995  8.859   -24.354 1.00 32.64 ? 12  ALA A O     1 
ATOM   91    C CB    . ALA A 1 12  ? 17.374  10.140  -26.195 1.00 35.01 ? 12  ALA A CB    1 
ATOM   92    N N     . ALA A 1 13  ? 16.529  7.287   -24.870 1.00 33.02 ? 13  ALA A N     1 
ATOM   93    C CA    . ALA A 1 13  ? 15.569  6.175   -24.758 1.00 32.00 ? 13  ALA A CA    1 
ATOM   94    C C     . ALA A 1 13  ? 15.304  5.707   -23.332 1.00 33.50 ? 13  ALA A C     1 
ATOM   95    O O     . ALA A 1 13  ? 14.394  4.895   -23.164 1.00 33.80 ? 13  ALA A O     1 
ATOM   96    C CB    . ALA A 1 13  ? 16.006  4.984   -25.585 1.00 32.22 ? 13  ALA A CB    1 
ATOM   97    N N     . ARG A 1 14  ? 16.090  6.151   -22.318 1.00 32.52 ? 14  ARG A N     1 
ATOM   98    C CA    . ARG A 1 14  ? 15.765  5.793   -20.925 1.00 32.31 ? 14  ARG A CA    1 
ATOM   99    C C     . ARG A 1 14  ? 14.339  6.169   -20.547 1.00 33.99 ? 14  ARG A C     1 
ATOM   100   O O     . ARG A 1 14  ? 13.929  7.327   -20.706 1.00 32.99 ? 14  ARG A O     1 
ATOM   101   C CB    . ARG A 1 14  ? 16.765  6.354   -19.884 1.00 30.21 ? 14  ARG A CB    1 
ATOM   102   C CG    . ARG A 1 14  ? 18.171  5.865   -20.137 1.00 29.51 ? 14  ARG A CG    1 
ATOM   103   C CD    . ARG A 1 14  ? 19.210  5.951   -18.969 1.00 31.33 ? 14  ARG A CD    1 
ATOM   104   N NE    . ARG A 1 14  ? 20.539  5.525   -19.432 1.00 26.95 ? 14  ARG A NE    1 
ATOM   105   C CZ    . ARG A 1 14  ? 20.894  4.233   -19.534 1.00 24.44 ? 14  ARG A CZ    1 
ATOM   106   N NH1   . ARG A 1 14  ? 20.077  3.324   -19.101 1.00 26.36 ? 14  ARG A NH1   1 
ATOM   107   N NH2   . ARG A 1 14  ? 22.086  3.852   -19.990 1.00 22.41 ? 14  ARG A NH2   1 
ATOM   108   N N     . ASN A 1 15  ? 13.581  5.185   -20.062 1.00 35.81 ? 15  ASN A N     1 
ATOM   109   C CA    . ASN A 1 15  ? 12.295  5.461   -19.384 1.00 39.69 ? 15  ASN A CA    1 
ATOM   110   C C     . ASN A 1 15  ? 12.510  5.269   -17.890 1.00 40.59 ? 15  ASN A C     1 
ATOM   111   O O     . ASN A 1 15  ? 13.422  4.516   -17.515 1.00 40.80 ? 15  ASN A O     1 
ATOM   112   C CB    . ASN A 1 15  ? 11.136  4.520   -19.841 1.00 38.97 ? 15  ASN A CB    1 
ATOM   113   C CG    . ASN A 1 15  ? 10.947  4.542   -21.319 1.00 41.19 ? 15  ASN A CG    1 
ATOM   114   O OD1   . ASN A 1 15  ? 10.868  5.621   -21.915 1.00 42.72 ? 15  ASN A OD1   1 
ATOM   115   N ND2   . ASN A 1 15  ? 10.919  3.345   -21.951 1.00 41.55 ? 15  ASN A ND2   1 
ATOM   116   N N     . PRO A 1 16  ? 11.721  5.985   -17.063 1.00 42.26 ? 16  PRO A N     1 
ATOM   117   C CA    . PRO A 1 16  ? 11.661  5.840   -15.620 1.00 44.83 ? 16  PRO A CA    1 
ATOM   118   C C     . PRO A 1 16  ? 11.300  4.482   -15.213 1.00 46.78 ? 16  PRO A C     1 
ATOM   119   O O     . PRO A 1 16  ? 10.152  4.085   -15.448 1.00 48.68 ? 16  PRO A O     1 
ATOM   120   C CB    . PRO A 1 16  ? 10.532  6.811   -15.170 1.00 44.79 ? 16  PRO A CB    1 
ATOM   121   C CG    . PRO A 1 16  ? 9.886   7.276   -16.391 1.00 45.38 ? 16  PRO A CG    1 
ATOM   122   C CD    . PRO A 1 16  ? 10.874  7.095   -17.525 1.00 42.77 ? 16  PRO A CD    1 
ATOM   123   N N     . SER A 1 17  ? 12.284  3.767   -14.672 1.00 48.63 ? 17  SER A N     1 
ATOM   124   C CA    . SER A 1 17  ? 12.023  2.629   -13.829 1.00 52.37 ? 17  SER A CA    1 
ATOM   125   C C     . SER A 1 17  ? 11.611  3.021   -12.383 1.00 55.37 ? 17  SER A C     1 
ATOM   126   O O     . SER A 1 17  ? 10.607  3.765   -12.138 1.00 54.66 ? 17  SER A O     1 
ATOM   127   C CB    . SER A 1 17  ? 13.241  1.670   -13.682 1.00 52.03 ? 17  SER A CB    1 
ATOM   128   O OG    . SER A 1 17  ? 13.663  1.084   -14.859 1.00 48.96 ? 17  SER A OG    1 
ATOM   129   N N     . PRO A 1 18  ? 12.445  2.556   -11.448 1.00 58.09 ? 18  PRO A N     1 
ATOM   130   C CA    . PRO A 1 18  ? 12.024  1.697   -10.346 1.00 61.68 ? 18  PRO A CA    1 
ATOM   131   C C     . PRO A 1 18  ? 11.656  2.244   -8.993  1.00 63.52 ? 18  PRO A C     1 
ATOM   132   O O     . PRO A 1 18  ? 12.020  3.367   -8.644  1.00 64.26 ? 18  PRO A O     1 
ATOM   133   C CB    . PRO A 1 18  ? 13.291  0.827   -10.139 1.00 62.28 ? 18  PRO A CB    1 
ATOM   134   C CG    . PRO A 1 18  ? 14.392  1.840   -10.267 1.00 60.62 ? 18  PRO A CG    1 
ATOM   135   C CD    . PRO A 1 18  ? 13.884  2.829   -11.363 1.00 58.74 ? 18  PRO A CD    1 
ATOM   136   N N     . ILE A 1 19  ? 11.010  1.351   -8.235  1.00 66.72 ? 19  ILE A N     1 
ATOM   137   C CA    . ILE A 1 19  ? 10.680  1.449   -6.792  1.00 68.47 ? 19  ILE A CA    1 
ATOM   138   C C     . ILE A 1 19  ? 9.530   2.459   -6.651  1.00 70.47 ? 19  ILE A C     1 
ATOM   139   O O     . ILE A 1 19  ? 9.523   3.336   -5.773  1.00 70.76 ? 19  ILE A O     1 
ATOM   140   C CB    . ILE A 1 19  ? 11.971  1.612   -5.902  1.00 68.95 ? 19  ILE A CB    1 
ATOM   141   C CG1   . ILE A 1 19  ? 13.125  0.795   -6.504  1.00 68.01 ? 19  ILE A CG1   1 
ATOM   142   C CG2   . ILE A 1 19  ? 11.745  1.127   -4.462  1.00 69.58 ? 19  ILE A CG2   1 
ATOM   143   C CD1   . ILE A 1 19  ? 14.361  0.651   -5.627  1.00 67.33 ? 19  ILE A CD1   1 
ATOM   144   N N     . ARG A 1 20  ? 8.496   2.173   -7.472  1.00 72.80 ? 20  ARG A N     1 
ATOM   145   C CA    . ARG A 1 20  ? 7.578   3.102   -8.208  1.00 73.90 ? 20  ARG A CA    1 
ATOM   146   C C     . ARG A 1 20  ? 6.372   3.800   -7.565  1.00 74.55 ? 20  ARG A C     1 
ATOM   147   O O     . ARG A 1 20  ? 6.483   4.405   -6.487  1.00 75.28 ? 20  ARG A O     1 
ATOM   148   C CB    . ARG A 1 20  ? 7.018   2.322   -9.418  1.00 74.11 ? 20  ARG A CB    1 
ATOM   149   C CG    . ARG A 1 20  ? 6.088   1.125   -9.084  1.00 73.72 ? 20  ARG A CG    1 
ATOM   150   C CD    . ARG A 1 20  ? 5.143   0.788   -10.243 1.00 74.95 ? 20  ARG A CD    1 
ATOM   151   N NE    . ARG A 1 20  ? 5.718   1.152   -11.549 1.00 79.72 ? 20  ARG A NE    1 
ATOM   152   C CZ    . ARG A 1 20  ? 5.427   0.581   -12.724 1.00 81.65 ? 20  ARG A CZ    1 
ATOM   153   N NH1   . ARG A 1 20  ? 4.548   -0.430  -12.815 1.00 80.12 ? 20  ARG A NH1   1 
ATOM   154   N NH2   . ARG A 1 20  ? 6.037   1.029   -13.824 1.00 80.99 ? 20  ARG A NH2   1 
ATOM   155   N N     . THR A 1 21  ? 5.244   3.759   -8.312  1.00 74.65 ? 21  THR A N     1 
ATOM   156   C CA    . THR A 1 21  ? 3.865   4.013   -7.819  1.00 75.16 ? 21  THR A CA    1 
ATOM   157   C C     . THR A 1 21  ? 3.359   3.017   -6.711  1.00 75.20 ? 21  THR A C     1 
ATOM   158   O O     . THR A 1 21  ? 2.293   2.332   -6.855  1.00 74.78 ? 21  THR A O     1 
ATOM   159   C CB    . THR A 1 21  ? 2.810   4.085   -8.981  1.00 75.58 ? 21  THR A CB    1 
ATOM   160   O OG1   . THR A 1 21  ? 2.563   2.769   -9.507  1.00 75.43 ? 21  THR A OG1   1 
ATOM   161   C CG2   . THR A 1 21  ? 3.248   5.060   -10.108 1.00 75.74 ? 21  THR A CG2   1 
ATOM   162   N N     . MET A 1 22  ? 4.123   2.989   -5.609  1.00 74.01 ? 22  MET A N     1 
ATOM   163   C CA    . MET A 1 22  ? 3.952   2.061   -4.512  1.00 72.99 ? 22  MET A CA    1 
ATOM   164   C C     . MET A 1 22  ? 4.148   2.767   -3.161  1.00 73.39 ? 22  MET A C     1 
ATOM   165   O O     . MET A 1 22  ? 3.203   2.893   -2.381  1.00 73.02 ? 22  MET A O     1 
ATOM   166   C CB    . MET A 1 22  ? 4.939   0.907   -4.661  1.00 73.18 ? 22  MET A CB    1 
ATOM   167   C CG    . MET A 1 22  ? 6.427   1.331   -4.684  1.00 73.19 ? 22  MET A CG    1 
ATOM   168   S SD    . MET A 1 22  ? 7.578   0.107   -4.010  1.00 70.39 ? 22  MET A SD    1 
ATOM   169   C CE    . MET A 1 22  ? 8.371   -0.554  -5.482  1.00 70.57 ? 22  MET A CE    1 
ATOM   170   N N     . THR A 1 23  ? 5.374   3.215   -2.891  1.00 73.94 ? 23  THR A N     1 
ATOM   171   C CA    . THR A 1 23  ? 5.682   4.089   -1.734  1.00 74.78 ? 23  THR A CA    1 
ATOM   172   C C     . THR A 1 23  ? 5.404   5.587   -2.120  1.00 75.19 ? 23  THR A C     1 
ATOM   173   O O     . THR A 1 23  ? 6.228   6.477   -1.887  1.00 74.50 ? 23  THR A O     1 
ATOM   174   C CB    . THR A 1 23  ? 7.168   3.819   -1.197  1.00 75.04 ? 23  THR A CB    1 
ATOM   175   O OG1   . THR A 1 23  ? 7.478   2.410   -1.235  1.00 73.87 ? 23  THR A OG1   1 
ATOM   176   C CG2   . THR A 1 23  ? 7.386   4.333   0.260   1.00 74.62 ? 23  THR A CG2   1 
ATOM   177   N N     . ASP A 1 24  ? 4.215   5.839   -2.693  1.00 76.22 ? 24  ASP A N     1 
ATOM   178   C CA    . ASP A 1 24  ? 3.932   7.074   -3.469  1.00 77.18 ? 24  ASP A CA    1 
ATOM   179   C C     . ASP A 1 24  ? 2.479   7.614   -3.399  1.00 77.64 ? 24  ASP A C     1 
ATOM   180   O O     . ASP A 1 24  ? 2.233   8.806   -3.143  1.00 77.46 ? 24  ASP A O     1 
ATOM   181   C CB    . ASP A 1 24  ? 4.427   6.906   -4.935  1.00 77.25 ? 24  ASP A CB    1 
ATOM   182   C CG    . ASP A 1 24  ? 3.295   6.671   -5.965  1.00 77.81 ? 24  ASP A CG    1 
ATOM   183   O OD1   . ASP A 1 24  ? 3.359   7.314   -7.053  1.00 77.19 ? 24  ASP A OD1   1 
ATOM   184   O OD2   . ASP A 1 24  ? 2.376   5.841   -5.729  1.00 77.86 ? 24  ASP A OD2   1 
ATOM   185   N N     . ILE A 1 25  ? 1.517   6.736   -3.652  1.00 78.01 ? 25  ILE A N     1 
ATOM   186   C CA    . ILE A 1 25  ? 0.125   7.080   -3.444  1.00 78.14 ? 25  ILE A CA    1 
ATOM   187   C C     . ILE A 1 25  ? -0.128  6.667   -1.982  1.00 77.89 ? 25  ILE A C     1 
ATOM   188   O O     . ILE A 1 25  ? -1.152  7.033   -1.366  1.00 78.19 ? 25  ILE A O     1 
ATOM   189   C CB    . ILE A 1 25  ? -0.798  6.370   -4.494  1.00 78.16 ? 25  ILE A CB    1 
ATOM   190   C CG1   . ILE A 1 25  ? -2.090  7.184   -4.789  1.00 78.37 ? 25  ILE A CG1   1 
ATOM   191   C CG2   . ILE A 1 25  ? -1.017  4.922   -4.134  1.00 77.62 ? 25  ILE A CG2   1 
ATOM   192   C CD1   . ILE A 1 25  ? -3.234  7.055   -3.751  1.00 79.61 ? 25  ILE A CD1   1 
ATOM   193   N N     . LEU A 1 26  ? 0.850   5.924   -1.451  1.00 76.76 ? 26  LEU A N     1 
ATOM   194   C CA    . LEU A 1 26  ? 0.921   5.522   -0.059  1.00 75.63 ? 26  LEU A CA    1 
ATOM   195   C C     . LEU A 1 26  ? 1.896   6.473   0.660   1.00 75.82 ? 26  LEU A C     1 
ATOM   196   O O     . LEU A 1 26  ? 2.240   6.275   1.846   1.00 76.12 ? 26  LEU A O     1 
ATOM   197   C CB    . LEU A 1 26  ? 1.370   4.058   0.046   1.00 75.35 ? 26  LEU A CB    1 
ATOM   198   C CG    . LEU A 1 26  ? 1.297   3.360   1.406   1.00 74.41 ? 26  LEU A CG    1 
ATOM   199   C CD1   . LEU A 1 26  ? -0.121  2.879   1.719   1.00 73.16 ? 26  LEU A CD1   1 
ATOM   200   C CD2   . LEU A 1 26  ? 2.315   2.230   1.520   1.00 74.60 ? 26  LEU A CD2   1 
ATOM   201   N N     . SER A 1 27  ? 2.343   7.498   -0.071  1.00 74.90 ? 27  SER A N     1 
ATOM   202   C CA    . SER A 1 27  ? 2.985   8.680   0.526   1.00 73.95 ? 27  SER A CA    1 
ATOM   203   C C     . SER A 1 27  ? 2.157   9.918   0.191   1.00 73.06 ? 27  SER A C     1 
ATOM   204   O O     . SER A 1 27  ? 2.631   10.850  -0.488  1.00 72.26 ? 27  SER A O     1 
ATOM   205   C CB    . SER A 1 27  ? 4.426   8.875   0.037   1.00 74.49 ? 27  SER A CB    1 
ATOM   206   O OG    . SER A 1 27  ? 4.883   10.199  0.323   1.00 74.45 ? 27  SER A OG    1 
ATOM   207   N N     . ARG A 1 28  ? 0.919   9.904   0.675   1.00 71.50 ? 28  ARG A N     1 
ATOM   208   C CA    . ARG A 1 28  ? -0.075  10.943  0.398   1.00 70.23 ? 28  ARG A CA    1 
ATOM   209   C C     . ARG A 1 28  ? -1.475  10.369  0.571   1.00 69.19 ? 28  ARG A C     1 
ATOM   210   O O     . ARG A 1 28  ? -2.461  11.120  0.456   1.00 69.67 ? 28  ARG A O     1 
ATOM   211   C CB    . ARG A 1 28  ? 0.097   11.598  -0.993  1.00 70.32 ? 28  ARG A CB    1 
ATOM   212   C CG    . ARG A 1 28  ? -0.442  10.786  -2.216  1.00 71.30 ? 28  ARG A CG    1 
ATOM   213   C CD    . ARG A 1 28  ? 0.170   11.238  -3.555  1.00 69.97 ? 28  ARG A CD    1 
ATOM   214   N NE    . ARG A 1 28  ? 0.663   12.589  -3.419  1.00 71.71 ? 28  ARG A NE    1 
ATOM   215   C CZ    . ARG A 1 28  ? 1.946   12.922  -3.418  1.00 72.64 ? 28  ARG A CZ    1 
ATOM   216   N NH1   . ARG A 1 28  ? 2.875   11.979  -3.597  1.00 73.41 ? 28  ARG A NH1   1 
ATOM   217   N NH2   . ARG A 1 28  ? 2.298   14.193  -3.243  1.00 68.52 ? 28  ARG A NH2   1 
ATOM   218   N N     . GLY A 1 29  ? -1.560  9.059   0.859   1.00 67.45 ? 29  GLY A N     1 
ATOM   219   C CA    . GLY A 1 29  ? -2.843  8.380   1.106   1.00 65.60 ? 29  GLY A CA    1 
ATOM   220   C C     . GLY A 1 29  ? -3.205  8.254   2.588   1.00 64.33 ? 29  GLY A C     1 
ATOM   221   O O     . GLY A 1 29  ? -2.359  8.509   3.462   1.00 64.65 ? 29  GLY A O     1 
ATOM   222   N N     . PRO A 1 30  ? -4.464  7.859   2.891   1.00 63.10 ? 30  PRO A N     1 
ATOM   223   C CA    . PRO A 1 30  ? -4.893  7.688   4.289   1.00 62.13 ? 30  PRO A CA    1 
ATOM   224   C C     . PRO A 1 30  ? -4.204  6.494   4.978   1.00 61.95 ? 30  PRO A C     1 
ATOM   225   O O     . PRO A 1 30  ? -3.707  5.591   4.317   1.00 61.17 ? 30  PRO A O     1 
ATOM   226   C CB    . PRO A 1 30  ? -6.398  7.455   4.177   1.00 62.12 ? 30  PRO A CB    1 
ATOM   227   C CG    . PRO A 1 30  ? -6.642  7.014   2.755   1.00 61.77 ? 30  PRO A CG    1 
ATOM   228   C CD    . PRO A 1 30  ? -5.536  7.547   1.921   1.00 62.80 ? 30  PRO A CD    1 
ATOM   229   N N     . LYS A 1 31  ? -4.175  6.483   6.307   1.00 61.67 ? 31  LYS A N     1 
ATOM   230   C CA    . LYS A 1 31  ? -3.363  5.468   6.991   1.00 60.65 ? 31  LYS A CA    1 
ATOM   231   C C     . LYS A 1 31  ? -3.988  4.081   6.916   1.00 58.83 ? 31  LYS A C     1 
ATOM   232   O O     . LYS A 1 31  ? -3.308  3.058   7.156   1.00 58.37 ? 31  LYS A O     1 
ATOM   233   C CB    . LYS A 1 31  ? -3.080  5.890   8.426   1.00 61.67 ? 31  LYS A CB    1 
ATOM   234   C CG    . LYS A 1 31  ? -1.844  6.767   8.507   1.00 63.00 ? 31  LYS A CG    1 
ATOM   235   C CD    . LYS A 1 31  ? -1.975  7.779   9.617   1.00 65.16 ? 31  LYS A CD    1 
ATOM   236   C CE    . LYS A 1 31  ? -1.210  7.356   10.845  1.00 65.06 ? 31  LYS A CE    1 
ATOM   237   N NZ    . LYS A 1 31  ? 0.207   7.718   10.673  1.00 64.80 ? 31  LYS A NZ    1 
ATOM   238   N N     . SER A 1 32  ? -5.268  4.086   6.530   1.00 56.52 ? 32  SER A N     1 
ATOM   239   C CA    . SER A 1 32  ? -6.095  2.887   6.350   1.00 54.47 ? 32  SER A CA    1 
ATOM   240   C C     . SER A 1 32  ? -5.744  2.149   5.060   1.00 53.13 ? 32  SER A C     1 
ATOM   241   O O     . SER A 1 32  ? -6.032  0.974   4.933   1.00 54.03 ? 32  SER A O     1 
ATOM   242   C CB    . SER A 1 32  ? -7.606  3.253   6.367   1.00 54.07 ? 32  SER A CB    1 
ATOM   243   O OG    . SER A 1 32  ? -7.925  4.226   5.382   1.00 51.72 ? 32  SER A OG    1 
ATOM   244   N N     . MET A 1 33  ? -5.120  2.833   4.118   1.00 50.32 ? 33  MET A N     1 
ATOM   245   C CA    . MET A 1 33  ? -4.775  2.238   2.833   1.00 49.51 ? 33  MET A CA    1 
ATOM   246   C C     . MET A 1 33  ? -3.985  0.938   3.035   1.00 46.89 ? 33  MET A C     1 
ATOM   247   O O     . MET A 1 33  ? -3.187  0.810   3.969   1.00 47.12 ? 33  MET A O     1 
ATOM   248   C CB    . MET A 1 33  ? -4.005  3.268   1.994   1.00 48.37 ? 33  MET A CB    1 
ATOM   249   C CG    . MET A 1 33  ? -3.612  2.911   0.589   1.00 49.87 ? 33  MET A CG    1 
ATOM   250   S SD    . MET A 1 33  ? -3.759  4.396   -0.474  1.00 55.04 ? 33  MET A SD    1 
ATOM   251   C CE    . MET A 1 33  ? -5.541  4.545   -0.439  1.00 42.76 ? 33  MET A CE    1 
ATOM   252   N N     . ILE A 1 34  ? -4.248  -0.053  2.199   1.00 44.36 ? 34  ILE A N     1 
ATOM   253   C CA    . ILE A 1 34  ? -3.373  -1.233  2.183   1.00 41.45 ? 34  ILE A CA    1 
ATOM   254   C C     . ILE A 1 34  ? -2.815  -1.512  0.831   1.00 39.86 ? 34  ILE A C     1 
ATOM   255   O O     . ILE A 1 34  ? -3.519  -1.448  -0.189  1.00 38.94 ? 34  ILE A O     1 
ATOM   256   C CB    . ILE A 1 34  ? -3.905  -2.503  2.864   1.00 41.99 ? 34  ILE A CB    1 
ATOM   257   C CG1   . ILE A 1 34  ? -3.733  -3.708  1.961   1.00 43.47 ? 34  ILE A CG1   1 
ATOM   258   C CG2   . ILE A 1 34  ? -5.302  -2.322  3.617   1.00 38.62 ? 34  ILE A CG2   1 
ATOM   259   C CD1   . ILE A 1 34  ? -3.318  -4.955  2.708   1.00 40.47 ? 34  ILE A CD1   1 
ATOM   260   N N     . SER A 1 35  ? -1.506  -1.728  0.821   1.00 37.74 ? 35  SER A N     1 
ATOM   261   C CA    . SER A 1 35  ? -0.837  -1.959  -0.428  1.00 36.75 ? 35  SER A CA    1 
ATOM   262   C C     . SER A 1 35  ? -0.117  -3.302  -0.448  1.00 35.68 ? 35  SER A C     1 
ATOM   263   O O     . SER A 1 35  ? 0.682   -3.594  0.426   1.00 36.15 ? 35  SER A O     1 
ATOM   264   C CB    . SER A 1 35  ? 0.166   -0.896  -0.773  1.00 34.87 ? 35  SER A CB    1 
ATOM   265   O OG    . SER A 1 35  ? 0.789   -1.349  -1.948  1.00 35.41 ? 35  SER A OG    1 
ATOM   266   N N     . LEU A 1 36  ? -0.368  -4.036  -1.519  1.00 32.99 ? 36  LEU A N     1 
ATOM   267   C CA    . LEU A 1 36  ? 0.305   -5.263  -1.798  1.00 32.46 ? 36  LEU A CA    1 
ATOM   268   C C     . LEU A 1 36  ? 1.045   -5.020  -3.091  1.00 31.25 ? 36  LEU A C     1 
ATOM   269   O O     . LEU A 1 36  ? 1.373   -5.920  -3.755  1.00 31.14 ? 36  LEU A O     1 
ATOM   270   C CB    . LEU A 1 36  ? -0.721  -6.435  -1.928  1.00 31.13 ? 36  LEU A CB    1 
ATOM   271   C CG    . LEU A 1 36  ? -1.588  -6.686  -0.686  1.00 31.84 ? 36  LEU A CG    1 
ATOM   272   C CD1   . LEU A 1 36  ? -2.571  -7.923  -0.870  1.00 34.00 ? 36  LEU A CD1   1 
ATOM   273   C CD2   . LEU A 1 36  ? -0.790  -6.764  0.656   1.00 21.36 ? 36  LEU A CD2   1 
ATOM   274   N N     . ALA A 1 37  ? 1.370   -3.786  -3.414  1.00 32.68 ? 37  ALA A N     1 
ATOM   275   C CA    . ALA A 1 37  ? 1.913   -3.458  -4.759  1.00 33.91 ? 37  ALA A CA    1 
ATOM   276   C C     . ALA A 1 37  ? 3.396   -3.184  -4.813  1.00 34.12 ? 37  ALA A C     1 
ATOM   277   O O     . ALA A 1 37  ? 3.982   -3.146  -5.901  1.00 35.26 ? 37  ALA A O     1 
ATOM   278   C CB    . ALA A 1 37  ? 1.149   -2.253  -5.410  1.00 34.22 ? 37  ALA A CB    1 
ATOM   279   N N     . GLY A 1 38  ? 4.014   -2.958  -3.671  1.00 35.23 ? 38  GLY A N     1 
ATOM   280   C CA    . GLY A 1 38  ? 5.394   -2.541  -3.705  1.00 35.88 ? 38  GLY A CA    1 
ATOM   281   C C     . GLY A 1 38  ? 6.406   -3.671  -3.849  1.00 36.70 ? 38  GLY A C     1 
ATOM   282   O O     . GLY A 1 38  ? 6.086   -4.846  -3.647  1.00 36.02 ? 38  GLY A O     1 
ATOM   283   N N     . GLY A 1 39  ? 7.655   -3.306  -4.128  1.00 36.00 ? 39  GLY A N     1 
ATOM   284   C CA    . GLY A 1 39  ? 8.662   -4.356  -4.373  1.00 35.07 ? 39  GLY A CA    1 
ATOM   285   C C     . GLY A 1 39  ? 9.740   -4.416  -3.326  1.00 33.70 ? 39  GLY A C     1 
ATOM   286   O O     . GLY A 1 39  ? 10.794  -5.000  -3.580  1.00 32.57 ? 39  GLY A O     1 
ATOM   287   N N     . LEU A 1 40  ? 9.468   -3.802  -2.159  1.00 32.58 ? 40  LEU A N     1 
ATOM   288   C CA    . LEU A 1 40  ? 10.446  -3.692  -1.061  1.00 30.65 ? 40  LEU A CA    1 
ATOM   289   C C     . LEU A 1 40  ? 10.377  -4.927  -0.205  1.00 29.47 ? 40  LEU A C     1 
ATOM   290   O O     . LEU A 1 40  ? 9.269   -5.339  0.153   1.00 30.42 ? 40  LEU A O     1 
ATOM   291   C CB    . LEU A 1 40  ? 10.106  -2.517  -0.144  1.00 30.37 ? 40  LEU A CB    1 
ATOM   292   C CG    . LEU A 1 40  ? 9.830   -1.064  -0.598  1.00 30.99 ? 40  LEU A CG    1 
ATOM   293   C CD1   . LEU A 1 40  ? 9.597   -0.246  0.729   1.00 27.69 ? 40  LEU A CD1   1 
ATOM   294   C CD2   . LEU A 1 40  ? 10.967  -0.525  -1.370  1.00 28.01 ? 40  LEU A CD2   1 
ATOM   295   N N     . PRO A 1 41  ? 11.517  -5.491  0.190   1.00 27.53 ? 41  PRO A N     1 
ATOM   296   C CA    . PRO A 1 41  ? 11.419  -6.696  1.094   1.00 28.12 ? 41  PRO A CA    1 
ATOM   297   C C     . PRO A 1 41  ? 11.192  -6.302  2.604   1.00 28.64 ? 41  PRO A C     1 
ATOM   298   O O     . PRO A 1 41  ? 11.351  -5.146  2.958   1.00 27.37 ? 41  PRO A O     1 
ATOM   299   C CB    . PRO A 1 41  ? 12.754  -7.381  0.885   1.00 25.73 ? 41  PRO A CB    1 
ATOM   300   C CG    . PRO A 1 41  ? 13.735  -6.284  0.773   1.00 27.39 ? 41  PRO A CG    1 
ATOM   301   C CD    . PRO A 1 41  ? 12.917  -5.100  -0.004  1.00 28.12 ? 41  PRO A CD    1 
ATOM   302   N N     . ASN A 1 42  ? 10.827  -7.236  3.486   1.00 30.11 ? 42  ASN A N     1 
ATOM   303   C CA    . ASN A 1 42  ? 10.617  -6.862  4.909   1.00 28.52 ? 42  ASN A CA    1 
ATOM   304   C C     . ASN A 1 42  ? 11.987  -6.481  5.540   1.00 29.17 ? 42  ASN A C     1 
ATOM   305   O O     . ASN A 1 42  ? 12.946  -7.340  5.578   1.00 28.90 ? 42  ASN A O     1 
ATOM   306   C CB    . ASN A 1 42  ? 9.945   -8.025  5.600   1.00 27.92 ? 42  ASN A CB    1 
ATOM   307   C CG    . ASN A 1 42  ? 9.312   -7.684  6.909   1.00 29.97 ? 42  ASN A CG    1 
ATOM   308   O OD1   . ASN A 1 42  ? 9.948   -7.162  7.839   1.00 35.72 ? 42  ASN A OD1   1 
ATOM   309   N ND2   . ASN A 1 42  ? 8.083   -8.090  7.048   1.00 30.35 ? 42  ASN A ND2   1 
ATOM   310   N N     . PRO A 1 43  ? 12.115  -5.220  6.016   1.00 28.09 ? 43  PRO A N     1 
ATOM   311   C CA    . PRO A 1 43  ? 13.310  -4.817  6.740   1.00 28.55 ? 43  PRO A CA    1 
ATOM   312   C C     . PRO A 1 43  ? 13.521  -5.444  8.187   1.00 28.12 ? 43  PRO A C     1 
ATOM   313   O O     . PRO A 1 43  ? 14.618  -5.483  8.673   1.00 27.02 ? 43  PRO A O     1 
ATOM   314   C CB    . PRO A 1 43  ? 13.182  -3.273  6.759   1.00 29.55 ? 43  PRO A CB    1 
ATOM   315   C CG    . PRO A 1 43  ? 11.686  -3.019  6.939   1.00 27.05 ? 43  PRO A CG    1 
ATOM   316   C CD    . PRO A 1 43  ? 11.123  -4.100  5.966   1.00 29.97 ? 43  PRO A CD    1 
ATOM   317   N N     . ASN A 1 44  ? 12.517  -6.051  8.787   1.00 29.65 ? 44  ASN A N     1 
ATOM   318   C CA    . ASN A 1 44  ? 12.681  -6.763  10.085  1.00 29.95 ? 44  ASN A CA    1 
ATOM   319   C C     . ASN A 1 44  ? 13.485  -8.031  10.061  1.00 30.35 ? 44  ASN A C     1 
ATOM   320   O O     . ASN A 1 44  ? 13.689  -8.638  11.118  1.00 31.09 ? 44  ASN A O     1 
ATOM   321   C CB    . ASN A 1 44  ? 11.261  -7.135  10.638  1.00 30.65 ? 44  ASN A CB    1 
ATOM   322   C CG    . ASN A 1 44  ? 10.436  -5.900  10.944  1.00 33.10 ? 44  ASN A CG    1 
ATOM   323   O OD1   . ASN A 1 44  ? 10.799  -5.137  11.869  1.00 37.09 ? 44  ASN A OD1   1 
ATOM   324   N ND2   . ASN A 1 44  ? 9.325   -5.696  10.198  1.00 21.22 ? 44  ASN A ND2   1 
ATOM   325   N N     . MET A 1 45  ? 13.893  -8.469  8.864   1.00 29.62 ? 45  MET A N     1 
ATOM   326   C CA    . MET A 1 45  ? 14.619  -9.760  8.671   1.00 27.98 ? 45  MET A CA    1 
ATOM   327   C C     . MET A 1 45  ? 16.094  -9.446  8.629   1.00 28.72 ? 45  MET A C     1 
ATOM   328   O O     . MET A 1 45  ? 16.954  -10.340 8.772   1.00 27.06 ? 45  MET A O     1 
ATOM   329   C CB    . MET A 1 45  ? 14.180  -10.370 7.378   1.00 27.81 ? 45  MET A CB    1 
ATOM   330   C CG    . MET A 1 45  ? 12.746  -10.761 7.418   1.00 25.54 ? 45  MET A CG    1 
ATOM   331   S SD    . MET A 1 45  ? 12.702  -12.253 8.357   1.00 44.88 ? 45  MET A SD    1 
ATOM   332   C CE    . MET A 1 45  ? 11.751  -11.746 9.798   1.00 40.09 ? 45  MET A CE    1 
ATOM   333   N N     . PHE A 1 46  ? 16.381  -8.133  8.495   1.00 26.33 ? 46  PHE A N     1 
ATOM   334   C CA    . PHE A 1 46  ? 17.740  -7.642  8.522   1.00 26.37 ? 46  PHE A CA    1 
ATOM   335   C C     . PHE A 1 46  ? 18.367  -7.726  9.920   1.00 27.87 ? 46  PHE A C     1 
ATOM   336   O O     . PHE A 1 46  ? 17.695  -7.323  10.877  1.00 28.13 ? 46  PHE A O     1 
ATOM   337   C CB    . PHE A 1 46  ? 17.756  -6.210  8.047   1.00 26.60 ? 46  PHE A CB    1 
ATOM   338   C CG    . PHE A 1 46  ? 17.326  -6.054  6.578   1.00 25.10 ? 46  PHE A CG    1 
ATOM   339   C CD1   . PHE A 1 46  ? 17.292  -7.170  5.735   1.00 17.11 ? 46  PHE A CD1   1 
ATOM   340   C CD2   . PHE A 1 46  ? 16.856  -4.845  6.114   1.00 13.61 ? 46  PHE A CD2   1 
ATOM   341   C CE1   . PHE A 1 46  ? 16.881  -7.038  4.360   1.00 26.41 ? 46  PHE A CE1   1 
ATOM   342   C CE2   . PHE A 1 46  ? 16.477  -4.663  4.704   1.00 24.02 ? 46  PHE A CE2   1 
ATOM   343   C CZ    . PHE A 1 46  ? 16.477  -5.807  3.833   1.00 22.43 ? 46  PHE A CZ    1 
ATOM   344   N N     . PRO A 1 47  ? 19.652  -8.243  10.039  1.00 27.86 ? 47  PRO A N     1 
ATOM   345   C CA    . PRO A 1 47  ? 20.280  -8.500  11.338  1.00 28.51 ? 47  PRO A CA    1 
ATOM   346   C C     . PRO A 1 47  ? 20.727  -7.322  12.159  1.00 29.86 ? 47  PRO A C     1 
ATOM   347   O O     . PRO A 1 47  ? 20.745  -7.444  13.394  1.00 32.10 ? 47  PRO A O     1 
ATOM   348   C CB    . PRO A 1 47  ? 21.477  -9.418  10.995  1.00 29.37 ? 47  PRO A CB    1 
ATOM   349   C CG    . PRO A 1 47  ? 21.781  -9.150  9.596   1.00 27.37 ? 47  PRO A CG    1 
ATOM   350   C CD    . PRO A 1 47  ? 20.538  -8.655  8.936   1.00 26.63 ? 47  PRO A CD    1 
ATOM   351   N N     . PHE A 1 48  ? 21.057  -6.198  11.540  1.00 28.34 ? 48  PHE A N     1 
ATOM   352   C CA    . PHE A 1 48  ? 21.520  -5.001  12.301  1.00 27.59 ? 48  PHE A CA    1 
ATOM   353   C C     . PHE A 1 48  ? 20.355  -4.144  12.757  1.00 27.73 ? 48  PHE A C     1 
ATOM   354   O O     . PHE A 1 48  ? 19.468  -3.821  11.956  1.00 25.67 ? 48  PHE A O     1 
ATOM   355   C CB    . PHE A 1 48  ? 22.443  -4.127  11.460  1.00 27.18 ? 48  PHE A CB    1 
ATOM   356   C CG    . PHE A 1 48  ? 23.349  -4.886  10.461  1.00 30.93 ? 48  PHE A CG    1 
ATOM   357   C CD1   . PHE A 1 48  ? 24.633  -5.346  10.837  1.00 27.67 ? 48  PHE A CD1   1 
ATOM   358   C CD2   . PHE A 1 48  ? 22.940  -5.092  9.162   1.00 31.21 ? 48  PHE A CD2   1 
ATOM   359   C CE1   . PHE A 1 48  ? 25.458  -5.968  9.940   1.00 32.46 ? 48  PHE A CE1   1 
ATOM   360   C CE2   . PHE A 1 48  ? 23.826  -5.710  8.227   1.00 37.14 ? 48  PHE A CE2   1 
ATOM   361   C CZ    . PHE A 1 48  ? 25.093  -6.178  8.652   1.00 28.25 ? 48  PHE A CZ    1 
ATOM   362   N N     . LYS A 1 49  ? 20.380  -3.752  14.027  1.00 29.86 ? 49  LYS A N     1 
ATOM   363   C CA    . LYS A 1 49  ? 19.202  -3.306  14.760  1.00 30.02 ? 49  LYS A CA    1 
ATOM   364   C C     . LYS A 1 49  ? 19.355  -1.875  15.274  1.00 31.85 ? 49  LYS A C     1 
ATOM   365   O O     . LYS A 1 49  ? 18.446  -1.072  15.139  1.00 32.87 ? 49  LYS A O     1 
ATOM   366   C CB    . LYS A 1 49  ? 18.890  -4.239  15.935  1.00 30.52 ? 49  LYS A CB    1 
ATOM   367   C CG    . LYS A 1 49  ? 18.478  -5.648  15.571  1.00 32.23 ? 49  LYS A CG    1 
ATOM   368   C CD    . LYS A 1 49  ? 17.393  -5.667  14.543  1.00 31.48 ? 49  LYS A CD    1 
ATOM   369   C CE    . LYS A 1 49  ? 17.067  -7.070  14.093  1.00 32.38 ? 49  LYS A CE    1 
ATOM   370   N NZ    . LYS A 1 49  ? 15.939  -7.103  13.140  1.00 32.87 ? 49  LYS A NZ    1 
ATOM   371   N N     . THR A 1 50  ? 20.500  -1.569  15.873  1.00 31.69 ? 50  THR A N     1 
ATOM   372   C CA    . THR A 1 50  ? 20.870  -0.195  16.183  1.00 32.92 ? 50  THR A CA    1 
ATOM   373   C C     . THR A 1 50  ? 22.281  0.169   15.784  1.00 32.36 ? 50  THR A C     1 
ATOM   374   O O     . THR A 1 50  ? 23.127  -0.683  15.609  1.00 31.75 ? 50  THR A O     1 
ATOM   375   C CB    . THR A 1 50  ? 20.653  0.151   17.666  1.00 33.50 ? 50  THR A CB    1 
ATOM   376   O OG1   . THR A 1 50  ? 21.794  -0.224  18.428  1.00 39.57 ? 50  THR A OG1   1 
ATOM   377   C CG2   . THR A 1 50  ? 19.544  -0.636  18.266  1.00 29.22 ? 50  THR A CG2   1 
ATOM   378   N N     . ALA A 1 51  ? 22.510  1.466   15.656  1.00 35.69 ? 51  ALA A N     1 
ATOM   379   C CA    . ALA A 1 51  ? 23.829  2.027   15.467  1.00 36.90 ? 51  ALA A CA    1 
ATOM   380   C C     . ALA A 1 51  ? 24.081  3.227   16.359  1.00 39.80 ? 51  ALA A C     1 
ATOM   381   O O     . ALA A 1 51  ? 23.227  4.074   16.540  1.00 38.36 ? 51  ALA A O     1 
ATOM   382   C CB    . ALA A 1 51  ? 24.039  2.404   14.031  1.00 38.41 ? 51  ALA A CB    1 
ATOM   383   N N     . VAL A 1 52  ? 25.281  3.286   16.909  1.00 41.77 ? 52  VAL A N     1 
ATOM   384   C CA    . VAL A 1 52  ? 25.750  4.473   17.585  1.00 44.02 ? 52  VAL A CA    1 
ATOM   385   C C     . VAL A 1 52  ? 27.050  4.888   16.940  1.00 44.13 ? 52  VAL A C     1 
ATOM   386   O O     . VAL A 1 52  ? 27.907  4.061   16.702  1.00 48.85 ? 52  VAL A O     1 
ATOM   387   C CB    . VAL A 1 52  ? 26.019  4.204   19.073  1.00 45.03 ? 52  VAL A CB    1 
ATOM   388   C CG1   . VAL A 1 52  ? 26.513  5.454   19.744  1.00 44.68 ? 52  VAL A CG1   1 
ATOM   389   C CG2   . VAL A 1 52  ? 24.797  3.676   19.772  1.00 42.81 ? 52  VAL A CG2   1 
ATOM   390   N N     . ILE A 1 53  ? 27.197  6.167   16.665  1.00 40.63 ? 53  ILE A N     1 
ATOM   391   C CA    . ILE A 1 53  ? 28.331  6.636   15.900  1.00 39.27 ? 53  ILE A CA    1 
ATOM   392   C C     . ILE A 1 53  ? 28.876  7.921   16.457  1.00 37.14 ? 53  ILE A C     1 
ATOM   393   O O     . ILE A 1 53  ? 28.193  8.925   16.443  1.00 36.14 ? 53  ILE A O     1 
ATOM   394   C CB    . ILE A 1 53  ? 27.938  6.900   14.463  1.00 38.75 ? 53  ILE A CB    1 
ATOM   395   C CG1   . ILE A 1 53  ? 27.536  5.629   13.759  1.00 35.85 ? 53  ILE A CG1   1 
ATOM   396   C CG2   . ILE A 1 53  ? 29.059  7.573   13.726  1.00 38.76 ? 53  ILE A CG2   1 
ATOM   397   C CD1   . ILE A 1 53  ? 27.162  5.867   12.359  1.00 38.69 ? 53  ILE A CD1   1 
ATOM   398   N N     . THR A 1 54  ? 30.120  7.907   16.914  1.00 37.48 ? 54  THR A N     1 
ATOM   399   C CA    . THR A 1 54  ? 30.604  9.081   17.613  1.00 37.29 ? 54  THR A CA    1 
ATOM   400   C C     . THR A 1 54  ? 31.241  10.011  16.648  1.00 37.91 ? 54  THR A C     1 
ATOM   401   O O     . THR A 1 54  ? 31.819  9.567   15.649  1.00 37.03 ? 54  THR A O     1 
ATOM   402   C CB    . THR A 1 54  ? 31.526  8.772   18.804  1.00 38.11 ? 54  THR A CB    1 
ATOM   403   O OG1   . THR A 1 54  ? 32.743  8.177   18.360  1.00 39.35 ? 54  THR A OG1   1 
ATOM   404   C CG2   . THR A 1 54  ? 30.824  7.884   19.863  1.00 37.95 ? 54  THR A CG2   1 
ATOM   405   N N     . VAL A 1 55  ? 31.058  11.309  16.937  1.00 37.97 ? 55  VAL A N     1 
ATOM   406   C CA    . VAL A 1 55  ? 31.497  12.408  16.135  1.00 39.17 ? 55  VAL A CA    1 
ATOM   407   C C     . VAL A 1 55  ? 32.441  13.303  16.950  1.00 42.59 ? 55  VAL A C     1 
ATOM   408   O O     . VAL A 1 55  ? 32.214  13.576  18.151  1.00 42.63 ? 55  VAL A O     1 
ATOM   409   C CB    . VAL A 1 55  ? 30.292  13.259  15.558  1.00 38.19 ? 55  VAL A CB    1 
ATOM   410   C CG1   . VAL A 1 55  ? 30.774  14.324  14.586  1.00 36.25 ? 55  VAL A CG1   1 
ATOM   411   C CG2   . VAL A 1 55  ? 29.362  12.407  14.759  1.00 37.54 ? 55  VAL A CG2   1 
ATOM   412   N N     . GLU A 1 56  ? 33.516  13.738  16.293  1.00 45.75 ? 56  GLU A N     1 
ATOM   413   C CA    . GLU A 1 56  ? 34.400  14.752  16.813  1.00 50.02 ? 56  GLU A CA    1 
ATOM   414   C C     . GLU A 1 56  ? 33.807  16.080  16.360  1.00 50.60 ? 56  GLU A C     1 
ATOM   415   O O     . GLU A 1 56  ? 33.701  16.279  15.147  1.00 53.02 ? 56  GLU A O     1 
ATOM   416   C CB    . GLU A 1 56  ? 35.805  14.560  16.188  1.00 48.75 ? 56  GLU A CB    1 
ATOM   417   C CG    . GLU A 1 56  ? 36.820  15.646  16.629  1.00 50.19 ? 56  GLU A CG    1 
ATOM   418   C CD    . GLU A 1 56  ? 38.256  15.303  16.312  1.00 52.29 ? 56  GLU A CD    1 
ATOM   419   O OE1   . GLU A 1 56  ? 38.845  14.486  17.055  1.00 49.48 ? 56  GLU A OE1   1 
ATOM   420   O OE2   . GLU A 1 56  ? 38.801  15.871  15.315  1.00 56.45 ? 56  GLU A OE2   1 
ATOM   421   N N     . ASN A 1 57  ? 33.437  16.950  17.294  1.00 51.32 ? 57  ASN A N     1 
ATOM   422   C CA    . ASN A 1 57  ? 33.205  18.356  16.984  1.00 52.25 ? 57  ASN A CA    1 
ATOM   423   C C     . ASN A 1 57  ? 31.733  18.652  16.719  1.00 51.68 ? 57  ASN A C     1 
ATOM   424   O O     . ASN A 1 57  ? 31.343  19.807  16.552  1.00 51.50 ? 57  ASN A O     1 
ATOM   425   C CB    . ASN A 1 57  ? 34.052  18.785  15.785  1.00 53.41 ? 57  ASN A CB    1 
ATOM   426   C CG    . ASN A 1 57  ? 35.470  19.155  16.175  1.00 57.37 ? 57  ASN A CG    1 
ATOM   427   O OD1   . ASN A 1 57  ? 35.698  19.784  17.209  1.00 59.01 ? 57  ASN A OD1   1 
ATOM   428   N ND2   . ASN A 1 57  ? 36.432  18.765  15.348  1.00 59.08 ? 57  ASN A ND2   1 
ATOM   429   N N     . GLY A 1 58  ? 30.908  17.607  16.741  1.00 50.43 ? 58  GLY A N     1 
ATOM   430   C CA    . GLY A 1 58  ? 29.459  17.725  16.765  1.00 48.65 ? 58  GLY A CA    1 
ATOM   431   C C     . GLY A 1 58  ? 28.924  16.506  17.476  1.00 48.22 ? 58  GLY A C     1 
ATOM   432   O O     . GLY A 1 58  ? 29.723  15.705  17.928  1.00 47.35 ? 58  GLY A O     1 
ATOM   433   N N     . LYS A 1 59  ? 27.609  16.357  17.636  1.00 46.88 ? 59  LYS A N     1 
ATOM   434   C CA    . LYS A 1 59  ? 27.174  15.411  18.644  1.00 45.27 ? 59  LYS A CA    1 
ATOM   435   C C     . LYS A 1 59  ? 26.937  14.027  18.066  1.00 44.27 ? 59  LYS A C     1 
ATOM   436   O O     . LYS A 1 59  ? 26.748  13.867  16.868  1.00 44.40 ? 59  LYS A O     1 
ATOM   437   C CB    . LYS A 1 59  ? 25.912  15.917  19.316  1.00 45.51 ? 59  LYS A CB    1 
ATOM   438   C CG    . LYS A 1 59  ? 24.644  15.548  18.619  1.00 42.91 ? 59  LYS A CG    1 
ATOM   439   C CD    . LYS A 1 59  ? 23.503  15.485  19.599  1.00 48.65 ? 59  LYS A CD    1 
ATOM   440   C CE    . LYS A 1 59  ? 23.943  15.947  20.949  1.00 47.43 ? 59  LYS A CE    1 
ATOM   441   N NZ    . LYS A 1 59  ? 24.725  17.188  20.819  1.00 45.11 ? 59  LYS A NZ    1 
ATOM   442   N N     . THR A 1 60  ? 26.958  13.025  18.931  1.00 41.83 ? 60  THR A N     1 
ATOM   443   C CA    . THR A 1 60  ? 26.776  11.641  18.495  1.00 40.11 ? 60  THR A CA    1 
ATOM   444   C C     . THR A 1 60  ? 25.453  11.270  17.837  1.00 37.83 ? 60  THR A C     1 
ATOM   445   O O     . THR A 1 60  ? 24.405  11.800  18.132  1.00 36.30 ? 60  THR A O     1 
ATOM   446   C CB    . THR A 1 60  ? 27.302  10.502  19.467  1.00 40.46 ? 60  THR A CB    1 
ATOM   447   O OG1   . THR A 1 60  ? 26.282  9.521   19.662  1.00 43.11 ? 60  THR A OG1   1 
ATOM   448   C CG2   . THR A 1 60  ? 27.811  10.983  20.727  1.00 39.40 ? 60  THR A CG2   1 
ATOM   449   N N     . ILE A 1 61  ? 25.557  10.296  16.946  1.00 37.07 ? 61  ILE A N     1 
ATOM   450   C CA    . ILE A 1 61  ? 24.500  9.952   16.053  1.00 35.54 ? 61  ILE A CA    1 
ATOM   451   C C     . ILE A 1 61  ? 23.907  8.611   16.425  1.00 35.25 ? 61  ILE A C     1 
ATOM   452   O O     . ILE A 1 61  ? 24.632  7.607   16.521  1.00 37.30 ? 61  ILE A O     1 
ATOM   453   C CB    . ILE A 1 61  ? 25.089  9.932   14.609  1.00 36.00 ? 61  ILE A CB    1 
ATOM   454   C CG1   . ILE A 1 61  ? 25.587  11.365  14.228  1.00 35.31 ? 61  ILE A CG1   1 
ATOM   455   C CG2   . ILE A 1 61  ? 24.084  9.305   13.607  1.00 33.79 ? 61  ILE A CG2   1 
ATOM   456   C CD1   . ILE A 1 61  ? 25.953  11.560  12.668  1.00 32.51 ? 61  ILE A CD1   1 
ATOM   457   N N     . GLN A 1 62  ? 22.602  8.540   16.562  1.00 34.50 ? 62  GLN A N     1 
ATOM   458   C CA    . GLN A 1 62  ? 21.998  7.325   17.092  1.00 36.54 ? 62  GLN A CA    1 
ATOM   459   C C     . GLN A 1 62  ? 20.971  6.852   16.101  1.00 36.36 ? 62  GLN A C     1 
ATOM   460   O O     . GLN A 1 62  ? 20.170  7.645   15.659  1.00 36.10 ? 62  GLN A O     1 
ATOM   461   C CB    . GLN A 1 62  ? 21.378  7.527   18.523  1.00 36.57 ? 62  GLN A CB    1 
ATOM   462   C CG    . GLN A 1 62  ? 22.380  8.148   19.451  1.00 40.83 ? 62  GLN A CG    1 
ATOM   463   C CD    . GLN A 1 62  ? 22.594  7.484   20.835  1.00 46.07 ? 62  GLN A CD    1 
ATOM   464   O OE1   . GLN A 1 62  ? 21.696  6.864   21.427  1.00 45.67 ? 62  GLN A OE1   1 
ATOM   465   N NE2   . GLN A 1 62  ? 23.813  7.669   21.367  1.00 46.26 ? 62  GLN A NE2   1 
ATOM   466   N N     . PHE A 1 63  ? 21.031  5.576   15.711  1.00 36.18 ? 63  PHE A N     1 
ATOM   467   C CA    . PHE A 1 63  ? 19.966  4.971   14.870  1.00 36.14 ? 63  PHE A CA    1 
ATOM   468   C C     . PHE A 1 63  ? 19.230  4.059   15.771  1.00 34.51 ? 63  PHE A C     1 
ATOM   469   O O     . PHE A 1 63  ? 19.729  3.008   16.124  1.00 33.55 ? 63  PHE A O     1 
ATOM   470   C CB    . PHE A 1 63  ? 20.482  4.103   13.675  1.00 36.12 ? 63  PHE A CB    1 
ATOM   471   C CG    . PHE A 1 63  ? 20.991  4.896   12.475  1.00 39.25 ? 63  PHE A CG    1 
ATOM   472   C CD1   . PHE A 1 63  ? 21.099  6.282   12.510  1.00 37.11 ? 63  PHE A CD1   1 
ATOM   473   C CD2   . PHE A 1 63  ? 21.423  4.223   11.315  1.00 40.97 ? 63  PHE A CD2   1 
ATOM   474   C CE1   . PHE A 1 63  ? 21.612  7.009   11.395  1.00 43.10 ? 63  PHE A CE1   1 
ATOM   475   C CE2   . PHE A 1 63  ? 21.945  4.945   10.197  1.00 46.37 ? 63  PHE A CE2   1 
ATOM   476   C CZ    . PHE A 1 63  ? 22.021  6.335   10.217  1.00 39.72 ? 63  PHE A CZ    1 
ATOM   477   N N     . GLY A 1 64  ? 18.043  4.490   16.156  1.00 35.63 ? 64  GLY A N     1 
ATOM   478   C CA    . GLY A 1 64  ? 17.078  3.639   16.892  1.00 35.36 ? 64  GLY A CA    1 
ATOM   479   C C     . GLY A 1 64  ? 16.557  2.575   15.948  1.00 35.56 ? 64  GLY A C     1 
ATOM   480   O O     . GLY A 1 64  ? 16.954  2.510   14.763  1.00 34.54 ? 64  GLY A O     1 
ATOM   481   N N     . GLU A 1 65  ? 15.695  1.734   16.509  1.00 36.15 ? 65  GLU A N     1 
ATOM   482   C CA    . GLU A 1 65  ? 15.134  0.560   15.874  1.00 36.89 ? 65  GLU A CA    1 
ATOM   483   C C     . GLU A 1 65  ? 14.467  0.970   14.559  1.00 35.87 ? 65  GLU A C     1 
ATOM   484   O O     . GLU A 1 65  ? 14.822  0.408   13.510  1.00 31.98 ? 65  GLU A O     1 
ATOM   485   C CB    . GLU A 1 65  ? 14.120  -0.125  16.781  1.00 38.15 ? 65  GLU A CB    1 
ATOM   486   C CG    . GLU A 1 65  ? 14.330  0.105   18.329  1.00 45.31 ? 65  GLU A CG    1 
ATOM   487   C CD    . GLU A 1 65  ? 15.418  -0.774  18.945  1.00 49.63 ? 65  GLU A CD    1 
ATOM   488   O OE1   . GLU A 1 65  ? 16.100  -0.324  19.895  1.00 50.28 ? 65  GLU A OE1   1 
ATOM   489   O OE2   . GLU A 1 65  ? 15.610  -1.912  18.464  1.00 54.98 ? 65  GLU A OE2   1 
ATOM   490   N N     . GLU A 1 66  ? 13.570  1.988   14.627  1.00 36.20 ? 66  GLU A N     1 
ATOM   491   C CA    . GLU A 1 66  ? 12.853  2.517   13.445  1.00 36.23 ? 66  GLU A CA    1 
ATOM   492   C C     . GLU A 1 66  ? 13.782  3.108   12.411  1.00 35.07 ? 66  GLU A C     1 
ATOM   493   O O     . GLU A 1 66  ? 13.755  2.677   11.231  1.00 32.45 ? 66  GLU A O     1 
ATOM   494   C CB    . GLU A 1 66  ? 11.637  3.425   13.740  1.00 36.85 ? 66  GLU A CB    1 
ATOM   495   C CG    . GLU A 1 66  ? 10.354  2.603   14.222  1.00 44.37 ? 66  GLU A CG    1 
ATOM   496   C CD    . GLU A 1 66  ? 10.050  1.265   13.457  1.00 46.83 ? 66  GLU A CD    1 
ATOM   497   O OE1   . GLU A 1 66  ? 9.908   1.226   12.209  1.00 50.26 ? 66  GLU A OE1   1 
ATOM   498   O OE2   . GLU A 1 66  ? 9.973   0.219   14.125  1.00 53.12 ? 66  GLU A OE2   1 
ATOM   499   N N     . MET A 1 67  ? 14.591  4.080   12.820  1.00 33.48 ? 67  MET A N     1 
ATOM   500   C CA    . MET A 1 67  ? 15.744  4.501   12.035  1.00 32.76 ? 67  MET A CA    1 
ATOM   501   C C     . MET A 1 67  ? 16.375  3.319   11.309  1.00 32.53 ? 67  MET A C     1 
ATOM   502   O O     . MET A 1 67  ? 16.200  3.155   10.101  1.00 31.21 ? 67  MET A O     1 
ATOM   503   C CB    . MET A 1 67  ? 16.781  5.183   12.930  1.00 32.87 ? 67  MET A CB    1 
ATOM   504   C CG    . MET A 1 67  ? 17.440  6.399   12.299  1.00 38.51 ? 67  MET A CG    1 
ATOM   505   S SD    . MET A 1 67  ? 16.647  6.902   10.760  1.00 42.89 ? 67  MET A SD    1 
ATOM   506   C CE    . MET A 1 67  ? 15.669  8.293   11.323  1.00 45.81 ? 67  MET A CE    1 
ATOM   507   N N     . MET A 1 68  ? 17.109  2.498   12.052  1.00 30.48 ? 68  MET A N     1 
ATOM   508   C CA    . MET A 1 68  ? 17.931  1.439   11.441  1.00 30.16 ? 68  MET A CA    1 
ATOM   509   C C     . MET A 1 68  ? 17.122  0.803   10.363  1.00 30.54 ? 68  MET A C     1 
ATOM   510   O O     . MET A 1 68  ? 17.577  0.621   9.228   1.00 29.22 ? 68  MET A O     1 
ATOM   511   C CB    . MET A 1 68  ? 18.349  0.408   12.493  1.00 31.90 ? 68  MET A CB    1 
ATOM   512   C CG    . MET A 1 68  ? 19.367  -0.601  12.142  1.00 31.72 ? 68  MET A CG    1 
ATOM   513   S SD    . MET A 1 68  ? 20.839  0.137   11.473  1.00 39.30 ? 68  MET A SD    1 
ATOM   514   C CE    . MET A 1 68  ? 21.329  1.215   12.778  1.00 38.85 ? 68  MET A CE    1 
ATOM   515   N N     . LYS A 1 69  ? 15.886  0.470   10.667  1.00 30.60 ? 69  LYS A N     1 
ATOM   516   C CA    . LYS A 1 69  ? 15.132  -0.163  9.593   1.00 31.92 ? 69  LYS A CA    1 
ATOM   517   C C     . LYS A 1 69  ? 15.204  0.704   8.307   1.00 32.50 ? 69  LYS A C     1 
ATOM   518   O O     . LYS A 1 69  ? 15.427  0.185   7.206   1.00 33.41 ? 69  LYS A O     1 
ATOM   519   C CB    . LYS A 1 69  ? 13.714  -0.597  10.043  1.00 30.46 ? 69  LYS A CB    1 
ATOM   520   C CG    . LYS A 1 69  ? 13.819  -1.754  11.093  1.00 33.13 ? 69  LYS A CG    1 
ATOM   521   C CD    . LYS A 1 69  ? 12.530  -2.342  11.595  1.00 34.57 ? 69  LYS A CD    1 
ATOM   522   C CE    . LYS A 1 69  ? 11.508  -1.312  11.963  1.00 41.52 ? 69  LYS A CE    1 
ATOM   523   N NZ    . LYS A 1 69  ? 10.381  -1.986  12.726  1.00 42.99 ? 69  LYS A NZ    1 
ATOM   524   N N     . ARG A 1 70  ? 15.107  2.026   8.456   1.00 31.14 ? 70  ARG A N     1 
ATOM   525   C CA    . ARG A 1 70  ? 15.101  2.879   7.292   1.00 31.82 ? 70  ARG A CA    1 
ATOM   526   C C     . ARG A 1 70  ? 16.514  2.959   6.668   1.00 31.97 ? 70  ARG A C     1 
ATOM   527   O O     . ARG A 1 70  ? 16.677  3.068   5.445   1.00 31.40 ? 70  ARG A O     1 
ATOM   528   C CB    . ARG A 1 70  ? 14.536  4.263   7.624   1.00 30.53 ? 70  ARG A CB    1 
ATOM   529   C CG    . ARG A 1 70  ? 14.545  5.226   6.494   1.00 32.42 ? 70  ARG A CG    1 
ATOM   530   C CD    . ARG A 1 70  ? 14.294  6.706   7.023   1.00 32.47 ? 70  ARG A CD    1 
ATOM   531   N NE    . ARG A 1 70  ? 14.487  7.600   5.899   1.00 32.75 ? 70  ARG A NE    1 
ATOM   532   C CZ    . ARG A 1 70  ? 14.649  8.905   5.964   1.00 31.90 ? 70  ARG A CZ    1 
ATOM   533   N NH1   . ARG A 1 70  ? 14.578  9.547   7.139   1.00 29.61 ? 70  ARG A NH1   1 
ATOM   534   N NH2   . ARG A 1 70  ? 14.848  9.552   4.811   1.00 30.93 ? 70  ARG A NH2   1 
ATOM   535   N N     . ALA A 1 71  ? 17.534  2.880   7.528   1.00 31.73 ? 71  ALA A N     1 
ATOM   536   C CA    . ALA A 1 71  ? 18.901  2.902   7.059   1.00 31.63 ? 71  ALA A CA    1 
ATOM   537   C C     . ALA A 1 71  ? 19.224  1.656   6.244   1.00 31.20 ? 71  ALA A C     1 
ATOM   538   O O     . ALA A 1 71  ? 20.057  1.709   5.342   1.00 33.01 ? 71  ALA A O     1 
ATOM   539   C CB    . ALA A 1 71  ? 19.895  3.090   8.219   1.00 30.06 ? 71  ALA A CB    1 
ATOM   540   N N     . LEU A 1 72  ? 18.531  0.574   6.520   1.00 29.75 ? 72  LEU A N     1 
ATOM   541   C CA    . LEU A 1 72  ? 18.792  -0.664  5.838   1.00 30.60 ? 72  LEU A CA    1 
ATOM   542   C C     . LEU A 1 72  ? 17.850  -0.921  4.657   1.00 30.13 ? 72  LEU A C     1 
ATOM   543   O O     . LEU A 1 72  ? 17.913  -2.054  4.122   1.00 29.38 ? 72  LEU A O     1 
ATOM   544   C CB    . LEU A 1 72  ? 18.674  -1.867  6.837   1.00 29.01 ? 72  LEU A CB    1 
ATOM   545   C CG    . LEU A 1 72  ? 19.728  -1.950  7.958   1.00 31.20 ? 72  LEU A CG    1 
ATOM   546   C CD1   . LEU A 1 72  ? 19.572  -3.184  8.944   1.00 31.13 ? 72  LEU A CD1   1 
ATOM   547   C CD2   . LEU A 1 72  ? 21.103  -1.996  7.354   1.00 23.72 ? 72  LEU A CD2   1 
ATOM   548   N N     . GLN A 1 73  ? 16.949  0.048   4.329   1.00 27.92 ? 73  GLN A N     1 
ATOM   549   C CA    . GLN A 1 73  ? 15.907  -0.175  3.334   1.00 27.17 ? 73  GLN A CA    1 
ATOM   550   C C     . GLN A 1 73  ? 16.244  0.532   1.956   1.00 29.01 ? 73  GLN A C     1 
ATOM   551   O O     . GLN A 1 73  ? 17.162  1.330   1.901   1.00 30.57 ? 73  GLN A O     1 
ATOM   552   C CB    . GLN A 1 73  ? 14.517  0.114   3.906   1.00 25.68 ? 73  GLN A CB    1 
ATOM   553   C CG    . GLN A 1 73  ? 13.355  -0.162  2.996   1.00 25.28 ? 73  GLN A CG    1 
ATOM   554   C CD    . GLN A 1 73  ? 13.274  -1.628  2.425   1.00 23.32 ? 73  GLN A CD    1 
ATOM   555   O OE1   . GLN A 1 73  ? 14.024  -2.067  1.510   1.00 27.60 ? 73  GLN A OE1   1 
ATOM   556   N NE2   . GLN A 1 73  ? 12.325  -2.353  2.949   1.00 21.51 ? 73  GLN A NE2   1 
ATOM   557   N N     . TYR A 1 74  ? 15.574  0.236   0.856   1.00 27.93 ? 74  TYR A N     1 
ATOM   558   C CA    . TYR A 1 74  ? 15.759  1.112   -0.316  1.00 28.37 ? 74  TYR A CA    1 
ATOM   559   C C     . TYR A 1 74  ? 15.238  2.545   -0.073  1.00 29.05 ? 74  TYR A C     1 
ATOM   560   O O     . TYR A 1 74  ? 14.332  2.799   0.751   1.00 28.61 ? 74  TYR A O     1 
ATOM   561   C CB    . TYR A 1 74  ? 14.916  0.577   -1.469  1.00 28.72 ? 74  TYR A CB    1 
ATOM   562   C CG    . TYR A 1 74  ? 15.393  -0.714  -2.042  1.00 26.66 ? 74  TYR A CG    1 
ATOM   563   C CD1   . TYR A 1 74  ? 16.562  -0.758  -2.803  1.00 24.30 ? 74  TYR A CD1   1 
ATOM   564   C CD2   . TYR A 1 74  ? 14.601  -1.911  -1.902  1.00 28.73 ? 74  TYR A CD2   1 
ATOM   565   C CE1   . TYR A 1 74  ? 17.002  -1.992  -3.396  1.00 26.51 ? 74  TYR A CE1   1 
ATOM   566   C CE2   . TYR A 1 74  ? 14.974  -3.114  -2.563  1.00 22.16 ? 74  TYR A CE2   1 
ATOM   567   C CZ    . TYR A 1 74  ? 16.198  -3.141  -3.265  1.00 25.13 ? 74  TYR A CZ    1 
ATOM   568   O OH    . TYR A 1 74  ? 16.633  -4.308  -3.872  1.00 26.39 ? 74  TYR A OH    1 
ATOM   569   N N     . SER A 1 75  ? 15.778  3.470   -0.850  1.00 29.57 ? 75  SER A N     1 
ATOM   570   C CA    . SER A 1 75  ? 15.459  4.897   -0.692  1.00 29.08 ? 75  SER A CA    1 
ATOM   571   C C     . SER A 1 75  ? 15.384  5.547   -2.110  1.00 29.21 ? 75  SER A C     1 
ATOM   572   O O     . SER A 1 75  ? 15.739  4.897   -3.092  1.00 29.44 ? 75  SER A O     1 
ATOM   573   C CB    . SER A 1 75  ? 16.481  5.543   0.224   1.00 27.15 ? 75  SER A CB    1 
ATOM   574   O OG    . SER A 1 75  ? 17.781  5.524   -0.322  1.00 24.96 ? 75  SER A OG    1 
ATOM   575   N N     . PRO A 1 76  ? 14.887  6.804   -2.232  1.00 28.38 ? 76  PRO A N     1 
ATOM   576   C CA    . PRO A 1 76  ? 14.816  7.369   -3.626  1.00 26.51 ? 76  PRO A CA    1 
ATOM   577   C C     . PRO A 1 76  ? 16.087  7.323   -4.480  1.00 26.74 ? 76  PRO A C     1 
ATOM   578   O O     . PRO A 1 76  ? 17.206  7.424   -3.977  1.00 28.36 ? 76  PRO A O     1 
ATOM   579   C CB    . PRO A 1 76  ? 14.327  8.824   -3.380  1.00 25.12 ? 76  PRO A CB    1 
ATOM   580   C CG    . PRO A 1 76  ? 13.551  8.746   -2.008  1.00 25.04 ? 76  PRO A CG    1 
ATOM   581   C CD    . PRO A 1 76  ? 14.281  7.704   -1.204  1.00 27.94 ? 76  PRO A CD    1 
ATOM   582   N N     . SER A 1 77  ? 15.951  7.241   -5.804  1.00 27.44 ? 77  SER A N     1 
ATOM   583   C CA    . SER A 1 77  ? 17.151  7.184   -6.699  1.00 27.57 ? 77  SER A CA    1 
ATOM   584   C C     . SER A 1 77  ? 18.154  8.271   -6.552  1.00 27.31 ? 77  SER A C     1 
ATOM   585   O O     . SER A 1 77  ? 19.385  8.039   -6.618  1.00 29.63 ? 77  SER A O     1 
ATOM   586   C CB    . SER A 1 77  ? 16.726  7.242   -8.144  1.00 27.04 ? 77  SER A CB    1 
ATOM   587   O OG    . SER A 1 77  ? 15.439  6.685   -8.279  1.00 32.22 ? 77  SER A OG    1 
ATOM   588   N N     . ALA A 1 78  ? 17.645  9.483   -6.403  1.00 25.75 ? 78  ALA A N     1 
ATOM   589   C CA    . ALA A 1 78  ? 18.429  10.670  -6.444  1.00 23.97 ? 78  ALA A CA    1 
ATOM   590   C C     . ALA A 1 78  ? 18.952  11.044  -5.039  1.00 25.28 ? 78  ALA A C     1 
ATOM   591   O O     . ALA A 1 78  ? 19.788  11.951  -4.924  1.00 25.13 ? 78  ALA A O     1 
ATOM   592   C CB    . ALA A 1 78  ? 17.522  11.816  -7.060  1.00 25.67 ? 78  ALA A CB    1 
ATOM   593   N N     . GLY A 1 79  ? 18.438  10.364  -3.998  1.00 23.27 ? 79  GLY A N     1 
ATOM   594   C CA    . GLY A 1 79  ? 18.899  10.534  -2.657  1.00 23.97 ? 79  GLY A CA    1 
ATOM   595   C C     . GLY A 1 79  ? 17.772  10.663  -1.665  1.00 23.41 ? 79  GLY A C     1 
ATOM   596   O O     . GLY A 1 79  ? 16.658  10.842  -1.997  1.00 25.01 ? 79  GLY A O     1 
ATOM   597   N N     . ILE A 1 80  ? 18.073  10.630  -0.405  1.00 26.31 ? 80  ILE A N     1 
ATOM   598   C CA    . ILE A 1 80  ? 17.057  10.955  0.577   1.00 26.92 ? 80  ILE A CA    1 
ATOM   599   C C     . ILE A 1 80  ? 16.742  12.476  0.607   1.00 29.12 ? 80  ILE A C     1 
ATOM   600   O O     . ILE A 1 80  ? 17.606  13.349  0.408   1.00 27.76 ? 80  ILE A O     1 
ATOM   601   C CB    . ILE A 1 80  ? 17.486  10.428  1.885   1.00 27.08 ? 80  ILE A CB    1 
ATOM   602   C CG1   . ILE A 1 80  ? 18.659  11.264  2.400   1.00 25.84 ? 80  ILE A CG1   1 
ATOM   603   C CG2   . ILE A 1 80  ? 17.759  8.858   1.703   1.00 28.69 ? 80  ILE A CG2   1 
ATOM   604   C CD1   . ILE A 1 80  ? 19.033  11.033  3.806   1.00 21.50 ? 80  ILE A CD1   1 
ATOM   605   N N     . PRO A 1 81  ? 15.477  12.768  0.814   1.00 30.98 ? 81  PRO A N     1 
ATOM   606   C CA    . PRO A 1 81  ? 14.849  14.060  0.748   1.00 31.71 ? 81  PRO A CA    1 
ATOM   607   C C     . PRO A 1 81  ? 15.578  15.054  1.626   1.00 33.24 ? 81  PRO A C     1 
ATOM   608   O O     . PRO A 1 81  ? 16.022  16.071  1.092   1.00 35.55 ? 81  PRO A O     1 
ATOM   609   C CB    . PRO A 1 81  ? 13.385  13.784  1.197   1.00 32.80 ? 81  PRO A CB    1 
ATOM   610   C CG    . PRO A 1 81  ? 13.387  12.484  1.938   1.00 31.11 ? 81  PRO A CG    1 
ATOM   611   C CD    . PRO A 1 81  ? 14.543  11.681  1.242   1.00 31.85 ? 81  PRO A CD    1 
ATOM   612   N N     . GLU A 1 82  ? 15.856  14.720  2.886   1.00 34.16 ? 82  GLU A N     1 
ATOM   613   C CA    . GLU A 1 82  ? 16.564  15.610  3.793   1.00 34.48 ? 82  GLU A CA    1 
ATOM   614   C C     . GLU A 1 82  ? 17.995  16.012  3.449   1.00 34.40 ? 82  GLU A C     1 
ATOM   615   O O     . GLU A 1 82  ? 18.412  17.105  3.785   1.00 33.84 ? 82  GLU A O     1 
ATOM   616   C CB    . GLU A 1 82  ? 16.462  15.157  5.267   1.00 35.90 ? 82  GLU A CB    1 
ATOM   617   C CG    . GLU A 1 82  ? 16.992  13.781  5.655   1.00 38.28 ? 82  GLU A CG    1 
ATOM   618   C CD    . GLU A 1 82  ? 15.954  12.679  5.502   1.00 37.68 ? 82  GLU A CD    1 
ATOM   619   O OE1   . GLU A 1 82  ? 15.445  12.444  4.405   1.00 35.85 ? 82  GLU A OE1   1 
ATOM   620   O OE2   . GLU A 1 82  ? 15.637  12.033  6.500   1.00 41.47 ? 82  GLU A OE2   1 
ATOM   621   N N     . LEU A 1 83  ? 18.716  15.142  2.755   1.00 34.10 ? 83  LEU A N     1 
ATOM   622   C CA    . LEU A 1 83  ? 20.006  15.413  2.268   1.00 32.89 ? 83  LEU A CA    1 
ATOM   623   C C     . LEU A 1 83  ? 19.885  16.100  0.907   1.00 32.44 ? 83  LEU A C     1 
ATOM   624   O O     . LEU A 1 83  ? 20.604  17.053  0.669   1.00 28.39 ? 83  LEU A O     1 
ATOM   625   C CB    . LEU A 1 83  ? 20.930  14.179  2.310   1.00 34.81 ? 83  LEU A CB    1 
ATOM   626   C CG    . LEU A 1 83  ? 22.293  14.230  1.542   1.00 37.37 ? 83  LEU A CG    1 
ATOM   627   C CD1   . LEU A 1 83  ? 23.437  15.008  2.350   1.00 34.90 ? 83  LEU A CD1   1 
ATOM   628   C CD2   . LEU A 1 83  ? 22.772  12.843  1.000   1.00 31.96 ? 83  LEU A CD2   1 
ATOM   629   N N     . LEU A 1 84  ? 18.915  15.725  0.071   1.00 32.19 ? 84  LEU A N     1 
ATOM   630   C CA    . LEU A 1 84  ? 18.667  16.563  -1.139  1.00 32.02 ? 84  LEU A CA    1 
ATOM   631   C C     . LEU A 1 84  ? 18.311  18.044  -0.766  1.00 32.99 ? 84  LEU A C     1 
ATOM   632   O O     . LEU A 1 84  ? 18.841  18.979  -1.390  1.00 33.31 ? 84  LEU A O     1 
ATOM   633   C CB    . LEU A 1 84  ? 17.530  16.029  -2.021  1.00 30.48 ? 84  LEU A CB    1 
ATOM   634   C CG    . LEU A 1 84  ? 17.688  14.845  -2.949  1.00 27.41 ? 84  LEU A CG    1 
ATOM   635   C CD1   . LEU A 1 84  ? 16.376  14.599  -3.732  1.00 23.21 ? 84  LEU A CD1   1 
ATOM   636   C CD2   . LEU A 1 84  ? 18.777  15.055  -3.902  1.00 18.39 ? 84  LEU A CD2   1 
ATOM   637   N N     . SER A 1 85  ? 17.434  18.240  0.230   1.00 31.94 ? 85  SER A N     1 
ATOM   638   C CA    . SER A 1 85  ? 17.053  19.568  0.632   1.00 33.30 ? 85  SER A CA    1 
ATOM   639   C C     . SER A 1 85  ? 18.262  20.295  1.165   1.00 33.87 ? 85  SER A C     1 
ATOM   640   O O     . SER A 1 85  ? 18.489  21.420  0.730   1.00 36.87 ? 85  SER A O     1 
ATOM   641   C CB    . SER A 1 85  ? 15.927  19.594  1.642   1.00 32.30 ? 85  SER A CB    1 
ATOM   642   O OG    . SER A 1 85  ? 16.325  18.874  2.807   1.00 38.11 ? 85  SER A OG    1 
ATOM   643   N N     . TRP A 1 86  ? 19.078  19.646  2.010   1.00 34.88 ? 86  TRP A N     1 
ATOM   644   C CA    . TRP A 1 86  ? 20.264  20.287  2.560   1.00 34.31 ? 86  TRP A CA    1 
ATOM   645   C C     . TRP A 1 86  ? 21.238  20.668  1.510   1.00 33.42 ? 86  TRP A C     1 
ATOM   646   O O     . TRP A 1 86  ? 21.643  21.833  1.467   1.00 35.69 ? 86  TRP A O     1 
ATOM   647   C CB    . TRP A 1 86  ? 20.981  19.586  3.752   1.00 35.02 ? 86  TRP A CB    1 
ATOM   648   C CG    . TRP A 1 86  ? 22.504  20.166  3.968   1.00 36.16 ? 86  TRP A CG    1 
ATOM   649   C CD1   . TRP A 1 86  ? 23.578  20.109  3.074   1.00 35.22 ? 86  TRP A CD1   1 
ATOM   650   C CD2   . TRP A 1 86  ? 23.012  20.814  5.105   1.00 36.72 ? 86  TRP A CD2   1 
ATOM   651   N NE1   . TRP A 1 86  ? 24.705  20.664  3.601   1.00 33.36 ? 86  TRP A NE1   1 
ATOM   652   C CE2   . TRP A 1 86  ? 24.394  21.119  4.848   1.00 38.79 ? 86  TRP A CE2   1 
ATOM   653   C CE3   . TRP A 1 86  ? 22.460  21.170  6.313   1.00 34.33 ? 86  TRP A CE3   1 
ATOM   654   C CZ2   . TRP A 1 86  ? 25.205  21.749  5.769   1.00 38.00 ? 86  TRP A CZ2   1 
ATOM   655   C CZ3   . TRP A 1 86  ? 23.266  21.811  7.219   1.00 37.52 ? 86  TRP A CZ3   1 
ATOM   656   C CH2   . TRP A 1 86  ? 24.627  22.086  6.952   1.00 37.76 ? 86  TRP A CH2   1 
ATOM   657   N N     . LEU A 1 87  ? 21.631  19.752  0.654   1.00 31.23 ? 87  LEU A N     1 
ATOM   658   C CA    . LEU A 1 87  ? 22.553  20.150  -0.459  1.00 29.82 ? 87  LEU A CA    1 
ATOM   659   C C     . LEU A 1 87  ? 22.095  21.287  -1.387  1.00 27.89 ? 87  LEU A C     1 
ATOM   660   O O     . LEU A 1 87  ? 22.864  22.166  -1.713  1.00 30.53 ? 87  LEU A O     1 
ATOM   661   C CB    . LEU A 1 87  ? 22.955  18.921  -1.284  1.00 28.73 ? 87  LEU A CB    1 
ATOM   662   C CG    . LEU A 1 87  ? 24.067  17.983  -0.828  1.00 31.42 ? 87  LEU A CG    1 
ATOM   663   C CD1   . LEU A 1 87  ? 24.590  18.184  0.601   1.00 35.41 ? 87  LEU A CD1   1 
ATOM   664   C CD2   . LEU A 1 87  ? 23.515  16.583  -1.011  1.00 30.34 ? 87  LEU A CD2   1 
ATOM   665   N N     . LYS A 1 88  ? 20.881  21.213  -1.893  1.00 28.72 ? 88  LYS A N     1 
ATOM   666   C CA    . LYS A 1 88  ? 20.239  22.267  -2.734  1.00 28.26 ? 88  LYS A CA    1 
ATOM   667   C C     . LYS A 1 88  ? 20.288  23.605  -2.030  1.00 30.01 ? 88  LYS A C     1 
ATOM   668   O O     . LYS A 1 88  ? 20.720  24.626  -2.582  1.00 30.16 ? 88  LYS A O     1 
ATOM   669   C CB    . LYS A 1 88  ? 18.767  21.911  -2.975  1.00 25.43 ? 88  LYS A CB    1 
ATOM   670   C CG    . LYS A 1 88  ? 18.614  20.566  -3.677  1.00 27.30 ? 88  LYS A CG    1 
ATOM   671   C CD    . LYS A 1 88  ? 17.248  20.354  -4.362  1.00 28.56 ? 88  LYS A CD    1 
ATOM   672   C CE    . LYS A 1 88  ? 17.437  19.408  -5.636  1.00 30.72 ? 88  LYS A CE    1 
ATOM   673   N NZ    . LYS A 1 88  ? 16.103  18.958  -6.129  1.00 25.20 ? 88  LYS A NZ    1 
ATOM   674   N N     . GLN A 1 89  ? 19.923  23.572  -0.758  1.00 30.89 ? 89  GLN A N     1 
ATOM   675   C CA    . GLN A 1 89  ? 19.979  24.789  -0.023  1.00 31.93 ? 89  GLN A CA    1 
ATOM   676   C C     . GLN A 1 89  ? 21.416  25.237  0.097   1.00 30.58 ? 89  GLN A C     1 
ATOM   677   O O     . GLN A 1 89  ? 21.683  26.448  0.077   1.00 30.79 ? 89  GLN A O     1 
ATOM   678   C CB    . GLN A 1 89  ? 19.253  24.696  1.353   1.00 31.91 ? 89  GLN A CB    1 
ATOM   679   C CG    . GLN A 1 89  ? 19.208  26.170  2.014   1.00 37.85 ? 89  GLN A CG    1 
ATOM   680   C CD    . GLN A 1 89  ? 18.582  27.190  1.030   1.00 40.12 ? 89  GLN A CD    1 
ATOM   681   O OE1   . GLN A 1 89  ? 19.219  28.178  0.625   1.00 38.60 ? 89  GLN A OE1   1 
ATOM   682   N NE2   . GLN A 1 89  ? 17.319  26.930  0.629   1.00 43.22 ? 89  GLN A NE2   1 
ATOM   683   N N     . LEU A 1 90  ? 22.345  24.287  0.226   1.00 30.54 ? 90  LEU A N     1 
ATOM   684   C CA    . LEU A 1 90  ? 23.770  24.630  0.278   1.00 31.57 ? 90  LEU A CA    1 
ATOM   685   C C     . LEU A 1 90  ? 24.305  25.276  -1.032  1.00 33.07 ? 90  LEU A C     1 
ATOM   686   O O     . LEU A 1 90  ? 25.076  26.260  -1.020  1.00 33.56 ? 90  LEU A O     1 
ATOM   687   C CB    . LEU A 1 90  ? 24.612  23.430  0.790   1.00 32.88 ? 90  LEU A CB    1 
ATOM   688   C CG    . LEU A 1 90  ? 26.090  23.715  0.896   1.00 30.59 ? 90  LEU A CG    1 
ATOM   689   C CD1   . LEU A 1 90  ? 26.554  24.159  2.309   1.00 29.35 ? 90  LEU A CD1   1 
ATOM   690   C CD2   . LEU A 1 90  ? 26.824  22.517  0.393   1.00 35.45 ? 90  LEU A CD2   1 
ATOM   691   N N     . GLN A 1 91  ? 23.866  24.777  -2.166  1.00 33.35 ? 91  GLN A N     1 
ATOM   692   C CA    . GLN A 1 91  ? 24.293  25.360  -3.408  1.00 34.44 ? 91  GLN A CA    1 
ATOM   693   C C     . GLN A 1 91  ? 23.832  26.818  -3.565  1.00 37.27 ? 91  GLN A C     1 
ATOM   694   O O     . GLN A 1 91  ? 24.581  27.720  -4.049  1.00 37.06 ? 91  GLN A O     1 
ATOM   695   C CB    . GLN A 1 91  ? 23.768  24.517  -4.578  1.00 35.29 ? 91  GLN A CB    1 
ATOM   696   C CG    . GLN A 1 91  ? 24.322  23.057  -4.670  1.00 32.85 ? 91  GLN A CG    1 
ATOM   697   C CD    . GLN A 1 91  ? 25.831  22.964  -4.823  1.00 33.23 ? 91  GLN A CD    1 
ATOM   698   O OE1   . GLN A 1 91  ? 26.341  22.557  -5.866  1.00 37.69 ? 91  GLN A OE1   1 
ATOM   699   N NE2   . GLN A 1 91  ? 26.552  23.343  -3.799  1.00 27.14 ? 91  GLN A NE2   1 
ATOM   700   N N     . ILE A 1 92  ? 22.613  27.063  -3.108  1.00 38.61 ? 92  ILE A N     1 
ATOM   701   C CA    . ILE A 1 92  ? 22.024  28.382  -3.215  1.00 40.24 ? 92  ILE A CA    1 
ATOM   702   C C     . ILE A 1 92  ? 22.749  29.394  -2.342  1.00 41.62 ? 92  ILE A C     1 
ATOM   703   O O     . ILE A 1 92  ? 23.122  30.495  -2.797  1.00 42.29 ? 92  ILE A O     1 
ATOM   704   C CB    . ILE A 1 92  ? 20.570  28.361  -2.861  1.00 40.11 ? 92  ILE A CB    1 
ATOM   705   C CG1   . ILE A 1 92  ? 19.838  27.394  -3.836  1.00 38.77 ? 92  ILE A CG1   1 
ATOM   706   C CG2   . ILE A 1 92  ? 20.063  29.847  -2.991  1.00 40.71 ? 92  ILE A CG2   1 
ATOM   707   C CD1   . ILE A 1 92  ? 18.331  27.203  -3.598  1.00 31.89 ? 92  ILE A CD1   1 
ATOM   708   N N     . LYS A 1 93  ? 22.973  28.988  -1.100  1.00 42.40 ? 93  LYS A N     1 
ATOM   709   C CA    . LYS A 1 93  ? 23.841  29.692  -0.236  1.00 42.81 ? 93  LYS A CA    1 
ATOM   710   C C     . LYS A 1 93  ? 25.200  29.891  -0.879  1.00 43.02 ? 93  LYS A C     1 
ATOM   711   O O     . LYS A 1 93  ? 25.675  31.007  -0.929  1.00 45.27 ? 93  LYS A O     1 
ATOM   712   C CB    . LYS A 1 93  ? 23.923  28.966  1.100   1.00 42.57 ? 93  LYS A CB    1 
ATOM   713   C CG    . LYS A 1 93  ? 22.671  29.200  1.964   1.00 44.40 ? 93  LYS A CG    1 
ATOM   714   C CD    . LYS A 1 93  ? 22.390  30.715  2.196   1.00 47.44 ? 93  LYS A CD    1 
ATOM   715   C CE    . LYS A 1 93  ? 21.638  30.983  3.495   1.00 51.70 ? 93  LYS A CE    1 
ATOM   716   N NZ    . LYS A 1 93  ? 20.854  29.833  4.142   1.00 55.10 ? 93  LYS A NZ    1 
ATOM   717   N N     . LEU A 1 94  ? 25.837  28.847  -1.389  1.00 43.09 ? 94  LEU A N     1 
ATOM   718   C CA    . LEU A 1 94  ? 27.208  29.005  -1.897  1.00 43.20 ? 94  LEU A CA    1 
ATOM   719   C C     . LEU A 1 94  ? 27.302  29.590  -3.295  1.00 42.63 ? 94  LEU A C     1 
ATOM   720   O O     . LEU A 1 94  ? 28.309  30.252  -3.608  1.00 43.90 ? 94  LEU A O     1 
ATOM   721   C CB    . LEU A 1 94  ? 27.949  27.671  -1.947  1.00 43.45 ? 94  LEU A CB    1 
ATOM   722   C CG    . LEU A 1 94  ? 28.662  27.071  -0.720  1.00 45.87 ? 94  LEU A CG    1 
ATOM   723   C CD1   . LEU A 1 94  ? 28.152  27.481  0.655   1.00 48.65 ? 94  LEU A CD1   1 
ATOM   724   C CD2   . LEU A 1 94  ? 28.703  25.539  -0.871  1.00 44.97 ? 94  LEU A CD2   1 
ATOM   725   N N     . HIS A 1 95  ? 26.358  29.293  -4.171  1.00 39.66 ? 95  HIS A N     1 
ATOM   726   C CA    . HIS A 1 95  ? 26.625  29.615  -5.590  1.00 40.45 ? 95  HIS A CA    1 
ATOM   727   C C     . HIS A 1 95  ? 25.529  30.495  -6.148  1.00 41.51 ? 95  HIS A C     1 
ATOM   728   O O     . HIS A 1 95  ? 25.676  31.021  -7.247  1.00 42.27 ? 95  HIS A O     1 
ATOM   729   C CB    . HIS A 1 95  ? 26.800  28.347  -6.473  1.00 38.78 ? 95  HIS A CB    1 
ATOM   730   C CG    . HIS A 1 95  ? 27.809  27.387  -5.942  1.00 37.83 ? 95  HIS A CG    1 
ATOM   731   N ND1   . HIS A 1 95  ? 27.462  26.144  -5.422  1.00 37.40 ? 95  HIS A ND1   1 
ATOM   732   C CD2   . HIS A 1 95  ? 29.145  27.510  -5.769  1.00 35.88 ? 95  HIS A CD2   1 
ATOM   733   C CE1   . HIS A 1 95  ? 28.544  25.558  -4.946  1.00 38.66 ? 95  HIS A CE1   1 
ATOM   734   N NE2   . HIS A 1 95  ? 29.581  26.348  -5.167  1.00 38.68 ? 95  HIS A NE2   1 
ATOM   735   N N     . ASN A 1 96  ? 24.419  30.633  -5.394  1.00 42.29 ? 96  ASN A N     1 
ATOM   736   C CA    . ASN A 1 96  ? 23.291  31.390  -5.851  1.00 43.13 ? 96  ASN A CA    1 
ATOM   737   C C     . ASN A 1 96  ? 23.082  31.225  -7.384  1.00 41.88 ? 96  ASN A C     1 
ATOM   738   O O     . ASN A 1 96  ? 23.186  32.188  -8.095  1.00 43.50 ? 96  ASN A O     1 
ATOM   739   C CB    . ASN A 1 96  ? 23.616  32.872  -5.559  1.00 44.86 ? 96  ASN A CB    1 
ATOM   740   C CG    . ASN A 1 96  ? 24.840  33.050  -4.679  1.00 46.77 ? 96  ASN A CG    1 
ATOM   741   O OD1   . ASN A 1 96  ? 24.734  33.012  -3.426  1.00 55.46 ? 96  ASN A OD1   1 
ATOM   742   N ND2   . ASN A 1 96  ? 26.030  33.278  -5.312  1.00 50.47 ? 96  ASN A ND2   1 
ATOM   743   N N     . PRO A 1 97  ? 22.863  30.009  -7.902  1.00 40.28 ? 97  PRO A N     1 
ATOM   744   C CA    . PRO A 1 97  ? 22.880  29.811  -9.389  1.00 38.73 ? 97  PRO A CA    1 
ATOM   745   C C     . PRO A 1 97  ? 21.726  30.460  -10.108 1.00 38.00 ? 97  PRO A C     1 
ATOM   746   O O     . PRO A 1 97  ? 20.608  30.122  -9.755  1.00 39.41 ? 97  PRO A O     1 
ATOM   747   C CB    . PRO A 1 97  ? 22.693  28.277  -9.549  1.00 37.89 ? 97  PRO A CB    1 
ATOM   748   C CG    . PRO A 1 97  ? 23.035  27.705  -8.169  1.00 37.91 ? 97  PRO A CG    1 
ATOM   749   C CD    . PRO A 1 97  ? 22.628  28.738  -7.168  1.00 39.76 ? 97  PRO A CD    1 
ATOM   750   N N     . PRO A 1 98  ? 21.961  31.319  -11.153 1.00 36.71 ? 98  PRO A N     1 
ATOM   751   C CA    . PRO A 1 98  ? 20.858  32.131  -11.750 1.00 36.22 ? 98  PRO A CA    1 
ATOM   752   C C     . PRO A 1 98  ? 19.613  31.288  -12.050 1.00 37.05 ? 98  PRO A C     1 
ATOM   753   O O     . PRO A 1 98  ? 18.575  31.781  -12.539 1.00 36.13 ? 98  PRO A O     1 
ATOM   754   C CB    . PRO A 1 98  ? 21.439  32.553  -13.135 1.00 36.12 ? 98  PRO A CB    1 
ATOM   755   C CG    . PRO A 1 98  ? 22.955  32.548  -12.975 1.00 34.10 ? 98  PRO A CG    1 
ATOM   756   C CD    . PRO A 1 98  ? 23.247  31.516  -11.864 1.00 36.41 ? 98  PRO A CD    1 
ATOM   757   N N     . THR A 1 99  ? 19.748  29.990  -11.809 1.00 37.47 ? 99  THR A N     1 
ATOM   758   C CA    . THR A 1 99  ? 18.940  29.002  -12.539 1.00 37.78 ? 99  THR A CA    1 
ATOM   759   C C     . THR A 1 99  ? 17.862  28.360  -11.654 1.00 38.75 ? 99  THR A C     1 
ATOM   760   O O     . THR A 1 99  ? 16.973  27.644  -12.134 1.00 39.75 ? 99  THR A O     1 
ATOM   761   C CB    . THR A 1 99  ? 19.951  27.958  -13.174 1.00 37.87 ? 99  THR A CB    1 
ATOM   762   O OG1   . THR A 1 99  ? 19.705  27.738  -14.583 1.00 38.94 ? 99  THR A OG1   1 
ATOM   763   C CG2   . THR A 1 99  ? 20.068  26.745  -12.385 1.00 27.30 ? 99  THR A CG2   1 
ATOM   764   N N     . ILE A 1 100 ? 17.944  28.620  -10.351 1.00 38.99 ? 100 ILE A N     1 
ATOM   765   C CA    . ILE A 1 100 ? 17.088  27.907  -9.355  1.00 38.90 ? 100 ILE A CA    1 
ATOM   766   C C     . ILE A 1 100 ? 15.546  27.885  -9.575  1.00 38.56 ? 100 ILE A C     1 
ATOM   767   O O     . ILE A 1 100 ? 14.850  26.901  -9.228  1.00 39.42 ? 100 ILE A O     1 
ATOM   768   C CB    . ILE A 1 100 ? 17.360  28.448  -7.903  1.00 38.64 ? 100 ILE A CB    1 
ATOM   769   C CG1   . ILE A 1 100 ? 17.290  30.004  -7.860  1.00 38.05 ? 100 ILE A CG1   1 
ATOM   770   C CG2   . ILE A 1 100 ? 18.662  27.862  -7.377  1.00 35.94 ? 100 ILE A CG2   1 
ATOM   771   C CD1   . ILE A 1 100 ? 16.861  30.501  -6.513  1.00 37.74 ? 100 ILE A CD1   1 
ATOM   772   N N     . HIS A 1 101 ? 15.036  29.014  -10.078 1.00 38.90 ? 101 HIS A N     1 
ATOM   773   C CA    . HIS A 1 101 ? 13.620  29.248  -10.389 1.00 37.94 ? 101 HIS A CA    1 
ATOM   774   C C     . HIS A 1 101 ? 13.389  29.430  -11.913 1.00 38.32 ? 101 HIS A C     1 
ATOM   775   O O     . HIS A 1 101 ? 12.396  30.061  -12.273 1.00 35.65 ? 101 HIS A O     1 
ATOM   776   C CB    . HIS A 1 101 ? 13.077  30.527  -9.635  1.00 37.87 ? 101 HIS A CB    1 
ATOM   777   C CG    . HIS A 1 101 ? 13.309  30.509  -8.159  1.00 37.83 ? 101 HIS A CG    1 
ATOM   778   N ND1   . HIS A 1 101 ? 13.823  31.588  -7.466  1.00 41.70 ? 101 HIS A ND1   1 
ATOM   779   C CD2   . HIS A 1 101 ? 13.163  29.515  -7.249  1.00 38.56 ? 101 HIS A CD2   1 
ATOM   780   C CE1   . HIS A 1 101 ? 13.932  31.279  -6.185  1.00 43.10 ? 101 HIS A CE1   1 
ATOM   781   N NE2   . HIS A 1 101 ? 13.553  30.020  -6.030  1.00 46.09 ? 101 HIS A NE2   1 
ATOM   782   N N     . TYR A 1 102 ? 14.281  28.905  -12.789 1.00 39.24 ? 102 TYR A N     1 
ATOM   783   C CA    . TYR A 1 102 ? 13.865  28.710  -14.207 1.00 39.39 ? 102 TYR A CA    1 
ATOM   784   C C     . TYR A 1 102 ? 12.791  27.600  -14.279 1.00 40.62 ? 102 TYR A C     1 
ATOM   785   O O     . TYR A 1 102 ? 12.636  26.811  -13.289 1.00 40.82 ? 102 TYR A O     1 
ATOM   786   C CB    . TYR A 1 102 ? 14.995  28.419  -15.209 1.00 38.10 ? 102 TYR A CB    1 
ATOM   787   C CG    . TYR A 1 102 ? 16.045  29.483  -15.472 1.00 37.44 ? 102 TYR A CG    1 
ATOM   788   C CD1   . TYR A 1 102 ? 17.190  29.154  -16.206 1.00 39.04 ? 102 TYR A CD1   1 
ATOM   789   C CD2   . TYR A 1 102 ? 15.948  30.754  -14.954 1.00 37.83 ? 102 TYR A CD2   1 
ATOM   790   C CE1   . TYR A 1 102 ? 18.199  30.012  -16.419 1.00 34.61 ? 102 TYR A CE1   1 
ATOM   791   C CE2   . TYR A 1 102 ? 16.965  31.677  -15.161 1.00 40.55 ? 102 TYR A CE2   1 
ATOM   792   C CZ    . TYR A 1 102 ? 18.099  31.286  -15.882 1.00 39.64 ? 102 TYR A CZ    1 
ATOM   793   O OH    . TYR A 1 102 ? 19.119  32.164  -16.086 1.00 37.07 ? 102 TYR A OH    1 
ATOM   794   N N     . PRO A 1 103 ? 11.995  27.572  -15.399 1.00 39.28 ? 103 PRO A N     1 
ATOM   795   C CA    . PRO A 1 103 ? 11.172  26.400  -15.725 1.00 38.94 ? 103 PRO A CA    1 
ATOM   796   C C     . PRO A 1 103 ? 12.099  25.210  -15.994 1.00 38.93 ? 103 PRO A C     1 
ATOM   797   O O     . PRO A 1 103 ? 13.269  25.440  -16.369 1.00 39.41 ? 103 PRO A O     1 
ATOM   798   C CB    . PRO A 1 103 ? 10.463  26.797  -17.022 1.00 39.12 ? 103 PRO A CB    1 
ATOM   799   C CG    . PRO A 1 103 ? 10.309  28.333  -16.882 1.00 39.82 ? 103 PRO A CG    1 
ATOM   800   C CD    . PRO A 1 103 ? 11.765  28.661  -16.348 1.00 39.20 ? 103 PRO A CD    1 
ATOM   801   N N     . PRO A 1 104 ? 11.623  23.960  -15.738 1.00 37.62 ? 104 PRO A N     1 
ATOM   802   C CA    . PRO A 1 104 ? 12.457  22.793  -15.892 1.00 37.88 ? 104 PRO A CA    1 
ATOM   803   C C     . PRO A 1 104 ? 12.932  22.510  -17.308 1.00 37.72 ? 104 PRO A C     1 
ATOM   804   O O     . PRO A 1 104 ? 14.108  22.392  -17.536 1.00 37.80 ? 104 PRO A O     1 
ATOM   805   C CB    . PRO A 1 104 ? 11.590  21.674  -15.276 1.00 37.99 ? 104 PRO A CB    1 
ATOM   806   C CG    . PRO A 1 104 ? 10.732  22.472  -14.269 1.00 37.59 ? 104 PRO A CG    1 
ATOM   807   C CD    . PRO A 1 104 ? 10.331  23.596  -15.140 1.00 37.02 ? 104 PRO A CD    1 
ATOM   808   N N     . SER A 1 105 ? 12.044  22.398  -18.272 1.00 39.61 ? 105 SER A N     1 
ATOM   809   C CA    . SER A 1 105 ? 12.477  22.301  -19.678 1.00 40.29 ? 105 SER A CA    1 
ATOM   810   C C     . SER A 1 105 ? 13.636  23.312  -20.034 1.00 40.79 ? 105 SER A C     1 
ATOM   811   O O     . SER A 1 105 ? 14.424  23.027  -20.943 1.00 42.01 ? 105 SER A O     1 
ATOM   812   C CB    . SER A 1 105 ? 11.286  22.548  -20.569 1.00 40.16 ? 105 SER A CB    1 
ATOM   813   O OG    . SER A 1 105 ? 10.952  23.924  -20.467 1.00 43.35 ? 105 SER A OG    1 
ATOM   814   N N     . GLN A 1 106 ? 13.744  24.440  -19.308 1.00 39.45 ? 106 GLN A N     1 
ATOM   815   C CA    . GLN A 1 106 ? 14.820  25.452  -19.478 1.00 39.77 ? 106 GLN A CA    1 
ATOM   816   C C     . GLN A 1 106 ? 16.067  25.386  -18.535 1.00 39.27 ? 106 GLN A C     1 
ATOM   817   O O     . GLN A 1 106 ? 16.895  26.365  -18.444 1.00 38.57 ? 106 GLN A O     1 
ATOM   818   C CB    . GLN A 1 106 ? 14.217  26.852  -19.404 1.00 39.52 ? 106 GLN A CB    1 
ATOM   819   C CG    . GLN A 1 106 ? 12.919  27.105  -20.274 1.00 41.93 ? 106 GLN A CG    1 
ATOM   820   C CD    . GLN A 1 106 ? 12.481  28.624  -20.234 1.00 42.62 ? 106 GLN A CD    1 
ATOM   821   O OE1   . GLN A 1 106 ? 13.318  29.509  -20.022 1.00 45.09 ? 106 GLN A OE1   1 
ATOM   822   N NE2   . GLN A 1 106 ? 11.187  28.897  -20.434 1.00 43.15 ? 106 GLN A NE2   1 
ATOM   823   N N     . GLY A 1 107 ? 16.249  24.276  -17.811 1.00 37.02 ? 107 GLY A N     1 
ATOM   824   C CA    . GLY A 1 107 ? 17.490  24.175  -17.038 1.00 34.67 ? 107 GLY A CA    1 
ATOM   825   C C     . GLY A 1 107 ? 17.453  24.625  -15.589 1.00 34.01 ? 107 GLY A C     1 
ATOM   826   O O     . GLY A 1 107 ? 18.542  24.879  -14.967 1.00 31.40 ? 107 GLY A O     1 
ATOM   827   N N     . GLN A 1 108 ? 16.227  24.655  -15.021 1.00 33.07 ? 108 GLN A N     1 
ATOM   828   C CA    . GLN A 1 108 ? 16.083  24.735  -13.579 1.00 31.93 ? 108 GLN A CA    1 
ATOM   829   C C     . GLN A 1 108 ? 17.141  23.811  -12.900 1.00 33.00 ? 108 GLN A C     1 
ATOM   830   O O     . GLN A 1 108 ? 17.391  22.671  -13.323 1.00 32.46 ? 108 GLN A O     1 
ATOM   831   C CB    . GLN A 1 108 ? 14.712  24.295  -13.193 1.00 31.88 ? 108 GLN A CB    1 
ATOM   832   C CG    . GLN A 1 108 ? 14.335  24.628  -11.813 1.00 32.96 ? 108 GLN A CG    1 
ATOM   833   C CD    . GLN A 1 108 ? 12.939  24.165  -11.468 1.00 38.36 ? 108 GLN A CD    1 
ATOM   834   O OE1   . GLN A 1 108 ? 12.166  24.940  -10.943 1.00 40.53 ? 108 GLN A OE1   1 
ATOM   835   N NE2   . GLN A 1 108 ? 12.632  22.867  -11.693 1.00 40.08 ? 108 GLN A NE2   1 
ATOM   836   N N     . MET A 1 109 ? 17.764  24.338  -11.853 1.00 32.43 ? 109 MET A N     1 
ATOM   837   C CA    . MET A 1 109 ? 18.842  23.699  -11.173 1.00 32.57 ? 109 MET A CA    1 
ATOM   838   C C     . MET A 1 109 ? 18.238  22.432  -10.623 1.00 30.49 ? 109 MET A C     1 
ATOM   839   O O     . MET A 1 109 ? 17.165  22.492  -10.006 1.00 29.92 ? 109 MET A O     1 
ATOM   840   C CB    . MET A 1 109 ? 19.314  24.612  -10.003 1.00 32.90 ? 109 MET A CB    1 
ATOM   841   C CG    . MET A 1 109 ? 20.767  24.406  -9.565  1.00 33.44 ? 109 MET A CG    1 
ATOM   842   S SD    . MET A 1 109 ? 21.198  24.777  -7.839  1.00 36.92 ? 109 MET A SD    1 
ATOM   843   C CE    . MET A 1 109 ? 19.958  23.942  -6.850  1.00 33.97 ? 109 MET A CE    1 
ATOM   844   N N     . ASP A 1 110 ? 18.916  21.290  -10.817 1.00 28.40 ? 110 ASP A N     1 
ATOM   845   C CA    . ASP A 1 110 ? 18.552  20.099  -10.055 1.00 26.20 ? 110 ASP A CA    1 
ATOM   846   C C     . ASP A 1 110 ? 19.815  19.479  -9.536  1.00 27.62 ? 110 ASP A C     1 
ATOM   847   O O     . ASP A 1 110 ? 20.867  19.823  -9.939  1.00 28.35 ? 110 ASP A O     1 
ATOM   848   C CB    . ASP A 1 110 ? 17.697  19.125  -10.880 1.00 24.08 ? 110 ASP A CB    1 
ATOM   849   C CG    . ASP A 1 110 ? 16.906  18.212  -10.038 1.00 27.66 ? 110 ASP A CG    1 
ATOM   850   O OD1   . ASP A 1 110 ? 16.720  18.441  -8.734  1.00 23.44 ? 110 ASP A OD1   1 
ATOM   851   O OD2   . ASP A 1 110 ? 16.470  17.229  -10.668 1.00 28.22 ? 110 ASP A OD2   1 
ATOM   852   N N     . LEU A 1 111 ? 19.704  18.578  -8.569  1.00 30.50 ? 111 LEU A N     1 
ATOM   853   C CA    . LEU A 1 111 ? 20.851  18.057  -7.870  1.00 30.63 ? 111 LEU A CA    1 
ATOM   854   C C     . LEU A 1 111 ? 20.568  16.587  -7.528  1.00 30.24 ? 111 LEU A C     1 
ATOM   855   O O     . LEU A 1 111 ? 19.464  16.251  -7.206  1.00 29.54 ? 111 LEU A O     1 
ATOM   856   C CB    . LEU A 1 111 ? 21.071  18.905  -6.617  1.00 30.70 ? 111 LEU A CB    1 
ATOM   857   C CG    . LEU A 1 111 ? 22.261  18.601  -5.694  1.00 31.98 ? 111 LEU A CG    1 
ATOM   858   C CD1   . LEU A 1 111 ? 22.745  19.905  -5.018  1.00 34.53 ? 111 LEU A CD1   1 
ATOM   859   C CD2   . LEU A 1 111 ? 21.793  17.585  -4.667  1.00 32.83 ? 111 LEU A CD2   1 
ATOM   860   N N     . CYS A 1 112 ? 21.547  15.695  -7.641  1.00 30.83 ? 112 CYS A N     1 
ATOM   861   C CA    . CYS A 1 112 ? 21.333  14.337  -7.117  1.00 30.85 ? 112 CYS A CA    1 
ATOM   862   C C     . CYS A 1 112 ? 22.509  13.741  -6.357  1.00 29.95 ? 112 CYS A C     1 
ATOM   863   O O     . CYS A 1 112 ? 23.627  13.877  -6.726  1.00 30.39 ? 112 CYS A O     1 
ATOM   864   C CB    . CYS A 1 112 ? 20.732  13.380  -8.163  1.00 31.42 ? 112 CYS A CB    1 
ATOM   865   S SG    . CYS A 1 112 ? 21.742  13.107  -9.559  1.00 42.59 ? 112 CYS A SG    1 
ATOM   866   N N     . VAL A 1 113 ? 22.235  13.006  -5.295  1.00 30.58 ? 113 VAL A N     1 
ATOM   867   C CA    . VAL A 1 113 ? 23.303  12.359  -4.563  1.00 30.41 ? 113 VAL A CA    1 
ATOM   868   C C     . VAL A 1 113 ? 23.719  11.189  -5.464  1.00 31.42 ? 113 VAL A C     1 
ATOM   869   O O     . VAL A 1 113 ? 22.825  10.499  -6.073  1.00 30.57 ? 113 VAL A O     1 
ATOM   870   C CB    . VAL A 1 113 ? 22.805  11.838  -3.170  1.00 32.63 ? 113 VAL A CB    1 
ATOM   871   C CG1   . VAL A 1 113 ? 23.995  11.161  -2.292  1.00 31.82 ? 113 VAL A CG1   1 
ATOM   872   C CG2   . VAL A 1 113 ? 22.037  12.942  -2.424  1.00 27.10 ? 113 VAL A CG2   1 
ATOM   873   N N     . THR A 1 114 ? 25.032  11.024  -5.611  1.00 28.69 ? 114 THR A N     1 
ATOM   874   C CA    . THR A 1 114 ? 25.567  9.962   -6.395  1.00 31.48 ? 114 THR A CA    1 
ATOM   875   C C     . THR A 1 114 ? 26.455  9.037   -5.502  1.00 32.48 ? 114 THR A C     1 
ATOM   876   O O     . THR A 1 114 ? 26.770  9.334   -4.346  1.00 33.30 ? 114 THR A O     1 
ATOM   877   C CB    . THR A 1 114 ? 26.428  10.507  -7.614  1.00 31.23 ? 114 THR A CB    1 
ATOM   878   O OG1   . THR A 1 114 ? 27.481  11.321  -7.134  1.00 30.14 ? 114 THR A OG1   1 
ATOM   879   C CG2   . THR A 1 114 ? 25.607  11.341  -8.507  1.00 30.56 ? 114 THR A CG2   1 
ATOM   880   N N     . SER A 1 115 ? 26.906  7.930   -6.030  1.00 33.41 ? 115 SER A N     1 
ATOM   881   C CA    . SER A 1 115 ? 27.734  7.088   -5.177  1.00 34.41 ? 115 SER A CA    1 
ATOM   882   C C     . SER A 1 115 ? 29.212  7.372   -5.289  1.00 33.13 ? 115 SER A C     1 
ATOM   883   O O     . SER A 1 115 ? 29.956  6.548   -5.768  1.00 33.52 ? 115 SER A O     1 
ATOM   884   C CB    . SER A 1 115 ? 27.425  5.597   -5.340  1.00 34.96 ? 115 SER A CB    1 
ATOM   885   O OG    . SER A 1 115 ? 28.695  4.949   -5.058  1.00 38.44 ? 115 SER A OG    1 
ATOM   886   N N     . GLY A 1 116 ? 29.622  8.541   -4.755  1.00 33.07 ? 116 GLY A N     1 
ATOM   887   C CA    . GLY A 1 116 ? 30.892  9.245   -5.042  1.00 29.08 ? 116 GLY A CA    1 
ATOM   888   C C     . GLY A 1 116 ? 30.591  10.274  -6.113  1.00 29.56 ? 116 GLY A C     1 
ATOM   889   O O     . GLY A 1 116 ? 29.584  10.127  -6.800  1.00 29.35 ? 116 GLY A O     1 
ATOM   890   N N     . SER A 1 117 ? 31.402  11.341  -6.285  1.00 29.38 ? 117 SER A N     1 
ATOM   891   C CA    . SER A 1 117 ? 31.078  12.334  -7.377  1.00 28.42 ? 117 SER A CA    1 
ATOM   892   C C     . SER A 1 117 ? 31.499  11.789  -8.698  1.00 29.63 ? 117 SER A C     1 
ATOM   893   O O     . SER A 1 117 ? 31.037  12.257  -9.717  1.00 31.08 ? 117 SER A O     1 
ATOM   894   C CB    . SER A 1 117 ? 31.820  13.651  -7.294  1.00 26.04 ? 117 SER A CB    1 
ATOM   895   O OG    . SER A 1 117 ? 33.218  13.440  -7.411  1.00 26.96 ? 117 SER A OG    1 
ATOM   896   N N     . GLN A 1 118 ? 32.432  10.840  -8.701  1.00 30.99 ? 118 GLN A N     1 
ATOM   897   C CA    . GLN A 1 118 ? 32.897  10.240  -9.989  1.00 31.08 ? 118 GLN A CA    1 
ATOM   898   C C     . GLN A 1 118 ? 31.853  9.391   -10.627 1.00 30.05 ? 118 GLN A C     1 
ATOM   899   O O     . GLN A 1 118 ? 31.916  9.184   -11.863 1.00 31.35 ? 118 GLN A O     1 
ATOM   900   C CB    . GLN A 1 118 ? 34.218  9.434   -9.796  1.00 31.22 ? 118 GLN A CB    1 
ATOM   901   C CG    . GLN A 1 118 ? 35.470  10.308  -10.049 1.00 34.60 ? 118 GLN A CG    1 
ATOM   902   C CD    . GLN A 1 118 ? 36.710  9.498   -9.982  1.00 38.23 ? 118 GLN A CD    1 
ATOM   903   O OE1   . GLN A 1 118 ? 37.463  9.535   -8.988  1.00 44.03 ? 118 GLN A OE1   1 
ATOM   904   N NE2   . GLN A 1 118 ? 36.920  8.722   -10.994 1.00 38.18 ? 118 GLN A NE2   1 
ATOM   905   N N     . GLN A 1 119 ? 30.863  8.921   -9.863  1.00 30.22 ? 119 GLN A N     1 
ATOM   906   C CA    . GLN A 1 119 ? 29.726  8.155   -10.553 1.00 32.77 ? 119 GLN A CA    1 
ATOM   907   C C     . GLN A 1 119 ? 28.847  9.086   -11.412 1.00 33.84 ? 119 GLN A C     1 
ATOM   908   O O     . GLN A 1 119 ? 28.413  8.674   -12.459 1.00 34.15 ? 119 GLN A O     1 
ATOM   909   C CB    . GLN A 1 119 ? 28.804  7.347   -9.622  1.00 32.39 ? 119 GLN A CB    1 
ATOM   910   C CG    . GLN A 1 119 ? 27.643  6.434   -10.308 1.00 29.39 ? 119 GLN A CG    1 
ATOM   911   C CD    . GLN A 1 119 ? 26.499  6.298   -9.386  1.00 31.37 ? 119 GLN A CD    1 
ATOM   912   O OE1   . GLN A 1 119 ? 26.323  7.148   -8.575  1.00 31.68 ? 119 GLN A OE1   1 
ATOM   913   N NE2   . GLN A 1 119 ? 25.730  5.235   -9.468  1.00 36.42 ? 119 GLN A NE2   1 
ATOM   914   N N     . GLY A 1 120 ? 28.607  10.321  -10.969 1.00 34.18 ? 120 GLY A N     1 
ATOM   915   C CA    . GLY A 1 120 ? 27.756  11.244  -11.755 1.00 35.92 ? 120 GLY A CA    1 
ATOM   916   C C     . GLY A 1 120 ? 28.520  11.812  -12.961 1.00 36.98 ? 120 GLY A C     1 
ATOM   917   O O     . GLY A 1 120 ? 27.956  12.085  -13.993 1.00 38.87 ? 120 GLY A O     1 
ATOM   918   N N     . LEU A 1 121 ? 29.811  12.058  -12.803 1.00 36.97 ? 121 LEU A N     1 
ATOM   919   C CA    . LEU A 1 121 ? 30.680  12.288  -13.938 1.00 37.68 ? 121 LEU A CA    1 
ATOM   920   C C     . LEU A 1 121 ? 30.641  11.213  -15.023 1.00 36.54 ? 121 LEU A C     1 
ATOM   921   O O     . LEU A 1 121 ? 30.428  11.504  -16.192 1.00 36.91 ? 121 LEU A O     1 
ATOM   922   C CB    . LEU A 1 121 ? 32.099  12.301  -13.449 1.00 37.38 ? 121 LEU A CB    1 
ATOM   923   C CG    . LEU A 1 121 ? 32.710  13.602  -13.082 1.00 43.03 ? 121 LEU A CG    1 
ATOM   924   C CD1   . LEU A 1 121 ? 34.188  13.247  -13.049 1.00 42.69 ? 121 LEU A CD1   1 
ATOM   925   C CD2   . LEU A 1 121 ? 32.394  14.724  -14.134 1.00 43.27 ? 121 LEU A CD2   1 
ATOM   926   N N     . CYS A 1 122 ? 30.941  9.975   -14.649 1.00 35.88 ? 122 CYS A N     1 
ATOM   927   C CA    . CYS A 1 122 ? 30.908  8.930   -15.588 1.00 34.63 ? 122 CYS A CA    1 
ATOM   928   C C     . CYS A 1 122 ? 29.547  8.939   -16.222 1.00 34.11 ? 122 CYS A C     1 
ATOM   929   O O     . CYS A 1 122 ? 29.440  8.862   -17.440 1.00 34.71 ? 122 CYS A O     1 
ATOM   930   C CB    . CYS A 1 122 ? 31.150  7.561   -14.939 1.00 35.30 ? 122 CYS A CB    1 
ATOM   931   S SG    . CYS A 1 122 ? 31.363  6.250   -16.193 1.00 36.80 ? 122 CYS A SG    1 
ATOM   932   N N     . LYS A 1 123 ? 28.490  9.020   -15.418 1.00 32.88 ? 123 LYS A N     1 
ATOM   933   C CA    . LYS A 1 123 ? 27.149  9.120   -16.021 1.00 31.62 ? 123 LYS A CA    1 
ATOM   934   C C     . LYS A 1 123 ? 26.891  10.307  -16.985 1.00 31.35 ? 123 LYS A C     1 
ATOM   935   O O     . LYS A 1 123 ? 26.100  10.138  -17.931 1.00 28.44 ? 123 LYS A O     1 
ATOM   936   C CB    . LYS A 1 123 ? 26.072  9.031   -15.019 1.00 31.50 ? 123 LYS A CB    1 
ATOM   937   C CG    . LYS A 1 123 ? 25.553  7.632   -15.013 1.00 32.99 ? 123 LYS A CG    1 
ATOM   938   C CD    . LYS A 1 123 ? 26.190  6.802   -13.988 1.00 32.32 ? 123 LYS A CD    1 
ATOM   939   C CE    . LYS A 1 123 ? 25.088  5.870   -13.321 1.00 27.87 ? 123 LYS A CE    1 
ATOM   940   N NZ    . LYS A 1 123 ? 25.181  4.612   -14.055 1.00 30.60 ? 123 LYS A NZ    1 
ATOM   941   N N     . VAL A 1 124 ? 27.599  11.425  -16.781 1.00 28.91 ? 124 VAL A N     1 
ATOM   942   C CA    . VAL A 1 124 ? 27.523  12.553  -17.674 1.00 29.85 ? 124 VAL A CA    1 
ATOM   943   C C     . VAL A 1 124 ? 28.263  12.317  -19.014 1.00 30.04 ? 124 VAL A C     1 
ATOM   944   O O     . VAL A 1 124 ? 27.745  12.632  -20.107 1.00 29.74 ? 124 VAL A O     1 
ATOM   945   C CB    . VAL A 1 124 ? 28.014  13.883  -16.955 1.00 29.48 ? 124 VAL A CB    1 
ATOM   946   C CG1   . VAL A 1 124 ? 28.367  14.984  -17.957 1.00 27.85 ? 124 VAL A CG1   1 
ATOM   947   C CG2   . VAL A 1 124 ? 26.943  14.369  -16.020 1.00 27.79 ? 124 VAL A CG2   1 
ATOM   948   N N     . PHE A 1 125 ? 29.496  11.852  -18.899 1.00 29.23 ? 125 PHE A N     1 
ATOM   949   C CA    . PHE A 1 125 ? 30.271  11.415  -20.002 1.00 29.51 ? 125 PHE A CA    1 
ATOM   950   C C     . PHE A 1 125 ? 29.446  10.445  -20.883 1.00 30.22 ? 125 PHE A C     1 
ATOM   951   O O     . PHE A 1 125 ? 29.306  10.662  -22.069 1.00 28.95 ? 125 PHE A O     1 
ATOM   952   C CB    . PHE A 1 125 ? 31.549  10.787  -19.501 1.00 27.43 ? 125 PHE A CB    1 
ATOM   953   C CG    . PHE A 1 125 ? 32.510  11.774  -18.827 1.00 30.56 ? 125 PHE A CG    1 
ATOM   954   C CD1   . PHE A 1 125 ? 33.610  11.298  -18.124 1.00 26.40 ? 125 PHE A CD1   1 
ATOM   955   C CD2   . PHE A 1 125 ? 32.324  13.174  -18.920 1.00 28.51 ? 125 PHE A CD2   1 
ATOM   956   C CE1   . PHE A 1 125 ? 34.517  12.174  -17.477 1.00 28.96 ? 125 PHE A CE1   1 
ATOM   957   C CE2   . PHE A 1 125 ? 33.238  14.068  -18.275 1.00 29.30 ? 125 PHE A CE2   1 
ATOM   958   C CZ    . PHE A 1 125 ? 34.330  13.566  -17.557 1.00 25.35 ? 125 PHE A CZ    1 
ATOM   959   N N     . GLU A 1 126 ? 28.819  9.470   -20.247 1.00 31.16 ? 126 GLU A N     1 
ATOM   960   C CA    . GLU A 1 126 ? 28.047  8.417   -20.936 1.00 32.35 ? 126 GLU A CA    1 
ATOM   961   C C     . GLU A 1 126 ? 26.826  8.972   -21.614 1.00 33.16 ? 126 GLU A C     1 
ATOM   962   O O     . GLU A 1 126 ? 26.517  8.562   -22.774 1.00 33.67 ? 126 GLU A O     1 
ATOM   963   C CB    . GLU A 1 126 ? 27.690  7.312   -19.946 1.00 30.04 ? 126 GLU A CB    1 
ATOM   964   C CG    . GLU A 1 126 ? 28.762  6.231   -19.967 1.00 30.96 ? 126 GLU A CG    1 
ATOM   965   C CD    . GLU A 1 126 ? 28.731  5.399   -18.732 1.00 35.11 ? 126 GLU A CD    1 
ATOM   966   O OE1   . GLU A 1 126 ? 29.512  4.417   -18.643 1.00 39.11 ? 126 GLU A OE1   1 
ATOM   967   O OE2   . GLU A 1 126 ? 27.939  5.736   -17.843 1.00 32.06 ? 126 GLU A OE2   1 
ATOM   968   N N     . MET A 1 127 ? 26.155  9.907   -20.915 1.00 31.98 ? 127 MET A N     1 
ATOM   969   C CA    . MET A 1 127 ? 24.967  10.571  -21.443 1.00 32.41 ? 127 MET A CA    1 
ATOM   970   C C     . MET A 1 127 ? 25.241  11.475  -22.703 1.00 33.15 ? 127 MET A C     1 
ATOM   971   O O     . MET A 1 127 ? 24.360  11.741  -23.531 1.00 34.04 ? 127 MET A O     1 
ATOM   972   C CB    . MET A 1 127 ? 24.256  11.340  -20.289 1.00 31.18 ? 127 MET A CB    1 
ATOM   973   C CG    . MET A 1 127 ? 23.343  12.495  -20.735 1.00 31.13 ? 127 MET A CG    1 
ATOM   974   S SD    . MET A 1 127 ? 22.841  13.725  -19.441 1.00 31.11 ? 127 MET A SD    1 
ATOM   975   C CE    . MET A 1 127 ? 24.390  14.390  -18.993 1.00 24.33 ? 127 MET A CE    1 
ATOM   976   N N     . ILE A 1 128 ? 26.475  11.956  -22.861 1.00 33.68 ? 128 ILE A N     1 
ATOM   977   C CA    . ILE A 1 128 ? 26.716  12.993  -23.832 1.00 32.10 ? 128 ILE A CA    1 
ATOM   978   C C     . ILE A 1 128 ? 27.423  12.473  -25.068 1.00 32.95 ? 128 ILE A C     1 
ATOM   979   O O     . ILE A 1 128 ? 27.101  12.883  -26.229 1.00 33.35 ? 128 ILE A O     1 
ATOM   980   C CB    . ILE A 1 128 ? 27.566  14.108  -23.236 1.00 31.64 ? 128 ILE A CB    1 
ATOM   981   C CG1   . ILE A 1 128 ? 26.782  14.880  -22.193 1.00 28.41 ? 128 ILE A CG1   1 
ATOM   982   C CG2   . ILE A 1 128 ? 28.060  15.117  -24.361 1.00 31.77 ? 128 ILE A CG2   1 
ATOM   983   C CD1   . ILE A 1 128 ? 27.679  15.929  -21.491 1.00 26.91 ? 128 ILE A CD1   1 
ATOM   984   N N     . ILE A 1 129 ? 28.389  11.591  -24.843 1.00 32.57 ? 129 ILE A N     1 
ATOM   985   C CA    . ILE A 1 129 ? 29.409  11.383  -25.879 1.00 32.92 ? 129 ILE A CA    1 
ATOM   986   C C     . ILE A 1 129 ? 29.034  10.241  -26.880 1.00 35.61 ? 129 ILE A C     1 
ATOM   987   O O     . ILE A 1 129 ? 28.868  9.058   -26.468 1.00 35.24 ? 129 ILE A O     1 
ATOM   988   C CB    . ILE A 1 129 ? 30.805  11.029  -25.247 1.00 33.36 ? 129 ILE A CB    1 
ATOM   989   C CG1   . ILE A 1 129 ? 31.363  12.161  -24.345 1.00 29.35 ? 129 ILE A CG1   1 
ATOM   990   C CG2   . ILE A 1 129 ? 31.814  10.677  -26.346 1.00 31.06 ? 129 ILE A CG2   1 
ATOM   991   C CD1   . ILE A 1 129 ? 32.562  11.702  -23.579 1.00 29.82 ? 129 ILE A CD1   1 
ATOM   992   N N     . ASN A 1 130 ? 28.987  10.603  -28.170 1.00 35.94 ? 130 ASN A N     1 
ATOM   993   C CA    . ASN A 1 130 ? 28.968  9.668   -29.314 1.00 36.53 ? 130 ASN A CA    1 
ATOM   994   C C     . ASN A 1 130 ? 30.391  9.428   -29.829 1.00 36.83 ? 130 ASN A C     1 
ATOM   995   O O     . ASN A 1 130 ? 31.296  10.271  -29.625 1.00 39.41 ? 130 ASN A O     1 
ATOM   996   C CB    . ASN A 1 130 ? 28.072  10.190  -30.459 1.00 36.34 ? 130 ASN A CB    1 
ATOM   997   C CG    . ASN A 1 130 ? 26.626  10.195  -30.100 1.00 36.47 ? 130 ASN A CG    1 
ATOM   998   O OD1   . ASN A 1 130 ? 26.154  9.254   -29.503 1.00 41.15 ? 130 ASN A OD1   1 
ATOM   999   N ND2   . ASN A 1 130 ? 25.895  11.248  -30.461 1.00 31.61 ? 130 ASN A ND2   1 
ATOM   1000  N N     . PRO A 1 131 ? 30.637  8.248   -30.390 1.00 35.79 ? 131 PRO A N     1 
ATOM   1001  C CA    . PRO A 1 131 ? 31.956  8.075   -30.972 1.00 36.28 ? 131 PRO A CA    1 
ATOM   1002  C C     . PRO A 1 131 ? 32.308  9.121   -32.060 1.00 36.88 ? 131 PRO A C     1 
ATOM   1003  O O     . PRO A 1 131 ? 31.471  9.432   -32.962 1.00 35.70 ? 131 PRO A O     1 
ATOM   1004  C CB    . PRO A 1 131 ? 31.896  6.640   -31.485 1.00 35.75 ? 131 PRO A CB    1 
ATOM   1005  C CG    . PRO A 1 131 ? 30.997  5.943   -30.353 1.00 35.29 ? 131 PRO A CG    1 
ATOM   1006  C CD    . PRO A 1 131 ? 29.887  6.960   -30.354 1.00 35.14 ? 131 PRO A CD    1 
ATOM   1007  N N     . GLY A 1 132 ? 33.495  9.722   -31.918 1.00 36.58 ? 132 GLY A N     1 
ATOM   1008  C CA    . GLY A 1 132 ? 33.876  10.791  -32.901 1.00 36.29 ? 132 GLY A CA    1 
ATOM   1009  C C     . GLY A 1 132 ? 33.691  12.202  -32.371 1.00 35.55 ? 132 GLY A C     1 
ATOM   1010  O O     . GLY A 1 132 ? 34.237  13.165  -32.943 1.00 36.42 ? 132 GLY A O     1 
ATOM   1011  N N     . ASP A 1 133 ? 32.860  12.351  -31.341 1.00 33.72 ? 133 ASP A N     1 
ATOM   1012  C CA    . ASP A 1 133 ? 32.582  13.671  -30.769 1.00 32.64 ? 133 ASP A CA    1 
ATOM   1013  C C     . ASP A 1 133 ? 33.902  14.369  -30.310 1.00 31.41 ? 133 ASP A C     1 
ATOM   1014  O O     . ASP A 1 133 ? 34.879  13.704  -29.930 1.00 31.24 ? 133 ASP A O     1 
ATOM   1015  C CB    . ASP A 1 133 ? 31.555  13.533  -29.603 1.00 32.79 ? 133 ASP A CB    1 
ATOM   1016  C CG    . ASP A 1 133 ? 30.083  13.438  -30.099 1.00 33.11 ? 133 ASP A CG    1 
ATOM   1017  O OD1   . ASP A 1 133 ? 29.858  13.412  -31.333 1.00 33.98 ? 133 ASP A OD1   1 
ATOM   1018  O OD2   . ASP A 1 133 ? 29.159  13.485  -29.254 1.00 29.71 ? 133 ASP A OD2   1 
ATOM   1019  N N     . ASN A 1 134 ? 33.958  15.695  -30.395 1.00 32.16 ? 134 ASN A N     1 
ATOM   1020  C CA    . ASN A 1 134 ? 35.114  16.467  -29.846 1.00 32.04 ? 134 ASN A CA    1 
ATOM   1021  C C     . ASN A 1 134 ? 34.857  17.040  -28.452 1.00 32.90 ? 134 ASN A C     1 
ATOM   1022  O O     . ASN A 1 134 ? 33.826  17.653  -28.176 1.00 33.13 ? 134 ASN A O     1 
ATOM   1023  C CB    . ASN A 1 134 ? 35.438  17.638  -30.743 1.00 30.09 ? 134 ASN A CB    1 
ATOM   1024  C CG    . ASN A 1 134 ? 35.696  17.244  -32.200 1.00 32.21 ? 134 ASN A CG    1 
ATOM   1025  O OD1   . ASN A 1 134 ? 36.498  16.373  -32.496 1.00 28.12 ? 134 ASN A OD1   1 
ATOM   1026  N ND2   . ASN A 1 134 ? 35.103  18.025  -33.139 1.00 36.71 ? 134 ASN A ND2   1 
ATOM   1027  N N     . VAL A 1 135 ? 35.834  16.927  -27.560 1.00 33.55 ? 135 VAL A N     1 
ATOM   1028  C CA    . VAL A 1 135 ? 35.635  17.440  -26.197 1.00 31.45 ? 135 VAL A CA    1 
ATOM   1029  C C     . VAL A 1 135 ? 36.859  18.288  -25.779 1.00 32.28 ? 135 VAL A C     1 
ATOM   1030  O O     . VAL A 1 135 ? 37.969  17.998  -26.116 1.00 32.69 ? 135 VAL A O     1 
ATOM   1031  C CB    . VAL A 1 135 ? 35.455  16.268  -25.180 1.00 30.77 ? 135 VAL A CB    1 
ATOM   1032  C CG1   . VAL A 1 135 ? 34.086  15.543  -25.372 1.00 28.82 ? 135 VAL A CG1   1 
ATOM   1033  C CG2   . VAL A 1 135 ? 36.620  15.336  -25.311 1.00 27.07 ? 135 VAL A CG2   1 
ATOM   1034  N N     . LEU A 1 136 ? 36.630  19.336  -25.019 1.00 33.09 ? 136 LEU A N     1 
ATOM   1035  C CA    . LEU A 1 136 ? 37.732  20.216  -24.584 1.00 32.38 ? 136 LEU A CA    1 
ATOM   1036  C C     . LEU A 1 136 ? 38.119  19.779  -23.171 1.00 30.98 ? 136 LEU A C     1 
ATOM   1037  O O     . LEU A 1 136 ? 37.245  19.512  -22.381 1.00 29.53 ? 136 LEU A O     1 
ATOM   1038  C CB    . LEU A 1 136 ? 37.286  21.670  -24.702 1.00 31.06 ? 136 LEU A CB    1 
ATOM   1039  C CG    . LEU A 1 136 ? 36.946  22.113  -26.160 1.00 33.20 ? 136 LEU A CG    1 
ATOM   1040  C CD1   . LEU A 1 136 ? 36.003  23.366  -26.221 1.00 31.65 ? 136 LEU A CD1   1 
ATOM   1041  C CD2   . LEU A 1 136 ? 38.145  22.209  -27.233 1.00 30.92 ? 136 LEU A CD2   1 
ATOM   1042  N N     . LEU A 1 137 ? 39.405  19.530  -22.928 1.00 32.05 ? 137 LEU A N     1 
ATOM   1043  C CA    . LEU A 1 137 ? 39.974  19.698  -21.546 1.00 33.96 ? 137 LEU A CA    1 
ATOM   1044  C C     . LEU A 1 137 ? 41.417  20.217  -21.536 1.00 34.13 ? 137 LEU A C     1 
ATOM   1045  O O     . LEU A 1 137 ? 42.006  20.350  -22.558 1.00 34.79 ? 137 LEU A O     1 
ATOM   1046  C CB    . LEU A 1 137 ? 39.844  18.470  -20.663 1.00 32.20 ? 137 LEU A CB    1 
ATOM   1047  C CG    . LEU A 1 137 ? 40.384  17.037  -20.953 1.00 33.43 ? 137 LEU A CG    1 
ATOM   1048  C CD1   . LEU A 1 137 ? 39.287  16.219  -21.537 1.00 32.78 ? 137 LEU A CD1   1 
ATOM   1049  C CD2   . LEU A 1 137 ? 41.644  16.927  -21.766 1.00 31.10 ? 137 LEU A CD2   1 
ATOM   1050  N N     . ASP A 1 138 ? 41.997  20.438  -20.357 1.00 36.15 ? 138 ASP A N     1 
ATOM   1051  C CA    . ASP A 1 138 ? 43.388  20.828  -20.283 1.00 35.87 ? 138 ASP A CA    1 
ATOM   1052  C C     . ASP A 1 138 ? 44.294  19.768  -19.719 1.00 36.07 ? 138 ASP A C     1 
ATOM   1053  O O     . ASP A 1 138 ? 44.006  19.201  -18.664 1.00 37.40 ? 138 ASP A O     1 
ATOM   1054  C CB    . ASP A 1 138 ? 43.526  22.152  -19.535 1.00 36.77 ? 138 ASP A CB    1 
ATOM   1055  C CG    . ASP A 1 138 ? 43.014  22.089  -18.074 1.00 39.98 ? 138 ASP A CG    1 
ATOM   1056  O OD1   . ASP A 1 138 ? 41.790  22.119  -17.841 1.00 44.79 ? 138 ASP A OD1   1 
ATOM   1057  O OD2   . ASP A 1 138 ? 43.862  22.110  -17.164 1.00 39.40 ? 138 ASP A OD2   1 
ATOM   1058  N N     . GLU A 1 139 ? 45.400  19.489  -20.403 1.00 36.70 ? 139 GLU A N     1 
ATOM   1059  C CA    . GLU A 1 139 ? 46.410  18.593  -19.852 1.00 38.98 ? 139 GLU A CA    1 
ATOM   1060  C C     . GLU A 1 139 ? 47.469  19.363  -19.050 1.00 39.20 ? 139 GLU A C     1 
ATOM   1061  O O     . GLU A 1 139 ? 47.718  20.504  -19.352 1.00 41.53 ? 139 GLU A O     1 
ATOM   1062  C CB    . GLU A 1 139 ? 47.052  17.775  -20.964 1.00 39.59 ? 139 GLU A CB    1 
ATOM   1063  C CG    . GLU A 1 139 ? 46.122  16.744  -21.602 1.00 43.10 ? 139 GLU A CG    1 
ATOM   1064  C CD    . GLU A 1 139 ? 46.818  16.077  -22.753 1.00 52.08 ? 139 GLU A CD    1 
ATOM   1065  O OE1   . GLU A 1 139 ? 47.361  14.965  -22.556 1.00 52.34 ? 139 GLU A OE1   1 
ATOM   1066  O OE2   . GLU A 1 139 ? 46.882  16.699  -23.855 1.00 57.38 ? 139 GLU A OE2   1 
ATOM   1067  N N     . PRO A 1 140 ? 48.076  18.753  -18.011 1.00 38.88 ? 140 PRO A N     1 
ATOM   1068  C CA    . PRO A 1 140 ? 47.761  17.414  -17.473 1.00 37.05 ? 140 PRO A CA    1 
ATOM   1069  C C     . PRO A 1 140 ? 46.361  17.302  -16.827 1.00 37.78 ? 140 PRO A C     1 
ATOM   1070  O O     . PRO A 1 140 ? 45.861  18.207  -16.123 1.00 36.54 ? 140 PRO A O     1 
ATOM   1071  C CB    . PRO A 1 140 ? 48.820  17.194  -16.424 1.00 36.63 ? 140 PRO A CB    1 
ATOM   1072  C CG    . PRO A 1 140 ? 49.277  18.610  -16.024 1.00 38.56 ? 140 PRO A CG    1 
ATOM   1073  C CD    . PRO A 1 140 ? 49.221  19.385  -17.311 1.00 37.45 ? 140 PRO A CD    1 
ATOM   1074  N N     . ALA A 1 141 ? 45.746  16.147  -17.054 1.00 37.40 ? 141 ALA A N     1 
ATOM   1075  C CA    . ALA A 1 141 ? 44.351  15.954  -16.715 1.00 36.22 ? 141 ALA A CA    1 
ATOM   1076  C C     . ALA A 1 141 ? 44.252  14.785  -15.744 1.00 35.89 ? 141 ALA A C     1 
ATOM   1077  O O     . ALA A 1 141 ? 44.981  13.779  -15.874 1.00 36.24 ? 141 ALA A O     1 
ATOM   1078  C CB    . ALA A 1 141 ? 43.571  15.728  -18.030 1.00 33.97 ? 141 ALA A CB    1 
ATOM   1079  N N     . TYR A 1 142 ? 43.390  14.864  -14.746 1.00 37.27 ? 142 TYR A N     1 
ATOM   1080  C CA    . TYR A 1 142 ? 43.215  13.656  -13.842 1.00 38.04 ? 142 TYR A CA    1 
ATOM   1081  C C     . TYR A 1 142 ? 43.201  12.300  -14.650 1.00 37.44 ? 142 TYR A C     1 
ATOM   1082  O O     . TYR A 1 142 ? 42.508  12.194  -15.675 1.00 37.35 ? 142 TYR A O     1 
ATOM   1083  C CB    . TYR A 1 142 ? 41.978  13.818  -12.963 1.00 38.65 ? 142 TYR A CB    1 
ATOM   1084  C CG    . TYR A 1 142 ? 41.576  12.578  -12.170 1.00 38.31 ? 142 TYR A CG    1 
ATOM   1085  C CD1   . TYR A 1 142 ? 40.248  12.148  -12.166 1.00 37.80 ? 142 TYR A CD1   1 
ATOM   1086  C CD2   . TYR A 1 142 ? 42.513  11.845  -11.451 1.00 35.95 ? 142 TYR A CD2   1 
ATOM   1087  C CE1   . TYR A 1 142 ? 39.861  11.062  -11.466 1.00 35.04 ? 142 TYR A CE1   1 
ATOM   1088  C CE2   . TYR A 1 142 ? 42.141  10.720  -10.787 1.00 35.88 ? 142 TYR A CE2   1 
ATOM   1089  C CZ    . TYR A 1 142 ? 40.814  10.333  -10.788 1.00 38.54 ? 142 TYR A CZ    1 
ATOM   1090  O OH    . TYR A 1 142 ? 40.416  9.209   -10.071 1.00 38.66 ? 142 TYR A OH    1 
ATOM   1091  N N     . SER A 1 143 ? 44.036  11.336  -14.265 1.00 35.36 ? 143 SER A N     1 
ATOM   1092  C CA    . SER A 1 143 ? 44.140  10.071  -15.015 1.00 34.33 ? 143 SER A CA    1 
ATOM   1093  C C     . SER A 1 143 ? 42.811  9.306   -15.122 1.00 35.13 ? 143 SER A C     1 
ATOM   1094  O O     . SER A 1 143 ? 42.504  8.668   -16.172 1.00 34.55 ? 143 SER A O     1 
ATOM   1095  C CB    . SER A 1 143 ? 45.253  9.165   -14.425 1.00 35.80 ? 143 SER A CB    1 
ATOM   1096  O OG    . SER A 1 143 ? 45.119  9.076   -13.008 1.00 33.97 ? 143 SER A OG    1 
ATOM   1097  N N     . GLY A 1 144 ? 42.000  9.402   -14.073 1.00 32.82 ? 144 GLY A N     1 
ATOM   1098  C CA    . GLY A 1 144 ? 40.675  8.804   -14.095 1.00 33.31 ? 144 GLY A CA    1 
ATOM   1099  C C     . GLY A 1 144 ? 39.735  9.360   -15.145 1.00 32.89 ? 144 GLY A C     1 
ATOM   1100  O O     . GLY A 1 144 ? 39.018  8.595   -15.773 1.00 30.84 ? 144 GLY A O     1 
ATOM   1101  N N     . THR A 1 145 ? 39.684  10.704  -15.308 1.00 33.43 ? 145 THR A N     1 
ATOM   1102  C CA    . THR A 1 145 ? 38.906  11.262  -16.371 1.00 33.52 ? 145 THR A CA    1 
ATOM   1103  C C     . THR A 1 145 ? 39.473  10.802  -17.749 1.00 32.69 ? 145 THR A C     1 
ATOM   1104  O O     . THR A 1 145 ? 38.745  10.510  -18.646 1.00 31.79 ? 145 THR A O     1 
ATOM   1105  C CB    . THR A 1 145 ? 38.782  12.786  -16.301 1.00 34.94 ? 145 THR A CB    1 
ATOM   1106  O OG1   . THR A 1 145 ? 38.035  13.162  -15.144 1.00 35.88 ? 145 THR A OG1   1 
ATOM   1107  C CG2   . THR A 1 145 ? 38.042  13.312  -17.553 1.00 33.17 ? 145 THR A CG2   1 
ATOM   1108  N N     . LEU A 1 146 ? 40.771  10.734  -17.888 1.00 33.67 ? 146 LEU A N     1 
ATOM   1109  C CA    . LEU A 1 146 ? 41.363  10.236  -19.125 1.00 36.46 ? 146 LEU A CA    1 
ATOM   1110  C C     . LEU A 1 146 ? 40.922  8.780   -19.416 1.00 37.53 ? 146 LEU A C     1 
ATOM   1111  O O     . LEU A 1 146 ? 40.645  8.436   -20.563 1.00 38.45 ? 146 LEU A O     1 
ATOM   1112  C CB    . LEU A 1 146 ? 42.890  10.349  -19.073 1.00 36.12 ? 146 LEU A CB    1 
ATOM   1113  C CG    . LEU A 1 146 ? 43.156  11.817  -19.369 1.00 37.43 ? 146 LEU A CG    1 
ATOM   1114  C CD1   . LEU A 1 146 ? 44.641  12.287  -19.289 1.00 28.60 ? 146 LEU A CD1   1 
ATOM   1115  C CD2   . LEU A 1 146 ? 42.565  11.985  -20.793 1.00 41.50 ? 146 LEU A CD2   1 
ATOM   1116  N N     . GLN A 1 147 ? 40.786  7.974   -18.369 1.00 36.59 ? 147 GLN A N     1 
ATOM   1117  C CA    . GLN A 1 147 ? 40.539  6.599   -18.572 1.00 38.00 ? 147 GLN A CA    1 
ATOM   1118  C C     . GLN A 1 147 ? 39.064  6.334   -18.672 1.00 37.58 ? 147 GLN A C     1 
ATOM   1119  O O     . GLN A 1 147 ? 38.665  5.300   -19.162 1.00 37.59 ? 147 GLN A O     1 
ATOM   1120  C CB    . GLN A 1 147 ? 41.224  5.755   -17.501 1.00 38.07 ? 147 GLN A CB    1 
ATOM   1121  C CG    . GLN A 1 147 ? 42.748  5.908   -17.573 1.00 40.61 ? 147 GLN A CG    1 
ATOM   1122  C CD    . GLN A 1 147 ? 43.389  5.023   -18.668 1.00 49.27 ? 147 GLN A CD    1 
ATOM   1123  O OE1   . GLN A 1 147 ? 42.714  4.538   -19.612 1.00 49.04 ? 147 GLN A OE1   1 
ATOM   1124  N NE2   . GLN A 1 147 ? 44.710  4.778   -18.521 1.00 53.27 ? 147 GLN A NE2   1 
ATOM   1125  N N     . SER A 1 148 ? 38.248  7.262   -18.211 1.00 37.17 ? 148 SER A N     1 
ATOM   1126  C CA    . SER A 1 148 ? 36.822  7.114   -18.461 1.00 37.43 ? 148 SER A CA    1 
ATOM   1127  C C     . SER A 1 148 ? 36.455  7.680   -19.827 1.00 36.99 ? 148 SER A C     1 
ATOM   1128  O O     . SER A 1 148 ? 35.505  7.237   -20.450 1.00 37.55 ? 148 SER A O     1 
ATOM   1129  C CB    . SER A 1 148 ? 35.997  7.678   -17.280 1.00 36.76 ? 148 SER A CB    1 
ATOM   1130  O OG    . SER A 1 148 ? 34.779  8.243   -17.666 1.00 35.86 ? 148 SER A OG    1 
ATOM   1131  N N     . LEU A 1 149 ? 37.224  8.618   -20.364 1.00 38.25 ? 149 LEU A N     1 
ATOM   1132  C CA    . LEU A 1 149 ? 36.817  9.195   -21.689 1.00 36.91 ? 149 LEU A CA    1 
ATOM   1133  C C     . LEU A 1 149 ? 37.290  8.360   -22.830 1.00 36.77 ? 149 LEU A C     1 
ATOM   1134  O O     . LEU A 1 149 ? 36.709  8.407   -23.954 1.00 37.99 ? 149 LEU A O     1 
ATOM   1135  C CB    . LEU A 1 149 ? 37.337  10.638  -21.884 1.00 36.50 ? 149 LEU A CB    1 
ATOM   1136  C CG    . LEU A 1 149 ? 36.787  11.761  -21.032 1.00 35.55 ? 149 LEU A CG    1 
ATOM   1137  C CD1   . LEU A 1 149 ? 37.596  13.101  -21.262 1.00 35.08 ? 149 LEU A CD1   1 
ATOM   1138  C CD2   . LEU A 1 149 ? 35.386  11.960  -21.454 1.00 34.67 ? 149 LEU A CD2   1 
ATOM   1139  N N     . HIS A 1 150 ? 38.371  7.613   -22.587 1.00 37.46 ? 150 HIS A N     1 
ATOM   1140  C CA    . HIS A 1 150 ? 39.008  6.780   -23.633 1.00 36.63 ? 150 HIS A CA    1 
ATOM   1141  C C     . HIS A 1 150 ? 38.065  5.828   -24.398 1.00 36.51 ? 150 HIS A C     1 
ATOM   1142  O O     . HIS A 1 150 ? 38.005  5.858   -25.630 1.00 36.65 ? 150 HIS A O     1 
ATOM   1143  C CB    . HIS A 1 150 ? 40.229  6.043   -23.074 1.00 38.24 ? 150 HIS A CB    1 
ATOM   1144  C CG    . HIS A 1 150 ? 40.870  5.050   -24.021 1.00 37.79 ? 150 HIS A CG    1 
ATOM   1145  N ND1   . HIS A 1 150 ? 40.945  3.693   -23.749 1.00 41.15 ? 150 HIS A ND1   1 
ATOM   1146  C CD2   . HIS A 1 150 ? 41.495  5.229   -25.210 1.00 36.92 ? 150 HIS A CD2   1 
ATOM   1147  C CE1   . HIS A 1 150 ? 41.564  3.081   -24.753 1.00 40.99 ? 150 HIS A CE1   1 
ATOM   1148  N NE2   . HIS A 1 150 ? 41.926  3.997   -25.639 1.00 35.68 ? 150 HIS A NE2   1 
ATOM   1149  N N     . PRO A 1 151 ? 37.354  4.941   -23.690 1.00 35.73 ? 151 PRO A N     1 
ATOM   1150  C CA    . PRO A 1 151 ? 36.519  3.977   -24.445 1.00 33.46 ? 151 PRO A CA    1 
ATOM   1151  C C     . PRO A 1 151 ? 35.321  4.607   -25.104 1.00 33.06 ? 151 PRO A C     1 
ATOM   1152  O O     . PRO A 1 151 ? 34.673  3.936   -25.862 1.00 31.31 ? 151 PRO A O     1 
ATOM   1153  C CB    . PRO A 1 151 ? 35.989  3.049   -23.355 1.00 32.58 ? 151 PRO A CB    1 
ATOM   1154  C CG    . PRO A 1 151 ? 36.036  3.847   -22.107 1.00 34.80 ? 151 PRO A CG    1 
ATOM   1155  C CD    . PRO A 1 151 ? 37.308  4.679   -22.234 1.00 35.82 ? 151 PRO A CD    1 
ATOM   1156  N N     . LEU A 1 152 ? 34.968  5.846   -24.724 1.00 31.68 ? 152 LEU A N     1 
ATOM   1157  C CA    . LEU A 1 152 ? 33.791  6.487   -25.257 1.00 31.85 ? 152 LEU A CA    1 
ATOM   1158  C C     . LEU A 1 152 ? 34.234  6.969   -26.667 1.00 34.68 ? 152 LEU A C     1 
ATOM   1159  O O     . LEU A 1 152 ? 33.423  7.408   -27.500 1.00 36.78 ? 152 LEU A O     1 
ATOM   1160  C CB    . LEU A 1 152 ? 33.246  7.599   -24.312 1.00 31.31 ? 152 LEU A CB    1 
ATOM   1161  C CG    . LEU A 1 152 ? 32.595  7.075   -22.951 1.00 30.76 ? 152 LEU A CG    1 
ATOM   1162  C CD1   . LEU A 1 152 ? 33.523  6.067   -22.361 1.00 30.16 ? 152 LEU A CD1   1 
ATOM   1163  C CD2   . LEU A 1 152 ? 32.326  8.124   -21.880 1.00 28.64 ? 152 LEU A CD2   1 
ATOM   1164  N N     . GLY A 1 153 ? 35.511  6.821   -26.966 1.00 33.45 ? 153 GLY A N     1 
ATOM   1165  C CA    . GLY A 1 153 ? 35.935  7.114   -28.316 1.00 37.52 ? 153 GLY A CA    1 
ATOM   1166  C C     . GLY A 1 153 ? 35.796  8.546   -28.792 1.00 38.23 ? 153 GLY A C     1 
ATOM   1167  O O     . GLY A 1 153 ? 35.752  8.738   -29.984 1.00 40.27 ? 153 GLY A O     1 
ATOM   1168  N N     . CYS A 1 154 ? 35.692  9.540   -27.883 1.00 37.94 ? 154 CYS A N     1 
ATOM   1169  C CA    . CYS A 1 154 ? 35.753  10.958  -28.282 1.00 37.00 ? 154 CYS A CA    1 
ATOM   1170  C C     . CYS A 1 154 ? 37.140  11.384  -28.755 1.00 36.89 ? 154 CYS A C     1 
ATOM   1171  O O     . CYS A 1 154 ? 38.144  10.756  -28.404 1.00 32.92 ? 154 CYS A O     1 
ATOM   1172  C CB    . CYS A 1 154 ? 35.284  11.950  -27.199 1.00 37.32 ? 154 CYS A CB    1 
ATOM   1173  S SG    . CYS A 1 154 ? 35.782  11.581  -25.495 1.00 37.65 ? 154 CYS A SG    1 
ATOM   1174  N N     . ASN A 1 155 ? 37.197  12.506  -29.495 1.00 37.35 ? 155 ASN A N     1 
ATOM   1175  C CA    . ASN A 1 155 ? 38.504  13.058  -29.788 1.00 39.84 ? 155 ASN A CA    1 
ATOM   1176  C C     . ASN A 1 155 ? 38.730  14.117  -28.724 1.00 38.37 ? 155 ASN A C     1 
ATOM   1177  O O     . ASN A 1 155 ? 37.979  15.050  -28.651 1.00 41.09 ? 155 ASN A O     1 
ATOM   1178  C CB    . ASN A 1 155 ? 38.589  13.614  -31.233 1.00 41.01 ? 155 ASN A CB    1 
ATOM   1179  C CG    . ASN A 1 155 ? 39.937  13.357  -31.872 1.00 48.08 ? 155 ASN A CG    1 
ATOM   1180  O OD1   . ASN A 1 155 ? 40.983  13.543  -31.214 1.00 47.68 ? 155 ASN A OD1   1 
ATOM   1181  N ND2   . ASN A 1 155 ? 39.936  12.844  -33.173 1.00 50.60 ? 155 ASN A ND2   1 
ATOM   1182  N N     . ILE A 1 156 ? 39.737  13.961  -27.886 1.00 37.45 ? 156 ILE A N     1 
ATOM   1183  C CA    . ILE A 1 156 ? 40.059  14.935  -26.856 1.00 37.61 ? 156 ILE A CA    1 
ATOM   1184  C C     . ILE A 1 156 ? 41.001  16.056  -27.347 1.00 37.70 ? 156 ILE A C     1 
ATOM   1185  O O     . ILE A 1 156 ? 42.125  15.804  -27.690 1.00 37.67 ? 156 ILE A O     1 
ATOM   1186  C CB    . ILE A 1 156 ? 40.702  14.215  -25.668 1.00 37.52 ? 156 ILE A CB    1 
ATOM   1187  C CG1   . ILE A 1 156 ? 39.654  13.297  -25.014 1.00 36.29 ? 156 ILE A CG1   1 
ATOM   1188  C CG2   . ILE A 1 156 ? 41.244  15.211  -24.637 1.00 38.64 ? 156 ILE A CG2   1 
ATOM   1189  C CD1   . ILE A 1 156 ? 40.280  12.165  -24.152 1.00 28.38 ? 156 ILE A CD1   1 
ATOM   1190  N N     . ILE A 1 157 ? 40.546  17.298  -27.347 1.00 38.14 ? 157 ILE A N     1 
ATOM   1191  C CA    . ILE A 1 157 ? 41.372  18.416  -27.898 1.00 37.74 ? 157 ILE A CA    1 
ATOM   1192  C C     . ILE A 1 157 ? 41.940  19.147  -26.687 1.00 38.71 ? 157 ILE A C     1 
ATOM   1193  O O     . ILE A 1 157 ? 41.177  19.502  -25.778 1.00 39.78 ? 157 ILE A O     1 
ATOM   1194  C CB    . ILE A 1 157 ? 40.536  19.414  -28.772 1.00 37.24 ? 157 ILE A CB    1 
ATOM   1195  C CG1   . ILE A 1 157 ? 39.854  18.671  -29.945 1.00 35.61 ? 157 ILE A CG1   1 
ATOM   1196  C CG2   . ILE A 1 157 ? 41.449  20.629  -29.237 1.00 37.99 ? 157 ILE A CG2   1 
ATOM   1197  C CD1   . ILE A 1 157 ? 38.687  19.471  -30.716 1.00 36.48 ? 157 ILE A CD1   1 
ATOM   1198  N N     . ASN A 1 158 ? 43.254  19.294  -26.634 1.00 37.82 ? 158 ASN A N     1 
ATOM   1199  C CA    . ASN A 1 158 ? 43.895  19.779  -25.451 1.00 38.51 ? 158 ASN A CA    1 
ATOM   1200  C C     . ASN A 1 158 ? 43.852  21.280  -25.442 1.00 39.79 ? 158 ASN A C     1 
ATOM   1201  O O     . ASN A 1 158 ? 44.179  21.903  -26.455 1.00 40.00 ? 158 ASN A O     1 
ATOM   1202  C CB    . ASN A 1 158 ? 45.373  19.329  -25.331 1.00 37.13 ? 158 ASN A CB    1 
ATOM   1203  C CG    . ASN A 1 158 ? 46.036  19.888  -24.015 1.00 39.87 ? 158 ASN A CG    1 
ATOM   1204  O OD1   . ASN A 1 158 ? 45.412  19.861  -22.928 1.00 36.96 ? 158 ASN A OD1   1 
ATOM   1205  N ND2   . ASN A 1 158 ? 47.220  20.488  -24.143 1.00 36.71 ? 158 ASN A ND2   1 
ATOM   1206  N N     . VAL A 1 159 ? 43.495  21.856  -24.294 1.00 40.47 ? 159 VAL A N     1 
ATOM   1207  C CA    . VAL A 1 159 ? 43.461  23.330  -24.142 1.00 41.77 ? 159 VAL A CA    1 
ATOM   1208  C C     . VAL A 1 159 ? 44.648  23.755  -23.242 1.00 43.76 ? 159 VAL A C     1 
ATOM   1209  O O     . VAL A 1 159 ? 44.815  23.231  -22.132 1.00 44.67 ? 159 VAL A O     1 
ATOM   1210  C CB    . VAL A 1 159 ? 42.073  23.857  -23.583 1.00 41.32 ? 159 VAL A CB    1 
ATOM   1211  C CG1   . VAL A 1 159 ? 42.094  25.359  -23.370 1.00 39.29 ? 159 VAL A CG1   1 
ATOM   1212  C CG2   . VAL A 1 159 ? 40.851  23.400  -24.495 1.00 36.57 ? 159 VAL A CG2   1 
ATOM   1213  N N     . ALA A 1 160 ? 45.499  24.640  -23.750 1.00 44.08 ? 160 ALA A N     1 
ATOM   1214  C CA    . ALA A 1 160 ? 46.626  25.179  -22.970 1.00 44.80 ? 160 ALA A CA    1 
ATOM   1215  C C     . ALA A 1 160 ? 46.206  25.825  -21.639 1.00 45.51 ? 160 ALA A C     1 
ATOM   1216  O O     . ALA A 1 160 ? 45.200  26.571  -21.552 1.00 45.91 ? 160 ALA A O     1 
ATOM   1217  C CB    . ALA A 1 160 ? 47.455  26.166  -23.819 1.00 44.24 ? 160 ALA A CB    1 
ATOM   1218  N N     . SER A 1 161 ? 47.018  25.523  -20.624 1.00 45.65 ? 161 SER A N     1 
ATOM   1219  C CA    . SER A 1 161 ? 46.840  25.868  -19.215 1.00 45.59 ? 161 SER A CA    1 
ATOM   1220  C C     . SER A 1 161 ? 48.230  26.314  -18.680 1.00 46.00 ? 161 SER A C     1 
ATOM   1221  O O     . SER A 1 161 ? 49.222  26.070  -19.342 1.00 46.17 ? 161 SER A O     1 
ATOM   1222  C CB    . SER A 1 161 ? 46.470  24.602  -18.488 1.00 43.34 ? 161 SER A CB    1 
ATOM   1223  O OG    . SER A 1 161 ? 47.338  23.600  -18.986 1.00 44.84 ? 161 SER A OG    1 
ATOM   1224  N N     . ASP A 1 162 ? 48.297  26.892  -17.477 1.00 46.47 ? 162 ASP A N     1 
ATOM   1225  C CA    . ASP A 1 162 ? 49.533  27.392  -16.893 1.00 46.90 ? 162 ASP A CA    1 
ATOM   1226  C C     . ASP A 1 162 ? 49.274  27.540  -15.384 1.00 47.60 ? 162 ASP A C     1 
ATOM   1227  O O     . ASP A 1 162 ? 48.301  26.985  -14.900 1.00 49.29 ? 162 ASP A O     1 
ATOM   1228  C CB    . ASP A 1 162 ? 49.915  28.731  -17.583 1.00 48.00 ? 162 ASP A CB    1 
ATOM   1229  C CG    . ASP A 1 162 ? 48.858  29.807  -17.406 1.00 46.58 ? 162 ASP A CG    1 
ATOM   1230  O OD1   . ASP A 1 162 ? 47.961  29.592  -16.580 1.00 44.09 ? 162 ASP A OD1   1 
ATOM   1231  O OD2   . ASP A 1 162 ? 48.896  30.840  -18.126 1.00 49.28 ? 162 ASP A OD2   1 
ATOM   1232  N N     . GLU A 1 163 ? 50.083  28.286  -14.635 1.00 47.75 ? 163 GLU A N     1 
ATOM   1233  C CA    . GLU A 1 163 ? 49.842  28.473  -13.186 1.00 48.34 ? 163 GLU A CA    1 
ATOM   1234  C C     . GLU A 1 163 ? 48.364  28.791  -12.805 1.00 47.51 ? 163 GLU A C     1 
ATOM   1235  O O     . GLU A 1 163 ? 47.928  28.472  -11.676 1.00 45.44 ? 163 GLU A O     1 
ATOM   1236  C CB    . GLU A 1 163 ? 50.726  29.617  -12.628 1.00 49.90 ? 163 GLU A CB    1 
ATOM   1237  C CG    . GLU A 1 163 ? 52.152  29.659  -13.183 1.00 53.28 ? 163 GLU A CG    1 
ATOM   1238  C CD    . GLU A 1 163 ? 52.283  30.526  -14.451 1.00 60.38 ? 163 GLU A CD    1 
ATOM   1239  O OE1   . GLU A 1 163 ? 52.539  29.919  -15.558 1.00 56.80 ? 163 GLU A OE1   1 
ATOM   1240  O OE2   . GLU A 1 163 ? 52.152  31.803  -14.318 1.00 60.02 ? 163 GLU A OE2   1 
ATOM   1241  N N     . SER A 1 164 ? 47.626  29.436  -13.729 1.00 46.10 ? 164 SER A N     1 
ATOM   1242  C CA    . SER A 1 164 ? 46.253  29.922  -13.447 1.00 46.26 ? 164 SER A CA    1 
ATOM   1243  C C     . SER A 1 164 ? 45.085  29.163  -14.086 1.00 45.00 ? 164 SER A C     1 
ATOM   1244  O O     . SER A 1 164 ? 43.949  29.658  -14.043 1.00 43.88 ? 164 SER A O     1 
ATOM   1245  C CB    . SER A 1 164 ? 46.089  31.449  -13.739 1.00 46.86 ? 164 SER A CB    1 
ATOM   1246  O OG    . SER A 1 164 ? 46.708  32.236  -12.747 1.00 47.27 ? 164 SER A OG    1 
ATOM   1247  N N     . GLY A 1 165 ? 45.355  27.992  -14.665 1.00 45.21 ? 165 GLY A N     1 
ATOM   1248  C CA    . GLY A 1 165 ? 44.306  27.130  -15.282 1.00 44.62 ? 165 GLY A CA    1 
ATOM   1249  C C     . GLY A 1 165 ? 44.160  27.305  -16.804 1.00 45.46 ? 165 GLY A C     1 
ATOM   1250  O O     . GLY A 1 165 ? 45.089  27.798  -17.462 1.00 44.86 ? 165 GLY A O     1 
ATOM   1251  N N     . ILE A 1 166 ? 43.015  26.922  -17.400 1.00 45.09 ? 166 ILE A N     1 
ATOM   1252  C CA    . ILE A 1 166 ? 42.975  27.041  -18.833 1.00 45.49 ? 166 ILE A CA    1 
ATOM   1253  C C     . ILE A 1 166 ? 43.325  28.520  -19.235 1.00 46.19 ? 166 ILE A C     1 
ATOM   1254  O O     . ILE A 1 166 ? 42.916  29.520  -18.532 1.00 44.74 ? 166 ILE A O     1 
ATOM   1255  C CB    . ILE A 1 166 ? 41.669  26.474  -19.581 1.00 44.78 ? 166 ILE A CB    1 
ATOM   1256  C CG1   . ILE A 1 166 ? 40.679  27.582  -19.903 1.00 46.99 ? 166 ILE A CG1   1 
ATOM   1257  C CG2   . ILE A 1 166 ? 41.000  25.191  -18.932 1.00 43.08 ? 166 ILE A CG2   1 
ATOM   1258  C CD1   . ILE A 1 166 ? 40.983  28.292  -21.220 1.00 48.28 ? 166 ILE A CD1   1 
ATOM   1259  N N     . VAL A 1 167 ? 44.049  28.647  -20.366 1.00 45.22 ? 167 VAL A N     1 
ATOM   1260  C CA    . VAL A 1 167 ? 44.364  29.962  -20.902 1.00 44.75 ? 167 VAL A CA    1 
ATOM   1261  C C     . VAL A 1 167 ? 43.265  30.344  -21.890 1.00 44.62 ? 167 VAL A C     1 
ATOM   1262  O O     . VAL A 1 167 ? 43.213  29.741  -22.947 1.00 46.62 ? 167 VAL A O     1 
ATOM   1263  C CB    . VAL A 1 167 ? 45.752  29.956  -21.621 1.00 45.57 ? 167 VAL A CB    1 
ATOM   1264  C CG1   . VAL A 1 167 ? 46.167  31.367  -22.037 1.00 41.64 ? 167 VAL A CG1   1 
ATOM   1265  C CG2   . VAL A 1 167 ? 46.843  29.284  -20.755 1.00 42.72 ? 167 VAL A CG2   1 
ATOM   1266  N N     . PRO A 1 168 ? 42.375  31.324  -21.571 1.00 43.93 ? 168 PRO A N     1 
ATOM   1267  C CA    . PRO A 1 168 ? 41.354  31.715  -22.551 1.00 43.43 ? 168 PRO A CA    1 
ATOM   1268  C C     . PRO A 1 168 ? 41.711  31.874  -24.042 1.00 43.31 ? 168 PRO A C     1 
ATOM   1269  O O     . PRO A 1 168 ? 40.928  31.412  -24.883 1.00 41.75 ? 168 PRO A O     1 
ATOM   1270  C CB    . PRO A 1 168 ? 40.776  32.985  -21.948 1.00 43.97 ? 168 PRO A CB    1 
ATOM   1271  C CG    . PRO A 1 168 ? 40.807  32.690  -20.535 1.00 42.58 ? 168 PRO A CG    1 
ATOM   1272  C CD    . PRO A 1 168 ? 42.175  32.098  -20.333 1.00 43.24 ? 168 PRO A CD    1 
ATOM   1273  N N     . ASP A 1 169 ? 42.833  32.509  -24.402 1.00 43.99 ? 169 ASP A N     1 
ATOM   1274  C CA    . ASP A 1 169 ? 43.070  32.729  -25.867 1.00 44.23 ? 169 ASP A CA    1 
ATOM   1275  C C     . ASP A 1 169 ? 43.285  31.390  -26.590 1.00 43.54 ? 169 ASP A C     1 
ATOM   1276  O O     . ASP A 1 169 ? 43.015  31.253  -27.817 1.00 42.63 ? 169 ASP A O     1 
ATOM   1277  C CB    . ASP A 1 169 ? 44.250  33.649  -26.215 1.00 44.09 ? 169 ASP A CB    1 
ATOM   1278  C CG    . ASP A 1 169 ? 44.337  34.888  -25.364 1.00 47.79 ? 169 ASP A CG    1 
ATOM   1279  O OD1   . ASP A 1 169 ? 43.290  35.591  -25.093 1.00 43.82 ? 169 ASP A OD1   1 
ATOM   1280  O OD2   . ASP A 1 169 ? 45.530  35.181  -25.034 1.00 49.06 ? 169 ASP A OD2   1 
ATOM   1281  N N     . SER A 1 170 ? 43.795  30.423  -25.823 1.00 42.71 ? 170 SER A N     1 
ATOM   1282  C CA    . SER A 1 170 ? 44.055  29.061  -26.346 1.00 41.29 ? 170 SER A CA    1 
ATOM   1283  C C     . SER A 1 170 ? 42.695  28.434  -26.607 1.00 41.09 ? 170 SER A C     1 
ATOM   1284  O O     . SER A 1 170 ? 42.437  27.886  -27.694 1.00 41.40 ? 170 SER A O     1 
ATOM   1285  C CB    . SER A 1 170 ? 44.962  28.263  -25.369 1.00 41.98 ? 170 SER A CB    1 
ATOM   1286  O OG    . SER A 1 170 ? 44.923  26.852  -25.542 1.00 41.24 ? 170 SER A OG    1 
ATOM   1287  N N     . LEU A 1 171 ? 41.778  28.598  -25.658 1.00 40.42 ? 171 LEU A N     1 
ATOM   1288  C CA    . LEU A 1 171 ? 40.404  28.161  -25.857 1.00 39.34 ? 171 LEU A CA    1 
ATOM   1289  C C     . LEU A 1 171 ? 39.781  28.820  -27.115 1.00 40.35 ? 171 LEU A C     1 
ATOM   1290  O O     . LEU A 1 171 ? 39.161  28.158  -27.939 1.00 39.39 ? 171 LEU A O     1 
ATOM   1291  C CB    . LEU A 1 171 ? 39.542  28.439  -24.602 1.00 38.77 ? 171 LEU A CB    1 
ATOM   1292  C CG    . LEU A 1 171 ? 38.130  27.789  -24.528 1.00 39.45 ? 171 LEU A CG    1 
ATOM   1293  C CD1   . LEU A 1 171 ? 38.067  26.337  -25.064 1.00 27.02 ? 171 LEU A CD1   1 
ATOM   1294  C CD2   . LEU A 1 171 ? 37.511  27.876  -23.080 1.00 36.29 ? 171 LEU A CD2   1 
ATOM   1295  N N     . ARG A 1 172 ? 39.946  30.138  -27.210 1.00 41.99 ? 172 ARG A N     1 
ATOM   1296  C CA    . ARG A 1 172 ? 39.408  30.987  -28.284 1.00 42.84 ? 172 ARG A CA    1 
ATOM   1297  C C     . ARG A 1 172 ? 40.022  30.717  -29.643 1.00 43.23 ? 172 ARG A C     1 
ATOM   1298  O O     . ARG A 1 172 ? 39.356  30.749  -30.661 1.00 44.06 ? 172 ARG A O     1 
ATOM   1299  C CB    . ARG A 1 172 ? 39.675  32.431  -27.926 1.00 42.56 ? 172 ARG A CB    1 
ATOM   1300  C CG    . ARG A 1 172 ? 38.797  33.449  -28.575 1.00 43.25 ? 172 ARG A CG    1 
ATOM   1301  C CD    . ARG A 1 172 ? 39.309  34.824  -28.119 1.00 44.01 ? 172 ARG A CD    1 
ATOM   1302  N NE    . ARG A 1 172 ? 38.896  35.049  -26.712 1.00 50.83 ? 172 ARG A NE    1 
ATOM   1303  C CZ    . ARG A 1 172 ? 39.705  35.325  -25.691 1.00 50.85 ? 172 ARG A CZ    1 
ATOM   1304  N NH1   . ARG A 1 172 ? 41.019  35.432  -25.855 1.00 52.59 ? 172 ARG A NH1   1 
ATOM   1305  N NH2   . ARG A 1 172 ? 39.195  35.504  -24.488 1.00 52.45 ? 172 ARG A NH2   1 
ATOM   1306  N N     . ASP A 1 173 ? 41.303  30.477  -29.666 1.00 44.47 ? 173 ASP A N     1 
ATOM   1307  C CA    . ASP A 1 173 ? 41.903  30.222  -30.947 1.00 45.66 ? 173 ASP A CA    1 
ATOM   1308  C C     . ASP A 1 173 ? 41.702  28.727  -31.433 1.00 45.23 ? 173 ASP A C     1 
ATOM   1309  O O     . ASP A 1 173 ? 41.589  28.457  -32.644 1.00 44.99 ? 173 ASP A O     1 
ATOM   1310  C CB    . ASP A 1 173 ? 43.282  30.896  -31.008 1.00 45.88 ? 173 ASP A CB    1 
ATOM   1311  C CG    . ASP A 1 173 ? 43.210  32.458  -30.543 1.00 49.84 ? 173 ASP A CG    1 
ATOM   1312  O OD1   . ASP A 1 173 ? 44.055  32.876  -29.702 1.00 49.71 ? 173 ASP A OD1   1 
ATOM   1313  O OD2   . ASP A 1 173 ? 42.277  33.249  -30.971 1.00 48.49 ? 173 ASP A OD2   1 
ATOM   1314  N N     . ILE A 1 174 ? 41.498  27.812  -30.484 1.00 44.80 ? 174 ILE A N     1 
ATOM   1315  C CA    . ILE A 1 174 ? 41.031  26.420  -30.766 1.00 43.66 ? 174 ILE A CA    1 
ATOM   1316  C C     . ILE A 1 174 ? 39.659  26.438  -31.430 1.00 42.81 ? 174 ILE A C     1 
ATOM   1317  O O     . ILE A 1 174 ? 39.427  25.742  -32.443 1.00 41.56 ? 174 ILE A O     1 
ATOM   1318  C CB    . ILE A 1 174 ? 40.887  25.555  -29.488 1.00 43.44 ? 174 ILE A CB    1 
ATOM   1319  C CG1   . ILE A 1 174 ? 42.203  25.435  -28.702 1.00 42.24 ? 174 ILE A CG1   1 
ATOM   1320  C CG2   . ILE A 1 174 ? 40.327  24.140  -29.827 1.00 44.54 ? 174 ILE A CG2   1 
ATOM   1321  C CD1   . ILE A 1 174 ? 43.314  24.756  -29.456 1.00 43.53 ? 174 ILE A CD1   1 
ATOM   1322  N N     . LEU A 1 175 ? 38.778  27.234  -30.818 1.00 41.67 ? 175 LEU A N     1 
ATOM   1323  C CA    . LEU A 1 175 ? 37.390  27.394  -31.201 1.00 42.12 ? 175 LEU A CA    1 
ATOM   1324  C C     . LEU A 1 175 ? 37.188  28.101  -32.507 1.00 43.65 ? 175 LEU A C     1 
ATOM   1325  O O     . LEU A 1 175 ? 36.146  27.938  -33.124 1.00 44.22 ? 175 LEU A O     1 
ATOM   1326  C CB    . LEU A 1 175 ? 36.591  28.107  -30.115 1.00 39.72 ? 175 LEU A CB    1 
ATOM   1327  C CG    . LEU A 1 175 ? 36.257  27.227  -28.879 1.00 39.90 ? 175 LEU A CG    1 
ATOM   1328  C CD1   . LEU A 1 175 ? 35.767  28.055  -27.659 1.00 36.01 ? 175 LEU A CD1   1 
ATOM   1329  C CD2   . LEU A 1 175 ? 35.296  25.989  -29.139 1.00 37.93 ? 175 LEU A CD2   1 
ATOM   1330  N N     . SER A 1 176 ? 38.178  28.881  -32.924 1.00 45.90 ? 176 SER A N     1 
ATOM   1331  C CA    . SER A 1 176 ? 38.081  29.702  -34.125 1.00 48.51 ? 176 SER A CA    1 
ATOM   1332  C C     . SER A 1 176 ? 38.093  28.867  -35.396 1.00 48.72 ? 176 SER A C     1 
ATOM   1333  O O     . SER A 1 176 ? 37.966  29.431  -36.478 1.00 49.62 ? 176 SER A O     1 
ATOM   1334  C CB    . SER A 1 176 ? 39.241  30.732  -34.188 1.00 49.17 ? 176 SER A CB    1 
ATOM   1335  O OG    . SER A 1 176 ? 40.474  30.107  -34.597 1.00 48.99 ? 176 SER A OG    1 
ATOM   1336  N N     . ARG A 1 177 ? 38.278  27.544  -35.274 1.00 49.84 ? 177 ARG A N     1 
ATOM   1337  C CA    . ARG A 1 177 ? 38.160  26.641  -36.452 1.00 49.66 ? 177 ARG A CA    1 
ATOM   1338  C C     . ARG A 1 177 ? 36.713  26.305  -36.787 1.00 49.88 ? 177 ARG A C     1 
ATOM   1339  O O     . ARG A 1 177 ? 36.446  25.554  -37.763 1.00 50.90 ? 177 ARG A O     1 
ATOM   1340  C CB    . ARG A 1 177 ? 39.101  25.413  -36.411 1.00 50.16 ? 177 ARG A CB    1 
ATOM   1341  C CG    . ARG A 1 177 ? 38.807  24.202  -35.434 1.00 51.31 ? 177 ARG A CG    1 
ATOM   1342  C CD    . ARG A 1 177 ? 40.112  23.801  -34.669 1.00 52.48 ? 177 ARG A CD    1 
ATOM   1343  N NE    . ARG A 1 177 ? 40.229  22.395  -34.253 1.00 55.34 ? 177 ARG A NE    1 
ATOM   1344  C CZ    . ARG A 1 177 ? 41.228  21.914  -33.492 1.00 60.19 ? 177 ARG A CZ    1 
ATOM   1345  N NH1   . ARG A 1 177 ? 42.189  22.725  -33.024 1.00 59.22 ? 177 ARG A NH1   1 
ATOM   1346  N NH2   . ARG A 1 177 ? 41.287  20.606  -33.179 1.00 58.91 ? 177 ARG A NH2   1 
ATOM   1347  N N     . TRP A 1 178 ? 35.784  26.846  -35.987 1.00 47.93 ? 178 TRP A N     1 
ATOM   1348  C CA    . TRP A 1 178 ? 34.358  26.715  -36.269 1.00 47.40 ? 178 TRP A CA    1 
ATOM   1349  C C     . TRP A 1 178 ? 33.748  28.107  -36.282 1.00 47.73 ? 178 TRP A C     1 
ATOM   1350  O O     . TRP A 1 178 ? 34.275  29.061  -35.701 1.00 48.93 ? 178 TRP A O     1 
ATOM   1351  C CB    . TRP A 1 178 ? 33.577  25.899  -35.206 1.00 46.69 ? 178 TRP A CB    1 
ATOM   1352  C CG    . TRP A 1 178 ? 34.405  24.993  -34.352 1.00 48.94 ? 178 TRP A CG    1 
ATOM   1353  C CD1   . TRP A 1 178 ? 35.159  25.339  -33.240 1.00 48.61 ? 178 TRP A CD1   1 
ATOM   1354  C CD2   . TRP A 1 178 ? 34.596  23.608  -34.536 1.00 45.81 ? 178 TRP A CD2   1 
ATOM   1355  N NE1   . TRP A 1 178 ? 35.828  24.247  -32.756 1.00 46.91 ? 178 TRP A NE1   1 
ATOM   1356  C CE2   . TRP A 1 178 ? 35.501  23.169  -33.532 1.00 47.36 ? 178 TRP A CE2   1 
ATOM   1357  C CE3   . TRP A 1 178 ? 34.121  22.694  -35.460 1.00 44.35 ? 178 TRP A CE3   1 
ATOM   1358  C CZ2   . TRP A 1 178 ? 35.906  21.859  -33.429 1.00 45.09 ? 178 TRP A CZ2   1 
ATOM   1359  C CZ3   . TRP A 1 178 ? 34.535  21.405  -35.354 1.00 45.23 ? 178 TRP A CZ3   1 
ATOM   1360  C CH2   . TRP A 1 178 ? 35.400  20.997  -34.349 1.00 46.61 ? 178 TRP A CH2   1 
ATOM   1361  N N     . LYS A 1 179 ? 32.580  28.202  -36.871 1.00 46.71 ? 179 LYS A N     1 
ATOM   1362  C CA    . LYS A 1 179 ? 31.827  29.387  -36.784 1.00 46.31 ? 179 LYS A CA    1 
ATOM   1363  C C     . LYS A 1 179 ? 30.920  29.116  -35.591 1.00 46.18 ? 179 LYS A C     1 
ATOM   1364  O O     . LYS A 1 179 ? 30.480  27.959  -35.409 1.00 45.88 ? 179 LYS A O     1 
ATOM   1365  C CB    . LYS A 1 179 ? 31.035  29.567  -38.113 1.00 46.46 ? 179 LYS A CB    1 
ATOM   1366  C CG    . LYS A 1 179 ? 31.902  29.946  -39.408 1.00 46.35 ? 179 LYS A CG    1 
ATOM   1367  C CD    . LYS A 1 179 ? 33.381  29.444  -39.399 1.00 45.48 ? 179 LYS A CD    1 
ATOM   1368  C CE    . LYS A 1 179 ? 34.388  30.477  -38.833 1.00 47.09 ? 179 LYS A CE    1 
ATOM   1369  N NZ    . LYS A 1 179 ? 35.800  29.977  -38.625 1.00 41.40 ? 179 LYS A NZ    1 
ATOM   1370  N N     . PRO A 1 180 ? 30.635  30.161  -34.773 1.00 46.37 ? 180 PRO A N     1 
ATOM   1371  C CA    . PRO A 1 180 ? 29.749  29.970  -33.604 1.00 46.75 ? 180 PRO A CA    1 
ATOM   1372  C C     . PRO A 1 180 ? 28.441  29.289  -34.012 1.00 47.32 ? 180 PRO A C     1 
ATOM   1373  O O     . PRO A 1 180 ? 27.762  28.710  -33.136 1.00 47.22 ? 180 PRO A O     1 
ATOM   1374  C CB    . PRO A 1 180 ? 29.485  31.389  -33.091 1.00 46.92 ? 180 PRO A CB    1 
ATOM   1375  C CG    . PRO A 1 180 ? 30.633  32.229  -33.630 1.00 46.91 ? 180 PRO A CG    1 
ATOM   1376  C CD    . PRO A 1 180 ? 31.165  31.543  -34.865 1.00 46.25 ? 180 PRO A CD    1 
ATOM   1377  N N     . GLU A 1 181 ? 28.129  29.309  -35.319 1.00 46.24 ? 181 GLU A N     1 
ATOM   1378  C CA    . GLU A 1 181 ? 26.872  28.744  -35.811 1.00 46.15 ? 181 GLU A CA    1 
ATOM   1379  C C     . GLU A 1 181 ? 26.830  27.277  -36.301 1.00 45.44 ? 181 GLU A C     1 
ATOM   1380  O O     . GLU A 1 181 ? 25.737  26.797  -36.536 1.00 44.41 ? 181 GLU A O     1 
ATOM   1381  C CB    . GLU A 1 181 ? 26.135  29.695  -36.789 1.00 47.65 ? 181 GLU A CB    1 
ATOM   1382  C CG    . GLU A 1 181 ? 26.917  30.168  -38.036 1.00 50.03 ? 181 GLU A CG    1 
ATOM   1383  C CD    . GLU A 1 181 ? 27.868  31.345  -37.792 1.00 53.21 ? 181 GLU A CD    1 
ATOM   1384  O OE1   . GLU A 1 181 ? 27.647  32.192  -36.895 1.00 52.70 ? 181 GLU A OE1   1 
ATOM   1385  O OE2   . GLU A 1 181 ? 28.868  31.416  -38.524 1.00 57.04 ? 181 GLU A OE2   1 
ATOM   1386  N N     . ASP A 1 182 ? 27.967  26.559  -36.401 1.00 46.56 ? 182 ASP A N     1 
ATOM   1387  C CA    . ASP A 1 182 ? 27.914  25.113  -36.699 1.00 45.99 ? 182 ASP A CA    1 
ATOM   1388  C C     . ASP A 1 182 ? 27.508  24.377  -35.458 1.00 45.02 ? 182 ASP A C     1 
ATOM   1389  O O     . ASP A 1 182 ? 27.146  23.221  -35.572 1.00 44.05 ? 182 ASP A O     1 
ATOM   1390  C CB    . ASP A 1 182 ? 29.212  24.506  -37.347 1.00 48.57 ? 182 ASP A CB    1 
ATOM   1391  C CG    . ASP A 1 182 ? 28.953  23.139  -38.234 1.00 49.57 ? 182 ASP A CG    1 
ATOM   1392  O OD1   . ASP A 1 182 ? 29.346  23.038  -39.459 1.00 50.95 ? 182 ASP A OD1   1 
ATOM   1393  O OD2   . ASP A 1 182 ? 28.410  22.146  -37.674 1.00 55.50 ? 182 ASP A OD2   1 
ATOM   1394  N N     . ALA A 1 183 ? 27.500  25.043  -34.289 1.00 42.97 ? 183 ALA A N     1 
ATOM   1395  C CA    . ALA A 1 183 ? 26.865  24.455  -33.088 1.00 43.27 ? 183 ALA A CA    1 
ATOM   1396  C C     . ALA A 1 183 ? 25.386  24.111  -33.298 1.00 43.47 ? 183 ALA A C     1 
ATOM   1397  O O     . ALA A 1 183 ? 24.792  23.325  -32.510 1.00 43.82 ? 183 ALA A O     1 
ATOM   1398  C CB    . ALA A 1 183 ? 27.031  25.355  -31.841 1.00 42.86 ? 183 ALA A CB    1 
ATOM   1399  N N     . LYS A 1 184 ? 24.771  24.722  -34.308 1.00 43.03 ? 184 LYS A N     1 
ATOM   1400  C CA    . LYS A 1 184 ? 23.352  24.560  -34.518 1.00 44.54 ? 184 LYS A CA    1 
ATOM   1401  C C     . LYS A 1 184 ? 23.287  23.387  -35.448 1.00 45.14 ? 184 LYS A C     1 
ATOM   1402  O O     . LYS A 1 184 ? 22.245  22.851  -35.708 1.00 45.48 ? 184 LYS A O     1 
ATOM   1403  C CB    . LYS A 1 184 ? 22.695  25.814  -35.137 1.00 46.22 ? 184 LYS A CB    1 
ATOM   1404  C CG    . LYS A 1 184 ? 22.568  27.114  -34.162 1.00 47.82 ? 184 LYS A CG    1 
ATOM   1405  C CD    . LYS A 1 184 ? 23.974  27.662  -33.677 1.00 50.22 ? 184 LYS A CD    1 
ATOM   1406  C CE    . LYS A 1 184 ? 23.973  28.491  -32.333 1.00 50.39 ? 184 LYS A CE    1 
ATOM   1407  N NZ    . LYS A 1 184 ? 23.632  27.721  -31.067 1.00 47.39 ? 184 LYS A NZ    1 
ATOM   1408  N N     . ASN A 1 185 ? 24.437  22.950  -35.920 1.00 45.59 ? 185 ASN A N     1 
ATOM   1409  C CA    . ASN A 1 185 ? 24.463  21.908  -36.927 1.00 46.02 ? 185 ASN A CA    1 
ATOM   1410  C C     . ASN A 1 185 ? 25.355  20.728  -36.572 1.00 45.88 ? 185 ASN A C     1 
ATOM   1411  O O     . ASN A 1 185 ? 26.577  20.841  -36.553 1.00 45.25 ? 185 ASN A O     1 
ATOM   1412  C CB    . ASN A 1 185 ? 24.811  22.499  -38.303 1.00 45.90 ? 185 ASN A CB    1 
ATOM   1413  C CG    . ASN A 1 185 ? 24.664  21.519  -39.387 1.00 45.61 ? 185 ASN A CG    1 
ATOM   1414  O OD1   . ASN A 1 185 ? 25.556  21.364  -40.225 1.00 53.45 ? 185 ASN A OD1   1 
ATOM   1415  N ND2   . ASN A 1 185 ? 23.533  20.841  -39.418 1.00 48.71 ? 185 ASN A ND2   1 
ATOM   1416  N N     . PRO A 1 186 ? 24.722  19.584  -36.262 1.00 46.89 ? 186 PRO A N     1 
ATOM   1417  C CA    . PRO A 1 186 ? 25.377  18.333  -35.791 1.00 47.00 ? 186 PRO A CA    1 
ATOM   1418  C C     . PRO A 1 186 ? 26.520  17.818  -36.610 1.00 47.06 ? 186 PRO A C     1 
ATOM   1419  O O     . PRO A 1 186 ? 27.461  17.234  -36.045 1.00 47.89 ? 186 PRO A O     1 
ATOM   1420  C CB    . PRO A 1 186 ? 24.243  17.325  -35.763 1.00 47.10 ? 186 PRO A CB    1 
ATOM   1421  C CG    . PRO A 1 186 ? 23.053  18.169  -35.446 1.00 47.59 ? 186 PRO A CG    1 
ATOM   1422  C CD    . PRO A 1 186 ? 23.252  19.466  -36.251 1.00 45.94 ? 186 PRO A CD    1 
ATOM   1423  N N     . GLN A 1 187 ? 26.526  18.068  -37.905 1.00 47.24 ? 187 GLN A N     1 
ATOM   1424  C CA    . GLN A 1 187 ? 27.431  17.239  -38.720 1.00 48.33 ? 187 GLN A CA    1 
ATOM   1425  C C     . GLN A 1 187 ? 28.959  17.438  -38.674 1.00 48.54 ? 187 GLN A C     1 
ATOM   1426  O O     . GLN A 1 187 ? 29.719  16.440  -38.705 1.00 51.43 ? 187 GLN A O     1 
ATOM   1427  C CB    . GLN A 1 187 ? 26.938  17.093  -40.149 1.00 48.09 ? 187 GLN A CB    1 
ATOM   1428  C CG    . GLN A 1 187 ? 25.598  16.389  -40.195 1.00 49.29 ? 187 GLN A CG    1 
ATOM   1429  C CD    . GLN A 1 187 ? 25.676  14.865  -40.235 1.00 51.57 ? 187 GLN A CD    1 
ATOM   1430  O OE1   . GLN A 1 187 ? 24.730  14.182  -39.807 1.00 53.83 ? 187 GLN A OE1   1 
ATOM   1431  N NE2   . GLN A 1 187 ? 26.781  14.327  -40.760 1.00 48.60 ? 187 GLN A NE2   1 
ATOM   1432  N N     . LYS A 1 188 ? 29.437  18.657  -38.655 1.00 47.35 ? 188 LYS A N     1 
ATOM   1433  C CA    . LYS A 1 188 ? 30.885  18.829  -38.463 1.00 47.10 ? 188 LYS A CA    1 
ATOM   1434  C C     . LYS A 1 188 ? 31.197  19.482  -37.073 1.00 45.39 ? 188 LYS A C     1 
ATOM   1435  O O     . LYS A 1 188 ? 32.015  20.373  -36.972 1.00 44.73 ? 188 LYS A O     1 
ATOM   1436  C CB    . LYS A 1 188 ? 31.595  19.500  -39.698 1.00 48.94 ? 188 LYS A CB    1 
ATOM   1437  C CG    . LYS A 1 188 ? 33.133  19.831  -39.625 1.00 49.50 ? 188 LYS A CG    1 
ATOM   1438  C CD    . LYS A 1 188 ? 33.405  21.335  -39.199 1.00 53.56 ? 188 LYS A CD    1 
ATOM   1439  C CE    . LYS A 1 188 ? 34.879  21.663  -38.859 1.00 54.77 ? 188 LYS A CE    1 
ATOM   1440  N NZ    . LYS A 1 188 ? 35.594  22.505  -39.874 1.00 56.27 ? 188 LYS A NZ    1 
ATOM   1441  N N     . ASN A 1 189 ? 30.486  19.029  -36.031 1.00 43.99 ? 189 ASN A N     1 
ATOM   1442  C CA    . ASN A 1 189 ? 31.167  18.561  -34.844 1.00 42.08 ? 189 ASN A CA    1 
ATOM   1443  C C     . ASN A 1 189 ? 31.703  19.590  -33.856 1.00 40.49 ? 189 ASN A C     1 
ATOM   1444  O O     . ASN A 1 189 ? 32.755  19.393  -33.262 1.00 39.22 ? 189 ASN A O     1 
ATOM   1445  C CB    . ASN A 1 189 ? 32.390  17.813  -35.411 1.00 44.04 ? 189 ASN A CB    1 
ATOM   1446  C CG    . ASN A 1 189 ? 32.554  16.400  -34.888 1.00 47.08 ? 189 ASN A CG    1 
ATOM   1447  O OD1   . ASN A 1 189 ? 32.246  16.081  -33.724 1.00 49.19 ? 189 ASN A OD1   1 
ATOM   1448  N ND2   . ASN A 1 189 ? 33.104  15.547  -35.748 1.00 48.28 ? 189 ASN A ND2   1 
ATOM   1449  N N     . THR A 1 190 ? 31.041  20.718  -33.664 1.00 39.41 ? 190 THR A N     1 
ATOM   1450  C CA    . THR A 1 190 ? 31.481  21.557  -32.530 1.00 36.76 ? 190 THR A CA    1 
ATOM   1451  C C     . THR A 1 190 ? 31.676  20.747  -31.166 1.00 35.70 ? 190 THR A C     1 
ATOM   1452  O O     . THR A 1 190 ? 31.109  19.691  -30.963 1.00 33.92 ? 190 THR A O     1 
ATOM   1453  C CB    . THR A 1 190 ? 30.698  22.920  -32.422 1.00 36.77 ? 190 THR A CB    1 
ATOM   1454  O OG1   . THR A 1 190 ? 29.301  22.695  -32.215 1.00 37.94 ? 190 THR A OG1   1 
ATOM   1455  C CG2   . THR A 1 190 ? 30.880  23.732  -33.650 1.00 33.19 ? 190 THR A CG2   1 
ATOM   1456  N N     . PRO A 1 191 ? 32.626  21.176  -30.316 1.00 35.27 ? 191 PRO A N     1 
ATOM   1457  C CA    . PRO A 1 191 ? 32.851  20.523  -29.017 1.00 34.63 ? 191 PRO A CA    1 
ATOM   1458  C C     . PRO A 1 191 ? 31.577  20.376  -28.211 1.00 34.76 ? 191 PRO A C     1 
ATOM   1459  O O     . PRO A 1 191 ? 30.749  21.315  -28.152 1.00 32.93 ? 191 PRO A O     1 
ATOM   1460  C CB    . PRO A 1 191 ? 33.845  21.450  -28.355 1.00 33.23 ? 191 PRO A CB    1 
ATOM   1461  C CG    . PRO A 1 191 ? 34.637  21.935  -29.479 1.00 33.37 ? 191 PRO A CG    1 
ATOM   1462  C CD    . PRO A 1 191 ? 33.654  22.191  -30.580 1.00 34.45 ? 191 PRO A CD    1 
ATOM   1463  N N     . LYS A 1 192 ? 31.349  19.180  -27.668 1.00 34.84 ? 192 LYS A N     1 
ATOM   1464  C CA    . LYS A 1 192 ? 30.117  18.980  -26.873 1.00 35.30 ? 192 LYS A CA    1 
ATOM   1465  C C     . LYS A 1 192 ? 30.244  19.673  -25.506 1.00 34.85 ? 192 LYS A C     1 
ATOM   1466  O O     . LYS A 1 192 ? 29.271  20.132  -24.912 1.00 34.53 ? 192 LYS A O     1 
ATOM   1467  C CB    . LYS A 1 192 ? 29.913  17.473  -26.657 1.00 37.40 ? 192 LYS A CB    1 
ATOM   1468  C CG    . LYS A 1 192 ? 29.278  16.736  -27.872 1.00 37.02 ? 192 LYS A CG    1 
ATOM   1469  C CD    . LYS A 1 192 ? 27.942  17.398  -28.160 1.00 37.84 ? 192 LYS A CD    1 
ATOM   1470  C CE    . LYS A 1 192 ? 26.909  16.389  -28.470 1.00 35.89 ? 192 LYS A CE    1 
ATOM   1471  N NZ    . LYS A 1 192 ? 27.568  15.478  -29.380 1.00 42.34 ? 192 LYS A NZ    1 
ATOM   1472  N N     . PHE A 1 193 ? 31.470  19.728  -25.008 1.00 33.33 ? 193 PHE A N     1 
ATOM   1473  C CA    . PHE A 1 193 ? 31.694  20.270  -23.716 1.00 33.71 ? 193 PHE A CA    1 
ATOM   1474  C C     . PHE A 1 193 ? 33.136  20.506  -23.419 1.00 34.65 ? 193 PHE A C     1 
ATOM   1475  O O     . PHE A 1 193 ? 34.017  19.908  -24.074 1.00 35.56 ? 193 PHE A O     1 
ATOM   1476  C CB    . PHE A 1 193 ? 31.142  19.368  -22.643 1.00 34.05 ? 193 PHE A CB    1 
ATOM   1477  C CG    . PHE A 1 193 ? 31.790  18.007  -22.557 1.00 31.88 ? 193 PHE A CG    1 
ATOM   1478  C CD1   . PHE A 1 193 ? 31.082  16.875  -22.976 1.00 31.60 ? 193 PHE A CD1   1 
ATOM   1479  C CD2   . PHE A 1 193 ? 33.056  17.830  -21.944 1.00 34.12 ? 193 PHE A CD2   1 
ATOM   1480  C CE1   . PHE A 1 193 ? 31.641  15.547  -22.803 1.00 27.19 ? 193 PHE A CE1   1 
ATOM   1481  C CE2   . PHE A 1 193 ? 33.648  16.498  -21.787 1.00 30.93 ? 193 PHE A CE2   1 
ATOM   1482  C CZ    . PHE A 1 193 ? 32.939  15.393  -22.234 1.00 31.84 ? 193 PHE A CZ    1 
ATOM   1483  N N     . LEU A 1 194 ? 33.334  21.345  -22.391 1.00 34.14 ? 194 LEU A N     1 
ATOM   1484  C CA    . LEU A 1 194 ? 34.607  21.585  -21.752 1.00 33.76 ? 194 LEU A CA    1 
ATOM   1485  C C     . LEU A 1 194 ? 34.616  20.999  -20.369 1.00 34.35 ? 194 LEU A C     1 
ATOM   1486  O O     . LEU A 1 194 ? 33.725  21.270  -19.587 1.00 36.13 ? 194 LEU A O     1 
ATOM   1487  C CB    . LEU A 1 194 ? 34.862  23.067  -21.618 1.00 32.70 ? 194 LEU A CB    1 
ATOM   1488  C CG    . LEU A 1 194 ? 36.224  23.512  -21.011 1.00 33.57 ? 194 LEU A CG    1 
ATOM   1489  C CD1   . LEU A 1 194 ? 37.428  23.150  -21.805 1.00 31.66 ? 194 LEU A CD1   1 
ATOM   1490  C CD2   . LEU A 1 194 ? 36.247  25.034  -20.827 1.00 34.38 ? 194 LEU A CD2   1 
ATOM   1491  N N     . TYR A 1 195 ? 35.648  20.224  -20.064 1.00 32.53 ? 195 TYR A N     1 
ATOM   1492  C CA    . TYR A 1 195 ? 35.723  19.669  -18.798 1.00 32.65 ? 195 TYR A CA    1 
ATOM   1493  C C     . TYR A 1 195 ? 36.862  20.418  -18.021 1.00 32.51 ? 195 TYR A C     1 
ATOM   1494  O O     . TYR A 1 195 ? 37.949  20.609  -18.545 1.00 29.88 ? 195 TYR A O     1 
ATOM   1495  C CB    . TYR A 1 195 ? 35.937  18.137  -18.941 1.00 32.13 ? 195 TYR A CB    1 
ATOM   1496  C CG    . TYR A 1 195 ? 36.367  17.481  -17.632 1.00 32.85 ? 195 TYR A CG    1 
ATOM   1497  C CD1   . TYR A 1 195 ? 35.441  16.869  -16.746 1.00 28.93 ? 195 TYR A CD1   1 
ATOM   1498  C CD2   . TYR A 1 195 ? 37.721  17.462  -17.283 1.00 32.33 ? 195 TYR A CD2   1 
ATOM   1499  C CE1   . TYR A 1 195 ? 35.930  16.245  -15.519 1.00 30.44 ? 195 TYR A CE1   1 
ATOM   1500  C CE2   . TYR A 1 195 ? 38.182  16.870  -16.120 1.00 32.38 ? 195 TYR A CE2   1 
ATOM   1501  C CZ    . TYR A 1 195 ? 37.297  16.289  -15.240 1.00 30.13 ? 195 TYR A CZ    1 
ATOM   1502  O OH    . TYR A 1 195 ? 37.863  15.771  -14.124 1.00 33.52 ? 195 TYR A OH    1 
ATOM   1503  N N     . THR A 1 196 ? 36.600  20.900  -16.801 1.00 31.06 ? 196 THR A N     1 
ATOM   1504  C CA    . THR A 1 196 ? 37.773  21.307  -16.039 1.00 31.23 ? 196 THR A CA    1 
ATOM   1505  C C     . THR A 1 196 ? 37.619  21.055  -14.542 1.00 30.63 ? 196 THR A C     1 
ATOM   1506  O O     . THR A 1 196 ? 36.493  20.891  -14.056 1.00 30.86 ? 196 THR A O     1 
ATOM   1507  C CB    . THR A 1 196 ? 38.358  22.739  -16.522 1.00 30.52 ? 196 THR A CB    1 
ATOM   1508  O OG1   . THR A 1 196 ? 39.731  22.927  -16.135 1.00 29.68 ? 196 THR A OG1   1 
ATOM   1509  C CG2   . THR A 1 196 ? 37.489  23.942  -16.211 1.00 30.55 ? 196 THR A CG2   1 
ATOM   1510  N N     . VAL A 1 197 ? 38.769  21.002  -13.858 1.00 31.03 ? 197 VAL A N     1 
ATOM   1511  C CA    . VAL A 1 197 ? 38.912  20.955  -12.419 1.00 30.45 ? 197 VAL A CA    1 
ATOM   1512  C C     . VAL A 1 197 ? 39.446  22.356  -11.987 1.00 32.27 ? 197 VAL A C     1 
ATOM   1513  O O     . VAL A 1 197 ? 40.672  22.611  -12.004 1.00 34.20 ? 197 VAL A O     1 
ATOM   1514  C CB    . VAL A 1 197 ? 39.872  19.791  -12.017 1.00 31.03 ? 197 VAL A CB    1 
ATOM   1515  C CG1   . VAL A 1 197 ? 40.029  19.713  -10.538 1.00 28.92 ? 197 VAL A CG1   1 
ATOM   1516  C CG2   . VAL A 1 197 ? 39.257  18.406  -12.541 1.00 30.29 ? 197 VAL A CG2   1 
ATOM   1517  N N     . PRO A 1 198 ? 38.527  23.270  -11.637 1.00 31.42 ? 198 PRO A N     1 
ATOM   1518  C CA    . PRO A 1 198 ? 38.911  24.682  -11.413 1.00 31.49 ? 198 PRO A CA    1 
ATOM   1519  C C     . PRO A 1 198 ? 39.729  24.976  -10.172 1.00 30.29 ? 198 PRO A C     1 
ATOM   1520  O O     . PRO A 1 198 ? 40.316  26.046  -10.031 1.00 30.68 ? 198 PRO A O     1 
ATOM   1521  C CB    . PRO A 1 198 ? 37.549  25.408  -11.323 1.00 30.04 ? 198 PRO A CB    1 
ATOM   1522  C CG    . PRO A 1 198 ? 36.588  24.512  -11.849 1.00 32.15 ? 198 PRO A CG    1 
ATOM   1523  C CD    . PRO A 1 198 ? 37.067  23.102  -11.510 1.00 30.68 ? 198 PRO A CD    1 
ATOM   1524  N N     . ASN A 1 199 ? 39.708  24.065  -9.247  1.00 30.18 ? 199 ASN A N     1 
ATOM   1525  C CA    . ASN A 1 199 ? 40.368  24.297  -8.006  1.00 29.86 ? 199 ASN A CA    1 
ATOM   1526  C C     . ASN A 1 199 ? 41.305  23.158  -7.703  1.00 30.37 ? 199 ASN A C     1 
ATOM   1527  O O     . ASN A 1 199 ? 40.878  21.981  -7.762  1.00 28.18 ? 199 ASN A O     1 
ATOM   1528  C CB    . ASN A 1 199 ? 39.343  24.469  -6.911  1.00 28.80 ? 199 ASN A CB    1 
ATOM   1529  C CG    . ASN A 1 199 ? 38.566  25.715  -7.067  1.00 30.42 ? 199 ASN A CG    1 
ATOM   1530  O OD1   . ASN A 1 199 ? 39.106  26.802  -6.861  1.00 33.15 ? 199 ASN A OD1   1 
ATOM   1531  N ND2   . ASN A 1 199 ? 37.280  25.599  -7.360  1.00 22.01 ? 199 ASN A ND2   1 
ATOM   1532  N N     . GLY A 1 200 ? 42.570  23.518  -7.400  1.00 30.45 ? 200 GLY A N     1 
ATOM   1533  C CA    . GLY A 1 200 ? 43.652  22.525  -7.132  1.00 30.33 ? 200 GLY A CA    1 
ATOM   1534  C C     . GLY A 1 200 ? 43.556  21.307  -8.081  1.00 31.46 ? 200 GLY A C     1 
ATOM   1535  O O     . GLY A 1 200 ? 43.306  20.227  -7.672  1.00 31.37 ? 200 GLY A O     1 
ATOM   1536  N N     . ASN A 1 201 ? 43.811  21.493  -9.353  1.00 33.36 ? 201 ASN A N     1 
ATOM   1537  C CA    . ASN A 1 201 ? 43.787  20.374  -10.347 1.00 34.20 ? 201 ASN A CA    1 
ATOM   1538  C C     . ASN A 1 201 ? 44.628  19.180  -9.972  1.00 35.09 ? 201 ASN A C     1 
ATOM   1539  O O     . ASN A 1 201 ? 45.750  19.347  -9.537  1.00 37.83 ? 201 ASN A O     1 
ATOM   1540  C CB    . ASN A 1 201 ? 44.236  20.950  -11.696 1.00 32.63 ? 201 ASN A CB    1 
ATOM   1541  C CG    . ASN A 1 201 ? 44.104  19.982  -12.813 1.00 33.92 ? 201 ASN A CG    1 
ATOM   1542  O OD1   . ASN A 1 201 ? 45.011  19.820  -13.639 1.00 33.41 ? 201 ASN A OD1   1 
ATOM   1543  N ND2   . ASN A 1 201 ? 42.974  19.310  -12.862 1.00 38.48 ? 201 ASN A ND2   1 
ATOM   1544  N N     . ASN A 1 202 ? 44.108  17.959  -10.121 1.00 35.49 ? 202 ASN A N     1 
ATOM   1545  C CA    . ASN A 1 202 ? 44.914  16.759  -9.962  1.00 34.18 ? 202 ASN A CA    1 
ATOM   1546  C C     . ASN A 1 202 ? 45.383  16.506  -11.380 1.00 33.92 ? 202 ASN A C     1 
ATOM   1547  O O     . ASN A 1 202 ? 44.544  16.175  -12.223 1.00 35.98 ? 202 ASN A O     1 
ATOM   1548  C CB    . ASN A 1 202 ? 44.007  15.620  -9.501  1.00 33.59 ? 202 ASN A CB    1 
ATOM   1549  C CG    . ASN A 1 202 ? 44.740  14.369  -9.098  1.00 32.84 ? 202 ASN A CG    1 
ATOM   1550  O OD1   . ASN A 1 202 ? 45.927  14.185  -9.389  1.00 26.81 ? 202 ASN A OD1   1 
ATOM   1551  N ND2   . ASN A 1 202 ? 43.988  13.437  -8.463  1.00 32.35 ? 202 ASN A ND2   1 
ATOM   1552  N N     . PRO A 1 203 ? 46.692  16.609  -11.652 1.00 32.07 ? 203 PRO A N     1 
ATOM   1553  C CA    . PRO A 1 203 ? 47.745  16.606  -10.645 1.00 31.75 ? 203 PRO A CA    1 
ATOM   1554  C C     . PRO A 1 203 ? 48.419  17.930  -10.294 1.00 31.39 ? 203 PRO A C     1 
ATOM   1555  O O     . PRO A 1 203 ? 49.278  17.910  -9.451  1.00 30.74 ? 203 PRO A O     1 
ATOM   1556  C CB    . PRO A 1 203 ? 48.792  15.685  -11.287 1.00 31.03 ? 203 PRO A CB    1 
ATOM   1557  C CG    . PRO A 1 203 ? 48.612  15.959  -12.837 1.00 30.62 ? 203 PRO A CG    1 
ATOM   1558  C CD    . PRO A 1 203 ? 47.280  16.664  -13.011 1.00 32.61 ? 203 PRO A CD    1 
ATOM   1559  N N     . THR A 1 204 ? 48.041  19.067  -10.878 1.00 33.11 ? 204 THR A N     1 
ATOM   1560  C CA    . THR A 1 204 ? 48.928  20.258  -10.765 1.00 34.94 ? 204 THR A CA    1 
ATOM   1561  C C     . THR A 1 204 ? 48.912  21.091  -9.489  1.00 34.34 ? 204 THR A C     1 
ATOM   1562  O O     . THR A 1 204 ? 49.849  21.816  -9.220  1.00 35.94 ? 204 THR A O     1 
ATOM   1563  C CB    . THR A 1 204 ? 48.725  21.274  -11.868 1.00 35.35 ? 204 THR A CB    1 
ATOM   1564  O OG1   . THR A 1 204 ? 47.438  21.885  -11.701 1.00 39.92 ? 204 THR A OG1   1 
ATOM   1565  C CG2   . THR A 1 204 ? 48.866  20.676  -13.212 1.00 36.66 ? 204 THR A CG2   1 
ATOM   1566  N N     . GLY A 1 205 ? 47.826  21.077  -8.743  1.00 35.16 ? 205 GLY A N     1 
ATOM   1567  C CA    . GLY A 1 205 ? 47.650  22.073  -7.700  1.00 33.59 ? 205 GLY A CA    1 
ATOM   1568  C C     . GLY A 1 205 ? 47.151  23.412  -8.187  1.00 33.60 ? 205 GLY A C     1 
ATOM   1569  O O     . GLY A 1 205 ? 46.889  24.279  -7.362  1.00 34.57 ? 205 GLY A O     1 
ATOM   1570  N N     . ASN A 1 206 ? 47.041  23.620  -9.509  1.00 34.41 ? 206 ASN A N     1 
ATOM   1571  C CA    . ASN A 1 206 ? 46.585  24.938  -10.095 1.00 33.66 ? 206 ASN A CA    1 
ATOM   1572  C C     . ASN A 1 206 ? 45.058  25.182  -10.100 1.00 34.53 ? 206 ASN A C     1 
ATOM   1573  O O     . ASN A 1 206 ? 44.243  24.249  -10.302 1.00 31.98 ? 206 ASN A O     1 
ATOM   1574  C CB    . ASN A 1 206 ? 47.073  25.095  -11.560 1.00 35.06 ? 206 ASN A CB    1 
ATOM   1575  C CG    . ASN A 1 206 ? 48.587  25.042  -11.693 1.00 34.12 ? 206 ASN A CG    1 
ATOM   1576  O OD1   . ASN A 1 206 ? 49.115  24.551  -12.699 1.00 34.19 ? 206 ASN A OD1   1 
ATOM   1577  N ND2   . ASN A 1 206 ? 49.308  25.553  -10.662 1.00 28.24 ? 206 ASN A ND2   1 
ATOM   1578  N N     . SER A 1 207 ? 44.668  26.452  -9.866  1.00 35.07 ? 207 SER A N     1 
ATOM   1579  C CA    . SER A 1 207 ? 43.278  26.844  -9.963  1.00 34.57 ? 207 SER A CA    1 
ATOM   1580  C C     . SER A 1 207 ? 43.023  27.943  -10.924 1.00 35.15 ? 207 SER A C     1 
ATOM   1581  O O     . SER A 1 207 ? 43.909  28.788  -11.095 1.00 36.36 ? 207 SER A O     1 
ATOM   1582  C CB    . SER A 1 207 ? 42.764  27.290  -8.596  1.00 34.17 ? 207 SER A CB    1 
ATOM   1583  O OG    . SER A 1 207 ? 43.198  26.391  -7.652  1.00 33.28 ? 207 SER A OG    1 
ATOM   1584  N N     . LEU A 1 208 ? 41.800  27.995  -11.467 1.00 36.01 ? 208 LEU A N     1 
ATOM   1585  C CA    . LEU A 1 208 ? 41.423  29.078  -12.374 1.00 37.96 ? 208 LEU A CA    1 
ATOM   1586  C C     . LEU A 1 208 ? 41.128  30.363  -11.623 1.00 39.31 ? 208 LEU A C     1 
ATOM   1587  O O     . LEU A 1 208 ? 40.703  30.318  -10.471 1.00 37.06 ? 208 LEU A O     1 
ATOM   1588  C CB    . LEU A 1 208 ? 40.199  28.741  -13.203 1.00 37.78 ? 208 LEU A CB    1 
ATOM   1589  C CG    . LEU A 1 208 ? 40.285  27.973  -14.529 1.00 40.76 ? 208 LEU A CG    1 
ATOM   1590  C CD1   . LEU A 1 208 ? 38.938  27.286  -14.818 1.00 38.14 ? 208 LEU A CD1   1 
ATOM   1591  C CD2   . LEU A 1 208 ? 40.697  28.919  -15.693 1.00 45.28 ? 208 LEU A CD2   1 
ATOM   1592  N N     . THR A 1 209 ? 41.327  31.513  -12.296 1.00 40.90 ? 209 THR A N     1 
ATOM   1593  C CA    . THR A 1 209 ? 40.945  32.800  -11.685 1.00 41.59 ? 209 THR A CA    1 
ATOM   1594  C C     . THR A 1 209 ? 39.520  33.088  -12.039 1.00 43.03 ? 209 THR A C     1 
ATOM   1595  O O     . THR A 1 209 ? 38.885  32.411  -12.896 1.00 44.01 ? 209 THR A O     1 
ATOM   1596  C CB    . THR A 1 209 ? 41.797  33.998  -12.140 1.00 42.21 ? 209 THR A CB    1 
ATOM   1597  O OG1   . THR A 1 209 ? 41.864  34.038  -13.600 1.00 41.33 ? 209 THR A OG1   1 
ATOM   1598  C CG2   . THR A 1 209 ? 43.194  33.946  -11.502 1.00 41.76 ? 209 THR A CG2   1 
ATOM   1599  N N     . SER A 1 210 ? 39.009  34.108  -11.386 1.00 43.08 ? 210 SER A N     1 
ATOM   1600  C CA    . SER A 1 210 ? 37.646  34.481  -11.578 1.00 44.37 ? 210 SER A CA    1 
ATOM   1601  C C     . SER A 1 210 ? 37.510  35.238  -12.884 1.00 43.28 ? 210 SER A C     1 
ATOM   1602  O O     . SER A 1 210 ? 36.469  35.294  -13.440 1.00 42.89 ? 210 SER A O     1 
ATOM   1603  C CB    . SER A 1 210 ? 37.169  35.383  -10.424 1.00 43.74 ? 210 SER A CB    1 
ATOM   1604  O OG    . SER A 1 210 ? 35.821  35.712  -10.685 1.00 47.33 ? 210 SER A OG    1 
ATOM   1605  N N     . GLU A 1 211 ? 38.575  35.880  -13.313 1.00 43.71 ? 211 GLU A N     1 
ATOM   1606  C CA    . GLU A 1 211 ? 38.529  36.688  -14.540 1.00 44.61 ? 211 GLU A CA    1 
ATOM   1607  C C     . GLU A 1 211 ? 38.570  35.700  -15.707 1.00 42.06 ? 211 GLU A C     1 
ATOM   1608  O O     . GLU A 1 211 ? 37.830  35.838  -16.659 1.00 42.08 ? 211 GLU A O     1 
ATOM   1609  C CB    . GLU A 1 211 ? 39.705  37.699  -14.586 1.00 43.90 ? 211 GLU A CB    1 
ATOM   1610  C CG    . GLU A 1 211 ? 39.896  38.537  -13.288 1.00 49.97 ? 211 GLU A CG    1 
ATOM   1611  C CD    . GLU A 1 211 ? 40.720  37.816  -12.167 1.00 54.64 ? 211 GLU A CD    1 
ATOM   1612  O OE1   . GLU A 1 211 ? 41.898  37.459  -12.465 1.00 58.67 ? 211 GLU A OE1   1 
ATOM   1613  O OE2   . GLU A 1 211 ? 40.218  37.655  -10.995 1.00 51.33 ? 211 GLU A OE2   1 
ATOM   1614  N N     . ARG A 1 212 ? 39.433  34.698  -15.592 1.00 40.76 ? 212 ARG A N     1 
ATOM   1615  C CA    . ARG A 1 212 ? 39.466  33.607  -16.583 1.00 40.95 ? 212 ARG A CA    1 
ATOM   1616  C C     . ARG A 1 212 ? 38.172  32.827  -16.636 1.00 40.94 ? 212 ARG A C     1 
ATOM   1617  O O     . ARG A 1 212 ? 37.646  32.624  -17.706 1.00 41.45 ? 212 ARG A O     1 
ATOM   1618  C CB    . ARG A 1 212 ? 40.673  32.699  -16.421 1.00 41.15 ? 212 ARG A CB    1 
ATOM   1619  C CG    . ARG A 1 212 ? 42.016  33.320  -16.813 1.00 39.64 ? 212 ARG A CG    1 
ATOM   1620  C CD    . ARG A 1 212 ? 43.065  32.206  -16.894 1.00 41.81 ? 212 ARG A CD    1 
ATOM   1621  N NE    . ARG A 1 212 ? 44.414  32.697  -17.159 1.00 40.46 ? 212 ARG A NE    1 
ATOM   1622  C CZ    . ARG A 1 212 ? 45.444  31.914  -17.427 1.00 42.59 ? 212 ARG A CZ    1 
ATOM   1623  N NH1   . ARG A 1 212 ? 45.316  30.572  -17.482 1.00 44.69 ? 212 ARG A NH1   1 
ATOM   1624  N NH2   . ARG A 1 212 ? 46.628  32.470  -17.597 1.00 43.38 ? 212 ARG A NH2   1 
ATOM   1625  N N     . LYS A 1 213 ? 37.622  32.429  -15.486 1.00 41.20 ? 213 LYS A N     1 
ATOM   1626  C CA    . LYS A 1 213 ? 36.282  31.834  -15.486 1.00 40.69 ? 213 LYS A CA    1 
ATOM   1627  C C     . LYS A 1 213 ? 35.206  32.568  -16.309 1.00 41.68 ? 213 LYS A C     1 
ATOM   1628  O O     . LYS A 1 213 ? 34.423  31.917  -16.995 1.00 41.18 ? 213 LYS A O     1 
ATOM   1629  C CB    . LYS A 1 213 ? 35.798  31.432  -14.066 1.00 40.71 ? 213 LYS A CB    1 
ATOM   1630  C CG    . LYS A 1 213 ? 36.766  30.446  -13.297 1.00 38.55 ? 213 LYS A CG    1 
ATOM   1631  C CD    . LYS A 1 213 ? 36.427  30.309  -11.853 1.00 38.26 ? 213 LYS A CD    1 
ATOM   1632  C CE    . LYS A 1 213 ? 36.522  28.825  -11.363 1.00 40.59 ? 213 LYS A CE    1 
ATOM   1633  N NZ    . LYS A 1 213 ? 36.055  28.659  -9.930  1.00 36.26 ? 213 LYS A NZ    1 
ATOM   1634  N N     . LYS A 1 214 ? 35.134  33.907  -16.263 1.00 43.86 ? 214 LYS A N     1 
ATOM   1635  C CA    . LYS A 1 214 ? 34.081  34.593  -17.053 1.00 43.99 ? 214 LYS A CA    1 
ATOM   1636  C C     . LYS A 1 214 ? 34.359  34.613  -18.536 1.00 44.49 ? 214 LYS A C     1 
ATOM   1637  O O     . LYS A 1 214 ? 33.419  34.612  -19.371 1.00 45.98 ? 214 LYS A O     1 
ATOM   1638  C CB    . LYS A 1 214 ? 33.846  36.003  -16.586 1.00 45.12 ? 214 LYS A CB    1 
ATOM   1639  C CG    . LYS A 1 214 ? 33.383  36.149  -15.143 1.00 44.94 ? 214 LYS A CG    1 
ATOM   1640  C CD    . LYS A 1 214 ? 33.236  37.682  -14.867 1.00 49.08 ? 214 LYS A CD    1 
ATOM   1641  C CE    . LYS A 1 214 ? 34.418  38.284  -14.089 1.00 48.75 ? 214 LYS A CE    1 
ATOM   1642  N NZ    . LYS A 1 214 ? 34.071  38.260  -12.638 1.00 49.66 ? 214 LYS A NZ    1 
ATOM   1643  N N     . GLU A 1 215 ? 35.639  34.625  -18.893 1.00 44.11 ? 215 GLU A N     1 
ATOM   1644  C CA    . GLU A 1 215 ? 36.006  34.600  -20.307 1.00 44.22 ? 215 GLU A CA    1 
ATOM   1645  C C     . GLU A 1 215 ? 35.611  33.235  -20.879 1.00 42.44 ? 215 GLU A C     1 
ATOM   1646  O O     . GLU A 1 215 ? 35.105  33.184  -21.978 1.00 41.63 ? 215 GLU A O     1 
ATOM   1647  C CB    . GLU A 1 215 ? 37.501  34.853  -20.523 1.00 44.60 ? 215 GLU A CB    1 
ATOM   1648  C CG    . GLU A 1 215 ? 37.882  36.296  -20.888 1.00 47.77 ? 215 GLU A CG    1 
ATOM   1649  C CD    . GLU A 1 215 ? 39.363  36.430  -21.352 1.00 48.01 ? 215 GLU A CD    1 
ATOM   1650  O OE1   . GLU A 1 215 ? 40.270  36.376  -20.475 1.00 53.44 ? 215 GLU A OE1   1 
ATOM   1651  O OE2   . GLU A 1 215 ? 39.617  36.578  -22.592 1.00 49.90 ? 215 GLU A OE2   1 
ATOM   1652  N N     . ILE A 1 216 ? 35.799  32.158  -20.094 1.00 39.81 ? 216 ILE A N     1 
ATOM   1653  C CA    . ILE A 1 216 ? 35.605  30.776  -20.549 1.00 38.82 ? 216 ILE A CA    1 
ATOM   1654  C C     . ILE A 1 216 ? 34.152  30.545  -20.757 1.00 39.06 ? 216 ILE A C     1 
ATOM   1655  O O     . ILE A 1 216 ? 33.729  30.018  -21.790 1.00 38.81 ? 216 ILE A O     1 
ATOM   1656  C CB    . ILE A 1 216 ? 36.201  29.731  -19.553 1.00 39.19 ? 216 ILE A CB    1 
ATOM   1657  C CG1   . ILE A 1 216 ? 37.703  29.772  -19.630 1.00 37.11 ? 216 ILE A CG1   1 
ATOM   1658  C CG2   . ILE A 1 216 ? 35.654  28.271  -19.802 1.00 37.74 ? 216 ILE A CG2   1 
ATOM   1659  C CD1   . ILE A 1 216 ? 38.350  29.483  -18.321 1.00 38.95 ? 216 ILE A CD1   1 
ATOM   1660  N N     . TYR A 1 217 ? 33.374  31.020  -19.793 1.00 39.93 ? 217 TYR A N     1 
ATOM   1661  C CA    . TYR A 1 217 ? 31.919  31.038  -19.905 1.00 39.69 ? 217 TYR A CA    1 
ATOM   1662  C C     . TYR A 1 217 ? 31.395  31.750  -21.178 1.00 40.06 ? 217 TYR A C     1 
ATOM   1663  O O     . TYR A 1 217 ? 30.525  31.221  -21.917 1.00 39.06 ? 217 TYR A O     1 
ATOM   1664  C CB    . TYR A 1 217 ? 31.285  31.659  -18.645 1.00 39.77 ? 217 TYR A CB    1 
ATOM   1665  C CG    . TYR A 1 217 ? 29.819  31.302  -18.586 1.00 40.76 ? 217 TYR A CG    1 
ATOM   1666  C CD1   . TYR A 1 217 ? 29.453  30.095  -18.057 1.00 37.12 ? 217 TYR A CD1   1 
ATOM   1667  C CD2   . TYR A 1 217 ? 28.798  32.142  -19.137 1.00 40.66 ? 217 TYR A CD2   1 
ATOM   1668  C CE1   . TYR A 1 217 ? 28.181  29.708  -17.972 1.00 40.91 ? 217 TYR A CE1   1 
ATOM   1669  C CE2   . TYR A 1 217 ? 27.467  31.724  -19.077 1.00 43.77 ? 217 TYR A CE2   1 
ATOM   1670  C CZ    . TYR A 1 217 ? 27.187  30.447  -18.491 1.00 43.30 ? 217 TYR A CZ    1 
ATOM   1671  O OH    . TYR A 1 217 ? 25.932  29.856  -18.359 1.00 44.20 ? 217 TYR A OH    1 
ATOM   1672  N N     . GLU A 1 218 ? 31.892  32.969  -21.396 1.00 40.85 ? 218 GLU A N     1 
ATOM   1673  C CA    . GLU A 1 218 ? 31.563  33.703  -22.632 1.00 42.51 ? 218 GLU A CA    1 
ATOM   1674  C C     . GLU A 1 218 ? 31.827  32.872  -23.907 1.00 41.43 ? 218 GLU A C     1 
ATOM   1675  O O     . GLU A 1 218 ? 30.972  32.776  -24.771 1.00 40.98 ? 218 GLU A O     1 
ATOM   1676  C CB    . GLU A 1 218 ? 32.273  35.056  -22.695 1.00 42.80 ? 218 GLU A CB    1 
ATOM   1677  C CG    . GLU A 1 218 ? 33.066  35.290  -24.019 1.00 46.85 ? 218 GLU A CG    1 
ATOM   1678  C CD    . GLU A 1 218 ? 34.516  35.748  -23.763 1.00 51.79 ? 218 GLU A CD    1 
ATOM   1679  O OE1   . GLU A 1 218 ? 35.452  34.947  -24.054 1.00 49.30 ? 218 GLU A OE1   1 
ATOM   1680  O OE2   . GLU A 1 218 ? 34.692  36.908  -23.270 1.00 54.39 ? 218 GLU A OE2   1 
ATOM   1681  N N     . LEU A 1 219 ? 33.024  32.300  -23.994 1.00 42.59 ? 219 LEU A N     1 
ATOM   1682  C CA    . LEU A 1 219 ? 33.392  31.337  -25.034 1.00 42.95 ? 219 LEU A CA    1 
ATOM   1683  C C     . LEU A 1 219 ? 32.360  30.247  -25.102 1.00 43.21 ? 219 LEU A C     1 
ATOM   1684  O O     . LEU A 1 219 ? 31.974  29.868  -26.202 1.00 44.17 ? 219 LEU A O     1 
ATOM   1685  C CB    . LEU A 1 219 ? 34.738  30.694  -24.737 1.00 43.05 ? 219 LEU A CB    1 
ATOM   1686  C CG    . LEU A 1 219 ? 36.034  31.190  -25.397 1.00 44.24 ? 219 LEU A CG    1 
ATOM   1687  C CD1   . LEU A 1 219 ? 35.716  32.154  -26.532 1.00 47.01 ? 219 LEU A CD1   1 
ATOM   1688  C CD2   . LEU A 1 219 ? 37.003  31.771  -24.396 1.00 41.51 ? 219 LEU A CD2   1 
ATOM   1689  N N     . ALA A 1 220 ? 31.919  29.778  -23.914 1.00 43.57 ? 220 ALA A N     1 
ATOM   1690  C CA    . ALA A 1 220 ? 30.898  28.701  -23.718 1.00 43.36 ? 220 ALA A CA    1 
ATOM   1691  C C     . ALA A 1 220 ? 29.503  28.909  -24.363 1.00 42.53 ? 220 ALA A C     1 
ATOM   1692  O O     . ALA A 1 220 ? 28.983  27.980  -24.931 1.00 40.00 ? 220 ALA A O     1 
ATOM   1693  C CB    . ALA A 1 220 ? 30.743  28.344  -22.155 1.00 42.54 ? 220 ALA A CB    1 
ATOM   1694  N N     . ARG A 1 221 ? 28.882  30.093  -24.249 1.00 43.69 ? 221 ARG A N     1 
ATOM   1695  C CA    . ARG A 1 221 ? 27.664  30.348  -25.080 1.00 44.57 ? 221 ARG A CA    1 
ATOM   1696  C C     . ARG A 1 221 ? 28.073  30.596  -26.492 1.00 44.57 ? 221 ARG A C     1 
ATOM   1697  O O     . ARG A 1 221 ? 27.488  30.038  -27.435 1.00 44.63 ? 221 ARG A O     1 
ATOM   1698  C CB    . ARG A 1 221 ? 26.747  31.507  -24.663 1.00 43.94 ? 221 ARG A CB    1 
ATOM   1699  C CG    . ARG A 1 221 ? 27.310  32.551  -23.765 1.00 49.00 ? 221 ARG A CG    1 
ATOM   1700  C CD    . ARG A 1 221 ? 26.627  33.950  -24.043 1.00 54.27 ? 221 ARG A CD    1 
ATOM   1701  N NE    . ARG A 1 221 ? 26.934  34.423  -25.397 1.00 57.25 ? 221 ARG A NE    1 
ATOM   1702  C CZ    . ARG A 1 221 ? 28.141  34.788  -25.832 1.00 61.02 ? 221 ARG A CZ    1 
ATOM   1703  N NH1   . ARG A 1 221 ? 29.202  34.798  -25.002 1.00 61.36 ? 221 ARG A NH1   1 
ATOM   1704  N NH2   . ARG A 1 221 ? 28.288  35.164  -27.108 1.00 60.49 ? 221 ARG A NH2   1 
ATOM   1705  N N     . LYS A 1 222 ? 29.091  31.436  -26.643 1.00 43.91 ? 222 LYS A N     1 
ATOM   1706  C CA    . LYS A 1 222 ? 29.541  31.744  -27.972 1.00 42.63 ? 222 LYS A CA    1 
ATOM   1707  C C     . LYS A 1 222 ? 29.495  30.536  -28.918 1.00 42.14 ? 222 LYS A C     1 
ATOM   1708  O O     . LYS A 1 222 ? 28.848  30.660  -29.982 1.00 40.99 ? 222 LYS A O     1 
ATOM   1709  C CB    . LYS A 1 222 ? 30.882  32.491  -27.987 1.00 42.50 ? 222 LYS A CB    1 
ATOM   1710  C CG    . LYS A 1 222 ? 30.908  33.495  -29.108 1.00 40.87 ? 222 LYS A CG    1 
ATOM   1711  C CD    . LYS A 1 222 ? 32.281  33.938  -29.522 1.00 42.39 ? 222 LYS A CD    1 
ATOM   1712  C CE    . LYS A 1 222 ? 32.243  34.249  -31.020 1.00 46.87 ? 222 LYS A CE    1 
ATOM   1713  N NZ    . LYS A 1 222 ? 33.333  35.168  -31.457 1.00 46.75 ? 222 LYS A NZ    1 
ATOM   1714  N N     . TYR A 1 223 ? 30.137  29.393  -28.558 1.00 41.40 ? 223 TYR A N     1 
ATOM   1715  C CA    . TYR A 1 223 ? 30.026  28.148  -29.432 1.00 41.71 ? 223 TYR A CA    1 
ATOM   1716  C C     . TYR A 1 223 ? 29.116  27.064  -28.838 1.00 41.36 ? 223 TYR A C     1 
ATOM   1717  O O     . TYR A 1 223 ? 29.209  25.891  -29.193 1.00 42.01 ? 223 TYR A O     1 
ATOM   1718  C CB    . TYR A 1 223 ? 31.368  27.537  -29.787 1.00 42.93 ? 223 TYR A CB    1 
ATOM   1719  C CG    . TYR A 1 223 ? 32.326  28.537  -30.369 1.00 43.99 ? 223 TYR A CG    1 
ATOM   1720  C CD1   . TYR A 1 223 ? 32.761  28.415  -31.685 1.00 41.65 ? 223 TYR A CD1   1 
ATOM   1721  C CD2   . TYR A 1 223 ? 32.757  29.618  -29.611 1.00 41.84 ? 223 TYR A CD2   1 
ATOM   1722  C CE1   . TYR A 1 223 ? 33.602  29.350  -32.225 1.00 46.25 ? 223 TYR A CE1   1 
ATOM   1723  C CE2   . TYR A 1 223 ? 33.607  30.549  -30.127 1.00 45.52 ? 223 TYR A CE2   1 
ATOM   1724  C CZ    . TYR A 1 223 ? 34.036  30.415  -31.436 1.00 45.57 ? 223 TYR A CZ    1 
ATOM   1725  O OH    . TYR A 1 223 ? 34.893  31.362  -31.953 1.00 47.71 ? 223 TYR A OH    1 
ATOM   1726  N N     . ASP A 1 224 ? 28.251  27.515  -27.937 1.00 40.40 ? 224 ASP A N     1 
ATOM   1727  C CA    . ASP A 1 224 ? 27.230  26.773  -27.253 1.00 40.16 ? 224 ASP A CA    1 
ATOM   1728  C C     . ASP A 1 224 ? 27.588  25.282  -26.946 1.00 39.93 ? 224 ASP A C     1 
ATOM   1729  O O     . ASP A 1 224 ? 27.007  24.309  -27.499 1.00 38.64 ? 224 ASP A O     1 
ATOM   1730  C CB    . ASP A 1 224 ? 25.906  27.035  -27.965 1.00 39.63 ? 224 ASP A CB    1 
ATOM   1731  C CG    . ASP A 1 224 ? 24.705  26.560  -27.184 1.00 43.39 ? 224 ASP A CG    1 
ATOM   1732  O OD1   . ASP A 1 224 ? 24.706  26.534  -25.923 1.00 44.97 ? 224 ASP A OD1   1 
ATOM   1733  O OD2   . ASP A 1 224 ? 23.720  26.229  -27.872 1.00 49.15 ? 224 ASP A OD2   1 
ATOM   1734  N N     . PHE A 1 225 ? 28.620  25.162  -26.111 1.00 39.31 ? 225 PHE A N     1 
ATOM   1735  C CA    . PHE A 1 225 ? 29.021  23.918  -25.445 1.00 39.30 ? 225 PHE A CA    1 
ATOM   1736  C C     . PHE A 1 225 ? 28.742  24.018  -23.917 1.00 38.06 ? 225 PHE A C     1 
ATOM   1737  O O     . PHE A 1 225 ? 28.613  25.106  -23.363 1.00 38.79 ? 225 PHE A O     1 
ATOM   1738  C CB    . PHE A 1 225 ? 30.494  23.522  -25.715 1.00 37.52 ? 225 PHE A CB    1 
ATOM   1739  C CG    . PHE A 1 225 ? 31.544  24.591  -25.326 1.00 39.40 ? 225 PHE A CG    1 
ATOM   1740  C CD1   . PHE A 1 225 ? 32.089  24.625  -24.044 1.00 37.34 ? 225 PHE A CD1   1 
ATOM   1741  C CD2   . PHE A 1 225 ? 32.043  25.530  -26.298 1.00 39.88 ? 225 PHE A CD2   1 
ATOM   1742  C CE1   . PHE A 1 225 ? 33.057  25.582  -23.704 1.00 37.25 ? 225 PHE A CE1   1 
ATOM   1743  C CE2   . PHE A 1 225 ? 33.044  26.470  -25.975 1.00 35.07 ? 225 PHE A CE2   1 
ATOM   1744  C CZ    . PHE A 1 225 ? 33.546  26.488  -24.667 1.00 36.04 ? 225 PHE A CZ    1 
ATOM   1745  N N     . LEU A 1 226 ? 28.666  22.855  -23.278 1.00 37.07 ? 226 LEU A N     1 
ATOM   1746  C CA    . LEU A 1 226 ? 28.391  22.693  -21.848 1.00 33.77 ? 226 LEU A CA    1 
ATOM   1747  C C     . LEU A 1 226 ? 29.693  22.826  -21.138 1.00 34.05 ? 226 LEU A C     1 
ATOM   1748  O O     . LEU A 1 226 ? 30.720  22.585  -21.778 1.00 32.08 ? 226 LEU A O     1 
ATOM   1749  C CB    . LEU A 1 226 ? 27.918  21.279  -21.613 1.00 33.93 ? 226 LEU A CB    1 
ATOM   1750  C CG    . LEU A 1 226 ? 26.455  20.779  -21.693 1.00 32.34 ? 226 LEU A CG    1 
ATOM   1751  C CD1   . LEU A 1 226 ? 25.541  21.548  -22.587 1.00 29.46 ? 226 LEU A CD1   1 
ATOM   1752  C CD2   . LEU A 1 226 ? 26.389  19.259  -21.970 1.00 29.98 ? 226 LEU A CD2   1 
ATOM   1753  N N     . ILE A 1 227 ? 29.650  23.161  -19.837 1.00 33.44 ? 227 ILE A N     1 
ATOM   1754  C CA    . ILE A 1 227 ? 30.858  23.187  -18.975 1.00 33.75 ? 227 ILE A CA    1 
ATOM   1755  C C     . ILE A 1 227 ? 30.744  22.133  -17.920 1.00 34.91 ? 227 ILE A C     1 
ATOM   1756  O O     . ILE A 1 227 ? 29.952  22.201  -16.976 1.00 33.24 ? 227 ILE A O     1 
ATOM   1757  C CB    . ILE A 1 227 ? 31.238  24.625  -18.307 1.00 34.01 ? 227 ILE A CB    1 
ATOM   1758  C CG1   . ILE A 1 227 ? 31.734  25.631  -19.357 1.00 31.00 ? 227 ILE A CG1   1 
ATOM   1759  C CG2   . ILE A 1 227 ? 32.344  24.542  -17.250 1.00 33.37 ? 227 ILE A CG2   1 
ATOM   1760  C CD1   . ILE A 1 227 ? 30.653  26.685  -19.632 1.00 36.74 ? 227 ILE A CD1   1 
ATOM   1761  N N     . ILE A 1 228 ? 31.578  21.101  -18.052 1.00 36.67 ? 228 ILE A N     1 
ATOM   1762  C CA    . ILE A 1 228 ? 31.626  20.288  -16.894 1.00 35.37 ? 228 ILE A CA    1 
ATOM   1763  C C     . ILE A 1 228 ? 32.630  20.795  -15.889 1.00 34.43 ? 228 ILE A C     1 
ATOM   1764  O O     . ILE A 1 228 ? 33.825  20.891  -16.147 1.00 32.53 ? 228 ILE A O     1 
ATOM   1765  C CB    . ILE A 1 228 ? 31.407  18.753  -17.074 1.00 35.40 ? 228 ILE A CB    1 
ATOM   1766  C CG1   . ILE A 1 228 ? 32.378  17.977  -16.219 1.00 37.19 ? 228 ILE A CG1   1 
ATOM   1767  C CG2   . ILE A 1 228 ? 31.411  18.273  -18.547 1.00 37.71 ? 228 ILE A CG2   1 
ATOM   1768  C CD1   . ILE A 1 228 ? 31.712  16.874  -15.520 1.00 44.79 ? 228 ILE A CD1   1 
ATOM   1769  N N     . GLU A 1 229 ? 32.053  21.157  -14.735 1.00 34.21 ? 229 GLU A N     1 
ATOM   1770  C CA    . GLU A 1 229 ? 32.759  21.724  -13.598 1.00 33.54 ? 229 GLU A CA    1 
ATOM   1771  C C     . GLU A 1 229 ? 33.015  20.632  -12.556 1.00 32.67 ? 229 GLU A C     1 
ATOM   1772  O O     . GLU A 1 229 ? 32.246  20.391  -11.670 1.00 33.62 ? 229 GLU A O     1 
ATOM   1773  C CB    . GLU A 1 229 ? 31.936  22.941  -13.010 1.00 32.65 ? 229 GLU A CB    1 
ATOM   1774  C CG    . GLU A 1 229 ? 32.707  23.676  -11.926 1.00 35.22 ? 229 GLU A CG    1 
ATOM   1775  C CD    . GLU A 1 229 ? 32.169  25.045  -11.602 1.00 34.03 ? 229 GLU A CD    1 
ATOM   1776  O OE1   . GLU A 1 229 ? 33.031  25.917  -11.424 1.00 36.08 ? 229 GLU A OE1   1 
ATOM   1777  O OE2   . GLU A 1 229 ? 30.935  25.277  -11.554 1.00 34.03 ? 229 GLU A OE2   1 
ATOM   1778  N N     . ASP A 1 230 ? 34.153  19.975  -12.627 1.00 34.72 ? 230 ASP A N     1 
ATOM   1779  C CA    . ASP A 1 230 ? 34.359  18.809  -11.804 1.00 32.93 ? 230 ASP A CA    1 
ATOM   1780  C C     . ASP A 1 230 ? 35.149  19.328  -10.622 1.00 33.38 ? 230 ASP A C     1 
ATOM   1781  O O     . ASP A 1 230 ? 36.312  19.607  -10.750 1.00 33.81 ? 230 ASP A O     1 
ATOM   1782  C CB    . ASP A 1 230 ? 35.070  17.704  -12.609 1.00 32.64 ? 230 ASP A CB    1 
ATOM   1783  C CG    . ASP A 1 230 ? 35.493  16.480  -11.709 1.00 33.16 ? 230 ASP A CG    1 
ATOM   1784  O OD1   . ASP A 1 230 ? 34.838  16.253  -10.622 1.00 29.46 ? 230 ASP A OD1   1 
ATOM   1785  O OD2   . ASP A 1 230 ? 36.482  15.797  -12.089 1.00 27.79 ? 230 ASP A OD2   1 
ATOM   1786  N N     . ASP A 1 231 ? 34.494  19.508  -9.460  1.00 33.24 ? 231 ASP A N     1 
ATOM   1787  C CA    . ASP A 1 231 ? 35.043  20.421  -8.441  1.00 31.98 ? 231 ASP A CA    1 
ATOM   1788  C C     . ASP A 1 231 ? 35.236  19.790  -7.061  1.00 30.57 ? 231 ASP A C     1 
ATOM   1789  O O     . ASP A 1 231 ? 34.681  20.280  -6.082  1.00 29.56 ? 231 ASP A O     1 
ATOM   1790  C CB    . ASP A 1 231 ? 34.159  21.704  -8.350  1.00 30.44 ? 231 ASP A CB    1 
ATOM   1791  C CG    . ASP A 1 231 ? 34.960  22.984  -8.030  1.00 31.94 ? 231 ASP A CG    1 
ATOM   1792  O OD1   . ASP A 1 231 ? 36.209  23.003  -7.785  1.00 30.96 ? 231 ASP A OD1   1 
ATOM   1793  O OD2   . ASP A 1 231 ? 34.272  24.003  -7.978  1.00 32.00 ? 231 ASP A OD2   1 
ATOM   1794  N N     . PRO A 1 232 ? 36.062  18.711  -6.975  1.00 31.16 ? 232 PRO A N     1 
ATOM   1795  C CA    . PRO A 1 232 ? 36.271  17.998  -5.726  1.00 28.84 ? 232 PRO A CA    1 
ATOM   1796  C C     . PRO A 1 232 ? 37.192  18.619  -4.696  1.00 30.46 ? 232 PRO A C     1 
ATOM   1797  O O     . PRO A 1 232 ? 37.197  18.151  -3.568  1.00 29.44 ? 232 PRO A O     1 
ATOM   1798  C CB    . PRO A 1 232 ? 36.911  16.722  -6.184  1.00 30.63 ? 232 PRO A CB    1 
ATOM   1799  C CG    . PRO A 1 232 ? 37.690  17.111  -7.421  1.00 29.54 ? 232 PRO A CG    1 
ATOM   1800  C CD    . PRO A 1 232 ? 36.800  18.055  -8.094  1.00 30.55 ? 232 PRO A CD    1 
ATOM   1801  N N     . TYR A 1 233 ? 37.948  19.669  -5.060  1.00 29.75 ? 233 TYR A N     1 
ATOM   1802  C CA    . TYR A 1 233 ? 38.711  20.421  -4.112  1.00 28.32 ? 233 TYR A CA    1 
ATOM   1803  C C     . TYR A 1 233 ? 38.103  21.847  -3.926  1.00 29.24 ? 233 TYR A C     1 
ATOM   1804  O O     . TYR A 1 233 ? 38.825  22.765  -3.568  1.00 29.78 ? 233 TYR A O     1 
ATOM   1805  C CB    . TYR A 1 233 ? 40.161  20.528  -4.624  1.00 27.48 ? 233 TYR A CB    1 
ATOM   1806  C CG    . TYR A 1 233 ? 40.771  19.170  -4.872  1.00 26.85 ? 233 TYR A CG    1 
ATOM   1807  C CD1   . TYR A 1 233 ? 40.867  18.628  -6.164  1.00 25.61 ? 233 TYR A CD1   1 
ATOM   1808  C CD2   . TYR A 1 233 ? 41.253  18.422  -3.802  1.00 23.24 ? 233 TYR A CD2   1 
ATOM   1809  C CE1   . TYR A 1 233 ? 41.410  17.336  -6.386  1.00 21.10 ? 233 TYR A CE1   1 
ATOM   1810  C CE2   . TYR A 1 233 ? 41.807  17.188  -4.018  1.00 26.98 ? 233 TYR A CE2   1 
ATOM   1811  C CZ    . TYR A 1 233 ? 41.856  16.653  -5.315  1.00 26.50 ? 233 TYR A CZ    1 
ATOM   1812  O OH    . TYR A 1 233 ? 42.391  15.446  -5.456  1.00 26.68 ? 233 TYR A OH    1 
ATOM   1813  N N     . TYR A 1 234 ? 36.822  22.035  -4.215  1.00 28.82 ? 234 TYR A N     1 
ATOM   1814  C CA    . TYR A 1 234 ? 36.185  23.288  -3.985  1.00 29.00 ? 234 TYR A CA    1 
ATOM   1815  C C     . TYR A 1 234 ? 36.252  23.513  -2.491  1.00 30.45 ? 234 TYR A C     1 
ATOM   1816  O O     . TYR A 1 234 ? 36.462  24.628  -2.029  1.00 31.38 ? 234 TYR A O     1 
ATOM   1817  C CB    . TYR A 1 234 ? 34.716  23.256  -4.379  1.00 29.02 ? 234 TYR A CB    1 
ATOM   1818  C CG    . TYR A 1 234 ? 34.006  24.560  -4.012  1.00 31.27 ? 234 TYR A CG    1 
ATOM   1819  C CD1   . TYR A 1 234 ? 34.094  25.692  -4.873  1.00 27.09 ? 234 TYR A CD1   1 
ATOM   1820  C CD2   . TYR A 1 234 ? 33.264  24.671  -2.833  1.00 27.99 ? 234 TYR A CD2   1 
ATOM   1821  C CE1   . TYR A 1 234 ? 33.472  26.878  -4.560  1.00 32.38 ? 234 TYR A CE1   1 
ATOM   1822  C CE2   . TYR A 1 234 ? 32.626  25.889  -2.481  1.00 35.49 ? 234 TYR A CE2   1 
ATOM   1823  C CZ    . TYR A 1 234 ? 32.730  26.993  -3.374  1.00 36.27 ? 234 TYR A CZ    1 
ATOM   1824  O OH    . TYR A 1 234 ? 32.111  28.204  -3.109  1.00 37.29 ? 234 TYR A OH    1 
ATOM   1825  N N     . PHE A 1 235 ? 36.087  22.485  -1.680  1.00 29.85 ? 235 PHE A N     1 
ATOM   1826  C CA    . PHE A 1 235 ? 36.140  22.839  -0.230  1.00 29.65 ? 235 PHE A CA    1 
ATOM   1827  C C     . PHE A 1 235 ? 37.582  22.782  0.341   1.00 29.53 ? 235 PHE A C     1 
ATOM   1828  O O     . PHE A 1 235 ? 37.803  22.717  1.581   1.00 26.69 ? 235 PHE A O     1 
ATOM   1829  C CB    . PHE A 1 235 ? 35.140  22.043  0.546   1.00 27.44 ? 235 PHE A CB    1 
ATOM   1830  C CG    . PHE A 1 235 ? 33.729  22.401  0.225   1.00 27.62 ? 235 PHE A CG    1 
ATOM   1831  C CD1   . PHE A 1 235 ? 33.186  23.642  0.637   1.00 28.89 ? 235 PHE A CD1   1 
ATOM   1832  C CD2   . PHE A 1 235 ? 32.917  21.510  -0.441  1.00 27.53 ? 235 PHE A CD2   1 
ATOM   1833  C CE1   . PHE A 1 235 ? 31.854  23.947  0.409   1.00 31.13 ? 235 PHE A CE1   1 
ATOM   1834  C CE2   . PHE A 1 235 ? 31.596  21.800  -0.677  1.00 23.45 ? 235 PHE A CE2   1 
ATOM   1835  C CZ    . PHE A 1 235 ? 31.062  22.999  -0.271  1.00 29.65 ? 235 PHE A CZ    1 
ATOM   1836  N N     . LEU A 1 236 ? 38.541  22.787  -0.605  1.00 28.76 ? 236 LEU A N     1 
ATOM   1837  C CA    . LEU A 1 236 ? 39.880  22.592  -0.230  1.00 30.58 ? 236 LEU A CA    1 
ATOM   1838  C C     . LEU A 1 236 ? 40.863  23.695  -0.659  1.00 31.28 ? 236 LEU A C     1 
ATOM   1839  O O     . LEU A 1 236 ? 42.040  23.426  -0.722  1.00 33.18 ? 236 LEU A O     1 
ATOM   1840  C CB    . LEU A 1 236 ? 40.317  21.170  -0.633  1.00 31.05 ? 236 LEU A CB    1 
ATOM   1841  C CG    . LEU A 1 236 ? 41.105  20.311  0.374   1.00 32.52 ? 236 LEU A CG    1 
ATOM   1842  C CD1   . LEU A 1 236 ? 40.385  19.942  1.727   1.00 34.29 ? 236 LEU A CD1   1 
ATOM   1843  C CD2   . LEU A 1 236 ? 41.683  19.067  -0.211  1.00 32.19 ? 236 LEU A CD2   1 
ATOM   1844  N N     . GLN A 1 237 ? 40.356  24.905  -0.887  1.00 31.16 ? 237 GLN A N     1 
ATOM   1845  C CA    . GLN A 1 237 ? 41.108  26.099  -1.358  1.00 33.08 ? 237 GLN A CA    1 
ATOM   1846  C C     . GLN A 1 237 ? 41.808  26.864  -0.251  1.00 33.41 ? 237 GLN A C     1 
ATOM   1847  O O     . GLN A 1 237 ? 41.220  27.162  0.746   1.00 32.73 ? 237 GLN A O     1 
ATOM   1848  C CB    . GLN A 1 237 ? 40.184  27.094  -2.070  1.00 31.52 ? 237 GLN A CB    1 
ATOM   1849  C CG    . GLN A 1 237 ? 39.542  26.546  -3.251  1.00 31.27 ? 237 GLN A CG    1 
ATOM   1850  C CD    . GLN A 1 237 ? 38.410  27.382  -3.747  1.00 30.95 ? 237 GLN A CD    1 
ATOM   1851  O OE1   . GLN A 1 237 ? 37.281  26.950  -3.694  1.00 29.74 ? 237 GLN A OE1   1 
ATOM   1852  N NE2   . GLN A 1 237 ? 38.710  28.583  -4.273  1.00 33.02 ? 237 GLN A NE2   1 
ATOM   1853  N N     . PHE A 1 238 ? 43.054  27.217  -0.504  1.00 35.66 ? 238 PHE A N     1 
ATOM   1854  C CA    . PHE A 1 238 ? 43.955  27.890  0.449   1.00 38.76 ? 238 PHE A CA    1 
ATOM   1855  C C     . PHE A 1 238 ? 43.698  29.418  0.752   1.00 38.91 ? 238 PHE A C     1 
ATOM   1856  O O     . PHE A 1 238 ? 43.743  29.878  1.927   1.00 40.19 ? 238 PHE A O     1 
ATOM   1857  C CB    . PHE A 1 238 ? 45.395  27.507  0.062   1.00 37.96 ? 238 PHE A CB    1 
ATOM   1858  C CG    . PHE A 1 238 ? 45.618  25.976  0.036   1.00 36.65 ? 238 PHE A CG    1 
ATOM   1859  C CD1   . PHE A 1 238 ? 46.488  25.410  -0.810  1.00 29.53 ? 238 PHE A CD1   1 
ATOM   1860  C CD2   . PHE A 1 238 ? 44.917  25.146  0.898   1.00 39.37 ? 238 PHE A CD2   1 
ATOM   1861  C CE1   . PHE A 1 238 ? 46.653  24.092  -0.833  1.00 34.21 ? 238 PHE A CE1   1 
ATOM   1862  C CE2   . PHE A 1 238 ? 45.088  23.776  0.879   1.00 36.53 ? 238 PHE A CE2   1 
ATOM   1863  C CZ    . PHE A 1 238 ? 45.941  23.261  0.024   1.00 35.37 ? 238 PHE A CZ    1 
ATOM   1864  N N     . ASN A 1 239 ? 43.391  30.161  -0.285  1.00 39.62 ? 239 ASN A N     1 
ATOM   1865  C CA    . ASN A 1 239 ? 42.704  31.445  -0.208  1.00 42.02 ? 239 ASN A CA    1 
ATOM   1866  C C     . ASN A 1 239 ? 41.345  31.261  0.449   1.00 43.38 ? 239 ASN A C     1 
ATOM   1867  O O     . ASN A 1 239 ? 40.497  30.472  -0.042  1.00 43.18 ? 239 ASN A O     1 
ATOM   1868  C CB    . ASN A 1 239 ? 42.441  31.895  -1.620  1.00 42.33 ? 239 ASN A CB    1 
ATOM   1869  C CG    . ASN A 1 239 ? 42.277  33.394  -1.755  1.00 46.46 ? 239 ASN A CG    1 
ATOM   1870  O OD1   . ASN A 1 239 ? 41.978  34.142  -0.778  1.00 46.09 ? 239 ASN A OD1   1 
ATOM   1871  N ND2   . ASN A 1 239 ? 42.493  33.865  -3.005  1.00 50.24 ? 239 ASN A ND2   1 
ATOM   1872  N N     . LYS A 1 240 ? 41.090  31.922  1.573   1.00 43.58 ? 240 LYS A N     1 
ATOM   1873  C CA    . LYS A 1 240 ? 39.796  31.628  2.143   1.00 45.12 ? 240 LYS A CA    1 
ATOM   1874  C C     . LYS A 1 240 ? 38.667  32.440  1.497   1.00 44.41 ? 240 LYS A C     1 
ATOM   1875  O O     . LYS A 1 240 ? 37.513  32.106  1.688   1.00 44.56 ? 240 LYS A O     1 
ATOM   1876  C CB    . LYS A 1 240 ? 39.796  31.643  3.668   1.00 46.48 ? 240 LYS A CB    1 
ATOM   1877  C CG    . LYS A 1 240 ? 40.939  30.839  4.300   1.00 50.22 ? 240 LYS A CG    1 
ATOM   1878  C CD    . LYS A 1 240 ? 40.624  29.369  4.420   1.00 51.95 ? 240 LYS A CD    1 
ATOM   1879  C CE    . LYS A 1 240 ? 41.273  28.801  5.649   1.00 56.08 ? 240 LYS A CE    1 
ATOM   1880  N NZ    . LYS A 1 240 ? 40.424  28.823  6.920   1.00 58.41 ? 240 LYS A NZ    1 
ATOM   1881  N N     . PHE A 1 241 ? 39.010  33.459  0.715   1.00 43.99 ? 241 PHE A N     1 
ATOM   1882  C CA    . PHE A 1 241 ? 38.102  34.059  -0.274  1.00 44.80 ? 241 PHE A CA    1 
ATOM   1883  C C     . PHE A 1 241 ? 37.994  33.176  -1.565  1.00 44.01 ? 241 PHE A C     1 
ATOM   1884  O O     . PHE A 1 241 ? 38.747  33.395  -2.535  1.00 44.65 ? 241 PHE A O     1 
ATOM   1885  C CB    . PHE A 1 241 ? 38.590  35.478  -0.647  1.00 46.38 ? 241 PHE A CB    1 
ATOM   1886  C CG    . PHE A 1 241 ? 38.215  36.562  0.357   1.00 49.61 ? 241 PHE A CG    1 
ATOM   1887  C CD1   . PHE A 1 241 ? 38.721  36.547  1.672   1.00 52.37 ? 241 PHE A CD1   1 
ATOM   1888  C CD2   . PHE A 1 241 ? 37.354  37.618  -0.025  1.00 54.07 ? 241 PHE A CD2   1 
ATOM   1889  C CE1   . PHE A 1 241 ? 38.357  37.512  2.583   1.00 49.28 ? 241 PHE A CE1   1 
ATOM   1890  C CE2   . PHE A 1 241 ? 36.990  38.601  0.874   1.00 48.18 ? 241 PHE A CE2   1 
ATOM   1891  C CZ    . PHE A 1 241 ? 37.493  38.544  2.179   1.00 48.79 ? 241 PHE A CZ    1 
ATOM   1892  N N     . ARG A 1 242 ? 37.067  32.210  -1.573  1.00 42.67 ? 242 ARG A N     1 
ATOM   1893  C CA    . ARG A 1 242 ? 36.827  31.251  -2.727  1.00 42.51 ? 242 ARG A CA    1 
ATOM   1894  C C     . ARG A 1 242 ? 36.416  31.941  -4.024  1.00 42.82 ? 242 ARG A C     1 
ATOM   1895  O O     . ARG A 1 242 ? 35.554  32.814  -3.986  1.00 44.50 ? 242 ARG A O     1 
ATOM   1896  C CB    . ARG A 1 242 ? 35.757  30.191  -2.419  1.00 39.63 ? 242 ARG A CB    1 
ATOM   1897  C CG    . ARG A 1 242 ? 36.014  29.409  -1.173  1.00 39.99 ? 242 ARG A CG    1 
ATOM   1898  C CD    . ARG A 1 242 ? 34.937  28.374  -0.888  1.00 40.19 ? 242 ARG A CD    1 
ATOM   1899  N NE    . ARG A 1 242 ? 33.632  28.963  -0.586  1.00 39.35 ? 242 ARG A NE    1 
ATOM   1900  C CZ    . ARG A 1 242 ? 33.255  29.429  0.619   1.00 36.12 ? 242 ARG A CZ    1 
ATOM   1901  N NH1   . ARG A 1 242 ? 34.071  29.406  1.664   1.00 38.63 ? 242 ARG A NH1   1 
ATOM   1902  N NH2   . ARG A 1 242 ? 32.068  29.952  0.778   1.00 28.31 ? 242 ARG A NH2   1 
ATOM   1903  N N     . VAL A 1 243 ? 36.966  31.532  -5.178  1.00 42.55 ? 243 VAL A N     1 
ATOM   1904  C CA    . VAL A 1 243 ? 36.544  32.209  -6.397  1.00 41.88 ? 243 VAL A CA    1 
ATOM   1905  C C     . VAL A 1 243 ? 35.128  31.755  -6.674  1.00 42.13 ? 243 VAL A C     1 
ATOM   1906  O O     . VAL A 1 243 ? 34.784  30.655  -6.237  1.00 41.69 ? 243 VAL A O     1 
ATOM   1907  C CB    . VAL A 1 243 ? 37.602  32.164  -7.601  1.00 42.61 ? 243 VAL A CB    1 
ATOM   1908  C CG1   . VAL A 1 243 ? 38.909  31.400  -7.275  1.00 41.91 ? 243 VAL A CG1   1 
ATOM   1909  C CG2   . VAL A 1 243 ? 36.993  31.919  -8.999  1.00 40.54 ? 243 VAL A CG2   1 
ATOM   1910  N N     . PRO A 1 244 ? 34.252  32.628  -7.236  1.00 40.94 ? 244 PRO A N     1 
ATOM   1911  C CA    . PRO A 1 244 ? 33.018  32.113  -7.806  1.00 40.70 ? 244 PRO A CA    1 
ATOM   1912  C C     . PRO A 1 244 ? 33.213  30.910  -8.669  1.00 39.92 ? 244 PRO A C     1 
ATOM   1913  O O     . PRO A 1 244 ? 34.262  30.749  -9.234  1.00 40.26 ? 244 PRO A O     1 
ATOM   1914  C CB    . PRO A 1 244 ? 32.485  33.301  -8.672  1.00 41.15 ? 244 PRO A CB    1 
ATOM   1915  C CG    . PRO A 1 244 ? 32.836  34.475  -7.886  1.00 41.71 ? 244 PRO A CG    1 
ATOM   1916  C CD    . PRO A 1 244 ? 34.245  34.097  -7.218  1.00 41.95 ? 244 PRO A CD    1 
ATOM   1917  N N     . THR A 1 245 ? 32.179  30.077  -8.765  1.00 39.98 ? 245 THR A N     1 
ATOM   1918  C CA    . THR A 1 245 ? 32.177  28.850  -9.575  1.00 39.00 ? 245 THR A CA    1 
ATOM   1919  C C     . THR A 1 245 ? 31.454  29.122  -10.879 1.00 38.55 ? 245 THR A C     1 
ATOM   1920  O O     . THR A 1 245 ? 30.640  30.071  -10.921 1.00 38.20 ? 245 THR A O     1 
ATOM   1921  C CB    . THR A 1 245 ? 31.394  27.729  -8.872  1.00 39.70 ? 245 THR A CB    1 
ATOM   1922  O OG1   . THR A 1 245 ? 30.038  28.145  -8.700  1.00 40.05 ? 245 THR A OG1   1 
ATOM   1923  C CG2   . THR A 1 245 ? 31.997  27.428  -7.484  1.00 42.25 ? 245 THR A CG2   1 
ATOM   1924  N N     . PHE A 1 246 ? 31.736  28.310  -11.933 1.00 37.09 ? 246 PHE A N     1 
ATOM   1925  C CA    . PHE A 1 246 ? 30.906  28.303  -13.152 1.00 35.61 ? 246 PHE A CA    1 
ATOM   1926  C C     . PHE A 1 246 ? 29.467  28.185  -12.838 1.00 34.83 ? 246 PHE A C     1 
ATOM   1927  O O     . PHE A 1 246 ? 28.674  28.727  -13.557 1.00 35.82 ? 246 PHE A O     1 
ATOM   1928  C CB    . PHE A 1 246 ? 31.304  27.211  -14.175 1.00 35.41 ? 246 PHE A CB    1 
ATOM   1929  C CG    . PHE A 1 246 ? 32.663  27.420  -14.750 1.00 36.25 ? 246 PHE A CG    1 
ATOM   1930  C CD1   . PHE A 1 246 ? 33.729  26.550  -14.401 1.00 33.95 ? 246 PHE A CD1   1 
ATOM   1931  C CD2   . PHE A 1 246 ? 32.918  28.544  -15.575 1.00 31.01 ? 246 PHE A CD2   1 
ATOM   1932  C CE1   . PHE A 1 246 ? 35.025  26.770  -14.889 1.00 29.52 ? 246 PHE A CE1   1 
ATOM   1933  C CE2   . PHE A 1 246 ? 34.177  28.763  -16.136 1.00 26.57 ? 246 PHE A CE2   1 
ATOM   1934  C CZ    . PHE A 1 246 ? 35.251  27.900  -15.776 1.00 36.56 ? 246 PHE A CZ    1 
ATOM   1935  N N     . LEU A 1 247 ? 29.096  27.493  -11.759 1.00 34.89 ? 247 LEU A N     1 
ATOM   1936  C CA    . LEU A 1 247 ? 27.688  27.470  -11.360 1.00 35.23 ? 247 LEU A CA    1 
ATOM   1937  C C     . LEU A 1 247 ? 27.151  28.866  -10.943 1.00 36.44 ? 247 LEU A C     1 
ATOM   1938  O O     . LEU A 1 247 ? 26.033  29.231  -11.278 1.00 35.06 ? 247 LEU A O     1 
ATOM   1939  C CB    . LEU A 1 247 ? 27.431  26.441  -10.255 1.00 35.35 ? 247 LEU A CB    1 
ATOM   1940  C CG    . LEU A 1 247 ? 26.012  26.085  -9.776  1.00 36.35 ? 247 LEU A CG    1 
ATOM   1941  C CD1   . LEU A 1 247 ? 25.073  25.618  -10.905 1.00 33.33 ? 247 LEU A CD1   1 
ATOM   1942  C CD2   . LEU A 1 247 ? 26.037  25.029  -8.621  1.00 34.88 ? 247 LEU A CD2   1 
ATOM   1943  N N     . SER A 1 248 ? 27.960  29.616  -10.191 1.00 38.03 ? 248 SER A N     1 
ATOM   1944  C CA    . SER A 1 248 ? 27.530  30.929  -9.643  1.00 38.98 ? 248 SER A CA    1 
ATOM   1945  C C     . SER A 1 248 ? 27.131  31.876  -10.788 1.00 39.72 ? 248 SER A C     1 
ATOM   1946  O O     . SER A 1 248 ? 26.101  32.502  -10.695 1.00 41.26 ? 248 SER A O     1 
ATOM   1947  C CB    . SER A 1 248 ? 28.596  31.516  -8.730  1.00 37.55 ? 248 SER A CB    1 
ATOM   1948  O OG    . SER A 1 248 ? 29.756  31.796  -9.460  1.00 35.08 ? 248 SER A OG    1 
ATOM   1949  N N     . MET A 1 249 ? 27.887  31.850  -11.895 1.00 41.30 ? 249 MET A N     1 
ATOM   1950  C CA    . MET A 1 249 ? 27.639  32.606  -13.159 1.00 41.97 ? 249 MET A CA    1 
ATOM   1951  C C     . MET A 1 249 ? 26.926  31.897  -14.338 1.00 41.11 ? 249 MET A C     1 
ATOM   1952  O O     . MET A 1 249 ? 26.999  32.382  -15.474 1.00 41.78 ? 249 MET A O     1 
ATOM   1953  C CB    . MET A 1 249 ? 28.982  33.078  -13.704 1.00 41.84 ? 249 MET A CB    1 
ATOM   1954  C CG    . MET A 1 249 ? 29.960  31.968  -13.985 1.00 44.20 ? 249 MET A CG    1 
ATOM   1955  S SD    . MET A 1 249 ? 31.638  32.550  -14.294 1.00 46.50 ? 249 MET A SD    1 
ATOM   1956  C CE    . MET A 1 249 ? 31.208  33.416  -15.790 1.00 48.41 ? 249 MET A CE    1 
ATOM   1957  N N     . ASP A 1 250 ? 26.226  30.796  -14.082 1.00 40.24 ? 250 ASP A N     1 
ATOM   1958  C CA    . ASP A 1 250 ? 25.556  29.999  -15.137 1.00 38.53 ? 250 ASP A CA    1 
ATOM   1959  C C     . ASP A 1 250 ? 24.137  30.517  -15.557 1.00 38.08 ? 250 ASP A C     1 
ATOM   1960  O O     . ASP A 1 250 ? 23.127  29.825  -15.312 1.00 35.52 ? 250 ASP A O     1 
ATOM   1961  C CB    . ASP A 1 250 ? 25.459  28.500  -14.711 1.00 38.56 ? 250 ASP A CB    1 
ATOM   1962  C CG    . ASP A 1 250 ? 24.887  27.617  -15.807 1.00 37.84 ? 250 ASP A CG    1 
ATOM   1963  O OD1   . ASP A 1 250 ? 25.130  27.937  -16.993 1.00 42.58 ? 250 ASP A OD1   1 
ATOM   1964  O OD2   . ASP A 1 250 ? 24.199  26.604  -15.515 1.00 37.36 ? 250 ASP A OD2   1 
ATOM   1965  N N     . VAL A 1 251 ? 24.083  31.688  -16.227 1.00 36.93 ? 251 VAL A N     1 
ATOM   1966  C CA    . VAL A 1 251 ? 22.795  32.316  -16.656 1.00 36.56 ? 251 VAL A CA    1 
ATOM   1967  C C     . VAL A 1 251 ? 21.979  31.544  -17.686 1.00 35.84 ? 251 VAL A C     1 
ATOM   1968  O O     . VAL A 1 251 ? 20.758  31.740  -17.765 1.00 36.02 ? 251 VAL A O     1 
ATOM   1969  C CB    . VAL A 1 251 ? 22.954  33.838  -17.092 1.00 35.73 ? 251 VAL A CB    1 
ATOM   1970  C CG1   . VAL A 1 251 ? 24.134  34.022  -18.039 1.00 37.43 ? 251 VAL A CG1   1 
ATOM   1971  C CG2   . VAL A 1 251 ? 21.647  34.390  -17.756 1.00 37.10 ? 251 VAL A CG2   1 
ATOM   1972  N N     . ASP A 1 252 ? 22.648  30.681  -18.457 1.00 36.36 ? 252 ASP A N     1 
ATOM   1973  C CA    . ASP A 1 252 ? 22.100  29.954  -19.587 1.00 35.36 ? 252 ASP A CA    1 
ATOM   1974  C C     . ASP A 1 252 ? 21.710  28.474  -19.244 1.00 35.85 ? 252 ASP A C     1 
ATOM   1975  O O     . ASP A 1 252 ? 20.952  27.826  -20.004 1.00 35.03 ? 252 ASP A O     1 
ATOM   1976  C CB    . ASP A 1 252 ? 23.175  29.770  -20.638 1.00 36.73 ? 252 ASP A CB    1 
ATOM   1977  C CG    . ASP A 1 252 ? 23.591  31.052  -21.381 1.00 40.53 ? 252 ASP A CG    1 
ATOM   1978  O OD1   . ASP A 1 252 ? 23.126  32.160  -21.144 1.00 41.92 ? 252 ASP A OD1   1 
ATOM   1979  O OD2   . ASP A 1 252 ? 24.470  30.912  -22.242 1.00 45.98 ? 252 ASP A OD2   1 
ATOM   1980  N N     . GLY A 1 253 ? 22.288  27.900  -18.175 1.00 33.34 ? 253 GLY A N     1 
ATOM   1981  C CA    . GLY A 1 253 ? 21.966  26.523  -17.848 1.00 31.05 ? 253 GLY A CA    1 
ATOM   1982  C C     . GLY A 1 253 ? 22.724  25.558  -18.726 1.00 31.30 ? 253 GLY A C     1 
ATOM   1983  O O     . GLY A 1 253 ? 22.138  24.691  -19.342 1.00 29.45 ? 253 GLY A O     1 
ATOM   1984  N N     . ARG A 1 254 ? 24.029  25.767  -18.795 1.00 32.16 ? 254 ARG A N     1 
ATOM   1985  C CA    . ARG A 1 254 ? 24.962  24.985  -19.581 1.00 33.87 ? 254 ARG A CA    1 
ATOM   1986  C C     . ARG A 1 254 ? 26.060  24.386  -18.690 1.00 34.20 ? 254 ARG A C     1 
ATOM   1987  O O     . ARG A 1 254 ? 27.085  23.983  -19.179 1.00 33.85 ? 254 ARG A O     1 
ATOM   1988  C CB    . ARG A 1 254 ? 25.643  25.888  -20.616 1.00 33.36 ? 254 ARG A CB    1 
ATOM   1989  C CG    . ARG A 1 254 ? 26.503  27.038  -20.031 1.00 33.25 ? 254 ARG A CG    1 
ATOM   1990  C CD    . ARG A 1 254 ? 27.229  27.750  -21.207 1.00 35.29 ? 254 ARG A CD    1 
ATOM   1991  N NE    . ARG A 1 254 ? 26.248  28.427  -22.051 1.00 35.24 ? 254 ARG A NE    1 
ATOM   1992  C CZ    . ARG A 1 254 ? 25.723  27.932  -23.143 1.00 38.74 ? 254 ARG A CZ    1 
ATOM   1993  N NH1   . ARG A 1 254 ? 26.113  26.709  -23.605 1.00 29.80 ? 254 ARG A NH1   1 
ATOM   1994  N NH2   . ARG A 1 254 ? 24.796  28.682  -23.761 1.00 38.94 ? 254 ARG A NH2   1 
ATOM   1995  N N     . VAL A 1 255 ? 25.840  24.337  -17.387 1.00 34.42 ? 255 VAL A N     1 
ATOM   1996  C CA    . VAL A 1 255 ? 26.900  23.886  -16.485 1.00 35.42 ? 255 VAL A CA    1 
ATOM   1997  C C     . VAL A 1 255 ? 26.408  22.709  -15.630 1.00 34.20 ? 255 VAL A C     1 
ATOM   1998  O O     . VAL A 1 255 ? 25.382  22.816  -14.958 1.00 33.16 ? 255 VAL A O     1 
ATOM   1999  C CB    . VAL A 1 255 ? 27.393  25.073  -15.571 1.00 34.13 ? 255 VAL A CB    1 
ATOM   2000  C CG1   . VAL A 1 255 ? 28.180  24.578  -14.408 1.00 38.63 ? 255 VAL A CG1   1 
ATOM   2001  C CG2   . VAL A 1 255 ? 28.253  26.059  -16.389 1.00 37.75 ? 255 VAL A CG2   1 
ATOM   2002  N N     . ILE A 1 256 ? 27.147  21.602  -15.636 1.00 33.60 ? 256 ILE A N     1 
ATOM   2003  C CA    . ILE A 1 256 ? 26.842  20.514  -14.706 1.00 32.28 ? 256 ILE A CA    1 
ATOM   2004  C C     . ILE A 1 256 ? 28.025  20.538  -13.776 1.00 31.44 ? 256 ILE A C     1 
ATOM   2005  O O     . ILE A 1 256 ? 29.156  20.481  -14.273 1.00 31.15 ? 256 ILE A O     1 
ATOM   2006  C CB    . ILE A 1 256 ? 26.987  19.165  -15.384 1.00 32.74 ? 256 ILE A CB    1 
ATOM   2007  C CG1   . ILE A 1 256 ? 26.147  19.058  -16.625 1.00 34.06 ? 256 ILE A CG1   1 
ATOM   2008  C CG2   . ILE A 1 256 ? 26.854  17.969  -14.391 1.00 28.28 ? 256 ILE A CG2   1 
ATOM   2009  C CD1   . ILE A 1 256 ? 27.084  18.679  -17.761 1.00 34.18 ? 256 ILE A CD1   1 
ATOM   2010  N N     . ARG A 1 257 ? 27.775  20.530  -12.472 1.00 28.93 ? 257 ARG A N     1 
ATOM   2011  C CA    . ARG A 1 257 ? 28.799  20.626  -11.452 1.00 28.69 ? 257 ARG A CA    1 
ATOM   2012  C C     . ARG A 1 257 ? 28.825  19.391  -10.595 1.00 30.21 ? 257 ARG A C     1 
ATOM   2013  O O     . ARG A 1 257 ? 27.802  19.044  -9.987  1.00 29.50 ? 257 ARG A O     1 
ATOM   2014  C CB    . ARG A 1 257 ? 28.483  21.809  -10.485 1.00 29.17 ? 257 ARG A CB    1 
ATOM   2015  C CG    . ARG A 1 257 ? 29.457  21.893  -9.333  1.00 26.36 ? 257 ARG A CG    1 
ATOM   2016  C CD    . ARG A 1 257 ? 29.076  22.965  -8.408  1.00 32.47 ? 257 ARG A CD    1 
ATOM   2017  N NE    . ARG A 1 257 ? 29.993  22.990  -7.315  1.00 31.17 ? 257 ARG A NE    1 
ATOM   2018  C CZ    . ARG A 1 257 ? 31.190  23.552  -7.292  1.00 34.96 ? 257 ARG A CZ    1 
ATOM   2019  N NH1   . ARG A 1 257 ? 31.713  24.195  -8.350  1.00 36.84 ? 257 ARG A NH1   1 
ATOM   2020  N NH2   . ARG A 1 257 ? 31.893  23.390  -6.168  1.00 36.99 ? 257 ARG A NH2   1 
ATOM   2021  N N     . ALA A 1 258 ? 30.013  18.772  -10.524 1.00 30.62 ? 258 ALA A N     1 
ATOM   2022  C CA    . ALA A 1 258 ? 30.304  17.670  -9.609  1.00 28.60 ? 258 ALA A CA    1 
ATOM   2023  C C     . ALA A 1 258 ? 31.015  18.211  -8.364  1.00 28.09 ? 258 ALA A C     1 
ATOM   2024  O O     . ALA A 1 258 ? 32.084  18.830  -8.445  1.00 25.23 ? 258 ALA A O     1 
ATOM   2025  C CB    . ALA A 1 258 ? 31.109  16.615  -10.280 1.00 27.33 ? 258 ALA A CB    1 
ATOM   2026  N N     . ASP A 1 259 ? 30.319  18.023  -7.230  1.00 28.41 ? 259 ASP A N     1 
ATOM   2027  C CA    . ASP A 1 259 ? 30.885  18.061  -5.911  1.00 28.93 ? 259 ASP A CA    1 
ATOM   2028  C C     . ASP A 1 259 ? 31.207  16.737  -5.196  1.00 28.67 ? 259 ASP A C     1 
ATOM   2029  O O     . ASP A 1 259 ? 30.469  15.735  -5.276  1.00 28.17 ? 259 ASP A O     1 
ATOM   2030  C CB    . ASP A 1 259 ? 29.902  18.768  -5.061  1.00 30.24 ? 259 ASP A CB    1 
ATOM   2031  C CG    . ASP A 1 259 ? 29.945  20.270  -5.254  1.00 33.18 ? 259 ASP A CG    1 
ATOM   2032  O OD1   . ASP A 1 259 ? 30.899  20.928  -4.713  1.00 37.49 ? 259 ASP A OD1   1 
ATOM   2033  O OD2   . ASP A 1 259 ? 29.019  20.768  -5.928  1.00 31.70 ? 259 ASP A OD2   1 
ATOM   2034  N N     . SER A 1 260 ? 32.280  16.786  -4.397  1.00 29.93 ? 260 SER A N     1 
ATOM   2035  C CA    . SER A 1 260 ? 32.770  15.627  -3.670  1.00 30.60 ? 260 SER A CA    1 
ATOM   2036  C C     . SER A 1 260 ? 32.874  15.852  -2.103  1.00 29.64 ? 260 SER A C     1 
ATOM   2037  O O     . SER A 1 260 ? 33.387  16.898  -1.626  1.00 29.48 ? 260 SER A O     1 
ATOM   2038  C CB    . SER A 1 260 ? 34.072  15.138  -4.354  1.00 29.24 ? 260 SER A CB    1 
ATOM   2039  O OG    . SER A 1 260 ? 34.542  13.958  -3.705  1.00 36.77 ? 260 SER A OG    1 
ATOM   2040  N N     . PHE A 1 261 ? 32.384  14.881  -1.338  1.00 29.26 ? 261 PHE A N     1 
ATOM   2041  C CA    . PHE A 1 261 ? 32.550  14.789  0.139   1.00 30.26 ? 261 PHE A CA    1 
ATOM   2042  C C     . PHE A 1 261 ? 33.823  14.067  0.608   1.00 30.13 ? 261 PHE A C     1 
ATOM   2043  O O     . PHE A 1 261 ? 34.079  13.980  1.843   1.00 28.96 ? 261 PHE A O     1 
ATOM   2044  C CB    . PHE A 1 261 ? 31.333  14.149  0.814   1.00 31.84 ? 261 PHE A CB    1 
ATOM   2045  C CG    . PHE A 1 261 ? 30.268  15.140  1.201   1.00 34.33 ? 261 PHE A CG    1 
ATOM   2046  C CD1   . PHE A 1 261 ? 30.593  16.493  1.406   1.00 41.13 ? 261 PHE A CD1   1 
ATOM   2047  C CD2   . PHE A 1 261 ? 28.951  14.757  1.284   1.00 36.82 ? 261 PHE A CD2   1 
ATOM   2048  C CE1   . PHE A 1 261 ? 29.600  17.452  1.744   1.00 39.02 ? 261 PHE A CE1   1 
ATOM   2049  C CE2   . PHE A 1 261 ? 27.979  15.681  1.606   1.00 38.67 ? 261 PHE A CE2   1 
ATOM   2050  C CZ    . PHE A 1 261 ? 28.313  17.030  1.858   1.00 38.62 ? 261 PHE A CZ    1 
ATOM   2051  N N     . SER A 1 262 ? 34.660  13.682  -0.373  1.00 30.03 ? 262 SER A N     1 
ATOM   2052  C CA    . SER A 1 262 ? 35.643  12.591  -0.205  1.00 31.18 ? 262 SER A CA    1 
ATOM   2053  C C     . SER A 1 262 ? 36.883  13.082  0.485   1.00 31.66 ? 262 SER A C     1 
ATOM   2054  O O     . SER A 1 262 ? 37.630  12.242  1.099   1.00 31.04 ? 262 SER A O     1 
ATOM   2055  C CB    . SER A 1 262 ? 36.057  11.979  -1.570  1.00 28.40 ? 262 SER A CB    1 
ATOM   2056  O OG    . SER A 1 262 ? 34.895  11.383  -2.139  1.00 32.45 ? 262 SER A OG    1 
HETATM 2057  N N1    . LLP A 1 263 ? 38.194  13.723  -9.260  1.00 36.07 ? 263 LLP A N1    1 
HETATM 2058  C C2    . LLP A 1 263 ? 39.516  14.024  -8.969  1.00 36.64 ? 263 LLP A C2    1 
HETATM 2059  C "C2'" . LLP A 1 263 ? 40.428  14.538  -10.065 1.00 34.50 ? 263 LLP A "C2'" 1 
HETATM 2060  C C3    . LLP A 1 263 ? 40.027  13.807  -7.686  1.00 31.45 ? 263 LLP A C3    1 
HETATM 2061  O O3    . LLP A 1 263 ? 41.241  14.013  -7.437  1.00 34.94 ? 263 LLP A O3    1 
HETATM 2062  C C4    . LLP A 1 263 ? 39.169  13.375  -6.694  1.00 34.15 ? 263 LLP A C4    1 
HETATM 2063  C "C4'" . LLP A 1 263 ? 39.730  13.174  -5.311  1.00 35.45 ? 263 LLP A "C4'" 1 
HETATM 2064  C C5    . LLP A 1 263 ? 37.803  13.128  -6.959  1.00 35.00 ? 263 LLP A C5    1 
HETATM 2065  C C6    . LLP A 1 263 ? 37.323  13.309  -8.246  1.00 34.31 ? 263 LLP A C6    1 
HETATM 2066  C "C5'" . LLP A 1 263 ? 36.862  12.590  -5.905  1.00 34.25 ? 263 LLP A "C5'" 1 
HETATM 2067  O OP4   . LLP A 1 263 ? 35.914  11.617  -6.446  1.00 33.33 ? 263 LLP A OP4   1 
HETATM 2068  P P     . LLP A 1 263 ? 34.923  10.780  -5.541  1.00 29.22 ? 263 LLP A P     1 
HETATM 2069  O OP1   . LLP A 1 263 ? 35.925  10.213  -4.635  1.00 30.19 ? 263 LLP A OP1   1 
HETATM 2070  O OP2   . LLP A 1 263 ? 34.013  11.873  -5.017  1.00 23.34 ? 263 LLP A OP2   1 
HETATM 2071  O OP3   . LLP A 1 263 ? 34.201  9.857   -6.464  1.00 31.26 ? 263 LLP A OP3   1 
HETATM 2072  N N     . LLP A 1 263 ? 37.153  14.398  0.280   1.00 30.43 ? 263 LLP A N     1 
HETATM 2073  C CA    . LLP A 1 263 ? 38.296  15.044  0.917   1.00 31.56 ? 263 LLP A CA    1 
HETATM 2074  C CB    . LLP A 1 263 ? 39.019  16.003  -0.022  1.00 32.21 ? 263 LLP A CB    1 
HETATM 2075  C CG    . LLP A 1 263 ? 39.846  15.251  -1.127  1.00 34.60 ? 263 LLP A CG    1 
HETATM 2076  C CD    . LLP A 1 263 ? 38.957  14.797  -2.259  1.00 24.29 ? 263 LLP A CD    1 
HETATM 2077  C CE    . LLP A 1 263 ? 39.683  13.911  -3.144  1.00 36.07 ? 263 LLP A CE    1 
HETATM 2078  N NZ    . LLP A 1 263 ? 38.914  13.722  -4.430  1.00 33.25 ? 263 LLP A NZ    1 
HETATM 2079  C C     . LLP A 1 263 ? 37.942  15.716  2.243   1.00 32.80 ? 263 LLP A C     1 
HETATM 2080  O O     . LLP A 1 263 ? 38.847  15.917  3.062   1.00 34.42 ? 263 LLP A O     1 
ATOM   2081  N N     . ILE A 1 264 ? 36.637  15.966  2.479   1.00 33.03 ? 264 ILE A N     1 
ATOM   2082  C CA    . ILE A 1 264 ? 36.140  16.594  3.685   1.00 34.09 ? 264 ILE A CA    1 
ATOM   2083  C C     . ILE A 1 264 ? 35.282  15.810  4.668   1.00 33.50 ? 264 ILE A C     1 
ATOM   2084  O O     . ILE A 1 264 ? 35.292  16.142  5.860   1.00 33.66 ? 264 ILE A O     1 
ATOM   2085  C CB    . ILE A 1 264 ? 35.527  17.930  3.372   1.00 35.47 ? 264 ILE A CB    1 
ATOM   2086  C CG1   . ILE A 1 264 ? 34.711  17.793  2.059   1.00 37.69 ? 264 ILE A CG1   1 
ATOM   2087  C CG2   . ILE A 1 264 ? 36.707  18.933  3.178   1.00 34.21 ? 264 ILE A CG2   1 
ATOM   2088  C CD1   . ILE A 1 264 ? 33.425  18.705  1.989   1.00 35.67 ? 264 ILE A CD1   1 
ATOM   2089  N N     . ILE A 1 265 ? 34.620  14.740  4.212   1.00 33.19 ? 265 ILE A N     1 
ATOM   2090  C CA    . ILE A 1 265 ? 33.731  13.976  5.069   1.00 32.70 ? 265 ILE A CA    1 
ATOM   2091  C C     . ILE A 1 265 ? 34.055  12.485  5.049   1.00 32.42 ? 265 ILE A C     1 
ATOM   2092  O O     . ILE A 1 265 ? 34.257  11.905  6.123   1.00 31.74 ? 265 ILE A O     1 
ATOM   2093  C CB    . ILE A 1 265 ? 32.189  14.353  4.797   1.00 34.73 ? 265 ILE A CB    1 
ATOM   2094  C CG1   . ILE A 1 265 ? 31.849  15.730  5.407   1.00 34.30 ? 265 ILE A CG1   1 
ATOM   2095  C CG2   . ILE A 1 265 ? 31.162  13.325  5.374   1.00 32.65 ? 265 ILE A CG2   1 
ATOM   2096  C CD1   . ILE A 1 265 ? 30.777  16.333  4.718   1.00 36.61 ? 265 ILE A CD1   1 
ATOM   2097  N N     . SER A 1 266 ? 34.129  11.868  3.848   1.00 31.65 ? 266 SER A N     1 
ATOM   2098  C CA    . SER A 1 266 ? 34.557  10.451  3.714   1.00 31.99 ? 266 SER A CA    1 
ATOM   2099  C C     . SER A 1 266 ? 34.725  9.942   2.310   1.00 30.93 ? 266 SER A C     1 
ATOM   2100  O O     . SER A 1 266 ? 33.771  9.966   1.553   1.00 32.27 ? 266 SER A O     1 
ATOM   2101  C CB    . SER A 1 266 ? 33.566  9.468   4.388   1.00 31.29 ? 266 SER A CB    1 
ATOM   2102  O OG    . SER A 1 266 ? 33.967  8.140   3.966   1.00 32.85 ? 266 SER A OG    1 
ATOM   2103  N N     . SER A 1 267 ? 35.880  9.386   1.988   1.00 30.26 ? 267 SER A N     1 
ATOM   2104  C CA    . SER A 1 267 ? 36.035  8.761   0.652   1.00 30.27 ? 267 SER A CA    1 
ATOM   2105  C C     . SER A 1 267 ? 35.225  7.455   0.530   1.00 31.17 ? 267 SER A C     1 
ATOM   2106  O O     . SER A 1 267 ? 34.624  7.177   -0.518  1.00 29.80 ? 267 SER A O     1 
ATOM   2107  C CB    . SER A 1 267 ? 37.476  8.480   0.298   1.00 28.63 ? 267 SER A CB    1 
ATOM   2108  O OG    . SER A 1 267 ? 38.351  8.757   1.363   1.00 28.31 ? 267 SER A OG    1 
ATOM   2109  N N     . GLY A 1 268 ? 35.204  6.698   1.634   1.00 31.38 ? 268 GLY A N     1 
ATOM   2110  C CA    . GLY A 1 268 ? 34.815  5.285   1.640   1.00 30.43 ? 268 GLY A CA    1 
ATOM   2111  C C     . GLY A 1 268 ? 33.343  5.116   1.647   1.00 30.37 ? 268 GLY A C     1 
ATOM   2112  O O     . GLY A 1 268 ? 32.859  4.077   1.224   1.00 33.52 ? 268 GLY A O     1 
ATOM   2113  N N     . LEU A 1 269 ? 32.637  6.168   2.076   1.00 29.73 ? 269 LEU A N     1 
ATOM   2114  C CA    . LEU A 1 269 ? 31.174  6.250   2.115   1.00 27.44 ? 269 LEU A CA    1 
ATOM   2115  C C     . LEU A 1 269 ? 30.492  6.380   0.757   1.00 26.47 ? 269 LEU A C     1 
ATOM   2116  O O     . LEU A 1 269 ? 29.304  6.079   0.676   1.00 28.77 ? 269 LEU A O     1 
ATOM   2117  C CB    . LEU A 1 269 ? 30.626  7.345   3.106   1.00 24.56 ? 269 LEU A CB    1 
ATOM   2118  C CG    . LEU A 1 269 ? 30.797  7.208   4.643   1.00 28.94 ? 269 LEU A CG    1 
ATOM   2119  C CD1   . LEU A 1 269 ? 29.983  8.307   5.491   1.00 24.16 ? 269 LEU A CD1   1 
ATOM   2120  C CD2   . LEU A 1 269 ? 30.449  5.805   5.205   1.00 20.20 ? 269 LEU A CD2   1 
ATOM   2121  N N     . ARG A 1 270 ? 31.181  6.861   -0.281  1.00 26.67 ? 270 ARG A N     1 
ATOM   2122  C CA    . ARG A 1 270 ? 30.633  6.923   -1.661  1.00 23.63 ? 270 ARG A CA    1 
ATOM   2123  C C     . ARG A 1 270 ? 29.382  7.823   -1.691  1.00 26.00 ? 270 ARG A C     1 
ATOM   2124  O O     . ARG A 1 270 ? 28.256  7.355   -1.915  1.00 27.92 ? 270 ARG A O     1 
ATOM   2125  C CB    . ARG A 1 270 ? 30.301  5.459   -2.139  1.00 23.10 ? 270 ARG A CB    1 
ATOM   2126  C CG    . ARG A 1 270 ? 31.547  4.398   -2.056  1.00 14.55 ? 270 ARG A CG    1 
ATOM   2127  C CD    . ARG A 1 270 ? 32.919  5.058   -2.276  1.00 25.90 ? 270 ARG A CD    1 
ATOM   2128  N NE    . ARG A 1 270 ? 32.992  5.517   -3.681  1.00 35.84 ? 270 ARG A NE    1 
ATOM   2129  C CZ    . ARG A 1 270 ? 33.519  6.660   -4.148  1.00 33.44 ? 270 ARG A CZ    1 
ATOM   2130  N NH1   . ARG A 1 270 ? 34.087  7.555   -3.377  1.00 30.04 ? 270 ARG A NH1   1 
ATOM   2131  N NH2   . ARG A 1 270 ? 33.448  6.910   -5.453  1.00 35.05 ? 270 ARG A NH2   1 
ATOM   2132  N N     . ILE A 1 271 ? 29.562  9.115   -1.422  1.00 26.81 ? 271 ILE A N     1 
ATOM   2133  C CA    . ILE A 1 271 ? 28.471  10.093  -1.375  1.00 27.11 ? 271 ILE A CA    1 
ATOM   2134  C C     . ILE A 1 271 ? 29.113  11.356  -1.925  1.00 29.23 ? 271 ILE A C     1 
ATOM   2135  O O     . ILE A 1 271 ? 30.140  11.916  -1.380  1.00 31.31 ? 271 ILE A O     1 
ATOM   2136  C CB    . ILE A 1 271 ? 27.911  10.297  0.139   1.00 28.01 ? 271 ILE A CB    1 
ATOM   2137  C CG1   . ILE A 1 271 ? 27.488  8.970   0.814   1.00 29.03 ? 271 ILE A CG1   1 
ATOM   2138  C CG2   . ILE A 1 271 ? 26.650  11.189  0.221   1.00 24.57 ? 271 ILE A CG2   1 
ATOM   2139  C CD1   . ILE A 1 271 ? 26.118  8.283   0.258   1.00 24.92 ? 271 ILE A CD1   1 
ATOM   2140  N N     . GLY A 1 272 ? 28.625  11.751  -3.086  1.00 29.24 ? 272 GLY A N     1 
ATOM   2141  C CA    . GLY A 1 272 ? 29.138  12.935  -3.766  1.00 26.98 ? 272 GLY A CA    1 
ATOM   2142  C C     . GLY A 1 272 ? 27.910  13.573  -4.377  1.00 26.26 ? 272 GLY A C     1 
ATOM   2143  O O     . GLY A 1 272 ? 26.792  13.152  -4.021  1.00 25.54 ? 272 GLY A O     1 
ATOM   2144  N N     . PHE A 1 273 ? 28.019  14.633  -5.204  1.00 26.65 ? 273 PHE A N     1 
ATOM   2145  C CA    . PHE A 1 273 ? 26.704  15.095  -5.735  1.00 27.29 ? 273 PHE A CA    1 
ATOM   2146  C C     . PHE A 1 273 ? 26.825  15.789  -6.985  1.00 28.51 ? 273 PHE A C     1 
ATOM   2147  O O     . PHE A 1 273 ? 27.852  16.427  -7.185  1.00 29.71 ? 273 PHE A O     1 
ATOM   2148  C CB    . PHE A 1 273 ? 25.778  15.851  -4.726  1.00 25.77 ? 273 PHE A CB    1 
ATOM   2149  C CG    . PHE A 1 273 ? 26.474  17.007  -3.964  1.00 30.47 ? 273 PHE A CG    1 
ATOM   2150  C CD1   . PHE A 1 273 ? 27.307  16.746  -2.826  1.00 31.01 ? 273 PHE A CD1   1 
ATOM   2151  C CD2   . PHE A 1 273 ? 26.252  18.296  -4.324  1.00 26.56 ? 273 PHE A CD2   1 
ATOM   2152  C CE1   . PHE A 1 273 ? 27.942  17.771  -2.115  1.00 26.57 ? 273 PHE A CE1   1 
ATOM   2153  C CE2   . PHE A 1 273 ? 26.864  19.340  -3.617  1.00 32.72 ? 273 PHE A CE2   1 
ATOM   2154  C CZ    . PHE A 1 273 ? 27.714  19.066  -2.495  1.00 30.83 ? 273 PHE A CZ    1 
ATOM   2155  N N     . LEU A 1 274 ? 25.751  15.728  -7.808  1.00 29.26 ? 274 LEU A N     1 
ATOM   2156  C CA    . LEU A 1 274 ? 25.785  16.306  -9.125  1.00 28.97 ? 274 LEU A CA    1 
ATOM   2157  C C     . LEU A 1 274 ? 24.771  17.463  -9.263  1.00 29.26 ? 274 LEU A C     1 
ATOM   2158  O O     . LEU A 1 274 ? 23.587  17.295  -8.889  1.00 26.92 ? 274 LEU A O     1 
ATOM   2159  C CB    . LEU A 1 274 ? 25.611  15.211  -10.179 1.00 28.43 ? 274 LEU A CB    1 
ATOM   2160  C CG    . LEU A 1 274 ? 26.038  15.597  -11.626 1.00 30.09 ? 274 LEU A CG    1 
ATOM   2161  C CD1   . LEU A 1 274 ? 27.589  15.610  -11.926 1.00 21.91 ? 274 LEU A CD1   1 
ATOM   2162  C CD2   . LEU A 1 274 ? 25.293  14.622  -12.595 1.00 31.05 ? 274 LEU A CD2   1 
ATOM   2163  N N     . THR A 1 275 ? 25.260  18.650  -9.727  1.00 30.15 ? 275 THR A N     1 
ATOM   2164  C CA    . THR A 1 275 ? 24.349  19.857  -9.939  1.00 30.97 ? 275 THR A CA    1 
ATOM   2165  C C     . THR A 1 275 ? 24.189  20.309  -11.359 1.00 31.26 ? 275 THR A C     1 
ATOM   2166  O O     . THR A 1 275 ? 25.128  20.591  -12.048 1.00 32.70 ? 275 THR A O     1 
ATOM   2167  C CB    . THR A 1 275 ? 24.678  21.036  -8.985  1.00 32.48 ? 275 THR A CB    1 
ATOM   2168  O OG1   . THR A 1 275 ? 24.851  20.478  -7.658  1.00 30.26 ? 275 THR A OG1   1 
ATOM   2169  C CG2   . THR A 1 275 ? 23.508  22.112  -9.023  1.00 28.48 ? 275 THR A CG2   1 
ATOM   2170  N N     . GLY A 1 276 ? 22.976  20.377  -11.843 1.00 32.75 ? 276 GLY A N     1 
ATOM   2171  C CA    . GLY A 1 276 ? 22.865  20.805  -13.201 1.00 32.27 ? 276 GLY A CA    1 
ATOM   2172  C C     . GLY A 1 276 ? 21.467  21.113  -13.620 1.00 32.50 ? 276 GLY A C     1 
ATOM   2173  O O     . GLY A 1 276 ? 20.556  21.010  -12.812 1.00 33.52 ? 276 GLY A O     1 
ATOM   2174  N N     . PRO A 1 277 ? 21.306  21.451  -14.913 1.00 32.67 ? 277 PRO A N     1 
ATOM   2175  C CA    . PRO A 1 277 ? 20.058  21.671  -15.571 1.00 33.26 ? 277 PRO A CA    1 
ATOM   2176  C C     . PRO A 1 277 ? 19.222  20.410  -15.408 1.00 34.12 ? 277 PRO A C     1 
ATOM   2177  O O     . PRO A 1 277 ? 19.641  19.311  -15.749 1.00 33.69 ? 277 PRO A O     1 
ATOM   2178  C CB    . PRO A 1 277 ? 20.469  21.822  -17.063 1.00 34.06 ? 277 PRO A CB    1 
ATOM   2179  C CG    . PRO A 1 277 ? 21.851  22.107  -17.051 1.00 33.12 ? 277 PRO A CG    1 
ATOM   2180  C CD    . PRO A 1 277 ? 22.448  21.526  -15.863 1.00 31.80 ? 277 PRO A CD    1 
ATOM   2181  N N     . LYS A 1 278 ? 18.016  20.612  -14.931 1.00 35.31 ? 278 LYS A N     1 
ATOM   2182  C CA    . LYS A 1 278 ? 17.065  19.560  -14.630 1.00 35.12 ? 278 LYS A CA    1 
ATOM   2183  C C     . LYS A 1 278 ? 16.923  18.354  -15.654 1.00 34.96 ? 278 LYS A C     1 
ATOM   2184  O O     . LYS A 1 278 ? 16.849  17.202  -15.223 1.00 34.75 ? 278 LYS A O     1 
ATOM   2185  C CB    . LYS A 1 278 ? 15.726  20.238  -14.249 1.00 34.66 ? 278 LYS A CB    1 
ATOM   2186  C CG    . LYS A 1 278 ? 14.778  19.366  -13.458 1.00 34.76 ? 278 LYS A CG    1 
ATOM   2187  C CD    . LYS A 1 278 ? 14.301  20.116  -12.185 1.00 43.21 ? 278 LYS A CD    1 
ATOM   2188  C CE    . LYS A 1 278 ? 13.913  19.102  -11.030 1.00 46.77 ? 278 LYS A CE    1 
ATOM   2189  N NZ    . LYS A 1 278 ? 13.355  17.794  -11.543 1.00 41.36 ? 278 LYS A NZ    1 
ATOM   2190  N N     . PRO A 1 279 ? 16.927  18.594  -16.981 1.00 35.16 ? 279 PRO A N     1 
ATOM   2191  C CA    . PRO A 1 279 ? 16.687  17.354  -17.745 1.00 33.88 ? 279 PRO A CA    1 
ATOM   2192  C C     . PRO A 1 279 ? 17.876  16.479  -18.094 1.00 32.01 ? 279 PRO A C     1 
ATOM   2193  O O     . PRO A 1 279 ? 17.689  15.351  -18.522 1.00 32.30 ? 279 PRO A O     1 
ATOM   2194  C CB    . PRO A 1 279 ? 15.943  17.865  -18.986 1.00 36.28 ? 279 PRO A CB    1 
ATOM   2195  C CG    . PRO A 1 279 ? 15.873  19.488  -18.786 1.00 35.30 ? 279 PRO A CG    1 
ATOM   2196  C CD    . PRO A 1 279 ? 16.985  19.764  -17.876 1.00 34.81 ? 279 PRO A CD    1 
ATOM   2197  N N     . LEU A 1 280 ? 19.092  16.985  -17.920 1.00 30.34 ? 280 LEU A N     1 
ATOM   2198  C CA    . LEU A 1 280 ? 20.289  16.200  -18.021 1.00 28.76 ? 280 LEU A CA    1 
ATOM   2199  C C     . LEU A 1 280 ? 20.500  15.397  -16.724 1.00 29.33 ? 280 LEU A C     1 
ATOM   2200  O O     . LEU A 1 280 ? 20.913  14.234  -16.796 1.00 29.58 ? 280 LEU A O     1 
ATOM   2201  C CB    . LEU A 1 280 ? 21.501  17.097  -18.252 1.00 27.63 ? 280 LEU A CB    1 
ATOM   2202  C CG    . LEU A 1 280 ? 21.372  17.976  -19.515 1.00 32.04 ? 280 LEU A CG    1 
ATOM   2203  C CD1   . LEU A 1 280 ? 22.544  18.978  -19.639 1.00 29.13 ? 280 LEU A CD1   1 
ATOM   2204  C CD2   . LEU A 1 280 ? 21.117  17.212  -20.852 1.00 21.75 ? 280 LEU A CD2   1 
ATOM   2205  N N     . ILE A 1 281 ? 20.291  16.040  -15.555 1.00 27.21 ? 281 ILE A N     1 
ATOM   2206  C CA    . ILE A 1 281 ? 20.338  15.357  -14.311 1.00 28.97 ? 281 ILE A CA    1 
ATOM   2207  C C     . ILE A 1 281 ? 19.300  14.250  -14.375 1.00 30.99 ? 281 ILE A C     1 
ATOM   2208  O O     . ILE A 1 281 ? 19.494  13.199  -13.767 1.00 30.79 ? 281 ILE A O     1 
ATOM   2209  C CB    . ILE A 1 281 ? 20.020  16.320  -13.067 1.00 27.07 ? 281 ILE A CB    1 
ATOM   2210  C CG1   . ILE A 1 281 ? 21.140  17.410  -12.808 1.00 26.97 ? 281 ILE A CG1   1 
ATOM   2211  C CG2   . ILE A 1 281 ? 19.669  15.555  -11.840 1.00 24.90 ? 281 ILE A CG2   1 
ATOM   2212  C CD1   . ILE A 1 281 ? 22.585  16.958  -12.679 1.00 22.61 ? 281 ILE A CD1   1 
ATOM   2213  N N     . GLU A 1 282 ? 18.203  14.471  -15.116 1.00 32.59 ? 282 GLU A N     1 
ATOM   2214  C CA    . GLU A 1 282 ? 17.191  13.402  -15.274 1.00 34.84 ? 282 GLU A CA    1 
ATOM   2215  C C     . GLU A 1 282 ? 17.718  12.186  -15.969 1.00 33.58 ? 282 GLU A C     1 
ATOM   2216  O O     . GLU A 1 282 ? 17.390  11.070  -15.591 1.00 32.44 ? 282 GLU A O     1 
ATOM   2217  C CB    . GLU A 1 282 ? 15.932  13.860  -16.003 1.00 34.36 ? 282 GLU A CB    1 
ATOM   2218  C CG    . GLU A 1 282 ? 14.806  12.772  -16.115 1.00 34.38 ? 282 GLU A CG    1 
ATOM   2219  C CD    . GLU A 1 282 ? 13.579  13.311  -16.855 1.00 40.22 ? 282 GLU A CD    1 
ATOM   2220  O OE1   . GLU A 1 282 ? 13.224  14.500  -16.604 1.00 44.08 ? 282 GLU A OE1   1 
ATOM   2221  O OE2   . GLU A 1 282 ? 13.019  12.578  -17.731 1.00 47.92 ? 282 GLU A OE2   1 
ATOM   2222  N N     . ARG A 1 283 ? 18.490  12.421  -17.024 1.00 33.57 ? 283 ARG A N     1 
ATOM   2223  C CA    . ARG A 1 283 ? 19.147  11.338  -17.783 1.00 31.73 ? 283 ARG A CA    1 
ATOM   2224  C C     . ARG A 1 283 ? 20.126  10.536  -16.904 1.00 30.54 ? 283 ARG A C     1 
ATOM   2225  O O     . ARG A 1 283 ? 20.147  9.283   -16.946 1.00 30.47 ? 283 ARG A O     1 
ATOM   2226  C CB    . ARG A 1 283 ? 19.856  11.895  -19.055 1.00 32.38 ? 283 ARG A CB    1 
ATOM   2227  C CG    . ARG A 1 283 ? 18.933  12.474  -20.259 1.00 27.31 ? 283 ARG A CG    1 
ATOM   2228  C CD    . ARG A 1 283 ? 17.328  12.477  -19.996 1.00 32.37 ? 283 ARG A CD    1 
ATOM   2229  N NE    . ARG A 1 283 ? 16.805  11.270  -20.502 1.00 24.61 ? 283 ARG A NE    1 
ATOM   2230  C CZ    . ARG A 1 283 ? 15.558  10.786  -20.513 1.00 24.18 ? 283 ARG A CZ    1 
ATOM   2231  N NH1   . ARG A 1 283 ? 14.443  11.377  -20.082 1.00 24.63 ? 283 ARG A NH1   1 
ATOM   2232  N NH2   . ARG A 1 283 ? 15.453  9.592   -21.027 1.00 26.43 ? 283 ARG A NH2   1 
ATOM   2233  N N     . VAL A 1 284 ? 20.934  11.231  -16.108 1.00 30.28 ? 284 VAL A N     1 
ATOM   2234  C CA    . VAL A 1 284 ? 21.764  10.505  -15.104 1.00 29.29 ? 284 VAL A CA    1 
ATOM   2235  C C     . VAL A 1 284 ? 20.955  9.844   -14.000 1.00 29.29 ? 284 VAL A C     1 
ATOM   2236  O O     . VAL A 1 284 ? 21.314  8.679   -13.592 1.00 28.05 ? 284 VAL A O     1 
ATOM   2237  C CB    . VAL A 1 284 ? 23.132  11.158  -14.627 1.00 29.73 ? 284 VAL A CB    1 
ATOM   2238  C CG1   . VAL A 1 284 ? 23.318  12.574  -15.036 1.00 29.03 ? 284 VAL A CG1   1 
ATOM   2239  C CG2   . VAL A 1 284 ? 23.415  10.905  -13.118 1.00 28.69 ? 284 VAL A CG2   1 
ATOM   2240  N N     . ILE A 1 285 ? 19.865  10.487  -13.560 1.00 27.23 ? 285 ILE A N     1 
ATOM   2241  C CA    . ILE A 1 285 ? 19.018  9.687   -12.720 1.00 29.38 ? 285 ILE A CA    1 
ATOM   2242  C C     . ILE A 1 285 ? 18.312  8.418   -13.309 1.00 29.66 ? 285 ILE A C     1 
ATOM   2243  O O     . ILE A 1 285 ? 18.161  7.394   -12.536 1.00 27.90 ? 285 ILE A O     1 
ATOM   2244  C CB    . ILE A 1 285 ? 18.220  10.310  -11.399 1.00 29.87 ? 285 ILE A CB    1 
ATOM   2245  C CG1   . ILE A 1 285 ? 17.179  9.257   -10.999 1.00 25.97 ? 285 ILE A CG1   1 
ATOM   2246  C CG2   . ILE A 1 285 ? 17.866  11.913  -11.278 1.00 31.63 ? 285 ILE A CG2   1 
ATOM   2247  C CD1   . ILE A 1 285 ? 15.805  9.689   -10.503 1.00 30.13 ? 285 ILE A CD1   1 
ATOM   2248  N N     . LEU A 1 286 ? 17.890  8.450   -14.578 1.00 27.27 ? 286 LEU A N     1 
ATOM   2249  C CA    . LEU A 1 286 ? 17.294  7.274   -15.141 1.00 28.80 ? 286 LEU A CA    1 
ATOM   2250  C C     . LEU A 1 286 ? 18.297  6.155   -15.224 1.00 29.16 ? 286 LEU A C     1 
ATOM   2251  O O     . LEU A 1 286 ? 17.891  5.025   -15.107 1.00 28.67 ? 286 LEU A O     1 
ATOM   2252  C CB    . LEU A 1 286 ? 16.680  7.488   -16.523 1.00 26.93 ? 286 LEU A CB    1 
ATOM   2253  C CG    . LEU A 1 286 ? 15.486  8.408   -16.531 1.00 27.49 ? 286 LEU A CG    1 
ATOM   2254  C CD1   . LEU A 1 286 ? 14.996  8.652   -18.034 1.00 23.32 ? 286 LEU A CD1   1 
ATOM   2255  C CD2   . LEU A 1 286 ? 14.382  8.160   -15.492 1.00 22.59 ? 286 LEU A CD2   1 
ATOM   2256  N N     . HIS A 1 287 ? 19.566  6.519   -15.498 1.00 29.74 ? 287 HIS A N     1 
ATOM   2257  C CA    . HIS A 1 287 ? 20.716  5.612   -15.506 1.00 30.65 ? 287 HIS A CA    1 
ATOM   2258  C C     . HIS A 1 287 ? 21.054  5.077   -14.104 1.00 30.43 ? 287 HIS A C     1 
ATOM   2259  O O     . HIS A 1 287 ? 21.191  3.824   -13.930 1.00 30.00 ? 287 HIS A O     1 
ATOM   2260  C CB    . HIS A 1 287 ? 21.978  6.250   -16.140 1.00 29.61 ? 287 HIS A CB    1 
ATOM   2261  C CG    . HIS A 1 287 ? 22.980  5.238   -16.581 1.00 30.28 ? 287 HIS A CG    1 
ATOM   2262  N ND1   . HIS A 1 287 ? 24.109  5.554   -17.311 1.00 26.99 ? 287 HIS A ND1   1 
ATOM   2263  C CD2   . HIS A 1 287 ? 22.966  3.879   -16.472 1.00 27.57 ? 287 HIS A CD2   1 
ATOM   2264  C CE1   . HIS A 1 287 ? 24.778  4.446   -17.569 1.00 28.30 ? 287 HIS A CE1   1 
ATOM   2265  N NE2   . HIS A 1 287 ? 24.106  3.422   -17.066 1.00 25.77 ? 287 HIS A NE2   1 
ATOM   2266  N N     . ILE A 1 288 ? 21.189  5.975   -13.109 1.00 29.53 ? 288 ILE A N     1 
ATOM   2267  C CA    . ILE A 1 288 ? 21.392  5.442   -11.776 1.00 29.03 ? 288 ILE A CA    1 
ATOM   2268  C C     . ILE A 1 288 ? 20.323  4.370   -11.450 1.00 29.83 ? 288 ILE A C     1 
ATOM   2269  O O     . ILE A 1 288 ? 20.637  3.297   -10.870 1.00 30.68 ? 288 ILE A O     1 
ATOM   2270  C CB    . ILE A 1 288 ? 21.643  6.456   -10.589 1.00 29.10 ? 288 ILE A CB    1 
ATOM   2271  C CG1   . ILE A 1 288 ? 20.410  6.570   -9.732  1.00 29.32 ? 288 ILE A CG1   1 
ATOM   2272  C CG2   . ILE A 1 288 ? 22.567  7.822   -10.864 1.00 26.66 ? 288 ILE A CG2   1 
ATOM   2273  C CD1   . ILE A 1 288 ? 20.577  5.721   -8.660  1.00 26.72 ? 288 ILE A CD1   1 
ATOM   2274  N N     . GLN A 1 289 ? 19.067  4.673   -11.801 1.00 30.83 ? 289 GLN A N     1 
ATOM   2275  C CA    . GLN A 1 289 ? 17.907  3.821   -11.566 1.00 31.44 ? 289 GLN A CA    1 
ATOM   2276  C C     . GLN A 1 289 ? 17.985  2.353   -12.063 1.00 31.17 ? 289 GLN A C     1 
ATOM   2277  O O     . GLN A 1 289 ? 17.359  1.473   -11.450 1.00 31.07 ? 289 GLN A O     1 
ATOM   2278  C CB    . GLN A 1 289 ? 16.603  4.426   -12.132 1.00 31.44 ? 289 GLN A CB    1 
ATOM   2279  C CG    . GLN A 1 289 ? 15.965  5.624   -11.381 1.00 32.46 ? 289 GLN A CG    1 
ATOM   2280  C CD    . GLN A 1 289 ? 14.544  5.977   -11.955 1.00 33.12 ? 289 GLN A CD    1 
ATOM   2281  O OE1   . GLN A 1 289 ? 14.268  5.794   -13.151 1.00 34.33 ? 289 GLN A OE1   1 
ATOM   2282  N NE2   . GLN A 1 289 ? 13.658  6.460   -11.087 1.00 29.56 ? 289 GLN A NE2   1 
ATOM   2283  N N     . VAL A 1 290 ? 18.661  2.094   -13.192 1.00 30.18 ? 290 VAL A N     1 
ATOM   2284  C CA    . VAL A 1 290 ? 18.812  0.704   -13.660 1.00 27.21 ? 290 VAL A CA    1 
ATOM   2285  C C     . VAL A 1 290 ? 20.144  0.100   -13.223 1.00 27.11 ? 290 VAL A C     1 
ATOM   2286  O O     . VAL A 1 290 ? 20.414  -1.042  -13.496 1.00 24.63 ? 290 VAL A O     1 
ATOM   2287  C CB    . VAL A 1 290 ? 18.652  0.570   -15.164 1.00 27.51 ? 290 VAL A CB    1 
ATOM   2288  C CG1   . VAL A 1 290 ? 17.145  0.683   -15.620 1.00 22.45 ? 290 VAL A CG1   1 
ATOM   2289  C CG2   . VAL A 1 290 ? 19.624  1.494   -15.864 1.00 27.78 ? 290 VAL A CG2   1 
ATOM   2290  N N     . SER A 1 291 ? 20.921  0.867   -12.462 1.00 27.39 ? 291 SER A N     1 
ATOM   2291  C CA    . SER A 1 291 ? 22.330  0.577   -12.116 1.00 30.72 ? 291 SER A CA    1 
ATOM   2292  C C     . SER A 1 291 ? 22.483  0.370   -10.567 1.00 31.08 ? 291 SER A C     1 
ATOM   2293  O O     . SER A 1 291 ? 22.048  -0.686  -10.028 1.00 30.12 ? 291 SER A O     1 
ATOM   2294  C CB    . SER A 1 291 ? 23.234  1.691   -12.619 1.00 30.03 ? 291 SER A CB    1 
ATOM   2295  O OG    . SER A 1 291 ? 24.480  1.118   -12.947 1.00 44.07 ? 291 SER A OG    1 
ATOM   2296  N N     . THR A 1 292 ? 23.111  1.337   -9.865  1.00 30.61 ? 292 THR A N     1 
ATOM   2297  C CA    . THR A 1 292 ? 23.294  1.231   -8.413  1.00 28.42 ? 292 THR A CA    1 
ATOM   2298  C C     . THR A 1 292 ? 21.955  1.353   -7.617  1.00 29.00 ? 292 THR A C     1 
ATOM   2299  O O     . THR A 1 292 ? 21.902  1.061   -6.404  1.00 28.03 ? 292 THR A O     1 
ATOM   2300  C CB    . THR A 1 292 ? 24.206  2.343   -7.888  1.00 29.22 ? 292 THR A CB    1 
ATOM   2301  O OG1   . THR A 1 292 ? 23.919  3.552   -8.587  1.00 26.23 ? 292 THR A OG1   1 
ATOM   2302  C CG2   . THR A 1 292 ? 25.663  1.989   -7.981  1.00 23.05 ? 292 THR A CG2   1 
ATOM   2303  N N     . LEU A 1 293 ? 20.908  1.783   -8.339  1.00 30.01 ? 293 LEU A N     1 
ATOM   2304  C CA    . LEU A 1 293 ? 19.594  2.227   -7.839  1.00 30.27 ? 293 LEU A CA    1 
ATOM   2305  C C     . LEU A 1 293 ? 19.608  3.483   -6.969  1.00 28.69 ? 293 LEU A C     1 
ATOM   2306  O O     . LEU A 1 293 ? 18.754  4.379   -7.123  1.00 25.92 ? 293 LEU A O     1 
ATOM   2307  C CB    . LEU A 1 293 ? 18.717  1.128   -7.196  1.00 31.89 ? 293 LEU A CB    1 
ATOM   2308  C CG    . LEU A 1 293 ? 18.777  -0.353  -7.702  1.00 34.43 ? 293 LEU A CG    1 
ATOM   2309  C CD1   . LEU A 1 293 ? 17.742  -1.053  -6.863  1.00 27.01 ? 293 LEU A CD1   1 
ATOM   2310  C CD2   . LEU A 1 293 ? 18.481  -0.459  -9.216  1.00 32.90 ? 293 LEU A CD2   1 
ATOM   2311  N N     . HIS A 1 294 ? 20.563  3.534   -6.070  1.00 27.32 ? 294 HIS A N     1 
ATOM   2312  C CA    . HIS A 1 294 ? 20.741  4.712   -5.251  1.00 29.74 ? 294 HIS A CA    1 
ATOM   2313  C C     . HIS A 1 294 ? 21.988  4.553   -4.342  1.00 29.17 ? 294 HIS A C     1 
ATOM   2314  O O     . HIS A 1 294 ? 22.616  3.468   -4.316  1.00 28.47 ? 294 HIS A O     1 
ATOM   2315  C CB    . HIS A 1 294 ? 19.489  4.963   -4.390  1.00 29.87 ? 294 HIS A CB    1 
ATOM   2316  C CG    . HIS A 1 294 ? 19.236  3.890   -3.401  1.00 33.24 ? 294 HIS A CG    1 
ATOM   2317  N ND1   . HIS A 1 294 ? 18.326  2.873   -3.622  1.00 33.17 ? 294 HIS A ND1   1 
ATOM   2318  C CD2   . HIS A 1 294 ? 19.821  3.645   -2.207  1.00 29.90 ? 294 HIS A CD2   1 
ATOM   2319  C CE1   . HIS A 1 294 ? 18.336  2.075   -2.568  1.00 35.98 ? 294 HIS A CE1   1 
ATOM   2320  N NE2   . HIS A 1 294 ? 19.229  2.531   -1.697  1.00 34.84 ? 294 HIS A NE2   1 
ATOM   2321  N N     . PRO A 1 295 ? 22.361  5.644   -3.671  1.00 27.72 ? 295 PRO A N     1 
ATOM   2322  C CA    . PRO A 1 295 ? 23.547  5.720   -2.803  1.00 28.72 ? 295 PRO A CA    1 
ATOM   2323  C C     . PRO A 1 295 ? 23.048  5.058   -1.485  1.00 28.69 ? 295 PRO A C     1 
ATOM   2324  O O     . PRO A 1 295 ? 21.846  5.010   -1.308  1.00 25.84 ? 295 PRO A O     1 
ATOM   2325  C CB    . PRO A 1 295 ? 23.740  7.256   -2.609  1.00 28.10 ? 295 PRO A CB    1 
ATOM   2326  C CG    . PRO A 1 295 ? 22.858  7.905   -3.642  1.00 25.73 ? 295 PRO A CG    1 
ATOM   2327  C CD    . PRO A 1 295 ? 21.689  6.965   -3.764  1.00 27.90 ? 295 PRO A CD    1 
ATOM   2328  N N     . SER A 1 296 ? 23.941  4.445   -0.702  1.00 27.95 ? 296 SER A N     1 
ATOM   2329  C CA    . SER A 1 296 ? 23.564  3.657   0.483   1.00 28.01 ? 296 SER A CA    1 
ATOM   2330  C C     . SER A 1 296 ? 22.721  4.547   1.405   1.00 28.58 ? 296 SER A C     1 
ATOM   2331  O O     . SER A 1 296 ? 23.091  5.670   1.727   1.00 28.64 ? 296 SER A O     1 
ATOM   2332  C CB    . SER A 1 296 ? 24.845  3.082   1.132   1.00 27.67 ? 296 SER A CB    1 
ATOM   2333  O OG    . SER A 1 296 ? 24.890  3.202   2.567   1.00 27.03 ? 296 SER A OG    1 
ATOM   2334  N N     . THR A 1 297 ? 21.551  4.068   1.745   1.00 29.16 ? 297 THR A N     1 
ATOM   2335  C CA    . THR A 1 297 ? 20.687  4.815   2.642   1.00 28.93 ? 297 THR A CA    1 
ATOM   2336  C C     . THR A 1 297 ? 21.265  5.031   4.067   1.00 29.02 ? 297 THR A C     1 
ATOM   2337  O O     . THR A 1 297 ? 21.181  6.118   4.572   1.00 28.23 ? 297 THR A O     1 
ATOM   2338  C CB    . THR A 1 297 ? 19.166  4.559   2.398   1.00 28.60 ? 297 THR A CB    1 
ATOM   2339  O OG1   . THR A 1 297 ? 18.322  4.904   3.500   1.00 32.39 ? 297 THR A OG1   1 
ATOM   2340  C CG2   . THR A 1 297 ? 18.874  3.278   1.891   1.00 22.55 ? 297 THR A CG2   1 
ATOM   2341  N N     . PHE A 1 298 ? 21.965  4.019   4.607   1.00 29.25 ? 298 PHE A N     1 
ATOM   2342  C CA    . PHE A 1 298 ? 22.708  4.095   5.814   1.00 29.20 ? 298 PHE A CA    1 
ATOM   2343  C C     . PHE A 1 298 ? 23.691  5.310   5.813   1.00 29.66 ? 298 PHE A C     1 
ATOM   2344  O O     . PHE A 1 298 ? 23.616  6.215   6.691   1.00 28.86 ? 298 PHE A O     1 
ATOM   2345  C CB    . PHE A 1 298 ? 23.341  2.733   6.015   1.00 30.41 ? 298 PHE A CB    1 
ATOM   2346  C CG    . PHE A 1 298 ? 23.871  2.492   7.364   1.00 35.21 ? 298 PHE A CG    1 
ATOM   2347  C CD1   . PHE A 1 298 ? 25.070  3.039   7.766   1.00 37.93 ? 298 PHE A CD1   1 
ATOM   2348  C CD2   . PHE A 1 298 ? 23.160  1.738   8.279   1.00 40.46 ? 298 PHE A CD2   1 
ATOM   2349  C CE1   . PHE A 1 298 ? 25.517  2.842   9.036   1.00 39.07 ? 298 PHE A CE1   1 
ATOM   2350  C CE2   . PHE A 1 298 ? 23.653  1.522   9.548   1.00 37.62 ? 298 PHE A CE2   1 
ATOM   2351  C CZ    . PHE A 1 298 ? 24.814  2.103   9.915   1.00 34.81 ? 298 PHE A CZ    1 
ATOM   2352  N N     . ASN A 1 299 ? 24.577  5.373   4.819   1.00 29.68 ? 299 ASN A N     1 
ATOM   2353  C CA    . ASN A 1 299 ? 25.659  6.364   4.767   1.00 29.04 ? 299 ASN A CA    1 
ATOM   2354  C C     . ASN A 1 299 ? 25.093  7.801   4.551   1.00 29.76 ? 299 ASN A C     1 
ATOM   2355  O O     . ASN A 1 299 ? 25.599  8.725   5.147   1.00 32.72 ? 299 ASN A O     1 
ATOM   2356  C CB    . ASN A 1 299 ? 26.698  5.994   3.691   1.00 26.78 ? 299 ASN A CB    1 
ATOM   2357  C CG    . ASN A 1 299 ? 27.370  4.590   3.919   1.00 30.48 ? 299 ASN A CG    1 
ATOM   2358  O OD1   . ASN A 1 299 ? 28.062  4.037   3.002   1.00 27.19 ? 299 ASN A OD1   1 
ATOM   2359  N ND2   . ASN A 1 299 ? 27.226  4.043   5.126   1.00 15.36 ? 299 ASN A ND2   1 
ATOM   2360  N N     . GLN A 1 300 ? 24.091  7.988   3.677   1.00 29.38 ? 300 GLN A N     1 
ATOM   2361  C CA    . GLN A 1 300 ? 23.343  9.257   3.567   1.00 28.71 ? 300 GLN A CA    1 
ATOM   2362  C C     . GLN A 1 300 ? 22.731  9.721   4.917   1.00 28.45 ? 300 GLN A C     1 
ATOM   2363  O O     . GLN A 1 300 ? 22.822  10.870  5.233   1.00 28.77 ? 300 GLN A O     1 
ATOM   2364  C CB    . GLN A 1 300 ? 22.179  9.170   2.560   1.00 29.40 ? 300 GLN A CB    1 
ATOM   2365  C CG    . GLN A 1 300 ? 22.348  8.538   1.054   1.00 25.51 ? 300 GLN A CG    1 
ATOM   2366  C CD    . GLN A 1 300 ? 21.266  9.071   0.173   1.00 30.74 ? 300 GLN A CD    1 
ATOM   2367  O OE1   . GLN A 1 300 ? 21.113  10.293  0.088   1.00 35.12 ? 300 GLN A OE1   1 
ATOM   2368  N NE2   . GLN A 1 300 ? 20.449  8.199   -0.449  1.00 29.60 ? 300 GLN A NE2   1 
ATOM   2369  N N     . LEU A 1 301 ? 22.090  8.845   5.685   1.00 27.04 ? 301 LEU A N     1 
ATOM   2370  C CA    . LEU A 1 301 ? 21.431  9.185   6.959   1.00 28.11 ? 301 LEU A CA    1 
ATOM   2371  C C     . LEU A 1 301 ? 22.439  9.763   7.942   1.00 28.35 ? 301 LEU A C     1 
ATOM   2372  O O     . LEU A 1 301 ? 22.269  10.903  8.358   1.00 29.12 ? 301 LEU A O     1 
ATOM   2373  C CB    . LEU A 1 301 ? 20.704  7.966   7.537   1.00 27.70 ? 301 LEU A CB    1 
ATOM   2374  C CG    . LEU A 1 301 ? 19.204  7.817   7.646   1.00 30.57 ? 301 LEU A CG    1 
ATOM   2375  C CD1   . LEU A 1 301 ? 18.470  8.990   6.996   1.00 29.23 ? 301 LEU A CD1   1 
ATOM   2376  C CD2   . LEU A 1 301 ? 18.775  6.416   7.162   1.00 32.96 ? 301 LEU A CD2   1 
ATOM   2377  N N     . MET A 1 302 ? 23.531  9.021   8.200   1.00 29.84 ? 302 MET A N     1 
ATOM   2378  C CA    . MET A 1 302 ? 24.792  9.485   8.803   1.00 30.82 ? 302 MET A CA    1 
ATOM   2379  C C     . MET A 1 302 ? 25.271  10.859  8.378   1.00 31.52 ? 302 MET A C     1 
ATOM   2380  O O     . MET A 1 302 ? 25.421  11.776  9.192   1.00 31.77 ? 302 MET A O     1 
ATOM   2381  C CB    . MET A 1 302 ? 25.928  8.499   8.466   1.00 30.12 ? 302 MET A CB    1 
ATOM   2382  C CG    . MET A 1 302 ? 25.904  7.124   9.241   1.00 30.92 ? 302 MET A CG    1 
ATOM   2383  S SD    . MET A 1 302 ? 27.401  6.166   8.716   1.00 34.90 ? 302 MET A SD    1 
ATOM   2384  C CE    . MET A 1 302 ? 28.764  7.162   9.280   1.00 35.76 ? 302 MET A CE    1 
ATOM   2385  N N     . ILE A 1 303 ? 25.610  11.008  7.103   1.00 31.70 ? 303 ILE A N     1 
ATOM   2386  C CA    . ILE A 1 303 ? 26.007  12.321  6.637   1.00 31.73 ? 303 ILE A CA    1 
ATOM   2387  C C     . ILE A 1 303 ? 24.896  13.374  6.853   1.00 32.98 ? 303 ILE A C     1 
ATOM   2388  O O     . ILE A 1 303 ? 25.167  14.416  7.371   1.00 33.39 ? 303 ILE A O     1 
ATOM   2389  C CB    . ILE A 1 303 ? 26.484  12.271  5.163   1.00 32.40 ? 303 ILE A CB    1 
ATOM   2390  C CG1   . ILE A 1 303 ? 27.851  11.577  5.109   1.00 30.34 ? 303 ILE A CG1   1 
ATOM   2391  C CG2   . ILE A 1 303 ? 26.554  13.717  4.550   1.00 27.55 ? 303 ILE A CG2   1 
ATOM   2392  C CD1   . ILE A 1 303 ? 28.200  11.020  3.670   1.00 31.65 ? 303 ILE A CD1   1 
ATOM   2393  N N     . SER A 1 304 ? 23.641  13.080  6.515   1.00 34.16 ? 304 SER A N     1 
ATOM   2394  C CA    . SER A 1 304 ? 22.545  14.089  6.621   1.00 34.61 ? 304 SER A CA    1 
ATOM   2395  C C     . SER A 1 304 ? 22.345  14.542  8.076   1.00 35.08 ? 304 SER A C     1 
ATOM   2396  O O     . SER A 1 304 ? 22.073  15.731  8.381   1.00 36.09 ? 304 SER A O     1 
ATOM   2397  C CB    . SER A 1 304 ? 21.240  13.516  6.051   1.00 34.49 ? 304 SER A CB    1 
ATOM   2398  O OG    . SER A 1 304 ? 20.222  14.499  5.810   1.00 35.79 ? 304 SER A OG    1 
ATOM   2399  N N     . GLN A 1 305 ? 22.496  13.605  8.993   1.00 35.87 ? 305 GLN A N     1 
ATOM   2400  C CA    . GLN A 1 305 ? 22.320  13.919  10.412  1.00 35.84 ? 305 GLN A CA    1 
ATOM   2401  C C     . GLN A 1 305 ? 23.515  14.562  10.988  1.00 36.12 ? 305 GLN A C     1 
ATOM   2402  O O     . GLN A 1 305 ? 23.380  15.328  11.915  1.00 36.93 ? 305 GLN A O     1 
ATOM   2403  C CB    . GLN A 1 305 ? 21.961  12.718  11.207  1.00 35.32 ? 305 GLN A CB    1 
ATOM   2404  C CG    . GLN A 1 305 ? 20.583  12.269  10.737  1.00 38.73 ? 305 GLN A CG    1 
ATOM   2405  C CD    . GLN A 1 305 ? 20.187  10.957  11.312  1.00 38.94 ? 305 GLN A CD    1 
ATOM   2406  O OE1   . GLN A 1 305 ? 19.337  10.249  10.774  1.00 40.99 ? 305 GLN A OE1   1 
ATOM   2407  N NE2   . GLN A 1 305 ? 20.760  10.648  12.462  1.00 40.64 ? 305 GLN A NE2   1 
ATOM   2408  N N     . LEU A 1 306 ? 24.676  14.290  10.412  1.00 36.63 ? 306 LEU A N     1 
ATOM   2409  C CA    . LEU A 1 306 ? 25.864  15.066  10.728  1.00 36.86 ? 306 LEU A CA    1 
ATOM   2410  C C     . LEU A 1 306 ? 25.634  16.475  10.289  1.00 36.45 ? 306 LEU A C     1 
ATOM   2411  O O     . LEU A 1 306 ? 25.966  17.400  10.998  1.00 37.31 ? 306 LEU A O     1 
ATOM   2412  C CB    . LEU A 1 306 ? 27.128  14.508  10.043  1.00 36.16 ? 306 LEU A CB    1 
ATOM   2413  C CG    . LEU A 1 306 ? 28.469  15.280  10.178  1.00 36.96 ? 306 LEU A CG    1 
ATOM   2414  C CD1   . LEU A 1 306 ? 29.106  15.269  11.556  1.00 36.84 ? 306 LEU A CD1   1 
ATOM   2415  C CD2   . LEU A 1 306 ? 29.462  14.701  9.221   1.00 36.97 ? 306 LEU A CD2   1 
ATOM   2416  N N     . LEU A 1 307 ? 25.068  16.625  9.117   1.00 35.68 ? 307 LEU A N     1 
ATOM   2417  C CA    . LEU A 1 307 ? 25.075  17.908  8.444   1.00 36.50 ? 307 LEU A CA    1 
ATOM   2418  C C     . LEU A 1 307 ? 24.036  18.855  9.064   1.00 36.08 ? 307 LEU A C     1 
ATOM   2419  O O     . LEU A 1 307 ? 24.336  19.994  9.363   1.00 35.21 ? 307 LEU A O     1 
ATOM   2420  C CB    . LEU A 1 307 ? 24.883  17.747  6.906   1.00 36.61 ? 307 LEU A CB    1 
ATOM   2421  C CG    . LEU A 1 307 ? 25.990  18.067  5.861   1.00 36.74 ? 307 LEU A CG    1 
ATOM   2422  C CD1   . LEU A 1 307 ? 27.499  18.022  6.223   1.00 29.35 ? 307 LEU A CD1   1 
ATOM   2423  C CD2   . LEU A 1 307 ? 25.720  17.361  4.560   1.00 34.22 ? 307 LEU A CD2   1 
ATOM   2424  N N     . HIS A 1 308 ? 22.828  18.349  9.226   1.00 36.39 ? 308 HIS A N     1 
ATOM   2425  C CA    . HIS A 1 308 ? 21.786  19.006  10.039  1.00 36.54 ? 308 HIS A CA    1 
ATOM   2426  C C     . HIS A 1 308 ? 22.123  19.367  11.469  1.00 36.66 ? 308 HIS A C     1 
ATOM   2427  O O     . HIS A 1 308 ? 21.640  20.370  11.971  1.00 34.14 ? 308 HIS A O     1 
ATOM   2428  C CB    . HIS A 1 308 ? 20.492  18.217  10.007  1.00 35.73 ? 308 HIS A CB    1 
ATOM   2429  C CG    . HIS A 1 308 ? 19.740  18.430  8.751   1.00 35.19 ? 308 HIS A CG    1 
ATOM   2430  N ND1   . HIS A 1 308 ? 19.949  17.655  7.630   1.00 38.93 ? 308 HIS A ND1   1 
ATOM   2431  C CD2   . HIS A 1 308 ? 18.831  19.377  8.407   1.00 32.50 ? 308 HIS A CD2   1 
ATOM   2432  C CE1   . HIS A 1 308 ? 19.137  18.077  6.664   1.00 41.15 ? 308 HIS A CE1   1 
ATOM   2433  N NE2   . HIS A 1 308 ? 18.454  19.123  7.108   1.00 39.36 ? 308 HIS A NE2   1 
ATOM   2434  N N     . GLU A 1 309 ? 23.022  18.614  12.089  1.00 37.62 ? 309 GLU A N     1 
ATOM   2435  C CA    . GLU A 1 309 ? 23.408  18.989  13.449  1.00 38.70 ? 309 GLU A CA    1 
ATOM   2436  C C     . GLU A 1 309 ? 24.457  20.107  13.394  1.00 38.84 ? 309 GLU A C     1 
ATOM   2437  O O     . GLU A 1 309 ? 24.414  21.038  14.194  1.00 37.85 ? 309 GLU A O     1 
ATOM   2438  C CB    . GLU A 1 309 ? 23.856  17.795  14.267  1.00 39.18 ? 309 GLU A CB    1 
ATOM   2439  C CG    . GLU A 1 309 ? 23.514  17.954  15.778  1.00 45.65 ? 309 GLU A CG    1 
ATOM   2440  C CD    . GLU A 1 309 ? 21.998  17.873  16.086  1.00 53.82 ? 309 GLU A CD    1 
ATOM   2441  O OE1   . GLU A 1 309 ? 21.599  18.422  17.137  1.00 54.65 ? 309 GLU A OE1   1 
ATOM   2442  O OE2   . GLU A 1 309 ? 21.212  17.255  15.294  1.00 56.12 ? 309 GLU A OE2   1 
ATOM   2443  N N     . TRP A 1 310 ? 25.316  20.097  12.361  1.00 37.38 ? 310 TRP A N     1 
ATOM   2444  C CA    . TRP A 1 310 ? 26.219  21.209  12.160  1.00 36.02 ? 310 TRP A CA    1 
ATOM   2445  C C     . TRP A 1 310 ? 25.631  22.575  11.836  1.00 36.71 ? 310 TRP A C     1 
ATOM   2446  O O     . TRP A 1 310 ? 26.212  23.563  12.230  1.00 39.11 ? 310 TRP A O     1 
ATOM   2447  C CB    . TRP A 1 310 ? 27.302  20.909  11.146  1.00 33.88 ? 310 TRP A CB    1 
ATOM   2448  C CG    . TRP A 1 310 ? 28.500  20.140  11.679  1.00 33.75 ? 310 TRP A CG    1 
ATOM   2449  C CD1   . TRP A 1 310 ? 28.905  19.966  12.998  1.00 31.71 ? 310 TRP A CD1   1 
ATOM   2450  C CD2   . TRP A 1 310 ? 29.490  19.485  10.874  1.00 31.83 ? 310 TRP A CD2   1 
ATOM   2451  N NE1   . TRP A 1 310 ? 30.076  19.217  13.034  1.00 31.13 ? 310 TRP A NE1   1 
ATOM   2452  C CE2   . TRP A 1 310 ? 30.441  18.910  11.747  1.00 34.62 ? 310 TRP A CE2   1 
ATOM   2453  C CE3   . TRP A 1 310 ? 29.633  19.280  9.499   1.00 28.66 ? 310 TRP A CE3   1 
ATOM   2454  C CZ2   . TRP A 1 310 ? 31.532  18.157  11.259  1.00 34.49 ? 310 TRP A CZ2   1 
ATOM   2455  C CZ3   . TRP A 1 310 ? 30.723  18.572  9.038   1.00 28.09 ? 310 TRP A CZ3   1 
ATOM   2456  C CH2   . TRP A 1 310 ? 31.632  18.014  9.898   1.00 31.26 ? 310 TRP A CH2   1 
ATOM   2457  N N     . GLY A 1 311 ? 24.515  22.677  11.145  1.00 38.32 ? 311 GLY A N     1 
ATOM   2458  C CA    . GLY A 1 311 ? 24.154  23.963  10.490  1.00 39.95 ? 311 GLY A CA    1 
ATOM   2459  C C     . GLY A 1 311 ? 25.213  24.232  9.430   1.00 41.17 ? 311 GLY A C     1 
ATOM   2460  O O     . GLY A 1 311 ? 26.344  23.772  9.563   1.00 42.04 ? 311 GLY A O     1 
ATOM   2461  N N     . GLU A 1 312 ? 24.902  24.949  8.356   1.00 42.73 ? 312 GLU A N     1 
ATOM   2462  C CA    . GLU A 1 312 ? 25.980  25.299  7.428   1.00 44.78 ? 312 GLU A CA    1 
ATOM   2463  C C     . GLU A 1 312 ? 27.098  26.058  8.155   1.00 43.83 ? 312 GLU A C     1 
ATOM   2464  O O     . GLU A 1 312 ? 28.122  26.334  7.565   1.00 43.36 ? 312 GLU A O     1 
ATOM   2465  C CB    . GLU A 1 312 ? 25.507  26.028  6.145   1.00 45.17 ? 312 GLU A CB    1 
ATOM   2466  C CG    . GLU A 1 312 ? 24.155  26.717  6.175   1.00 49.19 ? 312 GLU A CG    1 
ATOM   2467  C CD    . GLU A 1 312 ? 23.547  26.969  4.740   1.00 50.08 ? 312 GLU A CD    1 
ATOM   2468  O OE1   . GLU A 1 312 ? 23.570  28.152  4.312   1.00 56.17 ? 312 GLU A OE1   1 
ATOM   2469  O OE2   . GLU A 1 312 ? 23.061  26.018  4.063   1.00 51.46 ? 312 GLU A OE2   1 
ATOM   2470  N N     . GLU A 1 313 ? 26.902  26.352  9.449   1.00 43.64 ? 313 GLU A N     1 
ATOM   2471  C CA    . GLU A 1 313 ? 27.927  26.957  10.278  1.00 44.22 ? 313 GLU A CA    1 
ATOM   2472  C C     . GLU A 1 313 ? 29.022  25.941  10.704  1.00 42.28 ? 313 GLU A C     1 
ATOM   2473  O O     . GLU A 1 313 ? 30.254  26.221  10.623  1.00 41.99 ? 313 GLU A O     1 
ATOM   2474  C CB    . GLU A 1 313 ? 27.272  27.551  11.558  1.00 46.41 ? 313 GLU A CB    1 
ATOM   2475  C CG    . GLU A 1 313 ? 27.678  28.971  11.916  1.00 52.29 ? 313 GLU A CG    1 
ATOM   2476  C CD    . GLU A 1 313 ? 26.992  30.018  11.024  1.00 62.78 ? 313 GLU A CD    1 
ATOM   2477  O OE1   . GLU A 1 313 ? 26.681  29.673  9.839   1.00 61.15 ? 313 GLU A OE1   1 
ATOM   2478  O OE2   . GLU A 1 313 ? 26.793  31.190  11.504  1.00 65.03 ? 313 GLU A OE2   1 
ATOM   2479  N N     . GLY A 1 314 ? 28.572  24.807  11.230  1.00 38.94 ? 314 GLY A N     1 
ATOM   2480  C CA    . GLY A 1 314 ? 29.487  23.817  11.752  1.00 37.13 ? 314 GLY A CA    1 
ATOM   2481  C C     . GLY A 1 314 ? 30.136  23.096  10.569  1.00 35.64 ? 314 GLY A C     1 
ATOM   2482  O O     . GLY A 1 314 ? 31.260  22.529  10.680  1.00 33.57 ? 314 GLY A O     1 
ATOM   2483  N N     . PHE A 1 315 ? 29.461  23.206  9.431   1.00 34.34 ? 315 PHE A N     1 
ATOM   2484  C CA    . PHE A 1 315 ? 29.933  22.576  8.210   1.00 34.66 ? 315 PHE A CA    1 
ATOM   2485  C C     . PHE A 1 315 ? 31.074  23.411  7.760   1.00 34.62 ? 315 PHE A C     1 
ATOM   2486  O O     . PHE A 1 315 ? 32.188  22.924  7.544   1.00 34.14 ? 315 PHE A O     1 
ATOM   2487  C CB    . PHE A 1 315 ? 28.823  22.531  7.114   1.00 34.51 ? 315 PHE A CB    1 
ATOM   2488  C CG    . PHE A 1 315 ? 29.321  22.080  5.770   1.00 33.45 ? 315 PHE A CG    1 
ATOM   2489  C CD1   . PHE A 1 315 ? 29.847  20.814  5.591   1.00 34.70 ? 315 PHE A CD1   1 
ATOM   2490  C CD2   . PHE A 1 315 ? 29.384  22.964  4.722   1.00 39.60 ? 315 PHE A CD2   1 
ATOM   2491  C CE1   . PHE A 1 315 ? 30.377  20.434  4.357   1.00 39.48 ? 315 PHE A CE1   1 
ATOM   2492  C CE2   . PHE A 1 315 ? 29.893  22.595  3.451   1.00 39.57 ? 315 PHE A CE2   1 
ATOM   2493  C CZ    . PHE A 1 315 ? 30.351  21.325  3.259   1.00 37.39 ? 315 PHE A CZ    1 
ATOM   2494  N N     . MET A 1 316 ? 30.789  24.689  7.597   1.00 36.17 ? 316 MET A N     1 
ATOM   2495  C CA    . MET A 1 316 ? 31.782  25.639  7.095   1.00 36.54 ? 316 MET A CA    1 
ATOM   2496  C C     . MET A 1 316 ? 32.966  25.696  8.053   1.00 35.43 ? 316 MET A C     1 
ATOM   2497  O O     . MET A 1 316 ? 34.110  25.623  7.627   1.00 36.99 ? 316 MET A O     1 
ATOM   2498  C CB    . MET A 1 316 ? 31.154  27.037  6.807   1.00 37.95 ? 316 MET A CB    1 
ATOM   2499  C CG    . MET A 1 316 ? 30.562  27.279  5.362   1.00 38.36 ? 316 MET A CG    1 
ATOM   2500  S SD    . MET A 1 316 ? 30.921  26.046  3.976   1.00 44.36 ? 316 MET A SD    1 
ATOM   2501  C CE    . MET A 1 316 ? 32.435  26.581  3.301   1.00 40.92 ? 316 MET A CE    1 
ATOM   2502  N N     . ALA A 1 317 ? 32.718  25.728  9.356   1.00 35.99 ? 317 ALA A N     1 
ATOM   2503  C CA    . ALA A 1 317 ? 33.828  25.682  10.334  1.00 34.46 ? 317 ALA A CA    1 
ATOM   2504  C C     . ALA A 1 317 ? 34.604  24.388  10.246  1.00 34.35 ? 317 ALA A C     1 
ATOM   2505  O O     . ALA A 1 317 ? 35.775  24.362  10.574  1.00 35.90 ? 317 ALA A O     1 
ATOM   2506  C CB    . ALA A 1 317 ? 33.316  25.871  11.744  1.00 34.56 ? 317 ALA A CB    1 
ATOM   2507  N N     . HIS A 1 318 ? 33.966  23.301  9.849   1.00 35.01 ? 318 HIS A N     1 
ATOM   2508  C CA    . HIS A 1 318 ? 34.676  21.987  9.689   1.00 35.70 ? 318 HIS A CA    1 
ATOM   2509  C C     . HIS A 1 318 ? 35.591  22.087  8.484   1.00 35.50 ? 318 HIS A C     1 
ATOM   2510  O O     . HIS A 1 318 ? 36.660  21.518  8.506   1.00 36.18 ? 318 HIS A O     1 
ATOM   2511  C CB    . HIS A 1 318 ? 33.721  20.769  9.498   1.00 35.54 ? 318 HIS A CB    1 
ATOM   2512  C CG    . HIS A 1 318 ? 34.434  19.509  9.066   1.00 35.47 ? 318 HIS A CG    1 
ATOM   2513  N ND1   . HIS A 1 318 ? 34.429  19.043  7.757   1.00 37.91 ? 318 HIS A ND1   1 
ATOM   2514  C CD2   . HIS A 1 318 ? 35.205  18.640  9.766   1.00 33.64 ? 318 HIS A CD2   1 
ATOM   2515  C CE1   . HIS A 1 318 ? 35.164  17.935  7.682   1.00 36.46 ? 318 HIS A CE1   1 
ATOM   2516  N NE2   . HIS A 1 318 ? 35.654  17.673  8.886   1.00 33.61 ? 318 HIS A NE2   1 
ATOM   2517  N N     . VAL A 1 319 ? 35.192  22.844  7.463   1.00 35.82 ? 319 VAL A N     1 
ATOM   2518  C CA    . VAL A 1 319 ? 35.992  22.885  6.288   1.00 36.75 ? 319 VAL A CA    1 
ATOM   2519  C C     . VAL A 1 319 ? 37.183  23.790  6.499   1.00 38.02 ? 319 VAL A C     1 
ATOM   2520  O O     . VAL A 1 319 ? 38.266  23.433  6.077   1.00 38.97 ? 319 VAL A O     1 
ATOM   2521  C CB    . VAL A 1 319 ? 35.216  23.125  4.915   1.00 37.45 ? 319 VAL A CB    1 
ATOM   2522  C CG1   . VAL A 1 319 ? 34.081  22.134  4.713   1.00 32.64 ? 319 VAL A CG1   1 
ATOM   2523  C CG2   . VAL A 1 319 ? 34.755  24.473  4.755   1.00 38.99 ? 319 VAL A CG2   1 
ATOM   2524  N N     . ASP A 1 320 ? 37.011  24.920  7.209   1.00 38.54 ? 320 ASP A N     1 
ATOM   2525  C CA    . ASP A 1 320 ? 38.146  25.779  7.558   1.00 37.55 ? 320 ASP A CA    1 
ATOM   2526  C C     . ASP A 1 320 ? 39.223  25.022  8.346   1.00 36.46 ? 320 ASP A C     1 
ATOM   2527  O O     . ASP A 1 320 ? 40.391  25.223  8.096   1.00 37.68 ? 320 ASP A O     1 
ATOM   2528  C CB    . ASP A 1 320 ? 37.692  27.033  8.317   1.00 38.26 ? 320 ASP A CB    1 
ATOM   2529  C CG    . ASP A 1 320 ? 36.968  28.013  7.423   1.00 40.54 ? 320 ASP A CG    1 
ATOM   2530  O OD1   . ASP A 1 320 ? 37.474  28.324  6.315   1.00 49.32 ? 320 ASP A OD1   1 
ATOM   2531  O OD2   . ASP A 1 320 ? 35.856  28.446  7.779   1.00 41.84 ? 320 ASP A OD2   1 
ATOM   2532  N N     . ARG A 1 321 ? 38.844  24.158  9.270   1.00 34.92 ? 321 ARG A N     1 
ATOM   2533  C CA    . ARG A 1 321 ? 39.791  23.352  9.996   1.00 35.21 ? 321 ARG A CA    1 
ATOM   2534  C C     . ARG A 1 321 ? 40.489  22.393  9.088   1.00 35.40 ? 321 ARG A C     1 
ATOM   2535  O O     . ARG A 1 321 ? 41.669  22.083  9.313   1.00 36.28 ? 321 ARG A O     1 
ATOM   2536  C CB    . ARG A 1 321 ? 39.150  22.548  11.162  1.00 35.31 ? 321 ARG A CB    1 
ATOM   2537  C CG    . ARG A 1 321 ? 38.543  23.369  12.337  1.00 39.22 ? 321 ARG A CG    1 
ATOM   2538  C CD    . ARG A 1 321 ? 38.144  22.520  13.638  1.00 36.47 ? 321 ARG A CD    1 
ATOM   2539  N NE    . ARG A 1 321 ? 36.896  21.735  13.519  1.00 38.38 ? 321 ARG A NE    1 
ATOM   2540  C CZ    . ARG A 1 321 ? 35.667  22.248  13.521  1.00 38.67 ? 321 ARG A CZ    1 
ATOM   2541  N NH1   . ARG A 1 321 ? 35.517  23.559  13.604  1.00 34.20 ? 321 ARG A NH1   1 
ATOM   2542  N NH2   . ARG A 1 321 ? 34.582  21.463  13.392  1.00 41.10 ? 321 ARG A NH2   1 
ATOM   2543  N N     . VAL A 1 322 ? 39.782  21.807  8.110   1.00 36.12 ? 322 VAL A N     1 
ATOM   2544  C CA    . VAL A 1 322 ? 40.513  20.806  7.294   1.00 35.24 ? 322 VAL A CA    1 
ATOM   2545  C C     . VAL A 1 322 ? 41.382  21.561  6.314   1.00 34.39 ? 322 VAL A C     1 
ATOM   2546  O O     . VAL A 1 322 ? 42.415  21.039  5.913   1.00 32.21 ? 322 VAL A O     1 
ATOM   2547  C CB    . VAL A 1 322 ? 39.687  19.614  6.610   1.00 34.34 ? 322 VAL A CB    1 
ATOM   2548  C CG1   . VAL A 1 322 ? 38.284  19.701  6.826   1.00 33.74 ? 322 VAL A CG1   1 
ATOM   2549  C CG2   . VAL A 1 322 ? 39.994  19.478  5.118   1.00 32.61 ? 322 VAL A CG2   1 
ATOM   2550  N N     . ILE A 1 323 ? 40.949  22.789  5.983   1.00 35.22 ? 323 ILE A N     1 
ATOM   2551  C CA    . ILE A 1 323 ? 41.712  23.641  5.083   1.00 36.40 ? 323 ILE A CA    1 
ATOM   2552  C C     . ILE A 1 323 ? 43.029  23.971  5.785   1.00 38.53 ? 323 ILE A C     1 
ATOM   2553  O O     . ILE A 1 323 ? 44.115  23.743  5.232   1.00 39.05 ? 323 ILE A O     1 
ATOM   2554  C CB    . ILE A 1 323 ? 40.951  24.869  4.651   1.00 36.90 ? 323 ILE A CB    1 
ATOM   2555  C CG1   . ILE A 1 323 ? 39.843  24.499  3.601   1.00 34.91 ? 323 ILE A CG1   1 
ATOM   2556  C CG2   . ILE A 1 323 ? 41.913  25.909  4.025   1.00 36.78 ? 323 ILE A CG2   1 
ATOM   2557  C CD1   . ILE A 1 323 ? 38.945  25.712  3.147   1.00 34.12 ? 323 ILE A CD1   1 
ATOM   2558  N N     . ASP A 1 324 ? 42.925  24.383  7.042   1.00 39.17 ? 324 ASP A N     1 
ATOM   2559  C CA    . ASP A 1 324 ? 44.066  24.789  7.789   1.00 40.84 ? 324 ASP A CA    1 
ATOM   2560  C C     . ASP A 1 324 ? 45.064  23.700  7.752   1.00 40.35 ? 324 ASP A C     1 
ATOM   2561  O O     . ASP A 1 324 ? 46.189  23.999  7.488   1.00 41.91 ? 324 ASP A O     1 
ATOM   2562  C CB    . ASP A 1 324 ? 43.708  25.220  9.241   1.00 42.08 ? 324 ASP A CB    1 
ATOM   2563  C CG    . ASP A 1 324 ? 43.133  26.643  9.288   1.00 46.01 ? 324 ASP A CG    1 
ATOM   2564  O OD1   . ASP A 1 324 ? 43.407  27.409  8.313   1.00 49.99 ? 324 ASP A OD1   1 
ATOM   2565  O OD2   . ASP A 1 324 ? 42.412  26.999  10.262  1.00 48.16 ? 324 ASP A OD2   1 
ATOM   2566  N N     . PHE A 1 325 ? 44.668  22.448  8.015   1.00 40.57 ? 325 PHE A N     1 
ATOM   2567  C CA    . PHE A 1 325 ? 45.617  21.291  8.079   1.00 39.60 ? 325 PHE A CA    1 
ATOM   2568  C C     . PHE A 1 325 ? 46.311  21.107  6.713   1.00 39.51 ? 325 PHE A C     1 
ATOM   2569  O O     . PHE A 1 325 ? 47.507  20.867  6.663   1.00 41.24 ? 325 PHE A O     1 
ATOM   2570  C CB    . PHE A 1 325 ? 44.883  19.999  8.493   1.00 39.98 ? 325 PHE A CB    1 
ATOM   2571  C CG    . PHE A 1 325 ? 45.704  18.716  8.293   1.00 41.78 ? 325 PHE A CG    1 
ATOM   2572  C CD1   . PHE A 1 325 ? 46.516  18.224  9.325   1.00 40.49 ? 325 PHE A CD1   1 
ATOM   2573  C CD2   . PHE A 1 325 ? 45.683  18.040  7.069   1.00 38.51 ? 325 PHE A CD2   1 
ATOM   2574  C CE1   . PHE A 1 325 ? 47.291  17.121  9.143   1.00 40.75 ? 325 PHE A CE1   1 
ATOM   2575  C CE2   . PHE A 1 325 ? 46.434  16.910  6.863   1.00 38.06 ? 325 PHE A CE2   1 
ATOM   2576  C CZ    . PHE A 1 325 ? 47.242  16.433  7.871   1.00 43.08 ? 325 PHE A CZ    1 
ATOM   2577  N N     . TYR A 1 326 ? 45.552  21.226  5.617   1.00 36.80 ? 326 TYR A N     1 
ATOM   2578  C CA    . TYR A 1 326 ? 46.147  21.152  4.286   1.00 35.01 ? 326 TYR A CA    1 
ATOM   2579  C C     . TYR A 1 326 ? 47.028  22.333  3.840   1.00 34.24 ? 326 TYR A C     1 
ATOM   2580  O O     . TYR A 1 326 ? 48.015  22.020  3.151   1.00 32.89 ? 326 TYR A O     1 
ATOM   2581  C CB    . TYR A 1 326 ? 45.135  20.774  3.203   1.00 33.94 ? 326 TYR A CB    1 
ATOM   2582  C CG    . TYR A 1 326 ? 44.620  19.328  3.203   1.00 32.30 ? 326 TYR A CG    1 
ATOM   2583  C CD1   . TYR A 1 326 ? 45.095  18.429  2.290   1.00 33.21 ? 326 TYR A CD1   1 
ATOM   2584  C CD2   . TYR A 1 326 ? 43.652  18.866  4.115   1.00 32.04 ? 326 TYR A CD2   1 
ATOM   2585  C CE1   . TYR A 1 326 ? 44.631  17.169  2.225   1.00 30.87 ? 326 TYR A CE1   1 
ATOM   2586  C CE2   . TYR A 1 326 ? 43.170  17.507  4.066   1.00 29.71 ? 326 TYR A CE2   1 
ATOM   2587  C CZ    . TYR A 1 326 ? 43.642  16.707  3.068   1.00 31.73 ? 326 TYR A CZ    1 
ATOM   2588  O OH    . TYR A 1 326 ? 43.267  15.380  2.894   1.00 33.25 ? 326 TYR A OH    1 
ATOM   2589  N N     . SER A 1 327 ? 46.761  23.618  4.238   1.00 33.36 ? 327 SER A N     1 
ATOM   2590  C CA    . SER A 1 327 ? 47.840  24.664  4.149   1.00 34.81 ? 327 SER A CA    1 
ATOM   2591  C C     . SER A 1 327 ? 49.111  24.351  4.927   1.00 35.01 ? 327 SER A C     1 
ATOM   2592  O O     . SER A 1 327 ? 50.169  24.714  4.468   1.00 34.36 ? 327 SER A O     1 
ATOM   2593  C CB    . SER A 1 327 ? 47.480  26.166  4.531   1.00 35.41 ? 327 SER A CB    1 
ATOM   2594  O OG    . SER A 1 327 ? 46.151  26.538  4.280   1.00 37.75 ? 327 SER A OG    1 
ATOM   2595  N N     . ASN A 1 328 ? 49.005  23.747  6.122   1.00 37.13 ? 328 ASN A N     1 
ATOM   2596  C CA    . ASN A 1 328 ? 50.157  23.534  6.966   1.00 39.44 ? 328 ASN A CA    1 
ATOM   2597  C C     . ASN A 1 328 ? 51.073  22.426  6.417   1.00 40.02 ? 328 ASN A C     1 
ATOM   2598  O O     . ASN A 1 328 ? 52.288  22.469  6.671   1.00 40.30 ? 328 ASN A O     1 
ATOM   2599  C CB    . ASN A 1 328 ? 49.740  23.140  8.394   1.00 41.22 ? 328 ASN A CB    1 
ATOM   2600  C CG    . ASN A 1 328 ? 49.180  24.342  9.275   1.00 45.52 ? 328 ASN A CG    1 
ATOM   2601  O OD1   . ASN A 1 328 ? 49.245  24.267  10.517  1.00 49.17 ? 328 ASN A OD1   1 
ATOM   2602  N ND2   . ASN A 1 328 ? 48.586  25.364  8.655   1.00 46.99 ? 328 ASN A ND2   1 
ATOM   2603  N N     . GLN A 1 329 ? 50.456  21.403  5.782   1.00 39.87 ? 329 GLN A N     1 
ATOM   2604  C CA    . GLN A 1 329 ? 51.121  20.299  5.049   1.00 40.92 ? 329 GLN A CA    1 
ATOM   2605  C C     . GLN A 1 329 ? 51.637  20.818  3.720   1.00 40.42 ? 329 GLN A C     1 
ATOM   2606  O O     . GLN A 1 329 ? 52.659  20.370  3.274   1.00 41.48 ? 329 GLN A O     1 
ATOM   2607  C CB    . GLN A 1 329 ? 50.170  19.106  4.727   1.00 40.85 ? 329 GLN A CB    1 
ATOM   2608  C CG    . GLN A 1 329 ? 49.639  18.259  5.869   1.00 40.91 ? 329 GLN A CG    1 
ATOM   2609  C CD    . GLN A 1 329 ? 50.622  17.187  6.395   1.00 41.46 ? 329 GLN A CD    1 
ATOM   2610  O OE1   . GLN A 1 329 ? 50.971  17.167  7.597   1.00 41.78 ? 329 GLN A OE1   1 
ATOM   2611  N NE2   . GLN A 1 329 ? 51.036  16.272  5.515   1.00 42.91 ? 329 GLN A NE2   1 
ATOM   2612  N N     . LYS A 1 330 ? 50.899  21.717  3.068   1.00 39.67 ? 330 LYS A N     1 
ATOM   2613  C CA    . LYS A 1 330 ? 51.432  22.468  1.912   1.00 39.78 ? 330 LYS A CA    1 
ATOM   2614  C C     . LYS A 1 330 ? 52.725  23.263  2.300   1.00 39.55 ? 330 LYS A C     1 
ATOM   2615  O O     . LYS A 1 330 ? 53.759  23.091  1.700   1.00 38.01 ? 330 LYS A O     1 
ATOM   2616  C CB    . LYS A 1 330 ? 50.342  23.410  1.317   1.00 39.52 ? 330 LYS A CB    1 
ATOM   2617  C CG    . LYS A 1 330 ? 50.807  24.326  0.203   1.00 37.51 ? 330 LYS A CG    1 
ATOM   2618  C CD    . LYS A 1 330 ? 49.841  25.479  -0.018  1.00 39.68 ? 330 LYS A CD    1 
ATOM   2619  C CE    . LYS A 1 330 ? 50.258  26.802  0.683   1.00 40.33 ? 330 LYS A CE    1 
ATOM   2620  N NZ    . LYS A 1 330 ? 49.117  27.514  1.300   1.00 41.51 ? 330 LYS A NZ    1 
ATOM   2621  N N     . ASP A 1 331 ? 52.652  24.128  3.323   1.00 40.72 ? 331 ASP A N     1 
ATOM   2622  C CA    . ASP A 1 331 ? 53.847  24.827  3.853   1.00 38.72 ? 331 ASP A CA    1 
ATOM   2623  C C     . ASP A 1 331 ? 55.055  23.943  3.993   1.00 37.80 ? 331 ASP A C     1 
ATOM   2624  O O     . ASP A 1 331 ? 56.143  24.218  3.469   1.00 38.56 ? 331 ASP A O     1 
ATOM   2625  C CB    . ASP A 1 331 ? 53.501  25.481  5.173   1.00 39.84 ? 331 ASP A CB    1 
ATOM   2626  C CG    . ASP A 1 331 ? 52.567  26.597  4.978   1.00 39.86 ? 331 ASP A CG    1 
ATOM   2627  O OD1   . ASP A 1 331 ? 52.534  27.045  3.819   1.00 41.19 ? 331 ASP A OD1   1 
ATOM   2628  O OD2   . ASP A 1 331 ? 51.804  26.954  5.919   1.00 41.63 ? 331 ASP A OD2   1 
ATOM   2629  N N     . ALA A 1 332 ? 54.838  22.811  4.627   1.00 36.96 ? 332 ALA A N     1 
ATOM   2630  C CA    . ALA A 1 332 ? 55.884  21.840  4.875   1.00 34.53 ? 332 ALA A CA    1 
ATOM   2631  C C     . ALA A 1 332 ? 56.448  21.240  3.567   1.00 35.17 ? 332 ALA A C     1 
ATOM   2632  O O     . ALA A 1 332 ? 57.694  20.976  3.422   1.00 35.99 ? 332 ALA A O     1 
ATOM   2633  C CB    . ALA A 1 332 ? 55.340  20.766  5.791   1.00 33.87 ? 332 ALA A CB    1 
ATOM   2634  N N     . ILE A 1 333 ? 55.594  20.989  2.594   1.00 33.43 ? 333 ILE A N     1 
ATOM   2635  C CA    . ILE A 1 333 ? 56.133  20.205  1.460   1.00 34.46 ? 333 ILE A CA    1 
ATOM   2636  C C     . ILE A 1 333 ? 56.931  21.168  0.603   1.00 34.92 ? 333 ILE A C     1 
ATOM   2637  O O     . ILE A 1 333 ? 57.935  20.802  0.061   1.00 35.83 ? 333 ILE A O     1 
ATOM   2638  C CB    . ILE A 1 333 ? 55.040  19.452  0.614   1.00 34.23 ? 333 ILE A CB    1 
ATOM   2639  C CG1   . ILE A 1 333 ? 55.727  18.400  -0.272  1.00 37.05 ? 333 ILE A CG1   1 
ATOM   2640  C CG2   . ILE A 1 333 ? 54.212  20.464  -0.172  1.00 29.12 ? 333 ILE A CG2   1 
ATOM   2641  C CD1   . ILE A 1 333 ? 54.822  17.415  -1.120  1.00 34.45 ? 333 ILE A CD1   1 
ATOM   2642  N N     . LEU A 1 334 ? 56.446  22.402  0.502   1.00 35.45 ? 334 LEU A N     1 
ATOM   2643  C CA    . LEU A 1 334 ? 57.128  23.518  -0.117  1.00 35.39 ? 334 LEU A CA    1 
ATOM   2644  C C     . LEU A 1 334 ? 58.496  23.824  0.529   1.00 35.13 ? 334 LEU A C     1 
ATOM   2645  O O     . LEU A 1 334 ? 59.501  23.847  -0.149  1.00 37.47 ? 334 LEU A O     1 
ATOM   2646  C CB    . LEU A 1 334 ? 56.227  24.732  -0.063  1.00 35.79 ? 334 LEU A CB    1 
ATOM   2647  C CG    . LEU A 1 334 ? 55.348  25.061  -1.291  1.00 38.63 ? 334 LEU A CG    1 
ATOM   2648  C CD1   . LEU A 1 334 ? 55.233  23.923  -2.305  1.00 39.49 ? 334 LEU A CD1   1 
ATOM   2649  C CD2   . LEU A 1 334 ? 53.968  25.725  -0.916  1.00 34.93 ? 334 LEU A CD2   1 
ATOM   2650  N N     . ALA A 1 335 ? 58.544  24.091  1.810   1.00 33.77 ? 335 ALA A N     1 
ATOM   2651  C CA    . ALA A 1 335 ? 59.799  24.154  2.530   1.00 32.86 ? 335 ALA A CA    1 
ATOM   2652  C C     . ALA A 1 335 ? 60.764  22.957  2.260   1.00 33.16 ? 335 ALA A C     1 
ATOM   2653  O O     . ALA A 1 335 ? 61.939  23.151  2.058   1.00 31.31 ? 335 ALA A O     1 
ATOM   2654  C CB    . ALA A 1 335 ? 59.487  24.292  4.086   1.00 33.93 ? 335 ALA A CB    1 
ATOM   2655  N N     . ALA A 1 336 ? 60.270  21.718  2.246   1.00 32.86 ? 336 ALA A N     1 
ATOM   2656  C CA    . ALA A 1 336 ? 61.096  20.614  1.799   1.00 32.63 ? 336 ALA A CA    1 
ATOM   2657  C C     . ALA A 1 336 ? 61.646  20.823  0.389   1.00 32.64 ? 336 ALA A C     1 
ATOM   2658  O O     . ALA A 1 336 ? 62.754  20.430  0.080   1.00 32.40 ? 336 ALA A O     1 
ATOM   2659  C CB    . ALA A 1 336 ? 60.322  19.350  1.821   1.00 33.98 ? 336 ALA A CB    1 
ATOM   2660  N N     . ALA A 1 337 ? 60.872  21.457  -0.484  1.00 33.39 ? 337 ALA A N     1 
ATOM   2661  C CA    . ALA A 1 337 ? 61.252  21.546  -1.889  1.00 31.47 ? 337 ALA A CA    1 
ATOM   2662  C C     . ALA A 1 337 ? 62.311  22.535  -2.053  1.00 31.80 ? 337 ALA A C     1 
ATOM   2663  O O     . ALA A 1 337 ? 63.262  22.275  -2.834  1.00 33.79 ? 337 ALA A O     1 
ATOM   2664  C CB    . ALA A 1 337 ? 60.071  21.910  -2.727  1.00 31.86 ? 337 ALA A CB    1 
ATOM   2665  N N     . ASP A 1 338 ? 62.120  23.714  -1.418  1.00 32.46 ? 338 ASP A N     1 
ATOM   2666  C CA    . ASP A 1 338 ? 63.129  24.804  -1.361  1.00 33.56 ? 338 ASP A CA    1 
ATOM   2667  C C     . ASP A 1 338 ? 64.453  24.314  -0.747  1.00 32.97 ? 338 ASP A C     1 
ATOM   2668  O O     . ASP A 1 338 ? 65.512  24.457  -1.314  1.00 33.16 ? 338 ASP A O     1 
ATOM   2669  C CB    . ASP A 1 338 ? 62.548  26.024  -0.615  1.00 32.84 ? 338 ASP A CB    1 
ATOM   2670  C CG    . ASP A 1 338 ? 61.385  26.717  -1.430  1.00 36.73 ? 338 ASP A CG    1 
ATOM   2671  O OD1   . ASP A 1 338 ? 61.557  27.019  -2.655  1.00 42.85 ? 338 ASP A OD1   1 
ATOM   2672  O OD2   . ASP A 1 338 ? 60.295  26.926  -0.889  1.00 34.13 ? 338 ASP A OD2   1 
ATOM   2673  N N     . LYS A 1 339 ? 64.358  23.714  0.420   1.00 32.89 ? 339 LYS A N     1 
ATOM   2674  C CA    . LYS A 1 339 ? 65.444  23.013  0.980   1.00 34.19 ? 339 LYS A CA    1 
ATOM   2675  C C     . LYS A 1 339 ? 66.271  22.122  -0.054  1.00 34.21 ? 339 LYS A C     1 
ATOM   2676  O O     . LYS A 1 339 ? 67.479  22.354  -0.218  1.00 33.11 ? 339 LYS A O     1 
ATOM   2677  C CB    . LYS A 1 339 ? 64.989  22.239  2.198   1.00 33.43 ? 339 LYS A CB    1 
ATOM   2678  C CG    . LYS A 1 339 ? 66.150  21.686  3.016   1.00 35.94 ? 339 LYS A CG    1 
ATOM   2679  C CD    . LYS A 1 339 ? 65.739  21.354  4.421   1.00 28.98 ? 339 LYS A CD    1 
ATOM   2680  C CE    . LYS A 1 339 ? 66.974  20.904  5.153   1.00 31.27 ? 339 LYS A CE    1 
ATOM   2681  N NZ    . LYS A 1 339 ? 66.609  19.951  6.326   1.00 29.26 ? 339 LYS A NZ    1 
ATOM   2682  N N     . TRP A 1 340 ? 65.641  21.174  -0.749  1.00 32.73 ? 340 TRP A N     1 
ATOM   2683  C CA    . TRP A 1 340 ? 66.435  20.220  -1.511  1.00 32.69 ? 340 TRP A CA    1 
ATOM   2684  C C     . TRP A 1 340 ? 66.402  20.360  -2.992  1.00 32.78 ? 340 TRP A C     1 
ATOM   2685  O O     . TRP A 1 340 ? 67.307  19.866  -3.685  1.00 34.18 ? 340 TRP A O     1 
ATOM   2686  C CB    . TRP A 1 340 ? 66.132  18.773  -1.082  1.00 33.21 ? 340 TRP A CB    1 
ATOM   2687  C CG    . TRP A 1 340 ? 66.355  18.513  0.373   1.00 32.00 ? 340 TRP A CG    1 
ATOM   2688  C CD1   . TRP A 1 340 ? 65.391  18.484  1.404   1.00 33.02 ? 340 TRP A CD1   1 
ATOM   2689  C CD2   . TRP A 1 340 ? 67.599  18.175  0.974   1.00 32.20 ? 340 TRP A CD2   1 
ATOM   2690  N NE1   . TRP A 1 340 ? 66.004  18.145  2.604   1.00 32.85 ? 340 TRP A NE1   1 
ATOM   2691  C CE2   . TRP A 1 340 ? 67.356  17.990  2.374   1.00 35.06 ? 340 TRP A CE2   1 
ATOM   2692  C CE3   . TRP A 1 340 ? 68.916  18.036  0.476   1.00 31.17 ? 340 TRP A CE3   1 
ATOM   2693  C CZ2   . TRP A 1 340 ? 68.396  17.740  3.277   1.00 32.98 ? 340 TRP A CZ2   1 
ATOM   2694  C CZ3   . TRP A 1 340 ? 69.929  17.735  1.361   1.00 30.12 ? 340 TRP A CZ3   1 
ATOM   2695  C CH2   . TRP A 1 340 ? 69.663  17.600  2.742   1.00 33.56 ? 340 TRP A CH2   1 
ATOM   2696  N N     . LEU A 1 341 ? 65.394  21.043  -3.513  1.00 33.86 ? 341 LEU A N     1 
ATOM   2697  C CA    . LEU A 1 341 ? 65.228  21.167  -4.967  1.00 36.32 ? 341 LEU A CA    1 
ATOM   2698  C C     . LEU A 1 341 ? 65.616  22.592  -5.450  1.00 37.15 ? 341 LEU A C     1 
ATOM   2699  O O     . LEU A 1 341 ? 65.248  23.591  -4.883  1.00 38.62 ? 341 LEU A O     1 
ATOM   2700  C CB    . LEU A 1 341 ? 63.794  20.788  -5.287  1.00 36.68 ? 341 LEU A CB    1 
ATOM   2701  C CG    . LEU A 1 341 ? 63.549  19.343  -5.672  1.00 39.05 ? 341 LEU A CG    1 
ATOM   2702  C CD1   . LEU A 1 341 ? 64.776  18.358  -5.809  1.00 37.52 ? 341 LEU A CD1   1 
ATOM   2703  C CD2   . LEU A 1 341 ? 62.413  18.792  -4.911  1.00 40.62 ? 341 LEU A CD2   1 
ATOM   2704  N N     . THR A 1 342 ? 66.444  22.696  -6.459  1.00 38.70 ? 342 THR A N     1 
ATOM   2705  C CA    . THR A 1 342 ? 67.734  23.480  -6.147  1.00 36.80 ? 342 THR A CA    1 
ATOM   2706  C C     . THR A 1 342 ? 68.161  24.373  -7.212  1.00 37.49 ? 342 THR A C     1 
ATOM   2707  O O     . THR A 1 342 ? 69.348  24.642  -7.376  1.00 41.17 ? 342 THR A O     1 
ATOM   2708  C CB    . THR A 1 342 ? 68.973  22.446  -6.000  1.00 36.30 ? 342 THR A CB    1 
ATOM   2709  O OG1   . THR A 1 342 ? 69.110  21.839  -4.675  1.00 30.16 ? 342 THR A OG1   1 
ATOM   2710  C CG2   . THR A 1 342 ? 70.342  23.018  -6.585  1.00 37.55 ? 342 THR A CG2   1 
ATOM   2711  N N     . GLY A 1 343 ? 67.282  24.808  -8.054  1.00 37.64 ? 343 GLY A N     1 
ATOM   2712  C CA    . GLY A 1 343 ? 67.853  24.921  -9.393  1.00 36.97 ? 343 GLY A CA    1 
ATOM   2713  C C     . GLY A 1 343 ? 67.948  23.486  -9.916  1.00 36.13 ? 343 GLY A C     1 
ATOM   2714  O O     . GLY A 1 343 ? 68.619  23.253  -10.938 1.00 34.90 ? 343 GLY A O     1 
ATOM   2715  N N     . LEU A 1 344 ? 67.238  22.555  -9.242  1.00 33.59 ? 344 LEU A N     1 
ATOM   2716  C CA    . LEU A 1 344 ? 67.067  21.194  -9.722  1.00 36.01 ? 344 LEU A CA    1 
ATOM   2717  C C     . LEU A 1 344 ? 65.701  20.866  -10.333 1.00 36.04 ? 344 LEU A C     1 
ATOM   2718  O O     . LEU A 1 344 ? 65.605  19.937  -11.116 1.00 39.24 ? 344 LEU A O     1 
ATOM   2719  C CB    . LEU A 1 344 ? 67.329  20.173  -8.601  1.00 34.70 ? 344 LEU A CB    1 
ATOM   2720  C CG    . LEU A 1 344 ? 68.697  19.568  -8.350  1.00 35.72 ? 344 LEU A CG    1 
ATOM   2721  C CD1   . LEU A 1 344 ? 69.844  20.178  -9.061  1.00 33.85 ? 344 LEU A CD1   1 
ATOM   2722  C CD2   . LEU A 1 344 ? 68.983  19.496  -6.901  1.00 35.13 ? 344 LEU A CD2   1 
ATOM   2723  N N     . ALA A 1 345 ? 64.668  21.591  -9.914  1.00 36.23 ? 345 ALA A N     1 
ATOM   2724  C CA    . ALA A 1 345 ? 63.274  21.410  -10.270 1.00 36.38 ? 345 ALA A CA    1 
ATOM   2725  C C     . ALA A 1 345 ? 62.663  22.780  -10.173 1.00 37.15 ? 345 ALA A C     1 
ATOM   2726  O O     . ALA A 1 345 ? 63.176  23.591  -9.399  1.00 36.98 ? 345 ALA A O     1 
ATOM   2727  C CB    . ALA A 1 345 ? 62.592  20.533  -9.283  1.00 33.91 ? 345 ALA A CB    1 
ATOM   2728  N N     . GLU A 1 346 ? 61.578  23.002  -10.939 1.00 38.31 ? 346 GLU A N     1 
ATOM   2729  C CA    . GLU A 1 346 ? 60.614  24.159  -10.767 1.00 40.35 ? 346 GLU A CA    1 
ATOM   2730  C C     . GLU A 1 346 ? 59.215  23.639  -10.435 1.00 37.88 ? 346 GLU A C     1 
ATOM   2731  O O     . GLU A 1 346 ? 58.792  22.614  -11.010 1.00 38.05 ? 346 GLU A O     1 
ATOM   2732  C CB    . GLU A 1 346 ? 60.418  24.967  -12.073 1.00 38.13 ? 346 GLU A CB    1 
ATOM   2733  C CG    . GLU A 1 346 ? 61.643  25.387  -12.912 1.00 43.48 ? 346 GLU A CG    1 
ATOM   2734  C CD    . GLU A 1 346 ? 61.192  26.083  -14.251 1.00 47.93 ? 346 GLU A CD    1 
ATOM   2735  O OE1   . GLU A 1 346 ? 60.634  27.230  -14.213 1.00 53.41 ? 346 GLU A OE1   1 
ATOM   2736  O OE2   . GLU A 1 346 ? 61.370  25.472  -15.343 1.00 54.14 ? 346 GLU A OE2   1 
ATOM   2737  N N     . TRP A 1 347 ? 58.483  24.368  -9.578  1.00 35.82 ? 347 TRP A N     1 
ATOM   2738  C CA    . TRP A 1 347 ? 57.051  24.129  -9.283  1.00 33.98 ? 347 TRP A CA    1 
ATOM   2739  C C     . TRP A 1 347 ? 56.365  25.509  -9.005  1.00 33.61 ? 347 TRP A C     1 
ATOM   2740  O O     . TRP A 1 347 ? 57.022  26.460  -8.747  1.00 31.30 ? 347 TRP A O     1 
ATOM   2741  C CB    . TRP A 1 347 ? 56.889  23.211  -8.023  1.00 33.64 ? 347 TRP A CB    1 
ATOM   2742  C CG    . TRP A 1 347 ? 57.608  23.838  -6.819  1.00 34.72 ? 347 TRP A CG    1 
ATOM   2743  C CD1   . TRP A 1 347 ? 57.059  24.692  -5.799  1.00 32.38 ? 347 TRP A CD1   1 
ATOM   2744  C CD2   . TRP A 1 347 ? 58.995  23.757  -6.556  1.00 30.82 ? 347 TRP A CD2   1 
ATOM   2745  N NE1   . TRP A 1 347 ? 58.043  25.062  -4.934  1.00 29.61 ? 347 TRP A NE1   1 
ATOM   2746  C CE2   . TRP A 1 347 ? 59.247  24.534  -5.367  1.00 35.38 ? 347 TRP A CE2   1 
ATOM   2747  C CE3   . TRP A 1 347 ? 60.056  23.071  -7.162  1.00 29.14 ? 347 TRP A CE3   1 
ATOM   2748  C CZ2   . TRP A 1 347 ? 60.557  24.653  -4.809  1.00 32.22 ? 347 TRP A CZ2   1 
ATOM   2749  C CZ3   . TRP A 1 347 ? 61.352  23.243  -6.651  1.00 31.31 ? 347 TRP A CZ3   1 
ATOM   2750  C CH2   . TRP A 1 347 ? 61.584  24.022  -5.460  1.00 32.81 ? 347 TRP A CH2   1 
ATOM   2751  N N     . HIS A 1 348 ? 55.032  25.558  -9.062  1.00 35.58 ? 348 HIS A N     1 
ATOM   2752  C CA    . HIS A 1 348 ? 54.173  26.668  -8.635  1.00 34.60 ? 348 HIS A CA    1 
ATOM   2753  C C     . HIS A 1 348 ? 53.606  26.307  -7.260  1.00 35.64 ? 348 HIS A C     1 
ATOM   2754  O O     . HIS A 1 348 ? 53.527  25.113  -6.921  1.00 36.10 ? 348 HIS A O     1 
ATOM   2755  C CB    . HIS A 1 348 ? 53.031  26.866  -9.633  1.00 35.22 ? 348 HIS A CB    1 
ATOM   2756  C CG    . HIS A 1 348 ? 53.456  26.984  -11.076 1.00 35.90 ? 348 HIS A CG    1 
ATOM   2757  N ND1   . HIS A 1 348 ? 54.219  28.044  -11.564 1.00 36.17 ? 348 HIS A ND1   1 
ATOM   2758  C CD2   . HIS A 1 348 ? 53.143  26.225  -12.153 1.00 35.08 ? 348 HIS A CD2   1 
ATOM   2759  C CE1   . HIS A 1 348 ? 54.414  27.886  -12.860 1.00 36.19 ? 348 HIS A CE1   1 
ATOM   2760  N NE2   . HIS A 1 348 ? 53.730  26.816  -13.251 1.00 40.15 ? 348 HIS A NE2   1 
ATOM   2761  N N     . VAL A 1 349 ? 53.216  27.295  -6.419  1.00 35.46 ? 349 VAL A N     1 
ATOM   2762  C CA    . VAL A 1 349 ? 52.566  26.856  -5.190  1.00 34.64 ? 349 VAL A CA    1 
ATOM   2763  C C     . VAL A 1 349 ? 51.058  26.447  -5.501  1.00 35.98 ? 349 VAL A C     1 
ATOM   2764  O O     . VAL A 1 349 ? 50.306  27.230  -6.154  1.00 31.42 ? 349 VAL A O     1 
ATOM   2765  C CB    . VAL A 1 349 ? 52.834  27.747  -3.849  1.00 34.20 ? 349 VAL A CB    1 
ATOM   2766  C CG1   . VAL A 1 349 ? 54.105  28.683  -3.924  1.00 30.34 ? 349 VAL A CG1   1 
ATOM   2767  C CG2   . VAL A 1 349 ? 51.571  28.473  -3.313  1.00 31.45 ? 349 VAL A CG2   1 
ATOM   2768  N N     . PRO A 1 350 ? 50.652  25.205  -5.014  1.00 35.92 ? 350 PRO A N     1 
ATOM   2769  C CA    . PRO A 1 350 ? 49.279  24.696  -4.996  1.00 35.74 ? 350 PRO A CA    1 
ATOM   2770  C C     . PRO A 1 350 ? 48.338  25.736  -4.409  1.00 35.91 ? 350 PRO A C     1 
ATOM   2771  O O     . PRO A 1 350 ? 48.691  26.389  -3.424  1.00 36.86 ? 350 PRO A O     1 
ATOM   2772  C CB    . PRO A 1 350 ? 49.366  23.444  -4.102  1.00 35.03 ? 350 PRO A CB    1 
ATOM   2773  C CG    . PRO A 1 350 ? 50.726  22.922  -4.406  1.00 35.24 ? 350 PRO A CG    1 
ATOM   2774  C CD    . PRO A 1 350 ? 51.553  24.239  -4.362  1.00 36.28 ? 350 PRO A CD    1 
ATOM   2775  N N     . ALA A 1 351 ? 47.219  25.964  -5.087  1.00 34.31 ? 351 ALA A N     1 
ATOM   2776  C CA    . ALA A 1 351 ? 46.220  26.889  -4.604  1.00 33.66 ? 351 ALA A CA    1 
ATOM   2777  C C     . ALA A 1 351 ? 45.074  26.146  -3.882  1.00 34.47 ? 351 ALA A C     1 
ATOM   2778  O O     . ALA A 1 351 ? 44.321  26.736  -3.088  1.00 33.20 ? 351 ALA A O     1 
ATOM   2779  C CB    . ALA A 1 351 ? 45.693  27.717  -5.711  1.00 32.50 ? 351 ALA A CB    1 
ATOM   2780  N N     . ALA A 1 352 ? 44.941  24.839  -4.160  1.00 35.00 ? 352 ALA A N     1 
ATOM   2781  C CA    . ALA A 1 352 ? 43.864  24.053  -3.565  1.00 34.48 ? 352 ALA A CA    1 
ATOM   2782  C C     . ALA A 1 352 ? 44.254  22.598  -3.561  1.00 34.74 ? 352 ALA A C     1 
ATOM   2783  O O     . ALA A 1 352 ? 45.151  22.171  -4.280  1.00 38.68 ? 352 ALA A O     1 
ATOM   2784  C CB    . ALA A 1 352 ? 42.587  24.278  -4.318  1.00 32.79 ? 352 ALA A CB    1 
ATOM   2785  N N     . GLY A 1 353 ? 43.663  21.818  -2.703  1.00 34.44 ? 353 GLY A N     1 
ATOM   2786  C CA    . GLY A 1 353 ? 43.902  20.405  -2.837  1.00 35.26 ? 353 GLY A CA    1 
ATOM   2787  C C     . GLY A 1 353 ? 45.049  19.865  -2.044  1.00 34.65 ? 353 GLY A C     1 
ATOM   2788  O O     . GLY A 1 353 ? 45.289  20.325  -0.891  1.00 35.61 ? 353 GLY A O     1 
ATOM   2789  N N     . MET A 1 354 ? 45.692  18.835  -2.627  1.00 34.16 ? 354 MET A N     1 
ATOM   2790  C CA    . MET A 1 354 ? 46.660  17.965  -1.925  1.00 35.08 ? 354 MET A CA    1 
ATOM   2791  C C     . MET A 1 354 ? 47.820  17.489  -2.739  1.00 32.84 ? 354 MET A C     1 
ATOM   2792  O O     . MET A 1 354 ? 48.439  16.513  -2.337  1.00 33.45 ? 354 MET A O     1 
ATOM   2793  C CB    . MET A 1 354 ? 45.979  16.700  -1.275  1.00 35.47 ? 354 MET A CB    1 
ATOM   2794  C CG    . MET A 1 354 ? 45.214  15.757  -2.256  1.00 35.37 ? 354 MET A CG    1 
ATOM   2795  S SD    . MET A 1 354 ? 44.104  14.546  -1.385  1.00 39.04 ? 354 MET A SD    1 
ATOM   2796  C CE    . MET A 1 354 ? 43.154  15.839  -0.576  1.00 42.51 ? 354 MET A CE    1 
ATOM   2797  N N     . PHE A 1 355 ? 48.122  18.137  -3.859  1.00 32.54 ? 355 PHE A N     1 
ATOM   2798  C CA    . PHE A 1 355 ? 49.230  17.699  -4.719  1.00 32.95 ? 355 PHE A CA    1 
ATOM   2799  C C     . PHE A 1 355 ? 50.262  18.799  -5.042  1.00 33.14 ? 355 PHE A C     1 
ATOM   2800  O O     . PHE A 1 355 ? 49.880  19.934  -5.375  1.00 29.75 ? 355 PHE A O     1 
ATOM   2801  C CB    . PHE A 1 355 ? 48.724  17.035  -5.993  1.00 32.38 ? 355 PHE A CB    1 
ATOM   2802  C CG    . PHE A 1 355 ? 47.859  15.803  -5.722  1.00 35.64 ? 355 PHE A CG    1 
ATOM   2803  C CD1   . PHE A 1 355 ? 48.402  14.686  -5.085  1.00 33.04 ? 355 PHE A CD1   1 
ATOM   2804  C CD2   . PHE A 1 355 ? 46.524  15.787  -6.101  1.00 34.29 ? 355 PHE A CD2   1 
ATOM   2805  C CE1   . PHE A 1 355 ? 47.632  13.608  -4.839  1.00 34.47 ? 355 PHE A CE1   1 
ATOM   2806  C CE2   . PHE A 1 355 ? 45.755  14.732  -5.848  1.00 35.31 ? 355 PHE A CE2   1 
ATOM   2807  C CZ    . PHE A 1 355 ? 46.289  13.639  -5.176  1.00 32.80 ? 355 PHE A CZ    1 
ATOM   2808  N N     . LEU A 1 356 ? 51.543  18.425  -4.953  1.00 31.04 ? 356 LEU A N     1 
ATOM   2809  C CA    . LEU A 1 356 ? 52.583  19.259  -5.537  1.00 32.60 ? 356 LEU A CA    1 
ATOM   2810  C C     . LEU A 1 356 ? 53.048  18.699  -6.903  1.00 32.66 ? 356 LEU A C     1 
ATOM   2811  O O     . LEU A 1 356 ? 53.289  17.471  -7.047  1.00 33.49 ? 356 LEU A O     1 
ATOM   2812  C CB    . LEU A 1 356 ? 53.749  19.418  -4.539  1.00 31.73 ? 356 LEU A CB    1 
ATOM   2813  C CG    . LEU A 1 356 ? 54.915  20.307  -4.988  1.00 30.81 ? 356 LEU A CG    1 
ATOM   2814  C CD1   . LEU A 1 356 ? 54.473  21.749  -5.248  1.00 25.04 ? 356 LEU A CD1   1 
ATOM   2815  C CD2   . LEU A 1 356 ? 56.068  20.209  -3.891  1.00 33.71 ? 356 LEU A CD2   1 
ATOM   2816  N N     . TRP A 1 357 ? 53.113  19.572  -7.891  1.00 33.41 ? 357 TRP A N     1 
ATOM   2817  C CA    . TRP A 1 357 ? 53.512  19.212  -9.288  1.00 34.78 ? 357 TRP A CA    1 
ATOM   2818  C C     . TRP A 1 357 ? 54.885  19.857  -9.582  1.00 35.37 ? 357 TRP A C     1 
ATOM   2819  O O     . TRP A 1 357 ? 55.015  21.114  -9.728  1.00 33.71 ? 357 TRP A O     1 
ATOM   2820  C CB    . TRP A 1 357 ? 52.428  19.700  -10.258 1.00 33.72 ? 357 TRP A CB    1 
ATOM   2821  C CG    . TRP A 1 357 ? 52.450  19.268  -11.727 1.00 35.08 ? 357 TRP A CG    1 
ATOM   2822  C CD1   . TRP A 1 357 ? 52.427  20.127  -12.818 1.00 36.11 ? 357 TRP A CD1   1 
ATOM   2823  C CD2   . TRP A 1 357 ? 52.388  17.934  -12.291 1.00 33.80 ? 357 TRP A CD2   1 
ATOM   2824  N NE1   . TRP A 1 357 ? 52.396  19.427  -13.986 1.00 35.31 ? 357 TRP A NE1   1 
ATOM   2825  C CE2   . TRP A 1 357 ? 52.376  18.083  -13.709 1.00 37.30 ? 357 TRP A CE2   1 
ATOM   2826  C CE3   . TRP A 1 357 ? 52.419  16.644  -11.752 1.00 34.21 ? 357 TRP A CE3   1 
ATOM   2827  C CZ2   . TRP A 1 357 ? 52.350  16.969  -14.601 1.00 37.45 ? 357 TRP A CZ2   1 
ATOM   2828  C CZ3   . TRP A 1 357 ? 52.361  15.529  -12.628 1.00 33.77 ? 357 TRP A CZ3   1 
ATOM   2829  C CH2   . TRP A 1 357 ? 52.347  15.707  -14.035 1.00 36.13 ? 357 TRP A CH2   1 
ATOM   2830  N N     . ILE A 1 358 ? 55.898  18.978  -9.637  1.00 36.02 ? 358 ILE A N     1 
ATOM   2831  C CA    . ILE A 1 358 ? 57.265  19.381  -9.758  1.00 35.72 ? 358 ILE A CA    1 
ATOM   2832  C C     . ILE A 1 358 ? 57.936  18.985  -11.072 1.00 36.74 ? 358 ILE A C     1 
ATOM   2833  O O     . ILE A 1 358 ? 57.969  17.788  -11.446 1.00 36.27 ? 358 ILE A O     1 
ATOM   2834  C CB    . ILE A 1 358 ? 58.102  18.988  -8.504  1.00 36.69 ? 358 ILE A CB    1 
ATOM   2835  C CG1   . ILE A 1 358 ? 59.086  17.857  -8.727  1.00 38.21 ? 358 ILE A CG1   1 
ATOM   2836  C CG2   . ILE A 1 358 ? 57.344  19.072  -7.143  1.00 34.97 ? 358 ILE A CG2   1 
ATOM   2837  C CD1   . ILE A 1 358 ? 60.447  18.468  -8.867  1.00 40.32 ? 358 ILE A CD1   1 
ATOM   2838  N N     . LYS A 1 359 ? 58.476  19.980  -11.792 1.00 36.91 ? 359 LYS A N     1 
ATOM   2839  C CA    . LYS A 1 359 ? 59.065  19.698  -13.089 1.00 36.71 ? 359 LYS A CA    1 
ATOM   2840  C C     . LYS A 1 359 ? 60.563  19.544  -12.916 1.00 38.72 ? 359 LYS A C     1 
ATOM   2841  O O     . LYS A 1 359 ? 61.254  20.515  -12.541 1.00 38.72 ? 359 LYS A O     1 
ATOM   2842  C CB    . LYS A 1 359 ? 58.784  20.795  -14.106 1.00 37.33 ? 359 LYS A CB    1 
ATOM   2843  C CG    . LYS A 1 359 ? 59.177  20.435  -15.556 1.00 35.07 ? 359 LYS A CG    1 
ATOM   2844  C CD    . LYS A 1 359 ? 59.478  21.705  -16.318 1.00 36.40 ? 359 LYS A CD    1 
ATOM   2845  C CE    . LYS A 1 359 ? 59.968  21.487  -17.741 1.00 39.13 ? 359 LYS A CE    1 
ATOM   2846  N NZ    . LYS A 1 359 ? 59.220  20.400  -18.508 1.00 43.24 ? 359 LYS A NZ    1 
ATOM   2847  N N     . VAL A 1 360 ? 61.050  18.321  -13.187 1.00 39.76 ? 360 VAL A N     1 
ATOM   2848  C CA    . VAL A 1 360 ? 62.456  17.992  -13.061 1.00 40.40 ? 360 VAL A CA    1 
ATOM   2849  C C     . VAL A 1 360 ? 63.234  18.573  -14.254 1.00 41.96 ? 360 VAL A C     1 
ATOM   2850  O O     . VAL A 1 360 ? 62.828  18.412  -15.421 1.00 40.57 ? 360 VAL A O     1 
ATOM   2851  C CB    . VAL A 1 360 ? 62.675  16.449  -12.821 1.00 40.72 ? 360 VAL A CB    1 
ATOM   2852  C CG1   . VAL A 1 360 ? 64.134  16.116  -12.457 1.00 38.41 ? 360 VAL A CG1   1 
ATOM   2853  C CG2   . VAL A 1 360 ? 61.732  15.952  -11.700 1.00 39.37 ? 360 VAL A CG2   1 
ATOM   2854  N N     . LYS A 1 361 ? 64.336  19.275  -13.910 1.00 44.06 ? 361 LYS A N     1 
ATOM   2855  C CA    . LYS A 1 361 ? 65.259  19.961  -14.853 1.00 45.88 ? 361 LYS A CA    1 
ATOM   2856  C C     . LYS A 1 361 ? 66.245  19.036  -15.572 1.00 47.16 ? 361 LYS A C     1 
ATOM   2857  O O     . LYS A 1 361 ? 66.813  18.097  -14.976 1.00 46.33 ? 361 LYS A O     1 
ATOM   2858  C CB    . LYS A 1 361 ? 66.057  21.014  -14.095 1.00 45.57 ? 361 LYS A CB    1 
ATOM   2859  C CG    . LYS A 1 361 ? 65.146  22.041  -13.358 1.00 49.25 ? 361 LYS A CG    1 
ATOM   2860  C CD    . LYS A 1 361 ? 64.906  23.348  -14.123 1.00 50.97 ? 361 LYS A CD    1 
ATOM   2861  C CE    . LYS A 1 361 ? 65.235  24.566  -13.232 1.00 50.49 ? 361 LYS A CE    1 
ATOM   2862  N NZ    . LYS A 1 361 ? 66.680  24.508  -12.795 1.00 52.57 ? 361 LYS A NZ    1 
ATOM   2863  N N     . GLY A 1 362 ? 66.472  19.317  -16.862 1.00 49.65 ? 362 GLY A N     1 
ATOM   2864  C CA    . GLY A 1 362 ? 67.397  18.512  -17.682 1.00 50.63 ? 362 GLY A CA    1 
ATOM   2865  C C     . GLY A 1 362 ? 67.337  17.005  -17.472 1.00 52.35 ? 362 GLY A C     1 
ATOM   2866  O O     . GLY A 1 362 ? 68.339  16.327  -17.682 1.00 53.44 ? 362 GLY A O     1 
ATOM   2867  N N     . ILE A 1 363 ? 66.184  16.485  -17.041 1.00 52.69 ? 363 ILE A N     1 
ATOM   2868  C CA    . ILE A 1 363 ? 65.820  15.052  -17.141 1.00 54.47 ? 363 ILE A CA    1 
ATOM   2869  C C     . ILE A 1 363 ? 64.544  15.004  -17.986 1.00 54.81 ? 363 ILE A C     1 
ATOM   2870  O O     . ILE A 1 363 ? 63.533  15.587  -17.600 1.00 55.14 ? 363 ILE A O     1 
ATOM   2871  C CB    . ILE A 1 363 ? 65.553  14.392  -15.759 1.00 55.17 ? 363 ILE A CB    1 
ATOM   2872  C CG1   . ILE A 1 363 ? 66.804  14.448  -14.878 1.00 56.47 ? 363 ILE A CG1   1 
ATOM   2873  C CG2   . ILE A 1 363 ? 65.086  12.920  -15.908 1.00 56.61 ? 363 ILE A CG2   1 
ATOM   2874  C CD1   . ILE A 1 363 ? 66.802  13.455  -13.690 1.00 54.00 ? 363 ILE A CD1   1 
ATOM   2875  N N     . ASN A 1 364 ? 64.579  14.391  -19.165 1.00 55.03 ? 364 ASN A N     1 
ATOM   2876  C CA    . ASN A 1 364 ? 63.414  14.559  -20.059 1.00 55.10 ? 364 ASN A CA    1 
ATOM   2877  C C     . ASN A 1 364 ? 62.209  13.571  -19.913 1.00 54.18 ? 364 ASN A C     1 
ATOM   2878  O O     . ASN A 1 364 ? 61.090  13.876  -20.405 1.00 54.34 ? 364 ASN A O     1 
ATOM   2879  C CB    . ASN A 1 364 ? 63.805  14.895  -21.525 1.00 56.19 ? 364 ASN A CB    1 
ATOM   2880  C CG    . ASN A 1 364 ? 64.832  13.937  -22.116 1.00 58.66 ? 364 ASN A CG    1 
ATOM   2881  O OD1   . ASN A 1 364 ? 64.999  12.809  -21.634 1.00 64.49 ? 364 ASN A OD1   1 
ATOM   2882  N ND2   . ASN A 1 364 ? 65.525  14.382  -23.178 1.00 55.77 ? 364 ASN A ND2   1 
ATOM   2883  N N     . ASP A 1 365 ? 62.441  12.447  -19.227 1.00 52.12 ? 365 ASP A N     1 
ATOM   2884  C CA    . ASP A 1 365 ? 61.383  11.574  -18.662 1.00 51.91 ? 365 ASP A CA    1 
ATOM   2885  C C     . ASP A 1 365 ? 61.731  11.045  -17.252 1.00 51.30 ? 365 ASP A C     1 
ATOM   2886  O O     . ASP A 1 365 ? 62.863  10.612  -17.007 1.00 50.44 ? 365 ASP A O     1 
ATOM   2887  C CB    . ASP A 1 365 ? 61.116  10.384  -19.587 1.00 51.89 ? 365 ASP A CB    1 
ATOM   2888  C CG    . ASP A 1 365 ? 59.949  9.516   -19.120 1.00 54.44 ? 365 ASP A CG    1 
ATOM   2889  O OD1   . ASP A 1 365 ? 60.229  8.301   -18.866 1.00 57.88 ? 365 ASP A OD1   1 
ATOM   2890  O OD2   . ASP A 1 365 ? 58.779  10.034  -19.022 1.00 49.21 ? 365 ASP A OD2   1 
ATOM   2891  N N     . VAL A 1 366 ? 60.760  11.013  -16.344 1.00 51.18 ? 366 VAL A N     1 
ATOM   2892  C CA    . VAL A 1 366 ? 61.062  10.672  -14.912 1.00 51.95 ? 366 VAL A CA    1 
ATOM   2893  C C     . VAL A 1 366 ? 60.689  9.253   -14.399 1.00 52.45 ? 366 VAL A C     1 
ATOM   2894  O O     . VAL A 1 366 ? 60.772  8.967   -13.177 1.00 51.44 ? 366 VAL A O     1 
ATOM   2895  C CB    . VAL A 1 366 ? 60.514  11.778  -13.924 1.00 51.73 ? 366 VAL A CB    1 
ATOM   2896  C CG1   . VAL A 1 366 ? 58.969  11.708  -13.801 1.00 51.54 ? 366 VAL A CG1   1 
ATOM   2897  C CG2   . VAL A 1 366 ? 61.188  11.670  -12.546 1.00 52.02 ? 366 VAL A CG2   1 
ATOM   2898  N N     . LYS A 1 367 ? 60.305  8.380   -15.342 1.00 53.43 ? 367 LYS A N     1 
ATOM   2899  C CA    . LYS A 1 367 ? 59.946  6.962   -15.103 1.00 54.76 ? 367 LYS A CA    1 
ATOM   2900  C C     . LYS A 1 367 ? 61.079  6.133   -14.535 1.00 54.53 ? 367 LYS A C     1 
ATOM   2901  O O     . LYS A 1 367 ? 60.902  5.390   -13.573 1.00 54.75 ? 367 LYS A O     1 
ATOM   2902  C CB    . LYS A 1 367 ? 59.552  6.321   -16.430 1.00 55.31 ? 367 LYS A CB    1 
ATOM   2903  C CG    . LYS A 1 367 ? 58.394  5.326   -16.340 1.00 57.22 ? 367 LYS A CG    1 
ATOM   2904  C CD    . LYS A 1 367 ? 57.906  4.918   -17.753 1.00 57.45 ? 367 LYS A CD    1 
ATOM   2905  C CE    . LYS A 1 367 ? 58.921  4.044   -18.485 1.00 61.96 ? 367 LYS A CE    1 
ATOM   2906  N NZ    . LYS A 1 367 ? 59.023  2.677   -17.863 1.00 64.65 ? 367 LYS A NZ    1 
ATOM   2907  N N     . GLU A 1 368 ? 62.246  6.240   -15.154 1.00 54.05 ? 368 GLU A N     1 
ATOM   2908  C CA    . GLU A 1 368 ? 63.393  5.470   -14.763 1.00 53.81 ? 368 GLU A CA    1 
ATOM   2909  C C     . GLU A 1 368 ? 63.913  5.942   -13.377 1.00 54.32 ? 368 GLU A C     1 
ATOM   2910  O O     . GLU A 1 368 ? 64.198  5.120   -12.503 1.00 53.44 ? 368 GLU A O     1 
ATOM   2911  C CB    . GLU A 1 368 ? 64.464  5.611   -15.837 1.00 54.04 ? 368 GLU A CB    1 
ATOM   2912  C CG    . GLU A 1 368 ? 65.155  4.346   -16.252 1.00 54.53 ? 368 GLU A CG    1 
ATOM   2913  C CD    . GLU A 1 368 ? 66.354  4.027   -15.387 1.00 56.77 ? 368 GLU A CD    1 
ATOM   2914  O OE1   . GLU A 1 368 ? 66.182  3.942   -14.158 1.00 55.53 ? 368 GLU A OE1   1 
ATOM   2915  O OE2   . GLU A 1 368 ? 67.471  3.843   -15.930 1.00 54.37 ? 368 GLU A OE2   1 
ATOM   2916  N N     . LEU A 1 369 ? 64.033  7.263   -13.188 1.00 53.87 ? 369 LEU A N     1 
ATOM   2917  C CA    . LEU A 1 369 ? 64.418  7.832   -11.897 1.00 53.54 ? 369 LEU A CA    1 
ATOM   2918  C C     . LEU A 1 369 ? 63.504  7.428   -10.716 1.00 53.87 ? 369 LEU A C     1 
ATOM   2919  O O     . LEU A 1 369 ? 64.003  7.213   -9.593  1.00 52.95 ? 369 LEU A O     1 
ATOM   2920  C CB    . LEU A 1 369 ? 64.521  9.355   -12.012 1.00 53.35 ? 369 LEU A CB    1 
ATOM   2921  C CG    . LEU A 1 369 ? 65.005  10.070  -10.756 1.00 53.38 ? 369 LEU A CG    1 
ATOM   2922  C CD1   . LEU A 1 369 ? 66.101  11.025  -11.132 1.00 53.62 ? 369 LEU A CD1   1 
ATOM   2923  C CD2   . LEU A 1 369 ? 63.852  10.797  -10.008 1.00 52.06 ? 369 LEU A CD2   1 
ATOM   2924  N N     . ILE A 1 370 ? 62.188  7.344   -10.959 1.00 54.79 ? 370 ILE A N     1 
ATOM   2925  C CA    . ILE A 1 370 ? 61.226  6.887   -9.925  1.00 55.94 ? 370 ILE A CA    1 
ATOM   2926  C C     . ILE A 1 370 ? 60.954  5.385   -9.908  1.00 56.56 ? 370 ILE A C     1 
ATOM   2927  O O     . ILE A 1 370 ? 61.048  4.793   -8.820  1.00 57.00 ? 370 ILE A O     1 
ATOM   2928  C CB    . ILE A 1 370 ? 59.862  7.615   -9.954  1.00 56.14 ? 370 ILE A CB    1 
ATOM   2929  C CG1   . ILE A 1 370 ? 60.003  9.078   -10.296 1.00 57.87 ? 370 ILE A CG1   1 
ATOM   2930  C CG2   . ILE A 1 370 ? 59.260  7.575   -8.600  1.00 57.57 ? 370 ILE A CG2   1 
ATOM   2931  C CD1   . ILE A 1 370 ? 60.637  9.957   -9.143  1.00 63.18 ? 370 ILE A CD1   1 
ATOM   2932  N N     . GLU A 1 371 ? 60.628  4.771   -11.071 1.00 57.32 ? 371 GLU A N     1 
ATOM   2933  C CA    . GLU A 1 371 ? 60.346  3.303   -11.176 1.00 58.04 ? 371 GLU A CA    1 
ATOM   2934  C C     . GLU A 1 371 ? 61.571  2.509   -10.749 1.00 57.73 ? 371 GLU A C     1 
ATOM   2935  O O     . GLU A 1 371 ? 61.480  1.537   -10.004 1.00 58.96 ? 371 GLU A O     1 
ATOM   2936  C CB    . GLU A 1 371 ? 59.902  2.816   -12.605 1.00 57.81 ? 371 GLU A CB    1 
ATOM   2937  C CG    . GLU A 1 371 ? 59.335  1.318   -12.641 1.00 58.66 ? 371 GLU A CG    1 
ATOM   2938  C CD    . GLU A 1 371 ? 59.767  0.376   -13.858 1.00 59.35 ? 371 GLU A CD    1 
ATOM   2939  O OE1   . GLU A 1 371 ? 60.016  0.852   -15.016 1.00 54.81 ? 371 GLU A OE1   1 
ATOM   2940  O OE2   . GLU A 1 371 ? 59.842  -0.874  -13.606 1.00 58.85 ? 371 GLU A OE2   1 
ATOM   2941  N N     . GLU A 1 372 ? 62.733  2.904   -11.232 1.00 57.14 ? 372 GLU A N     1 
ATOM   2942  C CA    . GLU A 1 372 ? 63.905  2.180   -10.854 1.00 56.39 ? 372 GLU A CA    1 
ATOM   2943  C C     . GLU A 1 372 ? 64.560  2.802   -9.615  1.00 55.71 ? 372 GLU A C     1 
ATOM   2944  O O     . GLU A 1 372 ? 64.406  2.242   -8.511  1.00 56.59 ? 372 GLU A O     1 
ATOM   2945  C CB    . GLU A 1 372 ? 64.827  1.935   -12.061 1.00 56.11 ? 372 GLU A CB    1 
ATOM   2946  C CG    . GLU A 1 372 ? 64.448  0.636   -12.775 1.00 58.63 ? 372 GLU A CG    1 
ATOM   2947  C CD    . GLU A 1 372 ? 64.112  0.747   -14.270 1.00 61.35 ? 372 GLU A CD    1 
ATOM   2948  O OE1   . GLU A 1 372 ? 64.439  -0.219  -15.012 1.00 61.30 ? 372 GLU A OE1   1 
ATOM   2949  O OE2   . GLU A 1 372 ? 63.484  1.743   -14.710 1.00 61.15 ? 372 GLU A OE2   1 
ATOM   2950  N N     . LYS A 1 373 ? 65.222  3.955   -9.766  1.00 53.27 ? 373 LYS A N     1 
ATOM   2951  C CA    . LYS A 1 373 ? 66.138  4.483   -8.743  1.00 51.41 ? 373 LYS A CA    1 
ATOM   2952  C C     . LYS A 1 373 ? 65.541  4.915   -7.410  1.00 49.91 ? 373 LYS A C     1 
ATOM   2953  O O     . LYS A 1 373 ? 66.175  4.734   -6.378  1.00 49.78 ? 373 LYS A O     1 
ATOM   2954  C CB    . LYS A 1 373 ? 66.955  5.665   -9.293  1.00 51.81 ? 373 LYS A CB    1 
ATOM   2955  C CG    . LYS A 1 373 ? 67.825  5.362   -10.512 1.00 52.98 ? 373 LYS A CG    1 
ATOM   2956  C CD    . LYS A 1 373 ? 68.488  6.638   -11.040 1.00 52.98 ? 373 LYS A CD    1 
ATOM   2957  C CE    . LYS A 1 373 ? 69.919  6.351   -11.557 1.00 54.92 ? 373 LYS A CE    1 
ATOM   2958  N NZ    . LYS A 1 373 ? 70.742  7.566   -11.759 1.00 54.55 ? 373 LYS A NZ    1 
ATOM   2959  N N     . ALA A 1 374 ? 64.370  5.556   -7.408  1.00 48.36 ? 374 ALA A N     1 
ATOM   2960  C CA    . ALA A 1 374 ? 63.800  6.033   -6.135  1.00 47.44 ? 374 ALA A CA    1 
ATOM   2961  C C     . ALA A 1 374 ? 63.257  4.897   -5.228  1.00 47.00 ? 374 ALA A C     1 
ATOM   2962  O O     . ALA A 1 374 ? 63.487  4.918   -4.012  1.00 46.96 ? 374 ALA A O     1 
ATOM   2963  C CB    . ALA A 1 374 ? 62.727  7.157   -6.351  1.00 46.34 ? 374 ALA A CB    1 
ATOM   2964  N N     . VAL A 1 375 ? 62.537  3.936   -5.816  1.00 46.49 ? 375 VAL A N     1 
ATOM   2965  C CA    . VAL A 1 375 ? 61.967  2.819   -5.073  1.00 47.23 ? 375 VAL A CA    1 
ATOM   2966  C C     . VAL A 1 375 ? 63.014  2.033   -4.303  1.00 47.17 ? 375 VAL A C     1 
ATOM   2967  O O     . VAL A 1 375 ? 62.828  1.749   -3.129  1.00 47.46 ? 375 VAL A O     1 
ATOM   2968  C CB    . VAL A 1 375 ? 61.118  1.820   -5.975  1.00 47.90 ? 375 VAL A CB    1 
ATOM   2969  C CG1   . VAL A 1 375 ? 59.787  2.452   -6.380  1.00 49.19 ? 375 VAL A CG1   1 
ATOM   2970  C CG2   . VAL A 1 375 ? 61.941  1.249   -7.176  1.00 46.01 ? 375 VAL A CG2   1 
ATOM   2971  N N     . LYS A 1 376 ? 64.126  1.720   -4.967  1.00 48.00 ? 376 LYS A N     1 
ATOM   2972  C CA    . LYS A 1 376 ? 65.293  1.096   -4.329  1.00 48.94 ? 376 LYS A CA    1 
ATOM   2973  C C     . LYS A 1 376 ? 65.838  1.879   -3.167  1.00 48.71 ? 376 LYS A C     1 
ATOM   2974  O O     . LYS A 1 376 ? 66.408  1.276   -2.277  1.00 48.60 ? 376 LYS A O     1 
ATOM   2975  C CB    . LYS A 1 376 ? 66.420  0.759   -5.336  1.00 49.05 ? 376 LYS A CB    1 
ATOM   2976  C CG    . LYS A 1 376 ? 66.610  -0.771  -5.613  1.00 51.06 ? 376 LYS A CG    1 
ATOM   2977  C CD    . LYS A 1 376 ? 67.563  -1.069  -6.810  1.00 51.09 ? 376 LYS A CD    1 
ATOM   2978  C CE    . LYS A 1 376 ? 69.034  -0.819  -6.485  1.00 55.18 ? 376 LYS A CE    1 
ATOM   2979  N NZ    . LYS A 1 376 ? 69.926  -1.447  -7.535  1.00 51.31 ? 376 LYS A NZ    1 
ATOM   2980  N N     . MET A 1 377 ? 65.671  3.213   -3.167  1.00 49.49 ? 377 MET A N     1 
ATOM   2981  C CA    . MET A 1 377 ? 66.054  4.059   -1.989  1.00 49.92 ? 377 MET A CA    1 
ATOM   2982  C C     . MET A 1 377 ? 64.893  4.261   -0.983  1.00 48.82 ? 377 MET A C     1 
ATOM   2983  O O     . MET A 1 377 ? 64.977  5.090   -0.072  1.00 47.17 ? 377 MET A O     1 
ATOM   2984  C CB    . MET A 1 377 ? 66.564  5.448   -2.431  1.00 51.50 ? 377 MET A CB    1 
ATOM   2985  C CG    . MET A 1 377 ? 67.868  5.525   -3.290  1.00 55.34 ? 377 MET A CG    1 
ATOM   2986  S SD    . MET A 1 377 ? 69.401  5.473   -2.315  1.00 63.71 ? 377 MET A SD    1 
ATOM   2987  C CE    . MET A 1 377 ? 69.013  6.390   -0.811  1.00 58.92 ? 377 MET A CE    1 
ATOM   2988  N N     . GLY A 1 378 ? 63.787  3.533   -1.154  1.00 47.66 ? 378 GLY A N     1 
ATOM   2989  C CA    . GLY A 1 378 ? 62.670  3.712   -0.220  1.00 45.74 ? 378 GLY A CA    1 
ATOM   2990  C C     . GLY A 1 378 ? 61.832  4.984   -0.351  1.00 44.76 ? 378 GLY A C     1 
ATOM   2991  O O     . GLY A 1 378 ? 61.072  5.348   0.568   1.00 43.72 ? 378 GLY A O     1 
ATOM   2992  N N     . VAL A 1 379 ? 61.931  5.665   -1.483  1.00 44.22 ? 379 VAL A N     1 
ATOM   2993  C CA    . VAL A 1 379 ? 61.062  6.834   -1.677  1.00 44.62 ? 379 VAL A CA    1 
ATOM   2994  C C     . VAL A 1 379 ? 60.230  6.689   -2.926  1.00 44.83 ? 379 VAL A C     1 
ATOM   2995  O O     . VAL A 1 379 ? 60.765  6.373   -3.977  1.00 43.78 ? 379 VAL A O     1 
ATOM   2996  C CB    . VAL A 1 379 ? 61.794  8.187   -1.600  1.00 44.23 ? 379 VAL A CB    1 
ATOM   2997  C CG1   . VAL A 1 379 ? 63.174  8.108   -2.125  1.00 45.95 ? 379 VAL A CG1   1 
ATOM   2998  C CG2   . VAL A 1 379 ? 61.012  9.281   -2.309  1.00 45.98 ? 379 VAL A CG2   1 
ATOM   2999  N N     . LEU A 1 380 ? 58.910  6.870   -2.797  1.00 45.48 ? 380 LEU A N     1 
ATOM   3000  C CA    . LEU A 1 380 ? 58.068  6.827   -3.966  1.00 46.22 ? 380 LEU A CA    1 
ATOM   3001  C C     . LEU A 1 380 ? 57.377  8.137   -4.287  1.00 46.36 ? 380 LEU A C     1 
ATOM   3002  O O     . LEU A 1 380 ? 56.875  8.856   -3.396  1.00 47.36 ? 380 LEU A O     1 
ATOM   3003  C CB    . LEU A 1 380 ? 57.074  5.683   -3.933  1.00 46.82 ? 380 LEU A CB    1 
ATOM   3004  C CG    . LEU A 1 380 ? 57.169  4.435   -3.035  1.00 48.60 ? 380 LEU A CG    1 
ATOM   3005  C CD1   . LEU A 1 380 ? 55.829  3.688   -3.151  1.00 50.08 ? 380 LEU A CD1   1 
ATOM   3006  C CD2   . LEU A 1 380 ? 58.335  3.547   -3.331  1.00 47.63 ? 380 LEU A CD2   1 
ATOM   3007  N N     . MET A 1 381 ? 57.427  8.482   -5.565  1.00 45.51 ? 381 MET A N     1 
ATOM   3008  C CA    . MET A 1 381 ? 56.558  9.517   -6.126  1.00 46.22 ? 381 MET A CA    1 
ATOM   3009  C C     . MET A 1 381 ? 55.999  9.100   -7.503  1.00 44.80 ? 381 MET A C     1 
ATOM   3010  O O     . MET A 1 381 ? 56.410  8.058   -8.093  1.00 43.30 ? 381 MET A O     1 
ATOM   3011  C CB    . MET A 1 381 ? 57.182  10.934  -6.117  1.00 46.29 ? 381 MET A CB    1 
ATOM   3012  C CG    . MET A 1 381 ? 58.607  11.095  -5.588  1.00 46.73 ? 381 MET A CG    1 
ATOM   3013  S SD    . MET A 1 381 ? 58.819  12.813  -5.008  1.00 53.54 ? 381 MET A SD    1 
ATOM   3014  C CE    . MET A 1 381 ? 58.008  13.816  -6.246  1.00 51.30 ? 381 MET A CE    1 
ATOM   3015  N N     . LEU A 1 382 ? 55.040  9.894   -7.988  1.00 42.73 ? 382 LEU A N     1 
ATOM   3016  C CA    . LEU A 1 382 ? 54.252  9.515   -9.129  1.00 41.36 ? 382 LEU A CA    1 
ATOM   3017  C C     . LEU A 1 382 ? 54.704  10.199  -10.406 1.00 40.92 ? 382 LEU A C     1 
ATOM   3018  O O     . LEU A 1 382 ? 54.432  11.406  -10.553 1.00 40.49 ? 382 LEU A O     1 
ATOM   3019  C CB    . LEU A 1 382 ? 52.763  9.819   -8.856  1.00 40.96 ? 382 LEU A CB    1 
ATOM   3020  C CG    . LEU A 1 382 ? 51.819  9.301   -9.942  1.00 41.96 ? 382 LEU A CG    1 
ATOM   3021  C CD1   . LEU A 1 382 ? 51.851  7.718   -9.958  1.00 42.22 ? 382 LEU A CD1   1 
ATOM   3022  C CD2   . LEU A 1 382 ? 50.432  9.785   -9.688  1.00 41.61 ? 382 LEU A CD2   1 
ATOM   3023  N N     . PRO A 1 383 ? 55.343  9.427   -11.352 1.00 40.43 ? 383 PRO A N     1 
ATOM   3024  C CA    . PRO A 1 383 ? 55.677  9.926   -12.722 1.00 39.99 ? 383 PRO A CA    1 
ATOM   3025  C C     . PRO A 1 383 ? 54.498  10.643  -13.346 1.00 38.74 ? 383 PRO A C     1 
ATOM   3026  O O     . PRO A 1 383 ? 53.375  10.172  -13.240 1.00 39.08 ? 383 PRO A O     1 
ATOM   3027  C CB    . PRO A 1 383 ? 56.032  8.633   -13.545 1.00 38.53 ? 383 PRO A CB    1 
ATOM   3028  C CG    . PRO A 1 383 ? 56.576  7.679   -12.522 1.00 41.16 ? 383 PRO A CG    1 
ATOM   3029  C CD    . PRO A 1 383 ? 55.752  8.002   -11.185 1.00 40.99 ? 383 PRO A CD    1 
ATOM   3030  N N     . GLY A 1 384 ? 54.735  11.770  -13.995 1.00 37.79 ? 384 GLY A N     1 
ATOM   3031  C CA    . GLY A 1 384 ? 53.620  12.474  -14.642 1.00 38.08 ? 384 GLY A CA    1 
ATOM   3032  C C     . GLY A 1 384 ? 52.874  11.855  -15.839 1.00 37.87 ? 384 GLY A C     1 
ATOM   3033  O O     . GLY A 1 384 ? 51.913  12.437  -16.309 1.00 36.87 ? 384 GLY A O     1 
ATOM   3034  N N     . ASN A 1 385 ? 53.282  10.684  -16.317 1.00 38.86 ? 385 ASN A N     1 
ATOM   3035  C CA    . ASN A 1 385 ? 52.791  10.141  -17.629 1.00 41.20 ? 385 ASN A CA    1 
ATOM   3036  C C     . ASN A 1 385 ? 51.323  9.942   -17.762 1.00 40.73 ? 385 ASN A C     1 
ATOM   3037  O O     . ASN A 1 385 ? 50.706  10.261  -18.841 1.00 41.96 ? 385 ASN A O     1 
ATOM   3038  C CB    . ASN A 1 385 ? 53.470  8.788   -17.976 1.00 41.03 ? 385 ASN A CB    1 
ATOM   3039  C CG    . ASN A 1 385 ? 54.965  8.866   -17.847 1.00 46.32 ? 385 ASN A CG    1 
ATOM   3040  O OD1   . ASN A 1 385 ? 55.516  8.548   -16.803 1.00 50.60 ? 385 ASN A OD1   1 
ATOM   3041  N ND2   . ASN A 1 385 ? 55.630  9.363   -18.891 1.00 48.70 ? 385 ASN A ND2   1 
ATOM   3042  N N     . ALA A 1 386 ? 50.735  9.386   -16.712 1.00 39.10 ? 386 ALA A N     1 
ATOM   3043  C CA    . ALA A 1 386 ? 49.344  8.921   -16.840 1.00 38.50 ? 386 ALA A CA    1 
ATOM   3044  C C     . ALA A 1 386 ? 48.363  10.094  -16.786 1.00 38.04 ? 386 ALA A C     1 
ATOM   3045  O O     . ALA A 1 386 ? 47.123  9.892   -16.815 1.00 37.38 ? 386 ALA A O     1 
ATOM   3046  C CB    . ALA A 1 386 ? 49.039  7.888   -15.752 1.00 39.01 ? 386 ALA A CB    1 
ATOM   3047  N N     . PHE A 1 387 ? 48.899  11.323  -16.633 1.00 35.82 ? 387 PHE A N     1 
ATOM   3048  C CA    . PHE A 1 387 ? 48.017  12.484  -16.572 1.00 34.23 ? 387 PHE A CA    1 
ATOM   3049  C C     . PHE A 1 387 ? 47.867  13.145  -17.943 1.00 34.92 ? 387 PHE A C     1 
ATOM   3050  O O     . PHE A 1 387 ? 47.340  14.266  -18.020 1.00 34.88 ? 387 PHE A O     1 
ATOM   3051  C CB    . PHE A 1 387 ? 48.436  13.485  -15.455 1.00 33.93 ? 387 PHE A CB    1 
ATOM   3052  C CG    . PHE A 1 387 ? 48.448  12.850  -14.080 1.00 33.91 ? 387 PHE A CG    1 
ATOM   3053  C CD1   . PHE A 1 387 ? 49.644  12.296  -13.544 1.00 28.70 ? 387 PHE A CD1   1 
ATOM   3054  C CD2   . PHE A 1 387 ? 47.268  12.707  -13.384 1.00 30.71 ? 387 PHE A CD2   1 
ATOM   3055  C CE1   . PHE A 1 387 ? 49.628  11.604  -12.295 1.00 33.69 ? 387 PHE A CE1   1 
ATOM   3056  C CE2   . PHE A 1 387 ? 47.244  12.058  -12.128 1.00 34.79 ? 387 PHE A CE2   1 
ATOM   3057  C CZ    . PHE A 1 387 ? 48.427  11.502  -11.576 1.00 31.05 ? 387 PHE A CZ    1 
ATOM   3058  N N     . TYR A 1 388 ? 48.342  12.448  -18.989 1.00 34.77 ? 388 TYR A N     1 
ATOM   3059  C CA    . TYR A 1 388 ? 48.197  12.851  -20.377 1.00 36.96 ? 388 TYR A CA    1 
ATOM   3060  C C     . TYR A 1 388 ? 47.419  11.814  -21.232 1.00 38.25 ? 388 TYR A C     1 
ATOM   3061  O O     . TYR A 1 388 ? 47.480  10.621  -20.983 1.00 37.47 ? 388 TYR A O     1 
ATOM   3062  C CB    . TYR A 1 388 ? 49.565  13.115  -21.020 1.00 36.30 ? 388 TYR A CB    1 
ATOM   3063  C CG    . TYR A 1 388 ? 50.361  14.200  -20.315 1.00 37.50 ? 388 TYR A CG    1 
ATOM   3064  C CD1   . TYR A 1 388 ? 50.357  15.505  -20.803 1.00 32.54 ? 388 TYR A CD1   1 
ATOM   3065  C CD2   . TYR A 1 388 ? 51.097  13.911  -19.126 1.00 36.11 ? 388 TYR A CD2   1 
ATOM   3066  C CE1   . TYR A 1 388 ? 50.999  16.507  -20.139 1.00 35.29 ? 388 TYR A CE1   1 
ATOM   3067  C CE2   . TYR A 1 388 ? 51.759  14.909  -18.468 1.00 33.09 ? 388 TYR A CE2   1 
ATOM   3068  C CZ    . TYR A 1 388 ? 51.733  16.209  -18.984 1.00 34.56 ? 388 TYR A CZ    1 
ATOM   3069  O OH    . TYR A 1 388 ? 52.414  17.249  -18.354 1.00 38.86 ? 388 TYR A OH    1 
ATOM   3070  N N     . VAL A 1 389 ? 46.725  12.283  -22.265 1.00 38.87 ? 389 VAL A N     1 
ATOM   3071  C CA    . VAL A 1 389 ? 46.177  11.378  -23.256 1.00 40.18 ? 389 VAL A CA    1 
ATOM   3072  C C     . VAL A 1 389 ? 47.220  10.444  -23.878 1.00 41.33 ? 389 VAL A C     1 
ATOM   3073  O O     . VAL A 1 389 ? 47.019  9.237   -23.912 1.00 40.70 ? 389 VAL A O     1 
ATOM   3074  C CB    . VAL A 1 389 ? 45.381  12.104  -24.381 1.00 40.65 ? 389 VAL A CB    1 
ATOM   3075  C CG1   . VAL A 1 389 ? 44.805  11.031  -25.404 1.00 39.03 ? 389 VAL A CG1   1 
ATOM   3076  C CG2   . VAL A 1 389 ? 44.290  12.948  -23.771 1.00 37.08 ? 389 VAL A CG2   1 
ATOM   3077  N N     . ASP A 1 390 ? 48.304  10.990  -24.410 1.00 42.72 ? 390 ASP A N     1 
ATOM   3078  C CA    . ASP A 1 390 ? 49.362  10.098  -24.847 1.00 44.26 ? 390 ASP A CA    1 
ATOM   3079  C C     . ASP A 1 390 ? 50.302  9.921   -23.659 1.00 45.10 ? 390 ASP A C     1 
ATOM   3080  O O     . ASP A 1 390 ? 51.198  10.743  -23.437 1.00 43.72 ? 390 ASP A O     1 
ATOM   3081  C CB    . ASP A 1 390 ? 50.122  10.610  -26.075 1.00 46.00 ? 390 ASP A CB    1 
ATOM   3082  C CG    . ASP A 1 390 ? 51.393  9.789   -26.370 1.00 48.64 ? 390 ASP A CG    1 
ATOM   3083  O OD1   . ASP A 1 390 ? 52.001  10.016  -27.451 1.00 49.01 ? 390 ASP A OD1   1 
ATOM   3084  O OD2   . ASP A 1 390 ? 51.751  8.900   -25.530 1.00 49.86 ? 390 ASP A OD2   1 
ATOM   3085  N N     . SER A 1 391 ? 50.021  8.890   -22.864 1.00 44.63 ? 391 SER A N     1 
ATOM   3086  C CA    . SER A 1 391 ? 50.780  8.662   -21.657 1.00 46.68 ? 391 SER A CA    1 
ATOM   3087  C C     . SER A 1 391 ? 52.111  7.987   -21.958 1.00 46.72 ? 391 SER A C     1 
ATOM   3088  O O     . SER A 1 391 ? 52.849  7.703   -21.037 1.00 47.94 ? 391 SER A O     1 
ATOM   3089  C CB    . SER A 1 391 ? 49.987  7.787   -20.677 1.00 45.57 ? 391 SER A CB    1 
ATOM   3090  O OG    . SER A 1 391 ? 49.739  6.511   -21.249 1.00 46.93 ? 391 SER A OG    1 
ATOM   3091  N N     . SER A 1 392 ? 52.398  7.712   -23.240 1.00 47.56 ? 392 SER A N     1 
ATOM   3092  C CA    . SER A 1 392 ? 53.622  7.019   -23.632 1.00 47.56 ? 392 SER A CA    1 
ATOM   3093  C C     . SER A 1 392 ? 54.702  8.059   -23.865 1.00 47.45 ? 392 SER A C     1 
ATOM   3094  O O     . SER A 1 392 ? 55.867  7.760   -23.717 1.00 47.00 ? 392 SER A O     1 
ATOM   3095  C CB    . SER A 1 392 ? 53.416  6.179   -24.887 1.00 48.59 ? 392 SER A CB    1 
ATOM   3096  O OG    . SER A 1 392 ? 53.432  7.027   -26.044 1.00 51.42 ? 392 SER A OG    1 
ATOM   3097  N N     . ALA A 1 393 ? 54.306  9.288   -24.191 1.00 46.58 ? 393 ALA A N     1 
ATOM   3098  C CA    . ALA A 1 393 ? 55.245  10.404  -24.169 1.00 46.81 ? 393 ALA A CA    1 
ATOM   3099  C C     . ALA A 1 393 ? 55.971  10.524  -22.812 1.00 46.43 ? 393 ALA A C     1 
ATOM   3100  O O     . ALA A 1 393 ? 55.419  10.172  -21.758 1.00 47.68 ? 393 ALA A O     1 
ATOM   3101  C CB    . ALA A 1 393 ? 54.561  11.714  -24.535 1.00 45.73 ? 393 ALA A CB    1 
ATOM   3102  N N     . PRO A 1 394 ? 57.213  11.022  -22.846 1.00 45.71 ? 394 PRO A N     1 
ATOM   3103  C CA    . PRO A 1 394 ? 58.014  11.178  -21.667 1.00 43.70 ? 394 PRO A CA    1 
ATOM   3104  C C     . PRO A 1 394 ? 57.518  12.364  -20.905 1.00 42.17 ? 394 PRO A C     1 
ATOM   3105  O O     . PRO A 1 394 ? 57.265  13.415  -21.509 1.00 40.61 ? 394 PRO A O     1 
ATOM   3106  C CB    . PRO A 1 394 ? 59.391  11.520  -22.208 1.00 43.72 ? 394 PRO A CB    1 
ATOM   3107  C CG    . PRO A 1 394 ? 59.304  11.542  -23.669 1.00 46.02 ? 394 PRO A CG    1 
ATOM   3108  C CD    . PRO A 1 394 ? 57.905  11.495  -24.070 1.00 46.32 ? 394 PRO A CD    1 
ATOM   3109  N N     . SER A 1 395 ? 57.374  12.220  -19.593 1.00 39.84 ? 395 SER A N     1 
ATOM   3110  C CA    . SER A 1 395 ? 57.084  13.418  -18.774 1.00 39.79 ? 395 SER A CA    1 
ATOM   3111  C C     . SER A 1 395 ? 58.227  13.725  -17.773 1.00 38.44 ? 395 SER A C     1 
ATOM   3112  O O     . SER A 1 395 ? 58.673  12.837  -17.036 1.00 39.31 ? 395 SER A O     1 
ATOM   3113  C CB    . SER A 1 395 ? 55.694  13.339  -18.133 1.00 39.22 ? 395 SER A CB    1 
ATOM   3114  O OG    . SER A 1 395 ? 55.736  13.567  -16.721 1.00 40.31 ? 395 SER A OG    1 
ATOM   3115  N N     . PRO A 1 396 ? 58.737  14.958  -17.775 1.00 36.98 ? 396 PRO A N     1 
ATOM   3116  C CA    . PRO A 1 396 ? 59.736  15.237  -16.766 1.00 36.54 ? 396 PRO A CA    1 
ATOM   3117  C C     . PRO A 1 396 ? 59.169  15.598  -15.372 1.00 35.28 ? 396 PRO A C     1 
ATOM   3118  O O     . PRO A 1 396 ? 59.944  15.982  -14.480 1.00 35.60 ? 396 PRO A O     1 
ATOM   3119  C CB    . PRO A 1 396 ? 60.518  16.394  -17.385 1.00 36.18 ? 396 PRO A CB    1 
ATOM   3120  C CG    . PRO A 1 396 ? 59.554  17.108  -18.181 1.00 36.92 ? 396 PRO A CG    1 
ATOM   3121  C CD    . PRO A 1 396 ? 58.478  16.127  -18.619 1.00 37.25 ? 396 PRO A CD    1 
ATOM   3122  N N     . TYR A 1 397 ? 57.861  15.415  -15.162 1.00 34.84 ? 397 TYR A N     1 
ATOM   3123  C CA    . TYR A 1 397 ? 57.155  15.817  -13.925 1.00 33.81 ? 397 TYR A CA    1 
ATOM   3124  C C     . TYR A 1 397 ? 56.879  14.705  -12.957 1.00 33.69 ? 397 TYR A C     1 
ATOM   3125  O O     . TYR A 1 397 ? 56.654  13.600  -13.387 1.00 35.38 ? 397 TYR A O     1 
ATOM   3126  C CB    . TYR A 1 397 ? 55.785  16.425  -14.226 1.00 32.87 ? 397 TYR A CB    1 
ATOM   3127  C CG    . TYR A 1 397 ? 55.797  17.763  -14.939 1.00 33.86 ? 397 TYR A CG    1 
ATOM   3128  C CD1   . TYR A 1 397 ? 55.886  17.796  -16.331 1.00 31.65 ? 397 TYR A CD1   1 
ATOM   3129  C CD2   . TYR A 1 397 ? 55.632  18.995  -14.230 1.00 32.35 ? 397 TYR A CD2   1 
ATOM   3130  C CE1   . TYR A 1 397 ? 55.774  18.986  -17.038 1.00 33.52 ? 397 TYR A CE1   1 
ATOM   3131  C CE2   . TYR A 1 397 ? 55.625  20.213  -14.911 1.00 35.76 ? 397 TYR A CE2   1 
ATOM   3132  C CZ    . TYR A 1 397 ? 55.704  20.201  -16.328 1.00 34.53 ? 397 TYR A CZ    1 
ATOM   3133  O OH    . TYR A 1 397 ? 55.677  21.356  -17.089 1.00 36.10 ? 397 TYR A OH    1 
ATOM   3134  N N     . LEU A 1 398 ? 56.874  15.031  -11.656 1.00 33.42 ? 398 LEU A N     1 
ATOM   3135  C CA    . LEU A 1 398 ? 56.330  14.215  -10.585 1.00 33.50 ? 398 LEU A CA    1 
ATOM   3136  C C     . LEU A 1 398 ? 55.223  14.893  -9.812  1.00 32.83 ? 398 LEU A C     1 
ATOM   3137  O O     . LEU A 1 398 ? 55.341  16.049  -9.504  1.00 33.69 ? 398 LEU A O     1 
ATOM   3138  C CB    . LEU A 1 398 ? 57.434  14.014  -9.529  1.00 33.85 ? 398 LEU A CB    1 
ATOM   3139  C CG    . LEU A 1 398 ? 58.695  13.479  -10.168 1.00 32.79 ? 398 LEU A CG    1 
ATOM   3140  C CD1   . LEU A 1 398 ? 59.789  13.572  -9.167  1.00 28.06 ? 398 LEU A CD1   1 
ATOM   3141  C CD2   . LEU A 1 398 ? 58.409  11.992  -10.727 1.00 28.84 ? 398 LEU A CD2   1 
ATOM   3142  N N     . ARG A 1 399 ? 54.180  14.158  -9.443  1.00 34.11 ? 399 ARG A N     1 
ATOM   3143  C CA    . ARG A 1 399 ? 53.169  14.576  -8.436  1.00 33.63 ? 399 ARG A CA    1 
ATOM   3144  C C     . ARG A 1 399 ? 53.560  13.999  -7.081  1.00 33.83 ? 399 ARG A C     1 
ATOM   3145  O O     . ARG A 1 399 ? 53.858  12.796  -6.883  1.00 32.58 ? 399 ARG A O     1 
ATOM   3146  C CB    . ARG A 1 399 ? 51.778  14.080  -8.831  1.00 33.74 ? 399 ARG A CB    1 
ATOM   3147  C CG    . ARG A 1 399 ? 50.520  14.705  -8.122  1.00 33.72 ? 399 ARG A CG    1 
ATOM   3148  C CD    . ARG A 1 399 ? 49.269  13.731  -8.352  1.00 35.15 ? 399 ARG A CD    1 
ATOM   3149  N NE    . ARG A 1 399 ? 49.240  12.547  -7.465  1.00 39.40 ? 399 ARG A NE    1 
ATOM   3150  C CZ    . ARG A 1 399 ? 48.337  11.537  -7.500  1.00 38.80 ? 399 ARG A CZ    1 
ATOM   3151  N NH1   . ARG A 1 399 ? 47.372  11.504  -8.427  1.00 35.57 ? 399 ARG A NH1   1 
ATOM   3152  N NH2   . ARG A 1 399 ? 48.424  10.537  -6.604  1.00 29.88 ? 399 ARG A NH2   1 
ATOM   3153  N N     . ALA A 1 400 ? 53.569  14.867  -6.106  1.00 34.40 ? 400 ALA A N     1 
ATOM   3154  C CA    . ALA A 1 400 ? 53.948  14.422  -4.784  1.00 33.24 ? 400 ALA A CA    1 
ATOM   3155  C C     . ALA A 1 400 ? 52.754  14.802  -3.948  1.00 33.20 ? 400 ALA A C     1 
ATOM   3156  O O     . ALA A 1 400 ? 52.279  15.945  -3.992  1.00 34.34 ? 400 ALA A O     1 
ATOM   3157  C CB    . ALA A 1 400 ? 55.246  15.162  -4.347  1.00 31.71 ? 400 ALA A CB    1 
ATOM   3158  N N     . SER A 1 401 ? 52.288  13.866  -3.160  1.00 33.56 ? 401 SER A N     1 
ATOM   3159  C CA    . SER A 1 401 ? 51.108  14.087  -2.311  1.00 34.01 ? 401 SER A CA    1 
ATOM   3160  C C     . SER A 1 401 ? 51.540  14.663  -0.972  1.00 33.10 ? 401 SER A C     1 
ATOM   3161  O O     . SER A 1 401 ? 52.522  14.157  -0.376  1.00 32.29 ? 401 SER A O     1 
ATOM   3162  C CB    . SER A 1 401 ? 50.324  12.776  -2.064  1.00 32.26 ? 401 SER A CB    1 
ATOM   3163  O OG    . SER A 1 401 ? 49.219  13.105  -1.153  1.00 39.34 ? 401 SER A OG    1 
ATOM   3164  N N     . PHE A 1 402 ? 50.839  15.705  -0.496  1.00 31.72 ? 402 PHE A N     1 
ATOM   3165  C CA    . PHE A 1 402 ? 51.136  16.207  0.861   1.00 32.71 ? 402 PHE A CA    1 
ATOM   3166  C C     . PHE A 1 402 ? 50.037  15.970  1.892   1.00 33.08 ? 402 PHE A C     1 
ATOM   3167  O O     . PHE A 1 402 ? 50.021  16.628  2.911   1.00 33.53 ? 402 PHE A O     1 
ATOM   3168  C CB    . PHE A 1 402 ? 51.600  17.713  0.929   1.00 29.58 ? 402 PHE A CB    1 
ATOM   3169  C CG    . PHE A 1 402 ? 50.660  18.654  0.319   1.00 29.82 ? 402 PHE A CG    1 
ATOM   3170  C CD1   . PHE A 1 402 ? 49.586  19.156  1.034   1.00 30.43 ? 402 PHE A CD1   1 
ATOM   3171  C CD2   . PHE A 1 402 ? 50.862  19.102  -0.995  1.00 28.62 ? 402 PHE A CD2   1 
ATOM   3172  C CE1   . PHE A 1 402 ? 48.734  20.080  0.453   1.00 23.57 ? 402 PHE A CE1   1 
ATOM   3173  C CE2   . PHE A 1 402 ? 50.010  19.985  -1.551  1.00 27.95 ? 402 PHE A CE2   1 
ATOM   3174  C CZ    . PHE A 1 402 ? 48.940  20.438  -0.872  1.00 24.98 ? 402 PHE A CZ    1 
ATOM   3175  N N     . SER A 1 403 ? 49.145  15.023  1.641   1.00 35.33 ? 403 SER A N     1 
ATOM   3176  C CA    . SER A 1 403 ? 47.970  14.872  2.514   1.00 35.04 ? 403 SER A CA    1 
ATOM   3177  C C     . SER A 1 403 ? 48.327  14.212  3.808   1.00 36.16 ? 403 SER A C     1 
ATOM   3178  O O     . SER A 1 403 ? 47.613  14.398  4.760   1.00 37.13 ? 403 SER A O     1 
ATOM   3179  C CB    . SER A 1 403 ? 46.875  14.055  1.839   1.00 34.87 ? 403 SER A CB    1 
ATOM   3180  O OG    . SER A 1 403 ? 47.177  12.646  1.877   1.00 32.25 ? 403 SER A OG    1 
ATOM   3181  N N     . SER A 1 404 ? 49.414  13.424  3.827   1.00 37.71 ? 404 SER A N     1 
ATOM   3182  C CA    . SER A 1 404 ? 49.722  12.464  4.920   1.00 38.04 ? 404 SER A CA    1 
ATOM   3183  C C     . SER A 1 404 ? 51.122  12.480  5.590   1.00 37.81 ? 404 SER A C     1 
ATOM   3184  O O     . SER A 1 404 ? 51.214  12.240  6.770   1.00 37.53 ? 404 SER A O     1 
ATOM   3185  C CB    . SER A 1 404 ? 49.427  11.044  4.430   1.00 38.68 ? 404 SER A CB    1 
ATOM   3186  O OG    . SER A 1 404 ? 48.090  10.984  3.896   1.00 42.27 ? 404 SER A OG    1 
ATOM   3187  N N     . ALA A 1 405 ? 52.185  12.781  4.835   1.00 38.10 ? 405 ALA A N     1 
ATOM   3188  C CA    . ALA A 1 405 ? 53.570  12.622  5.288   1.00 37.13 ? 405 ALA A CA    1 
ATOM   3189  C C     . ALA A 1 405 ? 53.887  13.726  6.291   1.00 37.25 ? 405 ALA A C     1 
ATOM   3190  O O     . ALA A 1 405 ? 53.344  14.826  6.159   1.00 37.28 ? 405 ALA A O     1 
ATOM   3191  C CB    . ALA A 1 405 ? 54.560  12.635  4.102   1.00 35.17 ? 405 ALA A CB    1 
ATOM   3192  N N     . SER A 1 406 ? 54.655  13.384  7.334   1.00 36.22 ? 406 SER A N     1 
ATOM   3193  C CA    . SER A 1 406 ? 55.143  14.359  8.318   1.00 36.94 ? 406 SER A CA    1 
ATOM   3194  C C     . SER A 1 406 ? 56.248  15.095  7.648   1.00 37.40 ? 406 SER A C     1 
ATOM   3195  O O     . SER A 1 406 ? 56.853  14.512  6.741   1.00 39.17 ? 406 SER A O     1 
ATOM   3196  C CB    . SER A 1 406 ? 55.799  13.667  9.516   1.00 35.67 ? 406 SER A CB    1 
ATOM   3197  O OG    . SER A 1 406 ? 57.138  13.315  9.190   1.00 35.70 ? 406 SER A OG    1 
ATOM   3198  N N     . PRO A 1 407 ? 56.537  16.335  8.093   1.00 37.63 ? 407 PRO A N     1 
ATOM   3199  C CA    . PRO A 1 407 ? 57.680  17.128  7.578   1.00 38.64 ? 407 PRO A CA    1 
ATOM   3200  C C     . PRO A 1 407 ? 59.004  16.394  7.570   1.00 39.26 ? 407 PRO A C     1 
ATOM   3201  O O     . PRO A 1 407 ? 59.772  16.559  6.651   1.00 40.69 ? 407 PRO A O     1 
ATOM   3202  C CB    . PRO A 1 407 ? 57.754  18.366  8.498   1.00 37.16 ? 407 PRO A CB    1 
ATOM   3203  C CG    . PRO A 1 407 ? 56.520  18.290  9.422   1.00 37.58 ? 407 PRO A CG    1 
ATOM   3204  C CD    . PRO A 1 407 ? 55.735  17.063  9.124   1.00 37.99 ? 407 PRO A CD    1 
ATOM   3205  N N     . GLU A 1 408 ? 59.281  15.582  8.568   1.00 41.24 ? 408 GLU A N     1 
ATOM   3206  C CA    . GLU A 1 408 ? 60.470  14.758  8.508   1.00 42.27 ? 408 GLU A CA    1 
ATOM   3207  C C     . GLU A 1 408 ? 60.402  13.837  7.265   1.00 41.92 ? 408 GLU A C     1 
ATOM   3208  O O     . GLU A 1 408 ? 61.402  13.723  6.493   1.00 41.91 ? 408 GLU A O     1 
ATOM   3209  C CB    . GLU A 1 408 ? 60.605  13.952  9.800   1.00 43.35 ? 408 GLU A CB    1 
ATOM   3210  C CG    . GLU A 1 408 ? 60.427  14.774  11.118  1.00 49.32 ? 408 GLU A CG    1 
ATOM   3211  C CD    . GLU A 1 408 ? 58.960  14.864  11.635  1.00 55.59 ? 408 GLU A CD    1 
ATOM   3212  O OE1   . GLU A 1 408 ? 58.540  15.932  12.148  1.00 56.19 ? 408 GLU A OE1   1 
ATOM   3213  O OE2   . GLU A 1 408 ? 58.231  13.851  11.554  1.00 60.05 ? 408 GLU A OE2   1 
ATOM   3214  N N     . GLN A 1 409 ? 59.236  13.202  7.040   1.00 40.28 ? 409 GLN A N     1 
ATOM   3215  C CA    . GLN A 1 409 ? 59.149  12.236  5.962   1.00 39.75 ? 409 GLN A CA    1 
ATOM   3216  C C     . GLN A 1 409 ? 59.324  12.954  4.592   1.00 38.00 ? 409 GLN A C     1 
ATOM   3217  O O     . GLN A 1 409 ? 60.015  12.474  3.748   1.00 37.33 ? 409 GLN A O     1 
ATOM   3218  C CB    . GLN A 1 409 ? 57.864  11.407  6.031   1.00 39.18 ? 409 GLN A CB    1 
ATOM   3219  C CG    . GLN A 1 409 ? 57.697  10.447  7.219   1.00 40.60 ? 409 GLN A CG    1 
ATOM   3220  C CD    . GLN A 1 409 ? 56.323  9.743   7.145   1.00 42.24 ? 409 GLN A CD    1 
ATOM   3221  O OE1   . GLN A 1 409 ? 55.317  10.387  6.817   1.00 42.71 ? 409 GLN A OE1   1 
ATOM   3222  N NE2   . GLN A 1 409 ? 56.282  8.425   7.402   1.00 40.67 ? 409 GLN A NE2   1 
ATOM   3223  N N     . MET A 1 410 ? 58.724  14.112  4.416   1.00 37.61 ? 410 MET A N     1 
ATOM   3224  C CA    . MET A 1 410 ? 59.009  15.005  3.271   1.00 38.29 ? 410 MET A CA    1 
ATOM   3225  C C     . MET A 1 410 ? 60.477  15.385  3.081   1.00 39.23 ? 410 MET A C     1 
ATOM   3226  O O     . MET A 1 410 ? 61.053  15.285  1.931   1.00 37.66 ? 410 MET A O     1 
ATOM   3227  C CB    . MET A 1 410 ? 58.215  16.290  3.434   1.00 37.62 ? 410 MET A CB    1 
ATOM   3228  C CG    . MET A 1 410 ? 56.834  16.083  3.082   1.00 35.08 ? 410 MET A CG    1 
ATOM   3229  S SD    . MET A 1 410 ? 55.945  17.405  3.794   1.00 37.87 ? 410 MET A SD    1 
ATOM   3230  C CE    . MET A 1 410 ? 54.300  16.693  3.672   1.00 34.74 ? 410 MET A CE    1 
ATOM   3231  N N     . ASP A 1 411 ? 61.081  15.774  4.213   1.00 39.59 ? 411 ASP A N     1 
ATOM   3232  C CA    . ASP A 1 411 ? 62.521  16.038  4.267   1.00 42.18 ? 411 ASP A CA    1 
ATOM   3233  C C     . ASP A 1 411 ? 63.363  14.882  3.809   1.00 41.92 ? 411 ASP A C     1 
ATOM   3234  O O     . ASP A 1 411 ? 64.154  15.053  2.911   1.00 44.45 ? 411 ASP A O     1 
ATOM   3235  C CB    . ASP A 1 411 ? 63.016  16.471  5.650   1.00 42.98 ? 411 ASP A CB    1 
ATOM   3236  C CG    . ASP A 1 411 ? 64.321  17.319  5.552   1.00 47.53 ? 411 ASP A CG    1 
ATOM   3237  O OD1   . ASP A 1 411 ? 65.385  16.886  6.074   1.00 49.50 ? 411 ASP A OD1   1 
ATOM   3238  O OD2   . ASP A 1 411 ? 64.276  18.412  4.932   1.00 47.87 ? 411 ASP A OD2   1 
ATOM   3239  N N     . VAL A 1 412 ? 63.210  13.699  4.396   1.00 41.31 ? 412 VAL A N     1 
ATOM   3240  C CA    . VAL A 1 412 ? 63.976  12.570  3.898   1.00 40.34 ? 412 VAL A CA    1 
ATOM   3241  C C     . VAL A 1 412 ? 63.674  12.318  2.386   1.00 39.97 ? 412 VAL A C     1 
ATOM   3242  O O     . VAL A 1 412 ? 64.581  12.142  1.588   1.00 38.81 ? 412 VAL A O     1 
ATOM   3243  C CB    . VAL A 1 412 ? 63.731  11.241  4.729   1.00 40.23 ? 412 VAL A CB    1 
ATOM   3244  C CG1   . VAL A 1 412 ? 64.460  10.077  4.105   1.00 39.18 ? 412 VAL A CG1   1 
ATOM   3245  C CG2   . VAL A 1 412 ? 64.153  11.373  6.206   1.00 42.31 ? 412 VAL A CG2   1 
ATOM   3246  N N     . ALA A 1 413 ? 62.395  12.237  2.033   1.00 39.40 ? 413 ALA A N     1 
ATOM   3247  C CA    . ALA A 1 413 ? 61.971  12.062  0.616   1.00 39.30 ? 413 ALA A CA    1 
ATOM   3248  C C     . ALA A 1 413 ? 62.704  13.019  -0.400  1.00 38.24 ? 413 ALA A C     1 
ATOM   3249  O O     . ALA A 1 413 ? 63.256  12.603  -1.411  1.00 36.48 ? 413 ALA A O     1 
ATOM   3250  C CB    . ALA A 1 413 ? 60.434  12.274  0.547   1.00 37.63 ? 413 ALA A CB    1 
ATOM   3251  N N     . PHE A 1 414 ? 62.669  14.310  -0.106  1.00 39.51 ? 414 PHE A N     1 
ATOM   3252  C CA    . PHE A 1 414 ? 63.226  15.315  -0.979  1.00 39.76 ? 414 PHE A CA    1 
ATOM   3253  C C     . PHE A 1 414 ? 64.746  15.384  -0.970  1.00 40.74 ? 414 PHE A C     1 
ATOM   3254  O O     . PHE A 1 414 ? 65.311  15.796  -1.967  1.00 41.08 ? 414 PHE A O     1 
ATOM   3255  C CB    . PHE A 1 414 ? 62.660  16.661  -0.607  1.00 41.42 ? 414 PHE A CB    1 
ATOM   3256  C CG    . PHE A 1 414 ? 61.422  17.015  -1.350  1.00 40.27 ? 414 PHE A CG    1 
ATOM   3257  C CD1   . PHE A 1 414 ? 60.291  17.346  -0.684  1.00 42.27 ? 414 PHE A CD1   1 
ATOM   3258  C CD2   . PHE A 1 414 ? 61.411  17.027  -2.731  1.00 41.65 ? 414 PHE A CD2   1 
ATOM   3259  C CE1   . PHE A 1 414 ? 59.142  17.695  -1.364  1.00 45.18 ? 414 PHE A CE1   1 
ATOM   3260  C CE2   . PHE A 1 414 ? 60.263  17.389  -3.428  1.00 43.40 ? 414 PHE A CE2   1 
ATOM   3261  C CZ    . PHE A 1 414 ? 59.120  17.710  -2.731  1.00 43.77 ? 414 PHE A CZ    1 
ATOM   3262  N N     . GLN A 1 415 ? 65.386  15.043  0.169   1.00 40.35 ? 415 GLN A N     1 
ATOM   3263  C CA    . GLN A 1 415 ? 66.823  14.641  0.233   1.00 41.01 ? 415 GLN A CA    1 
ATOM   3264  C C     . GLN A 1 415 ? 67.263  13.501  -0.720  1.00 38.85 ? 415 GLN A C     1 
ATOM   3265  O O     . GLN A 1 415 ? 68.173  13.669  -1.519  1.00 38.42 ? 415 GLN A O     1 
ATOM   3266  C CB    . GLN A 1 415 ? 67.226  14.271  1.679   1.00 40.87 ? 415 GLN A CB    1 
ATOM   3267  C CG    . GLN A 1 415 ? 68.588  13.576  1.822   1.00 41.36 ? 415 GLN A CG    1 
ATOM   3268  C CD    . GLN A 1 415 ? 69.017  13.336  3.293   1.00 44.89 ? 415 GLN A CD    1 
ATOM   3269  O OE1   . GLN A 1 415 ? 70.220  13.214  3.552   1.00 51.29 ? 415 GLN A OE1   1 
ATOM   3270  N NE2   . GLN A 1 415 ? 68.049  13.296  4.265   1.00 47.53 ? 415 GLN A NE2   1 
ATOM   3271  N N     . VAL A 1 416 ? 66.623  12.358  -0.616  1.00 37.91 ? 416 VAL A N     1 
ATOM   3272  C CA    . VAL A 1 416 ? 66.902  11.204  -1.472  1.00 38.23 ? 416 VAL A CA    1 
ATOM   3273  C C     . VAL A 1 416 ? 66.674  11.556  -2.960  1.00 37.24 ? 416 VAL A C     1 
ATOM   3274  O O     . VAL A 1 416 ? 67.561  11.349  -3.794  1.00 38.64 ? 416 VAL A O     1 
ATOM   3275  C CB    . VAL A 1 416 ? 65.974  10.039  -1.065  1.00 38.11 ? 416 VAL A CB    1 
ATOM   3276  C CG1   . VAL A 1 416 ? 66.252  8.796   -1.871  1.00 39.16 ? 416 VAL A CG1   1 
ATOM   3277  C CG2   . VAL A 1 416 ? 66.150  9.728   0.382   1.00 41.87 ? 416 VAL A CG2   1 
ATOM   3278  N N     . LEU A 1 417 ? 65.491  12.097  -3.278  1.00 36.22 ? 417 LEU A N     1 
ATOM   3279  C CA    . LEU A 1 417 ? 65.187  12.595  -4.614  1.00 36.47 ? 417 LEU A CA    1 
ATOM   3280  C C     . LEU A 1 417 ? 66.212  13.584  -5.146  1.00 36.83 ? 417 LEU A C     1 
ATOM   3281  O O     . LEU A 1 417 ? 66.645  13.450  -6.276  1.00 37.54 ? 417 LEU A O     1 
ATOM   3282  C CB    . LEU A 1 417 ? 63.837  13.301  -4.624  1.00 35.83 ? 417 LEU A CB    1 
ATOM   3283  C CG    . LEU A 1 417 ? 62.910  13.391  -5.835  1.00 36.45 ? 417 LEU A CG    1 
ATOM   3284  C CD1   . LEU A 1 417 ? 62.170  14.721  -5.809  1.00 37.27 ? 417 LEU A CD1   1 
ATOM   3285  C CD2   . LEU A 1 417 ? 63.524  13.213  -7.150  1.00 32.93 ? 417 LEU A CD2   1 
ATOM   3286  N N     . ALA A 1 418 ? 66.534  14.637  -4.387  1.00 36.93 ? 418 ALA A N     1 
ATOM   3287  C CA    . ALA A 1 418 ? 67.424  15.659  -4.955  1.00 37.64 ? 418 ALA A CA    1 
ATOM   3288  C C     . ALA A 1 418 ? 68.685  14.954  -5.396  1.00 37.55 ? 418 ALA A C     1 
ATOM   3289  O O     . ALA A 1 418 ? 69.064  15.071  -6.528  1.00 37.71 ? 418 ALA A O     1 
ATOM   3290  C CB    . ALA A 1 418 ? 67.753  16.776  -3.954  1.00 37.44 ? 418 ALA A CB    1 
ATOM   3291  N N     . GLN A 1 419 ? 69.318  14.167  -4.522  1.00 38.49 ? 419 GLN A N     1 
ATOM   3292  C CA    . GLN A 1 419 ? 70.488  13.434  -4.957  1.00 38.92 ? 419 GLN A CA    1 
ATOM   3293  C C     . GLN A 1 419 ? 70.373  12.380  -6.048  1.00 39.46 ? 419 GLN A C     1 
ATOM   3294  O O     . GLN A 1 419 ? 71.353  12.119  -6.720  1.00 40.30 ? 419 GLN A O     1 
ATOM   3295  C CB    . GLN A 1 419 ? 71.216  12.936  -3.789  1.00 40.13 ? 419 GLN A CB    1 
ATOM   3296  C CG    . GLN A 1 419 ? 71.529  14.179  -2.946  1.00 44.86 ? 419 GLN A CG    1 
ATOM   3297  C CD    . GLN A 1 419 ? 70.757  14.183  -1.631  1.00 46.47 ? 419 GLN A CD    1 
ATOM   3298  O OE1   . GLN A 1 419 ? 70.488  15.240  -1.031  1.00 40.39 ? 419 GLN A OE1   1 
ATOM   3299  N NE2   . GLN A 1 419 ? 70.478  12.952  -1.120  1.00 47.80 ? 419 GLN A NE2   1 
ATOM   3300  N N     . LEU A 1 420 ? 69.206  11.799  -6.251  1.00 38.38 ? 420 LEU A N     1 
ATOM   3301  C CA    . LEU A 1 420 ? 69.046  10.889  -7.391  1.00 39.42 ? 420 LEU A CA    1 
ATOM   3302  C C     . LEU A 1 420 ? 68.917  11.693  -8.663  1.00 39.52 ? 420 LEU A C     1 
ATOM   3303  O O     . LEU A 1 420 ? 69.375  11.260  -9.710  1.00 39.93 ? 420 LEU A O     1 
ATOM   3304  C CB    . LEU A 1 420 ? 67.852  9.946   -7.207  1.00 37.29 ? 420 LEU A CB    1 
ATOM   3305  C CG    . LEU A 1 420 ? 68.070  8.925   -6.092  1.00 42.27 ? 420 LEU A CG    1 
ATOM   3306  C CD1   . LEU A 1 420 ? 66.796  8.367   -5.505  1.00 41.46 ? 420 LEU A CD1   1 
ATOM   3307  C CD2   . LEU A 1 420 ? 69.083  7.728   -6.489  1.00 39.49 ? 420 LEU A CD2   1 
ATOM   3308  N N     . ILE A 1 421 ? 68.285  12.856  -8.599  1.00 40.26 ? 421 ILE A N     1 
ATOM   3309  C CA    . ILE A 1 421 ? 68.400  13.790  -9.746  1.00 40.48 ? 421 ILE A CA    1 
ATOM   3310  C C     . ILE A 1 421 ? 69.869  14.151  -10.120 1.00 41.60 ? 421 ILE A C     1 
ATOM   3311  O O     . ILE A 1 421 ? 70.282  14.024  -11.275 1.00 41.66 ? 421 ILE A O     1 
ATOM   3312  C CB    . ILE A 1 421 ? 67.499  15.017  -9.592  1.00 40.49 ? 421 ILE A CB    1 
ATOM   3313  C CG1   . ILE A 1 421 ? 66.027  14.540  -9.546  1.00 40.42 ? 421 ILE A CG1   1 
ATOM   3314  C CG2   . ILE A 1 421 ? 67.807  16.088  -10.737 1.00 39.53 ? 421 ILE A CG2   1 
ATOM   3315  C CD1   . ILE A 1 421 ? 64.991  15.622  -9.162  1.00 37.26 ? 421 ILE A CD1   1 
ATOM   3316  N N     . LYS A 1 422 ? 70.665  14.588  -9.154  1.00 42.70 ? 422 LYS A N     1 
ATOM   3317  C CA    . LYS A 1 422 ? 72.060  14.944  -9.475  1.00 42.89 ? 422 LYS A CA    1 
ATOM   3318  C C     . LYS A 1 422 ? 72.899  13.771  -9.944  1.00 45.10 ? 422 LYS A C     1 
ATOM   3319  O O     . LYS A 1 422 ? 73.787  13.945  -10.793 1.00 45.55 ? 422 LYS A O     1 
ATOM   3320  C CB    . LYS A 1 422 ? 72.747  15.603  -8.314  1.00 40.60 ? 422 LYS A CB    1 
ATOM   3321  C CG    . LYS A 1 422 ? 72.043  16.809  -7.862  1.00 38.64 ? 422 LYS A CG    1 
ATOM   3322  C CD    . LYS A 1 422 ? 72.802  17.452  -6.710  1.00 36.35 ? 422 LYS A CD    1 
ATOM   3323  C CE    . LYS A 1 422 ? 72.551  16.750  -5.360  1.00 35.38 ? 422 LYS A CE    1 
ATOM   3324  N NZ    . LYS A 1 422 ? 73.112  17.592  -4.217  1.00 35.43 ? 422 LYS A NZ    1 
ATOM   3325  N N     . GLU A 1 423 ? 72.669  12.589  -9.375  1.00 46.90 ? 423 GLU A N     1 
ATOM   3326  C CA    . GLU A 1 423 ? 73.355  11.363  -9.877  1.00 49.19 ? 423 GLU A CA    1 
ATOM   3327  C C     . GLU A 1 423 ? 72.804  10.884  -11.261 1.00 49.98 ? 423 GLU A C     1 
ATOM   3328  O O     . GLU A 1 423 ? 73.171  9.814   -11.743 1.00 50.19 ? 423 GLU A O     1 
ATOM   3329  C CB    . GLU A 1 423 ? 73.236  10.237  -8.859  1.00 48.54 ? 423 GLU A CB    1 
ATOM   3330  C CG    . GLU A 1 423 ? 74.418  10.121  -7.920  1.00 50.94 ? 423 GLU A CG    1 
ATOM   3331  C CD    . GLU A 1 423 ? 74.092  9.277   -6.701  1.00 55.08 ? 423 GLU A CD    1 
ATOM   3332  O OE1   . GLU A 1 423 ? 73.145  8.419   -6.811  1.00 50.36 ? 423 GLU A OE1   1 
ATOM   3333  O OE2   . GLU A 1 423 ? 74.776  9.499   -5.648  1.00 54.43 ? 423 GLU A OE2   1 
ATOM   3334  N N     . SER A 1 424 ? 71.898  11.665  -11.851 1.00 50.46 ? 424 SER A N     1 
ATOM   3335  C CA    . SER A 1 424 ? 71.296  11.354  -13.148 1.00 52.30 ? 424 SER A CA    1 
ATOM   3336  C C     . SER A 1 424 ? 71.662  12.389  -14.217 1.00 53.37 ? 424 SER A C     1 
ATOM   3337  O O     . SER A 1 424 ? 71.648  12.050  -15.411 1.00 54.28 ? 424 SER A O     1 
ATOM   3338  C CB    . SER A 1 424 ? 69.776  11.196  -13.051 1.00 52.35 ? 424 SER A CB    1 
ATOM   3339  O OG    . SER A 1 424 ? 69.404  10.392  -11.925 1.00 52.26 ? 424 SER A OG    1 
ATOM   3340  N N     . LEU A 1 425 ? 72.043  13.607  -13.798 1.00 53.97 ? 425 LEU A N     1 
ATOM   3341  C CA    . LEU A 1 425 ? 72.327  14.711  -14.741 1.00 54.86 ? 425 LEU A CA    1 
ATOM   3342  C C     . LEU A 1 425 ? 73.515  14.494  -15.693 1.00 55.61 ? 425 LEU A C     1 
ATOM   3343  O O     . LEU A 1 425 ? 74.475  13.749  -15.396 1.00 56.91 ? 425 LEU A O     1 
ATOM   3344  C CB    . LEU A 1 425 ? 72.467  16.055  -14.002 1.00 55.02 ? 425 LEU A CB    1 
ATOM   3345  C CG    . LEU A 1 425 ? 71.150  16.776  -13.621 1.00 55.32 ? 425 LEU A CG    1 
ATOM   3346  C CD1   . LEU A 1 425 ? 71.339  17.878  -12.536 1.00 51.10 ? 425 LEU A CD1   1 
ATOM   3347  C CD2   . LEU A 1 425 ? 70.456  17.334  -14.876 1.00 54.51 ? 425 LEU A CD2   1 
ATOM   3348  N N     . MET B 1 1   ? 36.559  -21.070 -24.746 1.00 41.76 ? 1   MET B N     1 
ATOM   3349  C CA    . MET B 1 1   ? 35.752  -20.305 -25.689 1.00 40.88 ? 1   MET B CA    1 
ATOM   3350  C C     . MET B 1 1   ? 36.228  -18.859 -25.774 1.00 40.06 ? 1   MET B C     1 
ATOM   3351  O O     . MET B 1 1   ? 37.283  -18.510 -25.246 1.00 39.05 ? 1   MET B O     1 
ATOM   3352  C CB    . MET B 1 1   ? 34.275  -20.350 -25.290 1.00 41.84 ? 1   MET B CB    1 
ATOM   3353  C CG    . MET B 1 1   ? 33.996  -19.839 -23.886 1.00 41.29 ? 1   MET B CG    1 
ATOM   3354  S SD    . MET B 1 1   ? 32.296  -20.136 -23.362 1.00 41.64 ? 1   MET B SD    1 
ATOM   3355  C CE    . MET B 1 1   ? 31.591  -18.501 -23.557 1.00 36.83 ? 1   MET B CE    1 
ATOM   3356  N N     . ASN B 1 2   ? 35.442  -18.021 -26.443 1.00 38.45 ? 2   ASN B N     1 
ATOM   3357  C CA    . ASN B 1 2   ? 35.963  -16.795 -27.047 1.00 36.89 ? 2   ASN B CA    1 
ATOM   3358  C C     . ASN B 1 2   ? 35.274  -15.588 -26.420 1.00 34.84 ? 2   ASN B C     1 
ATOM   3359  O O     . ASN B 1 2   ? 34.293  -15.118 -26.904 1.00 35.01 ? 2   ASN B O     1 
ATOM   3360  C CB    . ASN B 1 2   ? 35.824  -16.881 -28.604 1.00 37.80 ? 2   ASN B CB    1 
ATOM   3361  C CG    . ASN B 1 2   ? 36.233  -15.576 -29.352 1.00 40.52 ? 2   ASN B CG    1 
ATOM   3362  O OD1   . ASN B 1 2   ? 35.773  -15.384 -30.434 1.00 46.65 ? 2   ASN B OD1   1 
ATOM   3363  N ND2   . ASN B 1 2   ? 37.078  -14.705 -28.770 1.00 41.53 ? 2   ASN B ND2   1 
ATOM   3364  N N     . TYR B 1 3   ? 35.774  -15.162 -25.267 1.00 33.86 ? 3   TYR B N     1 
ATOM   3365  C CA    . TYR B 1 3   ? 35.273  -14.003 -24.535 1.00 32.21 ? 3   TYR B CA    1 
ATOM   3366  C C     . TYR B 1 3   ? 35.176  -12.666 -25.317 1.00 32.82 ? 3   TYR B C     1 
ATOM   3367  O O     . TYR B 1 3   ? 34.294  -11.846 -25.044 1.00 31.88 ? 3   TYR B O     1 
ATOM   3368  C CB    . TYR B 1 3   ? 36.017  -13.889 -23.198 1.00 30.26 ? 3   TYR B CB    1 
ATOM   3369  C CG    . TYR B 1 3   ? 35.649  -15.061 -22.309 1.00 30.13 ? 3   TYR B CG    1 
ATOM   3370  C CD1   . TYR B 1 3   ? 36.659  -15.931 -21.873 1.00 29.19 ? 3   TYR B CD1   1 
ATOM   3371  C CD2   . TYR B 1 3   ? 34.278  -15.379 -21.996 1.00 26.81 ? 3   TYR B CD2   1 
ATOM   3372  C CE1   . TYR B 1 3   ? 36.389  -17.041 -21.140 1.00 28.63 ? 3   TYR B CE1   1 
ATOM   3373  C CE2   . TYR B 1 3   ? 33.979  -16.535 -21.178 1.00 28.03 ? 3   TYR B CE2   1 
ATOM   3374  C CZ    . TYR B 1 3   ? 35.073  -17.354 -20.751 1.00 30.03 ? 3   TYR B CZ    1 
ATOM   3375  O OH    . TYR B 1 3   ? 34.972  -18.539 -19.976 1.00 24.75 ? 3   TYR B OH    1 
ATOM   3376  N N     . ALA B 1 4   ? 36.045  -12.519 -26.323 1.00 32.80 ? 4   ALA B N     1 
ATOM   3377  C CA    . ALA B 1 4   ? 36.061  -11.410 -27.236 1.00 34.31 ? 4   ALA B CA    1 
ATOM   3378  C C     . ALA B 1 4   ? 34.743  -11.105 -27.825 1.00 35.96 ? 4   ALA B C     1 
ATOM   3379  O O     . ALA B 1 4   ? 34.428  -9.907  -28.116 1.00 37.92 ? 4   ALA B O     1 
ATOM   3380  C CB    . ALA B 1 4   ? 37.143  -11.611 -28.331 1.00 33.68 ? 4   ALA B CB    1 
ATOM   3381  N N     . ARG B 1 5   ? 33.955  -12.167 -28.002 1.00 37.23 ? 5   ARG B N     1 
ATOM   3382  C CA    . ARG B 1 5   ? 32.620  -12.114 -28.644 1.00 37.66 ? 5   ARG B CA    1 
ATOM   3383  C C     . ARG B 1 5   ? 31.535  -11.332 -27.890 1.00 38.53 ? 5   ARG B C     1 
ATOM   3384  O O     . ARG B 1 5   ? 30.570  -10.856 -28.490 1.00 37.28 ? 5   ARG B O     1 
ATOM   3385  C CB    . ARG B 1 5   ? 32.087  -13.559 -28.811 1.00 37.67 ? 5   ARG B CB    1 
ATOM   3386  C CG    . ARG B 1 5   ? 32.213  -14.128 -30.225 1.00 36.60 ? 5   ARG B CG    1 
ATOM   3387  C CD    . ARG B 1 5   ? 31.296  -15.389 -30.370 1.00 37.30 ? 5   ARG B CD    1 
ATOM   3388  N NE    . ARG B 1 5   ? 29.864  -15.072 -30.386 1.00 30.17 ? 5   ARG B NE    1 
ATOM   3389  C CZ    . ARG B 1 5   ? 28.896  -15.928 -30.061 1.00 28.40 ? 5   ARG B CZ    1 
ATOM   3390  N NH1   . ARG B 1 5   ? 27.640  -15.516 -30.150 1.00 20.07 ? 5   ARG B NH1   1 
ATOM   3391  N NH2   . ARG B 1 5   ? 29.188  -17.189 -29.656 1.00 24.22 ? 5   ARG B NH2   1 
ATOM   3392  N N     . PHE B 1 6   ? 31.664  -11.262 -26.555 1.00 39.43 ? 6   PHE B N     1 
ATOM   3393  C CA    . PHE B 1 6   ? 30.622  -10.687 -25.692 1.00 39.52 ? 6   PHE B CA    1 
ATOM   3394  C C     . PHE B 1 6   ? 31.207  -9.492  -24.972 1.00 40.28 ? 6   PHE B C     1 
ATOM   3395  O O     . PHE B 1 6   ? 30.896  -9.264  -23.775 1.00 42.20 ? 6   PHE B O     1 
ATOM   3396  C CB    . PHE B 1 6   ? 30.180  -11.731 -24.652 1.00 39.06 ? 6   PHE B CB    1 
ATOM   3397  C CG    . PHE B 1 6   ? 30.192  -13.155 -25.176 1.00 39.88 ? 6   PHE B CG    1 
ATOM   3398  C CD1   . PHE B 1 6   ? 31.372  -13.876 -25.238 1.00 37.65 ? 6   PHE B CD1   1 
ATOM   3399  C CD2   . PHE B 1 6   ? 29.030  -13.752 -25.646 1.00 34.89 ? 6   PHE B CD2   1 
ATOM   3400  C CE1   . PHE B 1 6   ? 31.379  -15.145 -25.707 1.00 36.31 ? 6   PHE B CE1   1 
ATOM   3401  C CE2   . PHE B 1 6   ? 29.073  -15.003 -26.165 1.00 32.60 ? 6   PHE B CE2   1 
ATOM   3402  C CZ    . PHE B 1 6   ? 30.212  -15.713 -26.164 1.00 35.23 ? 6   PHE B CZ    1 
ATOM   3403  N N     . ILE B 1 7   ? 32.150  -8.827  -25.638 1.00 38.16 ? 7   ILE B N     1 
ATOM   3404  C CA    . ILE B 1 7   ? 32.746  -7.626  -25.149 1.00 37.78 ? 7   ILE B CA    1 
ATOM   3405  C C     . ILE B 1 7   ? 32.658  -6.562  -26.284 1.00 37.34 ? 7   ILE B C     1 
ATOM   3406  O O     . ILE B 1 7   ? 33.184  -6.712  -27.373 1.00 35.40 ? 7   ILE B O     1 
ATOM   3407  C CB    . ILE B 1 7   ? 34.188  -7.827  -24.643 1.00 39.36 ? 7   ILE B CB    1 
ATOM   3408  C CG1   . ILE B 1 7   ? 34.227  -8.645  -23.326 1.00 39.21 ? 7   ILE B CG1   1 
ATOM   3409  C CG2   . ILE B 1 7   ? 34.891  -6.480  -24.414 1.00 37.46 ? 7   ILE B CG2   1 
ATOM   3410  C CD1   . ILE B 1 7   ? 35.533  -9.425  -23.175 1.00 37.47 ? 7   ILE B CD1   1 
ATOM   3411  N N     . THR B 1 8   ? 31.915  -5.517  -25.972 1.00 35.03 ? 8   THR B N     1 
ATOM   3412  C CA    . THR B 1 8   ? 31.761  -4.354  -26.803 1.00 34.75 ? 8   THR B CA    1 
ATOM   3413  C C     . THR B 1 8   ? 33.138  -3.817  -27.297 1.00 33.62 ? 8   THR B C     1 
ATOM   3414  O O     . THR B 1 8   ? 34.165  -4.054  -26.674 1.00 30.95 ? 8   THR B O     1 
ATOM   3415  C CB    . THR B 1 8   ? 30.923  -3.397  -25.961 1.00 34.02 ? 8   THR B CB    1 
ATOM   3416  O OG1   . THR B 1 8   ? 29.680  -3.160  -26.591 1.00 35.87 ? 8   THR B OG1   1 
ATOM   3417  C CG2   . THR B 1 8   ? 31.593  -2.228  -25.607 1.00 31.27 ? 8   THR B CG2   1 
ATOM   3418  N N     . ALA B 1 9   ? 33.212  -3.165  -28.455 1.00 33.58 ? 9   ALA B N     1 
ATOM   3419  C CA    . ALA B 1 9   ? 34.511  -2.458  -28.739 1.00 34.58 ? 9   ALA B CA    1 
ATOM   3420  C C     . ALA B 1 9   ? 34.871  -1.446  -27.612 1.00 33.34 ? 9   ALA B C     1 
ATOM   3421  O O     . ALA B 1 9   ? 36.011  -1.299  -27.232 1.00 35.60 ? 9   ALA B O     1 
ATOM   3422  C CB    . ALA B 1 9   ? 34.524  -1.753  -30.159 1.00 34.07 ? 9   ALA B CB    1 
ATOM   3423  N N     . ALA B 1 10  ? 33.918  -0.676  -27.163 1.00 33.90 ? 10  ALA B N     1 
ATOM   3424  C CA    . ALA B 1 10  ? 34.132  0.284   -26.027 1.00 33.94 ? 10  ALA B CA    1 
ATOM   3425  C C     . ALA B 1 10  ? 34.595  -0.402  -24.685 1.00 33.80 ? 10  ALA B C     1 
ATOM   3426  O O     . ALA B 1 10  ? 35.452  0.127   -23.925 1.00 32.00 ? 10  ALA B O     1 
ATOM   3427  C CB    . ALA B 1 10  ? 32.830  1.072   -25.788 1.00 32.67 ? 10  ALA B CB    1 
ATOM   3428  N N     . SER B 1 11  ? 34.050  -1.587  -24.440 1.00 33.84 ? 11  SER B N     1 
ATOM   3429  C CA    . SER B 1 11  ? 34.416  -2.408  -23.272 1.00 34.46 ? 11  SER B CA    1 
ATOM   3430  C C     . SER B 1 11  ? 35.856  -2.975  -23.261 1.00 34.37 ? 11  SER B C     1 
ATOM   3431  O O     . SER B 1 11  ? 36.599  -2.823  -22.259 1.00 35.82 ? 11  SER B O     1 
ATOM   3432  C CB    . SER B 1 11  ? 33.305  -3.480  -22.968 1.00 34.52 ? 11  SER B CB    1 
ATOM   3433  O OG    . SER B 1 11  ? 33.491  -4.072  -21.684 1.00 30.49 ? 11  SER B OG    1 
ATOM   3434  N N     . ALA B 1 12  ? 36.230  -3.677  -24.327 1.00 32.81 ? 12  ALA B N     1 
ATOM   3435  C CA    . ALA B 1 12  ? 37.619  -4.040  -24.608 1.00 32.14 ? 12  ALA B CA    1 
ATOM   3436  C C     . ALA B 1 12  ? 38.579  -2.898  -24.532 1.00 30.33 ? 12  ALA B C     1 
ATOM   3437  O O     . ALA B 1 12  ? 39.734  -3.094  -24.210 1.00 29.06 ? 12  ALA B O     1 
ATOM   3438  C CB    . ALA B 1 12  ? 37.748  -4.655  -26.081 1.00 32.88 ? 12  ALA B CB    1 
ATOM   3439  N N     . ALA B 1 13  ? 38.154  -1.698  -24.897 1.00 30.66 ? 13  ALA B N     1 
ATOM   3440  C CA    . ALA B 1 13  ? 39.106  -0.573  -24.839 1.00 29.65 ? 13  ALA B CA    1 
ATOM   3441  C C     . ALA B 1 13  ? 39.351  0.001   -23.428 1.00 29.92 ? 13  ALA B C     1 
ATOM   3442  O O     . ALA B 1 13  ? 40.323  0.680   -23.203 1.00 31.94 ? 13  ALA B O     1 
ATOM   3443  C CB    . ALA B 1 13  ? 38.715  0.490   -25.784 1.00 31.08 ? 13  ALA B CB    1 
ATOM   3444  N N     . ARG B 1 14  ? 38.527  -0.279  -22.438 1.00 30.16 ? 14  ARG B N     1 
ATOM   3445  C CA    . ARG B 1 14  ? 38.963  0.122   -21.050 1.00 27.98 ? 14  ARG B CA    1 
ATOM   3446  C C     . ARG B 1 14  ? 40.310  -0.539  -20.665 1.00 28.76 ? 14  ARG B C     1 
ATOM   3447  O O     . ARG B 1 14  ? 40.541  -1.716  -20.971 1.00 25.69 ? 14  ARG B O     1 
ATOM   3448  C CB    . ARG B 1 14  ? 37.884  -0.259  -20.003 1.00 26.52 ? 14  ARG B CB    1 
ATOM   3449  C CG    . ARG B 1 14  ? 36.426  -0.106  -20.418 1.00 24.59 ? 14  ARG B CG    1 
ATOM   3450  C CD    . ARG B 1 14  ? 35.469  -0.210  -19.147 1.00 26.17 ? 14  ARG B CD    1 
ATOM   3451  N NE    . ARG B 1 14  ? 34.099  0.136   -19.497 1.00 17.43 ? 14  ARG B NE    1 
ATOM   3452  C CZ    . ARG B 1 14  ? 33.701  1.422   -19.505 1.00 22.96 ? 14  ARG B CZ    1 
ATOM   3453  N NH1   . ARG B 1 14  ? 34.540  2.374   -19.070 1.00 22.01 ? 14  ARG B NH1   1 
ATOM   3454  N NH2   . ARG B 1 14  ? 32.495  1.777   -19.950 1.00 17.16 ? 14  ARG B NH2   1 
ATOM   3455  N N     . ASN B 1 15  ? 41.152  0.264   -20.002 1.00 32.44 ? 15  ASN B N     1 
ATOM   3456  C CA    . ASN B 1 15  ? 42.428  -0.019  -19.419 1.00 35.78 ? 15  ASN B CA    1 
ATOM   3457  C C     . ASN B 1 15  ? 42.316  0.112   -17.874 1.00 38.99 ? 15  ASN B C     1 
ATOM   3458  O O     . ASN B 1 15  ? 41.591  0.964   -17.345 1.00 38.51 ? 15  ASN B O     1 
ATOM   3459  C CB    . ASN B 1 15  ? 43.421  1.083   -19.783 1.00 36.97 ? 15  ASN B CB    1 
ATOM   3460  C CG    . ASN B 1 15  ? 43.666  1.225   -21.294 1.00 38.69 ? 15  ASN B CG    1 
ATOM   3461  O OD1   . ASN B 1 15  ? 43.986  0.234   -21.952 1.00 34.51 ? 15  ASN B OD1   1 
ATOM   3462  N ND2   . ASN B 1 15  ? 43.590  2.521   -21.840 1.00 33.49 ? 15  ASN B ND2   1 
ATOM   3463  N N     . PRO B 1 16  ? 43.078  -0.690  -17.121 1.00 40.96 ? 16  PRO B N     1 
ATOM   3464  C CA    . PRO B 1 16  ? 42.977  -0.353  -15.674 1.00 42.03 ? 16  PRO B CA    1 
ATOM   3465  C C     . PRO B 1 16  ? 43.155  1.103   -15.208 1.00 43.03 ? 16  PRO B C     1 
ATOM   3466  O O     . PRO B 1 16  ? 44.077  1.793   -15.519 1.00 44.14 ? 16  PRO B O     1 
ATOM   3467  C CB    . PRO B 1 16  ? 43.994  -1.303  -15.027 1.00 41.53 ? 16  PRO B CB    1 
ATOM   3468  C CG    . PRO B 1 16  ? 43.903  -2.515  -15.953 1.00 41.92 ? 16  PRO B CG    1 
ATOM   3469  C CD    . PRO B 1 16  ? 43.903  -1.884  -17.366 1.00 39.55 ? 16  PRO B CD    1 
ATOM   3470  N N     . SER B 1 17  ? 42.249  1.520   -14.368 1.00 46.17 ? 17  SER B N     1 
ATOM   3471  C CA    . SER B 1 17  ? 42.269  2.830   -13.770 1.00 48.22 ? 17  SER B CA    1 
ATOM   3472  C C     . SER B 1 17  ? 42.172  2.714   -12.211 1.00 49.04 ? 17  SER B C     1 
ATOM   3473  O O     . SER B 1 17  ? 41.239  3.189   -11.640 1.00 49.30 ? 17  SER B O     1 
ATOM   3474  C CB    . SER B 1 17  ? 41.067  3.582   -14.375 1.00 47.19 ? 17  SER B CB    1 
ATOM   3475  O OG    . SER B 1 17  ? 40.936  4.867   -13.851 1.00 47.23 ? 17  SER B OG    1 
ATOM   3476  N N     . PRO B 1 18  ? 43.159  2.123   -11.512 1.00 51.17 ? 18  PRO B N     1 
ATOM   3477  C CA    . PRO B 1 18  ? 42.969  2.019   -10.028 1.00 53.85 ? 18  PRO B CA    1 
ATOM   3478  C C     . PRO B 1 18  ? 43.394  3.216   -9.152  1.00 56.43 ? 18  PRO B C     1 
ATOM   3479  O O     . PRO B 1 18  ? 44.139  4.072   -9.596  1.00 55.38 ? 18  PRO B O     1 
ATOM   3480  C CB    . PRO B 1 18  ? 43.857  0.817   -9.649  1.00 53.01 ? 18  PRO B CB    1 
ATOM   3481  C CG    . PRO B 1 18  ? 44.937  0.826   -10.648 1.00 51.99 ? 18  PRO B CG    1 
ATOM   3482  C CD    . PRO B 1 18  ? 44.454  1.561   -11.921 1.00 51.16 ? 18  PRO B CD    1 
ATOM   3483  N N     . ILE B 1 19  ? 42.898  3.256   -7.910  1.00 61.70 ? 19  ILE B N     1 
ATOM   3484  C CA    . ILE B 1 19  ? 43.575  3.977   -6.809  1.00 66.91 ? 19  ILE B CA    1 
ATOM   3485  C C     . ILE B 1 19  ? 44.793  3.102   -6.435  1.00 69.88 ? 19  ILE B C     1 
ATOM   3486  O O     . ILE B 1 19  ? 44.670  2.163   -5.656  1.00 69.29 ? 19  ILE B O     1 
ATOM   3487  C CB    . ILE B 1 19  ? 42.614  4.223   -5.591  1.00 67.57 ? 19  ILE B CB    1 
ATOM   3488  C CG1   . ILE B 1 19  ? 41.133  4.175   -6.039  1.00 68.80 ? 19  ILE B CG1   1 
ATOM   3489  C CG2   . ILE B 1 19  ? 42.945  5.554   -4.893  1.00 67.92 ? 19  ILE B CG2   1 
ATOM   3490  C CD1   . ILE B 1 19  ? 40.150  4.948   -5.129  1.00 67.08 ? 19  ILE B CD1   1 
ATOM   3491  N N     . ARG B 1 20  ? 45.964  3.426   -7.013  1.00 74.52 ? 20  ARG B N     1 
ATOM   3492  C CA    . ARG B 1 20  ? 46.951  2.390   -7.477  1.00 77.93 ? 20  ARG B CA    1 
ATOM   3493  C C     . ARG B 1 20  ? 47.941  1.791   -6.481  1.00 80.56 ? 20  ARG B C     1 
ATOM   3494  O O     . ARG B 1 20  ? 47.745  1.917   -5.261  1.00 81.46 ? 20  ARG B O     1 
ATOM   3495  C CB    . ARG B 1 20  ? 47.694  2.867   -8.730  1.00 77.66 ? 20  ARG B CB    1 
ATOM   3496  C CG    . ARG B 1 20  ? 48.628  4.048   -8.535  1.00 78.45 ? 20  ARG B CG    1 
ATOM   3497  C CD    . ARG B 1 20  ? 50.095  3.647   -8.466  1.00 79.24 ? 20  ARG B CD    1 
ATOM   3498  N NE    . ARG B 1 20  ? 50.452  2.798   -9.593  1.00 81.16 ? 20  ARG B NE    1 
ATOM   3499  C CZ    . ARG B 1 20  ? 51.694  2.501   -9.965  1.00 82.34 ? 20  ARG B CZ    1 
ATOM   3500  N NH1   . ARG B 1 20  ? 52.736  2.978   -9.282  1.00 81.44 ? 20  ARG B NH1   1 
ATOM   3501  N NH2   . ARG B 1 20  ? 51.887  1.706   -11.021 1.00 82.81 ? 20  ARG B NH2   1 
ATOM   3502  N N     . THR B 1 21  ? 48.986  1.134   -7.021  1.00 83.18 ? 21  THR B N     1 
ATOM   3503  C CA    . THR B 1 21  ? 50.051  0.460   -6.241  1.00 85.30 ? 21  THR B CA    1 
ATOM   3504  C C     . THR B 1 21  ? 50.884  1.433   -5.383  1.00 86.63 ? 21  THR B C     1 
ATOM   3505  O O     . THR B 1 21  ? 51.960  1.094   -4.856  1.00 87.18 ? 21  THR B O     1 
ATOM   3506  C CB    . THR B 1 21  ? 50.964  -0.499  -7.123  1.00 85.76 ? 21  THR B CB    1 
ATOM   3507  O OG1   . THR B 1 21  ? 51.580  0.222   -8.205  1.00 85.73 ? 21  THR B OG1   1 
ATOM   3508  C CG2   . THR B 1 21  ? 50.158  -1.680  -7.699  1.00 85.59 ? 21  THR B CG2   1 
ATOM   3509  N N     . MET B 1 22  ? 50.367  2.654   -5.259  1.00 87.89 ? 22  MET B N     1 
ATOM   3510  C CA    . MET B 1 22  ? 50.783  3.599   -4.235  1.00 89.02 ? 22  MET B CA    1 
ATOM   3511  C C     . MET B 1 22  ? 50.571  2.895   -2.891  1.00 89.55 ? 22  MET B C     1 
ATOM   3512  O O     . MET B 1 22  ? 51.355  3.071   -1.943  1.00 89.93 ? 22  MET B O     1 
ATOM   3513  C CB    . MET B 1 22  ? 49.931  4.872   -4.335  1.00 89.10 ? 22  MET B CB    1 
ATOM   3514  C CG    . MET B 1 22  ? 48.452  4.627   -4.756  1.00 89.64 ? 22  MET B CG    1 
ATOM   3515  S SD    . MET B 1 22  ? 47.368  6.000   -5.279  1.00 89.35 ? 22  MET B SD    1 
ATOM   3516  C CE    . MET B 1 22  ? 48.371  6.879   -6.485  1.00 85.14 ? 22  MET B CE    1 
ATOM   3517  N N     . THR B 1 23  ? 49.505  2.087   -2.854  1.00 89.95 ? 23  THR B N     1 
ATOM   3518  C CA    . THR B 1 23  ? 49.101  1.277   -1.698  1.00 90.31 ? 23  THR B CA    1 
ATOM   3519  C C     . THR B 1 23  ? 49.179  -0.231  -2.003  1.00 90.60 ? 23  THR B C     1 
ATOM   3520  O O     . THR B 1 23  ? 48.402  -1.024  -1.444  1.00 90.53 ? 23  THR B O     1 
ATOM   3521  C CB    . THR B 1 23  ? 47.649  1.621   -1.219  1.00 90.52 ? 23  THR B CB    1 
ATOM   3522  O OG1   . THR B 1 23  ? 46.697  0.828   -1.941  1.00 90.36 ? 23  THR B OG1   1 
ATOM   3523  C CG2   . THR B 1 23  ? 47.314  3.129   -1.383  1.00 89.78 ? 23  THR B CG2   1 
ATOM   3524  N N     . ASP B 1 24  ? 50.085  -0.608  -2.915  1.00 90.94 ? 24  ASP B N     1 
ATOM   3525  C CA    . ASP B 1 24  ? 50.484  -2.011  -3.101  1.00 91.49 ? 24  ASP B CA    1 
ATOM   3526  C C     . ASP B 1 24  ? 52.012  -2.192  -3.005  1.00 91.31 ? 24  ASP B C     1 
ATOM   3527  O O     . ASP B 1 24  ? 52.480  -2.990  -2.178  1.00 91.24 ? 24  ASP B O     1 
ATOM   3528  C CB    . ASP B 1 24  ? 49.890  -2.645  -4.379  1.00 91.88 ? 24  ASP B CB    1 
ATOM   3529  C CG    . ASP B 1 24  ? 49.253  -4.043  -4.123  1.00 92.84 ? 24  ASP B CG    1 
ATOM   3530  O OD1   . ASP B 1 24  ? 48.173  -4.336  -4.706  1.00 92.74 ? 24  ASP B OD1   1 
ATOM   3531  O OD2   . ASP B 1 24  ? 49.823  -4.851  -3.344  1.00 93.33 ? 24  ASP B OD2   1 
ATOM   3532  N N     . ILE B 1 25  ? 52.792  -1.463  -3.814  1.00 90.83 ? 25  ILE B N     1 
ATOM   3533  C CA    . ILE B 1 25  ? 54.255  -1.414  -3.586  1.00 90.26 ? 25  ILE B CA    1 
ATOM   3534  C C     . ILE B 1 25  ? 54.568  -1.015  -2.118  1.00 90.31 ? 25  ILE B C     1 
ATOM   3535  O O     . ILE B 1 25  ? 55.588  -1.430  -1.546  1.00 90.47 ? 25  ILE B O     1 
ATOM   3536  C CB    . ILE B 1 25  ? 55.042  -0.534  -4.628  1.00 90.32 ? 25  ILE B CB    1 
ATOM   3537  C CG1   . ILE B 1 25  ? 55.389  -1.353  -5.887  1.00 89.78 ? 25  ILE B CG1   1 
ATOM   3538  C CG2   . ILE B 1 25  ? 56.312  0.044   -4.003  1.00 89.98 ? 25  ILE B CG2   1 
ATOM   3539  C CD1   . ILE B 1 25  ? 56.519  -0.810  -6.780  1.00 89.29 ? 25  ILE B CD1   1 
ATOM   3540  N N     . LEU B 1 26  ? 53.662  -0.240  -1.519  1.00 89.94 ? 26  LEU B N     1 
ATOM   3541  C CA    . LEU B 1 26  ? 53.726  0.139   -0.110  1.00 89.47 ? 26  LEU B CA    1 
ATOM   3542  C C     . LEU B 1 26  ? 52.907  -0.837  0.759   1.00 89.62 ? 26  LEU B C     1 
ATOM   3543  O O     . LEU B 1 26  ? 52.079  -0.443  1.592   1.00 89.83 ? 26  LEU B O     1 
ATOM   3544  C CB    . LEU B 1 26  ? 53.259  1.583   0.065   1.00 89.16 ? 26  LEU B CB    1 
ATOM   3545  C CG    . LEU B 1 26  ? 53.663  2.289   1.358   1.00 89.19 ? 26  LEU B CG    1 
ATOM   3546  C CD1   . LEU B 1 26  ? 55.094  2.828   1.266   1.00 88.12 ? 26  LEU B CD1   1 
ATOM   3547  C CD2   . LEU B 1 26  ? 52.647  3.389   1.701   1.00 89.66 ? 26  LEU B CD2   1 
ATOM   3548  N N     . SER B 1 27  ? 53.160  -2.125  0.543   1.00 89.66 ? 27  SER B N     1 
ATOM   3549  C CA    . SER B 1 27  ? 52.520  -3.218  1.277   1.00 89.21 ? 27  SER B CA    1 
ATOM   3550  C C     . SER B 1 27  ? 53.441  -4.432  1.247   1.00 88.68 ? 27  SER B C     1 
ATOM   3551  O O     . SER B 1 27  ? 53.223  -5.390  1.998   1.00 88.93 ? 27  SER B O     1 
ATOM   3552  C CB    . SER B 1 27  ? 51.159  -3.589  0.654   1.00 89.58 ? 27  SER B CB    1 
ATOM   3553  O OG    . SER B 1 27  ? 50.766  -4.916  1.003   1.00 89.30 ? 27  SER B OG    1 
ATOM   3554  N N     . ARG B 1 28  ? 54.427  -4.398  0.341   1.00 87.44 ? 28  ARG B N     1 
ATOM   3555  C CA    . ARG B 1 28  ? 55.507  -5.387  0.305   1.00 86.51 ? 28  ARG B CA    1 
ATOM   3556  C C     . ARG B 1 28  ? 56.850  -4.693  0.548   1.00 84.83 ? 28  ARG B C     1 
ATOM   3557  O O     . ARG B 1 28  ? 57.915  -5.323  0.487   1.00 85.13 ? 28  ARG B O     1 
ATOM   3558  C CB    . ARG B 1 28  ? 55.511  -6.200  -1.015  1.00 87.12 ? 28  ARG B CB    1 
ATOM   3559  C CG    . ARG B 1 28  ? 56.490  -5.710  -2.127  1.00 88.91 ? 28  ARG B CG    1 
ATOM   3560  C CD    . ARG B 1 28  ? 55.875  -4.672  -3.085  1.00 90.16 ? 28  ARG B CD    1 
ATOM   3561  N NE    . ARG B 1 28  ? 55.305  -5.248  -4.315  1.00 90.68 ? 28  ARG B NE    1 
ATOM   3562  C CZ    . ARG B 1 28  ? 54.209  -6.015  -4.378  1.00 90.44 ? 28  ARG B CZ    1 
ATOM   3563  N NH1   . ARG B 1 28  ? 53.536  -6.354  -3.277  1.00 90.17 ? 28  ARG B NH1   1 
ATOM   3564  N NH2   . ARG B 1 28  ? 53.784  -6.452  -5.560  1.00 89.59 ? 28  ARG B NH2   1 
ATOM   3565  N N     . GLY B 1 29  ? 56.791  -3.396  0.834   1.00 82.64 ? 29  GLY B N     1 
ATOM   3566  C CA    . GLY B 1 29  ? 57.999  -2.610  1.068   1.00 79.47 ? 29  GLY B CA    1 
ATOM   3567  C C     . GLY B 1 29  ? 58.526  -2.741  2.485   1.00 77.16 ? 29  GLY B C     1 
ATOM   3568  O O     . GLY B 1 29  ? 57.820  -3.273  3.366   1.00 76.81 ? 29  GLY B O     1 
ATOM   3569  N N     . PRO B 1 30  ? 59.781  -2.274  2.711   1.00 75.00 ? 30  PRO B N     1 
ATOM   3570  C CA    . PRO B 1 30  ? 60.345  -2.084  4.056   1.00 72.97 ? 30  PRO B CA    1 
ATOM   3571  C C     . PRO B 1 30  ? 59.541  -1.042  4.817   1.00 71.08 ? 30  PRO B C     1 
ATOM   3572  O O     . PRO B 1 30  ? 59.102  -0.063  4.219   1.00 70.26 ? 30  PRO B O     1 
ATOM   3573  C CB    . PRO B 1 30  ? 61.749  -1.520  3.780   1.00 72.75 ? 30  PRO B CB    1 
ATOM   3574  C CG    . PRO B 1 30  ? 62.073  -1.887  2.415   1.00 73.41 ? 30  PRO B CG    1 
ATOM   3575  C CD    . PRO B 1 30  ? 60.757  -1.932  1.663   1.00 74.27 ? 30  PRO B CD    1 
ATOM   3576  N N     . LYS B 1 31  ? 59.367  -1.265  6.122   1.00 69.27 ? 31  LYS B N     1 
ATOM   3577  C CA    . LYS B 1 31  ? 58.662  -0.365  7.037   1.00 67.00 ? 31  LYS B CA    1 
ATOM   3578  C C     . LYS B 1 31  ? 59.073  1.092   6.813   1.00 65.48 ? 31  LYS B C     1 
ATOM   3579  O O     . LYS B 1 31  ? 58.232  2.001   6.859   1.00 65.15 ? 31  LYS B O     1 
ATOM   3580  C CB    . LYS B 1 31  ? 58.986  -0.775  8.487   1.00 67.73 ? 31  LYS B CB    1 
ATOM   3581  C CG    . LYS B 1 31  ? 57.921  -0.437  9.543   1.00 67.99 ? 31  LYS B CG    1 
ATOM   3582  C CD    . LYS B 1 31  ? 56.874  -1.563  9.659   1.00 68.88 ? 31  LYS B CD    1 
ATOM   3583  C CE    . LYS B 1 31  ? 55.870  -1.311  10.807  1.00 68.38 ? 31  LYS B CE    1 
ATOM   3584  N NZ    . LYS B 1 31  ? 54.602  -2.071  10.602  1.00 64.65 ? 31  LYS B NZ    1 
ATOM   3585  N N     . SER B 1 32  ? 60.369  1.307   6.552   1.00 63.10 ? 32  SER B N     1 
ATOM   3586  C CA    . SER B 1 32  ? 60.930  2.667   6.458   1.00 60.28 ? 32  SER B CA    1 
ATOM   3587  C C     . SER B 1 32  ? 60.774  3.375   5.074   1.00 58.52 ? 32  SER B C     1 
ATOM   3588  O O     . SER B 1 32  ? 61.335  4.490   4.867   1.00 57.61 ? 32  SER B O     1 
ATOM   3589  C CB    . SER B 1 32  ? 62.391  2.641   6.897   1.00 60.04 ? 32  SER B CB    1 
ATOM   3590  O OG    . SER B 1 32  ? 63.147  1.953   5.929   1.00 59.53 ? 32  SER B OG    1 
ATOM   3591  N N     . MET B 1 33  ? 60.042  2.730   4.144   1.00 55.39 ? 33  MET B N     1 
ATOM   3592  C CA    . MET B 1 33  ? 59.639  3.361   2.876   1.00 53.48 ? 33  MET B CA    1 
ATOM   3593  C C     . MET B 1 33  ? 58.798  4.591   3.166   1.00 49.91 ? 33  MET B C     1 
ATOM   3594  O O     . MET B 1 33  ? 58.040  4.627   4.141   1.00 48.51 ? 33  MET B O     1 
ATOM   3595  C CB    . MET B 1 33  ? 58.816  2.412   1.987   1.00 52.87 ? 33  MET B CB    1 
ATOM   3596  C CG    . MET B 1 33  ? 58.786  2.797   0.490   1.00 53.21 ? 33  MET B CG    1 
ATOM   3597  S SD    . MET B 1 33  ? 59.634  1.620   -0.652  1.00 59.81 ? 33  MET B SD    1 
ATOM   3598  C CE    . MET B 1 33  ? 60.749  0.811   0.495   1.00 53.78 ? 33  MET B CE    1 
ATOM   3599  N N     . ILE B 1 34  ? 58.982  5.605   2.329   1.00 47.04 ? 34  ILE B N     1 
ATOM   3600  C CA    . ILE B 1 34  ? 58.133  6.802   2.334   1.00 44.14 ? 34  ILE B CA    1 
ATOM   3601  C C     . ILE B 1 34  ? 57.540  7.050   0.964   1.00 42.37 ? 34  ILE B C     1 
ATOM   3602  O O     . ILE B 1 34  ? 58.270  7.070   -0.010  1.00 43.07 ? 34  ILE B O     1 
ATOM   3603  C CB    . ILE B 1 34  ? 58.737  8.076   3.073   1.00 44.32 ? 34  ILE B CB    1 
ATOM   3604  C CG1   . ILE B 1 34  ? 58.365  9.358   2.348   1.00 43.81 ? 34  ILE B CG1   1 
ATOM   3605  C CG2   . ILE B 1 34  ? 60.245  8.008   3.359   1.00 44.28 ? 34  ILE B CG2   1 
ATOM   3606  C CD1   . ILE B 1 34  ? 57.830  10.379  3.217   1.00 41.19 ? 34  ILE B CD1   1 
ATOM   3607  N N     . SER B 1 35  ? 56.203  7.136   0.882   1.00 40.64 ? 35  SER B N     1 
ATOM   3608  C CA    . SER B 1 35  ? 55.541  7.448   -0.386  1.00 38.29 ? 35  SER B CA    1 
ATOM   3609  C C     . SER B 1 35  ? 54.833  8.789   -0.342  1.00 37.83 ? 35  SER B C     1 
ATOM   3610  O O     . SER B 1 35  ? 54.113  9.153   0.607   1.00 36.35 ? 35  SER B O     1 
ATOM   3611  C CB    . SER B 1 35  ? 54.587  6.351   -0.873  1.00 37.44 ? 35  SER B CB    1 
ATOM   3612  O OG    . SER B 1 35  ? 53.871  6.783   -2.026  1.00 33.09 ? 35  SER B OG    1 
ATOM   3613  N N     . LEU B 1 36  ? 55.114  9.521   -1.394  1.00 37.60 ? 36  LEU B N     1 
ATOM   3614  C CA    . LEU B 1 36  ? 54.470  10.780  -1.678  1.00 39.44 ? 36  LEU B CA    1 
ATOM   3615  C C     . LEU B 1 36  ? 53.676  10.516  -3.002  1.00 40.24 ? 36  LEU B C     1 
ATOM   3616  O O     . LEU B 1 36  ? 53.236  11.446  -3.663  1.00 42.67 ? 36  LEU B O     1 
ATOM   3617  C CB    . LEU B 1 36  ? 55.557  11.895  -1.747  1.00 38.50 ? 36  LEU B CB    1 
ATOM   3618  C CG    . LEU B 1 36  ? 56.368  12.011  -0.444  1.00 39.01 ? 36  LEU B CG    1 
ATOM   3619  C CD1   . LEU B 1 36  ? 57.344  13.141  -0.400  1.00 43.53 ? 36  LEU B CD1   1 
ATOM   3620  C CD2   . LEU B 1 36  ? 55.438  12.102  0.838   1.00 35.03 ? 36  LEU B CD2   1 
ATOM   3621  N N     . ALA B 1 37  ? 53.469  9.240   -3.346  1.00 39.43 ? 37  ALA B N     1 
ATOM   3622  C CA    . ALA B 1 37  ? 52.888  8.847   -4.636  1.00 40.37 ? 37  ALA B CA    1 
ATOM   3623  C C     . ALA B 1 37  ? 51.400  8.584   -4.566  1.00 39.69 ? 37  ALA B C     1 
ATOM   3624  O O     . ALA B 1 37  ? 50.758  8.493   -5.596  1.00 40.14 ? 37  ALA B O     1 
ATOM   3625  C CB    . ALA B 1 37  ? 53.600  7.592   -5.193  1.00 41.14 ? 37  ALA B CB    1 
ATOM   3626  N N     . GLY B 1 38  ? 50.868  8.491   -3.343  1.00 38.95 ? 38  GLY B N     1 
ATOM   3627  C CA    . GLY B 1 38  ? 49.474  8.094   -3.116  1.00 37.39 ? 38  GLY B CA    1 
ATOM   3628  C C     . GLY B 1 38  ? 48.441  9.160   -3.468  1.00 33.99 ? 38  GLY B C     1 
ATOM   3629  O O     . GLY B 1 38  ? 48.702  10.344  -3.282  1.00 31.90 ? 38  GLY B O     1 
ATOM   3630  N N     . GLY B 1 39  ? 47.301  8.709   -3.999  1.00 31.53 ? 39  GLY B N     1 
ATOM   3631  C CA    . GLY B 1 39  ? 46.099  9.544   -4.246  1.00 31.66 ? 39  GLY B CA    1 
ATOM   3632  C C     . GLY B 1 39  ? 45.060  9.631   -3.083  1.00 31.93 ? 39  GLY B C     1 
ATOM   3633  O O     . GLY B 1 39  ? 44.053  10.418  -3.172  1.00 31.30 ? 39  GLY B O     1 
ATOM   3634  N N     . LEU B 1 40  ? 45.306  8.897   -1.991  1.00 29.26 ? 40  LEU B N     1 
ATOM   3635  C CA    . LEU B 1 40  ? 44.342  8.964   -0.864  1.00 31.46 ? 40  LEU B CA    1 
ATOM   3636  C C     . LEU B 1 40  ? 44.295  10.316  -0.119  1.00 31.53 ? 40  LEU B C     1 
ATOM   3637  O O     . LEU B 1 40  ? 45.365  10.961  0.044   1.00 33.25 ? 40  LEU B O     1 
ATOM   3638  C CB    . LEU B 1 40  ? 44.631  7.871   0.146   1.00 30.40 ? 40  LEU B CB    1 
ATOM   3639  C CG    . LEU B 1 40  ? 44.719  6.420   -0.387  1.00 33.63 ? 40  LEU B CG    1 
ATOM   3640  C CD1   . LEU B 1 40  ? 44.840  5.463   0.839   1.00 29.83 ? 40  LEU B CD1   1 
ATOM   3641  C CD2   . LEU B 1 40  ? 43.569  6.006   -1.289  1.00 27.25 ? 40  LEU B CD2   1 
ATOM   3642  N N     . PRO B 1 41  ? 43.091  10.764  0.326   1.00 31.48 ? 41  PRO B N     1 
ATOM   3643  C CA    . PRO B 1 41  ? 43.066  11.935  1.287   1.00 31.77 ? 41  PRO B CA    1 
ATOM   3644  C C     . PRO B 1 41  ? 43.401  11.495  2.717   1.00 32.40 ? 41  PRO B C     1 
ATOM   3645  O O     . PRO B 1 41  ? 43.305  10.299  3.051   1.00 31.56 ? 41  PRO B O     1 
ATOM   3646  C CB    . PRO B 1 41  ? 41.578  12.372  1.318   1.00 30.44 ? 41  PRO B CB    1 
ATOM   3647  C CG    . PRO B 1 41  ? 40.809  11.241  0.952   1.00 31.26 ? 41  PRO B CG    1 
ATOM   3648  C CD    . PRO B 1 41  ? 41.725  10.276  0.067   1.00 31.34 ? 41  PRO B CD    1 
ATOM   3649  N N     . ASN B 1 42  ? 43.753  12.460  3.552   1.00 32.78 ? 42  ASN B N     1 
ATOM   3650  C CA    . ASN B 1 42  ? 43.913  12.204  4.955   1.00 33.51 ? 42  ASN B CA    1 
ATOM   3651  C C     . ASN B 1 42  ? 42.593  11.852  5.659   1.00 33.61 ? 42  ASN B C     1 
ATOM   3652  O O     . ASN B 1 42  ? 41.751  12.752  5.918   1.00 34.51 ? 42  ASN B O     1 
ATOM   3653  C CB    . ASN B 1 42  ? 44.612  13.389  5.657   1.00 34.58 ? 42  ASN B CB    1 
ATOM   3654  C CG    . ASN B 1 42  ? 45.312  12.989  6.998   1.00 34.12 ? 42  ASN B CG    1 
ATOM   3655  O OD1   . ASN B 1 42  ? 46.460  13.327  7.205   1.00 37.79 ? 42  ASN B OD1   1 
ATOM   3656  N ND2   . ASN B 1 42  ? 44.613  12.297  7.877   1.00 35.79 ? 42  ASN B ND2   1 
ATOM   3657  N N     . PRO B 1 43  ? 42.500  10.588  6.155   1.00 32.70 ? 43  PRO B N     1 
ATOM   3658  C CA    . PRO B 1 43  ? 41.342  10.102  6.834   1.00 32.04 ? 43  PRO B CA    1 
ATOM   3659  C C     . PRO B 1 43  ? 41.170  10.752  8.259   1.00 32.08 ? 43  PRO B C     1 
ATOM   3660  O O     . PRO B 1 43  ? 40.052  10.876  8.743   1.00 29.48 ? 43  PRO B O     1 
ATOM   3661  C CB    . PRO B 1 43  ? 41.621  8.589   6.918   1.00 34.61 ? 43  PRO B CB    1 
ATOM   3662  C CG    . PRO B 1 43  ? 43.113  8.500   7.164   1.00 30.32 ? 43  PRO B CG    1 
ATOM   3663  C CD    . PRO B 1 43  ? 43.627  9.632   6.256   1.00 32.53 ? 43  PRO B CD    1 
ATOM   3664  N N     . ASN B 1 44  ? 42.254  11.173  8.909   1.00 32.12 ? 44  ASN B N     1 
ATOM   3665  C CA    . ASN B 1 44  ? 42.155  11.811  10.289  1.00 32.89 ? 44  ASN B CA    1 
ATOM   3666  C C     . ASN B 1 44  ? 41.260  13.057  10.362  1.00 32.56 ? 44  ASN B C     1 
ATOM   3667  O O     . ASN B 1 44  ? 40.803  13.447  11.440  1.00 33.47 ? 44  ASN B O     1 
ATOM   3668  C CB    . ASN B 1 44  ? 43.546  12.226  10.771  1.00 33.73 ? 44  ASN B CB    1 
ATOM   3669  C CG    . ASN B 1 44  ? 44.391  11.025  11.236  1.00 39.53 ? 44  ASN B CG    1 
ATOM   3670  O OD1   . ASN B 1 44  ? 44.071  10.390  12.238  1.00 45.49 ? 44  ASN B OD1   1 
ATOM   3671  N ND2   . ASN B 1 44  ? 45.455  10.701  10.489  1.00 40.73 ? 44  ASN B ND2   1 
ATOM   3672  N N     . MET B 1 45  ? 41.046  13.684  9.198   1.00 33.23 ? 45  MET B N     1 
ATOM   3673  C CA    . MET B 1 45  ? 40.165  14.842  8.984   1.00 32.49 ? 45  MET B CA    1 
ATOM   3674  C C     . MET B 1 45  ? 38.655  14.495  8.990   1.00 31.84 ? 45  MET B C     1 
ATOM   3675  O O     . MET B 1 45  ? 37.809  15.383  9.253   1.00 32.66 ? 45  MET B O     1 
ATOM   3676  C CB    . MET B 1 45  ? 40.487  15.425  7.609   1.00 32.62 ? 45  MET B CB    1 
ATOM   3677  C CG    . MET B 1 45  ? 41.848  16.145  7.539   1.00 33.93 ? 45  MET B CG    1 
ATOM   3678  S SD    . MET B 1 45  ? 41.885  17.458  8.724   1.00 41.40 ? 45  MET B SD    1 
ATOM   3679  C CE    . MET B 1 45  ? 42.962  16.636  9.921   1.00 34.65 ? 45  MET B CE    1 
ATOM   3680  N N     . PHE B 1 46  ? 38.319  13.245  8.676   1.00 28.18 ? 46  PHE B N     1 
ATOM   3681  C CA    . PHE B 1 46  ? 36.917  12.872  8.647   1.00 29.09 ? 46  PHE B CA    1 
ATOM   3682  C C     . PHE B 1 46  ? 36.299  12.926  10.071  1.00 27.91 ? 46  PHE B C     1 
ATOM   3683  O O     . PHE B 1 46  ? 36.939  12.535  11.013  1.00 28.30 ? 46  PHE B O     1 
ATOM   3684  C CB    . PHE B 1 46  ? 36.695  11.490  8.023   1.00 29.09 ? 46  PHE B CB    1 
ATOM   3685  C CG    . PHE B 1 46  ? 37.243  11.362  6.597   1.00 28.40 ? 46  PHE B CG    1 
ATOM   3686  C CD1   . PHE B 1 46  ? 37.727  10.137  6.164   1.00 20.39 ? 46  PHE B CD1   1 
ATOM   3687  C CD2   . PHE B 1 46  ? 37.313  12.471  5.729   1.00 26.34 ? 46  PHE B CD2   1 
ATOM   3688  C CE1   . PHE B 1 46  ? 38.269  9.983   4.940   1.00 17.40 ? 46  PHE B CE1   1 
ATOM   3689  C CE2   . PHE B 1 46  ? 37.818  12.308  4.431   1.00 24.11 ? 46  PHE B CE2   1 
ATOM   3690  C CZ    . PHE B 1 46  ? 38.309  11.066  4.042   1.00 24.49 ? 46  PHE B CZ    1 
ATOM   3691  N N     . PRO B 1 47  ? 35.036  13.327  10.173  1.00 25.88 ? 47  PRO B N     1 
ATOM   3692  C CA    . PRO B 1 47  ? 34.518  13.713  11.467  1.00 27.50 ? 47  PRO B CA    1 
ATOM   3693  C C     . PRO B 1 47  ? 33.978  12.595  12.339  1.00 29.03 ? 47  PRO B C     1 
ATOM   3694  O O     . PRO B 1 47  ? 33.964  12.796  13.540  1.00 30.96 ? 47  PRO B O     1 
ATOM   3695  C CB    . PRO B 1 47  ? 33.382  14.696  11.128  1.00 27.09 ? 47  PRO B CB    1 
ATOM   3696  C CG    . PRO B 1 47  ? 33.044  14.472  9.637   1.00 25.11 ? 47  PRO B CG    1 
ATOM   3697  C CD    . PRO B 1 47  ? 34.026  13.390  9.120   1.00 24.25 ? 47  PRO B CD    1 
ATOM   3698  N N     . PHE B 1 48  ? 33.562  11.447  11.769  1.00 27.75 ? 48  PHE B N     1 
ATOM   3699  C CA    . PHE B 1 48  ? 32.974  10.335  12.550  1.00 29.12 ? 48  PHE B CA    1 
ATOM   3700  C C     . PHE B 1 48  ? 34.112  9.501   13.035  1.00 29.77 ? 48  PHE B C     1 
ATOM   3701  O O     . PHE B 1 48  ? 35.081  9.369   12.306  1.00 31.62 ? 48  PHE B O     1 
ATOM   3702  C CB    . PHE B 1 48  ? 32.105  9.401   11.680  1.00 28.36 ? 48  PHE B CB    1 
ATOM   3703  C CG    . PHE B 1 48  ? 31.192  10.066  10.712  1.00 28.95 ? 48  PHE B CG    1 
ATOM   3704  C CD1   . PHE B 1 48  ? 31.507  10.077  9.353   1.00 32.26 ? 48  PHE B CD1   1 
ATOM   3705  C CD2   . PHE B 1 48  ? 29.952  10.571  11.104  1.00 27.43 ? 48  PHE B CD2   1 
ATOM   3706  C CE1   . PHE B 1 48  ? 30.624  10.656  8.405   1.00 31.72 ? 48  PHE B CE1   1 
ATOM   3707  C CE2   . PHE B 1 48  ? 29.051  11.169  10.160  1.00 28.41 ? 48  PHE B CE2   1 
ATOM   3708  C CZ    . PHE B 1 48  ? 29.382  11.200  8.804   1.00 26.07 ? 48  PHE B CZ    1 
ATOM   3709  N N     . LYS B 1 49  ? 34.021  8.875   14.212  1.00 32.38 ? 49  LYS B N     1 
ATOM   3710  C CA    . LYS B 1 49  ? 35.219  8.237   14.842  1.00 32.70 ? 49  LYS B CA    1 
ATOM   3711  C C     . LYS B 1 49  ? 35.104  6.784   15.335  1.00 32.89 ? 49  LYS B C     1 
ATOM   3712  O O     . LYS B 1 49  ? 36.118  6.065   15.404  1.00 34.44 ? 49  LYS B O     1 
ATOM   3713  C CB    . LYS B 1 49  ? 35.729  9.129   15.997  1.00 34.29 ? 49  LYS B CB    1 
ATOM   3714  C CG    . LYS B 1 49  ? 36.067  10.613  15.633  1.00 34.39 ? 49  LYS B CG    1 
ATOM   3715  C CD    . LYS B 1 49  ? 37.226  10.742  14.577  1.00 32.97 ? 49  LYS B CD    1 
ATOM   3716  C CE    . LYS B 1 49  ? 37.394  12.181  14.151  1.00 33.66 ? 49  LYS B CE    1 
ATOM   3717  N NZ    . LYS B 1 49  ? 38.584  12.394  13.346  1.00 36.21 ? 49  LYS B NZ    1 
ATOM   3718  N N     . THR B 1 50  ? 33.909  6.347   15.730  1.00 32.83 ? 50  THR B N     1 
ATOM   3719  C CA    . THR B 1 50  ? 33.703  4.975   16.095  1.00 31.73 ? 50  THR B CA    1 
ATOM   3720  C C     . THR B 1 50  ? 32.221  4.657   15.880  1.00 33.68 ? 50  THR B C     1 
ATOM   3721  O O     . THR B 1 50  ? 31.396  5.553   15.691  1.00 33.63 ? 50  THR B O     1 
ATOM   3722  C CB    . THR B 1 50  ? 34.067  4.628   17.573  1.00 32.86 ? 50  THR B CB    1 
ATOM   3723  O OG1   . THR B 1 50  ? 33.254  5.354   18.442  1.00 25.62 ? 50  THR B OG1   1 
ATOM   3724  C CG2   . THR B 1 50  ? 35.576  4.851   17.964  1.00 33.52 ? 50  THR B CG2   1 
ATOM   3725  N N     . ALA B 1 51  ? 31.901  3.372   15.896  1.00 34.23 ? 51  ALA B N     1 
ATOM   3726  C CA    . ALA B 1 51  ? 30.593  2.907   15.562  1.00 35.40 ? 51  ALA B CA    1 
ATOM   3727  C C     . ALA B 1 51  ? 30.341  1.715   16.409  1.00 35.02 ? 51  ALA B C     1 
ATOM   3728  O O     . ALA B 1 51  ? 31.204  0.908   16.573  1.00 36.93 ? 51  ALA B O     1 
ATOM   3729  C CB    . ALA B 1 51  ? 30.525  2.524   14.127  1.00 34.51 ? 51  ALA B CB    1 
ATOM   3730  N N     . VAL B 1 52  ? 29.136  1.622   16.950  1.00 36.94 ? 52  VAL B N     1 
ATOM   3731  C CA    . VAL B 1 52  ? 28.680  0.450   17.728  1.00 35.68 ? 52  VAL B CA    1 
ATOM   3732  C C     . VAL B 1 52  ? 27.362  -0.016  17.046  1.00 35.33 ? 52  VAL B C     1 
ATOM   3733  O O     . VAL B 1 52  ? 26.369  0.773   16.942  1.00 35.48 ? 52  VAL B O     1 
ATOM   3734  C CB    . VAL B 1 52  ? 28.554  0.837   19.283  1.00 36.19 ? 52  VAL B CB    1 
ATOM   3735  C CG1   . VAL B 1 52  ? 27.910  -0.258  20.140  1.00 35.51 ? 52  VAL B CG1   1 
ATOM   3736  C CG2   . VAL B 1 52  ? 29.975  1.080   19.856  1.00 36.68 ? 52  VAL B CG2   1 
ATOM   3737  N N     . ILE B 1 53  ? 27.357  -1.244  16.530  1.00 31.32 ? 53  ILE B N     1 
ATOM   3738  C CA    . ILE B 1 53  ? 26.203  -1.713  15.803  1.00 30.41 ? 53  ILE B CA    1 
ATOM   3739  C C     . ILE B 1 53  ? 25.596  -3.042  16.278  1.00 30.26 ? 53  ILE B C     1 
ATOM   3740  O O     . ILE B 1 53  ? 26.289  -4.017  16.321  1.00 31.20 ? 53  ILE B O     1 
ATOM   3741  C CB    . ILE B 1 53  ? 26.572  -1.844  14.287  1.00 29.72 ? 53  ILE B CB    1 
ATOM   3742  C CG1   . ILE B 1 53  ? 26.886  -0.486  13.726  1.00 24.62 ? 53  ILE B CG1   1 
ATOM   3743  C CG2   . ILE B 1 53  ? 25.403  -2.553  13.503  1.00 28.88 ? 53  ILE B CG2   1 
ATOM   3744  C CD1   . ILE B 1 53  ? 27.428  -0.632  12.378  1.00 33.25 ? 53  ILE B CD1   1 
ATOM   3745  N N     . THR B 1 54  ? 24.321  -3.091  16.607  1.00 30.17 ? 54  THR B N     1 
ATOM   3746  C CA    . THR B 1 54  ? 23.777  -4.317  17.228  1.00 31.92 ? 54  THR B CA    1 
ATOM   3747  C C     . THR B 1 54  ? 23.205  -5.294  16.227  1.00 31.86 ? 54  THR B C     1 
ATOM   3748  O O     . THR B 1 54  ? 22.690  -4.920  15.191  1.00 31.52 ? 54  THR B O     1 
ATOM   3749  C CB    . THR B 1 54  ? 22.682  -4.085  18.348  1.00 31.85 ? 54  THR B CB    1 
ATOM   3750  O OG1   . THR B 1 54  ? 21.624  -3.329  17.781  1.00 33.55 ? 54  THR B OG1   1 
ATOM   3751  C CG2   . THR B 1 54  ? 23.243  -3.348  19.620  1.00 27.83 ? 54  THR B CG2   1 
ATOM   3752  N N     . VAL B 1 55  ? 23.306  -6.554  16.590  1.00 34.45 ? 55  VAL B N     1 
ATOM   3753  C CA    . VAL B 1 55  ? 22.898  -7.683  15.772  1.00 37.19 ? 55  VAL B CA    1 
ATOM   3754  C C     . VAL B 1 55  ? 21.940  -8.524  16.588  1.00 39.70 ? 55  VAL B C     1 
ATOM   3755  O O     . VAL B 1 55  ? 22.327  -9.025  17.680  1.00 41.72 ? 55  VAL B O     1 
ATOM   3756  C CB    . VAL B 1 55  ? 24.158  -8.542  15.394  1.00 38.35 ? 55  VAL B CB    1 
ATOM   3757  C CG1   . VAL B 1 55  ? 23.774  -10.055 15.018  1.00 37.51 ? 55  VAL B CG1   1 
ATOM   3758  C CG2   . VAL B 1 55  ? 24.907  -7.896  14.235  1.00 33.60 ? 55  VAL B CG2   1 
ATOM   3759  N N     . GLU B 1 56  ? 20.692  -8.629  16.150  1.00 41.81 ? 56  GLU B N     1 
ATOM   3760  C CA    . GLU B 1 56  ? 19.844  -9.725  16.685  1.00 46.61 ? 56  GLU B CA    1 
ATOM   3761  C C     . GLU B 1 56  ? 20.456  -11.097 16.230  1.00 47.55 ? 56  GLU B C     1 
ATOM   3762  O O     . GLU B 1 56  ? 20.699  -11.348 15.016  1.00 48.75 ? 56  GLU B O     1 
ATOM   3763  C CB    . GLU B 1 56  ? 18.411  -9.549  16.213  1.00 45.68 ? 56  GLU B CB    1 
ATOM   3764  C CG    . GLU B 1 56  ? 17.300  -10.363 16.928  1.00 47.55 ? 56  GLU B CG    1 
ATOM   3765  C CD    . GLU B 1 56  ? 15.917  -10.144 16.239  1.00 49.92 ? 56  GLU B CD    1 
ATOM   3766  O OE1   . GLU B 1 56  ? 15.522  -8.956  15.999  1.00 47.79 ? 56  GLU B OE1   1 
ATOM   3767  O OE2   . GLU B 1 56  ? 15.238  -11.170 15.925  1.00 53.65 ? 56  GLU B OE2   1 
ATOM   3768  N N     . ASN B 1 57  ? 20.758  -11.971 17.160  1.00 48.67 ? 57  ASN B N     1 
ATOM   3769  C CA    . ASN B 1 57  ? 21.350  -13.287 16.722  1.00 50.85 ? 57  ASN B CA    1 
ATOM   3770  C C     . ASN B 1 57  ? 22.914  -13.367 16.604  1.00 50.91 ? 57  ASN B C     1 
ATOM   3771  O O     . ASN B 1 57  ? 23.466  -14.212 15.849  1.00 50.11 ? 57  ASN B O     1 
ATOM   3772  C CB    . ASN B 1 57  ? 20.698  -13.744 15.403  1.00 50.94 ? 57  ASN B CB    1 
ATOM   3773  C CG    . ASN B 1 57  ? 19.287  -14.321 15.605  1.00 52.65 ? 57  ASN B CG    1 
ATOM   3774  O OD1   . ASN B 1 57  ? 18.315  -13.833 14.998  1.00 52.09 ? 57  ASN B OD1   1 
ATOM   3775  N ND2   . ASN B 1 57  ? 19.178  -15.396 16.417  1.00 50.05 ? 57  ASN B ND2   1 
ATOM   3776  N N     . GLY B 1 58  ? 23.603  -12.532 17.409  1.00 50.49 ? 58  GLY B N     1 
ATOM   3777  C CA    . GLY B 1 58  ? 25.011  -12.298 17.223  1.00 49.35 ? 58  GLY B CA    1 
ATOM   3778  C C     . GLY B 1 58  ? 25.625  -11.159 18.019  1.00 48.43 ? 58  GLY B C     1 
ATOM   3779  O O     . GLY B 1 58  ? 24.924  -10.326 18.597  1.00 48.75 ? 58  GLY B O     1 
ATOM   3780  N N     . LYS B 1 59  ? 26.957  -11.214 18.050  1.00 47.86 ? 59  LYS B N     1 
ATOM   3781  C CA    . LYS B 1 59  ? 27.888  -10.275 18.672  1.00 47.86 ? 59  LYS B CA    1 
ATOM   3782  C C     . LYS B 1 59  ? 27.749  -8.861  18.068  1.00 46.83 ? 59  LYS B C     1 
ATOM   3783  O O     . LYS B 1 59  ? 27.592  -8.719  16.825  1.00 46.32 ? 59  LYS B O     1 
ATOM   3784  C CB    . LYS B 1 59  ? 29.296  -10.786 18.413  1.00 47.07 ? 59  LYS B CB    1 
ATOM   3785  C CG    . LYS B 1 59  ? 30.187  -10.684 19.598  1.00 51.46 ? 59  LYS B CG    1 
ATOM   3786  C CD    . LYS B 1 59  ? 31.530  -11.372 19.333  1.00 56.94 ? 59  LYS B CD    1 
ATOM   3787  C CE    . LYS B 1 59  ? 32.705  -10.420 19.251  1.00 58.00 ? 59  LYS B CE    1 
ATOM   3788  N NZ    . LYS B 1 59  ? 33.844  -11.111 18.543  1.00 62.06 ? 59  LYS B NZ    1 
ATOM   3789  N N     . THR B 1 60  ? 27.808  -7.825  18.922  1.00 44.95 ? 60  THR B N     1 
ATOM   3790  C CA    . THR B 1 60  ? 27.627  -6.498  18.391  1.00 42.71 ? 60  THR B CA    1 
ATOM   3791  C C     . THR B 1 60  ? 28.865  -6.101  17.645  1.00 41.25 ? 60  THR B C     1 
ATOM   3792  O O     . THR B 1 60  ? 29.975  -6.459  18.036  1.00 41.08 ? 60  THR B O     1 
ATOM   3793  C CB    . THR B 1 60  ? 27.018  -5.399  19.369  1.00 42.50 ? 60  THR B CB    1 
ATOM   3794  O OG1   . THR B 1 60  ? 27.992  -4.476  19.907  1.00 38.61 ? 60  THR B OG1   1 
ATOM   3795  C CG2   . THR B 1 60  ? 26.081  -5.980  20.376  1.00 41.18 ? 60  THR B CG2   1 
ATOM   3796  N N     . ILE B 1 61  ? 28.650  -5.374  16.551  1.00 40.82 ? 61  ILE B N     1 
ATOM   3797  C CA    . ILE B 1 61  ? 29.763  -4.925  15.692  1.00 38.97 ? 61  ILE B CA    1 
ATOM   3798  C C     . ILE B 1 61  ? 30.396  -3.670  16.250  1.00 40.38 ? 61  ILE B C     1 
ATOM   3799  O O     . ILE B 1 61  ? 29.720  -2.708  16.607  1.00 40.20 ? 61  ILE B O     1 
ATOM   3800  C CB    . ILE B 1 61  ? 29.354  -4.865  14.214  1.00 38.12 ? 61  ILE B CB    1 
ATOM   3801  C CG1   . ILE B 1 61  ? 29.050  -6.310  13.741  1.00 36.66 ? 61  ILE B CG1   1 
ATOM   3802  C CG2   . ILE B 1 61  ? 30.449  -4.183  13.327  1.00 33.67 ? 61  ILE B CG2   1 
ATOM   3803  C CD1   . ILE B 1 61  ? 28.303  -6.462  12.415  1.00 37.25 ? 61  ILE B CD1   1 
ATOM   3804  N N     . GLN B 1 62  ? 31.721  -3.710  16.360  1.00 42.15 ? 62  GLN B N     1 
ATOM   3805  C CA    . GLN B 1 62  ? 32.501  -2.518  16.752  1.00 42.80 ? 62  GLN B CA    1 
ATOM   3806  C C     . GLN B 1 62  ? 33.545  -2.083  15.723  1.00 42.44 ? 62  GLN B C     1 
ATOM   3807  O O     . GLN B 1 62  ? 34.263  -2.905  15.207  1.00 41.06 ? 62  GLN B O     1 
ATOM   3808  C CB    . GLN B 1 62  ? 33.213  -2.819  18.016  1.00 41.74 ? 62  GLN B CB    1 
ATOM   3809  C CG    . GLN B 1 62  ? 32.264  -3.387  18.896  1.00 43.76 ? 62  GLN B CG    1 
ATOM   3810  C CD    . GLN B 1 62  ? 32.513  -3.036  20.300  1.00 45.22 ? 62  GLN B CD    1 
ATOM   3811  O OE1   . GLN B 1 62  ? 33.575  -3.351  20.868  1.00 51.15 ? 62  GLN B OE1   1 
ATOM   3812  N NE2   . GLN B 1 62  ? 31.535  -2.431  20.898  1.00 39.79 ? 62  GLN B NE2   1 
ATOM   3813  N N     . PHE B 1 63  ? 33.543  -0.776  15.447  1.00 42.68 ? 63  PHE B N     1 
ATOM   3814  C CA    . PHE B 1 63  ? 34.557  -0.058  14.688  1.00 42.90 ? 63  PHE B CA    1 
ATOM   3815  C C     . PHE B 1 63  ? 35.164  0.877   15.706  1.00 42.13 ? 63  PHE B C     1 
ATOM   3816  O O     . PHE B 1 63  ? 34.711  1.985   15.905  1.00 41.90 ? 63  PHE B O     1 
ATOM   3817  C CB    . PHE B 1 63  ? 33.983  0.793   13.515  1.00 42.15 ? 63  PHE B CB    1 
ATOM   3818  C CG    . PHE B 1 63  ? 33.264  -0.016  12.413  1.00 43.79 ? 63  PHE B CG    1 
ATOM   3819  C CD1   . PHE B 1 63  ? 32.868  0.613   11.225  1.00 44.25 ? 63  PHE B CD1   1 
ATOM   3820  C CD2   . PHE B 1 63  ? 33.000  -1.380  12.541  1.00 43.04 ? 63  PHE B CD2   1 
ATOM   3821  C CE1   . PHE B 1 63  ? 32.209  -0.086  10.220  1.00 42.24 ? 63  PHE B CE1   1 
ATOM   3822  C CE2   . PHE B 1 63  ? 32.321  -2.068  11.534  1.00 42.38 ? 63  PHE B CE2   1 
ATOM   3823  C CZ    . PHE B 1 63  ? 31.934  -1.437  10.388  1.00 41.74 ? 63  PHE B CZ    1 
ATOM   3824  N N     . GLY B 1 64  ? 36.232  0.435   16.353  1.00 42.50 ? 64  GLY B N     1 
ATOM   3825  C CA    . GLY B 1 64  ? 37.153  1.341   17.010  1.00 41.52 ? 64  GLY B CA    1 
ATOM   3826  C C     . GLY B 1 64  ? 37.722  2.393   16.085  1.00 42.27 ? 64  GLY B C     1 
ATOM   3827  O O     . GLY B 1 64  ? 37.350  2.471   14.926  1.00 41.85 ? 64  GLY B O     1 
ATOM   3828  N N     . GLU B 1 65  ? 38.631  3.205   16.604  1.00 43.28 ? 65  GLU B N     1 
ATOM   3829  C CA    . GLU B 1 65  ? 39.024  4.438   15.940  1.00 44.03 ? 65  GLU B CA    1 
ATOM   3830  C C     . GLU B 1 65  ? 39.779  4.204   14.644  1.00 43.84 ? 65  GLU B C     1 
ATOM   3831  O O     . GLU B 1 65  ? 39.661  4.962   13.698  1.00 44.17 ? 65  GLU B O     1 
ATOM   3832  C CB    . GLU B 1 65  ? 39.844  5.308   16.877  1.00 45.78 ? 65  GLU B CB    1 
ATOM   3833  C CG    . GLU B 1 65  ? 39.447  5.183   18.331  1.00 50.28 ? 65  GLU B CG    1 
ATOM   3834  C CD    . GLU B 1 65  ? 38.819  6.448   18.861  1.00 54.32 ? 65  GLU B CD    1 
ATOM   3835  O OE1   . GLU B 1 65  ? 38.648  6.560   20.084  1.00 54.91 ? 65  GLU B OE1   1 
ATOM   3836  O OE2   . GLU B 1 65  ? 38.484  7.326   18.049  1.00 50.97 ? 65  GLU B OE2   1 
ATOM   3837  N N     . GLU B 1 66  ? 40.549  3.132   14.630  1.00 43.18 ? 66  GLU B N     1 
ATOM   3838  C CA    . GLU B 1 66  ? 41.323  2.702   13.481  1.00 43.72 ? 66  GLU B CA    1 
ATOM   3839  C C     . GLU B 1 66  ? 40.468  2.035   12.402  1.00 42.60 ? 66  GLU B C     1 
ATOM   3840  O O     . GLU B 1 66  ? 40.622  2.308   11.225  1.00 41.68 ? 66  GLU B O     1 
ATOM   3841  C CB    . GLU B 1 66  ? 42.418  1.734   13.950  1.00 42.67 ? 66  GLU B CB    1 
ATOM   3842  C CG    . GLU B 1 66  ? 43.484  1.429   12.928  1.00 44.55 ? 66  GLU B CG    1 
ATOM   3843  C CD    . GLU B 1 66  ? 44.638  2.397   13.000  1.00 44.61 ? 66  GLU B CD    1 
ATOM   3844  O OE1   . GLU B 1 66  ? 45.554  2.299   12.152  1.00 48.80 ? 66  GLU B OE1   1 
ATOM   3845  O OE2   . GLU B 1 66  ? 44.626  3.263   13.902  1.00 41.31 ? 66  GLU B OE2   1 
ATOM   3846  N N     . MET B 1 67  ? 39.584  1.140   12.814  1.00 40.83 ? 67  MET B N     1 
ATOM   3847  C CA    . MET B 1 67  ? 38.738  0.426   11.878  1.00 40.13 ? 67  MET B CA    1 
ATOM   3848  C C     . MET B 1 67  ? 37.793  1.395   11.196  1.00 38.70 ? 67  MET B C     1 
ATOM   3849  O O     . MET B 1 67  ? 37.501  1.276   10.024  1.00 38.17 ? 67  MET B O     1 
ATOM   3850  C CB    . MET B 1 67  ? 37.975  -0.679  12.608  1.00 39.81 ? 67  MET B CB    1 
ATOM   3851  C CG    . MET B 1 67  ? 36.993  -1.477  11.782  1.00 43.40 ? 67  MET B CG    1 
ATOM   3852  S SD    . MET B 1 67  ? 37.658  -2.263  10.325  1.00 49.96 ? 67  MET B SD    1 
ATOM   3853  C CE    . MET B 1 67  ? 38.933  -3.263  11.049  1.00 49.01 ? 67  MET B CE    1 
ATOM   3854  N N     . MET B 1 68  ? 37.350  2.378   11.954  1.00 37.53 ? 68  MET B N     1 
ATOM   3855  C CA    . MET B 1 68  ? 36.523  3.495   11.409  1.00 37.29 ? 68  MET B CA    1 
ATOM   3856  C C     . MET B 1 68  ? 37.256  4.274   10.304  1.00 36.99 ? 68  MET B C     1 
ATOM   3857  O O     . MET B 1 68  ? 36.656  4.527   9.236   1.00 37.79 ? 68  MET B O     1 
ATOM   3858  C CB    . MET B 1 68  ? 36.074  4.467   12.530  1.00 37.44 ? 68  MET B CB    1 
ATOM   3859  C CG    . MET B 1 68  ? 35.154  5.631   12.047  1.00 39.13 ? 68  MET B CG    1 
ATOM   3860  S SD    . MET B 1 68  ? 33.620  5.045   11.251  1.00 38.21 ? 68  MET B SD    1 
ATOM   3861  C CE    . MET B 1 68  ? 32.497  5.291   12.633  1.00 36.57 ? 68  MET B CE    1 
ATOM   3862  N N     . LYS B 1 69  ? 38.548  4.593   10.529  1.00 34.50 ? 69  LYS B N     1 
ATOM   3863  C CA    . LYS B 1 69  ? 39.329  5.303   9.550   1.00 34.76 ? 69  LYS B CA    1 
ATOM   3864  C C     . LYS B 1 69  ? 39.457  4.527   8.257   1.00 33.44 ? 69  LYS B C     1 
ATOM   3865  O O     . LYS B 1 69  ? 39.539  5.104   7.241   1.00 34.14 ? 69  LYS B O     1 
ATOM   3866  C CB    . LYS B 1 69  ? 40.745  5.740   10.058  1.00 34.16 ? 69  LYS B CB    1 
ATOM   3867  C CG    . LYS B 1 69  ? 40.804  7.007   10.869  1.00 33.89 ? 69  LYS B CG    1 
ATOM   3868  C CD    . LYS B 1 69  ? 42.042  7.002   11.796  1.00 36.60 ? 69  LYS B CD    1 
ATOM   3869  C CE    . LYS B 1 69  ? 43.311  7.458   11.129  1.00 46.32 ? 69  LYS B CE    1 
ATOM   3870  N NZ    . LYS B 1 69  ? 44.570  6.875   11.793  1.00 50.81 ? 69  LYS B NZ    1 
ATOM   3871  N N     . ARG B 1 70  ? 39.577  3.220   8.316   1.00 33.54 ? 70  ARG B N     1 
ATOM   3872  C CA    . ARG B 1 70  ? 39.601  2.375   7.113   1.00 33.05 ? 70  ARG B CA    1 
ATOM   3873  C C     . ARG B 1 70  ? 38.199  2.291   6.392   1.00 32.35 ? 70  ARG B C     1 
ATOM   3874  O O     . ARG B 1 70  ? 38.091  2.373   5.158   1.00 32.37 ? 70  ARG B O     1 
ATOM   3875  C CB    . ARG B 1 70  ? 40.065  0.982   7.539   1.00 33.35 ? 70  ARG B CB    1 
ATOM   3876  C CG    . ARG B 1 70  ? 39.780  -0.060  6.490   1.00 31.85 ? 70  ARG B CG    1 
ATOM   3877  C CD    . ARG B 1 70  ? 40.427  -1.359  6.823   1.00 27.56 ? 70  ARG B CD    1 
ATOM   3878  N NE    . ARG B 1 70  ? 40.298  -2.204  5.654   1.00 30.73 ? 70  ARG B NE    1 
ATOM   3879  C CZ    . ARG B 1 70  ? 40.026  -3.505  5.648   1.00 29.86 ? 70  ARG B CZ    1 
ATOM   3880  N NH1   . ARG B 1 70  ? 39.875  -4.211  6.797   1.00 27.48 ? 70  ARG B NH1   1 
ATOM   3881  N NH2   . ARG B 1 70  ? 39.932  -4.113  4.468   1.00 28.47 ? 70  ARG B NH2   1 
ATOM   3882  N N     . ALA B 1 71  ? 37.167  2.153   7.207   1.00 29.44 ? 71  ALA B N     1 
ATOM   3883  C CA    . ALA B 1 71  ? 35.760  2.306   6.839   1.00 29.46 ? 71  ALA B CA    1 
ATOM   3884  C C     . ALA B 1 71  ? 35.375  3.605   6.143   1.00 29.71 ? 71  ALA B C     1 
ATOM   3885  O O     . ALA B 1 71  ? 34.418  3.565   5.333   1.00 30.05 ? 71  ALA B O     1 
ATOM   3886  C CB    . ALA B 1 71  ? 34.907  2.164   8.092   1.00 27.51 ? 71  ALA B CB    1 
ATOM   3887  N N     . LEU B 1 72  ? 36.028  4.736   6.504   1.00 28.28 ? 72  LEU B N     1 
ATOM   3888  C CA    . LEU B 1 72  ? 35.777  6.022   5.814   1.00 29.56 ? 72  LEU B CA    1 
ATOM   3889  C C     . LEU B 1 72  ? 36.683  6.259   4.602   1.00 29.74 ? 72  LEU B C     1 
ATOM   3890  O O     . LEU B 1 72  ? 36.480  7.249   3.893   1.00 29.84 ? 72  LEU B O     1 
ATOM   3891  C CB    . LEU B 1 72  ? 35.856  7.264   6.788   1.00 28.95 ? 72  LEU B CB    1 
ATOM   3892  C CG    . LEU B 1 72  ? 35.021  7.100   8.065   1.00 25.92 ? 72  LEU B CG    1 
ATOM   3893  C CD1   . LEU B 1 72  ? 35.163  8.209   9.185   1.00 26.55 ? 72  LEU B CD1   1 
ATOM   3894  C CD2   . LEU B 1 72  ? 33.522  6.781   7.660   1.00 27.68 ? 72  LEU B CD2   1 
ATOM   3895  N N     . GLN B 1 73  ? 37.677  5.368   4.359   1.00 27.87 ? 73  GLN B N     1 
ATOM   3896  C CA    . GLN B 1 73  ? 38.735  5.644   3.348   1.00 26.87 ? 73  GLN B CA    1 
ATOM   3897  C C     . GLN B 1 73  ? 38.368  4.808   2.142   1.00 27.80 ? 73  GLN B C     1 
ATOM   3898  O O     . GLN B 1 73  ? 37.612  3.813   2.240   1.00 28.18 ? 73  GLN B O     1 
ATOM   3899  C CB    . GLN B 1 73  ? 40.165  5.332   3.938   1.00 25.86 ? 73  GLN B CB    1 
ATOM   3900  C CG    . GLN B 1 73  ? 41.493  5.657   3.105   1.00 23.16 ? 73  GLN B CG    1 
ATOM   3901  C CD    . GLN B 1 73  ? 41.532  7.107   2.542   1.00 25.59 ? 73  GLN B CD    1 
ATOM   3902  O OE1   . GLN B 1 73  ? 40.758  7.456   1.655   1.00 28.48 ? 73  GLN B OE1   1 
ATOM   3903  N NE2   . GLN B 1 73  ? 42.378  7.937   3.089   1.00 24.03 ? 73  GLN B NE2   1 
ATOM   3904  N N     . TYR B 1 74  ? 38.879  5.215   0.984   1.00 28.58 ? 74  TYR B N     1 
ATOM   3905  C CA    . TYR B 1 74  ? 38.848  4.375   -0.258  1.00 28.49 ? 74  TYR B CA    1 
ATOM   3906  C C     . TYR B 1 74  ? 39.459  2.975   -0.091  1.00 28.86 ? 74  TYR B C     1 
ATOM   3907  O O     . TYR B 1 74  ? 40.522  2.820   0.451   1.00 31.98 ? 74  TYR B O     1 
ATOM   3908  C CB    . TYR B 1 74  ? 39.684  5.078   -1.343  1.00 27.85 ? 74  TYR B CB    1 
ATOM   3909  C CG    . TYR B 1 74  ? 39.165  6.391   -1.929  1.00 27.14 ? 74  TYR B CG    1 
ATOM   3910  C CD1   . TYR B 1 74  ? 38.006  6.445   -2.717  1.00 27.29 ? 74  TYR B CD1   1 
ATOM   3911  C CD2   . TYR B 1 74  ? 39.914  7.581   -1.801  1.00 27.86 ? 74  TYR B CD2   1 
ATOM   3912  C CE1   . TYR B 1 74  ? 37.584  7.670   -3.388  1.00 25.66 ? 74  TYR B CE1   1 
ATOM   3913  C CE2   . TYR B 1 74  ? 39.494  8.774   -2.432  1.00 26.31 ? 74  TYR B CE2   1 
ATOM   3914  C CZ    . TYR B 1 74  ? 38.343  8.835   -3.206  1.00 26.24 ? 74  TYR B CZ    1 
ATOM   3915  O OH    . TYR B 1 74  ? 37.973  10.095  -3.823  1.00 26.60 ? 74  TYR B OH    1 
ATOM   3916  N N     . SER B 1 75  ? 38.795  1.950   -0.611  1.00 29.72 ? 75  SER B N     1 
ATOM   3917  C CA    . SER B 1 75  ? 39.253  0.551   -0.659  1.00 27.53 ? 75  SER B CA    1 
ATOM   3918  C C     . SER B 1 75  ? 39.332  -0.122  -2.081  1.00 25.81 ? 75  SER B C     1 
ATOM   3919  O O     . SER B 1 75  ? 38.973  0.447   -3.056  1.00 23.12 ? 75  SER B O     1 
ATOM   3920  C CB    . SER B 1 75  ? 38.330  -0.308  0.151   1.00 26.34 ? 75  SER B CB    1 
ATOM   3921  O OG    . SER B 1 75  ? 37.033  -0.058  -0.250  1.00 30.02 ? 75  SER B OG    1 
ATOM   3922  N N     . PRO B 1 76  ? 39.742  -1.402  -2.144  1.00 26.15 ? 76  PRO B N     1 
ATOM   3923  C CA    . PRO B 1 76  ? 39.902  -1.909  -3.514  1.00 26.01 ? 76  PRO B CA    1 
ATOM   3924  C C     . PRO B 1 76  ? 38.639  -1.859  -4.400  1.00 26.28 ? 76  PRO B C     1 
ATOM   3925  O O     . PRO B 1 76  ? 37.541  -1.937  -3.905  1.00 26.82 ? 76  PRO B O     1 
ATOM   3926  C CB    . PRO B 1 76  ? 40.466  -3.311  -3.300  1.00 27.67 ? 76  PRO B CB    1 
ATOM   3927  C CG    . PRO B 1 76  ? 41.114  -3.237  -1.778  1.00 25.49 ? 76  PRO B CG    1 
ATOM   3928  C CD    . PRO B 1 76  ? 40.104  -2.404  -1.100  1.00 24.05 ? 76  PRO B CD    1 
ATOM   3929  N N     . SER B 1 77  ? 38.817  -1.723  -5.723  1.00 26.17 ? 77  SER B N     1 
ATOM   3930  C CA    . SER B 1 77  ? 37.685  -1.673  -6.679  1.00 25.93 ? 77  SER B CA    1 
ATOM   3931  C C     . SER B 1 77  ? 36.656  -2.854  -6.649  1.00 25.37 ? 77  SER B C     1 
ATOM   3932  O O     . SER B 1 77  ? 35.477  -2.621  -6.895  1.00 23.78 ? 77  SER B O     1 
ATOM   3933  C CB    . SER B 1 77  ? 38.214  -1.523  -8.102  1.00 26.95 ? 77  SER B CB    1 
ATOM   3934  O OG    . SER B 1 77  ? 39.415  -0.739  -8.158  1.00 28.18 ? 77  SER B OG    1 
ATOM   3935  N N     . ALA B 1 78  ? 37.132  -4.089  -6.390  1.00 24.99 ? 78  ALA B N     1 
ATOM   3936  C CA    . ALA B 1 78  ? 36.369  -5.362  -6.558  1.00 24.22 ? 78  ALA B CA    1 
ATOM   3937  C C     . ALA B 1 78  ? 35.873  -5.759  -5.188  1.00 25.25 ? 78  ALA B C     1 
ATOM   3938  O O     . ALA B 1 78  ? 35.165  -6.727  -5.084  1.00 24.57 ? 78  ALA B O     1 
ATOM   3939  C CB    . ALA B 1 78  ? 37.290  -6.559  -7.125  1.00 24.41 ? 78  ALA B CB    1 
ATOM   3940  N N     . GLY B 1 79  ? 36.211  -4.946  -4.167  1.00 25.68 ? 79  GLY B N     1 
ATOM   3941  C CA    . GLY B 1 79  ? 35.898  -5.196  -2.783  1.00 27.33 ? 79  GLY B CA    1 
ATOM   3942  C C     . GLY B 1 79  ? 37.075  -5.478  -1.852  1.00 27.88 ? 79  GLY B C     1 
ATOM   3943  O O     . GLY B 1 79  ? 38.186  -5.656  -2.288  1.00 30.05 ? 79  GLY B O     1 
ATOM   3944  N N     . ILE B 1 80  ? 36.797  -5.484  -0.550  1.00 28.74 ? 80  ILE B N     1 
ATOM   3945  C CA    . ILE B 1 80  ? 37.758  -5.713  0.508   1.00 28.04 ? 80  ILE B CA    1 
ATOM   3946  C C     . ILE B 1 80  ? 38.134  -7.203  0.499   1.00 28.31 ? 80  ILE B C     1 
ATOM   3947  O O     . ILE B 1 80  ? 37.296  -8.106  0.323   1.00 29.05 ? 80  ILE B O     1 
ATOM   3948  C CB    . ILE B 1 80  ? 37.264  -5.255  1.901   1.00 27.25 ? 80  ILE B CB    1 
ATOM   3949  C CG1   . ILE B 1 80  ? 36.039  -6.010  2.405   1.00 25.47 ? 80  ILE B CG1   1 
ATOM   3950  C CG2   . ILE B 1 80  ? 36.925  -3.739  1.899   1.00 32.29 ? 80  ILE B CG2   1 
ATOM   3951  C CD1   . ILE B 1 80  ? 35.529  -5.613  3.872   1.00 25.91 ? 80  ILE B CD1   1 
ATOM   3952  N N     . PRO B 1 81  ? 39.412  -7.451  0.695   1.00 28.15 ? 81  PRO B N     1 
ATOM   3953  C CA    . PRO B 1 81  ? 39.933  -8.764  0.514   1.00 27.32 ? 81  PRO B CA    1 
ATOM   3954  C C     . PRO B 1 81  ? 39.116  -9.760  1.393   1.00 28.82 ? 81  PRO B C     1 
ATOM   3955  O O     . PRO B 1 81  ? 38.661  -10.772 0.893   1.00 26.52 ? 81  PRO B O     1 
ATOM   3956  C CB    . PRO B 1 81  ? 41.421  -8.604  0.917   1.00 27.11 ? 81  PRO B CB    1 
ATOM   3957  C CG    . PRO B 1 81  ? 41.543  -7.237  1.681   1.00 25.45 ? 81  PRO B CG    1 
ATOM   3958  C CD    . PRO B 1 81  ? 40.421  -6.425  1.111   1.00 27.31 ? 81  PRO B CD    1 
ATOM   3959  N N     . GLU B 1 82  ? 38.846  -9.415  2.668   1.00 29.53 ? 82  GLU B N     1 
ATOM   3960  C CA    . GLU B 1 82  ? 38.079  -10.293 3.562   1.00 29.69 ? 82  GLU B CA    1 
ATOM   3961  C C     . GLU B 1 82  ? 36.672  -10.659 3.121   1.00 29.97 ? 82  GLU B C     1 
ATOM   3962  O O     . GLU B 1 82  ? 36.250  -11.810 3.299   1.00 31.35 ? 82  GLU B O     1 
ATOM   3963  C CB    . GLU B 1 82  ? 38.136  -9.795  5.062   1.00 32.37 ? 82  GLU B CB    1 
ATOM   3964  C CG    . GLU B 1 82  ? 37.760  -8.324  5.354   1.00 33.71 ? 82  GLU B CG    1 
ATOM   3965  C CD    . GLU B 1 82  ? 38.921  -7.358  5.418   1.00 34.67 ? 82  GLU B CD    1 
ATOM   3966  O OE1   . GLU B 1 82  ? 39.575  -7.206  4.357   1.00 34.19 ? 82  GLU B OE1   1 
ATOM   3967  O OE2   . GLU B 1 82  ? 39.156  -6.692  6.497   1.00 32.32 ? 82  GLU B OE2   1 
ATOM   3968  N N     . LEU B 1 83  ? 35.919  -9.716  2.570   1.00 29.18 ? 83  LEU B N     1 
ATOM   3969  C CA    . LEU B 1 83  ? 34.656  -10.014 1.964   1.00 28.61 ? 83  LEU B CA    1 
ATOM   3970  C C     . LEU B 1 83  ? 34.795  -10.846 0.667   1.00 28.47 ? 83  LEU B C     1 
ATOM   3971  O O     . LEU B 1 83  ? 34.144  -11.872 0.525   1.00 26.86 ? 83  LEU B O     1 
ATOM   3972  C CB    . LEU B 1 83  ? 33.815  -8.710  1.764   1.00 29.55 ? 83  LEU B CB    1 
ATOM   3973  C CG    . LEU B 1 83  ? 32.297  -8.718  1.975   1.00 30.74 ? 83  LEU B CG    1 
ATOM   3974  C CD1   . LEU B 1 83  ? 31.600  -7.742  1.019   1.00 27.64 ? 83  LEU B CD1   1 
ATOM   3975  C CD2   . LEU B 1 83  ? 31.637  -10.163 2.028   1.00 31.95 ? 83  LEU B CD2   1 
ATOM   3976  N N     . LEU B 1 84  ? 35.633  -10.421 -0.287  1.00 30.51 ? 84  LEU B N     1 
ATOM   3977  C CA    . LEU B 1 84  ? 35.908  -11.264 -1.483  1.00 32.19 ? 84  LEU B CA    1 
ATOM   3978  C C     . LEU B 1 84  ? 36.276  -12.713 -1.185  1.00 32.34 ? 84  LEU B C     1 
ATOM   3979  O O     . LEU B 1 84  ? 35.627  -13.632 -1.662  1.00 32.58 ? 84  LEU B O     1 
ATOM   3980  C CB    . LEU B 1 84  ? 37.050  -10.708 -2.315  1.00 34.76 ? 84  LEU B CB    1 
ATOM   3981  C CG    . LEU B 1 84  ? 36.875  -9.965  -3.633  1.00 38.22 ? 84  LEU B CG    1 
ATOM   3982  C CD1   . LEU B 1 84  ? 35.455  -9.561  -4.058  1.00 31.66 ? 84  LEU B CD1   1 
ATOM   3983  C CD2   . LEU B 1 84  ? 37.800  -8.714  -3.482  1.00 39.62 ? 84  LEU B CD2   1 
ATOM   3984  N N     . SER B 1 85  ? 37.300  -12.954 -0.394  1.00 33.02 ? 85  SER B N     1 
ATOM   3985  C CA    . SER B 1 85  ? 37.577  -14.352 0.011   1.00 34.12 ? 85  SER B CA    1 
ATOM   3986  C C     . SER B 1 85  ? 36.459  -15.048 0.747   1.00 33.55 ? 85  SER B C     1 
ATOM   3987  O O     . SER B 1 85  ? 36.319  -16.262 0.594   1.00 34.93 ? 85  SER B O     1 
ATOM   3988  C CB    . SER B 1 85  ? 38.850  -14.455 0.841   1.00 34.72 ? 85  SER B CB    1 
ATOM   3989  O OG    . SER B 1 85  ? 38.857  -13.364 1.704   1.00 36.84 ? 85  SER B OG    1 
ATOM   3990  N N     . TRP B 1 86  ? 35.657  -14.328 1.537   1.00 32.36 ? 86  TRP B N     1 
ATOM   3991  C CA    . TRP B 1 86  ? 34.554  -14.998 2.250   1.00 32.86 ? 86  TRP B CA    1 
ATOM   3992  C C     . TRP B 1 86  ? 33.473  -15.306 1.183   1.00 34.02 ? 86  TRP B C     1 
ATOM   3993  O O     . TRP B 1 86  ? 32.864  -16.400 1.159   1.00 33.19 ? 86  TRP B O     1 
ATOM   3994  C CB    . TRP B 1 86  ? 33.952  -14.122 3.371   1.00 32.10 ? 86  TRP B CB    1 
ATOM   3995  C CG    . TRP B 1 86  ? 33.029  -14.859 4.396   1.00 30.55 ? 86  TRP B CG    1 
ATOM   3996  C CD1   . TRP B 1 86  ? 33.394  -15.308 5.644   1.00 25.16 ? 86  TRP B CD1   1 
ATOM   3997  C CD2   . TRP B 1 86  ? 31.655  -15.257 4.210   1.00 28.10 ? 86  TRP B CD2   1 
ATOM   3998  N NE1   . TRP B 1 86  ? 32.332  -15.928 6.249   1.00 26.92 ? 86  TRP B NE1   1 
ATOM   3999  C CE2   . TRP B 1 86  ? 31.245  -15.900 5.408   1.00 27.57 ? 86  TRP B CE2   1 
ATOM   4000  C CE3   . TRP B 1 86  ? 30.712  -15.067 3.183   1.00 21.63 ? 86  TRP B CE3   1 
ATOM   4001  C CZ2   . TRP B 1 86  ? 29.929  -16.399 5.595   1.00 31.04 ? 86  TRP B CZ2   1 
ATOM   4002  C CZ3   . TRP B 1 86  ? 29.420  -15.569 3.354   1.00 28.75 ? 86  TRP B CZ3   1 
ATOM   4003  C CH2   . TRP B 1 86  ? 29.022  -16.216 4.560   1.00 29.19 ? 86  TRP B CH2   1 
ATOM   4004  N N     . LEU B 1 87  ? 33.243  -14.357 0.277   1.00 33.32 ? 87  LEU B N     1 
ATOM   4005  C CA    . LEU B 1 87  ? 32.192  -14.668 -0.753  1.00 32.83 ? 87  LEU B CA    1 
ATOM   4006  C C     . LEU B 1 87  ? 32.662  -15.736 -1.712  1.00 31.74 ? 87  LEU B C     1 
ATOM   4007  O O     . LEU B 1 87  ? 31.879  -16.635 -2.053  1.00 32.98 ? 87  LEU B O     1 
ATOM   4008  C CB    . LEU B 1 87  ? 31.666  -13.450 -1.489  1.00 31.65 ? 87  LEU B CB    1 
ATOM   4009  C CG    . LEU B 1 87  ? 30.534  -12.489 -1.107  1.00 31.73 ? 87  LEU B CG    1 
ATOM   4010  C CD1   . LEU B 1 87  ? 29.836  -12.602 0.272   1.00 30.50 ? 87  LEU B CD1   1 
ATOM   4011  C CD2   . LEU B 1 87  ? 30.911  -10.991 -1.487  1.00 31.51 ? 87  LEU B CD2   1 
ATOM   4012  N N     . LYS B 1 88  ? 33.921  -15.665 -2.122  1.00 31.91 ? 88  LYS B N     1 
ATOM   4013  C CA    . LYS B 1 88  ? 34.593  -16.763 -2.888  1.00 32.67 ? 88  LYS B CA    1 
ATOM   4014  C C     . LYS B 1 88  ? 34.454  -18.186 -2.263  1.00 34.60 ? 88  LYS B C     1 
ATOM   4015  O O     . LYS B 1 88  ? 34.017  -19.113 -2.957  1.00 36.27 ? 88  LYS B O     1 
ATOM   4016  C CB    . LYS B 1 88  ? 36.049  -16.396 -3.172  1.00 32.16 ? 88  LYS B CB    1 
ATOM   4017  C CG    . LYS B 1 88  ? 36.129  -15.177 -4.157  1.00 33.91 ? 88  LYS B CG    1 
ATOM   4018  C CD    . LYS B 1 88  ? 37.427  -15.034 -4.932  1.00 34.00 ? 88  LYS B CD    1 
ATOM   4019  C CE    . LYS B 1 88  ? 37.215  -14.062 -6.129  1.00 33.60 ? 88  LYS B CE    1 
ATOM   4020  N NZ    . LYS B 1 88  ? 38.490  -13.470 -6.453  1.00 30.98 ? 88  LYS B NZ    1 
ATOM   4021  N N     . GLN B 1 89  ? 34.834  -18.352 -0.988  1.00 34.37 ? 89  GLN B N     1 
ATOM   4022  C CA    . GLN B 1 89  ? 34.590  -19.579 -0.241  1.00 36.46 ? 89  GLN B CA    1 
ATOM   4023  C C     . GLN B 1 89  ? 33.134  -20.005 -0.260  1.00 35.65 ? 89  GLN B C     1 
ATOM   4024  O O     . GLN B 1 89  ? 32.825  -21.200 -0.520  1.00 36.17 ? 89  GLN B O     1 
ATOM   4025  C CB    . GLN B 1 89  ? 35.014  -19.466 1.239   1.00 37.89 ? 89  GLN B CB    1 
ATOM   4026  C CG    . GLN B 1 89  ? 35.173  -20.890 1.842   1.00 42.80 ? 89  GLN B CG    1 
ATOM   4027  C CD    . GLN B 1 89  ? 35.799  -21.853 0.798   1.00 48.55 ? 89  GLN B CD    1 
ATOM   4028  O OE1   . GLN B 1 89  ? 35.306  -22.968 0.580   1.00 47.73 ? 89  GLN B OE1   1 
ATOM   4029  N NE2   . GLN B 1 89  ? 36.906  -21.398 0.156   1.00 43.35 ? 89  GLN B NE2   1 
ATOM   4030  N N     . LEU B 1 90  ? 32.252  -19.041 0.002   1.00 33.85 ? 90  LEU B N     1 
ATOM   4031  C CA    . LEU B 1 90  ? 30.813  -19.293 -0.107  1.00 33.90 ? 90  LEU B CA    1 
ATOM   4032  C C     . LEU B 1 90  ? 30.352  -19.889 -1.450  1.00 33.91 ? 90  LEU B C     1 
ATOM   4033  O O     . LEU B 1 90  ? 29.658  -20.896 -1.451  1.00 34.68 ? 90  LEU B O     1 
ATOM   4034  C CB    . LEU B 1 90  ? 29.974  -18.076 0.367   1.00 33.44 ? 90  LEU B CB    1 
ATOM   4035  C CG    . LEU B 1 90  ? 28.447  -18.220 0.256   1.00 33.71 ? 90  LEU B CG    1 
ATOM   4036  C CD1   . LEU B 1 90  ? 27.808  -18.984 1.498   1.00 35.16 ? 90  LEU B CD1   1 
ATOM   4037  C CD2   . LEU B 1 90  ? 27.745  -16.870 -0.036  1.00 31.15 ? 90  LEU B CD2   1 
ATOM   4038  N N     . GLN B 1 91  ? 30.772  -19.343 -2.595  1.00 34.72 ? 91  GLN B N     1 
ATOM   4039  C CA    . GLN B 1 91  ? 30.283  -19.907 -3.891  1.00 35.33 ? 91  GLN B CA    1 
ATOM   4040  C C     . GLN B 1 91  ? 30.738  -21.355 -4.049  1.00 35.65 ? 91  GLN B C     1 
ATOM   4041  O O     . GLN B 1 91  ? 30.019  -22.237 -4.530  1.00 35.29 ? 91  GLN B O     1 
ATOM   4042  C CB    . GLN B 1 91  ? 30.840  -19.139 -5.088  1.00 35.96 ? 91  GLN B CB    1 
ATOM   4043  C CG    . GLN B 1 91  ? 30.504  -17.631 -5.107  1.00 36.15 ? 91  GLN B CG    1 
ATOM   4044  C CD    . GLN B 1 91  ? 29.055  -17.414 -5.141  1.00 34.69 ? 91  GLN B CD    1 
ATOM   4045  O OE1   . GLN B 1 91  ? 28.343  -17.822 -4.216  1.00 36.04 ? 91  GLN B OE1   1 
ATOM   4046  N NE2   . GLN B 1 91  ? 28.565  -16.759 -6.210  1.00 31.07 ? 91  GLN B NE2   1 
ATOM   4047  N N     . ILE B 1 92  ? 31.977  -21.547 -3.637  1.00 37.48 ? 92  ILE B N     1 
ATOM   4048  C CA    . ILE B 1 92  ? 32.632  -22.831 -3.661  1.00 38.23 ? 92  ILE B CA    1 
ATOM   4049  C C     . ILE B 1 92  ? 31.823  -23.828 -2.893  1.00 38.29 ? 92  ILE B C     1 
ATOM   4050  O O     . ILE B 1 92  ? 31.393  -24.774 -3.504  1.00 40.07 ? 92  ILE B O     1 
ATOM   4051  C CB    . ILE B 1 92  ? 34.123  -22.751 -3.265  1.00 37.60 ? 92  ILE B CB    1 
ATOM   4052  C CG1   . ILE B 1 92  ? 34.900  -22.151 -4.447  1.00 34.91 ? 92  ILE B CG1   1 
ATOM   4053  C CG2   . ILE B 1 92  ? 34.632  -24.171 -2.957  1.00 40.26 ? 92  ILE B CG2   1 
ATOM   4054  C CD1   . ILE B 1 92  ? 36.326  -21.666 -4.172  1.00 35.97 ? 92  ILE B CD1   1 
ATOM   4055  N N     . LYS B 1 93  ? 31.518  -23.560 -1.619  1.00 40.13 ? 93  LYS B N     1 
ATOM   4056  C CA    . LYS B 1 93  ? 30.638  -24.420 -0.839  1.00 40.34 ? 93  LYS B CA    1 
ATOM   4057  C C     . LYS B 1 93  ? 29.302  -24.659 -1.473  1.00 39.37 ? 93  LYS B C     1 
ATOM   4058  O O     . LYS B 1 93  ? 28.798  -25.815 -1.426  1.00 40.06 ? 93  LYS B O     1 
ATOM   4059  C CB    . LYS B 1 93  ? 30.411  -23.898 0.614   1.00 41.11 ? 93  LYS B CB    1 
ATOM   4060  C CG    . LYS B 1 93  ? 31.704  -23.948 1.514   1.00 47.66 ? 93  LYS B CG    1 
ATOM   4061  C CD    . LYS B 1 93  ? 32.462  -25.350 1.557   1.00 53.31 ? 93  LYS B CD    1 
ATOM   4062  C CE    . LYS B 1 93  ? 32.315  -26.064 2.918   1.00 54.61 ? 93  LYS B CE    1 
ATOM   4063  N NZ    . LYS B 1 93  ? 32.852  -25.219 4.048   1.00 58.83 ? 93  LYS B NZ    1 
ATOM   4064  N N     . LEU B 1 94  ? 28.707  -23.613 -2.069  1.00 37.98 ? 94  LEU B N     1 
ATOM   4065  C CA    . LEU B 1 94  ? 27.304  -23.736 -2.539  1.00 36.93 ? 94  LEU B CA    1 
ATOM   4066  C C     . LEU B 1 94  ? 27.184  -24.198 -3.970  1.00 36.07 ? 94  LEU B C     1 
ATOM   4067  O O     . LEU B 1 94  ? 26.145  -24.686 -4.381  1.00 34.26 ? 94  LEU B O     1 
ATOM   4068  C CB    . LEU B 1 94  ? 26.517  -22.438 -2.362  1.00 36.74 ? 94  LEU B CB    1 
ATOM   4069  C CG    . LEU B 1 94  ? 26.394  -21.934 -0.877  1.00 39.34 ? 94  LEU B CG    1 
ATOM   4070  C CD1   . LEU B 1 94  ? 25.522  -20.698 -0.869  1.00 36.13 ? 94  LEU B CD1   1 
ATOM   4071  C CD2   . LEU B 1 94  ? 25.867  -23.000 0.155   1.00 35.76 ? 94  LEU B CD2   1 
ATOM   4072  N N     . HIS B 1 95  ? 28.221  -23.996 -4.755  1.00 35.21 ? 95  HIS B N     1 
ATOM   4073  C CA    . HIS B 1 95  ? 28.021  -24.264 -6.216  1.00 35.81 ? 95  HIS B CA    1 
ATOM   4074  C C     . HIS B 1 95  ? 29.169  -25.039 -6.796  1.00 34.79 ? 95  HIS B C     1 
ATOM   4075  O O     . HIS B 1 95  ? 29.050  -25.511 -7.861  1.00 35.66 ? 95  HIS B O     1 
ATOM   4076  C CB    . HIS B 1 95  ? 27.794  -22.969 -7.053  1.00 34.21 ? 95  HIS B CB    1 
ATOM   4077  C CG    . HIS B 1 95  ? 26.951  -21.915 -6.367  1.00 36.61 ? 95  HIS B CG    1 
ATOM   4078  N ND1   . HIS B 1 95  ? 25.579  -22.017 -6.249  1.00 34.71 ? 95  HIS B ND1   1 
ATOM   4079  C CD2   . HIS B 1 95  ? 27.295  -20.724 -5.789  1.00 29.67 ? 95  HIS B CD2   1 
ATOM   4080  C CE1   . HIS B 1 95  ? 25.111  -20.919 -5.660  1.00 34.83 ? 95  HIS B CE1   1 
ATOM   4081  N NE2   . HIS B 1 95  ? 26.136  -20.136 -5.359  1.00 31.52 ? 95  HIS B NE2   1 
ATOM   4082  N N     . ASN B 1 96  ? 30.293  -25.138 -6.097  1.00 36.18 ? 96  ASN B N     1 
ATOM   4083  C CA    . ASN B 1 96  ? 31.378  -25.991 -6.540  1.00 38.13 ? 96  ASN B CA    1 
ATOM   4084  C C     . ASN B 1 96  ? 31.664  -25.721 -8.039  1.00 38.67 ? 96  ASN B C     1 
ATOM   4085  O O     . ASN B 1 96  ? 31.700  -26.647 -8.856  1.00 38.22 ? 96  ASN B O     1 
ATOM   4086  C CB    . ASN B 1 96  ? 31.050  -27.523 -6.304  1.00 36.70 ? 96  ASN B CB    1 
ATOM   4087  C CG    . ASN B 1 96  ? 29.804  -27.772 -5.413  1.00 41.76 ? 96  ASN B CG    1 
ATOM   4088  O OD1   . ASN B 1 96  ? 29.891  -27.936 -4.149  1.00 45.04 ? 96  ASN B OD1   1 
ATOM   4089  N ND2   . ASN B 1 96  ? 28.617  -27.825 -6.071  1.00 44.38 ? 96  ASN B ND2   1 
ATOM   4090  N N     . PRO B 1 97  ? 31.857  -24.442 -8.424  1.00 38.70 ? 97  PRO B N     1 
ATOM   4091  C CA    . PRO B 1 97  ? 31.759  -24.273 -9.871  1.00 38.01 ? 97  PRO B CA    1 
ATOM   4092  C C     . PRO B 1 97  ? 32.962  -24.904 -10.584 1.00 37.36 ? 97  PRO B C     1 
ATOM   4093  O O     . PRO B 1 97  ? 34.083  -24.810 -10.064 1.00 35.06 ? 97  PRO B O     1 
ATOM   4094  C CB    . PRO B 1 97  ? 31.682  -22.743 -10.047 1.00 39.03 ? 97  PRO B CB    1 
ATOM   4095  C CG    . PRO B 1 97  ? 31.596  -22.165 -8.640  1.00 36.19 ? 97  PRO B CG    1 
ATOM   4096  C CD    . PRO B 1 97  ? 32.169  -23.182 -7.732  1.00 38.77 ? 97  PRO B CD    1 
ATOM   4097  N N     . PRO B 1 98  ? 32.719  -25.608 -11.744 1.00 38.23 ? 98  PRO B N     1 
ATOM   4098  C CA    . PRO B 1 98  ? 33.757  -26.407 -12.495 1.00 38.22 ? 98  PRO B CA    1 
ATOM   4099  C C     . PRO B 1 98  ? 35.059  -25.704 -12.717 1.00 39.69 ? 98  PRO B C     1 
ATOM   4100  O O     . PRO B 1 98  ? 36.108  -26.317 -12.975 1.00 41.05 ? 98  PRO B O     1 
ATOM   4101  C CB    . PRO B 1 98  ? 33.086  -26.658 -13.833 1.00 37.69 ? 98  PRO B CB    1 
ATOM   4102  C CG    . PRO B 1 98  ? 31.646  -26.804 -13.450 1.00 35.04 ? 98  PRO B CG    1 
ATOM   4103  C CD    . PRO B 1 98  ? 31.389  -25.765 -12.382 1.00 37.16 ? 98  PRO B CD    1 
ATOM   4104  N N     . THR B 1 99  ? 34.988  -24.407 -12.485 1.00 40.51 ? 99  THR B N     1 
ATOM   4105  C CA    . THR B 1 99  ? 35.709  -23.407 -13.198 1.00 40.77 ? 99  THR B CA    1 
ATOM   4106  C C     . THR B 1 99  ? 36.769  -22.776 -12.272 1.00 42.99 ? 99  THR B C     1 
ATOM   4107  O O     . THR B 1 99  ? 37.545  -21.907 -12.715 1.00 42.81 ? 99  THR B O     1 
ATOM   4108  C CB    . THR B 1 99  ? 34.605  -22.358 -13.629 1.00 40.51 ? 99  THR B CB    1 
ATOM   4109  O OG1   . THR B 1 99  ? 34.738  -21.870 -14.995 1.00 40.17 ? 99  THR B OG1   1 
ATOM   4110  C CG2   . THR B 1 99  ? 34.486  -21.286 -12.652 1.00 34.28 ? 99  THR B CG2   1 
ATOM   4111  N N     . ILE B 1 100 ? 36.804  -23.197 -11.000 1.00 44.56 ? 100 ILE B N     1 
ATOM   4112  C CA    . ILE B 1 100 ? 37.562  -22.458 -9.980  1.00 46.64 ? 100 ILE B CA    1 
ATOM   4113  C C     . ILE B 1 100 ? 39.058  -22.453 -10.224 1.00 46.65 ? 100 ILE B C     1 
ATOM   4114  O O     . ILE B 1 100 ? 39.733  -21.483 -9.880  1.00 47.49 ? 100 ILE B O     1 
ATOM   4115  C CB    . ILE B 1 100 ? 37.299  -22.919 -8.480  1.00 47.31 ? 100 ILE B CB    1 
ATOM   4116  C CG1   . ILE B 1 100 ? 37.653  -24.409 -8.275  1.00 48.92 ? 100 ILE B CG1   1 
ATOM   4117  C CG2   . ILE B 1 100 ? 35.886  -22.489 -7.989  1.00 47.06 ? 100 ILE B CG2   1 
ATOM   4118  C CD1   . ILE B 1 100 ? 37.684  -24.940 -6.784  1.00 47.77 ? 100 ILE B CD1   1 
ATOM   4119  N N     . HIS B 1 101 ? 39.572  -23.548 -10.776 1.00 46.51 ? 101 HIS B N     1 
ATOM   4120  C CA    . HIS B 1 101 ? 41.014  -23.704 -11.001 1.00 45.39 ? 101 HIS B CA    1 
ATOM   4121  C C     . HIS B 1 101 ? 41.361  -23.755 -12.495 1.00 44.30 ? 101 HIS B C     1 
ATOM   4122  O O     . HIS B 1 101 ? 42.491  -24.003 -12.839 1.00 45.98 ? 101 HIS B O     1 
ATOM   4123  C CB    . HIS B 1 101 ? 41.591  -24.908 -10.230 1.00 44.92 ? 101 HIS B CB    1 
ATOM   4124  C CG    . HIS B 1 101 ? 41.385  -24.831 -8.751  1.00 45.13 ? 101 HIS B CG    1 
ATOM   4125  N ND1   . HIS B 1 101 ? 40.676  -25.783 -8.044  1.00 47.59 ? 101 HIS B ND1   1 
ATOM   4126  C CD2   . HIS B 1 101 ? 41.752  -23.890 -7.837  1.00 45.25 ? 101 HIS B CD2   1 
ATOM   4127  C CE1   . HIS B 1 101 ? 40.661  -25.469 -6.758  1.00 41.97 ? 101 HIS B CE1   1 
ATOM   4128  N NE2   . HIS B 1 101 ? 41.293  -24.319 -6.608  1.00 46.12 ? 101 HIS B NE2   1 
ATOM   4129  N N     . TYR B 1 102 ? 40.403  -23.468 -13.371 1.00 42.64 ? 102 TYR B N     1 
ATOM   4130  C CA    . TYR B 1 102 ? 40.692  -23.274 -14.802 1.00 41.53 ? 102 TYR B CA    1 
ATOM   4131  C C     . TYR B 1 102 ? 41.666  -22.100 -14.870 1.00 41.82 ? 102 TYR B C     1 
ATOM   4132  O O     . TYR B 1 102 ? 41.755  -21.338 -13.916 1.00 40.63 ? 102 TYR B O     1 
ATOM   4133  C CB    . TYR B 1 102 ? 39.448  -22.871 -15.581 1.00 40.12 ? 102 TYR B CB    1 
ATOM   4134  C CG    . TYR B 1 102 ? 38.429  -23.951 -15.877 1.00 38.23 ? 102 TYR B CG    1 
ATOM   4135  C CD1   . TYR B 1 102 ? 37.316  -23.625 -16.615 1.00 39.35 ? 102 TYR B CD1   1 
ATOM   4136  C CD2   . TYR B 1 102 ? 38.571  -25.283 -15.441 1.00 37.89 ? 102 TYR B CD2   1 
ATOM   4137  C CE1   . TYR B 1 102 ? 36.339  -24.533 -16.896 1.00 40.17 ? 102 TYR B CE1   1 
ATOM   4138  C CE2   . TYR B 1 102 ? 37.565  -26.267 -15.779 1.00 32.07 ? 102 TYR B CE2   1 
ATOM   4139  C CZ    . TYR B 1 102 ? 36.465  -25.866 -16.473 1.00 36.33 ? 102 TYR B CZ    1 
ATOM   4140  O OH    . TYR B 1 102 ? 35.442  -26.711 -16.822 1.00 32.12 ? 102 TYR B OH    1 
ATOM   4141  N N     . PRO B 1 103 ? 42.474  -22.018 -15.960 1.00 41.17 ? 103 PRO B N     1 
ATOM   4142  C CA    . PRO B 1 103 ? 43.336  -20.877 -16.149 1.00 41.16 ? 103 PRO B CA    1 
ATOM   4143  C C     . PRO B 1 103 ? 42.532  -19.610 -16.303 1.00 40.90 ? 103 PRO B C     1 
ATOM   4144  O O     . PRO B 1 103 ? 41.459  -19.655 -16.879 1.00 40.79 ? 103 PRO B O     1 
ATOM   4145  C CB    . PRO B 1 103 ? 44.083  -21.210 -17.457 1.00 41.40 ? 103 PRO B CB    1 
ATOM   4146  C CG    . PRO B 1 103 ? 44.172  -22.700 -17.430 1.00 41.19 ? 103 PRO B CG    1 
ATOM   4147  C CD    . PRO B 1 103 ? 42.734  -23.056 -16.973 1.00 40.48 ? 103 PRO B CD    1 
ATOM   4148  N N     . PRO B 1 104 ? 43.048  -18.497 -15.793 1.00 41.73 ? 104 PRO B N     1 
ATOM   4149  C CA    . PRO B 1 104 ? 42.381  -17.199 -15.942 1.00 41.96 ? 104 PRO B CA    1 
ATOM   4150  C C     . PRO B 1 104 ? 41.829  -17.004 -17.350 1.00 42.09 ? 104 PRO B C     1 
ATOM   4151  O O     . PRO B 1 104 ? 40.669  -16.625 -17.511 1.00 40.97 ? 104 PRO B O     1 
ATOM   4152  C CB    . PRO B 1 104 ? 43.508  -16.199 -15.676 1.00 42.45 ? 104 PRO B CB    1 
ATOM   4153  C CG    . PRO B 1 104 ? 44.443  -16.927 -14.778 1.00 42.13 ? 104 PRO B CG    1 
ATOM   4154  C CD    . PRO B 1 104 ? 44.395  -18.364 -15.212 1.00 41.20 ? 104 PRO B CD    1 
ATOM   4155  N N     . SER B 1 105 ? 42.658  -17.263 -18.357 1.00 44.11 ? 105 SER B N     1 
ATOM   4156  C CA    . SER B 1 105 ? 42.303  -16.963 -19.738 1.00 44.32 ? 105 SER B CA    1 
ATOM   4157  C C     . SER B 1 105 ? 41.109  -17.794 -20.194 1.00 44.30 ? 105 SER B C     1 
ATOM   4158  O O     . SER B 1 105 ? 40.330  -17.365 -21.046 1.00 45.18 ? 105 SER B O     1 
ATOM   4159  C CB    . SER B 1 105 ? 43.497  -17.207 -20.664 1.00 45.78 ? 105 SER B CB    1 
ATOM   4160  O OG    . SER B 1 105 ? 43.584  -18.571 -21.036 1.00 45.39 ? 105 SER B OG    1 
ATOM   4161  N N     . GLN B 1 106 ? 40.971  -18.986 -19.621 1.00 42.99 ? 106 GLN B N     1 
ATOM   4162  C CA    . GLN B 1 106 ? 39.681  -19.664 -19.564 1.00 41.14 ? 106 GLN B CA    1 
ATOM   4163  C C     . GLN B 1 106 ? 38.846  -19.163 -18.390 1.00 39.93 ? 106 GLN B C     1 
ATOM   4164  O O     . GLN B 1 106 ? 38.884  -17.981 -18.048 1.00 40.52 ? 106 GLN B O     1 
ATOM   4165  C CB    . GLN B 1 106 ? 39.875  -21.177 -19.462 1.00 42.81 ? 106 GLN B CB    1 
ATOM   4166  C CG    . GLN B 1 106 ? 40.498  -21.807 -20.698 1.00 45.90 ? 106 GLN B CG    1 
ATOM   4167  C CD    . GLN B 1 106 ? 41.361  -23.008 -20.368 1.00 54.54 ? 106 GLN B CD    1 
ATOM   4168  O OE1   . GLN B 1 106 ? 42.470  -23.143 -20.886 1.00 53.15 ? 106 GLN B OE1   1 
ATOM   4169  N NE2   . GLN B 1 106 ? 40.856  -23.884 -19.506 1.00 59.48 ? 106 GLN B NE2   1 
ATOM   4170  N N     . GLY B 1 107 ? 38.092  -20.070 -17.777 1.00 37.83 ? 107 GLY B N     1 
ATOM   4171  C CA    . GLY B 1 107 ? 36.722  -19.788 -17.392 1.00 37.48 ? 107 GLY B CA    1 
ATOM   4172  C C     . GLY B 1 107 ? 36.906  -19.225 -15.996 1.00 33.64 ? 107 GLY B C     1 
ATOM   4173  O O     . GLY B 1 107 ? 35.939  -18.847 -15.335 1.00 32.99 ? 107 GLY B O     1 
ATOM   4174  N N     . GLN B 1 108 ? 38.156  -19.169 -15.546 1.00 34.16 ? 108 GLN B N     1 
ATOM   4175  C CA    . GLN B 1 108 ? 38.463  -19.275 -14.125 1.00 34.25 ? 108 GLN B CA    1 
ATOM   4176  C C     . GLN B 1 108 ? 37.544  -18.386 -13.294 1.00 33.62 ? 108 GLN B C     1 
ATOM   4177  O O     . GLN B 1 108 ? 37.609  -17.160 -13.379 1.00 34.93 ? 108 GLN B O     1 
ATOM   4178  C CB    . GLN B 1 108 ? 39.926  -18.908 -13.865 1.00 34.58 ? 108 GLN B CB    1 
ATOM   4179  C CG    . GLN B 1 108 ? 40.473  -19.436 -12.549 1.00 33.29 ? 108 GLN B CG    1 
ATOM   4180  C CD    . GLN B 1 108 ? 41.645  -18.622 -12.038 1.00 38.00 ? 108 GLN B CD    1 
ATOM   4181  O OE1   . GLN B 1 108 ? 42.212  -18.932 -10.989 1.00 48.00 ? 108 GLN B OE1   1 
ATOM   4182  N NE2   . GLN B 1 108 ? 42.010  -17.579 -12.774 1.00 39.51 ? 108 GLN B NE2   1 
ATOM   4183  N N     . MET B 1 109 ? 36.690  -19.012 -12.489 1.00 33.24 ? 109 MET B N     1 
ATOM   4184  C CA    . MET B 1 109 ? 35.749  -18.269 -11.625 1.00 31.51 ? 109 MET B CA    1 
ATOM   4185  C C     . MET B 1 109 ? 36.407  -17.016 -11.120 1.00 29.43 ? 109 MET B C     1 
ATOM   4186  O O     . MET B 1 109 ? 37.544  -17.066 -10.689 1.00 28.16 ? 109 MET B O     1 
ATOM   4187  C CB    . MET B 1 109 ? 35.343  -19.112 -10.428 1.00 31.65 ? 109 MET B CB    1 
ATOM   4188  C CG    . MET B 1 109 ? 33.841  -18.977 -9.987  1.00 29.16 ? 109 MET B CG    1 
ATOM   4189  S SD    . MET B 1 109 ? 33.574  -19.181 -8.185  1.00 37.04 ? 109 MET B SD    1 
ATOM   4190  C CE    . MET B 1 109 ? 34.851  -18.083 -7.552  1.00 28.79 ? 109 MET B CE    1 
ATOM   4191  N N     . ASP B 1 110 ? 35.724  -15.862 -11.219 1.00 27.95 ? 110 ASP B N     1 
ATOM   4192  C CA    . ASP B 1 110 ? 36.175  -14.699 -10.485 1.00 26.63 ? 110 ASP B CA    1 
ATOM   4193  C C     . ASP B 1 110 ? 34.983  -13.976 -9.847  1.00 26.37 ? 110 ASP B C     1 
ATOM   4194  O O     . ASP B 1 110 ? 33.852  -14.259 -10.179 1.00 24.57 ? 110 ASP B O     1 
ATOM   4195  C CB    . ASP B 1 110 ? 36.966  -13.729 -11.365 1.00 27.81 ? 110 ASP B CB    1 
ATOM   4196  C CG    . ASP B 1 110 ? 37.742  -12.705 -10.515 1.00 28.54 ? 110 ASP B CG    1 
ATOM   4197  O OD1   . ASP B 1 110 ? 37.777  -12.824 -9.210  1.00 26.92 ? 110 ASP B OD1   1 
ATOM   4198  O OD2   . ASP B 1 110 ? 38.382  -11.854 -11.145 1.00 31.32 ? 110 ASP B OD2   1 
ATOM   4199  N N     . LEU B 1 111 ? 35.232  -13.016 -8.965  1.00 26.52 ? 111 LEU B N     1 
ATOM   4200  C CA    . LEU B 1 111 ? 34.120  -12.461 -8.165  1.00 27.59 ? 111 LEU B CA    1 
ATOM   4201  C C     . LEU B 1 111 ? 34.287  -10.939 -7.857  1.00 27.58 ? 111 LEU B C     1 
ATOM   4202  O O     . LEU B 1 111 ? 35.357  -10.496 -7.551  1.00 29.24 ? 111 LEU B O     1 
ATOM   4203  C CB    . LEU B 1 111 ? 33.827  -13.343 -6.921  1.00 26.86 ? 111 LEU B CB    1 
ATOM   4204  C CG    . LEU B 1 111 ? 32.521  -13.110 -6.115  1.00 26.90 ? 111 LEU B CG    1 
ATOM   4205  C CD1   . LEU B 1 111 ? 32.070  -14.372 -5.490  1.00 25.16 ? 111 LEU B CD1   1 
ATOM   4206  C CD2   . LEU B 1 111 ? 32.805  -11.999 -4.968  1.00 27.04 ? 111 LEU B CD2   1 
ATOM   4207  N N     . CYS B 1 112 ? 33.222  -10.160 -7.976  1.00 29.10 ? 112 CYS B N     1 
ATOM   4208  C CA    . CYS B 1 112 ? 33.307  -8.746  -7.740  1.00 29.65 ? 112 CYS B CA    1 
ATOM   4209  C C     . CYS B 1 112 ? 32.140  -8.342  -6.798  1.00 28.79 ? 112 CYS B C     1 
ATOM   4210  O O     . CYS B 1 112 ? 31.008  -8.661  -7.069  1.00 29.81 ? 112 CYS B O     1 
ATOM   4211  C CB    . CYS B 1 112 ? 33.301  -7.952  -9.101  1.00 29.01 ? 112 CYS B CB    1 
ATOM   4212  S SG    . CYS B 1 112 ? 33.237  -6.118  -8.858  1.00 35.40 ? 112 CYS B SG    1 
ATOM   4213  N N     . VAL B 1 113 ? 32.456  -7.682  -5.683  1.00 29.55 ? 113 VAL B N     1 
ATOM   4214  C CA    . VAL B 1 113 ? 31.483  -7.056  -4.795  1.00 28.65 ? 113 VAL B CA    1 
ATOM   4215  C C     . VAL B 1 113 ? 31.098  -5.781  -5.612  1.00 29.19 ? 113 VAL B C     1 
ATOM   4216  O O     . VAL B 1 113 ? 32.015  -5.066  -6.113  1.00 27.59 ? 113 VAL B O     1 
ATOM   4217  C CB    . VAL B 1 113 ? 32.136  -6.496  -3.481  1.00 28.68 ? 113 VAL B CB    1 
ATOM   4218  C CG1   . VAL B 1 113 ? 31.161  -5.678  -2.652  1.00 32.17 ? 113 VAL B CG1   1 
ATOM   4219  C CG2   . VAL B 1 113 ? 32.816  -7.584  -2.647  1.00 30.59 ? 113 VAL B CG2   1 
ATOM   4220  N N     . THR B 1 114 ? 29.774  -5.536  -5.707  1.00 26.34 ? 114 THR B N     1 
ATOM   4221  C CA    . THR B 1 114 ? 29.192  -4.480  -6.437  1.00 25.06 ? 114 THR B CA    1 
ATOM   4222  C C     . THR B 1 114 ? 28.184  -3.813  -5.498  1.00 26.24 ? 114 THR B C     1 
ATOM   4223  O O     . THR B 1 114 ? 27.846  -4.348  -4.391  1.00 24.38 ? 114 THR B O     1 
ATOM   4224  C CB    . THR B 1 114 ? 28.382  -5.011  -7.670  1.00 24.86 ? 114 THR B CB    1 
ATOM   4225  O OG1   . THR B 1 114 ? 27.248  -5.682  -7.226  1.00 22.07 ? 114 THR B OG1   1 
ATOM   4226  C CG2   . THR B 1 114 ? 29.095  -5.939  -8.564  1.00 23.75 ? 114 THR B CG2   1 
ATOM   4227  N N     . SER B 1 115 ? 27.652  -2.688  -5.961  1.00 26.09 ? 115 SER B N     1 
ATOM   4228  C CA    . SER B 1 115 ? 26.867  -1.789  -5.131  1.00 26.47 ? 115 SER B CA    1 
ATOM   4229  C C     . SER B 1 115 ? 25.488  -2.144  -5.515  1.00 27.26 ? 115 SER B C     1 
ATOM   4230  O O     . SER B 1 115 ? 24.964  -1.513  -6.440  1.00 29.86 ? 115 SER B O     1 
ATOM   4231  C CB    . SER B 1 115 ? 27.151  -0.299  -5.517  1.00 27.16 ? 115 SER B CB    1 
ATOM   4232  O OG    . SER B 1 115 ? 28.377  0.223   -4.897  1.00 23.51 ? 115 SER B OG    1 
ATOM   4233  N N     . GLY B 1 116 ? 24.891  -3.097  -4.795  1.00 25.09 ? 116 GLY B N     1 
ATOM   4234  C CA    . GLY B 1 116 ? 23.740  -3.871  -5.204  1.00 25.75 ? 116 GLY B CA    1 
ATOM   4235  C C     . GLY B 1 116 ? 24.054  -4.940  -6.236  1.00 27.11 ? 116 GLY B C     1 
ATOM   4236  O O     . GLY B 1 116 ? 25.061  -4.876  -6.871  1.00 30.11 ? 116 GLY B O     1 
ATOM   4237  N N     . SER B 1 117 ? 23.245  -5.967  -6.421  1.00 28.37 ? 117 SER B N     1 
ATOM   4238  C CA    . SER B 1 117 ? 23.559  -6.913  -7.565  1.00 26.34 ? 117 SER B CA    1 
ATOM   4239  C C     . SER B 1 117 ? 23.189  -6.238  -8.878  1.00 27.77 ? 117 SER B C     1 
ATOM   4240  O O     . SER B 1 117 ? 23.776  -6.518  -9.922  1.00 31.52 ? 117 SER B O     1 
ATOM   4241  C CB    . SER B 1 117 ? 22.862  -8.282  -7.446  1.00 23.11 ? 117 SER B CB    1 
ATOM   4242  O OG    . SER B 1 117 ? 21.422  -8.282  -7.622  1.00 20.71 ? 117 SER B OG    1 
ATOM   4243  N N     . GLN B 1 118 ? 22.169  -5.397  -8.869  1.00 28.13 ? 118 GLN B N     1 
ATOM   4244  C CA    . GLN B 1 118 ? 21.752  -4.738  -10.102 1.00 29.91 ? 118 GLN B CA    1 
ATOM   4245  C C     . GLN B 1 118 ? 22.818  -3.860  -10.809 1.00 28.30 ? 118 GLN B C     1 
ATOM   4246  O O     . GLN B 1 118 ? 22.830  -3.702  -12.044 1.00 31.46 ? 118 GLN B O     1 
ATOM   4247  C CB    . GLN B 1 118 ? 20.423  -4.000  -9.834  1.00 29.03 ? 118 GLN B CB    1 
ATOM   4248  C CG    . GLN B 1 118 ? 19.213  -4.979  -9.720  1.00 31.57 ? 118 GLN B CG    1 
ATOM   4249  C CD    . GLN B 1 118 ? 17.849  -4.245  -9.525  1.00 33.86 ? 118 GLN B CD    1 
ATOM   4250  O OE1   . GLN B 1 118 ? 17.115  -4.517  -8.540  1.00 40.02 ? 118 GLN B OE1   1 
ATOM   4251  N NE2   . GLN B 1 118 ? 17.552  -3.279  -10.385 1.00 31.27 ? 118 GLN B NE2   1 
ATOM   4252  N N     . GLN B 1 119 ? 23.735  -3.278  -10.066 1.00 28.13 ? 119 GLN B N     1 
ATOM   4253  C CA    . GLN B 1 119 ? 24.871  -2.540  -10.670 1.00 26.19 ? 119 GLN B CA    1 
ATOM   4254  C C     . GLN B 1 119 ? 25.724  -3.475  -11.523 1.00 27.85 ? 119 GLN B C     1 
ATOM   4255  O O     . GLN B 1 119 ? 26.118  -3.087  -12.611 1.00 27.35 ? 119 GLN B O     1 
ATOM   4256  C CB    . GLN B 1 119 ? 25.800  -1.821  -9.656  1.00 24.49 ? 119 GLN B CB    1 
ATOM   4257  C CG    . GLN B 1 119 ? 27.016  -1.337  -10.356 1.00 24.63 ? 119 GLN B CG    1 
ATOM   4258  C CD    . GLN B 1 119 ? 28.164  -0.813  -9.548  1.00 28.58 ? 119 GLN B CD    1 
ATOM   4259  O OE1   . GLN B 1 119 ? 28.664  -1.480  -8.669  1.00 24.31 ? 119 GLN B OE1   1 
ATOM   4260  N NE2   . GLN B 1 119 ? 28.640  0.419   -9.905  1.00 31.43 ? 119 GLN B NE2   1 
ATOM   4261  N N     . GLY B 1 120 ? 26.074  -4.676  -11.004 1.00 29.26 ? 120 GLY B N     1 
ATOM   4262  C CA    . GLY B 1 120 ? 26.887  -5.622  -11.788 1.00 29.69 ? 120 GLY B CA    1 
ATOM   4263  C C     . GLY B 1 120 ? 26.085  -6.159  -12.996 1.00 30.40 ? 120 GLY B C     1 
ATOM   4264  O O     . GLY B 1 120 ? 26.638  -6.495  -14.017 1.00 31.29 ? 120 GLY B O     1 
ATOM   4265  N N     . LEU B 1 121 ? 24.775  -6.269  -12.870 1.00 30.02 ? 121 LEU B N     1 
ATOM   4266  C CA    . LEU B 1 121 ? 24.002  -6.739  -13.976 1.00 30.13 ? 121 LEU B CA    1 
ATOM   4267  C C     . LEU B 1 121 ? 24.008  -5.631  -15.051 1.00 29.61 ? 121 LEU B C     1 
ATOM   4268  O O     . LEU B 1 121 ? 24.195  -5.900  -16.276 1.00 25.93 ? 121 LEU B O     1 
ATOM   4269  C CB    . LEU B 1 121 ? 22.593  -7.131  -13.525 1.00 29.36 ? 121 LEU B CB    1 
ATOM   4270  C CG    . LEU B 1 121 ? 21.832  -8.011  -14.490 1.00 35.10 ? 121 LEU B CG    1 
ATOM   4271  C CD1   . LEU B 1 121 ? 21.971  -9.494  -14.239 1.00 38.23 ? 121 LEU B CD1   1 
ATOM   4272  C CD2   . LEU B 1 121 ? 20.374  -7.568  -14.517 1.00 37.90 ? 121 LEU B CD2   1 
ATOM   4273  N N     . CYS B 1 122 ? 23.855  -4.381  -14.594 1.00 29.75 ? 122 CYS B N     1 
ATOM   4274  C CA    . CYS B 1 122 ? 23.835  -3.279  -15.577 1.00 28.52 ? 122 CYS B CA    1 
ATOM   4275  C C     . CYS B 1 122 ? 25.122  -3.288  -16.398 1.00 28.21 ? 122 CYS B C     1 
ATOM   4276  O O     . CYS B 1 122 ? 25.092  -3.059  -17.621 1.00 29.42 ? 122 CYS B O     1 
ATOM   4277  C CB    . CYS B 1 122 ? 23.604  -1.918  -14.946 1.00 28.08 ? 122 CYS B CB    1 
ATOM   4278  S SG    . CYS B 1 122 ? 23.318  -0.602  -16.150 1.00 33.14 ? 122 CYS B SG    1 
ATOM   4279  N N     . LYS B 1 123 ? 26.253  -3.504  -15.729 1.00 26.70 ? 123 LYS B N     1 
ATOM   4280  C CA    . LYS B 1 123 ? 27.497  -3.509  -16.412 1.00 27.76 ? 123 LYS B CA    1 
ATOM   4281  C C     . LYS B 1 123 ? 27.751  -4.749  -17.373 1.00 29.29 ? 123 LYS B C     1 
ATOM   4282  O O     . LYS B 1 123 ? 28.592  -4.735  -18.280 1.00 26.24 ? 123 LYS B O     1 
ATOM   4283  C CB    . LYS B 1 123 ? 28.581  -3.211  -15.393 1.00 28.46 ? 123 LYS B CB    1 
ATOM   4284  C CG    . LYS B 1 123 ? 28.202  -1.874  -14.577 1.00 26.54 ? 123 LYS B CG    1 
ATOM   4285  C CD    . LYS B 1 123 ? 29.373  -1.332  -13.832 1.00 27.48 ? 123 LYS B CD    1 
ATOM   4286  C CE    . LYS B 1 123 ? 29.075  0.128   -13.140 1.00 27.04 ? 123 LYS B CE    1 
ATOM   4287  N NZ    . LYS B 1 123 ? 29.445  1.191   -14.117 1.00 27.26 ? 123 LYS B NZ    1 
ATOM   4288  N N     . VAL B 1 124 ? 26.990  -5.812  -17.188 1.00 30.77 ? 124 VAL B N     1 
ATOM   4289  C CA    . VAL B 1 124 ? 27.280  -7.029  -17.941 1.00 31.74 ? 124 VAL B CA    1 
ATOM   4290  C C     . VAL B 1 124 ? 26.592  -6.753  -19.225 1.00 33.30 ? 124 VAL B C     1 
ATOM   4291  O O     . VAL B 1 124 ? 27.111  -7.035  -20.281 1.00 33.59 ? 124 VAL B O     1 
ATOM   4292  C CB    . VAL B 1 124 ? 26.667  -8.247  -17.246 1.00 32.09 ? 124 VAL B CB    1 
ATOM   4293  C CG1   . VAL B 1 124 ? 26.379  -9.444  -18.263 1.00 32.37 ? 124 VAL B CG1   1 
ATOM   4294  C CG2   . VAL B 1 124 ? 27.520  -8.607  -16.080 1.00 29.59 ? 124 VAL B CG2   1 
ATOM   4295  N N     . PHE B 1 125 ? 25.407  -6.169  -19.107 1.00 34.97 ? 125 PHE B N     1 
ATOM   4296  C CA    . PHE B 1 125 ? 24.594  -5.788  -20.249 1.00 36.07 ? 125 PHE B CA    1 
ATOM   4297  C C     . PHE B 1 125 ? 25.410  -4.833  -21.121 1.00 35.92 ? 125 PHE B C     1 
ATOM   4298  O O     . PHE B 1 125 ? 25.576  -5.054  -22.323 1.00 36.94 ? 125 PHE B O     1 
ATOM   4299  C CB    . PHE B 1 125 ? 23.277  -5.111  -19.753 1.00 35.65 ? 125 PHE B CB    1 
ATOM   4300  C CG    . PHE B 1 125 ? 22.249  -6.088  -19.139 1.00 36.50 ? 125 PHE B CG    1 
ATOM   4301  C CD1   . PHE B 1 125 ? 21.270  -5.620  -18.261 1.00 39.55 ? 125 PHE B CD1   1 
ATOM   4302  C CD2   . PHE B 1 125 ? 22.240  -7.442  -19.460 1.00 37.11 ? 125 PHE B CD2   1 
ATOM   4303  C CE1   . PHE B 1 125 ? 20.297  -6.461  -17.694 1.00 40.01 ? 125 PHE B CE1   1 
ATOM   4304  C CE2   . PHE B 1 125 ? 21.260  -8.296  -18.923 1.00 36.57 ? 125 PHE B CE2   1 
ATOM   4305  C CZ    . PHE B 1 125 ? 20.282  -7.800  -18.017 1.00 37.06 ? 125 PHE B CZ    1 
ATOM   4306  N N     . GLU B 1 126 ? 25.947  -3.789  -20.500 1.00 35.04 ? 126 GLU B N     1 
ATOM   4307  C CA    . GLU B 1 126 ? 26.669  -2.732  -21.240 1.00 34.31 ? 126 GLU B CA    1 
ATOM   4308  C C     . GLU B 1 126 ? 27.941  -3.260  -21.906 1.00 33.86 ? 126 GLU B C     1 
ATOM   4309  O O     . GLU B 1 126 ? 28.265  -2.896  -23.054 1.00 34.47 ? 126 GLU B O     1 
ATOM   4310  C CB    . GLU B 1 126 ? 26.973  -1.587  -20.301 1.00 32.65 ? 126 GLU B CB    1 
ATOM   4311  C CG    . GLU B 1 126 ? 25.761  -0.728  -20.013 1.00 34.22 ? 126 GLU B CG    1 
ATOM   4312  C CD    . GLU B 1 126 ? 25.882  0.117   -18.720 1.00 32.97 ? 126 GLU B CD    1 
ATOM   4313  O OE1   . GLU B 1 126 ? 25.187  1.129   -18.605 1.00 35.60 ? 126 GLU B OE1   1 
ATOM   4314  O OE2   . GLU B 1 126 ? 26.595  -0.251  -17.802 1.00 29.27 ? 126 GLU B OE2   1 
ATOM   4315  N N     . MET B 1 127 ? 28.630  -4.133  -21.188 1.00 31.73 ? 127 MET B N     1 
ATOM   4316  C CA    . MET B 1 127 ? 29.752  -4.891  -21.700 1.00 32.18 ? 127 MET B CA    1 
ATOM   4317  C C     . MET B 1 127 ? 29.404  -5.620  -23.029 1.00 33.16 ? 127 MET B C     1 
ATOM   4318  O O     . MET B 1 127 ? 30.216  -5.649  -23.947 1.00 34.69 ? 127 MET B O     1 
ATOM   4319  C CB    . MET B 1 127 ? 30.163  -5.941  -20.636 1.00 30.86 ? 127 MET B CB    1 
ATOM   4320  C CG    . MET B 1 127 ? 31.480  -6.648  -20.838 1.00 31.38 ? 127 MET B CG    1 
ATOM   4321  S SD    . MET B 1 127 ? 31.743  -8.057  -19.691 1.00 30.68 ? 127 MET B SD    1 
ATOM   4322  C CE    . MET B 1 127 ? 30.284  -9.020  -19.966 1.00 30.00 ? 127 MET B CE    1 
ATOM   4323  N N     . ILE B 1 128 ? 28.220  -6.258  -23.084 1.00 33.05 ? 128 ILE B N     1 
ATOM   4324  C CA    . ILE B 1 128 ? 27.892  -7.190  -24.106 1.00 32.45 ? 128 ILE B CA    1 
ATOM   4325  C C     . ILE B 1 128 ? 27.198  -6.541  -25.319 1.00 33.64 ? 128 ILE B C     1 
ATOM   4326  O O     . ILE B 1 128 ? 27.483  -6.948  -26.425 1.00 31.19 ? 128 ILE B O     1 
ATOM   4327  C CB    . ILE B 1 128 ? 27.023  -8.314  -23.551 1.00 32.14 ? 128 ILE B CB    1 
ATOM   4328  C CG1   . ILE B 1 128 ? 27.801  -9.198  -22.587 1.00 29.82 ? 128 ILE B CG1   1 
ATOM   4329  C CG2   . ILE B 1 128 ? 26.433  -9.222  -24.695 1.00 29.85 ? 128 ILE B CG2   1 
ATOM   4330  C CD1   . ILE B 1 128 ? 26.865  -10.082 -21.878 1.00 29.00 ? 128 ILE B CD1   1 
ATOM   4331  N N     . ILE B 1 129 ? 26.342  -5.513  -25.097 1.00 33.62 ? 129 ILE B N     1 
ATOM   4332  C CA    . ILE B 1 129 ? 25.364  -5.151  -26.090 1.00 33.56 ? 129 ILE B CA    1 
ATOM   4333  C C     . ILE B 1 129 ? 25.619  -4.019  -27.049 1.00 34.63 ? 129 ILE B C     1 
ATOM   4334  O O     . ILE B 1 129 ? 25.547  -2.836  -26.712 1.00 35.57 ? 129 ILE B O     1 
ATOM   4335  C CB    . ILE B 1 129 ? 23.968  -5.048  -25.524 1.00 34.08 ? 129 ILE B CB    1 
ATOM   4336  C CG1   . ILE B 1 129 ? 23.587  -6.382  -24.867 1.00 33.79 ? 129 ILE B CG1   1 
ATOM   4337  C CG2   . ILE B 1 129 ? 22.956  -4.599  -26.642 1.00 33.40 ? 129 ILE B CG2   1 
ATOM   4338  C CD1   . ILE B 1 129 ? 22.486  -6.292  -23.908 1.00 33.76 ? 129 ILE B CD1   1 
ATOM   4339  N N     . ASN B 1 130 ? 25.816  -4.440  -28.296 1.00 35.85 ? 130 ASN B N     1 
ATOM   4340  C CA    . ASN B 1 130 ? 25.715  -3.634  -29.515 1.00 34.69 ? 130 ASN B CA    1 
ATOM   4341  C C     . ASN B 1 130 ? 24.279  -3.475  -30.003 1.00 33.76 ? 130 ASN B C     1 
ATOM   4342  O O     . ASN B 1 130 ? 23.471  -4.375  -29.791 1.00 34.09 ? 130 ASN B O     1 
ATOM   4343  C CB    . ASN B 1 130 ? 26.507  -4.373  -30.551 1.00 35.43 ? 130 ASN B CB    1 
ATOM   4344  C CG    . ASN B 1 130 ? 27.965  -4.353  -30.236 1.00 36.96 ? 130 ASN B CG    1 
ATOM   4345  O OD1   . ASN B 1 130 ? 28.497  -3.314  -29.756 1.00 34.82 ? 130 ASN B OD1   1 
ATOM   4346  N ND2   . ASN B 1 130 ? 28.652  -5.488  -30.499 1.00 34.28 ? 130 ASN B ND2   1 
ATOM   4347  N N     . PRO B 1 131 ? 23.921  -2.283  -30.559 1.00 32.56 ? 131 PRO B N     1 
ATOM   4348  C CA    . PRO B 1 131 ? 22.547  -2.114  -30.987 1.00 32.08 ? 131 PRO B CA    1 
ATOM   4349  C C     . PRO B 1 131 ? 22.252  -3.089  -32.077 1.00 33.01 ? 131 PRO B C     1 
ATOM   4350  O O     . PRO B 1 131 ? 23.069  -3.207  -32.982 1.00 31.96 ? 131 PRO B O     1 
ATOM   4351  C CB    . PRO B 1 131 ? 22.510  -0.677  -31.560 1.00 32.32 ? 131 PRO B CB    1 
ATOM   4352  C CG    . PRO B 1 131 ? 23.669  0.054   -30.860 1.00 31.73 ? 131 PRO B CG    1 
ATOM   4353  C CD    . PRO B 1 131 ? 24.724  -1.038  -30.713 1.00 32.96 ? 131 PRO B CD    1 
ATOM   4354  N N     . GLY B 1 132 ? 21.092  -3.760  -32.018 1.00 34.17 ? 132 GLY B N     1 
ATOM   4355  C CA    . GLY B 1 132 ? 20.735  -4.792  -33.029 1.00 37.29 ? 132 GLY B CA    1 
ATOM   4356  C C     . GLY B 1 132 ? 21.101  -6.247  -32.660 1.00 37.14 ? 132 GLY B C     1 
ATOM   4357  O O     . GLY B 1 132 ? 20.707  -7.157  -33.340 1.00 38.43 ? 132 GLY B O     1 
ATOM   4358  N N     . ASP B 1 133 ? 21.819  -6.457  -31.565 1.00 37.66 ? 133 ASP B N     1 
ATOM   4359  C CA    . ASP B 1 133 ? 22.083  -7.815  -31.019 1.00 37.56 ? 133 ASP B CA    1 
ATOM   4360  C C     . ASP B 1 133 ? 20.829  -8.655  -30.632 1.00 36.84 ? 133 ASP B C     1 
ATOM   4361  O O     . ASP B 1 133 ? 19.797  -8.107  -30.183 1.00 37.23 ? 133 ASP B O     1 
ATOM   4362  C CB    . ASP B 1 133 ? 23.027  -7.702  -29.794 1.00 37.66 ? 133 ASP B CB    1 
ATOM   4363  C CG    . ASP B 1 133 ? 24.488  -7.486  -30.199 1.00 38.95 ? 133 ASP B CG    1 
ATOM   4364  O OD1   . ASP B 1 133 ? 24.825  -7.677  -31.417 1.00 36.36 ? 133 ASP B OD1   1 
ATOM   4365  O OD2   . ASP B 1 133 ? 25.315  -7.166  -29.304 1.00 42.54 ? 133 ASP B OD2   1 
ATOM   4366  N N     . ASN B 1 134 ? 20.883  -9.981  -30.767 1.00 34.87 ? 134 ASN B N     1 
ATOM   4367  C CA    . ASN B 1 134 ? 19.717  -10.741 -30.251 1.00 33.53 ? 134 ASN B CA    1 
ATOM   4368  C C     . ASN B 1 134 ? 19.983  -11.250 -28.785 1.00 32.54 ? 134 ASN B C     1 
ATOM   4369  O O     . ASN B 1 134 ? 21.069  -11.707 -28.507 1.00 31.07 ? 134 ASN B O     1 
ATOM   4370  C CB    . ASN B 1 134 ? 19.278  -11.913 -31.177 1.00 33.84 ? 134 ASN B CB    1 
ATOM   4371  C CG    . ASN B 1 134 ? 18.983  -11.509 -32.631 1.00 36.77 ? 134 ASN B CG    1 
ATOM   4372  O OD1   . ASN B 1 134 ? 18.248  -10.568 -32.923 1.00 35.92 ? 134 ASN B OD1   1 
ATOM   4373  N ND2   . ASN B 1 134 ? 19.540  -12.280 -33.554 1.00 36.79 ? 134 ASN B ND2   1 
ATOM   4374  N N     . VAL B 1 135 ? 18.980  -11.173 -27.890 1.00 31.85 ? 135 VAL B N     1 
ATOM   4375  C CA    . VAL B 1 135 ? 19.091  -11.683 -26.467 1.00 30.39 ? 135 VAL B CA    1 
ATOM   4376  C C     . VAL B 1 135 ? 17.808  -12.434 -26.087 1.00 29.89 ? 135 VAL B C     1 
ATOM   4377  O O     . VAL B 1 135 ? 16.677  -12.025 -26.477 1.00 27.22 ? 135 VAL B O     1 
ATOM   4378  C CB    . VAL B 1 135 ? 19.290  -10.500 -25.409 1.00 31.21 ? 135 VAL B CB    1 
ATOM   4379  C CG1   . VAL B 1 135 ? 20.509  -9.587  -25.713 1.00 28.30 ? 135 VAL B CG1   1 
ATOM   4380  C CG2   . VAL B 1 135 ? 18.065  -9.624  -25.287 1.00 28.35 ? 135 VAL B CG2   1 
ATOM   4381  N N     . LEU B 1 136 ? 17.965  -13.527 -25.335 1.00 29.95 ? 136 LEU B N     1 
ATOM   4382  C CA    . LEU B 1 136 ? 16.835  -14.328 -24.952 1.00 30.20 ? 136 LEU B CA    1 
ATOM   4383  C C     . LEU B 1 136 ? 16.483  -14.101 -23.468 1.00 30.94 ? 136 LEU B C     1 
ATOM   4384  O O     . LEU B 1 136 ? 17.348  -14.101 -22.618 1.00 30.18 ? 136 LEU B O     1 
ATOM   4385  C CB    . LEU B 1 136 ? 17.135  -15.830 -25.205 1.00 30.03 ? 136 LEU B CB    1 
ATOM   4386  C CG    . LEU B 1 136 ? 17.699  -16.277 -26.592 1.00 30.36 ? 136 LEU B CG    1 
ATOM   4387  C CD1   . LEU B 1 136 ? 18.597  -17.430 -26.502 1.00 21.73 ? 136 LEU B CD1   1 
ATOM   4388  C CD2   . LEU B 1 136 ? 16.578  -16.505 -27.626 1.00 25.38 ? 136 LEU B CD2   1 
ATOM   4389  N N     . LEU B 1 137 ? 15.200  -13.887 -23.193 1.00 33.12 ? 137 LEU B N     1 
ATOM   4390  C CA    . LEU B 1 137 ? 14.662  -13.979 -21.847 1.00 35.13 ? 137 LEU B CA    1 
ATOM   4391  C C     . LEU B 1 137 ? 13.249  -14.458 -21.932 1.00 35.41 ? 137 LEU B C     1 
ATOM   4392  O O     . LEU B 1 137 ? 12.718  -14.634 -23.009 1.00 31.88 ? 137 LEU B O     1 
ATOM   4393  C CB    . LEU B 1 137 ? 14.723  -12.688 -21.080 1.00 35.06 ? 137 LEU B CB    1 
ATOM   4394  C CG    . LEU B 1 137 ? 13.990  -11.401 -21.483 1.00 38.90 ? 137 LEU B CG    1 
ATOM   4395  C CD1   . LEU B 1 137 ? 14.964  -10.184 -21.196 1.00 29.85 ? 137 LEU B CD1   1 
ATOM   4396  C CD2   . LEU B 1 137 ? 13.508  -11.420 -22.958 1.00 39.39 ? 137 LEU B CD2   1 
ATOM   4397  N N     . ASP B 1 138 ? 12.684  -14.707 -20.750 1.00 36.85 ? 138 ASP B N     1 
ATOM   4398  C CA    . ASP B 1 138 ? 11.307  -15.160 -20.597 1.00 37.47 ? 138 ASP B CA    1 
ATOM   4399  C C     . ASP B 1 138 ? 10.427  -14.051 -20.005 1.00 37.85 ? 138 ASP B C     1 
ATOM   4400  O O     . ASP B 1 138 ? 10.676  -13.592 -18.881 1.00 37.13 ? 138 ASP B O     1 
ATOM   4401  C CB    . ASP B 1 138 ? 11.287  -16.391 -19.708 1.00 36.62 ? 138 ASP B CB    1 
ATOM   4402  C CG    . ASP B 1 138 ? 11.883  -16.130 -18.340 1.00 42.44 ? 138 ASP B CG    1 
ATOM   4403  O OD1   . ASP B 1 138 ? 13.149  -16.015 -18.241 1.00 45.92 ? 138 ASP B OD1   1 
ATOM   4404  O OD2   . ASP B 1 138 ? 11.105  -16.078 -17.341 1.00 46.60 ? 138 ASP B OD2   1 
ATOM   4405  N N     . GLU B 1 139 ? 9.409   -13.620 -20.758 1.00 37.23 ? 139 GLU B N     1 
ATOM   4406  C CA    . GLU B 1 139 ? 8.443   -12.678 -20.238 1.00 38.08 ? 139 GLU B CA    1 
ATOM   4407  C C     . GLU B 1 139 ? 7.308   -13.530 -19.643 1.00 37.24 ? 139 GLU B C     1 
ATOM   4408  O O     . GLU B 1 139 ? 6.986   -14.563 -20.228 1.00 39.26 ? 139 GLU B O     1 
ATOM   4409  C CB    . GLU B 1 139 ? 7.929   -11.823 -21.362 1.00 39.02 ? 139 GLU B CB    1 
ATOM   4410  C CG    . GLU B 1 139 ? 8.992   -11.156 -22.208 1.00 38.95 ? 139 GLU B CG    1 
ATOM   4411  C CD    . GLU B 1 139 ? 8.386   -10.441 -23.428 1.00 41.92 ? 139 GLU B CD    1 
ATOM   4412  O OE1   . GLU B 1 139 ? 7.295   -9.857  -23.307 1.00 32.13 ? 139 GLU B OE1   1 
ATOM   4413  O OE2   . GLU B 1 139 ? 9.009   -10.497 -24.543 1.00 48.67 ? 139 GLU B OE2   1 
ATOM   4414  N N     . PRO B 1 140 ? 6.771   -13.168 -18.443 1.00 35.37 ? 140 PRO B N     1 
ATOM   4415  C CA    . PRO B 1 140 ? 7.002   -11.898 -17.750 1.00 33.41 ? 140 PRO B CA    1 
ATOM   4416  C C     . PRO B 1 140 ? 8.397   -11.831 -17.107 1.00 33.14 ? 140 PRO B C     1 
ATOM   4417  O O     . PRO B 1 140 ? 8.978   -12.856 -16.689 1.00 30.92 ? 140 PRO B O     1 
ATOM   4418  C CB    . PRO B 1 140 ? 5.925   -11.885 -16.659 1.00 32.95 ? 140 PRO B CB    1 
ATOM   4419  C CG    . PRO B 1 140 ? 5.097   -13.194 -16.857 1.00 32.78 ? 140 PRO B CG    1 
ATOM   4420  C CD    . PRO B 1 140 ? 5.988   -14.100 -17.594 1.00 34.31 ? 140 PRO B CD    1 
ATOM   4421  N N     . ALA B 1 141 ? 8.922   -10.608 -17.066 1.00 32.46 ? 141 ALA B N     1 
ATOM   4422  C CA    . ALA B 1 141 ? 10.279  -10.389 -16.662 1.00 32.84 ? 141 ALA B CA    1 
ATOM   4423  C C     . ALA B 1 141 ? 10.323  -9.107  -15.819 1.00 33.24 ? 141 ALA B C     1 
ATOM   4424  O O     . ALA B 1 141 ? 9.681   -8.120  -16.122 1.00 32.56 ? 141 ALA B O     1 
ATOM   4425  C CB    . ALA B 1 141 ? 11.229  -10.285 -17.996 1.00 31.73 ? 141 ALA B CB    1 
ATOM   4426  N N     . TYR B 1 142 ? 11.099  -9.118  -14.751 1.00 35.21 ? 142 TYR B N     1 
ATOM   4427  C CA    . TYR B 1 142 ? 11.372  -7.898  -13.979 1.00 35.30 ? 142 TYR B CA    1 
ATOM   4428  C C     . TYR B 1 142 ? 11.367  -6.582  -14.861 1.00 34.04 ? 142 TYR B C     1 
ATOM   4429  O O     . TYR B 1 142 ? 12.066  -6.504  -15.806 1.00 31.88 ? 142 TYR B O     1 
ATOM   4430  C CB    . TYR B 1 142 ? 12.694  -8.086  -13.249 1.00 36.47 ? 142 TYR B CB    1 
ATOM   4431  C CG    . TYR B 1 142 ? 13.097  -6.907  -12.379 1.00 39.21 ? 142 TYR B CG    1 
ATOM   4432  C CD1   . TYR B 1 142 ? 12.157  -6.231  -11.639 1.00 35.86 ? 142 TYR B CD1   1 
ATOM   4433  C CD2   . TYR B 1 142 ? 14.429  -6.481  -12.314 1.00 40.23 ? 142 TYR B CD2   1 
ATOM   4434  C CE1   . TYR B 1 142 ? 12.523  -5.175  -10.860 1.00 40.83 ? 142 TYR B CE1   1 
ATOM   4435  C CE2   . TYR B 1 142 ? 14.784  -5.433  -11.539 1.00 39.89 ? 142 TYR B CE2   1 
ATOM   4436  C CZ    . TYR B 1 142 ? 13.823  -4.760  -10.845 1.00 39.31 ? 142 TYR B CZ    1 
ATOM   4437  O OH    . TYR B 1 142 ? 14.160  -3.686  -10.074 1.00 40.46 ? 142 TYR B OH    1 
ATOM   4438  N N     . SER B 1 143 ? 10.545  -5.591  -14.553 1.00 33.38 ? 143 SER B N     1 
ATOM   4439  C CA    . SER B 1 143 ? 10.500  -4.382  -15.407 1.00 35.68 ? 143 SER B CA    1 
ATOM   4440  C C     . SER B 1 143 ? 11.815  -3.551  -15.352 1.00 34.56 ? 143 SER B C     1 
ATOM   4441  O O     . SER B 1 143 ? 12.167  -2.872  -16.303 1.00 34.99 ? 143 SER B O     1 
ATOM   4442  C CB    . SER B 1 143 ? 9.344   -3.527  -14.969 1.00 35.72 ? 143 SER B CB    1 
ATOM   4443  O OG    . SER B 1 143 ? 9.306   -3.584  -13.546 1.00 42.00 ? 143 SER B OG    1 
ATOM   4444  N N     . GLY B 1 144 ? 12.555  -3.653  -14.250 1.00 33.68 ? 144 GLY B N     1 
ATOM   4445  C CA    . GLY B 1 144 ? 13.883  -3.010  -14.146 1.00 31.98 ? 144 GLY B CA    1 
ATOM   4446  C C     . GLY B 1 144 ? 14.857  -3.456  -15.215 1.00 31.63 ? 144 GLY B C     1 
ATOM   4447  O O     . GLY B 1 144 ? 15.620  -2.649  -15.687 1.00 33.77 ? 144 GLY B O     1 
ATOM   4448  N N     . THR B 1 145 ? 14.893  -4.738  -15.564 1.00 29.75 ? 145 THR B N     1 
ATOM   4449  C CA    . THR B 1 145 ? 15.804  -5.249  -16.588 1.00 30.54 ? 145 THR B CA    1 
ATOM   4450  C C     . THR B 1 145 ? 15.264  -4.972  -18.032 1.00 30.20 ? 145 THR B C     1 
ATOM   4451  O O     . THR B 1 145 ? 16.008  -4.646  -18.930 1.00 29.53 ? 145 THR B O     1 
ATOM   4452  C CB    . THR B 1 145 ? 16.215  -6.776  -16.334 1.00 31.19 ? 145 THR B CB    1 
ATOM   4453  O OG1   . THR B 1 145 ? 16.115  -7.523  -17.565 1.00 33.40 ? 145 THR B OG1   1 
ATOM   4454  C CG2   . THR B 1 145 ? 15.320  -7.355  -15.384 1.00 29.74 ? 145 THR B CG2   1 
ATOM   4455  N N     . LEU B 1 146 ? 13.957  -5.077  -18.216 1.00 31.09 ? 146 LEU B N     1 
ATOM   4456  C CA    . LEU B 1 146 ? 13.285  -4.527  -19.419 1.00 32.29 ? 146 LEU B CA    1 
ATOM   4457  C C     . LEU B 1 146 ? 13.718  -3.059  -19.701 1.00 31.90 ? 146 LEU B C     1 
ATOM   4458  O O     . LEU B 1 146 ? 14.029  -2.667  -20.839 1.00 32.32 ? 146 LEU B O     1 
ATOM   4459  C CB    . LEU B 1 146 ? 11.740  -4.695  -19.239 1.00 31.22 ? 146 LEU B CB    1 
ATOM   4460  C CG    . LEU B 1 146 ? 11.534  -6.246  -19.292 1.00 32.30 ? 146 LEU B CG    1 
ATOM   4461  C CD1   . LEU B 1 146 ? 10.123  -6.809  -19.115 1.00 31.08 ? 146 LEU B CD1   1 
ATOM   4462  C CD2   . LEU B 1 146 ? 12.094  -6.737  -20.629 1.00 31.28 ? 146 LEU B CD2   1 
ATOM   4463  N N     . GLN B 1 147 ? 13.768  -2.266  -18.658 1.00 31.20 ? 147 GLN B N     1 
ATOM   4464  C CA    . GLN B 1 147 ? 14.060  -0.817  -18.802 1.00 31.91 ? 147 GLN B CA    1 
ATOM   4465  C C     . GLN B 1 147 ? 15.569  -0.542  -18.896 1.00 30.09 ? 147 GLN B C     1 
ATOM   4466  O O     . GLN B 1 147 ? 16.006  0.479   -19.465 1.00 28.62 ? 147 GLN B O     1 
ATOM   4467  C CB    . GLN B 1 147 ? 13.413  -0.031  -17.637 1.00 32.65 ? 147 GLN B CB    1 
ATOM   4468  C CG    . GLN B 1 147 ? 11.862  -0.086  -17.689 1.00 33.13 ? 147 GLN B CG    1 
ATOM   4469  C CD    . GLN B 1 147 ? 11.169  0.937   -18.668 1.00 35.46 ? 147 GLN B CD    1 
ATOM   4470  O OE1   . GLN B 1 147 ? 11.701  1.371   -19.744 1.00 36.25 ? 147 GLN B OE1   1 
ATOM   4471  N NE2   . GLN B 1 147 ? 9.991   1.318   -18.279 1.00 34.06 ? 147 GLN B NE2   1 
ATOM   4472  N N     . SER B 1 148 ? 16.358  -1.468  -18.330 1.00 28.73 ? 148 SER B N     1 
ATOM   4473  C CA    . SER B 1 148 ? 17.808  -1.454  -18.565 1.00 27.05 ? 148 SER B CA    1 
ATOM   4474  C C     . SER B 1 148 ? 18.159  -1.833  -20.041 1.00 27.97 ? 148 SER B C     1 
ATOM   4475  O O     . SER B 1 148 ? 19.109  -1.278  -20.685 1.00 27.61 ? 148 SER B O     1 
ATOM   4476  C CB    . SER B 1 148 ? 18.430  -2.433  -17.638 1.00 26.59 ? 148 SER B CB    1 
ATOM   4477  O OG    . SER B 1 148 ? 19.777  -2.147  -17.315 1.00 22.07 ? 148 SER B OG    1 
ATOM   4478  N N     . LEU B 1 149 ? 17.425  -2.803  -20.563 1.00 27.58 ? 149 LEU B N     1 
ATOM   4479  C CA    . LEU B 1 149 ? 17.780  -3.426  -21.829 1.00 28.54 ? 149 LEU B CA    1 
ATOM   4480  C C     . LEU B 1 149 ? 17.418  -2.499  -22.976 1.00 29.02 ? 149 LEU B C     1 
ATOM   4481  O O     . LEU B 1 149 ? 18.208  -2.338  -23.918 1.00 29.32 ? 149 LEU B O     1 
ATOM   4482  C CB    . LEU B 1 149 ? 17.055  -4.768  -21.979 1.00 28.47 ? 149 LEU B CB    1 
ATOM   4483  C CG    . LEU B 1 149 ? 17.561  -5.990  -21.176 1.00 27.63 ? 149 LEU B CG    1 
ATOM   4484  C CD1   . LEU B 1 149 ? 16.836  -7.239  -21.711 1.00 26.56 ? 149 LEU B CD1   1 
ATOM   4485  C CD2   . LEU B 1 149 ? 19.050  -6.239  -21.320 1.00 19.24 ? 149 LEU B CD2   1 
ATOM   4486  N N     . HIS B 1 150 ? 16.242  -1.891  -22.863 1.00 29.99 ? 150 HIS B N     1 
ATOM   4487  C CA    . HIS B 1 150 ? 15.602  -1.133  -23.907 1.00 31.87 ? 150 HIS B CA    1 
ATOM   4488  C C     . HIS B 1 150 ? 16.445  0.003   -24.533 1.00 33.75 ? 150 HIS B C     1 
ATOM   4489  O O     . HIS B 1 150 ? 16.475  0.108   -25.787 1.00 35.32 ? 150 HIS B O     1 
ATOM   4490  C CB    . HIS B 1 150 ? 14.289  -0.593  -23.379 1.00 32.66 ? 150 HIS B CB    1 
ATOM   4491  C CG    . HIS B 1 150 ? 13.712  0.532   -24.189 1.00 36.64 ? 150 HIS B CG    1 
ATOM   4492  N ND1   . HIS B 1 150 ? 13.639  1.835   -23.722 1.00 41.99 ? 150 HIS B ND1   1 
ATOM   4493  C CD2   . HIS B 1 150 ? 13.197  0.548   -25.441 1.00 38.52 ? 150 HIS B CD2   1 
ATOM   4494  C CE1   . HIS B 1 150 ? 13.085  2.592   -24.658 1.00 40.53 ? 150 HIS B CE1   1 
ATOM   4495  N NE2   . HIS B 1 150 ? 12.795  1.831   -25.698 1.00 35.71 ? 150 HIS B NE2   1 
ATOM   4496  N N     . PRO B 1 151 ? 17.074  0.889   -23.694 1.00 33.42 ? 151 PRO B N     1 
ATOM   4497  C CA    . PRO B 1 151 ? 17.982  1.873   -24.338 1.00 32.74 ? 151 PRO B CA    1 
ATOM   4498  C C     . PRO B 1 151 ? 19.200  1.246   -25.011 1.00 32.23 ? 151 PRO B C     1 
ATOM   4499  O O     . PRO B 1 151 ? 19.907  1.918   -25.801 1.00 31.45 ? 151 PRO B O     1 
ATOM   4500  C CB    . PRO B 1 151 ? 18.407  2.834   -23.192 1.00 31.10 ? 151 PRO B CB    1 
ATOM   4501  C CG    . PRO B 1 151 ? 17.947  2.190   -21.880 1.00 31.75 ? 151 PRO B CG    1 
ATOM   4502  C CD    . PRO B 1 151 ? 16.956  1.074   -22.213 1.00 32.30 ? 151 PRO B CD    1 
ATOM   4503  N N     . LEU B 1 152 ? 19.449  -0.021  -24.697 1.00 31.78 ? 152 LEU B N     1 
ATOM   4504  C CA    . LEU B 1 152 ? 20.550  -0.765  -25.354 1.00 32.58 ? 152 LEU B CA    1 
ATOM   4505  C C     . LEU B 1 152 ? 20.333  -1.229  -26.841 1.00 32.31 ? 152 LEU B C     1 
ATOM   4506  O O     . LEU B 1 152 ? 21.289  -1.615  -27.516 1.00 32.88 ? 152 LEU B O     1 
ATOM   4507  C CB    . LEU B 1 152 ? 21.145  -1.883  -24.472 1.00 29.37 ? 152 LEU B CB    1 
ATOM   4508  C CG    . LEU B 1 152 ? 22.342  -1.738  -23.522 1.00 34.71 ? 152 LEU B CG    1 
ATOM   4509  C CD1   . LEU B 1 152 ? 23.268  -0.377  -23.558 1.00 29.32 ? 152 LEU B CD1   1 
ATOM   4510  C CD2   . LEU B 1 152 ? 21.886  -1.980  -22.090 1.00 35.06 ? 152 LEU B CD2   1 
ATOM   4511  N N     . GLY B 1 153 ? 19.128  -1.123  -27.356 1.00 33.65 ? 153 GLY B N     1 
ATOM   4512  C CA    . GLY B 1 153 ? 18.826  -1.588  -28.716 1.00 35.68 ? 153 GLY B CA    1 
ATOM   4513  C C     . GLY B 1 153 ? 19.064  -3.088  -28.969 1.00 37.00 ? 153 GLY B C     1 
ATOM   4514  O O     . GLY B 1 153 ? 19.373  -3.525  -30.108 1.00 36.29 ? 153 GLY B O     1 
ATOM   4515  N N     . CYS B 1 154 ? 18.935  -3.925  -27.942 1.00 36.81 ? 154 CYS B N     1 
ATOM   4516  C CA    . CYS B 1 154 ? 18.973  -5.336  -28.309 1.00 37.58 ? 154 CYS B CA    1 
ATOM   4517  C C     . CYS B 1 154 ? 17.583  -5.742  -28.896 1.00 37.80 ? 154 CYS B C     1 
ATOM   4518  O O     . CYS B 1 154 ? 16.545  -5.086  -28.638 1.00 35.57 ? 154 CYS B O     1 
ATOM   4519  C CB    . CYS B 1 154 ? 19.470  -6.194  -27.163 1.00 37.01 ? 154 CYS B CB    1 
ATOM   4520  S SG    . CYS B 1 154 ? 18.816  -5.635  -25.620 1.00 41.39 ? 154 CYS B SG    1 
ATOM   4521  N N     . ASN B 1 155 ? 17.536  -6.760  -29.743 1.00 38.40 ? 155 ASN B N     1 
ATOM   4522  C CA    . ASN B 1 155 ? 16.176  -7.292  -30.032 1.00 39.28 ? 155 ASN B CA    1 
ATOM   4523  C C     . ASN B 1 155 ? 15.981  -8.364  -28.993 1.00 38.98 ? 155 ASN B C     1 
ATOM   4524  O O     . ASN B 1 155 ? 16.807  -9.276  -28.865 1.00 38.78 ? 155 ASN B O     1 
ATOM   4525  C CB    . ASN B 1 155 ? 16.046  -7.894  -31.419 1.00 41.16 ? 155 ASN B CB    1 
ATOM   4526  C CG    . ASN B 1 155 ? 16.518  -6.974  -32.529 1.00 43.75 ? 155 ASN B CG    1 
ATOM   4527  O OD1   . ASN B 1 155 ? 15.786  -6.096  -32.979 1.00 48.86 ? 155 ASN B OD1   1 
ATOM   4528  N ND2   . ASN B 1 155 ? 17.714  -7.231  -33.031 1.00 48.10 ? 155 ASN B ND2   1 
ATOM   4529  N N     . ILE B 1 156 ? 14.927  -8.215  -28.203 1.00 38.86 ? 156 ILE B N     1 
ATOM   4530  C CA    . ILE B 1 156 ? 14.673  -9.128  -27.138 1.00 38.88 ? 156 ILE B CA    1 
ATOM   4531  C C     . ILE B 1 156 ? 13.774  -10.294 -27.637 1.00 39.19 ? 156 ILE B C     1 
ATOM   4532  O O     . ILE B 1 156 ? 12.632  -10.077 -28.011 1.00 40.48 ? 156 ILE B O     1 
ATOM   4533  C CB    . ILE B 1 156 ? 14.026  -8.368  -25.947 1.00 38.44 ? 156 ILE B CB    1 
ATOM   4534  C CG1   . ILE B 1 156 ? 15.104  -7.543  -25.217 1.00 38.64 ? 156 ILE B CG1   1 
ATOM   4535  C CG2   . ILE B 1 156 ? 13.307  -9.362  -25.037 1.00 34.80 ? 156 ILE B CG2   1 
ATOM   4536  C CD1   . ILE B 1 156 ? 14.551  -6.459  -24.230 1.00 39.72 ? 156 ILE B CD1   1 
ATOM   4537  N N     . ILE B 1 157 ? 14.250  -11.528 -27.602 1.00 38.92 ? 157 ILE B N     1 
ATOM   4538  C CA    . ILE B 1 157 ? 13.406  -12.620 -28.081 1.00 38.02 ? 157 ILE B CA    1 
ATOM   4539  C C     . ILE B 1 157 ? 12.777  -13.375 -26.911 1.00 38.41 ? 157 ILE B C     1 
ATOM   4540  O O     . ILE B 1 157 ? 13.475  -14.090 -26.161 1.00 37.49 ? 157 ILE B O     1 
ATOM   4541  C CB    . ILE B 1 157 ? 14.232  -13.595 -28.977 1.00 39.31 ? 157 ILE B CB    1 
ATOM   4542  C CG1   . ILE B 1 157 ? 15.047  -12.789 -30.053 1.00 38.30 ? 157 ILE B CG1   1 
ATOM   4543  C CG2   . ILE B 1 157 ? 13.342  -14.734 -29.598 1.00 36.75 ? 157 ILE B CG2   1 
ATOM   4544  C CD1   . ILE B 1 157 ? 16.224  -13.605 -30.644 1.00 38.43 ? 157 ILE B CD1   1 
ATOM   4545  N N     . ASN B 1 158 ? 11.452  -13.239 -26.781 1.00 37.37 ? 158 ASN B N     1 
ATOM   4546  C CA    . ASN B 1 158 ? 10.686  -13.981 -25.792 1.00 36.76 ? 158 ASN B CA    1 
ATOM   4547  C C     . ASN B 1 158 ? 10.643  -15.475 -25.966 1.00 36.81 ? 158 ASN B C     1 
ATOM   4548  O O     . ASN B 1 158 ? 10.110  -16.008 -26.944 1.00 38.65 ? 158 ASN B O     1 
ATOM   4549  C CB    . ASN B 1 158 ? 9.252   -13.498 -25.640 1.00 35.80 ? 158 ASN B CB    1 
ATOM   4550  C CG    . ASN B 1 158 ? 8.590   -14.092 -24.361 1.00 39.49 ? 158 ASN B CG    1 
ATOM   4551  O OD1   . ASN B 1 158 ? 9.247   -14.233 -23.328 1.00 41.32 ? 158 ASN B OD1   1 
ATOM   4552  N ND2   . ASN B 1 158 ? 7.323   -14.494 -24.461 1.00 40.52 ? 158 ASN B ND2   1 
ATOM   4553  N N     . VAL B 1 159 ? 11.126  -16.155 -24.948 1.00 36.71 ? 159 VAL B N     1 
ATOM   4554  C CA    . VAL B 1 159 ? 11.043  -17.593 -24.815 1.00 35.42 ? 159 VAL B CA    1 
ATOM   4555  C C     . VAL B 1 159 ? 9.832   -17.934 -23.874 1.00 36.99 ? 159 VAL B C     1 
ATOM   4556  O O     . VAL B 1 159 ? 9.554   -17.244 -22.851 1.00 35.87 ? 159 VAL B O     1 
ATOM   4557  C CB    . VAL B 1 159 ? 12.395  -18.123 -24.248 1.00 36.01 ? 159 VAL B CB    1 
ATOM   4558  C CG1   . VAL B 1 159 ? 12.505  -19.730 -24.257 1.00 30.79 ? 159 VAL B CG1   1 
ATOM   4559  C CG2   . VAL B 1 159 ? 13.617  -17.382 -24.952 1.00 31.48 ? 159 VAL B CG2   1 
ATOM   4560  N N     . ALA B 1 160 ? 9.086   -18.968 -24.254 1.00 37.51 ? 160 ALA B N     1 
ATOM   4561  C CA    . ALA B 1 160 ? 7.944   -19.435 -23.458 1.00 38.38 ? 160 ALA B CA    1 
ATOM   4562  C C     . ALA B 1 160 ? 8.378   -19.920 -22.073 1.00 37.91 ? 160 ALA B C     1 
ATOM   4563  O O     . ALA B 1 160 ? 9.419   -20.569 -21.901 1.00 37.81 ? 160 ALA B O     1 
ATOM   4564  C CB    . ALA B 1 160 ? 7.151   -20.566 -24.202 1.00 38.17 ? 160 ALA B CB    1 
ATOM   4565  N N     . SER B 1 161 ? 7.548   -19.621 -21.094 1.00 38.30 ? 161 SER B N     1 
ATOM   4566  C CA    . SER B 1 161 ? 7.765   -20.096 -19.693 1.00 39.12 ? 161 SER B CA    1 
ATOM   4567  C C     . SER B 1 161 ? 6.456   -20.745 -19.157 1.00 38.87 ? 161 SER B C     1 
ATOM   4568  O O     . SER B 1 161 ? 5.400   -20.612 -19.770 1.00 39.00 ? 161 SER B O     1 
ATOM   4569  C CB    . SER B 1 161 ? 8.167   -18.912 -18.845 1.00 36.37 ? 161 SER B CB    1 
ATOM   4570  O OG    . SER B 1 161 ? 7.260   -17.863 -19.210 1.00 39.30 ? 161 SER B OG    1 
ATOM   4571  N N     . ASP B 1 162 ? 6.533   -21.483 -18.064 1.00 39.49 ? 162 ASP B N     1 
ATOM   4572  C CA    . ASP B 1 162 ? 5.318   -21.951 -17.363 1.00 40.69 ? 162 ASP B CA    1 
ATOM   4573  C C     . ASP B 1 162 ? 5.626   -22.110 -15.874 1.00 40.32 ? 162 ASP B C     1 
ATOM   4574  O O     . ASP B 1 162 ? 6.673   -21.632 -15.457 1.00 42.16 ? 162 ASP B O     1 
ATOM   4575  C CB    . ASP B 1 162 ? 4.822   -23.289 -17.949 1.00 40.48 ? 162 ASP B CB    1 
ATOM   4576  C CG    . ASP B 1 162 ? 5.810   -24.409 -17.748 1.00 42.76 ? 162 ASP B CG    1 
ATOM   4577  O OD1   . ASP B 1 162 ? 6.635   -24.304 -16.813 1.00 39.57 ? 162 ASP B OD1   1 
ATOM   4578  O OD2   . ASP B 1 162 ? 5.763   -25.394 -18.533 1.00 43.37 ? 162 ASP B OD2   1 
ATOM   4579  N N     . GLU B 1 163 ? 4.787   -22.804 -15.097 1.00 40.09 ? 163 GLU B N     1 
ATOM   4580  C CA    . GLU B 1 163 ? 4.996   -22.962 -13.635 1.00 40.45 ? 163 GLU B CA    1 
ATOM   4581  C C     . GLU B 1 163 ? 6.442   -23.346 -13.292 1.00 38.78 ? 163 GLU B C     1 
ATOM   4582  O O     . GLU B 1 163 ? 6.865   -23.175 -12.126 1.00 38.78 ? 163 GLU B O     1 
ATOM   4583  C CB    . GLU B 1 163 ? 4.121   -24.053 -12.997 1.00 40.72 ? 163 GLU B CB    1 
ATOM   4584  C CG    . GLU B 1 163 ? 2.806   -24.333 -13.589 1.00 47.51 ? 163 GLU B CG    1 
ATOM   4585  C CD    . GLU B 1 163 ? 2.841   -25.437 -14.618 1.00 55.42 ? 163 GLU B CD    1 
ATOM   4586  O OE1   . GLU B 1 163 ? 3.065   -25.144 -15.814 1.00 56.62 ? 163 GLU B OE1   1 
ATOM   4587  O OE2   . GLU B 1 163 ? 2.613   -26.606 -14.232 1.00 59.84 ? 163 GLU B OE2   1 
ATOM   4588  N N     . SER B 1 164 ? 7.159   -23.936 -14.256 1.00 36.56 ? 164 SER B N     1 
ATOM   4589  C CA    . SER B 1 164 ? 8.536   -24.340 -13.997 1.00 37.31 ? 164 SER B CA    1 
ATOM   4590  C C     . SER B 1 164 ? 9.635   -23.534 -14.719 1.00 36.96 ? 164 SER B C     1 
ATOM   4591  O O     . SER B 1 164 ? 10.743  -23.987 -14.783 1.00 38.67 ? 164 SER B O     1 
ATOM   4592  C CB    . SER B 1 164 ? 8.766   -25.860 -14.116 1.00 37.26 ? 164 SER B CB    1 
ATOM   4593  O OG    . SER B 1 164 ? 7.578   -26.607 -13.781 1.00 38.83 ? 164 SER B OG    1 
ATOM   4594  N N     . GLY B 1 165 ? 9.372   -22.320 -15.175 1.00 36.65 ? 165 GLY B N     1 
ATOM   4595  C CA    . GLY B 1 165 ? 10.485  -21.475 -15.648 1.00 37.50 ? 165 GLY B CA    1 
ATOM   4596  C C     . GLY B 1 165 ? 10.501  -21.560 -17.158 1.00 37.29 ? 165 GLY B C     1 
ATOM   4597  O O     . GLY B 1 165 ? 9.529   -21.982 -17.730 1.00 37.54 ? 165 GLY B O     1 
ATOM   4598  N N     . ILE B 1 166 ? 11.597  -21.196 -17.804 1.00 37.63 ? 166 ILE B N     1 
ATOM   4599  C CA    . ILE B 1 166 ? 11.659  -21.370 -19.225 1.00 38.41 ? 166 ILE B CA    1 
ATOM   4600  C C     . ILE B 1 166 ? 11.339  -22.819 -19.732 1.00 40.34 ? 166 ILE B C     1 
ATOM   4601  O O     . ILE B 1 166 ? 11.847  -23.840 -19.176 1.00 37.79 ? 166 ILE B O     1 
ATOM   4602  C CB    . ILE B 1 166 ? 12.978  -20.811 -19.821 1.00 38.71 ? 166 ILE B CB    1 
ATOM   4603  C CG1   . ILE B 1 166 ? 13.998  -21.872 -20.039 1.00 38.69 ? 166 ILE B CG1   1 
ATOM   4604  C CG2   . ILE B 1 166 ? 13.516  -19.472 -19.113 1.00 39.72 ? 166 ILE B CG2   1 
ATOM   4605  C CD1   . ILE B 1 166 ? 14.252  -22.141 -21.538 1.00 37.19 ? 166 ILE B CD1   1 
ATOM   4606  N N     . VAL B 1 167 ? 10.491  -22.892 -20.782 1.00 40.81 ? 167 VAL B N     1 
ATOM   4607  C CA    . VAL B 1 167 ? 10.255  -24.162 -21.445 1.00 41.38 ? 167 VAL B CA    1 
ATOM   4608  C C     . VAL B 1 167 ? 11.358  -24.393 -22.508 1.00 41.92 ? 167 VAL B C     1 
ATOM   4609  O O     . VAL B 1 167 ? 11.420  -23.657 -23.554 1.00 42.83 ? 167 VAL B O     1 
ATOM   4610  C CB    . VAL B 1 167 ? 8.785   -24.277 -21.972 1.00 43.67 ? 167 VAL B CB    1 
ATOM   4611  C CG1   . VAL B 1 167 ? 8.565   -25.567 -22.927 1.00 45.08 ? 167 VAL B CG1   1 
ATOM   4612  C CG2   . VAL B 1 167 ? 7.819   -24.252 -20.768 1.00 38.37 ? 167 VAL B CG2   1 
ATOM   4613  N N     . PRO B 1 168 ? 12.256  -25.368 -22.226 1.00 40.25 ? 168 PRO B N     1 
ATOM   4614  C CA    . PRO B 1 168 ? 13.383  -25.688 -23.062 1.00 40.64 ? 168 PRO B CA    1 
ATOM   4615  C C     . PRO B 1 168 ? 13.050  -26.020 -24.527 1.00 42.23 ? 168 PRO B C     1 
ATOM   4616  O O     . PRO B 1 168 ? 13.839  -25.660 -25.422 1.00 42.42 ? 168 PRO B O     1 
ATOM   4617  C CB    . PRO B 1 168 ? 14.005  -26.887 -22.352 1.00 40.32 ? 168 PRO B CB    1 
ATOM   4618  C CG    . PRO B 1 168 ? 13.537  -26.718 -20.883 1.00 36.94 ? 168 PRO B CG    1 
ATOM   4619  C CD    . PRO B 1 168 ? 12.182  -26.278 -21.054 1.00 39.52 ? 168 PRO B CD    1 
ATOM   4620  N N     . ASP B 1 169 ? 11.916  -26.675 -24.784 1.00 42.68 ? 169 ASP B N     1 
ATOM   4621  C CA    . ASP B 1 169 ? 11.493  -26.876 -26.170 1.00 44.00 ? 169 ASP B CA    1 
ATOM   4622  C C     . ASP B 1 169 ? 11.136  -25.577 -26.878 1.00 43.60 ? 169 ASP B C     1 
ATOM   4623  O O     . ASP B 1 169 ? 11.356  -25.482 -28.076 1.00 44.39 ? 169 ASP B O     1 
ATOM   4624  C CB    . ASP B 1 169 ? 10.334  -27.863 -26.302 1.00 44.16 ? 169 ASP B CB    1 
ATOM   4625  C CG    . ASP B 1 169 ? 10.685  -29.246 -25.820 1.00 46.85 ? 169 ASP B CG    1 
ATOM   4626  O OD1   . ASP B 1 169 ? 11.877  -29.508 -25.540 1.00 47.28 ? 169 ASP B OD1   1 
ATOM   4627  O OD2   . ASP B 1 169 ? 9.742   -30.074 -25.719 1.00 51.71 ? 169 ASP B OD2   1 
ATOM   4628  N N     . SER B 1 170 ? 10.529  -24.608 -26.197 1.00 42.81 ? 170 SER B N     1 
ATOM   4629  C CA    . SER B 1 170 ? 10.374  -23.283 -26.829 1.00 42.96 ? 170 SER B CA    1 
ATOM   4630  C C     . SER B 1 170 ? 11.749  -22.696 -27.184 1.00 42.14 ? 170 SER B C     1 
ATOM   4631  O O     . SER B 1 170 ? 11.952  -22.133 -28.274 1.00 42.63 ? 170 SER B O     1 
ATOM   4632  C CB    . SER B 1 170 ? 9.583   -22.322 -25.947 1.00 43.91 ? 170 SER B CB    1 
ATOM   4633  O OG    . SER B 1 170 ? 9.736   -20.983 -26.403 1.00 46.63 ? 170 SER B OG    1 
ATOM   4634  N N     . LEU B 1 171 ? 12.714  -22.912 -26.291 1.00 41.42 ? 171 LEU B N     1 
ATOM   4635  C CA    . LEU B 1 171 ? 14.096  -22.439 -26.421 1.00 40.55 ? 171 LEU B CA    1 
ATOM   4636  C C     . LEU B 1 171 ? 14.749  -23.164 -27.598 1.00 41.90 ? 171 LEU B C     1 
ATOM   4637  O O     . LEU B 1 171 ? 15.433  -22.565 -28.423 1.00 41.27 ? 171 LEU B O     1 
ATOM   4638  C CB    . LEU B 1 171 ? 14.919  -22.750 -25.118 1.00 40.42 ? 171 LEU B CB    1 
ATOM   4639  C CG    . LEU B 1 171 ? 16.415  -22.346 -25.153 1.00 39.35 ? 171 LEU B CG    1 
ATOM   4640  C CD1   . LEU B 1 171 ? 16.639  -20.918 -25.622 1.00 30.63 ? 171 LEU B CD1   1 
ATOM   4641  C CD2   . LEU B 1 171 ? 17.181  -22.594 -23.890 1.00 37.72 ? 171 LEU B CD2   1 
ATOM   4642  N N     . ARG B 1 172 ? 14.562  -24.476 -27.635 1.00 42.57 ? 172 ARG B N     1 
ATOM   4643  C CA    . ARG B 1 172 ? 15.027  -25.260 -28.779 1.00 43.55 ? 172 ARG B CA    1 
ATOM   4644  C C     . ARG B 1 172 ? 14.423  -24.706 -30.060 1.00 42.66 ? 172 ARG B C     1 
ATOM   4645  O O     . ARG B 1 172 ? 15.132  -24.466 -30.990 1.00 43.29 ? 172 ARG B O     1 
ATOM   4646  C CB    . ARG B 1 172 ? 14.688  -26.734 -28.621 1.00 42.12 ? 172 ARG B CB    1 
ATOM   4647  C CG    . ARG B 1 172 ? 15.822  -27.556 -28.337 1.00 46.67 ? 172 ARG B CG    1 
ATOM   4648  C CD    . ARG B 1 172 ? 15.647  -29.003 -28.897 1.00 56.36 ? 172 ARG B CD    1 
ATOM   4649  N NE    . ARG B 1 172 ? 16.314  -29.980 -28.013 1.00 61.20 ? 172 ARG B NE    1 
ATOM   4650  C CZ    . ARG B 1 172 ? 16.042  -30.093 -26.697 1.00 61.82 ? 172 ARG B CZ    1 
ATOM   4651  N NH1   . ARG B 1 172 ? 15.128  -29.285 -26.143 1.00 58.46 ? 172 ARG B NH1   1 
ATOM   4652  N NH2   . ARG B 1 172 ? 16.675  -31.002 -25.935 1.00 59.71 ? 172 ARG B NH2   1 
ATOM   4653  N N     . ASP B 1 173 ? 13.131  -24.465 -30.068 1.00 43.09 ? 173 ASP B N     1 
ATOM   4654  C CA    . ASP B 1 173 ? 12.439  -24.018 -31.294 1.00 46.09 ? 173 ASP B CA    1 
ATOM   4655  C C     . ASP B 1 173 ? 12.844  -22.637 -31.864 1.00 44.63 ? 173 ASP B C     1 
ATOM   4656  O O     . ASP B 1 173 ? 13.022  -22.511 -33.081 1.00 47.55 ? 173 ASP B O     1 
ATOM   4657  C CB    . ASP B 1 173 ? 10.906  -24.164 -31.163 1.00 45.29 ? 173 ASP B CB    1 
ATOM   4658  C CG    . ASP B 1 173 ? 10.454  -25.636 -31.050 1.00 51.44 ? 173 ASP B CG    1 
ATOM   4659  O OD1   . ASP B 1 173 ? 11.315  -26.560 -30.823 1.00 56.89 ? 173 ASP B OD1   1 
ATOM   4660  O OD2   . ASP B 1 173 ? 9.219   -25.890 -31.139 1.00 53.82 ? 173 ASP B OD2   1 
ATOM   4661  N N     . ILE B 1 174 ? 12.937  -21.619 -31.006 1.00 43.51 ? 174 ILE B N     1 
ATOM   4662  C CA    . ILE B 1 174 ? 13.452  -20.295 -31.359 1.00 41.18 ? 174 ILE B CA    1 
ATOM   4663  C C     . ILE B 1 174 ? 14.896  -20.385 -31.874 1.00 41.09 ? 174 ILE B C     1 
ATOM   4664  O O     . ILE B 1 174 ? 15.233  -19.669 -32.829 1.00 40.51 ? 174 ILE B O     1 
ATOM   4665  C CB    . ILE B 1 174 ? 13.425  -19.236 -30.201 1.00 40.39 ? 174 ILE B CB    1 
ATOM   4666  C CG1   . ILE B 1 174 ? 14.274  -19.680 -29.025 1.00 42.35 ? 174 ILE B CG1   1 
ATOM   4667  C CG2   . ILE B 1 174 ? 12.021  -18.826 -29.755 1.00 40.48 ? 174 ILE B CG2   1 
ATOM   4668  C CD1   . ILE B 1 174 ? 15.667  -19.144 -29.128 1.00 43.95 ? 174 ILE B CD1   1 
ATOM   4669  N N     . LEU B 1 175 ? 15.741  -21.254 -31.292 1.00 38.81 ? 175 LEU B N     1 
ATOM   4670  C CA    . LEU B 1 175 ? 17.154  -21.226 -31.705 1.00 38.22 ? 175 LEU B CA    1 
ATOM   4671  C C     . LEU B 1 175 ? 17.331  -21.747 -33.122 1.00 39.16 ? 175 LEU B C     1 
ATOM   4672  O O     . LEU B 1 175 ? 18.366  -21.472 -33.745 1.00 37.80 ? 175 LEU B O     1 
ATOM   4673  C CB    . LEU B 1 175 ? 18.109  -21.944 -30.748 1.00 36.11 ? 175 LEU B CB    1 
ATOM   4674  C CG    . LEU B 1 175 ? 18.515  -21.110 -29.498 1.00 39.82 ? 175 LEU B CG    1 
ATOM   4675  C CD1   . LEU B 1 175 ? 18.872  -22.023 -28.272 1.00 35.21 ? 175 LEU B CD1   1 
ATOM   4676  C CD2   . LEU B 1 175 ? 19.548  -19.924 -29.753 1.00 31.13 ? 175 LEU B CD2   1 
ATOM   4677  N N     . SER B 1 176 ? 16.347  -22.530 -33.595 1.00 40.06 ? 176 SER B N     1 
ATOM   4678  C CA    . SER B 1 176 ? 16.416  -23.156 -34.943 1.00 41.29 ? 176 SER B CA    1 
ATOM   4679  C C     . SER B 1 176 ? 16.419  -22.082 -36.047 1.00 42.97 ? 176 SER B C     1 
ATOM   4680  O O     . SER B 1 176 ? 16.470  -22.408 -37.230 1.00 43.21 ? 176 SER B O     1 
ATOM   4681  C CB    . SER B 1 176 ? 15.305  -24.237 -35.141 1.00 40.34 ? 176 SER B CB    1 
ATOM   4682  O OG    . SER B 1 176 ? 14.001  -23.670 -35.229 1.00 36.38 ? 176 SER B OG    1 
ATOM   4683  N N     . ARG B 1 177 ? 16.361  -20.799 -35.650 1.00 44.08 ? 177 ARG B N     1 
ATOM   4684  C CA    . ARG B 1 177 ? 16.373  -19.729 -36.611 1.00 46.56 ? 177 ARG B CA    1 
ATOM   4685  C C     . ARG B 1 177 ? 17.818  -19.661 -37.146 1.00 46.26 ? 177 ARG B C     1 
ATOM   4686  O O     . ARG B 1 177 ? 18.067  -19.159 -38.283 1.00 46.17 ? 177 ARG B O     1 
ATOM   4687  C CB    . ARG B 1 177 ? 15.856  -18.386 -35.984 1.00 47.17 ? 177 ARG B CB    1 
ATOM   4688  C CG    . ARG B 1 177 ? 14.444  -18.526 -35.265 1.00 49.94 ? 177 ARG B CG    1 
ATOM   4689  C CD    . ARG B 1 177 ? 14.173  -17.456 -34.143 1.00 49.79 ? 177 ARG B CD    1 
ATOM   4690  N NE    . ARG B 1 177 ? 14.703  -16.181 -34.603 1.00 56.65 ? 177 ARG B NE    1 
ATOM   4691  C CZ    . ARG B 1 177 ? 14.329  -14.992 -34.164 1.00 58.43 ? 177 ARG B CZ    1 
ATOM   4692  N NH1   . ARG B 1 177 ? 13.406  -14.914 -33.220 1.00 57.36 ? 177 ARG B NH1   1 
ATOM   4693  N NH2   . ARG B 1 177 ? 14.885  -13.883 -34.693 1.00 56.34 ? 177 ARG B NH2   1 
ATOM   4694  N N     . TRP B 1 178 ? 18.741  -20.233 -36.349 1.00 45.85 ? 178 TRP B N     1 
ATOM   4695  C CA    . TRP B 1 178 ? 20.193  -20.202 -36.603 1.00 46.37 ? 178 TRP B CA    1 
ATOM   4696  C C     . TRP B 1 178 ? 20.651  -21.634 -36.688 1.00 46.68 ? 178 TRP B C     1 
ATOM   4697  O O     . TRP B 1 178 ? 19.917  -22.525 -36.357 1.00 47.36 ? 178 TRP B O     1 
ATOM   4698  C CB    . TRP B 1 178 ? 20.965  -19.501 -35.472 1.00 45.43 ? 178 TRP B CB    1 
ATOM   4699  C CG    . TRP B 1 178 ? 20.172  -18.462 -34.712 1.00 47.50 ? 178 TRP B CG    1 
ATOM   4700  C CD1   . TRP B 1 178 ? 19.381  -18.657 -33.571 1.00 46.52 ? 178 TRP B CD1   1 
ATOM   4701  C CD2   . TRP B 1 178 ? 20.063  -17.068 -35.034 1.00 46.64 ? 178 TRP B CD2   1 
ATOM   4702  N NE1   . TRP B 1 178 ? 18.813  -17.471 -33.176 1.00 48.12 ? 178 TRP B NE1   1 
ATOM   4703  C CE2   . TRP B 1 178 ? 19.215  -16.480 -34.057 1.00 45.89 ? 178 TRP B CE2   1 
ATOM   4704  C CE3   . TRP B 1 178 ? 20.615  -16.262 -36.054 1.00 44.44 ? 178 TRP B CE3   1 
ATOM   4705  C CZ2   . TRP B 1 178 ? 18.888  -15.156 -34.081 1.00 45.67 ? 178 TRP B CZ2   1 
ATOM   4706  C CZ3   . TRP B 1 178 ? 20.293  -14.942 -36.085 1.00 46.55 ? 178 TRP B CZ3   1 
ATOM   4707  C CH2   . TRP B 1 178 ? 19.428  -14.386 -35.100 1.00 48.68 ? 178 TRP B CH2   1 
ATOM   4708  N N     . LYS B 1 179 ? 21.862  -21.870 -37.164 1.00 48.14 ? 179 LYS B N     1 
ATOM   4709  C CA    . LYS B 1 179 ? 22.533  -23.147 -36.884 1.00 48.90 ? 179 LYS B CA    1 
ATOM   4710  C C     . LYS B 1 179 ? 23.695  -22.791 -35.997 1.00 47.37 ? 179 LYS B C     1 
ATOM   4711  O O     . LYS B 1 179 ? 24.119  -21.652 -36.046 1.00 47.09 ? 179 LYS B O     1 
ATOM   4712  C CB    . LYS B 1 179 ? 23.067  -23.746 -38.162 1.00 49.63 ? 179 LYS B CB    1 
ATOM   4713  C CG    . LYS B 1 179 ? 23.185  -25.237 -38.132 1.00 52.47 ? 179 LYS B CG    1 
ATOM   4714  C CD    . LYS B 1 179 ? 22.754  -25.871 -39.491 1.00 56.21 ? 179 LYS B CD    1 
ATOM   4715  C CE    . LYS B 1 179 ? 23.668  -25.449 -40.674 1.00 58.25 ? 179 LYS B CE    1 
ATOM   4716  N NZ    . LYS B 1 179 ? 23.027  -24.423 -41.568 1.00 55.20 ? 179 LYS B NZ    1 
ATOM   4717  N N     . PRO B 1 180 ? 24.219  -23.758 -35.197 1.00 47.16 ? 180 PRO B N     1 
ATOM   4718  C CA    . PRO B 1 180 ? 25.301  -23.450 -34.267 1.00 46.32 ? 180 PRO B CA    1 
ATOM   4719  C C     . PRO B 1 180 ? 26.411  -22.636 -34.891 1.00 47.69 ? 180 PRO B C     1 
ATOM   4720  O O     . PRO B 1 180 ? 26.911  -21.665 -34.244 1.00 47.59 ? 180 PRO B O     1 
ATOM   4721  C CB    . PRO B 1 180 ? 25.859  -24.822 -33.920 1.00 47.83 ? 180 PRO B CB    1 
ATOM   4722  C CG    . PRO B 1 180 ? 24.640  -25.778 -34.057 1.00 46.69 ? 180 PRO B CG    1 
ATOM   4723  C CD    . PRO B 1 180 ? 23.757  -25.162 -35.087 1.00 45.88 ? 180 PRO B CD    1 
ATOM   4724  N N     . GLU B 1 181 ? 26.828  -23.035 -36.112 1.00 45.90 ? 181 GLU B N     1 
ATOM   4725  C CA    . GLU B 1 181 ? 28.131  -22.642 -36.620 1.00 45.47 ? 181 GLU B CA    1 
ATOM   4726  C C     . GLU B 1 181 ? 28.104  -21.153 -36.972 1.00 44.52 ? 181 GLU B C     1 
ATOM   4727  O O     . GLU B 1 181 ? 29.143  -20.540 -37.056 1.00 43.77 ? 181 GLU B O     1 
ATOM   4728  C CB    . GLU B 1 181 ? 28.554  -23.418 -37.882 1.00 47.00 ? 181 GLU B CB    1 
ATOM   4729  C CG    . GLU B 1 181 ? 28.608  -24.931 -37.807 1.00 48.42 ? 181 GLU B CG    1 
ATOM   4730  C CD    . GLU B 1 181 ? 27.224  -25.546 -37.864 1.00 48.94 ? 181 GLU B CD    1 
ATOM   4731  O OE1   . GLU B 1 181 ? 27.116  -26.739 -37.465 1.00 53.17 ? 181 GLU B OE1   1 
ATOM   4732  O OE2   . GLU B 1 181 ? 26.258  -24.830 -38.276 1.00 46.25 ? 181 GLU B OE2   1 
ATOM   4733  N N     . ASP B 1 182 ? 26.927  -20.601 -37.210 1.00 44.39 ? 182 ASP B N     1 
ATOM   4734  C CA    . ASP B 1 182 ? 26.766  -19.144 -37.264 1.00 45.82 ? 182 ASP B CA    1 
ATOM   4735  C C     . ASP B 1 182 ? 27.247  -18.427 -35.994 1.00 45.25 ? 182 ASP B C     1 
ATOM   4736  O O     . ASP B 1 182 ? 27.523  -17.202 -36.058 1.00 44.99 ? 182 ASP B O     1 
ATOM   4737  C CB    . ASP B 1 182 ? 25.322  -18.749 -37.579 1.00 47.79 ? 182 ASP B CB    1 
ATOM   4738  C CG    . ASP B 1 182 ? 25.219  -17.489 -38.462 1.00 54.17 ? 182 ASP B CG    1 
ATOM   4739  O OD1   . ASP B 1 182 ? 25.253  -17.651 -39.739 1.00 58.99 ? 182 ASP B OD1   1 
ATOM   4740  O OD2   . ASP B 1 182 ? 25.064  -16.351 -37.885 1.00 56.18 ? 182 ASP B OD2   1 
ATOM   4741  N N     . ALA B 1 183 ? 27.381  -19.148 -34.866 1.00 43.45 ? 183 ALA B N     1 
ATOM   4742  C CA    . ALA B 1 183 ? 27.991  -18.513 -33.667 1.00 44.32 ? 183 ALA B CA    1 
ATOM   4743  C C     . ALA B 1 183 ? 29.342  -17.928 -34.004 1.00 43.87 ? 183 ALA B C     1 
ATOM   4744  O O     . ALA B 1 183 ? 29.871  -17.070 -33.292 1.00 43.85 ? 183 ALA B O     1 
ATOM   4745  C CB    . ALA B 1 183 ? 28.122  -19.454 -32.449 1.00 42.73 ? 183 ALA B CB    1 
ATOM   4746  N N     . LYS B 1 184 ? 29.930  -18.440 -35.073 1.00 44.73 ? 184 LYS B N     1 
ATOM   4747  C CA    . LYS B 1 184 ? 31.295  -18.056 -35.403 1.00 45.74 ? 184 LYS B CA    1 
ATOM   4748  C C     . LYS B 1 184 ? 31.328  -16.772 -36.231 1.00 44.29 ? 184 LYS B C     1 
ATOM   4749  O O     . LYS B 1 184 ? 32.394  -16.215 -36.429 1.00 43.84 ? 184 LYS B O     1 
ATOM   4750  C CB    . LYS B 1 184 ? 32.014  -19.214 -36.093 1.00 46.03 ? 184 LYS B CB    1 
ATOM   4751  C CG    . LYS B 1 184 ? 32.365  -20.374 -35.105 1.00 53.02 ? 184 LYS B CG    1 
ATOM   4752  C CD    . LYS B 1 184 ? 31.429  -21.624 -35.221 1.00 55.40 ? 184 LYS B CD    1 
ATOM   4753  C CE    . LYS B 1 184 ? 31.749  -22.439 -36.523 1.00 60.88 ? 184 LYS B CE    1 
ATOM   4754  N NZ    . LYS B 1 184 ? 31.747  -23.990 -36.521 1.00 58.58 ? 184 LYS B NZ    1 
ATOM   4755  N N     . ASN B 1 185 ? 30.138  -16.323 -36.646 1.00 43.65 ? 185 ASN B N     1 
ATOM   4756  C CA    . ASN B 1 185 ? 29.891  -15.402 -37.770 1.00 43.30 ? 185 ASN B CA    1 
ATOM   4757  C C     . ASN B 1 185 ? 29.082  -14.233 -37.351 1.00 43.47 ? 185 ASN B C     1 
ATOM   4758  O O     . ASN B 1 185 ? 27.893  -14.278 -37.490 1.00 43.11 ? 185 ASN B O     1 
ATOM   4759  C CB    . ASN B 1 185 ? 29.033  -16.104 -38.852 1.00 43.19 ? 185 ASN B CB    1 
ATOM   4760  C CG    . ASN B 1 185 ? 29.850  -16.923 -39.760 1.00 40.02 ? 185 ASN B CG    1 
ATOM   4761  O OD1   . ASN B 1 185 ? 29.488  -18.044 -40.162 1.00 40.68 ? 185 ASN B OD1   1 
ATOM   4762  N ND2   . ASN B 1 185 ? 31.021  -16.426 -40.004 1.00 31.12 ? 185 ASN B ND2   1 
ATOM   4763  N N     . PRO B 1 186 ? 29.728  -13.189 -36.833 1.00 45.59 ? 186 PRO B N     1 
ATOM   4764  C CA    . PRO B 1 186 ? 29.015  -12.127 -36.068 1.00 46.72 ? 186 PRO B CA    1 
ATOM   4765  C C     . PRO B 1 186 ? 27.775  -11.495 -36.727 1.00 47.59 ? 186 PRO B C     1 
ATOM   4766  O O     . PRO B 1 186 ? 26.762  -11.425 -36.073 1.00 47.95 ? 186 PRO B O     1 
ATOM   4767  C CB    . PRO B 1 186 ? 30.130  -11.092 -35.742 1.00 47.32 ? 186 PRO B CB    1 
ATOM   4768  C CG    . PRO B 1 186 ? 31.452  -11.924 -35.785 1.00 46.90 ? 186 PRO B CG    1 
ATOM   4769  C CD    . PRO B 1 186 ? 31.200  -12.992 -36.863 1.00 44.41 ? 186 PRO B CD    1 
ATOM   4770  N N     . GLN B 1 187 ? 27.825  -11.023 -37.972 1.00 49.48 ? 187 GLN B N     1 
ATOM   4771  C CA    . GLN B 1 187 ? 26.578  -10.676 -38.682 1.00 50.65 ? 187 GLN B CA    1 
ATOM   4772  C C     . GLN B 1 187 ? 25.815  -11.975 -38.903 1.00 50.66 ? 187 GLN B C     1 
ATOM   4773  O O     . GLN B 1 187 ? 26.393  -13.040 -38.779 1.00 52.54 ? 187 GLN B O     1 
ATOM   4774  C CB    . GLN B 1 187 ? 26.841  -10.015 -40.047 1.00 50.97 ? 187 GLN B CB    1 
ATOM   4775  C CG    . GLN B 1 187 ? 27.962  -8.980  -40.126 1.00 52.65 ? 187 GLN B CG    1 
ATOM   4776  C CD    . GLN B 1 187 ? 27.746  -7.979  -41.244 1.00 51.88 ? 187 GLN B CD    1 
ATOM   4777  O OE1   . GLN B 1 187 ? 28.306  -8.104  -42.313 1.00 47.94 ? 187 GLN B OE1   1 
ATOM   4778  N NE2   . GLN B 1 187 ? 26.921  -6.993  -40.989 1.00 57.12 ? 187 GLN B NE2   1 
ATOM   4779  N N     . LYS B 1 188 ? 24.527  -11.935 -39.205 1.00 49.20 ? 188 LYS B N     1 
ATOM   4780  C CA    . LYS B 1 188 ? 23.789  -13.165 -38.966 1.00 48.22 ? 188 LYS B CA    1 
ATOM   4781  C C     . LYS B 1 188 ? 23.459  -13.363 -37.462 1.00 44.67 ? 188 LYS B C     1 
ATOM   4782  O O     . LYS B 1 188 ? 22.456  -13.973 -37.205 1.00 43.12 ? 188 LYS B O     1 
ATOM   4783  C CB    . LYS B 1 188 ? 24.350  -14.408 -39.719 1.00 49.09 ? 188 LYS B CB    1 
ATOM   4784  C CG    . LYS B 1 188 ? 23.531  -14.856 -41.006 1.00 50.60 ? 188 LYS B CG    1 
ATOM   4785  C CD    . LYS B 1 188 ? 23.743  -14.125 -42.356 1.00 51.11 ? 188 LYS B CD    1 
ATOM   4786  C CE    . LYS B 1 188 ? 23.169  -12.654 -42.427 1.00 55.73 ? 188 LYS B CE    1 
ATOM   4787  N NZ    . LYS B 1 188 ? 21.754  -12.389 -42.963 1.00 52.19 ? 188 LYS B NZ    1 
ATOM   4788  N N     . ASN B 1 189 ? 24.185  -12.722 -36.515 1.00 41.78 ? 189 ASN B N     1 
ATOM   4789  C CA    . ASN B 1 189 ? 23.571  -12.342 -35.203 1.00 38.99 ? 189 ASN B CA    1 
ATOM   4790  C C     . ASN B 1 189 ? 22.968  -13.477 -34.317 1.00 36.47 ? 189 ASN B C     1 
ATOM   4791  O O     . ASN B 1 189 ? 21.800  -13.440 -34.023 1.00 35.80 ? 189 ASN B O     1 
ATOM   4792  C CB    . ASN B 1 189 ? 22.308  -11.562 -35.522 1.00 40.12 ? 189 ASN B CB    1 
ATOM   4793  C CG    . ASN B 1 189 ? 22.491  -10.108 -35.680 1.00 44.82 ? 189 ASN B CG    1 
ATOM   4794  O OD1   . ASN B 1 189 ? 21.509  -9.377  -35.449 1.00 53.98 ? 189 ASN B OD1   1 
ATOM   4795  N ND2   . ASN B 1 189 ? 23.693  -9.636  -36.057 1.00 41.78 ? 189 ASN B ND2   1 
ATOM   4796  N N     . THR B 1 190 ? 23.672  -14.501 -33.928 1.00 33.04 ? 190 THR B N     1 
ATOM   4797  C CA    . THR B 1 190 ? 23.064  -15.427 -33.015 1.00 31.52 ? 190 THR B CA    1 
ATOM   4798  C C     . THR B 1 190 ? 22.930  -14.834 -31.560 1.00 32.01 ? 190 THR B C     1 
ATOM   4799  O O     . THR B 1 190 ? 23.736  -14.039 -31.139 1.00 31.79 ? 190 THR B O     1 
ATOM   4800  C CB    . THR B 1 190 ? 23.970  -16.641 -32.893 1.00 31.46 ? 190 THR B CB    1 
ATOM   4801  O OG1   . THR B 1 190 ? 25.276  -16.147 -32.629 1.00 30.68 ? 190 THR B OG1   1 
ATOM   4802  C CG2   . THR B 1 190 ? 24.008  -17.509 -34.154 1.00 28.93 ? 190 THR B CG2   1 
ATOM   4803  N N     . PRO B 1 191 ? 21.931  -15.263 -30.771 1.00 33.50 ? 191 PRO B N     1 
ATOM   4804  C CA    . PRO B 1 191 ? 21.788  -14.631 -29.419 1.00 33.53 ? 191 PRO B CA    1 
ATOM   4805  C C     . PRO B 1 191 ? 23.104  -14.571 -28.725 1.00 32.80 ? 191 PRO B C     1 
ATOM   4806  O O     . PRO B 1 191 ? 23.934  -15.472 -28.874 1.00 33.31 ? 191 PRO B O     1 
ATOM   4807  C CB    . PRO B 1 191 ? 20.841  -15.563 -28.698 1.00 33.25 ? 191 PRO B CB    1 
ATOM   4808  C CG    . PRO B 1 191 ? 19.942  -16.043 -29.781 1.00 33.81 ? 191 PRO B CG    1 
ATOM   4809  C CD    . PRO B 1 191 ? 20.845  -16.236 -31.014 1.00 33.46 ? 191 PRO B CD    1 
ATOM   4810  N N     . LYS B 1 192 ? 23.357  -13.488 -28.015 1.00 32.76 ? 192 LYS B N     1 
ATOM   4811  C CA    . LYS B 1 192 ? 24.678  -13.378 -27.342 1.00 31.80 ? 192 LYS B CA    1 
ATOM   4812  C C     . LYS B 1 192 ? 24.501  -13.939 -25.938 1.00 30.96 ? 192 LYS B C     1 
ATOM   4813  O O     . LYS B 1 192 ? 25.458  -14.445 -25.329 1.00 30.93 ? 192 LYS B O     1 
ATOM   4814  C CB    . LYS B 1 192 ? 25.147  -11.914 -27.331 1.00 32.33 ? 192 LYS B CB    1 
ATOM   4815  C CG    . LYS B 1 192 ? 26.073  -11.492 -28.502 1.00 37.24 ? 192 LYS B CG    1 
ATOM   4816  C CD    . LYS B 1 192 ? 25.517  -11.919 -29.944 1.00 43.56 ? 192 LYS B CD    1 
ATOM   4817  C CE    . LYS B 1 192 ? 24.335  -11.035 -30.495 1.00 47.64 ? 192 LYS B CE    1 
ATOM   4818  N NZ    . LYS B 1 192 ? 23.343  -11.744 -31.386 1.00 40.39 ? 192 LYS B NZ    1 
ATOM   4819  N N     . PHE B 1 193 ? 23.265  -13.866 -25.435 1.00 30.40 ? 193 PHE B N     1 
ATOM   4820  C CA    . PHE B 1 193 ? 22.946  -14.411 -24.110 1.00 31.51 ? 193 PHE B CA    1 
ATOM   4821  C C     . PHE B 1 193 ? 21.496  -14.815 -23.866 1.00 30.81 ? 193 PHE B C     1 
ATOM   4822  O O     . PHE B 1 193 ? 20.557  -14.348 -24.513 1.00 30.39 ? 193 PHE B O     1 
ATOM   4823  C CB    . PHE B 1 193 ? 23.463  -13.544 -22.936 1.00 30.39 ? 193 PHE B CB    1 
ATOM   4824  C CG    . PHE B 1 193 ? 22.737  -12.252 -22.757 1.00 32.60 ? 193 PHE B CG    1 
ATOM   4825  C CD1   . PHE B 1 193 ? 23.364  -11.035 -23.065 1.00 28.31 ? 193 PHE B CD1   1 
ATOM   4826  C CD2   . PHE B 1 193 ? 21.455  -12.221 -22.238 1.00 28.97 ? 193 PHE B CD2   1 
ATOM   4827  C CE1   . PHE B 1 193 ? 22.689  -9.821  -22.896 1.00 29.65 ? 193 PHE B CE1   1 
ATOM   4828  C CE2   . PHE B 1 193 ? 20.775  -10.984 -22.030 1.00 32.66 ? 193 PHE B CE2   1 
ATOM   4829  C CZ    . PHE B 1 193 ? 21.375  -9.789  -22.374 1.00 27.79 ? 193 PHE B CZ    1 
ATOM   4830  N N     . LEU B 1 194 ? 21.333  -15.737 -22.939 1.00 31.01 ? 194 LEU B N     1 
ATOM   4831  C CA    . LEU B 1 194 ? 20.016  -15.936 -22.340 1.00 32.14 ? 194 LEU B CA    1 
ATOM   4832  C C     . LEU B 1 194 ? 19.995  -15.437 -20.894 1.00 32.00 ? 194 LEU B C     1 
ATOM   4833  O O     . LEU B 1 194 ? 20.815  -15.886 -20.069 1.00 33.19 ? 194 LEU B O     1 
ATOM   4834  C CB    . LEU B 1 194 ? 19.653  -17.409 -22.326 1.00 31.71 ? 194 LEU B CB    1 
ATOM   4835  C CG    . LEU B 1 194 ? 18.389  -17.662 -21.455 1.00 35.35 ? 194 LEU B CG    1 
ATOM   4836  C CD1   . LEU B 1 194 ? 17.092  -17.273 -22.141 1.00 32.35 ? 194 LEU B CD1   1 
ATOM   4837  C CD2   . LEU B 1 194 ? 18.375  -19.132 -20.970 1.00 32.86 ? 194 LEU B CD2   1 
ATOM   4838  N N     . TYR B 1 195 ? 19.050  -14.564 -20.578 1.00 30.97 ? 195 TYR B N     1 
ATOM   4839  C CA    . TYR B 1 195 ? 18.914  -14.090 -19.203 1.00 30.55 ? 195 TYR B CA    1 
ATOM   4840  C C     . TYR B 1 195 ? 17.684  -14.678 -18.530 1.00 29.44 ? 195 TYR B C     1 
ATOM   4841  O O     . TYR B 1 195 ? 16.626  -14.698 -19.106 1.00 27.24 ? 195 TYR B O     1 
ATOM   4842  C CB    . TYR B 1 195 ? 18.852  -12.557 -19.206 1.00 30.66 ? 195 TYR B CB    1 
ATOM   4843  C CG    . TYR B 1 195 ? 18.266  -11.948 -17.974 1.00 31.65 ? 195 TYR B CG    1 
ATOM   4844  C CD1   . TYR B 1 195 ? 19.095  -11.289 -16.974 1.00 26.60 ? 195 TYR B CD1   1 
ATOM   4845  C CD2   . TYR B 1 195 ? 16.893  -11.976 -17.774 1.00 28.88 ? 195 TYR B CD2   1 
ATOM   4846  C CE1   . TYR B 1 195 ? 18.491  -10.670 -15.840 1.00 16.42 ? 195 TYR B CE1   1 
ATOM   4847  C CE2   . TYR B 1 195 ? 16.340  -11.415 -16.599 1.00 29.75 ? 195 TYR B CE2   1 
ATOM   4848  C CZ    . TYR B 1 195 ? 17.160  -10.751 -15.672 1.00 25.47 ? 195 TYR B CZ    1 
ATOM   4849  O OH    . TYR B 1 195 ? 16.550  -10.202 -14.548 1.00 32.16 ? 195 TYR B OH    1 
ATOM   4850  N N     . THR B 1 196 ? 17.795  -15.103 -17.278 1.00 29.03 ? 196 THR B N     1 
ATOM   4851  C CA    . THR B 1 196 ? 16.562  -15.475 -16.576 1.00 28.42 ? 196 THR B CA    1 
ATOM   4852  C C     . THR B 1 196 ? 16.842  -15.239 -15.185 1.00 27.11 ? 196 THR B C     1 
ATOM   4853  O O     . THR B 1 196 ? 18.030  -15.207 -14.812 1.00 28.07 ? 196 THR B O     1 
ATOM   4854  C CB    . THR B 1 196 ? 16.209  -17.050 -16.810 1.00 30.35 ? 196 THR B CB    1 
ATOM   4855  O OG1   . THR B 1 196 ? 14.828  -17.368 -16.443 1.00 30.70 ? 196 THR B OG1   1 
ATOM   4856  C CG2   . THR B 1 196 ? 17.203  -17.932 -16.126 1.00 24.26 ? 196 THR B CG2   1 
ATOM   4857  N N     . VAL B 1 197 ? 15.769  -15.167 -14.405 1.00 26.41 ? 197 VAL B N     1 
ATOM   4858  C CA    . VAL B 1 197 ? 15.765  -15.254 -12.933 1.00 24.79 ? 197 VAL B CA    1 
ATOM   4859  C C     . VAL B 1 197 ? 15.349  -16.684 -12.477 1.00 26.78 ? 197 VAL B C     1 
ATOM   4860  O O     . VAL B 1 197 ? 14.142  -17.010 -12.474 1.00 29.38 ? 197 VAL B O     1 
ATOM   4861  C CB    . VAL B 1 197 ? 14.810  -14.094 -12.292 1.00 26.43 ? 197 VAL B CB    1 
ATOM   4862  C CG1   . VAL B 1 197 ? 14.663  -14.149 -10.787 1.00 21.31 ? 197 VAL B CG1   1 
ATOM   4863  C CG2   . VAL B 1 197 ? 15.394  -12.591 -12.577 1.00 24.93 ? 197 VAL B CG2   1 
ATOM   4864  N N     . PRO B 1 198 ? 16.303  -17.566 -12.086 1.00 26.59 ? 198 PRO B N     1 
ATOM   4865  C CA    . PRO B 1 198 ? 15.835  -18.996 -11.966 1.00 27.88 ? 198 PRO B CA    1 
ATOM   4866  C C     . PRO B 1 198 ? 15.078  -19.408 -10.703 1.00 29.17 ? 198 PRO B C     1 
ATOM   4867  O O     . PRO B 1 198 ? 14.448  -20.441 -10.738 1.00 32.21 ? 198 PRO B O     1 
ATOM   4868  C CB    . PRO B 1 198 ? 17.125  -19.817 -12.097 1.00 26.82 ? 198 PRO B CB    1 
ATOM   4869  C CG    . PRO B 1 198 ? 18.168  -18.798 -12.395 1.00 29.53 ? 198 PRO B CG    1 
ATOM   4870  C CD    . PRO B 1 198 ? 17.727  -17.488 -11.786 1.00 24.85 ? 198 PRO B CD    1 
ATOM   4871  N N     . ASN B 1 199 ? 15.156  -18.640 -9.607  1.00 28.94 ? 199 ASN B N     1 
ATOM   4872  C CA    . ASN B 1 199 ? 14.323  -18.815 -8.459  1.00 27.48 ? 199 ASN B CA    1 
ATOM   4873  C C     . ASN B 1 199 ? 13.389  -17.685 -8.203  1.00 28.51 ? 199 ASN B C     1 
ATOM   4874  O O     . ASN B 1 199 ? 13.818  -16.548 -8.078  1.00 28.85 ? 199 ASN B O     1 
ATOM   4875  C CB    . ASN B 1 199 ? 15.197  -19.040 -7.217  1.00 26.99 ? 199 ASN B CB    1 
ATOM   4876  C CG    . ASN B 1 199 ? 16.171  -20.114 -7.457  1.00 27.88 ? 199 ASN B CG    1 
ATOM   4877  O OD1   . ASN B 1 199 ? 15.777  -21.273 -7.585  1.00 30.84 ? 199 ASN B OD1   1 
ATOM   4878  N ND2   . ASN B 1 199 ? 17.429  -19.756 -7.663  1.00 27.24 ? 199 ASN B ND2   1 
ATOM   4879  N N     . GLY B 1 200 ? 12.101  -17.987 -8.109  1.00 27.90 ? 200 GLY B N     1 
ATOM   4880  C CA    . GLY B 1 200 ? 11.141  -16.977 -7.637  1.00 28.17 ? 200 GLY B CA    1 
ATOM   4881  C C     . GLY B 1 200 ? 11.148  -15.746 -8.498  1.00 29.39 ? 200 GLY B C     1 
ATOM   4882  O O     . GLY B 1 200 ? 11.354  -14.682 -7.976  1.00 28.65 ? 200 GLY B O     1 
ATOM   4883  N N     . ASN B 1 201 ? 10.921  -15.897 -9.815  1.00 29.79 ? 201 ASN B N     1 
ATOM   4884  C CA    . ASN B 1 201 ? 10.890  -14.780 -10.759 1.00 31.82 ? 201 ASN B CA    1 
ATOM   4885  C C     . ASN B 1 201 ? 10.023  -13.568 -10.289 1.00 31.55 ? 201 ASN B C     1 
ATOM   4886  O O     . ASN B 1 201 ? 8.860   -13.724 -9.840  1.00 32.43 ? 201 ASN B O     1 
ATOM   4887  C CB    . ASN B 1 201 ? 10.394  -15.307 -12.141 1.00 31.62 ? 201 ASN B CB    1 
ATOM   4888  C CG    . ASN B 1 201 ? 10.450  -14.260 -13.225 1.00 35.18 ? 201 ASN B CG    1 
ATOM   4889  O OD1   . ASN B 1 201 ? 9.455   -13.989 -13.853 1.00 37.17 ? 201 ASN B OD1   1 
ATOM   4890  N ND2   . ASN B 1 201 ? 11.601  -13.633 -13.412 1.00 32.33 ? 201 ASN B ND2   1 
ATOM   4891  N N     . ASN B 1 202 ? 10.595  -12.373 -10.397 1.00 31.82 ? 202 ASN B N     1 
ATOM   4892  C CA    . ASN B 1 202 ? 9.809   -11.146 -10.395 1.00 31.25 ? 202 ASN B CA    1 
ATOM   4893  C C     . ASN B 1 202 ? 9.187   -10.857 -11.757 1.00 32.72 ? 202 ASN B C     1 
ATOM   4894  O O     . ASN B 1 202 ? 9.753   -10.120 -12.565 1.00 31.83 ? 202 ASN B O     1 
ATOM   4895  C CB    . ASN B 1 202 ? 10.665  -9.962  -9.944  1.00 32.20 ? 202 ASN B CB    1 
ATOM   4896  C CG    . ASN B 1 202 ? 9.832   -8.808  -9.420  1.00 28.49 ? 202 ASN B CG    1 
ATOM   4897  O OD1   . ASN B 1 202 ? 8.612   -8.785  -9.581  1.00 29.13 ? 202 ASN B OD1   1 
ATOM   4898  N ND2   . ASN B 1 202 ? 10.490  -7.843  -8.788  1.00 29.40 ? 202 ASN B ND2   1 
ATOM   4899  N N     . PRO B 1 203 ? 8.021   -11.445 -12.007 1.00 34.17 ? 203 PRO B N     1 
ATOM   4900  C CA    . PRO B 1 203 ? 6.862   -11.259 -11.128 1.00 33.48 ? 203 PRO B CA    1 
ATOM   4901  C C     . PRO B 1 203 ? 6.326   -12.588 -10.605 1.00 34.67 ? 203 PRO B C     1 
ATOM   4902  O O     . PRO B 1 203 ? 5.784   -12.643 -9.501  1.00 35.94 ? 203 PRO B O     1 
ATOM   4903  C CB    . PRO B 1 203 ? 5.834   -10.605 -12.052 1.00 34.62 ? 203 PRO B CB    1 
ATOM   4904  C CG    . PRO B 1 203 ? 6.174   -11.120 -13.406 1.00 33.58 ? 203 PRO B CG    1 
ATOM   4905  C CD    . PRO B 1 203 ? 7.669   -11.290 -13.430 1.00 34.90 ? 203 PRO B CD    1 
ATOM   4906  N N     . THR B 1 204 ? 6.480   -13.646 -11.397 1.00 34.68 ? 204 THR B N     1 
ATOM   4907  C CA    . THR B 1 204 ? 5.539   -14.758 -11.377 1.00 33.49 ? 204 THR B CA    1 
ATOM   4908  C C     . THR B 1 204 ? 5.694   -15.591 -10.109 1.00 33.10 ? 204 THR B C     1 
ATOM   4909  O O     . THR B 1 204 ? 4.716   -16.114 -9.574  1.00 32.97 ? 204 THR B O     1 
ATOM   4910  C CB    . THR B 1 204 ? 5.730   -15.647 -12.621 1.00 32.17 ? 204 THR B CB    1 
ATOM   4911  O OG1   . THR B 1 204 ? 6.939   -16.405 -12.489 1.00 34.66 ? 204 THR B OG1   1 
ATOM   4912  C CG2   . THR B 1 204 ? 5.988   -14.792 -13.853 1.00 33.06 ? 204 THR B CG2   1 
ATOM   4913  N N     . GLY B 1 205 ? 6.929   -15.709 -9.632  1.00 32.92 ? 205 GLY B N     1 
ATOM   4914  C CA    . GLY B 1 205 ? 7.216   -16.484 -8.447  1.00 34.05 ? 205 GLY B CA    1 
ATOM   4915  C C     . GLY B 1 205 ? 7.557   -17.934 -8.811  1.00 35.38 ? 205 GLY B C     1 
ATOM   4916  O O     . GLY B 1 205 ? 7.742   -18.705 -7.926  1.00 36.22 ? 205 GLY B O     1 
ATOM   4917  N N     . ASN B 1 206 ? 7.668   -18.290 -10.104 1.00 34.92 ? 206 ASN B N     1 
ATOM   4918  C CA    . ASN B 1 206 ? 8.105   -19.650 -10.534 1.00 34.56 ? 206 ASN B CA    1 
ATOM   4919  C C     . ASN B 1 206 ? 9.607   -19.833 -10.552 1.00 34.26 ? 206 ASN B C     1 
ATOM   4920  O O     . ASN B 1 206 ? 10.403  -18.835 -10.585 1.00 35.29 ? 206 ASN B O     1 
ATOM   4921  C CB    . ASN B 1 206 ? 7.599   -20.001 -11.952 1.00 35.15 ? 206 ASN B CB    1 
ATOM   4922  C CG    . ASN B 1 206 ? 6.129   -19.685 -12.139 1.00 38.57 ? 206 ASN B CG    1 
ATOM   4923  O OD1   . ASN B 1 206 ? 5.707   -19.039 -13.155 1.00 36.59 ? 206 ASN B OD1   1 
ATOM   4924  N ND2   . ASN B 1 206 ? 5.320   -20.093 -11.134 1.00 35.43 ? 206 ASN B ND2   1 
ATOM   4925  N N     . SER B 1 207 ? 10.002  -21.099 -10.610 1.00 32.18 ? 207 SER B N     1 
ATOM   4926  C CA    . SER B 1 207 ? 11.365  -21.485 -10.454 1.00 32.09 ? 207 SER B CA    1 
ATOM   4927  C C     . SER B 1 207 ? 11.777  -22.558 -11.368 1.00 32.71 ? 207 SER B C     1 
ATOM   4928  O O     . SER B 1 207 ? 11.162  -23.631 -11.393 1.00 34.71 ? 207 SER B O     1 
ATOM   4929  C CB    . SER B 1 207 ? 11.589  -21.975 -9.031  1.00 31.09 ? 207 SER B CB    1 
ATOM   4930  O OG    . SER B 1 207 ? 11.707  -20.846 -8.198  1.00 34.56 ? 207 SER B OG    1 
ATOM   4931  N N     . LEU B 1 208 ? 12.866  -22.335 -12.072 1.00 33.31 ? 208 LEU B N     1 
ATOM   4932  C CA    . LEU B 1 208 ? 13.361  -23.338 -12.999 1.00 34.10 ? 208 LEU B CA    1 
ATOM   4933  C C     . LEU B 1 208 ? 13.622  -24.663 -12.231 1.00 34.72 ? 208 LEU B C     1 
ATOM   4934  O O     . LEU B 1 208 ? 13.890  -24.614 -11.044 1.00 35.21 ? 208 LEU B O     1 
ATOM   4935  C CB    . LEU B 1 208 ? 14.633  -22.842 -13.712 1.00 33.99 ? 208 LEU B CB    1 
ATOM   4936  C CG    . LEU B 1 208 ? 14.547  -22.284 -15.138 1.00 35.42 ? 208 LEU B CG    1 
ATOM   4937  C CD1   . LEU B 1 208 ? 15.962  -22.158 -15.708 1.00 33.95 ? 208 LEU B CD1   1 
ATOM   4938  C CD2   . LEU B 1 208 ? 13.761  -23.223 -16.009 1.00 35.93 ? 208 LEU B CD2   1 
ATOM   4939  N N     . THR B 1 209 ? 13.440  -25.807 -12.887 1.00 34.64 ? 209 THR B N     1 
ATOM   4940  C CA    . THR B 1 209 ? 13.730  -27.109 -12.310 1.00 35.56 ? 209 THR B CA    1 
ATOM   4941  C C     . THR B 1 209 ? 15.116  -27.435 -12.711 1.00 35.72 ? 209 THR B C     1 
ATOM   4942  O O     . THR B 1 209 ? 15.671  -26.801 -13.620 1.00 38.93 ? 209 THR B O     1 
ATOM   4943  C CB    . THR B 1 209 ? 12.717  -28.287 -12.712 1.00 35.66 ? 209 THR B CB    1 
ATOM   4944  O OG1   . THR B 1 209 ? 12.678  -28.490 -14.133 1.00 36.29 ? 209 THR B OG1   1 
ATOM   4945  C CG2   . THR B 1 209 ? 11.290  -28.015 -12.221 1.00 31.87 ? 209 THR B CG2   1 
ATOM   4946  N N     . SER B 1 210 ? 15.700  -28.387 -12.014 1.00 34.11 ? 210 SER B N     1 
ATOM   4947  C CA    . SER B 1 210 ? 17.042  -28.797 -12.202 1.00 32.78 ? 210 SER B CA    1 
ATOM   4948  C C     . SER B 1 210 ? 17.300  -29.378 -13.608 1.00 32.66 ? 210 SER B C     1 
ATOM   4949  O O     . SER B 1 210 ? 18.393  -29.222 -14.201 1.00 30.56 ? 210 SER B O     1 
ATOM   4950  C CB    . SER B 1 210 ? 17.308  -29.868 -11.186 1.00 33.51 ? 210 SER B CB    1 
ATOM   4951  O OG    . SER B 1 210 ? 18.653  -30.249 -11.251 1.00 38.38 ? 210 SER B OG    1 
ATOM   4952  N N     . GLU B 1 211 ? 16.305  -30.108 -14.091 1.00 32.94 ? 211 GLU B N     1 
ATOM   4953  C CA    . GLU B 1 211 ? 16.438  -30.894 -15.258 1.00 33.36 ? 211 GLU B CA    1 
ATOM   4954  C C     . GLU B 1 211 ? 16.257  -29.874 -16.369 1.00 32.81 ? 211 GLU B C     1 
ATOM   4955  O O     . GLU B 1 211 ? 16.950  -29.973 -17.392 1.00 31.94 ? 211 GLU B O     1 
ATOM   4956  C CB    . GLU B 1 211 ? 15.359  -32.009 -15.289 1.00 34.52 ? 211 GLU B CB    1 
ATOM   4957  C CG    . GLU B 1 211 ? 15.612  -33.221 -14.289 1.00 41.61 ? 211 GLU B CG    1 
ATOM   4958  C CD    . GLU B 1 211 ? 14.801  -33.197 -12.939 1.00 50.27 ? 211 GLU B CD    1 
ATOM   4959  O OE1   . GLU B 1 211 ? 14.091  -32.195 -12.573 1.00 51.13 ? 211 GLU B OE1   1 
ATOM   4960  O OE2   . GLU B 1 211 ? 14.906  -34.217 -12.226 1.00 49.19 ? 211 GLU B OE2   1 
ATOM   4961  N N     . ARG B 1 212 ? 15.345  -28.891 -16.208 1.00 31.75 ? 212 ARG B N     1 
ATOM   4962  C CA    . ARG B 1 212 ? 15.364  -27.789 -17.181 1.00 32.13 ? 212 ARG B CA    1 
ATOM   4963  C C     . ARG B 1 212 ? 16.635  -27.018 -17.180 1.00 34.48 ? 212 ARG B C     1 
ATOM   4964  O O     . ARG B 1 212 ? 17.101  -26.575 -18.246 1.00 35.56 ? 212 ARG B O     1 
ATOM   4965  C CB    . ARG B 1 212 ? 14.132  -26.932 -17.266 1.00 30.67 ? 212 ARG B CB    1 
ATOM   4966  C CG    . ARG B 1 212 ? 12.841  -27.675 -17.480 1.00 29.23 ? 212 ARG B CG    1 
ATOM   4967  C CD    . ARG B 1 212 ? 11.730  -26.796 -16.973 1.00 33.85 ? 212 ARG B CD    1 
ATOM   4968  N NE    . ARG B 1 212 ? 10.468  -27.336 -17.421 1.00 33.70 ? 212 ARG B NE    1 
ATOM   4969  C CZ    . ARG B 1 212 ? 9.431   -26.619 -17.797 1.00 38.07 ? 212 ARG B CZ    1 
ATOM   4970  N NH1   . ARG B 1 212 ? 9.492   -25.259 -17.807 1.00 43.69 ? 212 ARG B NH1   1 
ATOM   4971  N NH2   . ARG B 1 212 ? 8.326   -27.265 -18.175 1.00 35.59 ? 212 ARG B NH2   1 
ATOM   4972  N N     . LYS B 1 213 ? 17.258  -26.851 -16.026 1.00 37.55 ? 213 LYS B N     1 
ATOM   4973  C CA    . LYS B 1 213 ? 18.510  -26.118 -16.045 1.00 38.42 ? 213 LYS B CA    1 
ATOM   4974  C C     . LYS B 1 213 ? 19.488  -26.877 -16.929 1.00 40.75 ? 213 LYS B C     1 
ATOM   4975  O O     . LYS B 1 213 ? 20.214  -26.258 -17.750 1.00 41.15 ? 213 LYS B O     1 
ATOM   4976  C CB    . LYS B 1 213 ? 19.037  -25.918 -14.636 1.00 38.49 ? 213 LYS B CB    1 
ATOM   4977  C CG    . LYS B 1 213 ? 18.403  -24.626 -13.945 1.00 40.87 ? 213 LYS B CG    1 
ATOM   4978  C CD    . LYS B 1 213 ? 18.582  -24.639 -12.411 1.00 38.92 ? 213 LYS B CD    1 
ATOM   4979  C CE    . LYS B 1 213 ? 18.896  -23.254 -11.853 1.00 37.09 ? 213 LYS B CE    1 
ATOM   4980  N NZ    . LYS B 1 213 ? 18.671  -23.105 -10.414 1.00 36.48 ? 213 LYS B NZ    1 
ATOM   4981  N N     . LYS B 1 214 ? 19.516  -28.215 -16.775 1.00 41.39 ? 214 LYS B N     1 
ATOM   4982  C CA    . LYS B 1 214 ? 20.465  -29.068 -17.505 1.00 42.18 ? 214 LYS B CA    1 
ATOM   4983  C C     . LYS B 1 214 ? 20.254  -28.974 -19.036 1.00 41.17 ? 214 LYS B C     1 
ATOM   4984  O O     . LYS B 1 214 ? 21.234  -28.760 -19.768 1.00 39.88 ? 214 LYS B O     1 
ATOM   4985  C CB    . LYS B 1 214 ? 20.422  -30.545 -17.025 1.00 43.56 ? 214 LYS B CB    1 
ATOM   4986  C CG    . LYS B 1 214 ? 21.301  -30.862 -15.800 1.00 45.15 ? 214 LYS B CG    1 
ATOM   4987  C CD    . LYS B 1 214 ? 20.723  -32.042 -15.004 1.00 47.37 ? 214 LYS B CD    1 
ATOM   4988  C CE    . LYS B 1 214 ? 21.829  -32.857 -14.290 1.00 49.31 ? 214 LYS B CE    1 
ATOM   4989  N NZ    . LYS B 1 214 ? 21.250  -33.671 -13.132 1.00 45.92 ? 214 LYS B NZ    1 
ATOM   4990  N N     . GLU B 1 215 ? 19.004  -29.063 -19.510 1.00 40.42 ? 215 GLU B N     1 
ATOM   4991  C CA    . GLU B 1 215 ? 18.728  -28.925 -20.976 1.00 41.74 ? 215 GLU B CA    1 
ATOM   4992  C C     . GLU B 1 215 ? 19.018  -27.517 -21.537 1.00 41.41 ? 215 GLU B C     1 
ATOM   4993  O O     . GLU B 1 215 ? 19.385  -27.360 -22.717 1.00 42.86 ? 215 GLU B O     1 
ATOM   4994  C CB    . GLU B 1 215 ? 17.287  -29.296 -21.331 1.00 41.53 ? 215 GLU B CB    1 
ATOM   4995  C CG    . GLU B 1 215 ? 16.828  -30.618 -20.746 1.00 48.56 ? 215 GLU B CG    1 
ATOM   4996  C CD    . GLU B 1 215 ? 15.311  -30.759 -20.738 1.00 55.42 ? 215 GLU B CD    1 
ATOM   4997  O OE1   . GLU B 1 215 ? 14.732  -31.088 -19.640 1.00 57.02 ? 215 GLU B OE1   1 
ATOM   4998  O OE2   . GLU B 1 215 ? 14.714  -30.529 -21.830 1.00 56.41 ? 215 GLU B OE2   1 
ATOM   4999  N N     . ILE B 1 216 ? 18.879  -26.509 -20.680 1.00 40.10 ? 216 ILE B N     1 
ATOM   5000  C CA    . ILE B 1 216 ? 19.047  -25.113 -21.051 1.00 39.32 ? 216 ILE B CA    1 
ATOM   5001  C C     . ILE B 1 216 ? 20.519  -24.911 -21.209 1.00 38.99 ? 216 ILE B C     1 
ATOM   5002  O O     . ILE B 1 216 ? 20.965  -24.181 -22.114 1.00 38.17 ? 216 ILE B O     1 
ATOM   5003  C CB    . ILE B 1 216 ? 18.355  -24.185 -20.031 1.00 38.75 ? 216 ILE B CB    1 
ATOM   5004  C CG1   . ILE B 1 216 ? 16.860  -24.277 -20.302 1.00 40.11 ? 216 ILE B CG1   1 
ATOM   5005  C CG2   . ILE B 1 216 ? 18.801  -22.708 -20.118 1.00 37.60 ? 216 ILE B CG2   1 
ATOM   5006  C CD1   . ILE B 1 216 ? 16.007  -24.213 -19.086 1.00 39.07 ? 216 ILE B CD1   1 
ATOM   5007  N N     . TYR B 1 217 ? 21.282  -25.632 -20.396 1.00 38.56 ? 217 TYR B N     1 
ATOM   5008  C CA    . TYR B 1 217 ? 22.721  -25.461 -20.487 1.00 38.00 ? 217 TYR B CA    1 
ATOM   5009  C C     . TYR B 1 217 ? 23.276  -26.022 -21.790 1.00 38.98 ? 217 TYR B C     1 
ATOM   5010  O O     . TYR B 1 217 ? 24.248  -25.465 -22.342 1.00 37.74 ? 217 TYR B O     1 
ATOM   5011  C CB    . TYR B 1 217 ? 23.470  -25.966 -19.268 1.00 35.43 ? 217 TYR B CB    1 
ATOM   5012  C CG    . TYR B 1 217 ? 24.955  -25.518 -19.191 1.00 35.59 ? 217 TYR B CG    1 
ATOM   5013  C CD1   . TYR B 1 217 ? 25.338  -24.261 -18.597 1.00 28.28 ? 217 TYR B CD1   1 
ATOM   5014  C CD2   . TYR B 1 217 ? 25.973  -26.365 -19.674 1.00 29.14 ? 217 TYR B CD2   1 
ATOM   5015  C CE1   . TYR B 1 217 ? 26.725  -23.886 -18.540 1.00 31.65 ? 217 TYR B CE1   1 
ATOM   5016  C CE2   . TYR B 1 217 ? 27.350  -25.989 -19.668 1.00 30.61 ? 217 TYR B CE2   1 
ATOM   5017  C CZ    . TYR B 1 217 ? 27.724  -24.749 -19.072 1.00 35.09 ? 217 TYR B CZ    1 
ATOM   5018  O OH    . TYR B 1 217 ? 29.079  -24.443 -19.008 1.00 34.35 ? 217 TYR B OH    1 
ATOM   5019  N N     . GLU B 1 218 ? 22.661  -27.119 -22.288 1.00 40.29 ? 218 GLU B N     1 
ATOM   5020  C CA    . GLU B 1 218 ? 23.164  -27.752 -23.495 1.00 39.59 ? 218 GLU B CA    1 
ATOM   5021  C C     . GLU B 1 218 ? 22.781  -26.928 -24.753 1.00 38.34 ? 218 GLU B C     1 
ATOM   5022  O O     . GLU B 1 218 ? 23.574  -26.784 -25.663 1.00 38.24 ? 218 GLU B O     1 
ATOM   5023  C CB    . GLU B 1 218 ? 22.845  -29.267 -23.529 1.00 41.44 ? 218 GLU B CB    1 
ATOM   5024  C CG    . GLU B 1 218 ? 21.503  -29.701 -24.082 1.00 46.34 ? 218 GLU B CG    1 
ATOM   5025  C CD    . GLU B 1 218 ? 20.840  -30.818 -23.228 1.00 54.46 ? 218 GLU B CD    1 
ATOM   5026  O OE1   . GLU B 1 218 ? 19.593  -31.073 -23.369 1.00 50.23 ? 218 GLU B OE1   1 
ATOM   5027  O OE2   . GLU B 1 218 ? 21.586  -31.392 -22.387 1.00 56.15 ? 218 GLU B OE2   1 
ATOM   5028  N N     . LEU B 1 219 ? 21.587  -26.380 -24.782 1.00 37.72 ? 219 LEU B N     1 
ATOM   5029  C CA    . LEU B 1 219 ? 21.232  -25.395 -25.793 1.00 39.06 ? 219 LEU B CA    1 
ATOM   5030  C C     . LEU B 1 219 ? 22.268  -24.253 -25.898 1.00 39.29 ? 219 LEU B C     1 
ATOM   5031  O O     . LEU B 1 219 ? 22.580  -23.766 -27.011 1.00 38.98 ? 219 LEU B O     1 
ATOM   5032  C CB    . LEU B 1 219 ? 19.834  -24.801 -25.555 1.00 37.74 ? 219 LEU B CB    1 
ATOM   5033  C CG    . LEU B 1 219 ? 18.572  -25.376 -26.190 1.00 38.32 ? 219 LEU B CG    1 
ATOM   5034  C CD1   . LEU B 1 219 ? 18.897  -26.281 -27.451 1.00 36.53 ? 219 LEU B CD1   1 
ATOM   5035  C CD2   . LEU B 1 219 ? 17.663  -26.116 -25.187 1.00 34.34 ? 219 LEU B CD2   1 
ATOM   5036  N N     . ALA B 1 220 ? 22.761  -23.831 -24.733 1.00 39.68 ? 220 ALA B N     1 
ATOM   5037  C CA    . ALA B 1 220 ? 23.711  -22.670 -24.618 1.00 39.61 ? 220 ALA B CA    1 
ATOM   5038  C C     . ALA B 1 220 ? 25.029  -23.049 -25.212 1.00 38.76 ? 220 ALA B C     1 
ATOM   5039  O O     . ALA B 1 220 ? 25.678  -22.212 -25.837 1.00 37.85 ? 220 ALA B O     1 
ATOM   5040  C CB    . ALA B 1 220 ? 23.908  -22.193 -23.164 1.00 37.22 ? 220 ALA B CB    1 
ATOM   5041  N N     . ARG B 1 221 ? 25.432  -24.287 -24.967 1.00 39.09 ? 221 ARG B N     1 
ATOM   5042  C CA    . ARG B 1 221 ? 26.632  -24.800 -25.596 1.00 40.54 ? 221 ARG B CA    1 
ATOM   5043  C C     . ARG B 1 221 ? 26.461  -24.909 -27.123 1.00 41.46 ? 221 ARG B C     1 
ATOM   5044  O O     . ARG B 1 221 ? 27.177  -24.254 -27.863 1.00 42.73 ? 221 ARG B O     1 
ATOM   5045  C CB    . ARG B 1 221 ? 27.037  -26.110 -24.975 1.00 39.31 ? 221 ARG B CB    1 
ATOM   5046  C CG    . ARG B 1 221 ? 28.344  -26.650 -25.456 1.00 43.36 ? 221 ARG B CG    1 
ATOM   5047  C CD    . ARG B 1 221 ? 28.579  -28.065 -24.780 1.00 48.21 ? 221 ARG B CD    1 
ATOM   5048  N NE    . ARG B 1 221 ? 28.895  -27.902 -23.367 1.00 53.24 ? 221 ARG B NE    1 
ATOM   5049  C CZ    . ARG B 1 221 ? 28.839  -28.853 -22.452 1.00 58.25 ? 221 ARG B CZ    1 
ATOM   5050  N NH1   . ARG B 1 221 ? 28.453  -30.098 -22.765 1.00 59.88 ? 221 ARG B NH1   1 
ATOM   5051  N NH2   . ARG B 1 221 ? 29.169  -28.548 -21.209 1.00 59.74 ? 221 ARG B NH2   1 
ATOM   5052  N N     . LYS B 1 222 ? 25.458  -25.673 -27.564 1.00 40.71 ? 222 LYS B N     1 
ATOM   5053  C CA    . LYS B 1 222 ? 25.208  -25.918 -28.952 1.00 39.38 ? 222 LYS B CA    1 
ATOM   5054  C C     . LYS B 1 222 ? 25.300  -24.609 -29.778 1.00 38.96 ? 222 LYS B C     1 
ATOM   5055  O O     . LYS B 1 222 ? 26.015  -24.579 -30.759 1.00 36.61 ? 222 LYS B O     1 
ATOM   5056  C CB    . LYS B 1 222 ? 23.830  -26.571 -29.126 1.00 39.11 ? 222 LYS B CB    1 
ATOM   5057  C CG    . LYS B 1 222 ? 23.554  -27.005 -30.539 1.00 37.73 ? 222 LYS B CG    1 
ATOM   5058  C CD    . LYS B 1 222 ? 22.286  -27.896 -30.711 1.00 39.74 ? 222 LYS B CD    1 
ATOM   5059  C CE    . LYS B 1 222 ? 21.677  -27.623 -32.137 1.00 38.20 ? 222 LYS B CE    1 
ATOM   5060  N NZ    . LYS B 1 222 ? 20.754  -28.675 -32.726 1.00 38.97 ? 222 LYS B NZ    1 
ATOM   5061  N N     . TYR B 1 223 ? 24.547  -23.564 -29.384 1.00 37.96 ? 223 TYR B N     1 
ATOM   5062  C CA    . TYR B 1 223 ? 24.516  -22.284 -30.088 1.00 35.85 ? 223 TYR B CA    1 
ATOM   5063  C C     . TYR B 1 223 ? 25.443  -21.218 -29.384 1.00 36.36 ? 223 TYR B C     1 
ATOM   5064  O O     . TYR B 1 223 ? 25.482  -19.977 -29.740 1.00 36.73 ? 223 TYR B O     1 
ATOM   5065  C CB    . TYR B 1 223 ? 23.095  -21.819 -30.200 1.00 36.43 ? 223 TYR B CB    1 
ATOM   5066  C CG    . TYR B 1 223 ? 22.130  -22.752 -30.954 1.00 36.26 ? 223 TYR B CG    1 
ATOM   5067  C CD1   . TYR B 1 223 ? 21.849  -22.538 -32.324 1.00 29.43 ? 223 TYR B CD1   1 
ATOM   5068  C CD2   . TYR B 1 223 ? 21.557  -23.880 -30.324 1.00 34.22 ? 223 TYR B CD2   1 
ATOM   5069  C CE1   . TYR B 1 223 ? 20.948  -23.376 -33.053 1.00 35.51 ? 223 TYR B CE1   1 
ATOM   5070  C CE2   . TYR B 1 223 ? 20.671  -24.758 -31.040 1.00 35.84 ? 223 TYR B CE2   1 
ATOM   5071  C CZ    . TYR B 1 223 ? 20.356  -24.489 -32.427 1.00 39.93 ? 223 TYR B CZ    1 
ATOM   5072  O OH    . TYR B 1 223 ? 19.469  -25.317 -33.177 1.00 38.76 ? 223 TYR B OH    1 
ATOM   5073  N N     . ASP B 1 224 ? 26.205  -21.708 -28.423 1.00 33.72 ? 224 ASP B N     1 
ATOM   5074  C CA    . ASP B 1 224 ? 27.258  -20.927 -27.742 1.00 37.54 ? 224 ASP B CA    1 
ATOM   5075  C C     . ASP B 1 224 ? 26.915  -19.396 -27.293 1.00 36.89 ? 224 ASP B C     1 
ATOM   5076  O O     . ASP B 1 224 ? 27.584  -18.412 -27.657 1.00 37.73 ? 224 ASP B O     1 
ATOM   5077  C CB    . ASP B 1 224 ? 28.551  -21.086 -28.535 1.00 37.46 ? 224 ASP B CB    1 
ATOM   5078  C CG    . ASP B 1 224 ? 29.743  -20.637 -27.771 1.00 42.62 ? 224 ASP B CG    1 
ATOM   5079  O OD1   . ASP B 1 224 ? 30.311  -21.453 -26.971 1.00 47.38 ? 224 ASP B OD1   1 
ATOM   5080  O OD2   . ASP B 1 224 ? 30.136  -19.484 -28.004 1.00 41.22 ? 224 ASP B OD2   1 
ATOM   5081  N N     . PHE B 1 225 ? 25.859  -19.230 -26.538 1.00 35.49 ? 225 PHE B N     1 
ATOM   5082  C CA    . PHE B 1 225 ? 25.604  -17.968 -25.851 1.00 37.01 ? 225 PHE B CA    1 
ATOM   5083  C C     . PHE B 1 225 ? 25.964  -18.031 -24.323 1.00 36.47 ? 225 PHE B C     1 
ATOM   5084  O O     . PHE B 1 225 ? 26.154  -19.112 -23.767 1.00 35.83 ? 225 PHE B O     1 
ATOM   5085  C CB    . PHE B 1 225 ? 24.152  -17.477 -26.101 1.00 37.80 ? 225 PHE B CB    1 
ATOM   5086  C CG    . PHE B 1 225 ? 23.064  -18.551 -25.859 1.00 38.19 ? 225 PHE B CG    1 
ATOM   5087  C CD1   . PHE B 1 225 ? 22.475  -18.715 -24.570 1.00 34.58 ? 225 PHE B CD1   1 
ATOM   5088  C CD2   . PHE B 1 225 ? 22.627  -19.353 -26.929 1.00 35.52 ? 225 PHE B CD2   1 
ATOM   5089  C CE1   . PHE B 1 225 ? 21.465  -19.675 -24.357 1.00 36.40 ? 225 PHE B CE1   1 
ATOM   5090  C CE2   . PHE B 1 225 ? 21.644  -20.356 -26.730 1.00 38.99 ? 225 PHE B CE2   1 
ATOM   5091  C CZ    . PHE B 1 225 ? 21.039  -20.515 -25.456 1.00 39.03 ? 225 PHE B CZ    1 
ATOM   5092  N N     . LEU B 1 226 ? 26.134  -16.863 -23.690 1.00 36.16 ? 226 LEU B N     1 
ATOM   5093  C CA    . LEU B 1 226 ? 26.264  -16.769 -22.254 1.00 34.81 ? 226 LEU B CA    1 
ATOM   5094  C C     . LEU B 1 226 ? 24.939  -17.080 -21.608 1.00 34.56 ? 226 LEU B C     1 
ATOM   5095  O O     . LEU B 1 226 ? 23.902  -16.839 -22.195 1.00 36.14 ? 226 LEU B O     1 
ATOM   5096  C CB    . LEU B 1 226 ? 26.703  -15.369 -21.810 1.00 35.48 ? 226 LEU B CB    1 
ATOM   5097  C CG    . LEU B 1 226 ? 28.162  -14.884 -21.528 1.00 32.43 ? 226 LEU B CG    1 
ATOM   5098  C CD1   . LEU B 1 226 ? 29.373  -15.830 -21.764 1.00 29.63 ? 226 LEU B CD1   1 
ATOM   5099  C CD2   . LEU B 1 226 ? 28.350  -13.636 -22.271 1.00 27.70 ? 226 LEU B CD2   1 
ATOM   5100  N N     . ILE B 1 227 ? 24.938  -17.617 -20.395 1.00 32.98 ? 227 ILE B N     1 
ATOM   5101  C CA    . ILE B 1 227 ? 23.695  -17.644 -19.655 1.00 32.12 ? 227 ILE B CA    1 
ATOM   5102  C C     . ILE B 1 227 ? 23.827  -16.600 -18.598 1.00 31.54 ? 227 ILE B C     1 
ATOM   5103  O O     . ILE B 1 227 ? 24.720  -16.693 -17.746 1.00 31.31 ? 227 ILE B O     1 
ATOM   5104  C CB    . ILE B 1 227 ? 23.418  -19.038 -18.937 1.00 32.03 ? 227 ILE B CB    1 
ATOM   5105  C CG1   . ILE B 1 227 ? 23.069  -20.181 -19.918 1.00 30.57 ? 227 ILE B CG1   1 
ATOM   5106  C CG2   . ILE B 1 227 ? 22.299  -18.920 -17.819 1.00 31.44 ? 227 ILE B CG2   1 
ATOM   5107  C CD1   . ILE B 1 227 ? 23.337  -21.581 -19.263 1.00 31.65 ? 227 ILE B CD1   1 
ATOM   5108  N N     . ILE B 1 228 ? 22.947  -15.608 -18.590 1.00 32.51 ? 228 ILE B N     1 
ATOM   5109  C CA    . ILE B 1 228 ? 22.953  -14.779 -17.376 1.00 31.63 ? 228 ILE B CA    1 
ATOM   5110  C C     . ILE B 1 228 ? 22.001  -15.092 -16.227 1.00 30.96 ? 228 ILE B C     1 
ATOM   5111  O O     . ILE B 1 228 ? 20.804  -14.932 -16.294 1.00 27.67 ? 228 ILE B O     1 
ATOM   5112  C CB    . ILE B 1 228 ? 23.430  -13.271 -17.437 1.00 33.15 ? 228 ILE B CB    1 
ATOM   5113  C CG1   . ILE B 1 228 ? 22.565  -12.383 -16.516 1.00 29.05 ? 228 ILE B CG1   1 
ATOM   5114  C CG2   . ILE B 1 228 ? 23.796  -12.653 -18.845 1.00 34.13 ? 228 ILE B CG2   1 
ATOM   5115  C CD1   . ILE B 1 228 ? 23.364  -11.251 -16.081 1.00 20.94 ? 228 ILE B CD1   1 
ATOM   5116  N N     . GLU B 1 229 ? 22.604  -15.609 -15.166 1.00 29.99 ? 229 GLU B N     1 
ATOM   5117  C CA    . GLU B 1 229 ? 21.813  -16.094 -14.015 1.00 31.50 ? 229 GLU B CA    1 
ATOM   5118  C C     . GLU B 1 229 ? 21.680  -15.033 -12.951 1.00 30.37 ? 229 GLU B C     1 
ATOM   5119  O O     . GLU B 1 229 ? 22.530  -14.958 -12.053 1.00 29.04 ? 229 GLU B O     1 
ATOM   5120  C CB    . GLU B 1 229 ? 22.499  -17.370 -13.391 1.00 32.72 ? 229 GLU B CB    1 
ATOM   5121  C CG    . GLU B 1 229 ? 21.770  -17.985 -12.223 1.00 28.12 ? 229 GLU B CG    1 
ATOM   5122  C CD    . GLU B 1 229 ? 22.295  -19.360 -11.902 1.00 30.51 ? 229 GLU B CD    1 
ATOM   5123  O OE1   . GLU B 1 229 ? 23.513  -19.578 -11.815 1.00 29.02 ? 229 GLU B OE1   1 
ATOM   5124  O OE2   . GLU B 1 229 ? 21.469  -20.257 -11.749 1.00 31.53 ? 229 GLU B OE2   1 
ATOM   5125  N N     . ASP B 1 230 ? 20.593  -14.267 -13.050 1.00 31.92 ? 230 ASP B N     1 
ATOM   5126  C CA    . ASP B 1 230 ? 20.156  -13.244 -12.069 1.00 31.71 ? 230 ASP B CA    1 
ATOM   5127  C C     . ASP B 1 230 ? 19.408  -13.943 -10.886 1.00 32.06 ? 230 ASP B C     1 
ATOM   5128  O O     . ASP B 1 230 ? 18.232  -14.388 -11.010 1.00 32.15 ? 230 ASP B O     1 
ATOM   5129  C CB    . ASP B 1 230 ? 19.335  -12.162 -12.857 1.00 31.99 ? 230 ASP B CB    1 
ATOM   5130  C CG    . ASP B 1 230 ? 18.943  -10.900 -12.005 1.00 31.62 ? 230 ASP B CG    1 
ATOM   5131  O OD1   . ASP B 1 230 ? 19.680  -10.548 -11.038 1.00 27.98 ? 230 ASP B OD1   1 
ATOM   5132  O OD2   . ASP B 1 230 ? 17.874  -10.251 -12.329 1.00 27.59 ? 230 ASP B OD2   1 
ATOM   5133  N N     . ASP B 1 231 ? 20.088  -14.068 -9.727  1.00 31.99 ? 231 ASP B N     1 
ATOM   5134  C CA    . ASP B 1 231 ? 19.617  -15.045 -8.671  1.00 31.03 ? 231 ASP B CA    1 
ATOM   5135  C C     . ASP B 1 231 ? 19.415  -14.498 -7.201  1.00 30.59 ? 231 ASP B C     1 
ATOM   5136  O O     . ASP B 1 231 ? 19.816  -15.149 -6.218  1.00 29.21 ? 231 ASP B O     1 
ATOM   5137  C CB    . ASP B 1 231 ? 20.447  -16.316 -8.686  1.00 27.76 ? 231 ASP B CB    1 
ATOM   5138  C CG    . ASP B 1 231 ? 19.591  -17.589 -8.438  1.00 30.68 ? 231 ASP B CG    1 
ATOM   5139  O OD1   . ASP B 1 231 ? 18.349  -17.497 -8.242  1.00 28.36 ? 231 ASP B OD1   1 
ATOM   5140  O OD2   . ASP B 1 231 ? 20.182  -18.698 -8.389  1.00 27.63 ? 231 ASP B OD2   1 
ATOM   5141  N N     . PRO B 1 232 ? 18.703  -13.353 -7.098  1.00 31.89 ? 232 PRO B N     1 
ATOM   5142  C CA    . PRO B 1 232 ? 18.549  -12.548 -5.884  1.00 31.73 ? 232 PRO B CA    1 
ATOM   5143  C C     . PRO B 1 232 ? 17.645  -13.212 -4.853  1.00 32.19 ? 232 PRO B C     1 
ATOM   5144  O O     . PRO B 1 232 ? 17.612  -12.780 -3.669  1.00 31.14 ? 232 PRO B O     1 
ATOM   5145  C CB    . PRO B 1 232 ? 17.933  -11.265 -6.383  1.00 31.80 ? 232 PRO B CB    1 
ATOM   5146  C CG    . PRO B 1 232 ? 17.099  -11.731 -7.686  1.00 32.52 ? 232 PRO B CG    1 
ATOM   5147  C CD    . PRO B 1 232 ? 18.001  -12.753 -8.278  1.00 30.60 ? 232 PRO B CD    1 
ATOM   5148  N N     . TYR B 1 233 ? 16.918  -14.250 -5.297  1.00 32.19 ? 233 TYR B N     1 
ATOM   5149  C CA    . TYR B 1 233 ? 16.033  -14.996 -4.400  1.00 31.52 ? 233 TYR B CA    1 
ATOM   5150  C C     . TYR B 1 233 ? 16.646  -16.362 -4.219  1.00 31.11 ? 233 TYR B C     1 
ATOM   5151  O O     . TYR B 1 233 ? 16.005  -17.302 -3.806  1.00 31.11 ? 233 TYR B O     1 
ATOM   5152  C CB    . TYR B 1 233 ? 14.604  -15.053 -4.968  1.00 31.92 ? 233 TYR B CB    1 
ATOM   5153  C CG    . TYR B 1 233 ? 13.957  -13.654 -5.159  1.00 33.92 ? 233 TYR B CG    1 
ATOM   5154  C CD1   . TYR B 1 233 ? 13.586  -12.876 -4.048  1.00 34.29 ? 233 TYR B CD1   1 
ATOM   5155  C CD2   . TYR B 1 233 ? 13.738  -13.117 -6.430  1.00 31.99 ? 233 TYR B CD2   1 
ATOM   5156  C CE1   . TYR B 1 233 ? 12.982  -11.639 -4.211  1.00 32.05 ? 233 TYR B CE1   1 
ATOM   5157  C CE2   . TYR B 1 233 ? 13.131  -11.876 -6.587  1.00 30.78 ? 233 TYR B CE2   1 
ATOM   5158  C CZ    . TYR B 1 233 ? 12.770  -11.156 -5.488  1.00 32.35 ? 233 TYR B CZ    1 
ATOM   5159  O OH    . TYR B 1 233 ? 12.206  -9.936  -5.632  1.00 31.02 ? 233 TYR B OH    1 
ATOM   5160  N N     . TYR B 1 234 ? 17.914  -16.491 -4.545  1.00 32.38 ? 234 TYR B N     1 
ATOM   5161  C CA    . TYR B 1 234 ? 18.533  -17.817 -4.480  1.00 34.11 ? 234 TYR B CA    1 
ATOM   5162  C C     . TYR B 1 234 ? 18.389  -18.261 -3.049  1.00 34.21 ? 234 TYR B C     1 
ATOM   5163  O O     . TYR B 1 234 ? 18.202  -19.427 -2.758  1.00 35.66 ? 234 TYR B O     1 
ATOM   5164  C CB    . TYR B 1 234 ? 20.015  -17.790 -4.809  1.00 33.87 ? 234 TYR B CB    1 
ATOM   5165  C CG    . TYR B 1 234 ? 20.674  -19.102 -4.426  1.00 30.98 ? 234 TYR B CG    1 
ATOM   5166  C CD1   . TYR B 1 234 ? 20.484  -20.246 -5.221  1.00 31.99 ? 234 TYR B CD1   1 
ATOM   5167  C CD2   . TYR B 1 234 ? 21.533  -19.194 -3.354  1.00 25.55 ? 234 TYR B CD2   1 
ATOM   5168  C CE1   . TYR B 1 234 ? 21.082  -21.462 -4.898  1.00 26.88 ? 234 TYR B CE1   1 
ATOM   5169  C CE2   . TYR B 1 234 ? 22.163  -20.394 -3.035  1.00 25.91 ? 234 TYR B CE2   1 
ATOM   5170  C CZ    . TYR B 1 234 ? 21.902  -21.532 -3.827  1.00 33.98 ? 234 TYR B CZ    1 
ATOM   5171  O OH    . TYR B 1 234 ? 22.462  -22.774 -3.574  1.00 37.53 ? 234 TYR B OH    1 
ATOM   5172  N N     . PHE B 1 235 ? 18.488  -17.288 -2.150  1.00 33.00 ? 235 PHE B N     1 
ATOM   5173  C CA    . PHE B 1 235 ? 18.524  -17.587 -0.766  1.00 32.06 ? 235 PHE B CA    1 
ATOM   5174  C C     . PHE B 1 235 ? 17.119  -17.644 -0.181  1.00 32.25 ? 235 PHE B C     1 
ATOM   5175  O O     . PHE B 1 235 ? 16.956  -17.887 1.020   1.00 34.59 ? 235 PHE B O     1 
ATOM   5176  C CB    . PHE B 1 235 ? 19.428  -16.572 -0.042  1.00 31.07 ? 235 PHE B CB    1 
ATOM   5177  C CG    . PHE B 1 235 ? 20.915  -16.877 -0.164  1.00 27.74 ? 235 PHE B CG    1 
ATOM   5178  C CD1   . PHE B 1 235 ? 21.825  -15.938 -0.728  1.00 20.91 ? 235 PHE B CD1   1 
ATOM   5179  C CD2   . PHE B 1 235 ? 21.398  -18.104 0.260   1.00 17.94 ? 235 PHE B CD2   1 
ATOM   5180  C CE1   . PHE B 1 235 ? 23.154  -16.235 -0.799  1.00 26.04 ? 235 PHE B CE1   1 
ATOM   5181  C CE2   . PHE B 1 235 ? 22.805  -18.416 0.181   1.00 27.25 ? 235 PHE B CE2   1 
ATOM   5182  C CZ    . PHE B 1 235 ? 23.659  -17.558 -0.348  1.00 23.60 ? 235 PHE B CZ    1 
ATOM   5183  N N     . LEU B 1 236 ? 16.098  -17.437 -0.997  1.00 29.06 ? 236 LEU B N     1 
ATOM   5184  C CA    . LEU B 1 236 ? 14.763  -17.468 -0.487  1.00 28.91 ? 236 LEU B CA    1 
ATOM   5185  C C     . LEU B 1 236 ? 13.904  -18.617 -1.076  1.00 28.22 ? 236 LEU B C     1 
ATOM   5186  O O     . LEU B 1 236 ? 12.698  -18.482 -1.336  1.00 30.50 ? 236 LEU B O     1 
ATOM   5187  C CB    . LEU B 1 236 ? 14.118  -16.067 -0.624  1.00 29.17 ? 236 LEU B CB    1 
ATOM   5188  C CG    . LEU B 1 236 ? 13.708  -15.097 0.561   1.00 31.78 ? 236 LEU B CG    1 
ATOM   5189  C CD1   . LEU B 1 236 ? 14.821  -14.417 1.355   1.00 31.34 ? 236 LEU B CD1   1 
ATOM   5190  C CD2   . LEU B 1 236 ? 12.796  -13.966 0.062   1.00 30.98 ? 236 LEU B CD2   1 
ATOM   5191  N N     . GLN B 1 237 ? 14.485  -19.776 -1.261  1.00 27.86 ? 237 GLN B N     1 
ATOM   5192  C CA    . GLN B 1 237 ? 13.708  -20.941 -1.773  1.00 28.80 ? 237 GLN B CA    1 
ATOM   5193  C C     . GLN B 1 237 ? 12.872  -21.556 -0.669  1.00 29.09 ? 237 GLN B C     1 
ATOM   5194  O O     . GLN B 1 237 ? 13.336  -21.737 0.411   1.00 30.06 ? 237 GLN B O     1 
ATOM   5195  C CB    . GLN B 1 237 ? 14.675  -21.925 -2.438  1.00 27.73 ? 237 GLN B CB    1 
ATOM   5196  C CG    . GLN B 1 237 ? 15.219  -21.347 -3.786  1.00 28.04 ? 237 GLN B CG    1 
ATOM   5197  C CD    . GLN B 1 237 ? 16.381  -22.151 -4.304  1.00 29.36 ? 237 GLN B CD    1 
ATOM   5198  O OE1   . GLN B 1 237 ? 17.559  -21.758 -4.147  1.00 29.39 ? 237 GLN B OE1   1 
ATOM   5199  N NE2   . GLN B 1 237 ? 16.081  -23.337 -4.819  1.00 24.51 ? 237 GLN B NE2   1 
ATOM   5200  N N     . PHE B 1 238 ? 11.605  -21.811 -0.885  1.00 32.07 ? 238 PHE B N     1 
ATOM   5201  C CA    . PHE B 1 238 ? 10.802  -22.432 0.194   1.00 33.93 ? 238 PHE B CA    1 
ATOM   5202  C C     . PHE B 1 238 ? 11.057  -23.953 0.349   1.00 37.02 ? 238 PHE B C     1 
ATOM   5203  O O     . PHE B 1 238 ? 10.774  -24.527 1.436   1.00 38.52 ? 238 PHE B O     1 
ATOM   5204  C CB    . PHE B 1 238 ? 9.299   -22.149 0.004   1.00 33.75 ? 238 PHE B CB    1 
ATOM   5205  C CG    . PHE B 1 238 ? 8.969   -20.681 -0.122  1.00 29.79 ? 238 PHE B CG    1 
ATOM   5206  C CD1   . PHE B 1 238 ? 8.251   -20.208 -1.214  1.00 32.80 ? 238 PHE B CD1   1 
ATOM   5207  C CD2   . PHE B 1 238 ? 9.466   -19.787 0.790   1.00 30.92 ? 238 PHE B CD2   1 
ATOM   5208  C CE1   . PHE B 1 238 ? 7.982   -18.853 -1.345  1.00 35.23 ? 238 PHE B CE1   1 
ATOM   5209  C CE2   . PHE B 1 238 ? 9.223   -18.450 0.680   1.00 38.27 ? 238 PHE B CE2   1 
ATOM   5210  C CZ    . PHE B 1 238 ? 8.491   -17.953 -0.388  1.00 35.72 ? 238 PHE B CZ    1 
ATOM   5211  N N     . ASN B 1 239 ? 11.509  -24.573 -0.748  1.00 37.04 ? 239 ASN B N     1 
ATOM   5212  C CA    . ASN B 1 239 ? 12.003  -25.928 -0.798  1.00 40.60 ? 239 ASN B CA    1 
ATOM   5213  C C     . ASN B 1 239 ? 13.431  -25.906 -0.275  1.00 41.35 ? 239 ASN B C     1 
ATOM   5214  O O     . ASN B 1 239 ? 14.335  -25.339 -0.918  1.00 42.02 ? 239 ASN B O     1 
ATOM   5215  C CB    . ASN B 1 239 ? 12.013  -26.425 -2.259  1.00 40.40 ? 239 ASN B CB    1 
ATOM   5216  C CG    . ASN B 1 239 ? 11.928  -27.937 -2.376  1.00 46.32 ? 239 ASN B CG    1 
ATOM   5217  O OD1   . ASN B 1 239 ? 12.654  -28.694 -1.684  1.00 48.62 ? 239 ASN B OD1   1 
ATOM   5218  N ND2   . ASN B 1 239 ? 11.039  -28.405 -3.285  1.00 49.93 ? 239 ASN B ND2   1 
ATOM   5219  N N     . LYS B 1 240 ? 13.638  -26.528 0.870   1.00 41.53 ? 240 LYS B N     1 
ATOM   5220  C CA    . LYS B 1 240 ? 14.879  -26.414 1.587   1.00 43.35 ? 240 LYS B CA    1 
ATOM   5221  C C     . LYS B 1 240 ? 16.046  -27.237 0.992   1.00 44.04 ? 240 LYS B C     1 
ATOM   5222  O O     . LYS B 1 240 ? 17.224  -27.023 1.374   1.00 45.22 ? 240 LYS B O     1 
ATOM   5223  C CB    . LYS B 1 240 ? 14.656  -26.675 3.088   1.00 43.44 ? 240 LYS B CB    1 
ATOM   5224  C CG    . LYS B 1 240 ? 13.875  -25.463 3.820   1.00 46.42 ? 240 LYS B CG    1 
ATOM   5225  C CD    . LYS B 1 240 ? 14.755  -24.903 4.907   1.00 49.55 ? 240 LYS B CD    1 
ATOM   5226  C CE    . LYS B 1 240 ? 14.106  -23.868 5.858   1.00 49.82 ? 240 LYS B CE    1 
ATOM   5227  N NZ    . LYS B 1 240 ? 15.152  -23.692 6.981   1.00 51.26 ? 240 LYS B NZ    1 
ATOM   5228  N N     . PHE B 1 241 ? 15.714  -28.177 0.104   1.00 42.67 ? 241 PHE B N     1 
ATOM   5229  C CA    . PHE B 1 241 ? 16.675  -28.698 -0.831  1.00 41.80 ? 241 PHE B CA    1 
ATOM   5230  C C     . PHE B 1 241 ? 16.761  -27.727 -2.060  1.00 39.88 ? 241 PHE B C     1 
ATOM   5231  O O     . PHE B 1 241 ? 15.801  -27.553 -2.805  1.00 39.00 ? 241 PHE B O     1 
ATOM   5232  C CB    . PHE B 1 241 ? 16.361  -30.183 -1.115  1.00 45.39 ? 241 PHE B CB    1 
ATOM   5233  C CG    . PHE B 1 241 ? 16.970  -31.168 -0.035  1.00 47.32 ? 241 PHE B CG    1 
ATOM   5234  C CD1   . PHE B 1 241 ? 16.456  -31.234 1.279   1.00 51.35 ? 241 PHE B CD1   1 
ATOM   5235  C CD2   . PHE B 1 241 ? 18.064  -31.973 -0.342  1.00 50.36 ? 241 PHE B CD2   1 
ATOM   5236  C CE1   . PHE B 1 241 ? 17.024  -32.084 2.268   1.00 48.92 ? 241 PHE B CE1   1 
ATOM   5237  C CE2   . PHE B 1 241 ? 18.619  -32.871 0.645   1.00 50.29 ? 241 PHE B CE2   1 
ATOM   5238  C CZ    . PHE B 1 241 ? 18.116  -32.895 1.934   1.00 47.73 ? 241 PHE B CZ    1 
ATOM   5239  N N     . ARG B 1 242 ? 17.884  -27.006 -2.176  1.00 36.59 ? 242 ARG B N     1 
ATOM   5240  C CA    . ARG B 1 242 ? 18.029  -25.866 -3.116  1.00 34.55 ? 242 ARG B CA    1 
ATOM   5241  C C     . ARG B 1 242 ? 18.330  -26.364 -4.510  1.00 33.07 ? 242 ARG B C     1 
ATOM   5242  O O     . ARG B 1 242 ? 19.270  -27.145 -4.719  1.00 33.66 ? 242 ARG B O     1 
ATOM   5243  C CB    . ARG B 1 242 ? 19.139  -24.844 -2.655  1.00 29.94 ? 242 ARG B CB    1 
ATOM   5244  C CG    . ARG B 1 242 ? 18.742  -23.892 -1.571  1.00 31.03 ? 242 ARG B CG    1 
ATOM   5245  C CD    . ARG B 1 242 ? 19.840  -22.790 -1.286  1.00 35.30 ? 242 ARG B CD    1 
ATOM   5246  N NE    . ARG B 1 242 ? 21.171  -23.405 -1.233  1.00 38.51 ? 242 ARG B NE    1 
ATOM   5247  C CZ    . ARG B 1 242 ? 21.599  -24.062 -0.149  1.00 42.57 ? 242 ARG B CZ    1 
ATOM   5248  N NH1   . ARG B 1 242 ? 20.821  -24.066 0.941   1.00 41.59 ? 242 ARG B NH1   1 
ATOM   5249  N NH2   . ARG B 1 242 ? 22.785  -24.694 -0.136  1.00 40.59 ? 242 ARG B NH2   1 
ATOM   5250  N N     . VAL B 1 243 ? 17.577  -25.910 -5.497  1.00 34.08 ? 243 VAL B N     1 
ATOM   5251  C CA    . VAL B 1 243 ? 17.881  -26.368 -6.883  1.00 32.74 ? 243 VAL B CA    1 
ATOM   5252  C C     . VAL B 1 243 ? 19.284  -25.847 -7.158  1.00 32.74 ? 243 VAL B C     1 
ATOM   5253  O O     . VAL B 1 243 ? 19.609  -24.720 -6.806  1.00 34.15 ? 243 VAL B O     1 
ATOM   5254  C CB    . VAL B 1 243 ? 16.822  -25.983 -7.906  1.00 35.58 ? 243 VAL B CB    1 
ATOM   5255  C CG1   . VAL B 1 243 ? 16.569  -24.426 -7.871  1.00 37.75 ? 243 VAL B CG1   1 
ATOM   5256  C CG2   . VAL B 1 243 ? 17.171  -26.467 -9.371  1.00 31.46 ? 243 VAL B CG2   1 
ATOM   5257  N N     . PRO B 1 244 ? 20.168  -26.745 -7.615  1.00 32.99 ? 244 PRO B N     1 
ATOM   5258  C CA    . PRO B 1 244 ? 21.480  -26.572 -8.203  1.00 31.32 ? 244 PRO B CA    1 
ATOM   5259  C C     . PRO B 1 244 ? 21.475  -25.415 -9.164  1.00 30.21 ? 244 PRO B C     1 
ATOM   5260  O O     . PRO B 1 244 ? 20.550  -25.382 -9.966  1.00 27.84 ? 244 PRO B O     1 
ATOM   5261  C CB    . PRO B 1 244 ? 21.594  -27.843 -9.103  1.00 32.63 ? 244 PRO B CB    1 
ATOM   5262  C CG    . PRO B 1 244 ? 20.165  -28.680 -8.796  1.00 33.30 ? 244 PRO B CG    1 
ATOM   5263  C CD    . PRO B 1 244 ? 19.827  -28.199 -7.481  1.00 32.30 ? 244 PRO B CD    1 
ATOM   5264  N N     . THR B 1 245 ? 22.559  -24.602 -9.199  1.00 28.30 ? 245 THR B N     1 
ATOM   5265  C CA    . THR B 1 245 ? 22.599  -23.376 -10.007 1.00 29.29 ? 245 THR B CA    1 
ATOM   5266  C C     . THR B 1 245 ? 23.164  -23.576 -11.436 1.00 31.61 ? 245 THR B C     1 
ATOM   5267  O O     . THR B 1 245 ? 23.871  -24.520 -11.654 1.00 31.58 ? 245 THR B O     1 
ATOM   5268  C CB    . THR B 1 245 ? 23.406  -22.288 -9.275  1.00 29.55 ? 245 THR B CB    1 
ATOM   5269  O OG1   . THR B 1 245 ? 24.733  -22.736 -9.033  1.00 25.92 ? 245 THR B OG1   1 
ATOM   5270  C CG2   . THR B 1 245 ? 22.676  -21.865 -7.861  1.00 30.89 ? 245 THR B CG2   1 
ATOM   5271  N N     . PHE B 1 246 ? 22.844  -22.720 -12.426 1.00 32.80 ? 246 PHE B N     1 
ATOM   5272  C CA    . PHE B 1 246 ? 23.689  -22.732 -13.669 1.00 32.98 ? 246 PHE B CA    1 
ATOM   5273  C C     . PHE B 1 246 ? 25.195  -22.668 -13.389 1.00 33.28 ? 246 PHE B C     1 
ATOM   5274  O O     . PHE B 1 246 ? 25.980  -23.435 -13.977 1.00 34.56 ? 246 PHE B O     1 
ATOM   5275  C CB    . PHE B 1 246 ? 23.329  -21.590 -14.608 1.00 32.86 ? 246 PHE B CB    1 
ATOM   5276  C CG    . PHE B 1 246 ? 21.985  -21.735 -15.209 1.00 30.56 ? 246 PHE B CG    1 
ATOM   5277  C CD1   . PHE B 1 246 ? 20.996  -20.781 -14.957 1.00 26.85 ? 246 PHE B CD1   1 
ATOM   5278  C CD2   . PHE B 1 246 ? 21.697  -22.840 -16.023 1.00 29.40 ? 246 PHE B CD2   1 
ATOM   5279  C CE1   . PHE B 1 246 ? 19.757  -20.885 -15.489 1.00 24.59 ? 246 PHE B CE1   1 
ATOM   5280  C CE2   . PHE B 1 246 ? 20.432  -22.981 -16.584 1.00 27.45 ? 246 PHE B CE2   1 
ATOM   5281  C CZ    . PHE B 1 246 ? 19.467  -22.017 -16.334 1.00 32.28 ? 246 PHE B CZ    1 
ATOM   5282  N N     . LEU B 1 247 ? 25.613  -21.805 -12.452 1.00 33.07 ? 247 LEU B N     1 
ATOM   5283  C CA    . LEU B 1 247 ? 27.034  -21.733 -12.125 1.00 32.99 ? 247 LEU B CA    1 
ATOM   5284  C C     . LEU B 1 247 ? 27.534  -23.155 -11.809 1.00 34.33 ? 247 LEU B C     1 
ATOM   5285  O O     . LEU B 1 247 ? 28.614  -23.525 -12.259 1.00 35.43 ? 247 LEU B O     1 
ATOM   5286  C CB    . LEU B 1 247 ? 27.290  -20.816 -10.935 1.00 31.73 ? 247 LEU B CB    1 
ATOM   5287  C CG    . LEU B 1 247 ? 28.736  -20.465 -10.552 1.00 30.59 ? 247 LEU B CG    1 
ATOM   5288  C CD1   . LEU B 1 247 ? 29.223  -19.349 -11.404 1.00 31.56 ? 247 LEU B CD1   1 
ATOM   5289  C CD2   . LEU B 1 247 ? 28.832  -20.119 -9.080  1.00 29.79 ? 247 LEU B CD2   1 
ATOM   5290  N N     . SER B 1 248 ? 26.709  -23.950 -11.107 1.00 33.84 ? 248 SER B N     1 
ATOM   5291  C CA    . SER B 1 248 ? 27.158  -25.237 -10.550 1.00 34.61 ? 248 SER B CA    1 
ATOM   5292  C C     . SER B 1 248 ? 27.393  -26.300 -11.648 1.00 35.47 ? 248 SER B C     1 
ATOM   5293  O O     . SER B 1 248 ? 28.151  -27.189 -11.421 1.00 35.73 ? 248 SER B O     1 
ATOM   5294  C CB    . SER B 1 248 ? 26.160  -25.770 -9.521  1.00 33.03 ? 248 SER B CB    1 
ATOM   5295  O OG    . SER B 1 248 ? 25.122  -26.459 -10.211 1.00 27.92 ? 248 SER B OG    1 
ATOM   5296  N N     . MET B 1 249 ? 26.773  -26.135 -12.829 1.00 36.88 ? 249 MET B N     1 
ATOM   5297  C CA    . MET B 1 249 ? 27.027  -26.933 -14.044 1.00 37.32 ? 249 MET B CA    1 
ATOM   5298  C C     . MET B 1 249 ? 27.879  -26.247 -15.138 1.00 37.17 ? 249 MET B C     1 
ATOM   5299  O O     . MET B 1 249 ? 27.954  -26.713 -16.292 1.00 37.21 ? 249 MET B O     1 
ATOM   5300  C CB    . MET B 1 249 ? 25.664  -27.403 -14.632 1.00 37.14 ? 249 MET B CB    1 
ATOM   5301  C CG    . MET B 1 249 ? 24.614  -26.287 -14.730 1.00 38.83 ? 249 MET B CG    1 
ATOM   5302  S SD    . MET B 1 249 ? 22.901  -26.909 -14.874 1.00 39.53 ? 249 MET B SD    1 
ATOM   5303  C CE    . MET B 1 249 ? 22.895  -26.683 -16.580 1.00 39.11 ? 249 MET B CE    1 
ATOM   5304  N N     . ASP B 1 250 ? 28.516  -25.135 -14.781 1.00 37.69 ? 250 ASP B N     1 
ATOM   5305  C CA    . ASP B 1 250 ? 29.283  -24.317 -15.732 1.00 37.78 ? 250 ASP B CA    1 
ATOM   5306  C C     . ASP B 1 250 ? 30.695  -24.820 -16.099 1.00 37.45 ? 250 ASP B C     1 
ATOM   5307  O O     . ASP B 1 250 ? 31.709  -24.184 -15.834 1.00 37.88 ? 250 ASP B O     1 
ATOM   5308  C CB    . ASP B 1 250 ? 29.306  -22.859 -15.311 1.00 36.36 ? 250 ASP B CB    1 
ATOM   5309  C CG    . ASP B 1 250 ? 29.679  -21.933 -16.456 1.00 37.57 ? 250 ASP B CG    1 
ATOM   5310  O OD1   . ASP B 1 250 ? 29.432  -22.332 -17.627 1.00 31.32 ? 250 ASP B OD1   1 
ATOM   5311  O OD2   . ASP B 1 250 ? 30.198  -20.802 -16.175 1.00 38.65 ? 250 ASP B OD2   1 
ATOM   5312  N N     . VAL B 1 251 ? 30.716  -25.954 -16.790 1.00 38.27 ? 251 VAL B N     1 
ATOM   5313  C CA    . VAL B 1 251 ? 31.934  -26.623 -17.295 1.00 36.95 ? 251 VAL B CA    1 
ATOM   5314  C C     . VAL B 1 251 ? 32.675  -25.777 -18.338 1.00 35.84 ? 251 VAL B C     1 
ATOM   5315  O O     . VAL B 1 251 ? 33.896  -25.840 -18.423 1.00 33.27 ? 251 VAL B O     1 
ATOM   5316  C CB    . VAL B 1 251 ? 31.544  -28.072 -17.776 1.00 37.41 ? 251 VAL B CB    1 
ATOM   5317  C CG1   . VAL B 1 251 ? 32.392  -28.580 -18.942 1.00 39.96 ? 251 VAL B CG1   1 
ATOM   5318  C CG2   . VAL B 1 251 ? 31.638  -29.040 -16.570 1.00 35.44 ? 251 VAL B CG2   1 
ATOM   5319  N N     . ASP B 1 252 ? 31.908  -24.953 -19.081 1.00 36.74 ? 252 ASP B N     1 
ATOM   5320  C CA    . ASP B 1 252 ? 32.430  -24.194 -20.233 1.00 37.77 ? 252 ASP B CA    1 
ATOM   5321  C C     . ASP B 1 252 ? 33.001  -22.835 -19.940 1.00 37.41 ? 252 ASP B C     1 
ATOM   5322  O O     . ASP B 1 252 ? 33.676  -22.297 -20.828 1.00 38.38 ? 252 ASP B O     1 
ATOM   5323  C CB    . ASP B 1 252 ? 31.376  -24.023 -21.331 1.00 37.67 ? 252 ASP B CB    1 
ATOM   5324  C CG    . ASP B 1 252 ? 30.892  -25.385 -21.905 1.00 41.20 ? 252 ASP B CG    1 
ATOM   5325  O OD1   . ASP B 1 252 ? 31.618  -26.385 -21.665 1.00 42.59 ? 252 ASP B OD1   1 
ATOM   5326  O OD2   . ASP B 1 252 ? 29.782  -25.444 -22.534 1.00 38.47 ? 252 ASP B OD2   1 
ATOM   5327  N N     . GLY B 1 253 ? 32.721  -22.299 -18.736 1.00 35.48 ? 253 GLY B N     1 
ATOM   5328  C CA    . GLY B 1 253 ? 32.876  -20.871 -18.394 1.00 33.67 ? 253 GLY B CA    1 
ATOM   5329  C C     . GLY B 1 253 ? 31.924  -19.920 -19.111 1.00 33.77 ? 253 GLY B C     1 
ATOM   5330  O O     . GLY B 1 253 ? 32.343  -18.829 -19.506 1.00 33.31 ? 253 GLY B O     1 
ATOM   5331  N N     . ARG B 1 254 ? 30.654  -20.314 -19.313 1.00 33.50 ? 254 ARG B N     1 
ATOM   5332  C CA    . ARG B 1 254 ? 29.701  -19.460 -20.057 1.00 32.94 ? 254 ARG B CA    1 
ATOM   5333  C C     . ARG B 1 254 ? 28.624  -18.764 -19.221 1.00 32.98 ? 254 ARG B C     1 
ATOM   5334  O O     . ARG B 1 254 ? 27.731  -18.138 -19.775 1.00 32.61 ? 254 ARG B O     1 
ATOM   5335  C CB    . ARG B 1 254 ? 29.018  -20.222 -21.231 1.00 32.51 ? 254 ARG B CB    1 
ATOM   5336  C CG    . ARG B 1 254 ? 27.935  -21.305 -20.852 1.00 31.35 ? 254 ARG B CG    1 
ATOM   5337  C CD    . ARG B 1 254 ? 27.379  -22.144 -22.067 1.00 32.33 ? 254 ARG B CD    1 
ATOM   5338  N NE    . ARG B 1 254 ? 28.453  -22.864 -22.808 1.00 27.59 ? 254 ARG B NE    1 
ATOM   5339  C CZ    . ARG B 1 254 ? 29.000  -22.389 -23.916 1.00 30.02 ? 254 ARG B CZ    1 
ATOM   5340  N NH1   . ARG B 1 254 ? 28.549  -21.249 -24.375 1.00 28.87 ? 254 ARG B NH1   1 
ATOM   5341  N NH2   . ARG B 1 254 ? 30.015  -23.011 -24.546 1.00 31.51 ? 254 ARG B NH2   1 
ATOM   5342  N N     . VAL B 1 255 ? 28.673  -18.919 -17.904 1.00 34.03 ? 255 VAL B N     1 
ATOM   5343  C CA    . VAL B 1 255 ? 27.581  -18.433 -17.006 1.00 33.72 ? 255 VAL B CA    1 
ATOM   5344  C C     . VAL B 1 255 ? 28.031  -17.181 -16.294 1.00 32.26 ? 255 VAL B C     1 
ATOM   5345  O O     . VAL B 1 255 ? 29.141  -17.131 -15.858 1.00 32.86 ? 255 VAL B O     1 
ATOM   5346  C CB    . VAL B 1 255 ? 27.168  -19.517 -15.969 1.00 34.39 ? 255 VAL B CB    1 
ATOM   5347  C CG1   . VAL B 1 255 ? 26.325  -18.904 -14.799 1.00 38.15 ? 255 VAL B CG1   1 
ATOM   5348  C CG2   . VAL B 1 255 ? 26.330  -20.624 -16.665 1.00 36.40 ? 255 VAL B CG2   1 
ATOM   5349  N N     . ILE B 1 256 ? 27.193  -16.132 -16.210 1.00 33.13 ? 256 ILE B N     1 
ATOM   5350  C CA    . ILE B 1 256 ? 27.510  -14.985 -15.330 1.00 31.35 ? 256 ILE B CA    1 
ATOM   5351  C C     . ILE B 1 256 ? 26.438  -14.900 -14.229 1.00 30.66 ? 256 ILE B C     1 
ATOM   5352  O O     . ILE B 1 256 ? 25.324  -14.731 -14.587 1.00 31.31 ? 256 ILE B O     1 
ATOM   5353  C CB    . ILE B 1 256 ? 27.564  -13.631 -16.132 1.00 32.18 ? 256 ILE B CB    1 
ATOM   5354  C CG1   . ILE B 1 256 ? 28.695  -13.647 -17.120 1.00 29.56 ? 256 ILE B CG1   1 
ATOM   5355  C CG2   . ILE B 1 256 ? 27.690  -12.373 -15.189 1.00 30.90 ? 256 ILE B CG2   1 
ATOM   5356  C CD1   . ILE B 1 256 ? 28.785  -12.364 -17.925 1.00 34.50 ? 256 ILE B CD1   1 
ATOM   5357  N N     . ARG B 1 257 ? 26.799  -14.976 -12.923 1.00 29.29 ? 257 ARG B N     1 
ATOM   5358  C CA    . ARG B 1 257 ? 25.871  -15.078 -11.790 1.00 28.60 ? 257 ARG B CA    1 
ATOM   5359  C C     . ARG B 1 257 ? 25.716  -13.828 -10.923 1.00 26.69 ? 257 ARG B C     1 
ATOM   5360  O O     . ARG B 1 257 ? 26.674  -13.423 -10.326 1.00 26.20 ? 257 ARG B O     1 
ATOM   5361  C CB    . ARG B 1 257 ? 26.313  -16.212 -10.821 1.00 28.53 ? 257 ARG B CB    1 
ATOM   5362  C CG    . ARG B 1 257 ? 25.388  -16.311 -9.657  1.00 27.61 ? 257 ARG B CG    1 
ATOM   5363  C CD    . ARG B 1 257 ? 25.607  -17.438 -8.646  1.00 30.03 ? 257 ARG B CD    1 
ATOM   5364  N NE    . ARG B 1 257 ? 24.277  -18.055 -8.570  1.00 36.98 ? 257 ARG B NE    1 
ATOM   5365  C CZ    . ARG B 1 257 ? 23.449  -17.951 -7.555  1.00 34.80 ? 257 ARG B CZ    1 
ATOM   5366  N NH1   . ARG B 1 257 ? 23.821  -17.301 -6.495  1.00 39.07 ? 257 ARG B NH1   1 
ATOM   5367  N NH2   . ARG B 1 257 ? 22.285  -18.544 -7.588  1.00 34.48 ? 257 ARG B NH2   1 
ATOM   5368  N N     . ALA B 1 258 ? 24.524  -13.239 -10.792 1.00 25.23 ? 258 ALA B N     1 
ATOM   5369  C CA    . ALA B 1 258 ? 24.385  -12.205 -9.742  1.00 24.23 ? 258 ALA B CA    1 
ATOM   5370  C C     . ALA B 1 258 ? 23.648  -12.733 -8.535  1.00 23.27 ? 258 ALA B C     1 
ATOM   5371  O O     . ALA B 1 258 ? 22.557  -13.327 -8.674  1.00 22.27 ? 258 ALA B O     1 
ATOM   5372  C CB    . ALA B 1 258 ? 23.751  -10.882 -10.231 1.00 21.34 ? 258 ALA B CB    1 
ATOM   5373  N N     . ASP B 1 259 ? 24.247  -12.447 -7.362  1.00 23.83 ? 259 ASP B N     1 
ATOM   5374  C CA    . ASP B 1 259 ? 23.718  -12.731 -6.024  1.00 23.35 ? 259 ASP B CA    1 
ATOM   5375  C C     . ASP B 1 259 ? 23.404  -11.491 -5.289  1.00 26.41 ? 259 ASP B C     1 
ATOM   5376  O O     . ASP B 1 259 ? 24.108  -10.455 -5.402  1.00 27.73 ? 259 ASP B O     1 
ATOM   5377  C CB    . ASP B 1 259 ? 24.793  -13.374 -5.239  1.00 22.36 ? 259 ASP B CB    1 
ATOM   5378  C CG    . ASP B 1 259 ? 24.831  -14.897 -5.475  1.00 24.02 ? 259 ASP B CG    1 
ATOM   5379  O OD1   . ASP B 1 259 ? 23.950  -15.631 -4.983  1.00 20.41 ? 259 ASP B OD1   1 
ATOM   5380  O OD2   . ASP B 1 259 ? 25.753  -15.346 -6.135  1.00 29.06 ? 259 ASP B OD2   1 
ATOM   5381  N N     . SER B 1 260 ? 22.325  -11.547 -4.519  1.00 27.94 ? 260 SER B N     1 
ATOM   5382  C CA    . SER B 1 260 ? 21.948  -10.374 -3.866  1.00 30.07 ? 260 SER B CA    1 
ATOM   5383  C C     . SER B 1 260 ? 21.829  -10.619 -2.372  1.00 30.41 ? 260 SER B C     1 
ATOM   5384  O O     . SER B 1 260 ? 21.258  -11.634 -1.933  1.00 30.27 ? 260 SER B O     1 
ATOM   5385  C CB    . SER B 1 260 ? 20.691  -9.772  -4.516  1.00 29.70 ? 260 SER B CB    1 
ATOM   5386  O OG    . SER B 1 260 ? 20.214  -8.692  -3.791  1.00 32.31 ? 260 SER B OG    1 
ATOM   5387  N N     . PHE B 1 261 ? 22.381  -9.678  -1.600  1.00 30.91 ? 261 PHE B N     1 
ATOM   5388  C CA    . PHE B 1 261 ? 22.090  -9.614  -0.142  1.00 32.59 ? 261 PHE B CA    1 
ATOM   5389  C C     . PHE B 1 261 ? 20.853  -8.815  0.143   1.00 32.64 ? 261 PHE B C     1 
ATOM   5390  O O     . PHE B 1 261 ? 20.612  -8.462  1.308   1.00 33.69 ? 261 PHE B O     1 
ATOM   5391  C CB    . PHE B 1 261 ? 23.250  -8.967  0.653   1.00 33.54 ? 261 PHE B CB    1 
ATOM   5392  C CG    . PHE B 1 261 ? 24.473  -9.865  0.810   1.00 33.96 ? 261 PHE B CG    1 
ATOM   5393  C CD1   . PHE B 1 261 ? 24.344  -11.171 1.223   1.00 31.38 ? 261 PHE B CD1   1 
ATOM   5394  C CD2   . PHE B 1 261 ? 25.749  -9.357  0.594   1.00 38.01 ? 261 PHE B CD2   1 
ATOM   5395  C CE1   . PHE B 1 261 ? 25.429  -11.976 1.411   1.00 33.38 ? 261 PHE B CE1   1 
ATOM   5396  C CE2   . PHE B 1 261 ? 26.870  -10.177 0.774   1.00 35.90 ? 261 PHE B CE2   1 
ATOM   5397  C CZ    . PHE B 1 261 ? 26.694  -11.464 1.203   1.00 35.98 ? 261 PHE B CZ    1 
ATOM   5398  N N     . SER B 1 262 ? 20.061  -8.481  -0.882  1.00 33.88 ? 262 SER B N     1 
ATOM   5399  C CA    . SER B 1 262 ? 19.069  -7.389  -0.624  1.00 34.24 ? 262 SER B CA    1 
ATOM   5400  C C     . SER B 1 262 ? 17.876  -7.768  0.249   1.00 34.15 ? 262 SER B C     1 
ATOM   5401  O O     . SER B 1 262 ? 17.298  -6.891  0.934   1.00 32.33 ? 262 SER B O     1 
ATOM   5402  C CB    . SER B 1 262 ? 18.646  -6.703  -1.857  1.00 33.57 ? 262 SER B CB    1 
ATOM   5403  O OG    . SER B 1 262 ? 19.775  -5.989  -2.256  1.00 35.88 ? 262 SER B OG    1 
HETATM 5404  N N1    . LLP B 1 263 ? 16.522  -8.234  -9.343  1.00 34.86 ? 263 LLP B N1    1 
HETATM 5405  C C2    . LLP B 1 263 ? 15.226  -8.570  -9.100  1.00 30.06 ? 263 LLP B C2    1 
HETATM 5406  C "C2'" . LLP B 1 263 ? 14.351  -9.081  -10.200 1.00 27.80 ? 263 LLP B "C2'" 1 
HETATM 5407  C C3    . LLP B 1 263 ? 14.718  -8.449  -7.834  1.00 28.50 ? 263 LLP B C3    1 
HETATM 5408  O O3    . LLP B 1 263 ? 13.495  -8.776  -7.777  1.00 33.95 ? 263 LLP B O3    1 
HETATM 5409  C C4    . LLP B 1 263 ? 15.532  -8.038  -6.735  1.00 28.71 ? 263 LLP B C4    1 
HETATM 5410  C "C4'" . LLP B 1 263 ? 14.978  -7.877  -5.292  1.00 32.49 ? 263 LLP B "C4'" 1 
HETATM 5411  C C5    . LLP B 1 263 ? 16.851  -7.738  -7.005  1.00 29.34 ? 263 LLP B C5    1 
HETATM 5412  C C6    . LLP B 1 263 ? 17.343  -7.804  -8.309  1.00 32.59 ? 263 LLP B C6    1 
HETATM 5413  C "C5'" . LLP B 1 263 ? 17.831  -7.192  -6.016  1.00 29.72 ? 263 LLP B "C5'" 1 
HETATM 5414  O OP4   . LLP B 1 263 ? 18.589  -6.067  -6.579  1.00 25.14 ? 263 LLP B OP4   1 
HETATM 5415  P P     . LLP B 1 263 ? 19.699  -5.354  -5.696  1.00 30.35 ? 263 LLP B P     1 
HETATM 5416  O OP1   . LLP B 1 263 ? 19.137  -4.677  -4.529  1.00 24.14 ? 263 LLP B OP1   1 
HETATM 5417  O OP2   . LLP B 1 263 ? 20.502  -6.557  -5.297  1.00 23.74 ? 263 LLP B OP2   1 
HETATM 5418  O OP3   . LLP B 1 263 ? 20.393  -4.305  -6.492  1.00 25.24 ? 263 LLP B OP3   1 
HETATM 5419  N N     . LLP B 1 263 ? 17.601  -9.099  0.268   1.00 33.32 ? 263 LLP B N     1 
HETATM 5420  C CA    . LLP B 1 263 ? 16.454  -9.612  0.980   1.00 32.04 ? 263 LLP B CA    1 
HETATM 5421  C CB    . LLP B 1 263 ? 15.447  -10.412 0.100   1.00 30.99 ? 263 LLP B CB    1 
HETATM 5422  C CG    . LLP B 1 263 ? 15.620  -10.396 -1.452  1.00 32.35 ? 263 LLP B CG    1 
HETATM 5423  C CD    . LLP B 1 263 ? 14.694  -9.493  -2.175  1.00 30.65 ? 263 LLP B CD    1 
HETATM 5424  C CE    . LLP B 1 263 ? 15.315  -8.204  -2.807  1.00 33.51 ? 263 LLP B CE    1 
HETATM 5425  N NZ    . LLP B 1 263 ? 15.808  -8.329  -4.305  1.00 33.49 ? 263 LLP B NZ    1 
HETATM 5426  C C     . LLP B 1 263 ? 16.860  -10.394 2.213   1.00 32.47 ? 263 LLP B C     1 
HETATM 5427  O O     . LLP B 1 263 ? 15.981  -10.755 2.954   1.00 33.77 ? 263 LLP B O     1 
ATOM   5428  N N     . ILE B 1 264 ? 18.155  -10.673 2.457   1.00 32.40 ? 264 ILE B N     1 
ATOM   5429  C CA    . ILE B 1 264 ? 18.538  -11.477 3.659   1.00 33.06 ? 264 ILE B CA    1 
ATOM   5430  C C     . ILE B 1 264 ? 19.339  -10.616 4.648   1.00 32.70 ? 264 ILE B C     1 
ATOM   5431  O O     . ILE B 1 264 ? 19.140  -10.678 5.861   1.00 31.87 ? 264 ILE B O     1 
ATOM   5432  C CB    . ILE B 1 264 ? 19.324  -12.794 3.252   1.00 33.85 ? 264 ILE B CB    1 
ATOM   5433  C CG1   . ILE B 1 264 ? 20.356  -12.460 2.176   1.00 35.47 ? 264 ILE B CG1   1 
ATOM   5434  C CG2   . ILE B 1 264 ? 18.303  -13.824 2.670   1.00 32.89 ? 264 ILE B CG2   1 
ATOM   5435  C CD1   . ILE B 1 264 ? 21.349  -13.594 1.720   1.00 33.88 ? 264 ILE B CD1   1 
ATOM   5436  N N     . ILE B 1 265 ? 20.175  -9.730  4.095   1.00 32.14 ? 265 ILE B N     1 
ATOM   5437  C CA    . ILE B 1 265 ? 21.046  -8.946  4.919   1.00 31.15 ? 265 ILE B CA    1 
ATOM   5438  C C     . ILE B 1 265 ? 20.722  -7.441  4.851   1.00 30.34 ? 265 ILE B C     1 
ATOM   5439  O O     . ILE B 1 265 ? 20.547  -6.812  5.901   1.00 30.47 ? 265 ILE B O     1 
ATOM   5440  C CB    . ILE B 1 265 ? 22.526  -9.350  4.698   1.00 31.46 ? 265 ILE B CB    1 
ATOM   5441  C CG1   . ILE B 1 265 ? 22.739  -10.740 5.320   1.00 30.80 ? 265 ILE B CG1   1 
ATOM   5442  C CG2   . ILE B 1 265 ? 23.534  -8.308  5.323   1.00 30.36 ? 265 ILE B CG2   1 
ATOM   5443  C CD1   . ILE B 1 265 ? 23.900  -11.297 4.915   1.00 30.08 ? 265 ILE B CD1   1 
ATOM   5444  N N     . SER B 1 266 ? 20.628  -6.875  3.648   1.00 29.48 ? 266 SER B N     1 
ATOM   5445  C CA    . SER B 1 266 ? 20.235  -5.463  3.501   1.00 26.32 ? 266 SER B CA    1 
ATOM   5446  C C     . SER B 1 266 ? 20.096  -4.902  2.087   1.00 26.89 ? 266 SER B C     1 
ATOM   5447  O O     . SER B 1 266 ? 21.035  -4.896  1.344   1.00 25.66 ? 266 SER B O     1 
ATOM   5448  C CB    . SER B 1 266 ? 21.192  -4.574  4.263   1.00 25.13 ? 266 SER B CB    1 
ATOM   5449  O OG    . SER B 1 266 ? 20.731  -3.232  4.175   1.00 23.80 ? 266 SER B OG    1 
ATOM   5450  N N     . SER B 1 267 ? 18.946  -4.287  1.802   1.00 28.21 ? 267 SER B N     1 
ATOM   5451  C CA    . SER B 1 267 ? 18.690  -3.603  0.528   1.00 28.70 ? 267 SER B CA    1 
ATOM   5452  C C     . SER B 1 267 ? 19.327  -2.153  0.417   1.00 28.38 ? 267 SER B C     1 
ATOM   5453  O O     . SER B 1 267 ? 20.083  -1.787  -0.550  1.00 26.27 ? 267 SER B O     1 
ATOM   5454  C CB    . SER B 1 267 ? 17.176  -3.637  0.295   1.00 28.22 ? 267 SER B CB    1 
ATOM   5455  O OG    . SER B 1 267 ? 16.483  -3.145  1.443   1.00 28.36 ? 267 SER B OG    1 
ATOM   5456  N N     . GLY B 1 268 ? 19.102  -1.396  1.474   1.00 29.28 ? 268 GLY B N     1 
ATOM   5457  C CA    . GLY B 1 268 ? 19.705  -0.045  1.651   1.00 28.67 ? 268 GLY B CA    1 
ATOM   5458  C C     . GLY B 1 268 ? 21.209  0.075   1.737   1.00 28.36 ? 268 GLY B C     1 
ATOM   5459  O O     . GLY B 1 268 ? 21.756  1.141   1.400   1.00 30.47 ? 268 GLY B O     1 
ATOM   5460  N N     . LEU B 1 269 ? 21.908  -1.008  2.091   1.00 27.49 ? 269 LEU B N     1 
ATOM   5461  C CA    . LEU B 1 269 ? 23.364  -1.004  2.128   1.00 26.62 ? 269 LEU B CA    1 
ATOM   5462  C C     . LEU B 1 269 ? 24.052  -1.011  0.753   1.00 27.50 ? 269 LEU B C     1 
ATOM   5463  O O     . LEU B 1 269 ? 25.202  -0.678  0.669   1.00 29.57 ? 269 LEU B O     1 
ATOM   5464  C CB    . LEU B 1 269 ? 23.986  -2.120  3.031   1.00 26.77 ? 269 LEU B CB    1 
ATOM   5465  C CG    . LEU B 1 269 ? 23.888  -2.000  4.576   1.00 29.80 ? 269 LEU B CG    1 
ATOM   5466  C CD1   . LEU B 1 269 ? 24.833  -3.053  5.341   1.00 21.99 ? 269 LEU B CD1   1 
ATOM   5467  C CD2   . LEU B 1 269 ? 24.152  -0.557  5.035   1.00 27.76 ? 269 LEU B CD2   1 
ATOM   5468  N N     . ARG B 1 270 ? 23.384  -1.425  -0.297  1.00 27.93 ? 270 ARG B N     1 
ATOM   5469  C CA    . ARG B 1 270 ? 23.975  -1.447  -1.674  1.00 27.45 ? 270 ARG B CA    1 
ATOM   5470  C C     . ARG B 1 270 ? 25.213  -2.348  -1.731  1.00 28.00 ? 270 ARG B C     1 
ATOM   5471  O O     . ARG B 1 270 ? 26.273  -1.898  -2.151  1.00 27.48 ? 270 ARG B O     1 
ATOM   5472  C CB    . ARG B 1 270 ? 24.182  -0.037  -2.261  1.00 28.02 ? 270 ARG B CB    1 
ATOM   5473  C CG    . ARG B 1 270 ? 22.928  1.015   -2.063  1.00 25.98 ? 270 ARG B CG    1 
ATOM   5474  C CD    . ARG B 1 270 ? 21.538  0.335   -2.326  1.00 29.66 ? 270 ARG B CD    1 
ATOM   5475  N NE    . ARG B 1 270 ? 21.505  -0.152  -3.690  1.00 31.37 ? 270 ARG B NE    1 
ATOM   5476  C CZ    . ARG B 1 270 ? 21.179  -1.393  -4.091  1.00 31.18 ? 270 ARG B CZ    1 
ATOM   5477  N NH1   . ARG B 1 270 ? 20.750  -2.293  -3.258  1.00 20.49 ? 270 ARG B NH1   1 
ATOM   5478  N NH2   . ARG B 1 270 ? 21.235  -1.700  -5.379  1.00 25.69 ? 270 ARG B NH2   1 
ATOM   5479  N N     . ILE B 1 271 ? 25.060  -3.625  -1.320  1.00 27.87 ? 271 ILE B N     1 
ATOM   5480  C CA    . ILE B 1 271 ? 26.177  -4.621  -1.377  1.00 29.00 ? 271 ILE B CA    1 
ATOM   5481  C C     . ILE B 1 271 ? 25.567  -5.948  -1.802  1.00 30.08 ? 271 ILE B C     1 
ATOM   5482  O O     . ILE B 1 271 ? 24.591  -6.433  -1.177  1.00 29.73 ? 271 ILE B O     1 
ATOM   5483  C CB    . ILE B 1 271 ? 26.904  -4.792  -0.042  1.00 29.80 ? 271 ILE B CB    1 
ATOM   5484  C CG1   . ILE B 1 271 ? 27.326  -3.435  0.602   1.00 26.45 ? 271 ILE B CG1   1 
ATOM   5485  C CG2   . ILE B 1 271 ? 27.982  -5.862  -0.123  1.00 31.71 ? 271 ILE B CG2   1 
ATOM   5486  C CD1   . ILE B 1 271 ? 28.613  -2.836  0.148   1.00 23.95 ? 271 ILE B CD1   1 
ATOM   5487  N N     . GLY B 1 272 ? 26.124  -6.468  -2.921  1.00 31.06 ? 272 GLY B N     1 
ATOM   5488  C CA    . GLY B 1 272 ? 25.663  -7.611  -3.757  1.00 29.58 ? 272 GLY B CA    1 
ATOM   5489  C C     . GLY B 1 272 ? 26.966  -8.050  -4.381  1.00 30.18 ? 272 GLY B C     1 
ATOM   5490  O O     . GLY B 1 272 ? 28.011  -7.474  -4.060  1.00 28.94 ? 272 GLY B O     1 
ATOM   5491  N N     . PHE B 1 273 ? 26.925  -9.097  -5.211  1.00 30.07 ? 273 PHE B N     1 
ATOM   5492  C CA    . PHE B 1 273 ? 28.124  -9.681  -5.804  1.00 30.53 ? 273 PHE B CA    1 
ATOM   5493  C C     . PHE B 1 273 ? 27.928  -10.312 -7.196  1.00 30.29 ? 273 PHE B C     1 
ATOM   5494  O O     . PHE B 1 273 ? 26.859  -10.686 -7.592  1.00 30.81 ? 273 PHE B O     1 
ATOM   5495  C CB    . PHE B 1 273 ? 28.961  -10.549 -4.841  1.00 28.36 ? 273 PHE B CB    1 
ATOM   5496  C CG    . PHE B 1 273 ? 28.179  -11.634 -4.097  1.00 30.13 ? 273 PHE B CG    1 
ATOM   5497  C CD1   . PHE B 1 273 ? 27.447  -11.330 -2.911  1.00 26.29 ? 273 PHE B CD1   1 
ATOM   5498  C CD2   . PHE B 1 273 ? 28.236  -12.922 -4.508  1.00 28.07 ? 273 PHE B CD2   1 
ATOM   5499  C CE1   . PHE B 1 273 ? 26.774  -12.307 -2.188  1.00 28.42 ? 273 PHE B CE1   1 
ATOM   5500  C CE2   . PHE B 1 273 ? 27.586  -13.940 -3.759  1.00 31.19 ? 273 PHE B CE2   1 
ATOM   5501  C CZ    . PHE B 1 273 ? 26.849  -13.619 -2.606  1.00 31.07 ? 273 PHE B CZ    1 
ATOM   5502  N N     . LEU B 1 274 ? 28.984  -10.369 -7.961  1.00 30.60 ? 274 LEU B N     1 
ATOM   5503  C CA    . LEU B 1 274 ? 28.861  -10.844 -9.348  1.00 28.82 ? 274 LEU B CA    1 
ATOM   5504  C C     . LEU B 1 274 ? 29.960  -11.862 -9.564  1.00 28.44 ? 274 LEU B C     1 
ATOM   5505  O O     . LEU B 1 274 ? 31.177  -11.603 -9.281  1.00 26.77 ? 274 LEU B O     1 
ATOM   5506  C CB    . LEU B 1 274 ? 28.911  -9.624  -10.262 1.00 29.38 ? 274 LEU B CB    1 
ATOM   5507  C CG    . LEU B 1 274 ? 28.934  -9.827  -11.770 1.00 30.81 ? 274 LEU B CG    1 
ATOM   5508  C CD1   . LEU B 1 274 ? 27.504  -9.998  -12.280 1.00 30.49 ? 274 LEU B CD1   1 
ATOM   5509  C CD2   . LEU B 1 274 ? 29.686  -8.642  -12.319 1.00 31.45 ? 274 LEU B CD2   1 
ATOM   5510  N N     . THR B 1 275 ? 29.532  -13.075 -9.915  1.00 29.12 ? 275 THR B N     1 
ATOM   5511  C CA    . THR B 1 275 ? 30.454  -14.199 -10.089 1.00 30.87 ? 275 THR B CA    1 
ATOM   5512  C C     . THR B 1 275 ? 30.512  -14.623 -11.593 1.00 31.73 ? 275 THR B C     1 
ATOM   5513  O O     . THR B 1 275 ? 29.489  -14.703 -12.251 1.00 33.42 ? 275 THR B O     1 
ATOM   5514  C CB    . THR B 1 275 ? 30.060  -15.490 -9.166  1.00 31.75 ? 275 THR B CB    1 
ATOM   5515  O OG1   . THR B 1 275 ? 29.853  -15.088 -7.793  1.00 35.33 ? 275 THR B OG1   1 
ATOM   5516  C CG2   . THR B 1 275 ? 31.178  -16.602 -9.175  1.00 30.19 ? 275 THR B CG2   1 
ATOM   5517  N N     . GLY B 1 276 ? 31.689  -14.948 -12.116 1.00 31.39 ? 276 GLY B N     1 
ATOM   5518  C CA    . GLY B 1 276 ? 31.804  -15.339 -13.514 1.00 31.52 ? 276 GLY B CA    1 
ATOM   5519  C C     . GLY B 1 276 ? 33.230  -15.401 -14.014 1.00 32.34 ? 276 GLY B C     1 
ATOM   5520  O O     . GLY B 1 276 ? 34.171  -15.100 -13.269 1.00 29.24 ? 276 GLY B O     1 
ATOM   5521  N N     . PRO B 1 277 ? 33.385  -15.648 -15.337 1.00 33.29 ? 277 PRO B N     1 
ATOM   5522  C CA    . PRO B 1 277 ? 34.697  -15.850 -15.897 1.00 32.63 ? 277 PRO B CA    1 
ATOM   5523  C C     . PRO B 1 277 ? 35.552  -14.597 -15.779 1.00 33.16 ? 277 PRO B C     1 
ATOM   5524  O O     . PRO B 1 277 ? 35.125  -13.500 -16.160 1.00 34.20 ? 277 PRO B O     1 
ATOM   5525  C CB    . PRO B 1 277 ? 34.415  -16.234 -17.321 1.00 32.76 ? 277 PRO B CB    1 
ATOM   5526  C CG    . PRO B 1 277 ? 32.957  -16.704 -17.307 1.00 34.59 ? 277 PRO B CG    1 
ATOM   5527  C CD    . PRO B 1 277 ? 32.336  -15.715 -16.366 1.00 33.27 ? 277 PRO B CD    1 
ATOM   5528  N N     . LYS B 1 278 ? 36.746  -14.777 -15.205 1.00 32.40 ? 278 LYS B N     1 
ATOM   5529  C CA    . LYS B 1 278 ? 37.644  -13.691 -14.886 1.00 33.12 ? 278 LYS B CA    1 
ATOM   5530  C C     . LYS B 1 278 ? 37.838  -12.611 -15.946 1.00 33.01 ? 278 LYS B C     1 
ATOM   5531  O O     . LYS B 1 278 ? 37.908  -11.452 -15.594 1.00 34.42 ? 278 LYS B O     1 
ATOM   5532  C CB    . LYS B 1 278 ? 39.013  -14.267 -14.474 1.00 34.38 ? 278 LYS B CB    1 
ATOM   5533  C CG    . LYS B 1 278 ? 40.169  -13.290 -14.517 1.00 37.16 ? 278 LYS B CG    1 
ATOM   5534  C CD    . LYS B 1 278 ? 40.671  -12.992 -13.132 1.00 43.43 ? 278 LYS B CD    1 
ATOM   5535  C CE    . LYS B 1 278 ? 41.773  -13.959 -12.693 1.00 48.34 ? 278 LYS B CE    1 
ATOM   5536  N NZ    . LYS B 1 278 ? 41.140  -15.252 -12.258 1.00 48.53 ? 278 LYS B NZ    1 
ATOM   5537  N N     . PRO B 1 279 ? 37.918  -12.982 -17.250 1.00 33.10 ? 279 PRO B N     1 
ATOM   5538  C CA    . PRO B 1 279 ? 38.124  -11.945 -18.262 1.00 30.37 ? 279 PRO B CA    1 
ATOM   5539  C C     . PRO B 1 279 ? 36.924  -11.043 -18.418 1.00 31.54 ? 279 PRO B C     1 
ATOM   5540  O O     . PRO B 1 279 ? 37.031  -9.856  -18.803 1.00 33.94 ? 279 PRO B O     1 
ATOM   5541  C CB    . PRO B 1 279 ? 38.399  -12.793 -19.572 1.00 31.07 ? 279 PRO B CB    1 
ATOM   5542  C CG    . PRO B 1 279 ? 38.901  -14.241 -18.971 1.00 33.27 ? 279 PRO B CG    1 
ATOM   5543  C CD    . PRO B 1 279 ? 37.879  -14.360 -17.862 1.00 30.47 ? 279 PRO B CD    1 
ATOM   5544  N N     . LEU B 1 280 ? 35.759  -11.581 -18.148 1.00 30.45 ? 280 LEU B N     1 
ATOM   5545  C CA    . LEU B 1 280 ? 34.546  -10.862 -18.343 1.00 30.71 ? 280 LEU B CA    1 
ATOM   5546  C C     . LEU B 1 280 ? 34.200  -10.041 -17.068 1.00 29.92 ? 280 LEU B C     1 
ATOM   5547  O O     . LEU B 1 280 ? 33.778  -8.888  -17.158 1.00 31.64 ? 280 LEU B O     1 
ATOM   5548  C CB    . LEU B 1 280 ? 33.454  -11.913 -18.614 1.00 30.43 ? 280 LEU B CB    1 
ATOM   5549  C CG    . LEU B 1 280 ? 32.761  -11.990 -19.969 1.00 32.22 ? 280 LEU B CG    1 
ATOM   5550  C CD1   . LEU B 1 280 ? 33.599  -11.643 -21.227 1.00 25.59 ? 280 LEU B CD1   1 
ATOM   5551  C CD2   . LEU B 1 280 ? 31.977  -13.333 -20.055 1.00 23.88 ? 280 LEU B CD2   1 
ATOM   5552  N N     . ILE B 1 281 ? 34.383  -10.622 -15.894 1.00 28.51 ? 281 ILE B N     1 
ATOM   5553  C CA    . ILE B 1 281 ? 34.365  -9.841  -14.661 1.00 29.32 ? 281 ILE B CA    1 
ATOM   5554  C C     . ILE B 1 281 ? 35.420  -8.724  -14.702 1.00 29.54 ? 281 ILE B C     1 
ATOM   5555  O O     . ILE B 1 281 ? 35.201  -7.652  -14.185 1.00 28.20 ? 281 ILE B O     1 
ATOM   5556  C CB    . ILE B 1 281 ? 34.734  -10.695 -13.395 1.00 29.33 ? 281 ILE B CB    1 
ATOM   5557  C CG1   . ILE B 1 281 ? 33.751  -11.839 -13.153 1.00 27.33 ? 281 ILE B CG1   1 
ATOM   5558  C CG2   . ILE B 1 281 ? 35.021  -9.791  -12.166 1.00 28.52 ? 281 ILE B CG2   1 
ATOM   5559  C CD1   . ILE B 1 281 ? 32.309  -11.484 -12.972 1.00 28.35 ? 281 ILE B CD1   1 
ATOM   5560  N N     . GLU B 1 282 ? 36.583  -9.001  -15.247 1.00 31.39 ? 282 GLU B N     1 
ATOM   5561  C CA    . GLU B 1 282 ? 37.605  -7.938  -15.430 1.00 34.51 ? 282 GLU B CA    1 
ATOM   5562  C C     . GLU B 1 282 ? 36.986  -6.667  -16.058 1.00 34.38 ? 282 GLU B C     1 
ATOM   5563  O O     . GLU B 1 282 ? 37.368  -5.536  -15.697 1.00 34.85 ? 282 GLU B O     1 
ATOM   5564  C CB    . GLU B 1 282 ? 38.756  -8.473  -16.337 1.00 35.18 ? 282 GLU B CB    1 
ATOM   5565  C CG    . GLU B 1 282 ? 39.920  -7.501  -16.620 1.00 36.12 ? 282 GLU B CG    1 
ATOM   5566  C CD    . GLU B 1 282 ? 40.857  -7.971  -17.745 1.00 40.34 ? 282 GLU B CD    1 
ATOM   5567  O OE1   . GLU B 1 282 ? 41.349  -9.173  -17.706 1.00 44.51 ? 282 GLU B OE1   1 
ATOM   5568  O OE2   . GLU B 1 282 ? 41.114  -7.117  -18.657 1.00 44.39 ? 282 GLU B OE2   1 
ATOM   5569  N N     . ARG B 1 283 ? 36.027  -6.828  -16.977 1.00 33.77 ? 283 ARG B N     1 
ATOM   5570  C CA    . ARG B 1 283 ? 35.620  -5.661  -17.775 1.00 33.99 ? 283 ARG B CA    1 
ATOM   5571  C C     . ARG B 1 283 ? 34.682  -4.824  -16.927 1.00 32.32 ? 283 ARG B C     1 
ATOM   5572  O O     . ARG B 1 283 ? 34.661  -3.572  -17.060 1.00 31.68 ? 283 ARG B O     1 
ATOM   5573  C CB    . ARG B 1 283 ? 34.930  -5.985  -19.129 1.00 32.09 ? 283 ARG B CB    1 
ATOM   5574  C CG    . ARG B 1 283 ? 35.674  -6.858  -20.123 1.00 32.36 ? 283 ARG B CG    1 
ATOM   5575  C CD    . ARG B 1 283 ? 37.186  -6.657  -20.206 1.00 33.99 ? 283 ARG B CD    1 
ATOM   5576  N NE    . ARG B 1 283 ? 37.540  -5.397  -20.775 1.00 29.32 ? 283 ARG B NE    1 
ATOM   5577  C CZ    . ARG B 1 283 ? 38.756  -4.898  -20.778 1.00 29.76 ? 283 ARG B CZ    1 
ATOM   5578  N NH1   . ARG B 1 283 ? 39.783  -5.575  -20.251 1.00 30.12 ? 283 ARG B NH1   1 
ATOM   5579  N NH2   . ARG B 1 283 ? 38.948  -3.713  -21.352 1.00 32.54 ? 283 ARG B NH2   1 
ATOM   5580  N N     . VAL B 1 284 ? 33.896  -5.529  -16.105 1.00 32.11 ? 284 VAL B N     1 
ATOM   5581  C CA    . VAL B 1 284 ? 32.928  -4.849  -15.187 1.00 30.37 ? 284 VAL B CA    1 
ATOM   5582  C C     . VAL B 1 284 ? 33.594  -4.144  -14.042 1.00 30.66 ? 284 VAL B C     1 
ATOM   5583  O O     . VAL B 1 284 ? 33.118  -3.073  -13.690 1.00 30.52 ? 284 VAL B O     1 
ATOM   5584  C CB    . VAL B 1 284 ? 31.562  -5.564  -14.781 1.00 30.84 ? 284 VAL B CB    1 
ATOM   5585  C CG1   . VAL B 1 284 ? 31.163  -6.765  -15.652 1.00 26.93 ? 284 VAL B CG1   1 
ATOM   5586  C CG2   . VAL B 1 284 ? 31.373  -5.755  -13.175 1.00 31.06 ? 284 VAL B CG2   1 
ATOM   5587  N N     . ILE B 1 285 ? 34.672  -4.739  -13.510 1.00 28.22 ? 285 ILE B N     1 
ATOM   5588  C CA    . ILE B 1 285 ? 35.571  -4.075  -12.559 1.00 28.48 ? 285 ILE B CA    1 
ATOM   5589  C C     . ILE B 1 285 ? 36.235  -2.741  -13.087 1.00 29.04 ? 285 ILE B C     1 
ATOM   5590  O O     . ILE B 1 285 ? 36.391  -1.733  -12.327 1.00 30.46 ? 285 ILE B O     1 
ATOM   5591  C CB    . ILE B 1 285 ? 36.708  -5.034  -12.093 1.00 27.36 ? 285 ILE B CB    1 
ATOM   5592  C CG1   . ILE B 1 285 ? 36.255  -6.028  -10.969 1.00 30.63 ? 285 ILE B CG1   1 
ATOM   5593  C CG2   . ILE B 1 285 ? 37.921  -4.223  -11.593 1.00 24.88 ? 285 ILE B CG2   1 
ATOM   5594  C CD1   . ILE B 1 285 ? 37.367  -7.151  -10.668 1.00 25.84 ? 285 ILE B CD1   1 
ATOM   5595  N N     . LEU B 1 286 ? 36.695  -2.761  -14.347 1.00 27.55 ? 286 LEU B N     1 
ATOM   5596  C CA    . LEU B 1 286 ? 37.280  -1.586  -15.009 1.00 26.29 ? 286 LEU B CA    1 
ATOM   5597  C C     . LEU B 1 286 ? 36.276  -0.504  -15.234 1.00 25.77 ? 286 LEU B C     1 
ATOM   5598  O O     . LEU B 1 286 ? 36.648  0.665   -15.259 1.00 27.49 ? 286 LEU B O     1 
ATOM   5599  C CB    . LEU B 1 286 ? 37.913  -1.938  -16.378 1.00 27.14 ? 286 LEU B CB    1 
ATOM   5600  C CG    . LEU B 1 286 ? 39.191  -2.762  -16.403 1.00 26.59 ? 286 LEU B CG    1 
ATOM   5601  C CD1   . LEU B 1 286 ? 39.831  -2.923  -17.840 1.00 29.56 ? 286 LEU B CD1   1 
ATOM   5602  C CD2   . LEU B 1 286 ? 40.078  -2.149  -15.395 1.00 30.89 ? 286 LEU B CD2   1 
ATOM   5603  N N     . HIS B 1 287 ? 35.017  -0.879  -15.434 1.00 25.66 ? 287 HIS B N     1 
ATOM   5604  C CA    . HIS B 1 287 ? 33.899  0.075   -15.667 1.00 24.92 ? 287 HIS B CA    1 
ATOM   5605  C C     . HIS B 1 287 ? 33.515  0.557   -14.292 1.00 25.37 ? 287 HIS B C     1 
ATOM   5606  O O     . HIS B 1 287 ? 33.313  1.796   -14.117 1.00 25.64 ? 287 HIS B O     1 
ATOM   5607  C CB    . HIS B 1 287 ? 32.680  -0.608  -16.311 1.00 23.73 ? 287 HIS B CB    1 
ATOM   5608  C CG    . HIS B 1 287 ? 31.610  0.339   -16.741 1.00 25.63 ? 287 HIS B CG    1 
ATOM   5609  N ND1   . HIS B 1 287 ? 30.545  -0.052  -17.513 1.00 21.47 ? 287 HIS B ND1   1 
ATOM   5610  C CD2   . HIS B 1 287 ? 31.441  1.673   -16.516 1.00 26.44 ? 287 HIS B CD2   1 
ATOM   5611  C CE1   . HIS B 1 287 ? 29.742  0.981   -17.707 1.00 22.40 ? 287 HIS B CE1   1 
ATOM   5612  N NE2   . HIS B 1 287 ? 30.243  2.028   -17.079 1.00 23.55 ? 287 HIS B NE2   1 
ATOM   5613  N N     . ILE B 1 288 ? 33.452  -0.342  -13.266 1.00 24.57 ? 288 ILE B N     1 
ATOM   5614  C CA    . ILE B 1 288 ? 33.324  0.285   -11.920 1.00 26.98 ? 288 ILE B CA    1 
ATOM   5615  C C     . ILE B 1 288 ? 34.462  1.290   -11.559 1.00 27.55 ? 288 ILE B C     1 
ATOM   5616  O O     . ILE B 1 288 ? 34.160  2.237   -10.880 1.00 26.22 ? 288 ILE B O     1 
ATOM   5617  C CB    . ILE B 1 288 ? 32.856  -0.565  -10.671 1.00 27.26 ? 288 ILE B CB    1 
ATOM   5618  C CG1   . ILE B 1 288 ? 33.997  -0.699  -9.709  1.00 23.89 ? 288 ILE B CG1   1 
ATOM   5619  C CG2   . ILE B 1 288 ? 32.055  -1.938  -10.963 1.00 24.85 ? 288 ILE B CG2   1 
ATOM   5620  C CD1   . ILE B 1 288 ? 33.448  -0.611  -8.424  1.00 29.06 ? 288 ILE B CD1   1 
ATOM   5621  N N     . GLN B 1 289 ? 35.730  1.106   -12.017 1.00 28.47 ? 289 GLN B N     1 
ATOM   5622  C CA    . GLN B 1 289 ? 36.877  2.024   -11.622 1.00 28.67 ? 289 GLN B CA    1 
ATOM   5623  C C     . GLN B 1 289 ? 36.786  3.445   -12.118 1.00 28.25 ? 289 GLN B C     1 
ATOM   5624  O O     . GLN B 1 289 ? 37.605  4.260   -11.773 1.00 29.03 ? 289 GLN B O     1 
ATOM   5625  C CB    . GLN B 1 289 ? 38.268  1.501   -12.053 1.00 27.84 ? 289 GLN B CB    1 
ATOM   5626  C CG    . GLN B 1 289 ? 38.781  0.347   -11.236 1.00 32.11 ? 289 GLN B CG    1 
ATOM   5627  C CD    . GLN B 1 289 ? 40.058  -0.284  -11.759 1.00 32.74 ? 289 GLN B CD    1 
ATOM   5628  O OE1   . GLN B 1 289 ? 40.391  -0.128  -12.917 1.00 39.63 ? 289 GLN B OE1   1 
ATOM   5629  N NE2   . GLN B 1 289 ? 40.761  -1.060  -10.898 1.00 38.06 ? 289 GLN B NE2   1 
ATOM   5630  N N     . VAL B 1 290 ? 35.821  3.739   -12.974 1.00 28.54 ? 290 VAL B N     1 
ATOM   5631  C CA    . VAL B 1 290 ? 35.611  5.095   -13.496 1.00 27.48 ? 290 VAL B CA    1 
ATOM   5632  C C     . VAL B 1 290 ? 34.226  5.595   -13.088 1.00 28.86 ? 290 VAL B C     1 
ATOM   5633  O O     . VAL B 1 290 ? 33.843  6.752   -13.368 1.00 29.32 ? 290 VAL B O     1 
ATOM   5634  C CB    . VAL B 1 290 ? 35.893  5.130   -15.033 1.00 27.61 ? 290 VAL B CB    1 
ATOM   5635  C CG1   . VAL B 1 290 ? 37.363  4.701   -15.276 1.00 25.38 ? 290 VAL B CG1   1 
ATOM   5636  C CG2   . VAL B 1 290 ? 35.032  4.202   -15.780 1.00 18.96 ? 290 VAL B CG2   1 
ATOM   5637  N N     . SER B 1 291 ? 33.558  4.731   -12.313 1.00 27.57 ? 291 SER B N     1 
ATOM   5638  C CA    . SER B 1 291 ? 32.175  4.810   -11.878 1.00 29.65 ? 291 SER B CA    1 
ATOM   5639  C C     . SER B 1 291 ? 32.010  5.071   -10.402 1.00 29.54 ? 291 SER B C     1 
ATOM   5640  O O     . SER B 1 291 ? 32.415  6.133   -9.866  1.00 30.21 ? 291 SER B O     1 
ATOM   5641  C CB    . SER B 1 291 ? 31.476  3.457   -12.122 1.00 29.17 ? 291 SER B CB    1 
ATOM   5642  O OG    . SER B 1 291 ? 31.030  3.444   -13.436 1.00 34.68 ? 291 SER B OG    1 
ATOM   5643  N N     . THR B 1 292 ? 31.412  4.085   -9.753  1.00 29.55 ? 292 THR B N     1 
ATOM   5644  C CA    . THR B 1 292 ? 31.237  4.092   -8.266  1.00 30.99 ? 292 THR B CA    1 
ATOM   5645  C C     . THR B 1 292 ? 32.607  3.982   -7.584  1.00 32.12 ? 292 THR B C     1 
ATOM   5646  O O     . THR B 1 292 ? 32.781  4.518   -6.480  1.00 32.46 ? 292 THR B O     1 
ATOM   5647  C CB    . THR B 1 292 ? 30.367  2.955   -7.810  1.00 30.06 ? 292 THR B CB    1 
ATOM   5648  O OG1   . THR B 1 292 ? 30.863  1.748   -8.371  1.00 29.17 ? 292 THR B OG1   1 
ATOM   5649  C CG2   . THR B 1 292 ? 28.978  3.123   -8.315  1.00 32.03 ? 292 THR B CG2   1 
ATOM   5650  N N     . LEU B 1 293 ? 33.559  3.335   -8.297  1.00 32.80 ? 293 LEU B N     1 
ATOM   5651  C CA    . LEU B 1 293 ? 34.953  2.977   -7.867  1.00 32.91 ? 293 LEU B CA    1 
ATOM   5652  C C     . LEU B 1 293 ? 34.975  1.773   -6.965  1.00 31.91 ? 293 LEU B C     1 
ATOM   5653  O O     . LEU B 1 293 ? 35.745  0.914   -7.164  1.00 32.79 ? 293 LEU B O     1 
ATOM   5654  C CB    . LEU B 1 293 ? 35.755  4.147   -7.214  1.00 33.89 ? 293 LEU B CB    1 
ATOM   5655  C CG    . LEU B 1 293 ? 35.667  5.572   -7.838  1.00 36.97 ? 293 LEU B CG    1 
ATOM   5656  C CD1   . LEU B 1 293 ? 36.690  6.582   -7.278  1.00 36.56 ? 293 LEU B CD1   1 
ATOM   5657  C CD2   . LEU B 1 293 ? 35.758  5.543   -9.340  1.00 39.26 ? 293 LEU B CD2   1 
ATOM   5658  N N     . HIS B 1 294 ? 34.143  1.732   -5.930  1.00 30.42 ? 294 HIS B N     1 
ATOM   5659  C CA    . HIS B 1 294 ? 34.102  0.580   -5.077  1.00 28.48 ? 294 HIS B CA    1 
ATOM   5660  C C     . HIS B 1 294 ? 32.817  0.727   -4.247  1.00 26.18 ? 294 HIS B C     1 
ATOM   5661  O O     . HIS B 1 294 ? 32.229  1.794   -4.199  1.00 26.21 ? 294 HIS B O     1 
ATOM   5662  C CB    . HIS B 1 294 ? 35.342  0.468   -4.195  1.00 28.90 ? 294 HIS B CB    1 
ATOM   5663  C CG    . HIS B 1 294 ? 35.498  1.578   -3.186  1.00 32.44 ? 294 HIS B CG    1 
ATOM   5664  N ND1   . HIS B 1 294 ? 36.339  2.671   -3.390  1.00 33.01 ? 294 HIS B ND1   1 
ATOM   5665  C CD2   . HIS B 1 294 ? 34.937  1.758   -1.962  1.00 30.54 ? 294 HIS B CD2   1 
ATOM   5666  C CE1   . HIS B 1 294 ? 36.279  3.472   -2.343  1.00 27.82 ? 294 HIS B CE1   1 
ATOM   5667  N NE2   . HIS B 1 294 ? 35.442  2.947   -1.458  1.00 30.94 ? 294 HIS B NE2   1 
ATOM   5668  N N     . PRO B 1 295 ? 32.374  -0.356  -3.649  1.00 24.75 ? 295 PRO B N     1 
ATOM   5669  C CA    . PRO B 1 295 ? 31.227  -0.363  -2.740  1.00 24.51 ? 295 PRO B CA    1 
ATOM   5670  C C     . PRO B 1 295 ? 31.670  0.243   -1.385  1.00 23.99 ? 295 PRO B C     1 
ATOM   5671  O O     . PRO B 1 295 ? 32.836  -0.015  -0.892  1.00 20.89 ? 295 PRO B O     1 
ATOM   5672  C CB    . PRO B 1 295 ? 30.856  -1.871  -2.648  1.00 23.59 ? 295 PRO B CB    1 
ATOM   5673  C CG    . PRO B 1 295 ? 31.625  -2.521  -3.998  1.00 23.05 ? 295 PRO B CG    1 
ATOM   5674  C CD    . PRO B 1 295 ? 32.929  -1.726  -3.844  1.00 26.04 ? 295 PRO B CD    1 
ATOM   5675  N N     . SER B 1 296 ? 30.771  1.043   -0.805  1.00 24.16 ? 296 SER B N     1 
ATOM   5676  C CA    . SER B 1 296 ? 31.057  1.700   0.563   1.00 25.70 ? 296 SER B CA    1 
ATOM   5677  C C     . SER B 1 296 ? 31.965  0.739   1.356   1.00 25.76 ? 296 SER B C     1 
ATOM   5678  O O     . SER B 1 296 ? 31.566  -0.388  1.570   1.00 27.48 ? 296 SER B O     1 
ATOM   5679  C CB    . SER B 1 296 ? 29.730  1.966   1.272   1.00 24.99 ? 296 SER B CB    1 
ATOM   5680  O OG    . SER B 1 296 ? 29.919  2.223   2.626   1.00 27.27 ? 296 SER B OG    1 
ATOM   5681  N N     . THR B 1 297 ? 33.189  1.130   1.704   1.00 27.36 ? 297 THR B N     1 
ATOM   5682  C CA    . THR B 1 297 ? 34.066  0.284   2.545   1.00 29.48 ? 297 THR B CA    1 
ATOM   5683  C C     . THR B 1 297 ? 33.419  -0.056  3.928   1.00 30.08 ? 297 THR B C     1 
ATOM   5684  O O     . THR B 1 297 ? 33.463  -1.228  4.403   1.00 30.85 ? 297 THR B O     1 
ATOM   5685  C CB    . THR B 1 297 ? 35.593  0.805   2.548   1.00 31.30 ? 297 THR B CB    1 
ATOM   5686  O OG1   . THR B 1 297 ? 36.172  0.793   3.859   1.00 34.08 ? 297 THR B OG1   1 
ATOM   5687  C CG2   . THR B 1 297 ? 35.723  2.150   2.037   1.00 26.89 ? 297 THR B CG2   1 
ATOM   5688  N N     . PHE B 1 298 ? 32.726  0.939   4.465   1.00 29.60 ? 298 PHE B N     1 
ATOM   5689  C CA    . PHE B 1 298 ? 31.996  0.940   5.761   1.00 30.80 ? 298 PHE B CA    1 
ATOM   5690  C C     . PHE B 1 298 ? 30.926  -0.175  5.772   1.00 31.03 ? 298 PHE B C     1 
ATOM   5691  O O     . PHE B 1 298 ? 30.894  -1.046  6.677   1.00 30.23 ? 298 PHE B O     1 
ATOM   5692  C CB    . PHE B 1 298 ? 31.361  2.369   6.038   1.00 30.44 ? 298 PHE B CB    1 
ATOM   5693  C CG    . PHE B 1 298 ? 30.729  2.516   7.438   1.00 31.34 ? 298 PHE B CG    1 
ATOM   5694  C CD1   . PHE B 1 298 ? 29.522  1.861   7.772   1.00 33.25 ? 298 PHE B CD1   1 
ATOM   5695  C CD2   . PHE B 1 298 ? 31.339  3.275   8.413   1.00 33.03 ? 298 PHE B CD2   1 
ATOM   5696  C CE1   . PHE B 1 298 ? 28.952  1.943   9.103   1.00 37.25 ? 298 PHE B CE1   1 
ATOM   5697  C CE2   . PHE B 1 298 ? 30.764  3.368   9.731   1.00 36.92 ? 298 PHE B CE2   1 
ATOM   5698  C CZ    . PHE B 1 298 ? 29.572  2.712   10.058  1.00 33.17 ? 298 PHE B CZ    1 
ATOM   5699  N N     . ASN B 1 299 ? 30.027  -0.130  4.781   1.00 29.43 ? 299 ASN B N     1 
ATOM   5700  C CA    . ASN B 1 299 ? 28.994  -1.116  4.707   1.00 29.39 ? 299 ASN B CA    1 
ATOM   5701  C C     . ASN B 1 299 ? 29.559  -2.591  4.468   1.00 30.48 ? 299 ASN B C     1 
ATOM   5702  O O     . ASN B 1 299 ? 29.097  -3.527  5.117   1.00 31.44 ? 299 ASN B O     1 
ATOM   5703  C CB    . ASN B 1 299 ? 27.946  -0.697  3.667   1.00 28.36 ? 299 ASN B CB    1 
ATOM   5704  C CG    . ASN B 1 299 ? 27.235  0.637   4.006   1.00 23.83 ? 299 ASN B CG    1 
ATOM   5705  O OD1   . ASN B 1 299 ? 26.402  1.083   3.259   1.00 29.68 ? 299 ASN B OD1   1 
ATOM   5706  N ND2   . ASN B 1 299 ? 27.511  1.214   5.112   1.00 17.14 ? 299 ASN B ND2   1 
ATOM   5707  N N     . GLN B 1 300 ? 30.547  -2.749  3.561   1.00 30.25 ? 300 GLN B N     1 
ATOM   5708  C CA    . GLN B 1 300 ? 31.298  -4.028  3.355   1.00 29.99 ? 300 GLN B CA    1 
ATOM   5709  C C     . GLN B 1 300 ? 31.863  -4.612  4.685   1.00 29.64 ? 300 GLN B C     1 
ATOM   5710  O O     . GLN B 1 300 ? 31.807  -5.785  4.907   1.00 30.68 ? 300 GLN B O     1 
ATOM   5711  C CB    . GLN B 1 300 ? 32.511  -3.833  2.409   1.00 27.24 ? 300 GLN B CB    1 
ATOM   5712  C CG    . GLN B 1 300 ? 32.130  -3.525  0.999   1.00 25.22 ? 300 GLN B CG    1 
ATOM   5713  C CD    . GLN B 1 300 ? 33.224  -3.770  0.142   1.00 23.92 ? 300 GLN B CD    1 
ATOM   5714  O OE1   . GLN B 1 300 ? 33.517  -4.922  -0.203  1.00 31.33 ? 300 GLN B OE1   1 
ATOM   5715  N NE2   . GLN B 1 300 ? 33.943  -2.760  -0.160  1.00 12.11 ? 300 GLN B NE2   1 
ATOM   5716  N N     . LEU B 1 301 ? 32.423  -3.762  5.514   1.00 30.73 ? 301 LEU B N     1 
ATOM   5717  C CA    . LEU B 1 301 ? 33.001  -4.080  6.851   1.00 30.41 ? 301 LEU B CA    1 
ATOM   5718  C C     . LEU B 1 301 ? 31.992  -4.567  7.807   1.00 30.82 ? 301 LEU B C     1 
ATOM   5719  O O     . LEU B 1 301 ? 32.276  -5.468  8.574   1.00 31.60 ? 301 LEU B O     1 
ATOM   5720  C CB    . LEU B 1 301 ? 33.684  -2.857  7.448   1.00 29.11 ? 301 LEU B CB    1 
ATOM   5721  C CG    . LEU B 1 301 ? 35.218  -2.565  7.473   1.00 33.61 ? 301 LEU B CG    1 
ATOM   5722  C CD1   . LEU B 1 301 ? 36.174  -3.611  7.009   1.00 28.18 ? 301 LEU B CD1   1 
ATOM   5723  C CD2   . LEU B 1 301 ? 35.629  -1.146  6.938   1.00 31.57 ? 301 LEU B CD2   1 
ATOM   5724  N N     . MET B 1 302 ? 30.812  -3.958  7.801   1.00 32.11 ? 302 MET B N     1 
ATOM   5725  C CA    . MET B 1 302 ? 29.708  -4.320  8.699   1.00 33.28 ? 302 MET B CA    1 
ATOM   5726  C C     . MET B 1 302 ? 29.255  -5.726  8.338   1.00 32.80 ? 302 MET B C     1 
ATOM   5727  O O     . MET B 1 302 ? 28.959  -6.506  9.209   1.00 34.71 ? 302 MET B O     1 
ATOM   5728  C CB    . MET B 1 302 ? 28.477  -3.372  8.507   1.00 34.46 ? 302 MET B CB    1 
ATOM   5729  C CG    . MET B 1 302 ? 28.601  -1.930  9.052   1.00 32.61 ? 302 MET B CG    1 
ATOM   5730  S SD    . MET B 1 302 ? 27.199  -0.878  8.477   1.00 38.00 ? 302 MET B SD    1 
ATOM   5731  C CE    . MET B 1 302 ? 25.823  -1.921  8.745   1.00 25.85 ? 302 MET B CE    1 
ATOM   5732  N N     . ILE B 1 303 ? 29.124  -6.024  7.039   1.00 32.03 ? 303 ILE B N     1 
ATOM   5733  C CA    . ILE B 1 303 ? 28.616  -7.355  6.577   1.00 29.88 ? 303 ILE B CA    1 
ATOM   5734  C C     . ILE B 1 303 ? 29.710  -8.388  6.779   1.00 29.79 ? 303 ILE B C     1 
ATOM   5735  O O     . ILE B 1 303 ? 29.461  -9.476  7.274   1.00 31.27 ? 303 ILE B O     1 
ATOM   5736  C CB    . ILE B 1 303 ? 28.139  -7.302  5.107   1.00 30.28 ? 303 ILE B CB    1 
ATOM   5737  C CG1   . ILE B 1 303 ? 26.919  -6.341  5.025   1.00 30.97 ? 303 ILE B CG1   1 
ATOM   5738  C CG2   . ILE B 1 303 ? 27.845  -8.733  4.514   1.00 28.69 ? 303 ILE B CG2   1 
ATOM   5739  C CD1   . ILE B 1 303 ? 26.278  -6.174  3.556   1.00 27.13 ? 303 ILE B CD1   1 
ATOM   5740  N N     . SER B 1 304 ? 30.926  -8.030  6.424   1.00 28.42 ? 304 SER B N     1 
ATOM   5741  C CA    . SER B 1 304 ? 31.978  -8.916  6.595   1.00 30.70 ? 304 SER B CA    1 
ATOM   5742  C C     . SER B 1 304 ? 32.247  -9.231  8.093   1.00 30.23 ? 304 SER B C     1 
ATOM   5743  O O     . SER B 1 304 ? 32.501  -10.373 8.422   1.00 31.78 ? 304 SER B O     1 
ATOM   5744  C CB    . SER B 1 304 ? 33.205  -8.424  5.857   1.00 30.30 ? 304 SER B CB    1 
ATOM   5745  O OG    . SER B 1 304 ? 34.241  -9.369  6.071   1.00 37.95 ? 304 SER B OG    1 
ATOM   5746  N N     . GLN B 1 305 ? 32.197  -8.268  8.994   1.00 28.66 ? 305 GLN B N     1 
ATOM   5747  C CA    . GLN B 1 305 ? 32.370  -8.600  10.438  1.00 30.51 ? 305 GLN B CA    1 
ATOM   5748  C C     . GLN B 1 305 ? 31.307  -9.557  10.886  1.00 30.77 ? 305 GLN B C     1 
ATOM   5749  O O     . GLN B 1 305 ? 31.627  -10.581 11.359  1.00 32.66 ? 305 GLN B O     1 
ATOM   5750  C CB    . GLN B 1 305 ? 32.420  -7.346  11.329  1.00 30.17 ? 305 GLN B CB    1 
ATOM   5751  C CG    . GLN B 1 305 ? 33.320  -6.305  10.703  1.00 33.36 ? 305 GLN B CG    1 
ATOM   5752  C CD    . GLN B 1 305 ? 34.119  -5.521  11.652  1.00 37.68 ? 305 GLN B CD    1 
ATOM   5753  O OE1   . GLN B 1 305 ? 35.150  -4.943  11.268  1.00 38.75 ? 305 GLN B OE1   1 
ATOM   5754  N NE2   . GLN B 1 305 ? 33.659  -5.461  12.915  1.00 38.11 ? 305 GLN B NE2   1 
ATOM   5755  N N     . LEU B 1 306 ? 30.050  -9.238  10.625  1.00 31.23 ? 306 LEU B N     1 
ATOM   5756  C CA    . LEU B 1 306 ? 28.899  -10.084 10.890  1.00 30.97 ? 306 LEU B CA    1 
ATOM   5757  C C     . LEU B 1 306 ? 29.067  -11.527 10.450  1.00 31.54 ? 306 LEU B C     1 
ATOM   5758  O O     . LEU B 1 306 ? 28.861  -12.473 11.245  1.00 30.57 ? 306 LEU B O     1 
ATOM   5759  C CB    . LEU B 1 306 ? 27.679  -9.502  10.179  1.00 31.60 ? 306 LEU B CB    1 
ATOM   5760  C CG    . LEU B 1 306 ? 26.338  -10.260 10.207  1.00 32.88 ? 306 LEU B CG    1 
ATOM   5761  C CD1   . LEU B 1 306 ? 25.558  -9.909  11.512  1.00 29.05 ? 306 LEU B CD1   1 
ATOM   5762  C CD2   . LEU B 1 306 ? 25.475  -10.012 8.958   1.00 24.96 ? 306 LEU B CD2   1 
ATOM   5763  N N     . LEU B 1 307 ? 29.420  -11.646 9.165   1.00 31.15 ? 307 LEU B N     1 
ATOM   5764  C CA    . LEU B 1 307 ? 29.491  -12.868 8.354   1.00 30.75 ? 307 LEU B CA    1 
ATOM   5765  C C     . LEU B 1 307 ? 30.575  -13.833 8.844   1.00 31.10 ? 307 LEU B C     1 
ATOM   5766  O O     . LEU B 1 307 ? 30.454  -15.086 8.756   1.00 31.23 ? 307 LEU B O     1 
ATOM   5767  C CB    . LEU B 1 307 ? 29.811  -12.440 6.880   1.00 31.25 ? 307 LEU B CB    1 
ATOM   5768  C CG    . LEU B 1 307 ? 28.821  -12.777 5.713   1.00 30.02 ? 307 LEU B CG    1 
ATOM   5769  C CD1   . LEU B 1 307 ? 27.409  -12.816 6.134   1.00 25.72 ? 307 LEU B CD1   1 
ATOM   5770  C CD2   . LEU B 1 307 ? 28.998  -12.102 4.274   1.00 30.31 ? 307 LEU B CD2   1 
ATOM   5771  N N     . HIS B 1 308 ? 31.624  -13.211 9.350   1.00 31.74 ? 308 HIS B N     1 
ATOM   5772  C CA    . HIS B 1 308 ? 32.764  -13.836 9.918   1.00 32.98 ? 308 HIS B CA    1 
ATOM   5773  C C     . HIS B 1 308 ? 32.547  -14.374 11.338  1.00 33.78 ? 308 HIS B C     1 
ATOM   5774  O O     . HIS B 1 308 ? 33.188  -15.362 11.674  1.00 31.39 ? 308 HIS B O     1 
ATOM   5775  C CB    . HIS B 1 308 ? 34.000  -12.943 9.833   1.00 33.41 ? 308 HIS B CB    1 
ATOM   5776  C CG    . HIS B 1 308 ? 34.736  -13.028 8.528   1.00 32.24 ? 308 HIS B CG    1 
ATOM   5777  N ND1   . HIS B 1 308 ? 35.791  -13.903 8.307   1.00 34.12 ? 308 HIS B ND1   1 
ATOM   5778  C CD2   . HIS B 1 308 ? 34.557  -12.356 7.367   1.00 23.45 ? 308 HIS B CD2   1 
ATOM   5779  C CE1   . HIS B 1 308 ? 36.250  -13.722 7.077   1.00 29.88 ? 308 HIS B CE1   1 
ATOM   5780  N NE2   . HIS B 1 308 ? 35.547  -12.752 6.513   1.00 23.14 ? 308 HIS B NE2   1 
ATOM   5781  N N     . GLU B 1 309 ? 31.664  -13.747 12.140  1.00 35.56 ? 309 GLU B N     1 
ATOM   5782  C CA    . GLU B 1 309 ? 31.261  -14.309 13.416  1.00 36.61 ? 309 GLU B CA    1 
ATOM   5783  C C     . GLU B 1 309 ? 30.215  -15.411 13.225  1.00 37.99 ? 309 GLU B C     1 
ATOM   5784  O O     . GLU B 1 309 ? 30.117  -16.356 14.014  1.00 38.56 ? 309 GLU B O     1 
ATOM   5785  C CB    . GLU B 1 309 ? 30.737  -13.238 14.378  1.00 39.60 ? 309 GLU B CB    1 
ATOM   5786  C CG    . GLU B 1 309 ? 30.987  -13.583 15.949  1.00 41.63 ? 309 GLU B CG    1 
ATOM   5787  C CD    . GLU B 1 309 ? 32.441  -13.219 16.370  1.00 52.45 ? 309 GLU B CD    1 
ATOM   5788  O OE1   . GLU B 1 309 ? 32.976  -12.100 16.011  1.00 55.03 ? 309 GLU B OE1   1 
ATOM   5789  O OE2   . GLU B 1 309 ? 33.067  -14.039 17.078  1.00 55.04 ? 309 GLU B OE2   1 
ATOM   5790  N N     . TRP B 1 310 ? 29.454  -15.322 12.147  1.00 37.76 ? 310 TRP B N     1 
ATOM   5791  C CA    . TRP B 1 310 ? 28.428  -16.283 11.866  1.00 37.35 ? 310 TRP B CA    1 
ATOM   5792  C C     . TRP B 1 310 ? 29.055  -17.591 11.366  1.00 38.86 ? 310 TRP B C     1 
ATOM   5793  O O     . TRP B 1 310 ? 28.574  -18.667 11.689  1.00 40.71 ? 310 TRP B O     1 
ATOM   5794  C CB    . TRP B 1 310 ? 27.427  -15.716 10.806  1.00 35.26 ? 310 TRP B CB    1 
ATOM   5795  C CG    . TRP B 1 310 ? 26.234  -14.973 11.405  1.00 34.70 ? 310 TRP B CG    1 
ATOM   5796  C CD1   . TRP B 1 310 ? 25.896  -14.912 12.721  1.00 30.17 ? 310 TRP B CD1   1 
ATOM   5797  C CD2   . TRP B 1 310 ? 25.211  -14.244 10.690  1.00 32.22 ? 310 TRP B CD2   1 
ATOM   5798  N NE1   . TRP B 1 310 ? 24.760  -14.193 12.885  1.00 30.71 ? 310 TRP B NE1   1 
ATOM   5799  C CE2   . TRP B 1 310 ? 24.292  -13.788 11.655  1.00 32.22 ? 310 TRP B CE2   1 
ATOM   5800  C CE3   . TRP B 1 310 ? 24.967  -13.975 9.316   1.00 28.89 ? 310 TRP B CE3   1 
ATOM   5801  C CZ2   . TRP B 1 310 ? 23.155  -13.020 11.317  1.00 28.03 ? 310 TRP B CZ2   1 
ATOM   5802  C CZ3   . TRP B 1 310 ? 23.833  -13.266 8.983   1.00 28.48 ? 310 TRP B CZ3   1 
ATOM   5803  C CH2   . TRP B 1 310 ? 22.931  -12.795 9.983   1.00 29.89 ? 310 TRP B CH2   1 
ATOM   5804  N N     . GLY B 1 311 ? 30.093  -17.496 10.537  1.00 39.66 ? 311 GLY B N     1 
ATOM   5805  C CA    . GLY B 1 311 ? 30.640  -18.669 9.854   1.00 40.58 ? 311 GLY B CA    1 
ATOM   5806  C C     . GLY B 1 311 ? 29.614  -18.941 8.783   1.00 41.61 ? 311 GLY B C     1 
ATOM   5807  O O     . GLY B 1 311 ? 28.615  -18.201 8.679   1.00 43.44 ? 311 GLY B O     1 
ATOM   5808  N N     . GLU B 1 312 ? 29.835  -19.959 7.979   1.00 40.92 ? 312 GLU B N     1 
ATOM   5809  C CA    . GLU B 1 312 ? 28.888  -20.252 6.941   1.00 43.14 ? 312 GLU B CA    1 
ATOM   5810  C C     . GLU B 1 312 ? 27.571  -20.885 7.558   1.00 42.12 ? 312 GLU B C     1 
ATOM   5811  O O     . GLU B 1 312 ? 26.473  -20.645 7.077   1.00 40.17 ? 312 GLU B O     1 
ATOM   5812  C CB    . GLU B 1 312 ? 29.627  -20.882 5.709   1.00 43.68 ? 312 GLU B CB    1 
ATOM   5813  C CG    . GLU B 1 312 ? 31.122  -20.183 5.484   1.00 46.59 ? 312 GLU B CG    1 
ATOM   5814  C CD    . GLU B 1 312 ? 31.881  -20.204 4.045   1.00 48.90 ? 312 GLU B CD    1 
ATOM   5815  O OE1   . GLU B 1 312 ? 32.650  -19.182 3.727   1.00 47.00 ? 312 GLU B OE1   1 
ATOM   5816  O OE2   . GLU B 1 312 ? 31.771  -21.212 3.272   1.00 51.85 ? 312 GLU B OE2   1 
ATOM   5817  N N     . GLU B 1 313 ? 27.696  -21.534 8.731   1.00 43.05 ? 313 GLU B N     1 
ATOM   5818  C CA    . GLU B 1 313 ? 26.582  -22.123 9.528   1.00 43.10 ? 313 GLU B CA    1 
ATOM   5819  C C     . GLU B 1 313 ? 25.607  -21.124 10.092  1.00 40.48 ? 313 GLU B C     1 
ATOM   5820  O O     . GLU B 1 313 ? 24.401  -21.389 10.108  1.00 41.19 ? 313 GLU B O     1 
ATOM   5821  C CB    . GLU B 1 313 ? 27.094  -22.974 10.731  1.00 43.01 ? 313 GLU B CB    1 
ATOM   5822  C CG    . GLU B 1 313 ? 26.007  -24.031 11.259  1.00 46.17 ? 313 GLU B CG    1 
ATOM   5823  C CD    . GLU B 1 313 ? 26.633  -25.273 12.002  1.00 48.71 ? 313 GLU B CD    1 
ATOM   5824  O OE1   . GLU B 1 313 ? 27.782  -25.672 11.669  1.00 51.96 ? 313 GLU B OE1   1 
ATOM   5825  O OE2   . GLU B 1 313 ? 25.957  -25.852 12.905  1.00 54.60 ? 313 GLU B OE2   1 
ATOM   5826  N N     . GLY B 1 314 ? 26.121  -20.038 10.655  1.00 39.02 ? 314 GLY B N     1 
ATOM   5827  C CA    . GLY B 1 314 ? 25.279  -18.999 11.233  1.00 37.77 ? 314 GLY B CA    1 
ATOM   5828  C C     . GLY B 1 314 ? 24.637  -18.154 10.116  1.00 37.45 ? 314 GLY B C     1 
ATOM   5829  O O     . GLY B 1 314 ? 23.574  -17.581 10.328  1.00 37.50 ? 314 GLY B O     1 
ATOM   5830  N N     . PHE B 1 315 ? 25.276  -18.126 8.924   1.00 35.72 ? 315 PHE B N     1 
ATOM   5831  C CA    . PHE B 1 315 ? 24.726  -17.524 7.740   1.00 34.69 ? 315 PHE B CA    1 
ATOM   5832  C C     . PHE B 1 315 ? 23.531  -18.321 7.233   1.00 33.59 ? 315 PHE B C     1 
ATOM   5833  O O     . PHE B 1 315 ? 22.438  -17.789 7.104   1.00 32.74 ? 315 PHE B O     1 
ATOM   5834  C CB    . PHE B 1 315 ? 25.811  -17.428 6.613   1.00 35.85 ? 315 PHE B CB    1 
ATOM   5835  C CG    . PHE B 1 315 ? 25.304  -16.769 5.370   1.00 36.05 ? 315 PHE B CG    1 
ATOM   5836  C CD1   . PHE B 1 315 ? 24.868  -15.446 5.402   1.00 36.66 ? 315 PHE B CD1   1 
ATOM   5837  C CD2   . PHE B 1 315 ? 25.161  -17.492 4.195   1.00 38.64 ? 315 PHE B CD2   1 
ATOM   5838  C CE1   . PHE B 1 315 ? 24.343  -14.851 4.284   1.00 40.47 ? 315 PHE B CE1   1 
ATOM   5839  C CE2   . PHE B 1 315 ? 24.684  -16.907 3.064   1.00 40.95 ? 315 PHE B CE2   1 
ATOM   5840  C CZ    . PHE B 1 315 ? 24.239  -15.582 3.096   1.00 40.33 ? 315 PHE B CZ    1 
ATOM   5841  N N     . MET B 1 316 ? 23.754  -19.595 6.899   1.00 33.85 ? 316 MET B N     1 
ATOM   5842  C CA    . MET B 1 316 ? 22.705  -20.509 6.426   1.00 32.56 ? 316 MET B CA    1 
ATOM   5843  C C     . MET B 1 316 ? 21.612  -20.646 7.472   1.00 32.30 ? 316 MET B C     1 
ATOM   5844  O O     . MET B 1 316 ? 20.433  -20.859 7.132   1.00 32.97 ? 316 MET B O     1 
ATOM   5845  C CB    . MET B 1 316 ? 23.273  -21.903 6.077   1.00 32.74 ? 316 MET B CB    1 
ATOM   5846  C CG    . MET B 1 316 ? 24.315  -21.958 4.878   1.00 37.25 ? 316 MET B CG    1 
ATOM   5847  S SD    . MET B 1 316 ? 23.790  -21.087 3.347   1.00 44.95 ? 316 MET B SD    1 
ATOM   5848  C CE    . MET B 1 316 ? 22.587  -22.304 2.849   1.00 33.73 ? 316 MET B CE    1 
ATOM   5849  N N     . ALA B 1 317 ? 21.973  -20.544 8.747   1.00 32.16 ? 317 ALA B N     1 
ATOM   5850  C CA    . ALA B 1 317 ? 20.951  -20.549 9.788   1.00 32.96 ? 317 ALA B CA    1 
ATOM   5851  C C     . ALA B 1 317 ? 20.119  -19.296 9.716   1.00 31.66 ? 317 ALA B C     1 
ATOM   5852  O O     . ALA B 1 317 ? 18.976  -19.339 9.898   1.00 32.23 ? 317 ALA B O     1 
ATOM   5853  C CB    . ALA B 1 317 ? 21.554  -20.738 11.201  1.00 32.31 ? 317 ALA B CB    1 
ATOM   5854  N N     . HIS B 1 318 ? 20.728  -18.178 9.442   1.00 33.70 ? 318 HIS B N     1 
ATOM   5855  C CA    . HIS B 1 318 ? 19.994  -16.945 9.247   1.00 34.76 ? 318 HIS B CA    1 
ATOM   5856  C C     . HIS B 1 318 ? 19.086  -17.032 7.988   1.00 35.55 ? 318 HIS B C     1 
ATOM   5857  O O     . HIS B 1 318 ? 17.896  -16.748 8.054   1.00 36.25 ? 318 HIS B O     1 
ATOM   5858  C CB    . HIS B 1 318 ? 20.982  -15.763 9.158   1.00 34.98 ? 318 HIS B CB    1 
ATOM   5859  C CG    . HIS B 1 318 ? 20.331  -14.500 8.680   1.00 35.57 ? 318 HIS B CG    1 
ATOM   5860  N ND1   . HIS B 1 318 ? 19.502  -13.742 9.493   1.00 31.39 ? 318 HIS B ND1   1 
ATOM   5861  C CD2   . HIS B 1 318 ? 20.325  -13.907 7.455   1.00 31.14 ? 318 HIS B CD2   1 
ATOM   5862  C CE1   . HIS B 1 318 ? 18.987  -12.753 8.783   1.00 27.40 ? 318 HIS B CE1   1 
ATOM   5863  N NE2   . HIS B 1 318 ? 19.483  -12.819 7.550   1.00 30.25 ? 318 HIS B NE2   1 
ATOM   5864  N N     . VAL B 1 319 ? 19.639  -17.450 6.845   1.00 35.44 ? 319 VAL B N     1 
ATOM   5865  C CA    . VAL B 1 319 ? 18.794  -17.610 5.652   1.00 34.45 ? 319 VAL B CA    1 
ATOM   5866  C C     . VAL B 1 319 ? 17.606  -18.463 5.926   1.00 33.99 ? 319 VAL B C     1 
ATOM   5867  O O     . VAL B 1 319 ? 16.491  -18.078 5.597   1.00 34.47 ? 319 VAL B O     1 
ATOM   5868  C CB    . VAL B 1 319 ? 19.576  -18.116 4.336   1.00 33.76 ? 319 VAL B CB    1 
ATOM   5869  C CG1   . VAL B 1 319 ? 20.907  -17.569 4.321   1.00 30.69 ? 319 VAL B CG1   1 
ATOM   5870  C CG2   . VAL B 1 319 ? 19.641  -19.636 4.203   1.00 33.82 ? 319 VAL B CG2   1 
ATOM   5871  N N     . ASP B 1 320 ? 17.854  -19.641 6.502   1.00 33.77 ? 320 ASP B N     1 
ATOM   5872  C CA    . ASP B 1 320 ? 16.786  -20.527 7.015   1.00 35.28 ? 320 ASP B CA    1 
ATOM   5873  C C     . ASP B 1 320 ? 15.707  -19.772 7.857   1.00 34.72 ? 320 ASP B C     1 
ATOM   5874  O O     . ASP B 1 320 ? 14.525  -20.064 7.686   1.00 35.78 ? 320 ASP B O     1 
ATOM   5875  C CB    . ASP B 1 320 ? 17.329  -21.748 7.840   1.00 35.41 ? 320 ASP B CB    1 
ATOM   5876  C CG    . ASP B 1 320 ? 18.311  -22.738 7.017   1.00 43.96 ? 320 ASP B CG    1 
ATOM   5877  O OD1   . ASP B 1 320 ? 18.858  -22.442 5.869   1.00 46.28 ? 320 ASP B OD1   1 
ATOM   5878  O OD2   . ASP B 1 320 ? 18.591  -23.862 7.583   1.00 47.54 ? 320 ASP B OD2   1 
ATOM   5879  N N     . ARG B 1 321 ? 16.075  -18.847 8.774   1.00 33.29 ? 321 ARG B N     1 
ATOM   5880  C CA    . ARG B 1 321 ? 15.008  -18.157 9.591   1.00 32.93 ? 321 ARG B CA    1 
ATOM   5881  C C     . ARG B 1 321 ? 14.136  -17.198 8.712   1.00 30.86 ? 321 ARG B C     1 
ATOM   5882  O O     . ARG B 1 321 ? 12.947  -17.029 8.924   1.00 29.26 ? 321 ARG B O     1 
ATOM   5883  C CB    . ARG B 1 321 ? 15.611  -17.383 10.822  1.00 31.43 ? 321 ARG B CB    1 
ATOM   5884  C CG    . ARG B 1 321 ? 16.081  -18.289 11.998  1.00 32.00 ? 321 ARG B CG    1 
ATOM   5885  C CD    . ARG B 1 321 ? 16.592  -17.506 13.309  1.00 33.86 ? 321 ARG B CD    1 
ATOM   5886  N NE    . ARG B 1 321 ? 17.669  -16.533 13.097  1.00 30.28 ? 321 ARG B NE    1 
ATOM   5887  C CZ    . ARG B 1 321 ? 18.972  -16.762 13.113  1.00 33.08 ? 321 ARG B CZ    1 
ATOM   5888  N NH1   . ARG B 1 321 ? 19.466  -18.000 13.378  1.00 28.61 ? 321 ARG B NH1   1 
ATOM   5889  N NH2   . ARG B 1 321 ? 19.803  -15.726 12.864  1.00 29.76 ? 321 ARG B NH2   1 
ATOM   5890  N N     . VAL B 1 322 ? 14.787  -16.499 7.783   1.00 31.13 ? 322 VAL B N     1 
ATOM   5891  C CA    . VAL B 1 322 ? 14.071  -15.613 6.831   1.00 29.68 ? 322 VAL B CA    1 
ATOM   5892  C C     . VAL B 1 322 ? 13.212  -16.439 5.869   1.00 27.92 ? 322 VAL B C     1 
ATOM   5893  O O     . VAL B 1 322 ? 12.109  -16.046 5.610   1.00 27.65 ? 322 VAL B O     1 
ATOM   5894  C CB    . VAL B 1 322 ? 14.971  -14.391 6.246   1.00 30.44 ? 322 VAL B CB    1 
ATOM   5895  C CG1   . VAL B 1 322 ? 16.339  -14.605 6.378   1.00 28.58 ? 322 VAL B CG1   1 
ATOM   5896  C CG2   . VAL B 1 322 ? 14.711  -14.059 4.873   1.00 26.68 ? 322 VAL B CG2   1 
ATOM   5897  N N     . ILE B 1 323 ? 13.689  -17.611 5.448   1.00 27.20 ? 323 ILE B N     1 
ATOM   5898  C CA    . ILE B 1 323 ? 12.896  -18.503 4.600   1.00 28.46 ? 323 ILE B CA    1 
ATOM   5899  C C     . ILE B 1 323 ? 11.598  -18.808 5.375   1.00 29.42 ? 323 ILE B C     1 
ATOM   5900  O O     . ILE B 1 323 ? 10.477  -18.620 4.869   1.00 26.99 ? 323 ILE B O     1 
ATOM   5901  C CB    . ILE B 1 323 ? 13.674  -19.813 4.168   1.00 29.24 ? 323 ILE B CB    1 
ATOM   5902  C CG1   . ILE B 1 323 ? 14.779  -19.527 3.120   1.00 30.24 ? 323 ILE B CG1   1 
ATOM   5903  C CG2   . ILE B 1 323 ? 12.694  -20.923 3.623   1.00 28.30 ? 323 ILE B CG2   1 
ATOM   5904  C CD1   . ILE B 1 323 ? 15.809  -20.840 2.826   1.00 26.05 ? 323 ILE B CD1   1 
ATOM   5905  N N     . ASP B 1 324 ? 11.754  -19.196 6.657   1.00 31.51 ? 324 ASP B N     1 
ATOM   5906  C CA    . ASP B 1 324 ? 10.615  -19.619 7.447   1.00 30.94 ? 324 ASP B CA    1 
ATOM   5907  C C     . ASP B 1 324 ? 9.738   -18.400 7.573   1.00 29.61 ? 324 ASP B C     1 
ATOM   5908  O O     . ASP B 1 324 ? 8.567   -18.471 7.344   1.00 29.47 ? 324 ASP B O     1 
ATOM   5909  C CB    . ASP B 1 324 ? 11.087  -20.258 8.743   1.00 34.36 ? 324 ASP B CB    1 
ATOM   5910  C CG    . ASP B 1 324 ? 11.564  -21.740 8.531   1.00 42.46 ? 324 ASP B CG    1 
ATOM   5911  O OD1   . ASP B 1 324 ? 11.319  -22.302 7.410   1.00 51.85 ? 324 ASP B OD1   1 
ATOM   5912  O OD2   . ASP B 1 324 ? 12.164  -22.361 9.440   1.00 43.82 ? 324 ASP B OD2   1 
ATOM   5913  N N     . PHE B 1 325 ? 10.285  -17.237 7.823   1.00 29.01 ? 325 PHE B N     1 
ATOM   5914  C CA    . PHE B 1 325 ? 9.394   -16.054 7.786   1.00 29.50 ? 325 PHE B CA    1 
ATOM   5915  C C     . PHE B 1 325 ? 8.628   -15.771 6.460   1.00 30.38 ? 325 PHE B C     1 
ATOM   5916  O O     . PHE B 1 325 ? 7.413   -15.546 6.490   1.00 30.26 ? 325 PHE B O     1 
ATOM   5917  C CB    . PHE B 1 325 ? 10.104  -14.789 8.268   1.00 30.24 ? 325 PHE B CB    1 
ATOM   5918  C CG    . PHE B 1 325 ? 9.225   -13.530 8.105   1.00 30.66 ? 325 PHE B CG    1 
ATOM   5919  C CD1   . PHE B 1 325 ? 8.386   -13.114 9.138   1.00 28.98 ? 325 PHE B CD1   1 
ATOM   5920  C CD2   . PHE B 1 325 ? 9.212   -12.840 6.894   1.00 22.33 ? 325 PHE B CD2   1 
ATOM   5921  C CE1   . PHE B 1 325 ? 7.543   -11.998 8.947   1.00 27.99 ? 325 PHE B CE1   1 
ATOM   5922  C CE2   . PHE B 1 325 ? 8.443   -11.793 6.703   1.00 21.69 ? 325 PHE B CE2   1 
ATOM   5923  C CZ    . PHE B 1 325 ? 7.608   -11.338 7.755   1.00 27.98 ? 325 PHE B CZ    1 
ATOM   5924  N N     . TYR B 1 326 ? 9.327   -15.825 5.294   1.00 30.49 ? 326 TYR B N     1 
ATOM   5925  C CA    . TYR B 1 326 ? 8.645   -15.596 3.997   1.00 30.56 ? 326 TYR B CA    1 
ATOM   5926  C C     . TYR B 1 326 ? 7.765   -16.737 3.655   1.00 31.21 ? 326 TYR B C     1 
ATOM   5927  O O     . TYR B 1 326 ? 6.756   -16.582 2.971   1.00 32.18 ? 326 TYR B O     1 
ATOM   5928  C CB    . TYR B 1 326 ? 9.632   -15.303 2.833   1.00 29.77 ? 326 TYR B CB    1 
ATOM   5929  C CG    . TYR B 1 326 ? 10.140  -13.866 2.813   1.00 30.82 ? 326 TYR B CG    1 
ATOM   5930  C CD1   . TYR B 1 326 ? 9.448   -12.870 2.084   1.00 33.41 ? 326 TYR B CD1   1 
ATOM   5931  C CD2   . TYR B 1 326 ? 11.321  -13.491 3.491   1.00 29.90 ? 326 TYR B CD2   1 
ATOM   5932  C CE1   . TYR B 1 326 ? 9.904   -11.558 2.040   1.00 27.22 ? 326 TYR B CE1   1 
ATOM   5933  C CE2   . TYR B 1 326 ? 11.805  -12.158 3.444   1.00 26.36 ? 326 TYR B CE2   1 
ATOM   5934  C CZ    . TYR B 1 326 ? 11.070  -11.212 2.718   1.00 29.79 ? 326 TYR B CZ    1 
ATOM   5935  O OH    . TYR B 1 326 ? 11.498  -9.925  2.631   1.00 28.12 ? 326 TYR B OH    1 
ATOM   5936  N N     . SER B 1 327 ? 8.115   -17.911 4.145   1.00 32.33 ? 327 SER B N     1 
ATOM   5937  C CA    . SER B 1 327 ? 7.194   -19.029 3.962   1.00 33.42 ? 327 SER B CA    1 
ATOM   5938  C C     . SER B 1 327 ? 5.849   -18.974 4.647   1.00 32.51 ? 327 SER B C     1 
ATOM   5939  O O     . SER B 1 327 ? 4.860   -19.290 4.008   1.00 35.30 ? 327 SER B O     1 
ATOM   5940  C CB    . SER B 1 327 ? 7.845   -20.356 4.244   1.00 33.52 ? 327 SER B CB    1 
ATOM   5941  O OG    . SER B 1 327 ? 6.866   -21.281 3.826   1.00 38.69 ? 327 SER B OG    1 
ATOM   5942  N N     . ASN B 1 328 ? 5.764   -18.625 5.939   1.00 31.61 ? 328 ASN B N     1 
ATOM   5943  C CA    . ASN B 1 328 ? 4.469   -18.376 6.568   1.00 28.17 ? 328 ASN B CA    1 
ATOM   5944  C C     . ASN B 1 328 ? 3.685   -17.207 6.006   1.00 27.20 ? 328 ASN B C     1 
ATOM   5945  O O     . ASN B 1 328 ? 2.509   -17.156 6.184   1.00 25.47 ? 328 ASN B O     1 
ATOM   5946  C CB    . ASN B 1 328 ? 4.543   -18.028 8.095   1.00 30.61 ? 328 ASN B CB    1 
ATOM   5947  C CG    . ASN B 1 328 ? 5.359   -18.967 8.918   1.00 34.22 ? 328 ASN B CG    1 
ATOM   5948  O OD1   . ASN B 1 328 ? 6.339   -18.529 9.580   1.00 36.94 ? 328 ASN B OD1   1 
ATOM   5949  N ND2   . ASN B 1 328 ? 4.954   -20.240 8.960   1.00 34.33 ? 328 ASN B ND2   1 
ATOM   5950  N N     . GLN B 1 329 ? 4.347   -16.194 5.480   1.00 29.73 ? 329 GLN B N     1 
ATOM   5951  C CA    . GLN B 1 329 ? 3.711   -15.146 4.622   1.00 31.71 ? 329 GLN B CA    1 
ATOM   5952  C C     . GLN B 1 329 ? 3.128   -15.700 3.279   1.00 31.77 ? 329 GLN B C     1 
ATOM   5953  O O     . GLN B 1 329 ? 2.075   -15.245 2.799   1.00 33.76 ? 329 GLN B O     1 
ATOM   5954  C CB    . GLN B 1 329 ? 4.738   -13.976 4.350   1.00 32.49 ? 329 GLN B CB    1 
ATOM   5955  C CG    . GLN B 1 329 ? 5.244   -13.185 5.588   1.00 29.30 ? 329 GLN B CG    1 
ATOM   5956  C CD    . GLN B 1 329 ? 4.189   -12.205 6.163   1.00 32.10 ? 329 GLN B CD    1 
ATOM   5957  O OE1   . GLN B 1 329 ? 3.718   -12.317 7.325   1.00 32.93 ? 329 GLN B OE1   1 
ATOM   5958  N NE2   . GLN B 1 329 ? 3.776   -11.284 5.332   1.00 31.89 ? 329 GLN B NE2   1 
ATOM   5959  N N     . LYS B 1 330 ? 3.792   -16.661 2.661   1.00 32.86 ? 330 LYS B N     1 
ATOM   5960  C CA    . LYS B 1 330 ? 3.263   -17.403 1.465   1.00 32.82 ? 330 LYS B CA    1 
ATOM   5961  C C     . LYS B 1 330 ? 1.964   -18.223 1.740   1.00 34.26 ? 330 LYS B C     1 
ATOM   5962  O O     . LYS B 1 330 ? 0.867   -17.910 1.246   1.00 35.93 ? 330 LYS B O     1 
ATOM   5963  C CB    . LYS B 1 330 ? 4.366   -18.284 0.852   1.00 32.41 ? 330 LYS B CB    1 
ATOM   5964  C CG    . LYS B 1 330 ? 3.796   -19.346 -0.130  1.00 35.63 ? 330 LYS B CG    1 
ATOM   5965  C CD    . LYS B 1 330 ? 4.644   -20.644 -0.309  1.00 33.18 ? 330 LYS B CD    1 
ATOM   5966  C CE    . LYS B 1 330 ? 4.485   -21.731 0.724   1.00 35.10 ? 330 LYS B CE    1 
ATOM   5967  N NZ    . LYS B 1 330 ? 5.692   -21.977 1.564   1.00 34.59 ? 330 LYS B NZ    1 
ATOM   5968  N N     . ASP B 1 331 ? 2.054   -19.240 2.590   1.00 34.40 ? 331 ASP B N     1 
ATOM   5969  C CA    . ASP B 1 331 ? 0.904   -19.660 3.401   1.00 33.71 ? 331 ASP B CA    1 
ATOM   5970  C C     . ASP B 1 331 ? -0.268  -18.682 3.538   1.00 33.17 ? 331 ASP B C     1 
ATOM   5971  O O     . ASP B 1 331 ? -1.367  -18.870 2.956   1.00 32.46 ? 331 ASP B O     1 
ATOM   5972  C CB    . ASP B 1 331 ? 1.422   -20.043 4.772   1.00 32.39 ? 331 ASP B CB    1 
ATOM   5973  C CG    . ASP B 1 331 ? 2.261   -21.280 4.693   1.00 37.62 ? 331 ASP B CG    1 
ATOM   5974  O OD1   . ASP B 1 331 ? 2.368   -21.859 3.539   1.00 31.96 ? 331 ASP B OD1   1 
ATOM   5975  O OD2   . ASP B 1 331 ? 2.849   -21.646 5.739   1.00 37.62 ? 331 ASP B OD2   1 
ATOM   5976  N N     . ALA B 1 332 ? -0.022  -17.596 4.247   1.00 32.81 ? 332 ALA B N     1 
ATOM   5977  C CA    . ALA B 1 332 ? -1.105  -16.697 4.582   1.00 32.17 ? 332 ALA B CA    1 
ATOM   5978  C C     . ALA B 1 332 ? -1.702  -16.028 3.333   1.00 32.29 ? 332 ALA B C     1 
ATOM   5979  O O     . ALA B 1 332 ? -2.924  -15.915 3.160   1.00 33.01 ? 332 ALA B O     1 
ATOM   5980  C CB    . ALA B 1 332 ? -0.620  -15.754 5.522   1.00 32.52 ? 332 ALA B CB    1 
ATOM   5981  N N     . ILE B 1 333 ? -0.853  -15.643 2.395   1.00 32.30 ? 333 ILE B N     1 
ATOM   5982  C CA    . ILE B 1 333 ? -1.409  -15.067 1.184   1.00 30.72 ? 333 ILE B CA    1 
ATOM   5983  C C     . ILE B 1 333 ? -2.118  -16.147 0.363   1.00 30.18 ? 333 ILE B C     1 
ATOM   5984  O O     . ILE B 1 333 ? -3.149  -15.871 -0.325  1.00 29.98 ? 333 ILE B O     1 
ATOM   5985  C CB    . ILE B 1 333 ? -0.374  -14.191 0.373   1.00 29.81 ? 333 ILE B CB    1 
ATOM   5986  C CG1   . ILE B 1 333 ? -1.121  -13.061 -0.324  1.00 28.86 ? 333 ILE B CG1   1 
ATOM   5987  C CG2   . ILE B 1 333 ? 0.510   -15.066 -0.485  1.00 27.07 ? 333 ILE B CG2   1 
ATOM   5988  C CD1   . ILE B 1 333 ? -0.245  -12.121 -1.248  1.00 30.45 ? 333 ILE B CD1   1 
ATOM   5989  N N     . LEU B 1 334 ? -1.551  -17.358 0.365   1.00 30.48 ? 334 LEU B N     1 
ATOM   5990  C CA    . LEU B 1 334 ? -2.232  -18.489 -0.321  1.00 28.67 ? 334 LEU B CA    1 
ATOM   5991  C C     . LEU B 1 334 ? -3.583  -18.613 0.335   1.00 28.65 ? 334 LEU B C     1 
ATOM   5992  O O     . LEU B 1 334 ? -4.611  -18.582 -0.338  1.00 29.54 ? 334 LEU B O     1 
ATOM   5993  C CB    . LEU B 1 334 ? -1.397  -19.815 -0.223  1.00 27.87 ? 334 LEU B CB    1 
ATOM   5994  C CG    . LEU B 1 334 ? -0.582  -20.077 -1.481  1.00 25.75 ? 334 LEU B CG    1 
ATOM   5995  C CD1   . LEU B 1 334 ? -0.619  -18.815 -2.464  1.00 23.65 ? 334 LEU B CD1   1 
ATOM   5996  C CD2   . LEU B 1 334 ? 0.803   -20.501 -1.252  1.00 14.75 ? 334 LEU B CD2   1 
ATOM   5997  N N     . ALA B 1 335 ? -3.616  -18.584 1.665   1.00 28.31 ? 335 ALA B N     1 
ATOM   5998  C CA    . ALA B 1 335 ? -4.905  -18.685 2.330   1.00 29.06 ? 335 ALA B CA    1 
ATOM   5999  C C     . ALA B 1 335 ? -5.902  -17.579 2.087   1.00 29.61 ? 335 ALA B C     1 
ATOM   6000  O O     . ALA B 1 335 ? -7.102  -17.820 2.029   1.00 30.77 ? 335 ALA B O     1 
ATOM   6001  C CB    . ALA B 1 335 ? -4.715  -18.969 3.850   1.00 31.02 ? 335 ALA B CB    1 
ATOM   6002  N N     . ALA B 1 336 ? -5.431  -16.339 1.947   1.00 31.25 ? 336 ALA B N     1 
ATOM   6003  C CA    . ALA B 1 336 ? -6.306  -15.184 1.538   1.00 30.28 ? 336 ALA B CA    1 
ATOM   6004  C C     . ALA B 1 336 ? -6.889  -15.334 0.088   1.00 31.18 ? 336 ALA B C     1 
ATOM   6005  O O     . ALA B 1 336 ? -8.049  -14.905 -0.219  1.00 27.73 ? 336 ALA B O     1 
ATOM   6006  C CB    . ALA B 1 336 ? -5.479  -13.948 1.623   1.00 32.47 ? 336 ALA B CB    1 
ATOM   6007  N N     . ALA B 1 337 ? -6.100  -15.976 -0.806  1.00 31.57 ? 337 ALA B N     1 
ATOM   6008  C CA    . ALA B 1 337 ? -6.555  -16.114 -2.200  1.00 31.62 ? 337 ALA B CA    1 
ATOM   6009  C C     . ALA B 1 337 ? -7.553  -17.300 -2.409  1.00 32.69 ? 337 ALA B C     1 
ATOM   6010  O O     . ALA B 1 337 ? -8.522  -17.122 -3.165  1.00 32.89 ? 337 ALA B O     1 
ATOM   6011  C CB    . ALA B 1 337 ? -5.376  -16.159 -3.207  1.00 31.74 ? 337 ALA B CB    1 
ATOM   6012  N N     . ASP B 1 338 ? -7.285  -18.474 -1.798  1.00 31.70 ? 338 ASP B N     1 
ATOM   6013  C CA    . ASP B 1 338 ? -8.294  -19.536 -1.657  1.00 33.05 ? 338 ASP B CA    1 
ATOM   6014  C C     . ASP B 1 338 ? -9.609  -19.092 -1.069  1.00 33.82 ? 338 ASP B C     1 
ATOM   6015  O O     . ASP B 1 338 ? -10.656 -19.496 -1.542  1.00 36.00 ? 338 ASP B O     1 
ATOM   6016  C CB    . ASP B 1 338 ? -7.734  -20.801 -0.940  1.00 32.52 ? 338 ASP B CB    1 
ATOM   6017  C CG    . ASP B 1 338 ? -6.670  -21.485 -1.807  1.00 33.81 ? 338 ASP B CG    1 
ATOM   6018  O OD1   . ASP B 1 338 ? -5.529  -21.659 -1.369  1.00 32.45 ? 338 ASP B OD1   1 
ATOM   6019  O OD2   . ASP B 1 338 ? -6.970  -21.740 -3.018  1.00 28.32 ? 338 ASP B OD2   1 
ATOM   6020  N N     . LYS B 1 339 ? -9.549  -18.273 -0.019  1.00 33.36 ? 339 LYS B N     1 
ATOM   6021  C CA    . LYS B 1 339 ? -10.693 -17.801 0.628   1.00 31.40 ? 339 LYS B CA    1 
ATOM   6022  C C     . LYS B 1 339 ? -11.580 -16.915 -0.300  1.00 30.85 ? 339 LYS B C     1 
ATOM   6023  O O     . LYS B 1 339 ? -12.815 -17.142 -0.379  1.00 28.61 ? 339 LYS B O     1 
ATOM   6024  C CB    . LYS B 1 339 ? -10.297 -17.067 1.879   1.00 31.82 ? 339 LYS B CB    1 
ATOM   6025  C CG    . LYS B 1 339 ? -11.501 -16.437 2.665   1.00 33.65 ? 339 LYS B CG    1 
ATOM   6026  C CD    . LYS B 1 339 ? -11.088 -16.188 4.133   1.00 32.08 ? 339 LYS B CD    1 
ATOM   6027  C CE    . LYS B 1 339 ? -12.284 -15.689 4.954   1.00 34.56 ? 339 LYS B CE    1 
ATOM   6028  N NZ    . LYS B 1 339 ? -11.767 -14.909 6.095   1.00 35.65 ? 339 LYS B NZ    1 
ATOM   6029  N N     . TRP B 1 340 ? -10.964 -15.944 -0.972  1.00 29.61 ? 340 TRP B N     1 
ATOM   6030  C CA    . TRP B 1 340 ? -11.729 -14.921 -1.716  1.00 29.02 ? 340 TRP B CA    1 
ATOM   6031  C C     . TRP B 1 340 ? -11.806 -15.155 -3.208  1.00 28.18 ? 340 TRP B C     1 
ATOM   6032  O O     . TRP B 1 340 ? -12.767 -14.763 -3.870  1.00 28.39 ? 340 TRP B O     1 
ATOM   6033  C CB    . TRP B 1 340 ? -11.213 -13.473 -1.420  1.00 30.21 ? 340 TRP B CB    1 
ATOM   6034  C CG    . TRP B 1 340 ? -11.525 -13.098 0.022   1.00 31.99 ? 340 TRP B CG    1 
ATOM   6035  C CD1   . TRP B 1 340 ? -10.650 -13.036 1.108   1.00 29.92 ? 340 TRP B CD1   1 
ATOM   6036  C CD2   . TRP B 1 340 ? -12.820 -12.843 0.533   1.00 32.55 ? 340 TRP B CD2   1 
ATOM   6037  N NE1   . TRP B 1 340 ? -11.353 -12.755 2.245   1.00 31.68 ? 340 TRP B NE1   1 
ATOM   6038  C CE2   . TRP B 1 340 ? -12.682 -12.600 1.920   1.00 32.43 ? 340 TRP B CE2   1 
ATOM   6039  C CE3   . TRP B 1 340 ? -14.102 -12.756 -0.059  1.00 30.05 ? 340 TRP B CE3   1 
ATOM   6040  C CZ2   . TRP B 1 340 ? -13.794 -12.323 2.751   1.00 31.75 ? 340 TRP B CZ2   1 
ATOM   6041  C CZ3   . TRP B 1 340 ? -15.183 -12.479 0.763   1.00 30.90 ? 340 TRP B CZ3   1 
ATOM   6042  C CH2   . TRP B 1 340 ? -15.026 -12.270 2.146   1.00 28.74 ? 340 TRP B CH2   1 
ATOM   6043  N N     . LEU B 1 341 ? -10.782 -15.756 -3.756  1.00 26.81 ? 341 LEU B N     1 
ATOM   6044  C CA    . LEU B 1 341 ? -10.554 -15.562 -5.171  1.00 29.36 ? 341 LEU B CA    1 
ATOM   6045  C C     . LEU B 1 341 ? -10.827 -16.806 -6.053  1.00 28.91 ? 341 LEU B C     1 
ATOM   6046  O O     . LEU B 1 341 ? -10.596 -16.737 -7.264  1.00 25.33 ? 341 LEU B O     1 
ATOM   6047  C CB    . LEU B 1 341 ? -9.095  -15.071 -5.342  1.00 28.52 ? 341 LEU B CB    1 
ATOM   6048  C CG    . LEU B 1 341 ? -8.844  -13.607 -5.698  1.00 33.42 ? 341 LEU B CG    1 
ATOM   6049  C CD1   . LEU B 1 341 ? -9.978  -12.609 -5.317  1.00 37.09 ? 341 LEU B CD1   1 
ATOM   6050  C CD2   . LEU B 1 341 ? -7.435  -13.147 -5.295  1.00 33.93 ? 341 LEU B CD2   1 
ATOM   6051  N N     . THR B 1 342 ? -11.271 -17.921 -5.408  1.00 29.15 ? 342 THR B N     1 
ATOM   6052  C CA    . THR B 1 342 ? -11.436 -19.141 -6.098  1.00 30.26 ? 342 THR B CA    1 
ATOM   6053  C C     . THR B 1 342 ? -12.583 -19.041 -7.112  1.00 30.47 ? 342 THR B C     1 
ATOM   6054  O O     . THR B 1 342 ? -13.665 -18.610 -6.813  1.00 31.04 ? 342 THR B O     1 
ATOM   6055  C CB    . THR B 1 342 ? -11.408 -20.495 -5.177  1.00 30.95 ? 342 THR B CB    1 
ATOM   6056  O OG1   . THR B 1 342 ? -12.697 -20.953 -4.953  1.00 34.85 ? 342 THR B OG1   1 
ATOM   6057  C CG2   . THR B 1 342 ? -10.760 -20.395 -3.888  1.00 27.91 ? 342 THR B CG2   1 
ATOM   6058  N N     . GLY B 1 343 ? -12.313 -19.432 -8.359  1.00 33.38 ? 343 GLY B N     1 
ATOM   6059  C CA    . GLY B 1 343 ? -13.312 -19.349 -9.420  1.00 33.39 ? 343 GLY B CA    1 
ATOM   6060  C C     . GLY B 1 343 ? -13.210 -18.014 -10.141 1.00 35.61 ? 343 GLY B C     1 
ATOM   6061  O O     . GLY B 1 343 ? -13.878 -17.830 -11.198 1.00 37.93 ? 343 GLY B O     1 
ATOM   6062  N N     . LEU B 1 344 ? -12.422 -17.056 -9.656  1.00 34.90 ? 344 LEU B N     1 
ATOM   6063  C CA    . LEU B 1 344 ? -12.182 -15.927 -10.620 1.00 36.89 ? 344 LEU B CA    1 
ATOM   6064  C C     . LEU B 1 344 ? -10.818 -15.440 -10.868 1.00 34.56 ? 344 LEU B C     1 
ATOM   6065  O O     . LEU B 1 344 ? -10.683 -14.390 -11.450 1.00 34.18 ? 344 LEU B O     1 
ATOM   6066  C CB    . LEU B 1 344 ? -13.145 -14.709 -10.472 1.00 38.90 ? 344 LEU B CB    1 
ATOM   6067  C CG    . LEU B 1 344 ? -13.886 -14.231 -11.813 1.00 39.17 ? 344 LEU B CG    1 
ATOM   6068  C CD1   . LEU B 1 344 ? -13.094 -13.200 -12.612 1.00 29.07 ? 344 LEU B CD1   1 
ATOM   6069  C CD2   . LEU B 1 344 ? -14.485 -15.411 -12.737 1.00 34.27 ? 344 LEU B CD2   1 
ATOM   6070  N N     . ALA B 1 345 ? -9.844  -16.172 -10.368 1.00 33.50 ? 345 ALA B N     1 
ATOM   6071  C CA    . ALA B 1 345 ? -8.446  -15.959 -10.658 1.00 33.84 ? 345 ALA B CA    1 
ATOM   6072  C C     . ALA B 1 345 ? -7.747  -17.312 -10.545 1.00 34.33 ? 345 ALA B C     1 
ATOM   6073  O O     . ALA B 1 345 ? -8.180  -18.218 -9.821  1.00 32.51 ? 345 ALA B O     1 
ATOM   6074  C CB    . ALA B 1 345 ? -7.811  -14.984 -9.659  1.00 32.71 ? 345 ALA B CB    1 
ATOM   6075  N N     . GLU B 1 346 ? -6.650  -17.409 -11.271 1.00 34.29 ? 346 GLU B N     1 
ATOM   6076  C CA    . GLU B 1 346 ? -5.742  -18.543 -11.193 1.00 35.24 ? 346 GLU B CA    1 
ATOM   6077  C C     . GLU B 1 346 ? -4.342  -18.000 -10.757 1.00 34.88 ? 346 GLU B C     1 
ATOM   6078  O O     . GLU B 1 346 ? -4.050  -16.833 -11.039 1.00 33.83 ? 346 GLU B O     1 
ATOM   6079  C CB    . GLU B 1 346 ? -5.744  -19.216 -12.588 1.00 34.81 ? 346 GLU B CB    1 
ATOM   6080  C CG    . GLU B 1 346 ? -7.112  -19.927 -12.782 1.00 36.85 ? 346 GLU B CG    1 
ATOM   6081  C CD    . GLU B 1 346 ? -7.306  -20.545 -14.148 1.00 49.87 ? 346 GLU B CD    1 
ATOM   6082  O OE1   . GLU B 1 346 ? -8.154  -21.505 -14.228 1.00 52.98 ? 346 GLU B OE1   1 
ATOM   6083  O OE2   . GLU B 1 346 ? -6.613  -20.086 -15.130 1.00 52.52 ? 346 GLU B OE2   1 
ATOM   6084  N N     . TRP B 1 347 ? -3.565  -18.826 -10.035 1.00 33.53 ? 347 TRP B N     1 
ATOM   6085  C CA    . TRP B 1 347 ? -2.228  -18.554 -9.522  1.00 34.05 ? 347 TRP B CA    1 
ATOM   6086  C C     . TRP B 1 347 ? -1.532  -19.923 -9.231  1.00 34.26 ? 347 TRP B C     1 
ATOM   6087  O O     . TRP B 1 347 ? -2.192  -20.865 -8.813  1.00 32.72 ? 347 TRP B O     1 
ATOM   6088  C CB    . TRP B 1 347 ? -2.202  -17.683 -8.203  1.00 34.10 ? 347 TRP B CB    1 
ATOM   6089  C CG    . TRP B 1 347 ? -2.979  -18.295 -7.013  1.00 33.41 ? 347 TRP B CG    1 
ATOM   6090  C CD1   . TRP B 1 347 ? -2.472  -19.077 -5.988  1.00 31.82 ? 347 TRP B CD1   1 
ATOM   6091  C CD2   . TRP B 1 347 ? -4.387  -18.213 -6.790  1.00 31.35 ? 347 TRP B CD2   1 
ATOM   6092  N NE1   . TRP B 1 347 ? -3.480  -19.463 -5.151  1.00 33.85 ? 347 TRP B NE1   1 
ATOM   6093  C CE2   . TRP B 1 347 ? -4.671  -18.975 -5.620  1.00 34.49 ? 347 TRP B CE2   1 
ATOM   6094  C CE3   . TRP B 1 347 ? -5.444  -17.627 -7.488  1.00 26.42 ? 347 TRP B CE3   1 
ATOM   6095  C CZ2   . TRP B 1 347 ? -5.982  -19.126 -5.112  1.00 35.75 ? 347 TRP B CZ2   1 
ATOM   6096  C CZ3   . TRP B 1 347 ? -6.740  -17.758 -6.983  1.00 32.00 ? 347 TRP B CZ3   1 
ATOM   6097  C CH2   . TRP B 1 347 ? -6.996  -18.494 -5.794  1.00 35.57 ? 347 TRP B CH2   1 
ATOM   6098  N N     . HIS B 1 348 ? -0.222  -19.991 -9.480  1.00 33.50 ? 348 HIS B N     1 
ATOM   6099  C CA    . HIS B 1 348 ? 0.616   -21.052 -8.970  1.00 34.27 ? 348 HIS B CA    1 
ATOM   6100  C C     . HIS B 1 348 ? 1.168   -20.669 -7.568  1.00 34.25 ? 348 HIS B C     1 
ATOM   6101  O O     . HIS B 1 348 ? 1.241   -19.482 -7.186  1.00 33.77 ? 348 HIS B O     1 
ATOM   6102  C CB    . HIS B 1 348 ? 1.746   -21.408 -9.957  1.00 32.85 ? 348 HIS B CB    1 
ATOM   6103  C CG    . HIS B 1 348 ? 1.258   -21.615 -11.366 1.00 38.91 ? 348 HIS B CG    1 
ATOM   6104  N ND1   . HIS B 1 348 ? 0.576   -22.756 -11.759 1.00 33.76 ? 348 HIS B ND1   1 
ATOM   6105  C CD2   . HIS B 1 348 ? 1.296   -20.799 -12.458 1.00 34.99 ? 348 HIS B CD2   1 
ATOM   6106  C CE1   . HIS B 1 348 ? 0.217   -22.633 -13.030 1.00 35.76 ? 348 HIS B CE1   1 
ATOM   6107  N NE2   . HIS B 1 348 ? 0.648   -21.462 -13.479 1.00 38.06 ? 348 HIS B NE2   1 
ATOM   6108  N N     . VAL B 1 349 ? 1.559   -21.654 -6.795  1.00 33.05 ? 349 VAL B N     1 
ATOM   6109  C CA    . VAL B 1 349 ? 2.089   -21.277 -5.502  1.00 33.06 ? 349 VAL B CA    1 
ATOM   6110  C C     . VAL B 1 349 ? 3.528   -20.911 -5.821  1.00 34.57 ? 349 VAL B C     1 
ATOM   6111  O O     . VAL B 1 349 ? 4.230   -21.668 -6.524  1.00 34.28 ? 349 VAL B O     1 
ATOM   6112  C CB    . VAL B 1 349 ? 1.927   -22.404 -4.324  1.00 32.86 ? 349 VAL B CB    1 
ATOM   6113  C CG1   . VAL B 1 349 ? 0.809   -23.503 -4.641  1.00 30.57 ? 349 VAL B CG1   1 
ATOM   6114  C CG2   . VAL B 1 349 ? 3.259   -22.957 -3.827  1.00 27.55 ? 349 VAL B CG2   1 
ATOM   6115  N N     . PRO B 1 350 ? 3.959   -19.756 -5.303  1.00 35.27 ? 350 PRO B N     1 
ATOM   6116  C CA    . PRO B 1 350 ? 5.322   -19.234 -5.429  1.00 35.94 ? 350 PRO B CA    1 
ATOM   6117  C C     . PRO B 1 350 ? 6.305   -20.249 -4.850  1.00 36.39 ? 350 PRO B C     1 
ATOM   6118  O O     . PRO B 1 350 ? 6.120   -20.714 -3.714  1.00 37.89 ? 350 PRO B O     1 
ATOM   6119  C CB    . PRO B 1 350 ? 5.313   -17.930 -4.558  1.00 35.56 ? 350 PRO B CB    1 
ATOM   6120  C CG    . PRO B 1 350 ? 3.812   -17.556 -4.356  1.00 33.13 ? 350 PRO B CG    1 
ATOM   6121  C CD    . PRO B 1 350 ? 3.092   -18.931 -4.422  1.00 35.67 ? 350 PRO B CD    1 
ATOM   6122  N N     . ALA B 1 351 ? 7.331   -20.576 -5.638  1.00 35.91 ? 351 ALA B N     1 
ATOM   6123  C CA    . ALA B 1 351 ? 8.389   -21.565 -5.309  1.00 34.19 ? 351 ALA B CA    1 
ATOM   6124  C C     . ALA B 1 351 ? 9.551   -20.906 -4.503  1.00 33.48 ? 351 ALA B C     1 
ATOM   6125  O O     . ALA B 1 351 ? 10.340  -21.591 -3.834  1.00 32.50 ? 351 ALA B O     1 
ATOM   6126  C CB    . ALA B 1 351 ? 8.912   -22.143 -6.582  1.00 32.02 ? 351 ALA B CB    1 
ATOM   6127  N N     . ALA B 1 352 ? 9.604   -19.563 -4.546  1.00 32.16 ? 352 ALA B N     1 
ATOM   6128  C CA    . ALA B 1 352 ? 10.651  -18.788 -3.876  1.00 30.44 ? 352 ALA B CA    1 
ATOM   6129  C C     . ALA B 1 352 ? 10.232  -17.255 -3.928  1.00 30.66 ? 352 ALA B C     1 
ATOM   6130  O O     . ALA B 1 352 ? 9.175   -16.886 -4.524  1.00 30.24 ? 352 ALA B O     1 
ATOM   6131  C CB    . ALA B 1 352 ? 12.028  -19.060 -4.572  1.00 29.91 ? 352 ALA B CB    1 
ATOM   6132  N N     . GLY B 1 353 ? 10.957  -16.388 -3.247  1.00 28.64 ? 353 GLY B N     1 
ATOM   6133  C CA    . GLY B 1 353 ? 10.653  -14.992 -3.406  1.00 30.35 ? 353 GLY B CA    1 
ATOM   6134  C C     . GLY B 1 353 ? 9.580   -14.445 -2.493  1.00 31.87 ? 353 GLY B C     1 
ATOM   6135  O O     . GLY B 1 353 ? 9.315   -15.036 -1.431  1.00 32.72 ? 353 GLY B O     1 
ATOM   6136  N N     . MET B 1 354 ? 9.031   -13.280 -2.886  1.00 31.40 ? 354 MET B N     1 
ATOM   6137  C CA    . MET B 1 354 ? 8.035   -12.541 -2.080  1.00 31.87 ? 354 MET B CA    1 
ATOM   6138  C C     . MET B 1 354 ? 6.849   -12.094 -2.871  1.00 31.32 ? 354 MET B C     1 
ATOM   6139  O O     . MET B 1 354 ? 6.119   -11.228 -2.414  1.00 32.26 ? 354 MET B O     1 
ATOM   6140  C CB    . MET B 1 354 ? 8.651   -11.303 -1.320  1.00 31.25 ? 354 MET B CB    1 
ATOM   6141  C CG    . MET B 1 354 ? 9.725   -10.639 -2.100  1.00 28.25 ? 354 MET B CG    1 
ATOM   6142  S SD    . MET B 1 354 ? 10.494  -9.046  -1.714  1.00 34.78 ? 354 MET B SD    1 
ATOM   6143  C CE    . MET B 1 354 ? 11.236  -9.421  -0.201  1.00 36.46 ? 354 MET B CE    1 
ATOM   6144  N N     . PHE B 1 355 ? 6.637   -12.676 -4.050  1.00 31.68 ? 355 PHE B N     1 
ATOM   6145  C CA    . PHE B 1 355 ? 5.474   -12.314 -4.849  1.00 30.18 ? 355 PHE B CA    1 
ATOM   6146  C C     . PHE B 1 355 ? 4.469   -13.428 -5.194  1.00 31.24 ? 355 PHE B C     1 
ATOM   6147  O O     . PHE B 1 355 ? 4.843   -14.598 -5.449  1.00 29.33 ? 355 PHE B O     1 
ATOM   6148  C CB    . PHE B 1 355 ? 5.971   -11.673 -6.129  1.00 30.33 ? 355 PHE B CB    1 
ATOM   6149  C CG    . PHE B 1 355 ? 6.854   -10.448 -5.894  1.00 23.95 ? 355 PHE B CG    1 
ATOM   6150  C CD1   . PHE B 1 355 ? 6.315   -9.297  -5.333  1.00 24.99 ? 355 PHE B CD1   1 
ATOM   6151  C CD2   . PHE B 1 355 ? 8.192   -10.470 -6.249  1.00 17.17 ? 355 PHE B CD2   1 
ATOM   6152  C CE1   . PHE B 1 355 ? 7.111   -8.166  -5.117  1.00 25.47 ? 355 PHE B CE1   1 
ATOM   6153  C CE2   . PHE B 1 355 ? 9.001   -9.375  -6.071  1.00 20.47 ? 355 PHE B CE2   1 
ATOM   6154  C CZ    . PHE B 1 355 ? 8.455   -8.192  -5.473  1.00 23.68 ? 355 PHE B CZ    1 
ATOM   6155  N N     . LEU B 1 356 ? 3.190   -13.041 -5.210  1.00 30.35 ? 356 LEU B N     1 
ATOM   6156  C CA    . LEU B 1 356 ? 2.169   -13.870 -5.827  1.00 30.23 ? 356 LEU B CA    1 
ATOM   6157  C C     . LEU B 1 356 ? 1.717   -13.270 -7.163  1.00 30.31 ? 356 LEU B C     1 
ATOM   6158  O O     . LEU B 1 356 ? 1.440   -12.050 -7.243  1.00 33.85 ? 356 LEU B O     1 
ATOM   6159  C CB    . LEU B 1 356 ? 0.994   -14.096 -4.869  1.00 30.16 ? 356 LEU B CB    1 
ATOM   6160  C CG    . LEU B 1 356 ? -0.184  -15.045 -5.279  1.00 29.92 ? 356 LEU B CG    1 
ATOM   6161  C CD1   . LEU B 1 356 ? 0.162   -16.504 -5.218  1.00 23.61 ? 356 LEU B CD1   1 
ATOM   6162  C CD2   . LEU B 1 356 ? -1.492  -14.710 -4.491  1.00 28.65 ? 356 LEU B CD2   1 
ATOM   6163  N N     . TRP B 1 357 ? 1.693   -14.102 -8.198  1.00 29.83 ? 357 TRP B N     1 
ATOM   6164  C CA    . TRP B 1 357 ? 1.266   -13.738 -9.571  1.00 29.37 ? 357 TRP B CA    1 
ATOM   6165  C C     . TRP B 1 357 ? -0.095  -14.329 -9.880  1.00 29.14 ? 357 TRP B C     1 
ATOM   6166  O O     . TRP B 1 357 ? -0.242  -15.542 -9.928  1.00 27.44 ? 357 TRP B O     1 
ATOM   6167  C CB    . TRP B 1 357 ? 2.279   -14.306 -10.544 1.00 29.12 ? 357 TRP B CB    1 
ATOM   6168  C CG    . TRP B 1 357 ? 2.204   -13.938 -12.015 1.00 26.96 ? 357 TRP B CG    1 
ATOM   6169  C CD1   . TRP B 1 357 ? 2.171   -14.823 -13.080 1.00 26.86 ? 357 TRP B CD1   1 
ATOM   6170  C CD2   . TRP B 1 357 ? 2.261   -12.607 -12.600 1.00 27.40 ? 357 TRP B CD2   1 
ATOM   6171  N NE1   . TRP B 1 357 ? 2.202   -14.114 -14.284 1.00 31.46 ? 357 TRP B NE1   1 
ATOM   6172  C CE2   . TRP B 1 357 ? 2.265   -12.763 -14.023 1.00 30.46 ? 357 TRP B CE2   1 
ATOM   6173  C CE3   . TRP B 1 357 ? 2.343   -11.323 -12.076 1.00 24.16 ? 357 TRP B CE3   1 
ATOM   6174  C CZ2   . TRP B 1 357 ? 2.283   -11.646 -14.922 1.00 31.66 ? 357 TRP B CZ2   1 
ATOM   6175  C CZ3   . TRP B 1 357 ? 2.366   -10.221 -12.963 1.00 29.55 ? 357 TRP B CZ3   1 
ATOM   6176  C CH2   . TRP B 1 357 ? 2.360   -10.401 -14.379 1.00 27.22 ? 357 TRP B CH2   1 
ATOM   6177  N N     . ILE B 1 358 ? -1.099  -13.468 -10.031 1.00 30.83 ? 358 ILE B N     1 
ATOM   6178  C CA    . ILE B 1 358 ? -2.480  -13.924 -10.125 1.00 31.31 ? 358 ILE B CA    1 
ATOM   6179  C C     . ILE B 1 358 ? -3.206  -13.521 -11.417 1.00 32.31 ? 358 ILE B C     1 
ATOM   6180  O O     . ILE B 1 358 ? -3.323  -12.354 -11.766 1.00 33.86 ? 358 ILE B O     1 
ATOM   6181  C CB    . ILE B 1 358 ? -3.332  -13.647 -8.784  1.00 33.79 ? 358 ILE B CB    1 
ATOM   6182  C CG1   . ILE B 1 358 ? -4.414  -12.583 -8.935  1.00 32.33 ? 358 ILE B CG1   1 
ATOM   6183  C CG2   . ILE B 1 358 ? -2.453  -13.462 -7.527  1.00 27.12 ? 358 ILE B CG2   1 
ATOM   6184  C CD1   . ILE B 1 358 ? -5.717  -13.218 -9.448  1.00 37.24 ? 358 ILE B CD1   1 
ATOM   6185  N N     . LYS B 1 359 ? -3.652  -14.523 -12.164 1.00 33.53 ? 359 LYS B N     1 
ATOM   6186  C CA    . LYS B 1 359 ? -4.442  -14.296 -13.345 1.00 32.40 ? 359 LYS B CA    1 
ATOM   6187  C C     . LYS B 1 359 ? -5.936  -14.155 -13.029 1.00 32.86 ? 359 LYS B C     1 
ATOM   6188  O O     . LYS B 1 359 ? -6.578  -15.158 -12.731 1.00 32.52 ? 359 LYS B O     1 
ATOM   6189  C CB    . LYS B 1 359 ? -4.191  -15.403 -14.415 1.00 31.81 ? 359 LYS B CB    1 
ATOM   6190  C CG    . LYS B 1 359 ? -4.618  -14.916 -15.831 1.00 31.26 ? 359 LYS B CG    1 
ATOM   6191  C CD    . LYS B 1 359 ? -4.789  -16.015 -16.868 1.00 33.24 ? 359 LYS B CD    1 
ATOM   6192  C CE    . LYS B 1 359 ? -5.294  -15.376 -18.212 1.00 37.89 ? 359 LYS B CE    1 
ATOM   6193  N NZ    . LYS B 1 359 ? -6.859  -14.907 -18.071 1.00 41.91 ? 359 LYS B NZ    1 
ATOM   6194  N N     . VAL B 1 360 ? -6.497  -12.938 -13.195 1.00 32.72 ? 360 VAL B N     1 
ATOM   6195  C CA    . VAL B 1 360 ? -7.914  -12.737 -13.036 1.00 33.43 ? 360 VAL B CA    1 
ATOM   6196  C C     . VAL B 1 360 ? -8.709  -13.197 -14.254 1.00 34.89 ? 360 VAL B C     1 
ATOM   6197  O O     . VAL B 1 360 ? -8.225  -13.036 -15.437 1.00 32.45 ? 360 VAL B O     1 
ATOM   6198  C CB    . VAL B 1 360 ? -8.323  -11.318 -12.527 1.00 34.45 ? 360 VAL B CB    1 
ATOM   6199  C CG1   . VAL B 1 360 ? -7.135  -10.553 -11.818 1.00 34.43 ? 360 VAL B CG1   1 
ATOM   6200  C CG2   . VAL B 1 360 ? -9.006  -10.524 -13.560 1.00 37.69 ? 360 VAL B CG2   1 
ATOM   6201  N N     . LYS B 1 361 ? -9.908  -13.770 -13.979 1.00 33.93 ? 361 LYS B N     1 
ATOM   6202  C CA    . LYS B 1 361 ? -10.622 -14.495 -15.035 1.00 37.16 ? 361 LYS B CA    1 
ATOM   6203  C C     . LYS B 1 361 ? -11.459 -13.776 -16.063 1.00 38.79 ? 361 LYS B C     1 
ATOM   6204  O O     . LYS B 1 361 ? -11.297 -14.052 -17.256 1.00 41.27 ? 361 LYS B O     1 
ATOM   6205  C CB    . LYS B 1 361 ? -11.222 -15.872 -14.612 1.00 35.93 ? 361 LYS B CB    1 
ATOM   6206  C CG    . LYS B 1 361 ? -10.080 -16.748 -14.129 1.00 36.13 ? 361 LYS B CG    1 
ATOM   6207  C CD    . LYS B 1 361 ? -10.426 -18.135 -13.583 1.00 38.02 ? 361 LYS B CD    1 
ATOM   6208  C CE    . LYS B 1 361 ? -11.000 -18.992 -14.686 1.00 38.48 ? 361 LYS B CE    1 
ATOM   6209  N NZ    . LYS B 1 361 ? -12.439 -18.614 -14.766 1.00 42.72 ? 361 LYS B NZ    1 
ATOM   6210  N N     . GLY B 1 362 ? -12.370 -12.898 -15.774 1.00 40.04 ? 362 GLY B N     1 
ATOM   6211  C CA    . GLY B 1 362 ? -13.116 -12.556 -17.056 1.00 41.55 ? 362 GLY B CA    1 
ATOM   6212  C C     . GLY B 1 362 ? -12.838 -11.147 -17.535 1.00 42.17 ? 362 GLY B C     1 
ATOM   6213  O O     . GLY B 1 362 ? -13.756 -10.409 -17.842 1.00 43.68 ? 362 GLY B O     1 
ATOM   6214  N N     . ILE B 1 363 ? -11.567 -10.754 -17.493 1.00 43.02 ? 363 ILE B N     1 
ATOM   6215  C CA    . ILE B 1 363 ? -11.116 -9.363  -17.640 1.00 42.39 ? 363 ILE B CA    1 
ATOM   6216  C C     . ILE B 1 363 ? -9.868  -9.359  -18.552 1.00 43.54 ? 363 ILE B C     1 
ATOM   6217  O O     . ILE B 1 363 ? -8.922  -10.141 -18.371 1.00 42.58 ? 363 ILE B O     1 
ATOM   6218  C CB    . ILE B 1 363 ? -10.862 -8.680  -16.257 1.00 42.54 ? 363 ILE B CB    1 
ATOM   6219  C CG1   . ILE B 1 363 ? -12.137 -8.753  -15.393 1.00 41.77 ? 363 ILE B CG1   1 
ATOM   6220  C CG2   . ILE B 1 363 ? -10.523 -7.141  -16.437 1.00 42.23 ? 363 ILE B CG2   1 
ATOM   6221  C CD1   . ILE B 1 363 ? -12.006 -8.389  -13.908 1.00 39.93 ? 363 ILE B CD1   1 
ATOM   6222  N N     . ASN B 1 364 ? -9.933  -8.550  -19.596 1.00 44.13 ? 364 ASN B N     1 
ATOM   6223  C CA    . ASN B 1 364 ? -8.854  -8.446  -20.552 1.00 45.03 ? 364 ASN B CA    1 
ATOM   6224  C C     . ASN B 1 364 ? -7.703  -7.588  -19.999 1.00 44.53 ? 364 ASN B C     1 
ATOM   6225  O O     . ASN B 1 364 ? -6.520  -7.993  -20.048 1.00 42.58 ? 364 ASN B O     1 
ATOM   6226  C CB    . ASN B 1 364 ? -9.361  -7.882  -21.893 1.00 46.17 ? 364 ASN B CB    1 
ATOM   6227  C CG    . ASN B 1 364 ? -10.121 -8.942  -22.748 1.00 52.18 ? 364 ASN B CG    1 
ATOM   6228  O OD1   . ASN B 1 364 ? -10.204 -10.149 -22.392 1.00 54.07 ? 364 ASN B OD1   1 
ATOM   6229  N ND2   . ASN B 1 364 ? -10.703 -8.474  -23.887 1.00 55.72 ? 364 ASN B ND2   1 
ATOM   6230  N N     . ASP B 1 365 ? -8.046  -6.419  -19.458 1.00 44.54 ? 365 ASP B N     1 
ATOM   6231  C CA    . ASP B 1 365 ? -7.029  -5.588  -18.791 1.00 45.15 ? 365 ASP B CA    1 
ATOM   6232  C C     . ASP B 1 365 ? -7.318  -5.221  -17.293 1.00 44.76 ? 365 ASP B C     1 
ATOM   6233  O O     . ASP B 1 365 ? -8.390  -4.748  -16.932 1.00 42.87 ? 365 ASP B O     1 
ATOM   6234  C CB    . ASP B 1 365 ? -6.700  -4.386  -19.662 1.00 44.63 ? 365 ASP B CB    1 
ATOM   6235  C CG    . ASP B 1 365 ? -5.409  -3.699  -19.256 1.00 48.13 ? 365 ASP B CG    1 
ATOM   6236  O OD1   . ASP B 1 365 ? -5.439  -2.450  -19.211 1.00 52.69 ? 365 ASP B OD1   1 
ATOM   6237  O OD2   . ASP B 1 365 ? -4.367  -4.372  -19.019 1.00 47.31 ? 365 ASP B OD2   1 
ATOM   6238  N N     . VAL B 1 366 ? -6.349  -5.472  -16.436 1.00 45.45 ? 366 VAL B N     1 
ATOM   6239  C CA    . VAL B 1 366 ? -6.551  -5.296  -14.998 1.00 47.32 ? 366 VAL B CA    1 
ATOM   6240  C C     . VAL B 1 366 ? -6.109  -3.862  -14.513 1.00 48.14 ? 366 VAL B C     1 
ATOM   6241  O O     . VAL B 1 366 ? -6.140  -3.543  -13.313 1.00 49.26 ? 366 VAL B O     1 
ATOM   6242  C CB    . VAL B 1 366 ? -5.911  -6.534  -14.226 1.00 46.92 ? 366 VAL B CB    1 
ATOM   6243  C CG1   . VAL B 1 366 ? -4.443  -6.594  -14.417 1.00 45.46 ? 366 VAL B CG1   1 
ATOM   6244  C CG2   . VAL B 1 366 ? -6.190  -6.542  -12.719 1.00 50.15 ? 366 VAL B CG2   1 
ATOM   6245  N N     . LYS B 1 367 ? -5.730  -3.000  -15.463 1.00 48.83 ? 367 LYS B N     1 
ATOM   6246  C CA    . LYS B 1 367 ? -5.180  -1.648  -15.186 1.00 48.93 ? 367 LYS B CA    1 
ATOM   6247  C C     . LYS B 1 367 ? -6.198  -0.726  -14.487 1.00 48.43 ? 367 LYS B C     1 
ATOM   6248  O O     . LYS B 1 367 ? -5.884  -0.125  -13.470 1.00 47.83 ? 367 LYS B O     1 
ATOM   6249  C CB    . LYS B 1 367 ? -4.661  -0.979  -16.492 1.00 48.87 ? 367 LYS B CB    1 
ATOM   6250  C CG    . LYS B 1 367 ? -3.297  -0.218  -16.407 1.00 50.72 ? 367 LYS B CG    1 
ATOM   6251  C CD    . LYS B 1 367 ? -2.954  0.589   -17.730 1.00 51.74 ? 367 LYS B CD    1 
ATOM   6252  C CE    . LYS B 1 367 ? -3.354  2.112   -17.694 1.00 58.85 ? 367 LYS B CE    1 
ATOM   6253  N NZ    . LYS B 1 367 ? -2.231  3.107   -17.391 1.00 58.60 ? 367 LYS B NZ    1 
ATOM   6254  N N     . GLU B 1 368 ? -7.411  -0.601  -15.038 1.00 48.45 ? 368 GLU B N     1 
ATOM   6255  C CA    . GLU B 1 368 ? -8.448  0.305   -14.486 1.00 47.74 ? 368 GLU B CA    1 
ATOM   6256  C C     . GLU B 1 368 ? -8.997  -0.192  -13.171 1.00 46.50 ? 368 GLU B C     1 
ATOM   6257  O O     . GLU B 1 368 ? -9.434  0.593   -12.302 1.00 46.12 ? 368 GLU B O     1 
ATOM   6258  C CB    . GLU B 1 368 ? -9.632  0.372   -15.448 1.00 48.94 ? 368 GLU B CB    1 
ATOM   6259  C CG    . GLU B 1 368 ? -9.299  1.059   -16.740 1.00 54.59 ? 368 GLU B CG    1 
ATOM   6260  C CD    . GLU B 1 368 ? -8.416  0.238   -17.679 1.00 58.01 ? 368 GLU B CD    1 
ATOM   6261  O OE1   . GLU B 1 368 ? -8.262  -0.996  -17.453 1.00 58.22 ? 368 GLU B OE1   1 
ATOM   6262  O OE2   . GLU B 1 368 ? -7.898  0.856   -18.653 1.00 59.45 ? 368 GLU B OE2   1 
ATOM   6263  N N     . LEU B 1 369 ? -9.019  -1.521  -13.046 1.00 44.39 ? 369 LEU B N     1 
ATOM   6264  C CA    . LEU B 1 369 ? -9.653  -2.149  -11.929 1.00 42.67 ? 369 LEU B CA    1 
ATOM   6265  C C     . LEU B 1 369 ? -8.835  -1.771  -10.703 1.00 41.50 ? 369 LEU B C     1 
ATOM   6266  O O     . LEU B 1 369 ? -9.415  -1.457  -9.674  1.00 40.22 ? 369 LEU B O     1 
ATOM   6267  C CB    . LEU B 1 369 ? -9.784  -3.665  -12.132 1.00 42.36 ? 369 LEU B CB    1 
ATOM   6268  C CG    . LEU B 1 369 ? -9.583  -4.670  -10.980 1.00 42.65 ? 369 LEU B CG    1 
ATOM   6269  C CD1   . LEU B 1 369 ? -10.569 -4.576  -9.872  1.00 39.60 ? 369 LEU B CD1   1 
ATOM   6270  C CD2   . LEU B 1 369 ? -9.490  -6.130  -11.484 1.00 44.36 ? 369 LEU B CD2   1 
ATOM   6271  N N     . ILE B 1 370 ? -7.508  -1.778  -10.850 1.00 40.57 ? 370 ILE B N     1 
ATOM   6272  C CA    . ILE B 1 370 ? -6.591  -1.481  -9.765  1.00 41.37 ? 370 ILE B CA    1 
ATOM   6273  C C     . ILE B 1 370 ? -6.376  -0.008  -9.534  1.00 42.48 ? 370 ILE B C     1 
ATOM   6274  O O     . ILE B 1 370 ? -6.709  0.532   -8.441  1.00 41.42 ? 370 ILE B O     1 
ATOM   6275  C CB    . ILE B 1 370 ? -5.215  -2.195  -9.913  1.00 41.49 ? 370 ILE B CB    1 
ATOM   6276  C CG1   . ILE B 1 370 ? -5.423  -3.657  -10.285 1.00 39.82 ? 370 ILE B CG1   1 
ATOM   6277  C CG2   . ILE B 1 370 ? -4.559  -2.206  -8.598  1.00 42.22 ? 370 ILE B CG2   1 
ATOM   6278  C CD1   . ILE B 1 370 ? -6.149  -4.463  -9.131  1.00 44.73 ? 370 ILE B CD1   1 
ATOM   6279  N N     . GLU B 1 371 ? -5.926  0.631   -10.598 1.00 43.08 ? 371 GLU B N     1 
ATOM   6280  C CA    . GLU B 1 371 ? -5.378  1.982   -10.539 1.00 46.19 ? 371 GLU B CA    1 
ATOM   6281  C C     . GLU B 1 371 ? -6.500  3.000   -10.320 1.00 45.95 ? 371 GLU B C     1 
ATOM   6282  O O     . GLU B 1 371 ? -6.225  4.189   -10.126 1.00 46.70 ? 371 GLU B O     1 
ATOM   6283  C CB    . GLU B 1 371 ? -4.606  2.288   -11.843 1.00 44.46 ? 371 GLU B CB    1 
ATOM   6284  C CG    . GLU B 1 371 ? -5.539  2.904   -12.871 1.00 47.55 ? 371 GLU B CG    1 
ATOM   6285  C CD    . GLU B 1 371 ? -4.970  3.031   -14.304 1.00 50.26 ? 371 GLU B CD    1 
ATOM   6286  O OE1   . GLU B 1 371 ? -5.804  2.771   -15.246 1.00 51.77 ? 371 GLU B OE1   1 
ATOM   6287  O OE2   . GLU B 1 371 ? -3.733  3.371   -14.465 1.00 50.88 ? 371 GLU B OE2   1 
ATOM   6288  N N     . GLU B 1 372 ? -7.758  2.515   -10.347 1.00 46.50 ? 372 GLU B N     1 
ATOM   6289  C CA    . GLU B 1 372 ? -8.954  3.351   -10.309 1.00 45.43 ? 372 GLU B CA    1 
ATOM   6290  C C     . GLU B 1 372 ? -9.987  2.817   -9.343  1.00 44.67 ? 372 GLU B C     1 
ATOM   6291  O O     . GLU B 1 372 ? -10.459 3.550   -8.507  1.00 44.43 ? 372 GLU B O     1 
ATOM   6292  C CB    . GLU B 1 372 ? -9.672  3.392   -11.662 1.00 44.63 ? 372 GLU B CB    1 
ATOM   6293  C CG    . GLU B 1 372 ? -8.858  3.768   -12.827 1.00 48.96 ? 372 GLU B CG    1 
ATOM   6294  C CD    . GLU B 1 372 ? -9.721  4.409   -13.915 1.00 54.30 ? 372 GLU B CD    1 
ATOM   6295  O OE1   . GLU B 1 372 ? -10.759 5.049   -13.549 1.00 57.13 ? 372 GLU B OE1   1 
ATOM   6296  O OE2   . GLU B 1 372 ? -9.372  4.246   -15.110 1.00 53.27 ? 372 GLU B OE2   1 
ATOM   6297  N N     . LYS B 1 373 ? -10.414 1.566   -9.534  1.00 44.10 ? 373 LYS B N     1 
ATOM   6298  C CA    . LYS B 1 373 ? -11.442 0.957   -8.677  1.00 42.75 ? 373 LYS B CA    1 
ATOM   6299  C C     . LYS B 1 373 ? -10.788 0.596   -7.358  1.00 42.24 ? 373 LYS B C     1 
ATOM   6300  O O     . LYS B 1 373 ? -11.227 1.060   -6.299  1.00 42.89 ? 373 LYS B O     1 
ATOM   6301  C CB    . LYS B 1 373 ? -12.049 -0.308  -9.287  1.00 43.75 ? 373 LYS B CB    1 
ATOM   6302  C CG    . LYS B 1 373 ? -12.956 -0.134  -10.507 1.00 43.54 ? 373 LYS B CG    1 
ATOM   6303  C CD    . LYS B 1 373 ? -13.436 -1.488  -11.003 1.00 43.85 ? 373 LYS B CD    1 
ATOM   6304  C CE    . LYS B 1 373 ? -14.237 -1.405  -12.354 1.00 47.56 ? 373 LYS B CE    1 
ATOM   6305  N NZ    . LYS B 1 373 ? -15.632 -0.857  -12.229 1.00 49.40 ? 373 LYS B NZ    1 
ATOM   6306  N N     . ALA B 1 374 ? -9.722  -0.199  -7.401  1.00 40.24 ? 374 ALA B N     1 
ATOM   6307  C CA    . ALA B 1 374 ? -9.185  -0.714  -6.127  1.00 39.09 ? 374 ALA B CA    1 
ATOM   6308  C C     . ALA B 1 374 ? -8.580  0.412   -5.248  1.00 37.51 ? 374 ALA B C     1 
ATOM   6309  O O     . ALA B 1 374 ? -8.836  0.439   -4.068  1.00 36.62 ? 374 ALA B O     1 
ATOM   6310  C CB    . ALA B 1 374 ? -8.168  -1.952  -6.341  1.00 37.22 ? 374 ALA B CB    1 
ATOM   6311  N N     . VAL B 1 375 ? -7.805  1.334   -5.835  1.00 37.36 ? 375 VAL B N     1 
ATOM   6312  C CA    . VAL B 1 375 ? -7.220  2.487   -5.121  1.00 37.84 ? 375 VAL B CA    1 
ATOM   6313  C C     . VAL B 1 375 ? -8.247  3.289   -4.326  1.00 38.83 ? 375 VAL B C     1 
ATOM   6314  O O     . VAL B 1 375 ? -8.023  3.590   -3.146  1.00 38.03 ? 375 VAL B O     1 
ATOM   6315  C CB    . VAL B 1 375 ? -6.319  3.438   -6.041  1.00 40.18 ? 375 VAL B CB    1 
ATOM   6316  C CG1   . VAL B 1 375 ? -6.920  3.660   -7.370  1.00 37.64 ? 375 VAL B CG1   1 
ATOM   6317  C CG2   . VAL B 1 375 ? -5.999  4.836   -5.343  1.00 36.37 ? 375 VAL B CG2   1 
ATOM   6318  N N     . LYS B 1 376 ? -9.389  3.536   -4.943  1.00 39.80 ? 376 LYS B N     1 
ATOM   6319  C CA    . LYS B 1 376 ? -10.539 4.187   -4.317  1.00 42.80 ? 376 LYS B CA    1 
ATOM   6320  C C     . LYS B 1 376 ? -11.164 3.389   -3.138  1.00 43.86 ? 376 LYS B C     1 
ATOM   6321  O O     . LYS B 1 376 ? -11.856 3.957   -2.310  1.00 43.18 ? 376 LYS B O     1 
ATOM   6322  C CB    . LYS B 1 376 ? -11.594 4.400   -5.401  1.00 44.14 ? 376 LYS B CB    1 
ATOM   6323  C CG    . LYS B 1 376 ? -12.293 5.744   -5.491  1.00 47.75 ? 376 LYS B CG    1 
ATOM   6324  C CD    . LYS B 1 376 ? -12.717 5.963   -6.968  1.00 52.15 ? 376 LYS B CD    1 
ATOM   6325  C CE    . LYS B 1 376 ? -11.578 6.601   -7.852  1.00 55.12 ? 376 LYS B CE    1 
ATOM   6326  N NZ    . LYS B 1 376 ? -10.220 5.852   -7.834  1.00 52.12 ? 376 LYS B NZ    1 
ATOM   6327  N N     . MET B 1 377 ? -10.945 2.062   -3.097  1.00 44.12 ? 377 MET B N     1 
ATOM   6328  C CA    . MET B 1 377 ? -11.368 1.197   -1.987  1.00 43.49 ? 377 MET B CA    1 
ATOM   6329  C C     . MET B 1 377 ? -10.228 1.067   -1.017  1.00 43.31 ? 377 MET B C     1 
ATOM   6330  O O     . MET B 1 377 ? -10.310 0.265   -0.107  1.00 43.56 ? 377 MET B O     1 
ATOM   6331  C CB    . MET B 1 377 ? -11.656 -0.240  -2.488  1.00 44.08 ? 377 MET B CB    1 
ATOM   6332  C CG    . MET B 1 377 ? -12.785 -0.424  -3.484  1.00 46.22 ? 377 MET B CG    1 
ATOM   6333  S SD    . MET B 1 377 ? -14.364 -0.087  -2.719  1.00 58.29 ? 377 MET B SD    1 
ATOM   6334  C CE    . MET B 1 377 ? -14.505 -1.350  -1.438  1.00 56.58 ? 377 MET B CE    1 
ATOM   6335  N N     . GLY B 1 378 ? -9.130  1.778   -1.263  1.00 43.37 ? 378 GLY B N     1 
ATOM   6336  C CA    . GLY B 1 378 ? -7.947  1.775   -0.364  1.00 41.47 ? 378 GLY B CA    1 
ATOM   6337  C C     . GLY B 1 378 ? -7.177  0.454   -0.302  1.00 40.62 ? 378 GLY B C     1 
ATOM   6338  O O     . GLY B 1 378 ? -6.774  -0.009  0.796   1.00 38.93 ? 378 GLY B O     1 
ATOM   6339  N N     . VAL B 1 379 ? -7.054  -0.191  -1.468  1.00 39.43 ? 379 VAL B N     1 
ATOM   6340  C CA    . VAL B 1 379 ? -6.180  -1.353  -1.634  1.00 37.43 ? 379 VAL B CA    1 
ATOM   6341  C C     . VAL B 1 379 ? -5.429  -1.203  -2.980  1.00 38.33 ? 379 VAL B C     1 
ATOM   6342  O O     . VAL B 1 379 ? -6.031  -0.863  -3.991  1.00 37.28 ? 379 VAL B O     1 
ATOM   6343  C CB    . VAL B 1 379 ? -6.849  -2.781  -1.323  1.00 37.24 ? 379 VAL B CB    1 
ATOM   6344  C CG1   . VAL B 1 379 ? -8.170  -2.637  -0.582  1.00 35.31 ? 379 VAL B CG1   1 
ATOM   6345  C CG2   . VAL B 1 379 ? -6.928  -3.727  -2.534  1.00 33.32 ? 379 VAL B CG2   1 
ATOM   6346  N N     . LEU B 1 380 ? -4.103  -1.329  -2.911  1.00 37.95 ? 380 LEU B N     1 
ATOM   6347  C CA    . LEU B 1 380 ? -3.240  -1.359  -4.072  1.00 40.19 ? 380 LEU B CA    1 
ATOM   6348  C C     . LEU B 1 380 ? -2.677  -2.758  -4.318  1.00 40.51 ? 380 LEU B C     1 
ATOM   6349  O O     . LEU B 1 380 ? -2.354  -3.477  -3.373  1.00 39.24 ? 380 LEU B O     1 
ATOM   6350  C CB    . LEU B 1 380 ? -2.077  -0.405  -3.904  1.00 40.09 ? 380 LEU B CB    1 
ATOM   6351  C CG    . LEU B 1 380 ? -2.300  1.046   -3.481  1.00 41.09 ? 380 LEU B CG    1 
ATOM   6352  C CD1   . LEU B 1 380 ? -0.944  1.669   -3.506  1.00 39.43 ? 380 LEU B CD1   1 
ATOM   6353  C CD2   . LEU B 1 380 ? -3.292  1.835   -4.388  1.00 45.30 ? 380 LEU B CD2   1 
ATOM   6354  N N     . MET B 1 381 ? -2.623  -3.131  -5.601  1.00 41.25 ? 381 MET B N     1 
ATOM   6355  C CA    . MET B 1 381 ? -1.779  -4.204  -6.079  1.00 42.77 ? 381 MET B CA    1 
ATOM   6356  C C     . MET B 1 381 ? -1.224  -3.770  -7.405  1.00 40.39 ? 381 MET B C     1 
ATOM   6357  O O     . MET B 1 381 ? -1.589  -2.715  -7.896  1.00 41.71 ? 381 MET B O     1 
ATOM   6358  C CB    . MET B 1 381 ? -2.578  -5.500  -6.132  1.00 43.95 ? 381 MET B CB    1 
ATOM   6359  C CG    . MET B 1 381 ? -3.406  -5.618  -4.850  1.00 44.27 ? 381 MET B CG    1 
ATOM   6360  S SD    . MET B 1 381 ? -4.499  -7.006  -4.844  1.00 51.00 ? 381 MET B SD    1 
ATOM   6361  C CE    . MET B 1 381 ? -3.379  -8.304  -5.336  1.00 40.39 ? 381 MET B CE    1 
ATOM   6362  N N     . LEU B 1 382 ? -0.299  -4.541  -7.955  1.00 37.87 ? 382 LEU B N     1 
ATOM   6363  C CA    . LEU B 1 382 ? 0.451   -4.173  -9.146  1.00 36.20 ? 382 LEU B CA    1 
ATOM   6364  C C     . LEU B 1 382 ? 0.064   -4.950  -10.478 1.00 35.58 ? 382 LEU B C     1 
ATOM   6365  O O     . LEU B 1 382 ? 0.453   -6.121  -10.638 1.00 36.72 ? 382 LEU B O     1 
ATOM   6366  C CB    . LEU B 1 382 ? 1.975   -4.356  -8.857  1.00 34.57 ? 382 LEU B CB    1 
ATOM   6367  C CG    . LEU B 1 382 ? 2.801   -3.559  -9.856  1.00 37.09 ? 382 LEU B CG    1 
ATOM   6368  C CD1   . LEU B 1 382 ? 2.542   -2.020  -9.639  1.00 32.93 ? 382 LEU B CD1   1 
ATOM   6369  C CD2   . LEU B 1 382 ? 4.279   -3.891  -9.747  1.00 39.68 ? 382 LEU B CD2   1 
ATOM   6370  N N     . PRO B 1 383 ? -0.672  -4.300  -11.416 1.00 34.90 ? 383 PRO B N     1 
ATOM   6371  C CA    . PRO B 1 383 ? -1.051  -4.864  -12.759 1.00 34.18 ? 383 PRO B CA    1 
ATOM   6372  C C     . PRO B 1 383 ? 0.153   -5.423  -13.454 1.00 31.32 ? 383 PRO B C     1 
ATOM   6373  O O     . PRO B 1 383 ? 1.264   -4.917  -13.273 1.00 27.89 ? 383 PRO B O     1 
ATOM   6374  C CB    . PRO B 1 383 ? -1.515  -3.639  -13.573 1.00 34.59 ? 383 PRO B CB    1 
ATOM   6375  C CG    . PRO B 1 383 ? -1.777  -2.540  -12.605 1.00 34.83 ? 383 PRO B CG    1 
ATOM   6376  C CD    . PRO B 1 383 ? -1.171  -2.918  -11.239 1.00 35.80 ? 383 PRO B CD    1 
ATOM   6377  N N     . GLY B 1 384 ? -0.044  -6.509  -14.215 1.00 31.94 ? 384 GLY B N     1 
ATOM   6378  C CA    . GLY B 1 384 ? 1.110   -7.205  -14.868 1.00 29.45 ? 384 GLY B CA    1 
ATOM   6379  C C     . GLY B 1 384 ? 1.749   -6.360  -15.964 1.00 30.11 ? 384 GLY B C     1 
ATOM   6380  O O     . GLY B 1 384 ? 2.836   -6.691  -16.401 1.00 29.35 ? 384 GLY B O     1 
ATOM   6381  N N     . ASN B 1 385 ? 1.106   -5.283  -16.445 1.00 30.68 ? 385 ASN B N     1 
ATOM   6382  C CA    . ASN B 1 385 ? 1.584   -4.673  -17.796 1.00 34.06 ? 385 ASN B CA    1 
ATOM   6383  C C     . ASN B 1 385 ? 3.082   -4.382  -17.990 1.00 33.83 ? 385 ASN B C     1 
ATOM   6384  O O     . ASN B 1 385 ? 3.619   -4.413  -19.152 1.00 33.29 ? 385 ASN B O     1 
ATOM   6385  C CB    . ASN B 1 385 ? 0.839   -3.373  -18.187 1.00 32.56 ? 385 ASN B CB    1 
ATOM   6386  C CG    . ASN B 1 385 ? -0.607  -3.472  -17.936 1.00 37.95 ? 385 ASN B CG    1 
ATOM   6387  O OD1   . ASN B 1 385 ? -1.031  -3.637  -16.770 1.00 43.24 ? 385 ASN B OD1   1 
ATOM   6388  N ND2   . ASN B 1 385 ? -1.410  -3.431  -19.008 1.00 41.09 ? 385 ASN B ND2   1 
ATOM   6389  N N     . ALA B 1 386 ? 3.730   -4.045  -16.884 1.00 33.08 ? 386 ALA B N     1 
ATOM   6390  C CA    . ALA B 1 386 ? 5.094   -3.457  -16.925 1.00 34.45 ? 386 ALA B CA    1 
ATOM   6391  C C     . ALA B 1 386 ? 6.085   -4.573  -16.827 1.00 34.66 ? 386 ALA B C     1 
ATOM   6392  O O     . ALA B 1 386 ? 7.316   -4.365  -16.810 1.00 34.66 ? 386 ALA B O     1 
ATOM   6393  C CB    . ALA B 1 386 ? 5.306   -2.458  -15.729 1.00 35.30 ? 386 ALA B CB    1 
ATOM   6394  N N     . PHE B 1 387 ? 5.578   -5.797  -16.746 1.00 33.61 ? 387 PHE B N     1 
ATOM   6395  C CA    . PHE B 1 387 ? 6.545   -6.881  -16.799 1.00 31.75 ? 387 PHE B CA    1 
ATOM   6396  C C     . PHE B 1 387 ? 6.700   -7.498  -18.211 1.00 32.19 ? 387 PHE B C     1 
ATOM   6397  O O     . PHE B 1 387 ? 7.252   -8.576  -18.330 1.00 30.36 ? 387 PHE B O     1 
ATOM   6398  C CB    . PHE B 1 387 ? 6.191   -7.901  -15.741 1.00 31.11 ? 387 PHE B CB    1 
ATOM   6399  C CG    . PHE B 1 387 ? 6.176   -7.329  -14.390 1.00 29.35 ? 387 PHE B CG    1 
ATOM   6400  C CD1   . PHE B 1 387 ? 7.347   -7.168  -13.705 1.00 24.05 ? 387 PHE B CD1   1 
ATOM   6401  C CD2   . PHE B 1 387 ? 4.975   -6.880  -13.813 1.00 28.44 ? 387 PHE B CD2   1 
ATOM   6402  C CE1   . PHE B 1 387 ? 7.327   -6.599  -12.484 1.00 26.69 ? 387 PHE B CE1   1 
ATOM   6403  C CE2   . PHE B 1 387 ? 4.964   -6.288  -12.560 1.00 25.93 ? 387 PHE B CE2   1 
ATOM   6404  C CZ    . PHE B 1 387 ? 6.134   -6.169  -11.903 1.00 24.11 ? 387 PHE B CZ    1 
ATOM   6405  N N     . TYR B 1 388 ? 6.257   -6.778  -19.258 1.00 33.33 ? 388 TYR B N     1 
ATOM   6406  C CA    . TYR B 1 388 ? 6.397   -7.258  -20.656 1.00 34.29 ? 388 TYR B CA    1 
ATOM   6407  C C     . TYR B 1 388 ? 7.122   -6.222  -21.577 1.00 35.17 ? 388 TYR B C     1 
ATOM   6408  O O     . TYR B 1 388 ? 7.045   -5.028  -21.326 1.00 34.04 ? 388 TYR B O     1 
ATOM   6409  C CB    . TYR B 1 388 ? 5.023   -7.594  -21.206 1.00 34.80 ? 388 TYR B CB    1 
ATOM   6410  C CG    . TYR B 1 388 ? 4.260   -8.692  -20.482 1.00 33.36 ? 388 TYR B CG    1 
ATOM   6411  C CD1   . TYR B 1 388 ? 3.515   -8.411  -19.319 1.00 32.52 ? 388 TYR B CD1   1 
ATOM   6412  C CD2   . TYR B 1 388 ? 4.242   -10.027 -20.983 1.00 35.46 ? 388 TYR B CD2   1 
ATOM   6413  C CE1   . TYR B 1 388 ? 2.847   -9.397  -18.614 1.00 25.16 ? 388 TYR B CE1   1 
ATOM   6414  C CE2   . TYR B 1 388 ? 3.567   -11.026 -20.304 1.00 31.65 ? 388 TYR B CE2   1 
ATOM   6415  C CZ    . TYR B 1 388 ? 2.838   -10.683 -19.141 1.00 32.54 ? 388 TYR B CZ    1 
ATOM   6416  O OH    . TYR B 1 388 ? 2.121   -11.656 -18.502 1.00 35.06 ? 388 TYR B OH    1 
ATOM   6417  N N     . VAL B 1 389 ? 7.879   -6.661  -22.607 1.00 36.61 ? 389 VAL B N     1 
ATOM   6418  C CA    . VAL B 1 389 ? 8.521   -5.689  -23.500 1.00 38.20 ? 389 VAL B CA    1 
ATOM   6419  C C     . VAL B 1 389 ? 7.498   -4.659  -24.027 1.00 38.95 ? 389 VAL B C     1 
ATOM   6420  O O     . VAL B 1 389 ? 7.800   -3.526  -24.247 1.00 40.13 ? 389 VAL B O     1 
ATOM   6421  C CB    . VAL B 1 389 ? 9.210   -6.382  -24.712 1.00 39.74 ? 389 VAL B CB    1 
ATOM   6422  C CG1   . VAL B 1 389 ? 9.576   -5.346  -25.822 1.00 38.60 ? 389 VAL B CG1   1 
ATOM   6423  C CG2   . VAL B 1 389 ? 10.478  -7.132  -24.272 1.00 39.68 ? 389 VAL B CG2   1 
ATOM   6424  N N     . ASP B 1 390 ? 6.278   -5.103  -24.237 1.00 39.68 ? 390 ASP B N     1 
ATOM   6425  C CA    . ASP B 1 390 ? 5.173   -4.298  -24.696 1.00 40.02 ? 390 ASP B CA    1 
ATOM   6426  C C     . ASP B 1 390 ? 4.237   -4.037  -23.470 1.00 39.93 ? 390 ASP B C     1 
ATOM   6427  O O     . ASP B 1 390 ? 3.290   -4.742  -23.216 1.00 37.81 ? 390 ASP B O     1 
ATOM   6428  C CB    . ASP B 1 390 ? 4.457   -5.117  -25.811 1.00 39.10 ? 390 ASP B CB    1 
ATOM   6429  C CG    . ASP B 1 390 ? 3.358   -4.368  -26.433 1.00 41.25 ? 390 ASP B CG    1 
ATOM   6430  O OD1   . ASP B 1 390 ? 3.319   -3.162  -26.107 1.00 40.06 ? 390 ASP B OD1   1 
ATOM   6431  O OD2   . ASP B 1 390 ? 2.531   -4.947  -27.217 1.00 36.52 ? 390 ASP B OD2   1 
ATOM   6432  N N     . SER B 1 391 ? 4.536   -3.017  -22.678 1.00 41.81 ? 391 SER B N     1 
ATOM   6433  C CA    . SER B 1 391 ? 3.660   -2.746  -21.543 1.00 41.21 ? 391 SER B CA    1 
ATOM   6434  C C     . SER B 1 391 ? 2.334   -2.190  -21.993 1.00 40.45 ? 391 SER B C     1 
ATOM   6435  O O     . SER B 1 391 ? 1.487   -2.014  -21.136 1.00 40.33 ? 391 SER B O     1 
ATOM   6436  C CB    . SER B 1 391 ? 4.293   -1.781  -20.574 1.00 41.31 ? 391 SER B CB    1 
ATOM   6437  O OG    . SER B 1 391 ? 4.956   -0.806  -21.322 1.00 43.53 ? 391 SER B OG    1 
ATOM   6438  N N     . SER B 1 392 ? 2.146   -1.904  -23.298 1.00 39.14 ? 392 SER B N     1 
ATOM   6439  C CA    . SER B 1 392 ? 0.888   -1.330  -23.762 1.00 39.11 ? 392 SER B CA    1 
ATOM   6440  C C     . SER B 1 392 ? -0.151  -2.433  -23.960 1.00 39.62 ? 392 SER B C     1 
ATOM   6441  O O     . SER B 1 392 ? -1.361  -2.163  -24.146 1.00 40.36 ? 392 SER B O     1 
ATOM   6442  C CB    . SER B 1 392 ? 1.041   -0.438  -25.045 1.00 40.67 ? 392 SER B CB    1 
ATOM   6443  O OG    . SER B 1 392 ? 1.647   -1.098  -26.181 1.00 40.23 ? 392 SER B OG    1 
ATOM   6444  N N     . ALA B 1 393 ? 0.310   -3.674  -23.910 1.00 37.84 ? 393 ALA B N     1 
ATOM   6445  C CA    . ALA B 1 393 ? -0.595  -4.772  -24.160 1.00 38.45 ? 393 ALA B CA    1 
ATOM   6446  C C     . ALA B 1 393 ? -1.388  -5.004  -22.880 1.00 38.70 ? 393 ALA B C     1 
ATOM   6447  O O     . ALA B 1 393 ? -0.819  -4.948  -21.771 1.00 40.86 ? 393 ALA B O     1 
ATOM   6448  C CB    . ALA B 1 393 ? 0.145   -6.031  -24.650 1.00 36.19 ? 393 ALA B CB    1 
ATOM   6449  N N     . PRO B 1 394 ? -2.694  -5.259  -23.026 1.00 37.71 ? 394 PRO B N     1 
ATOM   6450  C CA    . PRO B 1 394 ? -3.512  -5.514  -21.863 1.00 37.27 ? 394 PRO B CA    1 
ATOM   6451  C C     . PRO B 1 394 ? -2.961  -6.773  -21.113 1.00 36.62 ? 394 PRO B C     1 
ATOM   6452  O O     . PRO B 1 394 ? -2.357  -7.649  -21.734 1.00 33.97 ? 394 PRO B O     1 
ATOM   6453  C CB    . PRO B 1 394 ? -4.931  -5.780  -22.442 1.00 37.70 ? 394 PRO B CB    1 
ATOM   6454  C CG    . PRO B 1 394 ? -4.740  -6.061  -23.963 1.00 38.47 ? 394 PRO B CG    1 
ATOM   6455  C CD    . PRO B 1 394 ? -3.401  -5.419  -24.324 1.00 37.81 ? 394 PRO B CD    1 
ATOM   6456  N N     . SER B 1 395 ? -3.152  -6.803  -19.785 1.00 35.57 ? 395 SER B N     1 
ATOM   6457  C CA    . SER B 1 395 ? -2.611  -7.860  -18.921 1.00 35.86 ? 395 SER B CA    1 
ATOM   6458  C C     . SER B 1 395 ? -3.709  -8.159  -17.932 1.00 35.02 ? 395 SER B C     1 
ATOM   6459  O O     . SER B 1 395 ? -4.290  -7.235  -17.401 1.00 36.97 ? 395 SER B O     1 
ATOM   6460  C CB    . SER B 1 395 ? -1.297  -7.437  -18.224 1.00 36.06 ? 395 SER B CB    1 
ATOM   6461  O OG    . SER B 1 395 ? -0.964  -8.249  -17.070 1.00 37.10 ? 395 SER B OG    1 
ATOM   6462  N N     . PRO B 1 396 ? -4.131  -9.430  -17.849 1.00 34.87 ? 396 PRO B N     1 
ATOM   6463  C CA    . PRO B 1 396 ? -5.060  -9.981  -16.807 1.00 34.48 ? 396 PRO B CA    1 
ATOM   6464  C C     . PRO B 1 396 ? -4.426  -10.210 -15.446 1.00 33.66 ? 396 PRO B C     1 
ATOM   6465  O O     . PRO B 1 396 ? -5.059  -10.683 -14.532 1.00 32.93 ? 396 PRO B O     1 
ATOM   6466  C CB    . PRO B 1 396 ? -5.479  -11.323 -17.388 1.00 34.49 ? 396 PRO B CB    1 
ATOM   6467  C CG    . PRO B 1 396 ? -4.430  -11.672 -18.410 1.00 33.91 ? 396 PRO B CG    1 
ATOM   6468  C CD    . PRO B 1 396 ? -3.772  -10.432 -18.882 1.00 32.97 ? 396 PRO B CD    1 
ATOM   6469  N N     . TYR B 1 397 ? -3.184  -9.779  -15.304 1.00 34.83 ? 397 TYR B N     1 
ATOM   6470  C CA    . TYR B 1 397 ? -2.328  -10.182 -14.223 1.00 33.92 ? 397 TYR B CA    1 
ATOM   6471  C C     . TYR B 1 397 ? -2.101  -9.106  -13.257 1.00 33.22 ? 397 TYR B C     1 
ATOM   6472  O O     . TYR B 1 397 ? -2.004  -7.941  -13.652 1.00 31.23 ? 397 TYR B O     1 
ATOM   6473  C CB    . TYR B 1 397 ? -0.968  -10.633 -14.771 1.00 35.62 ? 397 TYR B CB    1 
ATOM   6474  C CG    . TYR B 1 397 ? -0.987  -11.994 -15.506 1.00 36.63 ? 397 TYR B CG    1 
ATOM   6475  C CD1   . TYR B 1 397 ? -0.864  -13.170 -14.795 1.00 33.66 ? 397 TYR B CD1   1 
ATOM   6476  C CD2   . TYR B 1 397 ? -1.142  -12.074 -16.916 1.00 33.09 ? 397 TYR B CD2   1 
ATOM   6477  C CE1   . TYR B 1 397 ? -0.903  -14.437 -15.455 1.00 36.06 ? 397 TYR B CE1   1 
ATOM   6478  C CE2   . TYR B 1 397 ? -1.124  -13.332 -17.596 1.00 32.55 ? 397 TYR B CE2   1 
ATOM   6479  C CZ    . TYR B 1 397 ? -1.011  -14.502 -16.847 1.00 36.15 ? 397 TYR B CZ    1 
ATOM   6480  O OH    . TYR B 1 397 ? -1.008  -15.753 -17.467 1.00 37.31 ? 397 TYR B OH    1 
ATOM   6481  N N     . LEU B 1 398 ? -1.992  -9.553  -11.986 1.00 33.08 ? 398 LEU B N     1 
ATOM   6482  C CA    . LEU B 1 398 ? -1.678  -8.783  -10.803 1.00 31.46 ? 398 LEU B CA    1 
ATOM   6483  C C     . LEU B 1 398 ? -0.473  -9.430  -10.108 1.00 30.53 ? 398 LEU B C     1 
ATOM   6484  O O     . LEU B 1 398 ? -0.384  -10.659 -10.007 1.00 29.06 ? 398 LEU B O     1 
ATOM   6485  C CB    . LEU B 1 398 ? -2.866  -8.764  -9.852  1.00 31.91 ? 398 LEU B CB    1 
ATOM   6486  C CG    . LEU B 1 398 ? -4.048  -7.972  -10.373 1.00 36.39 ? 398 LEU B CG    1 
ATOM   6487  C CD1   . LEU B 1 398 ? -5.389  -8.151  -9.541  1.00 34.05 ? 398 LEU B CD1   1 
ATOM   6488  C CD2   . LEU B 1 398 ? -3.649  -6.495  -10.503 1.00 42.34 ? 398 LEU B CD2   1 
ATOM   6489  N N     . ARG B 1 399 ? 0.487   -8.596  -9.681  1.00 29.71 ? 399 ARG B N     1 
ATOM   6490  C CA    . ARG B 1 399 ? 1.544   -9.069  -8.802  1.00 28.61 ? 399 ARG B CA    1 
ATOM   6491  C C     . ARG B 1 399 ? 1.183   -8.573  -7.387  1.00 28.13 ? 399 ARG B C     1 
ATOM   6492  O O     . ARG B 1 399 ? 0.806   -7.446  -7.211  1.00 26.81 ? 399 ARG B O     1 
ATOM   6493  C CB    . ARG B 1 399 ? 2.907   -8.609  -9.278  1.00 27.05 ? 399 ARG B CB    1 
ATOM   6494  C CG    . ARG B 1 399 ? 4.089   -9.017  -8.407  1.00 26.79 ? 399 ARG B CG    1 
ATOM   6495  C CD    . ARG B 1 399 ? 5.312   -8.129  -8.599  1.00 25.46 ? 399 ARG B CD    1 
ATOM   6496  N NE    . ARG B 1 399 ? 5.285   -6.885  -7.836  1.00 27.86 ? 399 ARG B NE    1 
ATOM   6497  C CZ    . ARG B 1 399 ? 6.323   -6.018  -7.724  1.00 27.22 ? 399 ARG B CZ    1 
ATOM   6498  N NH1   . ARG B 1 399 ? 7.446   -6.221  -8.384  1.00 25.57 ? 399 ARG B NH1   1 
ATOM   6499  N NH2   . ARG B 1 399 ? 6.243   -4.932  -6.971  1.00 25.58 ? 399 ARG B NH2   1 
ATOM   6500  N N     . ALA B 1 400 ? 1.258   -9.444  -6.392  1.00 30.19 ? 400 ALA B N     1 
ATOM   6501  C CA    . ALA B 1 400 ? 0.886   -9.058  -4.975  1.00 31.12 ? 400 ALA B CA    1 
ATOM   6502  C C     . ALA B 1 400 ? 2.035   -9.522  -4.078  1.00 31.99 ? 400 ALA B C     1 
ATOM   6503  O O     . ALA B 1 400 ? 2.396   -10.740 -4.058  1.00 30.32 ? 400 ALA B O     1 
ATOM   6504  C CB    . ALA B 1 400 ? -0.416  -9.731  -4.568  1.00 29.65 ? 400 ALA B CB    1 
ATOM   6505  N N     . SER B 1 401 ? 2.671   -8.581  -3.374  1.00 32.86 ? 401 SER B N     1 
ATOM   6506  C CA    . SER B 1 401 ? 3.744   -9.032  -2.471  1.00 33.25 ? 401 SER B CA    1 
ATOM   6507  C C     . SER B 1 401 ? 3.082   -9.449  -1.207  1.00 32.70 ? 401 SER B C     1 
ATOM   6508  O O     . SER B 1 401 ? 2.055   -8.852  -0.746  1.00 29.93 ? 401 SER B O     1 
ATOM   6509  C CB    . SER B 1 401 ? 4.832   -7.997  -2.046  1.00 36.57 ? 401 SER B CB    1 
ATOM   6510  O OG    . SER B 1 401 ? 5.987   -8.727  -1.392  1.00 35.71 ? 401 SER B OG    1 
ATOM   6511  N N     . PHE B 1 402 ? 3.734   -10.461 -0.657  1.00 31.28 ? 402 PHE B N     1 
ATOM   6512  C CA    . PHE B 1 402 ? 3.472   -10.906 0.638   1.00 30.96 ? 402 PHE B CA    1 
ATOM   6513  C C     . PHE B 1 402 ? 4.663   -10.675 1.630   1.00 31.12 ? 402 PHE B C     1 
ATOM   6514  O O     . PHE B 1 402 ? 4.738   -11.343 2.686   1.00 32.12 ? 402 PHE B O     1 
ATOM   6515  C CB    . PHE B 1 402 ? 3.043   -12.372 0.545   1.00 27.80 ? 402 PHE B CB    1 
ATOM   6516  C CG    . PHE B 1 402 ? 4.050   -13.267 -0.040  1.00 27.10 ? 402 PHE B CG    1 
ATOM   6517  C CD1   . PHE B 1 402 ? 5.152   -13.676 0.688   1.00 26.64 ? 402 PHE B CD1   1 
ATOM   6518  C CD2   . PHE B 1 402 ? 3.869   -13.820 -1.334  1.00 27.19 ? 402 PHE B CD2   1 
ATOM   6519  C CE1   . PHE B 1 402 ? 6.106   -14.589 0.122   1.00 22.12 ? 402 PHE B CE1   1 
ATOM   6520  C CE2   . PHE B 1 402 ? 4.790   -14.736 -1.861  1.00 26.30 ? 402 PHE B CE2   1 
ATOM   6521  C CZ    . PHE B 1 402 ? 5.909   -15.132 -1.128  1.00 24.32 ? 402 PHE B CZ    1 
ATOM   6522  N N     . SER B 1 403 ? 5.540   -9.708  1.360   1.00 32.44 ? 403 SER B N     1 
ATOM   6523  C CA    . SER B 1 403 ? 6.715   -9.541  2.280   1.00 33.10 ? 403 SER B CA    1 
ATOM   6524  C C     . SER B 1 403 ? 6.346   -9.023  3.622   1.00 33.44 ? 403 SER B C     1 
ATOM   6525  O O     . SER B 1 403 ? 7.005   -9.406  4.590   1.00 35.81 ? 403 SER B O     1 
ATOM   6526  C CB    . SER B 1 403 ? 7.842   -8.686  1.723   1.00 32.06 ? 403 SER B CB    1 
ATOM   6527  O OG    . SER B 1 403 ? 7.552   -7.318  1.681   1.00 32.19 ? 403 SER B OG    1 
ATOM   6528  N N     . SER B 1 404 ? 5.302   -8.199  3.668   1.00 34.02 ? 404 SER B N     1 
ATOM   6529  C CA    . SER B 1 404 ? 4.945   -7.331  4.864   1.00 36.48 ? 404 SER B CA    1 
ATOM   6530  C C     . SER B 1 404 ? 3.558   -7.451  5.496   1.00 35.47 ? 404 SER B C     1 
ATOM   6531  O O     . SER B 1 404 ? 3.414   -7.452  6.727   1.00 34.99 ? 404 SER B O     1 
ATOM   6532  C CB    . SER B 1 404 ? 5.111   -5.835  4.479   1.00 34.73 ? 404 SER B CB    1 
ATOM   6533  O OG    . SER B 1 404 ? 6.501   -5.519  4.381   1.00 38.11 ? 404 SER B OG    1 
ATOM   6534  N N     . ALA B 1 405 ? 2.528   -7.459  4.637   1.00 35.65 ? 405 ALA B N     1 
ATOM   6535  C CA    . ALA B 1 405 ? 1.154   -7.407  5.111   1.00 35.37 ? 405 ALA B CA    1 
ATOM   6536  C C     . ALA B 1 405 ? 0.875   -8.507  6.162   1.00 35.09 ? 405 ALA B C     1 
ATOM   6537  O O     . ALA B 1 405 ? 1.496   -9.562  6.185   1.00 36.01 ? 405 ALA B O     1 
ATOM   6538  C CB    . ALA B 1 405 ? 0.204   -7.432  3.962   1.00 33.44 ? 405 ALA B CB    1 
ATOM   6539  N N     . SER B 1 406 ? 0.033   -8.187  7.105   1.00 35.98 ? 406 SER B N     1 
ATOM   6540  C CA    . SER B 1 406 ? -0.380  -9.116  8.164   1.00 36.34 ? 406 SER B CA    1 
ATOM   6541  C C     . SER B 1 406 ? -1.575  -9.885  7.594   1.00 37.14 ? 406 SER B C     1 
ATOM   6542  O O     . SER B 1 406 ? -2.202  -9.383  6.656   1.00 40.02 ? 406 SER B O     1 
ATOM   6543  C CB    . SER B 1 406 ? -0.867  -8.341  9.343   1.00 33.38 ? 406 SER B CB    1 
ATOM   6544  O OG    . SER B 1 406 ? -2.010  -7.669  8.947   1.00 33.58 ? 406 SER B OG    1 
ATOM   6545  N N     . PRO B 1 407 ? -1.858  -11.096 8.096   1.00 37.49 ? 407 PRO B N     1 
ATOM   6546  C CA    . PRO B 1 407 ? -3.005  -11.829 7.492   1.00 37.04 ? 407 PRO B CA    1 
ATOM   6547  C C     . PRO B 1 407 ? -4.259  -11.009 7.361   1.00 36.40 ? 407 PRO B C     1 
ATOM   6548  O O     . PRO B 1 407 ? -4.863  -11.027 6.291   1.00 36.38 ? 407 PRO B O     1 
ATOM   6549  C CB    . PRO B 1 407 ? -3.224  -13.031 8.423   1.00 35.63 ? 407 PRO B CB    1 
ATOM   6550  C CG    . PRO B 1 407 ? -1.735  -13.293 9.002   1.00 38.02 ? 407 PRO B CG    1 
ATOM   6551  C CD    . PRO B 1 407 ? -1.109  -11.906 9.099   1.00 37.08 ? 407 PRO B CD    1 
ATOM   6552  N N     . GLU B 1 408 ? -4.666  -10.321 8.431   1.00 35.78 ? 408 GLU B N     1 
ATOM   6553  C CA    . GLU B 1 408 ? -5.821  -9.453  8.351   1.00 36.87 ? 408 GLU B CA    1 
ATOM   6554  C C     . GLU B 1 408 ? -5.724  -8.453  7.166   1.00 35.53 ? 408 GLU B C     1 
ATOM   6555  O O     . GLU B 1 408 ? -6.666  -8.342  6.383   1.00 36.01 ? 408 GLU B O     1 
ATOM   6556  C CB    . GLU B 1 408 ? -6.216  -8.775  9.724   1.00 38.40 ? 408 GLU B CB    1 
ATOM   6557  C CG    . GLU B 1 408 ? -5.414  -9.016  11.071  1.00 42.51 ? 408 GLU B CG    1 
ATOM   6558  C CD    . GLU B 1 408 ? -4.327  -10.140 11.195  1.00 48.23 ? 408 GLU B CD    1 
ATOM   6559  O OE1   . GLU B 1 408 ? -3.445  -10.300 10.348  1.00 48.19 ? 408 GLU B OE1   1 
ATOM   6560  O OE2   . GLU B 1 408 ? -4.305  -10.851 12.227  1.00 53.36 ? 408 GLU B OE2   1 
ATOM   6561  N N     . GLN B 1 409 ? -4.591  -7.772  6.994   1.00 32.80 ? 409 GLN B N     1 
ATOM   6562  C CA    . GLN B 1 409 ? -4.461  -6.938  5.780   1.00 32.41 ? 409 GLN B CA    1 
ATOM   6563  C C     . GLN B 1 409 ? -4.616  -7.718  4.459   1.00 31.25 ? 409 GLN B C     1 
ATOM   6564  O O     . GLN B 1 409 ? -5.197  -7.204  3.530   1.00 29.33 ? 409 GLN B O     1 
ATOM   6565  C CB    . GLN B 1 409 ? -3.115  -6.142  5.740   1.00 32.41 ? 409 GLN B CB    1 
ATOM   6566  C CG    . GLN B 1 409 ? -3.028  -5.124  6.782   1.00 29.33 ? 409 GLN B CG    1 
ATOM   6567  C CD    . GLN B 1 409 ? -1.641  -4.537  6.947   1.00 34.54 ? 409 GLN B CD    1 
ATOM   6568  O OE1   . GLN B 1 409 ? -0.588  -5.185  6.795   1.00 32.77 ? 409 GLN B OE1   1 
ATOM   6569  N NE2   . GLN B 1 409 ? -1.635  -3.297  7.294   1.00 30.79 ? 409 GLN B NE2   1 
ATOM   6570  N N     . MET B 1 410 ? -4.123  -8.967  4.384   1.00 31.32 ? 410 MET B N     1 
ATOM   6571  C CA    . MET B 1 410 ? -4.247  -9.765  3.157   1.00 30.96 ? 410 MET B CA    1 
ATOM   6572  C C     . MET B 1 410 ? -5.726  -10.076 2.872   1.00 30.69 ? 410 MET B C     1 
ATOM   6573  O O     . MET B 1 410 ? -6.198  -10.027 1.721   1.00 30.21 ? 410 MET B O     1 
ATOM   6574  C CB    . MET B 1 410 ? -3.405  -11.067 3.259   1.00 30.95 ? 410 MET B CB    1 
ATOM   6575  C CG    . MET B 1 410 ? -1.863  -10.944 2.974   1.00 28.99 ? 410 MET B CG    1 
ATOM   6576  S SD    . MET B 1 410 ? -0.992  -12.468 3.532   1.00 34.71 ? 410 MET B SD    1 
ATOM   6577  C CE    . MET B 1 410 ? 0.724   -12.075 3.418   1.00 32.15 ? 410 MET B CE    1 
ATOM   6578  N N     . ASP B 1 411 ? -6.460  -10.334 3.937   1.00 31.07 ? 411 ASP B N     1 
ATOM   6579  C CA    . ASP B 1 411 ? -7.850  -10.814 3.889   1.00 32.36 ? 411 ASP B CA    1 
ATOM   6580  C C     . ASP B 1 411 ? -8.780  -9.747  3.366   1.00 32.84 ? 411 ASP B C     1 
ATOM   6581  O O     . ASP B 1 411 ? -9.667  -10.022 2.558   1.00 32.88 ? 411 ASP B O     1 
ATOM   6582  C CB    . ASP B 1 411 ? -8.279  -11.235 5.330   1.00 33.61 ? 411 ASP B CB    1 
ATOM   6583  C CG    . ASP B 1 411 ? -9.668  -11.866 5.379   1.00 36.58 ? 411 ASP B CG    1 
ATOM   6584  O OD1   . ASP B 1 411 ? -10.624 -11.172 5.823   1.00 35.03 ? 411 ASP B OD1   1 
ATOM   6585  O OD2   . ASP B 1 411 ? -9.793  -13.066 4.969   1.00 40.24 ? 411 ASP B OD2   1 
ATOM   6586  N N     . VAL B 1 412 ? -8.557  -8.502  3.824   1.00 33.36 ? 412 VAL B N     1 
ATOM   6587  C CA    . VAL B 1 412 ? -9.308  -7.320  3.377   1.00 33.23 ? 412 VAL B CA    1 
ATOM   6588  C C     . VAL B 1 412 ? -8.904  -6.992  1.966   1.00 32.62 ? 412 VAL B C     1 
ATOM   6589  O O     . VAL B 1 412 ? -9.729  -6.656  1.166   1.00 33.59 ? 412 VAL B O     1 
ATOM   6590  C CB    . VAL B 1 412 ? -9.065  -6.060  4.282   1.00 34.20 ? 412 VAL B CB    1 
ATOM   6591  C CG1   . VAL B 1 412 ? -9.889  -4.865  3.790   1.00 38.08 ? 412 VAL B CG1   1 
ATOM   6592  C CG2   . VAL B 1 412 ? -9.460  -6.340  5.788   1.00 34.90 ? 412 VAL B CG2   1 
ATOM   6593  N N     . ALA B 1 413 ? -7.613  -7.047  1.675   1.00 32.53 ? 413 ALA B N     1 
ATOM   6594  C CA    . ALA B 1 413 ? -7.126  -6.778  0.316   1.00 32.30 ? 413 ALA B CA    1 
ATOM   6595  C C     . ALA B 1 413 ? -7.762  -7.783  -0.648  1.00 32.68 ? 413 ALA B C     1 
ATOM   6596  O O     . ALA B 1 413 ? -8.277  -7.365  -1.646  1.00 31.49 ? 413 ALA B O     1 
ATOM   6597  C CB    . ALA B 1 413 ? -5.569  -6.880  0.267   1.00 30.35 ? 413 ALA B CB    1 
ATOM   6598  N N     . PHE B 1 414 ? -7.763  -9.107  -0.310  1.00 32.55 ? 414 PHE B N     1 
ATOM   6599  C CA    . PHE B 1 414 ? -8.449  -10.105 -1.163  1.00 32.48 ? 414 PHE B CA    1 
ATOM   6600  C C     . PHE B 1 414 ? -9.966  -10.014 -1.203  1.00 31.94 ? 414 PHE B C     1 
ATOM   6601  O O     . PHE B 1 414 ? -10.579 -10.242 -2.244  1.00 31.66 ? 414 PHE B O     1 
ATOM   6602  C CB    . PHE B 1 414 ? -7.927  -11.522 -0.933  1.00 31.22 ? 414 PHE B CB    1 
ATOM   6603  C CG    . PHE B 1 414 ? -6.578  -11.722 -1.537  1.00 35.43 ? 414 PHE B CG    1 
ATOM   6604  C CD1   . PHE B 1 414 ? -5.449  -11.478 -0.835  1.00 38.18 ? 414 PHE B CD1   1 
ATOM   6605  C CD2   . PHE B 1 414 ? -6.441  -12.061 -2.856  1.00 42.92 ? 414 PHE B CD2   1 
ATOM   6606  C CE1   . PHE B 1 414 ? -4.230  -11.595 -1.416  1.00 41.83 ? 414 PHE B CE1   1 
ATOM   6607  C CE2   . PHE B 1 414 ? -5.179  -12.209 -3.444  1.00 40.94 ? 414 PHE B CE2   1 
ATOM   6608  C CZ    . PHE B 1 414 ? -4.086  -11.960 -2.735  1.00 38.41 ? 414 PHE B CZ    1 
ATOM   6609  N N     . GLN B 1 415 ? -10.575 -9.688  -0.065  1.00 31.78 ? 415 GLN B N     1 
ATOM   6610  C CA    . GLN B 1 415 ? -12.003 -9.427  -0.044  1.00 31.57 ? 415 GLN B CA    1 
ATOM   6611  C C     . GLN B 1 415 ? -12.385 -8.303  -1.005  1.00 31.59 ? 415 GLN B C     1 
ATOM   6612  O O     . GLN B 1 415 ? -13.216 -8.520  -1.885  1.00 29.55 ? 415 GLN B O     1 
ATOM   6613  C CB    . GLN B 1 415 ? -12.502 -9.143  1.391   1.00 32.86 ? 415 GLN B CB    1 
ATOM   6614  C CG    . GLN B 1 415 ? -13.978 -8.961  1.501   1.00 31.16 ? 415 GLN B CG    1 
ATOM   6615  C CD    . GLN B 1 415 ? -14.338 -7.524  1.856   1.00 39.85 ? 415 GLN B CD    1 
ATOM   6616  O OE1   . GLN B 1 415 ? -13.712 -6.918  2.734   1.00 39.47 ? 415 GLN B OE1   1 
ATOM   6617  N NE2   . GLN B 1 415 ? -15.353 -6.969  1.178   1.00 40.99 ? 415 GLN B NE2   1 
ATOM   6618  N N     . VAL B 1 416 ? -11.779 -7.111  -0.814  1.00 30.68 ? 416 VAL B N     1 
ATOM   6619  C CA    . VAL B 1 416 ? -12.050 -5.938  -1.655  1.00 30.00 ? 416 VAL B CA    1 
ATOM   6620  C C     . VAL B 1 416 ? -11.798 -6.246  -3.130  1.00 32.05 ? 416 VAL B C     1 
ATOM   6621  O O     . VAL B 1 416 ? -12.544 -5.789  -4.019  1.00 33.71 ? 416 VAL B O     1 
ATOM   6622  C CB    . VAL B 1 416 ? -11.173 -4.708  -1.208  1.00 31.40 ? 416 VAL B CB    1 
ATOM   6623  C CG1   . VAL B 1 416 ? -11.288 -3.582  -2.199  1.00 29.68 ? 416 VAL B CG1   1 
ATOM   6624  C CG2   . VAL B 1 416 ? -11.539 -4.233  0.195   1.00 27.03 ? 416 VAL B CG2   1 
ATOM   6625  N N     . LEU B 1 417 ? -10.806 -7.069  -3.417  1.00 31.24 ? 417 LEU B N     1 
ATOM   6626  C CA    . LEU B 1 417 ? -10.418 -7.355  -4.819  1.00 32.50 ? 417 LEU B CA    1 
ATOM   6627  C C     . LEU B 1 417 ? -11.514 -8.237  -5.516  1.00 32.66 ? 417 LEU B C     1 
ATOM   6628  O O     . LEU B 1 417 ? -11.973 -7.997  -6.654  1.00 32.48 ? 417 LEU B O     1 
ATOM   6629  C CB    . LEU B 1 417 ? -9.067  -8.052  -4.796  1.00 30.67 ? 417 LEU B CB    1 
ATOM   6630  C CG    . LEU B 1 417 ? -8.010  -8.090  -5.907  1.00 36.29 ? 417 LEU B CG    1 
ATOM   6631  C CD1   . LEU B 1 417 ? -7.471  -9.500  -6.165  1.00 31.30 ? 417 LEU B CD1   1 
ATOM   6632  C CD2   . LEU B 1 417 ? -8.487  -7.449  -7.198  1.00 33.40 ? 417 LEU B CD2   1 
ATOM   6633  N N     . ALA B 1 418 ? -11.903 -9.263  -4.786  1.00 32.25 ? 418 ALA B N     1 
ATOM   6634  C CA    . ALA B 1 418 ? -12.913 -10.205 -5.183  1.00 31.91 ? 418 ALA B CA    1 
ATOM   6635  C C     . ALA B 1 418 ? -14.147 -9.480  -5.653  1.00 31.30 ? 418 ALA B C     1 
ATOM   6636  O O     . ALA B 1 418 ? -14.578 -9.639  -6.794  1.00 31.40 ? 418 ALA B O     1 
ATOM   6637  C CB    . ALA B 1 418 ? -13.228 -11.106 -4.010  1.00 29.52 ? 418 ALA B CB    1 
ATOM   6638  N N     . GLN B 1 419 ? -14.699 -8.683  -4.755  1.00 32.05 ? 419 GLN B N     1 
ATOM   6639  C CA    . GLN B 1 419 ? -15.874 -7.867  -4.969  1.00 33.04 ? 419 GLN B CA    1 
ATOM   6640  C C     . GLN B 1 419 ? -15.749 -6.938  -6.213  1.00 33.06 ? 419 GLN B C     1 
ATOM   6641  O O     . GLN B 1 419 ? -16.703 -6.689  -6.965  1.00 35.10 ? 419 GLN B O     1 
ATOM   6642  C CB    . GLN B 1 419 ? -15.977 -7.048  -3.683  1.00 34.07 ? 419 GLN B CB    1 
ATOM   6643  C CG    . GLN B 1 419 ? -17.063 -6.052  -3.662  1.00 41.50 ? 419 GLN B CG    1 
ATOM   6644  C CD    . GLN B 1 419 ? -16.580 -4.666  -3.329  1.00 52.48 ? 419 GLN B CD    1 
ATOM   6645  O OE1   . GLN B 1 419 ? -17.105 -3.668  -3.882  1.00 57.82 ? 419 GLN B OE1   1 
ATOM   6646  N NE2   . GLN B 1 419 ? -15.576 -4.571  -2.430  1.00 53.23 ? 419 GLN B NE2   1 
ATOM   6647  N N     . LEU B 1 420 ? -14.566 -6.395  -6.434  1.00 31.51 ? 420 LEU B N     1 
ATOM   6648  C CA    . LEU B 1 420 ? -14.407 -5.429  -7.490  1.00 31.35 ? 420 LEU B CA    1 
ATOM   6649  C C     . LEU B 1 420 ? -14.301 -6.180  -8.811  1.00 30.40 ? 420 LEU B C     1 
ATOM   6650  O O     . LEU B 1 420 ? -14.736 -5.657  -9.825  1.00 30.19 ? 420 LEU B O     1 
ATOM   6651  C CB    . LEU B 1 420 ? -13.174 -4.464  -7.253  1.00 28.62 ? 420 LEU B CB    1 
ATOM   6652  C CG    . LEU B 1 420 ? -13.384 -3.466  -6.163  1.00 28.51 ? 420 LEU B CG    1 
ATOM   6653  C CD1   . LEU B 1 420 ? -12.076 -2.858  -5.677  1.00 27.06 ? 420 LEU B CD1   1 
ATOM   6654  C CD2   . LEU B 1 420 ? -14.411 -2.312  -6.593  1.00 32.04 ? 420 LEU B CD2   1 
ATOM   6655  N N     . ILE B 1 421 ? -13.681 -7.375  -8.771  1.00 31.53 ? 421 ILE B N     1 
ATOM   6656  C CA    . ILE B 1 421 ? -13.567 -8.312  -9.901  1.00 29.86 ? 421 ILE B CA    1 
ATOM   6657  C C     . ILE B 1 421 ? -14.982 -8.655  -10.419 1.00 32.27 ? 421 ILE B C     1 
ATOM   6658  O O     . ILE B 1 421 ? -15.279 -8.558  -11.601 1.00 33.03 ? 421 ILE B O     1 
ATOM   6659  C CB    . ILE B 1 421 ? -12.694 -9.566  -9.517  1.00 31.83 ? 421 ILE B CB    1 
ATOM   6660  C CG1   . ILE B 1 421 ? -11.171 -9.283  -9.636  1.00 28.49 ? 421 ILE B CG1   1 
ATOM   6661  C CG2   . ILE B 1 421 ? -12.980 -10.842 -10.421 1.00 29.95 ? 421 ILE B CG2   1 
ATOM   6662  C CD1   . ILE B 1 421 ? -10.313 -10.400 -9.106  1.00 25.82 ? 421 ILE B CD1   1 
ATOM   6663  N N     . LYS B 1 422 ? -15.908 -8.952  -9.537  1.00 33.33 ? 422 LYS B N     1 
ATOM   6664  C CA    . LYS B 1 422 ? -17.263 -9.311  -10.005 1.00 34.35 ? 422 LYS B CA    1 
ATOM   6665  C C     . LYS B 1 422 ? -18.194 -8.109  -10.299 1.00 36.28 ? 422 LYS B C     1 
ATOM   6666  O O     . LYS B 1 422 ? -19.186 -8.269  -10.957 1.00 35.01 ? 422 LYS B O     1 
ATOM   6667  C CB    . LYS B 1 422 ? -17.954 -10.226 -9.002  1.00 33.14 ? 422 LYS B CB    1 
ATOM   6668  C CG    . LYS B 1 422 ? -17.095 -11.344 -8.373  1.00 29.91 ? 422 LYS B CG    1 
ATOM   6669  C CD    . LYS B 1 422 ? -18.002 -11.957 -7.282  1.00 32.18 ? 422 LYS B CD    1 
ATOM   6670  C CE    . LYS B 1 422 ? -17.481 -11.677 -5.867  1.00 35.17 ? 422 LYS B CE    1 
ATOM   6671  N NZ    . LYS B 1 422 ? -18.461 -12.216 -4.854  1.00 30.78 ? 422 LYS B NZ    1 
ATOM   6672  N N     . GLU B 1 423 ? -17.882 -6.921  -9.778  1.00 38.42 ? 423 GLU B N     1 
ATOM   6673  C CA    . GLU B 1 423 ? -18.599 -5.706  -10.187 1.00 40.78 ? 423 GLU B CA    1 
ATOM   6674  C C     . GLU B 1 423 ? -18.087 -5.238  -11.562 1.00 41.64 ? 423 GLU B C     1 
ATOM   6675  O O     . GLU B 1 423 ? -18.628 -4.317  -12.113 1.00 40.20 ? 423 GLU B O     1 
ATOM   6676  C CB    . GLU B 1 423 ? -18.545 -4.622  -9.106  1.00 39.27 ? 423 GLU B CB    1 
ATOM   6677  C CG    . GLU B 1 423 ? -19.373 -4.976  -7.900  1.00 39.59 ? 423 GLU B CG    1 
ATOM   6678  C CD    . GLU B 1 423 ? -19.202 -4.004  -6.718  1.00 43.33 ? 423 GLU B CD    1 
ATOM   6679  O OE1   . GLU B 1 423 ? -18.238 -3.189  -6.753  1.00 41.23 ? 423 GLU B OE1   1 
ATOM   6680  O OE2   . GLU B 1 423 ? -20.035 -4.069  -5.749  1.00 45.74 ? 423 GLU B OE2   1 
ATOM   6681  N N     . SER B 1 424 ? -17.068 -5.943  -12.102 1.00 43.55 ? 424 SER B N     1 
ATOM   6682  C CA    . SER B 1 424 ? -16.436 -5.672  -13.409 1.00 44.54 ? 424 SER B CA    1 
ATOM   6683  C C     . SER B 1 424 ? -16.781 -6.725  -14.504 1.00 45.56 ? 424 SER B C     1 
ATOM   6684  O O     . SER B 1 424 ? -16.661 -6.434  -15.690 1.00 45.45 ? 424 SER B O     1 
ATOM   6685  C CB    . SER B 1 424 ? -14.892 -5.653  -13.276 1.00 45.98 ? 424 SER B CB    1 
ATOM   6686  O OG    . SER B 1 424 ? -14.389 -4.742  -12.277 1.00 45.85 ? 424 SER B OG    1 
ATOM   6687  N N     . LEU B 1 425 ? -17.152 -7.946  -14.124 1.00 45.73 ? 425 LEU B N     1 
ATOM   6688  C CA    . LEU B 1 425 ? -17.646 -8.944  -15.085 1.00 47.26 ? 425 LEU B CA    1 
ATOM   6689  C C     . LEU B 1 425 ? -19.055 -8.625  -15.662 1.00 49.88 ? 425 LEU B C     1 
ATOM   6690  O O     . LEU B 1 425 ? -19.808 -9.629  -15.845 1.00 50.83 ? 425 LEU B O     1 
ATOM   6691  C CB    . LEU B 1 425 ? -17.719 -10.322 -14.436 1.00 46.36 ? 425 LEU B CB    1 
ATOM   6692  C CG    . LEU B 1 425 ? -16.494 -10.973 -13.760 1.00 43.61 ? 425 LEU B CG    1 
ATOM   6693  C CD1   . LEU B 1 425 ? -16.953 -12.231 -13.014 1.00 42.28 ? 425 LEU B CD1   1 
ATOM   6694  C CD2   . LEU B 1 425 ? -15.439 -11.263 -14.782 1.00 33.84 ? 425 LEU B CD2   1 
ATOM   6695  O OXT   . LEU B 1 425 ? -19.485 -7.436  -15.944 1.00 49.60 ? 425 LEU B OXT   1 
ATOM   6696  N N     . MET C 1 1   ? 22.748  -25.430 34.172  1.00 45.63 ? 1   MET C N     1 
ATOM   6697  C CA    . MET C 1 1   ? 24.195  -25.540 34.315  1.00 46.11 ? 1   MET C CA    1 
ATOM   6698  C C     . MET C 1 1   ? 24.897  -24.287 33.801  1.00 42.12 ? 1   MET C C     1 
ATOM   6699  O O     . MET C 1 1   ? 26.044  -24.017 34.154  1.00 39.53 ? 1   MET C O     1 
ATOM   6700  C CB    . MET C 1 1   ? 24.714  -26.774 33.575  1.00 45.53 ? 1   MET C CB    1 
ATOM   6701  C CG    . MET C 1 1   ? 26.215  -26.986 33.697  1.00 47.43 ? 1   MET C CG    1 
ATOM   6702  S SD    . MET C 1 1   ? 26.648  -28.695 34.070  1.00 58.20 ? 1   MET C SD    1 
ATOM   6703  C CE    . MET C 1 1   ? 26.719  -28.643 35.859  1.00 55.83 ? 1   MET C CE    1 
ATOM   6704  N N     . ASN C 1 2   ? 24.199  -23.526 32.964  1.00 40.54 ? 2   ASN C N     1 
ATOM   6705  C CA    . ASN C 1 2   ? 24.731  -22.246 32.452  1.00 38.74 ? 2   ASN C CA    1 
ATOM   6706  C C     . ASN C 1 2   ? 24.034  -21.062 33.118  1.00 36.71 ? 2   ASN C C     1 
ATOM   6707  O O     . ASN C 1 2   ? 23.015  -20.600 32.632  1.00 35.73 ? 2   ASN C O     1 
ATOM   6708  C CB    . ASN C 1 2   ? 24.826  -22.187 30.895  1.00 38.06 ? 2   ASN C CB    1 
ATOM   6709  C CG    . ASN C 1 2   ? 25.198  -20.753 30.332  1.00 40.17 ? 2   ASN C CG    1 
ATOM   6710  O OD1   . ASN C 1 2   ? 24.508  -20.238 29.472  1.00 37.04 ? 2   ASN C OD1   1 
ATOM   6711  N ND2   . ASN C 1 2   ? 26.266  -20.157 30.824  1.00 38.03 ? 2   ASN C ND2   1 
ATOM   6712  N N     . TYR C 1 3   ? 24.622  -20.566 34.224  1.00 35.73 ? 3   TYR C N     1 
ATOM   6713  C CA    . TYR C 1 3   ? 24.063  -19.414 34.944  1.00 34.09 ? 3   TYR C CA    1 
ATOM   6714  C C     . TYR C 1 3   ? 23.931  -18.108 34.109  1.00 32.30 ? 3   TYR C C     1 
ATOM   6715  O O     . TYR C 1 3   ? 22.919  -17.480 34.155  1.00 33.01 ? 3   TYR C O     1 
ATOM   6716  C CB    . TYR C 1 3   ? 24.677  -19.248 36.333  1.00 34.41 ? 3   TYR C CB    1 
ATOM   6717  C CG    . TYR C 1 3   ? 24.406  -20.454 37.220  1.00 34.76 ? 3   TYR C CG    1 
ATOM   6718  C CD1   . TYR C 1 3   ? 25.429  -21.350 37.562  1.00 34.35 ? 3   TYR C CD1   1 
ATOM   6719  C CD2   . TYR C 1 3   ? 23.102  -20.731 37.669  1.00 35.15 ? 3   TYR C CD2   1 
ATOM   6720  C CE1   . TYR C 1 3   ? 25.120  -22.513 38.385  1.00 36.27 ? 3   TYR C CE1   1 
ATOM   6721  C CE2   . TYR C 1 3   ? 22.797  -21.861 38.454  1.00 32.19 ? 3   TYR C CE2   1 
ATOM   6722  C CZ    . TYR C 1 3   ? 23.795  -22.737 38.825  1.00 32.90 ? 3   TYR C CZ    1 
ATOM   6723  O OH    . TYR C 1 3   ? 23.454  -23.836 39.633  1.00 32.68 ? 3   TYR C OH    1 
ATOM   6724  N N     . ALA C 1 4   ? 24.871  -17.773 33.262  1.00 31.25 ? 4   ALA C N     1 
ATOM   6725  C CA    . ALA C 1 4   ? 24.643  -16.711 32.267  1.00 31.65 ? 4   ALA C CA    1 
ATOM   6726  C C     . ALA C 1 4   ? 23.300  -16.574 31.514  1.00 32.17 ? 4   ALA C C     1 
ATOM   6727  O O     . ALA C 1 4   ? 22.899  -15.413 31.197  1.00 32.74 ? 4   ALA C O     1 
ATOM   6728  C CB    . ALA C 1 4   ? 25.957  -16.508 31.288  1.00 32.54 ? 4   ALA C CB    1 
ATOM   6729  N N     . ARG C 1 5   ? 22.553  -17.672 31.222  1.00 33.65 ? 5   ARG C N     1 
ATOM   6730  C CA    . ARG C 1 5   ? 21.181  -17.488 30.717  1.00 33.89 ? 5   ARG C CA    1 
ATOM   6731  C C     . ARG C 1 5   ? 20.111  -16.974 31.708  1.00 34.82 ? 5   ARG C C     1 
ATOM   6732  O O     . ARG C 1 5   ? 19.122  -16.386 31.288  1.00 36.37 ? 5   ARG C O     1 
ATOM   6733  C CB    . ARG C 1 5   ? 20.596  -18.590 29.744  1.00 35.78 ? 5   ARG C CB    1 
ATOM   6734  C CG    . ARG C 1 5   ? 21.082  -20.086 29.770  1.00 36.25 ? 5   ARG C CG    1 
ATOM   6735  C CD    . ARG C 1 5   ? 20.066  -21.098 29.011  1.00 34.77 ? 5   ARG C CD    1 
ATOM   6736  N NE    . ARG C 1 5   ? 18.627  -20.749 28.851  1.00 33.55 ? 5   ARG C NE    1 
ATOM   6737  C CZ    . ARG C 1 5   ? 17.602  -21.420 29.369  1.00 32.70 ? 5   ARG C CZ    1 
ATOM   6738  N NH1   . ARG C 1 5   ? 16.346  -21.058 29.121  1.00 32.26 ? 5   ARG C NH1   1 
ATOM   6739  N NH2   . ARG C 1 5   ? 17.820  -22.480 30.110  1.00 41.33 ? 5   ARG C NH2   1 
ATOM   6740  N N     . PHE C 1 6   ? 20.294  -17.109 33.011  1.00 35.17 ? 6   PHE C N     1 
ATOM   6741  C CA    . PHE C 1 6   ? 19.288  -16.525 33.924  1.00 36.16 ? 6   PHE C CA    1 
ATOM   6742  C C     . PHE C 1 6   ? 19.748  -15.148 34.587  1.00 36.09 ? 6   PHE C C     1 
ATOM   6743  O O     . PHE C 1 6   ? 19.455  -14.783 35.766  1.00 33.88 ? 6   PHE C O     1 
ATOM   6744  C CB    . PHE C 1 6   ? 18.823  -17.611 34.917  1.00 36.12 ? 6   PHE C CB    1 
ATOM   6745  C CG    . PHE C 1 6   ? 18.876  -19.047 34.311  1.00 36.73 ? 6   PHE C CG    1 
ATOM   6746  C CD1   . PHE C 1 6   ? 20.038  -19.781 34.341  1.00 34.20 ? 6   PHE C CD1   1 
ATOM   6747  C CD2   . PHE C 1 6   ? 17.756  -19.613 33.702  1.00 32.75 ? 6   PHE C CD2   1 
ATOM   6748  C CE1   . PHE C 1 6   ? 20.077  -21.042 33.751  1.00 38.06 ? 6   PHE C CE1   1 
ATOM   6749  C CE2   . PHE C 1 6   ? 17.772  -20.881 33.150  1.00 33.52 ? 6   PHE C CE2   1 
ATOM   6750  C CZ    . PHE C 1 6   ? 18.906  -21.610 33.181  1.00 34.94 ? 6   PHE C CZ    1 
ATOM   6751  N N     . ILE C 1 7   ? 20.501  -14.400 33.797  1.00 35.04 ? 7   ILE C N     1 
ATOM   6752  C CA    . ILE C 1 7   ? 21.157  -13.229 34.339  1.00 35.17 ? 7   ILE C CA    1 
ATOM   6753  C C     . ILE C 1 7   ? 21.205  -12.199 33.223  1.00 34.47 ? 7   ILE C C     1 
ATOM   6754  O O     . ILE C 1 7   ? 21.744  -12.435 32.138  1.00 35.44 ? 7   ILE C O     1 
ATOM   6755  C CB    . ILE C 1 7   ? 22.612  -13.491 34.891  1.00 35.68 ? 7   ILE C CB    1 
ATOM   6756  C CG1   . ILE C 1 7   ? 22.632  -14.484 36.048  1.00 35.85 ? 7   ILE C CG1   1 
ATOM   6757  C CG2   . ILE C 1 7   ? 23.209  -12.234 35.403  1.00 33.13 ? 7   ILE C CG2   1 
ATOM   6758  C CD1   . ILE C 1 7   ? 24.076  -14.768 36.515  1.00 35.12 ? 7   ILE C CD1   1 
ATOM   6759  N N     . THR C 1 8   ? 20.618  -11.054 33.533  1.00 32.78 ? 8   THR C N     1 
ATOM   6760  C CA    . THR C 1 8   ? 20.425  -9.947  32.632  1.00 31.70 ? 8   THR C CA    1 
ATOM   6761  C C     . THR C 1 8   ? 21.755  -9.272  32.250  1.00 31.39 ? 8   THR C C     1 
ATOM   6762  O O     . THR C 1 8   ? 22.769  -9.533  32.879  1.00 28.82 ? 8   THR C O     1 
ATOM   6763  C CB    . THR C 1 8   ? 19.455  -9.072  33.383  1.00 32.17 ? 8   THR C CB    1 
ATOM   6764  O OG1   . THR C 1 8   ? 18.197  -8.991  32.718  1.00 32.77 ? 8   THR C OG1   1 
ATOM   6765  C CG2   . THR C 1 8   ? 19.988  -7.854  33.927  1.00 26.71 ? 8   THR C CG2   1 
ATOM   6766  N N     . ALA C 1 9   ? 21.771  -8.469  31.168  1.00 32.09 ? 9   ALA C N     1 
ATOM   6767  C CA    . ALA C 1 9   ? 22.964  -7.659  30.869  1.00 32.09 ? 9   ALA C CA    1 
ATOM   6768  C C     . ALA C 1 9   ? 23.161  -6.563  31.923  1.00 30.14 ? 9   ALA C C     1 
ATOM   6769  O O     . ALA C 1 9   ? 24.254  -6.338  32.370  1.00 32.64 ? 9   ALA C O     1 
ATOM   6770  C CB    . ALA C 1 9   ? 22.953  -7.049  29.396  1.00 31.59 ? 9   ALA C CB    1 
ATOM   6771  N N     . ALA C 1 10  ? 22.156  -5.841  32.301  1.00 30.41 ? 10  ALA C N     1 
ATOM   6772  C CA    . ALA C 1 10  ? 22.427  -4.924  33.456  1.00 32.22 ? 10  ALA C CA    1 
ATOM   6773  C C     . ALA C 1 10  ? 22.990  -5.705  34.737  1.00 31.13 ? 10  ALA C C     1 
ATOM   6774  O O     . ALA C 1 10  ? 23.987  -5.315  35.328  1.00 30.28 ? 10  ALA C O     1 
ATOM   6775  C CB    . ALA C 1 10  ? 21.206  -4.001  33.785  1.00 30.79 ? 10  ALA C CB    1 
ATOM   6776  N N     . SER C 1 11  ? 22.436  -6.852  35.065  1.00 30.94 ? 11  SER C N     1 
ATOM   6777  C CA    . SER C 1 11  ? 22.897  -7.625  36.282  1.00 31.62 ? 11  SER C CA    1 
ATOM   6778  C C     . SER C 1 11  ? 24.294  -8.310  36.170  1.00 30.34 ? 11  SER C C     1 
ATOM   6779  O O     . SER C 1 11  ? 25.060  -8.332  37.146  1.00 30.09 ? 11  SER C O     1 
ATOM   6780  C CB    . SER C 1 11  ? 21.778  -8.590  36.788  1.00 32.18 ? 11  SER C CB    1 
ATOM   6781  O OG    . SER C 1 11  ? 22.200  -9.605  37.744  1.00 31.32 ? 11  SER C OG    1 
ATOM   6782  N N     . ALA C 1 12  ? 24.632  -8.865  35.007  1.00 30.65 ? 12  ALA C N     1 
ATOM   6783  C CA    . ALA C 1 12  ? 26.042  -9.195  34.701  1.00 32.28 ? 12  ALA C CA    1 
ATOM   6784  C C     . ALA C 1 12  ? 27.070  -8.036  34.723  1.00 32.68 ? 12  ALA C C     1 
ATOM   6785  O O     . ALA C 1 12  ? 28.236  -8.293  35.002  1.00 34.20 ? 12  ALA C O     1 
ATOM   6786  C CB    . ALA C 1 12  ? 26.134  -9.904  33.417  1.00 33.90 ? 12  ALA C CB    1 
ATOM   6787  N N     . ALA C 1 13  ? 26.649  -6.797  34.446  1.00 31.48 ? 13  ALA C N     1 
ATOM   6788  C CA    . ALA C 1 13  ? 27.501  -5.610  34.565  1.00 32.19 ? 13  ALA C CA    1 
ATOM   6789  C C     . ALA C 1 13  ? 27.846  -5.102  36.011  1.00 32.23 ? 13  ALA C C     1 
ATOM   6790  O O     . ALA C 1 13  ? 28.865  -4.472  36.191  1.00 33.11 ? 13  ALA C O     1 
ATOM   6791  C CB    . ALA C 1 13  ? 26.940  -4.482  33.766  1.00 32.47 ? 13  ALA C CB    1 
ATOM   6792  N N     . ARG C 1 14  ? 27.026  -5.397  37.005  1.00 32.61 ? 14  ARG C N     1 
ATOM   6793  C CA    . ARG C 1 14  ? 27.374  -5.214  38.443  1.00 31.77 ? 14  ARG C CA    1 
ATOM   6794  C C     . ARG C 1 14  ? 28.786  -5.707  38.818  1.00 33.61 ? 14  ARG C C     1 
ATOM   6795  O O     . ARG C 1 14  ? 29.192  -6.912  38.595  1.00 32.22 ? 14  ARG C O     1 
ATOM   6796  C CB    . ARG C 1 14  ? 26.273  -5.874  39.331  1.00 31.09 ? 14  ARG C CB    1 
ATOM   6797  C CG    . ARG C 1 14  ? 24.838  -5.205  39.233  1.00 30.63 ? 14  ARG C CG    1 
ATOM   6798  C CD    . ARG C 1 14  ? 23.803  -5.546  40.427  1.00 29.87 ? 14  ARG C CD    1 
ATOM   6799  N NE    . ARG C 1 14  ? 22.415  -5.153  40.022  1.00 24.44 ? 14  ARG C NE    1 
ATOM   6800  C CZ    . ARG C 1 14  ? 22.053  -3.867  39.812  1.00 25.80 ? 14  ARG C CZ    1 
ATOM   6801  N NH1   . ARG C 1 14  ? 22.947  -2.967  40.017  1.00 11.59 ? 14  ARG C NH1   1 
ATOM   6802  N NH2   . ARG C 1 14  ? 20.825  -3.457  39.408  1.00 23.36 ? 14  ARG C NH2   1 
ATOM   6803  N N     . ASN C 1 15  ? 29.562  -4.749  39.347  1.00 35.92 ? 15  ASN C N     1 
ATOM   6804  C CA    . ASN C 1 15  ? 30.864  -4.974  39.946  1.00 37.35 ? 15  ASN C CA    1 
ATOM   6805  C C     . ASN C 1 15  ? 30.675  -4.908  41.463  1.00 39.39 ? 15  ASN C C     1 
ATOM   6806  O O     . ASN C 1 15  ? 29.758  -4.215  41.961  1.00 39.53 ? 15  ASN C O     1 
ATOM   6807  C CB    . ASN C 1 15  ? 31.861  -3.912  39.520  1.00 37.99 ? 15  ASN C CB    1 
ATOM   6808  C CG    . ASN C 1 15  ? 32.068  -3.854  38.010  1.00 38.90 ? 15  ASN C CG    1 
ATOM   6809  O OD1   . ASN C 1 15  ? 31.913  -2.776  37.385  1.00 42.26 ? 15  ASN C OD1   1 
ATOM   6810  N ND2   . ASN C 1 15  ? 32.393  -4.989  37.413  1.00 37.64 ? 15  ASN C ND2   1 
ATOM   6811  N N     . PRO C 1 16  ? 31.477  -5.676  42.207  1.00 40.90 ? 16  PRO C N     1 
ATOM   6812  C CA    . PRO C 1 16  ? 31.418  -5.570  43.679  1.00 42.37 ? 16  PRO C CA    1 
ATOM   6813  C C     . PRO C 1 16  ? 31.481  -4.128  44.218  1.00 42.41 ? 16  PRO C C     1 
ATOM   6814  O O     . PRO C 1 16  ? 32.387  -3.371  43.927  1.00 42.19 ? 16  PRO C O     1 
ATOM   6815  C CB    . PRO C 1 16  ? 32.649  -6.398  44.137  1.00 42.39 ? 16  PRO C CB    1 
ATOM   6816  C CG    . PRO C 1 16  ? 32.854  -7.386  43.023  1.00 42.84 ? 16  PRO C CG    1 
ATOM   6817  C CD    . PRO C 1 16  ? 32.448  -6.703  41.760  1.00 41.26 ? 16  PRO C CD    1 
ATOM   6818  N N     . SER C 1 17  ? 30.525  -3.765  45.041  1.00 44.28 ? 17  SER C N     1 
ATOM   6819  C CA    . SER C 1 17  ? 30.538  -2.425  45.640  1.00 45.96 ? 17  SER C CA    1 
ATOM   6820  C C     . SER C 1 17  ? 30.488  -2.405  47.209  1.00 45.60 ? 17  SER C C     1 
ATOM   6821  O O     . SER C 1 17  ? 29.639  -1.745  47.767  1.00 44.50 ? 17  SER C O     1 
ATOM   6822  C CB    . SER C 1 17  ? 29.359  -1.629  45.044  1.00 45.12 ? 17  SER C CB    1 
ATOM   6823  O OG    . SER C 1 17  ? 29.490  -0.245  45.357  1.00 46.97 ? 17  SER C OG    1 
ATOM   6824  N N     . PRO C 1 18  ? 31.432  -3.066  47.910  1.00 47.73 ? 18  PRO C N     1 
ATOM   6825  C CA    . PRO C 1 18  ? 31.283  -3.274  49.390  1.00 49.18 ? 18  PRO C CA    1 
ATOM   6826  C C     . PRO C 1 18  ? 31.741  -2.093  50.278  1.00 52.22 ? 18  PRO C C     1 
ATOM   6827  O O     . PRO C 1 18  ? 32.233  -1.096  49.766  1.00 51.91 ? 18  PRO C O     1 
ATOM   6828  C CB    . PRO C 1 18  ? 32.170  -4.493  49.651  1.00 48.61 ? 18  PRO C CB    1 
ATOM   6829  C CG    . PRO C 1 18  ? 33.338  -4.291  48.644  1.00 48.80 ? 18  PRO C CG    1 
ATOM   6830  C CD    . PRO C 1 18  ? 32.726  -3.597  47.405  1.00 47.64 ? 18  PRO C CD    1 
ATOM   6831  N N     . ILE C 1 19  ? 31.569  -2.231  51.590  1.00 56.63 ? 19  ILE C N     1 
ATOM   6832  C CA    . ILE C 1 19  ? 32.414  -1.531  52.551  1.00 60.48 ? 19  ILE C CA    1 
ATOM   6833  C C     . ILE C 1 19  ? 33.425  -2.478  53.189  1.00 62.46 ? 19  ILE C C     1 
ATOM   6834  O O     . ILE C 1 19  ? 33.122  -3.158  54.169  1.00 62.89 ? 19  ILE C O     1 
ATOM   6835  C CB    . ILE C 1 19  ? 31.553  -0.864  53.640  1.00 60.94 ? 19  ILE C CB    1 
ATOM   6836  C CG1   . ILE C 1 19  ? 30.071  -0.930  53.264  1.00 60.50 ? 19  ILE C CG1   1 
ATOM   6837  C CG2   . ILE C 1 19  ? 31.990  0.577   53.855  1.00 61.54 ? 19  ILE C CG2   1 
ATOM   6838  C CD1   . ILE C 1 19  ? 29.160  -0.231  54.249  1.00 61.29 ? 19  ILE C CD1   1 
ATOM   6839  N N     . ARG C 1 20  ? 34.628  -2.517  52.624  1.00 65.70 ? 20  ARG C N     1 
ATOM   6840  C CA    . ARG C 1 20  ? 35.237  -3.773  52.202  1.00 68.06 ? 20  ARG C CA    1 
ATOM   6841  C C     . ARG C 1 20  ? 36.278  -4.247  53.210  1.00 69.91 ? 20  ARG C C     1 
ATOM   6842  O O     . ARG C 1 20  ? 36.081  -4.135  54.421  1.00 70.02 ? 20  ARG C O     1 
ATOM   6843  C CB    . ARG C 1 20  ? 35.874  -3.623  50.819  1.00 68.24 ? 20  ARG C CB    1 
ATOM   6844  C CG    . ARG C 1 20  ? 36.772  -2.404  50.679  1.00 69.09 ? 20  ARG C CG    1 
ATOM   6845  C CD    . ARG C 1 20  ? 38.256  -2.710  50.799  1.00 69.46 ? 20  ARG C CD    1 
ATOM   6846  N NE    . ARG C 1 20  ? 38.720  -3.599  49.737  1.00 69.13 ? 20  ARG C NE    1 
ATOM   6847  C CZ    . ARG C 1 20  ? 39.859  -3.440  49.076  1.00 66.83 ? 20  ARG C CZ    1 
ATOM   6848  N NH1   . ARG C 1 20  ? 40.659  -2.423  49.365  1.00 61.75 ? 20  ARG C NH1   1 
ATOM   6849  N NH2   . ARG C 1 20  ? 40.201  -4.298  48.125  1.00 65.40 ? 20  ARG C NH2   1 
ATOM   6850  N N     . THR C 1 21  ? 37.387  -4.778  52.703  1.00 71.54 ? 21  THR C N     1 
ATOM   6851  C CA    . THR C 1 21  ? 38.534  -5.100  53.542  1.00 72.77 ? 21  THR C CA    1 
ATOM   6852  C C     . THR C 1 21  ? 39.319  -3.846  53.910  1.00 73.81 ? 21  THR C C     1 
ATOM   6853  O O     . THR C 1 21  ? 40.549  -3.865  53.967  1.00 74.09 ? 21  THR C O     1 
ATOM   6854  C CB    . THR C 1 21  ? 39.455  -6.111  52.832  1.00 72.76 ? 21  THR C CB    1 
ATOM   6855  O OG1   . THR C 1 21  ? 40.430  -5.407  52.052  1.00 72.43 ? 21  THR C OG1   1 
ATOM   6856  C CG2   . THR C 1 21  ? 38.676  -6.899  51.790  1.00 71.99 ? 21  THR C CG2   1 
ATOM   6857  N N     . MET C 1 22  ? 38.600  -2.756  54.159  1.00 74.67 ? 22  MET C N     1 
ATOM   6858  C CA    . MET C 1 22  ? 39.027  -1.764  55.132  1.00 74.87 ? 22  MET C CA    1 
ATOM   6859  C C     . MET C 1 22  ? 39.062  -2.620  56.405  1.00 75.41 ? 22  MET C C     1 
ATOM   6860  O O     . MET C 1 22  ? 40.066  -2.631  57.150  1.00 75.37 ? 22  MET C O     1 
ATOM   6861  C CB    . MET C 1 22  ? 38.021  -0.618  55.241  1.00 74.96 ? 22  MET C CB    1 
ATOM   6862  C CG    . MET C 1 22  ? 36.543  -1.038  55.440  1.00 75.09 ? 22  MET C CG    1 
ATOM   6863  S SD    . MET C 1 22  ? 35.323  0.263   55.070  1.00 73.92 ? 22  MET C SD    1 
ATOM   6864  C CE    . MET C 1 22  ? 35.770  0.623   53.344  1.00 72.58 ? 22  MET C CE    1 
ATOM   6865  N N     . THR C 1 23  ? 37.980  -3.388  56.584  1.00 75.60 ? 23  THR C N     1 
ATOM   6866  C CA    . THR C 1 23  ? 37.797  -4.293  57.732  1.00 76.30 ? 23  THR C CA    1 
ATOM   6867  C C     . THR C 1 23  ? 38.072  -5.786  57.426  1.00 76.25 ? 23  THR C C     1 
ATOM   6868  O O     . THR C 1 23  ? 37.327  -6.654  57.903  1.00 76.46 ? 23  THR C O     1 
ATOM   6869  C CB    . THR C 1 23  ? 36.361  -4.142  58.353  1.00 76.41 ? 23  THR C CB    1 
ATOM   6870  O OG1   . THR C 1 23  ? 35.376  -4.574  57.391  1.00 76.16 ? 23  THR C OG1   1 
ATOM   6871  C CG2   . THR C 1 23  ? 36.086  -2.668  58.842  1.00 76.44 ? 23  THR C CG2   1 
ATOM   6872  N N     . ASP C 1 24  ? 39.119  -6.073  56.633  1.00 76.34 ? 24  ASP C N     1 
ATOM   6873  C CA    . ASP C 1 24  ? 39.601  -7.469  56.389  1.00 76.43 ? 24  ASP C CA    1 
ATOM   6874  C C     . ASP C 1 24  ? 41.116  -7.585  56.142  1.00 76.33 ? 24  ASP C C     1 
ATOM   6875  O O     . ASP C 1 24  ? 41.685  -8.658  56.348  1.00 75.59 ? 24  ASP C O     1 
ATOM   6876  C CB    . ASP C 1 24  ? 38.823  -8.210  55.272  1.00 76.28 ? 24  ASP C CB    1 
ATOM   6877  C CG    . ASP C 1 24  ? 37.542  -8.877  55.768  1.00 76.43 ? 24  ASP C CG    1 
ATOM   6878  O OD1   . ASP C 1 24  ? 36.660  -9.153  54.905  1.00 77.75 ? 24  ASP C OD1   1 
ATOM   6879  O OD2   . ASP C 1 24  ? 37.412  -9.124  56.993  1.00 71.10 ? 24  ASP C OD2   1 
ATOM   6880  N N     . ILE C 1 25  ? 41.770  -6.504  55.692  1.00 76.32 ? 25  ILE C N     1 
ATOM   6881  C CA    . ILE C 1 25  ? 43.235  -6.413  55.887  1.00 76.48 ? 25  ILE C CA    1 
ATOM   6882  C C     . ILE C 1 25  ? 43.424  -6.347  57.413  1.00 75.93 ? 25  ILE C C     1 
ATOM   6883  O O     . ILE C 1 25  ? 44.487  -6.688  57.959  1.00 75.35 ? 25  ILE C O     1 
ATOM   6884  C CB    . ILE C 1 25  ? 43.914  -5.205  55.178  1.00 76.22 ? 25  ILE C CB    1 
ATOM   6885  C CG1   . ILE C 1 25  ? 43.574  -5.189  53.676  1.00 77.54 ? 25  ILE C CG1   1 
ATOM   6886  C CG2   . ILE C 1 25  ? 45.426  -5.246  55.411  1.00 77.69 ? 25  ILE C CG2   1 
ATOM   6887  C CD1   . ILE C 1 25  ? 44.722  -4.844  52.691  1.00 77.15 ? 25  ILE C CD1   1 
ATOM   6888  N N     . LEU C 1 26  ? 42.317  -5.972  58.061  1.00 75.63 ? 26  LEU C N     1 
ATOM   6889  C CA    . LEU C 1 26  ? 42.180  -5.704  59.497  1.00 75.35 ? 26  LEU C CA    1 
ATOM   6890  C C     . LEU C 1 26  ? 41.336  -6.806  60.167  1.00 74.98 ? 26  LEU C C     1 
ATOM   6891  O O     . LEU C 1 26  ? 40.767  -6.589  61.244  1.00 75.09 ? 26  LEU C O     1 
ATOM   6892  C CB    . LEU C 1 26  ? 41.486  -4.349  59.653  1.00 75.34 ? 26  LEU C CB    1 
ATOM   6893  C CG    . LEU C 1 26  ? 41.765  -3.287  60.716  1.00 75.67 ? 26  LEU C CG    1 
ATOM   6894  C CD1   . LEU C 1 26  ? 43.233  -2.875  60.778  1.00 73.47 ? 26  LEU C CD1   1 
ATOM   6895  C CD2   . LEU C 1 26  ? 40.842  -2.080  60.411  1.00 75.17 ? 26  LEU C CD2   1 
ATOM   6896  N N     . SER C 1 27  ? 41.219  -7.954  59.494  1.00 74.36 ? 27  SER C N     1 
ATOM   6897  C CA    . SER C 1 27  ? 40.720  -9.200  60.106  1.00 73.94 ? 27  SER C CA    1 
ATOM   6898  C C     . SER C 1 27  ? 41.683  -10.378 59.845  1.00 73.35 ? 27  SER C C     1 
ATOM   6899  O O     . SER C 1 27  ? 41.471  -11.512 60.308  1.00 73.33 ? 27  SER C O     1 
ATOM   6900  C CB    . SER C 1 27  ? 39.287  -9.533  59.665  1.00 74.07 ? 27  SER C CB    1 
ATOM   6901  O OG    . SER C 1 27  ? 38.772  -10.642 60.401  1.00 74.00 ? 27  SER C OG    1 
ATOM   6902  N N     . ARG C 1 28  ? 42.753  -10.089 59.114  1.00 72.31 ? 28  ARG C N     1 
ATOM   6903  C CA    . ARG C 1 28  ? 43.888  -11.000 59.024  1.00 71.53 ? 28  ARG C CA    1 
ATOM   6904  C C     . ARG C 1 28  ? 45.180  -10.333 59.512  1.00 70.75 ? 28  ARG C C     1 
ATOM   6905  O O     . ARG C 1 28  ? 46.281  -10.797 59.196  1.00 71.29 ? 28  ARG C O     1 
ATOM   6906  C CB    . ARG C 1 28  ? 44.027  -11.599 57.606  1.00 71.35 ? 28  ARG C CB    1 
ATOM   6907  C CG    . ARG C 1 28  ? 43.936  -10.631 56.405  1.00 71.85 ? 28  ARG C CG    1 
ATOM   6908  C CD    . ARG C 1 28  ? 42.866  -11.094 55.381  1.00 70.90 ? 28  ARG C CD    1 
ATOM   6909  N NE    . ARG C 1 28  ? 42.466  -12.491 55.612  1.00 69.64 ? 28  ARG C NE    1 
ATOM   6910  C CZ    . ARG C 1 28  ? 41.229  -12.954 55.766  1.00 65.17 ? 28  ARG C CZ    1 
ATOM   6911  N NH1   . ARG C 1 28  ? 40.158  -12.178 55.682  1.00 66.60 ? 28  ARG C NH1   1 
ATOM   6912  N NH2   . ARG C 1 28  ? 41.073  -14.226 55.987  1.00 62.00 ? 28  ARG C NH2   1 
ATOM   6913  N N     . GLY C 1 29  ? 45.039  -9.256  60.304  1.00 69.32 ? 29  GLY C N     1 
ATOM   6914  C CA    . GLY C 1 29  ? 46.156  -8.319  60.510  1.00 66.62 ? 29  GLY C CA    1 
ATOM   6915  C C     . GLY C 1 29  ? 46.479  -7.930  61.937  1.00 64.85 ? 29  GLY C C     1 
ATOM   6916  O O     . GLY C 1 29  ? 45.620  -8.073  62.815  1.00 64.33 ? 29  GLY C O     1 
ATOM   6917  N N     . PRO C 1 30  ? 47.716  -7.403  62.165  1.00 63.65 ? 30  PRO C N     1 
ATOM   6918  C CA    . PRO C 1 30  ? 48.290  -7.190  63.512  1.00 62.53 ? 30  PRO C CA    1 
ATOM   6919  C C     . PRO C 1 30  ? 47.532  -6.091  64.237  1.00 62.07 ? 30  PRO C C     1 
ATOM   6920  O O     . PRO C 1 30  ? 47.189  -5.102  63.619  1.00 59.94 ? 30  PRO C O     1 
ATOM   6921  C CB    . PRO C 1 30  ? 49.737  -6.744  63.233  1.00 62.87 ? 30  PRO C CB    1 
ATOM   6922  C CG    . PRO C 1 30  ? 49.966  -6.957  61.694  1.00 62.47 ? 30  PRO C CG    1 
ATOM   6923  C CD    . PRO C 1 30  ? 48.616  -6.926  61.085  1.00 63.55 ? 30  PRO C CD    1 
ATOM   6924  N N     . LYS C 1 31  ? 47.263  -6.298  65.534  1.00 62.31 ? 31  LYS C N     1 
ATOM   6925  C CA    . LYS C 1 31  ? 46.482  -5.366  66.384  1.00 62.38 ? 31  LYS C CA    1 
ATOM   6926  C C     . LYS C 1 31  ? 47.160  -3.940  66.474  1.00 61.80 ? 31  LYS C C     1 
ATOM   6927  O O     . LYS C 1 31  ? 46.712  -3.057  67.238  1.00 62.50 ? 31  LYS C O     1 
ATOM   6928  C CB    . LYS C 1 31  ? 46.279  -6.022  67.772  1.00 62.68 ? 31  LYS C CB    1 
ATOM   6929  C CG    . LYS C 1 31  ? 44.812  -6.080  68.328  1.00 64.08 ? 31  LYS C CG    1 
ATOM   6930  C CD    . LYS C 1 31  ? 44.473  -7.370  69.178  1.00 62.55 ? 31  LYS C CD    1 
ATOM   6931  C CE    . LYS C 1 31  ? 45.401  -7.613  70.401  1.00 63.89 ? 31  LYS C CE    1 
ATOM   6932  N NZ    . LYS C 1 31  ? 45.526  -9.076  70.827  1.00 62.42 ? 31  LYS C NZ    1 
ATOM   6933  N N     . SER C 1 32  ? 48.228  -3.749  65.685  1.00 59.75 ? 32  SER C N     1 
ATOM   6934  C CA    . SER C 1 32  ? 49.016  -2.515  65.617  1.00 57.97 ? 32  SER C CA    1 
ATOM   6935  C C     . SER C 1 32  ? 48.733  -1.700  64.352  1.00 57.02 ? 32  SER C C     1 
ATOM   6936  O O     . SER C 1 32  ? 49.028  -0.469  64.310  1.00 57.50 ? 32  SER C O     1 
ATOM   6937  C CB    . SER C 1 32  ? 50.514  -2.843  65.630  1.00 58.47 ? 32  SER C CB    1 
ATOM   6938  O OG    . SER C 1 32  ? 50.827  -3.777  64.600  1.00 59.01 ? 32  SER C OG    1 
ATOM   6939  N N     . MET C 1 33  ? 48.219  -2.373  63.315  1.00 53.71 ? 33  MET C N     1 
ATOM   6940  C CA    . MET C 1 33  ? 47.797  -1.709  62.102  1.00 52.16 ? 33  MET C CA    1 
ATOM   6941  C C     . MET C 1 33  ? 46.927  -0.482  62.433  1.00 49.39 ? 33  MET C C     1 
ATOM   6942  O O     . MET C 1 33  ? 46.058  -0.515  63.301  1.00 48.88 ? 33  MET C O     1 
ATOM   6943  C CB    . MET C 1 33  ? 47.063  -2.671  61.154  1.00 52.06 ? 33  MET C CB    1 
ATOM   6944  C CG    . MET C 1 33  ? 47.313  -2.373  59.658  1.00 53.97 ? 33  MET C CG    1 
ATOM   6945  S SD    . MET C 1 33  ? 46.791  -3.692  58.533  1.00 58.42 ? 33  MET C SD    1 
ATOM   6946  C CE    . MET C 1 33  ? 48.305  -4.690  58.408  1.00 60.25 ? 33  MET C CE    1 
ATOM   6947  N N     . ILE C 1 34  ? 47.233  0.636   61.790  1.00 46.48 ? 34  ILE C N     1 
ATOM   6948  C CA    . ILE C 1 34  ? 46.315  1.703   61.779  1.00 43.99 ? 34  ILE C CA    1 
ATOM   6949  C C     . ILE C 1 34  ? 45.721  1.834   60.385  1.00 42.63 ? 34  ILE C C     1 
ATOM   6950  O O     . ILE C 1 34  ? 46.433  1.750   59.396  1.00 44.75 ? 34  ILE C O     1 
ATOM   6951  C CB    . ILE C 1 34  ? 46.798  3.098   62.498  1.00 44.72 ? 34  ILE C CB    1 
ATOM   6952  C CG1   . ILE C 1 34  ? 46.460  4.299   61.650  1.00 41.16 ? 34  ILE C CG1   1 
ATOM   6953  C CG2   . ILE C 1 34  ? 48.255  3.145   63.039  1.00 43.49 ? 34  ILE C CG2   1 
ATOM   6954  C CD1   . ILE C 1 34  ? 46.269  5.506   62.488  1.00 41.87 ? 34  ILE C CD1   1 
ATOM   6955  N N     . SER C 1 35  ? 44.405  1.972   60.294  1.00 39.74 ? 35  SER C N     1 
ATOM   6956  C CA    . SER C 1 35  ? 43.839  2.282   59.008  1.00 37.55 ? 35  SER C CA    1 
ATOM   6957  C C     . SER C 1 35  ? 43.115  3.596   58.952  1.00 36.65 ? 35  SER C C     1 
ATOM   6958  O O     . SER C 1 35  ? 42.242  3.910   59.826  1.00 35.26 ? 35  SER C O     1 
ATOM   6959  C CB    . SER C 1 35  ? 42.832  1.243   58.551  1.00 37.14 ? 35  SER C CB    1 
ATOM   6960  O OG    . SER C 1 35  ? 42.143  1.779   57.436  1.00 30.76 ? 35  SER C OG    1 
ATOM   6961  N N     . LEU C 1 36  ? 43.386  4.299   57.858  1.00 35.02 ? 36  LEU C N     1 
ATOM   6962  C CA    . LEU C 1 36  ? 42.584  5.483   57.535  1.00 35.95 ? 36  LEU C CA    1 
ATOM   6963  C C     . LEU C 1 36  ? 41.841  5.332   56.184  1.00 36.10 ? 36  LEU C C     1 
ATOM   6964  O O     . LEU C 1 36  ? 41.540  6.344   55.522  1.00 35.04 ? 36  LEU C O     1 
ATOM   6965  C CB    . LEU C 1 36  ? 43.479  6.733   57.497  1.00 37.09 ? 36  LEU C CB    1 
ATOM   6966  C CG    . LEU C 1 36  ? 44.350  7.197   58.672  1.00 37.54 ? 36  LEU C CG    1 
ATOM   6967  C CD1   . LEU C 1 36  ? 44.935  8.510   58.137  1.00 38.93 ? 36  LEU C CD1   1 
ATOM   6968  C CD2   . LEU C 1 36  ? 43.576  7.493   59.991  1.00 32.87 ? 36  LEU C CD2   1 
ATOM   6969  N N     . ALA C 1 37  ? 41.521  4.081   55.799  1.00 35.49 ? 37  ALA C N     1 
ATOM   6970  C CA    . ALA C 1 37  ? 40.967  3.788   54.461  1.00 36.37 ? 37  ALA C CA    1 
ATOM   6971  C C     . ALA C 1 37  ? 39.481  3.501   54.511  1.00 37.44 ? 37  ALA C C     1 
ATOM   6972  O O     . ALA C 1 37  ? 38.831  3.526   53.487  1.00 39.40 ? 37  ALA C O     1 
ATOM   6973  C CB    . ALA C 1 37  ? 41.715  2.653   53.843  1.00 37.03 ? 37  ALA C CB    1 
ATOM   6974  N N     . GLY C 1 38  ? 38.939  3.332   55.731  1.00 38.39 ? 38  GLY C N     1 
ATOM   6975  C CA    . GLY C 1 38  ? 37.545  3.007   56.011  1.00 36.73 ? 38  GLY C CA    1 
ATOM   6976  C C     . GLY C 1 38  ? 36.528  4.096   55.720  1.00 36.79 ? 38  GLY C C     1 
ATOM   6977  O O     . GLY C 1 38  ? 36.805  5.302   55.884  1.00 36.62 ? 38  GLY C O     1 
ATOM   6978  N N     . GLY C 1 39  ? 35.342  3.685   55.263  1.00 34.29 ? 39  GLY C N     1 
ATOM   6979  C CA    . GLY C 1 39  ? 34.236  4.605   55.244  1.00 34.31 ? 39  GLY C CA    1 
ATOM   6980  C C     . GLY C 1 39  ? 33.248  4.650   56.411  1.00 34.60 ? 39  GLY C C     1 
ATOM   6981  O O     . GLY C 1 39  ? 32.219  5.288   56.252  1.00 35.74 ? 39  GLY C O     1 
ATOM   6982  N N     . LEU C 1 40  ? 33.498  4.000   57.561  1.00 35.69 ? 40  LEU C N     1 
ATOM   6983  C CA    . LEU C 1 40  ? 32.458  3.933   58.648  1.00 34.66 ? 40  LEU C CA    1 
ATOM   6984  C C     . LEU C 1 40  ? 32.451  5.266   59.331  1.00 35.82 ? 40  LEU C C     1 
ATOM   6985  O O     . LEU C 1 40  ? 33.558  5.872   59.558  1.00 36.24 ? 40  LEU C O     1 
ATOM   6986  C CB    . LEU C 1 40  ? 32.792  2.870   59.696  1.00 33.48 ? 40  LEU C CB    1 
ATOM   6987  C CG    . LEU C 1 40  ? 32.926  1.401   59.184  1.00 36.90 ? 40  LEU C CG    1 
ATOM   6988  C CD1   . LEU C 1 40  ? 33.178  0.345   60.339  1.00 32.35 ? 40  LEU C CD1   1 
ATOM   6989  C CD2   . LEU C 1 40  ? 31.743  0.971   58.277  1.00 32.57 ? 40  LEU C CD2   1 
ATOM   6990  N N     . PRO C 1 41  ? 31.244  5.783   59.669  1.00 35.39 ? 41  PRO C N     1 
ATOM   6991  C CA    . PRO C 1 41  ? 31.283  6.960   60.566  1.00 34.46 ? 41  PRO C CA    1 
ATOM   6992  C C     . PRO C 1 41  ? 31.575  6.505   61.973  1.00 33.29 ? 41  PRO C C     1 
ATOM   6993  O O     . PRO C 1 41  ? 31.377  5.316   62.287  1.00 34.65 ? 41  PRO C O     1 
ATOM   6994  C CB    . PRO C 1 41  ? 29.865  7.497   60.474  1.00 33.25 ? 41  PRO C CB    1 
ATOM   6995  C CG    . PRO C 1 41  ? 29.052  6.328   60.297  1.00 33.82 ? 41  PRO C CG    1 
ATOM   6996  C CD    . PRO C 1 41  ? 29.864  5.470   59.300  1.00 35.50 ? 41  PRO C CD    1 
ATOM   6997  N N     . ASN C 1 42  ? 32.073  7.407   62.790  1.00 33.22 ? 42  ASN C N     1 
ATOM   6998  C CA    . ASN C 1 42  ? 32.225  7.173   64.268  1.00 33.29 ? 42  ASN C CA    1 
ATOM   6999  C C     . ASN C 1 42  ? 30.869  6.842   64.896  1.00 32.48 ? 42  ASN C C     1 
ATOM   7000  O O     . ASN C 1 42  ? 30.043  7.752   65.021  1.00 32.03 ? 42  ASN C O     1 
ATOM   7001  C CB    . ASN C 1 42  ? 32.830  8.426   64.982  1.00 32.98 ? 42  ASN C CB    1 
ATOM   7002  C CG    . ASN C 1 42  ? 33.590  8.068   66.317  1.00 37.54 ? 42  ASN C CG    1 
ATOM   7003  O OD1   . ASN C 1 42  ? 33.059  7.369   67.216  1.00 42.04 ? 42  ASN C OD1   1 
ATOM   7004  N ND2   . ASN C 1 42  ? 34.828  8.553   66.438  1.00 39.72 ? 42  ASN C ND2   1 
ATOM   7005  N N     . PRO C 1 43  ? 30.642  5.568   65.329  1.00 31.73 ? 43  PRO C N     1 
ATOM   7006  C CA    . PRO C 1 43  ? 29.384  5.139   66.003  1.00 31.56 ? 43  PRO C CA    1 
ATOM   7007  C C     . PRO C 1 43  ? 29.215  5.792   67.451  1.00 31.86 ? 43  PRO C C     1 
ATOM   7008  O O     . PRO C 1 43  ? 28.126  5.846   68.013  1.00 31.06 ? 43  PRO C O     1 
ATOM   7009  C CB    . PRO C 1 43  ? 29.540  3.586   66.059  1.00 31.63 ? 43  PRO C CB    1 
ATOM   7010  C CG    . PRO C 1 43  ? 31.096  3.415   66.320  1.00 31.83 ? 43  PRO C CG    1 
ATOM   7011  C CD    . PRO C 1 43  ? 31.648  4.477   65.322  1.00 33.18 ? 43  PRO C CD    1 
ATOM   7012  N N     . ASN C 1 44  ? 30.284  6.347   68.007  1.00 31.88 ? 44  ASN C N     1 
ATOM   7013  C CA    . ASN C 1 44  ? 30.235  6.921   69.401  1.00 31.06 ? 44  ASN C CA    1 
ATOM   7014  C C     . ASN C 1 44  ? 29.325  8.092   69.540  1.00 30.64 ? 44  ASN C C     1 
ATOM   7015  O O     . ASN C 1 44  ? 28.866  8.350   70.643  1.00 29.64 ? 44  ASN C O     1 
ATOM   7016  C CB    . ASN C 1 44  ? 31.625  7.340   69.863  1.00 31.51 ? 44  ASN C CB    1 
ATOM   7017  C CG    . ASN C 1 44  ? 32.447  6.136   70.389  1.00 33.98 ? 44  ASN C CG    1 
ATOM   7018  O OD1   . ASN C 1 44  ? 32.117  5.609   71.415  1.00 39.85 ? 44  ASN C OD1   1 
ATOM   7019  N ND2   . ASN C 1 44  ? 33.488  5.708   69.662  1.00 31.40 ? 44  ASN C ND2   1 
ATOM   7020  N N     . MET C 1 45  ? 29.041  8.756   68.391  1.00 30.67 ? 45  MET C N     1 
ATOM   7021  C CA    . MET C 1 45  ? 28.124  9.889   68.247  1.00 30.21 ? 45  MET C CA    1 
ATOM   7022  C C     . MET C 1 45  ? 26.670  9.526   68.325  1.00 29.80 ? 45  MET C C     1 
ATOM   7023  O O     . MET C 1 45  ? 25.807  10.361  68.640  1.00 32.06 ? 45  MET C O     1 
ATOM   7024  C CB    . MET C 1 45  ? 28.317  10.573  66.875  1.00 30.07 ? 45  MET C CB    1 
ATOM   7025  C CG    . MET C 1 45  ? 29.737  11.186  66.643  1.00 31.96 ? 45  MET C CG    1 
ATOM   7026  S SD    . MET C 1 45  ? 30.216  12.275  67.998  1.00 38.36 ? 45  MET C SD    1 
ATOM   7027  C CE    . MET C 1 45  ? 28.663  12.924  68.590  1.00 41.00 ? 45  MET C CE    1 
ATOM   7028  N N     . PHE C 1 46  ? 26.385  8.310   67.903  1.00 28.86 ? 46  PHE C N     1 
ATOM   7029  C CA    . PHE C 1 46  ? 25.054  7.794   67.928  1.00 27.50 ? 46  PHE C CA    1 
ATOM   7030  C C     . PHE C 1 46  ? 24.540  7.829   69.381  1.00 27.83 ? 46  PHE C C     1 
ATOM   7031  O O     . PHE C 1 46  ? 25.240  7.429   70.310  1.00 28.44 ? 46  PHE C O     1 
ATOM   7032  C CB    . PHE C 1 46  ? 25.098  6.394   67.321  1.00 25.54 ? 46  PHE C CB    1 
ATOM   7033  C CG    . PHE C 1 46  ? 25.594  6.392   65.832  1.00 25.96 ? 46  PHE C CG    1 
ATOM   7034  C CD1   . PHE C 1 46  ? 25.524  7.551   65.079  1.00 18.81 ? 46  PHE C CD1   1 
ATOM   7035  C CD2   . PHE C 1 46  ? 26.079  5.217   65.221  1.00 19.30 ? 46  PHE C CD2   1 
ATOM   7036  C CE1   . PHE C 1 46  ? 25.961  7.594   63.737  1.00 20.54 ? 46  PHE C CE1   1 
ATOM   7037  C CE2   . PHE C 1 46  ? 26.534  5.212   63.891  1.00 22.56 ? 46  PHE C CE2   1 
ATOM   7038  C CZ    . PHE C 1 46  ? 26.407  6.403   63.119  1.00 24.14 ? 46  PHE C CZ    1 
ATOM   7039  N N     . PRO C 1 47  ? 23.279  8.246   69.564  1.00 28.39 ? 47  PRO C N     1 
ATOM   7040  C CA    . PRO C 1 47  ? 22.740  8.570   70.924  1.00 28.47 ? 47  PRO C CA    1 
ATOM   7041  C C     . PRO C 1 47  ? 22.103  7.401   71.681  1.00 28.70 ? 47  PRO C C     1 
ATOM   7042  O O     . PRO C 1 47  ? 21.852  7.504   72.885  1.00 28.95 ? 47  PRO C O     1 
ATOM   7043  C CB    . PRO C 1 47  ? 21.693  9.634   70.622  1.00 26.90 ? 47  PRO C CB    1 
ATOM   7044  C CG    . PRO C 1 47  ? 21.167  9.130   69.173  1.00 29.08 ? 47  PRO C CG    1 
ATOM   7045  C CD    . PRO C 1 47  ? 22.308  8.488   68.459  1.00 27.06 ? 47  PRO C CD    1 
ATOM   7046  N N     . PHE C 1 48  ? 21.805  6.308   70.993  1.00 28.35 ? 48  PHE C N     1 
ATOM   7047  C CA    . PHE C 1 48  ? 21.199  5.152   71.659  1.00 26.85 ? 48  PHE C CA    1 
ATOM   7048  C C     . PHE C 1 48  ? 22.316  4.360   72.268  1.00 27.35 ? 48  PHE C C     1 
ATOM   7049  O O     . PHE C 1 48  ? 23.308  4.142   71.645  1.00 28.66 ? 48  PHE C O     1 
ATOM   7050  C CB    . PHE C 1 48  ? 20.450  4.261   70.661  1.00 26.79 ? 48  PHE C CB    1 
ATOM   7051  C CG    . PHE C 1 48  ? 19.376  4.957   69.883  1.00 26.31 ? 48  PHE C CG    1 
ATOM   7052  C CD1   . PHE C 1 48  ? 18.226  5.423   70.478  1.00 21.05 ? 48  PHE C CD1   1 
ATOM   7053  C CD2   . PHE C 1 48  ? 19.523  5.135   68.494  1.00 29.49 ? 48  PHE C CD2   1 
ATOM   7054  C CE1   . PHE C 1 48  ? 17.247  6.043   69.697  1.00 23.60 ? 48  PHE C CE1   1 
ATOM   7055  C CE2   . PHE C 1 48  ? 18.524  5.712   67.700  1.00 23.13 ? 48  PHE C CE2   1 
ATOM   7056  C CZ    . PHE C 1 48  ? 17.405  6.167   68.275  1.00 20.50 ? 48  PHE C CZ    1 
ATOM   7057  N N     . LYS C 1 49  ? 22.195  3.933   73.510  1.00 30.23 ? 49  LYS C N     1 
ATOM   7058  C CA    . LYS C 1 49  ? 23.364  3.401   74.185  1.00 30.93 ? 49  LYS C CA    1 
ATOM   7059  C C     . LYS C 1 49  ? 23.282  1.965   74.681  1.00 31.05 ? 49  LYS C C     1 
ATOM   7060  O O     . LYS C 1 49  ? 24.284  1.279   74.714  1.00 31.97 ? 49  LYS C O     1 
ATOM   7061  C CB    . LYS C 1 49  ? 23.842  4.320   75.305  1.00 30.73 ? 49  LYS C CB    1 
ATOM   7062  C CG    . LYS C 1 49  ? 24.221  5.702   74.889  1.00 31.46 ? 49  LYS C CG    1 
ATOM   7063  C CD    . LYS C 1 49  ? 25.369  5.754   73.922  1.00 30.74 ? 49  LYS C CD    1 
ATOM   7064  C CE    . LYS C 1 49  ? 25.732  7.183   73.603  1.00 25.83 ? 49  LYS C CE    1 
ATOM   7065  N NZ    . LYS C 1 49  ? 26.814  7.324   72.627  1.00 28.97 ? 49  LYS C NZ    1 
ATOM   7066  N N     . THR C 1 50  ? 22.102  1.529   75.104  1.00 32.76 ? 50  THR C N     1 
ATOM   7067  C CA    . THR C 1 50  ? 21.882  0.150   75.540  1.00 32.32 ? 50  THR C CA    1 
ATOM   7068  C C     . THR C 1 50  ? 20.506  -0.359  75.166  1.00 33.23 ? 50  THR C C     1 
ATOM   7069  O O     . THR C 1 50  ? 19.586  0.414   74.972  1.00 34.48 ? 50  THR C O     1 
ATOM   7070  C CB    . THR C 1 50  ? 22.095  -0.040  77.071  1.00 32.81 ? 50  THR C CB    1 
ATOM   7071  O OG1   . THR C 1 50  ? 21.118  0.688   77.810  1.00 30.22 ? 50  THR C OG1   1 
ATOM   7072  C CG2   . THR C 1 50  ? 23.398  0.518   77.530  1.00 31.83 ? 50  THR C CG2   1 
ATOM   7073  N N     . ALA C 1 51  ? 20.382  -1.678  75.093  1.00 35.16 ? 51  ALA C N     1 
ATOM   7074  C CA    . ALA C 1 51  ? 19.118  -2.335  74.845  1.00 35.17 ? 51  ALA C CA    1 
ATOM   7075  C C     . ALA C 1 51  ? 18.811  -3.428  75.843  1.00 33.91 ? 51  ALA C C     1 
ATOM   7076  O O     . ALA C 1 51  ? 19.670  -4.196  76.214  1.00 35.36 ? 51  ALA C O     1 
ATOM   7077  C CB    . ALA C 1 51  ? 19.080  -2.889  73.456  1.00 38.92 ? 51  ALA C CB    1 
ATOM   7078  N N     . VAL C 1 52  ? 17.564  -3.495  76.269  1.00 33.96 ? 52  VAL C N     1 
ATOM   7079  C CA    . VAL C 1 52  ? 17.059  -4.679  76.914  1.00 34.07 ? 52  VAL C CA    1 
ATOM   7080  C C     . VAL C 1 52  ? 15.755  -5.108  76.304  1.00 34.43 ? 52  VAL C C     1 
ATOM   7081  O O     . VAL C 1 52  ? 14.829  -4.333  76.182  1.00 37.59 ? 52  VAL C O     1 
ATOM   7082  C CB    . VAL C 1 52  ? 16.884  -4.494  78.422  1.00 32.64 ? 52  VAL C CB    1 
ATOM   7083  C CG1   . VAL C 1 52  ? 16.234  -5.689  79.016  1.00 33.76 ? 52  VAL C CG1   1 
ATOM   7084  C CG2   . VAL C 1 52  ? 18.206  -4.271  79.078  1.00 34.47 ? 52  VAL C CG2   1 
ATOM   7085  N N     . ILE C 1 53  ? 15.698  -6.370  75.932  1.00 33.63 ? 53  ILE C N     1 
ATOM   7086  C CA    . ILE C 1 53  ? 14.596  -6.910  75.106  1.00 33.77 ? 53  ILE C CA    1 
ATOM   7087  C C     . ILE C 1 53  ? 14.165  -8.205  75.746  1.00 33.14 ? 53  ILE C C     1 
ATOM   7088  O O     . ILE C 1 53  ? 15.007  -9.050  75.953  1.00 33.53 ? 53  ILE C O     1 
ATOM   7089  C CB    . ILE C 1 53  ? 15.053  -7.104  73.608  1.00 33.28 ? 53  ILE C CB    1 
ATOM   7090  C CG1   . ILE C 1 53  ? 15.471  -5.759  73.031  1.00 31.86 ? 53  ILE C CG1   1 
ATOM   7091  C CG2   . ILE C 1 53  ? 13.958  -7.837  72.755  1.00 32.06 ? 53  ILE C CG2   1 
ATOM   7092  C CD1   . ILE C 1 53  ? 15.957  -5.828  71.556  1.00 34.70 ? 53  ILE C CD1   1 
ATOM   7093  N N     . THR C 1 54  ? 12.900  -8.299  76.174  1.00 32.19 ? 54  THR C N     1 
ATOM   7094  C CA    . THR C 1 54  ? 12.415  -9.497  76.871  1.00 33.47 ? 54  THR C CA    1 
ATOM   7095  C C     . THR C 1 54  ? 11.840  -10.449 75.827  1.00 32.89 ? 54  THR C C     1 
ATOM   7096  O O     . THR C 1 54  ? 11.441  -10.051 74.711  1.00 30.24 ? 54  THR C O     1 
ATOM   7097  C CB    . THR C 1 54  ? 11.356  -9.227  78.026  1.00 32.87 ? 54  THR C CB    1 
ATOM   7098  O OG1   . THR C 1 54  ? 10.339  -8.329  77.554  1.00 38.69 ? 54  THR C OG1   1 
ATOM   7099  C CG2   . THR C 1 54  ? 11.978  -8.581  79.270  1.00 34.84 ? 54  THR C CG2   1 
ATOM   7100  N N     . VAL C 1 55  ? 11.811  -11.721 76.196  1.00 34.40 ? 55  VAL C N     1 
ATOM   7101  C CA    . VAL C 1 55  ? 11.516  -12.758 75.230  1.00 35.64 ? 55  VAL C CA    1 
ATOM   7102  C C     . VAL C 1 55  ? 10.686  -13.846 75.836  1.00 36.63 ? 55  VAL C C     1 
ATOM   7103  O O     . VAL C 1 55  ? 11.105  -14.405 76.835  1.00 38.90 ? 55  VAL C O     1 
ATOM   7104  C CB    . VAL C 1 55  ? 12.822  -13.388 74.766  1.00 35.27 ? 55  VAL C CB    1 
ATOM   7105  C CG1   . VAL C 1 55  ? 12.533  -14.570 73.827  1.00 35.22 ? 55  VAL C CG1   1 
ATOM   7106  C CG2   . VAL C 1 55  ? 13.707  -12.334 74.078  1.00 30.75 ? 55  VAL C CG2   1 
ATOM   7107  N N     . GLU C 1 56  ? 9.540   -14.163 75.247  1.00 36.03 ? 56  GLU C N     1 
ATOM   7108  C CA    . GLU C 1 56  ? 8.658   -15.211 75.789  1.00 36.88 ? 56  GLU C CA    1 
ATOM   7109  C C     . GLU C 1 56  ? 9.284   -16.578 75.480  1.00 36.38 ? 56  GLU C C     1 
ATOM   7110  O O     . GLU C 1 56  ? 9.714   -16.814 74.331  1.00 34.82 ? 56  GLU C O     1 
ATOM   7111  C CB    . GLU C 1 56  ? 7.285   -15.145 75.129  1.00 36.05 ? 56  GLU C CB    1 
ATOM   7112  C CG    . GLU C 1 56  ? 6.177   -15.773 75.924  1.00 39.39 ? 56  GLU C CG    1 
ATOM   7113  C CD    . GLU C 1 56  ? 4.909   -15.952 75.100  1.00 44.75 ? 56  GLU C CD    1 
ATOM   7114  O OE1   . GLU C 1 56  ? 3.851   -15.478 75.541  1.00 41.99 ? 56  GLU C OE1   1 
ATOM   7115  O OE2   . GLU C 1 56  ? 4.972   -16.533 73.988  1.00 50.01 ? 56  GLU C OE2   1 
ATOM   7116  N N     . ASN C 1 57  ? 9.407   -17.414 76.526  1.00 36.14 ? 57  ASN C N     1 
ATOM   7117  C CA    . ASN C 1 57  ? 10.017  -18.780 76.436  1.00 36.22 ? 57  ASN C CA    1 
ATOM   7118  C C     . ASN C 1 57  ? 11.424  -18.654 76.040  1.00 36.67 ? 57  ASN C C     1 
ATOM   7119  O O     . ASN C 1 57  ? 11.973  -19.462 75.253  1.00 37.08 ? 57  ASN C O     1 
ATOM   7120  C CB    . ASN C 1 57  ? 9.258   -19.668 75.449  1.00 35.52 ? 57  ASN C CB    1 
ATOM   7121  C CG    . ASN C 1 57  ? 7.839   -19.863 75.866  1.00 33.70 ? 57  ASN C CG    1 
ATOM   7122  O OD1   . ASN C 1 57  ? 7.556   -20.123 77.058  1.00 35.30 ? 57  ASN C OD1   1 
ATOM   7123  N ND2   . ASN C 1 57  ? 6.930   -19.685 74.943  1.00 34.47 ? 57  ASN C ND2   1 
ATOM   7124  N N     . GLY C 1 58  ? 12.024  -17.591 76.574  1.00 36.15 ? 58  GLY C N     1 
ATOM   7125  C CA    . GLY C 1 58  ? 13.381  -17.312 76.217  1.00 35.93 ? 58  GLY C CA    1 
ATOM   7126  C C     . GLY C 1 58  ? 13.940  -16.309 77.146  1.00 35.89 ? 58  GLY C C     1 
ATOM   7127  O O     . GLY C 1 58  ? 13.216  -15.661 77.911  1.00 37.34 ? 58  GLY C O     1 
ATOM   7128  N N     . LYS C 1 59  ? 15.252  -16.252 77.074  1.00 36.02 ? 59  LYS C N     1 
ATOM   7129  C CA    . LYS C 1 59  ? 16.170  -15.476 77.912  1.00 35.87 ? 59  LYS C CA    1 
ATOM   7130  C C     . LYS C 1 59  ? 16.303  -14.017 77.354  1.00 35.76 ? 59  LYS C C     1 
ATOM   7131  O O     . LYS C 1 59  ? 16.349  -13.811 76.110  1.00 34.05 ? 59  LYS C O     1 
ATOM   7132  C CB    . LYS C 1 59  ? 17.517  -16.209 77.820  1.00 32.90 ? 59  LYS C CB    1 
ATOM   7133  C CG    . LYS C 1 59  ? 18.655  -15.528 78.336  1.00 36.20 ? 59  LYS C CG    1 
ATOM   7134  C CD    . LYS C 1 59  ? 19.951  -16.077 77.815  1.00 37.19 ? 59  LYS C CD    1 
ATOM   7135  C CE    . LYS C 1 59  ? 21.186  -15.380 78.539  1.00 47.82 ? 59  LYS C CE    1 
ATOM   7136  N NZ    . LYS C 1 59  ? 22.168  -16.410 79.156  1.00 49.44 ? 59  LYS C NZ    1 
ATOM   7137  N N     . THR C 1 60  ? 16.450  -13.056 78.267  1.00 35.09 ? 60  THR C N     1 
ATOM   7138  C CA    . THR C 1 60  ? 16.419  -11.653 77.895  1.00 34.11 ? 60  THR C CA    1 
ATOM   7139  C C     . THR C 1 60  ? 17.656  -11.250 77.152  1.00 33.96 ? 60  THR C C     1 
ATOM   7140  O O     . THR C 1 60  ? 18.746  -11.676 77.475  1.00 36.42 ? 60  THR C O     1 
ATOM   7141  C CB    . THR C 1 60  ? 15.784  -10.650 79.034  1.00 34.98 ? 60  THR C CB    1 
ATOM   7142  O OG1   . THR C 1 60  ? 16.598  -9.502  79.396  1.00 30.28 ? 60  THR C OG1   1 
ATOM   7143  C CG2   . THR C 1 60  ? 15.246  -11.379 80.162  1.00 30.81 ? 60  THR C CG2   1 
ATOM   7144  N N     . ILE C 1 61  ? 17.477  -10.495 76.088  1.00 33.62 ? 61  ILE C N     1 
ATOM   7145  C CA    . ILE C 1 61  ? 18.607  -10.016 75.240  1.00 32.56 ? 61  ILE C CA    1 
ATOM   7146  C C     . ILE C 1 61  ? 19.128  -8.641  75.695  1.00 32.18 ? 61  ILE C C     1 
ATOM   7147  O O     . ILE C 1 61  ? 18.404  -7.751  75.970  1.00 30.58 ? 61  ILE C O     1 
ATOM   7148  C CB    . ILE C 1 61  ? 18.197  -10.097 73.717  1.00 32.30 ? 61  ILE C CB    1 
ATOM   7149  C CG1   . ILE C 1 61  ? 17.959  -11.604 73.341  1.00 29.03 ? 61  ILE C CG1   1 
ATOM   7150  C CG2   . ILE C 1 61  ? 19.237  -9.418  72.715  1.00 28.72 ? 61  ILE C CG2   1 
ATOM   7151  C CD1   . ILE C 1 61  ? 16.788  -11.785 72.294  1.00 19.77 ? 61  ILE C CD1   1 
ATOM   7152  N N     . GLN C 1 62  ? 20.420  -8.531  75.829  1.00 34.48 ? 62  GLN C N     1 
ATOM   7153  C CA    . GLN C 1 62  ? 21.051  -7.353  76.379  1.00 37.04 ? 62  GLN C CA    1 
ATOM   7154  C C     . GLN C 1 62  ? 21.981  -6.911  75.276  1.00 37.69 ? 62  GLN C C     1 
ATOM   7155  O O     . GLN C 1 62  ? 22.869  -7.682  74.890  1.00 36.65 ? 62  GLN C O     1 
ATOM   7156  C CB    . GLN C 1 62  ? 21.966  -7.739  77.521  1.00 36.37 ? 62  GLN C CB    1 
ATOM   7157  C CG    . GLN C 1 62  ? 21.288  -8.530  78.569  1.00 42.97 ? 62  GLN C CG    1 
ATOM   7158  C CD    . GLN C 1 62  ? 21.065  -7.753  79.829  1.00 45.34 ? 62  GLN C CD    1 
ATOM   7159  O OE1   . GLN C 1 62  ? 21.888  -6.928  80.194  1.00 48.49 ? 62  GLN C OE1   1 
ATOM   7160  N NE2   . GLN C 1 62  ? 19.956  -8.030  80.520  1.00 48.76 ? 62  GLN C NE2   1 
ATOM   7161  N N     . PHE C 1 63  ? 21.794  -5.705  74.763  1.00 37.55 ? 63  PHE C N     1 
ATOM   7162  C CA    . PHE C 1 63  ? 22.919  -5.089  74.078  1.00 37.87 ? 63  PHE C CA    1 
ATOM   7163  C C     . PHE C 1 63  ? 23.579  -4.135  75.117  1.00 36.76 ? 63  PHE C C     1 
ATOM   7164  O O     . PHE C 1 63  ? 23.034  -3.081  75.428  1.00 34.55 ? 63  PHE C O     1 
ATOM   7165  C CB    . PHE C 1 63  ? 22.518  -4.275  72.832  1.00 38.53 ? 63  PHE C CB    1 
ATOM   7166  C CG    . PHE C 1 63  ? 21.792  -5.057  71.729  1.00 41.41 ? 63  PHE C CG    1 
ATOM   7167  C CD1   . PHE C 1 63  ? 21.633  -6.441  71.771  1.00 41.35 ? 63  PHE C CD1   1 
ATOM   7168  C CD2   . PHE C 1 63  ? 21.269  -4.346  70.623  1.00 42.26 ? 63  PHE C CD2   1 
ATOM   7169  C CE1   . PHE C 1 63  ? 20.955  -7.132  70.735  1.00 42.19 ? 63  PHE C CE1   1 
ATOM   7170  C CE2   . PHE C 1 63  ? 20.602  -4.994  69.577  1.00 42.48 ? 63  PHE C CE2   1 
ATOM   7171  C CZ    . PHE C 1 63  ? 20.446  -6.426  69.618  1.00 42.05 ? 63  PHE C CZ    1 
ATOM   7172  N N     . GLY C 1 64  ? 24.746  -4.493  75.629  1.00 35.20 ? 64  GLY C N     1 
ATOM   7173  C CA    . GLY C 1 64  ? 25.598  -3.519  76.320  1.00 33.76 ? 64  GLY C CA    1 
ATOM   7174  C C     . GLY C 1 64  ? 26.260  -2.573  75.328  1.00 34.38 ? 64  GLY C C     1 
ATOM   7175  O O     . GLY C 1 64  ? 26.060  -2.689  74.083  1.00 32.14 ? 64  GLY C O     1 
ATOM   7176  N N     . GLU C 1 65  ? 27.078  -1.670  75.878  1.00 34.19 ? 65  GLU C N     1 
ATOM   7177  C CA    . GLU C 1 65  ? 27.670  -0.556  75.148  1.00 35.45 ? 65  GLU C CA    1 
ATOM   7178  C C     . GLU C 1 65  ? 28.433  -0.938  73.886  1.00 34.70 ? 65  GLU C C     1 
ATOM   7179  O O     . GLU C 1 65  ? 28.233  -0.297  72.895  1.00 32.88 ? 65  GLU C O     1 
ATOM   7180  C CB    . GLU C 1 65  ? 28.512  0.400   76.059  1.00 36.11 ? 65  GLU C CB    1 
ATOM   7181  C CG    . GLU C 1 65  ? 27.937  0.606   77.538  1.00 42.26 ? 65  GLU C CG    1 
ATOM   7182  C CD    . GLU C 1 65  ? 27.141  1.916   77.749  1.00 52.22 ? 65  GLU C CD    1 
ATOM   7183  O OE1   . GLU C 1 65  ? 26.998  2.721   76.769  1.00 54.81 ? 65  GLU C OE1   1 
ATOM   7184  O OE2   . GLU C 1 65  ? 26.677  2.158   78.919  1.00 51.46 ? 65  GLU C OE2   1 
ATOM   7185  N N     . GLU C 1 66  ? 29.317  -1.944  73.926  1.00 36.60 ? 66  GLU C N     1 
ATOM   7186  C CA    . GLU C 1 66  ? 30.019  -2.395  72.715  1.00 39.38 ? 66  GLU C CA    1 
ATOM   7187  C C     . GLU C 1 66  ? 29.097  -3.081  71.735  1.00 39.03 ? 66  GLU C C     1 
ATOM   7188  O O     . GLU C 1 66  ? 29.234  -2.833  70.548  1.00 38.70 ? 66  GLU C O     1 
ATOM   7189  C CB    . GLU C 1 66  ? 31.282  -3.287  72.993  1.00 41.41 ? 66  GLU C CB    1 
ATOM   7190  C CG    . GLU C 1 66  ? 32.393  -2.615  73.876  1.00 47.68 ? 66  GLU C CG    1 
ATOM   7191  C CD    . GLU C 1 66  ? 33.048  -1.369  73.235  1.00 58.12 ? 66  GLU C CD    1 
ATOM   7192  O OE1   . GLU C 1 66  ? 33.200  -0.352  73.955  1.00 60.79 ? 66  GLU C OE1   1 
ATOM   7193  O OE2   . GLU C 1 66  ? 33.401  -1.390  72.010  1.00 63.31 ? 66  GLU C OE2   1 
ATOM   7194  N N     . MET C 1 67  ? 28.189  -3.968  72.217  1.00 38.83 ? 67  MET C N     1 
ATOM   7195  C CA    . MET C 1 67  ? 27.214  -4.655  71.337  1.00 38.05 ? 67  MET C CA    1 
ATOM   7196  C C     . MET C 1 67  ? 26.344  -3.592  70.602  1.00 37.12 ? 67  MET C C     1 
ATOM   7197  O O     . MET C 1 67  ? 26.113  -3.632  69.352  1.00 35.27 ? 67  MET C O     1 
ATOM   7198  C CB    . MET C 1 67  ? 26.350  -5.630  72.161  1.00 39.60 ? 67  MET C CB    1 
ATOM   7199  C CG    . MET C 1 67  ? 25.404  -6.591  71.351  1.00 39.90 ? 67  MET C CG    1 
ATOM   7200  S SD    . MET C 1 67  ? 26.193  -7.512  69.997  1.00 43.81 ? 67  MET C SD    1 
ATOM   7201  C CE    . MET C 1 67  ? 27.265  -8.668  70.927  1.00 43.04 ? 67  MET C CE    1 
ATOM   7202  N N     . MET C 1 68  ? 25.931  -2.610  71.392  1.00 35.02 ? 68  MET C N     1 
ATOM   7203  C CA    . MET C 1 68  ? 25.131  -1.506  70.888  1.00 35.23 ? 68  MET C CA    1 
ATOM   7204  C C     . MET C 1 68  ? 25.782  -0.725  69.735  1.00 34.65 ? 68  MET C C     1 
ATOM   7205  O O     . MET C 1 68  ? 25.087  -0.510  68.742  1.00 35.82 ? 68  MET C O     1 
ATOM   7206  C CB    . MET C 1 68  ? 24.639  -0.558  72.003  1.00 34.98 ? 68  MET C CB    1 
ATOM   7207  C CG    . MET C 1 68  ? 23.695  0.551   71.516  1.00 34.82 ? 68  MET C CG    1 
ATOM   7208  S SD    . MET C 1 68  ? 22.173  0.008   70.726  1.00 38.90 ? 68  MET C SD    1 
ATOM   7209  C CE    . MET C 1 68  ? 21.183  -0.426  72.085  1.00 34.47 ? 68  MET C CE    1 
ATOM   7210  N N     . LYS C 1 69  ? 27.073  -0.367  69.838  1.00 32.57 ? 69  LYS C N     1 
ATOM   7211  C CA    . LYS C 1 69  ? 27.759  0.357   68.770  1.00 33.02 ? 69  LYS C CA    1 
ATOM   7212  C C     . LYS C 1 69  ? 27.752  -0.458  67.469  1.00 32.55 ? 69  LYS C C     1 
ATOM   7213  O O     . LYS C 1 69  ? 27.570  0.077   66.377  1.00 31.42 ? 69  LYS C O     1 
ATOM   7214  C CB    . LYS C 1 69  ? 29.211  0.798   69.146  1.00 32.60 ? 69  LYS C CB    1 
ATOM   7215  C CG    . LYS C 1 69  ? 29.352  1.937   70.286  1.00 32.67 ? 69  LYS C CG    1 
ATOM   7216  C CD    . LYS C 1 69  ? 30.804  2.049   70.760  1.00 35.20 ? 69  LYS C CD    1 
ATOM   7217  C CE    . LYS C 1 69  ? 30.991  2.631   72.195  1.00 39.94 ? 69  LYS C CE    1 
ATOM   7218  N NZ    . LYS C 1 69  ? 32.326  2.122   72.758  1.00 39.02 ? 69  LYS C NZ    1 
ATOM   7219  N N     . ARG C 1 70  ? 27.992  -1.750  67.597  1.00 32.26 ? 70  ARG C N     1 
ATOM   7220  C CA    . ARG C 1 70  ? 28.105  -2.661  66.436  1.00 31.48 ? 70  ARG C CA    1 
ATOM   7221  C C     . ARG C 1 70  ? 26.736  -2.625  65.763  1.00 31.55 ? 70  ARG C C     1 
ATOM   7222  O O     . ARG C 1 70  ? 26.622  -2.425  64.553  1.00 31.54 ? 70  ARG C O     1 
ATOM   7223  C CB    . ARG C 1 70  ? 28.490  -4.096  66.914  1.00 31.00 ? 70  ARG C CB    1 
ATOM   7224  C CG    . ARG C 1 70  ? 28.159  -5.209  65.885  1.00 29.65 ? 70  ARG C CG    1 
ATOM   7225  C CD    . ARG C 1 70  ? 28.713  -6.563  66.280  1.00 29.64 ? 70  ARG C CD    1 
ATOM   7226  N NE    . ARG C 1 70  ? 28.632  -7.417  65.121  1.00 32.31 ? 70  ARG C NE    1 
ATOM   7227  C CZ    . ARG C 1 70  ? 28.475  -8.738  65.120  1.00 33.30 ? 70  ARG C CZ    1 
ATOM   7228  N NH1   . ARG C 1 70  ? 28.446  -9.452  66.284  1.00 26.11 ? 70  ARG C NH1   1 
ATOM   7229  N NH2   . ARG C 1 70  ? 28.357  -9.342  63.926  1.00 25.15 ? 70  ARG C NH2   1 
ATOM   7230  N N     . ALA C 1 71  ? 25.701  -2.771  66.602  1.00 31.44 ? 71  ALA C N     1 
ATOM   7231  C CA    . ALA C 1 71  ? 24.250  -2.665  66.214  1.00 29.88 ? 71  ALA C CA    1 
ATOM   7232  C C     . ALA C 1 71  ? 23.807  -1.300  65.573  1.00 30.11 ? 71  ALA C C     1 
ATOM   7233  O O     . ALA C 1 71  ? 22.869  -1.284  64.756  1.00 30.37 ? 71  ALA C O     1 
ATOM   7234  C CB    . ALA C 1 71  ? 23.336  -3.029  67.465  1.00 28.10 ? 71  ALA C CB    1 
ATOM   7235  N N     . LEU C 1 72  ? 24.436  -0.171  65.946  1.00 29.03 ? 72  LEU C N     1 
ATOM   7236  C CA    . LEU C 1 72  ? 24.138  1.147   65.271  1.00 28.73 ? 72  LEU C CA    1 
ATOM   7237  C C     . LEU C 1 72  ? 25.041  1.394   64.010  1.00 27.28 ? 72  LEU C C     1 
ATOM   7238  O O     . LEU C 1 72  ? 25.070  2.504   63.358  1.00 27.26 ? 72  LEU C O     1 
ATOM   7239  C CB    . LEU C 1 72  ? 24.209  2.334   66.279  1.00 25.82 ? 72  LEU C CB    1 
ATOM   7240  C CG    . LEU C 1 72  ? 23.231  2.091   67.442  1.00 30.13 ? 72  LEU C CG    1 
ATOM   7241  C CD1   . LEU C 1 72  ? 23.314  3.126   68.607  1.00 24.80 ? 72  LEU C CD1   1 
ATOM   7242  C CD2   . LEU C 1 72  ? 21.725  1.897   66.946  1.00 26.75 ? 72  LEU C CD2   1 
ATOM   7243  N N     . GLN C 1 73  ? 25.796  0.355   63.685  1.00 25.80 ? 73  GLN C N     1 
ATOM   7244  C CA    . GLN C 1 73  ? 26.926  0.470   62.776  1.00 24.79 ? 73  GLN C CA    1 
ATOM   7245  C C     . GLN C 1 73  ? 26.663  -0.438  61.572  1.00 26.41 ? 73  GLN C C     1 
ATOM   7246  O O     . GLN C 1 73  ? 25.811  -1.306  61.629  1.00 23.43 ? 73  GLN C O     1 
ATOM   7247  C CB    . GLN C 1 73  ? 28.248  0.193   63.542  1.00 24.34 ? 73  GLN C CB    1 
ATOM   7248  C CG    . GLN C 1 73  ? 29.677  0.452   62.769  1.00 24.19 ? 73  GLN C CG    1 
ATOM   7249  C CD    . GLN C 1 73  ? 29.731  1.840   62.104  1.00 27.13 ? 73  GLN C CD    1 
ATOM   7250  O OE1   . GLN C 1 73  ? 28.908  2.213   61.208  1.00 27.12 ? 73  GLN C OE1   1 
ATOM   7251  N NE2   . GLN C 1 73  ? 30.681  2.631   62.551  1.00 30.79 ? 73  GLN C NE2   1 
ATOM   7252  N N     . TYR C 1 74  ? 27.287  -0.087  60.428  1.00 27.63 ? 74  TYR C N     1 
ATOM   7253  C CA    . TYR C 1 74  ? 27.285  -0.867  59.220  1.00 26.46 ? 74  TYR C CA    1 
ATOM   7254  C C     . TYR C 1 74  ? 27.775  -2.330  59.356  1.00 27.91 ? 74  TYR C C     1 
ATOM   7255  O O     . TYR C 1 74  ? 28.741  -2.668  60.059  1.00 27.88 ? 74  TYR C O     1 
ATOM   7256  C CB    . TYR C 1 74  ? 28.264  -0.167  58.229  1.00 26.43 ? 74  TYR C CB    1 
ATOM   7257  C CG    . TYR C 1 74  ? 27.682  1.062   57.523  1.00 21.77 ? 74  TYR C CG    1 
ATOM   7258  C CD1   . TYR C 1 74  ? 26.458  0.992   56.988  1.00 14.88 ? 74  TYR C CD1   1 
ATOM   7259  C CD2   . TYR C 1 74  ? 28.416  2.271   57.388  1.00 25.01 ? 74  TYR C CD2   1 
ATOM   7260  C CE1   . TYR C 1 74  ? 25.919  2.129   56.273  1.00 21.94 ? 74  TYR C CE1   1 
ATOM   7261  C CE2   . TYR C 1 74  ? 27.884  3.424   56.688  1.00 22.47 ? 74  TYR C CE2   1 
ATOM   7262  C CZ    . TYR C 1 74  ? 26.637  3.299   56.147  1.00 16.71 ? 74  TYR C CZ    1 
ATOM   7263  O OH    . TYR C 1 74  ? 26.002  4.316   55.447  1.00 26.90 ? 74  TYR C OH    1 
ATOM   7264  N N     . SER C 1 75  ? 27.192  -3.191  58.567  1.00 29.74 ? 75  SER C N     1 
ATOM   7265  C CA    . SER C 1 75  ? 27.570  -4.610  58.643  1.00 30.25 ? 75  SER C CA    1 
ATOM   7266  C C     . SER C 1 75  ? 27.675  -5.207  57.246  1.00 29.18 ? 75  SER C C     1 
ATOM   7267  O O     . SER C 1 75  ? 27.420  -4.493  56.265  1.00 28.43 ? 75  SER C O     1 
ATOM   7268  C CB    . SER C 1 75  ? 26.632  -5.376  59.515  1.00 27.56 ? 75  SER C CB    1 
ATOM   7269  O OG    . SER C 1 75  ? 25.302  -5.101  59.176  1.00 29.22 ? 75  SER C OG    1 
ATOM   7270  N N     . PRO C 1 76  ? 28.161  -6.466  57.146  1.00 28.96 ? 76  PRO C N     1 
ATOM   7271  C CA    . PRO C 1 76  ? 28.371  -6.954  55.765  1.00 28.53 ? 76  PRO C CA    1 
ATOM   7272  C C     . PRO C 1 76  ? 27.037  -6.985  54.943  1.00 29.15 ? 76  PRO C C     1 
ATOM   7273  O O     . PRO C 1 76  ? 25.945  -7.154  55.526  1.00 29.44 ? 76  PRO C O     1 
ATOM   7274  C CB    . PRO C 1 76  ? 28.932  -8.352  55.989  1.00 30.36 ? 76  PRO C CB    1 
ATOM   7275  C CG    . PRO C 1 76  ? 29.655  -8.296  57.352  1.00 29.91 ? 76  PRO C CG    1 
ATOM   7276  C CD    . PRO C 1 76  ? 28.617  -7.438  58.163  1.00 28.19 ? 76  PRO C CD    1 
ATOM   7277  N N     . SER C 1 77  ? 27.139  -6.780  53.634  1.00 27.67 ? 77  SER C N     1 
ATOM   7278  C CA    . SER C 1 77  ? 26.045  -6.898  52.637  1.00 28.31 ? 77  SER C CA    1 
ATOM   7279  C C     . SER C 1 77  ? 25.001  -8.017  52.737  1.00 27.62 ? 77  SER C C     1 
ATOM   7280  O O     . SER C 1 77  ? 23.756  -7.788  52.523  1.00 26.46 ? 77  SER C O     1 
ATOM   7281  C CB    . SER C 1 77  ? 26.668  -7.077  51.242  1.00 27.94 ? 77  SER C CB    1 
ATOM   7282  O OG    . SER C 1 77  ? 27.924  -6.424  51.103  1.00 31.13 ? 77  SER C OG    1 
ATOM   7283  N N     . ALA C 1 78  ? 25.538  -9.245  52.955  1.00 27.44 ? 78  ALA C N     1 
ATOM   7284  C CA    . ALA C 1 78  ? 24.801  -10.487 52.882  1.00 24.78 ? 78  ALA C CA    1 
ATOM   7285  C C     . ALA C 1 78  ? 24.287  -10.818 54.271  1.00 25.07 ? 78  ALA C C     1 
ATOM   7286  O O     . ALA C 1 78  ? 23.427  -11.671 54.434  1.00 26.17 ? 78  ALA C O     1 
ATOM   7287  C CB    . ALA C 1 78  ? 25.728  -11.648 52.302  1.00 26.79 ? 78  ALA C CB    1 
ATOM   7288  N N     . GLY C 1 79  ? 24.763  -10.128 55.296  1.00 24.79 ? 79  GLY C N     1 
ATOM   7289  C CA    . GLY C 1 79  ? 24.345  -10.451 56.656  1.00 22.75 ? 79  GLY C CA    1 
ATOM   7290  C C     . GLY C 1 79  ? 25.497  -10.478 57.639  1.00 23.44 ? 79  GLY C C     1 
ATOM   7291  O O     . GLY C 1 79  ? 26.616  -10.670 57.277  1.00 26.59 ? 79  GLY C O     1 
ATOM   7292  N N     . ILE C 1 80  ? 25.221  -10.289 58.919  1.00 26.24 ? 80  ILE C N     1 
ATOM   7293  C CA    . ILE C 1 80  ? 26.143  -10.679 60.028  1.00 24.88 ? 80  ILE C CA    1 
ATOM   7294  C C     . ILE C 1 80  ? 26.617  -12.158 60.008  1.00 27.70 ? 80  ILE C C     1 
ATOM   7295  O O     . ILE C 1 80  ? 25.823  -13.100 59.792  1.00 24.88 ? 80  ILE C O     1 
ATOM   7296  C CB    . ILE C 1 80  ? 25.573  -10.246 61.415  1.00 24.37 ? 80  ILE C CB    1 
ATOM   7297  C CG1   . ILE C 1 80  ? 24.447  -11.057 62.021  1.00 24.67 ? 80  ILE C CG1   1 
ATOM   7298  C CG2   . ILE C 1 80  ? 24.953  -8.912  61.342  1.00 27.59 ? 80  ILE C CG2   1 
ATOM   7299  C CD1   . ILE C 1 80  ? 24.082  -10.518 63.594  1.00 19.05 ? 80  ILE C CD1   1 
ATOM   7300  N N     . PRO C 1 81  ? 27.919  -12.365 60.284  1.00 29.68 ? 81  PRO C N     1 
ATOM   7301  C CA    . PRO C 1 81  ? 28.449  -13.727 60.140  1.00 29.99 ? 81  PRO C CA    1 
ATOM   7302  C C     . PRO C 1 81  ? 27.645  -14.777 60.902  1.00 30.93 ? 81  PRO C C     1 
ATOM   7303  O O     . PRO C 1 81  ? 27.323  -15.790 60.375  1.00 30.95 ? 81  PRO C O     1 
ATOM   7304  C CB    . PRO C 1 81  ? 29.880  -13.627 60.705  1.00 30.74 ? 81  PRO C CB    1 
ATOM   7305  C CG    . PRO C 1 81  ? 30.271  -12.185 60.701  1.00 28.24 ? 81  PRO C CG    1 
ATOM   7306  C CD    . PRO C 1 81  ? 28.951  -11.372 60.711  1.00 29.28 ? 81  PRO C CD    1 
ATOM   7307  N N     . GLU C 1 82  ? 27.276  -14.493 62.138  1.00 32.12 ? 82  GLU C N     1 
ATOM   7308  C CA    . GLU C 1 82  ? 26.712  -15.498 62.977  1.00 31.05 ? 82  GLU C CA    1 
ATOM   7309  C C     . GLU C 1 82  ? 25.253  -15.914 62.604  1.00 31.04 ? 82  GLU C C     1 
ATOM   7310  O O     . GLU C 1 82  ? 24.867  -17.076 62.803  1.00 30.91 ? 82  GLU C O     1 
ATOM   7311  C CB    . GLU C 1 82  ? 26.891  -15.101 64.419  1.00 31.25 ? 82  GLU C CB    1 
ATOM   7312  C CG    . GLU C 1 82  ? 26.254  -13.776 64.875  1.00 29.97 ? 82  GLU C CG    1 
ATOM   7313  C CD    . GLU C 1 82  ? 27.263  -12.632 64.812  1.00 29.50 ? 82  GLU C CD    1 
ATOM   7314  O OE1   . GLU C 1 82  ? 27.840  -12.332 63.737  1.00 32.47 ? 82  GLU C OE1   1 
ATOM   7315  O OE2   . GLU C 1 82  ? 27.481  -11.976 65.817  1.00 31.11 ? 82  GLU C OE2   1 
ATOM   7316  N N     . LEU C 1 83  ? 24.469  -14.986 62.078  1.00 29.25 ? 83  LEU C N     1 
ATOM   7317  C CA    . LEU C 1 83  ? 23.171  -15.284 61.569  1.00 30.38 ? 83  LEU C CA    1 
ATOM   7318  C C     . LEU C 1 83  ? 23.282  -15.956 60.190  1.00 30.89 ? 83  LEU C C     1 
ATOM   7319  O O     . LEU C 1 83  ? 22.547  -16.929 59.884  1.00 29.05 ? 83  LEU C O     1 
ATOM   7320  C CB    . LEU C 1 83  ? 22.291  -13.987 61.473  1.00 32.26 ? 83  LEU C CB    1 
ATOM   7321  C CG    . LEU C 1 83  ? 20.842  -14.187 60.934  1.00 31.15 ? 83  LEU C CG    1 
ATOM   7322  C CD1   . LEU C 1 83  ? 20.078  -15.163 61.890  1.00 24.18 ? 83  LEU C CD1   1 
ATOM   7323  C CD2   . LEU C 1 83  ? 19.987  -12.925 60.744  1.00 31.14 ? 83  LEU C CD2   1 
ATOM   7324  N N     . LEU C 1 84  ? 24.169  -15.440 59.347  1.00 30.44 ? 84  LEU C N     1 
ATOM   7325  C CA    . LEU C 1 84  ? 24.464  -16.173 58.117  1.00 34.27 ? 84  LEU C CA    1 
ATOM   7326  C C     . LEU C 1 84  ? 24.842  -17.649 58.422  1.00 34.88 ? 84  LEU C C     1 
ATOM   7327  O O     . LEU C 1 84  ? 24.256  -18.537 57.831  1.00 34.62 ? 84  LEU C O     1 
ATOM   7328  C CB    . LEU C 1 84  ? 25.616  -15.535 57.306  1.00 33.94 ? 84  LEU C CB    1 
ATOM   7329  C CG    . LEU C 1 84  ? 25.330  -14.395 56.356  1.00 32.84 ? 84  LEU C CG    1 
ATOM   7330  C CD1   . LEU C 1 84  ? 26.695  -13.996 55.738  1.00 30.86 ? 84  LEU C CD1   1 
ATOM   7331  C CD2   . LEU C 1 84  ? 24.304  -14.805 55.248  1.00 24.92 ? 84  LEU C CD2   1 
ATOM   7332  N N     . SER C 1 85  ? 25.803  -17.890 59.327  1.00 34.11 ? 85  SER C N     1 
ATOM   7333  C CA    . SER C 1 85  ? 26.176  -19.253 59.638  1.00 37.03 ? 85  SER C CA    1 
ATOM   7334  C C     . SER C 1 85  ? 25.051  -20.071 60.296  1.00 37.51 ? 85  SER C C     1 
ATOM   7335  O O     . SER C 1 85  ? 24.939  -21.304 60.072  1.00 36.94 ? 85  SER C O     1 
ATOM   7336  C CB    . SER C 1 85  ? 27.401  -19.318 60.532  1.00 36.06 ? 85  SER C CB    1 
ATOM   7337  O OG    . SER C 1 85  ? 27.531  -18.138 61.268  1.00 42.63 ? 85  SER C OG    1 
ATOM   7338  N N     . TRP C 1 86  ? 24.240  -19.396 61.130  1.00 37.11 ? 86  TRP C N     1 
ATOM   7339  C CA    . TRP C 1 86  ? 23.181  -20.105 61.844  1.00 36.73 ? 86  TRP C CA    1 
ATOM   7340  C C     . TRP C 1 86  ? 22.121  -20.536 60.806  1.00 35.29 ? 86  TRP C C     1 
ATOM   7341  O O     . TRP C 1 86  ? 21.538  -21.612 60.928  1.00 36.72 ? 86  TRP C O     1 
ATOM   7342  C CB    . TRP C 1 86  ? 22.583  -19.227 62.980  1.00 36.61 ? 86  TRP C CB    1 
ATOM   7343  C CG    . TRP C 1 86  ? 21.711  -19.989 63.936  1.00 36.04 ? 86  TRP C CG    1 
ATOM   7344  C CD1   . TRP C 1 86  ? 22.066  -20.472 65.186  1.00 35.90 ? 86  TRP C CD1   1 
ATOM   7345  C CD2   . TRP C 1 86  ? 20.364  -20.400 63.718  1.00 35.51 ? 86  TRP C CD2   1 
ATOM   7346  N NE1   . TRP C 1 86  ? 21.019  -21.166 65.737  1.00 35.49 ? 86  TRP C NE1   1 
ATOM   7347  C CE2   . TRP C 1 86  ? 19.951  -21.116 64.883  1.00 34.39 ? 86  TRP C CE2   1 
ATOM   7348  C CE3   . TRP C 1 86  ? 19.445  -20.198 62.687  1.00 32.73 ? 86  TRP C CE3   1 
ATOM   7349  C CZ2   . TRP C 1 86  ? 18.659  -21.646 65.027  1.00 35.78 ? 86  TRP C CZ2   1 
ATOM   7350  C CZ3   . TRP C 1 86  ? 18.175  -20.733 62.834  1.00 37.00 ? 86  TRP C CZ3   1 
ATOM   7351  C CH2   . TRP C 1 86  ? 17.793  -21.462 63.987  1.00 33.94 ? 86  TRP C CH2   1 
ATOM   7352  N N     . LEU C 1 87  ? 21.886  -19.714 59.786  1.00 33.36 ? 87  LEU C N     1 
ATOM   7353  C CA    . LEU C 1 87  ? 20.836  -19.976 58.740  1.00 32.29 ? 87  LEU C CA    1 
ATOM   7354  C C     . LEU C 1 87  ? 21.320  -20.974 57.696  1.00 31.85 ? 87  LEU C C     1 
ATOM   7355  O O     . LEU C 1 87  ? 20.563  -21.827 57.191  1.00 29.15 ? 87  LEU C O     1 
ATOM   7356  C CB    . LEU C 1 87  ? 20.369  -18.690 57.983  1.00 32.15 ? 87  LEU C CB    1 
ATOM   7357  C CG    . LEU C 1 87  ? 19.141  -17.849 58.399  1.00 32.82 ? 87  LEU C CG    1 
ATOM   7358  C CD1   . LEU C 1 87  ? 18.191  -18.467 59.449  1.00 32.02 ? 87  LEU C CD1   1 
ATOM   7359  C CD2   . LEU C 1 87  ? 19.553  -16.432 58.791  1.00 29.74 ? 87  LEU C CD2   1 
ATOM   7360  N N     . LYS C 1 88  ? 22.574  -20.856 57.330  1.00 33.18 ? 88  LYS C N     1 
ATOM   7361  C CA    . LYS C 1 88  ? 23.178  -21.953 56.500  1.00 34.92 ? 88  LYS C CA    1 
ATOM   7362  C C     . LYS C 1 88  ? 23.112  -23.263 57.220  1.00 35.20 ? 88  LYS C C     1 
ATOM   7363  O O     . LYS C 1 88  ? 22.759  -24.288 56.618  1.00 37.93 ? 88  LYS C O     1 
ATOM   7364  C CB    . LYS C 1 88  ? 24.573  -21.647 56.066  1.00 33.14 ? 88  LYS C CB    1 
ATOM   7365  C CG    . LYS C 1 88  ? 24.627  -20.471 55.137  1.00 37.82 ? 88  LYS C CG    1 
ATOM   7366  C CD    . LYS C 1 88  ? 26.010  -19.851 55.080  1.00 35.94 ? 88  LYS C CD    1 
ATOM   7367  C CE    . LYS C 1 88  ? 26.368  -19.284 53.714  1.00 34.33 ? 88  LYS C CE    1 
ATOM   7368  N NZ    . LYS C 1 88  ? 27.696  -18.667 53.994  1.00 37.74 ? 88  LYS C NZ    1 
ATOM   7369  N N     . GLN C 1 89  ? 23.408  -23.275 58.505  1.00 35.55 ? 89  GLN C N     1 
ATOM   7370  C CA    . GLN C 1 89  ? 23.349  -24.555 59.200  1.00 35.77 ? 89  GLN C CA    1 
ATOM   7371  C C     . GLN C 1 89  ? 21.957  -25.024 59.293  1.00 34.70 ? 89  GLN C C     1 
ATOM   7372  O O     . GLN C 1 89  ? 21.691  -26.191 59.126  1.00 35.03 ? 89  GLN C O     1 
ATOM   7373  C CB    . GLN C 1 89  ? 23.867  -24.463 60.641  1.00 37.42 ? 89  GLN C CB    1 
ATOM   7374  C CG    . GLN C 1 89  ? 23.945  -25.878 61.263  1.00 41.24 ? 89  GLN C CG    1 
ATOM   7375  C CD    . GLN C 1 89  ? 24.715  -26.844 60.283  1.00 42.46 ? 89  GLN C CD    1 
ATOM   7376  O OE1   . GLN C 1 89  ? 24.285  -28.004 60.020  1.00 38.56 ? 89  GLN C OE1   1 
ATOM   7377  N NE2   . GLN C 1 89  ? 25.874  -26.338 59.747  1.00 35.96 ? 89  GLN C NE2   1 
ATOM   7378  N N     . LEU C 1 90  ? 21.058  -24.131 59.691  1.00 34.56 ? 90  LEU C N     1 
ATOM   7379  C CA    . LEU C 1 90  ? 19.643  -24.469 59.598  1.00 34.55 ? 90  LEU C CA    1 
ATOM   7380  C C     . LEU C 1 90  ? 19.262  -25.142 58.262  1.00 34.14 ? 90  LEU C C     1 
ATOM   7381  O O     . LEU C 1 90  ? 18.566  -26.164 58.265  1.00 33.57 ? 90  LEU C O     1 
ATOM   7382  C CB    . LEU C 1 90  ? 18.797  -23.242 59.847  1.00 34.33 ? 90  LEU C CB    1 
ATOM   7383  C CG    . LEU C 1 90  ? 17.329  -23.579 59.822  1.00 32.34 ? 90  LEU C CG    1 
ATOM   7384  C CD1   . LEU C 1 90  ? 16.923  -24.137 61.187  1.00 32.22 ? 90  LEU C CD1   1 
ATOM   7385  C CD2   . LEU C 1 90  ? 16.511  -22.348 59.358  1.00 31.01 ? 90  LEU C CD2   1 
ATOM   7386  N N     . GLN C 1 91  ? 19.719  -24.586 57.124  1.00 35.48 ? 91  GLN C N     1 
ATOM   7387  C CA    . GLN C 1 91  ? 19.337  -25.103 55.759  1.00 35.57 ? 91  GLN C CA    1 
ATOM   7388  C C     . GLN C 1 91  ? 19.882  -26.523 55.462  1.00 37.93 ? 91  GLN C C     1 
ATOM   7389  O O     . GLN C 1 91  ? 19.203  -27.371 54.862  1.00 36.92 ? 91  GLN C O     1 
ATOM   7390  C CB    . GLN C 1 91  ? 19.794  -24.170 54.655  1.00 35.69 ? 91  GLN C CB    1 
ATOM   7391  C CG    . GLN C 1 91  ? 19.154  -22.731 54.637  1.00 32.95 ? 91  GLN C CG    1 
ATOM   7392  C CD    . GLN C 1 91  ? 17.698  -22.761 54.507  1.00 33.17 ? 91  GLN C CD    1 
ATOM   7393  O OE1   . GLN C 1 91  ? 17.136  -22.487 53.376  1.00 34.67 ? 91  GLN C OE1   1 
ATOM   7394  N NE2   . GLN C 1 91  ? 17.018  -23.189 55.591  1.00 28.20 ? 91  GLN C NE2   1 
ATOM   7395  N N     . ILE C 1 92  ? 21.135  -26.739 55.840  1.00 39.86 ? 92  ILE C N     1 
ATOM   7396  C CA    . ILE C 1 92  ? 21.748  -28.044 55.764  1.00 41.27 ? 92  ILE C CA    1 
ATOM   7397  C C     . ILE C 1 92  ? 20.947  -28.993 56.650  1.00 41.89 ? 92  ILE C C     1 
ATOM   7398  O O     . ILE C 1 92  ? 20.554  -30.052 56.209  1.00 41.27 ? 92  ILE C O     1 
ATOM   7399  C CB    . ILE C 1 92  ? 23.223  -28.004 56.200  1.00 41.58 ? 92  ILE C CB    1 
ATOM   7400  C CG1   . ILE C 1 92  ? 24.073  -27.310 55.151  1.00 39.09 ? 92  ILE C CG1   1 
ATOM   7401  C CG2   . ILE C 1 92  ? 23.786  -29.473 56.437  1.00 43.61 ? 92  ILE C CG2   1 
ATOM   7402  C CD1   . ILE C 1 92  ? 25.347  -26.668 55.702  1.00 41.20 ? 92  ILE C CD1   1 
ATOM   7403  N N     . LYS C 1 93  ? 20.716  -28.592 57.896  1.00 42.71 ? 93  LYS C N     1 
ATOM   7404  C CA    . LYS C 1 93  ? 19.976  -29.419 58.843  1.00 43.02 ? 93  LYS C CA    1 
ATOM   7405  C C     . LYS C 1 93  ? 18.617  -29.820 58.279  1.00 42.27 ? 93  LYS C C     1 
ATOM   7406  O O     . LYS C 1 93  ? 18.248  -30.995 58.299  1.00 42.29 ? 93  LYS C O     1 
ATOM   7407  C CB    . LYS C 1 93  ? 19.797  -28.682 60.172  1.00 43.48 ? 93  LYS C CB    1 
ATOM   7408  C CG    . LYS C 1 93  ? 20.771  -29.113 61.256  1.00 47.16 ? 93  LYS C CG    1 
ATOM   7409  C CD    . LYS C 1 93  ? 21.076  -30.600 61.165  1.00 50.84 ? 93  LYS C CD    1 
ATOM   7410  C CE    . LYS C 1 93  ? 19.971  -31.431 61.795  1.00 53.01 ? 93  LYS C CE    1 
ATOM   7411  N NZ    . LYS C 1 93  ? 20.093  -31.483 63.279  1.00 51.03 ? 93  LYS C NZ    1 
ATOM   7412  N N     . LEU C 1 94  ? 17.915  -28.848 57.699  1.00 40.74 ? 94  LEU C N     1 
ATOM   7413  C CA    . LEU C 1 94  ? 16.530  -28.990 57.259  1.00 38.43 ? 94  LEU C CA    1 
ATOM   7414  C C     . LEU C 1 94  ? 16.379  -29.581 55.863  1.00 38.38 ? 94  LEU C C     1 
ATOM   7415  O O     . LEU C 1 94  ? 15.417  -30.279 55.589  1.00 38.46 ? 94  LEU C O     1 
ATOM   7416  C CB    . LEU C 1 94  ? 15.832  -27.641 57.282  1.00 38.55 ? 94  LEU C CB    1 
ATOM   7417  C CG    . LEU C 1 94  ? 14.854  -27.404 58.423  1.00 39.62 ? 94  LEU C CG    1 
ATOM   7418  C CD1   . LEU C 1 94  ? 15.116  -28.375 59.551  1.00 40.37 ? 94  LEU C CD1   1 
ATOM   7419  C CD2   . LEU C 1 94  ? 14.912  -25.974 58.899  1.00 28.40 ? 94  LEU C CD2   1 
ATOM   7420  N N     . HIS C 1 95  ? 17.321  -29.285 54.977  1.00 36.45 ? 95  HIS C N     1 
ATOM   7421  C CA    . HIS C 1 95  ? 17.115  -29.531 53.561  1.00 39.05 ? 95  HIS C CA    1 
ATOM   7422  C C     . HIS C 1 95  ? 18.173  -30.403 52.916  1.00 40.10 ? 95  HIS C C     1 
ATOM   7423  O O     . HIS C 1 95  ? 17.917  -31.051 51.924  1.00 42.67 ? 95  HIS C O     1 
ATOM   7424  C CB    . HIS C 1 95  ? 16.980  -28.226 52.791  1.00 36.00 ? 95  HIS C CB    1 
ATOM   7425  C CG    . HIS C 1 95  ? 15.799  -27.412 53.192  1.00 34.84 ? 95  HIS C CG    1 
ATOM   7426  N ND1   . HIS C 1 95  ? 15.902  -26.099 53.579  1.00 34.00 ? 95  HIS C ND1   1 
ATOM   7427  C CD2   . HIS C 1 95  ? 14.488  -27.723 53.260  1.00 29.66 ? 95  HIS C CD2   1 
ATOM   7428  C CE1   . HIS C 1 95  ? 14.704  -25.637 53.870  1.00 33.18 ? 95  HIS C CE1   1 
ATOM   7429  N NE2   . HIS C 1 95  ? 13.829  -26.603 53.682  1.00 36.39 ? 95  HIS C NE2   1 
ATOM   7430  N N     . ASN C 1 96  ? 19.364  -30.410 53.483  1.00 40.02 ? 96  ASN C N     1 
ATOM   7431  C CA    . ASN C 1 96  ? 20.491  -31.094 52.875  1.00 40.70 ? 96  ASN C CA    1 
ATOM   7432  C C     . ASN C 1 96  ? 20.582  -30.955 51.367  1.00 40.38 ? 96  ASN C C     1 
ATOM   7433  O O     . ASN C 1 96  ? 20.561  -31.925 50.631  1.00 41.53 ? 96  ASN C O     1 
ATOM   7434  C CB    . ASN C 1 96  ? 20.562  -32.548 53.329  1.00 41.35 ? 96  ASN C CB    1 
ATOM   7435  C CG    . ASN C 1 96  ? 21.922  -33.145 53.139  1.00 40.33 ? 96  ASN C CG    1 
ATOM   7436  O OD1   . ASN C 1 96  ? 22.044  -34.275 52.716  1.00 42.13 ? 96  ASN C OD1   1 
ATOM   7437  N ND2   . ASN C 1 96  ? 22.954  -32.387 53.448  1.00 43.02 ? 96  ASN C ND2   1 
ATOM   7438  N N     . PRO C 1 97  ? 20.700  -29.709 50.945  1.00 39.91 ? 97  PRO C N     1 
ATOM   7439  C CA    . PRO C 1 97  ? 20.754  -29.254 49.545  1.00 38.98 ? 97  PRO C CA    1 
ATOM   7440  C C     . PRO C 1 97  ? 21.850  -30.077 48.921  1.00 38.67 ? 97  PRO C C     1 
ATOM   7441  O O     . PRO C 1 97  ? 22.977  -30.016 49.442  1.00 40.04 ? 97  PRO C O     1 
ATOM   7442  C CB    . PRO C 1 97  ? 21.181  -27.773 49.692  1.00 39.76 ? 97  PRO C CB    1 
ATOM   7443  C CG    . PRO C 1 97  ? 20.574  -27.388 51.087  1.00 38.89 ? 97  PRO C CG    1 
ATOM   7444  C CD    . PRO C 1 97  ? 20.847  -28.601 51.912  1.00 38.47 ? 97  PRO C CD    1 
ATOM   7445  N N     . PRO C 1 98  ? 21.540  -30.924 47.893  1.00 38.53 ? 98  PRO C N     1 
ATOM   7446  C CA    . PRO C 1 98  ? 22.611  -31.720 47.205  1.00 36.88 ? 98  PRO C CA    1 
ATOM   7447  C C     . PRO C 1 98  ? 23.830  -30.857 46.873  1.00 36.48 ? 98  PRO C C     1 
ATOM   7448  O O     . PRO C 1 98  ? 24.973  -31.308 46.746  1.00 35.97 ? 98  PRO C O     1 
ATOM   7449  C CB    . PRO C 1 98  ? 21.926  -32.169 45.904  1.00 36.38 ? 98  PRO C CB    1 
ATOM   7450  C CG    . PRO C 1 98  ? 20.505  -32.268 46.239  1.00 37.22 ? 98  PRO C CG    1 
ATOM   7451  C CD    . PRO C 1 98  ? 20.205  -31.182 47.279  1.00 38.66 ? 98  PRO C CD    1 
ATOM   7452  N N     . THR C 1 99  ? 23.565  -29.573 46.847  1.00 36.46 ? 99  THR C N     1 
ATOM   7453  C CA    . THR C 1 99  ? 24.480  -28.548 46.420  1.00 37.76 ? 99  THR C CA    1 
ATOM   7454  C C     . THR C 1 99  ? 25.532  -28.048 47.424  1.00 38.39 ? 99  THR C C     1 
ATOM   7455  O O     . THR C 1 99  ? 26.382  -27.204 47.079  1.00 39.10 ? 99  THR C O     1 
ATOM   7456  C CB    . THR C 1 99  ? 23.575  -27.395 46.071  1.00 37.08 ? 99  THR C CB    1 
ATOM   7457  O OG1   . THR C 1 99  ? 23.505  -27.290 44.661  1.00 40.88 ? 99  THR C OG1   1 
ATOM   7458  C CG2   . THR C 1 99  ? 24.054  -26.175 46.640  1.00 36.27 ? 99  THR C CG2   1 
ATOM   7459  N N     . ILE C 1 100 ? 25.487  -28.483 48.678  1.00 38.52 ? 100 ILE C N     1 
ATOM   7460  C CA    . ILE C 1 100 ? 26.217  -27.665 49.626  1.00 39.04 ? 100 ILE C CA    1 
ATOM   7461  C C     . ILE C 1 100 ? 27.660  -27.536 49.171  1.00 41.05 ? 100 ILE C C     1 
ATOM   7462  O O     . ILE C 1 100 ? 28.179  -26.410 49.072  1.00 43.08 ? 100 ILE C O     1 
ATOM   7463  C CB    . ILE C 1 100 ? 26.099  -28.101 51.147  1.00 38.96 ? 100 ILE C CB    1 
ATOM   7464  C CG1   . ILE C 1 100 ? 26.298  -29.625 51.308  1.00 38.73 ? 100 ILE C CG1   1 
ATOM   7465  C CG2   . ILE C 1 100 ? 24.795  -27.578 51.725  1.00 33.99 ? 100 ILE C CG2   1 
ATOM   7466  C CD1   . ILE C 1 100 ? 26.358  -30.125 52.820  1.00 39.62 ? 100 ILE C CD1   1 
ATOM   7467  N N     . HIS C 1 101 ? 28.279  -28.676 48.825  1.00 40.87 ? 101 HIS C N     1 
ATOM   7468  C CA    . HIS C 1 101 ? 29.703  -28.770 48.684  1.00 39.73 ? 101 HIS C CA    1 
ATOM   7469  C C     . HIS C 1 101 ? 30.178  -28.709 47.237  1.00 39.66 ? 101 HIS C C     1 
ATOM   7470  O O     . HIS C 1 101 ? 31.403  -28.815 47.002  1.00 39.08 ? 101 HIS C O     1 
ATOM   7471  C CB    . HIS C 1 101 ? 30.243  -30.049 49.392  1.00 41.16 ? 101 HIS C CB    1 
ATOM   7472  C CG    . HIS C 1 101 ? 30.097  -29.998 50.874  1.00 40.86 ? 101 HIS C CG    1 
ATOM   7473  N ND1   . HIS C 1 101 ? 29.622  -31.056 51.620  1.00 47.43 ? 101 HIS C ND1   1 
ATOM   7474  C CD2   . HIS C 1 101 ? 30.313  -28.988 51.747  1.00 38.98 ? 101 HIS C CD2   1 
ATOM   7475  C CE1   . HIS C 1 101 ? 29.583  -30.705 52.897  1.00 45.21 ? 101 HIS C CE1   1 
ATOM   7476  N NE2   . HIS C 1 101 ? 29.972  -29.444 52.989  1.00 43.01 ? 101 HIS C NE2   1 
ATOM   7477  N N     . TYR C 1 102 ? 29.265  -28.504 46.277  1.00 38.69 ? 102 TYR C N     1 
ATOM   7478  C CA    . TYR C 1 102 ? 29.741  -28.204 44.930  1.00 38.40 ? 102 TYR C CA    1 
ATOM   7479  C C     . TYR C 1 102 ? 30.750  -27.026 44.972  1.00 39.95 ? 102 TYR C C     1 
ATOM   7480  O O     . TYR C 1 102 ? 30.740  -26.190 45.898  1.00 38.63 ? 102 TYR C O     1 
ATOM   7481  C CB    . TYR C 1 102 ? 28.604  -27.849 43.966  1.00 37.41 ? 102 TYR C CB    1 
ATOM   7482  C CG    . TYR C 1 102 ? 27.594  -28.925 43.677  1.00 34.22 ? 102 TYR C CG    1 
ATOM   7483  C CD1   . TYR C 1 102 ? 26.543  -28.662 42.864  1.00 32.01 ? 102 TYR C CD1   1 
ATOM   7484  C CD2   . TYR C 1 102 ? 27.699  -30.195 44.225  1.00 34.91 ? 102 TYR C CD2   1 
ATOM   7485  C CE1   . TYR C 1 102 ? 25.589  -29.570 42.620  1.00 31.70 ? 102 TYR C CE1   1 
ATOM   7486  C CE2   . TYR C 1 102 ? 26.750  -31.163 43.959  1.00 36.40 ? 102 TYR C CE2   1 
ATOM   7487  C CZ    . TYR C 1 102 ? 25.698  -30.853 43.177  1.00 37.01 ? 102 TYR C CZ    1 
ATOM   7488  O OH    . TYR C 1 102 ? 24.736  -31.791 42.913  1.00 34.10 ? 102 TYR C OH    1 
ATOM   7489  N N     . PRO C 1 103 ? 31.682  -27.002 44.015  1.00 41.13 ? 103 PRO C N     1 
ATOM   7490  C CA    . PRO C 1 103 ? 32.332  -25.760 43.596  1.00 41.36 ? 103 PRO C CA    1 
ATOM   7491  C C     . PRO C 1 103 ? 31.337  -24.635 43.401  1.00 41.25 ? 103 PRO C C     1 
ATOM   7492  O O     . PRO C 1 103 ? 30.228  -24.902 42.924  1.00 41.26 ? 103 PRO C O     1 
ATOM   7493  C CB    . PRO C 1 103 ? 32.909  -26.118 42.192  1.00 41.64 ? 103 PRO C CB    1 
ATOM   7494  C CG    . PRO C 1 103 ? 33.027  -27.640 42.168  1.00 40.76 ? 103 PRO C CG    1 
ATOM   7495  C CD    . PRO C 1 103 ? 32.275  -28.191 43.364  1.00 42.14 ? 103 PRO C CD    1 
ATOM   7496  N N     . PRO C 1 104 ? 31.744  -23.389 43.726  1.00 41.01 ? 104 PRO C N     1 
ATOM   7497  C CA    . PRO C 1 104 ? 31.017  -22.176 43.477  1.00 41.61 ? 104 PRO C CA    1 
ATOM   7498  C C     . PRO C 1 104 ? 30.431  -22.103 42.096  1.00 42.31 ? 104 PRO C C     1 
ATOM   7499  O O     . PRO C 1 104 ? 29.222  -22.045 41.960  1.00 43.90 ? 104 PRO C O     1 
ATOM   7500  C CB    . PRO C 1 104 ? 32.073  -21.081 43.659  1.00 40.96 ? 104 PRO C CB    1 
ATOM   7501  C CG    . PRO C 1 104 ? 33.033  -21.633 44.619  1.00 40.70 ? 104 PRO C CG    1 
ATOM   7502  C CD    . PRO C 1 104 ? 33.031  -23.122 44.398  1.00 41.72 ? 104 PRO C CD    1 
ATOM   7503  N N     . SER C 1 105 ? 31.272  -22.102 41.067  1.00 43.86 ? 105 SER C N     1 
ATOM   7504  C CA    . SER C 1 105 ? 30.855  -21.709 39.705  1.00 43.56 ? 105 SER C CA    1 
ATOM   7505  C C     . SER C 1 105 ? 29.861  -22.747 39.213  1.00 43.37 ? 105 SER C C     1 
ATOM   7506  O O     . SER C 1 105 ? 29.114  -22.518 38.247  1.00 42.96 ? 105 SER C O     1 
ATOM   7507  C CB    . SER C 1 105 ? 32.061  -21.693 38.787  1.00 44.28 ? 105 SER C CB    1 
ATOM   7508  O OG    . SER C 1 105 ? 32.556  -23.017 38.697  1.00 44.14 ? 105 SER C OG    1 
ATOM   7509  N N     . GLN C 1 106 ? 29.836  -23.860 39.930  1.00 42.25 ? 106 GLN C N     1 
ATOM   7510  C CA    . GLN C 1 106 ? 28.872  -24.934 39.711  1.00 42.72 ? 106 GLN C CA    1 
ATOM   7511  C C     . GLN C 1 106 ? 27.557  -24.876 40.530  1.00 41.45 ? 106 GLN C C     1 
ATOM   7512  O O     . GLN C 1 106 ? 26.863  -25.883 40.638  1.00 41.83 ? 106 GLN C O     1 
ATOM   7513  C CB    . GLN C 1 106 ? 29.595  -26.249 39.969  1.00 42.76 ? 106 GLN C CB    1 
ATOM   7514  C CG    . GLN C 1 106 ? 28.851  -27.530 39.624  1.00 46.14 ? 106 GLN C CG    1 
ATOM   7515  C CD    . GLN C 1 106 ? 29.775  -28.763 39.545  1.00 45.98 ? 106 GLN C CD    1 
ATOM   7516  O OE1   . GLN C 1 106 ? 29.434  -29.846 40.072  1.00 49.81 ? 106 GLN C OE1   1 
ATOM   7517  N NE2   . GLN C 1 106 ? 30.959  -28.597 38.912  1.00 43.61 ? 106 GLN C NE2   1 
ATOM   7518  N N     . GLY C 1 107 ? 27.189  -23.756 41.150  1.00 39.21 ? 107 GLY C N     1 
ATOM   7519  C CA    . GLY C 1 107 ? 25.925  -23.825 41.912  1.00 36.91 ? 107 GLY C CA    1 
ATOM   7520  C C     . GLY C 1 107 ? 25.988  -24.070 43.421  1.00 36.15 ? 107 GLY C C     1 
ATOM   7521  O O     . GLY C 1 107 ? 24.923  -24.320 44.082  1.00 34.94 ? 107 GLY C O     1 
ATOM   7522  N N     . GLN C 1 108 ? 27.199  -24.033 43.986  1.00 34.57 ? 108 GLN C N     1 
ATOM   7523  C CA    . GLN C 1 108 ? 27.362  -24.309 45.424  1.00 34.36 ? 108 GLN C CA    1 
ATOM   7524  C C     . GLN C 1 108 ? 26.334  -23.465 46.212  1.00 34.90 ? 108 GLN C C     1 
ATOM   7525  O O     . GLN C 1 108 ? 26.176  -22.285 45.944  1.00 35.44 ? 108 GLN C O     1 
ATOM   7526  C CB    . GLN C 1 108 ? 28.805  -24.010 45.938  1.00 32.26 ? 108 GLN C CB    1 
ATOM   7527  C CG    . GLN C 1 108 ? 28.813  -24.033 47.482  1.00 28.78 ? 108 GLN C CG    1 
ATOM   7528  C CD    . GLN C 1 108 ? 30.188  -24.157 48.113  1.00 35.44 ? 108 GLN C CD    1 
ATOM   7529  O OE1   . GLN C 1 108 ? 30.402  -24.987 49.035  1.00 40.16 ? 108 GLN C OE1   1 
ATOM   7530  N NE2   . GLN C 1 108 ? 31.127  -23.354 47.653  1.00 31.14 ? 108 GLN C NE2   1 
ATOM   7531  N N     . MET C 1 109 ? 25.652  -24.048 47.197  1.00 35.89 ? 109 MET C N     1 
ATOM   7532  C CA    . MET C 1 109 ? 24.584  -23.316 47.911  1.00 37.02 ? 109 MET C CA    1 
ATOM   7533  C C     . MET C 1 109 ? 25.196  -22.119 48.548  1.00 35.55 ? 109 MET C C     1 
ATOM   7534  O O     . MET C 1 109 ? 26.186  -22.287 49.268  1.00 32.65 ? 109 MET C O     1 
ATOM   7535  C CB    . MET C 1 109 ? 23.984  -24.147 49.030  1.00 37.31 ? 109 MET C CB    1 
ATOM   7536  C CG    . MET C 1 109 ? 22.655  -23.663 49.522  1.00 39.94 ? 109 MET C CG    1 
ATOM   7537  S SD    . MET C 1 109 ? 22.331  -24.471 51.140  1.00 42.41 ? 109 MET C SD    1 
ATOM   7538  C CE    . MET C 1 109 ? 23.536  -23.594 52.182  1.00 43.78 ? 109 MET C CE    1 
ATOM   7539  N N     . ASP C 1 110 ? 24.640  -20.924 48.251  1.00 34.22 ? 110 ASP C N     1 
ATOM   7540  C CA    . ASP C 1 110 ? 24.922  -19.758 49.099  1.00 33.66 ? 110 ASP C CA    1 
ATOM   7541  C C     . ASP C 1 110 ? 23.665  -19.238 49.726  1.00 33.57 ? 110 ASP C C     1 
ATOM   7542  O O     . ASP C 1 110 ? 22.574  -19.687 49.370  1.00 33.80 ? 110 ASP C O     1 
ATOM   7543  C CB    . ASP C 1 110 ? 25.688  -18.609 48.376  1.00 33.39 ? 110 ASP C CB    1 
ATOM   7544  C CG    . ASP C 1 110 ? 26.478  -17.787 49.370  1.00 35.43 ? 110 ASP C CG    1 
ATOM   7545  O OD1   . ASP C 1 110 ? 26.278  -18.004 50.592  1.00 43.06 ? 110 ASP C OD1   1 
ATOM   7546  O OD2   . ASP C 1 110 ? 27.339  -17.009 49.011  1.00 36.71 ? 110 ASP C OD2   1 
ATOM   7547  N N     . LEU C 1 111 ? 23.832  -18.296 50.664  1.00 33.16 ? 111 LEU C N     1 
ATOM   7548  C CA    . LEU C 1 111 ? 22.751  -17.750 51.466  1.00 32.48 ? 111 LEU C CA    1 
ATOM   7549  C C     . LEU C 1 111 ? 22.944  -16.246 51.713  1.00 32.43 ? 111 LEU C C     1 
ATOM   7550  O O     . LEU C 1 111 ? 24.073  -15.729 51.902  1.00 30.38 ? 111 LEU C O     1 
ATOM   7551  C CB    . LEU C 1 111 ? 22.499  -18.547 52.758  1.00 31.48 ? 111 LEU C CB    1 
ATOM   7552  C CG    . LEU C 1 111 ? 21.246  -18.162 53.601  1.00 33.07 ? 111 LEU C CG    1 
ATOM   7553  C CD1   . LEU C 1 111 ? 20.664  -19.358 54.394  1.00 27.21 ? 111 LEU C CD1   1 
ATOM   7554  C CD2   . LEU C 1 111 ? 21.383  -16.877 54.560  1.00 29.18 ? 111 LEU C CD2   1 
ATOM   7555  N N     . CYS C 1 112 ? 21.844  -15.512 51.598  1.00 32.12 ? 112 CYS C N     1 
ATOM   7556  C CA    . CYS C 1 112 ? 21.931  -14.128 52.002  1.00 32.81 ? 112 CYS C CA    1 
ATOM   7557  C C     . CYS C 1 112 ? 20.730  -13.559 52.767  1.00 32.08 ? 112 CYS C C     1 
ATOM   7558  O O     . CYS C 1 112 ? 19.587  -13.850 52.466  1.00 32.29 ? 112 CYS C O     1 
ATOM   7559  C CB    . CYS C 1 112 ? 22.512  -13.334 50.872  1.00 32.77 ? 112 CYS C CB    1 
ATOM   7560  S SG    . CYS C 1 112 ? 21.695  -11.996 50.357  1.00 41.70 ? 112 CYS C SG    1 
ATOM   7561  N N     . VAL C 1 113 ? 21.012  -12.864 53.866  1.00 31.88 ? 113 VAL C N     1 
ATOM   7562  C CA    . VAL C 1 113 ? 19.952  -12.394 54.725  1.00 30.63 ? 113 VAL C CA    1 
ATOM   7563  C C     . VAL C 1 113 ? 19.429  -11.225 53.889  1.00 29.77 ? 113 VAL C C     1 
ATOM   7564  O O     . VAL C 1 113 ? 20.225  -10.497 53.309  1.00 31.09 ? 113 VAL C O     1 
ATOM   7565  C CB    . VAL C 1 113 ? 20.536  -11.905 56.138  1.00 31.77 ? 113 VAL C CB    1 
ATOM   7566  C CG1   . VAL C 1 113 ? 19.472  -11.363 57.038  1.00 29.25 ? 113 VAL C CG1   1 
ATOM   7567  C CG2   . VAL C 1 113 ? 21.460  -12.987 56.866  1.00 27.46 ? 113 VAL C CG2   1 
ATOM   7568  N N     . THR C 1 114 ? 18.120  -11.072 53.772  1.00 27.56 ? 114 THR C N     1 
ATOM   7569  C CA    . THR C 1 114 ? 17.587  -10.005 52.983  1.00 28.48 ? 114 THR C CA    1 
ATOM   7570  C C     . THR C 1 114 ? 16.865  -9.028  53.869  1.00 30.69 ? 114 THR C C     1 
ATOM   7571  O O     . THR C 1 114 ? 16.520  -9.294  55.053  1.00 31.20 ? 114 THR C O     1 
ATOM   7572  C CB    . THR C 1 114 ? 16.539  -10.492 51.906  1.00 28.11 ? 114 THR C CB    1 
ATOM   7573  O OG1   . THR C 1 114 ? 15.766  -11.481 52.491  1.00 26.92 ? 114 THR C OG1   1 
ATOM   7574  C CG2   . THR C 1 114 ? 17.187  -10.995 50.597  1.00 23.41 ? 114 THR C CG2   1 
ATOM   7575  N N     . SER C 1 115 ? 16.502  -7.919  53.276  1.00 30.20 ? 115 SER C N     1 
ATOM   7576  C CA    . SER C 1 115 ? 15.702  -7.038  54.082  1.00 30.80 ? 115 SER C CA    1 
ATOM   7577  C C     . SER C 1 115 ? 14.147  -7.260  53.900  1.00 30.04 ? 115 SER C C     1 
ATOM   7578  O O     . SER C 1 115 ? 13.415  -6.515  53.238  1.00 31.21 ? 115 SER C O     1 
ATOM   7579  C CB    . SER C 1 115 ? 16.316  -5.614  54.059  1.00 28.90 ? 115 SER C CB    1 
ATOM   7580  O OG    . SER C 1 115 ? 15.318  -4.734  53.723  1.00 37.23 ? 115 SER C OG    1 
ATOM   7581  N N     . GLY C 1 116 ? 13.679  -8.274  54.615  1.00 30.18 ? 116 GLY C N     1 
ATOM   7582  C CA    . GLY C 1 116 ? 12.448  -9.047  54.339  1.00 29.67 ? 116 GLY C CA    1 
ATOM   7583  C C     . GLY C 1 116 ? 12.659  -10.035 53.216  1.00 29.82 ? 116 GLY C C     1 
ATOM   7584  O O     . GLY C 1 116 ? 13.513  -9.808  52.354  1.00 31.51 ? 116 GLY C O     1 
ATOM   7585  N N     . SER C 1 117 ? 11.864  -11.079 53.139  1.00 30.20 ? 117 SER C N     1 
ATOM   7586  C CA    . SER C 1 117 ? 12.066  -12.055 52.052  1.00 29.38 ? 117 SER C CA    1 
ATOM   7587  C C     . SER C 1 117 ? 11.732  -11.596 50.608  1.00 29.21 ? 117 SER C C     1 
ATOM   7588  O O     . SER C 1 117 ? 12.348  -12.060 49.642  1.00 27.71 ? 117 SER C O     1 
ATOM   7589  C CB    . SER C 1 117 ? 11.418  -13.384 52.357  1.00 29.58 ? 117 SER C CB    1 
ATOM   7590  O OG    . SER C 1 117 ? 10.083  -13.504 51.879  1.00 31.18 ? 117 SER C OG    1 
ATOM   7591  N N     . GLN C 1 118 ? 10.768  -10.685 50.472  1.00 29.79 ? 118 GLN C N     1 
ATOM   7592  C CA    . GLN C 1 118 ? 10.318  -10.179 49.172  1.00 28.39 ? 118 GLN C CA    1 
ATOM   7593  C C     . GLN C 1 118 ? 11.393  -9.337  48.527  1.00 27.49 ? 118 GLN C C     1 
ATOM   7594  O O     . GLN C 1 118 ? 11.421  -9.125  47.295  1.00 26.41 ? 118 GLN C O     1 
ATOM   7595  C CB    . GLN C 1 118 ? 8.966   -9.378  49.338  1.00 28.56 ? 118 GLN C CB    1 
ATOM   7596  C CG    . GLN C 1 118 ? 7.704   -10.285 49.559  1.00 32.08 ? 118 GLN C CG    1 
ATOM   7597  C CD    . GLN C 1 118 ? 6.369   -9.525  49.570  1.00 32.57 ? 118 GLN C CD    1 
ATOM   7598  O OE1   . GLN C 1 118 ? 6.059   -8.821  48.625  1.00 40.54 ? 118 GLN C OE1   1 
ATOM   7599  N NE2   . GLN C 1 118 ? 5.567   -9.692  50.648  1.00 35.27 ? 118 GLN C NE2   1 
ATOM   7600  N N     . GLN C 1 119 ? 12.313  -8.809  49.321  1.00 27.86 ? 119 GLN C N     1 
ATOM   7601  C CA    . GLN C 1 119 ? 13.397  -7.984  48.670  1.00 26.78 ? 119 GLN C CA    1 
ATOM   7602  C C     . GLN C 1 119 ? 14.263  -8.920  47.868  1.00 27.10 ? 119 GLN C C     1 
ATOM   7603  O O     . GLN C 1 119 ? 14.658  -8.613  46.767  1.00 27.79 ? 119 GLN C O     1 
ATOM   7604  C CB    . GLN C 1 119 ? 14.318  -7.184  49.653  1.00 26.07 ? 119 GLN C CB    1 
ATOM   7605  C CG    . GLN C 1 119 ? 15.572  -6.586  48.916  1.00 25.89 ? 119 GLN C CG    1 
ATOM   7606  C CD    . GLN C 1 119 ? 16.653  -5.937  49.843  1.00 26.99 ? 119 GLN C CD    1 
ATOM   7607  O OE1   . GLN C 1 119 ? 17.182  -6.580  50.719  1.00 23.33 ? 119 GLN C OE1   1 
ATOM   7608  N NE2   . GLN C 1 119 ? 16.994  -4.653  49.591  1.00 27.82 ? 119 GLN C NE2   1 
ATOM   7609  N N     . GLY C 1 120 ? 14.575  -10.093 48.419  1.00 27.77 ? 120 GLY C N     1 
ATOM   7610  C CA    . GLY C 1 120 ? 15.456  -10.977 47.732  1.00 27.36 ? 120 GLY C CA    1 
ATOM   7611  C C     . GLY C 1 120 ? 14.750  -11.566 46.497  1.00 28.58 ? 120 GLY C C     1 
ATOM   7612  O O     . GLY C 1 120 ? 15.391  -11.835 45.523  1.00 28.58 ? 120 GLY C O     1 
ATOM   7613  N N     . LEU C 1 121 ? 13.447  -11.799 46.580  1.00 29.45 ? 121 LEU C N     1 
ATOM   7614  C CA    . LEU C 1 121 ? 12.603  -12.230 45.434  1.00 31.30 ? 121 LEU C CA    1 
ATOM   7615  C C     . LEU C 1 121 ? 12.593  -11.180 44.340  1.00 31.01 ? 121 LEU C C     1 
ATOM   7616  O O     . LEU C 1 121 ? 12.726  -11.532 43.141  1.00 27.25 ? 121 LEU C O     1 
ATOM   7617  C CB    . LEU C 1 121 ? 11.141  -12.315 45.853  1.00 30.17 ? 121 LEU C CB    1 
ATOM   7618  C CG    . LEU C 1 121 ? 10.545  -13.609 46.363  1.00 36.70 ? 121 LEU C CG    1 
ATOM   7619  C CD1   . LEU C 1 121 ? 9.917   -13.484 47.842  1.00 36.16 ? 121 LEU C CD1   1 
ATOM   7620  C CD2   . LEU C 1 121 ? 9.561   -14.113 45.317  1.00 37.91 ? 121 LEU C CD2   1 
ATOM   7621  N N     . CYS C 1 122 ? 12.371  -9.911  44.770  1.00 31.16 ? 122 CYS C N     1 
ATOM   7622  C CA    . CYS C 1 122 ? 12.344  -8.816  43.856  1.00 30.27 ? 122 CYS C CA    1 
ATOM   7623  C C     . CYS C 1 122 ? 13.641  -8.807  43.076  1.00 30.71 ? 122 CYS C C     1 
ATOM   7624  O O     . CYS C 1 122 ? 13.613  -8.583  41.884  1.00 31.29 ? 122 CYS C O     1 
ATOM   7625  C CB    . CYS C 1 122 ? 12.159  -7.457  44.531  1.00 30.52 ? 122 CYS C CB    1 
ATOM   7626  S SG    . CYS C 1 122 ? 11.650  -6.150  43.334  1.00 32.99 ? 122 CYS C SG    1 
ATOM   7627  N N     . LYS C 1 123 ? 14.781  -8.982  43.752  1.00 30.02 ? 123 LYS C N     1 
ATOM   7628  C CA    . LYS C 1 123 ? 16.052  -8.737  43.083  1.00 29.76 ? 123 LYS C CA    1 
ATOM   7629  C C     . LYS C 1 123 ? 16.371  -9.930  42.175  1.00 31.30 ? 123 LYS C C     1 
ATOM   7630  O O     . LYS C 1 123 ? 17.066  -9.785  41.132  1.00 30.21 ? 123 LYS C O     1 
ATOM   7631  C CB    . LYS C 1 123 ? 17.156  -8.429  44.059  1.00 29.03 ? 123 LYS C CB    1 
ATOM   7632  C CG    . LYS C 1 123 ? 16.842  -7.085  44.730  1.00 30.47 ? 123 LYS C CG    1 
ATOM   7633  C CD    . LYS C 1 123 ? 17.930  -6.529  45.642  1.00 29.64 ? 123 LYS C CD    1 
ATOM   7634  C CE    . LYS C 1 123 ? 17.557  -5.072  46.142  1.00 26.70 ? 123 LYS C CE    1 
ATOM   7635  N NZ    . LYS C 1 123 ? 17.477  -4.232  44.845  1.00 26.76 ? 123 LYS C NZ    1 
ATOM   7636  N N     . VAL C 1 124 ? 15.776  -11.082 42.531  1.00 29.49 ? 124 VAL C N     1 
ATOM   7637  C CA    . VAL C 1 124 ? 15.868  -12.219 41.704  1.00 29.34 ? 124 VAL C CA    1 
ATOM   7638  C C     . VAL C 1 124 ? 15.149  -12.032 40.384  1.00 29.42 ? 124 VAL C C     1 
ATOM   7639  O O     . VAL C 1 124 ? 15.701  -12.392 39.327  1.00 28.83 ? 124 VAL C O     1 
ATOM   7640  C CB    . VAL C 1 124 ? 15.376  -13.463 42.474  1.00 30.66 ? 124 VAL C CB    1 
ATOM   7641  C CG1   . VAL C 1 124 ? 15.092  -14.570 41.528  1.00 26.25 ? 124 VAL C CG1   1 
ATOM   7642  C CG2   . VAL C 1 124 ? 16.469  -13.860 43.449  1.00 28.06 ? 124 VAL C CG2   1 
ATOM   7643  N N     . PHE C 1 125 ? 13.929  -11.459 40.445  1.00 30.07 ? 125 PHE C N     1 
ATOM   7644  C CA    . PHE C 1 125 ? 13.116  -11.130 39.259  1.00 30.81 ? 125 PHE C CA    1 
ATOM   7645  C C     . PHE C 1 125 ? 13.845  -10.189 38.325  1.00 30.29 ? 125 PHE C C     1 
ATOM   7646  O O     . PHE C 1 125 ? 13.959  -10.462 37.174  1.00 29.24 ? 125 PHE C O     1 
ATOM   7647  C CB    . PHE C 1 125 ? 11.774  -10.523 39.678  1.00 30.74 ? 125 PHE C CB    1 
ATOM   7648  C CG    . PHE C 1 125 ? 10.843  -11.503 40.349  1.00 31.84 ? 125 PHE C CG    1 
ATOM   7649  C CD1   . PHE C 1 125 ? 9.831   -11.062 41.176  1.00 31.56 ? 125 PHE C CD1   1 
ATOM   7650  C CD2   . PHE C 1 125 ? 11.002  -12.907 40.158  1.00 35.63 ? 125 PHE C CD2   1 
ATOM   7651  C CE1   . PHE C 1 125 ? 8.955   -12.001 41.813  1.00 34.32 ? 125 PHE C CE1   1 
ATOM   7652  C CE2   . PHE C 1 125 ? 10.135  -13.816 40.766  1.00 34.04 ? 125 PHE C CE2   1 
ATOM   7653  C CZ    . PHE C 1 125 ? 9.119   -13.376 41.580  1.00 29.76 ? 125 PHE C CZ    1 
ATOM   7654  N N     . GLU C 1 126 ? 14.364  -9.085  38.879  1.00 33.17 ? 126 GLU C N     1 
ATOM   7655  C CA    . GLU C 1 126 ? 15.123  -8.000  38.156  1.00 32.17 ? 126 GLU C CA    1 
ATOM   7656  C C     . GLU C 1 126 ? 16.398  -8.580  37.511  1.00 33.64 ? 126 GLU C C     1 
ATOM   7657  O O     . GLU C 1 126 ? 16.671  -8.347  36.304  1.00 34.71 ? 126 GLU C O     1 
ATOM   7658  C CB    . GLU C 1 126 ? 15.453  -6.859  39.150  1.00 31.42 ? 126 GLU C CB    1 
ATOM   7659  C CG    . GLU C 1 126 ? 14.194  -6.022  39.620  1.00 27.61 ? 126 GLU C CG    1 
ATOM   7660  C CD    . GLU C 1 126 ? 14.391  -5.272  40.956  1.00 32.49 ? 126 GLU C CD    1 
ATOM   7661  O OE1   . GLU C 1 126 ? 13.813  -4.156  41.122  1.00 29.56 ? 126 GLU C OE1   1 
ATOM   7662  O OE2   . GLU C 1 126 ? 15.117  -5.808  41.861  1.00 34.64 ? 126 GLU C OE2   1 
ATOM   7663  N N     . MET C 1 127 ? 17.110  -9.417  38.280  1.00 31.86 ? 127 MET C N     1 
ATOM   7664  C CA    . MET C 1 127 ? 18.320  -10.109 37.814  1.00 32.58 ? 127 MET C CA    1 
ATOM   7665  C C     . MET C 1 127 ? 18.017  -10.837 36.507  1.00 31.84 ? 127 MET C C     1 
ATOM   7666  O O     . MET C 1 127 ? 18.691  -10.639 35.538  1.00 33.30 ? 127 MET C O     1 
ATOM   7667  C CB    . MET C 1 127 ? 18.836  -11.094 38.913  1.00 31.28 ? 127 MET C CB    1 
ATOM   7668  C CG    . MET C 1 127 ? 19.967  -12.100 38.488  1.00 31.80 ? 127 MET C CG    1 
ATOM   7669  S SD    . MET C 1 127 ? 20.346  -13.366 39.743  1.00 37.55 ? 127 MET C SD    1 
ATOM   7670  C CE    . MET C 1 127 ? 18.910  -14.416 39.527  1.00 28.33 ? 127 MET C CE    1 
ATOM   7671  N N     . ILE C 1 128 ? 16.949  -11.642 36.490  1.00 31.84 ? 128 ILE C N     1 
ATOM   7672  C CA    . ILE C 1 128 ? 16.607  -12.579 35.443  1.00 29.80 ? 128 ILE C CA    1 
ATOM   7673  C C     . ILE C 1 128 ? 15.845  -12.067 34.241  1.00 31.13 ? 128 ILE C C     1 
ATOM   7674  O O     . ILE C 1 128 ? 16.166  -12.439 33.073  1.00 28.17 ? 128 ILE C O     1 
ATOM   7675  C CB    . ILE C 1 128 ? 15.725  -13.680 36.046  1.00 31.50 ? 128 ILE C CB    1 
ATOM   7676  C CG1   . ILE C 1 128 ? 16.479  -14.506 37.116  1.00 27.61 ? 128 ILE C CG1   1 
ATOM   7677  C CG2   . ILE C 1 128 ? 15.073  -14.630 34.954  1.00 29.80 ? 128 ILE C CG2   1 
ATOM   7678  C CD1   . ILE C 1 128 ? 15.429  -15.304 37.945  1.00 25.18 ? 128 ILE C CD1   1 
ATOM   7679  N N     . ILE C 1 129 ? 14.819  -11.237 34.510  1.00 32.71 ? 129 ILE C N     1 
ATOM   7680  C CA    . ILE C 1 129 ? 13.792  -10.957 33.467  1.00 34.05 ? 129 ILE C CA    1 
ATOM   7681  C C     . ILE C 1 129 ? 14.090  -9.852  32.451  1.00 34.97 ? 129 ILE C C     1 
ATOM   7682  O O     . ILE C 1 129 ? 14.060  -8.663  32.810  1.00 34.15 ? 129 ILE C O     1 
ATOM   7683  C CB    . ILE C 1 129 ? 12.388  -10.711 34.029  1.00 33.33 ? 129 ILE C CB    1 
ATOM   7684  C CG1   . ILE C 1 129 ? 11.821  -12.019 34.590  1.00 33.87 ? 129 ILE C CG1   1 
ATOM   7685  C CG2   . ILE C 1 129 ? 11.482  -10.187 32.896  1.00 33.63 ? 129 ILE C CG2   1 
ATOM   7686  C CD1   . ILE C 1 129 ? 11.001  -11.921 35.905  1.00 31.27 ? 129 ILE C CD1   1 
ATOM   7687  N N     . ASN C 1 130 ? 14.324  -10.282 31.196  1.00 34.85 ? 130 ASN C N     1 
ATOM   7688  C CA    . ASN C 1 130 ? 14.273  -9.398  30.015  1.00 35.13 ? 130 ASN C CA    1 
ATOM   7689  C C     . ASN C 1 130 ? 12.826  -9.235  29.516  1.00 35.45 ? 130 ASN C C     1 
ATOM   7690  O O     . ASN C 1 130 ? 12.026  -10.137 29.625  1.00 35.80 ? 130 ASN C O     1 
ATOM   7691  C CB    . ASN C 1 130 ? 15.085  -9.978  28.836  1.00 34.10 ? 130 ASN C CB    1 
ATOM   7692  C CG    . ASN C 1 130 ? 16.513  -10.179 29.153  1.00 31.78 ? 130 ASN C CG    1 
ATOM   7693  O OD1   . ASN C 1 130 ? 17.105  -9.494  29.941  1.00 36.20 ? 130 ASN C OD1   1 
ATOM   7694  N ND2   . ASN C 1 130 ? 17.088  -11.115 28.518  1.00 34.76 ? 130 ASN C ND2   1 
ATOM   7695  N N     . PRO C 1 131 ? 12.483  -8.076  28.965  1.00 35.95 ? 131 PRO C N     1 
ATOM   7696  C CA    . PRO C 1 131 ? 11.130  -8.011  28.429  1.00 36.05 ? 131 PRO C CA    1 
ATOM   7697  C C     . PRO C 1 131 ? 10.813  -9.064  27.348  1.00 37.11 ? 131 PRO C C     1 
ATOM   7698  O O     . PRO C 1 131 ? 11.619  -9.328  26.440  1.00 36.53 ? 131 PRO C O     1 
ATOM   7699  C CB    . PRO C 1 131 ? 11.064  -6.601  27.838  1.00 36.08 ? 131 PRO C CB    1 
ATOM   7700  C CG    . PRO C 1 131 ? 12.013  -5.786  28.711  1.00 35.30 ? 131 PRO C CG    1 
ATOM   7701  C CD    . PRO C 1 131 ? 13.189  -6.779  28.872  1.00 35.65 ? 131 PRO C CD    1 
ATOM   7702  N N     . GLY C 1 132 ? 9.621   -9.638  27.411  1.00 38.16 ? 132 GLY C N     1 
ATOM   7703  C CA    . GLY C 1 132 ? 9.250   -10.648 26.406  1.00 39.76 ? 132 GLY C CA    1 
ATOM   7704  C C     . GLY C 1 132 ? 9.734   -12.039 26.816  1.00 40.49 ? 132 GLY C C     1 
ATOM   7705  O O     . GLY C 1 132 ? 9.483   -12.999 26.096  1.00 41.40 ? 132 GLY C O     1 
ATOM   7706  N N     . ASP C 1 133 ? 10.390  -12.159 27.980  1.00 39.81 ? 133 ASP C N     1 
ATOM   7707  C CA    . ASP C 1 133 ? 10.776  -13.472 28.540  1.00 38.99 ? 133 ASP C CA    1 
ATOM   7708  C C     . ASP C 1 133 ? 9.556   -14.284 28.981  1.00 38.41 ? 133 ASP C C     1 
ATOM   7709  O O     . ASP C 1 133 ? 8.575   -13.702 29.456  1.00 36.83 ? 133 ASP C O     1 
ATOM   7710  C CB    . ASP C 1 133 ? 11.663  -13.260 29.764  1.00 40.15 ? 133 ASP C CB    1 
ATOM   7711  C CG    . ASP C 1 133 ? 13.132  -13.375 29.451  1.00 41.56 ? 133 ASP C CG    1 
ATOM   7712  O OD1   . ASP C 1 133 ? 13.463  -13.322 28.251  1.00 44.65 ? 133 ASP C OD1   1 
ATOM   7713  O OD2   . ASP C 1 133 ? 13.968  -13.543 30.405  1.00 41.72 ? 133 ASP C OD2   1 
ATOM   7714  N N     . ASN C 1 134 ? 9.591   -15.616 28.848  1.00 37.19 ? 134 ASN C N     1 
ATOM   7715  C CA    . ASN C 1 134 ? 8.451   -16.385 29.375  1.00 37.42 ? 134 ASN C CA    1 
ATOM   7716  C C     . ASN C 1 134 ? 8.691   -16.897 30.768  1.00 36.34 ? 134 ASN C C     1 
ATOM   7717  O O     . ASN C 1 134 ? 9.798   -17.337 31.092  1.00 38.28 ? 134 ASN C O     1 
ATOM   7718  C CB    . ASN C 1 134 ? 7.964   -17.537 28.465  1.00 37.47 ? 134 ASN C CB    1 
ATOM   7719  C CG    . ASN C 1 134 ? 7.615   -17.084 27.081  1.00 40.83 ? 134 ASN C CG    1 
ATOM   7720  O OD1   . ASN C 1 134 ? 6.707   -16.238 26.829  1.00 41.31 ? 134 ASN C OD1   1 
ATOM   7721  N ND2   . ASN C 1 134 ? 8.357   -17.631 26.142  1.00 43.28 ? 134 ASN C ND2   1 
ATOM   7722  N N     . VAL C 1 135 ? 7.642   -16.870 31.575  1.00 35.23 ? 135 VAL C N     1 
ATOM   7723  C CA    . VAL C 1 135 ? 7.740   -17.337 32.981  1.00 34.35 ? 135 VAL C CA    1 
ATOM   7724  C C     . VAL C 1 135 ? 6.466   -18.164 33.316  1.00 33.11 ? 135 VAL C C     1 
ATOM   7725  O O     . VAL C 1 135 ? 5.361   -17.739 32.911  1.00 29.58 ? 135 VAL C O     1 
ATOM   7726  C CB    . VAL C 1 135 ? 7.915   -16.131 34.027  1.00 32.85 ? 135 VAL C CB    1 
ATOM   7727  C CG1   . VAL C 1 135 ? 9.085   -15.227 33.690  1.00 29.05 ? 135 VAL C CG1   1 
ATOM   7728  C CG2   . VAL C 1 135 ? 6.675   -15.275 34.041  1.00 35.85 ? 135 VAL C CG2   1 
ATOM   7729  N N     . LEU C 1 136 ? 6.620   -19.282 34.017  1.00 29.41 ? 136 LEU C N     1 
ATOM   7730  C CA    . LEU C 1 136 ? 5.477   -20.051 34.496  1.00 30.26 ? 136 LEU C CA    1 
ATOM   7731  C C     . LEU C 1 136 ? 5.186   -19.750 35.963  1.00 32.25 ? 136 LEU C C     1 
ATOM   7732  O O     . LEU C 1 136 ? 6.102   -19.647 36.778  1.00 34.45 ? 136 LEU C O     1 
ATOM   7733  C CB    . LEU C 1 136 ? 5.720   -21.548 34.304  1.00 29.36 ? 136 LEU C CB    1 
ATOM   7734  C CG    . LEU C 1 136 ? 6.376   -21.965 32.987  1.00 27.65 ? 136 LEU C CG    1 
ATOM   7735  C CD1   . LEU C 1 136 ? 7.423   -23.043 33.225  1.00 25.22 ? 136 LEU C CD1   1 
ATOM   7736  C CD2   . LEU C 1 136 ? 5.329   -22.441 31.991  1.00 29.20 ? 136 LEU C CD2   1 
ATOM   7737  N N     . LEU C 1 137 ? 3.906   -19.611 36.291  1.00 33.43 ? 137 LEU C N     1 
ATOM   7738  C CA    . LEU C 1 137 ? 3.442   -19.793 37.661  1.00 34.75 ? 137 LEU C CA    1 
ATOM   7739  C C     . LEU C 1 137 ? 1.938   -20.042 37.706  1.00 35.80 ? 137 LEU C C     1 
ATOM   7740  O O     . LEU C 1 137 ? 1.225   -19.774 36.739  1.00 36.08 ? 137 LEU C O     1 
ATOM   7741  C CB    . LEU C 1 137 ? 3.798   -18.573 38.513  1.00 34.61 ? 137 LEU C CB    1 
ATOM   7742  C CG    . LEU C 1 137 ? 2.787   -17.425 38.511  1.00 31.18 ? 137 LEU C CG    1 
ATOM   7743  C CD1   . LEU C 1 137 ? 3.492   -16.089 38.345  1.00 27.58 ? 137 LEU C CD1   1 
ATOM   7744  C CD2   . LEU C 1 137 ? 1.747   -17.627 37.420  1.00 28.29 ? 137 LEU C CD2   1 
ATOM   7745  N N     . ASP C 1 138 ? 1.461   -20.556 38.837  1.00 36.36 ? 138 ASP C N     1 
ATOM   7746  C CA    . ASP C 1 138 ? 0.064   -20.951 38.970  1.00 35.82 ? 138 ASP C CA    1 
ATOM   7747  C C     . ASP C 1 138 ? -0.774  -19.822 39.562  1.00 35.84 ? 138 ASP C C     1 
ATOM   7748  O O     . ASP C 1 138 ? -0.393  -19.210 40.560  1.00 37.39 ? 138 ASP C O     1 
ATOM   7749  C CB    . ASP C 1 138 ? -0.058  -22.205 39.838  1.00 33.95 ? 138 ASP C CB    1 
ATOM   7750  C CG    . ASP C 1 138 ? 0.615   -22.048 41.188  1.00 37.80 ? 138 ASP C CG    1 
ATOM   7751  O OD1   . ASP C 1 138 ? 1.853   -21.886 41.219  1.00 35.13 ? 138 ASP C OD1   1 
ATOM   7752  O OD2   . ASP C 1 138 ? -0.011  -22.073 42.268  1.00 34.31 ? 138 ASP C OD2   1 
ATOM   7753  N N     . GLU C 1 139 ? -1.917  -19.552 38.940  1.00 35.87 ? 139 GLU C N     1 
ATOM   7754  C CA    . GLU C 1 139 ? -2.904  -18.633 39.509  1.00 35.95 ? 139 GLU C CA    1 
ATOM   7755  C C     . GLU C 1 139 ? -4.072  -19.406 40.080  1.00 35.64 ? 139 GLU C C     1 
ATOM   7756  O O     . GLU C 1 139 ? -4.439  -20.416 39.475  1.00 36.87 ? 139 GLU C O     1 
ATOM   7757  C CB    . GLU C 1 139 ? -3.474  -17.840 38.406  1.00 36.78 ? 139 GLU C CB    1 
ATOM   7758  C CG    . GLU C 1 139 ? -2.524  -17.007 37.677  1.00 35.49 ? 139 GLU C CG    1 
ATOM   7759  C CD    . GLU C 1 139 ? -3.211  -16.487 36.426  1.00 40.46 ? 139 GLU C CD    1 
ATOM   7760  O OE1   . GLU C 1 139 ? -3.979  -15.471 36.466  1.00 28.52 ? 139 GLU C OE1   1 
ATOM   7761  O OE2   . GLU C 1 139 ? -2.992  -17.177 35.396  1.00 48.11 ? 139 GLU C OE2   1 
ATOM   7762  N N     . PRO C 1 140 ? -4.704  -18.929 41.206  1.00 34.96 ? 140 PRO C N     1 
ATOM   7763  C CA    . PRO C 1 140 ? -4.386  -17.623 41.755  1.00 34.08 ? 140 PRO C CA    1 
ATOM   7764  C C     . PRO C 1 140 ? -2.961  -17.517 42.314  1.00 34.21 ? 140 PRO C C     1 
ATOM   7765  O O     . PRO C 1 140 ? -2.348  -18.539 42.768  1.00 33.24 ? 140 PRO C O     1 
ATOM   7766  C CB    . PRO C 1 140 ? -5.484  -17.356 42.797  1.00 32.79 ? 140 PRO C CB    1 
ATOM   7767  C CG    . PRO C 1 140 ? -6.146  -18.636 43.019  1.00 33.10 ? 140 PRO C CG    1 
ATOM   7768  C CD    . PRO C 1 140 ? -5.759  -19.618 41.989  1.00 32.34 ? 140 PRO C CD    1 
ATOM   7769  N N     . ALA C 1 141 ? -2.452  -16.281 42.220  1.00 31.83 ? 141 ALA C N     1 
ATOM   7770  C CA    . ALA C 1 141 ? -1.096  -15.957 42.675  1.00 32.99 ? 141 ALA C CA    1 
ATOM   7771  C C     . ALA C 1 141 ? -1.134  -14.824 43.649  1.00 32.35 ? 141 ALA C C     1 
ATOM   7772  O O     . ALA C 1 141 ? -1.925  -13.866 43.453  1.00 29.52 ? 141 ALA C O     1 
ATOM   7773  C CB    . ALA C 1 141 ? -0.183  -15.576 41.443  1.00 31.33 ? 141 ALA C CB    1 
ATOM   7774  N N     . TYR C 1 142 ? -0.221  -14.864 44.625  1.00 33.69 ? 142 TYR C N     1 
ATOM   7775  C CA    . TYR C 1 142 ? 0.041   -13.654 45.464  1.00 36.34 ? 142 TYR C CA    1 
ATOM   7776  C C     . TYR C 1 142 ? 0.115   -12.327 44.620  1.00 35.32 ? 142 TYR C C     1 
ATOM   7777  O O     . TYR C 1 142 ? 0.860   -12.214 43.663  1.00 34.80 ? 142 TYR C O     1 
ATOM   7778  C CB    . TYR C 1 142 ? 1.262   -13.831 46.339  1.00 37.14 ? 142 TYR C CB    1 
ATOM   7779  C CG    . TYR C 1 142 ? 1.748   -12.592 47.074  1.00 39.43 ? 142 TYR C CG    1 
ATOM   7780  C CD1   . TYR C 1 142 ? 3.090   -12.187 46.968  1.00 44.70 ? 142 TYR C CD1   1 
ATOM   7781  C CD2   . TYR C 1 142 ? 0.910   -11.843 47.870  1.00 43.37 ? 142 TYR C CD2   1 
ATOM   7782  C CE1   . TYR C 1 142 ? 3.581   -11.064 47.666  1.00 40.41 ? 142 TYR C CE1   1 
ATOM   7783  C CE2   . TYR C 1 142 ? 1.386   -10.705 48.550  1.00 41.02 ? 142 TYR C CE2   1 
ATOM   7784  C CZ    . TYR C 1 142 ? 2.722   -10.357 48.437  1.00 39.78 ? 142 TYR C CZ    1 
ATOM   7785  O OH    . TYR C 1 142 ? 3.177   -9.270  49.104  1.00 44.08 ? 142 TYR C OH    1 
ATOM   7786  N N     . SER C 1 143 ? -0.714  -11.371 44.964  1.00 35.44 ? 143 SER C N     1 
ATOM   7787  C CA    . SER C 1 143 ? -0.876  -10.152 44.144  1.00 34.56 ? 143 SER C CA    1 
ATOM   7788  C C     . SER C 1 143 ? 0.406   -9.339  44.168  1.00 34.93 ? 143 SER C C     1 
ATOM   7789  O O     . SER C 1 143 ? 0.791   -8.739  43.188  1.00 35.98 ? 143 SER C O     1 
ATOM   7790  C CB    . SER C 1 143 ? -1.988  -9.374  44.790  1.00 34.54 ? 143 SER C CB    1 
ATOM   7791  O OG    . SER C 1 143 ? -1.711  -9.249  46.185  1.00 34.52 ? 143 SER C OG    1 
ATOM   7792  N N     . GLY C 1 144 ? 1.093   -9.316  45.308  1.00 34.82 ? 144 GLY C N     1 
ATOM   7793  C CA    . GLY C 1 144 ? 2.450   -8.709  45.368  1.00 33.46 ? 144 GLY C CA    1 
ATOM   7794  C C     . GLY C 1 144 ? 3.387   -9.166  44.255  1.00 32.47 ? 144 GLY C C     1 
ATOM   7795  O O     . GLY C 1 144 ? 4.079   -8.351  43.631  1.00 33.64 ? 144 GLY C O     1 
ATOM   7796  N N     . THR C 1 145 ? 3.455   -10.468 43.976  1.00 31.74 ? 145 THR C N     1 
ATOM   7797  C CA    . THR C 1 145 ? 4.427   -10.903 43.007  1.00 30.72 ? 145 THR C CA    1 
ATOM   7798  C C     . THR C 1 145 ? 3.989   -10.649 41.543  1.00 29.66 ? 145 THR C C     1 
ATOM   7799  O O     . THR C 1 145 ? 4.871   -10.428 40.685  1.00 28.85 ? 145 THR C O     1 
ATOM   7800  C CB    . THR C 1 145 ? 4.949   -12.358 43.149  1.00 31.34 ? 145 THR C CB    1 
ATOM   7801  O OG1   . THR C 1 145 ? 4.650   -13.111 41.943  1.00 34.86 ? 145 THR C OG1   1 
ATOM   7802  C CG2   . THR C 1 145 ? 4.543   -13.022 44.398  1.00 32.46 ? 145 THR C CG2   1 
ATOM   7803  N N     . LEU C 1 146 ? 2.677   -10.717 41.293  1.00 28.67 ? 146 LEU C N     1 
ATOM   7804  C CA    . LEU C 1 146 ? 2.028   -10.191 40.055  1.00 30.87 ? 146 LEU C CA    1 
ATOM   7805  C C     . LEU C 1 146 ? 2.402   -8.739  39.798  1.00 29.37 ? 146 LEU C C     1 
ATOM   7806  O O     . LEU C 1 146 ? 2.749   -8.376  38.681  1.00 30.19 ? 146 LEU C O     1 
ATOM   7807  C CB    . LEU C 1 146 ? 0.449   -10.349 40.053  1.00 28.58 ? 146 LEU C CB    1 
ATOM   7808  C CG    . LEU C 1 146 ? 0.059   -11.836 40.105  1.00 32.97 ? 146 LEU C CG    1 
ATOM   7809  C CD1   . LEU C 1 146 ? -1.499  -12.146 40.039  1.00 27.69 ? 146 LEU C CD1   1 
ATOM   7810  C CD2   . LEU C 1 146 ? 0.829   -12.682 39.050  1.00 29.86 ? 146 LEU C CD2   1 
ATOM   7811  N N     . GLN C 1 147 ? 2.335   -7.925  40.840  1.00 29.46 ? 147 GLN C N     1 
ATOM   7812  C CA    . GLN C 1 147 ? 2.651   -6.480  40.724  1.00 29.49 ? 147 GLN C CA    1 
ATOM   7813  C C     . GLN C 1 147 ? 4.132   -6.228  40.502  1.00 28.85 ? 147 GLN C C     1 
ATOM   7814  O O     . GLN C 1 147 ? 4.492   -5.341  39.796  1.00 28.98 ? 147 GLN C O     1 
ATOM   7815  C CB    . GLN C 1 147 ? 2.146   -5.729  41.934  1.00 29.54 ? 147 GLN C CB    1 
ATOM   7816  C CG    . GLN C 1 147 ? 0.651   -5.748  42.005  1.00 36.96 ? 147 GLN C CG    1 
ATOM   7817  C CD    . GLN C 1 147 ? -0.093  -4.954  40.908  1.00 47.39 ? 147 GLN C CD    1 
ATOM   7818  O OE1   . GLN C 1 147 ? 0.367   -4.764  39.724  1.00 49.30 ? 147 GLN C OE1   1 
ATOM   7819  N NE2   . GLN C 1 147 ? -1.275  -4.476  41.308  1.00 49.77 ? 147 GLN C NE2   1 
ATOM   7820  N N     . SER C 1 148 ? 4.980   -7.106  41.051  1.00 29.27 ? 148 SER C N     1 
ATOM   7821  C CA    . SER C 1 148 ? 6.405   -7.138  40.788  1.00 26.23 ? 148 SER C CA    1 
ATOM   7822  C C     . SER C 1 148 ? 6.773   -7.581  39.407  1.00 26.61 ? 148 SER C C     1 
ATOM   7823  O O     . SER C 1 148 ? 7.782   -7.135  38.845  1.00 25.78 ? 148 SER C O     1 
ATOM   7824  C CB    . SER C 1 148 ? 6.988   -8.139  41.705  1.00 26.86 ? 148 SER C CB    1 
ATOM   7825  O OG    . SER C 1 148 ? 8.322   -7.913  41.866  1.00 25.23 ? 148 SER C OG    1 
ATOM   7826  N N     . LEU C 1 149 ? 5.962   -8.442  38.810  1.00 27.42 ? 149 LEU C N     1 
ATOM   7827  C CA    . LEU C 1 149 ? 6.308   -9.089  37.538  1.00 25.97 ? 149 LEU C CA    1 
ATOM   7828  C C     . LEU C 1 149 ? 5.745   -8.276  36.453  1.00 26.69 ? 149 LEU C C     1 
ATOM   7829  O O     . LEU C 1 149 ? 6.319   -8.197  35.363  1.00 27.80 ? 149 LEU C O     1 
ATOM   7830  C CB    . LEU C 1 149 ? 5.701   -10.537 37.521  1.00 27.18 ? 149 LEU C CB    1 
ATOM   7831  C CG    . LEU C 1 149 ? 6.465   -11.666 38.323  1.00 26.28 ? 149 LEU C CG    1 
ATOM   7832  C CD1   . LEU C 1 149 ? 5.657   -12.795 38.272  1.00 21.26 ? 149 LEU C CD1   1 
ATOM   7833  C CD2   . LEU C 1 149 ? 7.808   -12.062 37.743  1.00 18.26 ? 149 LEU C CD2   1 
ATOM   7834  N N     . HIS C 1 150 ? 4.593   -7.679  36.696  1.00 30.70 ? 150 HIS C N     1 
ATOM   7835  C CA    . HIS C 1 150 ? 3.907   -6.822  35.624  1.00 32.27 ? 150 HIS C CA    1 
ATOM   7836  C C     . HIS C 1 150 ? 4.845   -5.787  34.903  1.00 32.52 ? 150 HIS C C     1 
ATOM   7837  O O     . HIS C 1 150 ? 5.019   -5.829  33.648  1.00 31.94 ? 150 HIS C O     1 
ATOM   7838  C CB    . HIS C 1 150 ? 2.644   -6.082  36.173  1.00 34.31 ? 150 HIS C CB    1 
ATOM   7839  C CG    . HIS C 1 150 ? 2.103   -5.032  35.229  1.00 35.88 ? 150 HIS C CG    1 
ATOM   7840  N ND1   . HIS C 1 150 ? 1.891   -3.717  35.598  1.00 35.79 ? 150 HIS C ND1   1 
ATOM   7841  C CD2   . HIS C 1 150 ? 1.779   -5.111  33.909  1.00 40.17 ? 150 HIS C CD2   1 
ATOM   7842  C CE1   . HIS C 1 150 ? 1.454   -3.039  34.547  1.00 38.14 ? 150 HIS C CE1   1 
ATOM   7843  N NE2   . HIS C 1 150 ? 1.358   -3.866  33.518  1.00 36.68 ? 150 HIS C NE2   1 
ATOM   7844  N N     . PRO C 1 151 ? 5.483   -4.884  35.682  1.00 31.76 ? 151 PRO C N     1 
ATOM   7845  C CA    . PRO C 1 151 ? 6.385   -3.912  35.063  1.00 30.72 ? 151 PRO C CA    1 
ATOM   7846  C C     . PRO C 1 151 ? 7.630   -4.478  34.382  1.00 31.02 ? 151 PRO C C     1 
ATOM   7847  O O     . PRO C 1 151 ? 8.259   -3.737  33.628  1.00 29.59 ? 151 PRO C O     1 
ATOM   7848  C CB    . PRO C 1 151 ? 6.791   -3.031  36.233  1.00 31.81 ? 151 PRO C CB    1 
ATOM   7849  C CG    . PRO C 1 151 ? 6.413   -3.765  37.449  1.00 30.83 ? 151 PRO C CG    1 
ATOM   7850  C CD    . PRO C 1 151 ? 5.339   -4.669  37.136  1.00 31.59 ? 151 PRO C CD    1 
ATOM   7851  N N     . LEU C 1 152 ? 8.004   -5.759  34.632  1.00 30.33 ? 152 LEU C N     1 
ATOM   7852  C CA    . LEU C 1 152 ? 9.103   -6.364  33.849  1.00 29.42 ? 152 LEU C CA    1 
ATOM   7853  C C     . LEU C 1 152 ? 8.803   -6.804  32.405  1.00 28.93 ? 152 LEU C C     1 
ATOM   7854  O O     . LEU C 1 152 ? 9.735   -7.225  31.713  1.00 31.20 ? 152 LEU C O     1 
ATOM   7855  C CB    . LEU C 1 152 ? 9.907   -7.476  34.548  1.00 27.32 ? 152 LEU C CB    1 
ATOM   7856  C CG    . LEU C 1 152 ? 10.816  -7.239  35.754  1.00 32.41 ? 152 LEU C CG    1 
ATOM   7857  C CD1   . LEU C 1 152 ? 11.680  -5.960  35.747  1.00 26.07 ? 152 LEU C CD1   1 
ATOM   7858  C CD2   . LEU C 1 152 ? 10.013  -7.237  36.968  1.00 28.96 ? 152 LEU C CD2   1 
ATOM   7859  N N     . GLY C 1 153 ? 7.586   -6.705  31.918  1.00 29.41 ? 153 GLY C N     1 
ATOM   7860  C CA    . GLY C 1 153 ? 7.335   -7.154  30.502  1.00 31.93 ? 153 GLY C CA    1 
ATOM   7861  C C     . GLY C 1 153 ? 7.629   -8.643  30.263  1.00 33.52 ? 153 GLY C C     1 
ATOM   7862  O O     . GLY C 1 153 ? 8.159   -9.036  29.219  1.00 33.33 ? 153 GLY C O     1 
ATOM   7863  N N     . CYS C 1 154 ? 7.372   -9.498  31.247  1.00 33.36 ? 154 CYS C N     1 
ATOM   7864  C CA    . CYS C 1 154 ? 7.500   -10.918 30.925  1.00 34.95 ? 154 CYS C CA    1 
ATOM   7865  C C     . CYS C 1 154 ? 6.118   -11.411 30.497  1.00 34.85 ? 154 CYS C C     1 
ATOM   7866  O O     . CYS C 1 154 ? 5.100   -10.731 30.717  1.00 33.60 ? 154 CYS C O     1 
ATOM   7867  C CB    . CYS C 1 154 ? 8.055   -11.743 32.104  1.00 33.45 ? 154 CYS C CB    1 
ATOM   7868  S SG    . CYS C 1 154 ? 7.242   -11.371 33.650  1.00 33.78 ? 154 CYS C SG    1 
ATOM   7869  N N     . ASN C 1 155 ? 6.073   -12.604 29.905  1.00 36.54 ? 155 ASN C N     1 
ATOM   7870  C CA    . ASN C 1 155 ? 4.775   -13.222 29.653  1.00 37.20 ? 155 ASN C CA    1 
ATOM   7871  C C     . ASN C 1 155 ? 4.630   -14.215 30.749  1.00 36.46 ? 155 ASN C C     1 
ATOM   7872  O O     . ASN C 1 155 ? 5.454   -15.118 30.935  1.00 36.12 ? 155 ASN C O     1 
ATOM   7873  C CB    . ASN C 1 155 ? 4.721   -13.868 28.241  1.00 39.59 ? 155 ASN C CB    1 
ATOM   7874  C CG    . ASN C 1 155 ? 3.286   -13.925 27.631  1.00 47.49 ? 155 ASN C CG    1 
ATOM   7875  O OD1   . ASN C 1 155 ? 2.892   -14.962 27.050  1.00 51.78 ? 155 ASN C OD1   1 
ATOM   7876  N ND2   . ASN C 1 155 ? 2.502   -12.808 27.760  1.00 51.28 ? 155 ASN C ND2   1 
ATOM   7877  N N     . ILE C 1 156 ? 3.584   -14.029 31.521  1.00 36.36 ? 156 ILE C N     1 
ATOM   7878  C CA    . ILE C 1 156 ? 3.180   -15.035 32.457  1.00 35.83 ? 156 ILE C CA    1 
ATOM   7879  C C     . ILE C 1 156 ? 2.358   -16.158 31.786  1.00 36.85 ? 156 ILE C C     1 
ATOM   7880  O O     . ILE C 1 156 ? 1.295   -15.939 31.228  1.00 36.08 ? 156 ILE C O     1 
ATOM   7881  C CB    . ILE C 1 156 ? 2.531   -14.353 33.713  1.00 36.24 ? 156 ILE C CB    1 
ATOM   7882  C CG1   . ILE C 1 156 ? 3.595   -13.386 34.320  1.00 31.64 ? 156 ILE C CG1   1 
ATOM   7883  C CG2   . ILE C 1 156 ? 2.036   -15.410 34.711  1.00 32.72 ? 156 ILE C CG2   1 
ATOM   7884  C CD1   . ILE C 1 156 ? 3.082   -12.410 35.290  1.00 28.00 ? 156 ILE C CD1   1 
ATOM   7885  N N     . ILE C 1 157 ? 2.895   -17.374 31.774  1.00 37.13 ? 157 ILE C N     1 
ATOM   7886  C CA    . ILE C 1 157 ? 2.092   -18.481 31.297  1.00 36.54 ? 157 ILE C CA    1 
ATOM   7887  C C     . ILE C 1 157 ? 1.506   -19.237 32.513  1.00 35.92 ? 157 ILE C C     1 
ATOM   7888  O O     . ILE C 1 157 ? 2.219   -19.663 33.369  1.00 34.76 ? 157 ILE C O     1 
ATOM   7889  C CB    . ILE C 1 157 ? 2.915   -19.360 30.400  1.00 37.84 ? 157 ILE C CB    1 
ATOM   7890  C CG1   . ILE C 1 157 ? 3.448   -18.536 29.212  1.00 34.96 ? 157 ILE C CG1   1 
ATOM   7891  C CG2   . ILE C 1 157 ? 2.061   -20.623 29.929  1.00 37.05 ? 157 ILE C CG2   1 
ATOM   7892  C CD1   . ILE C 1 157 ? 4.599   -19.263 28.448  1.00 32.69 ? 157 ILE C CD1   1 
ATOM   7893  N N     . ASN C 1 158 ? 0.191   -19.346 32.600  1.00 37.46 ? 158 ASN C N     1 
ATOM   7894  C CA    . ASN C 1 158 ? -0.428  -19.919 33.778  1.00 37.70 ? 158 ASN C CA    1 
ATOM   7895  C C     . ASN C 1 158 ? -0.443  -21.426 33.821  1.00 38.76 ? 158 ASN C C     1 
ATOM   7896  O O     . ASN C 1 158 ? -1.054  -21.989 32.948  1.00 41.13 ? 158 ASN C O     1 
ATOM   7897  C CB    . ASN C 1 158 ? -1.857  -19.448 33.858  1.00 37.53 ? 158 ASN C CB    1 
ATOM   7898  C CG    . ASN C 1 158 ? -2.499  -19.847 35.209  1.00 38.22 ? 158 ASN C CG    1 
ATOM   7899  O OD1   . ASN C 1 158 ? -1.820  -19.900 36.234  1.00 39.36 ? 158 ASN C OD1   1 
ATOM   7900  N ND2   . ASN C 1 158 ? -3.766  -20.169 35.189  1.00 34.36 ? 158 ASN C ND2   1 
ATOM   7901  N N     . VAL C 1 159 ? 0.194   -22.084 34.795  1.00 38.90 ? 159 VAL C N     1 
ATOM   7902  C CA    . VAL C 1 159 ? 0.110   -23.565 34.974  1.00 39.64 ? 159 VAL C CA    1 
ATOM   7903  C C     . VAL C 1 159 ? -1.260  -23.829 35.669  1.00 41.76 ? 159 VAL C C     1 
ATOM   7904  O O     . VAL C 1 159 ? -1.727  -22.999 36.497  1.00 41.81 ? 159 VAL C O     1 
ATOM   7905  C CB    . VAL C 1 159 ? 1.188   -24.149 35.971  1.00 39.07 ? 159 VAL C CB    1 
ATOM   7906  C CG1   . VAL C 1 159 ? 1.461   -25.609 35.734  1.00 40.72 ? 159 VAL C CG1   1 
ATOM   7907  C CG2   . VAL C 1 159 ? 2.469   -23.437 35.933  1.00 41.56 ? 159 VAL C CG2   1 
ATOM   7908  N N     . ALA C 1 160 ? -1.900  -24.974 35.348  1.00 41.00 ? 160 ALA C N     1 
ATOM   7909  C CA    . ALA C 1 160 ? -3.102  -25.415 36.057  1.00 39.21 ? 160 ALA C CA    1 
ATOM   7910  C C     . ALA C 1 160 ? -2.690  -25.729 37.474  1.00 38.46 ? 160 ALA C C     1 
ATOM   7911  O O     . ALA C 1 160 ? -1.580  -26.197 37.687  1.00 39.64 ? 160 ALA C O     1 
ATOM   7912  C CB    . ALA C 1 160 ? -3.726  -26.700 35.381  1.00 38.64 ? 160 ALA C CB    1 
ATOM   7913  N N     . SER C 1 161 ? -3.579  -25.492 38.426  1.00 37.35 ? 161 SER C N     1 
ATOM   7914  C CA    . SER C 1 161 ? -3.322  -25.835 39.855  1.00 37.80 ? 161 SER C CA    1 
ATOM   7915  C C     . SER C 1 161 ? -4.563  -26.464 40.534  1.00 37.49 ? 161 SER C C     1 
ATOM   7916  O O     . SER C 1 161 ? -5.649  -25.955 40.399  1.00 36.55 ? 161 SER C O     1 
ATOM   7917  C CB    . SER C 1 161 ? -2.888  -24.592 40.648  1.00 35.43 ? 161 SER C CB    1 
ATOM   7918  O OG    . SER C 1 161 ? -3.999  -23.712 40.741  1.00 33.82 ? 161 SER C OG    1 
ATOM   7919  N N     . ASP C 1 162 ? -4.410  -27.529 41.320  1.00 39.97 ? 162 ASP C N     1 
ATOM   7920  C CA    . ASP C 1 162 ? -5.597  -27.989 42.088  1.00 41.73 ? 162 ASP C CA    1 
ATOM   7921  C C     . ASP C 1 162 ? -5.387  -27.929 43.586  1.00 42.56 ? 162 ASP C C     1 
ATOM   7922  O O     . ASP C 1 162 ? -4.513  -27.191 44.015  1.00 44.51 ? 162 ASP C O     1 
ATOM   7923  C CB    . ASP C 1 162 ? -6.168  -29.338 41.578  1.00 41.08 ? 162 ASP C CB    1 
ATOM   7924  C CG    . ASP C 1 162 ? -5.178  -30.459 41.610  1.00 42.55 ? 162 ASP C CG    1 
ATOM   7925  O OD1   . ASP C 1 162 ? -4.168  -30.377 42.305  1.00 44.87 ? 162 ASP C OD1   1 
ATOM   7926  O OD2   . ASP C 1 162 ? -5.383  -31.467 40.898  1.00 49.93 ? 162 ASP C OD2   1 
ATOM   7927  N N     . GLU C 1 163 ? -6.184  -28.652 44.392  1.00 42.91 ? 163 GLU C N     1 
ATOM   7928  C CA    . GLU C 1 163 ? -5.981  -28.632 45.865  1.00 43.19 ? 163 GLU C CA    1 
ATOM   7929  C C     . GLU C 1 163 ? -4.640  -29.163 46.301  1.00 41.58 ? 163 GLU C C     1 
ATOM   7930  O O     . GLU C 1 163 ? -4.323  -29.005 47.449  1.00 39.44 ? 163 GLU C O     1 
ATOM   7931  C CB    . GLU C 1 163 ? -7.029  -29.391 46.646  1.00 43.07 ? 163 GLU C CB    1 
ATOM   7932  C CG    . GLU C 1 163 ? -8.381  -29.283 46.057  1.00 48.34 ? 163 GLU C CG    1 
ATOM   7933  C CD    . GLU C 1 163 ? -8.609  -30.342 44.957  1.00 56.70 ? 163 GLU C CD    1 
ATOM   7934  O OE1   . GLU C 1 163 ? -8.454  -29.977 43.735  1.00 51.50 ? 163 GLU C OE1   1 
ATOM   7935  O OE2   . GLU C 1 163 ? -8.942  -31.517 45.358  1.00 57.34 ? 163 GLU C OE2   1 
ATOM   7936  N N     . SER C 1 164 ? -3.887  -29.811 45.401  1.00 40.39 ? 164 SER C N     1 
ATOM   7937  C CA    . SER C 1 164 ? -2.521  -30.254 45.721  1.00 39.98 ? 164 SER C CA    1 
ATOM   7938  C C     . SER C 1 164 ? -1.471  -29.395 45.047  1.00 38.93 ? 164 SER C C     1 
ATOM   7939  O O     . SER C 1 164 ? -0.293  -29.770 45.046  1.00 37.60 ? 164 SER C O     1 
ATOM   7940  C CB    . SER C 1 164 ? -2.272  -31.735 45.307  1.00 40.41 ? 164 SER C CB    1 
ATOM   7941  O OG    . SER C 1 164 ? -3.268  -32.582 45.844  1.00 43.09 ? 164 SER C OG    1 
ATOM   7942  N N     . GLY C 1 165 ? -1.881  -28.271 44.446  1.00 38.13 ? 165 GLY C N     1 
ATOM   7943  C CA    . GLY C 1 165 ? -0.917  -27.311 43.927  1.00 37.36 ? 165 GLY C CA    1 
ATOM   7944  C C     . GLY C 1 165 ? -0.861  -27.439 42.423  1.00 37.41 ? 165 GLY C C     1 
ATOM   7945  O O     . GLY C 1 165 ? -1.813  -27.893 41.782  1.00 37.65 ? 165 GLY C O     1 
ATOM   7946  N N     . ILE C 1 166 ? 0.249   -27.060 41.817  1.00 37.90 ? 166 ILE C N     1 
ATOM   7947  C CA    . ILE C 1 166 ? 0.295   -27.129 40.370  1.00 37.62 ? 166 ILE C CA    1 
ATOM   7948  C C     . ILE C 1 166 ? 0.227   -28.589 39.743  1.00 37.75 ? 166 ILE C C     1 
ATOM   7949  O O     . ILE C 1 166 ? 0.902   -29.576 40.187  1.00 34.93 ? 166 ILE C O     1 
ATOM   7950  C CB    . ILE C 1 166 ? 1.436   -26.329 39.769  1.00 38.30 ? 166 ILE C CB    1 
ATOM   7951  C CG1   . ILE C 1 166 ? 2.673   -27.151 39.739  1.00 37.69 ? 166 ILE C CG1   1 
ATOM   7952  C CG2   . ILE C 1 166 ? 1.706   -25.028 40.444  1.00 39.50 ? 166 ILE C CG2   1 
ATOM   7953  C CD1   . ILE C 1 166 ? 2.936   -27.557 38.370  1.00 31.80 ? 166 ILE C CD1   1 
ATOM   7954  N N     . VAL C 1 167 ? -0.572  -28.705 38.700  1.00 37.61 ? 167 VAL C N     1 
ATOM   7955  C CA    . VAL C 1 167 ? -0.757  -30.028 38.119  1.00 39.25 ? 167 VAL C CA    1 
ATOM   7956  C C     . VAL C 1 167 ? 0.419   -30.274 37.160  1.00 40.02 ? 167 VAL C C     1 
ATOM   7957  O O     . VAL C 1 167 ? 0.604   -29.505 36.188  1.00 41.66 ? 167 VAL C O     1 
ATOM   7958  C CB    . VAL C 1 167 ? -2.175  -30.180 37.465  1.00 39.62 ? 167 VAL C CB    1 
ATOM   7959  C CG1   . VAL C 1 167 ? -2.391  -31.633 36.916  1.00 40.52 ? 167 VAL C CG1   1 
ATOM   7960  C CG2   . VAL C 1 167 ? -3.275  -29.784 38.502  1.00 36.75 ? 167 VAL C CG2   1 
ATOM   7961  N N     . PRO C 1 168 ? 1.251   -31.291 37.442  1.00 40.19 ? 168 PRO C N     1 
ATOM   7962  C CA    . PRO C 1 168 ? 2.364   -31.505 36.554  1.00 40.95 ? 168 PRO C CA    1 
ATOM   7963  C C     . PRO C 1 168 ? 1.917   -31.625 35.127  1.00 42.33 ? 168 PRO C C     1 
ATOM   7964  O O     . PRO C 1 168 ? 2.503   -30.970 34.277  1.00 43.77 ? 168 PRO C O     1 
ATOM   7965  C CB    . PRO C 1 168 ? 2.964   -32.794 37.070  1.00 40.06 ? 168 PRO C CB    1 
ATOM   7966  C CG    . PRO C 1 168 ? 2.729   -32.698 38.501  1.00 40.57 ? 168 PRO C CG    1 
ATOM   7967  C CD    . PRO C 1 168 ? 1.328   -32.237 38.575  1.00 41.01 ? 168 PRO C CD    1 
ATOM   7968  N N     . ASP C 1 169 ? 0.882   -32.424 34.858  1.00 44.12 ? 169 ASP C N     1 
ATOM   7969  C CA    . ASP C 1 169 ? 0.466   -32.705 33.470  1.00 44.66 ? 169 ASP C CA    1 
ATOM   7970  C C     . ASP C 1 169 ? 0.258   -31.406 32.729  1.00 43.83 ? 169 ASP C C     1 
ATOM   7971  O O     . ASP C 1 169 ? 0.539   -31.325 31.581  1.00 43.70 ? 169 ASP C O     1 
ATOM   7972  C CB    . ASP C 1 169 ? -0.823  -33.567 33.395  1.00 45.06 ? 169 ASP C CB    1 
ATOM   7973  C CG    . ASP C 1 169 ? -0.600  -35.022 33.817  1.00 47.08 ? 169 ASP C CG    1 
ATOM   7974  O OD1   . ASP C 1 169 ? 0.555   -35.437 33.984  1.00 46.56 ? 169 ASP C OD1   1 
ATOM   7975  O OD2   . ASP C 1 169 ? -1.601  -35.776 33.967  1.00 51.56 ? 169 ASP C OD2   1 
ATOM   7976  N N     . SER C 1 170 ? -0.254  -30.392 33.408  1.00 44.71 ? 170 SER C N     1 
ATOM   7977  C CA    . SER C 1 170 ? -0.603  -29.121 32.769  1.00 44.61 ? 170 SER C CA    1 
ATOM   7978  C C     . SER C 1 170 ? 0.671   -28.431 32.314  1.00 45.30 ? 170 SER C C     1 
ATOM   7979  O O     . SER C 1 170 ? 0.761   -27.921 31.164  1.00 46.23 ? 170 SER C O     1 
ATOM   7980  C CB    . SER C 1 170 ? -1.311  -28.237 33.773  1.00 44.96 ? 170 SER C CB    1 
ATOM   7981  O OG    . SER C 1 170 ? -1.200  -26.879 33.405  1.00 45.74 ? 170 SER C OG    1 
ATOM   7982  N N     . LEU C 1 171 ? 1.657   -28.446 33.232  1.00 44.10 ? 171 LEU C N     1 
ATOM   7983  C CA    . LEU C 1 171 ? 3.024   -27.963 33.010  1.00 42.91 ? 171 LEU C CA    1 
ATOM   7984  C C     . LEU C 1 171 ? 3.750   -28.726 31.863  1.00 43.58 ? 171 LEU C C     1 
ATOM   7985  O O     . LEU C 1 171 ? 4.309   -28.092 30.969  1.00 42.29 ? 171 LEU C O     1 
ATOM   7986  C CB    . LEU C 1 171 ? 3.832   -28.008 34.334  1.00 42.91 ? 171 LEU C CB    1 
ATOM   7987  C CG    . LEU C 1 171 ? 5.282   -27.457 34.395  1.00 41.91 ? 171 LEU C CG    1 
ATOM   7988  C CD1   . LEU C 1 171 ? 5.346   -25.990 34.193  1.00 43.37 ? 171 LEU C CD1   1 
ATOM   7989  C CD2   . LEU C 1 171 ? 5.872   -27.819 35.702  1.00 39.85 ? 171 LEU C CD2   1 
ATOM   7990  N N     . ARG C 1 172 ? 3.769   -30.064 31.921  1.00 44.33 ? 172 ARG C N     1 
ATOM   7991  C CA    . ARG C 1 172 ? 4.197   -30.894 30.778  1.00 46.51 ? 172 ARG C CA    1 
ATOM   7992  C C     . ARG C 1 172 ? 3.531   -30.424 29.458  1.00 47.24 ? 172 ARG C C     1 
ATOM   7993  O O     . ARG C 1 172 ? 4.218   -30.159 28.466  1.00 47.94 ? 172 ARG C O     1 
ATOM   7994  C CB    . ARG C 1 172 ? 3.854   -32.337 31.081  1.00 46.85 ? 172 ARG C CB    1 
ATOM   7995  C CG    . ARG C 1 172 ? 4.327   -33.389 30.126  1.00 50.55 ? 172 ARG C CG    1 
ATOM   7996  C CD    . ARG C 1 172 ? 4.060   -34.778 30.780  1.00 55.23 ? 172 ARG C CD    1 
ATOM   7997  N NE    . ARG C 1 172 ? 4.938   -34.962 31.964  1.00 57.83 ? 172 ARG C NE    1 
ATOM   7998  C CZ    . ARG C 1 172 ? 4.555   -34.954 33.248  1.00 56.70 ? 172 ARG C CZ    1 
ATOM   7999  N NH1   . ARG C 1 172 ? 3.281   -34.801 33.591  1.00 54.24 ? 172 ARG C NH1   1 
ATOM   8000  N NH2   . ARG C 1 172 ? 5.471   -35.089 34.202  1.00 55.28 ? 172 ARG C NH2   1 
ATOM   8001  N N     . ASP C 1 173 ? 2.211   -30.251 29.475  1.00 46.55 ? 173 ASP C N     1 
ATOM   8002  C CA    . ASP C 1 173 ? 1.506   -29.887 28.296  1.00 46.97 ? 173 ASP C CA    1 
ATOM   8003  C C     . ASP C 1 173 ? 1.977   -28.535 27.782  1.00 46.51 ? 173 ASP C C     1 
ATOM   8004  O O     . ASP C 1 173 ? 2.207   -28.401 26.564  1.00 47.37 ? 173 ASP C O     1 
ATOM   8005  C CB    . ASP C 1 173 ? -0.014  -29.954 28.514  1.00 47.02 ? 173 ASP C CB    1 
ATOM   8006  C CG    . ASP C 1 173 ? -0.586  -31.465 28.538  1.00 51.55 ? 173 ASP C CG    1 
ATOM   8007  O OD1   . ASP C 1 173 ? 0.109   -32.491 28.903  1.00 46.98 ? 173 ASP C OD1   1 
ATOM   8008  O OD2   . ASP C 1 173 ? -1.802  -31.598 28.197  1.00 54.71 ? 173 ASP C OD2   1 
ATOM   8009  N N     . ILE C 1 174 ? 2.176   -27.557 28.686  1.00 45.27 ? 174 ILE C N     1 
ATOM   8010  C CA    . ILE C 1 174 ? 2.577   -26.181 28.286  1.00 42.96 ? 174 ILE C CA    1 
ATOM   8011  C C     . ILE C 1 174 ? 3.989   -26.224 27.706  1.00 41.33 ? 174 ILE C C     1 
ATOM   8012  O O     . ILE C 1 174 ? 4.304   -25.487 26.766  1.00 38.72 ? 174 ILE C O     1 
ATOM   8013  C CB    . ILE C 1 174 ? 2.534   -25.115 29.458  1.00 43.12 ? 174 ILE C CB    1 
ATOM   8014  C CG1   . ILE C 1 174 ? 1.137   -24.874 30.021  1.00 44.17 ? 174 ILE C CG1   1 
ATOM   8015  C CG2   . ILE C 1 174 ? 2.944   -23.785 28.967  1.00 43.84 ? 174 ILE C CG2   1 
ATOM   8016  C CD1   . ILE C 1 174 ? 1.131   -24.747 31.622  1.00 42.95 ? 174 ILE C CD1   1 
ATOM   8017  N N     . LEU C 1 175 ? 4.803   -27.127 28.252  1.00 40.35 ? 175 LEU C N     1 
ATOM   8018  C CA    . LEU C 1 175 ? 6.187   -27.203 27.905  1.00 41.02 ? 175 LEU C CA    1 
ATOM   8019  C C     . LEU C 1 175 ? 6.389   -27.826 26.511  1.00 42.68 ? 175 LEU C C     1 
ATOM   8020  O O     . LEU C 1 175 ? 7.407   -27.547 25.842  1.00 42.61 ? 175 LEU C O     1 
ATOM   8021  C CB    . LEU C 1 175 ? 7.016   -27.902 29.015  1.00 40.45 ? 175 LEU C CB    1 
ATOM   8022  C CG    . LEU C 1 175 ? 7.201   -27.101 30.349  1.00 42.37 ? 175 LEU C CG    1 
ATOM   8023  C CD1   . LEU C 1 175 ? 7.831   -27.888 31.483  1.00 39.67 ? 175 LEU C CD1   1 
ATOM   8024  C CD2   . LEU C 1 175 ? 7.873   -25.686 30.158  1.00 39.90 ? 175 LEU C CD2   1 
ATOM   8025  N N     . SER C 1 176 ? 5.434   -28.665 26.090  1.00 43.17 ? 176 SER C N     1 
ATOM   8026  C CA    . SER C 1 176 ? 5.500   -29.369 24.796  1.00 44.77 ? 176 SER C CA    1 
ATOM   8027  C C     . SER C 1 176 ? 5.618   -28.414 23.584  1.00 45.10 ? 176 SER C C     1 
ATOM   8028  O O     . SER C 1 176 ? 6.218   -28.759 22.564  1.00 45.35 ? 176 SER C O     1 
ATOM   8029  C CB    . SER C 1 176 ? 4.287   -30.305 24.643  1.00 44.81 ? 176 SER C CB    1 
ATOM   8030  O OG    . SER C 1 176 ? 3.054   -29.575 24.658  1.00 44.15 ? 176 SER C OG    1 
ATOM   8031  N N     . ARG C 1 177 ? 5.094   -27.195 23.718  1.00 45.95 ? 177 ARG C N     1 
ATOM   8032  C CA    . ARG C 1 177 ? 5.172   -26.217 22.628  1.00 46.41 ? 177 ARG C CA    1 
ATOM   8033  C C     . ARG C 1 177 ? 6.606   -25.826 22.233  1.00 46.53 ? 177 ARG C C     1 
ATOM   8034  O O     . ARG C 1 177 ? 6.795   -25.121 21.217  1.00 47.11 ? 177 ARG C O     1 
ATOM   8035  C CB    . ARG C 1 177 ? 4.391   -25.006 23.003  1.00 46.60 ? 177 ARG C CB    1 
ATOM   8036  C CG    . ARG C 1 177 ? 5.068   -24.136 24.034  1.00 49.94 ? 177 ARG C CG    1 
ATOM   8037  C CD    . ARG C 1 177 ? 4.022   -23.292 24.762  1.00 52.92 ? 177 ARG C CD    1 
ATOM   8038  N NE    . ARG C 1 177 ? 4.329   -21.879 24.598  1.00 55.38 ? 177 ARG C NE    1 
ATOM   8039  C CZ    . ARG C 1 177 ? 3.543   -20.890 25.034  1.00 56.69 ? 177 ARG C CZ    1 
ATOM   8040  N NH1   . ARG C 1 177 ? 2.383   -21.184 25.665  1.00 45.39 ? 177 ARG C NH1   1 
ATOM   8041  N NH2   . ARG C 1 177 ? 3.928   -19.604 24.814  1.00 53.36 ? 177 ARG C NH2   1 
ATOM   8042  N N     . TRP C 1 178 ? 7.573   -26.246 23.062  1.00 45.73 ? 178 TRP C N     1 
ATOM   8043  C CA    . TRP C 1 178 ? 9.002   -26.123 22.835  1.00 46.74 ? 178 TRP C CA    1 
ATOM   8044  C C     . TRP C 1 178 ? 9.537   -27.528 22.814  1.00 47.25 ? 178 TRP C C     1 
ATOM   8045  O O     . TRP C 1 178 ? 8.886   -28.429 23.267  1.00 47.42 ? 178 TRP C O     1 
ATOM   8046  C CB    . TRP C 1 178 ? 9.725   -25.496 24.040  1.00 46.66 ? 178 TRP C CB    1 
ATOM   8047  C CG    . TRP C 1 178 ? 8.978   -24.446 24.771  1.00 48.63 ? 178 TRP C CG    1 
ATOM   8048  C CD1   . TRP C 1 178 ? 8.164   -24.594 25.905  1.00 47.22 ? 178 TRP C CD1   1 
ATOM   8049  C CD2   . TRP C 1 178 ? 8.961   -23.095 24.445  1.00 45.29 ? 178 TRP C CD2   1 
ATOM   8050  N NE1   . TRP C 1 178 ? 7.626   -23.395 26.262  1.00 44.56 ? 178 TRP C NE1   1 
ATOM   8051  C CE2   . TRP C 1 178 ? 8.109   -22.443 25.401  1.00 47.71 ? 178 TRP C CE2   1 
ATOM   8052  C CE3   . TRP C 1 178 ? 9.566   -22.352 23.443  1.00 44.18 ? 178 TRP C CE3   1 
ATOM   8053  C CZ2   . TRP C 1 178 ? 7.858   -21.083 25.364  1.00 45.27 ? 178 TRP C CZ2   1 
ATOM   8054  C CZ3   . TRP C 1 178 ? 9.293   -21.008 23.393  1.00 46.24 ? 178 TRP C CZ3   1 
ATOM   8055  C CH2   . TRP C 1 178 ? 8.449   -20.382 24.350  1.00 48.05 ? 178 TRP C CH2   1 
ATOM   8056  N N     . LYS C 1 179 ? 10.766  -27.698 22.370  1.00 48.27 ? 179 LYS C N     1 
ATOM   8057  C CA    . LYS C 1 179 ? 11.483  -28.899 22.719  1.00 49.52 ? 179 LYS C CA    1 
ATOM   8058  C C     . LYS C 1 179 ? 12.662  -28.592 23.670  1.00 49.07 ? 179 LYS C C     1 
ATOM   8059  O O     . LYS C 1 179 ? 13.111  -27.463 23.728  1.00 47.55 ? 179 LYS C O     1 
ATOM   8060  C CB    . LYS C 1 179 ? 11.947  -29.639 21.443  1.00 50.30 ? 179 LYS C CB    1 
ATOM   8061  C CG    . LYS C 1 179 ? 11.811  -31.196 21.569  1.00 54.36 ? 179 LYS C CG    1 
ATOM   8062  C CD    . LYS C 1 179 ? 10.314  -31.715 21.704  1.00 53.87 ? 179 LYS C CD    1 
ATOM   8063  C CE    . LYS C 1 179 ? 9.839   -32.001 23.170  1.00 53.08 ? 179 LYS C CE    1 
ATOM   8064  N NZ    . LYS C 1 179 ? 8.931   -30.996 23.781  1.00 46.79 ? 179 LYS C NZ    1 
ATOM   8065  N N     . PRO C 1 180 ? 13.172  -29.624 24.399  1.00 49.50 ? 180 PRO C N     1 
ATOM   8066  C CA    . PRO C 1 180 ? 14.266  -29.411 25.345  1.00 49.67 ? 180 PRO C CA    1 
ATOM   8067  C C     . PRO C 1 180 ? 15.369  -28.559 24.768  1.00 51.44 ? 180 PRO C C     1 
ATOM   8068  O O     . PRO C 1 180 ? 15.680  -27.473 25.359  1.00 52.52 ? 180 PRO C O     1 
ATOM   8069  C CB    . PRO C 1 180 ? 14.806  -30.822 25.592  1.00 49.77 ? 180 PRO C CB    1 
ATOM   8070  C CG    . PRO C 1 180 ? 13.611  -31.698 25.393  1.00 49.67 ? 180 PRO C CG    1 
ATOM   8071  C CD    . PRO C 1 180 ? 12.751  -31.044 24.357  1.00 47.68 ? 180 PRO C CD    1 
ATOM   8072  N N     . GLU C 1 181 ? 15.954  -29.002 23.630  1.00 50.55 ? 181 GLU C N     1 
ATOM   8073  C CA    . GLU C 1 181 ? 17.113  -28.318 23.034  1.00 49.30 ? 181 GLU C CA    1 
ATOM   8074  C C     . GLU C 1 181 ? 16.860  -26.849 22.715  1.00 47.90 ? 181 GLU C C     1 
ATOM   8075  O O     . GLU C 1 181 ? 17.763  -26.071 22.572  1.00 47.20 ? 181 GLU C O     1 
ATOM   8076  C CB    . GLU C 1 181 ? 17.622  -29.046 21.797  1.00 50.56 ? 181 GLU C CB    1 
ATOM   8077  C CG    . GLU C 1 181 ? 16.700  -28.993 20.603  1.00 50.63 ? 181 GLU C CG    1 
ATOM   8078  C CD    . GLU C 1 181 ? 15.986  -30.336 20.372  1.00 53.48 ? 181 GLU C CD    1 
ATOM   8079  O OE1   . GLU C 1 181 ? 15.298  -30.869 21.321  1.00 47.64 ? 181 GLU C OE1   1 
ATOM   8080  O OE2   . GLU C 1 181 ? 16.116  -30.821 19.206  1.00 54.73 ? 181 GLU C OE2   1 
ATOM   8081  N N     . ASP C 1 182 ? 15.613  -26.467 22.671  1.00 48.45 ? 182 ASP C N     1 
ATOM   8082  C CA    . ASP C 1 182 ? 15.268  -25.061 22.515  1.00 49.33 ? 182 ASP C CA    1 
ATOM   8083  C C     . ASP C 1 182 ? 15.799  -24.172 23.662  1.00 49.86 ? 182 ASP C C     1 
ATOM   8084  O O     . ASP C 1 182 ? 16.000  -22.968 23.435  1.00 48.87 ? 182 ASP C O     1 
ATOM   8085  C CB    . ASP C 1 182 ? 13.758  -24.890 22.306  1.00 49.15 ? 182 ASP C CB    1 
ATOM   8086  C CG    . ASP C 1 182 ? 13.312  -25.284 20.900  1.00 50.90 ? 182 ASP C CG    1 
ATOM   8087  O OD1   . ASP C 1 182 ? 14.095  -26.040 20.240  1.00 44.76 ? 182 ASP C OD1   1 
ATOM   8088  O OD2   . ASP C 1 182 ? 12.191  -24.817 20.465  1.00 51.58 ? 182 ASP C OD2   1 
ATOM   8089  N N     . ALA C 1 183 ? 16.046  -24.779 24.846  1.00 50.24 ? 183 ALA C N     1 
ATOM   8090  C CA    . ALA C 1 183 ? 16.639  -24.096 26.018  1.00 51.58 ? 183 ALA C CA    1 
ATOM   8091  C C     . ALA C 1 183 ? 18.079  -23.565 25.790  1.00 53.13 ? 183 ALA C C     1 
ATOM   8092  O O     . ALA C 1 183 ? 18.545  -22.654 26.503  1.00 52.12 ? 183 ALA C O     1 
ATOM   8093  C CB    . ALA C 1 183 ? 16.581  -24.984 27.254  1.00 50.96 ? 183 ALA C CB    1 
ATOM   8094  N N     . LYS C 1 184 ? 18.744  -24.119 24.770  1.00 54.41 ? 184 LYS C N     1 
ATOM   8095  C CA    . LYS C 1 184 ? 20.142  -23.843 24.465  1.00 56.58 ? 184 LYS C CA    1 
ATOM   8096  C C     . LYS C 1 184 ? 20.306  -22.912 23.267  1.00 57.39 ? 184 LYS C C     1 
ATOM   8097  O O     . LYS C 1 184 ? 21.426  -22.616 22.863  1.00 57.83 ? 184 LYS C O     1 
ATOM   8098  C CB    . LYS C 1 184 ? 20.857  -25.174 24.143  1.00 58.10 ? 184 LYS C CB    1 
ATOM   8099  C CG    . LYS C 1 184 ? 20.659  -26.275 25.194  1.00 58.43 ? 184 LYS C CG    1 
ATOM   8100  C CD    . LYS C 1 184 ? 20.726  -27.665 24.592  1.00 62.94 ? 184 LYS C CD    1 
ATOM   8101  C CE    . LYS C 1 184 ? 20.638  -28.730 25.706  1.00 63.09 ? 184 LYS C CE    1 
ATOM   8102  N NZ    . LYS C 1 184 ? 21.992  -28.849 26.406  1.00 64.87 ? 184 LYS C NZ    1 
ATOM   8103  N N     . ASN C 1 185 ? 19.188  -22.484 22.688  1.00 58.36 ? 185 ASN C N     1 
ATOM   8104  C CA    . ASN C 1 185 ? 19.148  -21.768 21.411  1.00 58.96 ? 185 ASN C CA    1 
ATOM   8105  C C     . ASN C 1 185 ? 18.744  -20.328 21.719  1.00 59.77 ? 185 ASN C C     1 
ATOM   8106  O O     . ASN C 1 185 ? 17.523  -20.057 21.900  1.00 59.29 ? 185 ASN C O     1 
ATOM   8107  C CB    . ASN C 1 185 ? 18.124  -22.411 20.480  1.00 58.93 ? 185 ASN C CB    1 
ATOM   8108  C CG    . ASN C 1 185 ? 18.092  -21.765 19.095  1.00 60.98 ? 185 ASN C CG    1 
ATOM   8109  O OD1   . ASN C 1 185 ? 18.350  -20.550 18.940  1.00 63.76 ? 185 ASN C OD1   1 
ATOM   8110  N ND2   . ASN C 1 185 ? 17.770  -22.577 18.067  1.00 61.17 ? 185 ASN C ND2   1 
ATOM   8111  N N     . PRO C 1 186 ? 19.749  -19.397 21.745  1.00 60.02 ? 186 PRO C N     1 
ATOM   8112  C CA    . PRO C 1 186 ? 19.593  -18.241 22.630  1.00 59.92 ? 186 PRO C CA    1 
ATOM   8113  C C     . PRO C 1 186 ? 18.113  -18.106 23.025  1.00 60.01 ? 186 PRO C C     1 
ATOM   8114  O O     . PRO C 1 186 ? 17.721  -18.348 24.210  1.00 59.45 ? 186 PRO C O     1 
ATOM   8115  C CB    . PRO C 1 186 ? 20.092  -17.082 21.753  1.00 60.77 ? 186 PRO C CB    1 
ATOM   8116  C CG    . PRO C 1 186 ? 21.297  -17.802 20.865  1.00 60.75 ? 186 PRO C CG    1 
ATOM   8117  C CD    . PRO C 1 186 ? 21.015  -19.324 20.963  1.00 59.00 ? 186 PRO C CD    1 
ATOM   8118  N N     . GLN C 1 187 ? 17.283  -17.797 22.028  1.00 58.33 ? 187 GLN C N     1 
ATOM   8119  C CA    . GLN C 1 187 ? 15.863  -17.805 22.280  1.00 56.93 ? 187 GLN C CA    1 
ATOM   8120  C C     . GLN C 1 187 ? 15.044  -18.298 21.065  1.00 55.76 ? 187 GLN C C     1 
ATOM   8121  O O     . GLN C 1 187 ? 14.792  -17.588 20.096  1.00 55.50 ? 187 GLN C O     1 
ATOM   8122  C CB    . GLN C 1 187 ? 15.369  -16.466 22.899  1.00 56.26 ? 187 GLN C CB    1 
ATOM   8123  C CG    . GLN C 1 187 ? 16.067  -16.081 24.307  1.00 55.87 ? 187 GLN C CG    1 
ATOM   8124  C CD    . GLN C 1 187 ? 15.165  -16.238 25.570  1.00 51.93 ? 187 GLN C CD    1 
ATOM   8125  O OE1   . GLN C 1 187 ? 15.451  -17.054 26.468  1.00 53.64 ? 187 GLN C OE1   1 
ATOM   8126  N NE2   . GLN C 1 187 ? 14.062  -15.495 25.616  1.00 49.30 ? 187 GLN C NE2   1 
ATOM   8127  N N     . LYS C 1 188 ? 14.651  -19.555 21.145  1.00 53.77 ? 188 LYS C N     1 
ATOM   8128  C CA    . LYS C 1 188 ? 13.327  -19.874 20.708  1.00 52.62 ? 188 LYS C CA    1 
ATOM   8129  C C     . LYS C 1 188 ? 12.398  -19.541 21.946  1.00 51.02 ? 188 LYS C C     1 
ATOM   8130  O O     . LYS C 1 188 ? 11.184  -19.786 21.928  1.00 50.04 ? 188 LYS C O     1 
ATOM   8131  C CB    . LYS C 1 188 ? 13.231  -21.309 20.143  1.00 54.17 ? 188 LYS C CB    1 
ATOM   8132  C CG    . LYS C 1 188 ? 14.287  -21.663 19.018  1.00 55.59 ? 188 LYS C CG    1 
ATOM   8133  C CD    . LYS C 1 188 ? 13.637  -22.432 17.812  1.00 57.71 ? 188 LYS C CD    1 
ATOM   8134  C CE    . LYS C 1 188 ? 14.641  -22.874 16.733  1.00 58.17 ? 188 LYS C CE    1 
ATOM   8135  N NZ    . LYS C 1 188 ? 14.055  -23.329 15.375  1.00 59.98 ? 188 LYS C NZ    1 
ATOM   8136  N N     . ASN C 1 189 ? 13.005  -18.924 22.978  1.00 48.32 ? 189 ASN C N     1 
ATOM   8137  C CA    . ASN C 1 189 ? 12.340  -18.156 24.044  1.00 45.78 ? 189 ASN C CA    1 
ATOM   8138  C C     . ASN C 1 189 ? 11.781  -19.051 25.136  1.00 42.95 ? 189 ASN C C     1 
ATOM   8139  O O     . ASN C 1 189 ? 10.611  -18.980 25.492  1.00 42.52 ? 189 ASN C O     1 
ATOM   8140  C CB    . ASN C 1 189 ? 11.215  -17.289 23.460  1.00 46.92 ? 189 ASN C CB    1 
ATOM   8141  C CG    . ASN C 1 189 ? 11.387  -15.823 23.743  1.00 47.55 ? 189 ASN C CG    1 
ATOM   8142  O OD1   . ASN C 1 189 ? 12.480  -15.272 23.532  1.00 50.45 ? 189 ASN C OD1   1 
ATOM   8143  N ND2   . ASN C 1 189 ? 10.294  -15.157 24.181  1.00 43.99 ? 189 ASN C ND2   1 
ATOM   8144  N N     . THR C 1 190 ? 12.607  -19.920 25.662  1.00 40.06 ? 190 THR C N     1 
ATOM   8145  C CA    . THR C 1 190 ? 12.093  -20.841 26.648  1.00 37.06 ? 190 THR C CA    1 
ATOM   8146  C C     . THR C 1 190 ? 11.937  -20.198 28.023  1.00 37.02 ? 190 THR C C     1 
ATOM   8147  O O     . THR C 1 190 ? 12.620  -19.153 28.337  1.00 37.94 ? 190 THR C O     1 
ATOM   8148  C CB    . THR C 1 190 ? 12.840  -22.149 26.743  1.00 36.56 ? 190 THR C CB    1 
ATOM   8149  O OG1   . THR C 1 190 ? 14.253  -21.926 26.807  1.00 33.82 ? 190 THR C OG1   1 
ATOM   8150  C CG2   . THR C 1 190 ? 12.495  -23.016 25.615  1.00 35.36 ? 190 THR C CG2   1 
ATOM   8151  N N     . PRO C 1 191 ? 10.967  -20.720 28.802  1.00 35.58 ? 191 PRO C N     1 
ATOM   8152  C CA    . PRO C 1 191 ? 10.740  -20.174 30.110  1.00 34.79 ? 191 PRO C CA    1 
ATOM   8153  C C     . PRO C 1 191 ? 12.028  -20.048 30.842  1.00 32.80 ? 191 PRO C C     1 
ATOM   8154  O O     . PRO C 1 191 ? 12.818  -21.019 30.976  1.00 32.51 ? 191 PRO C O     1 
ATOM   8155  C CB    . PRO C 1 191 ? 9.777   -21.191 30.744  1.00 33.68 ? 191 PRO C CB    1 
ATOM   8156  C CG    . PRO C 1 191 ? 8.966   -21.534 29.627  1.00 35.93 ? 191 PRO C CG    1 
ATOM   8157  C CD    . PRO C 1 191 ? 9.939   -21.722 28.490  1.00 35.35 ? 191 PRO C CD    1 
ATOM   8158  N N     . LYS C 1 192 ? 12.266  -18.847 31.333  1.00 31.23 ? 192 LYS C N     1 
ATOM   8159  C CA    . LYS C 1 192 ? 13.429  -18.702 32.233  1.00 30.33 ? 192 LYS C CA    1 
ATOM   8160  C C     . LYS C 1 192 ? 13.191  -19.373 33.640  1.00 28.52 ? 192 LYS C C     1 
ATOM   8161  O O     . LYS C 1 192 ? 14.128  -19.810 34.299  1.00 25.37 ? 192 LYS C O     1 
ATOM   8162  C CB    . LYS C 1 192 ? 13.790  -17.213 32.397  1.00 31.61 ? 192 LYS C CB    1 
ATOM   8163  C CG    . LYS C 1 192 ? 14.803  -16.770 31.307  1.00 32.82 ? 192 LYS C CG    1 
ATOM   8164  C CD    . LYS C 1 192 ? 14.085  -16.337 29.995  1.00 36.42 ? 192 LYS C CD    1 
ATOM   8165  C CE    . LYS C 1 192 ? 12.486  -16.491 29.937  1.00 39.55 ? 192 LYS C CE    1 
ATOM   8166  N NZ    . LYS C 1 192 ? 11.881  -16.853 28.516  1.00 31.60 ? 192 LYS C NZ    1 
ATOM   8167  N N     . PHE C 1 193 ? 11.939  -19.454 34.071  1.00 27.12 ? 193 PHE C N     1 
ATOM   8168  C CA    . PHE C 1 193 ? 11.686  -20.050 35.421  1.00 28.62 ? 193 PHE C CA    1 
ATOM   8169  C C     . PHE C 1 193 ? 10.265  -20.407 35.643  1.00 29.14 ? 193 PHE C C     1 
ATOM   8170  O O     . PHE C 1 193 ? 9.388   -19.938 34.913  1.00 31.33 ? 193 PHE C O     1 
ATOM   8171  C CB    . PHE C 1 193 ? 12.217  -19.205 36.625  1.00 26.92 ? 193 PHE C CB    1 
ATOM   8172  C CG    . PHE C 1 193 ? 11.520  -17.855 36.822  1.00 27.55 ? 193 PHE C CG    1 
ATOM   8173  C CD1   . PHE C 1 193 ? 12.194  -16.646 36.524  1.00 28.98 ? 193 PHE C CD1   1 
ATOM   8174  C CD2   . PHE C 1 193 ? 10.217  -17.773 37.314  1.00 21.75 ? 193 PHE C CD2   1 
ATOM   8175  C CE1   . PHE C 1 193 ? 11.599  -15.341 36.751  1.00 20.02 ? 193 PHE C CE1   1 
ATOM   8176  C CE2   . PHE C 1 193 ? 9.591   -16.484 37.537  1.00 25.97 ? 193 PHE C CE2   1 
ATOM   8177  C CZ    . PHE C 1 193 ? 10.283  -15.286 37.219  1.00 28.70 ? 193 PHE C CZ    1 
ATOM   8178  N N     . LEU C 1 194 ? 10.041  -21.239 36.663  1.00 30.35 ? 194 LEU C N     1 
ATOM   8179  C CA    . LEU C 1 194 ? 8.717   -21.419 37.218  1.00 30.52 ? 194 LEU C CA    1 
ATOM   8180  C C     . LEU C 1 194 ? 8.745   -20.809 38.604  1.00 30.37 ? 194 LEU C C     1 
ATOM   8181  O O     . LEU C 1 194 ? 9.679   -21.072 39.321  1.00 31.60 ? 194 LEU C O     1 
ATOM   8182  C CB    . LEU C 1 194 ? 8.357   -22.939 37.323  1.00 30.26 ? 194 LEU C CB    1 
ATOM   8183  C CG    . LEU C 1 194 ? 7.227   -23.292 38.334  1.00 28.17 ? 194 LEU C CG    1 
ATOM   8184  C CD1   . LEU C 1 194 ? 5.867   -22.928 37.854  1.00 29.68 ? 194 LEU C CD1   1 
ATOM   8185  C CD2   . LEU C 1 194 ? 7.251   -24.791 38.691  1.00 33.29 ? 194 LEU C CD2   1 
ATOM   8186  N N     . TYR C 1 195 ? 7.694   -20.089 38.989  1.00 29.46 ? 195 TYR C N     1 
ATOM   8187  C CA    . TYR C 1 195 ? 7.554   -19.502 40.326  1.00 29.67 ? 195 TYR C CA    1 
ATOM   8188  C C     . TYR C 1 195 ? 6.374   -20.233 41.036  1.00 30.16 ? 195 TYR C C     1 
ATOM   8189  O O     . TYR C 1 195 ? 5.338   -20.419 40.389  1.00 30.04 ? 195 TYR C O     1 
ATOM   8190  C CB    . TYR C 1 195 ? 7.223   -17.994 40.210  1.00 29.03 ? 195 TYR C CB    1 
ATOM   8191  C CG    . TYR C 1 195 ? 6.801   -17.380 41.536  1.00 30.50 ? 195 TYR C CG    1 
ATOM   8192  C CD1   . TYR C 1 195 ? 7.752   -16.886 42.508  1.00 31.79 ? 195 TYR C CD1   1 
ATOM   8193  C CD2   . TYR C 1 195 ? 5.478   -17.337 41.861  1.00 32.63 ? 195 TYR C CD2   1 
ATOM   8194  C CE1   . TYR C 1 195 ? 7.294   -16.314 43.761  1.00 30.54 ? 195 TYR C CE1   1 
ATOM   8195  C CE2   . TYR C 1 195 ? 5.016   -16.776 43.036  1.00 34.63 ? 195 TYR C CE2   1 
ATOM   8196  C CZ    . TYR C 1 195 ? 5.889   -16.308 43.992  1.00 32.89 ? 195 TYR C CZ    1 
ATOM   8197  O OH    . TYR C 1 195 ? 5.240   -15.847 45.125  1.00 31.77 ? 195 TYR C OH    1 
ATOM   8198  N N     . THR C 1 196 ? 6.501   -20.702 42.303  1.00 30.15 ? 196 THR C N     1 
ATOM   8199  C CA    . THR C 1 196 ? 5.260   -21.034 43.082  1.00 29.76 ? 196 THR C CA    1 
ATOM   8200  C C     . THR C 1 196 ? 5.534   -20.814 44.520  1.00 29.08 ? 196 THR C C     1 
ATOM   8201  O O     . THR C 1 196 ? 6.711   -20.653 44.904  1.00 28.95 ? 196 THR C O     1 
ATOM   8202  C CB    . THR C 1 196 ? 4.652   -22.544 42.834  1.00 32.52 ? 196 THR C CB    1 
ATOM   8203  O OG1   . THR C 1 196 ? 3.238   -22.648 43.215  1.00 35.38 ? 196 THR C OG1   1 
ATOM   8204  C CG2   . THR C 1 196 ? 5.455   -23.644 43.573  1.00 32.87 ? 196 THR C CG2   1 
ATOM   8205  N N     . VAL C 1 197 ? 4.447   -20.856 45.296  1.00 29.38 ? 197 VAL C N     1 
ATOM   8206  C CA    . VAL C 1 197 ? 4.381   -20.961 46.742  1.00 29.61 ? 197 VAL C CA    1 
ATOM   8207  C C     . VAL C 1 197 ? 3.858   -22.385 47.098  1.00 30.72 ? 197 VAL C C     1 
ATOM   8208  O O     . VAL C 1 197 ? 2.629   -22.683 46.921  1.00 31.10 ? 197 VAL C O     1 
ATOM   8209  C CB    . VAL C 1 197 ? 3.406   -19.861 47.404  1.00 30.66 ? 197 VAL C CB    1 
ATOM   8210  C CG1   . VAL C 1 197 ? 3.289   -20.143 48.853  1.00 30.61 ? 197 VAL C CG1   1 
ATOM   8211  C CG2   . VAL C 1 197 ? 3.989   -18.383 47.268  1.00 29.04 ? 197 VAL C CG2   1 
ATOM   8212  N N     . PRO C 1 198 ? 4.764   -23.265 47.553  1.00 29.80 ? 198 PRO C N     1 
ATOM   8213  C CA    . PRO C 1 198 ? 4.534   -24.699 47.681  1.00 31.44 ? 198 PRO C CA    1 
ATOM   8214  C C     . PRO C 1 198 ? 3.730   -25.153 48.862  1.00 33.26 ? 198 PRO C C     1 
ATOM   8215  O O     . PRO C 1 198 ? 3.041   -26.193 48.739  1.00 35.27 ? 198 PRO C O     1 
ATOM   8216  C CB    . PRO C 1 198 ? 5.946   -25.249 47.758  1.00 31.72 ? 198 PRO C CB    1 
ATOM   8217  C CG    . PRO C 1 198 ? 6.808   -24.056 47.326  1.00 30.55 ? 198 PRO C CG    1 
ATOM   8218  C CD    . PRO C 1 198 ? 6.170   -22.937 47.832  1.00 29.67 ? 198 PRO C CD    1 
ATOM   8219  N N     . ASN C 1 199 ? 3.831   -24.404 49.980  1.00 33.53 ? 199 ASN C N     1 
ATOM   8220  C CA    . ASN C 1 199 ? 3.070   -24.580 51.192  1.00 34.24 ? 199 ASN C CA    1 
ATOM   8221  C C     . ASN C 1 199 ? 2.189   -23.387 51.546  1.00 34.69 ? 199 ASN C C     1 
ATOM   8222  O O     . ASN C 1 199 ? 2.660   -22.244 51.620  1.00 36.44 ? 199 ASN C O     1 
ATOM   8223  C CB    . ASN C 1 199 ? 3.991   -24.857 52.345  1.00 33.22 ? 199 ASN C CB    1 
ATOM   8224  C CG    . ASN C 1 199 ? 5.023   -25.840 51.984  1.00 35.20 ? 199 ASN C CG    1 
ATOM   8225  O OD1   . ASN C 1 199 ? 4.772   -27.063 51.887  1.00 37.59 ? 199 ASN C OD1   1 
ATOM   8226  N ND2   . ASN C 1 199 ? 6.200   -25.351 51.774  1.00 32.49 ? 199 ASN C ND2   1 
ATOM   8227  N N     . GLY C 1 200 ? 0.912   -23.648 51.747  1.00 34.22 ? 200 GLY C N     1 
ATOM   8228  C CA    . GLY C 1 200 ? -0.007  -22.578 52.063  1.00 35.98 ? 200 GLY C CA    1 
ATOM   8229  C C     . GLY C 1 200 ? -0.108  -21.459 51.071  1.00 35.95 ? 200 GLY C C     1 
ATOM   8230  O O     . GLY C 1 200 ? -0.058  -20.287 51.445  1.00 37.92 ? 200 GLY C O     1 
ATOM   8231  N N     . ASN C 1 201 ? -0.350  -21.780 49.810  1.00 36.24 ? 201 ASN C N     1 
ATOM   8232  C CA    . ASN C 1 201 ? -0.350  -20.717 48.817  1.00 36.88 ? 201 ASN C CA    1 
ATOM   8233  C C     . ASN C 1 201 ? -1.226  -19.576 49.264  1.00 35.91 ? 201 ASN C C     1 
ATOM   8234  O O     . ASN C 1 201 ? -2.356  -19.816 49.725  1.00 36.84 ? 201 ASN C O     1 
ATOM   8235  C CB    . ASN C 1 201 ? -0.774  -21.194 47.427  1.00 36.99 ? 201 ASN C CB    1 
ATOM   8236  C CG    . ASN C 1 201 ? -0.626  -20.084 46.369  1.00 38.06 ? 201 ASN C CG    1 
ATOM   8237  O OD1   . ASN C 1 201 ? -1.548  -19.791 45.599  1.00 38.91 ? 201 ASN C OD1   1 
ATOM   8238  N ND2   . ASN C 1 201 ? 0.502   -19.420 46.394  1.00 37.73 ? 201 ASN C ND2   1 
ATOM   8239  N N     . ASN C 1 202 ? -0.731  -18.349 49.137  1.00 35.20 ? 202 ASN C N     1 
ATOM   8240  C CA    . ASN C 1 202 ? -1.574  -17.167 49.261  1.00 33.13 ? 202 ASN C CA    1 
ATOM   8241  C C     . ASN C 1 202 ? -2.221  -16.779 47.937  1.00 32.19 ? 202 ASN C C     1 
ATOM   8242  O O     . ASN C 1 202 ? -1.704  -15.934 47.206  1.00 31.31 ? 202 ASN C O     1 
ATOM   8243  C CB    . ASN C 1 202 ? -0.768  -15.991 49.817  1.00 33.97 ? 202 ASN C CB    1 
ATOM   8244  C CG    . ASN C 1 202 ? -1.595  -14.727 49.945  1.00 34.07 ? 202 ASN C CG    1 
ATOM   8245  O OD1   . ASN C 1 202 ? -2.708  -14.644 49.425  1.00 32.17 ? 202 ASN C OD1   1 
ATOM   8246  N ND2   . ASN C 1 202 ? -1.053  -13.733 50.640  1.00 33.31 ? 202 ASN C ND2   1 
ATOM   8247  N N     . PRO C 1 203 ? -3.355  -17.402 47.633  1.00 30.49 ? 203 PRO C N     1 
ATOM   8248  C CA    . PRO C 1 203 ? -4.582  -17.193 48.410  1.00 30.01 ? 203 PRO C CA    1 
ATOM   8249  C C     . PRO C 1 203 ? -5.109  -18.496 48.999  1.00 31.02 ? 203 PRO C C     1 
ATOM   8250  O O     . PRO C 1 203 ? -5.646  -18.499 50.107  1.00 30.79 ? 203 PRO C O     1 
ATOM   8251  C CB    . PRO C 1 203 ? -5.561  -16.654 47.367  1.00 32.52 ? 203 PRO C CB    1 
ATOM   8252  C CG    . PRO C 1 203 ? -5.097  -17.248 46.084  1.00 29.39 ? 203 PRO C CG    1 
ATOM   8253  C CD    . PRO C 1 203 ? -3.599  -17.334 46.182  1.00 30.30 ? 203 PRO C CD    1 
ATOM   8254  N N     . THR C 1 204 ? -4.954  -19.590 48.261  1.00 31.05 ? 204 THR C N     1 
ATOM   8255  C CA    . THR C 1 204 ? -5.910  -20.689 48.311  1.00 30.16 ? 204 THR C CA    1 
ATOM   8256  C C     . THR C 1 204 ? -5.718  -21.531 49.567  1.00 29.51 ? 204 THR C C     1 
ATOM   8257  O O     . THR C 1 204 ? -6.620  -22.259 49.982  1.00 29.27 ? 204 THR C O     1 
ATOM   8258  C CB    . THR C 1 204 ? -5.781  -21.572 47.056  1.00 27.24 ? 204 THR C CB    1 
ATOM   8259  O OG1   . THR C 1 204 ? -4.461  -22.127 46.992  1.00 27.27 ? 204 THR C OG1   1 
ATOM   8260  C CG2   . THR C 1 204 ? -5.864  -20.726 45.796  1.00 25.94 ? 204 THR C CG2   1 
ATOM   8261  N N     . GLY C 1 205 ? -4.538  -21.426 50.168  1.00 31.16 ? 205 GLY C N     1 
ATOM   8262  C CA    . GLY C 1 205 ? -4.168  -22.288 51.304  1.00 30.01 ? 205 GLY C CA    1 
ATOM   8263  C C     . GLY C 1 205 ? -3.687  -23.669 50.843  1.00 33.94 ? 205 GLY C C     1 
ATOM   8264  O O     . GLY C 1 205 ? -3.391  -24.530 51.680  1.00 33.86 ? 205 GLY C O     1 
ATOM   8265  N N     . ASN C 1 206 ? -3.539  -23.927 49.542  1.00 34.11 ? 206 ASN C N     1 
ATOM   8266  C CA    . ASN C 1 206 ? -3.083  -25.256 49.069  1.00 36.67 ? 206 ASN C CA    1 
ATOM   8267  C C     . ASN C 1 206 ? -1.564  -25.533 49.027  1.00 36.99 ? 206 ASN C C     1 
ATOM   8268  O O     . ASN C 1 206 ? -0.774  -24.608 48.953  1.00 37.08 ? 206 ASN C O     1 
ATOM   8269  C CB    . ASN C 1 206 ? -3.619  -25.558 47.673  1.00 36.81 ? 206 ASN C CB    1 
ATOM   8270  C CG    . ASN C 1 206 ? -5.114  -25.463 47.570  1.00 38.43 ? 206 ASN C CG    1 
ATOM   8271  O OD1   . ASN C 1 206 ? -5.629  -25.022 46.550  1.00 32.17 ? 206 ASN C OD1   1 
ATOM   8272  N ND2   . ASN C 1 206 ? -5.822  -25.904 48.597  1.00 25.08 ? 206 ASN C ND2   1 
ATOM   8273  N N     . SER C 1 207 ? -1.165  -26.811 49.010  1.00 36.81 ? 207 SER C N     1 
ATOM   8274  C CA    . SER C 1 207 ? 0.248   -27.168 49.014  1.00 35.40 ? 207 SER C CA    1 
ATOM   8275  C C     . SER C 1 207 ? 0.571   -28.333 48.122  1.00 36.01 ? 207 SER C C     1 
ATOM   8276  O O     . SER C 1 207 ? -0.174  -29.377 48.073  1.00 35.50 ? 207 SER C O     1 
ATOM   8277  C CB    . SER C 1 207 ? 0.691   -27.550 50.441  1.00 35.07 ? 207 SER C CB    1 
ATOM   8278  O OG    . SER C 1 207 ? 0.549   -26.475 51.326  1.00 35.03 ? 207 SER C OG    1 
ATOM   8279  N N     . LEU C 1 208 ? 1.741   -28.196 47.507  1.00 36.05 ? 208 LEU C N     1 
ATOM   8280  C CA    . LEU C 1 208 ? 2.291   -29.177 46.652  1.00 36.61 ? 208 LEU C CA    1 
ATOM   8281  C C     . LEU C 1 208 ? 2.667   -30.457 47.452  1.00 38.17 ? 208 LEU C C     1 
ATOM   8282  O O     . LEU C 1 208 ? 3.070   -30.384 48.636  1.00 37.79 ? 208 LEU C O     1 
ATOM   8283  C CB    . LEU C 1 208 ? 3.467   -28.579 45.933  1.00 35.88 ? 208 LEU C CB    1 
ATOM   8284  C CG    . LEU C 1 208 ? 3.197   -28.011 44.521  1.00 41.83 ? 208 LEU C CG    1 
ATOM   8285  C CD1   . LEU C 1 208 ? 4.170   -26.863 44.219  1.00 44.37 ? 208 LEU C CD1   1 
ATOM   8286  C CD2   . LEU C 1 208 ? 3.234   -29.069 43.377  1.00 42.68 ? 208 LEU C CD2   1 
ATOM   8287  N N     . THR C 1 209 ? 2.478   -31.625 46.823  1.00 39.13 ? 209 THR C N     1 
ATOM   8288  C CA    . THR C 1 209 ? 2.822   -32.932 47.439  1.00 38.28 ? 209 THR C CA    1 
ATOM   8289  C C     . THR C 1 209 ? 4.265   -33.311 47.155  1.00 39.46 ? 209 THR C C     1 
ATOM   8290  O O     . THR C 1 209 ? 4.815   -32.888 46.107  1.00 40.71 ? 209 THR C O     1 
ATOM   8291  C CB    . THR C 1 209 ? 1.950   -34.045 46.843  1.00 38.75 ? 209 THR C CB    1 
ATOM   8292  O OG1   . THR C 1 209 ? 1.722   -33.780 45.446  1.00 35.31 ? 209 THR C OG1   1 
ATOM   8293  C CG2   . THR C 1 209 ? 0.585   -34.147 47.614  1.00 37.97 ? 209 THR C CG2   1 
ATOM   8294  N N     . SER C 1 210 ? 4.911   -34.105 48.026  1.00 38.84 ? 210 SER C N     1 
ATOM   8295  C CA    . SER C 1 210 ? 6.260   -34.579 47.679  1.00 41.07 ? 210 SER C CA    1 
ATOM   8296  C C     . SER C 1 210 ? 6.300   -35.010 46.184  1.00 40.89 ? 210 SER C C     1 
ATOM   8297  O O     . SER C 1 210 ? 7.202   -34.645 45.459  1.00 39.85 ? 210 SER C O     1 
ATOM   8298  C CB    . SER C 1 210 ? 6.759   -35.719 48.610  1.00 41.76 ? 210 SER C CB    1 
ATOM   8299  O OG    . SER C 1 210 ? 7.927   -36.362 48.033  1.00 44.89 ? 210 SER C OG    1 
ATOM   8300  N N     . GLU C 1 211 ? 5.275   -35.749 45.739  1.00 41.67 ? 211 GLU C N     1 
ATOM   8301  C CA    . GLU C 1 211 ? 5.297   -36.425 44.437  1.00 42.13 ? 211 GLU C CA    1 
ATOM   8302  C C     . GLU C 1 211 ? 5.216   -35.448 43.321  1.00 40.87 ? 211 GLU C C     1 
ATOM   8303  O O     . GLU C 1 211 ? 5.829   -35.650 42.262  1.00 41.20 ? 211 GLU C O     1 
ATOM   8304  C CB    . GLU C 1 211 ? 4.122   -37.422 44.280  1.00 43.07 ? 211 GLU C CB    1 
ATOM   8305  C CG    . GLU C 1 211 ? 4.069   -38.475 45.301  1.00 48.42 ? 211 GLU C CG    1 
ATOM   8306  C CD    . GLU C 1 211 ? 3.204   -38.047 46.470  1.00 53.82 ? 211 GLU C CD    1 
ATOM   8307  O OE1   . GLU C 1 211 ? 3.314   -36.849 46.832  1.00 51.51 ? 211 GLU C OE1   1 
ATOM   8308  O OE2   . GLU C 1 211 ? 2.385   -38.899 46.964  1.00 54.78 ? 211 GLU C OE2   1 
ATOM   8309  N N     . ARG C 1 212 ? 4.428   -34.400 43.523  1.00 40.34 ? 212 ARG C N     1 
ATOM   8310  C CA    . ARG C 1 212 ? 4.319   -33.381 42.484  1.00 38.69 ? 212 ARG C CA    1 
ATOM   8311  C C     . ARG C 1 212 ? 5.608   -32.619 42.253  1.00 40.02 ? 212 ARG C C     1 
ATOM   8312  O O     . ARG C 1 212 ? 6.001   -32.355 41.093  1.00 39.90 ? 212 ARG C O     1 
ATOM   8313  C CB    . ARG C 1 212 ? 3.106   -32.518 42.700  1.00 38.45 ? 212 ARG C CB    1 
ATOM   8314  C CG    . ARG C 1 212 ? 1.832   -33.169 42.179  1.00 35.18 ? 212 ARG C CG    1 
ATOM   8315  C CD    . ARG C 1 212 ? 0.686   -32.189 42.258  1.00 39.76 ? 212 ARG C CD    1 
ATOM   8316  N NE    . ARG C 1 212 ? -0.536  -32.870 41.903  1.00 37.17 ? 212 ARG C NE    1 
ATOM   8317  C CZ    . ARG C 1 212 ? -1.725  -32.310 41.750  1.00 39.04 ? 212 ARG C CZ    1 
ATOM   8318  N NH1   . ARG C 1 212 ? -1.933  -30.981 41.881  1.00 34.43 ? 212 ARG C NH1   1 
ATOM   8319  N NH2   . ARG C 1 212 ? -2.737  -33.119 41.457  1.00 39.02 ? 212 ARG C NH2   1 
ATOM   8320  N N     . LYS C 1 213 ? 6.298   -32.300 43.347  1.00 40.85 ? 213 LYS C N     1 
ATOM   8321  C CA    . LYS C 1 213 ? 7.663   -31.730 43.287  1.00 39.65 ? 213 LYS C CA    1 
ATOM   8322  C C     . LYS C 1 213 ? 8.700   -32.521 42.492  1.00 40.80 ? 213 LYS C C     1 
ATOM   8323  O O     . LYS C 1 213 ? 9.443   -31.903 41.710  1.00 40.01 ? 213 LYS C O     1 
ATOM   8324  C CB    . LYS C 1 213 ? 8.211   -31.431 44.683  1.00 37.90 ? 213 LYS C CB    1 
ATOM   8325  C CG    . LYS C 1 213 ? 7.353   -30.302 45.398  1.00 39.82 ? 213 LYS C CG    1 
ATOM   8326  C CD    . LYS C 1 213 ? 7.736   -30.024 46.819  1.00 38.57 ? 213 LYS C CD    1 
ATOM   8327  C CE    . LYS C 1 213 ? 6.980   -28.790 47.339  1.00 33.09 ? 213 LYS C CE    1 
ATOM   8328  N NZ    . LYS C 1 213 ? 7.485   -28.490 48.757  1.00 29.56 ? 213 LYS C NZ    1 
ATOM   8329  N N     . LYS C 1 214 ? 8.813   -33.842 42.712  1.00 41.09 ? 214 LYS C N     1 
ATOM   8330  C CA    . LYS C 1 214 ? 9.830   -34.577 42.009  1.00 41.63 ? 214 LYS C CA    1 
ATOM   8331  C C     . LYS C 1 214 ? 9.611   -34.520 40.468  1.00 42.12 ? 214 LYS C C     1 
ATOM   8332  O O     . LYS C 1 214 ? 10.595  -34.438 39.724  1.00 42.61 ? 214 LYS C O     1 
ATOM   8333  C CB    . LYS C 1 214 ? 9.919   -36.024 42.506  1.00 42.63 ? 214 LYS C CB    1 
ATOM   8334  C CG    . LYS C 1 214 ? 10.396  -36.244 44.002  1.00 42.60 ? 214 LYS C CG    1 
ATOM   8335  C CD    . LYS C 1 214 ? 9.606   -37.417 44.544  1.00 44.60 ? 214 LYS C CD    1 
ATOM   8336  C CE    . LYS C 1 214 ? 10.184  -38.143 45.748  1.00 47.92 ? 214 LYS C CE    1 
ATOM   8337  N NZ    . LYS C 1 214 ? 8.953   -38.781 46.317  1.00 50.38 ? 214 LYS C NZ    1 
ATOM   8338  N N     . GLU C 1 215 ? 8.338   -34.597 40.036  1.00 42.69 ? 215 GLU C N     1 
ATOM   8339  C CA    . GLU C 1 215 ? 7.865   -34.464 38.613  1.00 43.84 ? 215 GLU C CA    1 
ATOM   8340  C C     . GLU C 1 215 ? 8.160   -33.084 38.075  1.00 42.98 ? 215 GLU C C     1 
ATOM   8341  O O     . GLU C 1 215 ? 8.712   -32.948 36.988  1.00 44.53 ? 215 GLU C O     1 
ATOM   8342  C CB    . GLU C 1 215 ? 6.335   -34.592 38.491  1.00 42.47 ? 215 GLU C CB    1 
ATOM   8343  C CG    . GLU C 1 215 ? 5.743   -35.980 38.359  1.00 47.17 ? 215 GLU C CG    1 
ATOM   8344  C CD    . GLU C 1 215 ? 4.214   -35.919 38.136  1.00 46.29 ? 215 GLU C CD    1 
ATOM   8345  O OE1   . GLU C 1 215 ? 3.498   -35.605 39.112  1.00 51.05 ? 215 GLU C OE1   1 
ATOM   8346  O OE2   . GLU C 1 215 ? 3.735   -36.174 37.002  1.00 48.37 ? 215 GLU C OE2   1 
ATOM   8347  N N     . ILE C 1 216 ? 7.725   -32.072 38.821  1.00 42.29 ? 216 ILE C N     1 
ATOM   8348  C CA    . ILE C 1 216 ? 7.929   -30.653 38.478  1.00 42.67 ? 216 ILE C CA    1 
ATOM   8349  C C     . ILE C 1 216 ? 9.393   -30.378 38.249  1.00 41.35 ? 216 ILE C C     1 
ATOM   8350  O O     . ILE C 1 216 ? 9.739   -29.850 37.224  1.00 41.73 ? 216 ILE C O     1 
ATOM   8351  C CB    . ILE C 1 216 ? 7.403   -29.707 39.591  1.00 43.26 ? 216 ILE C CB    1 
ATOM   8352  C CG1   . ILE C 1 216 ? 5.897   -29.855 39.722  1.00 46.30 ? 216 ILE C CG1   1 
ATOM   8353  C CG2   . ILE C 1 216 ? 7.811   -28.198 39.357  1.00 42.22 ? 216 ILE C CG2   1 
ATOM   8354  C CD1   . ILE C 1 216 ? 5.143   -28.990 38.753  1.00 50.96 ? 216 ILE C CD1   1 
ATOM   8355  N N     . TYR C 1 217 ? 10.222  -30.793 39.208  1.00 39.74 ? 217 TYR C N     1 
ATOM   8356  C CA    . TYR C 1 217 ? 11.644  -30.712 39.136  1.00 39.14 ? 217 TYR C CA    1 
ATOM   8357  C C     . TYR C 1 217 ? 12.316  -31.448 37.954  1.00 39.70 ? 217 TYR C C     1 
ATOM   8358  O O     . TYR C 1 217 ? 13.269  -30.897 37.375  1.00 37.58 ? 217 TYR C O     1 
ATOM   8359  C CB    . TYR C 1 217 ? 12.314  -31.162 40.445  1.00 38.34 ? 217 TYR C CB    1 
ATOM   8360  C CG    . TYR C 1 217 ? 13.812  -30.810 40.432  1.00 39.40 ? 217 TYR C CG    1 
ATOM   8361  C CD1   . TYR C 1 217 ? 14.270  -29.587 40.953  1.00 34.36 ? 217 TYR C CD1   1 
ATOM   8362  C CD2   . TYR C 1 217 ? 14.761  -31.688 39.847  1.00 39.18 ? 217 TYR C CD2   1 
ATOM   8363  C CE1   . TYR C 1 217 ? 15.649  -29.249 40.902  1.00 37.24 ? 217 TYR C CE1   1 
ATOM   8364  C CE2   . TYR C 1 217 ? 16.129  -31.342 39.792  1.00 40.12 ? 217 TYR C CE2   1 
ATOM   8365  C CZ    . TYR C 1 217 ? 16.540  -30.115 40.332  1.00 35.41 ? 217 TYR C CZ    1 
ATOM   8366  O OH    . TYR C 1 217 ? 17.862  -29.779 40.292  1.00 41.17 ? 217 TYR C OH    1 
ATOM   8367  N N     . GLU C 1 218 ? 11.895  -32.697 37.666  1.00 40.35 ? 218 GLU C N     1 
ATOM   8368  C CA    . GLU C 1 218 ? 12.337  -33.453 36.445  1.00 40.76 ? 218 GLU C CA    1 
ATOM   8369  C C     . GLU C 1 218 ? 12.037  -32.736 35.116  1.00 39.66 ? 218 GLU C C     1 
ATOM   8370  O O     . GLU C 1 218 ? 12.857  -32.740 34.230  1.00 39.83 ? 218 GLU C O     1 
ATOM   8371  C CB    . GLU C 1 218 ? 11.763  -34.896 36.441  1.00 42.09 ? 218 GLU C CB    1 
ATOM   8372  C CG    . GLU C 1 218 ? 12.814  -36.028 36.722  1.00 43.84 ? 218 GLU C CG    1 
ATOM   8373  C CD    . GLU C 1 218 ? 12.126  -37.385 36.983  1.00 45.03 ? 218 GLU C CD    1 
ATOM   8374  O OE1   . GLU C 1 218 ? 11.263  -37.792 36.181  1.00 50.31 ? 218 GLU C OE1   1 
ATOM   8375  O OE2   . GLU C 1 218 ? 12.404  -38.048 38.009  1.00 50.57 ? 218 GLU C OE2   1 
ATOM   8376  N N     . LEU C 1 219 ? 10.854  -32.122 35.000  1.00 39.41 ? 219 LEU C N     1 
ATOM   8377  C CA    . LEU C 1 219 ? 10.511  -31.176 33.937  1.00 39.26 ? 219 LEU C CA    1 
ATOM   8378  C C     . LEU C 1 219 ? 11.363  -29.910 33.812  1.00 40.51 ? 219 LEU C C     1 
ATOM   8379  O O     . LEU C 1 219 ? 11.699  -29.456 32.672  1.00 38.06 ? 219 LEU C O     1 
ATOM   8380  C CB    . LEU C 1 219 ? 9.103   -30.692 34.119  1.00 38.87 ? 219 LEU C CB    1 
ATOM   8381  C CG    . LEU C 1 219 ? 7.902   -31.109 33.288  1.00 39.83 ? 219 LEU C CG    1 
ATOM   8382  C CD1   . LEU C 1 219 ? 8.279   -31.708 31.849  1.00 36.25 ? 219 LEU C CD1   1 
ATOM   8383  C CD2   . LEU C 1 219 ? 6.939   -31.961 34.102  1.00 38.74 ? 219 LEU C CD2   1 
ATOM   8384  N N     . ALA C 1 220 ? 11.628  -29.280 34.974  1.00 42.32 ? 220 ALA C N     1 
ATOM   8385  C CA    . ALA C 1 220 ? 12.585  -28.159 35.060  1.00 42.38 ? 220 ALA C CA    1 
ATOM   8386  C C     . ALA C 1 220 ? 13.924  -28.648 34.539  1.00 44.46 ? 220 ALA C C     1 
ATOM   8387  O O     . ALA C 1 220 ? 14.527  -27.986 33.696  1.00 47.23 ? 220 ALA C O     1 
ATOM   8388  C CB    . ALA C 1 220 ? 12.702  -27.638 36.475  1.00 39.25 ? 220 ALA C CB    1 
ATOM   8389  N N     . ARG C 1 221 ? 14.388  -29.810 34.987  1.00 46.26 ? 221 ARG C N     1 
ATOM   8390  C CA    . ARG C 1 221 ? 15.620  -30.434 34.418  1.00 48.95 ? 221 ARG C CA    1 
ATOM   8391  C C     . ARG C 1 221 ? 15.499  -30.389 32.890  1.00 49.49 ? 221 ARG C C     1 
ATOM   8392  O O     . ARG C 1 221 ? 16.198  -29.612 32.187  1.00 50.41 ? 221 ARG C O     1 
ATOM   8393  C CB    . ARG C 1 221 ? 15.686  -31.902 34.839  1.00 49.09 ? 221 ARG C CB    1 
ATOM   8394  C CG    . ARG C 1 221 ? 17.007  -32.413 35.400  1.00 52.04 ? 221 ARG C CG    1 
ATOM   8395  C CD    . ARG C 1 221 ? 16.875  -33.907 35.884  1.00 51.35 ? 221 ARG C CD    1 
ATOM   8396  N NE    . ARG C 1 221 ? 17.620  -34.115 37.135  1.00 51.65 ? 221 ARG C NE    1 
ATOM   8397  C CZ    . ARG C 1 221 ? 18.943  -34.248 37.216  1.00 52.99 ? 221 ARG C CZ    1 
ATOM   8398  N NH1   . ARG C 1 221 ? 19.695  -34.252 36.135  1.00 57.00 ? 221 ARG C NH1   1 
ATOM   8399  N NH2   . ARG C 1 221 ? 19.534  -34.362 38.384  1.00 53.84 ? 221 ARG C NH2   1 
ATOM   8400  N N     . LYS C 1 222 ? 14.520  -31.164 32.402  1.00 48.54 ? 222 LYS C N     1 
ATOM   8401  C CA    . LYS C 1 222 ? 14.269  -31.375 30.991  1.00 48.19 ? 222 LYS C CA    1 
ATOM   8402  C C     . LYS C 1 222 ? 14.368  -30.109 30.131  1.00 47.09 ? 222 LYS C C     1 
ATOM   8403  O O     . LYS C 1 222 ? 15.050  -30.082 29.080  1.00 46.58 ? 222 LYS C O     1 
ATOM   8404  C CB    . LYS C 1 222 ? 12.891  -32.026 30.821  1.00 48.73 ? 222 LYS C CB    1 
ATOM   8405  C CG    . LYS C 1 222 ? 12.551  -32.331 29.385  1.00 49.86 ? 222 LYS C CG    1 
ATOM   8406  C CD    . LYS C 1 222 ? 11.455  -33.390 29.232  1.00 50.37 ? 222 LYS C CD    1 
ATOM   8407  C CE    . LYS C 1 222 ? 11.172  -33.620 27.740  1.00 50.27 ? 222 LYS C CE    1 
ATOM   8408  N NZ    . LYS C 1 222 ? 9.904   -34.460 27.606  1.00 51.65 ? 222 LYS C NZ    1 
ATOM   8409  N N     . TYR C 1 223 ? 13.695  -29.057 30.585  1.00 46.65 ? 223 TYR C N     1 
ATOM   8410  C CA    . TYR C 1 223 ? 13.528  -27.834 29.766  1.00 44.35 ? 223 TYR C CA    1 
ATOM   8411  C C     . TYR C 1 223 ? 14.477  -26.785 30.279  1.00 43.01 ? 223 TYR C C     1 
ATOM   8412  O O     . TYR C 1 223 ? 14.449  -25.632 29.855  1.00 42.76 ? 223 TYR C O     1 
ATOM   8413  C CB    . TYR C 1 223 ? 12.078  -27.391 29.779  1.00 44.55 ? 223 TYR C CB    1 
ATOM   8414  C CG    . TYR C 1 223 ? 11.194  -28.284 28.934  1.00 44.12 ? 223 TYR C CG    1 
ATOM   8415  C CD1   . TYR C 1 223 ? 11.028  -28.045 27.550  1.00 45.32 ? 223 TYR C CD1   1 
ATOM   8416  C CD2   . TYR C 1 223 ? 10.536  -29.360 29.494  1.00 43.53 ? 223 TYR C CD2   1 
ATOM   8417  C CE1   . TYR C 1 223 ? 10.209  -28.882 26.749  1.00 45.99 ? 223 TYR C CE1   1 
ATOM   8418  C CE2   . TYR C 1 223 ? 9.713   -30.204 28.728  1.00 45.48 ? 223 TYR C CE2   1 
ATOM   8419  C CZ    . TYR C 1 223 ? 9.553   -29.958 27.353  1.00 46.86 ? 223 TYR C CZ    1 
ATOM   8420  O OH    . TYR C 1 223 ? 8.754   -30.801 26.621  1.00 47.67 ? 223 TYR C OH    1 
ATOM   8421  N N     . ASP C 1 224 ? 15.346  -27.242 31.179  1.00 42.20 ? 224 ASP C N     1 
ATOM   8422  C CA    . ASP C 1 224 ? 16.396  -26.440 31.824  1.00 42.01 ? 224 ASP C CA    1 
ATOM   8423  C C     . ASP C 1 224 ? 15.944  -25.038 32.216  1.00 40.64 ? 224 ASP C C     1 
ATOM   8424  O O     . ASP C 1 224 ? 16.392  -24.010 31.655  1.00 39.27 ? 224 ASP C O     1 
ATOM   8425  C CB    . ASP C 1 224 ? 17.681  -26.365 30.989  1.00 42.38 ? 224 ASP C CB    1 
ATOM   8426  C CG    . ASP C 1 224 ? 18.686  -25.415 31.609  1.00 45.93 ? 224 ASP C CG    1 
ATOM   8427  O OD1   . ASP C 1 224 ? 18.740  -25.353 32.859  1.00 43.66 ? 224 ASP C OD1   1 
ATOM   8428  O OD2   . ASP C 1 224 ? 19.382  -24.692 30.863  1.00 53.54 ? 224 ASP C OD2   1 
ATOM   8429  N N     . PHE C 1 225 ? 14.998  -25.003 33.139  1.00 39.81 ? 225 PHE C N     1 
ATOM   8430  C CA    . PHE C 1 225 ? 14.640  -23.733 33.731  1.00 37.97 ? 225 PHE C CA    1 
ATOM   8431  C C     . PHE C 1 225 ? 14.848  -23.781 35.245  1.00 37.03 ? 225 PHE C C     1 
ATOM   8432  O O     . PHE C 1 225 ? 15.027  -24.844 35.837  1.00 37.24 ? 225 PHE C O     1 
ATOM   8433  C CB    . PHE C 1 225 ? 13.233  -23.222 33.344  1.00 36.29 ? 225 PHE C CB    1 
ATOM   8434  C CG    . PHE C 1 225 ? 12.130  -24.214 33.592  1.00 40.22 ? 225 PHE C CG    1 
ATOM   8435  C CD1   . PHE C 1 225 ? 11.614  -24.414 34.909  1.00 33.49 ? 225 PHE C CD1   1 
ATOM   8436  C CD2   . PHE C 1 225 ? 11.565  -24.931 32.503  1.00 29.58 ? 225 PHE C CD2   1 
ATOM   8437  C CE1   . PHE C 1 225 ? 10.595  -25.333 35.147  1.00 35.42 ? 225 PHE C CE1   1 
ATOM   8438  C CE2   . PHE C 1 225 ? 10.605  -25.927 32.743  1.00 33.69 ? 225 PHE C CE2   1 
ATOM   8439  C CZ    . PHE C 1 225 ? 10.082  -26.114 34.055  1.00 35.74 ? 225 PHE C CZ    1 
ATOM   8440  N N     . LEU C 1 226 ? 14.757  -22.605 35.833  1.00 34.94 ? 226 LEU C N     1 
ATOM   8441  C CA    . LEU C 1 226 ? 14.967  -22.406 37.176  1.00 33.45 ? 226 LEU C CA    1 
ATOM   8442  C C     . LEU C 1 226 ? 13.622  -22.589 37.865  1.00 33.49 ? 226 LEU C C     1 
ATOM   8443  O O     . LEU C 1 226 ? 12.486  -22.492 37.268  1.00 31.69 ? 226 LEU C O     1 
ATOM   8444  C CB    . LEU C 1 226 ? 15.552  -20.988 37.353  1.00 35.26 ? 226 LEU C CB    1 
ATOM   8445  C CG    . LEU C 1 226 ? 16.957  -20.551 37.830  1.00 35.94 ? 226 LEU C CG    1 
ATOM   8446  C CD1   . LEU C 1 226 ? 18.251  -21.561 37.634  1.00 30.66 ? 226 LEU C CD1   1 
ATOM   8447  C CD2   . LEU C 1 226 ? 17.188  -19.162 37.371  1.00 30.24 ? 226 LEU C CD2   1 
ATOM   8448  N N     . ILE C 1 227 ? 13.732  -22.865 39.140  1.00 30.24 ? 227 ILE C N     1 
ATOM   8449  C CA    . ILE C 1 227 ? 12.518  -23.068 39.873  1.00 31.32 ? 227 ILE C CA    1 
ATOM   8450  C C     . ILE C 1 227 ? 12.595  -22.081 41.003  1.00 30.91 ? 227 ILE C C     1 
ATOM   8451  O O     . ILE C 1 227 ? 13.553  -22.078 41.765  1.00 27.88 ? 227 ILE C O     1 
ATOM   8452  C CB    . ILE C 1 227 ? 12.445  -24.503 40.469  1.00 32.30 ? 227 ILE C CB    1 
ATOM   8453  C CG1   . ILE C 1 227 ? 11.907  -25.491 39.423  1.00 30.84 ? 227 ILE C CG1   1 
ATOM   8454  C CG2   . ILE C 1 227 ? 11.581  -24.533 41.714  1.00 31.64 ? 227 ILE C CG2   1 
ATOM   8455  C CD1   . ILE C 1 227 ? 11.652  -26.862 40.008  1.00 29.94 ? 227 ILE C CD1   1 
ATOM   8456  N N     . ILE C 1 228 ? 11.636  -21.176 41.107  1.00 30.99 ? 228 ILE C N     1 
ATOM   8457  C CA    . ILE C 1 228 ? 11.875  -20.329 42.234  1.00 32.91 ? 228 ILE C CA    1 
ATOM   8458  C C     . ILE C 1 228 ? 10.937  -20.598 43.446  1.00 31.91 ? 228 ILE C C     1 
ATOM   8459  O O     . ILE C 1 228 ? 9.712   -20.534 43.367  1.00 31.82 ? 228 ILE C O     1 
ATOM   8460  C CB    . ILE C 1 228 ? 12.206  -18.886 41.845  1.00 33.96 ? 228 ILE C CB    1 
ATOM   8461  C CG1   . ILE C 1 228 ? 11.039  -17.946 42.003  1.00 34.57 ? 228 ILE C CG1   1 
ATOM   8462  C CG2   . ILE C 1 228 ? 13.038  -18.775 40.531  1.00 35.18 ? 228 ILE C CG2   1 
ATOM   8463  C CD1   . ILE C 1 228 ? 11.239  -17.092 43.161  1.00 31.23 ? 228 ILE C CD1   1 
ATOM   8464  N N     . GLU C 1 229 ? 11.525  -21.004 44.531  1.00 28.72 ? 229 GLU C N     1 
ATOM   8465  C CA    . GLU C 1 229 ? 10.644  -21.556 45.560  1.00 30.99 ? 229 GLU C CA    1 
ATOM   8466  C C     . GLU C 1 229 ? 10.332  -20.576 46.634  1.00 29.56 ? 229 GLU C C     1 
ATOM   8467  O O     . GLU C 1 229 ? 11.070  -20.454 47.541  1.00 30.74 ? 229 GLU C O     1 
ATOM   8468  C CB    . GLU C 1 229 ? 11.259  -22.884 46.060  1.00 29.95 ? 229 GLU C CB    1 
ATOM   8469  C CG    . GLU C 1 229 ? 11.090  -23.236 47.414  1.00 33.09 ? 229 GLU C CG    1 
ATOM   8470  C CD    . GLU C 1 229 ? 11.330  -24.723 47.575  1.00 27.22 ? 229 GLU C CD    1 
ATOM   8471  O OE1   . GLU C 1 229 ? 10.319  -25.425 47.481  1.00 21.30 ? 229 GLU C OE1   1 
ATOM   8472  O OE2   . GLU C 1 229 ? 12.490  -25.116 47.716  1.00 25.56 ? 229 GLU C OE2   1 
ATOM   8473  N N     . ASP C 1 230 ? 9.265   -19.808 46.444  1.00 30.90 ? 230 ASP C N     1 
ATOM   8474  C CA    . ASP C 1 230 ? 8.799   -18.796 47.397  1.00 29.79 ? 230 ASP C CA    1 
ATOM   8475  C C     . ASP C 1 230 ? 8.117   -19.430 48.638  1.00 28.38 ? 230 ASP C C     1 
ATOM   8476  O O     . ASP C 1 230 ? 6.938   -19.724 48.614  1.00 28.20 ? 230 ASP C O     1 
ATOM   8477  C CB    . ASP C 1 230 ? 7.870   -17.839 46.657  1.00 30.09 ? 230 ASP C CB    1 
ATOM   8478  C CG    . ASP C 1 230 ? 7.425   -16.616 47.504  1.00 32.16 ? 230 ASP C CG    1 
ATOM   8479  O OD1   . ASP C 1 230 ? 7.888   -16.405 48.637  1.00 32.42 ? 230 ASP C OD1   1 
ATOM   8480  O OD2   . ASP C 1 230 ? 6.579   -15.838 46.984  1.00 34.95 ? 230 ASP C OD2   1 
ATOM   8481  N N     . ASP C 1 231 ? 8.843   -19.619 49.736  1.00 28.44 ? 231 ASP C N     1 
ATOM   8482  C CA    . ASP C 1 231 ? 8.269   -20.507 50.817  1.00 30.77 ? 231 ASP C CA    1 
ATOM   8483  C C     . ASP C 1 231 ? 8.000   -19.850 52.184  1.00 30.23 ? 231 ASP C C     1 
ATOM   8484  O O     . ASP C 1 231 ? 8.578   -20.249 53.169  1.00 28.46 ? 231 ASP C O     1 
ATOM   8485  C CB    . ASP C 1 231 ? 9.174   -21.751 50.944  1.00 29.35 ? 231 ASP C CB    1 
ATOM   8486  C CG    . ASP C 1 231 ? 8.387   -23.096 51.222  1.00 31.73 ? 231 ASP C CG    1 
ATOM   8487  O OD1   . ASP C 1 231 ? 7.146   -23.131 51.395  1.00 27.81 ? 231 ASP C OD1   1 
ATOM   8488  O OD2   . ASP C 1 231 ? 9.066   -24.165 51.214  1.00 33.56 ? 231 ASP C OD2   1 
ATOM   8489  N N     . PRO C 1 232 ? 7.162   -18.791 52.232  1.00 32.91 ? 232 PRO C N     1 
ATOM   8490  C CA    . PRO C 1 232 ? 6.994   -18.055 53.476  1.00 33.46 ? 232 PRO C CA    1 
ATOM   8491  C C     . PRO C 1 232 ? 6.184   -18.726 54.570  1.00 33.88 ? 232 PRO C C     1 
ATOM   8492  O O     . PRO C 1 232 ? 6.259   -18.341 55.698  1.00 33.93 ? 232 PRO C O     1 
ATOM   8493  C CB    . PRO C 1 232 ? 6.297   -16.784 53.008  1.00 35.21 ? 232 PRO C CB    1 
ATOM   8494  C CG    . PRO C 1 232 ? 5.489   -17.215 51.835  1.00 32.59 ? 232 PRO C CG    1 
ATOM   8495  C CD    . PRO C 1 232 ? 6.408   -18.137 51.142  1.00 33.16 ? 232 PRO C CD    1 
ATOM   8496  N N     . TYR C 1 233 ? 5.476   -19.801 54.262  1.00 34.31 ? 233 TYR C N     1 
ATOM   8497  C CA    . TYR C 1 233 ? 4.622   -20.435 55.263  1.00 32.30 ? 233 TYR C CA    1 
ATOM   8498  C C     . TYR C 1 233 ? 5.231   -21.814 55.454  1.00 34.06 ? 233 TYR C C     1 
ATOM   8499  O O     . TYR C 1 233 ? 4.549   -22.714 55.925  1.00 33.59 ? 233 TYR C O     1 
ATOM   8500  C CB    . TYR C 1 233 ? 3.192   -20.538 54.708  1.00 30.78 ? 233 TYR C CB    1 
ATOM   8501  C CG    . TYR C 1 233 ? 2.585   -19.193 54.316  1.00 28.51 ? 233 TYR C CG    1 
ATOM   8502  C CD1   . TYR C 1 233 ? 2.447   -18.787 52.955  1.00 27.77 ? 233 TYR C CD1   1 
ATOM   8503  C CD2   . TYR C 1 233 ? 2.115   -18.337 55.299  1.00 24.57 ? 233 TYR C CD2   1 
ATOM   8504  C CE1   . TYR C 1 233 ? 1.887   -17.512 52.645  1.00 25.31 ? 233 TYR C CE1   1 
ATOM   8505  C CE2   . TYR C 1 233 ? 1.577   -17.176 54.999  1.00 26.45 ? 233 TYR C CE2   1 
ATOM   8506  C CZ    . TYR C 1 233 ? 1.458   -16.725 53.701  1.00 27.10 ? 233 TYR C CZ    1 
ATOM   8507  O OH    . TYR C 1 233 ? 0.901   -15.473 53.581  1.00 28.17 ? 233 TYR C OH    1 
ATOM   8508  N N     . TYR C 1 234 ? 6.492   -21.989 55.028  1.00 33.74 ? 234 TYR C N     1 
ATOM   8509  C CA    . TYR C 1 234 ? 7.192   -23.263 55.197  1.00 35.24 ? 234 TYR C CA    1 
ATOM   8510  C C     . TYR C 1 234 ? 7.129   -23.709 56.669  1.00 36.51 ? 234 TYR C C     1 
ATOM   8511  O O     . TYR C 1 234 ? 6.879   -24.865 56.953  1.00 36.48 ? 234 TYR C O     1 
ATOM   8512  C CB    . TYR C 1 234 ? 8.636   -23.181 54.799  1.00 34.25 ? 234 TYR C CB    1 
ATOM   8513  C CG    . TYR C 1 234 ? 9.388   -24.494 55.109  1.00 35.44 ? 234 TYR C CG    1 
ATOM   8514  C CD1   . TYR C 1 234 ? 9.234   -25.643 54.273  1.00 33.58 ? 234 TYR C CD1   1 
ATOM   8515  C CD2   . TYR C 1 234 ? 10.240  -24.592 56.228  1.00 32.91 ? 234 TYR C CD2   1 
ATOM   8516  C CE1   . TYR C 1 234 ? 9.874   -26.868 54.594  1.00 34.16 ? 234 TYR C CE1   1 
ATOM   8517  C CE2   . TYR C 1 234 ? 10.896  -25.793 56.541  1.00 32.52 ? 234 TYR C CE2   1 
ATOM   8518  C CZ    . TYR C 1 234 ? 10.695  -26.931 55.717  1.00 33.65 ? 234 TYR C CZ    1 
ATOM   8519  O OH    . TYR C 1 234 ? 11.329  -28.114 56.001  1.00 31.77 ? 234 TYR C OH    1 
ATOM   8520  N N     . PHE C 1 235 ? 7.374   -22.775 57.602  1.00 36.89 ? 235 PHE C N     1 
ATOM   8521  C CA    . PHE C 1 235 ? 7.306   -23.085 59.012  1.00 35.66 ? 235 PHE C CA    1 
ATOM   8522  C C     . PHE C 1 235 ? 5.904   -22.893 59.545  1.00 36.54 ? 235 PHE C C     1 
ATOM   8523  O O     . PHE C 1 235 ? 5.784   -22.506 60.714  1.00 38.15 ? 235 PHE C O     1 
ATOM   8524  C CB    . PHE C 1 235 ? 8.245   -22.157 59.801  1.00 35.79 ? 235 PHE C CB    1 
ATOM   8525  C CG    . PHE C 1 235 ? 9.742   -22.398 59.533  1.00 33.41 ? 235 PHE C CG    1 
ATOM   8526  C CD1   . PHE C 1 235 ? 10.357  -23.518 59.993  1.00 31.99 ? 235 PHE C CD1   1 
ATOM   8527  C CD2   . PHE C 1 235 ? 10.520  -21.442 58.877  1.00 29.71 ? 235 PHE C CD2   1 
ATOM   8528  C CE1   . PHE C 1 235 ? 11.743  -23.710 59.814  1.00 33.10 ? 235 PHE C CE1   1 
ATOM   8529  C CE2   . PHE C 1 235 ? 11.823  -21.643 58.684  1.00 31.93 ? 235 PHE C CE2   1 
ATOM   8530  C CZ    . PHE C 1 235 ? 12.446  -22.793 59.151  1.00 32.03 ? 235 PHE C CZ    1 
ATOM   8531  N N     . LEU C 1 236 ? 4.859   -23.102 58.710  1.00 34.48 ? 236 LEU C N     1 
ATOM   8532  C CA    . LEU C 1 236 ? 3.466   -22.968 59.119  1.00 32.86 ? 236 LEU C CA    1 
ATOM   8533  C C     . LEU C 1 236 ? 2.569   -24.021 58.435  1.00 34.76 ? 236 LEU C C     1 
ATOM   8534  O O     . LEU C 1 236 ? 1.426   -23.706 57.982  1.00 32.37 ? 236 LEU C O     1 
ATOM   8535  C CB    . LEU C 1 236 ? 2.957   -21.557 58.840  1.00 33.99 ? 236 LEU C CB    1 
ATOM   8536  C CG    . LEU C 1 236 ? 2.148   -20.794 59.888  1.00 31.48 ? 236 LEU C CG    1 
ATOM   8537  C CD1   . LEU C 1 236 ? 2.945   -20.675 61.161  1.00 29.56 ? 236 LEU C CD1   1 
ATOM   8538  C CD2   . LEU C 1 236 ? 1.836   -19.386 59.420  1.00 32.82 ? 236 LEU C CD2   1 
ATOM   8539  N N     . GLN C 1 237 ? 3.087   -25.282 58.381  1.00 35.04 ? 237 GLN C N     1 
ATOM   8540  C CA    . GLN C 1 237 ? 2.334   -26.377 57.771  1.00 36.12 ? 237 GLN C CA    1 
ATOM   8541  C C     . GLN C 1 237 ? 1.603   -27.157 58.864  1.00 36.80 ? 237 GLN C C     1 
ATOM   8542  O O     . GLN C 1 237 ? 2.168   -27.431 59.912  1.00 38.46 ? 237 GLN C O     1 
ATOM   8543  C CB    . GLN C 1 237 ? 3.238   -27.264 56.896  1.00 36.88 ? 237 GLN C CB    1 
ATOM   8544  C CG    . GLN C 1 237 ? 4.120   -26.511 55.808  1.00 35.04 ? 237 GLN C CG    1 
ATOM   8545  C CD    . GLN C 1 237 ? 5.226   -27.428 55.273  1.00 32.48 ? 237 GLN C CD    1 
ATOM   8546  O OE1   . GLN C 1 237 ? 6.457   -27.109 55.321  1.00 27.73 ? 237 GLN C OE1   1 
ATOM   8547  N NE2   . GLN C 1 237 ? 4.802   -28.602 54.796  1.00 25.47 ? 237 GLN C NE2   1 
ATOM   8548  N N     . PHE C 1 238 ? 0.338   -27.484 58.643  1.00 37.73 ? 238 PHE C N     1 
ATOM   8549  C CA    . PHE C 1 238 ? -0.512  -27.943 59.753  1.00 39.02 ? 238 PHE C CA    1 
ATOM   8550  C C     . PHE C 1 238 ? -0.278  -29.400 59.982  1.00 41.11 ? 238 PHE C C     1 
ATOM   8551  O O     . PHE C 1 238 ? -0.427  -29.914 61.108  1.00 40.43 ? 238 PHE C O     1 
ATOM   8552  C CB    . PHE C 1 238 ? -1.939  -27.561 59.451  1.00 38.50 ? 238 PHE C CB    1 
ATOM   8553  C CG    . PHE C 1 238 ? -2.150  -26.037 59.493  1.00 37.06 ? 238 PHE C CG    1 
ATOM   8554  C CD1   . PHE C 1 238 ? -2.913  -25.394 58.566  1.00 35.26 ? 238 PHE C CD1   1 
ATOM   8555  C CD2   . PHE C 1 238 ? -1.517  -25.273 60.453  1.00 34.14 ? 238 PHE C CD2   1 
ATOM   8556  C CE1   . PHE C 1 238 ? -3.085  -24.058 58.619  1.00 31.32 ? 238 PHE C CE1   1 
ATOM   8557  C CE2   . PHE C 1 238 ? -1.687  -23.905 60.467  1.00 38.03 ? 238 PHE C CE2   1 
ATOM   8558  C CZ    . PHE C 1 238 ? -2.477  -23.321 59.543  1.00 31.04 ? 238 PHE C CZ    1 
ATOM   8559  N N     . ASN C 1 239 ? 0.193   -29.989 58.877  1.00 42.52 ? 239 ASN C N     1 
ATOM   8560  C CA    . ASN C 1 239 ? 0.834   -31.255 58.733  1.00 45.53 ? 239 ASN C CA    1 
ATOM   8561  C C     . ASN C 1 239 ? 2.107   -31.339 59.564  1.00 46.55 ? 239 ASN C C     1 
ATOM   8562  O O     . ASN C 1 239 ? 3.058   -30.549 59.346  1.00 48.44 ? 239 ASN C O     1 
ATOM   8563  C CB    . ASN C 1 239 ? 1.254   -31.330 57.263  1.00 47.51 ? 239 ASN C CB    1 
ATOM   8564  C CG    . ASN C 1 239 ? 1.364   -32.750 56.762  1.00 49.36 ? 239 ASN C CG    1 
ATOM   8565  O OD1   . ASN C 1 239 ? 0.451   -33.537 56.963  1.00 54.33 ? 239 ASN C OD1   1 
ATOM   8566  N ND2   . ASN C 1 239 ? 2.490   -33.087 56.094  1.00 51.97 ? 239 ASN C ND2   1 
ATOM   8567  N N     . LYS C 1 240 ? 2.228   -32.265 60.495  1.00 45.72 ? 240 LYS C N     1 
ATOM   8568  C CA    . LYS C 1 240 ? 3.489   -32.135 61.197  1.00 46.32 ? 240 LYS C CA    1 
ATOM   8569  C C     . LYS C 1 240 ? 4.767   -32.867 60.656  1.00 45.50 ? 240 LYS C C     1 
ATOM   8570  O O     . LYS C 1 240 ? 5.856   -32.561 61.127  1.00 46.08 ? 240 LYS C O     1 
ATOM   8571  C CB    . LYS C 1 240 ? 3.329   -32.059 62.722  1.00 47.35 ? 240 LYS C CB    1 
ATOM   8572  C CG    . LYS C 1 240 ? 2.497   -30.852 63.199  1.00 48.87 ? 240 LYS C CG    1 
ATOM   8573  C CD    . LYS C 1 240 ? 3.017   -30.383 64.582  1.00 53.72 ? 240 LYS C CD    1 
ATOM   8574  C CE    . LYS C 1 240 ? 1.947   -29.537 65.292  1.00 52.12 ? 240 LYS C CE    1 
ATOM   8575  N NZ    . LYS C 1 240 ? 2.507   -28.736 66.407  1.00 48.60 ? 240 LYS C NZ    1 
ATOM   8576  N N     . PHE C 1 241 ? 4.629   -33.731 59.637  1.00 43.94 ? 241 PHE C N     1 
ATOM   8577  C CA    . PHE C 1 241 ? 5.703   -34.012 58.675  1.00 43.23 ? 241 PHE C CA    1 
ATOM   8578  C C     . PHE C 1 241 ? 5.679   -33.060 57.499  1.00 41.73 ? 241 PHE C C     1 
ATOM   8579  O O     . PHE C 1 241 ? 4.726   -33.062 56.699  1.00 41.72 ? 241 PHE C O     1 
ATOM   8580  C CB    . PHE C 1 241 ? 5.644   -35.480 58.168  1.00 46.04 ? 241 PHE C CB    1 
ATOM   8581  C CG    . PHE C 1 241 ? 6.013   -36.486 59.222  1.00 46.33 ? 241 PHE C CG    1 
ATOM   8582  C CD1   . PHE C 1 241 ? 5.054   -37.298 59.794  1.00 50.53 ? 241 PHE C CD1   1 
ATOM   8583  C CD2   . PHE C 1 241 ? 7.336   -36.592 59.668  1.00 51.53 ? 241 PHE C CD2   1 
ATOM   8584  C CE1   . PHE C 1 241 ? 5.424   -38.205 60.800  1.00 51.47 ? 241 PHE C CE1   1 
ATOM   8585  C CE2   . PHE C 1 241 ? 7.690   -37.498 60.710  1.00 51.62 ? 241 PHE C CE2   1 
ATOM   8586  C CZ    . PHE C 1 241 ? 6.743   -38.289 61.247  1.00 47.98 ? 241 PHE C CZ    1 
ATOM   8587  N N     . ARG C 1 242 ? 6.703   -32.212 57.417  1.00 39.63 ? 242 ARG C N     1 
ATOM   8588  C CA    . ARG C 1 242 ? 6.789   -31.162 56.409  1.00 38.01 ? 242 ARG C CA    1 
ATOM   8589  C C     . ARG C 1 242 ? 7.214   -31.856 55.109  1.00 38.71 ? 242 ARG C C     1 
ATOM   8590  O O     . ARG C 1 242 ? 8.249   -32.553 55.050  1.00 37.51 ? 242 ARG C O     1 
ATOM   8591  C CB    . ARG C 1 242 ? 7.788   -29.997 56.764  1.00 35.59 ? 242 ARG C CB    1 
ATOM   8592  C CG    . ARG C 1 242 ? 7.563   -29.310 58.115  1.00 31.62 ? 242 ARG C CG    1 
ATOM   8593  C CD    . ARG C 1 242 ? 8.694   -28.233 58.459  1.00 37.60 ? 242 ARG C CD    1 
ATOM   8594  N NE    . ARG C 1 242 ? 10.034  -28.832 58.598  1.00 30.83 ? 242 ARG C NE    1 
ATOM   8595  C CZ    . ARG C 1 242 ? 10.415  -29.510 59.665  1.00 26.36 ? 242 ARG C CZ    1 
ATOM   8596  N NH1   . ARG C 1 242 ? 9.544   -29.579 60.662  1.00 28.46 ? 242 ARG C NH1   1 
ATOM   8597  N NH2   . ARG C 1 242 ? 11.624  -30.115 59.733  1.00 17.57 ? 242 ARG C NH2   1 
ATOM   8598  N N     . VAL C 1 243 ? 6.407   -31.659 54.071  1.00 38.85 ? 243 VAL C N     1 
ATOM   8599  C CA    . VAL C 1 243 ? 6.788   -32.073 52.754  1.00 39.34 ? 243 VAL C CA    1 
ATOM   8600  C C     . VAL C 1 243 ? 8.213   -31.580 52.407  1.00 39.22 ? 243 VAL C C     1 
ATOM   8601  O O     . VAL C 1 243 ? 8.573   -30.458 52.646  1.00 40.23 ? 243 VAL C O     1 
ATOM   8602  C CB    . VAL C 1 243 ? 5.664   -31.763 51.700  1.00 39.82 ? 243 VAL C CB    1 
ATOM   8603  C CG1   . VAL C 1 243 ? 4.958   -30.396 51.983  1.00 42.42 ? 243 VAL C CG1   1 
ATOM   8604  C CG2   . VAL C 1 243 ? 6.149   -31.932 50.258  1.00 35.11 ? 243 VAL C CG2   1 
ATOM   8605  N N     . PRO C 1 244 ? 9.072   -32.463 51.934  1.00 39.77 ? 244 PRO C N     1 
ATOM   8606  C CA    . PRO C 1 244 ? 10.364  -31.952 51.465  1.00 38.87 ? 244 PRO C CA    1 
ATOM   8607  C C     . PRO C 1 244 ? 10.319  -30.925 50.344  1.00 37.16 ? 244 PRO C C     1 
ATOM   8608  O O     . PRO C 1 244 ? 9.370   -30.895 49.601  1.00 37.70 ? 244 PRO C O     1 
ATOM   8609  C CB    . PRO C 1 244 ? 11.139  -33.226 51.082  1.00 40.82 ? 244 PRO C CB    1 
ATOM   8610  C CG    . PRO C 1 244 ? 10.517  -34.319 51.986  1.00 41.59 ? 244 PRO C CG    1 
ATOM   8611  C CD    . PRO C 1 244 ? 9.015   -33.938 51.913  1.00 40.78 ? 244 PRO C CD    1 
ATOM   8612  N N     . THR C 1 245 ? 11.352  -30.075 50.273  1.00 34.69 ? 245 THR C N     1 
ATOM   8613  C CA    . THR C 1 245 ? 11.299  -28.819 49.586  1.00 32.71 ? 245 THR C CA    1 
ATOM   8614  C C     . THR C 1 245 ? 11.961  -28.976 48.270  1.00 32.78 ? 245 THR C C     1 
ATOM   8615  O O     . THR C 1 245 ? 12.678  -29.925 48.079  1.00 32.64 ? 245 THR C O     1 
ATOM   8616  C CB    . THR C 1 245 ? 12.068  -27.745 50.360  1.00 32.89 ? 245 THR C CB    1 
ATOM   8617  O OG1   . THR C 1 245 ? 13.427  -28.177 50.516  1.00 29.04 ? 245 THR C OG1   1 
ATOM   8618  C CG2   . THR C 1 245 ? 11.413  -27.472 51.747  1.00 30.07 ? 245 THR C CG2   1 
ATOM   8619  N N     . PHE C 1 246 ? 11.770  -28.033 47.349  1.00 33.26 ? 246 PHE C N     1 
ATOM   8620  C CA    . PHE C 1 246 ? 12.517  -28.125 46.069  1.00 33.72 ? 246 PHE C CA    1 
ATOM   8621  C C     . PHE C 1 246 ? 14.023  -28.061 46.255  1.00 34.99 ? 246 PHE C C     1 
ATOM   8622  O O     . PHE C 1 246 ? 14.786  -28.643 45.444  1.00 35.51 ? 246 PHE C O     1 
ATOM   8623  C CB    . PHE C 1 246 ? 12.129  -27.023 45.098  1.00 33.88 ? 246 PHE C CB    1 
ATOM   8624  C CG    . PHE C 1 246 ? 10.768  -27.174 44.503  1.00 31.39 ? 246 PHE C CG    1 
ATOM   8625  C CD1   . PHE C 1 246 ? 9.819   -26.152 44.657  1.00 28.67 ? 246 PHE C CD1   1 
ATOM   8626  C CD2   . PHE C 1 246 ? 10.456  -28.273 43.727  1.00 27.89 ? 246 PHE C CD2   1 
ATOM   8627  C CE1   . PHE C 1 246 ? 8.526   -26.243 44.079  1.00 27.19 ? 246 PHE C CE1   1 
ATOM   8628  C CE2   . PHE C 1 246 ? 9.156   -28.395 43.129  1.00 29.04 ? 246 PHE C CE2   1 
ATOM   8629  C CZ    . PHE C 1 246 ? 8.212   -27.363 43.291  1.00 32.40 ? 246 PHE C CZ    1 
ATOM   8630  N N     . LEU C 1 247 ? 14.454  -27.391 47.316  1.00 33.48 ? 247 LEU C N     1 
ATOM   8631  C CA    . LEU C 1 247 ? 15.859  -27.189 47.463  1.00 35.72 ? 247 LEU C CA    1 
ATOM   8632  C C     . LEU C 1 247 ? 16.534  -28.500 47.882  1.00 35.84 ? 247 LEU C C     1 
ATOM   8633  O O     . LEU C 1 247 ? 17.519  -28.857 47.289  1.00 36.74 ? 247 LEU C O     1 
ATOM   8634  C CB    . LEU C 1 247 ? 16.180  -25.941 48.364  1.00 34.72 ? 247 LEU C CB    1 
ATOM   8635  C CG    . LEU C 1 247 ? 17.615  -25.803 48.831  1.00 36.19 ? 247 LEU C CG    1 
ATOM   8636  C CD1   . LEU C 1 247 ? 18.515  -24.908 47.933  1.00 36.33 ? 247 LEU C CD1   1 
ATOM   8637  C CD2   . LEU C 1 247 ? 17.662  -25.416 50.357  1.00 33.87 ? 247 LEU C CD2   1 
ATOM   8638  N N     . SER C 1 248 ? 15.966  -29.209 48.851  1.00 35.80 ? 248 SER C N     1 
ATOM   8639  C CA    . SER C 1 248 ? 16.359  -30.576 49.251  1.00 36.98 ? 248 SER C CA    1 
ATOM   8640  C C     . SER C 1 248 ? 16.601  -31.673 48.087  1.00 37.51 ? 248 SER C C     1 
ATOM   8641  O O     . SER C 1 248 ? 17.421  -32.614 48.255  1.00 38.18 ? 248 SER C O     1 
ATOM   8642  C CB    . SER C 1 248 ? 15.293  -31.098 50.204  1.00 34.79 ? 248 SER C CB    1 
ATOM   8643  O OG    . SER C 1 248 ? 14.131  -31.449 49.432  1.00 36.84 ? 248 SER C OG    1 
ATOM   8644  N N     . MET C 1 249 ? 15.879  -31.550 46.977  1.00 37.02 ? 249 MET C N     1 
ATOM   8645  C CA    . MET C 1 249 ? 16.057  -32.345 45.766  1.00 38.04 ? 249 MET C CA    1 
ATOM   8646  C C     . MET C 1 249 ? 16.834  -31.636 44.606  1.00 37.97 ? 249 MET C C     1 
ATOM   8647  O O     . MET C 1 249 ? 16.786  -32.069 43.431  1.00 38.10 ? 249 MET C O     1 
ATOM   8648  C CB    . MET C 1 249 ? 14.673  -32.770 45.271  1.00 38.35 ? 249 MET C CB    1 
ATOM   8649  C CG    . MET C 1 249 ? 13.719  -31.652 44.934  1.00 39.04 ? 249 MET C CG    1 
ATOM   8650  S SD    . MET C 1 249 ? 12.030  -32.257 44.621  1.00 43.89 ? 249 MET C SD    1 
ATOM   8651  C CE    . MET C 1 249 ? 12.498  -33.341 43.236  1.00 45.21 ? 249 MET C CE    1 
ATOM   8652  N N     . ASP C 1 250 ? 17.564  -30.566 44.933  1.00 38.01 ? 250 ASP C N     1 
ATOM   8653  C CA    . ASP C 1 250 ? 18.117  -29.691 43.907  1.00 38.01 ? 250 ASP C CA    1 
ATOM   8654  C C     . ASP C 1 250 ? 19.511  -30.095 43.446  1.00 37.37 ? 250 ASP C C     1 
ATOM   8655  O O     . ASP C 1 250 ? 20.503  -29.326 43.601  1.00 34.83 ? 250 ASP C O     1 
ATOM   8656  C CB    . ASP C 1 250 ? 18.071  -28.223 44.359  1.00 38.31 ? 250 ASP C CB    1 
ATOM   8657  C CG    . ASP C 1 250 ? 18.541  -27.302 43.282  1.00 39.87 ? 250 ASP C CG    1 
ATOM   8658  O OD1   . ASP C 1 250 ? 18.266  -27.608 42.106  1.00 42.87 ? 250 ASP C OD1   1 
ATOM   8659  O OD2   . ASP C 1 250 ? 19.243  -26.328 43.603  1.00 41.24 ? 250 ASP C OD2   1 
ATOM   8660  N N     . VAL C 1 251 ? 19.576  -31.338 42.918  1.00 38.97 ? 251 VAL C N     1 
ATOM   8661  C CA    . VAL C 1 251 ? 20.801  -31.952 42.420  1.00 37.69 ? 251 VAL C CA    1 
ATOM   8662  C C     . VAL C 1 251 ? 21.477  -31.087 41.398  1.00 37.67 ? 251 VAL C C     1 
ATOM   8663  O O     . VAL C 1 251 ? 22.702  -31.109 41.342  1.00 38.25 ? 251 VAL C O     1 
ATOM   8664  C CB    . VAL C 1 251 ? 20.628  -33.521 42.011  1.00 39.53 ? 251 VAL C CB    1 
ATOM   8665  C CG1   . VAL C 1 251 ? 19.489  -33.780 41.012  1.00 41.98 ? 251 VAL C CG1   1 
ATOM   8666  C CG2   . VAL C 1 251 ? 21.912  -34.136 41.492  1.00 39.75 ? 251 VAL C CG2   1 
ATOM   8667  N N     . ASP C 1 252 ? 20.728  -30.251 40.653  1.00 37.83 ? 252 ASP C N     1 
ATOM   8668  C CA    . ASP C 1 252 ? 21.342  -29.490 39.536  1.00 38.31 ? 252 ASP C CA    1 
ATOM   8669  C C     . ASP C 1 252 ? 21.851  -28.102 39.834  1.00 38.07 ? 252 ASP C C     1 
ATOM   8670  O O     . ASP C 1 252 ? 22.462  -27.475 38.945  1.00 35.65 ? 252 ASP C O     1 
ATOM   8671  C CB    . ASP C 1 252 ? 20.380  -29.227 38.381  1.00 38.62 ? 252 ASP C CB    1 
ATOM   8672  C CG    . ASP C 1 252 ? 19.929  -30.486 37.674  1.00 42.04 ? 252 ASP C CG    1 
ATOM   8673  O OD1   . ASP C 1 252 ? 20.654  -31.525 37.703  1.00 40.73 ? 252 ASP C OD1   1 
ATOM   8674  O OD2   . ASP C 1 252 ? 18.797  -30.399 37.144  1.00 44.12 ? 252 ASP C OD2   1 
ATOM   8675  N N     . GLY C 1 253 ? 21.504  -27.574 41.011  1.00 36.61 ? 253 GLY C N     1 
ATOM   8676  C CA    . GLY C 1 253 ? 21.709  -26.137 41.255  1.00 34.84 ? 253 GLY C CA    1 
ATOM   8677  C C     . GLY C 1 253 ? 20.719  -25.288 40.485  1.00 33.06 ? 253 GLY C C     1 
ATOM   8678  O O     . GLY C 1 253 ? 21.079  -24.246 40.037  1.00 35.37 ? 253 GLY C O     1 
ATOM   8679  N N     . ARG C 1 254 ? 19.454  -25.697 40.356  1.00 32.32 ? 254 ARG C N     1 
ATOM   8680  C CA    . ARG C 1 254 ? 18.473  -24.896 39.639  1.00 31.02 ? 254 ARG C CA    1 
ATOM   8681  C C     . ARG C 1 254 ? 17.390  -24.199 40.492  1.00 29.87 ? 254 ARG C C     1 
ATOM   8682  O O     . ARG C 1 254 ? 16.426  -23.669 39.933  1.00 28.28 ? 254 ARG C O     1 
ATOM   8683  C CB    . ARG C 1 254 ? 17.823  -25.664 38.468  1.00 29.63 ? 254 ARG C CB    1 
ATOM   8684  C CG    . ARG C 1 254 ? 16.789  -26.771 38.888  1.00 33.17 ? 254 ARG C CG    1 
ATOM   8685  C CD    . ARG C 1 254 ? 16.224  -27.500 37.666  1.00 31.59 ? 254 ARG C CD    1 
ATOM   8686  N NE    . ARG C 1 254 ? 17.336  -27.963 36.823  1.00 32.49 ? 254 ARG C NE    1 
ATOM   8687  C CZ    . ARG C 1 254 ? 17.754  -27.303 35.753  1.00 33.86 ? 254 ARG C CZ    1 
ATOM   8688  N NH1   . ARG C 1 254 ? 17.176  -26.139 35.407  1.00 34.11 ? 254 ARG C NH1   1 
ATOM   8689  N NH2   . ARG C 1 254 ? 18.780  -27.767 35.058  1.00 35.32 ? 254 ARG C NH2   1 
ATOM   8690  N N     . VAL C 1 255 ? 17.532  -24.208 41.825  1.00 30.90 ? 255 VAL C N     1 
ATOM   8691  C CA    . VAL C 1 255 ? 16.446  -23.640 42.694  1.00 28.87 ? 255 VAL C CA    1 
ATOM   8692  C C     . VAL C 1 255 ? 16.986  -22.462 43.431  1.00 30.34 ? 255 VAL C C     1 
ATOM   8693  O O     . VAL C 1 255 ? 18.077  -22.515 43.950  1.00 31.36 ? 255 VAL C O     1 
ATOM   8694  C CB    . VAL C 1 255 ? 15.978  -24.691 43.672  1.00 29.61 ? 255 VAL C CB    1 
ATOM   8695  C CG1   . VAL C 1 255 ? 15.190  -24.093 44.950  1.00 24.52 ? 255 VAL C CG1   1 
ATOM   8696  C CG2   . VAL C 1 255 ? 15.182  -25.830 42.917  1.00 27.01 ? 255 VAL C CG2   1 
ATOM   8697  N N     . ILE C 1 256 ? 16.210  -21.389 43.510  1.00 32.36 ? 256 ILE C N     1 
ATOM   8698  C CA    . ILE C 1 256 ? 16.451  -20.370 44.487  1.00 32.74 ? 256 ILE C CA    1 
ATOM   8699  C C     . ILE C 1 256 ? 15.280  -20.489 45.508  1.00 33.01 ? 256 ILE C C     1 
ATOM   8700  O O     . ILE C 1 256 ? 14.134  -20.614 45.154  1.00 33.16 ? 256 ILE C O     1 
ATOM   8701  C CB    . ILE C 1 256 ? 16.495  -18.990 43.723  1.00 35.32 ? 256 ILE C CB    1 
ATOM   8702  C CG1   . ILE C 1 256 ? 17.638  -18.919 42.695  1.00 37.16 ? 256 ILE C CG1   1 
ATOM   8703  C CG2   . ILE C 1 256 ? 16.552  -17.764 44.608  1.00 33.40 ? 256 ILE C CG2   1 
ATOM   8704  C CD1   . ILE C 1 256 ? 17.336  -17.836 41.551  1.00 31.95 ? 256 ILE C CD1   1 
ATOM   8705  N N     . ARG C 1 257 ? 15.623  -20.400 46.791  1.00 33.49 ? 257 ARG C N     1 
ATOM   8706  C CA    . ARG C 1 257 ? 14.623  -20.287 47.852  1.00 30.32 ? 257 ARG C CA    1 
ATOM   8707  C C     . ARG C 1 257 ? 14.563  -18.889 48.474  1.00 29.18 ? 257 ARG C C     1 
ATOM   8708  O O     . ARG C 1 257 ? 15.591  -18.305 48.812  1.00 27.58 ? 257 ARG C O     1 
ATOM   8709  C CB    . ARG C 1 257 ? 14.874  -21.334 48.938  1.00 31.72 ? 257 ARG C CB    1 
ATOM   8710  C CG    . ARG C 1 257 ? 14.130  -21.070 50.238  1.00 28.23 ? 257 ARG C CG    1 
ATOM   8711  C CD    . ARG C 1 257 ? 14.148  -22.238 51.213  1.00 35.73 ? 257 ARG C CD    1 
ATOM   8712  N NE    . ARG C 1 257 ? 13.196  -23.279 50.835  1.00 39.97 ? 257 ARG C NE    1 
ATOM   8713  C CZ    . ARG C 1 257 ? 12.175  -23.665 51.589  1.00 32.70 ? 257 ARG C CZ    1 
ATOM   8714  N NH1   . ARG C 1 257 ? 11.968  -23.096 52.769  1.00 36.13 ? 257 ARG C NH1   1 
ATOM   8715  N NH2   . ARG C 1 257 ? 11.359  -24.620 51.166  1.00 32.50 ? 257 ARG C NH2   1 
ATOM   8716  N N     . ALA C 1 258 ? 13.348  -18.365 48.618  1.00 28.00 ? 258 ALA C N     1 
ATOM   8717  C CA    . ALA C 1 258 ? 13.031  -17.339 49.643  1.00 27.49 ? 258 ALA C CA    1 
ATOM   8718  C C     . ALA C 1 258 ? 12.457  -18.027 50.870  1.00 26.01 ? 258 ALA C C     1 
ATOM   8719  O O     . ALA C 1 258 ? 11.390  -18.666 50.718  1.00 26.16 ? 258 ALA C O     1 
ATOM   8720  C CB    . ALA C 1 258 ? 11.946  -16.421 49.129  1.00 25.65 ? 258 ALA C CB    1 
ATOM   8721  N N     . ASP C 1 259 ? 13.096  -17.856 52.039  1.00 24.73 ? 259 ASP C N     1 
ATOM   8722  C CA    . ASP C 1 259 ? 12.453  -17.999 53.404  1.00 24.19 ? 259 ASP C CA    1 
ATOM   8723  C C     . ASP C 1 259 ? 12.187  -16.627 54.089  1.00 25.45 ? 259 ASP C C     1 
ATOM   8724  O O     . ASP C 1 259 ? 12.917  -15.635 53.846  1.00 25.07 ? 259 ASP C O     1 
ATOM   8725  C CB    . ASP C 1 259 ? 13.395  -18.769 54.307  1.00 24.24 ? 259 ASP C CB    1 
ATOM   8726  C CG    . ASP C 1 259 ? 13.476  -20.252 53.947  1.00 28.45 ? 259 ASP C CG    1 
ATOM   8727  O OD1   . ASP C 1 259 ? 12.622  -21.033 54.434  1.00 32.90 ? 259 ASP C OD1   1 
ATOM   8728  O OD2   . ASP C 1 259 ? 14.382  -20.628 53.190  1.00 27.50 ? 259 ASP C OD2   1 
ATOM   8729  N N     . SER C 1 260 ? 11.115  -16.567 54.869  1.00 27.51 ? 260 SER C N     1 
ATOM   8730  C CA    . SER C 1 260 ? 10.953  -15.547 55.841  1.00 28.93 ? 260 SER C CA    1 
ATOM   8731  C C     . SER C 1 260 ? 10.623  -16.010 57.247  1.00 28.48 ? 260 SER C C     1 
ATOM   8732  O O     . SER C 1 260 ? 10.114  -17.078 57.472  1.00 29.41 ? 260 SER C O     1 
ATOM   8733  C CB    . SER C 1 260 ? 9.976   -14.425 55.435  1.00 30.29 ? 260 SER C CB    1 
ATOM   8734  O OG    . SER C 1 260 ? 8.722   -14.873 55.247  1.00 27.93 ? 260 SER C OG    1 
ATOM   8735  N N     . PHE C 1 261 ? 10.935  -15.122 58.158  1.00 27.90 ? 261 PHE C N     1 
ATOM   8736  C CA    . PHE C 1 261 ? 10.598  -15.114 59.539  1.00 26.11 ? 261 PHE C CA    1 
ATOM   8737  C C     . PHE C 1 261 ? 9.366   -14.259 59.788  1.00 26.84 ? 261 PHE C C     1 
ATOM   8738  O O     . PHE C 1 261 ? 8.885   -14.177 60.894  1.00 29.04 ? 261 PHE C O     1 
ATOM   8739  C CB    . PHE C 1 261 ? 11.793  -14.446 60.245  1.00 29.05 ? 261 PHE C CB    1 
ATOM   8740  C CG    . PHE C 1 261 ? 13.050  -15.342 60.439  1.00 25.77 ? 261 PHE C CG    1 
ATOM   8741  C CD1   . PHE C 1 261 ? 12.944  -16.726 60.709  1.00 30.96 ? 261 PHE C CD1   1 
ATOM   8742  C CD2   . PHE C 1 261 ? 14.322  -14.768 60.383  1.00 34.71 ? 261 PHE C CD2   1 
ATOM   8743  C CE1   . PHE C 1 261 ? 14.066  -17.559 60.925  1.00 27.41 ? 261 PHE C CE1   1 
ATOM   8744  C CE2   . PHE C 1 261 ? 15.501  -15.573 60.630  1.00 35.13 ? 261 PHE C CE2   1 
ATOM   8745  C CZ    . PHE C 1 261 ? 15.351  -16.978 60.902  1.00 30.58 ? 261 PHE C CZ    1 
ATOM   8746  N N     . SER C 1 262 ? 8.763   -13.641 58.787  1.00 28.17 ? 262 SER C N     1 
ATOM   8747  C CA    . SER C 1 262 ? 7.725   -12.550 59.058  1.00 27.17 ? 262 SER C CA    1 
ATOM   8748  C C     . SER C 1 262 ? 6.487   -13.112 59.811  1.00 28.82 ? 262 SER C C     1 
ATOM   8749  O O     . SER C 1 262 ? 5.706   -12.340 60.431  1.00 26.70 ? 262 SER C O     1 
ATOM   8750  C CB    . SER C 1 262 ? 7.189   -11.985 57.761  1.00 25.26 ? 262 SER C CB    1 
ATOM   8751  O OG    . SER C 1 262 ? 8.113   -10.974 57.246  1.00 28.81 ? 262 SER C OG    1 
HETATM 8752  N N1    . LLP C 1 263 ? 5.267   -13.790 49.963  1.00 34.47 ? 263 LLP C N1    1 
HETATM 8753  C C2    . LLP C 1 263 ? 3.932   -14.128 50.208  1.00 33.07 ? 263 LLP C C2    1 
HETATM 8754  C "C2'" . LLP C 1 263 ? 3.048   -14.688 49.168  1.00 29.90 ? 263 LLP C "C2'" 1 
HETATM 8755  C C3    . LLP C 1 263 ? 3.421   -13.972 51.486  1.00 32.50 ? 263 LLP C C3    1 
HETATM 8756  O O3    . LLP C 1 263 ? 2.255   -14.285 51.672  1.00 35.31 ? 263 LLP C O3    1 
HETATM 8757  C C4    . LLP C 1 263 ? 4.247   -13.535 52.512  1.00 31.22 ? 263 LLP C C4    1 
HETATM 8758  C "C4'" . LLP C 1 263 ? 3.722   -13.284 53.867  1.00 33.39 ? 263 LLP C "C4'" 1 
HETATM 8759  C C5    . LLP C 1 263 ? 5.571   -13.171 52.263  1.00 31.56 ? 263 LLP C C5    1 
HETATM 8760  C C6    . LLP C 1 263 ? 6.093   -13.330 50.982  1.00 28.50 ? 263 LLP C C6    1 
HETATM 8761  C "C5'" . LLP C 1 263 ? 6.455   -12.630 53.346  1.00 29.88 ? 263 LLP C "C5'" 1 
HETATM 8762  O OP4   . LLP C 1 263 ? 7.273   -11.529 52.898  1.00 31.43 ? 263 LLP C OP4   1 
HETATM 8763  P P     . LLP C 1 263 ? 8.347   -10.736 53.791  1.00 28.54 ? 263 LLP C P     1 
HETATM 8764  O OP1   . LLP C 1 263 ? 7.617   -10.186 54.981  1.00 34.42 ? 263 LLP C OP1   1 
HETATM 8765  O OP2   . LLP C 1 263 ? 9.168   -11.939 54.096  1.00 37.38 ? 263 LLP C OP2   1 
HETATM 8766  O OP3   . LLP C 1 263 ? 8.972   -9.774  52.909  1.00 31.11 ? 263 LLP C OP3   1 
HETATM 8767  N N     . LLP C 1 263 ? 6.289   -14.444 59.666  1.00 27.45 ? 263 LLP C N     1 
HETATM 8768  C CA    . LLP C 1 263 ? 5.068   -15.080 60.159  1.00 29.96 ? 263 LLP C CA    1 
HETATM 8769  C CB    . LLP C 1 263 ? 4.384   -16.076 59.167  1.00 29.59 ? 263 LLP C CB    1 
HETATM 8770  C CG    . LLP C 1 263 ? 3.635   -15.454 57.932  1.00 28.50 ? 263 LLP C CG    1 
HETATM 8771  C CD    . LLP C 1 263 ? 4.566   -14.999 56.783  1.00 30.97 ? 263 LLP C CD    1 
HETATM 8772  C CE    . LLP C 1 263 ? 3.969   -13.750 56.018  1.00 29.44 ? 263 LLP C CE    1 
HETATM 8773  N NZ    . LLP C 1 263 ? 3.388   -14.206 54.696  1.00 32.87 ? 263 LLP C NZ    1 
HETATM 8774  C C     . LLP C 1 263 ? 5.361   -15.742 61.507  1.00 30.61 ? 263 LLP C C     1 
HETATM 8775  O O     . LLP C 1 263 ? 4.445   -15.776 62.314  1.00 30.95 ? 263 LLP C O     1 
ATOM   8776  N N     . ILE C 1 264 ? 6.635   -16.153 61.752  1.00 31.18 ? 264 ILE C N     1 
ATOM   8777  C CA    . ILE C 1 264 ? 7.053   -16.806 63.019  1.00 32.98 ? 264 ILE C CA    1 
ATOM   8778  C C     . ILE C 1 264 ? 7.893   -15.961 63.943  1.00 33.53 ? 264 ILE C C     1 
ATOM   8779  O O     . ILE C 1 264 ? 7.759   -16.103 65.187  1.00 34.34 ? 264 ILE C O     1 
ATOM   8780  C CB    . ILE C 1 264 ? 7.798   -18.195 62.793  1.00 35.23 ? 264 ILE C CB    1 
ATOM   8781  C CG1   . ILE C 1 264 ? 8.697   -18.045 61.580  1.00 38.08 ? 264 ILE C CG1   1 
ATOM   8782  C CG2   . ILE C 1 264 ? 6.720   -19.324 62.550  1.00 30.51 ? 264 ILE C CG2   1 
ATOM   8783  C CD1   . ILE C 1 264 ? 10.094  -18.655 61.764  1.00 47.96 ? 264 ILE C CD1   1 
ATOM   8784  N N     . ILE C 1 265 ? 8.742   -15.073 63.409  1.00 32.45 ? 265 ILE C N     1 
ATOM   8785  C CA    . ILE C 1 265 ? 9.425   -14.186 64.354  1.00 32.47 ? 265 ILE C CA    1 
ATOM   8786  C C     . ILE C 1 265 ? 9.162   -12.680 64.361  1.00 30.81 ? 265 ILE C C     1 
ATOM   8787  O O     . ILE C 1 265 ? 9.089   -12.115 65.460  1.00 31.96 ? 265 ILE C O     1 
ATOM   8788  C CB    . ILE C 1 265 ? 10.948  -14.555 64.769  1.00 32.61 ? 265 ILE C CB    1 
ATOM   8789  C CG1   . ILE C 1 265 ? 11.938  -13.465 64.325  1.00 33.33 ? 265 ILE C CG1   1 
ATOM   8790  C CG2   . ILE C 1 265 ? 11.386  -16.096 64.590  1.00 31.18 ? 265 ILE C CG2   1 
ATOM   8791  C CD1   . ILE C 1 265 ? 12.088  -13.338 62.795  1.00 39.64 ? 265 ILE C CD1   1 
ATOM   8792  N N     . SER C 1 266 ? 9.066   -12.037 63.183  1.00 29.63 ? 266 SER C N     1 
ATOM   8793  C CA    . SER C 1 266 ? 8.659   -10.662 63.069  1.00 27.03 ? 266 SER C CA    1 
ATOM   8794  C C     . SER C 1 266 ? 8.563   -10.191 61.628  1.00 27.45 ? 266 SER C C     1 
ATOM   8795  O O     . SER C 1 266 ? 9.548   -10.203 60.908  1.00 26.91 ? 266 SER C O     1 
ATOM   8796  C CB    . SER C 1 266 ? 9.645   -9.731  63.735  1.00 25.66 ? 266 SER C CB    1 
ATOM   8797  O OG    . SER C 1 266 ? 9.051   -8.452  63.653  1.00 31.05 ? 266 SER C OG    1 
ATOM   8798  N N     . SER C 1 267 ? 7.390   -9.673  61.238  1.00 27.64 ? 267 SER C N     1 
ATOM   8799  C CA    . SER C 1 267 ? 7.214   -9.044  59.917  1.00 26.42 ? 267 SER C CA    1 
ATOM   8800  C C     . SER C 1 267 ? 7.915   -7.649  59.769  1.00 26.67 ? 267 SER C C     1 
ATOM   8801  O O     . SER C 1 267 ? 8.473   -7.250  58.682  1.00 23.11 ? 267 SER C O     1 
ATOM   8802  C CB    . SER C 1 267 ? 5.737   -9.004  59.578  1.00 25.84 ? 267 SER C CB    1 
ATOM   8803  O OG    . SER C 1 267 ? 4.838   -8.816  60.675  1.00 22.25 ? 267 SER C OG    1 
ATOM   8804  N N     . GLY C 1 268 ? 7.945   -6.983  60.914  1.00 24.43 ? 268 GLY C N     1 
ATOM   8805  C CA    . GLY C 1 268 ? 8.269   -5.570  60.934  1.00 25.73 ? 268 GLY C CA    1 
ATOM   8806  C C     . GLY C 1 268 ? 9.711   -5.351  61.175  1.00 26.25 ? 268 GLY C C     1 
ATOM   8807  O O     . GLY C 1 268 ? 10.170  -4.233  61.039  1.00 27.12 ? 268 GLY C O     1 
ATOM   8808  N N     . LEU C 1 269 ? 10.451  -6.415  61.584  1.00 26.80 ? 269 LEU C N     1 
ATOM   8809  C CA    . LEU C 1 269 ? 11.931  -6.323  61.524  1.00 25.37 ? 269 LEU C CA    1 
ATOM   8810  C C     . LEU C 1 269 ? 12.574  -6.326  60.147  1.00 24.48 ? 269 LEU C C     1 
ATOM   8811  O O     . LEU C 1 269 ? 13.657  -5.904  60.027  1.00 25.83 ? 269 LEU C O     1 
ATOM   8812  C CB    . LEU C 1 269 ? 12.637  -7.314  62.447  1.00 26.44 ? 269 LEU C CB    1 
ATOM   8813  C CG    . LEU C 1 269 ? 12.295  -7.196  63.942  1.00 28.06 ? 269 LEU C CG    1 
ATOM   8814  C CD1   . LEU C 1 269 ? 13.154  -8.215  64.609  1.00 15.39 ? 269 LEU C CD1   1 
ATOM   8815  C CD2   . LEU C 1 269 ? 12.627  -5.770  64.426  1.00 27.41 ? 269 LEU C CD2   1 
ATOM   8816  N N     . ARG C 1 270 ? 11.947  -6.872  59.122  1.00 25.74 ? 270 ARG C N     1 
ATOM   8817  C CA    . ARG C 1 270 ? 12.496  -6.810  57.729  1.00 24.20 ? 270 ARG C CA    1 
ATOM   8818  C C     . ARG C 1 270 ? 13.759  -7.690  57.585  1.00 24.04 ? 270 ARG C C     1 
ATOM   8819  O O     . ARG C 1 270 ? 14.840  -7.237  57.247  1.00 23.74 ? 270 ARG C O     1 
ATOM   8820  C CB    . ARG C 1 270 ? 12.625  -5.312  57.230  1.00 25.26 ? 270 ARG C CB    1 
ATOM   8821  C CG    . ARG C 1 270 ? 11.235  -4.456  57.284  1.00 21.86 ? 270 ARG C CG    1 
ATOM   8822  C CD    . ARG C 1 270 ? 9.938   -5.122  56.861  1.00 25.28 ? 270 ARG C CD    1 
ATOM   8823  N NE    . ARG C 1 270 ? 9.883   -5.660  55.474  1.00 30.34 ? 270 ARG C NE    1 
ATOM   8824  C CZ    . ARG C 1 270 ? 9.505   -6.919  55.166  1.00 31.36 ? 270 ARG C CZ    1 
ATOM   8825  N NH1   . ARG C 1 270 ? 9.120   -7.801  56.120  1.00 24.64 ? 270 ARG C NH1   1 
ATOM   8826  N NH2   . ARG C 1 270 ? 9.491   -7.314  53.907  1.00 21.53 ? 270 ARG C NH2   1 
ATOM   8827  N N     . ILE C 1 271 ? 13.600  -9.002  57.809  1.00 26.50 ? 271 ILE C N     1 
ATOM   8828  C CA    . ILE C 1 271 ? 14.716  -9.988  57.806  1.00 27.25 ? 271 ILE C CA    1 
ATOM   8829  C C     . ILE C 1 271 ? 14.140  -11.365 57.400  1.00 27.90 ? 271 ILE C C     1 
ATOM   8830  O O     . ILE C 1 271 ? 13.300  -11.968 58.114  1.00 29.21 ? 271 ILE C O     1 
ATOM   8831  C CB    . ILE C 1 271 ? 15.420  -10.076 59.208  1.00 28.21 ? 271 ILE C CB    1 
ATOM   8832  C CG1   . ILE C 1 271 ? 15.808  -8.660  59.788  1.00 26.41 ? 271 ILE C CG1   1 
ATOM   8833  C CG2   . ILE C 1 271 ? 16.634  -11.044 59.146  1.00 27.83 ? 271 ILE C CG2   1 
ATOM   8834  C CD1   . ILE C 1 271 ? 17.218  -8.191  59.396  1.00 16.70 ? 271 ILE C CD1   1 
ATOM   8835  N N     . GLY C 1 272 ? 14.545  -11.784 56.215  1.00 28.82 ? 272 GLY C N     1 
ATOM   8836  C CA    . GLY C 1 272 ? 14.092  -12.948 55.477  1.00 26.88 ? 272 GLY C CA    1 
ATOM   8837  C C     . GLY C 1 272 ? 15.380  -13.426 54.764  1.00 27.45 ? 272 GLY C C     1 
ATOM   8838  O O     . GLY C 1 272 ? 16.432  -12.860 54.971  1.00 27.58 ? 272 GLY C O     1 
ATOM   8839  N N     . PHE C 1 273 ? 15.372  -14.552 54.075  1.00 27.31 ? 273 PHE C N     1 
ATOM   8840  C CA    . PHE C 1 273 ? 16.707  -15.003 53.537  1.00 28.36 ? 273 PHE C CA    1 
ATOM   8841  C C     . PHE C 1 273 ? 16.433  -15.714 52.271  1.00 26.42 ? 273 PHE C C     1 
ATOM   8842  O O     . PHE C 1 273 ? 15.310  -16.202 52.082  1.00 28.24 ? 273 PHE C O     1 
ATOM   8843  C CB    . PHE C 1 273 ? 17.551  -15.867 54.495  1.00 26.35 ? 273 PHE C CB    1 
ATOM   8844  C CG    . PHE C 1 273 ? 16.792  -16.860 55.271  1.00 28.00 ? 273 PHE C CG    1 
ATOM   8845  C CD1   . PHE C 1 273 ? 15.985  -16.456 56.364  1.00 26.10 ? 273 PHE C CD1   1 
ATOM   8846  C CD2   . PHE C 1 273 ? 16.938  -18.202 54.997  1.00 27.20 ? 273 PHE C CD2   1 
ATOM   8847  C CE1   . PHE C 1 273 ? 15.270  -17.341 57.094  1.00 20.67 ? 273 PHE C CE1   1 
ATOM   8848  C CE2   . PHE C 1 273 ? 16.261  -19.116 55.758  1.00 31.14 ? 273 PHE C CE2   1 
ATOM   8849  C CZ    . PHE C 1 273 ? 15.452  -18.685 56.840  1.00 28.10 ? 273 PHE C CZ    1 
ATOM   8850  N N     . LEU C 1 274 ? 17.444  -15.708 51.462  1.00 26.52 ? 274 LEU C N     1 
ATOM   8851  C CA    . LEU C 1 274 ? 17.478  -16.223 50.090  1.00 26.65 ? 274 LEU C CA    1 
ATOM   8852  C C     . LEU C 1 274 ? 18.591  -17.291 49.958  1.00 25.73 ? 274 LEU C C     1 
ATOM   8853  O O     . LEU C 1 274 ? 19.771  -17.054 50.335  1.00 23.44 ? 274 LEU C O     1 
ATOM   8854  C CB    . LEU C 1 274 ? 17.752  -15.037 49.183  1.00 27.07 ? 274 LEU C CB    1 
ATOM   8855  C CG    . LEU C 1 274 ? 17.446  -15.347 47.728  1.00 30.35 ? 274 LEU C CG    1 
ATOM   8856  C CD1   . LEU C 1 274 ? 15.945  -15.370 47.411  1.00 28.81 ? 274 LEU C CD1   1 
ATOM   8857  C CD2   . LEU C 1 274 ? 18.199  -14.336 46.958  1.00 32.08 ? 274 LEU C CD2   1 
ATOM   8858  N N     . THR C 1 275 ? 18.184  -18.501 49.521  1.00 25.88 ? 275 THR C N     1 
ATOM   8859  C CA    . THR C 1 275 ? 19.110  -19.647 49.391  1.00 26.45 ? 275 THR C CA    1 
ATOM   8860  C C     . THR C 1 275 ? 19.177  -20.056 47.879  1.00 25.72 ? 275 THR C C     1 
ATOM   8861  O O     . THR C 1 275 ? 18.187  -20.083 47.172  1.00 25.60 ? 275 THR C O     1 
ATOM   8862  C CB    . THR C 1 275 ? 18.808  -20.860 50.422  1.00 28.52 ? 275 THR C CB    1 
ATOM   8863  O OG1   . THR C 1 275 ? 18.409  -20.372 51.742  1.00 31.66 ? 275 THR C OG1   1 
ATOM   8864  C CG2   . THR C 1 275 ? 20.050  -21.699 50.622  1.00 25.43 ? 275 THR C CG2   1 
ATOM   8865  N N     . GLY C 1 276 ? 20.345  -20.239 47.314  1.00 27.46 ? 276 GLY C N     1 
ATOM   8866  C CA    . GLY C 1 276 ? 20.350  -20.520 45.873  1.00 26.90 ? 276 GLY C CA    1 
ATOM   8867  C C     . GLY C 1 276 ? 21.793  -20.599 45.467  1.00 29.05 ? 276 GLY C C     1 
ATOM   8868  O O     . GLY C 1 276 ? 22.658  -20.388 46.307  1.00 28.72 ? 276 GLY C O     1 
ATOM   8869  N N     . PRO C 1 277 ? 22.048  -20.947 44.176  1.00 30.81 ? 277 PRO C N     1 
ATOM   8870  C CA    . PRO C 1 277 ? 23.384  -21.231 43.612  1.00 30.33 ? 277 PRO C CA    1 
ATOM   8871  C C     . PRO C 1 277 ? 24.264  -19.993 43.796  1.00 32.18 ? 277 PRO C C     1 
ATOM   8872  O O     . PRO C 1 277 ? 23.809  -18.871 43.469  1.00 33.19 ? 277 PRO C O     1 
ATOM   8873  C CB    . PRO C 1 277 ? 23.110  -21.450 42.095  1.00 31.16 ? 277 PRO C CB    1 
ATOM   8874  C CG    . PRO C 1 277 ? 21.587  -21.523 41.900  1.00 30.43 ? 277 PRO C CG    1 
ATOM   8875  C CD    . PRO C 1 277 ? 20.924  -21.190 43.222  1.00 29.46 ? 277 PRO C CD    1 
ATOM   8876  N N     . LYS C 1 278 ? 25.510  -20.163 44.249  1.00 31.27 ? 278 LYS C N     1 
ATOM   8877  C CA    . LYS C 1 278 ? 26.366  -19.002 44.600  1.00 30.80 ? 278 LYS C CA    1 
ATOM   8878  C C     . LYS C 1 278 ? 26.455  -17.874 43.549  1.00 31.06 ? 278 LYS C C     1 
ATOM   8879  O O     . LYS C 1 278 ? 26.476  -16.730 43.954  1.00 30.41 ? 278 LYS C O     1 
ATOM   8880  C CB    . LYS C 1 278 ? 27.760  -19.488 45.012  1.00 31.37 ? 278 LYS C CB    1 
ATOM   8881  C CG    . LYS C 1 278 ? 28.828  -18.528 45.472  1.00 31.87 ? 278 LYS C CG    1 
ATOM   8882  C CD    . LYS C 1 278 ? 29.525  -18.946 46.841  1.00 38.21 ? 278 LYS C CD    1 
ATOM   8883  C CE    . LYS C 1 278 ? 29.710  -20.531 47.236  1.00 42.87 ? 278 LYS C CE    1 
ATOM   8884  N NZ    . LYS C 1 278 ? 29.444  -20.815 48.824  1.00 43.34 ? 278 LYS C NZ    1 
ATOM   8885  N N     . PRO C 1 279 ? 26.557  -18.196 42.208  1.00 30.88 ? 279 PRO C N     1 
ATOM   8886  C CA    . PRO C 1 279 ? 26.624  -17.109 41.179  1.00 30.14 ? 279 PRO C CA    1 
ATOM   8887  C C     . PRO C 1 279 ? 25.354  -16.276 41.054  1.00 29.70 ? 279 PRO C C     1 
ATOM   8888  O O     . PRO C 1 279 ? 25.438  -15.123 40.576  1.00 30.36 ? 279 PRO C O     1 
ATOM   8889  C CB    . PRO C 1 279 ? 26.791  -17.908 39.818  1.00 32.93 ? 279 PRO C CB    1 
ATOM   8890  C CG    . PRO C 1 279 ? 27.464  -19.314 40.274  1.00 31.16 ? 279 PRO C CG    1 
ATOM   8891  C CD    . PRO C 1 279 ? 26.631  -19.549 41.584  1.00 29.90 ? 279 PRO C CD    1 
ATOM   8892  N N     . LEU C 1 280 ? 24.181  -16.868 41.378  1.00 27.76 ? 280 LEU C N     1 
ATOM   8893  C CA    . LEU C 1 280 ? 22.925  -16.113 41.445  1.00 27.72 ? 280 LEU C CA    1 
ATOM   8894  C C     . LEU C 1 280 ? 22.711  -15.270 42.763  1.00 28.20 ? 280 LEU C C     1 
ATOM   8895  O O     . LEU C 1 280 ? 22.215  -14.133 42.709  1.00 27.50 ? 280 LEU C O     1 
ATOM   8896  C CB    . LEU C 1 280 ? 21.660  -16.985 41.117  1.00 25.21 ? 280 LEU C CB    1 
ATOM   8897  C CG    . LEU C 1 280 ? 21.586  -17.853 39.834  1.00 26.14 ? 280 LEU C CG    1 
ATOM   8898  C CD1   . LEU C 1 280 ? 20.236  -18.506 39.704  1.00 26.65 ? 280 LEU C CD1   1 
ATOM   8899  C CD2   . LEU C 1 280 ? 21.922  -17.202 38.488  1.00 22.60 ? 280 LEU C CD2   1 
ATOM   8900  N N     . ILE C 1 281 ? 23.071  -15.815 43.906  1.00 28.53 ? 281 ILE C N     1 
ATOM   8901  C CA    . ILE C 1 281 ? 23.085  -15.022 45.154  1.00 30.69 ? 281 ILE C CA    1 
ATOM   8902  C C     . ILE C 1 281 ? 24.056  -13.874 44.992  1.00 31.49 ? 281 ILE C C     1 
ATOM   8903  O O     . ILE C 1 281 ? 23.783  -12.785 45.398  1.00 28.47 ? 281 ILE C O     1 
ATOM   8904  C CB    . ILE C 1 281 ? 23.561  -15.878 46.346  1.00 32.65 ? 281 ILE C CB    1 
ATOM   8905  C CG1   . ILE C 1 281 ? 22.642  -17.057 46.495  1.00 29.60 ? 281 ILE C CG1   1 
ATOM   8906  C CG2   . ILE C 1 281 ? 23.663  -15.056 47.660  1.00 31.08 ? 281 ILE C CG2   1 
ATOM   8907  C CD1   . ILE C 1 281 ? 21.255  -16.632 46.518  1.00 32.54 ? 281 ILE C CD1   1 
ATOM   8908  N N     . GLU C 1 282 ? 25.137  -14.119 44.261  1.00 33.99 ? 282 GLU C N     1 
ATOM   8909  C CA    . GLU C 1 282 ? 26.110  -13.075 44.031  1.00 36.67 ? 282 GLU C CA    1 
ATOM   8910  C C     . GLU C 1 282 ? 25.490  -11.870 43.299  1.00 34.83 ? 282 GLU C C     1 
ATOM   8911  O O     . GLU C 1 282 ? 25.822  -10.740 43.625  1.00 33.97 ? 282 GLU C O     1 
ATOM   8912  C CB    . GLU C 1 282 ? 27.311  -13.624 43.250  1.00 36.90 ? 282 GLU C CB    1 
ATOM   8913  C CG    . GLU C 1 282 ? 28.257  -12.542 42.722  1.00 40.43 ? 282 GLU C CG    1 
ATOM   8914  C CD    . GLU C 1 282 ? 29.328  -13.104 41.814  1.00 41.71 ? 282 GLU C CD    1 
ATOM   8915  O OE1   . GLU C 1 282 ? 29.856  -14.229 42.168  1.00 40.49 ? 282 GLU C OE1   1 
ATOM   8916  O OE2   . GLU C 1 282 ? 29.602  -12.425 40.738  1.00 44.00 ? 282 GLU C OE2   1 
ATOM   8917  N N     . ARG C 1 283 ? 24.578  -12.083 42.346  1.00 35.16 ? 283 ARG C N     1 
ATOM   8918  C CA    . ARG C 1 283 ? 24.095  -10.902 41.557  1.00 34.13 ? 283 ARG C CA    1 
ATOM   8919  C C     . ARG C 1 283 ? 23.186  -10.126 42.451  1.00 33.94 ? 283 ARG C C     1 
ATOM   8920  O O     . ARG C 1 283 ? 23.184  -8.891  42.424  1.00 35.82 ? 283 ARG C O     1 
ATOM   8921  C CB    . ARG C 1 283 ? 23.351  -11.171 40.238  1.00 33.30 ? 283 ARG C CB    1 
ATOM   8922  C CG    . ARG C 1 283 ? 23.821  -12.305 39.282  1.00 32.70 ? 283 ARG C CG    1 
ATOM   8923  C CD    . ARG C 1 283 ? 25.239  -12.161 38.807  1.00 37.41 ? 283 ARG C CD    1 
ATOM   8924  N NE    . ARG C 1 283 ? 25.609  -10.827 38.444  1.00 32.52 ? 283 ARG C NE    1 
ATOM   8925  C CZ    . ARG C 1 283 ? 26.807  -10.288 38.748  1.00 34.83 ? 283 ARG C CZ    1 
ATOM   8926  N NH1   . ARG C 1 283 ? 27.720  -10.992 39.358  1.00 32.48 ? 283 ARG C NH1   1 
ATOM   8927  N NH2   . ARG C 1 283 ? 27.108  -9.038  38.386  1.00 32.68 ? 283 ARG C NH2   1 
ATOM   8928  N N     . VAL C 1 284 ? 22.406  -10.828 43.245  1.00 33.32 ? 284 VAL C N     1 
ATOM   8929  C CA    . VAL C 1 284 ? 21.531  -10.108 44.172  1.00 32.64 ? 284 VAL C CA    1 
ATOM   8930  C C     . VAL C 1 284 ? 22.201  -9.455  45.352  1.00 33.31 ? 284 VAL C C     1 
ATOM   8931  O O     . VAL C 1 284 ? 21.781  -8.310  45.722  1.00 32.25 ? 284 VAL C O     1 
ATOM   8932  C CB    . VAL C 1 284 ? 20.197  -10.808 44.549  1.00 34.49 ? 284 VAL C CB    1 
ATOM   8933  C CG1   . VAL C 1 284 ? 19.962  -12.156 43.830  1.00 31.77 ? 284 VAL C CG1   1 
ATOM   8934  C CG2   . VAL C 1 284 ? 19.867  -10.775 46.106  1.00 31.76 ? 284 VAL C CG2   1 
ATOM   8935  N N     . ILE C 1 285 ? 23.219  -10.108 45.944  1.00 32.54 ? 285 ILE C N     1 
ATOM   8936  C CA    . ILE C 1 285 ? 24.054  -9.311  46.871  1.00 33.34 ? 285 ILE C CA    1 
ATOM   8937  C C     . ILE C 1 285 ? 24.700  -8.039  46.252  1.00 32.61 ? 285 ILE C C     1 
ATOM   8938  O O     . ILE C 1 285 ? 24.785  -7.018  46.940  1.00 31.45 ? 285 ILE C O     1 
ATOM   8939  C CB    . ILE C 1 285 ? 25.053  -10.081 47.830  1.00 33.97 ? 285 ILE C CB    1 
ATOM   8940  C CG1   . ILE C 1 285 ? 26.494  -9.677  47.583  1.00 34.55 ? 285 ILE C CG1   1 
ATOM   8941  C CG2   . ILE C 1 285 ? 24.638  -11.617 48.176  1.00 35.06 ? 285 ILE C CG2   1 
ATOM   8942  C CD1   . ILE C 1 285 ? 27.428  -10.777 46.820  1.00 45.33 ? 285 ILE C CD1   1 
ATOM   8943  N N     . LEU C 1 286 ? 25.139  -8.075  44.970  1.00 30.91 ? 286 LEU C N     1 
ATOM   8944  C CA    . LEU C 1 286 ? 25.732  -6.898  44.387  1.00 27.38 ? 286 LEU C CA    1 
ATOM   8945  C C     . LEU C 1 286 ? 24.722  -5.731  44.219  1.00 26.66 ? 286 LEU C C     1 
ATOM   8946  O O     . LEU C 1 286 ? 25.128  -4.595  44.289  1.00 26.09 ? 286 LEU C O     1 
ATOM   8947  C CB    . LEU C 1 286 ? 26.410  -7.201  43.059  1.00 26.76 ? 286 LEU C CB    1 
ATOM   8948  C CG    . LEU C 1 286 ? 27.791  -7.935  43.058  1.00 31.54 ? 286 LEU C CG    1 
ATOM   8949  C CD1   . LEU C 1 286 ? 28.420  -8.145  41.647  1.00 25.89 ? 286 LEU C CD1   1 
ATOM   8950  C CD2   . LEU C 1 286 ? 28.748  -7.334  43.988  1.00 31.28 ? 286 LEU C CD2   1 
ATOM   8951  N N     . HIS C 1 287 ? 23.478  -6.036  43.846  1.00 24.41 ? 287 HIS C N     1 
ATOM   8952  C CA    . HIS C 1 287 ? 22.396  -5.072  43.657  1.00 24.60 ? 287 HIS C CA    1 
ATOM   8953  C C     . HIS C 1 287 ? 21.976  -4.584  45.046  1.00 25.74 ? 287 HIS C C     1 
ATOM   8954  O O     . HIS C 1 287 ? 21.708  -3.348  45.264  1.00 22.52 ? 287 HIS C O     1 
ATOM   8955  C CB    . HIS C 1 287 ? 21.217  -5.853  43.045  1.00 22.85 ? 287 HIS C CB    1 
ATOM   8956  C CG    . HIS C 1 287 ? 20.087  -5.015  42.573  1.00 25.22 ? 287 HIS C CG    1 
ATOM   8957  N ND1   . HIS C 1 287 ? 19.062  -5.536  41.809  1.00 18.37 ? 287 HIS C ND1   1 
ATOM   8958  C CD2   . HIS C 1 287 ? 19.798  -3.689  42.752  1.00 24.72 ? 287 HIS C CD2   1 
ATOM   8959  C CE1   . HIS C 1 287 ? 18.172  -4.584  41.568  1.00 21.18 ? 287 HIS C CE1   1 
ATOM   8960  N NE2   . HIS C 1 287 ? 18.598  -3.452  42.125  1.00 24.29 ? 287 HIS C NE2   1 
ATOM   8961  N N     . ILE C 1 288 ? 21.903  -5.540  46.013  1.00 25.47 ? 288 ILE C N     1 
ATOM   8962  C CA    . ILE C 1 288 ? 21.682  -5.046  47.385  1.00 28.08 ? 288 ILE C CA    1 
ATOM   8963  C C     . ILE C 1 288 ? 22.819  -4.078  47.852  1.00 29.71 ? 288 ILE C C     1 
ATOM   8964  O O     . ILE C 1 288 ? 22.521  -3.216  48.600  1.00 28.21 ? 288 ILE C O     1 
ATOM   8965  C CB    . ILE C 1 288 ? 21.203  -6.043  48.477  1.00 28.37 ? 288 ILE C CB    1 
ATOM   8966  C CG1   . ILE C 1 288 ? 22.293  -6.246  49.511  1.00 32.21 ? 288 ILE C CG1   1 
ATOM   8967  C CG2   . ILE C 1 288 ? 20.430  -7.355  47.987  1.00 26.06 ? 288 ILE C CG2   1 
ATOM   8968  C CD1   . ILE C 1 288 ? 22.055  -5.237  50.651  1.00 27.86 ? 288 ILE C CD1   1 
ATOM   8969  N N     . GLN C 1 289 ? 24.064  -4.152  47.320  1.00 29.76 ? 289 GLN C N     1 
ATOM   8970  C CA    . GLN C 1 289 ? 25.132  -3.299  47.781  1.00 30.12 ? 289 GLN C CA    1 
ATOM   8971  C C     . GLN C 1 289 ? 25.043  -1.831  47.262  1.00 30.61 ? 289 GLN C C     1 
ATOM   8972  O O     . GLN C 1 289 ? 25.787  -0.988  47.739  1.00 29.38 ? 289 GLN C O     1 
ATOM   8973  C CB    . GLN C 1 289 ? 26.490  -3.880  47.366  1.00 30.18 ? 289 GLN C CB    1 
ATOM   8974  C CG    . GLN C 1 289 ? 26.869  -5.124  48.106  1.00 31.73 ? 289 GLN C CG    1 
ATOM   8975  C CD    . GLN C 1 289 ? 28.278  -5.527  47.807  1.00 37.22 ? 289 GLN C CD    1 
ATOM   8976  O OE1   . GLN C 1 289 ? 28.841  -5.060  46.812  1.00 37.43 ? 289 GLN C OE1   1 
ATOM   8977  N NE2   . GLN C 1 289 ? 28.870  -6.411  48.653  1.00 33.41 ? 289 GLN C NE2   1 
ATOM   8978  N N     . VAL C 1 290 ? 24.215  -1.573  46.229  1.00 30.58 ? 290 VAL C N     1 
ATOM   8979  C CA    . VAL C 1 290 ? 23.968  -0.221  45.720  1.00 29.15 ? 290 VAL C CA    1 
ATOM   8980  C C     . VAL C 1 290 ? 22.614  0.275   46.121  1.00 28.93 ? 290 VAL C C     1 
ATOM   8981  O O     . VAL C 1 290 ? 22.211  1.339   45.702  1.00 30.07 ? 290 VAL C O     1 
ATOM   8982  C CB    . VAL C 1 290 ? 24.171  -0.113  44.104  1.00 30.89 ? 290 VAL C CB    1 
ATOM   8983  C CG1   . VAL C 1 290 ? 25.674  -0.249  43.731  1.00 26.31 ? 290 VAL C CG1   1 
ATOM   8984  C CG2   . VAL C 1 290 ? 23.285  -1.113  43.292  1.00 30.82 ? 290 VAL C CG2   1 
ATOM   8985  N N     . SER C 1 291 ? 21.883  -0.523  46.896  1.00 27.93 ? 291 SER C N     1 
ATOM   8986  C CA    . SER C 1 291 ? 20.564  -0.158  47.376  1.00 29.06 ? 291 SER C CA    1 
ATOM   8987  C C     . SER C 1 291 ? 20.541  -0.029  48.932  1.00 28.01 ? 291 SER C C     1 
ATOM   8988  O O     . SER C 1 291 ? 21.067  0.934   49.428  1.00 27.02 ? 291 SER C O     1 
ATOM   8989  C CB    . SER C 1 291 ? 19.494  -1.128  46.908  1.00 28.07 ? 291 SER C CB    1 
ATOM   8990  O OG    . SER C 1 291 ? 19.910  -2.453  47.192  1.00 33.98 ? 291 SER C OG    1 
ATOM   8991  N N     . THR C 1 292 ? 19.936  -0.981  49.644  1.00 28.76 ? 292 THR C N     1 
ATOM   8992  C CA    . THR C 1 292 ? 19.724  -0.896  51.121  1.00 29.10 ? 292 THR C CA    1 
ATOM   8993  C C     . THR C 1 292 ? 21.056  -1.082  51.803  1.00 29.51 ? 292 THR C C     1 
ATOM   8994  O O     . THR C 1 292 ? 21.208  -0.750  53.023  1.00 28.00 ? 292 THR C O     1 
ATOM   8995  C CB    . THR C 1 292 ? 18.694  -2.010  51.723  1.00 29.02 ? 292 THR C CB    1 
ATOM   8996  O OG1   . THR C 1 292 ? 18.950  -3.322  51.186  1.00 29.75 ? 292 THR C OG1   1 
ATOM   8997  C CG2   . THR C 1 292 ? 17.315  -1.723  51.403  1.00 26.28 ? 292 THR C CG2   1 
ATOM   8998  N N     . LEU C 1 293 ? 21.980  -1.685  51.033  1.00 27.16 ? 293 LEU C N     1 
ATOM   8999  C CA    . LEU C 1 293 ? 23.277  -2.104  51.510  1.00 27.37 ? 293 LEU C CA    1 
ATOM   9000  C C     . LEU C 1 293 ? 23.305  -3.314  52.415  1.00 28.52 ? 293 LEU C C     1 
ATOM   9001  O O     . LEU C 1 293 ? 24.137  -4.209  52.250  1.00 28.58 ? 293 LEU C O     1 
ATOM   9002  C CB    . LEU C 1 293 ? 24.021  -0.941  52.244  1.00 29.76 ? 293 LEU C CB    1 
ATOM   9003  C CG    . LEU C 1 293 ? 24.048  0.467   51.616  1.00 29.36 ? 293 LEU C CG    1 
ATOM   9004  C CD1   . LEU C 1 293 ? 24.939  1.507   52.493  1.00 21.37 ? 293 LEU C CD1   1 
ATOM   9005  C CD2   . LEU C 1 293 ? 24.479  0.337   50.148  1.00 24.09 ? 293 LEU C CD2   1 
ATOM   9006  N N     . HIS C 1 294 ? 22.478  -3.333  53.454  1.00 28.13 ? 294 HIS C N     1 
ATOM   9007  C CA    . HIS C 1 294 ? 22.336  -4.596  54.196  1.00 29.37 ? 294 HIS C CA    1 
ATOM   9008  C C     . HIS C 1 294 ? 21.118  -4.476  55.092  1.00 26.58 ? 294 HIS C C     1 
ATOM   9009  O O     . HIS C 1 294 ? 20.567  -3.385  55.238  1.00 25.31 ? 294 HIS C O     1 
ATOM   9010  C CB    . HIS C 1 294 ? 23.579  -4.861  55.061  1.00 30.08 ? 294 HIS C CB    1 
ATOM   9011  C CG    . HIS C 1 294 ? 23.806  -3.782  56.057  1.00 34.46 ? 294 HIS C CG    1 
ATOM   9012  N ND1   . HIS C 1 294 ? 24.649  -2.713  55.800  1.00 35.36 ? 294 HIS C ND1   1 
ATOM   9013  C CD2   . HIS C 1 294 ? 23.208  -3.535  57.257  1.00 30.54 ? 294 HIS C CD2   1 
ATOM   9014  C CE1   . HIS C 1 294 ? 24.614  -1.889  56.836  1.00 35.53 ? 294 HIS C CE1   1 
ATOM   9015  N NE2   . HIS C 1 294 ? 23.763  -2.369  57.739  1.00 31.93 ? 294 HIS C NE2   1 
ATOM   9016  N N     . PRO C 1 295 ? 20.714  -5.582  55.692  1.00 24.63 ? 295 PRO C N     1 
ATOM   9017  C CA    . PRO C 1 295 ? 19.483  -5.558  56.484  1.00 25.18 ? 295 PRO C CA    1 
ATOM   9018  C C     . PRO C 1 295 ? 19.894  -4.891  57.798  1.00 25.13 ? 295 PRO C C     1 
ATOM   9019  O O     . PRO C 1 295 ? 21.056  -4.969  58.147  1.00 21.25 ? 295 PRO C O     1 
ATOM   9020  C CB    . PRO C 1 295 ? 19.143  -7.054  56.675  1.00 24.15 ? 295 PRO C CB    1 
ATOM   9021  C CG    . PRO C 1 295 ? 20.303  -7.841  56.000  1.00 22.91 ? 295 PRO C CG    1 
ATOM   9022  C CD    . PRO C 1 295 ? 21.404  -6.888  55.749  1.00 25.08 ? 295 PRO C CD    1 
ATOM   9023  N N     . SER C 1 296 ? 19.001  -4.128  58.448  1.00 26.70 ? 296 SER C N     1 
ATOM   9024  C CA    . SER C 1 296 ? 19.367  -3.465  59.756  1.00 25.96 ? 296 SER C CA    1 
ATOM   9025  C C     . SER C 1 296 ? 20.261  -4.391  60.614  1.00 26.62 ? 296 SER C C     1 
ATOM   9026  O O     . SER C 1 296 ? 19.899  -5.514  60.866  1.00 26.41 ? 296 SER C O     1 
ATOM   9027  C CB    . SER C 1 296 ? 18.068  -3.116  60.476  1.00 25.60 ? 296 SER C CB    1 
ATOM   9028  O OG    . SER C 1 296 ? 18.226  -3.087  61.869  1.00 28.05 ? 296 SER C OG    1 
ATOM   9029  N N     . THR C 1 297 ? 21.459  -3.949  61.045  1.00 28.15 ? 297 THR C N     1 
ATOM   9030  C CA    . THR C 1 297 ? 22.344  -4.829  61.874  1.00 27.87 ? 297 THR C CA    1 
ATOM   9031  C C     . THR C 1 297 ? 21.782  -5.168  63.262  1.00 29.80 ? 297 THR C C     1 
ATOM   9032  O O     . THR C 1 297 ? 21.987  -6.278  63.805  1.00 29.43 ? 297 THR C O     1 
ATOM   9033  C CB    . THR C 1 297 ? 23.899  -4.468  61.771  1.00 29.62 ? 297 THR C CB    1 
ATOM   9034  O OG1   . THR C 1 297 ? 24.670  -4.715  62.954  1.00 28.14 ? 297 THR C OG1   1 
ATOM   9035  C CG2   . THR C 1 297 ? 24.186  -3.154  61.223  1.00 17.37 ? 297 THR C CG2   1 
ATOM   9036  N N     . PHE C 1 298 ? 20.998  -4.221  63.773  1.00 30.70 ? 298 PHE C N     1 
ATOM   9037  C CA    . PHE C 1 298 ? 20.420  -4.232  65.115  1.00 30.35 ? 298 PHE C CA    1 
ATOM   9038  C C     . PHE C 1 298 ? 19.378  -5.393  65.212  1.00 30.10 ? 298 PHE C C     1 
ATOM   9039  O O     . PHE C 1 298 ? 19.441  -6.231  66.143  1.00 27.78 ? 298 PHE C O     1 
ATOM   9040  C CB    . PHE C 1 298 ? 19.738  -2.891  65.285  1.00 30.54 ? 298 PHE C CB    1 
ATOM   9041  C CG    . PHE C 1 298 ? 19.177  -2.650  66.654  1.00 33.25 ? 298 PHE C CG    1 
ATOM   9042  C CD1   . PHE C 1 298 ? 17.911  -3.101  66.989  1.00 32.71 ? 298 PHE C CD1   1 
ATOM   9043  C CD2   . PHE C 1 298 ? 19.901  -1.931  67.581  1.00 29.54 ? 298 PHE C CD2   1 
ATOM   9044  C CE1   . PHE C 1 298 ? 17.397  -2.886  68.262  1.00 34.25 ? 298 PHE C CE1   1 
ATOM   9045  C CE2   . PHE C 1 298 ? 19.388  -1.691  68.865  1.00 34.13 ? 298 PHE C CE2   1 
ATOM   9046  C CZ    . PHE C 1 298 ? 18.127  -2.151  69.199  1.00 33.96 ? 298 PHE C CZ    1 
ATOM   9047  N N     . ASN C 1 299 ? 18.449  -5.416  64.230  1.00 27.80 ? 299 ASN C N     1 
ATOM   9048  C CA    . ASN C 1 299 ? 17.396  -6.385  64.130  1.00 28.08 ? 299 ASN C CA    1 
ATOM   9049  C C     . ASN C 1 299 ? 17.867  -7.826  63.902  1.00 29.42 ? 299 ASN C C     1 
ATOM   9050  O O     . ASN C 1 299 ? 17.274  -8.778  64.472  1.00 32.38 ? 299 ASN C O     1 
ATOM   9051  C CB    . ASN C 1 299 ? 16.440  -5.939  63.024  1.00 29.75 ? 299 ASN C CB    1 
ATOM   9052  C CG    . ASN C 1 299 ? 15.694  -4.623  63.353  1.00 27.51 ? 299 ASN C CG    1 
ATOM   9053  O OD1   . ASN C 1 299 ? 14.937  -4.051  62.554  1.00 33.50 ? 299 ASN C OD1   1 
ATOM   9054  N ND2   . ASN C 1 299 ? 15.833  -4.218  64.517  1.00 24.28 ? 299 ASN C ND2   1 
ATOM   9055  N N     . GLN C 1 300 ? 18.917  -8.015  63.089  1.00 28.36 ? 300 GLN C N     1 
ATOM   9056  C CA    . GLN C 1 300 ? 19.640  -9.296  62.891  1.00 26.89 ? 300 GLN C CA    1 
ATOM   9057  C C     . GLN C 1 300 ? 20.405  -9.736  64.142  1.00 26.81 ? 300 GLN C C     1 
ATOM   9058  O O     . GLN C 1 300 ? 20.513  -10.923 64.411  1.00 26.85 ? 300 GLN C O     1 
ATOM   9059  C CB    . GLN C 1 300 ? 20.787  -9.079  61.859  1.00 28.28 ? 300 GLN C CB    1 
ATOM   9060  C CG    . GLN C 1 300 ? 20.365  -8.682  60.409  1.00 28.30 ? 300 GLN C CG    1 
ATOM   9061  C CD    . GLN C 1 300 ? 21.521  -8.783  59.538  1.00 26.71 ? 300 GLN C CD    1 
ATOM   9062  O OE1   . GLN C 1 300 ? 22.041  -9.864  59.405  1.00 33.05 ? 300 GLN C OE1   1 
ATOM   9063  N NE2   . GLN C 1 300 ? 22.038  -7.643  59.015  1.00 26.81 ? 300 GLN C NE2   1 
ATOM   9064  N N     . LEU C 1 301 ? 21.032  -8.808  64.836  1.00 25.05 ? 301 LEU C N     1 
ATOM   9065  C CA    . LEU C 1 301 ? 21.542  -9.077  66.215  1.00 27.04 ? 301 LEU C CA    1 
ATOM   9066  C C     . LEU C 1 301 ? 20.571  -9.704  67.179  1.00 27.26 ? 301 LEU C C     1 
ATOM   9067  O O     . LEU C 1 301 ? 20.886  -10.751 67.752  1.00 29.67 ? 301 LEU C O     1 
ATOM   9068  C CB    . LEU C 1 301 ? 22.150  -7.827  66.832  1.00 26.69 ? 301 LEU C CB    1 
ATOM   9069  C CG    . LEU C 1 301 ? 23.677  -7.632  66.873  1.00 29.08 ? 301 LEU C CG    1 
ATOM   9070  C CD1   . LEU C 1 301 ? 24.542  -8.842  66.487  1.00 23.37 ? 301 LEU C CD1   1 
ATOM   9071  C CD2   . LEU C 1 301 ? 24.196  -6.333  66.291  1.00 30.97 ? 301 LEU C CD2   1 
ATOM   9072  N N     . MET C 1 302 ? 19.388  -9.105  67.321  1.00 28.48 ? 302 MET C N     1 
ATOM   9073  C CA    . MET C 1 302 ? 18.229  -9.623  68.078  1.00 28.84 ? 302 MET C CA    1 
ATOM   9074  C C     . MET C 1 302 ? 17.804  -11.050 67.611  1.00 28.09 ? 302 MET C C     1 
ATOM   9075  O O     . MET C 1 302 ? 17.758  -11.933 68.434  1.00 29.30 ? 302 MET C O     1 
ATOM   9076  C CB    . MET C 1 302 ? 17.013  -8.739  67.914  1.00 26.64 ? 302 MET C CB    1 
ATOM   9077  C CG    . MET C 1 302 ? 17.045  -7.254  68.547  1.00 32.59 ? 302 MET C CG    1 
ATOM   9078  S SD    . MET C 1 302 ? 15.660  -6.184  67.870  1.00 35.80 ? 302 MET C SD    1 
ATOM   9079  C CE    . MET C 1 302 ? 14.186  -7.091  68.215  1.00 30.84 ? 302 MET C CE    1 
ATOM   9080  N N     . ILE C 1 303 ? 17.516  -11.276 66.322  1.00 25.71 ? 303 ILE C N     1 
ATOM   9081  C CA    . ILE C 1 303 ? 17.165  -12.626 65.835  1.00 27.13 ? 303 ILE C CA    1 
ATOM   9082  C C     . ILE C 1 303 ? 18.298  -13.618 66.106  1.00 27.45 ? 303 ILE C C     1 
ATOM   9083  O O     . ILE C 1 303 ? 18.067  -14.758 66.516  1.00 24.73 ? 303 ILE C O     1 
ATOM   9084  C CB    . ILE C 1 303 ? 16.753  -12.625 64.334  1.00 26.53 ? 303 ILE C CB    1 
ATOM   9085  C CG1   . ILE C 1 303 ? 15.476  -11.759 64.181  1.00 29.70 ? 303 ILE C CG1   1 
ATOM   9086  C CG2   . ILE C 1 303 ? 16.514  -14.099 63.836  1.00 26.50 ? 303 ILE C CG2   1 
ATOM   9087  C CD1   . ILE C 1 303 ? 15.193  -11.330 62.736  1.00 25.60 ? 303 ILE C CD1   1 
ATOM   9088  N N     . SER C 1 304 ? 19.537  -13.174 65.845  1.00 28.35 ? 304 SER C N     1 
ATOM   9089  C CA    . SER C 1 304 ? 20.672  -14.070 66.029  1.00 30.34 ? 304 SER C CA    1 
ATOM   9090  C C     . SER C 1 304 ? 20.882  -14.482 67.517  1.00 30.53 ? 304 SER C C     1 
ATOM   9091  O O     . SER C 1 304 ? 21.198  -15.628 67.850  1.00 30.73 ? 304 SER C O     1 
ATOM   9092  C CB    . SER C 1 304 ? 21.919  -13.448 65.442  1.00 30.06 ? 304 SER C CB    1 
ATOM   9093  O OG    . SER C 1 304 ? 22.978  -14.388 65.490  1.00 33.92 ? 304 SER C OG    1 
ATOM   9094  N N     . GLN C 1 305 ? 20.697  -13.539 68.407  1.00 31.73 ? 305 GLN C N     1 
ATOM   9095  C CA    . GLN C 1 305 ? 20.882  -13.821 69.813  1.00 33.11 ? 305 GLN C CA    1 
ATOM   9096  C C     . GLN C 1 305 ? 19.743  -14.686 70.347  1.00 32.86 ? 305 GLN C C     1 
ATOM   9097  O O     . GLN C 1 305 ? 20.014  -15.589 71.145  1.00 34.09 ? 305 GLN C O     1 
ATOM   9098  C CB    . GLN C 1 305 ? 21.119  -12.539 70.595  1.00 32.19 ? 305 GLN C CB    1 
ATOM   9099  C CG    . GLN C 1 305 ? 22.630  -12.169 70.501  1.00 36.76 ? 305 GLN C CG    1 
ATOM   9100  C CD    . GLN C 1 305 ? 22.938  -10.738 70.794  1.00 39.63 ? 305 GLN C CD    1 
ATOM   9101  O OE1   . GLN C 1 305 ? 23.892  -10.162 70.247  1.00 42.10 ? 305 GLN C OE1   1 
ATOM   9102  N NE2   . GLN C 1 305 ? 22.132  -10.134 71.624  1.00 42.61 ? 305 GLN C NE2   1 
ATOM   9103  N N     . LEU C 1 306 ? 18.546  -14.529 69.782  1.00 31.58 ? 306 LEU C N     1 
ATOM   9104  C CA    . LEU C 1 306 ? 17.382  -15.338 70.128  1.00 31.46 ? 306 LEU C CA    1 
ATOM   9105  C C     . LEU C 1 306 ? 17.604  -16.800 69.813  1.00 31.70 ? 306 LEU C C     1 
ATOM   9106  O O     . LEU C 1 306 ? 17.392  -17.699 70.647  1.00 29.67 ? 306 LEU C O     1 
ATOM   9107  C CB    . LEU C 1 306 ? 16.172  -14.887 69.320  1.00 33.12 ? 306 LEU C CB    1 
ATOM   9108  C CG    . LEU C 1 306 ? 14.832  -15.638 69.557  1.00 33.09 ? 306 LEU C CG    1 
ATOM   9109  C CD1   . LEU C 1 306 ? 14.145  -15.281 70.916  1.00 30.80 ? 306 LEU C CD1   1 
ATOM   9110  C CD2   . LEU C 1 306 ? 13.886  -15.418 68.366  1.00 30.44 ? 306 LEU C CD2   1 
ATOM   9111  N N     . LEU C 1 307 ? 18.086  -16.973 68.598  1.00 31.49 ? 307 LEU C N     1 
ATOM   9112  C CA    . LEU C 1 307 ? 18.132  -18.181 67.858  1.00 32.63 ? 307 LEU C CA    1 
ATOM   9113  C C     . LEU C 1 307 ? 19.296  -19.049 68.306  1.00 32.74 ? 307 LEU C C     1 
ATOM   9114  O O     . LEU C 1 307 ? 19.120  -20.260 68.418  1.00 31.80 ? 307 LEU C O     1 
ATOM   9115  C CB    . LEU C 1 307 ? 18.317  -17.817 66.405  1.00 32.16 ? 307 LEU C CB    1 
ATOM   9116  C CG    . LEU C 1 307 ? 17.250  -18.079 65.338  1.00 35.36 ? 307 LEU C CG    1 
ATOM   9117  C CD1   . LEU C 1 307 ? 15.875  -18.235 65.831  1.00 24.02 ? 307 LEU C CD1   1 
ATOM   9118  C CD2   . LEU C 1 307 ? 17.315  -17.105 64.109  1.00 32.26 ? 307 LEU C CD2   1 
ATOM   9119  N N     . HIS C 1 308 ? 20.454  -18.410 68.527  1.00 32.88 ? 308 HIS C N     1 
ATOM   9120  C CA    . HIS C 1 308 ? 21.607  -19.027 69.197  1.00 34.60 ? 308 HIS C CA    1 
ATOM   9121  C C     . HIS C 1 308 ? 21.260  -19.512 70.647  1.00 35.45 ? 308 HIS C C     1 
ATOM   9122  O O     . HIS C 1 308 ? 21.660  -20.641 71.063  1.00 34.70 ? 308 HIS C O     1 
ATOM   9123  C CB    . HIS C 1 308 ? 22.899  -18.152 69.166  1.00 32.50 ? 308 HIS C CB    1 
ATOM   9124  C CG    . HIS C 1 308 ? 23.682  -18.251 67.882  1.00 36.11 ? 308 HIS C CG    1 
ATOM   9125  N ND1   . HIS C 1 308 ? 23.485  -17.387 66.797  1.00 32.79 ? 308 HIS C ND1   1 
ATOM   9126  C CD2   . HIS C 1 308 ? 24.646  -19.124 67.492  1.00 33.81 ? 308 HIS C CD2   1 
ATOM   9127  C CE1   . HIS C 1 308 ? 24.280  -17.738 65.802  1.00 31.60 ? 308 HIS C CE1   1 
ATOM   9128  N NE2   . HIS C 1 308 ? 25.003  -18.783 66.194  1.00 33.45 ? 308 HIS C NE2   1 
ATOM   9129  N N     . GLU C 1 309 ? 20.512  -18.692 71.383  1.00 35.51 ? 309 GLU C N     1 
ATOM   9130  C CA    . GLU C 1 309 ? 20.125  -19.060 72.756  1.00 36.67 ? 309 GLU C CA    1 
ATOM   9131  C C     . GLU C 1 309 ? 19.065  -20.183 72.782  1.00 37.44 ? 309 GLU C C     1 
ATOM   9132  O O     . GLU C 1 309 ? 19.135  -21.089 73.632  1.00 40.13 ? 309 GLU C O     1 
ATOM   9133  C CB    . GLU C 1 309 ? 19.696  -17.836 73.563  1.00 35.90 ? 309 GLU C CB    1 
ATOM   9134  C CG    . GLU C 1 309 ? 19.850  -18.015 75.093  1.00 42.41 ? 309 GLU C CG    1 
ATOM   9135  C CD    . GLU C 1 309 ? 21.329  -18.000 75.558  1.00 49.16 ? 309 GLU C CD    1 
ATOM   9136  O OE1   . GLU C 1 309 ? 21.807  -19.058 75.984  1.00 49.78 ? 309 GLU C OE1   1 
ATOM   9137  O OE2   . GLU C 1 309 ? 22.024  -16.930 75.503  1.00 54.43 ? 309 GLU C OE2   1 
ATOM   9138  N N     . TRP C 1 310 ? 18.117  -20.189 71.839  1.00 36.13 ? 310 TRP C N     1 
ATOM   9139  C CA    . TRP C 1 310 ? 17.191  -21.330 71.698  1.00 33.97 ? 310 TRP C CA    1 
ATOM   9140  C C     . TRP C 1 310 ? 17.877  -22.588 71.161  1.00 34.77 ? 310 TRP C C     1 
ATOM   9141  O O     . TRP C 1 310 ? 17.549  -23.747 71.554  1.00 35.68 ? 310 TRP C O     1 
ATOM   9142  C CB    . TRP C 1 310 ? 16.033  -20.974 70.765  1.00 31.93 ? 310 TRP C CB    1 
ATOM   9143  C CG    . TRP C 1 310 ? 14.828  -20.222 71.346  1.00 30.19 ? 310 TRP C CG    1 
ATOM   9144  C CD1   . TRP C 1 310 ? 14.440  -20.119 72.677  1.00 29.38 ? 310 TRP C CD1   1 
ATOM   9145  C CD2   . TRP C 1 310 ? 13.836  -19.509 70.590  1.00 25.46 ? 310 TRP C CD2   1 
ATOM   9146  N NE1   . TRP C 1 310 ? 13.251  -19.375 72.767  1.00 26.36 ? 310 TRP C NE1   1 
ATOM   9147  C CE2   . TRP C 1 310 ? 12.887  -19.002 71.488  1.00 29.52 ? 310 TRP C CE2   1 
ATOM   9148  C CE3   . TRP C 1 310 ? 13.643  -19.277 69.215  1.00 30.20 ? 310 TRP C CE3   1 
ATOM   9149  C CZ2   . TRP C 1 310 ? 11.741  -18.273 71.030  1.00 31.77 ? 310 TRP C CZ2   1 
ATOM   9150  C CZ3   . TRP C 1 310 ? 12.513  -18.564 68.805  1.00 27.63 ? 310 TRP C CZ3   1 
ATOM   9151  C CH2   . TRP C 1 310 ? 11.610  -18.085 69.684  1.00 26.18 ? 310 TRP C CH2   1 
ATOM   9152  N N     . GLY C 1 311 ? 18.820  -22.395 70.253  1.00 34.29 ? 311 GLY C N     1 
ATOM   9153  C CA    . GLY C 1 311 ? 19.326  -23.512 69.481  1.00 35.73 ? 311 GLY C CA    1 
ATOM   9154  C C     . GLY C 1 311 ? 18.295  -23.953 68.474  1.00 36.06 ? 311 GLY C C     1 
ATOM   9155  O O     . GLY C 1 311 ? 17.217  -23.401 68.408  1.00 36.23 ? 311 GLY C O     1 
ATOM   9156  N N     . GLU C 1 312 ? 18.600  -24.950 67.666  1.00 38.44 ? 312 GLU C N     1 
ATOM   9157  C CA    . GLU C 1 312 ? 17.582  -25.419 66.714  1.00 41.36 ? 312 GLU C CA    1 
ATOM   9158  C C     . GLU C 1 312 ? 16.353  -26.005 67.442  1.00 41.13 ? 312 GLU C C     1 
ATOM   9159  O O     . GLU C 1 312 ? 15.216  -25.980 66.949  1.00 41.14 ? 312 GLU C O     1 
ATOM   9160  C CB    . GLU C 1 312 ? 18.170  -26.411 65.692  1.00 41.07 ? 312 GLU C CB    1 
ATOM   9161  C CG    . GLU C 1 312 ? 19.293  -25.777 64.854  1.00 44.57 ? 312 GLU C CG    1 
ATOM   9162  C CD    . GLU C 1 312 ? 19.939  -26.739 63.843  1.00 45.75 ? 312 GLU C CD    1 
ATOM   9163  O OE1   . GLU C 1 312 ? 19.828  -27.968 64.077  1.00 51.77 ? 312 GLU C OE1   1 
ATOM   9164  O OE2   . GLU C 1 312 ? 20.546  -26.260 62.828  1.00 48.05 ? 312 GLU C OE2   1 
ATOM   9165  N N     . GLU C 1 313 ? 16.616  -26.529 68.625  1.00 41.64 ? 313 GLU C N     1 
ATOM   9166  C CA    . GLU C 1 313 ? 15.624  -27.163 69.445  1.00 42.75 ? 313 GLU C CA    1 
ATOM   9167  C C     . GLU C 1 313 ? 14.668  -26.071 69.914  1.00 40.98 ? 313 GLU C C     1 
ATOM   9168  O O     . GLU C 1 313 ? 13.458  -26.172 69.658  1.00 42.00 ? 313 GLU C O     1 
ATOM   9169  C CB    . GLU C 1 313 ? 16.340  -27.900 70.586  1.00 43.78 ? 313 GLU C CB    1 
ATOM   9170  C CG    . GLU C 1 313 ? 15.492  -28.757 71.521  1.00 52.94 ? 313 GLU C CG    1 
ATOM   9171  C CD    . GLU C 1 313 ? 15.565  -30.279 71.247  1.00 62.12 ? 313 GLU C CD    1 
ATOM   9172  O OE1   . GLU C 1 313 ? 16.565  -30.733 70.608  1.00 65.85 ? 313 GLU C OE1   1 
ATOM   9173  O OE2   . GLU C 1 313 ? 14.607  -31.016 71.673  1.00 62.30 ? 313 GLU C OE2   1 
ATOM   9174  N N     . GLY C 1 314 ? 15.160  -24.990 70.534  1.00 39.07 ? 314 GLY C N     1 
ATOM   9175  C CA    . GLY C 1 314 ? 14.217  -23.937 70.951  1.00 36.27 ? 314 GLY C CA    1 
ATOM   9176  C C     . GLY C 1 314 ? 13.381  -23.373 69.801  1.00 34.51 ? 314 GLY C C     1 
ATOM   9177  O O     . GLY C 1 314 ? 12.198  -23.049 69.967  1.00 35.08 ? 314 GLY C O     1 
ATOM   9178  N N     . PHE C 1 315 ? 14.018  -23.276 68.630  1.00 33.25 ? 315 PHE C N     1 
ATOM   9179  C CA    . PHE C 1 315 ? 13.422  -22.740 67.404  1.00 31.47 ? 315 PHE C CA    1 
ATOM   9180  C C     . PHE C 1 315 ? 12.237  -23.574 66.928  1.00 30.78 ? 315 PHE C C     1 
ATOM   9181  O O     . PHE C 1 315 ? 11.140  -23.043 66.720  1.00 30.39 ? 315 PHE C O     1 
ATOM   9182  C CB    . PHE C 1 315 ? 14.508  -22.589 66.282  1.00 30.05 ? 315 PHE C CB    1 
ATOM   9183  C CG    . PHE C 1 315 ? 13.974  -21.954 64.999  1.00 30.33 ? 315 PHE C CG    1 
ATOM   9184  C CD1   . PHE C 1 315 ? 13.354  -20.713 65.018  1.00 28.63 ? 315 PHE C CD1   1 
ATOM   9185  C CD2   . PHE C 1 315 ? 14.074  -22.613 63.785  1.00 31.38 ? 315 PHE C CD2   1 
ATOM   9186  C CE1   . PHE C 1 315 ? 12.813  -20.187 63.902  1.00 28.53 ? 315 PHE C CE1   1 
ATOM   9187  C CE2   . PHE C 1 315 ? 13.588  -22.036 62.579  1.00 32.99 ? 315 PHE C CE2   1 
ATOM   9188  C CZ    . PHE C 1 315 ? 12.931  -20.846 62.631  1.00 32.33 ? 315 PHE C CZ    1 
ATOM   9189  N N     . MET C 1 316 ? 12.447  -24.870 66.716  1.00 31.19 ? 316 MET C N     1 
ATOM   9190  C CA    . MET C 1 316 ? 11.351  -25.758 66.229  1.00 32.14 ? 316 MET C CA    1 
ATOM   9191  C C     . MET C 1 316 ? 10.272  -25.904 67.256  1.00 32.22 ? 316 MET C C     1 
ATOM   9192  O O     . MET C 1 316 ? 9.105   -26.112 66.901  1.00 34.48 ? 316 MET C O     1 
ATOM   9193  C CB    . MET C 1 316 ? 11.875  -27.165 65.816  1.00 31.69 ? 316 MET C CB    1 
ATOM   9194  C CG    . MET C 1 316 ? 12.939  -27.120 64.716  1.00 35.05 ? 316 MET C CG    1 
ATOM   9195  S SD    . MET C 1 316 ? 12.480  -26.244 63.157  1.00 40.20 ? 316 MET C SD    1 
ATOM   9196  C CE    . MET C 1 316 ? 11.316  -27.459 62.485  1.00 38.65 ? 316 MET C CE    1 
ATOM   9197  N N     . ALA C 1 317 ? 10.619  -25.795 68.553  1.00 32.07 ? 317 ALA C N     1 
ATOM   9198  C CA    . ALA C 1 317 ? 9.529   -25.838 69.586  1.00 31.48 ? 317 ALA C CA    1 
ATOM   9199  C C     . ALA C 1 317 ? 8.623   -24.555 69.437  1.00 29.82 ? 317 ALA C C     1 
ATOM   9200  O O     . ALA C 1 317 ? 7.379   -24.601 69.549  1.00 29.70 ? 317 ALA C O     1 
ATOM   9201  C CB    . ALA C 1 317 ? 10.141  -25.991 71.044  1.00 28.98 ? 317 ALA C CB    1 
ATOM   9202  N N     . HIS C 1 318 ? 9.268   -23.398 69.287  1.00 30.37 ? 318 HIS C N     1 
ATOM   9203  C CA    . HIS C 1 318 ? 8.521   -22.115 69.032  1.00 28.69 ? 318 HIS C CA    1 
ATOM   9204  C C     . HIS C 1 318 ? 7.650   -22.314 67.741  1.00 28.64 ? 318 HIS C C     1 
ATOM   9205  O O     . HIS C 1 318 ? 6.428   -22.060 67.715  1.00 28.42 ? 318 HIS C O     1 
ATOM   9206  C CB    . HIS C 1 318 ? 9.502   -20.975 68.785  1.00 28.30 ? 318 HIS C CB    1 
ATOM   9207  C CG    . HIS C 1 318 ? 8.839   -19.711 68.271  1.00 28.51 ? 318 HIS C CG    1 
ATOM   9208  N ND1   . HIS C 1 318 ? 9.108   -19.167 67.038  1.00 31.48 ? 318 HIS C ND1   1 
ATOM   9209  C CD2   . HIS C 1 318 ? 7.903   -18.908 68.831  1.00 28.02 ? 318 HIS C CD2   1 
ATOM   9210  C CE1   . HIS C 1 318 ? 8.381   -18.061 66.874  1.00 29.08 ? 318 HIS C CE1   1 
ATOM   9211  N NE2   . HIS C 1 318 ? 7.612   -17.908 67.935  1.00 22.77 ? 318 HIS C NE2   1 
ATOM   9212  N N     . VAL C 1 319 ? 8.250   -22.825 66.676  1.00 28.65 ? 319 VAL C N     1 
ATOM   9213  C CA    . VAL C 1 319 ? 7.427   -23.016 65.512  1.00 29.82 ? 319 VAL C CA    1 
ATOM   9214  C C     . VAL C 1 319 ? 6.267   -23.930 65.700  1.00 31.82 ? 319 VAL C C     1 
ATOM   9215  O O     . VAL C 1 319 ? 5.157   -23.577 65.235  1.00 31.55 ? 319 VAL C O     1 
ATOM   9216  C CB    . VAL C 1 319 ? 8.202   -23.199 64.171  1.00 30.79 ? 319 VAL C CB    1 
ATOM   9217  C CG1   . VAL C 1 319 ? 9.622   -22.968 64.290  1.00 29.39 ? 319 VAL C CG1   1 
ATOM   9218  C CG2   . VAL C 1 319 ? 7.689   -24.337 63.195  1.00 28.43 ? 319 VAL C CG2   1 
ATOM   9219  N N     . ASP C 1 320 ? 6.475   -25.052 66.426  1.00 33.00 ? 320 ASP C N     1 
ATOM   9220  C CA    . ASP C 1 320 ? 5.392   -26.032 66.624  1.00 35.39 ? 320 ASP C CA    1 
ATOM   9221  C C     . ASP C 1 320 ? 4.294   -25.350 67.436  1.00 34.39 ? 320 ASP C C     1 
ATOM   9222  O O     . ASP C 1 320 ? 3.164   -25.629 67.187  1.00 34.40 ? 320 ASP C O     1 
ATOM   9223  C CB    . ASP C 1 320 ? 5.780   -27.351 67.328  1.00 35.41 ? 320 ASP C CB    1 
ATOM   9224  C CG    . ASP C 1 320 ? 6.777   -28.206 66.551  1.00 43.18 ? 320 ASP C CG    1 
ATOM   9225  O OD1   . ASP C 1 320 ? 7.276   -27.838 65.461  1.00 52.09 ? 320 ASP C OD1   1 
ATOM   9226  O OD2   . ASP C 1 320 ? 7.128   -29.307 67.064  1.00 53.67 ? 320 ASP C OD2   1 
ATOM   9227  N N     . ARG C 1 321 ? 4.640   -24.508 68.408  1.00 35.57 ? 321 ARG C N     1 
ATOM   9228  C CA    . ARG C 1 321 ? 3.660   -23.688 69.205  1.00 36.97 ? 321 ARG C CA    1 
ATOM   9229  C C     . ARG C 1 321 ? 2.861   -22.689 68.372  1.00 36.18 ? 321 ARG C C     1 
ATOM   9230  O O     . ARG C 1 321 ? 1.695   -22.434 68.653  1.00 36.83 ? 321 ARG C O     1 
ATOM   9231  C CB    . ARG C 1 321 ? 4.397   -22.802 70.205  1.00 36.87 ? 321 ARG C CB    1 
ATOM   9232  C CG    . ARG C 1 321 ? 4.149   -23.065 71.698  1.00 40.45 ? 321 ARG C CG    1 
ATOM   9233  C CD    . ARG C 1 321 ? 4.974   -22.038 72.543  1.00 38.81 ? 321 ARG C CD    1 
ATOM   9234  N NE    . ARG C 1 321 ? 6.241   -22.640 72.790  1.00 38.86 ? 321 ARG C NE    1 
ATOM   9235  C CZ    . ARG C 1 321 ? 7.430   -22.097 72.692  1.00 40.66 ? 321 ARG C CZ    1 
ATOM   9236  N NH1   . ARG C 1 321 ? 7.636   -20.809 72.450  1.00 46.63 ? 321 ARG C NH1   1 
ATOM   9237  N NH2   . ARG C 1 321 ? 8.436   -22.889 72.926  1.00 44.09 ? 321 ARG C NH2   1 
ATOM   9238  N N     . VAL C 1 322 ? 3.511   -22.045 67.408  1.00 35.77 ? 322 VAL C N     1 
ATOM   9239  C CA    . VAL C 1 322 ? 2.756   -21.246 66.484  1.00 35.37 ? 322 VAL C CA    1 
ATOM   9240  C C     . VAL C 1 322 ? 1.932   -22.025 65.427  1.00 34.02 ? 322 VAL C C     1 
ATOM   9241  O O     . VAL C 1 322 ? 0.834   -21.553 65.075  1.00 33.78 ? 322 VAL C O     1 
ATOM   9242  C CB    . VAL C 1 322 ? 3.486   -19.876 65.960  1.00 36.36 ? 322 VAL C CB    1 
ATOM   9243  C CG1   . VAL C 1 322 ? 4.776   -19.631 66.605  1.00 36.97 ? 322 VAL C CG1   1 
ATOM   9244  C CG2   . VAL C 1 322 ? 3.582   -19.792 64.432  1.00 33.91 ? 322 VAL C CG2   1 
ATOM   9245  N N     . ILE C 1 323 ? 2.428   -23.167 64.920  1.00 33.52 ? 323 ILE C N     1 
ATOM   9246  C CA    . ILE C 1 323 ? 1.579   -24.094 64.159  1.00 32.01 ? 323 ILE C CA    1 
ATOM   9247  C C     . ILE C 1 323 ? 0.361   -24.392 64.970  1.00 32.78 ? 323 ILE C C     1 
ATOM   9248  O O     . ILE C 1 323 ? -0.772  -24.100 64.565  1.00 33.19 ? 323 ILE C O     1 
ATOM   9249  C CB    . ILE C 1 323 ? 2.272   -25.449 63.717  1.00 34.51 ? 323 ILE C CB    1 
ATOM   9250  C CG1   . ILE C 1 323 ? 3.263   -25.227 62.548  1.00 31.89 ? 323 ILE C CG1   1 
ATOM   9251  C CG2   . ILE C 1 323 ? 1.174   -26.486 63.275  1.00 32.81 ? 323 ILE C CG2   1 
ATOM   9252  C CD1   . ILE C 1 323 ? 4.511   -26.245 62.507  1.00 29.80 ? 323 ILE C CD1   1 
ATOM   9253  N N     . ASP C 1 324 ? 0.552   -24.890 66.178  1.00 33.71 ? 324 ASP C N     1 
ATOM   9254  C CA    . ASP C 1 324 ? -0.608  -25.072 67.066  1.00 33.37 ? 324 ASP C CA    1 
ATOM   9255  C C     . ASP C 1 324 ? -1.555  -23.877 67.056  1.00 29.74 ? 324 ASP C C     1 
ATOM   9256  O O     . ASP C 1 324 ? -2.762  -24.019 66.879  1.00 27.88 ? 324 ASP C O     1 
ATOM   9257  C CB    . ASP C 1 324 ? -0.134  -25.456 68.490  1.00 35.23 ? 324 ASP C CB    1 
ATOM   9258  C CG    . ASP C 1 324 ? -0.170  -27.000 68.707  1.00 43.62 ? 324 ASP C CG    1 
ATOM   9259  O OD1   . ASP C 1 324 ? -1.118  -27.461 69.396  1.00 47.46 ? 324 ASP C OD1   1 
ATOM   9260  O OD2   . ASP C 1 324 ? 0.667   -27.747 68.106  1.00 47.00 ? 324 ASP C OD2   1 
ATOM   9261  N N     . PHE C 1 325 ? -1.048  -22.669 67.246  1.00 28.71 ? 325 PHE C N     1 
ATOM   9262  C CA    . PHE C 1 325 ? -2.033  -21.515 67.359  1.00 27.32 ? 325 PHE C CA    1 
ATOM   9263  C C     . PHE C 1 325 ? -2.882  -21.223 66.018  1.00 26.35 ? 325 PHE C C     1 
ATOM   9264  O O     . PHE C 1 325 ? -4.107  -20.909 66.066  1.00 25.78 ? 325 PHE C O     1 
ATOM   9265  C CB    . PHE C 1 325 ? -1.332  -20.227 67.819  1.00 26.13 ? 325 PHE C CB    1 
ATOM   9266  C CG    . PHE C 1 325 ? -2.255  -18.983 67.703  1.00 27.93 ? 325 PHE C CG    1 
ATOM   9267  C CD1   . PHE C 1 325 ? -3.056  -18.592 68.787  1.00 28.71 ? 325 PHE C CD1   1 
ATOM   9268  C CD2   . PHE C 1 325 ? -2.445  -18.364 66.481  1.00 20.50 ? 325 PHE C CD2   1 
ATOM   9269  C CE1   . PHE C 1 325 ? -3.970  -17.494 68.682  1.00 25.90 ? 325 PHE C CE1   1 
ATOM   9270  C CE2   . PHE C 1 325 ? -3.273  -17.331 66.370  1.00 25.82 ? 325 PHE C CE2   1 
ATOM   9271  C CZ    . PHE C 1 325 ? -4.098  -16.899 67.523  1.00 24.87 ? 325 PHE C CZ    1 
ATOM   9272  N N     . TYR C 1 326 ? -2.205  -21.298 64.851  1.00 27.86 ? 326 TYR C N     1 
ATOM   9273  C CA    . TYR C 1 326 ? -2.827  -21.009 63.539  1.00 28.41 ? 326 TYR C CA    1 
ATOM   9274  C C     . TYR C 1 326 ? -3.693  -22.242 63.201  1.00 30.44 ? 326 TYR C C     1 
ATOM   9275  O O     . TYR C 1 326 ? -4.749  -22.135 62.543  1.00 29.88 ? 326 TYR C O     1 
ATOM   9276  C CB    . TYR C 1 326 ? -1.762  -20.784 62.438  1.00 27.99 ? 326 TYR C CB    1 
ATOM   9277  C CG    . TYR C 1 326 ? -1.160  -19.405 62.418  1.00 29.06 ? 326 TYR C CG    1 
ATOM   9278  C CD1   . TYR C 1 326 ? -1.764  -18.356 61.673  1.00 26.74 ? 326 TYR C CD1   1 
ATOM   9279  C CD2   . TYR C 1 326 ? -0.033  -19.111 63.134  1.00 26.40 ? 326 TYR C CD2   1 
ATOM   9280  C CE1   . TYR C 1 326 ? -1.279  -17.090 61.681  1.00 23.54 ? 326 TYR C CE1   1 
ATOM   9281  C CE2   . TYR C 1 326 ? 0.477   -17.760 63.138  1.00 30.28 ? 326 TYR C CE2   1 
ATOM   9282  C CZ    . TYR C 1 326 ? -0.148  -16.786 62.344  1.00 28.71 ? 326 TYR C CZ    1 
ATOM   9283  O OH    . TYR C 1 326 ? 0.326   -15.497 62.258  1.00 27.58 ? 326 TYR C OH    1 
ATOM   9284  N N     . SER C 1 327 ? -3.292  -23.391 63.704  1.00 31.50 ? 327 SER C N     1 
ATOM   9285  C CA    . SER C 1 327 ? -4.128  -24.591 63.500  1.00 36.23 ? 327 SER C CA    1 
ATOM   9286  C C     . SER C 1 327 ? -5.454  -24.613 64.252  1.00 35.55 ? 327 SER C C     1 
ATOM   9287  O O     . SER C 1 327 ? -6.422  -25.107 63.732  1.00 37.41 ? 327 SER C O     1 
ATOM   9288  C CB    . SER C 1 327 ? -3.373  -25.912 63.750  1.00 36.98 ? 327 SER C CB    1 
ATOM   9289  O OG    . SER C 1 327 ? -4.046  -26.914 62.974  1.00 43.72 ? 327 SER C OG    1 
ATOM   9290  N N     . ASN C 1 328 ? -5.498  -24.166 65.499  1.00 35.42 ? 328 ASN C N     1 
ATOM   9291  C CA    . ASN C 1 328 ? -6.779  -23.932 66.154  1.00 34.19 ? 328 ASN C CA    1 
ATOM   9292  C C     . ASN C 1 328 ? -7.613  -22.785 65.541  1.00 34.10 ? 328 ASN C C     1 
ATOM   9293  O O     . ASN C 1 328 ? -8.854  -22.825 65.544  1.00 35.37 ? 328 ASN C O     1 
ATOM   9294  C CB    . ASN C 1 328 ? -6.539  -23.584 67.654  1.00 34.88 ? 328 ASN C CB    1 
ATOM   9295  C CG    . ASN C 1 328 ? -6.460  -24.800 68.492  1.00 38.39 ? 328 ASN C CG    1 
ATOM   9296  O OD1   . ASN C 1 328 ? -5.543  -24.959 69.320  1.00 44.90 ? 328 ASN C OD1   1 
ATOM   9297  N ND2   . ASN C 1 328 ? -7.394  -25.739 68.242  1.00 40.97 ? 328 ASN C ND2   1 
ATOM   9298  N N     . GLN C 1 329 ? -6.943  -21.728 65.122  1.00 33.53 ? 329 GLN C N     1 
ATOM   9299  C CA    . GLN C 1 329 ? -7.585  -20.662 64.342  1.00 35.15 ? 329 GLN C CA    1 
ATOM   9300  C C     . GLN C 1 329 ? -8.222  -21.200 63.033  1.00 34.26 ? 329 GLN C C     1 
ATOM   9301  O O     . GLN C 1 329 ? -9.313  -20.835 62.689  1.00 34.58 ? 329 GLN C O     1 
ATOM   9302  C CB    . GLN C 1 329 ? -6.544  -19.598 63.938  1.00 35.45 ? 329 GLN C CB    1 
ATOM   9303  C CG    . GLN C 1 329 ? -6.047  -18.727 65.053  1.00 35.48 ? 329 GLN C CG    1 
ATOM   9304  C CD    . GLN C 1 329 ? -7.112  -17.804 65.633  1.00 35.10 ? 329 GLN C CD    1 
ATOM   9305  O OE1   . GLN C 1 329 ? -7.486  -17.954 66.778  1.00 35.99 ? 329 GLN C OE1   1 
ATOM   9306  N NE2   . GLN C 1 329 ? -7.612  -16.864 64.835  1.00 32.11 ? 329 GLN C NE2   1 
ATOM   9307  N N     . LYS C 1 330 ? -7.507  -22.023 62.293  1.00 34.54 ? 330 LYS C N     1 
ATOM   9308  C CA    . LYS C 1 330 ? -8.034  -22.685 61.077  1.00 34.50 ? 330 LYS C CA    1 
ATOM   9309  C C     . LYS C 1 330 ? -9.285  -23.560 61.410  1.00 35.03 ? 330 LYS C C     1 
ATOM   9310  O O     . LYS C 1 330 ? -10.357 -23.401 60.809  1.00 34.11 ? 330 LYS C O     1 
ATOM   9311  C CB    . LYS C 1 330 ? -6.934  -23.552 60.437  1.00 34.64 ? 330 LYS C CB    1 
ATOM   9312  C CG    . LYS C 1 330 ? -7.530  -24.707 59.647  1.00 35.34 ? 330 LYS C CG    1 
ATOM   9313  C CD    . LYS C 1 330 ? -6.451  -25.689 59.195  1.00 35.10 ? 330 LYS C CD    1 
ATOM   9314  C CE    . LYS C 1 330 ? -6.803  -27.105 59.723  1.00 40.34 ? 330 LYS C CE    1 
ATOM   9315  N NZ    . LYS C 1 330 ? -5.785  -27.531 60.707  1.00 33.50 ? 330 LYS C NZ    1 
ATOM   9316  N N     . ASP C 1 331 ? -9.172  -24.424 62.435  1.00 34.50 ? 331 ASP C N     1 
ATOM   9317  C CA    . ASP C 1 331 ? -10.359 -25.056 63.005  1.00 33.21 ? 331 ASP C CA    1 
ATOM   9318  C C     . ASP C 1 331 ? -11.500 -24.030 63.209  1.00 32.77 ? 331 ASP C C     1 
ATOM   9319  O O     . ASP C 1 331 ? -12.651 -24.232 62.738  1.00 31.07 ? 331 ASP C O     1 
ATOM   9320  C CB    . ASP C 1 331 ? -10.027 -25.684 64.375  1.00 33.44 ? 331 ASP C CB    1 
ATOM   9321  C CG    . ASP C 1 331 ? -9.040  -26.868 64.283  1.00 38.11 ? 331 ASP C CG    1 
ATOM   9322  O OD1   . ASP C 1 331 ? -8.929  -27.599 63.248  1.00 43.22 ? 331 ASP C OD1   1 
ATOM   9323  O OD2   . ASP C 1 331 ? -8.327  -27.056 65.272  1.00 40.37 ? 331 ASP C OD2   1 
ATOM   9324  N N     . ALA C 1 332 ? -11.222 -22.949 63.967  1.00 30.50 ? 332 ALA C N     1 
ATOM   9325  C CA    . ALA C 1 332 ? -12.334 -22.088 64.314  1.00 29.93 ? 332 ALA C CA    1 
ATOM   9326  C C     . ALA C 1 332 ? -12.948 -21.516 63.029  1.00 28.03 ? 332 ALA C C     1 
ATOM   9327  O O     . ALA C 1 332 ? -14.141 -21.421 62.893  1.00 28.27 ? 332 ALA C O     1 
ATOM   9328  C CB    . ALA C 1 332 ? -11.928 -20.963 65.350  1.00 30.70 ? 332 ALA C CB    1 
ATOM   9329  N N     . ILE C 1 333 ? -12.160 -21.183 62.045  1.00 29.53 ? 333 ILE C N     1 
ATOM   9330  C CA    . ILE C 1 333 ? -12.780 -20.600 60.806  1.00 29.65 ? 333 ILE C CA    1 
ATOM   9331  C C     . ILE C 1 333 ? -13.510 -21.649 59.914  1.00 29.58 ? 333 ILE C C     1 
ATOM   9332  O O     . ILE C 1 333 ? -14.502 -21.360 59.268  1.00 30.53 ? 333 ILE C O     1 
ATOM   9333  C CB    . ILE C 1 333 ? -11.750 -19.709 59.978  1.00 30.53 ? 333 ILE C CB    1 
ATOM   9334  C CG1   . ILE C 1 333 ? -12.480 -18.777 59.002  1.00 28.83 ? 333 ILE C CG1   1 
ATOM   9335  C CG2   . ILE C 1 333 ? -10.689 -20.556 59.188  1.00 28.44 ? 333 ILE C CG2   1 
ATOM   9336  C CD1   . ILE C 1 333 ? -11.608 -17.831 58.307  1.00 28.87 ? 333 ILE C CD1   1 
ATOM   9337  N N     . LEU C 1 334 ? -12.985 -22.859 59.869  1.00 31.64 ? 334 LEU C N     1 
ATOM   9338  C CA    . LEU C 1 334 ? -13.663 -24.020 59.267  1.00 30.96 ? 334 LEU C CA    1 
ATOM   9339  C C     . LEU C 1 334 ? -15.025 -24.318 59.914  1.00 29.59 ? 334 LEU C C     1 
ATOM   9340  O O     . LEU C 1 334 ? -15.996 -24.561 59.212  1.00 30.92 ? 334 LEU C O     1 
ATOM   9341  C CB    . LEU C 1 334 ? -12.729 -25.245 59.297  1.00 31.29 ? 334 LEU C CB    1 
ATOM   9342  C CG    . LEU C 1 334 ? -11.975 -25.558 57.967  1.00 34.37 ? 334 LEU C CG    1 
ATOM   9343  C CD1   . LEU C 1 334 ? -11.747 -24.346 57.073  1.00 36.06 ? 334 LEU C CD1   1 
ATOM   9344  C CD2   . LEU C 1 334 ? -10.666 -26.281 58.197  1.00 31.51 ? 334 LEU C CD2   1 
ATOM   9345  N N     . ALA C 1 335 ? -15.135 -24.223 61.226  1.00 25.96 ? 335 ALA C N     1 
ATOM   9346  C CA    . ALA C 1 335 ? -16.412 -24.432 61.827  1.00 25.46 ? 335 ALA C CA    1 
ATOM   9347  C C     . ALA C 1 335 ? -17.391 -23.267 61.594  1.00 26.01 ? 335 ALA C C     1 
ATOM   9348  O O     . ALA C 1 335 ? -18.599 -23.464 61.396  1.00 26.86 ? 335 ALA C O     1 
ATOM   9349  C CB    . ALA C 1 335 ? -16.252 -24.721 63.395  1.00 26.12 ? 335 ALA C CB    1 
ATOM   9350  N N     . ALA C 1 336 ? -16.906 -22.029 61.651  1.00 25.64 ? 336 ALA C N     1 
ATOM   9351  C CA    . ALA C 1 336 ? -17.756 -20.905 61.211  1.00 25.54 ? 336 ALA C CA    1 
ATOM   9352  C C     . ALA C 1 336 ? -18.284 -21.062 59.722  1.00 26.50 ? 336 ALA C C     1 
ATOM   9353  O O     . ALA C 1 336 ? -19.310 -20.503 59.342  1.00 24.93 ? 336 ALA C O     1 
ATOM   9354  C CB    . ALA C 1 336 ? -16.966 -19.718 61.299  1.00 24.72 ? 336 ALA C CB    1 
ATOM   9355  N N     . ALA C 1 337 ? -17.530 -21.758 58.860  1.00 27.38 ? 337 ALA C N     1 
ATOM   9356  C CA    . ALA C 1 337 ? -17.868 -21.755 57.429  1.00 27.48 ? 337 ALA C CA    1 
ATOM   9357  C C     . ALA C 1 337 ? -18.897 -22.860 57.212  1.00 28.85 ? 337 ALA C C     1 
ATOM   9358  O O     . ALA C 1 337 ? -19.949 -22.597 56.632  1.00 29.27 ? 337 ALA C O     1 
ATOM   9359  C CB    . ALA C 1 337 ? -16.581 -21.956 56.516  1.00 26.61 ? 337 ALA C CB    1 
ATOM   9360  N N     . ASP C 1 338 ? -18.619 -24.081 57.715  1.00 30.49 ? 338 ASP C N     1 
ATOM   9361  C CA    . ASP C 1 338 ? -19.695 -25.118 57.867  1.00 32.18 ? 338 ASP C CA    1 
ATOM   9362  C C     . ASP C 1 338 ? -20.989 -24.700 58.497  1.00 32.78 ? 338 ASP C C     1 
ATOM   9363  O O     . ASP C 1 338 ? -22.077 -25.225 58.120  1.00 34.55 ? 338 ASP C O     1 
ATOM   9364  C CB    . ASP C 1 338 ? -19.185 -26.311 58.624  1.00 32.31 ? 338 ASP C CB    1 
ATOM   9365  C CG    . ASP C 1 338 ? -18.023 -26.931 57.921  1.00 37.73 ? 338 ASP C CG    1 
ATOM   9366  O OD1   . ASP C 1 338 ? -18.031 -26.946 56.638  1.00 39.44 ? 338 ASP C OD1   1 
ATOM   9367  O OD2   . ASP C 1 338 ? -17.126 -27.385 58.638  1.00 39.01 ? 338 ASP C OD2   1 
ATOM   9368  N N     . LYS C 1 339 ? -20.925 -23.762 59.425  1.00 31.16 ? 339 LYS C N     1 
ATOM   9369  C CA    . LYS C 1 339 ? -22.106 -23.421 60.141  1.00 32.29 ? 339 LYS C CA    1 
ATOM   9370  C C     . LYS C 1 339 ? -22.983 -22.413 59.332  1.00 32.54 ? 339 LYS C C     1 
ATOM   9371  O O     . LYS C 1 339 ? -24.199 -22.589 59.258  1.00 32.41 ? 339 LYS C O     1 
ATOM   9372  C CB    . LYS C 1 339 ? -21.789 -23.026 61.603  1.00 32.74 ? 339 LYS C CB    1 
ATOM   9373  C CG    . LYS C 1 339 ? -22.693 -21.948 62.220  1.00 36.00 ? 339 LYS C CG    1 
ATOM   9374  C CD    . LYS C 1 339 ? -22.391 -21.736 63.713  1.00 32.11 ? 339 LYS C CD    1 
ATOM   9375  C CE    . LYS C 1 339 ? -23.519 -20.976 64.365  1.00 31.46 ? 339 LYS C CE    1 
ATOM   9376  N NZ    . LYS C 1 339 ? -23.033 -20.371 65.683  1.00 34.23 ? 339 LYS C NZ    1 
ATOM   9377  N N     . TRP C 1 340 ? -22.392 -21.434 58.660  1.00 30.80 ? 340 TRP C N     1 
ATOM   9378  C CA    . TRP C 1 340 ? -23.208 -20.475 57.969  1.00 28.65 ? 340 TRP C CA    1 
ATOM   9379  C C     . TRP C 1 340 ? -23.195 -20.665 56.450  1.00 30.18 ? 340 TRP C C     1 
ATOM   9380  O O     . TRP C 1 340 ? -24.150 -20.246 55.755  1.00 29.58 ? 340 TRP C O     1 
ATOM   9381  C CB    . TRP C 1 340 ? -22.729 -19.047 58.329  1.00 29.20 ? 340 TRP C CB    1 
ATOM   9382  C CG    . TRP C 1 340 ? -22.997 -18.705 59.770  1.00 26.90 ? 340 TRP C CG    1 
ATOM   9383  C CD1   . TRP C 1 340 ? -22.092 -18.634 60.775  1.00 22.36 ? 340 TRP C CD1   1 
ATOM   9384  C CD2   . TRP C 1 340 ? -24.287 -18.415 60.355  1.00 31.37 ? 340 TRP C CD2   1 
ATOM   9385  N NE1   . TRP C 1 340 ? -22.731 -18.340 61.959  1.00 26.74 ? 340 TRP C NE1   1 
ATOM   9386  C CE2   . TRP C 1 340 ? -24.063 -18.137 61.719  1.00 30.36 ? 340 TRP C CE2   1 
ATOM   9387  C CE3   . TRP C 1 340 ? -25.610 -18.308 59.842  1.00 27.28 ? 340 TRP C CE3   1 
ATOM   9388  C CZ2   . TRP C 1 340 ? -25.105 -17.807 62.588  1.00 27.39 ? 340 TRP C CZ2   1 
ATOM   9389  C CZ3   . TRP C 1 340 ? -26.637 -17.934 60.714  1.00 26.12 ? 340 TRP C CZ3   1 
ATOM   9390  C CH2   . TRP C 1 340 ? -26.382 -17.718 62.047  1.00 25.64 ? 340 TRP C CH2   1 
ATOM   9391  N N     . LEU C 1 341 ? -22.133 -21.281 55.914  1.00 29.97 ? 341 LEU C N     1 
ATOM   9392  C CA    . LEU C 1 341 ? -21.949 -21.281 54.461  1.00 31.25 ? 341 LEU C CA    1 
ATOM   9393  C C     . LEU C 1 341 ? -22.260 -22.557 53.694  1.00 31.38 ? 341 LEU C C     1 
ATOM   9394  O O     . LEU C 1 341 ? -22.201 -22.574 52.470  1.00 30.17 ? 341 LEU C O     1 
ATOM   9395  C CB    . LEU C 1 341 ? -20.506 -20.826 54.107  1.00 31.46 ? 341 LEU C CB    1 
ATOM   9396  C CG    . LEU C 1 341 ? -20.057 -19.437 54.559  1.00 29.62 ? 341 LEU C CG    1 
ATOM   9397  C CD1   . LEU C 1 341 ? -18.679 -19.161 54.083  1.00 26.99 ? 341 LEU C CD1   1 
ATOM   9398  C CD2   . LEU C 1 341 ? -21.041 -18.400 54.038  1.00 33.76 ? 341 LEU C CD2   1 
ATOM   9399  N N     . THR C 1 342 ? -22.572 -23.614 54.425  1.00 34.31 ? 342 THR C N     1 
ATOM   9400  C CA    . THR C 1 342 ? -22.559 -24.984 53.861  1.00 34.82 ? 342 THR C CA    1 
ATOM   9401  C C     . THR C 1 342 ? -23.107 -25.144 52.417  1.00 34.92 ? 342 THR C C     1 
ATOM   9402  O O     . THR C 1 342 ? -22.447 -25.747 51.502  1.00 37.60 ? 342 THR C O     1 
ATOM   9403  C CB    . THR C 1 342 ? -23.222 -25.978 54.813  1.00 34.89 ? 342 THR C CB    1 
ATOM   9404  O OG1   . THR C 1 342 ? -22.301 -26.241 55.879  1.00 38.63 ? 342 THR C OG1   1 
ATOM   9405  C CG2   . THR C 1 342 ? -23.531 -27.301 54.090  1.00 31.05 ? 342 THR C CG2   1 
ATOM   9406  N N     . GLY C 1 343 ? -24.293 -24.664 52.139  1.00 32.85 ? 343 GLY C N     1 
ATOM   9407  C CA    . GLY C 1 343 ? -24.602 -24.957 50.725  1.00 30.92 ? 343 GLY C CA    1 
ATOM   9408  C C     . GLY C 1 343 ? -24.536 -23.741 49.838  1.00 28.39 ? 343 GLY C C     1 
ATOM   9409  O O     . GLY C 1 343 ? -25.237 -23.701 48.886  1.00 26.88 ? 343 GLY C O     1 
ATOM   9410  N N     . LEU C 1 344 ? -23.696 -22.775 50.181  1.00 26.24 ? 344 LEU C N     1 
ATOM   9411  C CA    . LEU C 1 344 ? -23.705 -21.460 49.524  1.00 28.47 ? 344 LEU C CA    1 
ATOM   9412  C C     . LEU C 1 344 ? -22.382 -21.079 48.910  1.00 28.38 ? 344 LEU C C     1 
ATOM   9413  O O     . LEU C 1 344 ? -22.322 -20.134 48.156  1.00 28.36 ? 344 LEU C O     1 
ATOM   9414  C CB    . LEU C 1 344 ? -23.991 -20.352 50.578  1.00 28.31 ? 344 LEU C CB    1 
ATOM   9415  C CG    . LEU C 1 344 ? -25.322 -19.676 50.874  1.00 29.02 ? 344 LEU C CG    1 
ATOM   9416  C CD1   . LEU C 1 344 ? -26.596 -20.312 50.329  1.00 24.99 ? 344 LEU C CD1   1 
ATOM   9417  C CD2   . LEU C 1 344 ? -25.374 -19.661 52.389  1.00 29.64 ? 344 LEU C CD2   1 
ATOM   9418  N N     . ALA C 1 345 ? -21.327 -21.800 49.326  1.00 29.08 ? 345 ALA C N     1 
ATOM   9419  C CA    . ALA C 1 345 ? -19.954 -21.593 48.917  1.00 29.73 ? 345 ALA C CA    1 
ATOM   9420  C C     . ALA C 1 345 ? -19.268 -22.967 49.044  1.00 30.12 ? 345 ALA C C     1 
ATOM   9421  O O     . ALA C 1 345 ? -19.786 -23.842 49.706  1.00 28.38 ? 345 ALA C O     1 
ATOM   9422  C CB    . ALA C 1 345 ? -19.267 -20.520 49.844  1.00 28.38 ? 345 ALA C CB    1 
ATOM   9423  N N     . GLU C 1 346 ? -18.125 -23.126 48.380  1.00 31.39 ? 346 GLU C N     1 
ATOM   9424  C CA    . GLU C 1 346 ? -17.207 -24.288 48.554  1.00 34.42 ? 346 GLU C CA    1 
ATOM   9425  C C     . GLU C 1 346 ? -15.835 -23.764 49.010  1.00 33.13 ? 346 GLU C C     1 
ATOM   9426  O O     . GLU C 1 346 ? -15.460 -22.608 48.716  1.00 32.66 ? 346 GLU C O     1 
ATOM   9427  C CB    . GLU C 1 346 ? -17.079 -25.064 47.198  1.00 32.06 ? 346 GLU C CB    1 
ATOM   9428  C CG    . GLU C 1 346 ? -18.503 -25.318 46.639  1.00 36.64 ? 346 GLU C CG    1 
ATOM   9429  C CD    . GLU C 1 346 ? -18.638 -26.171 45.397  1.00 40.99 ? 346 GLU C CD    1 
ATOM   9430  O OE1   . GLU C 1 346 ? -19.509 -27.120 45.446  1.00 49.50 ? 346 GLU C OE1   1 
ATOM   9431  O OE2   . GLU C 1 346 ? -17.939 -25.880 44.370  1.00 47.28 ? 346 GLU C OE2   1 
ATOM   9432  N N     . TRP C 1 347 ? -15.061 -24.624 49.663  1.00 31.88 ? 347 TRP C N     1 
ATOM   9433  C CA    . TRP C 1 347 ? -13.673 -24.287 50.047  1.00 31.97 ? 347 TRP C CA    1 
ATOM   9434  C C     . TRP C 1 347 ? -12.944 -25.600 50.324  1.00 32.60 ? 347 TRP C C     1 
ATOM   9435  O O     . TRP C 1 347 ? -13.563 -26.605 50.639  1.00 30.27 ? 347 TRP C O     1 
ATOM   9436  C CB    . TRP C 1 347 ? -13.645 -23.381 51.330  1.00 30.98 ? 347 TRP C CB    1 
ATOM   9437  C CG    . TRP C 1 347 ? -14.384 -24.038 52.512  1.00 30.41 ? 347 TRP C CG    1 
ATOM   9438  C CD1   . TRP C 1 347 ? -13.815 -24.823 53.473  1.00 29.04 ? 347 TRP C CD1   1 
ATOM   9439  C CD2   . TRP C 1 347 ? -15.793 -24.001 52.820  1.00 29.42 ? 347 TRP C CD2   1 
ATOM   9440  N NE1   . TRP C 1 347 ? -14.749 -25.274 54.356  1.00 31.89 ? 347 TRP C NE1   1 
ATOM   9441  C CE2   . TRP C 1 347 ? -15.983 -24.816 53.977  1.00 32.71 ? 347 TRP C CE2   1 
ATOM   9442  C CE3   . TRP C 1 347 ? -16.920 -23.408 52.220  1.00 29.16 ? 347 TRP C CE3   1 
ATOM   9443  C CZ2   . TRP C 1 347 ? -17.249 -25.032 54.550  1.00 32.35 ? 347 TRP C CZ2   1 
ATOM   9444  C CZ3   . TRP C 1 347 ? -18.174 -23.627 52.771  1.00 29.95 ? 347 TRP C CZ3   1 
ATOM   9445  C CH2   . TRP C 1 347 ? -18.339 -24.440 53.954  1.00 31.78 ? 347 TRP C CH2   1 
ATOM   9446  N N     . HIS C 1 348 ? -11.623 -25.577 50.234  1.00 34.77 ? 348 HIS C N     1 
ATOM   9447  C CA    . HIS C 1 348 ? -10.826 -26.717 50.689  1.00 35.97 ? 348 HIS C CA    1 
ATOM   9448  C C     . HIS C 1 348 ? -10.219 -26.369 52.060  1.00 36.23 ? 348 HIS C C     1 
ATOM   9449  O O     . HIS C 1 348 ? -10.090 -25.170 52.442  1.00 35.77 ? 348 HIS C O     1 
ATOM   9450  C CB    . HIS C 1 348 ? -9.697  -27.030 49.690  1.00 36.91 ? 348 HIS C CB    1 
ATOM   9451  C CG    . HIS C 1 348 ? -10.136 -27.181 48.273  1.00 36.35 ? 348 HIS C CG    1 
ATOM   9452  N ND1   . HIS C 1 348 ? -10.759 -28.308 47.803  1.00 40.07 ? 348 HIS C ND1   1 
ATOM   9453  C CD2   . HIS C 1 348 ? -9.961  -26.375 47.193  1.00 40.23 ? 348 HIS C CD2   1 
ATOM   9454  C CE1   . HIS C 1 348 ? -10.989 -28.183 46.505  1.00 39.61 ? 348 HIS C CE1   1 
ATOM   9455  N NE2   . HIS C 1 348 ? -10.495 -27.023 46.109  1.00 37.19 ? 348 HIS C NE2   1 
ATOM   9456  N N     . VAL C 1 349 ? -9.800  -27.414 52.777  1.00 35.15 ? 349 VAL C N     1 
ATOM   9457  C CA    . VAL C 1 349 ? -9.035  -27.259 54.046  1.00 33.24 ? 349 VAL C CA    1 
ATOM   9458  C C     . VAL C 1 349 ? -7.585  -26.789 53.659  1.00 33.48 ? 349 VAL C C     1 
ATOM   9459  O O     . VAL C 1 349 ? -6.882  -27.491 52.912  1.00 32.54 ? 349 VAL C O     1 
ATOM   9460  C CB    . VAL C 1 349 ? -9.129  -28.541 54.943  1.00 34.04 ? 349 VAL C CB    1 
ATOM   9461  C CG1   . VAL C 1 349 ? -8.752  -29.769 54.099  1.00 39.00 ? 349 VAL C CG1   1 
ATOM   9462  C CG2   . VAL C 1 349 ? -8.202  -28.539 56.169  1.00 30.78 ? 349 VAL C CG2   1 
ATOM   9463  N N     . PRO C 1 350 ? -7.169  -25.564 54.135  1.00 31.87 ? 350 PRO C N     1 
ATOM   9464  C CA    . PRO C 1 350 ? -5.814  -25.046 53.986  1.00 31.67 ? 350 PRO C CA    1 
ATOM   9465  C C     . PRO C 1 350 ? -4.850  -26.072 54.628  1.00 30.35 ? 350 PRO C C     1 
ATOM   9466  O O     . PRO C 1 350 ? -5.119  -26.557 55.773  1.00 30.06 ? 350 PRO C O     1 
ATOM   9467  C CB    . PRO C 1 350 ? -5.831  -23.741 54.879  1.00 31.31 ? 350 PRO C CB    1 
ATOM   9468  C CG    . PRO C 1 350 ? -7.223  -23.400 55.064  1.00 31.08 ? 350 PRO C CG    1 
ATOM   9469  C CD    . PRO C 1 350 ? -8.021  -24.648 54.928  1.00 32.25 ? 350 PRO C CD    1 
ATOM   9470  N N     . ALA C 1 351 ? -3.742  -26.338 53.946  1.00 29.07 ? 351 ALA C N     1 
ATOM   9471  C CA    . ALA C 1 351 ? -2.703  -27.306 54.370  1.00 28.97 ? 351 ALA C CA    1 
ATOM   9472  C C     . ALA C 1 351 ? -1.598  -26.577 55.120  1.00 29.53 ? 351 ALA C C     1 
ATOM   9473  O O     . ALA C 1 351 ? -0.801  -27.183 55.874  1.00 31.03 ? 351 ALA C O     1 
ATOM   9474  C CB    . ALA C 1 351 ? -2.090  -27.954 53.146  1.00 30.07 ? 351 ALA C CB    1 
ATOM   9475  N N     . ALA C 1 352 ? -1.551  -25.262 54.927  1.00 28.25 ? 352 ALA C N     1 
ATOM   9476  C CA    . ALA C 1 352 ? -0.539  -24.427 55.558  1.00 29.27 ? 352 ALA C CA    1 
ATOM   9477  C C     . ALA C 1 352 ? -1.023  -22.969 55.575  1.00 28.69 ? 352 ALA C C     1 
ATOM   9478  O O     . ALA C 1 352 ? -2.111  -22.664 55.069  1.00 29.36 ? 352 ALA C O     1 
ATOM   9479  C CB    . ALA C 1 352 ? 0.799   -24.521 54.830  1.00 29.50 ? 352 ALA C CB    1 
ATOM   9480  N N     . GLY C 1 353 ? -0.259  -22.119 56.239  1.00 27.01 ? 353 GLY C N     1 
ATOM   9481  C CA    . GLY C 1 353 ? -0.556  -20.701 56.316  1.00 26.40 ? 353 GLY C CA    1 
ATOM   9482  C C     . GLY C 1 353 ? -1.705  -20.141 57.118  1.00 27.90 ? 353 GLY C C     1 
ATOM   9483  O O     . GLY C 1 353 ? -2.010  -20.554 58.285  1.00 25.84 ? 353 GLY C O     1 
ATOM   9484  N N     . MET C 1 354 ? -2.343  -19.144 56.479  1.00 29.05 ? 354 MET C N     1 
ATOM   9485  C CA    . MET C 1 354 ? -3.182  -18.223 57.204  1.00 29.56 ? 354 MET C CA    1 
ATOM   9486  C C     . MET C 1 354 ? -4.444  -17.783 56.467  1.00 28.55 ? 354 MET C C     1 
ATOM   9487  O O     . MET C 1 354 ? -5.135  -16.896 56.900  1.00 26.44 ? 354 MET C O     1 
ATOM   9488  C CB    . MET C 1 354 ? -2.357  -17.076 57.832  1.00 30.28 ? 354 MET C CB    1 
ATOM   9489  C CG    . MET C 1 354 ? -1.959  -15.836 56.998  1.00 34.14 ? 354 MET C CG    1 
ATOM   9490  S SD    . MET C 1 354 ? -0.667  -14.820 57.887  1.00 32.61 ? 354 MET C SD    1 
ATOM   9491  C CE    . MET C 1 354 ? 0.066   -16.141 58.836  1.00 28.45 ? 354 MET C CE    1 
ATOM   9492  N N     . PHE C 1 355 ? -4.733  -18.473 55.370  1.00 28.14 ? 355 PHE C N     1 
ATOM   9493  C CA    . PHE C 1 355 ? -5.823  -18.086 54.503  1.00 28.75 ? 355 PHE C CA    1 
ATOM   9494  C C     . PHE C 1 355 ? -6.841  -19.175 54.258  1.00 28.64 ? 355 PHE C C     1 
ATOM   9495  O O     . PHE C 1 355 ? -6.511  -20.358 54.153  1.00 29.77 ? 355 PHE C O     1 
ATOM   9496  C CB    . PHE C 1 355 ? -5.247  -17.484 53.239  1.00 29.75 ? 355 PHE C CB    1 
ATOM   9497  C CG    . PHE C 1 355 ? -4.475  -16.171 53.515  1.00 29.02 ? 355 PHE C CG    1 
ATOM   9498  C CD1   . PHE C 1 355 ? -5.147  -15.068 54.041  1.00 29.01 ? 355 PHE C CD1   1 
ATOM   9499  C CD2   . PHE C 1 355 ? -3.118  -16.077 53.256  1.00 28.03 ? 355 PHE C CD2   1 
ATOM   9500  C CE1   . PHE C 1 355 ? -4.480  -13.872 54.314  1.00 32.47 ? 355 PHE C CE1   1 
ATOM   9501  C CE2   . PHE C 1 355 ? -2.428  -14.921 53.528  1.00 32.01 ? 355 PHE C CE2   1 
ATOM   9502  C CZ    . PHE C 1 355 ? -3.119  -13.795 54.088  1.00 31.33 ? 355 PHE C CZ    1 
ATOM   9503  N N     . LEU C 1 356 ? -8.100  -18.798 54.265  1.00 27.71 ? 356 LEU C N     1 
ATOM   9504  C CA    . LEU C 1 356 ? -9.113  -19.690 53.751  1.00 27.26 ? 356 LEU C CA    1 
ATOM   9505  C C     . LEU C 1 356 ? -9.648  -19.061 52.416  1.00 28.86 ? 356 LEU C C     1 
ATOM   9506  O O     . LEU C 1 356 ? -9.964  -17.852 52.331  1.00 30.23 ? 356 LEU C O     1 
ATOM   9507  C CB    . LEU C 1 356 ? -10.260 -19.989 54.777  1.00 27.14 ? 356 LEU C CB    1 
ATOM   9508  C CG    . LEU C 1 356 ? -11.474 -20.836 54.264  1.00 26.31 ? 356 LEU C CG    1 
ATOM   9509  C CD1   . LEU C 1 356 ? -11.037 -22.252 54.106  1.00 26.36 ? 356 LEU C CD1   1 
ATOM   9510  C CD2   . LEU C 1 356 ? -12.822 -20.695 55.131  1.00 24.81 ? 356 LEU C CD2   1 
ATOM   9511  N N     . TRP C 1 357 ? -9.726  -19.872 51.381  1.00 28.45 ? 357 TRP C N     1 
ATOM   9512  C CA    . TRP C 1 357 ? -10.192 -19.379 50.061  1.00 29.09 ? 357 TRP C CA    1 
ATOM   9513  C C     . TRP C 1 357 ? -11.611 -19.897 49.789  1.00 30.04 ? 357 TRP C C     1 
ATOM   9514  O O     . TRP C 1 357 ? -11.884 -21.122 49.778  1.00 29.66 ? 357 TRP C O     1 
ATOM   9515  C CB    . TRP C 1 357 ? -9.167  -19.892 49.069  1.00 27.40 ? 357 TRP C CB    1 
ATOM   9516  C CG    . TRP C 1 357 ? -9.177  -19.455 47.637  1.00 29.26 ? 357 TRP C CG    1 
ATOM   9517  C CD1   . TRP C 1 357 ? -9.164  -20.290 46.558  1.00 23.91 ? 357 TRP C CD1   1 
ATOM   9518  C CD2   . TRP C 1 357 ? -9.037  -18.120 47.109  1.00 26.70 ? 357 TRP C CD2   1 
ATOM   9519  N NE1   . TRP C 1 357 ? -8.998  -19.557 45.418  1.00 25.75 ? 357 TRP C NE1   1 
ATOM   9520  C CE2   . TRP C 1 357 ? -8.940  -18.237 45.707  1.00 29.99 ? 357 TRP C CE2   1 
ATOM   9521  C CE3   . TRP C 1 357 ? -8.975  -16.855 47.677  1.00 26.68 ? 357 TRP C CE3   1 
ATOM   9522  C CZ2   . TRP C 1 357 ? -8.873  -17.094 44.824  1.00 31.86 ? 357 TRP C CZ2   1 
ATOM   9523  C CZ3   . TRP C 1 357 ? -8.914  -15.731 46.840  1.00 27.66 ? 357 TRP C CZ3   1 
ATOM   9524  C CH2   . TRP C 1 357 ? -8.835  -15.868 45.407  1.00 28.66 ? 357 TRP C CH2   1 
ATOM   9525  N N     . ILE C 1 358 ? -12.544 -18.970 49.660  1.00 32.16 ? 358 ILE C N     1 
ATOM   9526  C CA    . ILE C 1 358 ? -13.887 -19.369 49.531  1.00 32.57 ? 358 ILE C CA    1 
ATOM   9527  C C     . ILE C 1 358 ? -14.568 -19.004 48.189  1.00 32.73 ? 358 ILE C C     1 
ATOM   9528  O O     . ILE C 1 358 ? -14.591 -17.821 47.767  1.00 31.30 ? 358 ILE C O     1 
ATOM   9529  C CB    . ILE C 1 358 ? -14.804 -19.074 50.809  1.00 34.55 ? 358 ILE C CB    1 
ATOM   9530  C CG1   . ILE C 1 358 ? -15.960 -18.116 50.483  1.00 36.64 ? 358 ILE C CG1   1 
ATOM   9531  C CG2   . ILE C 1 358 ? -14.074 -18.837 52.221  1.00 30.60 ? 358 ILE C CG2   1 
ATOM   9532  C CD1   . ILE C 1 358 ? -17.167 -18.852 49.893  1.00 38.25 ? 358 ILE C CD1   1 
ATOM   9533  N N     . LYS C 1 359 ? -15.163 -20.016 47.544  1.00 31.97 ? 359 LYS C N     1 
ATOM   9534  C CA    . LYS C 1 359 ? -15.931 -19.766 46.330  1.00 31.49 ? 359 LYS C CA    1 
ATOM   9535  C C     . LYS C 1 359 ? -17.456 -19.722 46.606  1.00 31.74 ? 359 LYS C C     1 
ATOM   9536  O O     . LYS C 1 359 ? -18.024 -20.660 47.249  1.00 32.23 ? 359 LYS C O     1 
ATOM   9537  C CB    . LYS C 1 359 ? -15.564 -20.812 45.276  1.00 33.01 ? 359 LYS C CB    1 
ATOM   9538  C CG    . LYS C 1 359 ? -16.007 -20.508 43.823  1.00 35.59 ? 359 LYS C CG    1 
ATOM   9539  C CD    . LYS C 1 359 ? -16.060 -21.874 43.076  1.00 34.82 ? 359 LYS C CD    1 
ATOM   9540  C CE    . LYS C 1 359 ? -16.186 -21.688 41.549  1.00 44.23 ? 359 LYS C CE    1 
ATOM   9541  N NZ    . LYS C 1 359 ? -16.149 -23.019 40.753  1.00 39.47 ? 359 LYS C NZ    1 
ATOM   9542  N N     . VAL C 1 360 ? -18.095 -18.606 46.195  1.00 28.92 ? 360 VAL C N     1 
ATOM   9543  C CA    . VAL C 1 360 ? -19.504 -18.339 46.429  1.00 27.07 ? 360 VAL C CA    1 
ATOM   9544  C C     . VAL C 1 360 ? -20.090 -18.933 45.193  1.00 29.96 ? 360 VAL C C     1 
ATOM   9545  O O     . VAL C 1 360 ? -19.519 -18.704 44.072  1.00 29.30 ? 360 VAL C O     1 
ATOM   9546  C CB    . VAL C 1 360 ? -19.841 -16.760 46.486  1.00 26.10 ? 360 VAL C CB    1 
ATOM   9547  C CG1   . VAL C 1 360 ? -21.130 -16.514 47.059  1.00 26.07 ? 360 VAL C CG1   1 
ATOM   9548  C CG2   . VAL C 1 360 ? -18.899 -16.009 47.303  1.00 20.71 ? 360 VAL C CG2   1 
ATOM   9549  N N     . LYS C 1 361 ? -21.161 -19.733 45.364  1.00 31.80 ? 361 LYS C N     1 
ATOM   9550  C CA    . LYS C 1 361 ? -21.920 -20.278 44.246  1.00 35.50 ? 361 LYS C CA    1 
ATOM   9551  C C     . LYS C 1 361 ? -22.967 -19.193 43.940  1.00 37.49 ? 361 LYS C C     1 
ATOM   9552  O O     . LYS C 1 361 ? -23.518 -18.575 44.877  1.00 37.45 ? 361 LYS C O     1 
ATOM   9553  C CB    . LYS C 1 361 ? -22.722 -21.523 44.679  1.00 37.38 ? 361 LYS C CB    1 
ATOM   9554  C CG    . LYS C 1 361 ? -22.060 -22.789 45.338  1.00 34.12 ? 361 LYS C CG    1 
ATOM   9555  C CD    . LYS C 1 361 ? -23.200 -23.847 45.178  1.00 40.71 ? 361 LYS C CD    1 
ATOM   9556  C CE    . LYS C 1 361 ? -23.202 -25.008 46.228  1.00 47.78 ? 361 LYS C CE    1 
ATOM   9557  N NZ    . LYS C 1 361 ? -21.844 -25.529 46.479  1.00 47.62 ? 361 LYS C NZ    1 
ATOM   9558  N N     . GLY C 1 362 ? -23.256 -18.909 42.679  1.00 38.49 ? 362 GLY C N     1 
ATOM   9559  C CA    . GLY C 1 362 ? -24.381 -17.994 42.447  1.00 42.03 ? 362 GLY C CA    1 
ATOM   9560  C C     . GLY C 1 362 ? -23.992 -16.517 42.358  1.00 44.57 ? 362 GLY C C     1 
ATOM   9561  O O     . GLY C 1 362 ? -24.784 -15.650 41.957  1.00 43.76 ? 362 GLY C O     1 
ATOM   9562  N N     . ILE C 1 363 ? -22.774 -16.221 42.788  1.00 46.87 ? 363 ILE C N     1 
ATOM   9563  C CA    . ILE C 1 363 ? -22.151 -14.934 42.494  1.00 47.58 ? 363 ILE C CA    1 
ATOM   9564  C C     . ILE C 1 363 ? -21.069 -15.104 41.400  1.00 48.71 ? 363 ILE C C     1 
ATOM   9565  O O     . ILE C 1 363 ? -20.344 -16.144 41.322  1.00 48.02 ? 363 ILE C O     1 
ATOM   9566  C CB    . ILE C 1 363 ? -21.637 -14.244 43.769  1.00 47.89 ? 363 ILE C CB    1 
ATOM   9567  C CG1   . ILE C 1 363 ? -22.687 -14.293 44.897  1.00 48.07 ? 363 ILE C CG1   1 
ATOM   9568  C CG2   . ILE C 1 363 ? -21.392 -12.748 43.504  1.00 48.95 ? 363 ILE C CG2   1 
ATOM   9569  C CD1   . ILE C 1 363 ? -23.969 -13.485 44.582  1.00 47.29 ? 363 ILE C CD1   1 
ATOM   9570  N N     . ASN C 1 364 ? -21.022 -14.099 40.523  1.00 49.21 ? 364 ASN C N     1 
ATOM   9571  C CA    . ASN C 1 364 ? -20.053 -14.012 39.430  1.00 49.30 ? 364 ASN C CA    1 
ATOM   9572  C C     . ASN C 1 364 ? -18.880 -13.131 39.877  1.00 48.64 ? 364 ASN C C     1 
ATOM   9573  O O     . ASN C 1 364 ? -17.711 -13.468 39.671  1.00 47.08 ? 364 ASN C O     1 
ATOM   9574  C CB    . ASN C 1 364 ? -20.720 -13.309 38.263  1.00 49.51 ? 364 ASN C CB    1 
ATOM   9575  C CG    . ASN C 1 364 ? -19.982 -13.495 36.976  1.00 51.18 ? 364 ASN C CG    1 
ATOM   9576  O OD1   . ASN C 1 364 ? -19.655 -12.492 36.270  1.00 47.83 ? 364 ASN C OD1   1 
ATOM   9577  N ND2   . ASN C 1 364 ? -19.740 -14.787 36.609  1.00 48.39 ? 364 ASN C ND2   1 
ATOM   9578  N N     . ASP C 1 365 ? -19.254 -12.017 40.505  1.00 48.31 ? 365 ASP C N     1 
ATOM   9579  C CA    . ASP C 1 365 ? -18.375 -10.942 40.903  1.00 48.89 ? 365 ASP C CA    1 
ATOM   9580  C C     . ASP C 1 365 ? -18.627 -10.685 42.392  1.00 48.84 ? 365 ASP C C     1 
ATOM   9581  O O     . ASP C 1 365 ? -19.668 -10.140 42.775  1.00 48.24 ? 365 ASP C O     1 
ATOM   9582  C CB    . ASP C 1 365 ? -18.760 -9.699  40.083  1.00 48.89 ? 365 ASP C CB    1 
ATOM   9583  C CG    . ASP C 1 365 ? -17.582 -8.771  39.770  1.00 49.12 ? 365 ASP C CG    1 
ATOM   9584  O OD1   . ASP C 1 365 ? -17.780 -7.856  38.893  1.00 49.79 ? 365 ASP C OD1   1 
ATOM   9585  O OD2   . ASP C 1 365 ? -16.486 -8.950  40.365  1.00 48.92 ? 365 ASP C OD2   1 
ATOM   9586  N N     . VAL C 1 366 ? -17.667 -11.073 43.218  1.00 48.84 ? 366 VAL C N     1 
ATOM   9587  C CA    . VAL C 1 366 ? -17.772 -10.981 44.671  1.00 48.38 ? 366 VAL C CA    1 
ATOM   9588  C C     . VAL C 1 366 ? -17.292 -9.576  45.109  1.00 48.80 ? 366 VAL C C     1 
ATOM   9589  O O     . VAL C 1 366 ? -17.497 -9.139  46.280  1.00 47.43 ? 366 VAL C O     1 
ATOM   9590  C CB    . VAL C 1 366 ? -16.974 -12.178 45.315  1.00 49.22 ? 366 VAL C CB    1 
ATOM   9591  C CG1   . VAL C 1 366 ? -15.488 -11.826 45.542  1.00 49.15 ? 366 VAL C CG1   1 
ATOM   9592  C CG2   . VAL C 1 366 ? -17.644 -12.744 46.586  1.00 47.02 ? 366 VAL C CG2   1 
ATOM   9593  N N     . LYS C 1 367 ? -16.688 -8.874  44.134  1.00 49.66 ? 367 LYS C N     1 
ATOM   9594  C CA    . LYS C 1 367 ? -16.366 -7.402  44.182  1.00 50.68 ? 367 LYS C CA    1 
ATOM   9595  C C     . LYS C 1 367 ? -17.432 -6.487  44.819  1.00 49.26 ? 367 LYS C C     1 
ATOM   9596  O O     . LYS C 1 367 ? -17.168 -5.911  45.881  1.00 49.72 ? 367 LYS C O     1 
ATOM   9597  C CB    . LYS C 1 367 ? -15.889 -6.840  42.811  1.00 50.91 ? 367 LYS C CB    1 
ATOM   9598  C CG    . LYS C 1 367 ? -15.719 -5.258  42.758  1.00 52.00 ? 367 LYS C CG    1 
ATOM   9599  C CD    . LYS C 1 367 ? -15.268 -4.728  41.351  1.00 52.38 ? 367 LYS C CD    1 
ATOM   9600  C CE    . LYS C 1 367 ? -15.868 -3.329  41.026  1.00 54.01 ? 367 LYS C CE    1 
ATOM   9601  N NZ    . LYS C 1 367 ? -15.210 -2.192  41.823  1.00 54.69 ? 367 LYS C NZ    1 
ATOM   9602  N N     . GLU C 1 368 ? -18.623 -6.395  44.237  1.00 49.30 ? 368 GLU C N     1 
ATOM   9603  C CA    . GLU C 1 368 ? -19.672 -5.477  44.770  1.00 49.79 ? 368 GLU C CA    1 
ATOM   9604  C C     . GLU C 1 368 ? -20.284 -5.901  46.107  1.00 49.56 ? 368 GLU C C     1 
ATOM   9605  O O     . GLU C 1 368 ? -20.679 -5.032  46.945  1.00 50.00 ? 368 GLU C O     1 
ATOM   9606  C CB    . GLU C 1 368 ? -20.761 -5.108  43.708  1.00 50.59 ? 368 GLU C CB    1 
ATOM   9607  C CG    . GLU C 1 368 ? -22.260 -5.033  44.213  1.00 51.23 ? 368 GLU C CG    1 
ATOM   9608  C CD    . GLU C 1 368 ? -23.023 -3.768  43.793  1.00 57.17 ? 368 GLU C CD    1 
ATOM   9609  O OE1   . GLU C 1 368 ? -23.975 -3.372  44.524  1.00 58.79 ? 368 GLU C OE1   1 
ATOM   9610  O OE2   . GLU C 1 368 ? -22.691 -3.135  42.756  1.00 58.39 ? 368 GLU C OE2   1 
ATOM   9611  N N     . LEU C 1 369 ? -20.373 -7.210  46.338  1.00 48.31 ? 369 LEU C N     1 
ATOM   9612  C CA    . LEU C 1 369 ? -20.944 -7.663  47.612  1.00 47.43 ? 369 LEU C CA    1 
ATOM   9613  C C     . LEU C 1 369 ? -20.086 -7.201  48.793  1.00 47.52 ? 369 LEU C C     1 
ATOM   9614  O O     . LEU C 1 369 ? -20.615 -6.923  49.886  1.00 48.98 ? 369 LEU C O     1 
ATOM   9615  C CB    . LEU C 1 369 ? -21.104 -9.164  47.621  1.00 46.85 ? 369 LEU C CB    1 
ATOM   9616  C CG    . LEU C 1 369 ? -21.562 -9.956  48.832  1.00 44.77 ? 369 LEU C CG    1 
ATOM   9617  C CD1   . LEU C 1 369 ? -22.938 -10.331 48.541  1.00 42.34 ? 369 LEU C CD1   1 
ATOM   9618  C CD2   . LEU C 1 369 ? -20.708 -11.226 48.977  1.00 43.19 ? 369 LEU C CD2   1 
ATOM   9619  N N     . ILE C 1 370 ? -18.769 -7.121  48.625  1.00 46.99 ? 370 ILE C N     1 
ATOM   9620  C CA    . ILE C 1 370 ? -17.963 -6.712  49.775  1.00 46.74 ? 370 ILE C CA    1 
ATOM   9621  C C     . ILE C 1 370 ? -18.028 -5.237  49.937  1.00 46.16 ? 370 ILE C C     1 
ATOM   9622  O O     . ILE C 1 370 ? -18.417 -4.751  50.984  1.00 46.02 ? 370 ILE C O     1 
ATOM   9623  C CB    . ILE C 1 370 ? -16.515 -7.191  49.757  1.00 46.28 ? 370 ILE C CB    1 
ATOM   9624  C CG1   . ILE C 1 370 ? -16.453 -8.663  50.076  1.00 47.55 ? 370 ILE C CG1   1 
ATOM   9625  C CG2   . ILE C 1 370 ? -15.697 -6.444  50.821  1.00 47.41 ? 370 ILE C CG2   1 
ATOM   9626  C CD1   . ILE C 1 370 ? -16.751 -9.506  48.907  1.00 54.49 ? 370 ILE C CD1   1 
ATOM   9627  N N     . GLU C 1 371 ? -17.694 -4.554  48.856  1.00 47.33 ? 371 GLU C N     1 
ATOM   9628  C CA    . GLU C 1 371 ? -17.491 -3.111  48.831  1.00 48.88 ? 371 GLU C CA    1 
ATOM   9629  C C     . GLU C 1 371 ? -18.801 -2.329  48.878  1.00 49.11 ? 371 GLU C C     1 
ATOM   9630  O O     . GLU C 1 371 ? -18.830 -1.270  49.445  1.00 50.19 ? 371 GLU C O     1 
ATOM   9631  C CB    . GLU C 1 371 ? -16.681 -2.707  47.589  1.00 48.80 ? 371 GLU C CB    1 
ATOM   9632  C CG    . GLU C 1 371 ? -15.374 -3.439  47.449  1.00 51.04 ? 371 GLU C CG    1 
ATOM   9633  C CD    . GLU C 1 371 ? -14.746 -3.199  46.080  1.00 55.88 ? 371 GLU C CD    1 
ATOM   9634  O OE1   . GLU C 1 371 ? -13.503 -3.159  45.980  1.00 52.46 ? 371 GLU C OE1   1 
ATOM   9635  O OE2   . GLU C 1 371 ? -15.515 -3.060  45.093  1.00 62.09 ? 371 GLU C OE2   1 
ATOM   9636  N N     . GLU C 1 372 ? -19.896 -2.806  48.301  1.00 49.70 ? 372 GLU C N     1 
ATOM   9637  C CA    . GLU C 1 372 ? -21.136 -2.123  48.638  1.00 50.10 ? 372 GLU C CA    1 
ATOM   9638  C C     . GLU C 1 372 ? -21.781 -2.780  49.871  1.00 49.81 ? 372 GLU C C     1 
ATOM   9639  O O     . GLU C 1 372 ? -22.097 -2.110  50.884  1.00 51.03 ? 372 GLU C O     1 
ATOM   9640  C CB    . GLU C 1 372 ? -22.089 -1.985  47.453  1.00 50.43 ? 372 GLU C CB    1 
ATOM   9641  C CG    . GLU C 1 372 ? -21.558 -0.976  46.362  1.00 55.26 ? 372 GLU C CG    1 
ATOM   9642  C CD    . GLU C 1 372 ? -21.935 0.521   46.612  1.00 61.59 ? 372 GLU C CD    1 
ATOM   9643  O OE1   . GLU C 1 372 ? -21.253 1.219   47.408  1.00 64.66 ? 372 GLU C OE1   1 
ATOM   9644  O OE2   . GLU C 1 372 ? -22.897 1.025   45.982  1.00 62.07 ? 372 GLU C OE2   1 
ATOM   9645  N N     . LYS C 1 373 ? -21.902 -4.100  49.842  1.00 47.58 ? 373 LYS C N     1 
ATOM   9646  C CA    . LYS C 1 373 ? -22.876 -4.668  50.682  1.00 45.06 ? 373 LYS C CA    1 
ATOM   9647  C C     . LYS C 1 373 ? -22.276 -5.051  51.999  1.00 44.54 ? 373 LYS C C     1 
ATOM   9648  O O     . LYS C 1 373 ? -22.825 -4.637  53.038  1.00 44.83 ? 373 LYS C O     1 
ATOM   9649  C CB    . LYS C 1 373 ? -23.642 -5.755  49.957  1.00 44.36 ? 373 LYS C CB    1 
ATOM   9650  C CG    . LYS C 1 373 ? -24.744 -5.242  49.159  1.00 45.49 ? 373 LYS C CG    1 
ATOM   9651  C CD    . LYS C 1 373 ? -25.352 -6.386  48.355  1.00 55.57 ? 373 LYS C CD    1 
ATOM   9652  C CE    . LYS C 1 373 ? -26.762 -6.080  47.841  1.00 56.32 ? 373 LYS C CE    1 
ATOM   9653  N NZ    . LYS C 1 373 ? -27.158 -7.100  46.809  1.00 63.04 ? 373 LYS C NZ    1 
ATOM   9654  N N     . ALA C 1 374 ? -21.120 -5.735  52.003  1.00 43.27 ? 374 ALA C N     1 
ATOM   9655  C CA    . ALA C 1 374 ? -20.581 -6.173  53.328  1.00 42.52 ? 374 ALA C CA    1 
ATOM   9656  C C     . ALA C 1 374 ? -20.018 -5.006  54.171  1.00 42.05 ? 374 ALA C C     1 
ATOM   9657  O O     . ALA C 1 374 ? -20.242 -4.997  55.383  1.00 39.71 ? 374 ALA C O     1 
ATOM   9658  C CB    . ALA C 1 374 ? -19.540 -7.427  53.241  1.00 40.62 ? 374 ALA C CB    1 
ATOM   9659  N N     . VAL C 1 375 ? -19.267 -4.076  53.551  1.00 42.14 ? 375 VAL C N     1 
ATOM   9660  C CA    . VAL C 1 375 ? -18.828 -2.884  54.293  1.00 44.70 ? 375 VAL C CA    1 
ATOM   9661  C C     . VAL C 1 375 ? -19.912 -2.301  55.150  1.00 45.28 ? 375 VAL C C     1 
ATOM   9662  O O     . VAL C 1 375 ? -19.684 -2.020  56.335  1.00 46.17 ? 375 VAL C O     1 
ATOM   9663  C CB    . VAL C 1 375 ? -18.422 -1.587  53.448  1.00 45.84 ? 375 VAL C CB    1 
ATOM   9664  C CG1   . VAL C 1 375 ? -16.907 -1.303  53.486  1.00 43.91 ? 375 VAL C CG1   1 
ATOM   9665  C CG2   . VAL C 1 375 ? -19.204 -1.425  52.064  1.00 44.88 ? 375 VAL C CG2   1 
ATOM   9666  N N     . LYS C 1 376 ? -21.072 -2.075  54.550  1.00 46.13 ? 376 LYS C N     1 
ATOM   9667  C CA    . LYS C 1 376 ? -22.149 -1.338  55.231  1.00 47.92 ? 376 LYS C CA    1 
ATOM   9668  C C     . LYS C 1 376 ? -22.658 -2.079  56.448  1.00 47.62 ? 376 LYS C C     1 
ATOM   9669  O O     . LYS C 1 376 ? -23.346 -1.514  57.298  1.00 47.25 ? 376 LYS C O     1 
ATOM   9670  C CB    . LYS C 1 376 ? -23.276 -1.049  54.229  1.00 48.31 ? 376 LYS C CB    1 
ATOM   9671  C CG    . LYS C 1 376 ? -24.221 0.114   54.583  1.00 52.57 ? 376 LYS C CG    1 
ATOM   9672  C CD    . LYS C 1 376 ? -24.358 1.162   53.428  1.00 55.91 ? 376 LYS C CD    1 
ATOM   9673  C CE    . LYS C 1 376 ? -24.780 0.556   52.080  1.00 60.16 ? 376 LYS C CE    1 
ATOM   9674  N NZ    . LYS C 1 376 ? -23.597 -0.020  51.251  1.00 62.21 ? 376 LYS C NZ    1 
ATOM   9675  N N     . MET C 1 377 ? -22.341 -3.377  56.501  1.00 48.72 ? 377 MET C N     1 
ATOM   9676  C CA    . MET C 1 377 ? -22.796 -4.259  57.588  1.00 49.59 ? 377 MET C CA    1 
ATOM   9677  C C     . MET C 1 377 ? -21.662 -4.412  58.524  1.00 48.83 ? 377 MET C C     1 
ATOM   9678  O O     . MET C 1 377 ? -21.783 -5.115  59.510  1.00 50.02 ? 377 MET C O     1 
ATOM   9679  C CB    . MET C 1 377 ? -23.225 -5.661  57.130  1.00 49.20 ? 377 MET C CB    1 
ATOM   9680  C CG    . MET C 1 377 ? -24.409 -5.714  56.202  1.00 53.10 ? 377 MET C CG    1 
ATOM   9681  S SD    . MET C 1 377 ? -25.942 -4.987  56.824  1.00 61.77 ? 377 MET C SD    1 
ATOM   9682  C CE    . MET C 1 377 ? -26.235 -5.802  58.407  1.00 57.92 ? 377 MET C CE    1 
ATOM   9683  N N     . GLY C 1 378 ? -20.556 -3.750  58.201  1.00 48.11 ? 378 GLY C N     1 
ATOM   9684  C CA    . GLY C 1 378 ? -19.328 -3.826  58.982  1.00 45.93 ? 378 GLY C CA    1 
ATOM   9685  C C     . GLY C 1 378 ? -18.654 -5.184  59.034  1.00 44.65 ? 378 GLY C C     1 
ATOM   9686  O O     . GLY C 1 378 ? -18.124 -5.550  60.066  1.00 44.56 ? 378 GLY C O     1 
ATOM   9687  N N     . VAL C 1 379 ? -18.656 -5.944  57.939  1.00 43.88 ? 379 VAL C N     1 
ATOM   9688  C CA    . VAL C 1 379 ? -17.660 -7.000  57.802  1.00 40.65 ? 379 VAL C CA    1 
ATOM   9689  C C     . VAL C 1 379 ? -16.905 -6.940  56.459  1.00 41.12 ? 379 VAL C C     1 
ATOM   9690  O O     . VAL C 1 379 ? -17.491 -6.611  55.388  1.00 39.32 ? 379 VAL C O     1 
ATOM   9691  C CB    . VAL C 1 379 ? -18.145 -8.460  58.247  1.00 42.12 ? 379 VAL C CB    1 
ATOM   9692  C CG1   . VAL C 1 379 ? -19.332 -8.394  59.231  1.00 38.75 ? 379 VAL C CG1   1 
ATOM   9693  C CG2   . VAL C 1 379 ? -18.336 -9.489  57.075  1.00 36.76 ? 379 VAL C CG2   1 
ATOM   9694  N N     . LEU C 1 380 ? -15.592 -7.193  56.551  1.00 39.25 ? 380 LEU C N     1 
ATOM   9695  C CA    . LEU C 1 380 ? -14.747 -7.273  55.391  1.00 39.43 ? 380 LEU C CA    1 
ATOM   9696  C C     . LEU C 1 380 ? -14.152 -8.676  55.181  1.00 39.20 ? 380 LEU C C     1 
ATOM   9697  O O     . LEU C 1 380 ? -13.875 -9.391  56.136  1.00 37.52 ? 380 LEU C O     1 
ATOM   9698  C CB    . LEU C 1 380 ? -13.623 -6.233  55.414  1.00 39.28 ? 380 LEU C CB    1 
ATOM   9699  C CG    . LEU C 1 380 ? -13.656 -4.755  55.839  1.00 38.20 ? 380 LEU C CG    1 
ATOM   9700  C CD1   . LEU C 1 380 ? -12.544 -4.047  55.064  1.00 37.84 ? 380 LEU C CD1   1 
ATOM   9701  C CD2   . LEU C 1 380 ? -15.030 -4.058  55.704  1.00 39.04 ? 380 LEU C CD2   1 
ATOM   9702  N N     . MET C 1 381 ? -14.137 -9.096  53.914  1.00 39.30 ? 381 MET C N     1 
ATOM   9703  C CA    . MET C 1 381 ? -13.138 -10.006 53.402  1.00 41.71 ? 381 MET C CA    1 
ATOM   9704  C C     . MET C 1 381 ? -12.703 -9.527  52.029  1.00 40.97 ? 381 MET C C     1 
ATOM   9705  O O     . MET C 1 381 ? -13.159 -8.451  51.519  1.00 41.42 ? 381 MET C O     1 
ATOM   9706  C CB    . MET C 1 381 ? -13.486 -11.519 53.503  1.00 41.55 ? 381 MET C CB    1 
ATOM   9707  C CG    . MET C 1 381 ? -14.940 -11.900 53.693  1.00 43.14 ? 381 MET C CG    1 
ATOM   9708  S SD    . MET C 1 381 ? -14.975 -13.562 54.428  1.00 46.82 ? 381 MET C SD    1 
ATOM   9709  C CE    . MET C 1 381 ? -14.672 -14.695 53.057  1.00 43.12 ? 381 MET C CE    1 
ATOM   9710  N N     . LEU C 1 382 ? -11.812 -10.311 51.437  1.00 39.67 ? 382 LEU C N     1 
ATOM   9711  C CA    . LEU C 1 382 ? -10.979 -9.823  50.363  1.00 38.16 ? 382 LEU C CA    1 
ATOM   9712  C C     . LEU C 1 382 ? -11.360 -10.449 49.048  1.00 36.11 ? 382 LEU C C     1 
ATOM   9713  O O     . LEU C 1 382 ? -10.941 -11.588 48.780  1.00 34.57 ? 382 LEU C O     1 
ATOM   9714  C CB    . LEU C 1 382 ? -9.479  -10.138 50.662  1.00 37.40 ? 382 LEU C CB    1 
ATOM   9715  C CG    . LEU C 1 382 ? -8.579  -9.644  49.512  1.00 40.17 ? 382 LEU C CG    1 
ATOM   9716  C CD1   . LEU C 1 382 ? -8.702  -8.064  49.342  1.00 38.68 ? 382 LEU C CD1   1 
ATOM   9717  C CD2   . LEU C 1 382 ? -7.114  -10.046 49.652  1.00 40.36 ? 382 LEU C CD2   1 
ATOM   9718  N N     . PRO C 1 383 ? -12.048 -9.684  48.175  1.00 35.76 ? 383 PRO C N     1 
ATOM   9719  C CA    . PRO C 1 383 ? -12.357 -10.166 46.786  1.00 35.11 ? 383 PRO C CA    1 
ATOM   9720  C C     . PRO C 1 383 ? -11.160 -10.846 46.140  1.00 34.20 ? 383 PRO C C     1 
ATOM   9721  O O     . PRO C 1 383 ? -10.043 -10.330 46.151  1.00 32.84 ? 383 PRO C O     1 
ATOM   9722  C CB    . PRO C 1 383 ? -12.702 -8.875  46.038  1.00 34.69 ? 383 PRO C CB    1 
ATOM   9723  C CG    . PRO C 1 383 ? -13.339 -8.020  47.151  1.00 36.06 ? 383 PRO C CG    1 
ATOM   9724  C CD    . PRO C 1 383 ? -12.538 -8.308  48.392  1.00 35.53 ? 383 PRO C CD    1 
ATOM   9725  N N     . GLY C 1 384 ? -11.376 -12.009 45.568  1.00 34.53 ? 384 GLY C N     1 
ATOM   9726  C CA    . GLY C 1 384 ? -10.243 -12.667 44.864  1.00 36.40 ? 384 GLY C CA    1 
ATOM   9727  C C     . GLY C 1 384 ? -9.701  -11.988 43.610  1.00 36.02 ? 384 GLY C C     1 
ATOM   9728  O O     . GLY C 1 384 ? -8.710  -12.433 43.089  1.00 37.32 ? 384 GLY C O     1 
ATOM   9729  N N     . ASN C 1 385 ? -10.312 -10.921 43.118  1.00 36.13 ? 385 ASN C N     1 
ATOM   9730  C CA    . ASN C 1 385 ? -9.830  -10.325 41.826  1.00 38.29 ? 385 ASN C CA    1 
ATOM   9731  C C     . ASN C 1 385 ? -8.256  -10.142 41.671  1.00 38.58 ? 385 ASN C C     1 
ATOM   9732  O O     . ASN C 1 385 ? -7.681  -10.347 40.531  1.00 38.23 ? 385 ASN C O     1 
ATOM   9733  C CB    . ASN C 1 385 ? -10.581 -9.029  41.511  1.00 38.03 ? 385 ASN C CB    1 
ATOM   9734  C CG    . ASN C 1 385 ? -12.104 -9.175  41.704  1.00 41.20 ? 385 ASN C CG    1 
ATOM   9735  O OD1   . ASN C 1 385 ? -12.579 -9.619  42.764  1.00 49.71 ? 385 ASN C OD1   1 
ATOM   9736  N ND2   . ASN C 1 385 ? -12.876 -8.774  40.705  1.00 42.11 ? 385 ASN C ND2   1 
ATOM   9737  N N     . ALA C 1 386 ? -7.589  -9.760  42.786  1.00 37.16 ? 386 ALA C N     1 
ATOM   9738  C CA    . ALA C 1 386 ? -6.182  -9.297  42.789  1.00 36.91 ? 386 ALA C CA    1 
ATOM   9739  C C     . ALA C 1 386 ? -5.179  -10.396 42.653  1.00 37.02 ? 386 ALA C C     1 
ATOM   9740  O O     . ALA C 1 386 ? -3.991  -10.137 42.464  1.00 36.99 ? 386 ALA C O     1 
ATOM   9741  C CB    . ALA C 1 386 ? -5.852  -8.526  44.127  1.00 37.63 ? 386 ALA C CB    1 
ATOM   9742  N N     . PHE C 1 387 ? -5.637  -11.641 42.834  1.00 35.96 ? 387 PHE C N     1 
ATOM   9743  C CA    . PHE C 1 387 ? -4.733  -12.746 42.799  1.00 34.09 ? 387 PHE C CA    1 
ATOM   9744  C C     . PHE C 1 387 ? -4.569  -13.378 41.413  1.00 32.77 ? 387 PHE C C     1 
ATOM   9745  O O     . PHE C 1 387 ? -4.015  -14.447 41.341  1.00 31.10 ? 387 PHE C O     1 
ATOM   9746  C CB    . PHE C 1 387 ? -5.038  -13.732 43.898  1.00 32.84 ? 387 PHE C CB    1 
ATOM   9747  C CG    . PHE C 1 387 ? -5.124  -13.088 45.204  1.00 34.39 ? 387 PHE C CG    1 
ATOM   9748  C CD1   . PHE C 1 387 ? -6.366  -12.758 45.747  1.00 31.83 ? 387 PHE C CD1   1 
ATOM   9749  C CD2   . PHE C 1 387 ? -3.957  -12.707 45.875  1.00 32.42 ? 387 PHE C CD2   1 
ATOM   9750  C CE1   . PHE C 1 387 ? -6.421  -12.041 46.959  1.00 36.84 ? 387 PHE C CE1   1 
ATOM   9751  C CE2   . PHE C 1 387 ? -4.022  -12.071 47.056  1.00 31.63 ? 387 PHE C CE2   1 
ATOM   9752  C CZ    . PHE C 1 387 ? -5.271  -11.722 47.613  1.00 32.48 ? 387 PHE C CZ    1 
ATOM   9753  N N     . TYR C 1 388 ? -4.970  -12.633 40.371  1.00 32.99 ? 388 TYR C N     1 
ATOM   9754  C CA    . TYR C 1 388 ? -4.870  -13.030 38.906  1.00 34.13 ? 388 TYR C CA    1 
ATOM   9755  C C     . TYR C 1 388 ? -4.161  -11.976 38.019  1.00 34.08 ? 388 TYR C C     1 
ATOM   9756  O O     . TYR C 1 388 ? -4.262  -10.805 38.267  1.00 33.05 ? 388 TYR C O     1 
ATOM   9757  C CB    . TYR C 1 388 ? -6.270  -13.300 38.329  1.00 33.70 ? 388 TYR C CB    1 
ATOM   9758  C CG    . TYR C 1 388 ? -7.044  -14.414 39.039  1.00 33.89 ? 388 TYR C CG    1 
ATOM   9759  C CD1   . TYR C 1 388 ? -7.076  -15.702 38.513  1.00 32.57 ? 388 TYR C CD1   1 
ATOM   9760  C CD2   . TYR C 1 388 ? -7.757  -14.156 40.223  1.00 34.48 ? 388 TYR C CD2   1 
ATOM   9761  C CE1   . TYR C 1 388 ? -7.757  -16.729 39.142  1.00 32.49 ? 388 TYR C CE1   1 
ATOM   9762  C CE2   . TYR C 1 388 ? -8.451  -15.155 40.880  1.00 30.84 ? 388 TYR C CE2   1 
ATOM   9763  C CZ    . TYR C 1 388 ? -8.450  -16.463 40.334  1.00 36.74 ? 388 TYR C CZ    1 
ATOM   9764  O OH    . TYR C 1 388 ? -9.147  -17.499 40.966  1.00 33.46 ? 388 TYR C OH    1 
ATOM   9765  N N     . VAL C 1 389 ? -3.406  -12.409 37.017  1.00 35.77 ? 389 VAL C N     1 
ATOM   9766  C CA    . VAL C 1 389 ? -2.820  -11.494 36.030  1.00 37.88 ? 389 VAL C CA    1 
ATOM   9767  C C     . VAL C 1 389 ? -3.828  -10.408 35.521  1.00 39.06 ? 389 VAL C C     1 
ATOM   9768  O O     . VAL C 1 389 ? -3.546  -9.208  35.530  1.00 39.53 ? 389 VAL C O     1 
ATOM   9769  C CB    . VAL C 1 389 ? -2.112  -12.251 34.862  1.00 37.33 ? 389 VAL C CB    1 
ATOM   9770  C CG1   . VAL C 1 389 ? -1.539  -11.258 33.781  1.00 38.57 ? 389 VAL C CG1   1 
ATOM   9771  C CG2   . VAL C 1 389 ? -0.999  -13.012 35.379  1.00 35.85 ? 389 VAL C CG2   1 
ATOM   9772  N N     . ASP C 1 390 ? -5.015  -10.866 35.137  1.00 40.74 ? 390 ASP C N     1 
ATOM   9773  C CA    . ASP C 1 390 ? -6.164  -10.039 34.727  1.00 41.22 ? 390 ASP C CA    1 
ATOM   9774  C C     . ASP C 1 390 ? -7.066  -9.843  35.998  1.00 41.33 ? 390 ASP C C     1 
ATOM   9775  O O     . ASP C 1 390 ? -7.969  -10.631 36.276  1.00 40.48 ? 390 ASP C O     1 
ATOM   9776  C CB    . ASP C 1 390 ? -6.910  -10.821 33.617  1.00 41.90 ? 390 ASP C CB    1 
ATOM   9777  C CG    . ASP C 1 390 ? -8.141  -10.092 33.064  1.00 44.48 ? 390 ASP C CG    1 
ATOM   9778  O OD1   . ASP C 1 390 ? -8.977  -10.746 32.391  1.00 48.59 ? 390 ASP C OD1   1 
ATOM   9779  O OD2   . ASP C 1 390 ? -8.271  -8.889  33.279  1.00 44.33 ? 390 ASP C OD2   1 
ATOM   9780  N N     . SER C 1 391 ? -6.755  -8.832  36.802  1.00 40.34 ? 391 SER C N     1 
ATOM   9781  C CA    . SER C 1 391 ? -7.529  -8.556  37.996  1.00 40.22 ? 391 SER C CA    1 
ATOM   9782  C C     . SER C 1 391 ? -8.941  -8.126  37.615  1.00 40.24 ? 391 SER C C     1 
ATOM   9783  O O     . SER C 1 391 ? -9.860  -8.096  38.484  1.00 40.23 ? 391 SER C O     1 
ATOM   9784  C CB    . SER C 1 391 ? -6.830  -7.469  38.828  1.00 40.08 ? 391 SER C CB    1 
ATOM   9785  O OG    . SER C 1 391 ? -6.429  -6.384  38.020  1.00 42.50 ? 391 SER C OG    1 
ATOM   9786  N N     . SER C 1 392 ? -9.108  -7.792  36.317  1.00 38.16 ? 392 SER C N     1 
ATOM   9787  C CA    . SER C 1 392 ? -10.347 -7.279  35.774  1.00 38.31 ? 392 SER C CA    1 
ATOM   9788  C C     . SER C 1 392 ? -11.401 -8.385  35.571  1.00 37.31 ? 392 SER C C     1 
ATOM   9789  O O     . SER C 1 392 ? -12.591 -8.153  35.627  1.00 36.06 ? 392 SER C O     1 
ATOM   9790  C CB    . SER C 1 392 ? -10.075 -6.578  34.419  1.00 38.95 ? 392 SER C CB    1 
ATOM   9791  O OG    . SER C 1 392 ? -10.689 -5.270  34.484  1.00 45.33 ? 392 SER C OG    1 
ATOM   9792  N N     . ALA C 1 393 ? -10.954 -9.599  35.307  1.00 37.71 ? 393 ALA C N     1 
ATOM   9793  C CA    . ALA C 1 393 ? -11.880 -10.687 35.179  1.00 37.48 ? 393 ALA C CA    1 
ATOM   9794  C C     . ALA C 1 393 ? -12.696 -10.666 36.509  1.00 38.67 ? 393 ALA C C     1 
ATOM   9795  O O     . ALA C 1 393 ? -12.145 -10.295 37.579  1.00 37.57 ? 393 ALA C O     1 
ATOM   9796  C CB    . ALA C 1 393 ? -11.098 -11.957 35.012  1.00 37.24 ? 393 ALA C CB    1 
ATOM   9797  N N     . PRO C 1 394 ? -14.010 -11.021 36.420  1.00 38.88 ? 394 PRO C N     1 
ATOM   9798  C CA    . PRO C 1 394 ? -14.881 -11.231 37.561  1.00 38.05 ? 394 PRO C CA    1 
ATOM   9799  C C     . PRO C 1 394 ? -14.313 -12.365 38.425  1.00 37.57 ? 394 PRO C C     1 
ATOM   9800  O O     . PRO C 1 394 ? -13.758 -13.335 37.880  1.00 37.75 ? 394 PRO C O     1 
ATOM   9801  C CB    . PRO C 1 394 ? -16.211 -11.681 36.949  1.00 37.84 ? 394 PRO C CB    1 
ATOM   9802  C CG    . PRO C 1 394 ? -16.122 -11.319 35.440  1.00 40.18 ? 394 PRO C CG    1 
ATOM   9803  C CD    . PRO C 1 394 ? -14.667 -11.319 35.109  1.00 38.67 ? 394 PRO C CD    1 
ATOM   9804  N N     . SER C 1 395 ? -14.428 -12.239 39.755  1.00 35.64 ? 395 SER C N     1 
ATOM   9805  C CA    . SER C 1 395 ? -13.997 -13.367 40.677  1.00 33.20 ? 395 SER C CA    1 
ATOM   9806  C C     . SER C 1 395 ? -15.091 -13.795 41.650  1.00 31.83 ? 395 SER C C     1 
ATOM   9807  O O     . SER C 1 395 ? -15.672 -12.984 42.355  1.00 31.74 ? 395 SER C O     1 
ATOM   9808  C CB    . SER C 1 395 ? -12.708 -13.023 41.395  1.00 31.58 ? 395 SER C CB    1 
ATOM   9809  O OG    . SER C 1 395 ? -12.133 -14.072 42.144  1.00 35.96 ? 395 SER C OG    1 
ATOM   9810  N N     . PRO C 1 396 ? -15.463 -15.079 41.617  1.00 31.75 ? 396 PRO C N     1 
ATOM   9811  C CA    . PRO C 1 396 ? -16.370 -15.578 42.673  1.00 32.44 ? 396 PRO C CA    1 
ATOM   9812  C C     . PRO C 1 396 ? -15.677 -15.810 44.069  1.00 32.83 ? 396 PRO C C     1 
ATOM   9813  O O     . PRO C 1 396 ? -16.307 -16.239 45.039  1.00 33.42 ? 396 PRO C O     1 
ATOM   9814  C CB    . PRO C 1 396 ? -16.927 -16.875 42.031  1.00 33.01 ? 396 PRO C CB    1 
ATOM   9815  C CG    . PRO C 1 396 ? -15.707 -17.395 41.210  1.00 30.94 ? 396 PRO C CG    1 
ATOM   9816  C CD    . PRO C 1 396 ? -15.157 -16.097 40.595  1.00 29.56 ? 396 PRO C CD    1 
ATOM   9817  N N     . TYR C 1 397 ? -14.423 -15.410 44.212  1.00 34.98 ? 397 TYR C N     1 
ATOM   9818  C CA    . TYR C 1 397 ? -13.582 -15.878 45.369  1.00 34.51 ? 397 TYR C CA    1 
ATOM   9819  C C     . TYR C 1 397 ? -13.272 -14.800 46.422  1.00 34.54 ? 397 TYR C C     1 
ATOM   9820  O O     . TYR C 1 397 ? -12.952 -13.638 46.065  1.00 35.88 ? 397 TYR C O     1 
ATOM   9821  C CB    . TYR C 1 397 ? -12.263 -16.431 44.886  1.00 33.96 ? 397 TYR C CB    1 
ATOM   9822  C CG    . TYR C 1 397 ? -12.303 -17.790 44.262  1.00 34.33 ? 397 TYR C CG    1 
ATOM   9823  C CD1   . TYR C 1 397 ? -12.438 -17.928 42.873  1.00 32.89 ? 397 TYR C CD1   1 
ATOM   9824  C CD2   . TYR C 1 397 ? -12.136 -18.940 45.024  1.00 31.05 ? 397 TYR C CD2   1 
ATOM   9825  C CE1   . TYR C 1 397 ? -12.440 -19.183 42.260  1.00 31.12 ? 397 TYR C CE1   1 
ATOM   9826  C CE2   . TYR C 1 397 ? -12.174 -20.243 44.409  1.00 32.66 ? 397 TYR C CE2   1 
ATOM   9827  C CZ    . TYR C 1 397 ? -12.335 -20.329 43.023  1.00 34.31 ? 397 TYR C CZ    1 
ATOM   9828  O OH    . TYR C 1 397 ? -12.339 -21.566 42.361  1.00 37.92 ? 397 TYR C OH    1 
ATOM   9829  N N     . LEU C 1 398 ? -13.397 -15.195 47.703  1.00 33.40 ? 398 LEU C N     1 
ATOM   9830  C CA    . LEU C 1 398 ? -13.050 -14.366 48.846  1.00 31.71 ? 398 LEU C CA    1 
ATOM   9831  C C     . LEU C 1 398 ? -11.860 -14.980 49.476  1.00 31.46 ? 398 LEU C C     1 
ATOM   9832  O O     . LEU C 1 398 ? -11.782 -16.201 49.572  1.00 32.77 ? 398 LEU C O     1 
ATOM   9833  C CB    . LEU C 1 398 ? -14.193 -14.327 49.833  1.00 31.85 ? 398 LEU C CB    1 
ATOM   9834  C CG    . LEU C 1 398 ? -15.479 -13.574 49.393  1.00 33.40 ? 398 LEU C CG    1 
ATOM   9835  C CD1   . LEU C 1 398 ? -16.613 -13.677 50.515  1.00 29.20 ? 398 LEU C CD1   1 
ATOM   9836  C CD2   . LEU C 1 398 ? -15.268 -12.069 49.015  1.00 32.00 ? 398 LEU C CD2   1 
ATOM   9837  N N     . ARG C 1 399 ? -10.849 -14.185 49.817  1.00 31.16 ? 399 ARG C N     1 
ATOM   9838  C CA    . ARG C 1 399 ? -9.789  -14.719 50.658  1.00 29.23 ? 399 ARG C CA    1 
ATOM   9839  C C     . ARG C 1 399 ? -10.202 -14.386 52.112  1.00 29.21 ? 399 ARG C C     1 
ATOM   9840  O O     . ARG C 1 399 ? -10.468 -13.204 52.466  1.00 25.87 ? 399 ARG C O     1 
ATOM   9841  C CB    . ARG C 1 399 ? -8.421  -14.117 50.363  1.00 29.71 ? 399 ARG C CB    1 
ATOM   9842  C CG    . ARG C 1 399 ? -7.193  -14.794 51.022  1.00 24.44 ? 399 ARG C CG    1 
ATOM   9843  C CD    . ARG C 1 399 ? -5.921  -13.816 50.886  1.00 30.72 ? 399 ARG C CD    1 
ATOM   9844  N NE    . ARG C 1 399 ? -5.988  -12.618 51.746  1.00 25.94 ? 399 ARG C NE    1 
ATOM   9845  C CZ    . ARG C 1 399 ? -5.000  -11.719 51.892  1.00 29.37 ? 399 ARG C CZ    1 
ATOM   9846  N NH1   . ARG C 1 399 ? -3.866  -11.866 51.239  1.00 27.39 ? 399 ARG C NH1   1 
ATOM   9847  N NH2   . ARG C 1 399 ? -5.156  -10.655 52.711  1.00 27.55 ? 399 ARG C NH2   1 
ATOM   9848  N N     . ALA C 1 400 ? -10.231 -15.416 52.951  1.00 27.69 ? 400 ALA C N     1 
ATOM   9849  C CA    . ALA C 1 400 ? -10.450 -15.093 54.357  1.00 28.65 ? 400 ALA C CA    1 
ATOM   9850  C C     . ALA C 1 400 ? -9.331  -15.577 55.279  1.00 30.29 ? 400 ALA C C     1 
ATOM   9851  O O     . ALA C 1 400 ? -8.976  -16.792 55.392  1.00 30.34 ? 400 ALA C O     1 
ATOM   9852  C CB    . ALA C 1 400 ? -11.874 -15.485 54.859  1.00 25.46 ? 400 ALA C CB    1 
ATOM   9853  N N     . SER C 1 401 ? -8.885  -14.574 56.000  1.00 30.82 ? 401 SER C N     1 
ATOM   9854  C CA    . SER C 1 401 ? -7.788  -14.599 56.879  1.00 32.83 ? 401 SER C CA    1 
ATOM   9855  C C     . SER C 1 401 ? -8.199  -15.212 58.228  1.00 31.67 ? 401 SER C C     1 
ATOM   9856  O O     . SER C 1 401 ? -9.097  -14.711 58.898  1.00 30.95 ? 401 SER C O     1 
ATOM   9857  C CB    . SER C 1 401 ? -7.448  -13.087 57.058  1.00 34.11 ? 401 SER C CB    1 
ATOM   9858  O OG    . SER C 1 401 ? -6.509  -12.839 58.083  1.00 37.46 ? 401 SER C OG    1 
ATOM   9859  N N     . PHE C 1 402 ? -7.458  -16.200 58.694  1.00 29.48 ? 402 PHE C N     1 
ATOM   9860  C CA    . PHE C 1 402 ? -7.756  -16.687 60.018  1.00 29.09 ? 402 PHE C CA    1 
ATOM   9861  C C     . PHE C 1 402 ? -6.715  -16.383 61.089  1.00 29.16 ? 402 PHE C C     1 
ATOM   9862  O O     . PHE C 1 402 ? -6.795  -16.836 62.242  1.00 31.00 ? 402 PHE C O     1 
ATOM   9863  C CB    . PHE C 1 402 ? -8.196  -18.176 59.977  1.00 27.56 ? 402 PHE C CB    1 
ATOM   9864  C CG    . PHE C 1 402 ? -7.169  -19.125 59.419  1.00 25.06 ? 402 PHE C CG    1 
ATOM   9865  C CD1   . PHE C 1 402 ? -6.079  -19.498 60.154  1.00 26.72 ? 402 PHE C CD1   1 
ATOM   9866  C CD2   . PHE C 1 402 ? -7.293  -19.618 58.163  1.00 28.18 ? 402 PHE C CD2   1 
ATOM   9867  C CE1   . PHE C 1 402 ? -5.206  -20.354 59.662  1.00 25.71 ? 402 PHE C CE1   1 
ATOM   9868  C CE2   . PHE C 1 402 ? -6.380  -20.491 57.649  1.00 23.80 ? 402 PHE C CE2   1 
ATOM   9869  C CZ    . PHE C 1 402 ? -5.361  -20.870 58.384  1.00 24.97 ? 402 PHE C CZ    1 
ATOM   9870  N N     . SER C 1 403 ? -5.789  -15.531 60.748  1.00 29.92 ? 403 SER C N     1 
ATOM   9871  C CA    . SER C 1 403 ? -4.679  -15.259 61.635  1.00 30.87 ? 403 SER C CA    1 
ATOM   9872  C C     . SER C 1 403 ? -4.998  -14.591 63.003  1.00 30.04 ? 403 SER C C     1 
ATOM   9873  O O     . SER C 1 403 ? -4.168  -14.697 63.884  1.00 30.33 ? 403 SER C O     1 
ATOM   9874  C CB    . SER C 1 403 ? -3.668  -14.378 60.885  1.00 31.94 ? 403 SER C CB    1 
ATOM   9875  O OG    . SER C 1 403 ? -4.062  -13.021 60.953  1.00 30.99 ? 403 SER C OG    1 
ATOM   9876  N N     . SER C 1 404 ? -6.154  -13.953 63.179  1.00 29.93 ? 404 SER C N     1 
ATOM   9877  C CA    . SER C 1 404 ? -6.369  -12.944 64.295  1.00 31.69 ? 404 SER C CA    1 
ATOM   9878  C C     . SER C 1 404 ? -7.755  -12.908 65.020  1.00 30.74 ? 404 SER C C     1 
ATOM   9879  O O     . SER C 1 404 ? -7.846  -12.681 66.221  1.00 30.28 ? 404 SER C O     1 
ATOM   9880  C CB    . SER C 1 404 ? -6.045  -11.528 63.756  1.00 30.23 ? 404 SER C CB    1 
ATOM   9881  O OG    . SER C 1 404 ? -4.658  -11.493 63.320  1.00 34.37 ? 404 SER C OG    1 
ATOM   9882  N N     . ALA C 1 405 ? -8.819  -13.155 64.262  1.00 30.46 ? 405 ALA C N     1 
ATOM   9883  C CA    . ALA C 1 405 ? -10.182 -12.959 64.735  1.00 30.13 ? 405 ALA C CA    1 
ATOM   9884  C C     . ALA C 1 405 ? -10.451 -14.038 65.747  1.00 30.62 ? 405 ALA C C     1 
ATOM   9885  O O     . ALA C 1 405 ? -9.904  -15.126 65.624  1.00 29.66 ? 405 ALA C O     1 
ATOM   9886  C CB    . ALA C 1 405 ? -11.218 -13.018 63.535  1.00 27.13 ? 405 ALA C CB    1 
ATOM   9887  N N     . SER C 1 406 ? -11.244 -13.680 66.747  1.00 30.99 ? 406 SER C N     1 
ATOM   9888  C CA    . SER C 1 406 ? -11.728 -14.602 67.717  1.00 34.26 ? 406 SER C CA    1 
ATOM   9889  C C     . SER C 1 406 ? -12.920 -15.406 67.165  1.00 35.42 ? 406 SER C C     1 
ATOM   9890  O O     . SER C 1 406 ? -13.583 -14.952 66.227  1.00 36.50 ? 406 SER C O     1 
ATOM   9891  C CB    . SER C 1 406 ? -12.231 -13.852 68.914  1.00 30.79 ? 406 SER C CB    1 
ATOM   9892  O OG    . SER C 1 406 ? -13.378 -13.220 68.451  1.00 33.82 ? 406 SER C OG    1 
ATOM   9893  N N     . PRO C 1 407 ? -13.203 -16.579 67.792  1.00 35.65 ? 407 PRO C N     1 
ATOM   9894  C CA    . PRO C 1 407 ? -14.247 -17.497 67.327  1.00 37.34 ? 407 PRO C CA    1 
ATOM   9895  C C     . PRO C 1 407 ? -15.580 -16.822 67.162  1.00 38.43 ? 407 PRO C C     1 
ATOM   9896  O O     . PRO C 1 407 ? -16.345 -17.222 66.275  1.00 40.69 ? 407 PRO C O     1 
ATOM   9897  C CB    . PRO C 1 407 ? -14.260 -18.627 68.417  1.00 36.41 ? 407 PRO C CB    1 
ATOM   9898  C CG    . PRO C 1 407 ? -12.719 -18.691 68.805  1.00 35.57 ? 407 PRO C CG    1 
ATOM   9899  C CD    . PRO C 1 407 ? -12.422 -17.154 68.915  1.00 35.71 ? 407 PRO C CD    1 
ATOM   9900  N N     . GLU C 1 408 ? -15.850 -15.821 68.007  1.00 37.95 ? 408 GLU C N     1 
ATOM   9901  C CA    . GLU C 1 408 ? -17.077 -15.055 67.988  1.00 37.99 ? 408 GLU C CA    1 
ATOM   9902  C C     . GLU C 1 408 ? -17.115 -14.102 66.762  1.00 37.11 ? 408 GLU C C     1 
ATOM   9903  O O     . GLU C 1 408 ? -18.159 -13.882 66.117  1.00 37.52 ? 408 GLU C O     1 
ATOM   9904  C CB    . GLU C 1 408 ? -17.186 -14.249 69.310  1.00 38.59 ? 408 GLU C CB    1 
ATOM   9905  C CG    . GLU C 1 408 ? -17.383 -15.127 70.629  1.00 42.41 ? 408 GLU C CG    1 
ATOM   9906  C CD    . GLU C 1 408 ? -16.076 -15.698 71.300  1.00 45.81 ? 408 GLU C CD    1 
ATOM   9907  O OE1   . GLU C 1 408 ? -15.054 -15.908 70.619  1.00 38.97 ? 408 GLU C OE1   1 
ATOM   9908  O OE2   . GLU C 1 408 ? -16.079 -15.920 72.561  1.00 47.31 ? 408 GLU C OE2   1 
ATOM   9909  N N     . GLN C 1 409 ? -15.970 -13.496 66.502  1.00 35.65 ? 409 GLN C N     1 
ATOM   9910  C CA    . GLN C 1 409 ? -15.756 -12.631 65.339  1.00 35.13 ? 409 GLN C CA    1 
ATOM   9911  C C     . GLN C 1 409 ? -15.906 -13.359 64.022  1.00 33.24 ? 409 GLN C C     1 
ATOM   9912  O O     . GLN C 1 409 ? -16.569 -12.887 63.174  1.00 33.56 ? 409 GLN C O     1 
ATOM   9913  C CB    . GLN C 1 409 ? -14.373 -11.942 65.394  1.00 34.51 ? 409 GLN C CB    1 
ATOM   9914  C CG    . GLN C 1 409 ? -14.374 -10.765 66.282  1.00 32.92 ? 409 GLN C CG    1 
ATOM   9915  C CD    . GLN C 1 409 ? -12.986 -10.239 66.475  1.00 34.60 ? 409 GLN C CD    1 
ATOM   9916  O OE1   . GLN C 1 409 ? -11.990 -10.961 66.305  1.00 31.92 ? 409 GLN C OE1   1 
ATOM   9917  N NE2   . GLN C 1 409 ? -12.901 -8.971  66.821  1.00 33.12 ? 409 GLN C NE2   1 
ATOM   9918  N N     . MET C 1 410 ? -15.327 -14.525 63.860  1.00 33.27 ? 410 MET C N     1 
ATOM   9919  C CA    . MET C 1 410 ? -15.618 -15.292 62.666  1.00 31.36 ? 410 MET C CA    1 
ATOM   9920  C C     . MET C 1 410 ? -17.069 -15.718 62.557  1.00 31.53 ? 410 MET C C     1 
ATOM   9921  O O     . MET C 1 410 ? -17.615 -15.813 61.459  1.00 32.60 ? 410 MET C O     1 
ATOM   9922  C CB    . MET C 1 410 ? -14.706 -16.509 62.570  1.00 32.83 ? 410 MET C CB    1 
ATOM   9923  C CG    . MET C 1 410 ? -13.176 -16.272 62.651  1.00 29.29 ? 410 MET C CG    1 
ATOM   9924  S SD    . MET C 1 410 ? -12.495 -17.939 63.040  1.00 32.91 ? 410 MET C SD    1 
ATOM   9925  C CE    . MET C 1 410 ? -10.761 -17.726 62.659  1.00 30.68 ? 410 MET C CE    1 
ATOM   9926  N N     . ASP C 1 411 ? -17.727 -15.938 63.685  1.00 32.22 ? 411 ASP C N     1 
ATOM   9927  C CA    . ASP C 1 411 ? -19.119 -16.363 63.688  1.00 32.19 ? 411 ASP C CA    1 
ATOM   9928  C C     . ASP C 1 411 ? -19.980 -15.263 63.144  1.00 31.40 ? 411 ASP C C     1 
ATOM   9929  O O     . ASP C 1 411 ? -20.768 -15.528 62.235  1.00 31.23 ? 411 ASP C O     1 
ATOM   9930  C CB    . ASP C 1 411 ? -19.581 -16.819 65.088  1.00 32.81 ? 411 ASP C CB    1 
ATOM   9931  C CG    . ASP C 1 411 ? -21.025 -17.386 65.100  1.00 37.14 ? 411 ASP C CG    1 
ATOM   9932  O OD1   . ASP C 1 411 ? -21.991 -16.622 65.412  1.00 37.11 ? 411 ASP C OD1   1 
ATOM   9933  O OD2   . ASP C 1 411 ? -21.172 -18.597 64.803  1.00 39.16 ? 411 ASP C OD2   1 
ATOM   9934  N N     . VAL C 1 412 ? -19.815 -14.043 63.664  1.00 31.28 ? 412 VAL C N     1 
ATOM   9935  C CA    . VAL C 1 412 ? -20.615 -12.875 63.209  1.00 33.30 ? 412 VAL C CA    1 
ATOM   9936  C C     . VAL C 1 412 ? -20.234 -12.464 61.793  1.00 33.76 ? 412 VAL C C     1 
ATOM   9937  O O     . VAL C 1 412 ? -21.105 -12.202 60.984  1.00 36.53 ? 412 VAL C O     1 
ATOM   9938  C CB    . VAL C 1 412 ? -20.519 -11.615 64.157  1.00 33.35 ? 412 VAL C CB    1 
ATOM   9939  C CG1   . VAL C 1 412 ? -21.307 -10.365 63.564  1.00 31.91 ? 412 VAL C CG1   1 
ATOM   9940  C CG2   . VAL C 1 412 ? -21.037 -11.954 65.478  1.00 33.80 ? 412 VAL C CG2   1 
ATOM   9941  N N     . ALA C 1 413 ? -18.951 -12.475 61.471  1.00 34.01 ? 413 ALA C N     1 
ATOM   9942  C CA    . ALA C 1 413 ? -18.562 -12.286 60.096  1.00 34.87 ? 413 ALA C CA    1 
ATOM   9943  C C     . ALA C 1 413 ? -19.233 -13.252 59.101  1.00 35.08 ? 413 ALA C C     1 
ATOM   9944  O O     . ALA C 1 413 ? -19.724 -12.849 58.063  1.00 34.36 ? 413 ALA C O     1 
ATOM   9945  C CB    . ALA C 1 413 ? -17.064 -12.374 59.977  1.00 35.28 ? 413 ALA C CB    1 
ATOM   9946  N N     . PHE C 1 414 ? -19.225 -14.547 59.429  1.00 36.27 ? 414 PHE C N     1 
ATOM   9947  C CA    . PHE C 1 414 ? -19.759 -15.557 58.538  1.00 34.94 ? 414 PHE C CA    1 
ATOM   9948  C C     . PHE C 1 414 ? -21.244 -15.461 58.420  1.00 34.75 ? 414 PHE C C     1 
ATOM   9949  O O     . PHE C 1 414 ? -21.694 -15.469 57.306  1.00 34.66 ? 414 PHE C O     1 
ATOM   9950  C CB    . PHE C 1 414 ? -19.241 -16.977 58.880  1.00 36.21 ? 414 PHE C CB    1 
ATOM   9951  C CG    . PHE C 1 414 ? -17.960 -17.317 58.177  1.00 37.32 ? 414 PHE C CG    1 
ATOM   9952  C CD1   . PHE C 1 414 ? -16.737 -17.171 58.811  1.00 41.05 ? 414 PHE C CD1   1 
ATOM   9953  C CD2   . PHE C 1 414 ? -17.967 -17.705 56.865  1.00 37.39 ? 414 PHE C CD2   1 
ATOM   9954  C CE1   . PHE C 1 414 ? -15.572 -17.437 58.148  1.00 41.29 ? 414 PHE C CE1   1 
ATOM   9955  C CE2   . PHE C 1 414 ? -16.780 -18.022 56.201  1.00 37.49 ? 414 PHE C CE2   1 
ATOM   9956  C CZ    . PHE C 1 414 ? -15.599 -17.881 56.817  1.00 38.55 ? 414 PHE C CZ    1 
ATOM   9957  N N     . GLN C 1 415 ? -22.010 -15.298 59.531  1.00 35.13 ? 415 GLN C N     1 
ATOM   9958  C CA    . GLN C 1 415 ? -23.454 -15.114 59.435  1.00 34.72 ? 415 GLN C CA    1 
ATOM   9959  C C     . GLN C 1 415 ? -23.836 -13.912 58.562  1.00 34.71 ? 415 GLN C C     1 
ATOM   9960  O O     . GLN C 1 415 ? -24.813 -13.960 57.835  1.00 34.84 ? 415 GLN C O     1 
ATOM   9961  C CB    . GLN C 1 415 ? -24.179 -14.873 60.792  1.00 36.49 ? 415 GLN C CB    1 
ATOM   9962  C CG    . GLN C 1 415 ? -24.554 -13.348 60.857  1.00 37.55 ? 415 GLN C CG    1 
ATOM   9963  C CD    . GLN C 1 415 ? -25.870 -12.956 61.284  1.00 39.02 ? 415 GLN C CD    1 
ATOM   9964  O OE1   . GLN C 1 415 ? -26.817 -12.752 60.476  1.00 36.78 ? 415 GLN C OE1   1 
ATOM   9965  N NE2   . GLN C 1 415 ? -25.951 -12.654 62.580  1.00 46.71 ? 415 GLN C NE2   1 
ATOM   9966  N N     . VAL C 1 416 ? -23.146 -12.785 58.757  1.00 34.32 ? 416 VAL C N     1 
ATOM   9967  C CA    . VAL C 1 416 ? -23.481 -11.577 58.044  1.00 32.60 ? 416 VAL C CA    1 
ATOM   9968  C C     . VAL C 1 416 ? -23.225 -11.796 56.524  1.00 30.82 ? 416 VAL C C     1 
ATOM   9969  O O     . VAL C 1 416 ? -24.012 -11.400 55.732  1.00 29.70 ? 416 VAL C O     1 
ATOM   9970  C CB    . VAL C 1 416 ? -22.701 -10.384 58.672  1.00 34.24 ? 416 VAL C CB    1 
ATOM   9971  C CG1   . VAL C 1 416 ? -22.751 -9.145  57.824  1.00 33.49 ? 416 VAL C CG1   1 
ATOM   9972  C CG2   . VAL C 1 416 ? -23.237 -10.061 60.028  1.00 35.17 ? 416 VAL C CG2   1 
ATOM   9973  N N     . LEU C 1 417 ? -22.158 -12.489 56.171  1.00 30.10 ? 417 LEU C N     1 
ATOM   9974  C CA    . LEU C 1 417 ? -21.816 -12.894 54.766  1.00 31.18 ? 417 LEU C CA    1 
ATOM   9975  C C     . LEU C 1 417 ? -22.875 -13.833 54.131  1.00 31.32 ? 417 LEU C C     1 
ATOM   9976  O O     . LEU C 1 417 ? -23.314 -13.609 52.954  1.00 32.08 ? 417 LEU C O     1 
ATOM   9977  C CB    . LEU C 1 417 ? -20.430 -13.616 54.708  1.00 29.81 ? 417 LEU C CB    1 
ATOM   9978  C CG    . LEU C 1 417 ? -19.418 -13.698 53.511  1.00 31.05 ? 417 LEU C CG    1 
ATOM   9979  C CD1   . LEU C 1 417 ? -18.867 -15.099 53.050  1.00 27.20 ? 417 LEU C CD1   1 
ATOM   9980  C CD2   . LEU C 1 417 ? -19.890 -12.895 52.354  1.00 33.76 ? 417 LEU C CD2   1 
ATOM   9981  N N     . ALA C 1 418 ? -23.252 -14.883 54.862  1.00 29.80 ? 418 ALA C N     1 
ATOM   9982  C CA    . ALA C 1 418 ? -24.207 -15.842 54.322  1.00 29.78 ? 418 ALA C CA    1 
ATOM   9983  C C     . ALA C 1 418 ? -25.440 -15.102 54.013  1.00 28.64 ? 418 ALA C C     1 
ATOM   9984  O O     . ALA C 1 418 ? -25.951 -15.262 53.005  1.00 30.50 ? 418 ALA C O     1 
ATOM   9985  C CB    . ALA C 1 418 ? -24.497 -17.021 55.300  1.00 29.46 ? 418 ALA C CB    1 
ATOM   9986  N N     . GLN C 1 419 ? -25.908 -14.224 54.864  1.00 31.65 ? 419 GLN C N     1 
ATOM   9987  C CA    . GLN C 1 419 ? -27.169 -13.489 54.588  1.00 31.17 ? 419 GLN C CA    1 
ATOM   9988  C C     . GLN C 1 419 ? -27.035 -12.516 53.472  1.00 31.66 ? 419 GLN C C     1 
ATOM   9989  O O     . GLN C 1 419 ? -28.005 -12.269 52.783  1.00 32.84 ? 419 GLN C O     1 
ATOM   9990  C CB    . GLN C 1 419 ? -27.595 -12.678 55.808  1.00 31.61 ? 419 GLN C CB    1 
ATOM   9991  C CG    . GLN C 1 419 ? -28.872 -11.799 55.602  1.00 36.92 ? 419 GLN C CG    1 
ATOM   9992  C CD    . GLN C 1 419 ? -30.159 -12.628 55.284  1.00 49.21 ? 419 GLN C CD    1 
ATOM   9993  O OE1   . GLN C 1 419 ? -30.128 -13.898 55.203  1.00 51.37 ? 419 GLN C OE1   1 
ATOM   9994  N NE2   . GLN C 1 419 ? -31.306 -11.916 55.143  1.00 50.94 ? 419 GLN C NE2   1 
ATOM   9995  N N     . LEU C 1 420 ? -25.876 -11.877 53.355  1.00 31.64 ? 420 LEU C N     1 
ATOM   9996  C CA    . LEU C 1 420 ? -25.609 -11.006 52.206  1.00 31.47 ? 420 LEU C CA    1 
ATOM   9997  C C     . LEU C 1 420 ? -25.587 -11.777 50.945  1.00 31.20 ? 420 LEU C C     1 
ATOM   9998  O O     . LEU C 1 420 ? -26.134 -11.295 49.991  1.00 34.74 ? 420 LEU C O     1 
ATOM   9999  C CB    . LEU C 1 420 ? -24.328 -10.174 52.332  1.00 30.04 ? 420 LEU C CB    1 
ATOM   10000 C CG    . LEU C 1 420 ? -24.533 -8.889  53.210  1.00 32.09 ? 420 LEU C CG    1 
ATOM   10001 C CD1   . LEU C 1 420 ? -23.239 -8.017  53.419  1.00 33.05 ? 420 LEU C CD1   1 
ATOM   10002 C CD2   . LEU C 1 420 ? -25.634 -7.977  52.670  1.00 30.73 ? 420 LEU C CD2   1 
ATOM   10003 N N     . ILE C 1 421 ? -24.967 -12.954 50.910  1.00 29.38 ? 421 ILE C N     1 
ATOM   10004 C CA    . ILE C 1 421 ? -24.920 -13.759 49.693  1.00 28.24 ? 421 ILE C CA    1 
ATOM   10005 C C     . ILE C 1 421 ? -26.327 -14.222 49.307  1.00 30.26 ? 421 ILE C C     1 
ATOM   10006 O O     . ILE C 1 421 ? -26.643 -14.280 48.160  1.00 29.13 ? 421 ILE C O     1 
ATOM   10007 C CB    . ILE C 1 421 ? -24.057 -14.985 49.924  1.00 29.41 ? 421 ILE C CB    1 
ATOM   10008 C CG1   . ILE C 1 421 ? -22.546 -14.560 49.955  1.00 27.40 ? 421 ILE C CG1   1 
ATOM   10009 C CG2   . ILE C 1 421 ? -24.435 -16.207 48.931  1.00 25.59 ? 421 ILE C CG2   1 
ATOM   10010 C CD1   . ILE C 1 421 ? -21.663 -15.630 50.579  1.00 25.92 ? 421 ILE C CD1   1 
ATOM   10011 N N     . LYS C 1 422 ? -27.169 -14.537 50.282  1.00 31.86 ? 422 LYS C N     1 
ATOM   10012 C CA    . LYS C 1 422 ? -28.533 -14.915 49.986  1.00 34.79 ? 422 LYS C CA    1 
ATOM   10013 C C     . LYS C 1 422 ? -29.471 -13.767 49.604  1.00 36.01 ? 422 LYS C C     1 
ATOM   10014 O O     . LYS C 1 422 ? -30.452 -13.965 48.896  1.00 33.26 ? 422 LYS C O     1 
ATOM   10015 C CB    . LYS C 1 422 ? -29.097 -15.624 51.166  1.00 35.57 ? 422 LYS C CB    1 
ATOM   10016 C CG    . LYS C 1 422 ? -28.635 -17.001 51.255  1.00 36.28 ? 422 LYS C CG    1 
ATOM   10017 C CD    . LYS C 1 422 ? -29.525 -17.668 52.250  1.00 40.92 ? 422 LYS C CD    1 
ATOM   10018 C CE    . LYS C 1 422 ? -29.443 -17.042 53.612  1.00 41.21 ? 422 LYS C CE    1 
ATOM   10019 N NZ    . LYS C 1 422 ? -28.022 -17.245 53.920  1.00 44.91 ? 422 LYS C NZ    1 
ATOM   10020 N N     . GLU C 1 423 ? -29.137 -12.562 50.077  1.00 38.13 ? 423 GLU C N     1 
ATOM   10021 C CA    . GLU C 1 423 ? -29.826 -11.365 49.598  1.00 40.64 ? 423 GLU C CA    1 
ATOM   10022 C C     . GLU C 1 423 ? -29.388 -10.915 48.193  1.00 41.29 ? 423 GLU C C     1 
ATOM   10023 O O     . GLU C 1 423 ? -30.098 -10.127 47.562  1.00 40.38 ? 423 GLU C O     1 
ATOM   10024 C CB    . GLU C 1 423 ? -29.728 -10.224 50.574  1.00 40.14 ? 423 GLU C CB    1 
ATOM   10025 C CG    . GLU C 1 423 ? -30.771 -10.318 51.609  1.00 41.91 ? 423 GLU C CG    1 
ATOM   10026 C CD    . GLU C 1 423 ? -30.386 -9.542  52.812  1.00 45.09 ? 423 GLU C CD    1 
ATOM   10027 O OE1   . GLU C 1 423 ? -29.321 -8.912  52.719  1.00 41.77 ? 423 GLU C OE1   1 
ATOM   10028 O OE2   . GLU C 1 423 ? -31.129 -9.585  53.838  1.00 47.39 ? 423 GLU C OE2   1 
ATOM   10029 N N     . SER C 1 424 ? -28.271 -11.472 47.711  1.00 41.69 ? 424 SER C N     1 
ATOM   10030 C CA    . SER C 1 424 ? -27.716 -11.161 46.390  1.00 43.60 ? 424 SER C CA    1 
ATOM   10031 C C     . SER C 1 424 ? -28.257 -12.163 45.357  1.00 44.47 ? 424 SER C C     1 
ATOM   10032 O O     . SER C 1 424 ? -28.169 -11.932 44.136  1.00 45.49 ? 424 SER C O     1 
ATOM   10033 C CB    . SER C 1 424 ? -26.197 -11.349 46.433  1.00 43.61 ? 424 SER C CB    1 
ATOM   10034 O OG    . SER C 1 424 ? -25.492 -10.198 46.811  1.00 46.18 ? 424 SER C OG    1 
ATOM   10035 N N     . LEU C 1 425 ? -28.719 -13.306 45.858  1.00 44.47 ? 425 LEU C N     1 
ATOM   10036 C CA    . LEU C 1 425 ? -29.233 -14.394 45.040  1.00 45.15 ? 425 LEU C CA    1 
ATOM   10037 C C     . LEU C 1 425 ? -30.654 -14.133 44.488  1.00 45.80 ? 425 LEU C C     1 
ATOM   10038 O O     . LEU C 1 425 ? -31.036 -14.660 43.445  1.00 44.87 ? 425 LEU C O     1 
ATOM   10039 C CB    . LEU C 1 425 ? -29.251 -15.673 45.886  1.00 45.26 ? 425 LEU C CB    1 
ATOM   10040 C CG    . LEU C 1 425 ? -27.978 -16.523 46.036  1.00 45.23 ? 425 LEU C CG    1 
ATOM   10041 C CD1   . LEU C 1 425 ? -28.385 -17.818 46.770  1.00 39.91 ? 425 LEU C CD1   1 
ATOM   10042 C CD2   . LEU C 1 425 ? -27.366 -16.798 44.613  1.00 41.02 ? 425 LEU C CD2   1 
ATOM   10043 N N     . MET D 1 1   ? 8.166   19.853  35.500  1.00 46.19 ? 1   MET D N     1 
ATOM   10044 C CA    . MET D 1 1   ? 6.804   20.161  35.081  1.00 44.92 ? 1   MET D CA    1 
ATOM   10045 C C     . MET D 1 1   ? 6.219   19.033  34.239  1.00 42.49 ? 1   MET D C     1 
ATOM   10046 O O     . MET D 1 1   ? 5.029   18.729  34.332  1.00 42.39 ? 1   MET D O     1 
ATOM   10047 C CB    . MET D 1 1   ? 6.769   21.475  34.297  1.00 44.39 ? 1   MET D CB    1 
ATOM   10048 C CG    . MET D 1 1   ? 5.429   22.190  34.346  1.00 47.92 ? 1   MET D CG    1 
ATOM   10049 S SD    . MET D 1 1   ? 5.594   23.956  34.670  1.00 52.62 ? 1   MET D SD    1 
ATOM   10050 C CE    . MET D 1 1   ? 6.327   24.516  33.135  1.00 52.44 ? 1   MET D CE    1 
ATOM   10051 N N     . ASN D 1 2   ? 7.061   18.415  33.417  1.00 40.62 ? 2   ASN D N     1 
ATOM   10052 C CA    . ASN D 1 2   ? 6.665   17.126  32.671  1.00 40.29 ? 2   ASN D CA    1 
ATOM   10053 C C     . ASN D 1 2   ? 7.346   15.852  33.186  1.00 38.33 ? 2   ASN D C     1 
ATOM   10054 O O     . ASN D 1 2   ? 8.333   15.348  32.604  1.00 39.14 ? 2   ASN D O     1 
ATOM   10055 C CB    . ASN D 1 2   ? 6.860   17.193  31.137  1.00 40.41 ? 2   ASN D CB    1 
ATOM   10056 C CG    . ASN D 1 2   ? 6.512   15.838  30.394  1.00 40.28 ? 2   ASN D CG    1 
ATOM   10057 O OD1   . ASN D 1 2   ? 7.052   15.564  29.332  1.00 41.02 ? 2   ASN D OD1   1 
ATOM   10058 N ND2   . ASN D 1 2   ? 5.622   15.018  30.969  1.00 40.54 ? 2   ASN D ND2   1 
ATOM   10059 N N     . TYR D 1 3   ? 6.790   15.334  34.273  1.00 36.76 ? 3   TYR D N     1 
ATOM   10060 C CA    . TYR D 1 3   ? 7.417   14.316  35.099  1.00 35.35 ? 3   TYR D CA    1 
ATOM   10061 C C     . TYR D 1 3   ? 7.603   13.021  34.322  1.00 36.19 ? 3   TYR D C     1 
ATOM   10062 O O     . TYR D 1 3   ? 8.564   12.326  34.564  1.00 36.53 ? 3   TYR D O     1 
ATOM   10063 C CB    . TYR D 1 3   ? 6.641   14.142  36.432  1.00 32.70 ? 3   TYR D CB    1 
ATOM   10064 C CG    . TYR D 1 3   ? 6.911   15.285  37.377  1.00 31.61 ? 3   TYR D CG    1 
ATOM   10065 C CD1   . TYR D 1 3   ? 5.861   16.078  37.893  1.00 33.11 ? 3   TYR D CD1   1 
ATOM   10066 C CD2   . TYR D 1 3   ? 8.231   15.629  37.718  1.00 30.05 ? 3   TYR D CD2   1 
ATOM   10067 C CE1   . TYR D 1 3   ? 6.116   17.177  38.745  1.00 27.66 ? 3   TYR D CE1   1 
ATOM   10068 C CE2   . TYR D 1 3   ? 8.493   16.728  38.566  1.00 25.06 ? 3   TYR D CE2   1 
ATOM   10069 C CZ    . TYR D 1 3   ? 7.422   17.472  39.050  1.00 30.73 ? 3   TYR D CZ    1 
ATOM   10070 O OH    . TYR D 1 3   ? 7.726   18.549  39.839  1.00 32.73 ? 3   TYR D OH    1 
ATOM   10071 N N     . ALA D 1 4   ? 6.689   12.738  33.374  1.00 37.13 ? 4   ALA D N     1 
ATOM   10072 C CA    . ALA D 1 4   ? 6.754   11.568  32.462  1.00 37.19 ? 4   ALA D CA    1 
ATOM   10073 C C     . ALA D 1 4   ? 8.027   11.321  31.679  1.00 37.59 ? 4   ALA D C     1 
ATOM   10074 O O     . ALA D 1 4   ? 8.310   10.133  31.335  1.00 36.95 ? 4   ALA D O     1 
ATOM   10075 C CB    . ALA D 1 4   ? 5.539   11.546  31.474  1.00 37.62 ? 4   ALA D CB    1 
ATOM   10076 N N     . ARG D 1 5   ? 8.793   12.383  31.353  1.00 37.63 ? 5   ARG D N     1 
ATOM   10077 C CA    . ARG D 1 5   ? 10.084  12.142  30.657  1.00 37.85 ? 5   ARG D CA    1 
ATOM   10078 C C     . ARG D 1 5   ? 11.191  11.612  31.597  1.00 36.81 ? 5   ARG D C     1 
ATOM   10079 O O     . ARG D 1 5   ? 12.291  11.232  31.175  1.00 35.60 ? 5   ARG D O     1 
ATOM   10080 C CB    . ARG D 1 5   ? 10.586  13.302  29.731  1.00 38.43 ? 5   ARG D CB    1 
ATOM   10081 C CG    . ARG D 1 5   ? 10.850  14.654  30.354  1.00 40.22 ? 5   ARG D CG    1 
ATOM   10082 C CD    . ARG D 1 5   ? 11.466  15.672  29.347  1.00 38.18 ? 5   ARG D CD    1 
ATOM   10083 N NE    . ARG D 1 5   ? 12.916  15.529  29.214  1.00 38.49 ? 5   ARG D NE    1 
ATOM   10084 C CZ    . ARG D 1 5   ? 13.814  16.395  29.634  1.00 39.05 ? 5   ARG D CZ    1 
ATOM   10085 N NH1   . ARG D 1 5   ? 15.091  16.157  29.431  1.00 42.61 ? 5   ARG D NH1   1 
ATOM   10086 N NH2   . ARG D 1 5   ? 13.449  17.528  30.216  1.00 43.99 ? 5   ARG D NH2   1 
ATOM   10087 N N     . PHE D 1 6   ? 10.855  11.524  32.865  1.00 35.94 ? 6   PHE D N     1 
ATOM   10088 C CA    . PHE D 1 6   ? 11.836  11.119  33.859  1.00 36.08 ? 6   PHE D CA    1 
ATOM   10089 C C     . PHE D 1 6   ? 11.433  9.761   34.512  1.00 35.67 ? 6   PHE D C     1 
ATOM   10090 O O     . PHE D 1 6   ? 11.928  9.384   35.606  1.00 37.96 ? 6   PHE D O     1 
ATOM   10091 C CB    . PHE D 1 6   ? 11.993  12.246  34.872  1.00 35.15 ? 6   PHE D CB    1 
ATOM   10092 C CG    . PHE D 1 6   ? 12.357  13.601  34.243  1.00 34.70 ? 6   PHE D CG    1 
ATOM   10093 C CD1   . PHE D 1 6   ? 11.418  14.609  34.195  1.00 33.16 ? 6   PHE D CD1   1 
ATOM   10094 C CD2   . PHE D 1 6   ? 13.647  13.851  33.744  1.00 28.91 ? 6   PHE D CD2   1 
ATOM   10095 C CE1   . PHE D 1 6   ? 11.714  15.874  33.628  1.00 35.98 ? 6   PHE D CE1   1 
ATOM   10096 C CE2   . PHE D 1 6   ? 13.966  15.115  33.199  1.00 38.07 ? 6   PHE D CE2   1 
ATOM   10097 C CZ    . PHE D 1 6   ? 12.973  16.143  33.126  1.00 32.90 ? 6   PHE D CZ    1 
ATOM   10098 N N     . ILE D 1 7   ? 10.523  9.076   33.832  1.00 32.46 ? 7   ILE D N     1 
ATOM   10099 C CA    . ILE D 1 7   ? 9.929   7.831   34.263  1.00 29.84 ? 7   ILE D CA    1 
ATOM   10100 C C     . ILE D 1 7   ? 9.987   6.889   33.015  1.00 32.06 ? 7   ILE D C     1 
ATOM   10101 O O     . ILE D 1 7   ? 9.400   7.124   31.956  1.00 32.26 ? 7   ILE D O     1 
ATOM   10102 C CB    . ILE D 1 7   ? 8.483   8.030   34.783  1.00 29.69 ? 7   ILE D CB    1 
ATOM   10103 C CG1   . ILE D 1 7   ? 8.412   8.973   36.031  1.00 28.07 ? 7   ILE D CG1   1 
ATOM   10104 C CG2   . ILE D 1 7   ? 7.834   6.753   35.132  1.00 25.36 ? 7   ILE D CG2   1 
ATOM   10105 C CD1   . ILE D 1 7   ? 6.932   9.497   36.341  1.00 26.15 ? 7   ILE D CD1   1 
ATOM   10106 N N     . THR D 1 8   ? 10.859  5.921   33.162  1.00 30.96 ? 8   THR D N     1 
ATOM   10107 C CA    . THR D 1 8   ? 10.902  4.689   32.472  1.00 30.45 ? 8   THR D CA    1 
ATOM   10108 C C     . THR D 1 8   ? 9.482   4.063   32.171  1.00 29.66 ? 8   THR D C     1 
ATOM   10109 O O     . THR D 1 8   ? 8.550   4.126   32.955  1.00 27.37 ? 8   THR D O     1 
ATOM   10110 C CB    . THR D 1 8   ? 11.916  3.943   33.334  1.00 30.29 ? 8   THR D CB    1 
ATOM   10111 O OG1   . THR D 1 8   ? 13.196  3.970   32.697  1.00 32.49 ? 8   THR D OG1   1 
ATOM   10112 C CG2   . THR D 1 8   ? 11.527  2.611   33.780  1.00 27.50 ? 8   THR D CG2   1 
ATOM   10113 N N     . ALA D 1 9   ? 9.268   3.590   30.945  1.00 29.69 ? 9   ALA D N     1 
ATOM   10114 C CA    . ALA D 1 9   ? 8.116   2.656   30.734  1.00 30.06 ? 9   ALA D CA    1 
ATOM   10115 C C     . ALA D 1 9   ? 8.026   1.614   31.870  1.00 27.65 ? 9   ALA D C     1 
ATOM   10116 O O     . ALA D 1 9   ? 7.012   1.244   32.214  1.00 28.56 ? 9   ALA D O     1 
ATOM   10117 C CB    . ALA D 1 9   ? 8.272   1.889   29.398  1.00 29.91 ? 9   ALA D CB    1 
ATOM   10118 N N     . ALA D 1 10  ? 9.107   1.116   32.425  1.00 27.22 ? 10  ALA D N     1 
ATOM   10119 C CA    . ALA D 1 10  ? 8.934   0.027   33.363  1.00 27.74 ? 10  ALA D CA    1 
ATOM   10120 C C     . ALA D 1 10  ? 8.315   0.512   34.722  1.00 29.48 ? 10  ALA D C     1 
ATOM   10121 O O     . ALA D 1 10  ? 7.431   -0.160  35.348  1.00 29.33 ? 10  ALA D O     1 
ATOM   10122 C CB    . ALA D 1 10  ? 10.232  -0.631  33.550  1.00 27.15 ? 10  ALA D CB    1 
ATOM   10123 N N     . SER D 1 11  ? 8.794   1.693   35.130  1.00 29.41 ? 11  SER D N     1 
ATOM   10124 C CA    . SER D 1 11  ? 8.361   2.427   36.323  1.00 30.16 ? 11  SER D CA    1 
ATOM   10125 C C     . SER D 1 11  ? 6.943   3.113   36.229  1.00 29.01 ? 11  SER D C     1 
ATOM   10126 O O     . SER D 1 11  ? 6.108   3.132   37.204  1.00 27.84 ? 11  SER D O     1 
ATOM   10127 C CB    . SER D 1 11  ? 9.521   3.424   36.692  1.00 29.99 ? 11  SER D CB    1 
ATOM   10128 O OG    . SER D 1 11  ? 9.159   4.168   37.808  1.00 27.87 ? 11  SER D OG    1 
ATOM   10129 N N     . ALA D 1 12  ? 6.666   3.694   35.075  1.00 26.24 ? 12  ALA D N     1 
ATOM   10130 C CA    . ALA D 1 12  ? 5.315   4.142   34.786  1.00 27.85 ? 12  ALA D CA    1 
ATOM   10131 C C     . ALA D 1 12  ? 4.275   3.012   34.817  1.00 26.73 ? 12  ALA D C     1 
ATOM   10132 O O     . ALA D 1 12  ? 3.140   3.250   35.183  1.00 27.93 ? 12  ALA D O     1 
ATOM   10133 C CB    . ALA D 1 12  ? 5.212   4.933   33.295  1.00 26.62 ? 12  ALA D CB    1 
ATOM   10134 N N     . ALA D 1 13  ? 4.673   1.829   34.392  1.00 27.40 ? 13  ALA D N     1 
ATOM   10135 C CA    . ALA D 1 13  ? 3.818   0.568   34.444  1.00 28.95 ? 13  ALA D CA    1 
ATOM   10136 C C     . ALA D 1 13  ? 3.499   -0.016  35.810  1.00 29.08 ? 13  ALA D C     1 
ATOM   10137 O O     . ALA D 1 13  ? 2.693   -0.945  35.877  1.00 29.33 ? 13  ALA D O     1 
ATOM   10138 C CB    . ALA D 1 13  ? 4.439   -0.573  33.574  1.00 25.79 ? 13  ALA D CB    1 
ATOM   10139 N N     . ARG D 1 14  ? 4.157   0.453   36.882  1.00 29.22 ? 14  ARG D N     1 
ATOM   10140 C CA    . ARG D 1 14  ? 3.988   -0.152  38.218  1.00 26.10 ? 14  ARG D CA    1 
ATOM   10141 C C     . ARG D 1 14  ? 2.685   0.374   38.766  1.00 30.07 ? 14  ARG D C     1 
ATOM   10142 O O     . ARG D 1 14  ? 2.352   1.658   38.648  1.00 29.45 ? 14  ARG D O     1 
ATOM   10143 C CB    . ARG D 1 14  ? 5.080   0.409   39.169  1.00 27.91 ? 14  ARG D CB    1 
ATOM   10144 C CG    . ARG D 1 14  ? 6.498   -0.134  39.079  1.00 26.24 ? 14  ARG D CG    1 
ATOM   10145 C CD    . ARG D 1 14  ? 7.411   0.324   40.242  1.00 19.76 ? 14  ARG D CD    1 
ATOM   10146 N NE    . ARG D 1 14  ? 8.804   0.080   39.896  1.00 23.20 ? 14  ARG D NE    1 
ATOM   10147 C CZ    . ARG D 1 14  ? 9.318   -1.164  39.944  1.00 28.08 ? 14  ARG D CZ    1 
ATOM   10148 N NH1   . ARG D 1 14  ? 8.534   -2.168  40.297  1.00 22.28 ? 14  ARG D NH1   1 
ATOM   10149 N NH2   . ARG D 1 14  ? 10.575  -1.417  39.642  1.00 25.50 ? 14  ARG D NH2   1 
ATOM   10150 N N     . ASN D 1 15  ? 1.941   -0.524  39.439  1.00 30.83 ? 15  ASN D N     1 
ATOM   10151 C CA    . ASN D 1 15  ? 0.695   -0.078  40.141  1.00 32.13 ? 15  ASN D CA    1 
ATOM   10152 C C     . ASN D 1 15  ? 0.853   -0.341  41.607  1.00 33.84 ? 15  ASN D C     1 
ATOM   10153 O O     . ASN D 1 15  ? 1.698   -1.210  41.990  1.00 33.89 ? 15  ASN D O     1 
ATOM   10154 C CB    . ASN D 1 15  ? -0.524  -0.909  39.678  1.00 32.64 ? 15  ASN D CB    1 
ATOM   10155 C CG    . ASN D 1 15  ? -0.648  -1.022  38.152  1.00 30.17 ? 15  ASN D CG    1 
ATOM   10156 O OD1   . ASN D 1 15  ? -0.900  -0.024  37.448  1.00 27.07 ? 15  ASN D OD1   1 
ATOM   10157 N ND2   . ASN D 1 15  ? -0.599  -2.248  37.663  1.00 31.93 ? 15  ASN D ND2   1 
ATOM   10158 N N     . PRO D 1 16  ? 0.013   0.301   42.435  1.00 36.14 ? 16  PRO D N     1 
ATOM   10159 C CA    . PRO D 1 16  ? 0.013   0.155   43.925  1.00 38.04 ? 16  PRO D CA    1 
ATOM   10160 C C     . PRO D 1 16  ? 0.282   -1.211  44.533  1.00 40.49 ? 16  PRO D C     1 
ATOM   10161 O O     . PRO D 1 16  ? 1.291   -1.380  45.193  1.00 42.72 ? 16  PRO D O     1 
ATOM   10162 C CB    . PRO D 1 16  ? -1.321  0.755   44.389  1.00 36.11 ? 16  PRO D CB    1 
ATOM   10163 C CG    . PRO D 1 16  ? -1.621  1.766   43.338  1.00 37.74 ? 16  PRO D CG    1 
ATOM   10164 C CD    . PRO D 1 16  ? -0.994  1.282   42.005  1.00 36.41 ? 16  PRO D CD    1 
ATOM   10165 N N     . SER D 1 17  ? -0.499  -2.232  44.396  1.00 43.69 ? 17  SER D N     1 
ATOM   10166 C CA    . SER D 1 17  ? 0.096   -3.413  45.111  1.00 47.35 ? 17  SER D CA    1 
ATOM   10167 C C     . SER D 1 17  ? -0.122  -3.364  46.667  1.00 49.73 ? 17  SER D C     1 
ATOM   10168 O O     . SER D 1 17  ? 0.654   -2.702  47.431  1.00 47.53 ? 17  SER D O     1 
ATOM   10169 C CB    . SER D 1 17  ? 1.601   -3.570  44.818  1.00 46.75 ? 17  SER D CB    1 
ATOM   10170 O OG    . SER D 1 17  ? 2.048   -4.831  45.260  1.00 47.62 ? 17  SER D OG    1 
ATOM   10171 N N     . PRO D 1 18  ? -1.084  -4.223  47.126  1.00 51.49 ? 18  PRO D N     1 
ATOM   10172 C CA    . PRO D 1 18  ? -2.056  -4.064  48.196  1.00 52.83 ? 18  PRO D CA    1 
ATOM   10173 C C     . PRO D 1 18  ? -1.607  -3.945  49.711  1.00 54.00 ? 18  PRO D C     1 
ATOM   10174 O O     . PRO D 1 18  ? -0.473  -3.495  50.042  1.00 52.05 ? 18  PRO D O     1 
ATOM   10175 C CB    . PRO D 1 18  ? -3.020  -5.248  47.962  1.00 52.86 ? 18  PRO D CB    1 
ATOM   10176 C CG    . PRO D 1 18  ? -2.455  -6.074  46.879  1.00 52.62 ? 18  PRO D CG    1 
ATOM   10177 C CD    . PRO D 1 18  ? -1.073  -5.616  46.615  1.00 51.63 ? 18  PRO D CD    1 
ATOM   10178 N N     . ILE D 1 19  ? -2.545  -4.397  50.569  1.00 57.06 ? 19  ILE D N     1 
ATOM   10179 C CA    . ILE D 1 19  ? -2.821  -3.969  51.993  1.00 60.12 ? 19  ILE D CA    1 
ATOM   10180 C C     . ILE D 1 19  ? -3.941  -2.838  51.875  1.00 62.21 ? 19  ILE D C     1 
ATOM   10181 O O     . ILE D 1 19  ? -3.737  -1.627  52.143  1.00 61.59 ? 19  ILE D O     1 
ATOM   10182 C CB    . ILE D 1 19  ? -1.545  -3.594  52.823  1.00 59.34 ? 19  ILE D CB    1 
ATOM   10183 C CG1   . ILE D 1 19  ? -0.578  -4.788  52.935  1.00 61.43 ? 19  ILE D CG1   1 
ATOM   10184 C CG2   . ILE D 1 19  ? -1.943  -3.119  54.183  1.00 61.05 ? 19  ILE D CG2   1 
ATOM   10185 C CD1   . ILE D 1 19  ? 0.911   -4.459  53.276  1.00 59.72 ? 19  ILE D CD1   1 
ATOM   10186 N N     . ARG D 1 20  ? -5.120  -3.295  51.447  1.00 64.24 ? 20  ARG D N     1 
ATOM   10187 C CA    . ARG D 1 20  ? -5.897  -2.574  50.433  1.00 66.43 ? 20  ARG D CA    1 
ATOM   10188 C C     . ARG D 1 20  ? -6.674  -1.335  50.785  1.00 68.19 ? 20  ARG D C     1 
ATOM   10189 O O     . ARG D 1 20  ? -6.777  -0.984  51.954  1.00 68.35 ? 20  ARG D O     1 
ATOM   10190 C CB    . ARG D 1 20  ? -6.733  -3.529  49.569  1.00 66.12 ? 20  ARG D CB    1 
ATOM   10191 C CG    . ARG D 1 20  ? -6.048  -3.851  48.224  1.00 65.20 ? 20  ARG D CG    1 
ATOM   10192 C CD    . ARG D 1 20  ? -5.310  -2.609  47.633  1.00 65.33 ? 20  ARG D CD    1 
ATOM   10193 N NE    . ARG D 1 20  ? -4.922  -2.763  46.221  1.00 64.67 ? 20  ARG D NE    1 
ATOM   10194 C CZ    . ARG D 1 20  ? -4.586  -1.757  45.405  1.00 62.34 ? 20  ARG D CZ    1 
ATOM   10195 N NH1   . ARG D 1 20  ? -4.553  -0.497  45.846  1.00 59.30 ? 20  ARG D NH1   1 
ATOM   10196 N NH2   . ARG D 1 20  ? -4.271  -2.015  44.141  1.00 59.80 ? 20  ARG D NH2   1 
ATOM   10197 N N     . THR D 1 21  ? -7.151  -0.668  49.721  1.00 70.97 ? 21  THR D N     1 
ATOM   10198 C CA    . THR D 1 21  ? -8.079  0.486   49.748  1.00 73.74 ? 21  THR D CA    1 
ATOM   10199 C C     . THR D 1 21  ? -9.385  0.047   50.444  1.00 75.65 ? 21  THR D C     1 
ATOM   10200 O O     . THR D 1 21  ? -10.490 0.610   50.238  1.00 75.92 ? 21  THR D O     1 
ATOM   10201 C CB    . THR D 1 21  ? -8.316  1.096   48.305  1.00 73.93 ? 21  THR D CB    1 
ATOM   10202 O OG1   . THR D 1 21  ? -7.984  0.130   47.293  1.00 73.26 ? 21  THR D OG1   1 
ATOM   10203 C CG2   . THR D 1 21  ? -7.458  2.371   48.070  1.00 73.98 ? 21  THR D CG2   1 
ATOM   10204 N N     . MET D 1 22  ? -9.189  -1.003  51.251  1.00 77.94 ? 22  MET D N     1 
ATOM   10205 C CA    . MET D 1 22  ? -10.136 -1.628  52.172  1.00 79.60 ? 22  MET D CA    1 
ATOM   10206 C C     . MET D 1 22  ? -9.523  -1.535  53.583  1.00 80.24 ? 22  MET D C     1 
ATOM   10207 O O     . MET D 1 22  ? -9.834  -0.617  54.318  1.00 80.55 ? 22  MET D O     1 
ATOM   10208 C CB    . MET D 1 22  ? -10.366 -3.097  51.798  1.00 79.36 ? 22  MET D CB    1 
ATOM   10209 C CG    . MET D 1 22  ? -10.485 -3.367  50.302  1.00 80.00 ? 22  MET D CG    1 
ATOM   10210 S SD    . MET D 1 22  ? -11.453 -4.862  49.939  1.00 80.78 ? 22  MET D SD    1 
ATOM   10211 C CE    . MET D 1 22  ? -12.037 -4.465  48.288  1.00 80.11 ? 22  MET D CE    1 
ATOM   10212 N N     . THR D 1 23  ? -8.623  -2.460  53.931  1.00 81.20 ? 23  THR D N     1 
ATOM   10213 C CA    . THR D 1 23  ? -8.052  -2.583  55.293  1.00 81.58 ? 23  THR D CA    1 
ATOM   10214 C C     . THR D 1 23  ? -7.276  -1.371  55.859  1.00 82.24 ? 23  THR D C     1 
ATOM   10215 O O     . THR D 1 23  ? -6.811  -1.384  57.022  1.00 81.96 ? 23  THR D O     1 
ATOM   10216 C CB    . THR D 1 23  ? -7.266  -3.923  55.468  1.00 81.70 ? 23  THR D CB    1 
ATOM   10217 O OG1   . THR D 1 23  ? -6.519  -4.224  54.277  1.00 80.65 ? 23  THR D OG1   1 
ATOM   10218 C CG2   . THR D 1 23  ? -8.237  -5.057  55.751  1.00 81.42 ? 23  THR D CG2   1 
ATOM   10219 N N     . ASP D 1 24  ? -7.129  -0.333  55.023  1.00 82.93 ? 24  ASP D N     1 
ATOM   10220 C CA    . ASP D 1 24  ? -7.087  1.059   55.505  1.00 83.30 ? 24  ASP D CA    1 
ATOM   10221 C C     . ASP D 1 24  ? -8.480  1.640   55.252  1.00 83.53 ? 24  ASP D C     1 
ATOM   10222 O O     . ASP D 1 24  ? -8.732  2.289   54.232  1.00 83.61 ? 24  ASP D O     1 
ATOM   10223 C CB    . ASP D 1 24  ? -5.998  1.901   54.819  1.00 83.56 ? 24  ASP D CB    1 
ATOM   10224 C CG    . ASP D 1 24  ? -5.814  3.287   55.460  1.00 82.52 ? 24  ASP D CG    1 
ATOM   10225 O OD1   . ASP D 1 24  ? -6.768  3.810   56.080  1.00 79.96 ? 24  ASP D OD1   1 
ATOM   10226 O OD2   . ASP D 1 24  ? -4.705  3.848   55.328  1.00 81.29 ? 24  ASP D OD2   1 
ATOM   10227 N N     . ILE D 1 25  ? -9.374  1.335   56.194  1.00 83.66 ? 25  ILE D N     1 
ATOM   10228 C CA    . ILE D 1 25  ? -10.794 1.658   56.161  1.00 83.67 ? 25  ILE D CA    1 
ATOM   10229 C C     . ILE D 1 25  ? -11.266 1.265   57.561  1.00 83.44 ? 25  ILE D C     1 
ATOM   10230 O O     . ILE D 1 25  ? -12.015 2.005   58.201  1.00 83.38 ? 25  ILE D O     1 
ATOM   10231 C CB    . ILE D 1 25  ? -11.582 0.865   55.038  1.00 83.80 ? 25  ILE D CB    1 
ATOM   10232 C CG1   . ILE D 1 25  ? -12.103 1.818   53.934  1.00 84.22 ? 25  ILE D CG1   1 
ATOM   10233 C CG2   . ILE D 1 25  ? -12.668 -0.063  55.640  1.00 83.10 ? 25  ILE D CG2   1 
ATOM   10234 C CD1   . ILE D 1 25  ? -12.884 1.151   52.766  1.00 83.73 ? 25  ILE D CD1   1 
ATOM   10235 N N     . LEU D 1 26  ? -10.783 0.106   58.026  1.00 83.21 ? 26  LEU D N     1 
ATOM   10236 C CA    . LEU D 1 26  ? -10.957 -0.386  59.407  1.00 83.22 ? 26  LEU D CA    1 
ATOM   10237 C C     . LEU D 1 26  ? -10.500 0.629   60.485  1.00 82.99 ? 26  LEU D C     1 
ATOM   10238 O O     . LEU D 1 26  ? -11.050 0.662   61.603  1.00 83.17 ? 26  LEU D O     1 
ATOM   10239 C CB    . LEU D 1 26  ? -10.241 -1.741  59.562  1.00 83.24 ? 26  LEU D CB    1 
ATOM   10240 C CG    . LEU D 1 26  ? -9.732  -2.278  60.914  1.00 84.02 ? 26  LEU D CG    1 
ATOM   10241 C CD1   . LEU D 1 26  ? -10.167 -3.750  61.148  1.00 83.78 ? 26  LEU D CD1   1 
ATOM   10242 C CD2   . LEU D 1 26  ? -8.187  -2.091  61.104  1.00 83.26 ? 26  LEU D CD2   1 
ATOM   10243 N N     . SER D 1 27  ? -9.501  1.442   60.134  1.00 82.25 ? 27  SER D N     1 
ATOM   10244 C CA    . SER D 1 27  ? -9.070  2.585   60.939  1.00 81.91 ? 27  SER D CA    1 
ATOM   10245 C C     . SER D 1 27  ? -10.081 3.756   60.900  1.00 81.44 ? 27  SER D C     1 
ATOM   10246 O O     . SER D 1 27  ? -10.350 4.385   61.939  1.00 81.07 ? 27  SER D O     1 
ATOM   10247 C CB    . SER D 1 27  ? -7.678  3.054   60.480  1.00 82.26 ? 27  SER D CB    1 
ATOM   10248 O OG    . SER D 1 27  ? -7.595  3.092   59.061  1.00 82.19 ? 27  SER D OG    1 
ATOM   10249 N N     . ARG D 1 28  ? -10.628 4.024   59.702  1.00 80.38 ? 28  ARG D N     1 
ATOM   10250 C CA    . ARG D 1 28  ? -11.630 5.078   59.465  1.00 79.06 ? 28  ARG D CA    1 
ATOM   10251 C C     . ARG D 1 28  ? -13.126 4.716   59.750  1.00 77.53 ? 28  ARG D C     1 
ATOM   10252 O O     . ARG D 1 28  ? -14.022 5.551   59.535  1.00 77.55 ? 28  ARG D O     1 
ATOM   10253 C CB    . ARG D 1 28  ? -11.462 5.655   58.040  1.00 79.15 ? 28  ARG D CB    1 
ATOM   10254 C CG    . ARG D 1 28  ? -10.871 7.078   57.988  1.00 80.08 ? 28  ARG D CG    1 
ATOM   10255 C CD    . ARG D 1 28  ? -10.161 7.453   56.663  1.00 80.13 ? 28  ARG D CD    1 
ATOM   10256 N NE    . ARG D 1 28  ? -10.701 6.737   55.499  1.00 83.99 ? 28  ARG D NE    1 
ATOM   10257 C CZ    . ARG D 1 28  ? -10.506 7.089   54.225  1.00 84.14 ? 28  ARG D CZ    1 
ATOM   10258 N NH1   . ARG D 1 28  ? -9.793  8.170   53.918  1.00 84.31 ? 28  ARG D NH1   1 
ATOM   10259 N NH2   . ARG D 1 28  ? -11.041 6.358   53.254  1.00 84.00 ? 28  ARG D NH2   1 
ATOM   10260 N N     . GLY D 1 29  ? -13.400 3.501   60.236  1.00 75.37 ? 29  GLY D N     1 
ATOM   10261 C CA    . GLY D 1 29  ? -14.777 3.116   60.578  1.00 72.27 ? 29  GLY D CA    1 
ATOM   10262 C C     . GLY D 1 29  ? -15.040 2.778   62.052  1.00 71.24 ? 29  GLY D C     1 
ATOM   10263 O O     . GLY D 1 29  ? -14.109 2.801   62.884  1.00 70.08 ? 29  GLY D O     1 
ATOM   10264 N N     . PRO D 1 30  ? -16.309 2.409   62.370  1.00 70.45 ? 30  PRO D N     1 
ATOM   10265 C CA    . PRO D 1 30  ? -16.860 2.089   63.715  1.00 69.98 ? 30  PRO D CA    1 
ATOM   10266 C C     . PRO D 1 30  ? -16.050 1.038   64.483  1.00 68.42 ? 30  PRO D C     1 
ATOM   10267 O O     . PRO D 1 30  ? -15.554 0.089   63.877  1.00 68.60 ? 30  PRO D O     1 
ATOM   10268 C CB    . PRO D 1 30  ? -18.264 1.544   63.403  1.00 69.70 ? 30  PRO D CB    1 
ATOM   10269 C CG    . PRO D 1 30  ? -18.260 1.261   61.902  1.00 70.21 ? 30  PRO D CG    1 
ATOM   10270 C CD    . PRO D 1 30  ? -17.328 2.227   61.315  1.00 70.58 ? 30  PRO D CD    1 
ATOM   10271 N N     . LYS D 1 31  ? -15.914 1.193   65.799  1.00 66.60 ? 31  LYS D N     1 
ATOM   10272 C CA    . LYS D 1 31  ? -15.057 0.284   66.581  1.00 64.47 ? 31  LYS D CA    1 
ATOM   10273 C C     . LYS D 1 31  ? -15.384 -1.213  66.268  1.00 62.70 ? 31  LYS D C     1 
ATOM   10274 O O     . LYS D 1 31  ? -14.459 -2.057  66.176  1.00 62.06 ? 31  LYS D O     1 
ATOM   10275 C CB    . LYS D 1 31  ? -15.188 0.585   68.097  1.00 65.73 ? 31  LYS D CB    1 
ATOM   10276 C CG    . LYS D 1 31  ? -13.858 0.649   68.898  1.00 65.45 ? 31  LYS D CG    1 
ATOM   10277 C CD    . LYS D 1 31  ? -13.317 2.121   68.994  1.00 67.39 ? 31  LYS D CD    1 
ATOM   10278 C CE    . LYS D 1 31  ? -13.865 2.921   70.211  1.00 66.17 ? 31  LYS D CE    1 
ATOM   10279 N NZ    . LYS D 1 31  ? -13.910 4.418   69.978  1.00 63.23 ? 31  LYS D NZ    1 
ATOM   10280 N N     . SER D 1 32  ? -16.679 -1.511  66.049  1.00 59.54 ? 32  SER D N     1 
ATOM   10281 C CA    . SER D 1 32  ? -17.160 -2.887  65.802  1.00 57.27 ? 32  SER D CA    1 
ATOM   10282 C C     . SER D 1 32  ? -17.219 -3.389  64.311  1.00 55.80 ? 32  SER D C     1 
ATOM   10283 O O     . SER D 1 32  ? -18.023 -4.297  63.999  1.00 56.35 ? 32  SER D O     1 
ATOM   10284 C CB    . SER D 1 32  ? -18.523 -3.083  66.444  1.00 57.19 ? 32  SER D CB    1 
ATOM   10285 O OG    . SER D 1 32  ? -19.494 -2.330  65.761  1.00 55.33 ? 32  SER D OG    1 
ATOM   10286 N N     . MET D 1 33  ? -16.408 -2.813  63.426  1.00 51.46 ? 33  MET D N     1 
ATOM   10287 C CA    . MET D 1 33  ? -16.112 -3.421  62.104  1.00 51.28 ? 33  MET D CA    1 
ATOM   10288 C C     . MET D 1 33  ? -15.433 -4.780  62.324  1.00 47.07 ? 33  MET D C     1 
ATOM   10289 O O     . MET D 1 33  ? -14.566 -4.893  63.144  1.00 48.78 ? 33  MET D O     1 
ATOM   10290 C CB    . MET D 1 33  ? -15.152 -2.510  61.287  1.00 49.05 ? 33  MET D CB    1 
ATOM   10291 C CG    . MET D 1 33  ? -14.702 -3.043  59.907  1.00 52.47 ? 33  MET D CG    1 
ATOM   10292 S SD    . MET D 1 33  ? -14.309 -1.754  58.632  1.00 58.74 ? 33  MET D SD    1 
ATOM   10293 C CE    . MET D 1 33  ? -15.726 -0.660  58.891  1.00 53.34 ? 33  MET D CE    1 
ATOM   10294 N N     . ILE D 1 34  ? -15.796 -5.836  61.638  1.00 43.34 ? 34  ILE D N     1 
ATOM   10295 C CA    . ILE D 1 34  ? -14.839 -6.944  61.653  1.00 39.43 ? 34  ILE D CA    1 
ATOM   10296 C C     . ILE D 1 34  ? -14.248 -7.193  60.288  1.00 37.58 ? 34  ILE D C     1 
ATOM   10297 O O     . ILE D 1 34  ? -14.926 -7.090  59.325  1.00 39.22 ? 34  ILE D O     1 
ATOM   10298 C CB    . ILE D 1 34  ? -15.298 -8.228  62.380  1.00 39.26 ? 34  ILE D CB    1 
ATOM   10299 C CG1   . ILE D 1 34  ? -15.406 -9.401  61.443  1.00 39.42 ? 34  ILE D CG1   1 
ATOM   10300 C CG2   . ILE D 1 34  ? -16.470 -8.029  63.470  1.00 35.39 ? 34  ILE D CG2   1 
ATOM   10301 C CD1   . ILE D 1 34  ? -14.756 -10.583 62.051  1.00 40.75 ? 34  ILE D CD1   1 
ATOM   10302 N N     . SER D 1 35  ? -12.958 -7.418  60.189  1.00 35.08 ? 35  SER D N     1 
ATOM   10303 C CA    . SER D 1 35  ? -12.367 -7.682  58.907  1.00 33.32 ? 35  SER D CA    1 
ATOM   10304 C C     . SER D 1 35  ? -11.563 -8.942  58.951  1.00 32.63 ? 35  SER D C     1 
ATOM   10305 O O     . SER D 1 35  ? -10.756 -9.174  59.851  1.00 33.61 ? 35  SER D O     1 
ATOM   10306 C CB    . SER D 1 35  ? -11.386 -6.632  58.496  1.00 33.43 ? 35  SER D CB    1 
ATOM   10307 O OG    . SER D 1 35  ? -10.555 -7.222  57.509  1.00 32.45 ? 35  SER D OG    1 
ATOM   10308 N N     . LEU D 1 36  ? -11.823 -9.772  57.984  1.00 30.63 ? 36  LEU D N     1 
ATOM   10309 C CA    . LEU D 1 36  ? -10.989 -10.895 57.735  1.00 31.08 ? 36  LEU D CA    1 
ATOM   10310 C C     . LEU D 1 36  ? -10.337 -10.677 56.364  1.00 30.11 ? 36  LEU D C     1 
ATOM   10311 O O     . LEU D 1 36  ? -10.143 -11.669 55.636  1.00 31.56 ? 36  LEU D O     1 
ATOM   10312 C CB    . LEU D 1 36  ? -11.806 -12.229 57.739  1.00 30.09 ? 36  LEU D CB    1 
ATOM   10313 C CG    . LEU D 1 36  ? -12.981 -12.465 58.735  1.00 32.36 ? 36  LEU D CG    1 
ATOM   10314 C CD1   . LEU D 1 36  ? -13.530 -13.933 58.637  1.00 30.96 ? 36  LEU D CD1   1 
ATOM   10315 C CD2   . LEU D 1 36  ? -12.579 -12.168 60.170  1.00 20.90 ? 36  LEU D CD2   1 
ATOM   10316 N N     . ALA D 1 37  ? -9.969  -9.426  56.016  1.00 28.10 ? 37  ALA D N     1 
ATOM   10317 C CA    . ALA D 1 37  ? -9.509  -9.163  54.639  1.00 27.51 ? 37  ALA D CA    1 
ATOM   10318 C C     . ALA D 1 37  ? -8.029  -8.893  54.648  1.00 26.57 ? 37  ALA D C     1 
ATOM   10319 O O     . ALA D 1 37  ? -7.306  -9.146  53.675  1.00 26.46 ? 37  ALA D O     1 
ATOM   10320 C CB    . ALA D 1 37  ? -10.324 -8.059  53.950  1.00 27.10 ? 37  ALA D CB    1 
ATOM   10321 N N     . GLY D 1 38  ? -7.544  -8.471  55.792  1.00 25.94 ? 38  GLY D N     1 
ATOM   10322 C CA    . GLY D 1 38  ? -6.179  -7.998  55.839  1.00 27.27 ? 38  GLY D CA    1 
ATOM   10323 C C     . GLY D 1 38  ? -5.169  -9.115  55.771  1.00 29.31 ? 38  GLY D C     1 
ATOM   10324 O O     . GLY D 1 38  ? -5.473  -10.282 56.100  1.00 30.56 ? 38  GLY D O     1 
ATOM   10325 N N     . GLY D 1 39  ? -3.947  -8.776  55.379  1.00 29.08 ? 39  GLY D N     1 
ATOM   10326 C CA    . GLY D 1 39  ? -2.985  -9.833  55.230  1.00 29.23 ? 39  GLY D CA    1 
ATOM   10327 C C     . GLY D 1 39  ? -1.977  -9.910  56.322  1.00 28.67 ? 39  GLY D C     1 
ATOM   10328 O O     . GLY D 1 39  ? -0.896  -10.448 56.098  1.00 25.44 ? 39  GLY D O     1 
ATOM   10329 N N     . LEU D 1 40  ? -2.283  -9.326  57.499  1.00 28.64 ? 40  LEU D N     1 
ATOM   10330 C CA    . LEU D 1 40  ? -1.177  -9.374  58.455  1.00 30.05 ? 40  LEU D CA    1 
ATOM   10331 C C     . LEU D 1 40  ? -1.199  -10.673 59.243  1.00 29.48 ? 40  LEU D C     1 
ATOM   10332 O O     . LEU D 1 40  ? -2.288  -11.326 59.358  1.00 30.95 ? 40  LEU D O     1 
ATOM   10333 C CB    . LEU D 1 40  ? -1.076  -8.123  59.330  1.00 29.54 ? 40  LEU D CB    1 
ATOM   10334 C CG    . LEU D 1 40  ? -1.437  -6.726  58.814  1.00 31.06 ? 40  LEU D CG    1 
ATOM   10335 C CD1   . LEU D 1 40  ? -2.126  -5.997  59.957  1.00 26.78 ? 40  LEU D CD1   1 
ATOM   10336 C CD2   . LEU D 1 40  ? -0.216  -5.927  58.421  1.00 32.18 ? 40  LEU D CD2   1 
ATOM   10337 N N     . PRO D 1 41  ? -0.019  -11.073 59.783  1.00 27.61 ? 41  PRO D N     1 
ATOM   10338 C CA    . PRO D 1 41  ? 0.054   -12.245 60.659  1.00 27.04 ? 41  PRO D CA    1 
ATOM   10339 C C     . PRO D 1 41  ? -0.235  -11.782 62.075  1.00 26.89 ? 41  PRO D C     1 
ATOM   10340 O O     . PRO D 1 41  ? -0.080  -10.595 62.362  1.00 25.54 ? 41  PRO D O     1 
ATOM   10341 C CB    . PRO D 1 41  ? 1.514   -12.696 60.550  1.00 27.42 ? 41  PRO D CB    1 
ATOM   10342 C CG    . PRO D 1 41  ? 2.314   -11.478 60.100  1.00 24.21 ? 41  PRO D CG    1 
ATOM   10343 C CD    . PRO D 1 41  ? 1.289   -10.426 59.613  1.00 28.32 ? 41  PRO D CD    1 
ATOM   10344 N N     . ASN D 1 42  ? -0.646  -12.702 62.945  1.00 26.15 ? 42  ASN D N     1 
ATOM   10345 C CA    . ASN D 1 42  ? -0.813  -12.379 64.376  1.00 25.00 ? 42  ASN D CA    1 
ATOM   10346 C C     . ASN D 1 42  ? 0.546   -11.971 65.071  1.00 25.67 ? 42  ASN D C     1 
ATOM   10347 O O     . ASN D 1 42  ? 1.506   -12.800 65.288  1.00 26.80 ? 42  ASN D O     1 
ATOM   10348 C CB    . ASN D 1 42  ? -1.522  -13.533 65.017  1.00 22.39 ? 42  ASN D CB    1 
ATOM   10349 C CG    . ASN D 1 42  ? -2.213  -13.201 66.373  1.00 25.60 ? 42  ASN D CG    1 
ATOM   10350 O OD1   . ASN D 1 42  ? -3.410  -13.508 66.560  1.00 26.75 ? 42  ASN D OD1   1 
ATOM   10351 N ND2   . ASN D 1 42  ? -1.449  -12.690 67.339  1.00 21.94 ? 42  ASN D ND2   1 
ATOM   10352 N N     . PRO D 1 43  ? 0.679   -10.703 65.398  1.00 25.86 ? 43  PRO D N     1 
ATOM   10353 C CA    . PRO D 1 43  ? 1.920   -10.340 66.054  1.00 27.54 ? 43  PRO D CA    1 
ATOM   10354 C C     . PRO D 1 43  ? 2.078   -10.852 67.561  1.00 28.63 ? 43  PRO D C     1 
ATOM   10355 O O     . PRO D 1 43  ? 3.137   -10.605 68.170  1.00 27.75 ? 43  PRO D O     1 
ATOM   10356 C CB    . PRO D 1 43  ? 1.886   -8.820  65.978  1.00 26.88 ? 43  PRO D CB    1 
ATOM   10357 C CG    . PRO D 1 43  ? 0.422   -8.539  66.346  1.00 26.65 ? 43  PRO D CG    1 
ATOM   10358 C CD    . PRO D 1 43  ? -0.193  -9.531  65.289  1.00 27.06 ? 43  PRO D CD    1 
ATOM   10359 N N     . ASN D 1 44  ? 1.115   -11.637 68.074  1.00 28.24 ? 44  ASN D N     1 
ATOM   10360 C CA    . ASN D 1 44  ? 1.211   -12.188 69.435  1.00 29.80 ? 44  ASN D CA    1 
ATOM   10361 C C     . ASN D 1 44  ? 2.070   -13.358 69.429  1.00 30.99 ? 44  ASN D C     1 
ATOM   10362 O O     . ASN D 1 44  ? 2.477   -13.864 70.499  1.00 32.69 ? 44  ASN D O     1 
ATOM   10363 C CB    . ASN D 1 44  ? -0.156  -12.623 70.003  1.00 28.19 ? 44  ASN D CB    1 
ATOM   10364 C CG    . ASN D 1 44  ? -0.923  -11.450 70.577  1.00 31.74 ? 44  ASN D CG    1 
ATOM   10365 O OD1   . ASN D 1 44  ? -0.482  -10.776 71.529  1.00 32.35 ? 44  ASN D OD1   1 
ATOM   10366 N ND2   . ASN D 1 44  ? -2.062  -11.218 70.039  1.00 26.49 ? 44  ASN D ND2   1 
ATOM   10367 N N     . MET D 1 45  ? 2.314   -13.835 68.209  1.00 31.13 ? 45  MET D N     1 
ATOM   10368 C CA    . MET D 1 45  ? 3.173   -14.980 68.014  1.00 30.87 ? 45  MET D CA    1 
ATOM   10369 C C     . MET D 1 45  ? 4.617   -14.593 68.187  1.00 29.40 ? 45  MET D C     1 
ATOM   10370 O O     . MET D 1 45  ? 5.442   -15.445 68.344  1.00 32.27 ? 45  MET D O     1 
ATOM   10371 C CB    . MET D 1 45  ? 2.904   -15.630 66.619  1.00 31.44 ? 45  MET D CB    1 
ATOM   10372 C CG    . MET D 1 45  ? 1.549   -16.455 66.498  1.00 31.90 ? 45  MET D CG    1 
ATOM   10373 S SD    . MET D 1 45  ? 1.303   -17.658 67.854  1.00 39.86 ? 45  MET D SD    1 
ATOM   10374 C CE    . MET D 1 45  ? 0.306   -16.818 69.130  1.00 34.24 ? 45  MET D CE    1 
ATOM   10375 N N     . PHE D 1 46  ? 4.967   -13.314 68.163  1.00 28.33 ? 46  PHE D N     1 
ATOM   10376 C CA    . PHE D 1 46  ? 6.360   -12.970 68.019  1.00 27.25 ? 46  PHE D CA    1 
ATOM   10377 C C     . PHE D 1 46  ? 7.029   -13.047 69.407  1.00 29.09 ? 46  PHE D C     1 
ATOM   10378 O O     . PHE D 1 46  ? 6.374   -12.701 70.394  1.00 29.35 ? 46  PHE D O     1 
ATOM   10379 C CB    . PHE D 1 46  ? 6.483   -11.636 67.325  1.00 27.24 ? 46  PHE D CB    1 
ATOM   10380 C CG    . PHE D 1 46  ? 5.931   -11.630 65.887  1.00 27.10 ? 46  PHE D CG    1 
ATOM   10381 C CD1   . PHE D 1 46  ? 5.297   -10.489 65.371  1.00 15.06 ? 46  PHE D CD1   1 
ATOM   10382 C CD2   . PHE D 1 46  ? 5.940   -12.782 65.111  1.00 25.20 ? 46  PHE D CD2   1 
ATOM   10383 C CE1   . PHE D 1 46  ? 4.868   -10.427 64.083  1.00 24.19 ? 46  PHE D CE1   1 
ATOM   10384 C CE2   . PHE D 1 46  ? 5.431   -12.743 63.797  1.00 29.14 ? 46  PHE D CE2   1 
ATOM   10385 C CZ    . PHE D 1 46  ? 4.904   -11.523 63.288  1.00 26.97 ? 46  PHE D CZ    1 
ATOM   10386 N N     . PRO D 1 47  ? 8.294   -13.557 69.499  1.00 28.54 ? 47  PRO D N     1 
ATOM   10387 C CA    . PRO D 1 47  ? 8.916   -13.767 70.819  1.00 28.15 ? 47  PRO D CA    1 
ATOM   10388 C C     . PRO D 1 47  ? 9.388   -12.545 71.590  1.00 28.91 ? 47  PRO D C     1 
ATOM   10389 O O     . PRO D 1 47  ? 9.489   -12.628 72.775  1.00 31.12 ? 47  PRO D O     1 
ATOM   10390 C CB    . PRO D 1 47  ? 10.112  -14.657 70.515  1.00 27.97 ? 47  PRO D CB    1 
ATOM   10391 C CG    . PRO D 1 47  ? 10.441  -14.410 69.095  1.00 25.48 ? 47  PRO D CG    1 
ATOM   10392 C CD    . PRO D 1 47  ? 9.183   -13.989 68.396  1.00 29.23 ? 47  PRO D CD    1 
ATOM   10393 N N     . PHE D 1 48  ? 9.704   -11.434 70.946  1.00 27.15 ? 48  PHE D N     1 
ATOM   10394 C CA    . PHE D 1 48  ? 10.185  -10.290 71.685  1.00 24.98 ? 48  PHE D CA    1 
ATOM   10395 C C     . PHE D 1 48  ? 8.993   -9.545  72.168  1.00 24.99 ? 48  PHE D C     1 
ATOM   10396 O O     . PHE D 1 48  ? 8.003   -9.358  71.437  1.00 19.85 ? 48  PHE D O     1 
ATOM   10397 C CB    . PHE D 1 48  ? 11.101  -9.373  70.883  1.00 26.01 ? 48  PHE D CB    1 
ATOM   10398 C CG    . PHE D 1 48  ? 12.033  -10.081 69.916  1.00 28.13 ? 48  PHE D CG    1 
ATOM   10399 C CD1   . PHE D 1 48  ? 11.664  -10.280 68.603  1.00 29.73 ? 48  PHE D CD1   1 
ATOM   10400 C CD2   . PHE D 1 48  ? 13.312  -10.525 70.339  1.00 28.68 ? 48  PHE D CD2   1 
ATOM   10401 C CE1   . PHE D 1 48  ? 12.565  -10.893 67.683  1.00 29.08 ? 48  PHE D CE1   1 
ATOM   10402 C CE2   . PHE D 1 48  ? 14.175  -11.097 69.445  1.00 23.74 ? 48  PHE D CE2   1 
ATOM   10403 C CZ    . PHE D 1 48  ? 13.801  -11.302 68.107  1.00 20.69 ? 48  PHE D CZ    1 
ATOM   10404 N N     . LYS D 1 49  ? 9.107   -9.101  73.439  1.00 25.88 ? 49  LYS D N     1 
ATOM   10405 C CA    . LYS D 1 49  ? 7.922   -8.744  74.229  1.00 28.23 ? 49  LYS D CA    1 
ATOM   10406 C C     . LYS D 1 49  ? 7.913   -7.263  74.669  1.00 28.50 ? 49  LYS D C     1 
ATOM   10407 O O     . LYS D 1 49  ? 6.879   -6.641  74.585  1.00 31.04 ? 49  LYS D O     1 
ATOM   10408 C CB    . LYS D 1 49  ? 7.706   -9.736  75.417  1.00 26.30 ? 49  LYS D CB    1 
ATOM   10409 C CG    . LYS D 1 49  ? 7.059   -11.130 75.041  1.00 29.98 ? 49  LYS D CG    1 
ATOM   10410 C CD    . LYS D 1 49  ? 5.870   -11.107 74.004  1.00 28.02 ? 49  LYS D CD    1 
ATOM   10411 C CE    . LYS D 1 49  ? 5.713   -12.472 73.254  1.00 24.57 ? 49  LYS D CE    1 
ATOM   10412 N NZ    . LYS D 1 49  ? 4.462   -12.577 72.375  1.00 27.44 ? 49  LYS D NZ    1 
ATOM   10413 N N     . THR D 1 50  ? 9.061   -6.713  75.095  1.00 29.15 ? 50  THR D N     1 
ATOM   10414 C CA    . THR D 1 50  ? 9.213   -5.340  75.543  1.00 27.72 ? 50  THR D CA    1 
ATOM   10415 C C     . THR D 1 50  ? 10.593  -4.864  75.161  1.00 28.43 ? 50  THR D C     1 
ATOM   10416 O O     . THR D 1 50  ? 11.456  -5.641  74.922  1.00 27.45 ? 50  THR D O     1 
ATOM   10417 C CB    . THR D 1 50  ? 9.114   -5.150  77.152  1.00 29.74 ? 50  THR D CB    1 
ATOM   10418 O OG1   . THR D 1 50  ? 10.225  -5.773  77.792  1.00 27.64 ? 50  THR D OG1   1 
ATOM   10419 C CG2   . THR D 1 50  ? 7.820   -5.697  77.754  1.00 28.85 ? 50  THR D CG2   1 
ATOM   10420 N N     . ALA D 1 51  ? 10.815  -3.560  75.146  1.00 30.01 ? 51  ALA D N     1 
ATOM   10421 C CA    . ALA D 1 51  ? 12.154  -3.047  74.927  1.00 31.32 ? 51  ALA D CA    1 
ATOM   10422 C C     . ALA D 1 51  ? 12.526  -1.862  75.789  1.00 33.25 ? 51  ALA D C     1 
ATOM   10423 O O     . ALA D 1 51  ? 11.737  -0.954  75.985  1.00 31.09 ? 51  ALA D O     1 
ATOM   10424 C CB    . ALA D 1 51  ? 12.380  -2.739  73.473  1.00 30.72 ? 51  ALA D CB    1 
ATOM   10425 N N     . VAL D 1 52  ? 13.749  -1.893  76.302  1.00 33.55 ? 52  VAL D N     1 
ATOM   10426 C CA    . VAL D 1 52  ? 14.340  -0.743  76.967  1.00 36.27 ? 52  VAL D CA    1 
ATOM   10427 C C     . VAL D 1 52  ? 15.618  -0.253  76.320  1.00 34.96 ? 52  VAL D C     1 
ATOM   10428 O O     . VAL D 1 52  ? 16.661  -0.852  76.471  1.00 36.49 ? 52  VAL D O     1 
ATOM   10429 C CB    . VAL D 1 52  ? 14.630  -1.016  78.443  1.00 36.60 ? 52  VAL D CB    1 
ATOM   10430 C CG1   . VAL D 1 52  ? 14.948  0.276   79.143  1.00 32.16 ? 52  VAL D CG1   1 
ATOM   10431 C CG2   . VAL D 1 52  ? 13.464  -1.697  79.103  1.00 37.51 ? 52  VAL D CG2   1 
ATOM   10432 N N     . ILE D 1 53  ? 15.536  0.850   75.608  1.00 35.09 ? 53  ILE D N     1 
ATOM   10433 C CA    . ILE D 1 53  ? 16.729  1.461   75.055  1.00 35.98 ? 53  ILE D CA    1 
ATOM   10434 C C     . ILE D 1 53  ? 17.111  2.782   75.703  1.00 34.12 ? 53  ILE D C     1 
ATOM   10435 O O     . ILE D 1 53  ? 16.331  3.710   75.712  1.00 34.46 ? 53  ILE D O     1 
ATOM   10436 C CB    . ILE D 1 53  ? 16.602  1.584   73.556  1.00 35.33 ? 53  ILE D CB    1 
ATOM   10437 C CG1   . ILE D 1 53  ? 16.404  0.203   72.965  1.00 34.06 ? 53  ILE D CG1   1 
ATOM   10438 C CG2   . ILE D 1 53  ? 17.804  2.240   72.979  1.00 40.60 ? 53  ILE D CG2   1 
ATOM   10439 C CD1   . ILE D 1 53  ? 15.415  0.155   71.892  1.00 31.95 ? 53  ILE D CD1   1 
ATOM   10440 N N     . THR D 1 54  ? 18.313  2.832   76.266  1.00 32.53 ? 54  THR D N     1 
ATOM   10441 C CA    . THR D 1 54  ? 18.837  4.063   76.829  1.00 33.20 ? 54  THR D CA    1 
ATOM   10442 C C     . THR D 1 54  ? 19.372  4.978   75.764  1.00 34.68 ? 54  THR D C     1 
ATOM   10443 O O     . THR D 1 54  ? 19.741  4.551   74.691  1.00 34.94 ? 54  THR D O     1 
ATOM   10444 C CB    . THR D 1 54  ? 19.880  3.832   77.935  1.00 32.25 ? 54  THR D CB    1 
ATOM   10445 O OG1   . THR D 1 54  ? 20.820  2.837   77.546  1.00 32.23 ? 54  THR D OG1   1 
ATOM   10446 C CG2   . THR D 1 54  ? 19.253  3.256   79.158  1.00 28.42 ? 54  THR D CG2   1 
ATOM   10447 N N     . VAL D 1 55  ? 19.382  6.255   76.074  1.00 34.78 ? 55  VAL D N     1 
ATOM   10448 C CA    . VAL D 1 55  ? 19.722  7.275   75.105  1.00 37.67 ? 55  VAL D CA    1 
ATOM   10449 C C     . VAL D 1 55  ? 20.649  8.194   75.848  1.00 38.40 ? 55  VAL D C     1 
ATOM   10450 O O     . VAL D 1 55  ? 20.357  8.536   76.953  1.00 37.90 ? 55  VAL D O     1 
ATOM   10451 C CB    . VAL D 1 55  ? 18.468  8.111   74.710  1.00 36.59 ? 55  VAL D CB    1 
ATOM   10452 C CG1   . VAL D 1 55  ? 18.864  9.325   73.889  1.00 40.24 ? 55  VAL D CG1   1 
ATOM   10453 C CG2   . VAL D 1 55  ? 17.449  7.293   73.994  1.00 33.59 ? 55  VAL D CG2   1 
ATOM   10454 N N     . GLU D 1 56  ? 21.772  8.580   75.282  1.00 42.09 ? 56  GLU D N     1 
ATOM   10455 C CA    . GLU D 1 56  ? 22.629  9.540   76.016  1.00 46.39 ? 56  GLU D CA    1 
ATOM   10456 C C     . GLU D 1 56  ? 22.148  10.981  75.844  1.00 47.30 ? 56  GLU D C     1 
ATOM   10457 O O     . GLU D 1 56  ? 21.990  11.452  74.711  1.00 48.06 ? 56  GLU D O     1 
ATOM   10458 C CB    . GLU D 1 56  ? 24.115  9.391   75.641  1.00 46.27 ? 56  GLU D CB    1 
ATOM   10459 C CG    . GLU D 1 56  ? 24.959  10.677  75.843  1.00 47.97 ? 56  GLU D CG    1 
ATOM   10460 C CD    . GLU D 1 56  ? 26.439  10.447  75.990  1.00 49.37 ? 56  GLU D CD    1 
ATOM   10461 O OE1   . GLU D 1 56  ? 26.891  9.407   76.555  1.00 53.93 ? 56  GLU D OE1   1 
ATOM   10462 O OE2   . GLU D 1 56  ? 27.171  11.349  75.546  1.00 57.02 ? 56  GLU D OE2   1 
ATOM   10463 N N     . ASN D 1 57  ? 21.950  11.658  76.972  1.00 48.33 ? 57  ASN D N     1 
ATOM   10464 C CA    . ASN D 1 57  ? 21.461  13.052  77.034  1.00 50.61 ? 57  ASN D CA    1 
ATOM   10465 C C     . ASN D 1 57  ? 20.008  13.134  76.596  1.00 50.92 ? 57  ASN D C     1 
ATOM   10466 O O     . ASN D 1 57  ? 19.621  14.106  75.867  1.00 51.62 ? 57  ASN D O     1 
ATOM   10467 C CB    . ASN D 1 57  ? 22.289  14.061  76.184  1.00 51.65 ? 57  ASN D CB    1 
ATOM   10468 C CG    . ASN D 1 57  ? 23.686  14.327  76.735  1.00 52.79 ? 57  ASN D CG    1 
ATOM   10469 O OD1   . ASN D 1 57  ? 24.573  14.736  75.982  1.00 55.56 ? 57  ASN D OD1   1 
ATOM   10470 N ND2   . ASN D 1 57  ? 23.891  14.097  78.038  1.00 55.33 ? 57  ASN D ND2   1 
ATOM   10471 N N     . GLY D 1 58  ? 19.236  12.130  77.063  1.00 48.93 ? 58  GLY D N     1 
ATOM   10472 C CA    . GLY D 1 58  ? 17.958  11.754  76.465  1.00 46.39 ? 58  GLY D CA    1 
ATOM   10473 C C     . GLY D 1 58  ? 17.159  10.858  77.395  1.00 44.39 ? 58  GLY D C     1 
ATOM   10474 O O     . GLY D 1 58  ? 17.737  10.235  78.294  1.00 43.35 ? 58  GLY D O     1 
ATOM   10475 N N     . LYS D 1 59  ? 15.832  10.876  77.224  1.00 42.90 ? 59  LYS D N     1 
ATOM   10476 C CA    . LYS D 1 59  ? 14.875  10.079  78.037  1.00 41.73 ? 59  LYS D CA    1 
ATOM   10477 C C     . LYS D 1 59  ? 15.011  8.656   77.496  1.00 40.52 ? 59  LYS D C     1 
ATOM   10478 O O     . LYS D 1 59  ? 15.188  8.454   76.282  1.00 39.78 ? 59  LYS D O     1 
ATOM   10479 C CB    . LYS D 1 59  ? 13.432  10.583  77.886  1.00 41.29 ? 59  LYS D CB    1 
ATOM   10480 C CG    . LYS D 1 59  ? 12.518  10.405  79.144  1.00 46.97 ? 59  LYS D CG    1 
ATOM   10481 C CD    . LYS D 1 59  ? 11.105  9.817   78.850  1.00 53.94 ? 59  LYS D CD    1 
ATOM   10482 C CE    . LYS D 1 59  ? 9.955   10.856  78.654  1.00 60.54 ? 59  LYS D CE    1 
ATOM   10483 N NZ    . LYS D 1 59  ? 10.067  12.160  79.469  1.00 62.32 ? 59  LYS D NZ    1 
ATOM   10484 N N     . THR D 1 60  ? 14.967  7.674   78.383  1.00 38.47 ? 60  THR D N     1 
ATOM   10485 C CA    . THR D 1 60  ? 15.088  6.326   77.901  1.00 36.67 ? 60  THR D CA    1 
ATOM   10486 C C     . THR D 1 60  ? 13.810  5.872   77.147  1.00 35.25 ? 60  THR D C     1 
ATOM   10487 O O     . THR D 1 60  ? 12.663  6.097   77.549  1.00 34.65 ? 60  THR D O     1 
ATOM   10488 C CB    . THR D 1 60  ? 15.626  5.259   78.982  1.00 37.07 ? 60  THR D CB    1 
ATOM   10489 O OG1   . THR D 1 60  ? 14.607  4.326   79.339  1.00 39.14 ? 60  THR D OG1   1 
ATOM   10490 C CG2   . THR D 1 60  ? 16.286  5.847   80.150  1.00 29.36 ? 60  THR D CG2   1 
ATOM   10491 N N     . ILE D 1 61  ? 14.029  5.232   76.032  1.00 34.30 ? 61  ILE D N     1 
ATOM   10492 C CA    . ILE D 1 61  ? 12.896  4.795   75.238  1.00 32.81 ? 61  ILE D CA    1 
ATOM   10493 C C     . ILE D 1 61  ? 12.337  3.461   75.663  1.00 34.44 ? 61  ILE D C     1 
ATOM   10494 O O     . ILE D 1 61  ? 13.056  2.513   75.964  1.00 33.12 ? 61  ILE D O     1 
ATOM   10495 C CB    . ILE D 1 61  ? 13.317  4.843   73.753  1.00 33.86 ? 61  ILE D CB    1 
ATOM   10496 C CG1   . ILE D 1 61  ? 13.681  6.338   73.490  1.00 29.15 ? 61  ILE D CG1   1 
ATOM   10497 C CG2   . ILE D 1 61  ? 12.207  4.145   72.813  1.00 23.08 ? 61  ILE D CG2   1 
ATOM   10498 C CD1   . ILE D 1 61  ? 14.185  6.684   72.145  1.00 27.43 ? 61  ILE D CD1   1 
ATOM   10499 N N     . GLN D 1 62  ? 11.019  3.376   75.735  1.00 35.80 ? 62  GLN D N     1 
ATOM   10500 C CA    . GLN D 1 62  ? 10.357  2.157   76.176  1.00 36.36 ? 62  GLN D CA    1 
ATOM   10501 C C     . GLN D 1 62  ? 9.263   1.741   75.209  1.00 35.96 ? 62  GLN D C     1 
ATOM   10502 O O     . GLN D 1 62  ? 8.350   2.500   74.927  1.00 33.62 ? 62  GLN D O     1 
ATOM   10503 C CB    . GLN D 1 62  ? 9.856   2.284   77.618  1.00 36.61 ? 62  GLN D CB    1 
ATOM   10504 C CG    . GLN D 1 62  ? 10.974  2.187   78.643  1.00 38.46 ? 62  GLN D CG    1 
ATOM   10505 C CD    . GLN D 1 62  ? 10.506  2.041   80.100  1.00 41.61 ? 62  GLN D CD    1 
ATOM   10506 O OE1   . GLN D 1 62  ? 10.151  0.958   80.540  1.00 49.12 ? 62  GLN D OE1   1 
ATOM   10507 N NE2   . GLN D 1 62  ? 10.535  3.125   80.838  1.00 42.82 ? 62  GLN D NE2   1 
ATOM   10508 N N     . PHE D 1 63  ? 9.400   0.540   74.670  1.00 35.22 ? 63  PHE D N     1 
ATOM   10509 C CA    . PHE D 1 63  ? 8.285   -0.170  74.065  1.00 32.85 ? 63  PHE D CA    1 
ATOM   10510 C C     . PHE D 1 63  ? 7.652   -1.114  75.073  1.00 32.37 ? 63  PHE D C     1 
ATOM   10511 O O     . PHE D 1 63  ? 8.162   -2.189  75.328  1.00 31.99 ? 63  PHE D O     1 
ATOM   10512 C CB    . PHE D 1 63  ? 8.720   -0.966  72.828  1.00 32.30 ? 63  PHE D CB    1 
ATOM   10513 C CG    . PHE D 1 63  ? 9.344   -0.139  71.753  1.00 32.23 ? 63  PHE D CG    1 
ATOM   10514 C CD1   . PHE D 1 63  ? 9.476   1.217   71.891  1.00 34.26 ? 63  PHE D CD1   1 
ATOM   10515 C CD2   . PHE D 1 63  ? 9.806   -0.722  70.607  1.00 36.89 ? 63  PHE D CD2   1 
ATOM   10516 C CE1   . PHE D 1 63  ? 10.048  1.970   70.902  1.00 33.04 ? 63  PHE D CE1   1 
ATOM   10517 C CE2   . PHE D 1 63  ? 10.381  0.037   69.621  1.00 39.19 ? 63  PHE D CE2   1 
ATOM   10518 C CZ    . PHE D 1 63  ? 10.505  1.387   69.783  1.00 32.70 ? 63  PHE D CZ    1 
ATOM   10519 N N     . GLY D 1 64  ? 6.538   -0.699  75.642  1.00 31.04 ? 64  GLY D N     1 
ATOM   10520 C CA    . GLY D 1 64  ? 5.604   -1.629  76.248  1.00 35.52 ? 64  GLY D CA    1 
ATOM   10521 C C     . GLY D 1 64  ? 5.045   -2.693  75.326  1.00 34.15 ? 64  GLY D C     1 
ATOM   10522 O O     . GLY D 1 64  ? 5.449   -2.835  74.181  1.00 31.87 ? 64  GLY D O     1 
ATOM   10523 N N     . GLU D 1 65  ? 4.090   -3.431  75.874  1.00 32.63 ? 65  GLU D N     1 
ATOM   10524 C CA    . GLU D 1 65  ? 3.484   -4.587  75.246  1.00 33.34 ? 65  GLU D CA    1 
ATOM   10525 C C     . GLU D 1 65  ? 2.840   -4.294  73.898  1.00 33.18 ? 65  GLU D C     1 
ATOM   10526 O O     . GLU D 1 65  ? 3.198   -4.904  72.910  1.00 33.47 ? 65  GLU D O     1 
ATOM   10527 C CB    . GLU D 1 65  ? 2.482   -5.251  76.192  1.00 33.67 ? 65  GLU D CB    1 
ATOM   10528 C CG    . GLU D 1 65  ? 1.715   -6.422  75.579  1.00 40.76 ? 65  GLU D CG    1 
ATOM   10529 C CD    . GLU D 1 65  ? 0.637   -7.017  76.483  1.00 44.26 ? 65  GLU D CD    1 
ATOM   10530 O OE1   . GLU D 1 65  ? 0.206   -8.159  76.225  1.00 47.00 ? 65  GLU D OE1   1 
ATOM   10531 O OE2   . GLU D 1 65  ? 0.207   -6.356  77.448  1.00 44.53 ? 65  GLU D OE2   1 
ATOM   10532 N N     . GLU D 1 66  ? 1.888   -3.367  73.875  1.00 31.90 ? 66  GLU D N     1 
ATOM   10533 C CA    . GLU D 1 66  ? 1.279   -2.868  72.650  1.00 32.01 ? 66  GLU D CA    1 
ATOM   10534 C C     . GLU D 1 66  ? 2.188   -2.299  71.566  1.00 31.76 ? 66  GLU D C     1 
ATOM   10535 O O     . GLU D 1 66  ? 2.126   -2.732  70.369  1.00 28.71 ? 66  GLU D O     1 
ATOM   10536 C CB    . GLU D 1 66  ? 0.124   -1.897  72.981  1.00 31.97 ? 66  GLU D CB    1 
ATOM   10537 C CG    . GLU D 1 66  ? -1.170  -2.633  73.456  1.00 36.31 ? 66  GLU D CG    1 
ATOM   10538 C CD    . GLU D 1 66  ? -1.589  -3.772  72.516  1.00 44.60 ? 66  GLU D CD    1 
ATOM   10539 O OE1   . GLU D 1 66  ? -2.033  -3.514  71.366  1.00 51.18 ? 66  GLU D OE1   1 
ATOM   10540 O OE2   . GLU D 1 66  ? -1.406  -4.936  72.875  1.00 49.24 ? 66  GLU D OE2   1 
ATOM   10541 N N     . MET D 1 67  ? 3.017   -1.331  71.996  1.00 31.36 ? 67  MET D N     1 
ATOM   10542 C CA    . MET D 1 67  ? 4.127   -0.762  71.248  1.00 31.07 ? 67  MET D CA    1 
ATOM   10543 C C     . MET D 1 67  ? 5.111   -1.849  70.585  1.00 31.56 ? 67  MET D C     1 
ATOM   10544 O O     . MET D 1 67  ? 5.416   -1.823  69.323  1.00 31.30 ? 67  MET D O     1 
ATOM   10545 C CB    . MET D 1 67  ? 4.816   0.244   72.201  1.00 32.65 ? 67  MET D CB    1 
ATOM   10546 C CG    . MET D 1 67  ? 5.688   1.430   71.595  1.00 36.45 ? 67  MET D CG    1 
ATOM   10547 S SD    . MET D 1 67  ? 5.130   2.068   69.983  1.00 44.90 ? 67  MET D SD    1 
ATOM   10548 C CE    . MET D 1 67  ? 3.957   3.403   70.351  1.00 40.98 ? 67  MET D CE    1 
ATOM   10549 N N     . MET D 1 68  ? 5.579   -2.799  71.393  1.00 29.56 ? 68  MET D N     1 
ATOM   10550 C CA    . MET D 1 68  ? 6.383   -3.954  70.868  1.00 30.17 ? 68  MET D CA    1 
ATOM   10551 C C     . MET D 1 68  ? 5.646   -4.738  69.777  1.00 28.39 ? 68  MET D C     1 
ATOM   10552 O O     . MET D 1 68  ? 6.208   -4.960  68.684  1.00 29.21 ? 68  MET D O     1 
ATOM   10553 C CB    . MET D 1 68  ? 6.874   -4.870  72.018  1.00 30.68 ? 68  MET D CB    1 
ATOM   10554 C CG    . MET D 1 68  ? 8.049   -5.768  71.743  1.00 34.08 ? 68  MET D CG    1 
ATOM   10555 S SD    . MET D 1 68  ? 9.451   -4.979  71.004  1.00 37.35 ? 68  MET D SD    1 
ATOM   10556 C CE    . MET D 1 68  ? 10.907  -5.825  71.644  1.00 34.90 ? 68  MET D CE    1 
ATOM   10557 N N     . LYS D 1 69  ? 4.376   -5.072  69.974  1.00 27.36 ? 69  LYS D N     1 
ATOM   10558 C CA    . LYS D 1 69  ? 3.614   -5.595  68.830  1.00 28.22 ? 69  LYS D CA    1 
ATOM   10559 C C     . LYS D 1 69  ? 3.594   -4.727  67.557  1.00 29.88 ? 69  LYS D C     1 
ATOM   10560 O O     . LYS D 1 69  ? 3.790   -5.252  66.426  1.00 33.23 ? 69  LYS D O     1 
ATOM   10561 C CB    . LYS D 1 69  ? 2.190   -5.982  69.219  1.00 26.49 ? 69  LYS D CB    1 
ATOM   10562 C CG    . LYS D 1 69  ? 2.115   -7.282  70.106  1.00 31.93 ? 69  LYS D CG    1 
ATOM   10563 C CD    . LYS D 1 69  ? 0.744   -7.706  70.482  1.00 30.76 ? 69  LYS D CD    1 
ATOM   10564 C CE    . LYS D 1 69  ? 0.552   -7.384  71.966  1.00 39.23 ? 69  LYS D CE    1 
ATOM   10565 N NZ    . LYS D 1 69  ? -0.834  -7.665  72.509  1.00 35.37 ? 69  LYS D NZ    1 
ATOM   10566 N N     . ARG D 1 70  ? 3.297   -3.435  67.694  1.00 29.51 ? 70  ARG D N     1 
ATOM   10567 C CA    . ARG D 1 70  ? 3.291   -2.536  66.565  1.00 30.17 ? 70  ARG D CA    1 
ATOM   10568 C C     . ARG D 1 70  ? 4.719   -2.563  65.941  1.00 29.15 ? 70  ARG D C     1 
ATOM   10569 O O     . ARG D 1 70  ? 4.910   -2.734  64.748  1.00 29.74 ? 70  ARG D O     1 
ATOM   10570 C CB    . ARG D 1 70  ? 2.798   -1.096  67.003  1.00 29.80 ? 70  ARG D CB    1 
ATOM   10571 C CG    . ARG D 1 70  ? 3.097   -0.042  65.995  1.00 31.85 ? 70  ARG D CG    1 
ATOM   10572 C CD    . ARG D 1 70  ? 2.566   1.260   66.349  1.00 32.12 ? 70  ARG D CD    1 
ATOM   10573 N NE    . ARG D 1 70  ? 2.802   2.039   65.165  1.00 31.64 ? 70  ARG D NE    1 
ATOM   10574 C CZ    . ARG D 1 70  ? 2.885   3.375   65.093  1.00 29.22 ? 70  ARG D CZ    1 
ATOM   10575 N NH1   . ARG D 1 70  ? 2.668   4.076   66.190  1.00 27.28 ? 70  ARG D NH1   1 
ATOM   10576 N NH2   . ARG D 1 70  ? 3.107   4.001   63.889  1.00 19.71 ? 70  ARG D NH2   1 
ATOM   10577 N N     . ALA D 1 71  ? 5.731   -2.502  66.775  1.00 27.83 ? 71  ALA D N     1 
ATOM   10578 C CA    . ALA D 1 71  ? 7.122   -2.483  66.262  1.00 26.53 ? 71  ALA D CA    1 
ATOM   10579 C C     . ALA D 1 71  ? 7.639   -3.726  65.519  1.00 26.40 ? 71  ALA D C     1 
ATOM   10580 O O     . ALA D 1 71  ? 8.605   -3.658  64.692  1.00 24.79 ? 71  ALA D O     1 
ATOM   10581 C CB    . ALA D 1 71  ? 8.050   -2.178  67.397  1.00 26.06 ? 71  ALA D CB    1 
ATOM   10582 N N     . LEU D 1 72  ? 7.083   -4.858  65.927  1.00 24.81 ? 72  LEU D N     1 
ATOM   10583 C CA    . LEU D 1 72  ? 7.326   -6.135  65.301  1.00 26.17 ? 72  LEU D CA    1 
ATOM   10584 C C     . LEU D 1 72  ? 6.462   -6.442  64.089  1.00 25.50 ? 72  LEU D C     1 
ATOM   10585 O O     . LEU D 1 72  ? 6.616   -7.550  63.515  1.00 27.93 ? 72  LEU D O     1 
ATOM   10586 C CB    . LEU D 1 72  ? 7.171   -7.336  66.377  1.00 23.54 ? 72  LEU D CB    1 
ATOM   10587 C CG    . LEU D 1 72  ? 8.174   -7.357  67.532  1.00 21.70 ? 72  LEU D CG    1 
ATOM   10588 C CD1   . LEU D 1 72  ? 8.182   -8.673  68.544  1.00 20.56 ? 72  LEU D CD1   1 
ATOM   10589 C CD2   . LEU D 1 72  ? 9.574   -7.114  66.920  1.00 17.43 ? 72  LEU D CD2   1 
ATOM   10590 N N     . GLN D 1 73  ? 5.460   -5.600  63.806  1.00 24.60 ? 73  GLN D N     1 
ATOM   10591 C CA    . GLN D 1 73  ? 4.468   -5.858  62.722  1.00 24.57 ? 73  GLN D CA    1 
ATOM   10592 C C     . GLN D 1 73  ? 4.730   -4.939  61.490  1.00 26.43 ? 73  GLN D C     1 
ATOM   10593 O O     . GLN D 1 73  ? 5.449   -3.922  61.614  1.00 24.56 ? 73  GLN D O     1 
ATOM   10594 C CB    . GLN D 1 73  ? 3.039   -5.742  63.313  1.00 26.89 ? 73  GLN D CB    1 
ATOM   10595 C CG    . GLN D 1 73  ? 1.816   -5.882  62.397  1.00 22.25 ? 73  GLN D CG    1 
ATOM   10596 C CD    . GLN D 1 73  ? 1.739   -7.287  61.825  1.00 26.03 ? 73  GLN D CD    1 
ATOM   10597 O OE1   . GLN D 1 73  ? 2.569   -7.745  60.923  1.00 24.13 ? 73  GLN D OE1   1 
ATOM   10598 N NE2   . GLN D 1 73  ? 0.803   -8.039  62.385  1.00 19.90 ? 73  GLN D NE2   1 
ATOM   10599 N N     . TYR D 1 74  ? 4.254   -5.356  60.297  1.00 24.17 ? 74  TYR D N     1 
ATOM   10600 C CA    . TYR D 1 74  ? 4.354   -4.531  59.140  1.00 25.39 ? 74  TYR D CA    1 
ATOM   10601 C C     . TYR D 1 74  ? 3.773   -3.156  59.360  1.00 26.68 ? 74  TYR D C     1 
ATOM   10602 O O     . TYR D 1 74  ? 3.094   -2.935  60.367  1.00 28.10 ? 74  TYR D O     1 
ATOM   10603 C CB    . TYR D 1 74  ? 3.475   -5.089  58.042  1.00 24.54 ? 74  TYR D CB    1 
ATOM   10604 C CG    . TYR D 1 74  ? 3.935   -6.390  57.463  1.00 25.73 ? 74  TYR D CG    1 
ATOM   10605 C CD1   . TYR D 1 74  ? 5.175   -6.479  56.826  1.00 20.20 ? 74  TYR D CD1   1 
ATOM   10606 C CD2   . TYR D 1 74  ? 3.101   -7.522  57.461  1.00 21.11 ? 74  TYR D CD2   1 
ATOM   10607 C CE1   . TYR D 1 74  ? 5.572   -7.628  56.207  1.00 20.06 ? 74  TYR D CE1   1 
ATOM   10608 C CE2   . TYR D 1 74  ? 3.515   -8.689  56.804  1.00 27.34 ? 74  TYR D CE2   1 
ATOM   10609 C CZ    . TYR D 1 74  ? 4.759   -8.723  56.169  1.00 21.24 ? 74  TYR D CZ    1 
ATOM   10610 O OH    . TYR D 1 74  ? 5.234   -9.926  55.563  1.00 29.53 ? 74  TYR D OH    1 
ATOM   10611 N N     . SER D 1 75  ? 3.897   -2.291  58.331  1.00 26.24 ? 75  SER D N     1 
ATOM   10612 C CA    . SER D 1 75  ? 3.583   -0.878  58.475  1.00 24.26 ? 75  SER D CA    1 
ATOM   10613 C C     . SER D 1 75  ? 3.741   -0.128  57.127  1.00 24.80 ? 75  SER D C     1 
ATOM   10614 O O     . SER D 1 75  ? 4.339   -0.661  56.237  1.00 26.72 ? 75  SER D O     1 
ATOM   10615 C CB    . SER D 1 75  ? 4.435   -0.264  59.558  1.00 19.34 ? 75  SER D CB    1 
ATOM   10616 O OG    . SER D 1 75  ? 5.772   -0.235  59.162  1.00 17.93 ? 75  SER D OG    1 
ATOM   10617 N N     . PRO D 1 76  ? 3.254   1.134   57.016  1.00 24.61 ? 76  PRO D N     1 
ATOM   10618 C CA    . PRO D 1 76  ? 3.120   1.703   55.671  1.00 23.11 ? 76  PRO D CA    1 
ATOM   10619 C C     . PRO D 1 76  ? 4.416   1.646   54.894  1.00 22.55 ? 76  PRO D C     1 
ATOM   10620 O O     . PRO D 1 76  ? 5.469   1.798   55.462  1.00 23.38 ? 76  PRO D O     1 
ATOM   10621 C CB    . PRO D 1 76  ? 2.603   3.171   55.924  1.00 23.51 ? 76  PRO D CB    1 
ATOM   10622 C CG    . PRO D 1 76  ? 1.962   3.129   57.328  1.00 23.55 ? 76  PRO D CG    1 
ATOM   10623 C CD    . PRO D 1 76  ? 2.785   2.063   58.100  1.00 24.26 ? 76  PRO D CD    1 
ATOM   10624 N N     . SER D 1 77  ? 4.365   1.454   53.561  1.00 23.34 ? 77  SER D N     1 
ATOM   10625 C CA    . SER D 1 77  ? 5.628   1.567   52.703  1.00 22.86 ? 77  SER D CA    1 
ATOM   10626 C C     . SER D 1 77  ? 6.540   2.845   52.798  1.00 23.22 ? 77  SER D C     1 
ATOM   10627 O O     . SER D 1 77  ? 7.789   2.800   52.794  1.00 24.33 ? 77  SER D O     1 
ATOM   10628 C CB    . SER D 1 77  ? 5.236   1.324   51.243  1.00 23.54 ? 77  SER D CB    1 
ATOM   10629 O OG    . SER D 1 77  ? 3.909   0.813   51.177  1.00 28.80 ? 77  SER D OG    1 
ATOM   10630 N N     . ALA D 1 78  ? 5.903   3.997   52.855  1.00 22.28 ? 78  ALA D N     1 
ATOM   10631 C CA    . ALA D 1 78  ? 6.581   5.240   52.902  1.00 22.37 ? 78  ALA D CA    1 
ATOM   10632 C C     . ALA D 1 78  ? 7.002   5.500   54.304  1.00 22.77 ? 78  ALA D C     1 
ATOM   10633 O O     . ALA D 1 78  ? 7.616   6.478   54.527  1.00 25.58 ? 78  ALA D O     1 
ATOM   10634 C CB    . ALA D 1 78  ? 5.595   6.383   52.454  1.00 20.67 ? 78  ALA D CB    1 
ATOM   10635 N N     . GLY D 1 79  ? 6.561   4.704   55.283  1.00 25.71 ? 79  GLY D N     1 
ATOM   10636 C CA    . GLY D 1 79  ? 6.965   4.937   56.685  1.00 24.30 ? 79  GLY D CA    1 
ATOM   10637 C C     . GLY D 1 79  ? 5.829   5.085   57.649  1.00 24.08 ? 79  GLY D C     1 
ATOM   10638 O O     . GLY D 1 79  ? 4.743   5.430   57.284  1.00 25.36 ? 79  GLY D O     1 
ATOM   10639 N N     . ILE D 1 80  ? 6.119   4.889   58.919  1.00 24.71 ? 80  ILE D N     1 
ATOM   10640 C CA    . ILE D 1 80  ? 5.219   5.262   60.046  1.00 25.83 ? 80  ILE D CA    1 
ATOM   10641 C C     . ILE D 1 80  ? 4.804   6.735   60.066  1.00 28.14 ? 80  ILE D C     1 
ATOM   10642 O O     . ILE D 1 80  ? 5.613   7.640   59.796  1.00 27.29 ? 80  ILE D O     1 
ATOM   10643 C CB    . ILE D 1 80  ? 5.816   4.833   61.402  1.00 26.39 ? 80  ILE D CB    1 
ATOM   10644 C CG1   . ILE D 1 80  ? 6.973   5.753   61.841  1.00 26.15 ? 80  ILE D CG1   1 
ATOM   10645 C CG2   . ILE D 1 80  ? 6.390   3.432   61.291  1.00 23.96 ? 80  ILE D CG2   1 
ATOM   10646 C CD1   . ILE D 1 80  ? 7.316   5.507   63.274  1.00 25.17 ? 80  ILE D CD1   1 
ATOM   10647 N N     . PRO D 1 81  ? 3.518   6.979   60.354  1.00 29.61 ? 81  PRO D N     1 
ATOM   10648 C CA    . PRO D 1 81  ? 2.963   8.303   60.093  1.00 30.53 ? 81  PRO D CA    1 
ATOM   10649 C C     . PRO D 1 81  ? 3.617   9.345   60.982  1.00 32.52 ? 81  PRO D C     1 
ATOM   10650 O O     . PRO D 1 81  ? 3.979   10.471  60.477  1.00 33.06 ? 81  PRO D O     1 
ATOM   10651 C CB    . PRO D 1 81  ? 1.474   8.141   60.376  1.00 31.26 ? 81  PRO D CB    1 
ATOM   10652 C CG    . PRO D 1 81  ? 1.307   6.772   61.100  1.00 30.22 ? 81  PRO D CG    1 
ATOM   10653 C CD    . PRO D 1 81  ? 2.561   6.006   60.939  1.00 28.49 ? 81  PRO D CD    1 
ATOM   10654 N N     . GLU D 1 82  ? 3.940   8.950   62.231  1.00 31.80 ? 82  GLU D N     1 
ATOM   10655 C CA    . GLU D 1 82  ? 4.608   9.913   63.129  1.00 32.29 ? 82  GLU D CA    1 
ATOM   10656 C C     . GLU D 1 82  ? 6.024   10.332  62.677  1.00 31.29 ? 82  GLU D C     1 
ATOM   10657 O O     . GLU D 1 82  ? 6.447   11.468  62.881  1.00 28.73 ? 82  GLU D O     1 
ATOM   10658 C CB    . GLU D 1 82  ? 4.503   9.535   64.648  1.00 32.03 ? 82  GLU D CB    1 
ATOM   10659 C CG    . GLU D 1 82  ? 5.014   8.186   65.057  1.00 35.35 ? 82  GLU D CG    1 
ATOM   10660 C CD    . GLU D 1 82  ? 3.949   7.113   65.054  1.00 35.76 ? 82  GLU D CD    1 
ATOM   10661 O OE1   . GLU D 1 82  ? 3.561   6.676   63.956  1.00 35.77 ? 82  GLU D OE1   1 
ATOM   10662 O OE2   . GLU D 1 82  ? 3.499   6.671   66.153  1.00 39.99 ? 82  GLU D OE2   1 
ATOM   10663 N N     . LEU D 1 83  ? 6.750   9.419   62.032  1.00 30.46 ? 83  LEU D N     1 
ATOM   10664 C CA    . LEU D 1 83  ? 8.038   9.820   61.499  1.00 30.98 ? 83  LEU D CA    1 
ATOM   10665 C C     . LEU D 1 83  ? 7.911   10.631  60.249  1.00 29.09 ? 83  LEU D C     1 
ATOM   10666 O O     . LEU D 1 83  ? 8.743   11.492  59.948  1.00 30.84 ? 83  LEU D O     1 
ATOM   10667 C CB    . LEU D 1 83  ? 8.950   8.627   61.185  1.00 29.32 ? 83  LEU D CB    1 
ATOM   10668 C CG    . LEU D 1 83  ? 10.400  8.668   61.548  1.00 30.75 ? 83  LEU D CG    1 
ATOM   10669 C CD1   . LEU D 1 83  ? 11.089  7.589   60.678  1.00 27.33 ? 83  LEU D CD1   1 
ATOM   10670 C CD2   . LEU D 1 83  ? 11.233  10.042  61.603  1.00 26.56 ? 83  LEU D CD2   1 
ATOM   10671 N N     . LEU D 1 84  ? 6.969   10.247  59.444  1.00 27.25 ? 84  LEU D N     1 
ATOM   10672 C CA    . LEU D 1 84  ? 6.752   10.934  58.176  1.00 28.54 ? 84  LEU D CA    1 
ATOM   10673 C C     . LEU D 1 84  ? 6.437   12.391  58.452  1.00 26.64 ? 84  LEU D C     1 
ATOM   10674 O O     . LEU D 1 84  ? 6.978   13.254  57.812  1.00 27.57 ? 84  LEU D O     1 
ATOM   10675 C CB    . LEU D 1 84  ? 5.560   10.297  57.407  1.00 28.09 ? 84  LEU D CB    1 
ATOM   10676 C CG    . LEU D 1 84  ? 5.712   9.641   56.040  1.00 29.33 ? 84  LEU D CG    1 
ATOM   10677 C CD1   . LEU D 1 84  ? 7.070   9.116   55.814  1.00 27.02 ? 84  LEU D CD1   1 
ATOM   10678 C CD2   . LEU D 1 84  ? 4.563   8.579   55.738  1.00 18.70 ? 84  LEU D CD2   1 
ATOM   10679 N N     . SER D 1 85  ? 5.559   12.653  59.420  1.00 26.89 ? 85  SER D N     1 
ATOM   10680 C CA    . SER D 1 85  ? 5.267   14.060  59.755  1.00 29.53 ? 85  SER D CA    1 
ATOM   10681 C C     . SER D 1 85  ? 6.370   14.850  60.502  1.00 29.42 ? 85  SER D C     1 
ATOM   10682 O O     . SER D 1 85  ? 6.492   16.068  60.296  1.00 30.27 ? 85  SER D O     1 
ATOM   10683 C CB    . SER D 1 85  ? 3.950   14.137  60.470  1.00 29.41 ? 85  SER D CB    1 
ATOM   10684 O OG    . SER D 1 85  ? 4.133   13.342  61.588  1.00 32.16 ? 85  SER D OG    1 
ATOM   10685 N N     . TRP D 1 86  ? 7.162   14.200  61.338  1.00 29.23 ? 86  TRP D N     1 
ATOM   10686 C CA    . TRP D 1 86  ? 8.306   14.866  61.925  1.00 27.99 ? 86  TRP D CA    1 
ATOM   10687 C C     . TRP D 1 86  ? 9.288   15.294  60.849  1.00 28.90 ? 86  TRP D C     1 
ATOM   10688 O O     . TRP D 1 86  ? 9.777   16.403  60.861  1.00 29.98 ? 86  TRP D O     1 
ATOM   10689 C CB    . TRP D 1 86  ? 8.973   13.992  62.982  1.00 29.83 ? 86  TRP D CB    1 
ATOM   10690 C CG    . TRP D 1 86  ? 9.862   14.733  63.917  1.00 26.85 ? 86  TRP D CG    1 
ATOM   10691 C CD1   . TRP D 1 86  ? 9.542   15.198  65.145  1.00 26.23 ? 86  TRP D CD1   1 
ATOM   10692 C CD2   . TRP D 1 86  ? 11.221  15.084  63.696  1.00 25.88 ? 86  TRP D CD2   1 
ATOM   10693 N NE1   . TRP D 1 86  ? 10.619  15.824  65.707  1.00 28.17 ? 86  TRP D NE1   1 
ATOM   10694 C CE2   . TRP D 1 86  ? 11.664  15.768  64.834  1.00 28.88 ? 86  TRP D CE2   1 
ATOM   106