data_2QME
# 
_entry.id   2QME 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QME         
RCSB  RCSB043780   
WWPDB D_1000043780 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2G0N 
_pdbx_database_related.details        'Crystal structure of human RAC3 in complex with GDP and chlorine' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2QME 
_pdbx_database_status.recvd_initial_deposition_date   2007-07-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ugochukwu, E.'                        1  
'Yang, X.'                             2  
'Elkins, J.M.'                         3  
'Burgess-Brown, N.'                    4  
'Bunkoczi, G.'                         5  
'Sundstrom, M.'                        6  
'Arrowsmith, C.H.'                     7  
'Weigelt, J.'                          8  
'Edwards, A.'                          9  
'von Delft, F.'                        10 
'Knapp, S.'                            11 
'Doyle, D.'                            12 
'Structural Genomics Consortium (SGC)' 13 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 1 (PAK1).' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ugochukwu, E.'     1 
primary 'Yang, X.'          2 
primary 'Elkins, J.M.'      3 
primary 'Burgess-Brown, N.' 4 
primary 'Bunkoczi, G.'      5 
primary 'Knapp, S.'         6 
primary 'Doyle, D.'         7 
# 
_cell.entry_id           2QME 
_cell.length_a           84.226 
_cell.length_b           53.480 
_cell.length_c           47.682 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QME 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related C3 botulinum toxin substrate 3'               19934.928 1   ?        ? ?             ? 
2 polymer     syn 'CRIB domain of the Serine/threonine-protein kinase PAK 1' 4063.479  1   2.7.11.1 ? 'CRIB domain' ? 
3 non-polymer syn 'MAGNESIUM ION'                                            24.305    1   ?        ? ?             ? 
4 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER'             521.208   1   ?        ? ?             ? 
5 non-polymer syn GLYCEROL                                                   92.094    2   ?        ? ?             ? 
6 water       nat water                                                      18.015    238 ?        ? ?             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 p21-Rac3                                            
2 'p21-activated kinase 1, PAK-1, p65-PAK, Alpha-PAK' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFL
ICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSA
LTQRGLKTVFDEAIRAVLG
;
;SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFL
ICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSA
LTQRGLKTVFDEAIRAVLG
;
A ? 
2 'polypeptide(L)' no no EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQT EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQT I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLN n 
1 4   ALA n 
1 5   ILE n 
1 6   LYS n 
1 7   CYS n 
1 8   VAL n 
1 9   VAL n 
1 10  VAL n 
1 11  GLY n 
1 12  ASP n 
1 13  GLY n 
1 14  ALA n 
1 15  VAL n 
1 16  GLY n 
1 17  LYS n 
1 18  THR n 
1 19  CYS n 
1 20  LEU n 
1 21  LEU n 
1 22  ILE n 
1 23  SER n 
1 24  TYR n 
1 25  THR n 
1 26  THR n 
1 27  ASN n 
1 28  ALA n 
1 29  PHE n 
1 30  PRO n 
1 31  GLY n 
1 32  GLU n 
1 33  TYR n 
1 34  ILE n 
1 35  PRO n 
1 36  THR n 
1 37  VAL n 
1 38  PHE n 
1 39  ASP n 
1 40  ASN n 
1 41  TYR n 
1 42  SER n 
1 43  ALA n 
1 44  ASN n 
1 45  VAL n 
1 46  MET n 
1 47  VAL n 
1 48  ASP n 
1 49  GLY n 
1 50  LYS n 
1 51  PRO n 
1 52  VAL n 
1 53  ASN n 
1 54  LEU n 
1 55  GLY n 
1 56  LEU n 
1 57  TRP n 
1 58  ASP n 
1 59  THR n 
1 60  ALA n 
1 61  GLY n 
1 62  GLN n 
1 63  GLU n 
1 64  ASP n 
1 65  TYR n 
1 66  ASP n 
1 67  ARG n 
1 68  LEU n 
1 69  ARG n 
1 70  PRO n 
1 71  LEU n 
1 72  SER n 
1 73  TYR n 
1 74  PRO n 
1 75  GLN n 
1 76  THR n 
1 77  ASP n 
1 78  VAL n 
1 79  PHE n 
1 80  LEU n 
1 81  ILE n 
1 82  CYS n 
1 83  PHE n 
1 84  SER n 
1 85  LEU n 
1 86  VAL n 
1 87  SER n 
1 88  PRO n 
1 89  ALA n 
1 90  SER n 
1 91  PHE n 
1 92  GLU n 
1 93  ASN n 
1 94  VAL n 
1 95  ARG n 
1 96  ALA n 
1 97  LYS n 
1 98  TRP n 
1 99  TYR n 
1 100 PRO n 
1 101 GLU n 
1 102 VAL n 
1 103 ARG n 
1 104 HIS n 
1 105 HIS n 
1 106 CYS n 
1 107 PRO n 
1 108 HIS n 
1 109 THR n 
1 110 PRO n 
1 111 ILE n 
1 112 LEU n 
1 113 LEU n 
1 114 VAL n 
1 115 GLY n 
1 116 THR n 
1 117 LYS n 
1 118 LEU n 
1 119 ASP n 
1 120 LEU n 
1 121 ARG n 
1 122 ASP n 
1 123 ASP n 
1 124 LYS n 
1 125 ASP n 
1 126 THR n 
1 127 ILE n 
1 128 GLU n 
1 129 ARG n 
1 130 LEU n 
1 131 ARG n 
1 132 ASP n 
1 133 LYS n 
1 134 LYS n 
1 135 LEU n 
1 136 ALA n 
1 137 PRO n 
1 138 ILE n 
1 139 THR n 
1 140 TYR n 
1 141 PRO n 
1 142 GLN n 
1 143 GLY n 
1 144 LEU n 
1 145 ALA n 
1 146 MET n 
1 147 ALA n 
1 148 ARG n 
1 149 GLU n 
1 150 ILE n 
1 151 GLY n 
1 152 SER n 
1 153 VAL n 
1 154 LYS n 
1 155 TYR n 
1 156 LEU n 
1 157 GLU n 
1 158 CYS n 
1 159 SER n 
1 160 ALA n 
1 161 LEU n 
1 162 THR n 
1 163 GLN n 
1 164 ARG n 
1 165 GLY n 
1 166 LEU n 
1 167 LYS n 
1 168 THR n 
1 169 VAL n 
1 170 PHE n 
1 171 ASP n 
1 172 GLU n 
1 173 ALA n 
1 174 ILE n 
1 175 ARG n 
1 176 ALA n 
1 177 VAL n 
1 178 LEU n 
1 179 GLY n 
2 1   GLU n 
2 2   ILE n 
2 3   SER n 
2 4   LEU n 
2 5   PRO n 
2 6   SER n 
2 7   ASP n 
2 8   PHE n 
2 9   GLU n 
2 10  HIS n 
2 11  THR n 
2 12  ILE n 
2 13  HIS n 
2 14  VAL n 
2 15  GLY n 
2 16  PHE n 
2 17  ASP n 
2 18  ALA n 
2 19  VAL n 
2 20  THR n 
2 21  GLY n 
2 22  GLU n 
2 23  PHE n 
2 24  THR n 
2 25  GLY n 
2 26  MET n 
2 27  PRO n 
2 28  GLU n 
2 29  GLN n 
2 30  TRP n 
2 31  ALA n 
2 32  ARG n 
2 33  LEU n 
2 34  LEU n 
2 35  GLN n 
2 36  THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RAC3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic peptide with the sequence of the CRIB domain of human PAK1 protein' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RAC3_HUMAN P60763 1 
;MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLI
CFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSAL
TQRGLKTVFDEAIRAVL
;
1  ? 
2 UNP PAK1_HUMAN Q13153 2 EISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQT 74 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2QME A 2 ? 178 ? P60763 1  ? 177 ? 1  177 
2 2 2QME I 1 ? 36  ? Q13153 74 ? 109 ? 10 45  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2QME SER A 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   1 
1 2QME GLY A 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ?                               'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                               'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                               'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                               'C4 H7 N O4'        
133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?                               'C3 H7 N O2 S'      
121.158 
GCP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' ?                               'C11 H18 N5 O13 P3' 
521.208 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                               'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                               'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                               'C2 H5 N O2'        
75.067  
GOL non-polymer         . GLYCEROL                                       'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          
92.094  
HIS 'L-peptide linking' y HISTIDINE                                      ?                               'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                          ?                               'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                               'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                               'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                               'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                               'C5 H11 N O2 S'     
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                ?                               'Mg 2'              
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                               'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                               'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                         ?                               'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                      ?                               'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                               'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                               'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                         ?                               'C5 H11 N O2'       
117.146 
# 
_exptl.entry_id          2QME 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_percent_sol   44.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris-HCl pH 8.5, 2 M (NH4)2S04, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS HTC' 
_diffrn_detector.pdbx_collection_date   2007-01-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54180 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54180 
# 
_reflns.entry_id                     2QME 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.75 
_reflns.d_resolution_low             47.62 
_reflns.number_all                   21448 
_reflns.number_obs                   21448 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              0.053 
_reflns.pdbx_netI_over_sigmaI        27.1 
_reflns.B_iso_Wilson_estimate        20.0 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.84 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.343 
_reflns_shell.pdbx_Rsym_value        0.343 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        7.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2QME 
_refine.ls_number_reflns_obs                     20345 
_refine.ls_number_reflns_all                     20345 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.62 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    99.88 
_refine.ls_R_factor_obs                          0.15114 
_refine.ls_R_factor_all                          0.15114 
_refine.ls_R_factor_R_work                       0.14893 
_refine.ls_R_factor_R_free                       0.19177 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1100 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.969 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               22.090 
_refine.aniso_B[1][1]                            -0.15 
_refine.aniso_B[2][2]                            0.59 
_refine.aniso_B[3][3]                            -0.43 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.02 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2G0N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.101 
_refine.pdbx_overall_ESU_R_Free                  0.103 
_refine.overall_SU_ML                            0.069 
_refine.overall_SU_B                             3.899 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1560 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               1843 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        47.62 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.013  0.022  ? 1663 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020  ? 1095 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.470  1.996  ? 2273 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.884  3.000  ? 2681 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.917  5.000  ? 202  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.215 24.058 ? 69   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.612 15.000 ? 258  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   11.228 15.000 ? 8    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.088  0.200  ? 257  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 1808 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 329  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.202  0.200  ? 336  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.202  0.200  ? 1182 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.181  0.200  ? 816  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.085  0.200  ? 806  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.168  0.200  ? 168  'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.021  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.171  0.200  ? 15   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.258  0.200  ? 47   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.135  0.200  ? 30   'X-RAY DIFFRACTION' ? 
r_mcbond_it              3.517  5.000  ? 1051 'X-RAY DIFFRACTION' ? 
r_mcbond_other           1.286  5.000  ? 405  'X-RAY DIFFRACTION' ? 
r_mcangle_it             4.295  7.000  ? 1644 'X-RAY DIFFRACTION' ? 
r_scbond_it              6.175  9.000  ? 728  'X-RAY DIFFRACTION' ? 
r_scangle_it             7.435  11.000 ? 628  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.750 
_refine_ls_shell.d_res_low                        1.795 
_refine_ls_shell.number_reflns_R_work             1481 
_refine_ls_shell.R_factor_R_work                  0.194 
_refine_ls_shell.percent_reflns_obs               99.18 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             86 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2QME 
_struct.title                     
'Crystal structure of human RAC3 in complex with CRIB domain of human p21-activated kinase 1 (PAK1)' 
_struct.pdbx_descriptor           
'Ras-related C3 botulinum toxin substrate 3, Serine/threonine-protein kinase PAK 1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QME 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/TRANSFERASE' 
_struct_keywords.text            
;GTPase RAC3, small GTP binding protein, p21 rac, ras-related C3 botulinum toxin substrate 3, signaling protein, CRIB, kinase, Structural Genomics, Structural Genomics Consortium, SGC, Cell projection, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, Allosteric enzyme, ATP-binding, Phosphorylation, Serine/threonine-protein kinase, Transferase, Apoptosis, Cell junction, SIGNALING PROTEIN-TRANSFERASE COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 16  ? ASN A 27  ? GLY A 15  ASN A 26  1 ? 12 
HELX_P HELX_P2 2 GLN A 62  ? ASP A 66  ? GLN A 61  ASP A 65  5 ? 5  
HELX_P HELX_P3 3 LEU A 68  ? TYR A 73  ? LEU A 67  TYR A 72  5 ? 6  
HELX_P HELX_P4 4 SER A 87  ? LYS A 97  ? SER A 86  LYS A 96  1 ? 11 
HELX_P HELX_P5 5 LYS A 97  ? CYS A 106 ? LYS A 96  CYS A 105 1 ? 10 
HELX_P HELX_P6 6 LYS A 117 ? ARG A 121 ? LYS A 116 ARG A 120 5 ? 5  
HELX_P HELX_P7 7 ASP A 123 ? ASP A 132 ? ASP A 122 ASP A 131 1 ? 10 
HELX_P HELX_P8 8 THR A 139 ? ILE A 150 ? THR A 138 ILE A 149 1 ? 12 
HELX_P HELX_P9 9 GLY A 165 ? GLY A 179 ? GLY A 164 GLY A 178 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A THR 18 OG1 ? ? ? 1_555 C MG  . MG  ? ? A THR 17  A MG  179 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc2 metalc ? ? A THR 36 OG1 ? ? ? 1_555 C MG  . MG  ? ? A THR 35  A MG  179 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc3 metalc ? ? C MG  .  MG  ? ? ? 1_555 D GCP . O2B ? ? A MG  179 A GCP 200 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc4 metalc ? ? C MG  .  MG  ? ? ? 1_555 D GCP . O1G ? ? A MG  179 A GCP 200 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc5 metalc ? ? C MG  .  MG  ? ? ? 1_555 G HOH . O   ? ? A MG  179 A HOH 509 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc6 metalc ? ? C MG  .  MG  ? ? ? 1_555 G HOH . O   ? ? A MG  179 A HOH 477 1_555 ? ? ? ? ? ? ? 2.238 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 154 ? GLU A 157 ? LYS A 153 GLU A 156 
A 2 ILE A 111 ? THR A 116 ? ILE A 110 THR A 115 
A 3 VAL A 78  ? SER A 84  ? VAL A 77  SER A 83  
A 4 GLN A 3   ? GLY A 11  ? GLN A 2   GLY A 10  
A 5 LYS A 50  ? THR A 59  ? LYS A 49  THR A 58  
A 6 PHE A 38  ? VAL A 47  ? PHE A 37  VAL A 46  
A 7 SER B 6   ? VAL B 14  ? SER I 15  VAL I 23  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 156 ? O LEU A 155 N GLY A 115 ? N GLY A 114 
A 2 3 O VAL A 114 ? O VAL A 113 N ILE A 81  ? N ILE A 80  
A 3 4 O LEU A 80  ? O LEU A 79  N VAL A 10  ? N VAL A 9   
A 4 5 N ILE A 5   ? N ILE A 4   O GLY A 55  ? O GLY A 54  
A 5 6 O LEU A 54  ? O LEU A 53  N ALA A 43  ? N ALA A 42  
A 6 7 N ASN A 44  ? N ASN A 43  O SER B 6   ? O SER I 15  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 179'  
AC2 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE GCP A 200' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 301' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  THR A 18  ? THR A 17  . ? 1_555 ? 
2  AC1 5  THR A 36  ? THR A 35  . ? 1_555 ? 
3  AC1 5  GCP D .   ? GCP A 200 . ? 1_555 ? 
4  AC1 5  HOH G .   ? HOH A 477 . ? 1_555 ? 
5  AC1 5  HOH G .   ? HOH A 509 . ? 1_555 ? 
6  AC2 29 ALA A 14  ? ALA A 13  . ? 1_555 ? 
7  AC2 29 VAL A 15  ? VAL A 14  . ? 1_555 ? 
8  AC2 29 GLY A 16  ? GLY A 15  . ? 1_555 ? 
9  AC2 29 LYS A 17  ? LYS A 16  . ? 1_555 ? 
10 AC2 29 THR A 18  ? THR A 17  . ? 1_555 ? 
11 AC2 29 CYS A 19  ? CYS A 18  . ? 1_555 ? 
12 AC2 29 PHE A 29  ? PHE A 28  . ? 1_555 ? 
13 AC2 29 TYR A 33  ? TYR A 32  . ? 1_555 ? 
14 AC2 29 PRO A 35  ? PRO A 34  . ? 1_555 ? 
15 AC2 29 THR A 36  ? THR A 35  . ? 1_555 ? 
16 AC2 29 GLY A 61  ? GLY A 60  . ? 1_555 ? 
17 AC2 29 LYS A 117 ? LYS A 116 . ? 1_555 ? 
18 AC2 29 ASP A 119 ? ASP A 118 . ? 1_555 ? 
19 AC2 29 LEU A 120 ? LEU A 119 . ? 1_555 ? 
20 AC2 29 SER A 159 ? SER A 158 . ? 1_555 ? 
21 AC2 29 ALA A 160 ? ALA A 159 . ? 1_555 ? 
22 AC2 29 LEU A 161 ? LEU A 160 . ? 1_555 ? 
23 AC2 29 MG  C .   ? MG  A 179 . ? 1_555 ? 
24 AC2 29 HOH G .   ? HOH A 303 . ? 1_555 ? 
25 AC2 29 HOH G .   ? HOH A 309 . ? 1_555 ? 
26 AC2 29 HOH G .   ? HOH A 319 . ? 1_555 ? 
27 AC2 29 HOH G .   ? HOH A 331 . ? 1_555 ? 
28 AC2 29 HOH G .   ? HOH A 338 . ? 1_555 ? 
29 AC2 29 HOH G .   ? HOH A 347 . ? 1_555 ? 
30 AC2 29 HOH G .   ? HOH A 359 . ? 1_555 ? 
31 AC2 29 HOH G .   ? HOH A 391 . ? 1_555 ? 
32 AC2 29 HOH G .   ? HOH A 477 . ? 1_555 ? 
33 AC2 29 HOH G .   ? HOH A 509 . ? 1_555 ? 
34 AC2 29 ALA B 18  ? ALA I 27  . ? 2_556 ? 
35 AC3 7  LYS A 167 ? LYS A 166 . ? 1_555 ? 
36 AC3 7  ASP A 171 ? ASP A 170 . ? 1_555 ? 
37 AC3 7  ARG A 175 ? ARG A 174 . ? 1_555 ? 
38 AC3 7  HOH G .   ? HOH A 489 . ? 1_555 ? 
39 AC3 7  GLU B 1   ? GLU I 10  . ? 1_555 ? 
40 AC3 7  ILE B 2   ? ILE I 11  . ? 1_555 ? 
41 AC3 7  HOH H .   ? HOH I 53  . ? 1_555 ? 
42 AC4 6  ARG A 164 ? ARG A 163 . ? 1_555 ? 
43 AC4 6  GLY A 165 ? GLY A 164 . ? 1_555 ? 
44 AC4 6  LEU A 166 ? LEU A 165 . ? 1_555 ? 
45 AC4 6  LYS A 167 ? LYS A 166 . ? 1_555 ? 
46 AC4 6  THR A 168 ? THR A 167 . ? 1_555 ? 
47 AC4 6  HOH G .   ? HOH A 453 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2QME 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2QME 
_atom_sites.fract_transf_matrix[1][1]   0.011873 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000716 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018699 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021010 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 2   ? -19.704 -0.068 -7.448  1.00 56.77 ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 2   ? -20.252 0.565  -6.211  1.00 54.27 ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 2   ? -19.628 1.951  -6.022  1.00 43.67 ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 2   ? -18.402 2.100  -6.032  1.00 51.36 ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 2   ? -19.997 -0.318 -4.975  1.00 50.90 ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 2   ? -20.755 0.115  -3.709  1.00 58.02 ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 2   ? -20.471 -0.907 -2.222  1.00 50.26 ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 2   ? -20.828 -2.535 -2.876  1.00 56.36 ? 1   MET A CE    1 
ATOM   9    N  N     . GLN A 1 3   ? -20.480 2.960  -5.854  1.00 42.14 ? 2   GLN A N     1 
ATOM   10   C  CA    . GLN A 1 3   ? -20.030 4.299  -5.487  1.00 34.43 ? 2   GLN A CA    1 
ATOM   11   C  C     . GLN A 1 3   ? -19.147 4.168  -4.241  1.00 31.09 ? 2   GLN A C     1 
ATOM   12   O  O     . GLN A 1 3   ? -19.391 3.313  -3.392  1.00 28.80 ? 2   GLN A O     1 
ATOM   13   C  CB    . GLN A 1 3   ? -21.230 5.201  -5.187  1.00 35.23 ? 2   GLN A CB    1 
ATOM   14   C  CG    . GLN A 1 3   ? -20.889 6.599  -4.685  1.00 50.92 ? 2   GLN A CG    1 
ATOM   15   C  CD    . GLN A 1 3   ? -20.714 7.602  -5.793  1.00 63.11 ? 2   GLN A CD    1 
ATOM   16   O  OE1   . GLN A 1 3   ? -21.667 7.930  -6.492  1.00 56.14 ? 2   GLN A OE1   1 
ATOM   17   N  NE2   . GLN A 1 3   ? -19.496 8.119  -5.946  1.00 71.00 ? 2   GLN A NE2   1 
ATOM   18   N  N     . ALA A 1 4   ? -18.120 5.001  -4.164  1.00 30.16 ? 3   ALA A N     1 
ATOM   19   C  CA    . ALA A 1 4   ? -17.180 4.983  -3.025  1.00 27.12 ? 3   ALA A CA    1 
ATOM   20   C  C     . ALA A 1 4   ? -16.957 6.401  -2.511  1.00 34.13 ? 3   ALA A C     1 
ATOM   21   O  O     . ALA A 1 4   ? -16.979 7.371  -3.278  1.00 33.38 ? 3   ALA A O     1 
ATOM   22   C  CB    . ALA A 1 4   ? -15.859 4.336  -3.425  1.00 32.45 ? 3   ALA A CB    1 
ATOM   23   N  N     . ILE A 1 5   ? -16.777 6.524  -1.201  1.00 25.65 ? 4   ILE A N     1 
ATOM   24   C  CA    . ILE A 1 5   ? -16.554 7.808  -0.569  1.00 25.62 ? 4   ILE A CA    1 
ATOM   25   C  C     . ILE A 1 5   ? -15.310 7.642  0.296   1.00 28.19 ? 4   ILE A C     1 
ATOM   26   O  O     . ILE A 1 5   ? -15.211 6.683  1.052   1.00 26.93 ? 4   ILE A O     1 
ATOM   27   C  CB    . ILE A 1 5   ? -17.742 8.188  0.345   1.00 30.77 ? 4   ILE A CB    1 
ATOM   28   C  CG1   . ILE A 1 5   ? -18.924 8.677  -0.496  1.00 38.76 ? 4   ILE A CG1   1 
ATOM   29   C  CG2   . ILE A 1 5   ? -17.330 9.251  1.367   1.00 41.29 ? 4   ILE A CG2   1 
ATOM   30   C  CD1   . ILE A 1 5   ? -20.101 9.119  0.351   1.00 35.24 ? 4   ILE A CD1   1 
ATOM   31   N  N     . LYS A 1 6   ? -14.381 8.579  0.187   1.00 25.20 ? 5   LYS A N     1 
ATOM   32   C  CA    . LYS A 1 6   ? -13.186 8.586  1.029   1.00 21.79 ? 5   LYS A CA    1 
ATOM   33   C  C     . LYS A 1 6   ? -13.321 9.643  2.121   1.00 21.63 ? 5   LYS A C     1 
ATOM   34   O  O     . LYS A 1 6   ? -13.433 10.845 1.835   1.00 21.62 ? 5   LYS A O     1 
ATOM   35   C  CB    . LYS A 1 6   ? -11.932 8.865  0.196   1.00 25.20 ? 5   LYS A CB    1 
ATOM   36   C  CG    . LYS A 1 6   ? -10.710 9.054  1.042   1.00 28.56 ? 5   LYS A CG    1 
ATOM   37   C  CD    . LYS A 1 6   ? -9.428  8.866  0.252   1.00 28.90 ? 5   LYS A CD    1 
ATOM   38   C  CE    . LYS A 1 6   ? -8.255  9.398  1.055   1.00 28.39 ? 5   LYS A CE    1 
ATOM   39   N  NZ    . LYS A 1 6   ? -6.917  9.130  0.436   1.00 25.56 ? 5   LYS A NZ    1 
ATOM   40   N  N     . CYS A 1 7   ? -13.255 9.188  3.371   1.00 22.78 ? 6   CYS A N     1 
ATOM   41   C  CA    . CYS A 1 7   ? -13.384 10.056 4.536   1.00 23.42 ? 6   CYS A CA    1 
ATOM   42   C  C     . CYS A 1 7   ? -12.169 9.912  5.436   1.00 22.25 ? 6   CYS A C     1 
ATOM   43   O  O     . CYS A 1 7   ? -11.783 8.787  5.829   1.00 24.18 ? 6   CYS A O     1 
ATOM   44   C  CB    . CYS A 1 7   ? -14.639 9.675  5.281   1.00 22.94 ? 6   CYS A CB    1 
ATOM   45   S  SG    . CYS A 1 7   ? -14.908 10.512 6.862   1.00 27.19 ? 6   CYS A SG    1 
ATOM   46   N  N     . VAL A 1 8   ? -11.535 11.044 5.731   1.00 21.74 ? 7   VAL A N     1 
ATOM   47   C  CA    . VAL A 1 8   ? -10.308 11.064 6.528   1.00 19.90 ? 7   VAL A CA    1 
ATOM   48   C  C     . VAL A 1 8   ? -10.603 11.743 7.861   1.00 19.01 ? 7   VAL A C     1 
ATOM   49   O  O     . VAL A 1 8   ? -11.234 12.795 7.913   1.00 23.07 ? 7   VAL A O     1 
ATOM   50   C  CB    . VAL A 1 8   ? -9.146  11.808 5.819   1.00 22.05 ? 7   VAL A CB    1 
ATOM   51   C  CG1   . VAL A 1 8   ? -7.910  11.809 6.704   1.00 28.35 ? 7   VAL A CG1   1 
ATOM   52   C  CG2   . VAL A 1 8   ? -8.812  11.129 4.457   1.00 23.41 ? 7   VAL A CG2   1 
ATOM   53   N  N     . VAL A 1 9   ? -10.120 11.147 8.950   1.00 22.25 ? 8   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 9   ? -10.452 11.608 10.300  1.00 21.99 ? 8   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 9   ? -9.152  12.111 10.935  1.00 21.18 ? 8   VAL A C     1 
ATOM   56   O  O     . VAL A 1 9   ? -8.153  11.349 10.980  1.00 22.08 ? 8   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 9   ? -11.068 10.475 11.138  1.00 23.34 ? 8   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 9   ? -11.478 10.972 12.529  1.00 25.05 ? 8   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 9   ? -12.331 9.903  10.393  1.00 25.34 ? 8   VAL A CG2   1 
ATOM   60   N  N     . VAL A 1 10  ? -9.153  13.363 11.396  1.00 22.79 ? 9   VAL A N     1 
ATOM   61   C  CA    . VAL A 1 10  ? -7.960  13.973 12.006  1.00 21.24 ? 9   VAL A CA    1 
ATOM   62   C  C     . VAL A 1 10  ? -8.327  14.713 13.304  1.00 22.19 ? 9   VAL A C     1 
ATOM   63   O  O     . VAL A 1 10  ? -9.477  14.999 13.535  1.00 22.03 ? 9   VAL A O     1 
ATOM   64   C  CB    . VAL A 1 10  ? -7.254  14.990 11.030  1.00 22.31 ? 9   VAL A CB    1 
ATOM   65   C  CG1   . VAL A 1 10  ? -6.923  14.317 9.663   1.00 20.25 ? 9   VAL A CG1   1 
ATOM   66   C  CG2   . VAL A 1 10  ? -8.124  16.256 10.815  1.00 22.41 ? 9   VAL A CG2   1 
ATOM   67   N  N     . GLY A 1 11  ? -7.331  15.019 14.134  1.00 22.85 ? 10  GLY A N     1 
ATOM   68   C  CA    . GLY A 1 11  ? -7.550  15.756 15.370  1.00 26.09 ? 10  GLY A CA    1 
ATOM   69   C  C     . GLY A 1 11  ? -6.535  15.325 16.402  1.00 25.89 ? 10  GLY A C     1 
ATOM   70   O  O     . GLY A 1 11  ? -5.804  14.359 16.191  1.00 21.21 ? 10  GLY A O     1 
ATOM   71   N  N     . ASP A 1 12  ? -6.517  16.023 17.527  1.00 23.76 ? 11  ASP A N     1 
ATOM   72   C  CA    . ASP A 1 12  ? -5.497  15.811 18.564  1.00 28.12 ? 11  ASP A CA    1 
ATOM   73   C  C     . ASP A 1 12  ? -5.391  14.387 19.107  1.00 27.01 ? 11  ASP A C     1 
ATOM   74   O  O     . ASP A 1 12  ? -6.346  13.609 19.080  1.00 22.69 ? 11  ASP A O     1 
ATOM   75   C  CB    . ASP A 1 12  ? -5.751  16.751 19.755  1.00 27.19 ? 11  ASP A CB    1 
ATOM   76   C  CG    . ASP A 1 12  ? -5.171  18.164 19.557  1.00 26.95 ? 11  ASP A CG    1 
ATOM   77   O  OD1   . ASP A 1 12  ? -4.651  18.505 18.473  1.00 25.82 ? 11  ASP A OD1   1 
ATOM   78   O  OD2   . ASP A 1 12  ? -5.232  18.945 20.534  1.00 25.78 ? 11  ASP A OD2   1 
ATOM   79   N  N     . GLY A 1 13  ? -4.223  14.064 19.683  1.00 23.08 ? 12  GLY A N     1 
ATOM   80   C  CA    . GLY A 1 13  ? -4.089  12.833 20.443  1.00 26.17 ? 12  GLY A CA    1 
ATOM   81   C  C     . GLY A 1 13  ? -5.156  12.772 21.520  1.00 28.04 ? 12  GLY A C     1 
ATOM   82   O  O     . GLY A 1 13  ? -5.600  13.814 22.040  1.00 27.55 ? 12  GLY A O     1 
ATOM   83   N  N     . ALA A 1 14  ? -5.613  11.551 21.772  1.00 26.84 ? 13  ALA A N     1 
ATOM   84   C  CA    . ALA A 1 14  ? -6.606  11.211 22.792  1.00 24.35 ? 13  ALA A CA    1 
ATOM   85   C  C     . ALA A 1 14  ? -8.043  11.696 22.546  1.00 25.59 ? 13  ALA A C     1 
ATOM   86   O  O     . ALA A 1 14  ? -8.874  11.508 23.424  1.00 28.03 ? 13  ALA A O     1 
ATOM   87   C  CB    . ALA A 1 14  ? -6.144  11.691 24.175  1.00 28.09 ? 13  ALA A CB    1 
ATOM   88   N  N     . VAL A 1 15  ? -8.373  12.279 21.390  1.00 21.36 ? 14  VAL A N     1 
ATOM   89   C  CA    . VAL A 1 15  ? -9.748  12.818 21.226  1.00 21.75 ? 14  VAL A CA    1 
ATOM   90   C  C     . VAL A 1 15  ? -10.839 11.769 20.979  1.00 23.06 ? 14  VAL A C     1 
ATOM   91   O  O     . VAL A 1 15  ? -12.022 12.018 21.221  1.00 25.52 ? 14  VAL A O     1 
ATOM   92   C  CB    . VAL A 1 15  ? -9.865  13.881 20.098  1.00 24.62 ? 14  VAL A CB    1 
ATOM   93   C  CG1   . VAL A 1 15  ? -8.975  15.158 20.374  1.00 24.60 ? 14  VAL A CG1   1 
ATOM   94   C  CG2   . VAL A 1 15  ? -9.643  13.282 18.759  1.00 31.49 ? 14  VAL A CG2   1 
ATOM   95   N  N     . GLY A 1 16  ? -10.465 10.634 20.409  1.00 22.08 ? 15  GLY A N     1 
ATOM   96   C  CA    . GLY A 1 16  ? -11.429 9.529  20.204  1.00 24.20 ? 15  GLY A CA    1 
ATOM   97   C  C     . GLY A 1 16  ? -11.712 9.196  18.732  1.00 25.80 ? 15  GLY A C     1 
ATOM   98   O  O     . GLY A 1 16  ? -12.737 8.590  18.432  1.00 21.08 ? 15  GLY A O     1 
ATOM   99   N  N     . LYS A 1 17  ? -10.773 9.524  17.839  1.00 23.16 ? 16  LYS A N     1 
ATOM   100  C  CA    . LYS A 1 17  ? -10.916 9.270  16.410  1.00 20.36 ? 16  LYS A CA    1 
ATOM   101  C  C     . LYS A 1 17  ? -11.131 7.770  16.111  1.00 21.94 ? 16  LYS A C     1 
ATOM   102  O  O     . LYS A 1 17  ? -12.055 7.370  15.373  1.00 22.15 ? 16  LYS A O     1 
ATOM   103  C  CB    . LYS A 1 17  ? -9.689  9.805  15.670  1.00 23.63 ? 16  LYS A CB    1 
ATOM   104  C  CG    . LYS A 1 17  ? -9.481  11.327 15.845  1.00 24.08 ? 16  LYS A CG    1 
ATOM   105  C  CD    . LYS A 1 17  ? -8.315  11.872 15.023  1.00 22.42 ? 16  LYS A CD    1 
ATOM   106  C  CE    . LYS A 1 17  ? -6.970  11.318 15.487  1.00 20.94 ? 16  LYS A CE    1 
ATOM   107  N  NZ    . LYS A 1 17  ? -6.618  11.642 16.926  1.00 21.71 ? 16  LYS A NZ    1 
ATOM   108  N  N     . THR A 1 18  ? -10.266 6.947  16.674  1.00 25.24 ? 17  THR A N     1 
ATOM   109  C  CA    . THR A 1 18  ? -10.348 5.500  16.449  1.00 21.85 ? 17  THR A CA    1 
ATOM   110  C  C     . THR A 1 18  ? -11.623 4.886  17.012  1.00 22.11 ? 17  THR A C     1 
ATOM   111  O  O     . THR A 1 18  ? -12.301 4.131  16.316  1.00 23.06 ? 17  THR A O     1 
ATOM   112  C  CB    . THR A 1 18  ? -9.106  4.806  16.968  1.00 23.70 ? 17  THR A CB    1 
ATOM   113  O  OG1   . THR A 1 18  ? -7.983  5.297  16.219  1.00 24.19 ? 17  THR A OG1   1 
ATOM   114  C  CG2   . THR A 1 18  ? -9.225  3.263  16.803  1.00 26.25 ? 17  THR A CG2   1 
ATOM   115  N  N     . CYS A 1 19  ? -11.965 5.241  18.244  1.00 22.97 ? 18  CYS A N     1 
ATOM   116  C  CA    . CYS A 1 19  ? -13.188 4.755  18.848  1.00 20.28 ? 18  CYS A CA    1 
ATOM   117  C  C     . CYS A 1 19  ? -14.416 5.186  18.049  1.00 21.87 ? 18  CYS A C     1 
ATOM   118  O  O     . CYS A 1 19  ? -15.341 4.405  17.896  1.00 23.96 ? 18  CYS A O     1 
ATOM   119  C  CB    . CYS A 1 19  ? -13.332 5.220  20.291  1.00 28.29 ? 18  CYS A CB    1 
ATOM   120  S  SG    . CYS A 1 19  ? -12.201 4.349  21.434  1.00 26.09 ? 18  CYS A SG    1 
ATOM   121  N  N     . LEU A 1 20  ? -14.413 6.412  17.530  1.00 22.53 ? 19  LEU A N     1 
ATOM   122  C  CA    . LEU A 1 20  ? -15.507 6.907  16.667  1.00 24.81 ? 19  LEU A CA    1 
ATOM   123  C  C     . LEU A 1 20  ? -15.709 5.969  15.476  1.00 22.88 ? 19  LEU A C     1 
ATOM   124  O  O     . LEU A 1 20  ? -16.814 5.452  15.228  1.00 23.41 ? 19  LEU A O     1 
ATOM   125  C  CB    . LEU A 1 20  ? -15.143 8.335  16.172  1.00 22.29 ? 19  LEU A CB    1 
ATOM   126  C  CG    . LEU A 1 20  ? -16.047 8.996  15.137  1.00 27.56 ? 19  LEU A CG    1 
ATOM   127  C  CD1   . LEU A 1 20  ? -17.195 9.733  15.884  1.00 28.77 ? 19  LEU A CD1   1 
ATOM   128  C  CD2   . LEU A 1 20  ? -15.265 9.971  14.246  1.00 29.65 ? 19  LEU A CD2   1 
ATOM   129  N  N     . LEU A 1 21  ? -14.625 5.713  14.748  1.00 22.43 ? 20  LEU A N     1 
ATOM   130  C  CA    . LEU A 1 21  ? -14.680 4.874  13.550  1.00 20.52 ? 20  LEU A CA    1 
ATOM   131  C  C     . LEU A 1 21  ? -15.023 3.416  13.845  1.00 19.80 ? 20  LEU A C     1 
ATOM   132  O  O     . LEU A 1 21  ? -15.841 2.822  13.134  1.00 23.18 ? 20  LEU A O     1 
ATOM   133  C  CB    . LEU A 1 21  ? -13.350 4.901  12.805  1.00 24.61 ? 20  LEU A CB    1 
ATOM   134  C  CG    . LEU A 1 21  ? -13.019 6.238  12.133  1.00 25.83 ? 20  LEU A CG    1 
ATOM   135  C  CD1   . LEU A 1 21  ? -11.544 6.246  11.721  1.00 27.38 ? 20  LEU A CD1   1 
ATOM   136  C  CD2   . LEU A 1 21  ? -13.907 6.441  10.942  1.00 27.52 ? 20  LEU A CD2   1 
ATOM   137  N  N     . ILE A 1 22  ? -14.450 2.858  14.904  1.00 22.93 ? 21  ILE A N     1 
ATOM   138  C  CA    . ILE A 1 22  ? -14.671 1.453  15.241  1.00 22.18 ? 21  ILE A CA    1 
ATOM   139  C  C     . ILE A 1 22  ? -16.079 1.207  15.833  1.00 21.04 ? 21  ILE A C     1 
ATOM   140  O  O     . ILE A 1 22  ? -16.752 0.258  15.479  1.00 21.89 ? 21  ILE A O     1 
ATOM   141  C  CB    . ILE A 1 22  ? -13.563 0.927  16.199  1.00 23.99 ? 21  ILE A CB    1 
ATOM   142  C  CG1   . ILE A 1 22  ? -12.185 0.975  15.504  1.00 23.68 ? 21  ILE A CG1   1 
ATOM   143  C  CG2   . ILE A 1 22  ? -13.899 -0.503 16.687  1.00 23.54 ? 21  ILE A CG2   1 
ATOM   144  C  CD1   . ILE A 1 22  ? -12.108 0.157  14.204  1.00 25.06 ? 21  ILE A CD1   1 
ATOM   145  N  N     . SER A 1 23  ? -16.538 2.092  16.698  1.00 22.15 ? 22  SER A N     1 
ATOM   146  C  CA    . SER A 1 23  ? -17.879 1.966  17.246  1.00 24.51 ? 22  SER A CA    1 
ATOM   147  C  C     . SER A 1 23  ? -18.911 2.079  16.117  1.00 21.58 ? 22  SER A C     1 
ATOM   148  O  O     . SER A 1 23  ? -19.894 1.335  16.075  1.00 22.23 ? 22  SER A O     1 
ATOM   149  C  CB    . SER A 1 23  ? -18.135 3.032  18.284  1.00 23.77 ? 22  SER A CB    1 
ATOM   150  O  OG    . SER A 1 23  ? -19.428 2.893  18.880  1.00 22.62 ? 22  SER A OG    1 
ATOM   151  N  N     . TYR A 1 24  ? -18.700 3.017  15.208  1.00 21.94 ? 23  TYR A N     1 
ATOM   152  C  CA    . TYR A 1 24  ? -19.656 3.170  14.095  1.00 22.03 ? 23  TYR A CA    1 
ATOM   153  C  C     . TYR A 1 24  ? -19.682 1.937  13.197  1.00 22.66 ? 23  TYR A C     1 
ATOM   154  O  O     . TYR A 1 24  ? -20.756 1.411  12.883  1.00 23.79 ? 23  TYR A O     1 
ATOM   155  C  CB    . TYR A 1 24  ? -19.383 4.443  13.268  1.00 22.96 ? 23  TYR A CB    1 
ATOM   156  C  CG    . TYR A 1 24  ? -20.207 4.541  12.005  1.00 22.23 ? 23  TYR A CG    1 
ATOM   157  C  CD1   . TYR A 1 24  ? -21.585 4.754  12.047  1.00 22.44 ? 23  TYR A CD1   1 
ATOM   158  C  CD2   . TYR A 1 24  ? -19.607 4.399  10.749  1.00 24.34 ? 23  TYR A CD2   1 
ATOM   159  C  CE1   . TYR A 1 24  ? -22.341 4.831  10.865  1.00 22.27 ? 23  TYR A CE1   1 
ATOM   160  C  CE2   . TYR A 1 24  ? -20.343 4.500  9.571   1.00 24.01 ? 23  TYR A CE2   1 
ATOM   161  C  CZ    . TYR A 1 24  ? -21.710 4.721  9.629   1.00 25.75 ? 23  TYR A CZ    1 
ATOM   162  O  OH    . TYR A 1 24  ? -22.430 4.822  8.442   1.00 23.15 ? 23  TYR A OH    1 
ATOM   163  N  N     . THR A 1 25  ? -18.514 1.474  12.771  1.00 20.05 ? 24  THR A N     1 
ATOM   164  C  CA    . THR A 1 25  ? -18.453 0.413  11.746  1.00 22.05 ? 24  THR A CA    1 
ATOM   165  C  C     . THR A 1 25  ? -18.676 -1.020 12.276  1.00 25.85 ? 24  THR A C     1 
ATOM   166  O  O     . THR A 1 25  ? -19.036 -1.922 11.515  1.00 24.46 ? 24  THR A O     1 
ATOM   167  C  CB    . THR A 1 25  ? -17.107 0.436  10.983  1.00 23.32 ? 24  THR A CB    1 
ATOM   168  O  OG1   . THR A 1 25  ? -16.035 0.305  11.927  1.00 22.54 ? 24  THR A OG1   1 
ATOM   169  C  CG2   . THR A 1 25  ? -16.946 1.748  10.154  1.00 21.79 ? 24  THR A CG2   1 
ATOM   170  N  N     . THR A 1 26  ? -18.448 -1.233 13.562  1.00 21.30 ? 25  THR A N     1 
ATOM   171  C  CA    . THR A 1 26  ? -18.501 -2.586 14.174  1.00 23.87 ? 25  THR A CA    1 
ATOM   172  C  C     . THR A 1 26  ? -19.470 -2.716 15.353  1.00 22.36 ? 25  THR A C     1 
ATOM   173  O  O     . THR A 1 26  ? -19.752 -3.841 15.790  1.00 21.09 ? 25  THR A O     1 
ATOM   174  C  CB    . THR A 1 26  ? -17.113 -3.064 14.683  1.00 22.91 ? 25  THR A CB    1 
ATOM   175  O  OG1   . THR A 1 26  ? -16.779 -2.435 15.936  1.00 21.89 ? 25  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1 26  ? -15.966 -2.836 13.633  1.00 24.54 ? 25  THR A CG2   1 
ATOM   177  N  N     . ASN A 1 27  ? -19.921 -1.583 15.876  1.00 23.37 ? 26  ASN A N     1 
ATOM   178  C  CA    . ASN A 1 27  ? -20.725 -1.495 17.111  1.00 25.95 ? 26  ASN A CA    1 
ATOM   179  C  C     . ASN A 1 27  ? -20.050 -1.944 18.392  1.00 26.11 ? 26  ASN A C     1 
ATOM   180  O  O     . ASN A 1 27  ? -20.692 -2.048 19.448  1.00 25.81 ? 26  ASN A O     1 
ATOM   181  C  CB    . ASN A 1 27  ? -22.080 -2.158 16.930  1.00 31.91 ? 26  ASN A CB    1 
ATOM   182  C  CG    . ASN A 1 27  ? -22.947 -1.393 15.994  1.00 40.50 ? 26  ASN A CG    1 
ATOM   183  O  OD1   . ASN A 1 27  ? -22.996 -0.159 16.038  1.00 34.00 ? 26  ASN A OD1   1 
ATOM   184  N  ND2   . ASN A 1 27  ? -23.620 -2.100 15.118  1.00 41.08 ? 26  ASN A ND2   1 
ATOM   185  N  N     . ALA A 1 28  ? -18.744 -2.149 18.319  1.00 21.77 ? 27  ALA A N     1 
ATOM   186  C  CA    . ALA A 1 28  ? -17.966 -2.575 19.466  1.00 26.47 ? 27  ALA A CA    1 
ATOM   187  C  C     . ALA A 1 28  ? -17.045 -1.411 19.782  1.00 30.35 ? 27  ALA A C     1 
ATOM   188  O  O     . ALA A 1 28  ? -16.406 -0.864 18.899  1.00 37.63 ? 27  ALA A O     1 
ATOM   189  C  CB    . ALA A 1 28  ? -17.172 -3.831 19.141  1.00 30.41 ? 27  ALA A CB    1 
ATOM   190  N  N     . PHE A 1 29  ? -16.990 -1.038 21.042  1.00 28.99 ? 28  PHE A N     1 
ATOM   191  C  CA    . PHE A 1 29  ? -16.194 0.096  21.461  1.00 28.30 ? 28  PHE A CA    1 
ATOM   192  C  C     . PHE A 1 29  ? -14.861 -0.477 21.955  1.00 31.45 ? 28  PHE A C     1 
ATOM   193  O  O     . PHE A 1 29  ? -14.853 -1.392 22.770  1.00 29.65 ? 28  PHE A O     1 
ATOM   194  C  CB    . PHE A 1 29  ? -16.930 0.868  22.547  1.00 29.57 ? 28  PHE A CB    1 
ATOM   195  C  CG    . PHE A 1 29  ? -16.174 2.043  23.054  1.00 23.81 ? 28  PHE A CG    1 
ATOM   196  C  CD1   . PHE A 1 29  ? -16.352 3.302  22.506  1.00 25.82 ? 28  PHE A CD1   1 
ATOM   197  C  CD2   . PHE A 1 29  ? -15.268 1.887  24.097  1.00 26.63 ? 28  PHE A CD2   1 
ATOM   198  C  CE1   . PHE A 1 29  ? -15.622 4.399  22.986  1.00 25.42 ? 28  PHE A CE1   1 
ATOM   199  C  CE2   . PHE A 1 29  ? -14.542 2.994  24.581  1.00 31.80 ? 28  PHE A CE2   1 
ATOM   200  C  CZ    . PHE A 1 29  ? -14.730 4.241  24.023  1.00 31.16 ? 28  PHE A CZ    1 
ATOM   201  N  N     . PRO A 1 30  ? -13.736 -0.011 21.387  1.00 26.26 ? 29  PRO A N     1 
ATOM   202  C  CA    . PRO A 1 30  ? -12.404 -0.489 21.797  1.00 30.64 ? 29  PRO A CA    1 
ATOM   203  C  C     . PRO A 1 30  ? -12.171 -0.434 23.311  1.00 28.22 ? 29  PRO A C     1 
ATOM   204  O  O     . PRO A 1 30  ? -12.475 0.571  23.953  1.00 32.53 ? 29  PRO A O     1 
ATOM   205  C  CB    . PRO A 1 30  ? -11.463 0.485  21.064  1.00 24.81 ? 29  PRO A CB    1 
ATOM   206  C  CG    . PRO A 1 30  ? -12.180 0.825  19.866  1.00 28.48 ? 29  PRO A CG    1 
ATOM   207  C  CD    . PRO A 1 30  ? -13.623 0.950  20.283  1.00 27.55 ? 29  PRO A CD    1 
ATOM   208  N  N     . GLY A 1 31  ? -11.620 -1.513 23.865  1.00 38.25 ? 30  GLY A N     1 
ATOM   209  C  CA    . GLY A 1 31  ? -11.312 -1.582 25.301  1.00 39.37 ? 30  GLY A CA    1 
ATOM   210  C  C     . GLY A 1 31  ? -10.028 -0.859 25.718  1.00 43.57 ? 30  GLY A C     1 
ATOM   211  O  O     . GLY A 1 31  ? -9.922  -0.366 26.846  1.00 39.40 ? 30  GLY A O     1 
ATOM   212  N  N     . GLU A 1 32  ? -9.069  -0.785 24.794  1.00 29.77 ? 31  GLU A N     1 
ATOM   213  C  CA    . GLU A 1 32  ? -7.738  -0.246 25.050  1.00 32.31 ? 31  GLU A CA    1 
ATOM   214  C  C     . GLU A 1 32  ? -7.552  1.119  24.396  1.00 35.27 ? 31  GLU A C     1 
ATOM   215  O  O     . GLU A 1 32  ? -8.295  1.500  23.489  1.00 33.96 ? 31  GLU A O     1 
ATOM   216  C  CB    . GLU A 1 32  ? -6.697  -1.215 24.489  1.00 31.98 ? 31  GLU A CB    1 
ATOM   217  N  N     . TYR A 1 33  ? -6.577  1.873  24.889  1.00 28.22 ? 32  TYR A N     1 
ATOM   218  C  CA    . TYR A 1 33  ? -6.172  3.117  24.232  1.00 28.56 ? 32  TYR A CA    1 
ATOM   219  C  C     . TYR A 1 33  ? -4.845  2.805  23.545  1.00 25.69 ? 32  TYR A C     1 
ATOM   220  O  O     . TYR A 1 33  ? -3.806  2.695  24.205  1.00 28.70 ? 32  TYR A O     1 
ATOM   221  C  CB    . TYR A 1 33  ? -6.094  4.240  25.267  1.00 26.52 ? 32  TYR A CB    1 
ATOM   222  C  CG    . TYR A 1 33  ? -5.521  5.575  24.821  1.00 27.31 ? 32  TYR A CG    1 
ATOM   223  C  CD1   . TYR A 1 33  ? -5.262  5.857  23.486  1.00 27.97 ? 32  TYR A CD1   1 
ATOM   224  C  CD2   . TYR A 1 33  ? -5.270  6.564  25.747  1.00 29.73 ? 32  TYR A CD2   1 
ATOM   225  C  CE1   . TYR A 1 33  ? -4.727  7.087  23.106  1.00 25.81 ? 32  TYR A CE1   1 
ATOM   226  C  CE2   . TYR A 1 33  ? -4.741  7.795  25.377  1.00 31.70 ? 32  TYR A CE2   1 
ATOM   227  C  CZ    . TYR A 1 33  ? -4.477  8.048  24.054  1.00 24.82 ? 32  TYR A CZ    1 
ATOM   228  O  OH    . TYR A 1 33  ? -3.940  9.266  23.692  1.00 28.72 ? 32  TYR A OH    1 
ATOM   229  N  N     . ILE A 1 34  ? -4.908  2.576  22.237  1.00 26.57 ? 33  ILE A N     1 
ATOM   230  C  CA    . ILE A 1 34  ? -3.733  2.280  21.423  1.00 23.84 ? 33  ILE A CA    1 
ATOM   231  C  C     . ILE A 1 34  ? -3.581  3.404  20.400  1.00 23.94 ? 33  ILE A C     1 
ATOM   232  O  O     . ILE A 1 34  ? -4.313  3.462  19.411  1.00 22.97 ? 33  ILE A O     1 
ATOM   233  C  CB    . ILE A 1 34  ? -3.833  0.943  20.701  1.00 29.13 ? 33  ILE A CB    1 
ATOM   234  C  CG1   . ILE A 1 34  ? -4.075  -0.188 21.708  1.00 33.73 ? 33  ILE A CG1   1 
ATOM   235  C  CG2   . ILE A 1 34  ? -2.534  0.671  19.918  1.00 29.95 ? 33  ILE A CG2   1 
ATOM   236  C  CD1   . ILE A 1 34  ? -4.723  -1.412 21.092  1.00 38.23 ? 33  ILE A CD1   1 
ATOM   237  N  N     . PRO A 1 35  ? -2.625  4.299  20.630  1.00 24.07 ? 34  PRO A N     1 
ATOM   238  C  CA    . PRO A 1 35  ? -2.439  5.380  19.665  1.00 23.87 ? 34  PRO A CA    1 
ATOM   239  C  C     . PRO A 1 35  ? -2.190  4.898  18.242  1.00 21.41 ? 34  PRO A C     1 
ATOM   240  O  O     . PRO A 1 35  ? -1.471  3.907  17.998  1.00 23.47 ? 34  PRO A O     1 
ATOM   241  C  CB    . PRO A 1 35  ? -1.216  6.130  20.198  1.00 26.37 ? 34  PRO A CB    1 
ATOM   242  C  CG    . PRO A 1 35  ? -1.199  5.816  21.646  1.00 23.46 ? 34  PRO A CG    1 
ATOM   243  C  CD    . PRO A 1 35  ? -1.729  4.440  21.796  1.00 27.95 ? 34  PRO A CD    1 
ATOM   244  N  N     . THR A 1 36  ? -2.800  5.604  17.310  1.00 22.27 ? 35  THR A N     1 
ATOM   245  C  CA    . THR A 1 36  ? -2.748  5.203  15.918  1.00 23.08 ? 35  THR A CA    1 
ATOM   246  C  C     . THR A 1 36  ? -1.548  5.744  15.209  1.00 24.49 ? 35  THR A C     1 
ATOM   247  O  O     . THR A 1 36  ? -1.135  6.864  15.458  1.00 24.50 ? 35  THR A O     1 
ATOM   248  C  CB    . THR A 1 36  ? -3.976  5.769  15.188  1.00 23.52 ? 35  THR A CB    1 
ATOM   249  O  OG1   . THR A 1 36  ? -5.127  5.281  15.864  1.00 22.58 ? 35  THR A OG1   1 
ATOM   250  C  CG2   . THR A 1 36  ? -4.007  5.368  13.701  1.00 28.77 ? 35  THR A CG2   1 
ATOM   251  N  N     . VAL A 1 37  ? -1.045  4.961  14.253  1.00 21.95 ? 36  VAL A N     1 
ATOM   252  C  CA    . VAL A 1 37  ? -0.119  5.457  13.276  1.00 23.83 ? 36  VAL A CA    1 
ATOM   253  C  C     . VAL A 1 37  ? -0.879  5.722  11.970  1.00 28.92 ? 36  VAL A C     1 
ATOM   254  O  O     . VAL A 1 37  ? -1.017  6.859  11.547  1.00 31.40 ? 36  VAL A O     1 
ATOM   255  C  CB    . VAL A 1 37  ? 1.074   4.496  13.105  1.00 24.38 ? 36  VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 37  ? 2.015   5.026  12.015  1.00 23.70 ? 36  VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 37  ? 1.827   4.335  14.483  1.00 22.37 ? 36  VAL A CG2   1 
ATOM   258  N  N     . PHE A 1 38  ? -1.384  4.665  11.349  1.00 23.91 ? 37  PHE A N     1 
ATOM   259  C  CA    . PHE A 1 38  ? -2.213  4.788  10.161  1.00 27.64 ? 37  PHE A CA    1 
ATOM   260  C  C     . PHE A 1 38  ? -3.045  3.496  10.078  1.00 30.49 ? 37  PHE A C     1 
ATOM   261  O  O     . PHE A 1 38  ? -2.495  2.407  10.187  1.00 26.81 ? 37  PHE A O     1 
ATOM   262  C  CB    . PHE A 1 38  ? -1.254  5.023  8.987   1.00 26.90 ? 37  PHE A CB    1 
ATOM   263  C  CG    . PHE A 1 38  ? -1.884  5.076  7.640   1.00 41.50 ? 37  PHE A CG    1 
ATOM   264  C  CD1   . PHE A 1 38  ? -1.779  6.232  6.870   1.00 40.40 ? 37  PHE A CD1   1 
ATOM   265  C  CD2   . PHE A 1 38  ? -2.475  3.955  7.081   1.00 39.75 ? 37  PHE A CD2   1 
ATOM   266  C  CE1   . PHE A 1 38  ? -2.317  6.298  5.591   1.00 52.68 ? 37  PHE A CE1   1 
ATOM   267  C  CE2   . PHE A 1 38  ? -3.015  4.006  5.796   1.00 53.91 ? 37  PHE A CE2   1 
ATOM   268  C  CZ    . PHE A 1 38  ? -2.935  5.188  5.051   1.00 53.23 ? 37  PHE A CZ    1 
ATOM   269  N  N     . ASP A 1 39  ? -4.375  3.631  9.948   1.00 26.18 ? 38  ASP A N     1 
ATOM   270  C  CA    . ASP A 1 39  ? -5.261  2.505  9.693   1.00 22.91 ? 38  ASP A CA    1 
ATOM   271  C  C     . ASP A 1 39  ? -6.317  2.932  8.692   1.00 25.93 ? 38  ASP A C     1 
ATOM   272  O  O     . ASP A 1 39  ? -6.791  4.077  8.742   1.00 25.36 ? 38  ASP A O     1 
ATOM   273  C  CB    . ASP A 1 39  ? -5.944  2.022  10.969  1.00 26.55 ? 38  ASP A CB    1 
ATOM   274  C  CG    . ASP A 1 39  ? -4.978  1.340  11.908  1.00 32.35 ? 38  ASP A CG    1 
ATOM   275  O  OD1   . ASP A 1 39  ? -4.661  0.172  11.663  1.00 26.35 ? 38  ASP A OD1   1 
ATOM   276  O  OD2   . ASP A 1 39  ? -4.510  1.978  12.869  1.00 26.75 ? 38  ASP A OD2   1 
ATOM   277  N  N     . ASN A 1 40  ? -6.675  2.001  7.816   1.00 24.44 ? 39  ASN A N     1 
ATOM   278  C  CA    . ASN A 1 40  ? -7.799  2.175  6.883   1.00 24.73 ? 39  ASN A CA    1 
ATOM   279  C  C     . ASN A 1 40  ? -8.842  1.078  7.139   1.00 28.89 ? 39  ASN A C     1 
ATOM   280  O  O     . ASN A 1 40  ? -8.516  -0.128 7.227   1.00 24.26 ? 39  ASN A O     1 
ATOM   281  C  CB    . ASN A 1 40  ? -7.301  2.111  5.440   1.00 25.25 ? 39  ASN A CB    1 
ATOM   282  C  CG    . ASN A 1 40  ? -8.420  2.123  4.422   1.00 39.29 ? 39  ASN A CG    1 
ATOM   283  O  OD1   . ASN A 1 40  ? -8.411  1.332  3.470   1.00 47.44 ? 39  ASN A OD1   1 
ATOM   284  N  ND2   . ASN A 1 40  ? -9.383  3.011  4.602   1.00 48.41 ? 39  ASN A ND2   1 
ATOM   285  N  N     . TYR A 1 41  ? -10.092 1.507  7.255   1.00 25.74 ? 40  TYR A N     1 
ATOM   286  C  CA    . TYR A 1 41  ? -11.228 0.604  7.403   1.00 23.82 ? 40  TYR A CA    1 
ATOM   287  C  C     . TYR A 1 41  ? -12.167 0.843  6.226   1.00 27.72 ? 40  TYR A C     1 
ATOM   288  O  O     . TYR A 1 41  ? -12.134 1.891  5.580   1.00 28.24 ? 40  TYR A O     1 
ATOM   289  C  CB    . TYR A 1 41  ? -11.982 0.833  8.707   1.00 24.58 ? 40  TYR A CB    1 
ATOM   290  C  CG    . TYR A 1 41  ? -11.085 1.070  9.899   1.00 24.42 ? 40  TYR A CG    1 
ATOM   291  C  CD1   . TYR A 1 41  ? -10.290 0.043  10.409  1.00 33.74 ? 40  TYR A CD1   1 
ATOM   292  C  CD2   . TYR A 1 41  ? -11.026 2.325  10.509  1.00 32.09 ? 40  TYR A CD2   1 
ATOM   293  C  CE1   . TYR A 1 41  ? -9.450  0.267  11.491  1.00 31.60 ? 40  TYR A CE1   1 
ATOM   294  C  CE2   . TYR A 1 41  ? -10.184 2.551  11.569  1.00 33.56 ? 40  TYR A CE2   1 
ATOM   295  C  CZ    . TYR A 1 41  ? -9.400  1.531  12.052  1.00 31.99 ? 40  TYR A CZ    1 
ATOM   296  O  OH    . TYR A 1 41  ? -8.577  1.751  13.140  1.00 43.90 ? 40  TYR A OH    1 
ATOM   297  N  N     . SER A 1 42  ? -12.950 -0.176 5.921   1.00 24.58 ? 41  SER A N     1 
ATOM   298  C  CA    . SER A 1 42  ? -13.937 -0.116 4.859   1.00 24.42 ? 41  SER A CA    1 
ATOM   299  C  C     . SER A 1 42  ? -15.262 -0.604 5.463   1.00 23.21 ? 41  SER A C     1 
ATOM   300  O  O     . SER A 1 42  ? -15.283 -1.500 6.305   1.00 26.42 ? 41  SER A O     1 
ATOM   301  C  CB    . SER A 1 42  ? -13.476 -1.011 3.702   1.00 30.86 ? 41  SER A CB    1 
ATOM   302  O  OG    . SER A 1 42  ? -14.533 -1.360 2.823   1.00 35.66 ? 41  SER A OG    1 
ATOM   303  N  N     . ALA A 1 43  ? -16.360 -0.002 5.024   1.00 26.12 ? 42  ALA A N     1 
ATOM   304  C  CA    . ALA A 1 43  ? -17.693 -0.451 5.409   1.00 22.45 ? 42  ALA A CA    1 
ATOM   305  C  C     . ALA A 1 43  ? -18.630 -0.017 4.303   1.00 27.63 ? 42  ALA A C     1 
ATOM   306  O  O     . ALA A 1 43  ? -18.320 0.927  3.581   1.00 27.80 ? 42  ALA A O     1 
ATOM   307  C  CB    . ALA A 1 43  ? -18.133 0.137  6.741   1.00 23.60 ? 42  ALA A CB    1 
ATOM   308  N  N     . ASN A 1 44  ? -19.758 -0.704 4.177   1.00 20.69 ? 43  ASN A N     1 
ATOM   309  C  CA    . ASN A 1 44  ? -20.757 -0.330 3.200   1.00 22.64 ? 43  ASN A CA    1 
ATOM   310  C  C     . ASN A 1 44  ? -22.003 0.207  3.898   1.00 26.08 ? 43  ASN A C     1 
ATOM   311  O  O     . ASN A 1 44  ? -22.354 -0.264 4.970   1.00 24.07 ? 43  ASN A O     1 
ATOM   312  C  CB    . ASN A 1 44  ? -21.141 -1.538 2.366   1.00 24.28 ? 43  ASN A CB    1 
ATOM   313  C  CG    . ASN A 1 44  ? -19.998 -2.065 1.537   1.00 31.70 ? 43  ASN A CG    1 
ATOM   314  O  OD1   . ASN A 1 44  ? -19.181 -1.304 0.993   1.00 30.05 ? 43  ASN A OD1   1 
ATOM   315  N  ND2   . ASN A 1 44  ? -19.950 -3.385 1.400   1.00 28.45 ? 43  ASN A ND2   1 
ATOM   316  N  N     . VAL A 1 45  ? -22.661 1.180  3.274   1.00 22.31 ? 44  VAL A N     1 
ATOM   317  C  CA    . VAL A 1 45  ? -23.975 1.622  3.705   1.00 20.02 ? 44  VAL A CA    1 
ATOM   318  C  C     . VAL A 1 45  ? -24.901 1.700  2.505   1.00 23.58 ? 44  VAL A C     1 
ATOM   319  O  O     . VAL A 1 45  ? -24.430 1.904  1.384   1.00 25.01 ? 44  VAL A O     1 
ATOM   320  C  CB    . VAL A 1 45  ? -23.931 3.004  4.369   1.00 27.23 ? 44  VAL A CB    1 
ATOM   321  C  CG1   . VAL A 1 45  ? -23.366 2.884  5.764   1.00 32.01 ? 44  VAL A CG1   1 
ATOM   322  C  CG2   . VAL A 1 45  ? -23.155 3.995  3.513   1.00 27.46 ? 44  VAL A CG2   1 
ATOM   323  N  N     . MET A 1 46  ? -26.209 1.530  2.728   1.00 22.51 ? 45  MET A N     1 
ATOM   324  C  CA    . MET A 1 46  ? -27.197 1.773  1.665   1.00 21.81 ? 45  MET A CA    1 
ATOM   325  C  C     . MET A 1 46  ? -27.643 3.226  1.763   1.00 24.93 ? 45  MET A C     1 
ATOM   326  O  O     . MET A 1 46  ? -28.023 3.692  2.840   1.00 24.54 ? 45  MET A O     1 
ATOM   327  C  CB    . MET A 1 46  ? -28.412 0.876  1.839   1.00 25.25 ? 45  MET A CB    1 
ATOM   328  C  CG    . MET A 1 46  ? -28.098 -0.605 1.619   1.00 35.55 ? 45  MET A CG    1 
ATOM   329  S  SD    . MET A 1 46  ? -27.515 -0.989 -0.038  1.00 29.54 ? 45  MET A SD    1 
ATOM   330  C  CE    . MET A 1 46  ? -28.982 -0.844 -1.022  1.00 32.04 ? 45  MET A CE    1 
ATOM   331  N  N     . VAL A 1 47  ? -27.554 3.948  0.659   1.00 22.48 ? 46  VAL A N     1 
ATOM   332  C  CA    . VAL A 1 47  ? -27.908 5.364  0.625   1.00 24.15 ? 46  VAL A CA    1 
ATOM   333  C  C     . VAL A 1 47  ? -29.008 5.512  -0.430  1.00 26.69 ? 46  VAL A C     1 
ATOM   334  O  O     . VAL A 1 47  ? -28.760 5.317  -1.632  1.00 25.66 ? 46  VAL A O     1 
ATOM   335  C  CB    . VAL A 1 47  ? -26.703 6.250  0.253   1.00 24.01 ? 46  VAL A CB    1 
ATOM   336  C  CG1   . VAL A 1 47  ? -27.168 7.719  0.170   1.00 24.90 ? 46  VAL A CG1   1 
ATOM   337  C  CG2   . VAL A 1 47  ? -25.531 6.057  1.238   1.00 24.51 ? 46  VAL A CG2   1 
ATOM   338  N  N     . ASP A 1 48  ? -30.231 5.774  0.023   1.00 24.78 ? 47  ASP A N     1 
ATOM   339  C  CA    . ASP A 1 48  ? -31.368 5.975  -0.872  1.00 27.26 ? 47  ASP A CA    1 
ATOM   340  C  C     . ASP A 1 48  ? -31.483 4.808  -1.859  1.00 28.30 ? 47  ASP A C     1 
ATOM   341  O  O     . ASP A 1 48  ? -31.705 5.003  -3.049  1.00 29.38 ? 47  ASP A O     1 
ATOM   342  C  CB    . ASP A 1 48  ? -31.240 7.315  -1.601  1.00 30.35 ? 47  ASP A CB    1 
ATOM   343  C  CG    . ASP A 1 48  ? -31.160 8.498  -0.638  1.00 33.57 ? 47  ASP A CG    1 
ATOM   344  O  OD1   . ASP A 1 48  ? -31.579 8.366  0.526   1.00 34.13 ? 47  ASP A OD1   1 
ATOM   345  O  OD2   . ASP A 1 48  ? -30.636 9.543  -1.034  1.00 33.94 ? 47  ASP A OD2   1 
ATOM   346  N  N     . GLY A 1 49  ? -31.302 3.596  -1.340  1.00 23.68 ? 48  GLY A N     1 
ATOM   347  C  CA    . GLY A 1 49  ? -31.524 2.367  -2.118  1.00 25.80 ? 48  GLY A CA    1 
ATOM   348  C  C     . GLY A 1 49  ? -30.351 1.863  -2.944  1.00 25.96 ? 48  GLY A C     1 
ATOM   349  O  O     . GLY A 1 49  ? -30.509 0.901  -3.692  1.00 26.33 ? 48  GLY A O     1 
ATOM   350  N  N     . LYS A 1 50  ? -29.186 2.493  -2.788  1.00 25.96 ? 49  LYS A N     1 
ATOM   351  C  CA    . LYS A 1 50  ? -27.980 2.120  -3.514  1.00 22.88 ? 49  LYS A CA    1 
ATOM   352  C  C     . LYS A 1 50  ? -26.806 2.000  -2.546  1.00 24.01 ? 49  LYS A C     1 
ATOM   353  O  O     . LYS A 1 50  ? -26.662 2.819  -1.632  1.00 24.07 ? 49  LYS A O     1 
ATOM   354  C  CB    . LYS A 1 50  ? -27.650 3.178  -4.579  1.00 25.78 ? 49  LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 50  ? -28.666 3.259  -5.713  1.00 29.70 ? 49  LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 50  ? -28.361 4.415  -6.659  1.00 35.47 ? 49  LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 50  ? -27.139 4.135  -7.517  1.00 33.04 ? 49  LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 50  ? -26.924 5.193  -8.592  1.00 35.33 ? 49  LYS A NZ    1 
ATOM   359  N  N     . PRO A 1 51  ? -25.944 0.993  -2.743  1.00 24.09 ? 50  PRO A N     1 
ATOM   360  C  CA    . PRO A 1 51  ? -24.823 0.843  -1.820  1.00 24.72 ? 50  PRO A CA    1 
ATOM   361  C  C     . PRO A 1 51  ? -23.694 1.810  -2.101  1.00 26.78 ? 50  PRO A C     1 
ATOM   362  O  O     . PRO A 1 51  ? -23.398 2.100  -3.266  1.00 25.11 ? 50  PRO A O     1 
ATOM   363  C  CB    . PRO A 1 51  ? -24.346 -0.575 -2.087  1.00 25.67 ? 50  PRO A CB    1 
ATOM   364  C  CG    . PRO A 1 51  ? -24.705 -0.831 -3.515  1.00 25.56 ? 50  PRO A CG    1 
ATOM   365  C  CD    . PRO A 1 51  ? -25.913 -0.010 -3.823  1.00 24.97 ? 50  PRO A CD    1 
ATOM   366  N  N     . VAL A 1 52  ? -23.077 2.291  -1.024  1.00 22.40 ? 51  VAL A N     1 
ATOM   367  C  CA    . VAL A 1 52  ? -21.906 3.118  -1.076  1.00 23.08 ? 51  VAL A CA    1 
ATOM   368  C  C     . VAL A 1 52  ? -20.837 2.511  -0.193  1.00 22.82 ? 51  VAL A C     1 
ATOM   369  O  O     . VAL A 1 52  ? -21.101 2.132  0.959   1.00 23.71 ? 51  VAL A O     1 
ATOM   370  C  CB    . VAL A 1 52  ? -22.236 4.532  -0.565  1.00 23.72 ? 51  VAL A CB    1 
ATOM   371  C  CG1   . VAL A 1 52  ? -20.983 5.396  -0.509  1.00 28.47 ? 51  VAL A CG1   1 
ATOM   372  C  CG2   . VAL A 1 52  ? -23.350 5.135  -1.449  1.00 30.59 ? 51  VAL A CG2   1 
ATOM   373  N  N     . ASN A 1 53  ? -19.642 2.420  -0.730  1.00 22.08 ? 52  ASN A N     1 
ATOM   374  C  CA    . ASN A 1 53  ? -18.498 1.970  0.050   1.00 23.66 ? 52  ASN A CA    1 
ATOM   375  C  C     . ASN A 1 53  ? -17.820 3.137  0.710   1.00 27.81 ? 52  ASN A C     1 
ATOM   376  O  O     . ASN A 1 53  ? -17.431 4.132  0.057   1.00 28.50 ? 52  ASN A O     1 
ATOM   377  C  CB    . ASN A 1 53  ? -17.465 1.221  -0.786  1.00 25.48 ? 52  ASN A CB    1 
ATOM   378  C  CG    . ASN A 1 53  ? -16.265 0.798  0.057   1.00 39.12 ? 52  ASN A CG    1 
ATOM   379  O  OD1   . ASN A 1 53  ? -15.140 1.233  -0.173  1.00 52.18 ? 52  ASN A OD1   1 
ATOM   380  N  ND2   . ASN A 1 53  ? -16.529 0.016  1.095   1.00 35.18 ? 52  ASN A ND2   1 
ATOM   381  N  N     . LEU A 1 54  ? -17.686 3.016  2.017   1.00 24.45 ? 53  LEU A N     1 
ATOM   382  C  CA    . LEU A 1 54  ? -17.012 4.016  2.814   1.00 23.97 ? 53  LEU A CA    1 
ATOM   383  C  C     . LEU A 1 54  ? -15.564 3.585  3.029   1.00 25.69 ? 53  LEU A C     1 
ATOM   384  O  O     . LEU A 1 54  ? -15.329 2.545  3.628   1.00 28.21 ? 53  LEU A O     1 
ATOM   385  C  CB    . LEU A 1 54  ? -17.692 4.116  4.161   1.00 27.11 ? 53  LEU A CB    1 
ATOM   386  C  CG    . LEU A 1 54  ? -19.179 4.456  4.168   1.00 24.97 ? 53  LEU A CG    1 
ATOM   387  C  CD1   . LEU A 1 54  ? -19.666 4.480  5.635   1.00 28.99 ? 53  LEU A CD1   1 
ATOM   388  C  CD2   . LEU A 1 54  ? -19.441 5.798  3.468   1.00 30.59 ? 53  LEU A CD2   1 
ATOM   389  N  N     . GLY A 1 55  ? -14.598 4.369  2.537   1.00 23.51 ? 54  GLY A N     1 
ATOM   390  C  CA    . GLY A 1 55  ? -13.201 4.134  2.818   1.00 24.02 ? 54  GLY A CA    1 
ATOM   391  C  C     . GLY A 1 55  ? -12.808 5.113  3.910   1.00 27.55 ? 54  GLY A C     1 
ATOM   392  O  O     . GLY A 1 55  ? -12.803 6.326  3.679   1.00 28.92 ? 54  GLY A O     1 
ATOM   393  N  N     . LEU A 1 56  ? -12.544 4.590  5.107   1.00 22.16 ? 55  LEU A N     1 
ATOM   394  C  CA    . LEU A 1 56  ? -12.379 5.401  6.304   1.00 21.64 ? 55  LEU A CA    1 
ATOM   395  C  C     . LEU A 1 56  ? -10.896 5.379  6.711   1.00 25.88 ? 55  LEU A C     1 
ATOM   396  O  O     . LEU A 1 56  ? -10.310 4.305  6.934   1.00 25.16 ? 55  LEU A O     1 
ATOM   397  C  CB    . LEU A 1 56  ? -13.231 4.830  7.430   1.00 24.05 ? 55  LEU A CB    1 
ATOM   398  C  CG    . LEU A 1 56  ? -14.733 4.818  7.134   1.00 28.01 ? 55  LEU A CG    1 
ATOM   399  C  CD1   . LEU A 1 56  ? -15.496 4.036  8.197   1.00 28.55 ? 55  LEU A CD1   1 
ATOM   400  C  CD2   . LEU A 1 56  ? -15.308 6.211  6.957   1.00 27.98 ? 55  LEU A CD2   1 
ATOM   401  N  N     . TRP A 1 57  ? -10.299 6.560  6.775   1.00 22.73 ? 56  TRP A N     1 
ATOM   402  C  CA    . TRP A 1 57  ? -8.861  6.688  6.958   1.00 23.38 ? 56  TRP A CA    1 
ATOM   403  C  C     . TRP A 1 57  ? -8.608  7.293  8.342   1.00 21.79 ? 56  TRP A C     1 
ATOM   404  O  O     . TRP A 1 57  ? -8.961  8.465  8.624   1.00 25.60 ? 56  TRP A O     1 
ATOM   405  C  CB    A TRP A 1 57  ? -8.261  7.551  5.835   0.60 27.49 ? 56  TRP A CB    1 
ATOM   406  C  CB    B TRP A 1 57  ? -8.243  7.548  5.869   0.40 27.55 ? 56  TRP A CB    1 
ATOM   407  C  CG    A TRP A 1 57  ? -8.382  6.945  4.439   0.60 32.14 ? 56  TRP A CG    1 
ATOM   408  C  CG    B TRP A 1 57  ? -8.315  6.892  4.561   0.40 31.24 ? 56  TRP A CG    1 
ATOM   409  C  CD1   A TRP A 1 57  ? -9.526  6.475  3.848   0.60 26.69 ? 56  TRP A CD1   1 
ATOM   410  C  CD1   B TRP A 1 57  ? -9.254  7.109  3.608   0.40 24.41 ? 56  TRP A CD1   1 
ATOM   411  C  CD2   A TRP A 1 57  ? -7.336  6.777  3.464   0.60 32.31 ? 56  TRP A CD2   1 
ATOM   412  C  CD2   B TRP A 1 57  ? -7.451  5.866  4.055   0.40 34.97 ? 56  TRP A CD2   1 
ATOM   413  N  NE1   A TRP A 1 57  ? -9.254  6.003  2.593   0.60 26.06 ? 56  TRP A NE1   1 
ATOM   414  N  NE1   B TRP A 1 57  ? -9.027  6.299  2.526   0.40 36.52 ? 56  TRP A NE1   1 
ATOM   415  C  CE2   A TRP A 1 57  ? -7.922  6.186  2.322   0.60 32.18 ? 56  TRP A CE2   1 
ATOM   416  C  CE2   B TRP A 1 57  ? -7.926  5.523  2.776   0.40 30.16 ? 56  TRP A CE2   1 
ATOM   417  C  CE3   A TRP A 1 57  ? -5.968  7.062  3.446   0.60 29.30 ? 56  TRP A CE3   1 
ATOM   418  C  CE3   B TRP A 1 57  ? -6.321  5.205  4.554   0.40 35.00 ? 56  TRP A CE3   1 
ATOM   419  C  CZ2   A TRP A 1 57  ? -7.182  5.876  1.166   0.60 30.97 ? 56  TRP A CZ2   1 
ATOM   420  C  CZ2   B TRP A 1 57  ? -7.310  4.559  1.982   0.40 34.04 ? 56  TRP A CZ2   1 
ATOM   421  C  CZ3   A TRP A 1 57  ? -5.226  6.754  2.283   0.60 22.57 ? 56  TRP A CZ3   1 
ATOM   422  C  CZ3   B TRP A 1 57  ? -5.711  4.233  3.745   0.40 23.81 ? 56  TRP A CZ3   1 
ATOM   423  C  CH2   A TRP A 1 57  ? -5.835  6.162  1.173   0.60 26.02 ? 56  TRP A CH2   1 
ATOM   424  C  CH2   B TRP A 1 57  ? -6.211  3.928  2.492   0.40 26.17 ? 56  TRP A CH2   1 
ATOM   425  N  N     . ASP A 1 58  ? -8.045  6.455  9.202   1.00 22.81 ? 57  ASP A N     1 
ATOM   426  C  CA    . ASP A 1 58  ? -7.780  6.794  10.574  1.00 23.43 ? 57  ASP A CA    1 
ATOM   427  C  C     . ASP A 1 58  ? -6.350  7.312  10.647  1.00 29.74 ? 57  ASP A C     1 
ATOM   428  O  O     . ASP A 1 58  ? -5.449  6.697  10.107  1.00 29.62 ? 57  ASP A O     1 
ATOM   429  C  CB    . ASP A 1 58  ? -7.976  5.584  11.445  1.00 24.01 ? 57  ASP A CB    1 
ATOM   430  C  CG    . ASP A 1 58  ? -8.145  5.930  12.941  1.00 24.72 ? 57  ASP A CG    1 
ATOM   431  O  OD1   . ASP A 1 58  ? -8.206  7.123  13.314  1.00 27.37 ? 57  ASP A OD1   1 
ATOM   432  O  OD2   . ASP A 1 58  ? -8.230  4.963  13.730  1.00 24.86 ? 57  ASP A OD2   1 
ATOM   433  N  N     . THR A 1 59  ? -6.147  8.462  11.273  1.00 23.42 ? 58  THR A N     1 
ATOM   434  C  CA    . THR A 1 59  ? -4.804  9.072  11.268  1.00 26.57 ? 58  THR A CA    1 
ATOM   435  C  C     . THR A 1 59  ? -4.287  9.258  12.705  1.00 25.95 ? 58  THR A C     1 
ATOM   436  O  O     . THR A 1 59  ? -5.052  9.146  13.663  1.00 25.37 ? 58  THR A O     1 
ATOM   437  C  CB    . THR A 1 59  ? -4.803  10.430 10.547  1.00 23.46 ? 58  THR A CB    1 
ATOM   438  O  OG1   . THR A 1 59  ? -5.601  11.385 11.269  1.00 24.52 ? 58  THR A OG1   1 
ATOM   439  C  CG2   . THR A 1 59  ? -5.327  10.327 9.091   1.00 25.60 ? 58  THR A CG2   1 
ATOM   440  N  N     . ALA A 1 60  ? -2.991  9.580  12.832  1.00 23.89 ? 59  ALA A N     1 
ATOM   441  C  CA    . ALA A 1 60  ? -2.344  9.787  14.113  1.00 22.18 ? 59  ALA A CA    1 
ATOM   442  C  C     . ALA A 1 60  ? -2.548  11.222 14.624  1.00 22.83 ? 59  ALA A C     1 
ATOM   443  O  O     . ALA A 1 60  ? -2.238  12.197 13.927  1.00 23.88 ? 59  ALA A O     1 
ATOM   444  C  CB    . ALA A 1 60  ? -0.831  9.498  13.966  1.00 23.43 ? 59  ALA A CB    1 
ATOM   445  N  N     . GLY A 1 61  ? -3.030  11.365 15.854  1.00 24.19 ? 60  GLY A N     1 
ATOM   446  C  CA    . GLY A 1 61  ? -3.083  12.695 16.494  1.00 23.81 ? 60  GLY A CA    1 
ATOM   447  C  C     . GLY A 1 61  ? -1.710  13.231 16.906  1.00 26.14 ? 60  GLY A C     1 
ATOM   448  O  O     . GLY A 1 61  ? -1.545  14.450 17.002  1.00 27.55 ? 60  GLY A O     1 
ATOM   449  N  N     . GLN A 1 62  ? -0.729  12.341 17.108  1.00 25.97 ? 61  GLN A N     1 
ATOM   450  C  CA    . GLN A 1 62  ? 0.623   12.743 17.574  1.00 27.76 ? 61  GLN A CA    1 
ATOM   451  C  C     . GLN A 1 62  ? 1.355   13.636 16.567  1.00 23.70 ? 61  GLN A C     1 
ATOM   452  O  O     . GLN A 1 62  ? 1.416   13.313 15.382  1.00 22.39 ? 61  GLN A O     1 
ATOM   453  C  CB    . GLN A 1 62  ? 1.509   11.515 17.803  1.00 29.80 ? 61  GLN A CB    1 
ATOM   454  C  CG    . GLN A 1 62  ? 1.167   10.666 19.018  1.00 43.86 ? 61  GLN A CG    1 
ATOM   455  C  CD    . GLN A 1 62  ? 1.929   9.338  19.011  1.00 38.20 ? 61  GLN A CD    1 
ATOM   456  O  OE1   . GLN A 1 62  ? 3.107   9.268  19.385  1.00 44.87 ? 61  GLN A OE1   1 
ATOM   457  N  NE2   . GLN A 1 62  ? 1.261   8.291  18.594  1.00 36.80 ? 61  GLN A NE2   1 
ATOM   458  N  N     . GLU A 1 63  ? 1.983   14.710 17.046  1.00 25.34 ? 62  GLU A N     1 
ATOM   459  C  CA    . GLU A 1 63  ? 2.755   15.569 16.155  1.00 26.61 ? 62  GLU A CA    1 
ATOM   460  C  C     . GLU A 1 63  ? 3.894   14.818 15.438  1.00 29.11 ? 62  GLU A C     1 
ATOM   461  O  O     . GLU A 1 63  ? 4.315   15.235 14.354  1.00 24.83 ? 62  GLU A O     1 
ATOM   462  C  CB    . GLU A 1 63  ? 3.309   16.782 16.911  1.00 35.70 ? 62  GLU A CB    1 
ATOM   463  C  CG    . GLU A 1 63  ? 4.385   16.432 17.886  1.00 36.61 ? 62  GLU A CG    1 
ATOM   464  C  CD    . GLU A 1 63  ? 5.015   17.651 18.512  1.00 57.90 ? 62  GLU A CD    1 
ATOM   465  O  OE1   . GLU A 1 63  ? 4.289   18.363 19.227  1.00 35.22 ? 62  GLU A OE1   1 
ATOM   466  O  OE2   . GLU A 1 63  ? 6.229   17.884 18.292  1.00 61.28 ? 62  GLU A OE2   1 
ATOM   467  N  N     . ASP A 1 64  ? 4.358   13.700 16.012  1.00 25.81 ? 63  ASP A N     1 
ATOM   468  C  CA    . ASP A 1 64  ? 5.448   12.878 15.408  1.00 22.31 ? 63  ASP A CA    1 
ATOM   469  C  C     . ASP A 1 64  ? 5.184   12.538 13.972  1.00 22.45 ? 63  ASP A C     1 
ATOM   470  O  O     . ASP A 1 64  ? 6.111   12.347 13.188  1.00 28.54 ? 63  ASP A O     1 
ATOM   471  C  CB    . ASP A 1 64  ? 5.604   11.553 16.118  1.00 32.99 ? 63  ASP A CB    1 
ATOM   472  C  CG    . ASP A 1 64  ? 5.849   11.719 17.569  1.00 34.91 ? 63  ASP A CG    1 
ATOM   473  O  OD1   . ASP A 1 64  ? 6.671   10.940 18.087  1.00 34.86 ? 63  ASP A OD1   1 
ATOM   474  O  OD2   . ASP A 1 64  ? 5.211   12.624 18.171  1.00 37.83 ? 63  ASP A OD2   1 
ATOM   475  N  N     . TYR A 1 65  ? 3.902   12.433 13.647  1.00 22.76 ? 64  TYR A N     1 
ATOM   476  C  CA    . TYR A 1 65  ? 3.472   11.961 12.356  1.00 22.33 ? 64  TYR A CA    1 
ATOM   477  C  C     . TYR A 1 65  ? 3.039   13.058 11.391  1.00 23.96 ? 64  TYR A C     1 
ATOM   478  O  O     . TYR A 1 65  ? 2.433   12.770 10.341  1.00 25.17 ? 64  TYR A O     1 
ATOM   479  C  CB    . TYR A 1 65  ? 2.408   10.882 12.551  1.00 25.99 ? 64  TYR A CB    1 
ATOM   480  C  CG    . TYR A 1 65  ? 2.996   9.691  13.289  1.00 24.34 ? 64  TYR A CG    1 
ATOM   481  C  CD1   . TYR A 1 65  ? 2.566   9.336  14.561  1.00 26.80 ? 64  TYR A CD1   1 
ATOM   482  C  CD2   . TYR A 1 65  ? 4.017   8.947  12.728  1.00 32.56 ? 64  TYR A CD2   1 
ATOM   483  C  CE1   . TYR A 1 65  ? 3.120   8.276  15.242  1.00 24.40 ? 64  TYR A CE1   1 
ATOM   484  C  CE2   . TYR A 1 65  ? 4.594   7.866  13.416  1.00 28.08 ? 64  TYR A CE2   1 
ATOM   485  C  CZ    . TYR A 1 65  ? 4.114   7.527  14.671  1.00 35.18 ? 64  TYR A CZ    1 
ATOM   486  O  OH    . TYR A 1 65  ? 4.667   6.464  15.359  1.00 37.55 ? 64  TYR A OH    1 
ATOM   487  N  N     . ASP A 1 66  ? 3.415   14.295 11.698  1.00 22.18 ? 65  ASP A N     1 
ATOM   488  C  CA    . ASP A 1 66  ? 3.042   15.433 10.862  1.00 23.85 ? 65  ASP A CA    1 
ATOM   489  C  C     . ASP A 1 66  ? 3.526   15.308 9.424   1.00 22.53 ? 65  ASP A C     1 
ATOM   490  O  O     . ASP A 1 66  ? 2.823   15.732 8.510   1.00 24.81 ? 65  ASP A O     1 
ATOM   491  C  CB    . ASP A 1 66  ? 3.539   16.754 11.479  1.00 27.07 ? 65  ASP A CB    1 
ATOM   492  C  CG    . ASP A 1 66  ? 2.694   17.212 12.665  1.00 30.18 ? 65  ASP A CG    1 
ATOM   493  O  OD1   . ASP A 1 66  ? 1.594   16.683 12.918  1.00 25.43 ? 65  ASP A OD1   1 
ATOM   494  O  OD2   . ASP A 1 66  ? 3.120   18.148 13.356  1.00 30.68 ? 65  ASP A OD2   1 
ATOM   495  N  N     . ARG A 1 67  ? 4.704   14.726 9.184   1.00 27.46 ? 66  ARG A N     1 
ATOM   496  C  CA    . ARG A 1 67  ? 5.169   14.567 7.792   1.00 27.61 ? 66  ARG A CA    1 
ATOM   497  C  C     . ARG A 1 67  ? 4.484   13.429 7.055   1.00 25.80 ? 66  ARG A C     1 
ATOM   498  O  O     . ARG A 1 67  ? 4.327   13.488 5.833   1.00 27.52 ? 66  ARG A O     1 
ATOM   499  C  CB    . ARG A 1 67  ? 6.690   14.384 7.704   1.00 34.09 ? 66  ARG A CB    1 
ATOM   500  C  CG    . ARG A 1 67  ? 7.479   15.604 8.153   1.00 39.87 ? 66  ARG A CG    1 
ATOM   501  C  CD    . ARG A 1 67  ? 8.882   15.688 7.498   1.00 40.58 ? 66  ARG A CD    1 
ATOM   502  N  NE    . ARG A 1 67  ? 8.875   16.613 6.363   1.00 56.37 ? 66  ARG A NE    1 
ATOM   503  C  CZ    . ARG A 1 67  ? 9.886   16.810 5.518   1.00 58.53 ? 66  ARG A CZ    1 
ATOM   504  N  NH1   . ARG A 1 67  ? 11.023  16.130 5.625   1.00 52.44 ? 66  ARG A NH1   1 
ATOM   505  N  NH2   . ARG A 1 67  ? 9.738   17.685 4.529   1.00 66.51 ? 66  ARG A NH2   1 
ATOM   506  N  N     . LEU A 1 68  ? 4.104   12.387 7.795   1.00 24.27 ? 67  LEU A N     1 
ATOM   507  C  CA    . LEU A 1 68  ? 3.438   11.201 7.226   1.00 25.11 ? 67  LEU A CA    1 
ATOM   508  C  C     . LEU A 1 68  ? 1.968   11.429 6.920   1.00 22.60 ? 67  LEU A C     1 
ATOM   509  O  O     . LEU A 1 68  ? 1.436   10.893 5.944   1.00 24.94 ? 67  LEU A O     1 
ATOM   510  C  CB    . LEU A 1 68  ? 3.522   10.026 8.208   1.00 31.29 ? 67  LEU A CB    1 
ATOM   511  C  CG    . LEU A 1 68  ? 2.439   8.941  7.999   1.00 40.22 ? 67  LEU A CG    1 
ATOM   512  C  CD2   . LEU A 1 68  ? 2.536   7.831  9.034   1.00 34.87 ? 67  LEU A CD2   1 
ATOM   513  N  N     . ARG A 1 69  ? 1.300   12.172 7.806   1.00 22.78 ? 68  ARG A N     1 
ATOM   514  C  CA    . ARG A 1 69  ? -0.159  12.236 7.808   1.00 22.29 ? 68  ARG A CA    1 
ATOM   515  C  C     . ARG A 1 69  ? -0.752  12.541 6.445   1.00 22.90 ? 68  ARG A C     1 
ATOM   516  O  O     . ARG A 1 69  ? -1.754  11.950 6.073   1.00 22.53 ? 68  ARG A O     1 
ATOM   517  C  CB    . ARG A 1 69  ? -0.682  13.244 8.846   1.00 24.38 ? 68  ARG A CB    1 
ATOM   518  C  CG    . ARG A 1 69  ? -2.125  12.960 9.213   1.00 21.53 ? 68  ARG A CG    1 
ATOM   519  C  CD    . ARG A 1 69  ? -2.668  13.850 10.375  1.00 22.45 ? 68  ARG A CD    1 
ATOM   520  N  NE    . ARG A 1 69  ? -1.861  13.721 11.596  1.00 24.28 ? 68  ARG A NE    1 
ATOM   521  C  CZ    . ARG A 1 69  ? -0.908  14.562 11.976  1.00 23.24 ? 68  ARG A CZ    1 
ATOM   522  N  NH1   . ARG A 1 69  ? -0.224  14.320 13.094  1.00 25.49 ? 68  ARG A NH1   1 
ATOM   523  N  NH2   . ARG A 1 69  ? -0.613  15.635 11.255  1.00 25.36 ? 68  ARG A NH2   1 
ATOM   524  N  N     . PRO A 1 70  ? -0.149  13.504 5.702   1.00 22.86 ? 69  PRO A N     1 
ATOM   525  C  CA    . PRO A 1 70  ? -0.733  13.831 4.401   1.00 23.25 ? 69  PRO A CA    1 
ATOM   526  C  C     . PRO A 1 70  ? -0.712  12.704 3.370   1.00 21.92 ? 69  PRO A C     1 
ATOM   527  O  O     . PRO A 1 70  ? -1.301  12.861 2.283   1.00 22.76 ? 69  PRO A O     1 
ATOM   528  C  CB    . PRO A 1 70  ? 0.076   15.058 3.944   1.00 22.97 ? 69  PRO A CB    1 
ATOM   529  C  CG    . PRO A 1 70  ? 0.609   15.619 5.169   1.00 25.91 ? 69  PRO A CG    1 
ATOM   530  C  CD    . PRO A 1 70  ? 0.942   14.431 6.027   1.00 30.39 ? 69  PRO A CD    1 
ATOM   531  N  N     . LEU A 1 71  ? -0.042  11.581 3.676   1.00 22.89 ? 70  LEU A N     1 
ATOM   532  C  CA    . LEU A 1 71  ? -0.195  10.393 2.835   1.00 26.73 ? 70  LEU A CA    1 
ATOM   533  C  C     . LEU A 1 71  ? -1.682  10.022 2.664   1.00 24.95 ? 70  LEU A C     1 
ATOM   534  O  O     . LEU A 1 71  ? -2.083  9.561  1.608   1.00 29.92 ? 70  LEU A O     1 
ATOM   535  C  CB    . LEU A 1 71  ? 0.602   9.204  3.387   1.00 28.71 ? 70  LEU A CB    1 
ATOM   536  C  CG    . LEU A 1 71  ? 2.134   9.223  3.270   1.00 35.10 ? 70  LEU A CG    1 
ATOM   537  C  CD1   . LEU A 1 71  ? 2.746   8.017  4.018   1.00 34.95 ? 70  LEU A CD1   1 
ATOM   538  C  CD2   . LEU A 1 71  ? 2.566   9.205  1.814   1.00 41.95 ? 70  LEU A CD2   1 
ATOM   539  N  N     . SER A 1 72  ? -2.504  10.293 3.685   1.00 21.53 ? 71  SER A N     1 
ATOM   540  C  CA    . SER A 1 72  ? -3.951  10.071 3.627   1.00 21.93 ? 71  SER A CA    1 
ATOM   541  C  C     . SER A 1 72  ? -4.794  11.025 2.807   1.00 25.49 ? 71  SER A C     1 
ATOM   542  O  O     . SER A 1 72  ? -5.977  10.726 2.524   1.00 28.12 ? 71  SER A O     1 
ATOM   543  C  CB    . SER A 1 72  ? -4.519  10.113 5.061   1.00 25.32 ? 71  SER A CB    1 
ATOM   544  O  OG    . SER A 1 72  ? -3.982  9.051  5.772   1.00 32.71 ? 71  SER A OG    1 
ATOM   545  N  N     . TYR A 1 73  ? -4.245  12.189 2.460   1.00 24.79 ? 72  TYR A N     1 
ATOM   546  C  CA    . TYR A 1 73  ? -5.108  13.297 2.023   1.00 23.49 ? 72  TYR A CA    1 
ATOM   547  C  C     . TYR A 1 73  ? -5.570  13.320 0.557   1.00 26.13 ? 72  TYR A C     1 
ATOM   548  O  O     . TYR A 1 73  ? -6.699  13.742 0.287   1.00 25.07 ? 72  TYR A O     1 
ATOM   549  C  CB    . TYR A 1 73  ? -4.479  14.649 2.397   1.00 26.13 ? 72  TYR A CB    1 
ATOM   550  C  CG    . TYR A 1 73  ? -4.322  14.882 3.889   1.00 22.96 ? 72  TYR A CG    1 
ATOM   551  C  CD1   . TYR A 1 73  ? -4.967  14.087 4.835   1.00 25.61 ? 72  TYR A CD1   1 
ATOM   552  C  CD2   . TYR A 1 73  ? -3.554  15.944 4.362   1.00 23.09 ? 72  TYR A CD2   1 
ATOM   553  C  CE1   . TYR A 1 73  ? -4.796  14.335 6.220   1.00 22.00 ? 72  TYR A CE1   1 
ATOM   554  C  CE2   . TYR A 1 73  ? -3.390  16.192 5.724   1.00 19.62 ? 72  TYR A CE2   1 
ATOM   555  C  CZ    . TYR A 1 73  ? -4.015  15.396 6.643   1.00 23.01 ? 72  TYR A CZ    1 
ATOM   556  O  OH    . TYR A 1 73  ? -3.866  15.657 7.986   1.00 24.46 ? 72  TYR A OH    1 
ATOM   557  N  N     . PRO A 1 74  ? -4.692  12.969 -0.396  1.00 25.55 ? 73  PRO A N     1 
ATOM   558  C  CA    . PRO A 1 74  ? -5.125  13.063 -1.794  1.00 24.67 ? 73  PRO A CA    1 
ATOM   559  C  C     . PRO A 1 74  ? -6.413  12.298 -2.084  1.00 25.92 ? 73  PRO A C     1 
ATOM   560  O  O     . PRO A 1 74  ? -6.558  11.174 -1.628  1.00 30.14 ? 73  PRO A O     1 
ATOM   561  C  CB    . PRO A 1 74  ? -3.949  12.439 -2.577  1.00 26.77 ? 73  PRO A CB    1 
ATOM   562  C  CG    . PRO A 1 74  ? -2.758  12.692 -1.707  1.00 26.03 ? 73  PRO A CG    1 
ATOM   563  C  CD    . PRO A 1 74  ? -3.275  12.552 -0.283  1.00 26.19 ? 73  PRO A CD    1 
ATOM   564  N  N     . GLN A 1 75  ? -7.316  12.913 -2.839  1.00 26.83 ? 74  GLN A N     1 
ATOM   565  C  CA    . GLN A 1 75  ? -8.558  12.262 -3.284  1.00 30.00 ? 74  GLN A CA    1 
ATOM   566  C  C     . GLN A 1 75  ? -9.554  12.069 -2.142  1.00 26.43 ? 74  GLN A C     1 
ATOM   567  O  O     . GLN A 1 75  ? -10.538 11.344 -2.289  1.00 28.61 ? 74  GLN A O     1 
ATOM   568  C  CB    . GLN A 1 75  ? -8.288  10.912 -3.979  1.00 32.86 ? 74  GLN A CB    1 
ATOM   569  C  CG    . GLN A 1 75  ? -7.159  10.954 -5.033  1.00 36.54 ? 74  GLN A CG    1 
ATOM   570  C  CD    . GLN A 1 75  ? -6.931  9.612  -5.734  1.00 51.54 ? 74  GLN A CD    1 
ATOM   571  O  OE1   . GLN A 1 75  ? -7.015  9.525  -6.961  1.00 53.22 ? 74  GLN A OE1   1 
ATOM   572  N  NE2   . GLN A 1 75  ? -6.632  8.564  -4.951  1.00 44.28 ? 74  GLN A NE2   1 
ATOM   573  N  N     . THR A 1 76  ? -9.345  12.748 -1.018  1.00 23.80 ? 75  THR A N     1 
ATOM   574  C  CA    . THR A 1 76  ? -10.343 12.731 0.065   1.00 27.18 ? 75  THR A CA    1 
ATOM   575  C  C     . THR A 1 76  ? -11.620 13.450 -0.361  1.00 26.39 ? 75  THR A C     1 
ATOM   576  O  O     . THR A 1 76  ? -11.574 14.527 -0.949  1.00 27.92 ? 75  THR A O     1 
ATOM   577  C  CB    . THR A 1 76  ? -9.781  13.409 1.325   1.00 27.97 ? 75  THR A CB    1 
ATOM   578  O  OG1   . THR A 1 76  ? -8.633  12.681 1.735   1.00 28.08 ? 75  THR A OG1   1 
ATOM   579  C  CG2   . THR A 1 76  ? -10.811 13.459 2.480   1.00 27.76 ? 75  THR A CG2   1 
ATOM   580  N  N     . ASP A 1 77  ? -12.770 12.855 -0.048  1.00 27.15 ? 76  ASP A N     1 
ATOM   581  C  CA    . ASP A 1 77  ? -14.072 13.455 -0.337  1.00 22.47 ? 76  ASP A CA    1 
ATOM   582  C  C     . ASP A 1 77  ? -14.639 14.292 0.799   1.00 25.63 ? 76  ASP A C     1 
ATOM   583  O  O     . ASP A 1 77  ? -15.413 15.231 0.553   1.00 22.24 ? 76  ASP A O     1 
ATOM   584  C  CB    . ASP A 1 77  ? -15.083 12.373 -0.703  1.00 24.08 ? 76  ASP A CB    1 
ATOM   585  C  CG    . ASP A 1 77  ? -14.688 11.616 -1.968  1.00 34.27 ? 76  ASP A CG    1 
ATOM   586  O  OD1   . ASP A 1 77  ? -14.483 12.269 -3.005  1.00 30.20 ? 76  ASP A OD1   1 
ATOM   587  O  OD2   . ASP A 1 77  ? -14.557 10.381 -1.909  1.00 26.17 ? 76  ASP A OD2   1 
ATOM   588  N  N     . VAL A 1 78  ? -14.275 13.926 2.033   1.00 26.28 ? 77  VAL A N     1 
ATOM   589  C  CA    . VAL A 1 78  ? -14.737 14.629 3.220   1.00 23.06 ? 77  VAL A CA    1 
ATOM   590  C  C     . VAL A 1 78  ? -13.817 14.339 4.405   1.00 23.27 ? 77  VAL A C     1 
ATOM   591  O  O     . VAL A 1 78  ? -13.296 13.243 4.524   1.00 23.20 ? 77  VAL A O     1 
ATOM   592  C  CB    . VAL A 1 78  ? -16.202 14.259 3.574   1.00 26.52 ? 77  VAL A CB    1 
ATOM   593  C  CG1   . VAL A 1 78  ? -16.363 12.758 3.839   1.00 21.07 ? 77  VAL A CG1   1 
ATOM   594  C  CG2   . VAL A 1 78  ? -16.711 15.097 4.763   1.00 25.06 ? 77  VAL A CG2   1 
ATOM   595  N  N     . PHE A 1 79  ? -13.575 15.377 5.206   1.00 22.00 ? 78  PHE A N     1 
ATOM   596  C  CA    . PHE A 1 79  ? -12.780 15.295 6.427   1.00 21.22 ? 78  PHE A CA    1 
ATOM   597  C  C     . PHE A 1 79  ? -13.676 15.378 7.640   1.00 22.63 ? 78  PHE A C     1 
ATOM   598  O  O     . PHE A 1 79  ? -14.656 16.128 7.666   1.00 25.60 ? 78  PHE A O     1 
ATOM   599  C  CB    . PHE A 1 79  ? -11.762 16.441 6.495   1.00 25.48 ? 78  PHE A CB    1 
ATOM   600  C  CG    . PHE A 1 79  ? -10.580 16.253 5.598   1.00 27.41 ? 78  PHE A CG    1 
ATOM   601  C  CD1   . PHE A 1 79  ? -9.481  15.528 6.024   1.00 25.70 ? 78  PHE A CD1   1 
ATOM   602  C  CD2   . PHE A 1 79  ? -10.574 16.798 4.313   1.00 24.86 ? 78  PHE A CD2   1 
ATOM   603  C  CE1   . PHE A 1 79  ? -8.373  15.366 5.192   1.00 24.51 ? 78  PHE A CE1   1 
ATOM   604  C  CE2   . PHE A 1 79  ? -9.485  16.631 3.469   1.00 29.65 ? 78  PHE A CE2   1 
ATOM   605  C  CZ    . PHE A 1 79  ? -8.391  15.895 3.897   1.00 26.80 ? 78  PHE A CZ    1 
ATOM   606  N  N     . LEU A 1 80  ? -13.302 14.624 8.667   1.00 20.35 ? 79  LEU A N     1 
ATOM   607  C  CA    . LEU A 1 80  ? -13.818 14.844 10.012  1.00 21.11 ? 79  LEU A CA    1 
ATOM   608  C  C     . LEU A 1 80  ? -12.672 15.375 10.848  1.00 21.85 ? 79  LEU A C     1 
ATOM   609  O  O     . LEU A 1 80  ? -11.669 14.675 11.069  1.00 25.34 ? 79  LEU A O     1 
ATOM   610  C  CB    . LEU A 1 80  ? -14.389 13.552 10.604  1.00 22.26 ? 79  LEU A CB    1 
ATOM   611  C  CG    . LEU A 1 80  ? -15.417 12.731 9.804   1.00 26.38 ? 79  LEU A CG    1 
ATOM   612  C  CD1   . LEU A 1 80  ? -15.985 11.527 10.636  1.00 25.51 ? 79  LEU A CD1   1 
ATOM   613  C  CD2   . LEU A 1 80  ? -16.565 13.606 9.324   1.00 22.96 ? 79  LEU A CD2   1 
ATOM   614  N  N     . ILE A 1 81  ? -12.763 16.635 11.240  1.00 23.94 ? 80  ILE A N     1 
ATOM   615  C  CA    . ILE A 1 81  ? -11.856 17.189 12.222  1.00 23.16 ? 80  ILE A CA    1 
ATOM   616  C  C     . ILE A 1 81  ? -12.520 17.045 13.586  1.00 23.84 ? 80  ILE A C     1 
ATOM   617  O  O     . ILE A 1 81  ? -13.649 17.560 13.809  1.00 23.98 ? 80  ILE A O     1 
ATOM   618  C  CB    . ILE A 1 81  ? -11.558 18.675 11.973  1.00 22.87 ? 80  ILE A CB    1 
ATOM   619  C  CG1   . ILE A 1 81  ? -10.823 18.863 10.644  1.00 22.36 ? 80  ILE A CG1   1 
ATOM   620  C  CG2   . ILE A 1 81  ? -10.697 19.227 13.104  1.00 23.10 ? 80  ILE A CG2   1 
ATOM   621  C  CD1   . ILE A 1 81  ? -10.540 20.349 10.338  1.00 25.37 ? 80  ILE A CD1   1 
ATOM   622  N  N     . CYS A 1 82  ? -11.812 16.389 14.498  1.00 23.73 ? 81  CYS A N     1 
ATOM   623  C  CA    . CYS A 1 82  ? -12.368 15.959 15.761  1.00 20.81 ? 81  CYS A CA    1 
ATOM   624  C  C     . CYS A 1 82  ? -11.684 16.660 16.930  1.00 24.37 ? 81  CYS A C     1 
ATOM   625  O  O     . CYS A 1 82  ? -10.470 16.905 16.912  1.00 22.74 ? 81  CYS A O     1 
ATOM   626  C  CB    . CYS A 1 82  ? -12.182 14.464 15.957  1.00 25.84 ? 81  CYS A CB    1 
ATOM   627  S  SG    . CYS A 1 82  ? -13.066 13.404 14.814  1.00 26.66 ? 81  CYS A SG    1 
ATOM   628  N  N     . PHE A 1 83  ? -12.481 16.979 17.939  1.00 22.52 ? 82  PHE A N     1 
ATOM   629  C  CA    . PHE A 1 83  ? -11.952 17.446 19.219  1.00 22.67 ? 82  PHE A CA    1 
ATOM   630  C  C     . PHE A 1 83  ? -12.824 16.901 20.327  1.00 23.11 ? 82  PHE A C     1 
ATOM   631  O  O     . PHE A 1 83  ? -14.025 16.654 20.146  1.00 22.89 ? 82  PHE A O     1 
ATOM   632  C  CB    . PHE A 1 83  ? -11.910 18.977 19.267  1.00 23.28 ? 82  PHE A CB    1 
ATOM   633  C  CG    . PHE A 1 83  ? -13.253 19.588 19.401  1.00 20.69 ? 82  PHE A CG    1 
ATOM   634  C  CD1   . PHE A 1 83  ? -14.053 19.776 18.285  1.00 24.22 ? 82  PHE A CD1   1 
ATOM   635  C  CD2   . PHE A 1 83  ? -13.747 19.934 20.650  1.00 21.62 ? 82  PHE A CD2   1 
ATOM   636  C  CE1   . PHE A 1 83  ? -15.335 20.334 18.400  1.00 27.73 ? 82  PHE A CE1   1 
ATOM   637  C  CE2   . PHE A 1 83  ? -15.031 20.451 20.797  1.00 22.61 ? 82  PHE A CE2   1 
ATOM   638  C  CZ    . PHE A 1 83  ? -15.836 20.656 19.664  1.00 25.49 ? 82  PHE A CZ    1 
ATOM   639  N  N     . SER A 1 84  ? -12.238 16.767 21.521  1.00 22.20 ? 83  SER A N     1 
ATOM   640  C  CA    . SER A 1 84  ? -13.006 16.238 22.630  1.00 23.05 ? 83  SER A CA    1 
ATOM   641  C  C     . SER A 1 84  ? -13.769 17.383 23.266  1.00 25.58 ? 83  SER A C     1 
ATOM   642  O  O     . SER A 1 84  ? -13.163 18.378 23.611  1.00 23.73 ? 83  SER A O     1 
ATOM   643  C  CB    . SER A 1 84  ? -12.094 15.645 23.688  1.00 23.19 ? 83  SER A CB    1 
ATOM   644  O  OG    . SER A 1 84  ? -12.819 15.402 24.889  1.00 21.90 ? 83  SER A OG    1 
ATOM   645  N  N     . LEU A 1 85  ? -15.062 17.196 23.508  1.00 23.20 ? 84  LEU A N     1 
ATOM   646  C  CA    . LEU A 1 85  ? -15.891 18.224 24.128  1.00 25.04 ? 84  LEU A CA    1 
ATOM   647  C  C     . LEU A 1 85  ? -15.452 18.543 25.563  1.00 22.55 ? 84  LEU A C     1 
ATOM   648  O  O     . LEU A 1 85  ? -15.887 19.546 26.145  1.00 27.73 ? 84  LEU A O     1 
ATOM   649  C  CB    . LEU A 1 85  ? -17.360 17.795 24.122  1.00 24.74 ? 84  LEU A CB    1 
ATOM   650  C  CG    . LEU A 1 85  ? -17.978 17.769 22.736  1.00 22.29 ? 84  LEU A CG    1 
ATOM   651  C  CD1   . LEU A 1 85  ? -19.307 17.024 22.669  1.00 24.75 ? 84  LEU A CD1   1 
ATOM   652  C  CD2   . LEU A 1 85  ? -18.166 19.242 22.277  1.00 24.35 ? 84  LEU A CD2   1 
ATOM   653  N  N     . VAL A 1 86  ? -14.604 17.685 26.132  1.00 21.55 ? 85  VAL A N     1 
ATOM   654  C  CA    . VAL A 1 86  ? -14.121 17.908 27.504  1.00 23.71 ? 85  VAL A CA    1 
ATOM   655  C  C     . VAL A 1 86  ? -12.619 18.191 27.551  1.00 31.60 ? 85  VAL A C     1 
ATOM   656  O  O     . VAL A 1 86  ? -12.001 18.076 28.607  1.00 25.11 ? 85  VAL A O     1 
ATOM   657  C  CB    . VAL A 1 86  ? -14.573 16.742 28.429  1.00 23.53 ? 85  VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 86  ? -16.109 16.697 28.445  1.00 24.34 ? 85  VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 86  ? -13.968 15.377 27.986  1.00 24.66 ? 85  VAL A CG2   1 
ATOM   660  N  N     . SER A 1 87  ? -12.068 18.625 26.407  1.00 25.50 ? 86  SER A N     1 
ATOM   661  C  CA    . SER A 1 87  ? -10.677 19.093 26.283  1.00 24.30 ? 86  SER A CA    1 
ATOM   662  C  C     . SER A 1 87  ? -10.595 20.394 25.485  1.00 33.39 ? 86  SER A C     1 
ATOM   663  O  O     . SER A 1 87  ? -10.443 20.405 24.237  1.00 26.29 ? 86  SER A O     1 
ATOM   664  C  CB    . SER A 1 87  ? -9.789  18.035 25.634  1.00 29.73 ? 86  SER A CB    1 
ATOM   665  O  OG    . SER A 1 87  ? -8.479  18.552 25.476  1.00 26.92 ? 86  SER A OG    1 
ATOM   666  N  N     . PRO A 1 88  ? -10.715 21.515 26.193  1.00 29.04 ? 87  PRO A N     1 
ATOM   667  C  CA    . PRO A 1 88  ? -10.501 22.829 25.565  1.00 28.07 ? 87  PRO A CA    1 
ATOM   668  C  C     . PRO A 1 88  ? -9.184  22.939 24.759  1.00 26.77 ? 87  PRO A C     1 
ATOM   669  O  O     . PRO A 1 88  ? -9.158  23.619 23.714  1.00 26.00 ? 87  PRO A O     1 
ATOM   670  C  CB    . PRO A 1 88  ? -10.542 23.792 26.768  1.00 28.04 ? 87  PRO A CB    1 
ATOM   671  C  CG    . PRO A 1 88  ? -11.469 23.079 27.773  1.00 31.50 ? 87  PRO A CG    1 
ATOM   672  C  CD    . PRO A 1 88  ? -11.099 21.628 27.620  1.00 30.78 ? 87  PRO A CD    1 
ATOM   673  N  N     . ALA A 1 89  ? -8.100  22.276 25.191  1.00 26.83 ? 88  ALA A N     1 
ATOM   674  C  CA    . ALA A 1 89  ? -6.851  22.296 24.403  1.00 26.45 ? 88  ALA A CA    1 
ATOM   675  C  C     . ALA A 1 89  ? -7.072  21.702 23.007  1.00 23.73 ? 88  ALA A C     1 
ATOM   676  O  O     . ALA A 1 89  ? -6.609  22.222 21.984  1.00 25.62 ? 88  ALA A O     1 
ATOM   677  C  CB    . ALA A 1 89  ? -5.738  21.540 25.125  1.00 28.32 ? 88  ALA A CB    1 
ATOM   678  N  N     . SER A 1 90  ? -7.793  20.602 22.959  1.00 23.90 ? 89  SER A N     1 
ATOM   679  C  CA    . SER A 1 90  ? -8.040  19.923 21.676  1.00 24.99 ? 89  SER A CA    1 
ATOM   680  C  C     . SER A 1 90  ? -8.917  20.772 20.752  1.00 24.22 ? 89  SER A C     1 
ATOM   681  O  O     . SER A 1 90  ? -8.735  20.770 19.547  1.00 23.08 ? 89  SER A O     1 
ATOM   682  C  CB    . SER A 1 90  ? -8.628  18.534 21.908  1.00 22.14 ? 89  SER A CB    1 
ATOM   683  O  OG    . SER A 1 90  ? -10.016 18.583 22.205  1.00 23.07 ? 89  SER A OG    1 
ATOM   684  N  N     . PHE A 1 91  ? -9.835  21.526 21.354  1.00 25.35 ? 90  PHE A N     1 
ATOM   685  C  CA    . PHE A 1 91  ? -10.741 22.430 20.657  1.00 27.98 ? 90  PHE A CA    1 
ATOM   686  C  C     . PHE A 1 91  ? -9.927  23.555 20.023  1.00 29.10 ? 90  PHE A C     1 
ATOM   687  O  O     . PHE A 1 91  ? -10.093 23.867 18.841  1.00 24.55 ? 90  PHE A O     1 
ATOM   688  C  CB    . PHE A 1 91  ? -11.737 23.004 21.669  1.00 24.07 ? 90  PHE A CB    1 
ATOM   689  C  CG    . PHE A 1 91  ? -12.831 23.856 21.083  1.00 21.76 ? 90  PHE A CG    1 
ATOM   690  C  CD1   . PHE A 1 91  ? -13.610 23.409 20.029  1.00 25.89 ? 90  PHE A CD1   1 
ATOM   691  C  CD2   . PHE A 1 91  ? -13.097 25.112 21.633  1.00 28.05 ? 90  PHE A CD2   1 
ATOM   692  C  CE1   . PHE A 1 91  ? -14.631 24.201 19.519  1.00 26.16 ? 90  PHE A CE1   1 
ATOM   693  C  CE2   . PHE A 1 91  ? -14.126 25.915 21.130  1.00 26.13 ? 90  PHE A CE2   1 
ATOM   694  C  CZ    . PHE A 1 91  ? -14.890 25.460 20.096  1.00 22.85 ? 90  PHE A CZ    1 
ATOM   695  N  N     . GLU A 1 92  ? -9.015  24.143 20.793  1.00 25.28 ? 91  GLU A N     1 
ATOM   696  C  CA    . GLU A 1 92  ? -8.182  25.224 20.273  1.00 25.02 ? 91  GLU A CA    1 
ATOM   697  C  C     . GLU A 1 92  ? -7.372  24.775 19.072  1.00 23.29 ? 91  GLU A C     1 
ATOM   698  O  O     . GLU A 1 92  ? -7.183  25.536 18.123  1.00 25.70 ? 91  GLU A O     1 
ATOM   699  C  CB    . GLU A 1 92  ? -7.236  25.737 21.355  1.00 26.48 ? 91  GLU A CB    1 
ATOM   700  C  CG    . GLU A 1 92  ? -6.181  26.733 20.840  1.00 33.21 ? 91  GLU A CG    1 
ATOM   701  C  CD    . GLU A 1 92  ? -6.767  27.996 20.216  1.00 38.94 ? 91  GLU A CD    1 
ATOM   702  O  OE1   . GLU A 1 92  ? -6.058  28.634 19.411  1.00 44.21 ? 91  GLU A OE1   1 
ATOM   703  O  OE2   . GLU A 1 92  ? -7.911  28.365 20.551  1.00 41.35 ? 91  GLU A OE2   1 
ATOM   704  N  N     . ASN A 1 93  ? -6.916  23.528 19.098  1.00 23.84 ? 92  ASN A N     1 
ATOM   705  C  CA    . ASN A 1 93  ? -6.103  23.007 18.000  1.00 25.64 ? 92  ASN A CA    1 
ATOM   706  C  C     . ASN A 1 93  ? -6.852  22.761 16.707  1.00 22.88 ? 92  ASN A C     1 
ATOM   707  O  O     . ASN A 1 93  ? -6.238  22.611 15.654  1.00 23.60 ? 92  ASN A O     1 
ATOM   708  C  CB    . ASN A 1 93  ? -5.306  21.792 18.442  1.00 28.11 ? 92  ASN A CB    1 
ATOM   709  C  CG    . ASN A 1 93  ? -4.059  22.188 19.201  1.00 43.27 ? 92  ASN A CG    1 
ATOM   710  O  OD1   . ASN A 1 93  ? -3.431  23.217 18.894  1.00 35.94 ? 92  ASN A OD1   1 
ATOM   711  N  ND2   . ASN A 1 93  ? -3.708  21.407 20.206  1.00 33.22 ? 92  ASN A ND2   1 
ATOM   712  N  N     . VAL A 1 94  ? -8.184  22.735 16.769  1.00 23.17 ? 93  VAL A N     1 
ATOM   713  C  CA    . VAL A 1 94  ? -9.000  22.703 15.564  1.00 24.16 ? 93  VAL A CA    1 
ATOM   714  C  C     . VAL A 1 94  ? -8.618  23.879 14.653  1.00 25.82 ? 93  VAL A C     1 
ATOM   715  O  O     . VAL A 1 94  ? -8.356  23.719 13.455  1.00 24.26 ? 93  VAL A O     1 
ATOM   716  C  CB    . VAL A 1 94  ? -10.502 22.781 15.906  1.00 24.97 ? 93  VAL A CB    1 
ATOM   717  C  CG1   . VAL A 1 94  ? -11.314 23.018 14.646  1.00 26.02 ? 93  VAL A CG1   1 
ATOM   718  C  CG2   . VAL A 1 94  ? -10.951 21.494 16.653  1.00 25.81 ? 93  VAL A CG2   1 
ATOM   719  N  N     . ARG A 1 95  ? -8.563  25.049 15.259  1.00 24.69 ? 94  ARG A N     1 
ATOM   720  C  CA    . ARG A 1 95  ? -8.247  26.299 14.598  1.00 22.77 ? 94  ARG A CA    1 
ATOM   721  C  C     . ARG A 1 95  ? -6.749  26.442 14.355  1.00 26.04 ? 94  ARG A C     1 
ATOM   722  O  O     . ARG A 1 95  ? -6.339  26.868 13.279  1.00 26.19 ? 94  ARG A O     1 
ATOM   723  C  CB    . ARG A 1 95  ? -8.710  27.433 15.521  1.00 30.86 ? 94  ARG A CB    1 
ATOM   724  C  CG    . ARG A 1 95  ? -8.536  28.816 15.045  1.00 48.16 ? 94  ARG A CG    1 
ATOM   725  C  CD    . ARG A 1 95  ? -9.394  29.739 15.904  1.00 43.56 ? 94  ARG A CD    1 
ATOM   726  N  NE    . ARG A 1 95  ? -9.092  29.716 17.341  1.00 48.16 ? 94  ARG A NE    1 
ATOM   727  C  CZ    . ARG A 1 95  ? -9.799  30.376 18.262  1.00 58.51 ? 94  ARG A CZ    1 
ATOM   728  N  NH1   . ARG A 1 95  ? -9.454  30.330 19.540  1.00 59.85 ? 94  ARG A NH1   1 
ATOM   729  N  NH2   . ARG A 1 95  ? -10.863 31.089 17.914  1.00 44.86 ? 94  ARG A NH2   1 
ATOM   730  N  N     . ALA A 1 96  ? -5.952  26.127 15.375  1.00 24.28 ? 95  ALA A N     1 
ATOM   731  C  CA    . ALA A 1 96  ? -4.499  26.369 15.340  1.00 27.65 ? 95  ALA A CA    1 
ATOM   732  C  C     . ALA A 1 96  ? -3.759  25.411 14.424  1.00 28.33 ? 95  ALA A C     1 
ATOM   733  O  O     . ALA A 1 96  ? -2.765  25.805 13.817  1.00 28.40 ? 95  ALA A O     1 
ATOM   734  C  CB    . ALA A 1 96  ? -3.901  26.311 16.740  1.00 26.28 ? 95  ALA A CB    1 
ATOM   735  N  N     . LYS A 1 97  ? -4.237  24.160 14.332  1.00 24.33 ? 96  LYS A N     1 
ATOM   736  C  CA    . LYS A 1 97  ? -3.501  23.112 13.604  1.00 19.88 ? 96  LYS A CA    1 
ATOM   737  C  C     . LYS A 1 97  ? -4.306  22.439 12.491  1.00 26.11 ? 96  LYS A C     1 
ATOM   738  O  O     . LYS A 1 97  ? -3.862  22.388 11.333  1.00 25.83 ? 96  LYS A O     1 
ATOM   739  C  CB    . LYS A 1 97  ? -2.995  22.035 14.571  1.00 21.50 ? 96  LYS A CB    1 
ATOM   740  C  CG    . LYS A 1 97  ? -2.111  21.026 13.834  1.00 26.96 ? 96  LYS A CG    1 
ATOM   741  C  CD    . LYS A 1 97  ? -1.528  19.940 14.728  1.00 29.84 ? 96  LYS A CD    1 
ATOM   742  C  CE    . LYS A 1 97  ? -0.566  19.038 13.884  1.00 33.83 ? 96  LYS A CE    1 
ATOM   743  N  NZ    . LYS A 1 97  ? 0.419   18.325 14.733  1.00 32.63 ? 96  LYS A NZ    1 
ATOM   744  N  N     . TRP A 1 98  ? -5.454  21.870 12.842  1.00 22.12 ? 97  TRP A N     1 
ATOM   745  C  CA    . TRP A 1 98  ? -6.110  20.907 11.938  1.00 23.98 ? 97  TRP A CA    1 
ATOM   746  C  C     . TRP A 1 98  ? -6.723  21.555 10.700  1.00 23.80 ? 97  TRP A C     1 
ATOM   747  O  O     . TRP A 1 98  ? -6.527  21.088 9.575   1.00 22.27 ? 97  TRP A O     1 
ATOM   748  C  CB    . TRP A 1 98  ? -7.098  20.010 12.717  1.00 20.09 ? 97  TRP A CB    1 
ATOM   749  C  CG    . TRP A 1 98  ? -6.380  19.251 13.758  1.00 20.37 ? 97  TRP A CG    1 
ATOM   750  C  CD1   . TRP A 1 98  ? -6.452  19.444 15.111  1.00 23.51 ? 97  TRP A CD1   1 
ATOM   751  C  CD2   . TRP A 1 98  ? -5.369  18.270 13.546  1.00 22.66 ? 97  TRP A CD2   1 
ATOM   752  N  NE1   . TRP A 1 98  ? -5.584  18.608 15.750  1.00 26.57 ? 97  TRP A NE1   1 
ATOM   753  C  CE2   . TRP A 1 98  ? -4.903  17.870 14.810  1.00 26.93 ? 97  TRP A CE2   1 
ATOM   754  C  CE3   . TRP A 1 98  ? -4.832  17.655 12.400  1.00 20.39 ? 97  TRP A CE3   1 
ATOM   755  C  CZ2   . TRP A 1 98  ? -3.902  16.896 14.963  1.00 25.83 ? 97  TRP A CZ2   1 
ATOM   756  C  CZ3   . TRP A 1 98  ? -3.857  16.693 12.553  1.00 21.32 ? 97  TRP A CZ3   1 
ATOM   757  C  CH2   . TRP A 1 98  ? -3.411  16.306 13.823  1.00 25.25 ? 97  TRP A CH2   1 
ATOM   758  N  N     . TYR A 1 99  ? -7.471  22.636 10.900  1.00 22.28 ? 98  TYR A N     1 
ATOM   759  C  CA    . TYR A 1 99  ? -8.064  23.352 9.763   1.00 23.34 ? 98  TYR A CA    1 
ATOM   760  C  C     . TYR A 1 99  ? -6.992  23.781 8.747   1.00 24.02 ? 98  TYR A C     1 
ATOM   761  O  O     . TYR A 1 99  ? -7.091  23.437 7.567   1.00 25.36 ? 98  TYR A O     1 
ATOM   762  C  CB    . TYR A 1 99  ? -8.951  24.508 10.256  1.00 27.85 ? 98  TYR A CB    1 
ATOM   763  C  CG    . TYR A 1 99  ? -9.256  25.559 9.217   1.00 30.19 ? 98  TYR A CG    1 
ATOM   764  C  CD1   . TYR A 1 99  ? -9.842  25.220 7.995   1.00 29.76 ? 98  TYR A CD1   1 
ATOM   765  C  CD2   . TYR A 1 99  ? -8.966  26.908 9.456   1.00 33.81 ? 98  TYR A CD2   1 
ATOM   766  C  CE1   . TYR A 1 99  ? -10.139 26.210 7.037   1.00 35.77 ? 98  TYR A CE1   1 
ATOM   767  C  CE2   . TYR A 1 99  ? -9.258  27.887 8.508   1.00 37.29 ? 98  TYR A CE2   1 
ATOM   768  C  CZ    . TYR A 1 99  ? -9.841  27.531 7.303   1.00 37.44 ? 98  TYR A CZ    1 
ATOM   769  O  OH    . TYR A 1 99  ? -10.126 28.520 6.373   1.00 43.54 ? 98  TYR A OH    1 
ATOM   770  N  N     . PRO A 1 100 ? -5.953  24.504 9.192   1.00 26.55 ? 99  PRO A N     1 
ATOM   771  C  CA    . PRO A 1 100 ? -4.905  24.924 8.236   1.00 25.96 ? 99  PRO A CA    1 
ATOM   772  C  C     . PRO A 1 100 ? -4.148  23.776 7.565   1.00 24.28 ? 99  PRO A C     1 
ATOM   773  O  O     . PRO A 1 100 ? -3.778  23.917 6.410   1.00 24.63 ? 99  PRO A O     1 
ATOM   774  C  CB    . PRO A 1 100 ? -3.943  25.755 9.088   1.00 28.06 ? 99  PRO A CB    1 
ATOM   775  C  CG    . PRO A 1 100 ? -4.617  25.984 10.378  1.00 35.54 ? 99  PRO A CG    1 
ATOM   776  C  CD    . PRO A 1 100 ? -5.742  25.045 10.543  1.00 26.16 ? 99  PRO A CD    1 
ATOM   777  N  N     . GLU A 1 101 ? -3.927  22.667 8.279   1.00 26.23 ? 100 GLU A N     1 
ATOM   778  C  CA    . GLU A 1 101 ? -3.266  21.479 7.691   1.00 22.77 ? 100 GLU A CA    1 
ATOM   779  C  C     . GLU A 1 101 ? -4.108  20.912 6.557   1.00 23.36 ? 100 GLU A C     1 
ATOM   780  O  O     . GLU A 1 101 ? -3.648  20.766 5.413   1.00 23.60 ? 100 GLU A O     1 
ATOM   781  C  CB    . GLU A 1 101 ? -2.985  20.404 8.748   1.00 23.07 ? 100 GLU A CB    1 
ATOM   782  C  CG    . GLU A 1 101 ? -2.394  19.136 8.133   1.00 21.33 ? 100 GLU A CG    1 
ATOM   783  C  CD    . GLU A 1 101 ? -1.693  18.214 9.112   1.00 29.26 ? 100 GLU A CD    1 
ATOM   784  O  OE1   . GLU A 1 101 ? -0.829  18.665 9.905   1.00 26.99 ? 100 GLU A OE1   1 
ATOM   785  O  OE2   . GLU A 1 101 ? -1.987  17.012 9.047   1.00 27.07 ? 100 GLU A OE2   1 
ATOM   786  N  N     . VAL A 1 102 ? -5.357  20.596 6.869   1.00 23.28 ? 101 VAL A N     1 
ATOM   787  C  CA    . VAL A 1 102 ? -6.257  19.992 5.889   1.00 20.29 ? 101 VAL A CA    1 
ATOM   788  C  C     . VAL A 1 102 ? -6.484  20.857 4.652   1.00 23.69 ? 101 VAL A C     1 
ATOM   789  O  O     . VAL A 1 102 ? -6.418  20.376 3.513   1.00 26.58 ? 101 VAL A O     1 
ATOM   790  C  CB    . VAL A 1 102 ? -7.578  19.626 6.568   1.00 26.66 ? 101 VAL A CB    1 
ATOM   791  C  CG1   . VAL A 1 102 ? -8.604  19.258 5.529   1.00 34.39 ? 101 VAL A CG1   1 
ATOM   792  C  CG2   . VAL A 1 102 ? -7.325  18.451 7.576   1.00 21.54 ? 101 VAL A CG2   1 
ATOM   793  N  N     . ARG A 1 103 ? -6.698  22.149 4.879   1.00 26.86 ? 102 ARG A N     1 
ATOM   794  C  CA    . ARG A 1 103 ? -6.914  23.102 3.777   1.00 30.61 ? 102 ARG A CA    1 
ATOM   795  C  C     . ARG A 1 103 ? -5.748  23.299 2.834   1.00 31.26 ? 102 ARG A C     1 
ATOM   796  O  O     . ARG A 1 103 ? -5.931  23.578 1.635   1.00 30.68 ? 102 ARG A O     1 
ATOM   797  C  CB    . ARG A 1 103 ? -7.268  24.469 4.344   1.00 35.47 ? 102 ARG A CB    1 
ATOM   798  C  CG    . ARG A 1 103 ? -8.698  24.662 4.485   1.00 34.82 ? 102 ARG A CG    1 
ATOM   799  C  CD    . ARG A 1 103 ? -9.435  24.666 3.125   1.00 29.67 ? 102 ARG A CD    1 
ATOM   800  N  NE    . ARG A 1 103 ? -10.859 24.500 3.408   1.00 27.82 ? 102 ARG A NE    1 
ATOM   801  C  CZ    . ARG A 1 103 ? -11.589 23.404 3.223   1.00 33.86 ? 102 ARG A CZ    1 
ATOM   802  N  NH1   . ARG A 1 103 ? -11.098 22.315 2.640   1.00 23.38 ? 102 ARG A NH1   1 
ATOM   803  N  NH2   . ARG A 1 103 ? -12.860 23.432 3.578   1.00 23.83 ? 102 ARG A NH2   1 
ATOM   804  N  N     . HIS A 1 104 ? -4.547  23.215 3.378   1.00 25.31 ? 103 HIS A N     1 
ATOM   805  C  CA    . HIS A 1 104 ? -3.344  23.337 2.569   1.00 29.33 ? 103 HIS A CA    1 
ATOM   806  C  C     . HIS A 1 104 ? -3.295  22.244 1.515   1.00 29.94 ? 103 HIS A C     1 
ATOM   807  O  O     . HIS A 1 104 ? -2.992  22.496 0.370   1.00 29.48 ? 103 HIS A O     1 
ATOM   808  C  CB    . HIS A 1 104 ? -2.090  23.272 3.441   1.00 34.30 ? 103 HIS A CB    1 
ATOM   809  C  CG    . HIS A 1 104 ? -0.816  23.310 2.654   1.00 34.54 ? 103 HIS A CG    1 
ATOM   810  N  ND1   . HIS A 1 104 ? -0.321  24.471 2.101   1.00 38.60 ? 103 HIS A ND1   1 
ATOM   811  C  CD2   . HIS A 1 104 ? 0.049   22.326 2.304   1.00 40.01 ? 103 HIS A CD2   1 
ATOM   812  C  CE1   . HIS A 1 104 ? 0.805   24.206 1.459   1.00 43.57 ? 103 HIS A CE1   1 
ATOM   813  N  NE2   . HIS A 1 104 ? 1.048   22.911 1.558   1.00 40.54 ? 103 HIS A NE2   1 
ATOM   814  N  N     . HIS A 1 105 ? -3.618  21.027 1.919   1.00 25.84 ? 104 HIS A N     1 
ATOM   815  C  CA    . HIS A 1 105 ? -3.582  19.889 1.022   1.00 23.40 ? 104 HIS A CA    1 
ATOM   816  C  C     . HIS A 1 105 ? -4.830  19.731 0.188   1.00 30.87 ? 104 HIS A C     1 
ATOM   817  O  O     . HIS A 1 105 ? -4.751  19.212 -0.920  1.00 25.91 ? 104 HIS A O     1 
ATOM   818  C  CB    . HIS A 1 105 ? -3.338  18.623 1.830   1.00 26.65 ? 104 HIS A CB    1 
ATOM   819  C  CG    . HIS A 1 105 ? -1.983  18.582 2.447   1.00 25.57 ? 104 HIS A CG    1 
ATOM   820  N  ND1   . HIS A 1 105 ? -0.875  18.133 1.762   1.00 24.56 ? 104 HIS A ND1   1 
ATOM   821  C  CD2   . HIS A 1 105 ? -1.543  18.991 3.657   1.00 28.96 ? 104 HIS A CD2   1 
ATOM   822  C  CE1   . HIS A 1 105 ? 0.185   18.225 2.550   1.00 21.65 ? 104 HIS A CE1   1 
ATOM   823  N  NE2   . HIS A 1 105 ? -0.188  18.766 3.694   1.00 27.74 ? 104 HIS A NE2   1 
ATOM   824  N  N     . CYS A 1 106 ? -5.974  20.159 0.732   1.00 22.05 ? 105 CYS A N     1 
ATOM   825  C  CA    . CYS A 1 106 ? -7.258  19.907 0.129   1.00 20.42 ? 105 CYS A CA    1 
ATOM   826  C  C     . CYS A 1 106 ? -8.041  21.213 0.188   1.00 27.18 ? 105 CYS A C     1 
ATOM   827  O  O     . CYS A 1 106 ? -8.777  21.453 1.137   1.00 27.78 ? 105 CYS A O     1 
ATOM   828  C  CB    . CYS A 1 106 ? -7.977  18.804 0.917   1.00 24.40 ? 105 CYS A CB    1 
ATOM   829  S  SG    . CYS A 1 106 ? -7.075  17.213 0.805   1.00 28.69 ? 105 CYS A SG    1 
ATOM   830  N  N     . PRO A 1 107 ? -7.834  22.082 -0.805  1.00 25.47 ? 106 PRO A N     1 
ATOM   831  C  CA    . PRO A 1 107 ? -8.350  23.454 -0.710  1.00 27.10 ? 106 PRO A CA    1 
ATOM   832  C  C     . PRO A 1 107 ? -9.870  23.540 -0.715  1.00 28.99 ? 106 PRO A C     1 
ATOM   833  O  O     . PRO A 1 107 ? -10.409 24.494 -0.164  1.00 29.80 ? 106 PRO A O     1 
ATOM   834  C  CB    . PRO A 1 107 ? -7.767  24.145 -1.963  1.00 28.95 ? 106 PRO A CB    1 
ATOM   835  C  CG    . PRO A 1 107 ? -7.518  23.023 -2.926  1.00 41.83 ? 106 PRO A CG    1 
ATOM   836  C  CD    . PRO A 1 107 ? -7.087  21.855 -2.053  1.00 27.82 ? 106 PRO A CD    1 
ATOM   837  N  N     . HIS A 1 108 ? -10.543 22.578 -1.347  1.00 26.08 ? 107 HIS A N     1 
ATOM   838  C  CA    . HIS A 1 108 ? -11.992 22.659 -1.507  1.00 28.04 ? 107 HIS A CA    1 
ATOM   839  C  C     . HIS A 1 108 ? -12.787 21.556 -0.812  1.00 32.09 ? 107 HIS A C     1 
ATOM   840  O  O     . HIS A 1 108 ? -14.007 21.539 -0.870  1.00 31.81 ? 107 HIS A O     1 
ATOM   841  C  CB    . HIS A 1 108 ? -12.335 22.672 -2.972  1.00 27.29 ? 107 HIS A CB    1 
ATOM   842  C  CG    . HIS A 1 108 ? -11.724 23.824 -3.718  1.00 27.71 ? 107 HIS A CG    1 
ATOM   843  N  ND1   . HIS A 1 108 ? -11.390 23.746 -5.049  1.00 29.07 ? 107 HIS A ND1   1 
ATOM   844  C  CD2   . HIS A 1 108 ? -11.362 25.065 -3.313  1.00 29.59 ? 107 HIS A CD2   1 
ATOM   845  C  CE1   . HIS A 1 108 ? -10.879 24.900 -5.446  1.00 23.29 ? 107 HIS A CE1   1 
ATOM   846  N  NE2   . HIS A 1 108 ? -10.847 25.717 -4.409  1.00 27.28 ? 107 HIS A NE2   1 
ATOM   847  N  N     . THR A 1 109 ? -12.109 20.631 -0.160  1.00 24.53 ? 108 THR A N     1 
ATOM   848  C  CA    . THR A 1 109 ? -12.793 19.445 0.347   1.00 23.78 ? 108 THR A CA    1 
ATOM   849  C  C     . THR A 1 109 ? -13.663 19.794 1.566   1.00 25.35 ? 108 THR A C     1 
ATOM   850  O  O     . THR A 1 109 ? -13.232 20.522 2.432   1.00 24.92 ? 108 THR A O     1 
ATOM   851  C  CB    . THR A 1 109 ? -11.755 18.361 0.700   1.00 23.40 ? 108 THR A CB    1 
ATOM   852  O  OG1   . THR A 1 109 ? -10.986 18.058 -0.475  1.00 25.53 ? 108 THR A OG1   1 
ATOM   853  C  CG2   . THR A 1 109 ? -12.434 17.094 1.233   1.00 25.83 ? 108 THR A CG2   1 
ATOM   854  N  N     . PRO A 1 110 ? -14.922 19.314 1.611   1.00 22.29 ? 109 PRO A N     1 
ATOM   855  C  CA    . PRO A 1 110 ? -15.777 19.606 2.770   1.00 23.28 ? 109 PRO A CA    1 
ATOM   856  C  C     . PRO A 1 110 ? -15.181 19.096 4.070   1.00 21.61 ? 109 PRO A C     1 
ATOM   857  O  O     . PRO A 1 110 ? -14.597 18.012 4.085   1.00 23.81 ? 109 PRO A O     1 
ATOM   858  C  CB    . PRO A 1 110 ? -17.084 18.850 2.481   1.00 26.55 ? 109 PRO A CB    1 
ATOM   859  C  CG    . PRO A 1 110 ? -16.890 18.105 1.253   1.00 33.58 ? 109 PRO A CG    1 
ATOM   860  C  CD    . PRO A 1 110 ? -15.600 18.488 0.593   1.00 24.15 ? 109 PRO A CD    1 
ATOM   861  N  N     . ILE A 1 111 ? -15.330 19.886 5.130   1.00 22.03 ? 110 ILE A N     1 
ATOM   862  C  CA    . ILE A 1 111 ? -14.899 19.543 6.495   1.00 22.56 ? 110 ILE A CA    1 
ATOM   863  C  C     . ILE A 1 111 ? -16.099 19.522 7.424   1.00 23.54 ? 110 ILE A C     1 
ATOM   864  O  O     . ILE A 1 111 ? -16.858 20.503 7.482   1.00 23.19 ? 110 ILE A O     1 
ATOM   865  C  CB    . ILE A 1 111 ? -13.943 20.610 7.065   1.00 23.84 ? 110 ILE A CB    1 
ATOM   866  C  CG1   . ILE A 1 111 ? -12.611 20.603 6.309   1.00 25.71 ? 110 ILE A CG1   1 
ATOM   867  C  CG2   . ILE A 1 111 ? -13.751 20.377 8.592   1.00 23.34 ? 110 ILE A CG2   1 
ATOM   868  C  CD1   . ILE A 1 111 ? -11.610 21.736 6.730   1.00 26.31 ? 110 ILE A CD1   1 
ATOM   869  N  N     . LEU A 1 112 ? -16.278 18.426 8.159   1.00 24.44 ? 111 LEU A N     1 
ATOM   870  C  CA    . LEU A 1 112 ? -17.239 18.398 9.257   1.00 23.25 ? 111 LEU A CA    1 
ATOM   871  C  C     . LEU A 1 112 ? -16.457 18.563 10.557  1.00 19.70 ? 111 LEU A C     1 
ATOM   872  O  O     . LEU A 1 112 ? -15.430 17.927 10.730  1.00 24.73 ? 111 LEU A O     1 
ATOM   873  C  CB    . LEU A 1 112 ? -18.031 17.091 9.284   1.00 23.17 ? 111 LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 112 ? -19.188 16.953 8.280   1.00 32.12 ? 111 LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 112 ? -18.684 17.136 6.874   1.00 35.68 ? 111 LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 112 ? -19.906 15.583 8.478   1.00 32.45 ? 111 LEU A CD2   1 
ATOM   877  N  N     . LEU A 1 113 ? -16.940 19.416 11.460  1.00 20.47 ? 112 LEU A N     1 
ATOM   878  C  CA    . LEU A 1 113 ? -16.316 19.540 12.784  1.00 20.29 ? 112 LEU A CA    1 
ATOM   879  C  C     . LEU A 1 113 ? -17.093 18.623 13.731  1.00 20.70 ? 112 LEU A C     1 
ATOM   880  O  O     . LEU A 1 113 ? -18.326 18.759 13.870  1.00 21.25 ? 112 LEU A O     1 
ATOM   881  C  CB    . LEU A 1 113 ? -16.348 20.980 13.291  1.00 20.94 ? 112 LEU A CB    1 
ATOM   882  C  CG    . LEU A 1 113 ? -15.628 21.265 14.619  1.00 21.36 ? 112 LEU A CG    1 
ATOM   883  C  CD1   . LEU A 1 113 ? -14.157 20.860 14.567  1.00 24.27 ? 112 LEU A CD1   1 
ATOM   884  C  CD2   . LEU A 1 113 ? -15.813 22.741 15.057  1.00 23.04 ? 112 LEU A CD2   1 
ATOM   885  N  N     . VAL A 1 114 ? -16.382 17.719 14.395  1.00 23.22 ? 113 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 114 ? -17.001 16.740 15.270  1.00 21.22 ? 113 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 114 ? -16.500 16.866 16.710  1.00 22.68 ? 113 VAL A C     1 
ATOM   888  O  O     . VAL A 1 114 ? -15.322 16.680 16.996  1.00 19.39 ? 113 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 114 ? -16.752 15.298 14.742  1.00 23.23 ? 113 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 114 ? -17.466 14.281 15.647  1.00 23.59 ? 113 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 114 ? -17.251 15.181 13.292  1.00 23.16 ? 113 VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 115 ? -17.420 17.187 17.608  1.00 22.84 ? 114 GLY A N     1 
ATOM   893  C  CA    . GLY A 1 115 ? -17.157 17.183 19.030  1.00 23.37 ? 114 GLY A CA    1 
ATOM   894  C  C     . GLY A 1 115 ? -17.420 15.776 19.543  1.00 23.60 ? 114 GLY A C     1 
ATOM   895  O  O     . GLY A 1 115 ? -18.541 15.258 19.392  1.00 23.84 ? 114 GLY A O     1 
ATOM   896  N  N     . THR A 1 116 ? -16.391 15.149 20.120  1.00 21.60 ? 115 THR A N     1 
ATOM   897  C  CA    . THR A 1 116 ? -16.434 13.749 20.603  1.00 18.95 ? 115 THR A CA    1 
ATOM   898  C  C     . THR A 1 116 ? -16.580 13.671 22.130  1.00 25.71 ? 115 THR A C     1 
ATOM   899  O  O     . THR A 1 116 ? -16.442 14.669 22.840  1.00 24.69 ? 115 THR A O     1 
ATOM   900  C  CB    . THR A 1 116 ? -15.123 13.031 20.229  1.00 24.10 ? 115 THR A CB    1 
ATOM   901  O  OG1   . THR A 1 116 ? -14.028 13.710 20.872  1.00 23.77 ? 115 THR A OG1   1 
ATOM   902  C  CG2   . THR A 1 116 ? -14.938 13.010 18.718  1.00 20.90 ? 115 THR A CG2   1 
ATOM   903  N  N     . LYS A 1 117 ? -16.836 12.476 22.635  1.00 21.57 ? 116 LYS A N     1 
ATOM   904  C  CA    . LYS A 1 117 ? -16.970 12.233 24.075  1.00 22.53 ? 116 LYS A CA    1 
ATOM   905  C  C     . LYS A 1 117 ? -18.156 13.011 24.683  1.00 22.17 ? 116 LYS A C     1 
ATOM   906  O  O     . LYS A 1 117 ? -18.111 13.456 25.820  1.00 22.93 ? 116 LYS A O     1 
ATOM   907  C  CB    . LYS A 1 117 ? -15.663 12.549 24.810  1.00 24.55 ? 116 LYS A CB    1 
ATOM   908  C  CG    . LYS A 1 117 ? -14.420 11.803 24.221  1.00 21.89 ? 116 LYS A CG    1 
ATOM   909  C  CD    . LYS A 1 117 ? -13.206 11.869 25.145  1.00 25.16 ? 116 LYS A CD    1 
ATOM   910  C  CE    . LYS A 1 117 ? -11.976 11.270 24.508  1.00 28.87 ? 116 LYS A CE    1 
ATOM   911  N  NZ    . LYS A 1 117 ? -10.813 11.146 25.427  1.00 23.60 ? 116 LYS A NZ    1 
ATOM   912  N  N     . LEU A 1 118 ? -19.236 13.106 23.922  1.00 25.44 ? 117 LEU A N     1 
ATOM   913  C  CA    . LEU A 1 118 ? -20.444 13.784 24.356  1.00 23.39 ? 117 LEU A CA    1 
ATOM   914  C  C     . LEU A 1 118 ? -20.965 13.275 25.704  1.00 27.24 ? 117 LEU A C     1 
ATOM   915  O  O     . LEU A 1 118 ? -21.526 14.051 26.490  1.00 24.90 ? 117 LEU A O     1 
ATOM   916  C  CB    . LEU A 1 118 ? -21.511 13.649 23.268  1.00 23.60 ? 117 LEU A CB    1 
ATOM   917  C  CG    . LEU A 1 118 ? -22.899 14.203 23.569  1.00 25.29 ? 117 LEU A CG    1 
ATOM   918  C  CD1   . LEU A 1 118 ? -22.845 15.694 23.944  1.00 24.99 ? 117 LEU A CD1   1 
ATOM   919  C  CD2   . LEU A 1 118 ? -23.861 13.966 22.390  1.00 29.79 ? 117 LEU A CD2   1 
ATOM   920  N  N     . ASP A 1 119 ? -20.777 11.981 25.964  1.00 22.69 ? 118 ASP A N     1 
ATOM   921  C  CA    . ASP A 1 119 ? -21.204 11.368 27.246  1.00 27.76 ? 118 ASP A CA    1 
ATOM   922  C  C     . ASP A 1 119 ? -20.488 11.986 28.449  1.00 24.94 ? 118 ASP A C     1 
ATOM   923  O  O     . ASP A 1 119 ? -21.030 11.981 29.561  1.00 26.54 ? 118 ASP A O     1 
ATOM   924  C  CB    . ASP A 1 119 ? -20.966 9.843  27.245  1.00 25.24 ? 118 ASP A CB    1 
ATOM   925  C  CG    . ASP A 1 119 ? -19.520 9.476  27.004  1.00 25.11 ? 118 ASP A CG    1 
ATOM   926  O  OD1   . ASP A 1 119 ? -19.030 9.715  25.859  1.00 26.57 ? 118 ASP A OD1   1 
ATOM   927  O  OD2   . ASP A 1 119 ? -18.856 8.978  27.954  1.00 24.33 ? 118 ASP A OD2   1 
ATOM   928  N  N     . LEU A 1 120 ? -19.286 12.509 28.251  1.00 23.58 ? 119 LEU A N     1 
ATOM   929  C  CA    . LEU A 1 120 ? -18.543 13.115 29.373  1.00 23.32 ? 119 LEU A CA    1 
ATOM   930  C  C     . LEU A 1 120 ? -18.973 14.562 29.688  1.00 24.90 ? 119 LEU A C     1 
ATOM   931  O  O     . LEU A 1 120 ? -18.643 15.076 30.753  1.00 24.62 ? 119 LEU A O     1 
ATOM   932  C  CB    . LEU A 1 120 ? -17.041 13.055 29.128  1.00 23.09 ? 119 LEU A CB    1 
ATOM   933  C  CG    . LEU A 1 120 ? -16.434 11.656 29.040  1.00 22.83 ? 119 LEU A CG    1 
ATOM   934  C  CD1   . LEU A 1 120 ? -14.888 11.756 28.856  1.00 23.52 ? 119 LEU A CD1   1 
ATOM   935  C  CD2   . LEU A 1 120 ? -16.820 10.795 30.227  1.00 24.30 ? 119 LEU A CD2   1 
ATOM   936  N  N     . ARG A 1 121 ? -19.694 15.222 28.786  1.00 27.20 ? 120 ARG A N     1 
ATOM   937  C  CA    . ARG A 1 121 ? -20.116 16.609 29.065  1.00 29.12 ? 120 ARG A CA    1 
ATOM   938  C  C     . ARG A 1 121 ? -21.044 16.704 30.286  1.00 28.33 ? 120 ARG A C     1 
ATOM   939  O  O     . ARG A 1 121 ? -21.009 17.698 30.996  1.00 32.77 ? 120 ARG A O     1 
ATOM   940  C  CB    . ARG A 1 121 ? -20.757 17.252 27.834  1.00 27.31 ? 120 ARG A CB    1 
ATOM   941  C  CG    . ARG A 1 121 ? -21.070 18.721 28.030  1.00 32.44 ? 120 ARG A CG    1 
ATOM   942  C  CD    . ARG A 1 121 ? -21.045 19.485 26.747  1.00 28.00 ? 120 ARG A CD    1 
ATOM   943  N  NE    . ARG A 1 121 ? -22.202 19.113 25.962  1.00 29.20 ? 120 ARG A NE    1 
ATOM   944  C  CZ    . ARG A 1 121 ? -22.394 19.453 24.690  1.00 22.55 ? 120 ARG A CZ    1 
ATOM   945  N  NH1   . ARG A 1 121 ? -21.497 20.159 24.015  1.00 24.40 ? 120 ARG A NH1   1 
ATOM   946  N  NH2   . ARG A 1 121 ? -23.501 19.042 24.106  1.00 27.45 ? 120 ARG A NH2   1 
ATOM   947  N  N     . ASP A 1 122 ? -21.839 15.651 30.525  1.00 27.93 ? 121 ASP A N     1 
ATOM   948  C  CA    . ASP A 1 122 ? -22.737 15.541 31.687  1.00 35.95 ? 121 ASP A CA    1 
ATOM   949  C  C     . ASP A 1 122 ? -22.188 14.627 32.794  1.00 32.17 ? 121 ASP A C     1 
ATOM   950  O  O     . ASP A 1 122 ? -22.888 14.339 33.762  1.00 36.90 ? 121 ASP A O     1 
ATOM   951  C  CB    . ASP A 1 122 ? -24.103 14.978 31.231  1.00 34.52 ? 121 ASP A CB    1 
ATOM   952  C  CG    . ASP A 1 122 ? -24.788 15.860 30.205  1.00 55.29 ? 121 ASP A CG    1 
ATOM   953  O  OD1   . ASP A 1 122 ? -24.857 17.091 30.416  1.00 66.47 ? 121 ASP A OD1   1 
ATOM   954  O  OD2   . ASP A 1 122 ? -25.267 15.323 29.187  1.00 69.28 ? 121 ASP A OD2   1 
ATOM   955  N  N     . ASP A 1 123 ? -20.957 14.148 32.639  1.00 27.39 ? 122 ASP A N     1 
ATOM   956  C  CA    . ASP A 1 123 ? -20.314 13.299 33.638  1.00 28.08 ? 122 ASP A CA    1 
ATOM   957  C  C     . ASP A 1 123 ? -19.805 14.136 34.807  1.00 31.15 ? 122 ASP A C     1 
ATOM   958  O  O     . ASP A 1 123 ? -18.944 14.992 34.625  1.00 27.41 ? 122 ASP A O     1 
ATOM   959  C  CB    . ASP A 1 123 ? -19.140 12.546 33.006  1.00 27.15 ? 122 ASP A CB    1 
ATOM   960  C  CG    . ASP A 1 123 ? -18.454 11.628 33.981  1.00 34.41 ? 122 ASP A CG    1 
ATOM   961  O  OD1   . ASP A 1 123 ? -19.131 10.700 34.471  1.00 31.67 ? 122 ASP A OD1   1 
ATOM   962  O  OD2   . ASP A 1 123 ? -17.242 11.819 34.259  1.00 26.88 ? 122 ASP A OD2   1 
ATOM   963  N  N     . LYS A 1 124 ? -20.310 13.871 36.009  1.00 28.53 ? 123 LYS A N     1 
ATOM   964  C  CA    . LYS A 1 124 ? -19.960 14.668 37.192  1.00 29.78 ? 123 LYS A CA    1 
ATOM   965  C  C     . LYS A 1 124 ? -18.460 14.792 37.457  1.00 24.61 ? 123 LYS A C     1 
ATOM   966  O  O     . LYS A 1 124 ? -17.958 15.902 37.679  1.00 28.09 ? 123 LYS A O     1 
ATOM   967  C  CB    . LYS A 1 124 ? -20.627 14.102 38.452  1.00 35.65 ? 123 LYS A CB    1 
ATOM   968  C  CG    . LYS A 1 124 ? -20.455 15.010 39.689  1.00 39.56 ? 123 LYS A CG    1 
ATOM   969  N  N     . ASP A 1 125 ? -17.745 13.671 37.415  1.00 28.29 ? 124 ASP A N     1 
ATOM   970  C  CA    . ASP A 1 125 ? -16.302 13.687 37.680  1.00 27.18 ? 124 ASP A CA    1 
ATOM   971  C  C     . ASP A 1 125 ? -15.541 14.544 36.643  1.00 24.04 ? 124 ASP A C     1 
ATOM   972  O  O     . ASP A 1 125 ? -14.579 15.263 36.967  1.00 25.16 ? 124 ASP A O     1 
ATOM   973  C  CB    . ASP A 1 125 ? -15.752 12.270 37.718  1.00 29.92 ? 124 ASP A CB    1 
ATOM   974  C  CG    . ASP A 1 125 ? -16.175 11.497 38.972  1.00 39.55 ? 124 ASP A CG    1 
ATOM   975  O  OD1   . ASP A 1 125 ? -16.808 12.082 39.881  1.00 41.61 ? 124 ASP A OD1   1 
ATOM   976  O  OD2   . ASP A 1 125 ? -15.862 10.293 39.044  1.00 41.74 ? 124 ASP A OD2   1 
ATOM   977  N  N     . THR A 1 126 ? -15.955 14.439 35.393  1.00 22.64 ? 125 THR A N     1 
ATOM   978  C  CA    . THR A 1 126 ? -15.326 15.207 34.330  1.00 22.79 ? 125 THR A CA    1 
ATOM   979  C  C     . THR A 1 126 ? -15.598 16.705 34.528  1.00 23.18 ? 125 THR A C     1 
ATOM   980  O  O     . THR A 1 126 ? -14.694 17.539 34.440  1.00 21.57 ? 125 THR A O     1 
ATOM   981  C  CB    . THR A 1 126 ? -15.838 14.773 32.946  1.00 23.12 ? 125 THR A CB    1 
ATOM   982  O  OG1   . THR A 1 126 ? -15.549 13.380 32.728  1.00 24.76 ? 125 THR A OG1   1 
ATOM   983  C  CG2   . THR A 1 126 ? -15.200 15.609 31.854  1.00 24.96 ? 125 THR A CG2   1 
ATOM   984  N  N     . ILE A 1 127 ? -16.857 17.031 34.803  1.00 23.35 ? 126 ILE A N     1 
ATOM   985  C  CA    . ILE A 1 127 ? -17.246 18.422 35.097  1.00 23.38 ? 126 ILE A CA    1 
ATOM   986  C  C     . ILE A 1 127 ? -16.421 18.979 36.271  1.00 23.11 ? 126 ILE A C     1 
ATOM   987  O  O     . ILE A 1 127 ? -15.913 20.103 36.221  1.00 24.05 ? 126 ILE A O     1 
ATOM   988  C  CB    . ILE A 1 127 ? -18.768 18.504 35.402  1.00 24.88 ? 126 ILE A CB    1 
ATOM   989  C  CG1   . ILE A 1 127 ? -19.560 18.232 34.116  1.00 26.65 ? 126 ILE A CG1   1 
ATOM   990  C  CG2   . ILE A 1 127 ? -19.119 19.879 35.997  1.00 29.55 ? 126 ILE A CG2   1 
ATOM   991  C  CD1   . ILE A 1 127 ? -21.043 17.933 34.317  1.00 29.88 ? 126 ILE A CD1   1 
ATOM   992  N  N     . GLU A 1 128 ? -16.246 18.182 37.313  1.00 23.94 ? 127 GLU A N     1 
ATOM   993  C  CA    . GLU A 1 128 ? -15.484 18.639 38.477  1.00 23.40 ? 127 GLU A CA    1 
ATOM   994  C  C     . GLU A 1 128 ? -14.019 18.800 38.151  1.00 27.04 ? 127 GLU A C     1 
ATOM   995  O  O     . GLU A 1 128 ? -13.402 19.775 38.559  1.00 23.42 ? 127 GLU A O     1 
ATOM   996  C  CB    . GLU A 1 128 ? -15.665 17.705 39.664  1.00 23.98 ? 127 GLU A CB    1 
ATOM   997  C  CG    . GLU A 1 128 ? -17.061 17.805 40.253  1.00 30.39 ? 127 GLU A CG    1 
ATOM   998  C  CD    . GLU A 1 128 ? -17.440 19.258 40.559  1.00 46.24 ? 127 GLU A CD    1 
ATOM   999  O  OE1   . GLU A 1 128 ? -16.837 19.859 41.472  1.00 33.93 ? 127 GLU A OE1   1 
ATOM   1000 O  OE2   . GLU A 1 128 ? -18.312 19.800 39.863  1.00 43.44 ? 127 GLU A OE2   1 
ATOM   1001 N  N     . ARG A 1 129 ? -13.452 17.850 37.412  1.00 22.75 ? 128 ARG A N     1 
ATOM   1002 C  CA    . ARG A 1 129 ? -12.061 17.946 37.029  1.00 29.96 ? 128 ARG A CA    1 
ATOM   1003 C  C     . ARG A 1 129 ? -11.770 19.261 36.275  1.00 28.29 ? 128 ARG A C     1 
ATOM   1004 O  O     . ARG A 1 129 ? -10.747 19.903 36.494  1.00 24.38 ? 128 ARG A O     1 
ATOM   1005 C  CB    . ARG A 1 129 ? -11.695 16.727 36.170  1.00 33.13 ? 128 ARG A CB    1 
ATOM   1006 C  CG    . ARG A 1 129 ? -10.437 16.869 35.381  1.00 44.67 ? 128 ARG A CG    1 
ATOM   1007 C  CD    . ARG A 1 129 ? -10.079 15.561 34.688  1.00 32.28 ? 128 ARG A CD    1 
ATOM   1008 N  NE    . ARG A 1 129 ? -10.854 15.230 33.477  1.00 29.74 ? 128 ARG A NE    1 
ATOM   1009 C  CZ    . ARG A 1 129 ? -10.760 15.875 32.315  1.00 25.31 ? 128 ARG A CZ    1 
ATOM   1010 N  NH1   . ARG A 1 129 ? -11.469 15.479 31.269  1.00 37.58 ? 128 ARG A NH1   1 
ATOM   1011 N  NH2   . ARG A 1 129 ? -9.972  16.927 32.179  1.00 25.17 ? 128 ARG A NH2   1 
ATOM   1012 N  N     . LEU A 1 130 ? -12.661 19.647 35.372  1.00 20.82 ? 129 LEU A N     1 
ATOM   1013 C  CA    . LEU A 1 130 ? -12.525 20.907 34.640  1.00 23.61 ? 129 LEU A CA    1 
ATOM   1014 C  C     . LEU A 1 130 ? -12.814 22.133 35.552  1.00 20.80 ? 129 LEU A C     1 
ATOM   1015 O  O     . LEU A 1 130 ? -12.119 23.162 35.488  1.00 27.04 ? 129 LEU A O     1 
ATOM   1016 C  CB    . LEU A 1 130 ? -13.454 20.912 33.416  1.00 24.75 ? 129 LEU A CB    1 
ATOM   1017 C  CG    . LEU A 1 130 ? -13.096 19.933 32.273  1.00 21.48 ? 129 LEU A CG    1 
ATOM   1018 C  CD1   . LEU A 1 130 ? -14.246 19.785 31.304  1.00 23.48 ? 129 LEU A CD1   1 
ATOM   1019 C  CD2   . LEU A 1 130 ? -11.857 20.421 31.549  1.00 25.85 ? 129 LEU A CD2   1 
ATOM   1020 N  N     . ARG A 1 131 ? -13.841 22.014 36.394  1.00 24.23 ? 130 ARG A N     1 
ATOM   1021 C  CA    . ARG A 1 131 ? -14.269 23.110 37.249  1.00 23.60 ? 130 ARG A CA    1 
ATOM   1022 C  C     . ARG A 1 131 ? -13.182 23.458 38.256  1.00 24.61 ? 130 ARG A C     1 
ATOM   1023 O  O     . ARG A 1 131 ? -13.050 24.615 38.659  1.00 26.72 ? 130 ARG A O     1 
ATOM   1024 C  CB    . ARG A 1 131 ? -15.554 22.740 37.971  1.00 25.14 ? 130 ARG A CB    1 
ATOM   1025 C  CG    . ARG A 1 131 ? -16.164 23.884 38.743  1.00 26.03 ? 130 ARG A CG    1 
ATOM   1026 C  CD    . ARG A 1 131 ? -17.628 23.657 38.985  1.00 34.01 ? 130 ARG A CD    1 
ATOM   1027 N  NE    . ARG A 1 131 ? -17.783 22.821 40.156  1.00 31.23 ? 130 ARG A NE    1 
ATOM   1028 C  CZ    . ARG A 1 131 ? -18.053 23.278 41.378  1.00 34.19 ? 130 ARG A CZ    1 
ATOM   1029 N  NH1   . ARG A 1 131 ? -18.164 22.427 42.379  1.00 30.72 ? 130 ARG A NH1   1 
ATOM   1030 N  NH2   . ARG A 1 131 ? -18.224 24.568 41.611  1.00 33.29 ? 130 ARG A NH2   1 
ATOM   1031 N  N     . ASP A 1 132 ? -12.388 22.457 38.632  1.00 23.12 ? 131 ASP A N     1 
ATOM   1032 C  CA    . ASP A 1 132 ? -11.233 22.662 39.508  1.00 31.36 ? 131 ASP A CA    1 
ATOM   1033 C  C     . ASP A 1 132 ? -10.236 23.623 38.888  1.00 29.37 ? 131 ASP A C     1 
ATOM   1034 O  O     . ASP A 1 132 ? -9.494  24.289 39.603  1.00 34.86 ? 131 ASP A O     1 
ATOM   1035 C  CB    . ASP A 1 132 ? -10.492 21.344 39.748  1.00 31.73 ? 131 ASP A CB    1 
ATOM   1036 C  CG    . ASP A 1 132 ? -11.190 20.426 40.735  1.00 41.67 ? 131 ASP A CG    1 
ATOM   1037 O  OD1   . ASP A 1 132 ? -12.108 20.848 41.483  1.00 34.65 ? 131 ASP A OD1   1 
ATOM   1038 O  OD2   . ASP A 1 132 ? -10.775 19.251 40.760  1.00 35.90 ? 131 ASP A OD2   1 
ATOM   1039 N  N     . LYS A 1 133 ? -10.193 23.660 37.564  1.00 31.76 ? 132 LYS A N     1 
ATOM   1040 C  CA    . LYS A 1 133 ? -9.270  24.517 36.828  1.00 30.31 ? 132 LYS A CA    1 
ATOM   1041 C  C     . LYS A 1 133 ? -10.011 25.675 36.150  1.00 33.34 ? 132 LYS A C     1 
ATOM   1042 O  O     . LYS A 1 133 ? -9.508  26.248 35.187  1.00 35.19 ? 132 LYS A O     1 
ATOM   1043 C  CB    . LYS A 1 133 ? -8.534  23.708 35.765  1.00 37.87 ? 132 LYS A CB    1 
ATOM   1044 C  CG    . LYS A 1 133 ? -8.032  22.338 36.207  1.00 48.06 ? 132 LYS A CG    1 
ATOM   1045 C  CD    . LYS A 1 133 ? -6.569  22.344 36.620  1.00 51.46 ? 132 LYS A CD    1 
ATOM   1046 C  CE    . LYS A 1 133 ? -6.057  20.912 36.845  1.00 47.00 ? 132 LYS A CE    1 
ATOM   1047 N  NZ    . LYS A 1 133 ? -6.255  20.429 38.249  1.00 41.19 ? 132 LYS A NZ    1 
ATOM   1048 N  N     . LYS A 1 134 ? -11.212 25.987 36.635  1.00 30.09 ? 133 LYS A N     1 
ATOM   1049 C  CA    . LYS A 1 134 ? -11.996 27.131 36.155  1.00 35.38 ? 133 LYS A CA    1 
ATOM   1050 C  C     . LYS A 1 134 ? -12.428 26.959 34.689  1.00 35.80 ? 133 LYS A C     1 
ATOM   1051 O  O     . LYS A 1 134 ? -12.680 27.942 33.986  1.00 34.18 ? 133 LYS A O     1 
ATOM   1052 C  CB    . LYS A 1 134 ? -11.200 28.436 36.349  1.00 34.54 ? 133 LYS A CB    1 
ATOM   1053 C  CG    . LYS A 1 134 ? -10.550 28.519 37.733  1.00 44.01 ? 133 LYS A CG    1 
ATOM   1054 C  CD    . LYS A 1 134 ? -9.593  29.689 37.905  1.00 45.29 ? 133 LYS A CD    1 
ATOM   1055 C  CE    . LYS A 1 134 ? -8.616  29.413 39.049  1.00 61.84 ? 133 LYS A CE    1 
ATOM   1056 N  NZ    . LYS A 1 134 ? -9.197  28.541 40.130  1.00 54.58 ? 133 LYS A NZ    1 
ATOM   1057 N  N     . LEU A 1 135 ? -12.538 25.703 34.258  1.00 26.76 ? 134 LEU A N     1 
ATOM   1058 C  CA    . LEU A 1 135 ? -12.949 25.350 32.894  1.00 27.62 ? 134 LEU A CA    1 
ATOM   1059 C  C     . LEU A 1 135 ? -14.283 24.591 32.905  1.00 32.64 ? 134 LEU A C     1 
ATOM   1060 O  O     . LEU A 1 135 ? -14.745 24.094 33.929  1.00 25.38 ? 134 LEU A O     1 
ATOM   1061 C  CB    . LEU A 1 135 ? -11.888 24.492 32.207  1.00 31.13 ? 134 LEU A CB    1 
ATOM   1062 C  CG    . LEU A 1 135 ? -10.532 25.153 31.984  1.00 37.80 ? 134 LEU A CG    1 
ATOM   1063 C  CD1   . LEU A 1 135 ? -9.503  24.179 31.432  1.00 35.59 ? 134 LEU A CD1   1 
ATOM   1064 C  CD2   . LEU A 1 135 ? -10.705 26.361 31.064  1.00 44.27 ? 134 LEU A CD2   1 
ATOM   1065 N  N     . ALA A 1 136 ? -14.911 24.539 31.740  1.00 33.68 ? 135 ALA A N     1 
ATOM   1066 C  CA    . ALA A 1 136 ? -16.113 23.760 31.561  1.00 28.68 ? 135 ALA A CA    1 
ATOM   1067 C  C     . ALA A 1 136 ? -16.061 23.071 30.205  1.00 26.73 ? 135 ALA A C     1 
ATOM   1068 O  O     . ALA A 1 136 ? -15.290 23.476 29.327  1.00 25.72 ? 135 ALA A O     1 
ATOM   1069 C  CB    . ALA A 1 136 ? -17.330 24.618 31.668  1.00 26.44 ? 135 ALA A CB    1 
ATOM   1070 N  N     . PRO A 1 137 ? -16.861 22.017 30.034  1.00 25.98 ? 136 PRO A N     1 
ATOM   1071 C  CA    . PRO A 1 137 ? -16.965 21.427 28.676  1.00 22.10 ? 136 PRO A CA    1 
ATOM   1072 C  C     . PRO A 1 137 ? -17.332 22.440 27.597  1.00 29.38 ? 136 PRO A C     1 
ATOM   1073 O  O     . PRO A 1 137 ? -17.995 23.455 27.875  1.00 26.00 ? 136 PRO A O     1 
ATOM   1074 C  CB    . PRO A 1 137 ? -18.099 20.411 28.837  1.00 26.00 ? 136 PRO A CB    1 
ATOM   1075 C  CG    . PRO A 1 137 ? -18.052 19.990 30.285  1.00 26.96 ? 136 PRO A CG    1 
ATOM   1076 C  CD    . PRO A 1 137 ? -17.660 21.267 31.032  1.00 31.49 ? 136 PRO A CD    1 
ATOM   1077 N  N     . ILE A 1 138 ? -16.941 22.149 26.364  1.00 25.07 ? 137 ILE A N     1 
ATOM   1078 C  CA    . ILE A 1 138 ? -17.326 22.967 25.226  1.00 24.99 ? 137 ILE A CA    1 
ATOM   1079 C  C     . ILE A 1 138 ? -18.829 22.792 24.988  1.00 22.66 ? 137 ILE A C     1 
ATOM   1080 O  O     . ILE A 1 138 ? -19.353 21.664 24.997  1.00 22.20 ? 137 ILE A O     1 
ATOM   1081 C  CB    . ILE A 1 138 ? -16.516 22.565 23.965  1.00 23.80 ? 137 ILE A CB    1 
ATOM   1082 C  CG1   . ILE A 1 138 ? -14.995 22.673 24.217  1.00 27.26 ? 137 ILE A CG1   1 
ATOM   1083 C  CG2   . ILE A 1 138 ? -16.993 23.400 22.754  1.00 27.43 ? 137 ILE A CG2   1 
ATOM   1084 C  CD1   . ILE A 1 138 ? -14.561 24.036 24.666  1.00 36.48 ? 137 ILE A CD1   1 
ATOM   1085 N  N     . THR A 1 139 ? -19.545 23.902 24.803  1.00 22.01 ? 138 THR A N     1 
ATOM   1086 C  CA    . THR A 1 139 ? -20.995 23.825 24.591  1.00 19.60 ? 138 THR A CA    1 
ATOM   1087 C  C     . THR A 1 139 ? -21.316 23.726 23.115  1.00 25.72 ? 138 THR A C     1 
ATOM   1088 O  O     . THR A 1 139 ? -20.474 23.994 22.263  1.00 22.36 ? 138 THR A O     1 
ATOM   1089 C  CB    . THR A 1 139 ? -21.716 25.079 25.159  1.00 25.26 ? 138 THR A CB    1 
ATOM   1090 O  OG1   . THR A 1 139 ? -21.416 26.197 24.328  1.00 22.08 ? 138 THR A OG1   1 
ATOM   1091 C  CG2   . THR A 1 139 ? -21.323 25.359 26.664  1.00 23.72 ? 138 THR A CG2   1 
ATOM   1092 N  N     . TYR A 1 140 ? -22.548 23.355 22.789  1.00 22.58 ? 139 TYR A N     1 
ATOM   1093 C  CA    . TYR A 1 140 ? -22.913 23.207 21.398  1.00 25.17 ? 139 TYR A CA    1 
ATOM   1094 C  C     . TYR A 1 140 ? -22.789 24.565 20.657  1.00 23.63 ? 139 TYR A C     1 
ATOM   1095 O  O     . TYR A 1 140 ? -22.162 24.614 19.615  1.00 23.67 ? 139 TYR A O     1 
ATOM   1096 C  CB    . TYR A 1 140 ? -24.304 22.591 21.252  1.00 24.07 ? 139 TYR A CB    1 
ATOM   1097 C  CG    . TYR A 1 140 ? -24.716 22.392 19.814  1.00 26.81 ? 139 TYR A CG    1 
ATOM   1098 C  CD1   . TYR A 1 140 ? -25.193 23.460 19.049  1.00 31.01 ? 139 TYR A CD1   1 
ATOM   1099 C  CD2   . TYR A 1 140 ? -24.615 21.144 19.206  1.00 33.89 ? 139 TYR A CD2   1 
ATOM   1100 C  CE1   . TYR A 1 140 ? -25.578 23.283 17.742  1.00 27.31 ? 139 TYR A CE1   1 
ATOM   1101 C  CE2   . TYR A 1 140 ? -24.986 20.969 17.884  1.00 37.13 ? 139 TYR A CE2   1 
ATOM   1102 C  CZ    . TYR A 1 140 ? -25.461 22.046 17.163  1.00 31.05 ? 139 TYR A CZ    1 
ATOM   1103 O  OH    . TYR A 1 140 ? -25.827 21.890 15.849  1.00 38.58 ? 139 TYR A OH    1 
ATOM   1104 N  N     . PRO A 1 141 ? -23.376 25.669 21.190  1.00 23.08 ? 140 PRO A N     1 
ATOM   1105 C  CA    . PRO A 1 141 ? -23.151 26.946 20.485  1.00 20.65 ? 140 PRO A CA    1 
ATOM   1106 C  C     . PRO A 1 141 ? -21.678 27.333 20.301  1.00 21.84 ? 140 PRO A C     1 
ATOM   1107 O  O     . PRO A 1 141 ? -21.331 27.968 19.299  1.00 24.80 ? 140 PRO A O     1 
ATOM   1108 C  CB    . PRO A 1 141 ? -23.851 27.971 21.389  1.00 24.57 ? 140 PRO A CB    1 
ATOM   1109 C  CG    . PRO A 1 141 ? -24.909 27.172 22.126  1.00 23.80 ? 140 PRO A CG    1 
ATOM   1110 C  CD    . PRO A 1 141 ? -24.256 25.835 22.363  1.00 23.47 ? 140 PRO A CD    1 
ATOM   1111 N  N     . GLN A 1 142 ? -20.830 27.003 21.270  1.00 23.40 ? 141 GLN A N     1 
ATOM   1112 C  CA    . GLN A 1 142 ? -19.408 27.319 21.176  1.00 23.55 ? 141 GLN A CA    1 
ATOM   1113 C  C     . GLN A 1 142 ? -18.752 26.500 20.065  1.00 24.27 ? 141 GLN A C     1 
ATOM   1114 O  O     . GLN A 1 142 ? -17.920 27.010 19.292  1.00 21.98 ? 141 GLN A O     1 
ATOM   1115 C  CB    . GLN A 1 142 ? -18.722 27.069 22.521  1.00 23.48 ? 141 GLN A CB    1 
ATOM   1116 C  CG    . GLN A 1 142 ? -19.071 28.149 23.542  1.00 28.12 ? 141 GLN A CG    1 
ATOM   1117 C  CD    . GLN A 1 142 ? -18.833 27.741 24.979  1.00 32.43 ? 141 GLN A CD    1 
ATOM   1118 O  OE1   . GLN A 1 142 ? -18.274 26.680 25.254  1.00 26.13 ? 141 GLN A OE1   1 
ATOM   1119 N  NE2   . GLN A 1 142 ? -19.252 28.605 25.913  1.00 25.04 ? 141 GLN A NE2   1 
ATOM   1120 N  N     . GLY A 1 143 ? -19.138 25.231 19.976  1.00 24.58 ? 142 GLY A N     1 
ATOM   1121 C  CA    . GLY A 1 143 ? -18.599 24.345 18.932  1.00 26.42 ? 142 GLY A CA    1 
ATOM   1122 C  C     . GLY A 1 143 ? -19.048 24.855 17.574  1.00 22.45 ? 142 GLY A C     1 
ATOM   1123 O  O     . GLY A 1 143 ? -18.262 24.913 16.627  1.00 25.11 ? 142 GLY A O     1 
ATOM   1124 N  N     . LEU A 1 144 ? -20.309 25.271 17.486  1.00 21.28 ? 143 LEU A N     1 
ATOM   1125 C  CA    . LEU A 1 144 ? -20.863 25.755 16.228  1.00 20.97 ? 143 LEU A CA    1 
ATOM   1126 C  C     . LEU A 1 144 ? -20.102 27.007 15.783  1.00 22.64 ? 143 LEU A C     1 
ATOM   1127 O  O     . LEU A 1 144 ? -19.790 27.192 14.593  1.00 23.26 ? 143 LEU A O     1 
ATOM   1128 C  CB    . LEU A 1 144 ? -22.344 26.069 16.416  1.00 23.79 ? 143 LEU A CB    1 
ATOM   1129 C  CG    . LEU A 1 144 ? -23.147 26.430 15.169  1.00 36.18 ? 143 LEU A CG    1 
ATOM   1130 C  CD1   . LEU A 1 144 ? -23.178 25.247 14.225  1.00 34.59 ? 143 LEU A CD1   1 
ATOM   1131 C  CD2   . LEU A 1 144 ? -24.557 26.865 15.560  1.00 39.88 ? 143 LEU A CD2   1 
ATOM   1132 N  N     . ALA A 1 145 ? -19.780 27.870 16.742  1.00 25.12 ? 144 ALA A N     1 
ATOM   1133 C  CA    . ALA A 1 145 ? -19.027 29.095 16.435  1.00 24.48 ? 144 ALA A CA    1 
ATOM   1134 C  C     . ALA A 1 145 ? -17.643 28.757 15.850  1.00 22.42 ? 144 ALA A C     1 
ATOM   1135 O  O     . ALA A 1 145 ? -17.175 29.393 14.886  1.00 22.40 ? 144 ALA A O     1 
ATOM   1136 C  CB    . ALA A 1 145 ? -18.873 29.944 17.670  1.00 25.41 ? 144 ALA A CB    1 
ATOM   1137 N  N     . MET A 1 146 ? -16.999 27.747 16.423  1.00 22.72 ? 145 MET A N     1 
ATOM   1138 C  CA    . MET A 1 146 ? -15.727 27.266 15.882  1.00 24.56 ? 145 MET A CA    1 
ATOM   1139 C  C     . MET A 1 146 ? -15.922 26.690 14.478  1.00 24.98 ? 145 MET A C     1 
ATOM   1140 O  O     . MET A 1 146 ? -15.111 26.936 13.584  1.00 24.04 ? 145 MET A O     1 
ATOM   1141 C  CB    . MET A 1 146 ? -15.088 26.255 16.816  1.00 24.08 ? 145 MET A CB    1 
ATOM   1142 C  CG    . MET A 1 146 ? -13.790 25.624 16.311  1.00 26.93 ? 145 MET A CG    1 
ATOM   1143 S  SD    . MET A 1 146 ? -12.425 26.809 16.332  1.00 26.43 ? 145 MET A SD    1 
ATOM   1144 C  CE    . MET A 1 146 ? -12.021 26.796 18.109  1.00 27.55 ? 145 MET A CE    1 
ATOM   1145 N  N     . ALA A 1 147 ? -16.985 25.916 14.286  1.00 23.66 ? 146 ALA A N     1 
ATOM   1146 C  CA    . ALA A 1 147 ? -17.284 25.358 12.951  1.00 25.45 ? 146 ALA A CA    1 
ATOM   1147 C  C     . ALA A 1 147 ? -17.395 26.475 11.890  1.00 26.01 ? 146 ALA A C     1 
ATOM   1148 O  O     . ALA A 1 147 ? -16.880 26.342 10.774  1.00 27.74 ? 146 ALA A O     1 
ATOM   1149 C  CB    . ALA A 1 147 ? -18.549 24.522 12.998  1.00 27.63 ? 146 ALA A CB    1 
ATOM   1150 N  N     . ARG A 1 148 ? -18.071 27.566 12.243  1.00 24.11 ? 147 ARG A N     1 
ATOM   1151 C  CA    . ARG A 1 148 ? -18.206 28.727 11.365  1.00 25.56 ? 147 ARG A CA    1 
ATOM   1152 C  C     . ARG A 1 148 ? -16.859 29.398 11.104  1.00 26.72 ? 147 ARG A C     1 
ATOM   1153 O  O     . ARG A 1 148 ? -16.529 29.776 9.967   1.00 26.60 ? 147 ARG A O     1 
ATOM   1154 C  CB    . ARG A 1 148 ? -19.204 29.712 11.978  1.00 26.35 ? 147 ARG A CB    1 
ATOM   1155 N  N     . GLU A 1 149 ? -16.056 29.532 12.144  1.00 24.88 ? 148 GLU A N     1 
ATOM   1156 C  CA    . GLU A 1 149 ? -14.742 30.173 12.003  1.00 26.25 ? 148 GLU A CA    1 
ATOM   1157 C  C     . GLU A 1 149 ? -13.844 29.425 11.025  1.00 29.04 ? 148 GLU A C     1 
ATOM   1158 O  O     . GLU A 1 149 ? -13.113 30.034 10.235  1.00 31.47 ? 148 GLU A O     1 
ATOM   1159 C  CB    . GLU A 1 149 ? -14.052 30.247 13.359  1.00 27.02 ? 148 GLU A CB    1 
ATOM   1160 C  CG    . GLU A 1 149 ? -12.611 30.716 13.277  1.00 38.19 ? 148 GLU A CG    1 
ATOM   1161 C  CD    . GLU A 1 149 ? -12.068 31.189 14.615  1.00 40.88 ? 148 GLU A CD    1 
ATOM   1162 O  OE1   . GLU A 1 149 ? -12.720 30.955 15.658  1.00 45.69 ? 148 GLU A OE1   1 
ATOM   1163 O  OE2   . GLU A 1 149 ? -10.978 31.787 14.605  1.00 47.01 ? 148 GLU A OE2   1 
ATOM   1164 N  N     . ILE A 1 150 ? -13.915 28.102 11.059  1.00 24.14 ? 149 ILE A N     1 
ATOM   1165 C  CA    . ILE A 1 150 ? -13.058 27.274 10.190  1.00 27.67 ? 149 ILE A CA    1 
ATOM   1166 C  C     . ILE A 1 150 ? -13.737 26.856 8.888   1.00 27.28 ? 149 ILE A C     1 
ATOM   1167 O  O     . ILE A 1 150 ? -13.143 26.121 8.072   1.00 30.54 ? 149 ILE A O     1 
ATOM   1168 C  CB    . ILE A 1 150 ? -12.507 26.043 10.918  1.00 28.96 ? 149 ILE A CB    1 
ATOM   1169 C  CG1   . ILE A 1 150 ? -13.595 24.987 11.162  1.00 25.31 ? 149 ILE A CG1   1 
ATOM   1170 C  CG2   . ILE A 1 150 ? -11.843 26.487 12.228  1.00 28.00 ? 149 ILE A CG2   1 
ATOM   1171 C  CD1   . ILE A 1 150 ? -13.033 23.552 11.485  1.00 24.45 ? 149 ILE A CD1   1 
ATOM   1172 N  N     . GLY A 1 151 ? -14.965 27.320 8.684   1.00 22.90 ? 150 GLY A N     1 
ATOM   1173 C  CA    . GLY A 1 151 ? -15.680 27.009 7.449   1.00 23.87 ? 150 GLY A CA    1 
ATOM   1174 C  C     . GLY A 1 151 ? -16.073 25.553 7.302   1.00 28.93 ? 150 GLY A C     1 
ATOM   1175 O  O     . GLY A 1 151 ? -16.013 25.004 6.204   1.00 27.67 ? 150 GLY A O     1 
ATOM   1176 N  N     . SER A 1 152 ? -16.461 24.918 8.404   1.00 24.02 ? 151 SER A N     1 
ATOM   1177 C  CA    A SER A 1 152 ? -17.000 23.560 8.348   0.50 26.17 ? 151 SER A CA    1 
ATOM   1178 C  CA    B SER A 1 152 ? -17.006 23.563 8.363   0.50 24.57 ? 151 SER A CA    1 
ATOM   1179 C  C     . SER A 1 152 ? -18.367 23.604 7.700   1.00 24.27 ? 151 SER A C     1 
ATOM   1180 O  O     . SER A 1 152 ? -19.129 24.550 7.936   1.00 24.18 ? 151 SER A O     1 
ATOM   1181 C  CB    A SER A 1 152 ? -17.152 22.973 9.757   0.50 28.90 ? 151 SER A CB    1 
ATOM   1182 C  CB    B SER A 1 152 ? -17.187 23.017 9.787   0.50 25.83 ? 151 SER A CB    1 
ATOM   1183 O  OG    A SER A 1 152 ? -15.919 23.019 10.449  0.50 38.14 ? 151 SER A OG    1 
ATOM   1184 O  OG    B SER A 1 152 ? -17.708 21.706 9.760   0.50 28.26 ? 151 SER A OG    1 
ATOM   1185 N  N     . VAL A 1 153 ? -18.696 22.570 6.920   1.00 24.19 ? 152 VAL A N     1 
ATOM   1186 C  CA    . VAL A 1 153 ? -20.044 22.477 6.326   1.00 24.73 ? 152 VAL A CA    1 
ATOM   1187 C  C     . VAL A 1 153 ? -21.095 22.039 7.345   1.00 24.52 ? 152 VAL A C     1 
ATOM   1188 O  O     . VAL A 1 153 ? -22.284 22.304 7.163   1.00 29.01 ? 152 VAL A O     1 
ATOM   1189 C  CB    . VAL A 1 153 ? -20.054 21.589 5.067   1.00 27.67 ? 152 VAL A CB    1 
ATOM   1190 C  CG1   . VAL A 1 153 ? -19.096 22.184 4.031   1.00 31.66 ? 152 VAL A CG1   1 
ATOM   1191 C  CG2   . VAL A 1 153 ? -19.667 20.135 5.373   1.00 29.14 ? 152 VAL A CG2   1 
ATOM   1192 N  N     . LYS A 1 154 ? -20.658 21.437 8.455   1.00 23.48 ? 153 LYS A N     1 
ATOM   1193 C  CA    . LYS A 1 154 ? -21.586 20.963 9.508   1.00 24.06 ? 153 LYS A CA    1 
ATOM   1194 C  C     . LYS A 1 154 ? -20.814 20.767 10.793  1.00 26.61 ? 153 LYS A C     1 
ATOM   1195 O  O     . LYS A 1 154 ? -19.679 20.318 10.764  1.00 29.57 ? 153 LYS A O     1 
ATOM   1196 C  CB    . LYS A 1 154 ? -22.213 19.640 9.100   1.00 26.68 ? 153 LYS A CB    1 
ATOM   1197 C  CG    . LYS A 1 154 ? -23.555 19.319 9.770   1.00 45.90 ? 153 LYS A CG    1 
ATOM   1198 C  CD    . LYS A 1 154 ? -24.731 19.718 8.882   1.00 47.29 ? 153 LYS A CD    1 
ATOM   1199 C  CE    . LYS A 1 154 ? -26.042 19.045 9.302   1.00 59.03 ? 153 LYS A CE    1 
ATOM   1200 N  NZ    . LYS A 1 154 ? -26.877 19.843 10.238  1.00 51.46 ? 153 LYS A NZ    1 
ATOM   1201 N  N     . TYR A 1 155 ? -21.453 21.088 11.908  1.00 23.27 ? 154 TYR A N     1 
ATOM   1202 C  CA    . TYR A 1 155 ? -20.942 20.808 13.241  1.00 22.51 ? 154 TYR A CA    1 
ATOM   1203 C  C     . TYR A 1 155 ? -21.810 19.709 13.851  1.00 25.86 ? 154 TYR A C     1 
ATOM   1204 O  O     . TYR A 1 155 ? -23.042 19.782 13.780  1.00 25.47 ? 154 TYR A O     1 
ATOM   1205 C  CB    . TYR A 1 155 ? -21.010 22.061 14.128  1.00 24.37 ? 154 TYR A CB    1 
ATOM   1206 C  CG    . TYR A 1 155 ? -20.648 21.778 15.571  1.00 26.33 ? 154 TYR A CG    1 
ATOM   1207 C  CD1   . TYR A 1 155 ? -19.377 21.328 15.913  1.00 27.45 ? 154 TYR A CD1   1 
ATOM   1208 C  CD2   . TYR A 1 155 ? -21.582 21.905 16.593  1.00 23.61 ? 154 TYR A CD2   1 
ATOM   1209 C  CE1   . TYR A 1 155 ? -19.035 21.028 17.249  1.00 28.23 ? 154 TYR A CE1   1 
ATOM   1210 C  CE2   . TYR A 1 155 ? -21.240 21.627 17.949  1.00 20.46 ? 154 TYR A CE2   1 
ATOM   1211 C  CZ    . TYR A 1 155 ? -19.973 21.176 18.263  1.00 24.35 ? 154 TYR A CZ    1 
ATOM   1212 O  OH    . TYR A 1 155 ? -19.624 20.877 19.574  1.00 24.33 ? 154 TYR A OH    1 
ATOM   1213 N  N     . LEU A 1 156 ? -21.175 18.669 14.387  1.00 24.31 ? 155 LEU A N     1 
ATOM   1214 C  CA    . LEU A 1 156 ? -21.897 17.548 14.984  1.00 22.46 ? 155 LEU A CA    1 
ATOM   1215 C  C     . LEU A 1 156 ? -21.245 17.155 16.293  1.00 24.35 ? 155 LEU A C     1 
ATOM   1216 O  O     . LEU A 1 156 ? -20.029 17.299 16.451  1.00 25.18 ? 155 LEU A O     1 
ATOM   1217 C  CB    . LEU A 1 156 ? -21.909 16.347 14.030  1.00 27.83 ? 155 LEU A CB    1 
ATOM   1218 C  CG    . LEU A 1 156 ? -22.698 16.604 12.714  1.00 32.14 ? 155 LEU A CG    1 
ATOM   1219 C  CD1   . LEU A 1 156 ? -22.402 15.571 11.679  1.00 46.59 ? 155 LEU A CD1   1 
ATOM   1220 C  CD2   . LEU A 1 156 ? -24.178 16.700 12.993  1.00 31.67 ? 155 LEU A CD2   1 
ATOM   1221 N  N     . GLU A 1 157 ? -22.045 16.638 17.218  1.00 20.76 ? 156 GLU A N     1 
ATOM   1222 C  CA    . GLU A 1 157 ? -21.535 16.113 18.468  1.00 23.82 ? 156 GLU A CA    1 
ATOM   1223 C  C     . GLU A 1 157 ? -21.949 14.646 18.618  1.00 22.09 ? 156 GLU A C     1 
ATOM   1224 O  O     . GLU A 1 157 ? -23.044 14.253 18.196  1.00 22.50 ? 156 GLU A O     1 
ATOM   1225 C  CB    . GLU A 1 157 ? -22.058 16.915 19.674  1.00 26.17 ? 156 GLU A CB    1 
ATOM   1226 C  CG    . GLU A 1 157 ? -21.733 18.408 19.606  1.00 25.47 ? 156 GLU A CG    1 
ATOM   1227 C  CD    . GLU A 1 157 ? -22.273 19.170 20.789  1.00 26.25 ? 156 GLU A CD    1 
ATOM   1228 O  OE1   . GLU A 1 157 ? -23.310 18.745 21.374  1.00 24.31 ? 156 GLU A OE1   1 
ATOM   1229 O  OE2   . GLU A 1 157 ? -21.632 20.179 21.149  1.00 25.14 ? 156 GLU A OE2   1 
ATOM   1230 N  N     . CYS A 1 158 ? -21.071 13.838 19.225  1.00 22.04 ? 157 CYS A N     1 
ATOM   1231 C  CA    . CYS A 1 158 ? -21.368 12.409 19.374  1.00 21.19 ? 157 CYS A CA    1 
ATOM   1232 C  C     . CYS A 1 158 ? -20.575 11.802 20.531  1.00 23.52 ? 157 CYS A C     1 
ATOM   1233 O  O     . CYS A 1 158 ? -19.615 12.417 21.022  1.00 23.68 ? 157 CYS A O     1 
ATOM   1234 C  CB    . CYS A 1 158 ? -21.077 11.640 18.069  1.00 23.67 ? 157 CYS A CB    1 
ATOM   1235 S  SG    . CYS A 1 158 ? -19.345 11.399 17.734  1.00 25.20 ? 157 CYS A SG    1 
ATOM   1236 N  N     . SER A 1 159 ? -21.020 10.606 20.945  1.00 22.03 ? 158 SER A N     1 
ATOM   1237 C  CA    . SER A 1 159 ? -20.286 9.730  21.861  1.00 23.24 ? 158 SER A CA    1 
ATOM   1238 C  C     . SER A 1 159 ? -20.125 8.409  21.146  1.00 21.88 ? 158 SER A C     1 
ATOM   1239 O  O     . SER A 1 159 ? -21.120 7.767  20.819  1.00 22.27 ? 158 SER A O     1 
ATOM   1240 C  CB    . SER A 1 159 ? -21.071 9.482  23.150  1.00 22.00 ? 158 SER A CB    1 
ATOM   1241 O  OG    . SER A 1 159 ? -20.488 8.429  23.902  1.00 24.03 ? 158 SER A OG    1 
ATOM   1242 N  N     . ALA A 1 160 ? -18.877 8.017  20.909  1.00 23.52 ? 159 ALA A N     1 
ATOM   1243 C  CA    . ALA A 1 160 ? -18.546 6.689  20.407  1.00 24.85 ? 159 ALA A CA    1 
ATOM   1244 C  C     . ALA A 1 160 ? -18.981 5.619  21.416  1.00 21.67 ? 159 ALA A C     1 
ATOM   1245 O  O     . ALA A 1 160 ? -19.331 4.495  21.058  1.00 24.72 ? 159 ALA A O     1 
ATOM   1246 C  CB    . ALA A 1 160 ? -17.067 6.584  20.156  1.00 24.72 ? 159 ALA A CB    1 
ATOM   1247 N  N     . LEU A 1 161 ? -18.952 5.990  22.680  1.00 21.60 ? 160 LEU A N     1 
ATOM   1248 C  CA    . LEU A 1 161 ? -19.206 5.065  23.771  1.00 23.59 ? 160 LEU A CA    1 
ATOM   1249 C  C     . LEU A 1 161 ? -20.669 4.679  23.872  1.00 29.01 ? 160 LEU A C     1 
ATOM   1250 O  O     . LEU A 1 161 ? -21.008 3.473  23.932  1.00 23.71 ? 160 LEU A O     1 
ATOM   1251 C  CB    . LEU A 1 161 ? -18.730 5.697  25.080  1.00 21.34 ? 160 LEU A CB    1 
ATOM   1252 C  CG    . LEU A 1 161 ? -18.794 4.769  26.305  1.00 28.81 ? 160 LEU A CG    1 
ATOM   1253 C  CD1   . LEU A 1 161 ? -18.106 3.415  26.023  1.00 27.18 ? 160 LEU A CD1   1 
ATOM   1254 C  CD2   . LEU A 1 161 ? -18.166 5.474  27.505  1.00 28.47 ? 160 LEU A CD2   1 
ATOM   1255 N  N     . THR A 1 162 ? -21.547 5.682  23.916  1.00 21.77 ? 161 THR A N     1 
ATOM   1256 C  CA    . THR A 1 162 ? -22.984 5.427  23.976  1.00 20.47 ? 161 THR A CA    1 
ATOM   1257 C  C     . THR A 1 162 ? -23.608 5.290  22.586  1.00 25.42 ? 161 THR A C     1 
ATOM   1258 O  O     . THR A 1 162 ? -24.729 4.786  22.463  1.00 25.00 ? 161 THR A O     1 
ATOM   1259 C  CB    . THR A 1 162 ? -23.762 6.529  24.711  1.00 28.80 ? 161 THR A CB    1 
ATOM   1260 O  OG1   . THR A 1 162 ? -23.784 7.707  23.907  1.00 24.55 ? 161 THR A OG1   1 
ATOM   1261 C  CG2   . THR A 1 162 ? -23.181 6.808  26.131  1.00 27.33 ? 161 THR A CG2   1 
ATOM   1262 N  N     . GLN A 1 163 ? -22.901 5.801  21.568  1.00 20.70 ? 162 GLN A N     1 
ATOM   1263 C  CA    . GLN A 1 163 ? -23.383 5.906  20.182  1.00 20.36 ? 162 GLN A CA    1 
ATOM   1264 C  C     . GLN A 1 163 ? -24.396 7.036  19.952  1.00 22.99 ? 162 GLN A C     1 
ATOM   1265 O  O     . GLN A 1 163 ? -24.915 7.180  18.844  1.00 23.78 ? 162 GLN A O     1 
ATOM   1266 C  CB    . GLN A 1 163 ? -23.897 4.564  19.656  1.00 24.64 ? 162 GLN A CB    1 
ATOM   1267 C  CG    . GLN A 1 163 ? -22.861 3.440  19.777  1.00 23.90 ? 162 GLN A CG    1 
ATOM   1268 C  CD    . GLN A 1 163 ? -23.238 2.253  18.914  1.00 37.38 ? 162 GLN A CD    1 
ATOM   1269 O  OE1   . GLN A 1 163 ? -24.384 1.821  18.935  1.00 28.81 ? 162 GLN A OE1   1 
ATOM   1270 N  NE2   . GLN A 1 163 ? -22.287 1.742  18.133  1.00 26.35 ? 162 GLN A NE2   1 
ATOM   1271 N  N     . ARG A 1 164 ? -24.690 7.836  20.979  1.00 24.51 ? 163 ARG A N     1 
ATOM   1272 C  CA    . ARG A 1 164 ? -25.517 9.015  20.760  1.00 26.14 ? 163 ARG A CA    1 
ATOM   1273 C  C     . ARG A 1 164 ? -24.858 9.965  19.739  1.00 24.07 ? 163 ARG A C     1 
ATOM   1274 O  O     . ARG A 1 164 ? -23.694 10.357 19.903  1.00 23.20 ? 163 ARG A O     1 
ATOM   1275 C  CB    . ARG A 1 164 ? -25.803 9.750  22.082  1.00 23.57 ? 163 ARG A CB    1 
ATOM   1276 C  CG    . ARG A 1 164 ? -26.624 10.997 21.880  1.00 30.61 ? 163 ARG A CG    1 
ATOM   1277 N  N     . GLY A 1 165 ? -25.589 10.262 18.663  1.00 22.41 ? 164 GLY A N     1 
ATOM   1278 C  CA    . GLY A 1 165 ? -25.131 11.170 17.589  1.00 25.73 ? 164 GLY A CA    1 
ATOM   1279 C  C     . GLY A 1 165 ? -24.159 10.548 16.592  1.00 23.13 ? 164 GLY A C     1 
ATOM   1280 O  O     . GLY A 1 165 ? -23.807 11.194 15.582  1.00 24.92 ? 164 GLY A O     1 
ATOM   1281 N  N     . LEU A 1 166 ? -23.798 9.282  16.813  1.00 23.46 ? 165 LEU A N     1 
ATOM   1282 C  CA    . LEU A 1 166 ? -22.712 8.645  16.055  1.00 21.51 ? 165 LEU A CA    1 
ATOM   1283 C  C     . LEU A 1 166 ? -23.129 8.398  14.603  1.00 26.30 ? 165 LEU A C     1 
ATOM   1284 O  O     . LEU A 1 166 ? -22.421 8.784  13.669  1.00 22.15 ? 165 LEU A O     1 
ATOM   1285 C  CB    . LEU A 1 166 ? -22.299 7.332  16.722  1.00 21.23 ? 165 LEU A CB    1 
ATOM   1286 C  CG    . LEU A 1 166 ? -21.074 6.595  16.160  1.00 22.62 ? 165 LEU A CG    1 
ATOM   1287 C  CD1   . LEU A 1 166 ? -19.826 7.469  16.135  1.00 25.37 ? 165 LEU A CD1   1 
ATOM   1288 C  CD2   . LEU A 1 166 ? -20.847 5.303  16.953  1.00 22.92 ? 165 LEU A CD2   1 
ATOM   1289 N  N     . LYS A 1 167 ? -24.264 7.734  14.415  1.00 23.33 ? 166 LYS A N     1 
ATOM   1290 C  CA    . LYS A 1 167 ? -24.780 7.496  13.039  1.00 23.43 ? 166 LYS A CA    1 
ATOM   1291 C  C     . LYS A 1 167 ? -24.889 8.798  12.250  1.00 24.47 ? 166 LYS A C     1 
ATOM   1292 O  O     . LYS A 1 167 ? -24.522 8.871  11.069  1.00 22.94 ? 166 LYS A O     1 
ATOM   1293 C  CB    . LYS A 1 167 ? -26.132 6.786  13.069  1.00 22.90 ? 166 LYS A CB    1 
ATOM   1294 C  CG    . LYS A 1 167 ? -26.609 6.388  11.673  1.00 22.12 ? 166 LYS A CG    1 
ATOM   1295 C  CD    . LYS A 1 167 ? -27.950 5.672  11.708  1.00 23.69 ? 166 LYS A CD    1 
ATOM   1296 C  CE    . LYS A 1 167 ? -28.396 5.301  10.286  1.00 31.67 ? 166 LYS A CE    1 
ATOM   1297 N  NZ    . LYS A 1 167 ? -29.048 6.428  9.568   1.00 26.08 ? 166 LYS A NZ    1 
ATOM   1298 N  N     . THR A 1 168 ? -25.405 9.832  12.910  1.00 20.93 ? 167 THR A N     1 
ATOM   1299 C  CA    . THR A 1 168 ? -25.605 11.118 12.258  1.00 24.07 ? 167 THR A CA    1 
ATOM   1300 C  C     . THR A 1 168 ? -24.299 11.741 11.743  1.00 23.38 ? 167 THR A C     1 
ATOM   1301 O  O     . THR A 1 168 ? -24.304 12.370 10.691  1.00 22.84 ? 167 THR A O     1 
ATOM   1302 C  CB    . THR A 1 168 ? -26.372 12.079 13.188  1.00 25.95 ? 167 THR A CB    1 
ATOM   1303 O  OG1   . THR A 1 168 ? -27.659 11.502 13.467  1.00 25.88 ? 167 THR A OG1   1 
ATOM   1304 C  CG2   . THR A 1 168 ? -26.543 13.433 12.523  1.00 25.13 ? 167 THR A CG2   1 
ATOM   1305 N  N     . VAL A 1 169 ? -23.188 11.526 12.442  1.00 24.44 ? 168 VAL A N     1 
ATOM   1306 C  CA    . VAL A 1 169 ? -21.881 12.040 11.982  1.00 24.10 ? 168 VAL A CA    1 
ATOM   1307 C  C     . VAL A 1 169 ? -21.584 11.496 10.569  1.00 26.53 ? 168 VAL A C     1 
ATOM   1308 O  O     . VAL A 1 169 ? -21.298 12.267 9.635   1.00 24.65 ? 168 VAL A O     1 
ATOM   1309 C  CB    . VAL A 1 169 ? -20.759 11.723 12.991  1.00 21.56 ? 168 VAL A CB    1 
ATOM   1310 C  CG1   . VAL A 1 169 ? -19.355 11.930 12.387  1.00 25.42 ? 168 VAL A CG1   1 
ATOM   1311 C  CG2   . VAL A 1 169 ? -20.951 12.601 14.266  1.00 22.77 ? 168 VAL A CG2   1 
ATOM   1312 N  N     . PHE A 1 170 ? -21.744 10.190 10.400  1.00 24.72 ? 169 PHE A N     1 
ATOM   1313 C  CA    . PHE A 1 170 ? -21.446 9.546  9.128   1.00 22.92 ? 169 PHE A CA    1 
ATOM   1314 C  C     . PHE A 1 170 ? -22.523 9.813  8.078   1.00 21.61 ? 169 PHE A C     1 
ATOM   1315 O  O     . PHE A 1 170 ? -22.217 9.994  6.895   1.00 23.27 ? 169 PHE A O     1 
ATOM   1316 C  CB    . PHE A 1 170 ? -21.136 8.070  9.371   1.00 24.64 ? 169 PHE A CB    1 
ATOM   1317 C  CG    . PHE A 1 170 ? -19.863 7.881  10.140  1.00 21.16 ? 169 PHE A CG    1 
ATOM   1318 C  CD1   . PHE A 1 170 ? -18.623 7.887  9.497   1.00 22.83 ? 169 PHE A CD1   1 
ATOM   1319 C  CD2   . PHE A 1 170 ? -19.885 7.820  11.531  1.00 20.17 ? 169 PHE A CD2   1 
ATOM   1320 C  CE1   . PHE A 1 170 ? -17.449 7.785  10.217  1.00 27.82 ? 169 PHE A CE1   1 
ATOM   1321 C  CE2   . PHE A 1 170 ? -18.713 7.724  12.272  1.00 25.06 ? 169 PHE A CE2   1 
ATOM   1322 C  CZ    . PHE A 1 170 ? -17.487 7.697  11.615  1.00 26.02 ? 169 PHE A CZ    1 
ATOM   1323 N  N     . ASP A 1 171 ? -23.778 9.897  8.506   1.00 21.66 ? 170 ASP A N     1 
ATOM   1324 C  CA    . ASP A 1 171 ? -24.865 10.299 7.596   1.00 21.32 ? 170 ASP A CA    1 
ATOM   1325 C  C     . ASP A 1 171 ? -24.562 11.666 6.969   1.00 23.06 ? 170 ASP A C     1 
ATOM   1326 O  O     . ASP A 1 171 ? -24.663 11.850 5.741   1.00 24.25 ? 170 ASP A O     1 
ATOM   1327 C  CB    . ASP A 1 171 ? -26.191 10.364 8.321   1.00 23.02 ? 170 ASP A CB    1 
ATOM   1328 C  CG    . ASP A 1 171 ? -26.744 8.987  8.694   1.00 26.27 ? 170 ASP A CG    1 
ATOM   1329 O  OD1   . ASP A 1 171 ? -26.152 7.941  8.301   1.00 25.62 ? 170 ASP A OD1   1 
ATOM   1330 O  OD2   . ASP A 1 171 ? -27.759 8.994  9.406   1.00 28.61 ? 170 ASP A OD2   1 
ATOM   1331 N  N     . GLU A 1 172 ? -24.159 12.612 7.804   1.00 25.34 ? 171 GLU A N     1 
ATOM   1332 C  CA    . GLU A 1 172 ? -23.870 13.973 7.330   1.00 22.81 ? 171 GLU A CA    1 
ATOM   1333 C  C     . GLU A 1 172 ? -22.591 14.030 6.490   1.00 24.40 ? 171 GLU A C     1 
ATOM   1334 O  O     . GLU A 1 172 ? -22.501 14.839 5.542   1.00 24.10 ? 171 GLU A O     1 
ATOM   1335 C  CB    . GLU A 1 172 ? -23.839 14.948 8.514   1.00 25.15 ? 171 GLU A CB    1 
ATOM   1336 C  CG    . GLU A 1 172 ? -25.204 15.112 9.160   1.00 25.81 ? 171 GLU A CG    1 
ATOM   1337 C  CD    . GLU A 1 172 ? -26.187 15.848 8.262   1.00 40.49 ? 171 GLU A CD    1 
ATOM   1338 O  OE1   . GLU A 1 172 ? -25.725 16.572 7.359   1.00 36.27 ? 171 GLU A OE1   1 
ATOM   1339 O  OE2   . GLU A 1 172 ? -27.406 15.691 8.452   1.00 42.05 ? 171 GLU A OE2   1 
ATOM   1340 N  N     . ALA A 1 173 ? -21.617 13.174 6.811   1.00 23.59 ? 172 ALA A N     1 
ATOM   1341 C  CA    . ALA A 1 173 ? -20.401 13.048 6.012   1.00 21.12 ? 172 ALA A CA    1 
ATOM   1342 C  C     . ALA A 1 173 ? -20.758 12.563 4.608   1.00 22.74 ? 172 ALA A C     1 
ATOM   1343 O  O     . ALA A 1 173 ? -20.298 13.111 3.601   1.00 27.27 ? 172 ALA A O     1 
ATOM   1344 C  CB    . ALA A 1 173 ? -19.361 12.069 6.714   1.00 25.17 ? 172 ALA A CB    1 
ATOM   1345 N  N     . ILE A 1 174 ? -21.624 11.563 4.549   1.00 22.73 ? 173 ILE A N     1 
ATOM   1346 C  CA    . ILE A 1 174 ? -22.098 11.032 3.281   1.00 21.10 ? 173 ILE A CA    1 
ATOM   1347 C  C     . ILE A 1 174 ? -22.844 12.109 2.489   1.00 24.15 ? 173 ILE A C     1 
ATOM   1348 O  O     . ILE A 1 174 ? -22.559 12.328 1.314   1.00 27.27 ? 173 ILE A O     1 
ATOM   1349 C  CB    . ILE A 1 174 ? -22.974 9.800  3.524   1.00 22.63 ? 173 ILE A CB    1 
ATOM   1350 C  CG1   . ILE A 1 174 ? -22.095 8.651  4.024   1.00 23.35 ? 173 ILE A CG1   1 
ATOM   1351 C  CG2   . ILE A 1 174 ? -23.677 9.367  2.231   1.00 25.55 ? 173 ILE A CG2   1 
ATOM   1352 C  CD1   . ILE A 1 174 ? -22.863 7.573  4.728   1.00 22.66 ? 173 ILE A CD1   1 
ATOM   1353 N  N     . ARG A 1 175 ? -23.807 12.775 3.117   1.00 23.49 ? 174 ARG A N     1 
ATOM   1354 C  CA    . ARG A 1 175 ? -24.614 13.806 2.445   1.00 25.52 ? 174 ARG A CA    1 
ATOM   1355 C  C     . ARG A 1 175 ? -23.783 15.002 1.998   1.00 24.05 ? 174 ARG A C     1 
ATOM   1356 O  O     . ARG A 1 175 ? -24.087 15.614 0.968   1.00 27.18 ? 174 ARG A O     1 
ATOM   1357 C  CB    . ARG A 1 175 ? -25.729 14.306 3.373   1.00 27.47 ? 174 ARG A CB    1 
ATOM   1358 C  CG    . ARG A 1 175 ? -26.794 13.258 3.747   1.00 26.68 ? 174 ARG A CG    1 
ATOM   1359 C  CD    . ARG A 1 175 ? -27.495 12.712 2.529   1.00 26.79 ? 174 ARG A CD    1 
ATOM   1360 N  NE    . ARG A 1 175 ? -28.604 11.819 2.882   1.00 28.27 ? 174 ARG A NE    1 
ATOM   1361 C  CZ    . ARG A 1 175 ? -29.281 11.115 1.989   1.00 29.29 ? 174 ARG A CZ    1 
ATOM   1362 N  NH1   . ARG A 1 175 ? -30.264 10.336 2.380   1.00 28.77 ? 174 ARG A NH1   1 
ATOM   1363 N  NH2   . ARG A 1 175 ? -28.961 11.184 0.699   1.00 33.34 ? 174 ARG A NH2   1 
ATOM   1364 N  N     . ALA A 1 176 ? -22.730 15.320 2.760   1.00 24.92 ? 175 ALA A N     1 
ATOM   1365 C  CA    . ALA A 1 176 ? -21.755 16.356 2.379   1.00 24.96 ? 175 ALA A CA    1 
ATOM   1366 C  C     . ALA A 1 176 ? -21.091 16.044 1.033   1.00 30.27 ? 175 ALA A C     1 
ATOM   1367 O  O     . ALA A 1 176 ? -20.720 16.962 0.300   1.00 31.31 ? 175 ALA A O     1 
ATOM   1368 C  CB    . ALA A 1 176 ? -20.690 16.519 3.498   1.00 26.91 ? 175 ALA A CB    1 
ATOM   1369 N  N     . VAL A 1 177 ? -20.954 14.756 0.683   1.00 24.10 ? 176 VAL A N     1 
ATOM   1370 C  CA    . VAL A 1 177 ? -20.319 14.362 -0.563  1.00 25.53 ? 176 VAL A CA    1 
ATOM   1371 C  C     . VAL A 1 177 ? -21.339 14.101 -1.660  1.00 30.66 ? 176 VAL A C     1 
ATOM   1372 O  O     . VAL A 1 177 ? -21.179 14.578 -2.786  1.00 31.77 ? 176 VAL A O     1 
ATOM   1373 C  CB    . VAL A 1 177 ? -19.453 13.093 -0.379  1.00 27.42 ? 176 VAL A CB    1 
ATOM   1374 C  CG1   . VAL A 1 177 ? -18.806 12.639 -1.702  1.00 24.10 ? 176 VAL A CG1   1 
ATOM   1375 C  CG2   . VAL A 1 177 ? -18.386 13.330 0.723   1.00 27.78 ? 176 VAL A CG2   1 
ATOM   1376 N  N     . LEU A 1 178 ? -22.383 13.348 -1.334  1.00 25.65 ? 177 LEU A N     1 
ATOM   1377 C  CA    . LEU A 1 178 ? -23.293 12.858 -2.362  1.00 34.20 ? 177 LEU A CA    1 
ATOM   1378 C  C     . LEU A 1 178 ? -24.573 13.660 -2.469  1.00 33.79 ? 177 LEU A C     1 
ATOM   1379 O  O     . LEU A 1 178 ? -25.309 13.493 -3.429  1.00 30.28 ? 177 LEU A O     1 
ATOM   1380 C  CB    . LEU A 1 178 ? -23.644 11.386 -2.104  1.00 27.71 ? 177 LEU A CB    1 
ATOM   1381 C  CG    . LEU A 1 178 ? -22.506 10.369 -2.133  1.00 31.50 ? 177 LEU A CG    1 
ATOM   1382 C  CD1   . LEU A 1 178 ? -23.095 8.973  -1.962  1.00 37.40 ? 177 LEU A CD1   1 
ATOM   1383 C  CD2   . LEU A 1 178 ? -21.688 10.466 -3.388  1.00 29.69 ? 177 LEU A CD2   1 
ATOM   1384 N  N     . GLY A 1 179 ? -24.851 14.510 -1.492  1.00 34.95 ? 178 GLY A N     1 
ATOM   1385 C  CA    . GLY A 1 179 ? -26.094 15.255 -1.458  1.00 40.63 ? 178 GLY A CA    1 
ATOM   1386 C  C     . GLY A 1 179 ? -27.241 14.412 -0.929  1.00 47.02 ? 178 GLY A C     1 
ATOM   1387 O  O     . GLY A 1 179 ? -27.126 13.182 -0.771  1.00 38.62 ? 178 GLY A O     1 
ATOM   1388 O  OXT   . GLY A 1 179 ? -28.317 14.957 -0.655  1.00 44.52 ? 178 GLY A OXT   1 
ATOM   1389 N  N     . GLU B 2 1   ? -33.175 7.172  2.463   1.00 27.30 ? 10  GLU I N     1 
ATOM   1390 C  CA    . GLU B 2 1   ? -32.509 7.382  3.778   1.00 27.59 ? 10  GLU I CA    1 
ATOM   1391 C  C     . GLU B 2 1   ? -31.175 6.635  3.770   1.00 25.93 ? 10  GLU I C     1 
ATOM   1392 O  O     . GLU B 2 1   ? -30.818 6.034  2.757   1.00 23.73 ? 10  GLU I O     1 
ATOM   1393 C  CB    . GLU B 2 1   ? -33.415 6.888  4.910   1.00 37.86 ? 10  GLU I CB    1 
ATOM   1394 C  CG    . GLU B 2 1   ? -33.956 5.481  4.755   1.00 50.83 ? 10  GLU I CG    1 
ATOM   1395 C  CD    . GLU B 2 1   ? -35.131 5.210  5.691   1.00 55.04 ? 10  GLU I CD    1 
ATOM   1396 O  OE1   . GLU B 2 1   ? -35.134 5.752  6.822   1.00 76.65 ? 10  GLU I OE1   1 
ATOM   1397 O  OE2   . GLU B 2 1   ? -36.054 4.465  5.289   1.00 74.69 ? 10  GLU I OE2   1 
ATOM   1398 N  N     . ILE B 2 2   ? -30.418 6.731  4.859   1.00 21.25 ? 11  ILE I N     1 
ATOM   1399 C  CA    . ILE B 2 2   ? -29.133 6.033  4.963   1.00 21.52 ? 11  ILE I CA    1 
ATOM   1400 C  C     . ILE B 2 2   ? -29.192 4.916  6.019   1.00 26.40 ? 11  ILE I C     1 
ATOM   1401 O  O     . ILE B 2 2   ? -29.586 5.141  7.163   1.00 23.06 ? 11  ILE I O     1 
ATOM   1402 C  CB    . ILE B 2 2   ? -27.992 7.004  5.284   1.00 20.69 ? 11  ILE I CB    1 
ATOM   1403 C  CG1   . ILE B 2 2   ? -27.869 8.072  4.181   1.00 23.54 ? 11  ILE I CG1   1 
ATOM   1404 C  CG2   . ILE B 2 2   ? -26.673 6.254  5.407   1.00 24.12 ? 11  ILE I CG2   1 
ATOM   1405 C  CD1   . ILE B 2 2   ? -26.900 9.231  4.538   1.00 25.61 ? 11  ILE I CD1   1 
ATOM   1406 N  N     . SER B 2 3   ? -28.733 3.726  5.643   1.00 19.89 ? 12  SER I N     1 
ATOM   1407 C  CA    . SER B 2 3   ? -28.828 2.566  6.530   1.00 22.07 ? 12  SER I CA    1 
ATOM   1408 C  C     . SER B 2 3   ? -27.687 2.578  7.518   1.00 21.92 ? 12  SER I C     1 
ATOM   1409 O  O     . SER B 2 3   ? -26.729 3.332  7.366   1.00 25.59 ? 12  SER I O     1 
ATOM   1410 C  CB    . SER B 2 3   ? -28.724 1.270  5.734   1.00 29.00 ? 12  SER I CB    1 
ATOM   1411 O  OG    . SER B 2 3   ? -27.384 1.056  5.324   1.00 24.72 ? 12  SER I OG    1 
ATOM   1412 N  N     . LEU B 2 4   ? -27.749 1.660  8.487   1.00 22.28 ? 13  LEU I N     1 
ATOM   1413 C  CA    . LEU B 2 4   ? -26.618 1.359  9.346   1.00 20.79 ? 13  LEU I CA    1 
ATOM   1414 C  C     . LEU B 2 4   ? -25.524 0.686  8.491   1.00 22.88 ? 13  LEU I C     1 
ATOM   1415 O  O     . LEU B 2 4   ? -25.843 0.066  7.472   1.00 23.53 ? 13  LEU I O     1 
ATOM   1416 C  CB    . LEU B 2 4   ? -27.064 0.419  10.472  1.00 24.05 ? 13  LEU I CB    1 
ATOM   1417 C  CG    . LEU B 2 4   ? -27.971 1.054  11.521  1.00 29.74 ? 13  LEU I CG    1 
ATOM   1418 C  CD1   . LEU B 2 4   ? -28.579 -0.032 12.455  1.00 27.64 ? 13  LEU I CD1   1 
ATOM   1419 C  CD2   . LEU B 2 4   ? -27.169 2.095  12.281  1.00 26.71 ? 13  LEU I CD2   1 
ATOM   1420 N  N     . PRO B 2 5   ? -24.244 0.816  8.877   1.00 25.70 ? 14  PRO I N     1 
ATOM   1421 C  CA    . PRO B 2 5   ? -23.178 0.212  8.091   1.00 26.04 ? 14  PRO I CA    1 
ATOM   1422 C  C     . PRO B 2 5   ? -23.081 -1.295 8.243   1.00 24.89 ? 14  PRO I C     1 
ATOM   1423 O  O     . PRO B 2 5   ? -23.539 -1.844 9.245   1.00 25.29 ? 14  PRO I O     1 
ATOM   1424 C  CB    . PRO B 2 5   ? -21.907 0.876  8.653   1.00 24.71 ? 14  PRO I CB    1 
ATOM   1425 C  CG    . PRO B 2 5   ? -22.247 1.163  10.047  1.00 25.67 ? 14  PRO I CG    1 
ATOM   1426 C  CD    . PRO B 2 5   ? -23.699 1.582  10.017  1.00 26.62 ? 14  PRO I CD    1 
ATOM   1427 N  N     . SER B 2 6   ? -22.452 -1.937 7.263   1.00 23.75 ? 15  SER I N     1 
ATOM   1428 C  CA    . SER B 2 6   ? -22.205 -3.377 7.272   1.00 22.88 ? 15  SER I CA    1 
ATOM   1429 C  C     . SER B 2 6   ? -20.838 -3.666 6.659   1.00 25.41 ? 15  SER I C     1 
ATOM   1430 O  O     . SER B 2 6   ? -20.169 -2.758 6.175   1.00 23.55 ? 15  SER I O     1 
ATOM   1431 C  CB    . SER B 2 6   ? -23.253 -4.095 6.432   1.00 25.54 ? 15  SER I CB    1 
ATOM   1432 O  OG    . SER B 2 6   ? -23.189 -3.661 5.083   1.00 29.47 ? 15  SER I OG    1 
ATOM   1433 N  N     . ASP B 2 7   ? -20.443 -4.934 6.670   1.00 22.83 ? 16  ASP I N     1 
ATOM   1434 C  CA    . ASP B 2 7   ? -19.256 -5.391 5.923   1.00 28.09 ? 16  ASP I CA    1 
ATOM   1435 C  C     . ASP B 2 7   ? -17.952 -4.732 6.367   1.00 23.59 ? 16  ASP I C     1 
ATOM   1436 O  O     . ASP B 2 7   ? -17.088 -4.391 5.543   1.00 27.51 ? 16  ASP I O     1 
ATOM   1437 C  CB    . ASP B 2 7   ? -19.452 -5.179 4.424   1.00 27.02 ? 16  ASP I CB    1 
ATOM   1438 C  CG    . ASP B 2 7   ? -20.727 -5.813 3.911   1.00 38.46 ? 16  ASP I CG    1 
ATOM   1439 O  OD1   . ASP B 2 7   ? -20.917 -7.008 4.154   1.00 35.11 ? 16  ASP I OD1   1 
ATOM   1440 O  OD2   . ASP B 2 7   ? -21.522 -5.122 3.249   1.00 27.64 ? 16  ASP I OD2   1 
ATOM   1441 N  N     . PHE B 2 8   ? -17.785 -4.557 7.669   1.00 25.14 ? 17  PHE I N     1 
ATOM   1442 C  CA    . PHE B 2 8   ? -16.541 -3.974 8.168   1.00 24.35 ? 17  PHE I CA    1 
ATOM   1443 C  C     . PHE B 2 8   ? -15.338 -4.787 7.684   1.00 22.93 ? 17  PHE I C     1 
ATOM   1444 O  O     . PHE B 2 8   ? -15.327 -6.009 7.833   1.00 24.73 ? 17  PHE I O     1 
ATOM   1445 C  CB    . PHE B 2 8   ? -16.509 -3.956 9.689   1.00 25.63 ? 17  PHE I CB    1 
ATOM   1446 C  CG    . PHE B 2 8   ? -15.149 -3.618 10.260  1.00 22.41 ? 17  PHE I CG    1 
ATOM   1447 C  CD1   . PHE B 2 8   ? -14.705 -2.302 10.329  1.00 23.96 ? 17  PHE I CD1   1 
ATOM   1448 C  CD2   . PHE B 2 8   ? -14.321 -4.616 10.731  1.00 23.71 ? 17  PHE I CD2   1 
ATOM   1449 C  CE1   . PHE B 2 8   ? -13.441 -1.988 10.861  1.00 25.02 ? 17  PHE I CE1   1 
ATOM   1450 C  CE2   . PHE B 2 8   ? -13.064 -4.317 11.275  1.00 29.30 ? 17  PHE I CE2   1 
ATOM   1451 C  CZ    . PHE B 2 8   ? -12.627 -3.007 11.331  1.00 27.64 ? 17  PHE I CZ    1 
ATOM   1452 N  N     . GLU B 2 9   ? -14.306 -4.103 7.186   1.00 23.65 ? 18  GLU I N     1 
ATOM   1453 C  CA    . GLU B 2 9   ? -13.008 -4.757 6.921   1.00 26.88 ? 18  GLU I CA    1 
ATOM   1454 C  C     . GLU B 2 9   ? -11.891 -3.827 7.376   1.00 30.11 ? 18  GLU I C     1 
ATOM   1455 O  O     . GLU B 2 9   ? -11.969 -2.632 7.162   1.00 26.81 ? 18  GLU I O     1 
ATOM   1456 C  CB    A GLU B 2 9   ? -12.838 -5.082 5.433   0.50 25.16 ? 18  GLU I CB    1 
ATOM   1457 C  CB    B GLU B 2 9   ? -12.859 -5.083 5.428   0.50 25.08 ? 18  GLU I CB    1 
ATOM   1458 C  CG    A GLU B 2 9   ? -11.574 -5.883 5.124   0.50 28.87 ? 18  GLU I CG    1 
ATOM   1459 C  CG    B GLU B 2 9   ? -13.916 -6.049 4.897   0.50 26.76 ? 18  GLU I CG    1 
ATOM   1460 C  CD    A GLU B 2 9   ? -11.330 -6.058 3.635   0.50 34.64 ? 18  GLU I CD    1 
ATOM   1461 C  CD    B GLU B 2 9   ? -13.797 -6.315 3.407   0.50 38.46 ? 18  GLU I CD    1 
ATOM   1462 O  OE1   A GLU B 2 9   ? -11.513 -5.078 2.885   0.50 47.41 ? 18  GLU I OE1   1 
ATOM   1463 O  OE1   B GLU B 2 9   ? -12.799 -5.883 2.791   0.50 42.20 ? 18  GLU I OE1   1 
ATOM   1464 O  OE2   A GLU B 2 9   ? -10.939 -7.171 3.220   0.50 40.23 ? 18  GLU I OE2   1 
ATOM   1465 O  OE2   B GLU B 2 9   ? -14.710 -6.969 2.856   0.50 48.95 ? 18  GLU I OE2   1 
ATOM   1466 N  N     . HIS B 2 10  ? -10.867 -4.380 8.026   1.00 23.44 ? 19  HIS I N     1 
ATOM   1467 C  CA    . HIS B 2 10  ? -9.684  -3.601 8.436   1.00 24.11 ? 19  HIS I CA    1 
ATOM   1468 C  C     . HIS B 2 10  ? -8.679  -3.810 7.334   1.00 30.11 ? 19  HIS I C     1 
ATOM   1469 O  O     . HIS B 2 10  ? -7.975  -4.813 7.313   1.00 29.39 ? 19  HIS I O     1 
ATOM   1470 C  CB    . HIS B 2 10  ? -9.176  -4.084 9.793   1.00 28.48 ? 19  HIS I CB    1 
ATOM   1471 C  CG    . HIS B 2 10  ? -8.097  -3.231 10.395  1.00 29.51 ? 19  HIS I CG    1 
ATOM   1472 N  ND1   . HIS B 2 10  ? -7.677  -3.385 11.705  1.00 29.46 ? 19  HIS I ND1   1 
ATOM   1473 C  CD2   . HIS B 2 10  ? -7.352  -2.226 9.875   1.00 31.07 ? 19  HIS I CD2   1 
ATOM   1474 C  CE1   . HIS B 2 10  ? -6.718  -2.510 11.960  1.00 34.67 ? 19  HIS I CE1   1 
ATOM   1475 N  NE2   . HIS B 2 10  ? -6.503  -1.792 10.870  1.00 27.96 ? 19  HIS I NE2   1 
ATOM   1476 N  N     . THR B 2 11  ? -8.643  -2.881 6.393   1.00 25.91 ? 20  THR I N     1 
ATOM   1477 C  CA    . THR B 2 11  ? -7.943  -3.088 5.138   1.00 30.17 ? 20  THR I CA    1 
ATOM   1478 C  C     . THR B 2 11  ? -6.443  -2.829 5.251   1.00 29.69 ? 20  THR I C     1 
ATOM   1479 O  O     . THR B 2 11  ? -5.668  -3.569 4.672   1.00 28.55 ? 20  THR I O     1 
ATOM   1480 C  CB    . THR B 2 11  ? -8.540  -2.222 4.030   1.00 31.09 ? 20  THR I CB    1 
ATOM   1481 O  OG1   . THR B 2 11  ? -8.282  -0.848 4.323   1.00 42.94 ? 20  THR I OG1   1 
ATOM   1482 C  CG2   . THR B 2 11  ? -10.063 -2.450 3.942   1.00 27.95 ? 20  THR I CG2   1 
ATOM   1483 N  N     . ILE B 2 12  ? -6.040  -1.788 5.993   1.00 28.20 ? 21  ILE I N     1 
ATOM   1484 C  CA    . ILE B 2 12  ? -4.618  -1.458 6.169   1.00 24.62 ? 21  ILE I CA    1 
ATOM   1485 C  C     . ILE B 2 12  ? -4.365  -1.210 7.643   1.00 28.47 ? 21  ILE I C     1 
ATOM   1486 O  O     . ILE B 2 12  ? -5.150  -0.515 8.324   1.00 26.15 ? 21  ILE I O     1 
ATOM   1487 C  CB    . ILE B 2 12  ? -4.188  -0.202 5.345   1.00 30.46 ? 21  ILE I CB    1 
ATOM   1488 C  CG1   . ILE B 2 12  ? -4.440  -0.417 3.851   1.00 32.15 ? 21  ILE I CG1   1 
ATOM   1489 C  CG2   . ILE B 2 12  ? -2.718  0.148  5.594   1.00 30.20 ? 21  ILE I CG2   1 
ATOM   1490 C  CD1   . ILE B 2 12  ? -4.232  0.841  3.011   1.00 41.87 ? 21  ILE I CD1   1 
ATOM   1491 N  N     . HIS B 2 13  ? -3.282  -1.800 8.139   1.00 28.99 ? 22  HIS I N     1 
ATOM   1492 C  CA    . HIS B 2 13  ? -2.747  -1.453 9.449   1.00 28.22 ? 22  HIS I CA    1 
ATOM   1493 C  C     . HIS B 2 13  ? -1.278  -1.146 9.341   1.00 34.00 ? 22  HIS I C     1 
ATOM   1494 O  O     . HIS B 2 13  ? -0.501  -1.942 8.814   1.00 30.83 ? 22  HIS I O     1 
ATOM   1495 C  CB    . HIS B 2 13  ? -2.942  -2.549 10.477  1.00 31.26 ? 22  HIS I CB    1 
ATOM   1496 C  CG    . HIS B 2 13  ? -2.280  -2.246 11.785  1.00 35.52 ? 22  HIS I CG    1 
ATOM   1497 N  ND1   . HIS B 2 13  ? -2.784  -1.320 12.673  1.00 35.81 ? 22  HIS I ND1   1 
ATOM   1498 C  CD2   . HIS B 2 13  ? -1.126  -2.702 12.330  1.00 44.94 ? 22  HIS I CD2   1 
ATOM   1499 C  CE1   . HIS B 2 13  ? -1.986  -1.246 13.727  1.00 51.37 ? 22  HIS I CE1   1 
ATOM   1500 N  NE2   . HIS B 2 13  ? -0.970  -2.070 13.541  1.00 35.77 ? 22  HIS I NE2   1 
ATOM   1501 N  N     . VAL B 2 14  ? -0.897  0.022  9.842   1.00 28.88 ? 23  VAL I N     1 
ATOM   1502 C  CA    . VAL B 2 14  ? 0.495   0.380  9.987   1.00 29.91 ? 23  VAL I CA    1 
ATOM   1503 C  C     . VAL B 2 14  ? 0.834   0.582  11.477  1.00 33.49 ? 23  VAL I C     1 
ATOM   1504 O  O     . VAL B 2 14  ? 0.123   1.271  12.211  1.00 30.31 ? 23  VAL I O     1 
ATOM   1505 C  CB    . VAL B 2 14  ? 0.815   1.634  9.192   1.00 32.09 ? 23  VAL I CB    1 
ATOM   1506 C  CG1   . VAL B 2 14  ? 2.289   2.040  9.423   1.00 33.53 ? 23  VAL I CG1   1 
ATOM   1507 C  CG2   . VAL B 2 14  ? 0.538   1.389  7.713   1.00 34.32 ? 23  VAL I CG2   1 
ATOM   1508 N  N     . GLY B 2 15  ? 1.909   -0.062 11.917  1.00 28.03 ? 24  GLY I N     1 
ATOM   1509 C  CA    . GLY B 2 15  ? 2.367   0.035  13.289  1.00 33.32 ? 24  GLY I CA    1 
ATOM   1510 C  C     . GLY B 2 15  ? 3.718   0.712  13.308  1.00 39.26 ? 24  GLY I C     1 
ATOM   1511 O  O     . GLY B 2 15  ? 4.248   1.098  12.262  1.00 37.25 ? 24  GLY I O     1 
ATOM   1512 N  N     . PHE B 2 16  ? 4.253   0.906  14.510  1.00 33.96 ? 25  PHE I N     1 
ATOM   1513 C  CA    . PHE B 2 16  ? 5.609   1.386  14.648  1.00 41.64 ? 25  PHE I CA    1 
ATOM   1514 C  C     . PHE B 2 16  ? 6.233   0.736  15.865  1.00 37.16 ? 25  PHE I C     1 
ATOM   1515 O  O     . PHE B 2 16  ? 5.673   0.755  16.952  1.00 37.30 ? 25  PHE I O     1 
ATOM   1516 C  CB    . PHE B 2 16  ? 5.639   2.900  14.743  1.00 44.04 ? 25  PHE I CB    1 
ATOM   1517 C  CG    . PHE B 2 16  ? 7.018   3.463  14.910  1.00 58.33 ? 25  PHE I CG    1 
ATOM   1518 C  CD1   . PHE B 2 16  ? 7.944   3.368  13.883  1.00 58.00 ? 25  PHE I CD1   1 
ATOM   1519 C  CD2   . PHE B 2 16  ? 7.387   4.101  16.087  1.00 63.45 ? 25  PHE I CD2   1 
ATOM   1520 C  CE1   . PHE B 2 16  ? 9.222   3.888  14.027  1.00 61.94 ? 25  PHE I CE1   1 
ATOM   1521 C  CE2   . PHE B 2 16  ? 8.666   4.628  16.240  1.00 61.83 ? 25  PHE I CE2   1 
ATOM   1522 C  CZ    . PHE B 2 16  ? 9.583   4.525  15.207  1.00 60.41 ? 25  PHE I CZ    1 
ATOM   1523 N  N     . ASP B 2 17  ? 7.393   0.125  15.653  1.00 39.29 ? 26  ASP I N     1 
ATOM   1524 C  CA    . ASP B 2 17  ? 8.087   -0.616 16.691  1.00 39.37 ? 26  ASP I CA    1 
ATOM   1525 C  C     . ASP B 2 17  ? 9.260   0.256  17.110  1.00 44.12 ? 26  ASP I C     1 
ATOM   1526 O  O     . ASP B 2 17  ? 10.251  0.364  16.380  1.00 46.06 ? 26  ASP I O     1 
ATOM   1527 C  CB    . ASP B 2 17  ? 8.541   -1.968 16.129  1.00 42.06 ? 26  ASP I CB    1 
ATOM   1528 C  CG    . ASP B 2 17  ? 9.290   -2.815 17.143  1.00 46.57 ? 26  ASP I CG    1 
ATOM   1529 O  OD1   . ASP B 2 17  ? 9.851   -2.256 18.103  1.00 37.43 ? 26  ASP I OD1   1 
ATOM   1530 O  OD2   . ASP B 2 17  ? 9.320   -4.055 16.968  1.00 47.60 ? 26  ASP I OD2   1 
ATOM   1531 N  N     . ALA B 2 18  ? 9.144   0.879  18.288  1.00 41.52 ? 27  ALA I N     1 
ATOM   1532 C  CA    . ALA B 2 18  ? 10.093  1.903  18.697  1.00 35.20 ? 27  ALA I CA    1 
ATOM   1533 C  C     . ALA B 2 18  ? 11.498  1.335  18.960  1.00 30.64 ? 27  ALA I C     1 
ATOM   1534 O  O     . ALA B 2 18  ? 12.480  2.070  18.863  1.00 39.64 ? 27  ALA I O     1 
ATOM   1535 C  CB    . ALA B 2 18  ? 9.581   2.655  19.929  1.00 37.32 ? 27  ALA I CB    1 
ATOM   1536 N  N     . VAL B 2 19  ? 11.577  0.038  19.279  1.00 38.40 ? 28  VAL I N     1 
ATOM   1537 C  CA    . VAL B 2 19  ? 12.848  -0.660 19.538  1.00 36.74 ? 28  VAL I CA    1 
ATOM   1538 C  C     . VAL B 2 19  ? 13.629  -0.915 18.243  1.00 41.95 ? 28  VAL I C     1 
ATOM   1539 O  O     . VAL B 2 19  ? 14.854  -0.769 18.210  1.00 36.08 ? 28  VAL I O     1 
ATOM   1540 C  CB    . VAL B 2 19  ? 12.603  -2.021 20.270  1.00 37.65 ? 28  VAL I CB    1 
ATOM   1541 C  CG1   . VAL B 2 19  ? 13.851  -2.918 20.257  1.00 29.86 ? 28  VAL I CG1   1 
ATOM   1542 C  CG2   . VAL B 2 19  ? 12.134  -1.766 21.705  1.00 34.35 ? 28  VAL I CG2   1 
ATOM   1543 N  N     . THR B 2 20  ? 12.925  -1.315 17.185  1.00 33.00 ? 29  THR I N     1 
ATOM   1544 C  CA    . THR B 2 20  ? 13.561  -1.516 15.873  1.00 34.50 ? 29  THR I CA    1 
ATOM   1545 C  C     . THR B 2 20  ? 13.569  -0.217 15.061  1.00 38.84 ? 29  THR I C     1 
ATOM   1546 O  O     . THR B 2 20  ? 14.255  -0.117 14.050  1.00 35.24 ? 29  THR I O     1 
ATOM   1547 C  CB    . THR B 2 20  ? 12.853  -2.607 15.083  1.00 42.41 ? 29  THR I CB    1 
ATOM   1548 O  OG1   . THR B 2 20  ? 11.479  -2.239 14.890  1.00 37.47 ? 29  THR I OG1   1 
ATOM   1549 C  CG2   . THR B 2 20  ? 12.947  -3.956 15.828  1.00 34.82 ? 29  THR I CG2   1 
ATOM   1550 N  N     . GLY B 2 21  ? 12.807  0.777  15.511  1.00 32.25 ? 30  GLY I N     1 
ATOM   1551 C  CA    . GLY B 2 21  ? 12.612  2.013  14.746  1.00 38.49 ? 30  GLY I CA    1 
ATOM   1552 C  C     . GLY B 2 21  ? 11.907  1.854  13.395  1.00 43.53 ? 30  GLY I C     1 
ATOM   1553 O  O     . GLY B 2 21  ? 12.006  2.743  12.540  1.00 41.91 ? 30  GLY I O     1 
ATOM   1554 N  N     . GLU B 2 22  ? 11.181  0.748  13.201  1.00 40.42 ? 31  GLU I N     1 
ATOM   1555 C  CA    . GLU B 2 22  ? 10.499  0.479  11.915  1.00 39.36 ? 31  GLU I CA    1 
ATOM   1556 C  C     . GLU B 2 22  ? 8.965   0.381  11.998  1.00 33.90 ? 31  GLU I C     1 
ATOM   1557 O  O     . GLU B 2 22  ? 8.423   -0.020 13.018  1.00 34.54 ? 31  GLU I O     1 
ATOM   1558 C  CB    . GLU B 2 22  ? 11.025  -0.821 11.326  1.00 42.70 ? 31  GLU I CB    1 
ATOM   1559 C  CG    . GLU B 2 22  ? 12.453  -0.718 10.832  1.00 46.42 ? 31  GLU I CG    1 
ATOM   1560 C  CD    . GLU B 2 22  ? 13.045  -2.061 10.487  1.00 51.97 ? 31  GLU I CD    1 
ATOM   1561 O  OE1   . GLU B 2 22  ? 12.283  -3.040 10.355  1.00 65.06 ? 31  GLU I OE1   1 
ATOM   1562 O  OE2   . GLU B 2 22  ? 14.280  -2.136 10.346  1.00 38.95 ? 31  GLU I OE2   1 
ATOM   1563 N  N     . PHE B 2 23  ? 8.289   0.688  10.890  1.00 38.45 ? 32  PHE I N     1 
ATOM   1564 C  CA    . PHE B 2 23  ? 6.848   0.417  10.745  1.00 38.06 ? 32  PHE I CA    1 
ATOM   1565 C  C     . PHE B 2 23  ? 6.548   -1.083 10.559  1.00 45.49 ? 32  PHE I C     1 
ATOM   1566 O  O     . PHE B 2 23  ? 7.279   -1.782 9.853   1.00 51.75 ? 32  PHE I O     1 
ATOM   1567 C  CB    . PHE B 2 23  ? 6.280   1.183  9.555   1.00 35.41 ? 32  PHE I CB    1 
ATOM   1568 C  CG    . PHE B 2 23  ? 6.367   2.682  9.689   1.00 36.65 ? 32  PHE I CG    1 
ATOM   1569 C  CD1   . PHE B 2 23  ? 5.560   3.363  10.598  1.00 48.76 ? 32  PHE I CD1   1 
ATOM   1570 C  CD2   . PHE B 2 23  ? 7.208   3.420  8.882   1.00 43.08 ? 32  PHE I CD2   1 
ATOM   1571 C  CE1   . PHE B 2 23  ? 5.616   4.752  10.715  1.00 42.26 ? 32  PHE I CE1   1 
ATOM   1572 C  CE2   . PHE B 2 23  ? 7.275   4.811  9.002   1.00 44.26 ? 32  PHE I CE2   1 
ATOM   1573 C  CZ    . PHE B 2 23  ? 6.468   5.472  9.918   1.00 52.31 ? 32  PHE I CZ    1 
ATOM   1574 N  N     . THR B 2 24  ? 5.484   -1.561 11.204  1.00 32.52 ? 33  THR I N     1 
ATOM   1575 C  CA    . THR B 2 24  ? 5.053   -2.951 11.134  1.00 40.32 ? 33  THR I CA    1 
ATOM   1576 C  C     . THR B 2 24  ? 3.781   -3.028 10.297  1.00 41.04 ? 33  THR I C     1 
ATOM   1577 O  O     . THR B 2 24  ? 2.923   -2.154 10.429  1.00 38.67 ? 33  THR I O     1 
ATOM   1578 C  CB    . THR B 2 24  ? 4.739   -3.497 12.547  1.00 47.16 ? 33  THR I CB    1 
HETATM 1579 MG MG    . MG  C 3 .   ? -6.363  6.573  17.015  1.00 25.16 ? 179 MG  A MG    1 
HETATM 1580 P  PG    . GCP D 4 .   ? -4.523  8.733  18.437  1.00 23.43 ? 200 GCP A PG    1 
HETATM 1581 O  O1G   . GCP D 4 .   ? -4.739  7.575  17.500  1.00 21.35 ? 200 GCP A O1G   1 
HETATM 1582 O  O2G   . GCP D 4 .   ? -4.590  10.022 17.722  1.00 22.88 ? 200 GCP A O2G   1 
HETATM 1583 O  O3G   . GCP D 4 .   ? -3.201  8.548  19.198  1.00 23.67 ? 200 GCP A O3G   1 
HETATM 1584 C  C3B   . GCP D 4 .   ? -5.809  8.576  19.697  1.00 21.84 ? 200 GCP A C3B   1 
HETATM 1585 P  PB    . GCP D 4 .   ? -7.531  8.673  19.117  1.00 22.72 ? 200 GCP A PB    1 
HETATM 1586 O  O1B   . GCP D 4 .   ? -7.896  10.108 18.786  1.00 22.84 ? 200 GCP A O1B   1 
HETATM 1587 O  O2B   . GCP D 4 .   ? -7.745  7.625  18.089  1.00 19.87 ? 200 GCP A O2B   1 
HETATM 1588 O  O3A   . GCP D 4 .   ? -8.362  8.255  20.469  1.00 20.96 ? 200 GCP A O3A   1 
HETATM 1589 P  PA    . GCP D 4 .   ? -8.926  6.788  20.803  1.00 24.12 ? 200 GCP A PA    1 
HETATM 1590 O  O1A   . GCP D 4 .   ? -10.118 6.526  19.944  1.00 21.86 ? 200 GCP A O1A   1 
HETATM 1591 O  O2A   . GCP D 4 .   ? -7.762  5.840  20.814  1.00 26.23 ? 200 GCP A O2A   1 
HETATM 1592 O  "O5'" . GCP D 4 .   ? -9.485  7.070  22.283  1.00 23.93 ? 200 GCP A "O5'" 1 
HETATM 1593 C  "C5'" . GCP D 4 .   ? -8.670  7.697  23.271  1.00 22.25 ? 200 GCP A "C5'" 1 
HETATM 1594 C  "C4'" . GCP D 4 .   ? -9.302  7.503  24.649  1.00 23.99 ? 200 GCP A "C4'" 1 
HETATM 1595 O  "O4'" . GCP D 4 .   ? -10.544 8.204  24.722  1.00 24.52 ? 200 GCP A "O4'" 1 
HETATM 1596 C  "C3'" . GCP D 4 .   ? -9.591  6.071  24.995  1.00 27.70 ? 200 GCP A "C3'" 1 
HETATM 1597 O  "O3'" . GCP D 4 .   ? -9.298  5.860  26.391  1.00 27.33 ? 200 GCP A "O3'" 1 
HETATM 1598 C  "C2'" . GCP D 4 .   ? -11.067 5.896  24.736  1.00 22.39 ? 200 GCP A "C2'" 1 
HETATM 1599 O  "O2'" . GCP D 4 .   ? -11.653 4.922  25.592  1.00 26.78 ? 200 GCP A "O2'" 1 
HETATM 1600 C  "C1'" . GCP D 4 .   ? -11.584 7.283  25.039  1.00 26.10 ? 200 GCP A "C1'" 1 
HETATM 1601 N  N9    . GCP D 4 .   ? -12.790 7.561  24.253  1.00 28.60 ? 200 GCP A N9    1 
HETATM 1602 C  C8    . GCP D 4 .   ? -12.891 7.540  22.895  1.00 24.64 ? 200 GCP A C8    1 
HETATM 1603 N  N7    . GCP D 4 .   ? -14.150 7.829  22.529  1.00 20.71 ? 200 GCP A N7    1 
HETATM 1604 C  C5    . GCP D 4 .   ? -14.852 8.036  23.689  1.00 21.60 ? 200 GCP A C5    1 
HETATM 1605 C  C6    . GCP D 4 .   ? -16.223 8.426  24.037  1.00 27.57 ? 200 GCP A C6    1 
HETATM 1606 O  O6    . GCP D 4 .   ? -17.077 8.592  23.133  1.00 23.30 ? 200 GCP A O6    1 
HETATM 1607 N  N1    . GCP D 4 .   ? -16.532 8.557  25.339  1.00 22.45 ? 200 GCP A N1    1 
HETATM 1608 C  C2    . GCP D 4 .   ? -15.650 8.360  26.353  1.00 21.06 ? 200 GCP A C2    1 
HETATM 1609 N  N2    . GCP D 4 .   ? -16.064 8.504  27.618  1.00 24.17 ? 200 GCP A N2    1 
HETATM 1610 N  N3    . GCP D 4 .   ? -14.361 8.007  26.138  1.00 21.81 ? 200 GCP A N3    1 
HETATM 1611 C  C4    . GCP D 4 .   ? -13.933 7.875  24.824  1.00 26.82 ? 200 GCP A C4    1 
HETATM 1612 C  C1    . GOL E 5 .   ? -29.930 11.654 6.910   1.00 54.02 ? 301 GOL A C1    1 
HETATM 1613 O  O1    . GOL E 5 .   ? -29.370 12.084 5.691   1.00 41.12 ? 301 GOL A O1    1 
HETATM 1614 C  C2    . GOL E 5 .   ? -30.912 10.504 6.698   1.00 51.71 ? 301 GOL A C2    1 
HETATM 1615 O  O2    . GOL E 5 .   ? -31.105 10.232 5.329   1.00 39.15 ? 301 GOL A O2    1 
HETATM 1616 C  C3    . GOL E 5 .   ? -30.400 9.271  7.427   1.00 45.10 ? 301 GOL A C3    1 
HETATM 1617 O  O3    . GOL E 5 .   ? -31.250 8.160  7.226   1.00 32.18 ? 301 GOL A O3    1 
HETATM 1618 C  C1    A GOL F 5 .   ? -29.366 11.138 17.456  0.50 53.95 ? 302 GOL A C1    1 
HETATM 1619 C  C1    B GOL F 5 .   ? -29.428 11.068 17.567  0.50 54.08 ? 302 GOL A C1    1 
HETATM 1620 O  O1    A GOL F 5 .   ? -28.909 12.185 16.619  0.50 43.90 ? 302 GOL A O1    1 
HETATM 1621 O  O1    B GOL F 5 .   ? -29.435 11.599 18.876  0.50 48.22 ? 302 GOL A O1    1 
HETATM 1622 C  C2    . GOL F 5 .   ? -28.304 10.051 17.462  1.00 52.38 ? 302 GOL A C2    1 
HETATM 1623 O  O2    . GOL F 5 .   ? -28.408 9.183  18.564  1.00 36.96 ? 302 GOL A O2    1 
HETATM 1624 C  C3    . GOL F 5 .   ? -28.245 9.300  16.127  1.00 49.85 ? 302 GOL A C3    1 
HETATM 1625 O  O3    . GOL F 5 .   ? -26.945 9.433  15.556  1.00 27.32 ? 302 GOL A O3    1 
HETATM 1626 O  O     . HOH G 6 .   ? -3.018  9.826  21.373  1.00 26.57 ? 303 HOH A O     1 
HETATM 1627 O  O     . HOH G 6 .   ? -1.940  2.263  13.653  1.00 27.17 ? 304 HOH A O     1 
HETATM 1628 O  O     . HOH G 6 .   ? 0.000   14.042 0.000   0.50 24.92 ? 305 HOH A O     1 
HETATM 1629 O  O     . HOH G 6 .   ? -1.608  16.214 -0.236  1.00 30.01 ? 306 HOH A O     1 
HETATM 1630 O  O     . HOH G 6 .   ? -4.899  13.358 13.148  1.00 21.46 ? 307 HOH A O     1 
HETATM 1631 O  O     . HOH G 6 .   ? -17.240 10.470 20.524  1.00 20.03 ? 308 HOH A O     1 
HETATM 1632 O  O     . HOH G 6 .   ? -14.881 9.085  20.117  1.00 22.93 ? 309 HOH A O     1 
HETATM 1633 O  O     . HOH G 6 .   ? -16.746 22.293 34.606  1.00 25.68 ? 310 HOH A O     1 
HETATM 1634 O  O     . HOH G 6 .   ? -24.250 13.860 15.713  1.00 26.17 ? 311 HOH A O     1 
HETATM 1635 O  O     . HOH G 6 .   ? -28.832 11.075 10.524  1.00 32.18 ? 312 HOH A O     1 
HETATM 1636 O  O     . HOH G 6 .   ? -25.019 5.295  8.641   1.00 22.36 ? 313 HOH A O     1 
HETATM 1637 O  O     . HOH G 6 .   ? -29.202 -0.883 -5.256  1.00 29.56 ? 314 HOH A O     1 
HETATM 1638 O  O     . HOH G 6 .   ? -15.666 22.766 4.597   1.00 25.35 ? 315 HOH A O     1 
HETATM 1639 O  O     . HOH G 6 .   ? -1.295  9.354  10.406  1.00 29.34 ? 316 HOH A O     1 
HETATM 1640 O  O     . HOH G 6 .   ? -24.439 22.347 24.719  1.00 25.86 ? 317 HOH A O     1 
HETATM 1641 O  O     . HOH G 6 .   ? -24.930 17.257 16.917  1.00 28.37 ? 318 HOH A O     1 
HETATM 1642 O  O     . HOH G 6 .   ? -7.495  3.054  21.022  1.00 29.79 ? 319 HOH A O     1 
HETATM 1643 O  O     . HOH G 6 .   ? 1.512   18.166 8.839   1.00 35.09 ? 320 HOH A O     1 
HETATM 1644 O  O     . HOH G 6 .   ? -11.014 14.244 26.405  1.00 25.78 ? 321 HOH A O     1 
HETATM 1645 O  O     . HOH G 6 .   ? -1.973  15.801 20.082  1.00 34.19 ? 322 HOH A O     1 
HETATM 1646 O  O     . HOH G 6 .   ? -27.125 6.663  -3.511  1.00 35.69 ? 323 HOH A O     1 
HETATM 1647 O  O     . HOH G 6 .   ? -25.939 6.516  16.486  1.00 25.38 ? 324 HOH A O     1 
HETATM 1648 O  O     . HOH G 6 .   ? 4.297   15.909 4.226   1.00 36.05 ? 325 HOH A O     1 
HETATM 1649 O  O     . HOH G 6 .   ? -24.190 10.172 25.418  1.00 25.78 ? 326 HOH A O     1 
HETATM 1650 O  O     . HOH G 6 .   ? -10.530 5.159  0.185   1.00 36.47 ? 327 HOH A O     1 
HETATM 1651 O  O     . HOH G 6 .   ? 4.816   21.196 19.722  1.00 30.38 ? 328 HOH A O     1 
HETATM 1652 O  O     . HOH G 6 .   ? -8.335  18.258 18.025  1.00 22.41 ? 329 HOH A O     1 
HETATM 1653 O  O     . HOH G 6 .   ? -18.880 10.756 37.106  1.00 32.96 ? 330 HOH A O     1 
HETATM 1654 O  O     . HOH G 6 .   ? -8.098  7.147  28.451  1.00 33.67 ? 331 HOH A O     1 
HETATM 1655 O  O     . HOH G 6 .   ? -23.643 -4.816 14.402  1.00 29.58 ? 332 HOH A O     1 
HETATM 1656 O  O     . HOH G 6 .   ? -16.419 15.951 -1.723  1.00 32.28 ? 333 HOH A O     1 
HETATM 1657 O  O     . HOH G 6 .   ? -1.890  18.549 18.495  1.00 35.02 ? 334 HOH A O     1 
HETATM 1658 O  O     . HOH G 6 .   ? 1.389   19.377 6.167   1.00 38.10 ? 335 HOH A O     1 
HETATM 1659 O  O     . HOH G 6 .   ? -23.111 28.077 25.128  1.00 27.15 ? 336 HOH A O     1 
HETATM 1660 O  O     . HOH G 6 .   ? -11.904 9.648  27.574  1.00 43.59 ? 337 HOH A O     1 
HETATM 1661 O  O     . HOH G 6 .   ? -14.417 7.632  30.016  1.00 35.89 ? 338 HOH A O     1 
HETATM 1662 O  O     . HOH G 6 .   ? -21.788 20.239 31.208  1.00 31.96 ? 339 HOH A O     1 
HETATM 1663 O  O     . HOH G 6 .   ? -3.664  26.224 5.246   1.00 33.83 ? 340 HOH A O     1 
HETATM 1664 O  O     . HOH G 6 .   ? -0.950  1.863  16.203  1.00 33.44 ? 341 HOH A O     1 
HETATM 1665 O  O     . HOH G 6 .   ? -14.514 27.119 38.936  1.00 28.30 ? 342 HOH A O     1 
HETATM 1666 O  O     . HOH G 6 .   ? -4.848  17.982 23.041  1.00 35.09 ? 343 HOH A O     1 
HETATM 1667 O  O     . HOH G 6 .   ? -16.543 28.997 20.332  1.00 31.58 ? 344 HOH A O     1 
HETATM 1668 O  O     . HOH G 6 .   ? -0.559  16.914 16.798  1.00 33.36 ? 345 HOH A O     1 
HETATM 1669 O  O     . HOH G 6 .   ? -2.049  9.523  7.335   1.00 39.64 ? 346 HOH A O     1 
HETATM 1670 O  O     . HOH G 6 .   ? -1.079  9.106  17.241  1.00 28.51 ? 347 HOH A O     1 
HETATM 1671 O  O     . HOH G 6 .   ? -23.974 22.566 11.417  1.00 30.85 ? 348 HOH A O     1 
HETATM 1672 O  O     . HOH G 6 .   ? -28.937 13.512 9.715   1.00 45.91 ? 349 HOH A O     1 
HETATM 1673 O  O     . HOH G 6 .   ? -31.309 7.401  10.876  1.00 39.97 ? 350 HOH A O     1 
HETATM 1674 O  O     . HOH G 6 .   ? -6.789  7.715  -2.061  1.00 42.77 ? 351 HOH A O     1 
HETATM 1675 O  O     . HOH G 6 .   ? -17.259 26.331 27.791  1.00 37.96 ? 352 HOH A O     1 
HETATM 1676 O  O     . HOH G 6 .   ? -31.236 3.053  1.486   1.00 36.38 ? 353 HOH A O     1 
HETATM 1677 O  O     . HOH G 6 .   ? 10.944  13.373 6.201   1.00 48.19 ? 354 HOH A O     1 
HETATM 1678 O  O     . HOH G 6 .   ? 5.538   18.719 13.740  1.00 32.72 ? 355 HOH A O     1 
HETATM 1679 O  O     . HOH G 6 .   ? -17.686 31.970 14.657  1.00 33.59 ? 356 HOH A O     1 
HETATM 1680 O  O     . HOH G 6 .   ? -4.464  23.843 22.522  1.00 33.12 ? 357 HOH A O     1 
HETATM 1681 O  O     . HOH G 6 .   ? -9.967  28.368 -4.198  1.00 49.36 ? 358 HOH A O     1 
HETATM 1682 O  O     . HOH G 6 .   ? -10.742 2.692  24.160  1.00 32.59 ? 359 HOH A O     1 
HETATM 1683 O  O     . HOH G 6 .   ? -11.821 7.433  29.089  1.00 51.11 ? 360 HOH A O     1 
HETATM 1684 O  O     . HOH G 6 .   ? -25.615 14.673 19.425  1.00 41.75 ? 361 HOH A O     1 
HETATM 1685 O  O     . HOH G 6 .   ? -25.518 17.589 21.146  1.00 41.53 ? 362 HOH A O     1 
HETATM 1686 O  O     . HOH G 6 .   ? -18.526 -2.562 23.114  1.00 37.25 ? 363 HOH A O     1 
HETATM 1687 O  O     . HOH G 6 .   ? -8.175  14.966 26.169  1.00 46.55 ? 364 HOH A O     1 
HETATM 1688 O  O     . HOH G 6 .   ? -1.237  22.993 10.823  1.00 33.25 ? 365 HOH A O     1 
HETATM 1689 O  O     . HOH G 6 .   ? 0.225   20.885 10.681  1.00 41.35 ? 366 HOH A O     1 
HETATM 1690 O  O     . HOH G 6 .   ? -18.095 30.988 21.113  1.00 34.06 ? 367 HOH A O     1 
HETATM 1691 O  O     . HOH G 6 .   ? -20.304 19.656 1.272   1.00 43.46 ? 368 HOH A O     1 
HETATM 1692 O  O     . HOH G 6 .   ? 6.111   12.681 10.545  1.00 35.09 ? 369 HOH A O     1 
HETATM 1693 O  O     . HOH G 6 .   ? -16.104 -3.382 3.282   1.00 33.97 ? 370 HOH A O     1 
HETATM 1694 O  O     . HOH G 6 .   ? 1.707   20.250 16.186  1.00 44.53 ? 371 HOH A O     1 
HETATM 1695 O  O     . HOH G 6 .   ? -27.396 18.981 13.339  1.00 54.08 ? 372 HOH A O     1 
HETATM 1696 O  O     . HOH G 6 .   ? -12.779 16.834 -2.382  1.00 43.09 ? 373 HOH A O     1 
HETATM 1697 O  O     . HOH G 6 .   ? -23.730 17.119 5.709   1.00 33.82 ? 374 HOH A O     1 
HETATM 1698 O  O     . HOH G 6 .   ? -29.308 7.673  -5.302  1.00 52.58 ? 375 HOH A O     1 
HETATM 1699 O  O     . HOH G 6 .   ? -13.071 5.231  -0.685  1.00 44.71 ? 376 HOH A O     1 
HETATM 1700 O  O     . HOH G 6 .   ? -3.055  25.022 20.520  1.00 42.01 ? 377 HOH A O     1 
HETATM 1701 O  O     . HOH G 6 .   ? -5.908  27.977 6.458   1.00 48.42 ? 378 HOH A O     1 
HETATM 1702 O  O     . HOH G 6 .   ? -14.597 -3.939 16.938  1.00 40.68 ? 379 HOH A O     1 
HETATM 1703 O  O     . HOH G 6 .   ? -13.898 29.495 37.554  1.00 46.39 ? 380 HOH A O     1 
HETATM 1704 O  O     . HOH G 6 .   ? -14.856 30.319 17.443  1.00 48.54 ? 381 HOH A O     1 
HETATM 1705 O  O     . HOH G 6 .   ? -15.794 9.709  34.629  1.00 35.93 ? 382 HOH A O     1 
HETATM 1706 O  O     . HOH G 6 .   ? 0.993   15.881 19.509  1.00 37.66 ? 383 HOH A O     1 
HETATM 1707 O  O     . HOH G 6 .   ? -24.655 9.966  28.202  1.00 48.12 ? 384 HOH A O     1 
HETATM 1708 O  O     . HOH G 6 .   ? -25.396 19.266 14.874  1.00 36.67 ? 385 HOH A O     1 
HETATM 1709 O  O     . HOH G 6 .   ? -6.654  15.961 24.093  1.00 42.71 ? 386 HOH A O     1 
HETATM 1710 O  O     . HOH G 6 .   ? -9.796  20.178 -2.654  1.00 46.75 ? 387 HOH A O     1 
HETATM 1711 O  O     . HOH G 6 .   ? -26.976 4.939  23.985  1.00 36.67 ? 388 HOH A O     1 
HETATM 1712 O  O     . HOH G 6 .   ? -3.116  20.444 -2.814  1.00 43.36 ? 389 HOH A O     1 
HETATM 1713 O  O     . HOH G 6 .   ? -31.546 6.211  -5.325  1.00 41.05 ? 390 HOH A O     1 
HETATM 1714 O  O     . HOH G 6 .   ? -9.276  3.120  26.880  1.00 34.33 ? 391 HOH A O     1 
HETATM 1715 O  O     . HOH G 6 .   ? -23.597 -4.900 18.564  1.00 44.54 ? 392 HOH A O     1 
HETATM 1716 O  O     . HOH G 6 .   ? -11.901 21.513 -6.405  1.00 34.62 ? 393 HOH A O     1 
HETATM 1717 O  O     . HOH G 6 .   ? -5.766  2.840  15.151  1.00 36.70 ? 394 HOH A O     1 
HETATM 1718 O  O     . HOH G 6 .   ? -25.750 -0.153 17.928  1.00 37.94 ? 395 HOH A O     1 
HETATM 1719 O  O     . HOH G 6 .   ? -10.432 26.076 23.863  1.00 39.03 ? 396 HOH A O     1 
HETATM 1720 O  O     . HOH G 6 .   ? -12.306 29.629 21.215  1.00 50.07 ? 397 HOH A O     1 
HETATM 1721 O  O     . HOH G 6 .   ? -8.342  18.773 40.180  1.00 46.43 ? 398 HOH A O     1 
HETATM 1722 O  O     . HOH G 6 .   ? -23.867 14.406 27.425  1.00 44.45 ? 399 HOH A O     1 
HETATM 1723 O  O     . HOH G 6 .   ? -2.988  27.875 20.036  1.00 41.61 ? 400 HOH A O     1 
HETATM 1724 O  O     . HOH G 6 .   ? 12.545  18.816 4.036   1.00 47.66 ? 401 HOH A O     1 
HETATM 1725 O  O     . HOH G 6 .   ? -22.343 11.768 36.375  1.00 38.22 ? 402 HOH A O     1 
HETATM 1726 O  O     . HOH G 6 .   ? -7.016  28.918 11.537  1.00 43.64 ? 403 HOH A O     1 
HETATM 1727 O  O     . HOH G 6 .   ? -16.450 14.364 -3.837  1.00 55.51 ? 404 HOH A O     1 
HETATM 1728 O  O     . HOH G 6 .   ? -5.841  4.836  -2.085  1.00 59.17 ? 405 HOH A O     1 
HETATM 1729 O  O     . HOH G 6 .   ? -16.862 14.783 41.149  1.00 51.74 ? 406 HOH A O     1 
HETATM 1730 O  O     . HOH G 6 .   ? -12.512 6.402  -2.872  1.00 46.55 ? 407 HOH A O     1 
HETATM 1731 O  O     . HOH G 6 .   ? -21.438 -4.474 20.357  1.00 27.57 ? 408 HOH A O     1 
HETATM 1732 O  O     . HOH G 6 .   ? -13.510 -3.225 19.080  1.00 37.58 ? 409 HOH A O     1 
HETATM 1733 O  O     . HOH G 6 .   ? -24.606 7.092  29.591  1.00 48.65 ? 410 HOH A O     1 
HETATM 1734 O  O     . HOH G 6 .   ? -10.897 -2.491 18.579  1.00 50.00 ? 411 HOH A O     1 
HETATM 1735 O  O     . HOH G 6 .   ? -18.423 33.133 19.365  1.00 36.85 ? 412 HOH A O     1 
HETATM 1736 O  O     . HOH G 6 .   ? -9.469  -0.564 17.716  1.00 44.07 ? 413 HOH A O     1 
HETATM 1737 O  O     . HOH G 6 .   ? -26.899 8.355  26.130  1.00 56.79 ? 414 HOH A O     1 
HETATM 1738 O  O     . HOH G 6 .   ? -16.177 22.366 -2.261  1.00 42.91 ? 415 HOH A O     1 
HETATM 1739 O  O     . HOH G 6 .   ? -25.551 -3.510 12.885  1.00 32.16 ? 416 HOH A O     1 
HETATM 1740 O  O     . HOH G 6 .   ? -19.932 7.902  30.079  1.00 36.91 ? 417 HOH A O     1 
HETATM 1741 O  O     . HOH G 6 .   ? 0.653   3.201  19.600  1.00 32.28 ? 418 HOH A O     1 
HETATM 1742 O  O     . HOH G 6 .   ? -13.017 12.813 32.160  1.00 39.95 ? 419 HOH A O     1 
HETATM 1743 O  O     . HOH G 6 .   ? -7.164  15.591 -3.789  1.00 36.14 ? 420 HOH A O     1 
HETATM 1744 O  O     . HOH G 6 .   ? -18.957 17.773 -1.827  1.00 39.44 ? 421 HOH A O     1 
HETATM 1745 O  O     . HOH G 6 .   ? -4.628  1.043  26.935  1.00 45.98 ? 422 HOH A O     1 
HETATM 1746 O  O     . HOH G 6 .   ? -1.017  21.405 21.701  1.00 44.22 ? 423 HOH A O     1 
HETATM 1747 O  O     . HOH G 6 .   ? -3.866  16.460 -1.586  1.00 36.93 ? 424 HOH A O     1 
HETATM 1748 O  O     . HOH G 6 .   ? -9.953  27.860 21.689  1.00 41.05 ? 425 HOH A O     1 
HETATM 1749 O  O     . HOH G 6 .   ? 5.546   10.083 20.447  1.00 40.91 ? 426 HOH A O     1 
HETATM 1750 O  O     . HOH G 6 .   ? -23.669 29.815 13.381  1.00 54.71 ? 427 HOH A O     1 
HETATM 1751 O  O     . HOH G 6 .   ? -0.100  20.431 18.854  1.00 51.03 ? 428 HOH A O     1 
HETATM 1752 O  O     . HOH G 6 .   ? -23.230 1.616  14.068  1.00 38.02 ? 429 HOH A O     1 
HETATM 1753 O  O     . HOH G 6 .   ? 4.074   12.875 20.155  1.00 39.97 ? 430 HOH A O     1 
HETATM 1754 O  O     . HOH G 6 .   ? -25.789 22.865 13.043  1.00 57.21 ? 431 HOH A O     1 
HETATM 1755 O  O     . HOH G 6 .   ? -21.953 5.743  29.459  1.00 51.54 ? 432 HOH A O     1 
HETATM 1756 O  O     . HOH G 6 .   ? -9.366  26.970 -0.078  1.00 37.20 ? 433 HOH A O     1 
HETATM 1757 O  O     . HOH G 6 .   ? -12.224 11.537 -4.506  1.00 53.67 ? 434 HOH A O     1 
HETATM 1758 O  O     . HOH G 6 .   ? -0.870  23.570 17.801  1.00 48.83 ? 435 HOH A O     1 
HETATM 1759 O  O     . HOH G 6 .   ? -24.520 3.507  15.083  1.00 51.03 ? 436 HOH A O     1 
HETATM 1760 O  O     . HOH G 6 .   ? -26.792 1.296  15.812  1.00 47.77 ? 437 HOH A O     1 
HETATM 1761 O  O     . HOH G 6 .   ? -15.960 22.876 1.833   1.00 26.46 ? 438 HOH A O     1 
HETATM 1762 O  O     . HOH G 6 .   ? -7.587  0.641  19.335  1.00 41.24 ? 439 HOH A O     1 
HETATM 1763 O  O     . HOH G 6 .   ? -26.475 15.264 15.678  1.00 32.59 ? 440 HOH A O     1 
HETATM 1764 O  O     . HOH G 6 .   ? -2.242  10.813 25.634  1.00 31.97 ? 441 HOH A O     1 
HETATM 1765 O  O     . HOH G 6 .   ? -4.168  8.497  0.343   1.00 50.10 ? 442 HOH A O     1 
HETATM 1766 O  O     . HOH G 6 .   ? -5.318  7.186  6.904   1.00 41.35 ? 443 HOH A O     1 
HETATM 1767 O  O     . HOH G 6 .   ? -14.692 8.942  36.782  1.00 46.33 ? 444 HOH A O     1 
HETATM 1768 O  O     . HOH G 6 .   ? -24.470 17.623 27.050  1.00 39.46 ? 445 HOH A O     1 
HETATM 1769 O  O     . HOH G 6 .   ? -8.617  18.958 37.750  1.00 46.42 ? 446 HOH A O     1 
HETATM 1770 O  O     . HOH G 6 .   ? -20.074 0.334  20.724  1.00 41.95 ? 447 HOH A O     1 
HETATM 1771 O  O     . HOH G 6 .   ? -15.563 27.544 24.346  1.00 56.80 ? 448 HOH A O     1 
HETATM 1772 O  O     . HOH G 6 .   ? -17.062 6.070  -6.633  1.00 52.40 ? 449 HOH A O     1 
HETATM 1773 O  O     . HOH G 6 .   ? -23.792 6.782  -5.268  1.00 59.23 ? 450 HOH A O     1 
HETATM 1774 O  O     . HOH G 6 .   ? -32.232 11.769 -0.491  1.00 44.70 ? 451 HOH A O     1 
HETATM 1775 O  O     . HOH G 6 .   ? -20.595 32.339 14.969  1.00 46.09 ? 452 HOH A O     1 
HETATM 1776 O  O     . HOH G 6 .   ? -28.677 6.598  19.499  1.00 66.00 ? 453 HOH A O     1 
HETATM 1777 O  O     . HOH G 6 .   ? -5.130  14.735 26.436  1.00 40.67 ? 454 HOH A O     1 
HETATM 1778 O  O     . HOH G 6 .   ? -14.063 26.244 29.706  1.00 50.01 ? 455 HOH A O     1 
HETATM 1779 O  O     . HOH G 6 .   ? -2.818  13.122 25.801  1.00 40.62 ? 456 HOH A O     1 
HETATM 1780 O  O     . HOH G 6 .   ? -12.610 0.819  0.822   1.00 49.03 ? 457 HOH A O     1 
HETATM 1781 O  O     . HOH G 6 .   ? -10.476 2.148  1.568   1.00 47.64 ? 458 HOH A O     1 
HETATM 1782 O  O     . HOH G 6 .   ? -12.611 13.143 35.044  1.00 59.22 ? 459 HOH A O     1 
HETATM 1783 O  O     . HOH G 6 .   ? -2.296  28.446 13.233  1.00 55.65 ? 460 HOH A O     1 
HETATM 1784 O  O     . HOH G 6 .   ? -18.390 5.983  31.198  1.00 48.33 ? 461 HOH A O     1 
HETATM 1785 O  O     . HOH G 6 .   ? -14.119 -3.957 21.991  1.00 56.56 ? 462 HOH A O     1 
HETATM 1786 O  O     . HOH G 6 .   ? -26.070 17.505 25.198  1.00 49.72 ? 463 HOH A O     1 
HETATM 1787 O  O     . HOH G 6 .   ? -14.715 6.679  38.105  1.00 58.38 ? 464 HOH A O     1 
HETATM 1788 O  O     . HOH G 6 .   ? -21.779 -4.370 12.459  1.00 54.84 ? 465 HOH A O     1 
HETATM 1789 O  O     . HOH G 6 .   ? -30.732 13.960 0.161   1.00 54.61 ? 466 HOH A O     1 
HETATM 1790 O  O     . HOH G 6 .   ? 7.179   8.523  16.682  1.00 46.94 ? 467 HOH A O     1 
HETATM 1791 O  O     . HOH G 6 .   ? -14.926 18.279 -2.800  1.00 57.00 ? 468 HOH A O     1 
HETATM 1792 O  O     . HOH G 6 .   ? -23.147 29.739 18.081  1.00 45.14 ? 469 HOH A O     1 
HETATM 1793 O  O     . HOH G 6 .   ? -24.679 12.257 -5.768  1.00 50.06 ? 470 HOH A O     1 
HETATM 1794 O  O     . HOH G 6 .   ? -22.868 11.372 31.348  1.00 59.14 ? 471 HOH A O     1 
HETATM 1795 O  O     . HOH G 6 .   ? -14.311 29.961 34.796  1.00 46.34 ? 472 HOH A O     1 
HETATM 1796 O  O     . HOH G 6 .   ? -8.589  -1.608 21.865  1.00 53.43 ? 473 HOH A O     1 
HETATM 1797 O  O     . HOH G 6 .   ? -21.690 9.969  33.964  1.00 45.48 ? 474 HOH A O     1 
HETATM 1798 O  O     . HOH G 6 .   ? -9.191  15.925 -2.056  1.00 56.18 ? 475 HOH A O     1 
HETATM 1799 O  O     . HOH G 6 .   ? -24.323 18.503 3.365   1.00 47.91 ? 476 HOH A O     1 
HETATM 1800 O  O     . HOH G 6 .   ? -6.351  5.149  18.742  1.00 24.79 ? 477 HOH A O     1 
HETATM 1801 O  O     . HOH G 6 .   ? -1.063  14.198 24.053  0.50 53.00 ? 478 HOH A O     1 
HETATM 1802 O  O     . HOH G 6 .   ? -29.398 3.783  14.881  1.00 48.86 ? 479 HOH A O     1 
HETATM 1803 O  O     . HOH G 6 .   ? -22.209 30.518 15.086  1.00 47.10 ? 480 HOH A O     1 
HETATM 1804 O  O     . HOH G 6 .   ? -8.190  11.199 -9.068  1.00 50.34 ? 481 HOH A O     1 
HETATM 1805 O  O     . HOH G 6 .   ? -1.792  26.784 2.155   1.00 66.52 ? 482 HOH A O     1 
HETATM 1806 O  O     . HOH G 6 .   ? -8.637  3.355  -0.994  1.00 62.97 ? 483 HOH A O     1 
HETATM 1807 O  O     . HOH G 6 .   ? -29.718 9.681  -3.420  1.00 46.32 ? 484 HOH A O     1 
HETATM 1808 O  O     . HOH G 6 .   ? -8.175  -0.427 15.105  1.00 49.98 ? 485 HOH A O     1 
HETATM 1809 O  O     . HOH G 6 .   ? -12.752 26.488 25.234  1.00 66.35 ? 486 HOH A O     1 
HETATM 1810 O  O     . HOH G 6 .   ? -10.976 -4.030 22.183  1.00 55.89 ? 487 HOH A O     1 
HETATM 1811 O  O     . HOH G 6 .   ? -27.778 11.291 -3.285  1.00 62.67 ? 488 HOH A O     1 
HETATM 1812 O  O     . HOH G 6 .   ? -33.513 11.405 4.921   1.00 58.72 ? 489 HOH A O     1 
HETATM 1813 O  O     . HOH G 6 .   ? -11.124 8.860  -3.462  1.00 59.05 ? 490 HOH A O     1 
HETATM 1814 O  O     . HOH G 6 .   ? -10.890 31.409 9.730   1.00 47.06 ? 491 HOH A O     1 
HETATM 1815 O  O     . HOH G 6 .   ? -9.229  9.609  -10.695 1.00 51.29 ? 492 HOH A O     1 
HETATM 1816 O  O     . HOH G 6 .   ? -30.260 7.907  14.043  1.00 62.46 ? 493 HOH A O     1 
HETATM 1817 O  O     . HOH G 6 .   ? -26.658 4.249  15.707  1.00 56.82 ? 494 HOH A O     1 
HETATM 1818 O  O     . HOH G 6 .   ? -25.173 -0.022 13.634  1.00 49.48 ? 495 HOH A O     1 
HETATM 1819 O  O     . HOH G 6 .   ? -19.761 -6.626 19.444  1.00 49.87 ? 496 HOH A O     1 
HETATM 1820 O  O     . HOH G 6 .   ? -5.307  25.682 0.598   1.00 55.39 ? 497 HOH A O     1 
HETATM 1821 O  O     . HOH G 6 .   ? -23.805 11.316 34.302  1.00 62.37 ? 498 HOH A O     1 
HETATM 1822 O  O     . HOH G 6 .   ? 5.074   20.454 15.875  1.00 49.94 ? 499 HOH A O     1 
HETATM 1823 O  O     . HOH G 6 .   ? -8.194  14.497 23.735  1.00 45.75 ? 500 HOH A O     1 
HETATM 1824 O  O     . HOH G 6 .   ? -5.446  1.678  17.460  1.00 48.62 ? 501 HOH A O     1 
HETATM 1825 O  O     . HOH G 6 .   ? -4.373  27.119 2.757   1.00 50.45 ? 502 HOH A O     1 
HETATM 1826 O  O     . HOH G 6 .   ? -31.972 6.002  12.971  1.00 54.24 ? 503 HOH A O     1 
HETATM 1827 O  O     . HOH G 6 .   ? 3.932   5.578  17.531  1.00 50.52 ? 504 HOH A O     1 
HETATM 1828 O  O     . HOH G 6 .   ? -10.129 -3.210 28.086  1.00 71.09 ? 505 HOH A O     1 
HETATM 1829 O  O     . HOH G 6 .   ? -21.879 -1.329 12.902  1.00 54.27 ? 506 HOH A O     1 
HETATM 1830 O  O     . HOH G 6 .   ? -25.128 -2.983 17.889  1.00 34.62 ? 507 HOH A O     1 
HETATM 1831 O  O     . HOH G 6 .   ? -20.924 9.604  31.959  1.00 50.68 ? 508 HOH A O     1 
HETATM 1832 O  O     . HOH G 6 .   ? -6.678  7.756  15.291  1.00 22.14 ? 509 HOH A O     1 
HETATM 1833 O  O     . HOH G 6 .   ? -18.995 27.217 7.894   1.00 41.26 ? 510 HOH A O     1 
HETATM 1834 O  O     . HOH G 6 .   ? -1.419  0.706  23.769  0.50 41.03 ? 511 HOH A O     1 
HETATM 1835 O  O     . HOH G 6 .   ? -4.449  -0.769 -0.808  1.00 56.66 ? 512 HOH A O     1 
HETATM 1836 O  O     . HOH G 6 .   ? -23.506 2.400  -5.794  1.00 44.12 ? 513 HOH A O     1 
HETATM 1837 O  O     . HOH G 6 .   ? -24.676 -1.859 3.434   1.00 38.76 ? 514 HOH A O     1 
HETATM 1838 O  O     . HOH H 6 .   ? -24.234 -1.396 11.992  1.00 34.08 ? 46  HOH I O     1 
HETATM 1839 O  O     . HOH H 6 .   ? -32.074 4.472  8.226   1.00 32.96 ? 47  HOH I O     1 
HETATM 1840 O  O     . HOH H 6 .   ? -11.040 -7.090 8.925   1.00 37.03 ? 48  HOH I O     1 
HETATM 1841 O  O     . HOH H 6 .   ? -19.807 -4.591 9.750   1.00 46.92 ? 49  HOH I O     1 
HETATM 1842 O  O     . HOH H 6 .   ? -5.064  -5.544 8.056   1.00 50.48 ? 50  HOH I O     1 
HETATM 1843 O  O     . HOH H 6 .   ? 2.202   1.748  16.187  1.00 52.51 ? 52  HOH I O     1 
HETATM 1844 O  O     . HOH H 6 .   ? -33.216 6.683  8.624   1.00 44.82 ? 53  HOH I O     1 
HETATM 1845 O  O     . HOH H 6 .   ? -32.341 1.570  6.937   1.00 45.29 ? 54  HOH I O     1 
HETATM 1846 O  O     . HOH H 6 .   ? -17.183 -7.860 7.965   1.00 51.62 ? 55  HOH I O     1 
HETATM 1847 O  O     . HOH H 6 .   ? -23.709 -7.490 4.787   1.00 53.58 ? 56  HOH I O     1 
HETATM 1848 O  O     . HOH H 6 .   ? 2.758   3.405  18.121  1.00 43.15 ? 57  HOH I O     1 
HETATM 1849 O  O     . HOH H 6 .   ? -24.342 -4.357 10.137  1.00 38.05 ? 58  HOH I O     1 
HETATM 1850 O  O     . HOH H 6 .   ? -23.188 -6.311 1.612   1.00 51.39 ? 59  HOH I O     1 
HETATM 1851 O  O     . HOH H 6 .   ? -23.959 -4.002 -0.209  1.00 53.90 ? 60  HOH I O     1 
HETATM 1852 O  O     . HOH H 6 .   ? -21.682 -7.145 7.816   1.00 40.48 ? 61  HOH I O     1 
HETATM 1853 O  O     . HOH H 6 .   ? -10.128 -3.971 14.020  1.00 60.12 ? 62  HOH I O     1 
HETATM 1854 O  O     . HOH H 6 .   ? 12.456  4.395  17.850  1.00 35.85 ? 63  HOH I O     1 
HETATM 1855 O  O     . HOH H 6 .   ? -10.460 -7.198 11.503  1.00 49.87 ? 64  HOH I O     1 
HETATM 1856 O  O     . HOH H 6 .   ? -8.371  -5.773 12.844  1.00 49.17 ? 65  HOH I O     1 
HETATM 1857 O  O     . HOH H 6 .   ? -12.345 -4.259 15.468  1.00 53.13 ? 66  HOH I O     1 
HETATM 1858 O  O     . HOH H 6 .   ? -13.495 -7.918 8.555   1.00 45.45 ? 67  HOH I O     1 
HETATM 1859 O  O     . HOH H 6 .   ? -5.307  -1.066 14.915  1.00 55.83 ? 68  HOH I O     1 
HETATM 1860 O  O     . HOH H 6 .   ? 4.853   2.269  18.877  1.00 49.13 ? 69  HOH I O     1 
HETATM 1861 O  O     . HOH H 6 .   ? -18.634 -8.669 3.589   1.00 63.89 ? 70  HOH I O     1 
HETATM 1862 O  O     . HOH H 6 .   ? -33.679 4.697  1.497   1.00 44.41 ? 71  HOH I O     1 
HETATM 1863 O  O     . HOH H 6 .   ? 3.021   -0.559 16.357  1.00 58.62 ? 72  HOH I O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   GLN 3   2   2   GLN GLN A . n 
A 1 4   ALA 4   3   3   ALA ALA A . n 
A 1 5   ILE 5   4   4   ILE ILE A . n 
A 1 6   LYS 6   5   5   LYS LYS A . n 
A 1 7   CYS 7   6   6   CYS CYS A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  VAL 10  9   9   VAL VAL A . n 
A 1 11  GLY 11  10  10  GLY GLY A . n 
A 1 12  ASP 12  11  11  ASP ASP A . n 
A 1 13  GLY 13  12  12  GLY GLY A . n 
A 1 14  ALA 14  13  13  ALA ALA A . n 
A 1 15  VAL 15  14  14  VAL VAL A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  THR 18  17  17  THR THR A . n 
A 1 19  CYS 19  18  18  CYS CYS A . n 
A 1 20  LEU 20  19  19  LEU LEU A . n 
A 1 21  LEU 21  20  20  LEU LEU A . n 
A 1 22  ILE 22  21  21  ILE ILE A . n 
A 1 23  SER 23  22  22  SER SER A . n 
A 1 24  TYR 24  23  23  TYR TYR A . n 
A 1 25  THR 25  24  24  THR THR A . n 
A 1 26  THR 26  25  25  THR THR A . n 
A 1 27  ASN 27  26  26  ASN ASN A . n 
A 1 28  ALA 28  27  27  ALA ALA A . n 
A 1 29  PHE 29  28  28  PHE PHE A . n 
A 1 30  PRO 30  29  29  PRO PRO A . n 
A 1 31  GLY 31  30  30  GLY GLY A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  ILE 34  33  33  ILE ILE A . n 
A 1 35  PRO 35  34  34  PRO PRO A . n 
A 1 36  THR 36  35  35  THR THR A . n 
A 1 37  VAL 37  36  36  VAL VAL A . n 
A 1 38  PHE 38  37  37  PHE PHE A . n 
A 1 39  ASP 39  38  38  ASP ASP A . n 
A 1 40  ASN 40  39  39  ASN ASN A . n 
A 1 41  TYR 41  40  40  TYR TYR A . n 
A 1 42  SER 42  41  41  SER SER A . n 
A 1 43  ALA 43  42  42  ALA ALA A . n 
A 1 44  ASN 44  43  43  ASN ASN A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  MET 46  45  45  MET MET A . n 
A 1 47  VAL 47  46  46  VAL VAL A . n 
A 1 48  ASP 48  47  47  ASP ASP A . n 
A 1 49  GLY 49  48  48  GLY GLY A . n 
A 1 50  LYS 50  49  49  LYS LYS A . n 
A 1 51  PRO 51  50  50  PRO PRO A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  ASN 53  52  52  ASN ASN A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  GLY 55  54  54  GLY GLY A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  TRP 57  56  56  TRP TRP A . n 
A 1 58  ASP 58  57  57  ASP ASP A . n 
A 1 59  THR 59  58  58  THR THR A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  GLY 61  60  60  GLY GLY A . n 
A 1 62  GLN 62  61  61  GLN GLN A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  ASP 64  63  63  ASP ASP A . n 
A 1 65  TYR 65  64  64  TYR TYR A . n 
A 1 66  ASP 66  65  65  ASP ASP A . n 
A 1 67  ARG 67  66  66  ARG ARG A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  ARG 69  68  68  ARG ARG A . n 
A 1 70  PRO 70  69  69  PRO PRO A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  SER 72  71  71  SER SER A . n 
A 1 73  TYR 73  72  72  TYR TYR A . n 
A 1 74  PRO 74  73  73  PRO PRO A . n 
A 1 75  GLN 75  74  74  GLN GLN A . n 
A 1 76  THR 76  75  75  THR THR A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  VAL 78  77  77  VAL VAL A . n 
A 1 79  PHE 79  78  78  PHE PHE A . n 
A 1 80  LEU 80  79  79  LEU LEU A . n 
A 1 81  ILE 81  80  80  ILE ILE A . n 
A 1 82  CYS 82  81  81  CYS CYS A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  SER 84  83  83  SER SER A . n 
A 1 85  LEU 85  84  84  LEU LEU A . n 
A 1 86  VAL 86  85  85  VAL VAL A . n 
A 1 87  SER 87  86  86  SER SER A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  ALA 89  88  88  ALA ALA A . n 
A 1 90  SER 90  89  89  SER SER A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  GLU 92  91  91  GLU GLU A . n 
A 1 93  ASN 93  92  92  ASN ASN A . n 
A 1 94  VAL 94  93  93  VAL VAL A . n 
A 1 95  ARG 95  94  94  ARG ARG A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  TRP 98  97  97  TRP TRP A . n 
A 1 99  TYR 99  98  98  TYR TYR A . n 
A 1 100 PRO 100 99  99  PRO PRO A . n 
A 1 101 GLU 101 100 100 GLU GLU A . n 
A 1 102 VAL 102 101 101 VAL VAL A . n 
A 1 103 ARG 103 102 102 ARG ARG A . n 
A 1 104 HIS 104 103 103 HIS HIS A . n 
A 1 105 HIS 105 104 104 HIS HIS A . n 
A 1 106 CYS 106 105 105 CYS CYS A . n 
A 1 107 PRO 107 106 106 PRO PRO A . n 
A 1 108 HIS 108 107 107 HIS HIS A . n 
A 1 109 THR 109 108 108 THR THR A . n 
A 1 110 PRO 110 109 109 PRO PRO A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 LEU 112 111 111 LEU LEU A . n 
A 1 113 LEU 113 112 112 LEU LEU A . n 
A 1 114 VAL 114 113 113 VAL VAL A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 THR 116 115 115 THR THR A . n 
A 1 117 LYS 117 116 116 LYS LYS A . n 
A 1 118 LEU 118 117 117 LEU LEU A . n 
A 1 119 ASP 119 118 118 ASP ASP A . n 
A 1 120 LEU 120 119 119 LEU LEU A . n 
A 1 121 ARG 121 120 120 ARG ARG A . n 
A 1 122 ASP 122 121 121 ASP ASP A . n 
A 1 123 ASP 123 122 122 ASP ASP A . n 
A 1 124 LYS 124 123 123 LYS LYS A . n 
A 1 125 ASP 125 124 124 ASP ASP A . n 
A 1 126 THR 126 125 125 THR THR A . n 
A 1 127 ILE 127 126 126 ILE ILE A . n 
A 1 128 GLU 128 127 127 GLU GLU A . n 
A 1 129 ARG 129 128 128 ARG ARG A . n 
A 1 130 LEU 130 129 129 LEU LEU A . n 
A 1 131 ARG 131 130 130 ARG ARG A . n 
A 1 132 ASP 132 131 131 ASP ASP A . n 
A 1 133 LYS 133 132 132 LYS LYS A . n 
A 1 134 LYS 134 133 133 LYS LYS A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 PRO 137 136 136 PRO PRO A . n 
A 1 138 ILE 138 137 137 ILE ILE A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 TYR 140 139 139 TYR TYR A . n 
A 1 141 PRO 141 140 140 PRO PRO A . n 
A 1 142 GLN 142 141 141 GLN GLN A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 MET 146 145 145 MET MET A . n 
A 1 147 ALA 147 146 146 ALA ALA A . n 
A 1 148 ARG 148 147 147 ARG ARG A . n 
A 1 149 GLU 149 148 148 GLU GLU A . n 
A 1 150 ILE 150 149 149 ILE ILE A . n 
A 1 151 GLY 151 150 150 GLY GLY A . n 
A 1 152 SER 152 151 151 SER SER A . n 
A 1 153 VAL 153 152 152 VAL VAL A . n 
A 1 154 LYS 154 153 153 LYS LYS A . n 
A 1 155 TYR 155 154 154 TYR TYR A . n 
A 1 156 LEU 156 155 155 LEU LEU A . n 
A 1 157 GLU 157 156 156 GLU GLU A . n 
A 1 158 CYS 158 157 157 CYS CYS A . n 
A 1 159 SER 159 158 158 SER SER A . n 
A 1 160 ALA 160 159 159 ALA ALA A . n 
A 1 161 LEU 161 160 160 LEU LEU A . n 
A 1 162 THR 162 161 161 THR THR A . n 
A 1 163 GLN 163 162 162 GLN GLN A . n 
A 1 164 ARG 164 163 163 ARG ARG A . n 
A 1 165 GLY 165 164 164 GLY GLY A . n 
A 1 166 LEU 166 165 165 LEU LEU A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 THR 168 167 167 THR THR A . n 
A 1 169 VAL 169 168 168 VAL VAL A . n 
A 1 170 PHE 170 169 169 PHE PHE A . n 
A 1 171 ASP 171 170 170 ASP ASP A . n 
A 1 172 GLU 172 171 171 GLU GLU A . n 
A 1 173 ALA 173 172 172 ALA ALA A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 ARG 175 174 174 ARG ARG A . n 
A 1 176 ALA 176 175 175 ALA ALA A . n 
A 1 177 VAL 177 176 176 VAL VAL A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 GLY 179 178 178 GLY GLY A . n 
B 2 1   GLU 1   10  10  GLU GLU I . n 
B 2 2   ILE 2   11  11  ILE ILE I . n 
B 2 3   SER 3   12  12  SER SER I . n 
B 2 4   LEU 4   13  13  LEU LEU I . n 
B 2 5   PRO 5   14  14  PRO PRO I . n 
B 2 6   SER 6   15  15  SER SER I . n 
B 2 7   ASP 7   16  16  ASP ASP I . n 
B 2 8   PHE 8   17  17  PHE PHE I . n 
B 2 9   GLU 9   18  18  GLU GLU I . n 
B 2 10  HIS 10  19  19  HIS HIS I . n 
B 2 11  THR 11  20  20  THR THR I . n 
B 2 12  ILE 12  21  21  ILE ILE I . n 
B 2 13  HIS 13  22  22  HIS HIS I . n 
B 2 14  VAL 14  23  23  VAL VAL I . n 
B 2 15  GLY 15  24  24  GLY GLY I . n 
B 2 16  PHE 16  25  25  PHE PHE I . n 
B 2 17  ASP 17  26  26  ASP ASP I . n 
B 2 18  ALA 18  27  27  ALA ALA I . n 
B 2 19  VAL 19  28  28  VAL VAL I . n 
B 2 20  THR 20  29  29  THR THR I . n 
B 2 21  GLY 21  30  30  GLY GLY I . n 
B 2 22  GLU 22  31  31  GLU GLU I . n 
B 2 23  PHE 23  32  32  PHE PHE I . n 
B 2 24  THR 24  33  33  THR THR I . n 
B 2 25  GLY 25  34  ?   ?   ?   I . n 
B 2 26  MET 26  35  ?   ?   ?   I . n 
B 2 27  PRO 27  36  ?   ?   ?   I . n 
B 2 28  GLU 28  37  ?   ?   ?   I . n 
B 2 29  GLN 29  38  ?   ?   ?   I . n 
B 2 30  TRP 30  39  ?   ?   ?   I . n 
B 2 31  ALA 31  40  ?   ?   ?   I . n 
B 2 32  ARG 32  41  ?   ?   ?   I . n 
B 2 33  LEU 33  42  ?   ?   ?   I . n 
B 2 34  LEU 34  43  ?   ?   ?   I . n 
B 2 35  GLN 35  44  ?   ?   ?   I . n 
B 2 36  THR 36  45  ?   ?   ?   I . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MG  1   179 1   MG  MG  A . 
D 4 GCP 1   200 200 GCP GCP A . 
E 5 GOL 1   301 1   GOL GOL A . 
F 5 GOL 1   302 2   GOL GOL A . 
G 6 HOH 1   303 2   HOH HOH A . 
G 6 HOH 2   304 3   HOH HOH A . 
G 6 HOH 3   305 4   HOH HOH A . 
G 6 HOH 4   306 5   HOH HOH A . 
G 6 HOH 5   307 6   HOH HOH A . 
G 6 HOH 6   308 7   HOH HOH A . 
G 6 HOH 7   309 8   HOH HOH A . 
G 6 HOH 8   310 9   HOH HOH A . 
G 6 HOH 9   311 10  HOH HOH A . 
G 6 HOH 10  312 11  HOH HOH A . 
G 6 HOH 11  313 12  HOH HOH A . 
G 6 HOH 12  314 13  HOH HOH A . 
G 6 HOH 13  315 14  HOH HOH A . 
G 6 HOH 14  316 15  HOH HOH A . 
G 6 HOH 15  317 16  HOH HOH A . 
G 6 HOH 16  318 17  HOH HOH A . 
G 6 HOH 17  319 18  HOH HOH A . 
G 6 HOH 18  320 19  HOH HOH A . 
G 6 HOH 19  321 20  HOH HOH A . 
G 6 HOH 20  322 21  HOH HOH A . 
G 6 HOH 21  323 22  HOH HOH A . 
G 6 HOH 22  324 23  HOH HOH A . 
G 6 HOH 23  325 24  HOH HOH A . 
G 6 HOH 24  326 25  HOH HOH A . 
G 6 HOH 25  327 26  HOH HOH A . 
G 6 HOH 26  328 27  HOH HOH A . 
G 6 HOH 27  329 28  HOH HOH A . 
G 6 HOH 28  330 29  HOH HOH A . 
G 6 HOH 29  331 30  HOH HOH A . 
G 6 HOH 30  332 31  HOH HOH A . 
G 6 HOH 31  333 32  HOH HOH A . 
G 6 HOH 32  334 33  HOH HOH A . 
G 6 HOH 33  335 34  HOH HOH A . 
G 6 HOH 34  336 35  HOH HOH A . 
G 6 HOH 35  337 36  HOH HOH A . 
G 6 HOH 36  338 38  HOH HOH A . 
G 6 HOH 37  339 39  HOH HOH A . 
G 6 HOH 38  340 40  HOH HOH A . 
G 6 HOH 39  341 41  HOH HOH A . 
G 6 HOH 40  342 42  HOH HOH A . 
G 6 HOH 41  343 44  HOH HOH A . 
G 6 HOH 42  344 45  HOH HOH A . 
G 6 HOH 43  345 47  HOH HOH A . 
G 6 HOH 44  346 48  HOH HOH A . 
G 6 HOH 45  347 49  HOH HOH A . 
G 6 HOH 46  348 50  HOH HOH A . 
G 6 HOH 47  349 51  HOH HOH A . 
G 6 HOH 48  350 52  HOH HOH A . 
G 6 HOH 49  351 53  HOH HOH A . 
G 6 HOH 50  352 54  HOH HOH A . 
G 6 HOH 51  353 55  HOH HOH A . 
G 6 HOH 52  354 56  HOH HOH A . 
G 6 HOH 53  355 57  HOH HOH A . 
G 6 HOH 54  356 58  HOH HOH A . 
G 6 HOH 55  357 60  HOH HOH A . 
G 6 HOH 56  358 61  HOH HOH A . 
G 6 HOH 57  359 63  HOH HOH A . 
G 6 HOH 58  360 64  HOH HOH A . 
G 6 HOH 59  361 65  HOH HOH A . 
G 6 HOH 60  362 67  HOH HOH A . 
G 6 HOH 61  363 68  HOH HOH A . 
G 6 HOH 62  364 72  HOH HOH A . 
G 6 HOH 63  365 73  HOH HOH A . 
G 6 HOH 64  366 74  HOH HOH A . 
G 6 HOH 65  367 75  HOH HOH A . 
G 6 HOH 66  368 76  HOH HOH A . 
G 6 HOH 67  369 77  HOH HOH A . 
G 6 HOH 68  370 78  HOH HOH A . 
G 6 HOH 69  371 79  HOH HOH A . 
G 6 HOH 70  372 80  HOH HOH A . 
G 6 HOH 71  373 82  HOH HOH A . 
G 6 HOH 72  374 83  HOH HOH A . 
G 6 HOH 73  375 84  HOH HOH A . 
G 6 HOH 74  376 85  HOH HOH A . 
G 6 HOH 75  377 86  HOH HOH A . 
G 6 HOH 76  378 87  HOH HOH A . 
G 6 HOH 77  379 88  HOH HOH A . 
G 6 HOH 78  380 90  HOH HOH A . 
G 6 HOH 79  381 91  HOH HOH A . 
G 6 HOH 80  382 92  HOH HOH A . 
G 6 HOH 81  383 93  HOH HOH A . 
G 6 HOH 82  384 95  HOH HOH A . 
G 6 HOH 83  385 96  HOH HOH A . 
G 6 HOH 84  386 97  HOH HOH A . 
G 6 HOH 85  387 98  HOH HOH A . 
G 6 HOH 86  388 99  HOH HOH A . 
G 6 HOH 87  389 100 HOH HOH A . 
G 6 HOH 88  390 101 HOH HOH A . 
G 6 HOH 89  391 103 HOH HOH A . 
G 6 HOH 90  392 104 HOH HOH A . 
G 6 HOH 91  393 105 HOH HOH A . 
G 6 HOH 92  394 109 HOH HOH A . 
G 6 HOH 93  395 110 HOH HOH A . 
G 6 HOH 94  396 111 HOH HOH A . 
G 6 HOH 95  397 112 HOH HOH A . 
G 6 HOH 96  398 113 HOH HOH A . 
G 6 HOH 97  399 115 HOH HOH A . 
G 6 HOH 98  400 116 HOH HOH A . 
G 6 HOH 99  401 117 HOH HOH A . 
G 6 HOH 100 402 118 HOH HOH A . 
G 6 HOH 101 403 119 HOH HOH A . 
G 6 HOH 102 404 120 HOH HOH A . 
G 6 HOH 103 405 121 HOH HOH A . 
G 6 HOH 104 406 123 HOH HOH A . 
G 6 HOH 105 407 124 HOH HOH A . 
G 6 HOH 106 408 125 HOH HOH A . 
G 6 HOH 107 409 126 HOH HOH A . 
G 6 HOH 108 410 127 HOH HOH A . 
G 6 HOH 109 411 128 HOH HOH A . 
G 6 HOH 110 412 129 HOH HOH A . 
G 6 HOH 111 413 130 HOH HOH A . 
G 6 HOH 112 414 131 HOH HOH A . 
G 6 HOH 113 415 132 HOH HOH A . 
G 6 HOH 114 416 133 HOH HOH A . 
G 6 HOH 115 417 134 HOH HOH A . 
G 6 HOH 116 418 136 HOH HOH A . 
G 6 HOH 117 419 137 HOH HOH A . 
G 6 HOH 118 420 138 HOH HOH A . 
G 6 HOH 119 421 140 HOH HOH A . 
G 6 HOH 120 422 143 HOH HOH A . 
G 6 HOH 121 423 145 HOH HOH A . 
G 6 HOH 122 424 146 HOH HOH A . 
G 6 HOH 123 425 147 HOH HOH A . 
G 6 HOH 124 426 148 HOH HOH A . 
G 6 HOH 125 427 149 HOH HOH A . 
G 6 HOH 126 428 151 HOH HOH A . 
G 6 HOH 127 429 152 HOH HOH A . 
G 6 HOH 128 430 155 HOH HOH A . 
G 6 HOH 129 431 156 HOH HOH A . 
G 6 HOH 130 432 157 HOH HOH A . 
G 6 HOH 131 433 158 HOH HOH A . 
G 6 HOH 132 434 159 HOH HOH A . 
G 6 HOH 133 435 160 HOH HOH A . 
G 6 HOH 134 436 161 HOH HOH A . 
G 6 HOH 135 437 164 HOH HOH A . 
G 6 HOH 136 438 165 HOH HOH A . 
G 6 HOH 137 439 168 HOH HOH A . 
G 6 HOH 138 440 169 HOH HOH A . 
G 6 HOH 139 441 170 HOH HOH A . 
G 6 HOH 140 442 171 HOH HOH A . 
G 6 HOH 141 443 176 HOH HOH A . 
G 6 HOH 142 444 178 HOH HOH A . 
G 6 HOH 143 445 179 HOH HOH A . 
G 6 HOH 144 446 181 HOH HOH A . 
G 6 HOH 145 447 182 HOH HOH A . 
G 6 HOH 146 448 184 HOH HOH A . 
G 6 HOH 147 449 185 HOH HOH A . 
G 6 HOH 148 450 186 HOH HOH A . 
G 6 HOH 149 451 189 HOH HOH A . 
G 6 HOH 150 452 193 HOH HOH A . 
G 6 HOH 151 453 197 HOH HOH A . 
G 6 HOH 152 454 198 HOH HOH A . 
G 6 HOH 153 455 199 HOH HOH A . 
G 6 HOH 154 456 200 HOH HOH A . 
G 6 HOH 155 457 203 HOH HOH A . 
G 6 HOH 156 458 204 HOH HOH A . 
G 6 HOH 157 459 206 HOH HOH A . 
G 6 HOH 158 460 207 HOH HOH A . 
G 6 HOH 159 461 208 HOH HOH A . 
G 6 HOH 160 462 209 HOH HOH A . 
G 6 HOH 161 463 212 HOH HOH A . 
G 6 HOH 162 464 213 HOH HOH A . 
G 6 HOH 163 465 214 HOH HOH A . 
G 6 HOH 164 466 215 HOH HOH A . 
G 6 HOH 165 467 216 HOH HOH A . 
G 6 HOH 166 468 217 HOH HOH A . 
G 6 HOH 167 469 219 HOH HOH A . 
G 6 HOH 168 470 221 HOH HOH A . 
G 6 HOH 169 471 222 HOH HOH A . 
G 6 HOH 170 472 223 HOH HOH A . 
G 6 HOH 171 473 224 HOH HOH A . 
G 6 HOH 172 474 225 HOH HOH A . 
G 6 HOH 173 475 227 HOH HOH A . 
G 6 HOH 174 476 229 HOH HOH A . 
G 6 HOH 175 477 232 HOH HOH A . 
G 6 HOH 176 478 236 HOH HOH A . 
G 6 HOH 177 479 237 HOH HOH A . 
G 6 HOH 178 480 239 HOH HOH A . 
G 6 HOH 179 481 242 HOH HOH A . 
G 6 HOH 180 482 244 HOH HOH A . 
G 6 HOH 181 483 245 HOH HOH A . 
G 6 HOH 182 484 246 HOH HOH A . 
G 6 HOH 183 485 247 HOH HOH A . 
G 6 HOH 184 486 248 HOH HOH A . 
G 6 HOH 185 487 250 HOH HOH A . 
G 6 HOH 186 488 251 HOH HOH A . 
G 6 HOH 187 489 253 HOH HOH A . 
G 6 HOH 188 490 254 HOH HOH A . 
G 6 HOH 189 491 255 HOH HOH A . 
G 6 HOH 190 492 259 HOH HOH A . 
G 6 HOH 191 493 260 HOH HOH A . 
G 6 HOH 192 494 261 HOH HOH A . 
G 6 HOH 193 495 263 HOH HOH A . 
G 6 HOH 194 496 264 HOH HOH A . 
G 6 HOH 195 497 265 HOH HOH A . 
G 6 HOH 196 498 267 HOH HOH A . 
G 6 HOH 197 499 268 HOH HOH A . 
G 6 HOH 198 500 270 HOH HOH A . 
G 6 HOH 199 501 272 HOH HOH A . 
G 6 HOH 200 502 273 HOH HOH A . 
G 6 HOH 201 503 275 HOH HOH A . 
G 6 HOH 202 504 276 HOH HOH A . 
G 6 HOH 203 505 278 HOH HOH A . 
G 6 HOH 204 506 280 HOH HOH A . 
G 6 HOH 205 507 281 HOH HOH A . 
G 6 HOH 206 508 282 HOH HOH A . 
G 6 HOH 207 509 283 HOH HOH A . 
G 6 HOH 208 510 284 HOH HOH A . 
G 6 HOH 209 511 285 HOH HOH A . 
G 6 HOH 210 512 286 HOH HOH A . 
G 6 HOH 211 513 287 HOH HOH A . 
G 6 HOH 212 514 94  HOH HOH A . 
H 6 HOH 1   46  43  HOH HOH I . 
H 6 HOH 2   47  46  HOH HOH I . 
H 6 HOH 3   48  59  HOH HOH I . 
H 6 HOH 4   49  70  HOH HOH I . 
H 6 HOH 5   50  71  HOH HOH I . 
H 6 HOH 6   52  107 HOH HOH I . 
H 6 HOH 7   53  108 HOH HOH I . 
H 6 HOH 8   54  114 HOH HOH I . 
H 6 HOH 9   55  139 HOH HOH I . 
H 6 HOH 10  56  142 HOH HOH I . 
H 6 HOH 11  57  144 HOH HOH I . 
H 6 HOH 12  58  150 HOH HOH I . 
H 6 HOH 13  59  154 HOH HOH I . 
H 6 HOH 14  60  163 HOH HOH I . 
H 6 HOH 15  61  175 HOH HOH I . 
H 6 HOH 16  62  187 HOH HOH I . 
H 6 HOH 17  63  190 HOH HOH I . 
H 6 HOH 18  64  191 HOH HOH I . 
H 6 HOH 19  65  195 HOH HOH I . 
H 6 HOH 20  66  201 HOH HOH I . 
H 6 HOH 21  67  202 HOH HOH I . 
H 6 HOH 22  68  220 HOH HOH I . 
H 6 HOH 23  69  238 HOH HOH I . 
H 6 HOH 24  70  243 HOH HOH I . 
H 6 HOH 25  71  274 HOH HOH I . 
H 6 HOH 26  72  279 HOH HOH I . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3240 ? 
2 'ABSA (A^2)' 8640 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -2.8693825761 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 47.5955855898 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 305 ? G HOH . 
2 1 A HOH 511 ? G HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 18 ? A THR 17  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 OG1 ? A THR 36 ? A THR 35  ? 1_555 83.1  ? 
2  OG1 ? A THR 18 ? A THR 17  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O2B ? D GCP .  ? A GCP 200 ? 1_555 89.5  ? 
3  OG1 ? A THR 36 ? A THR 35  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O2B ? D GCP .  ? A GCP 200 ? 1_555 172.3 ? 
4  OG1 ? A THR 18 ? A THR 17  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O1G ? D GCP .  ? A GCP 200 ? 1_555 170.7 ? 
5  OG1 ? A THR 36 ? A THR 35  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O1G ? D GCP .  ? A GCP 200 ? 1_555 87.9  ? 
6  O2B ? D GCP .  ? A GCP 200 ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O1G ? D GCP .  ? A GCP 200 ? 1_555 99.6  ? 
7  OG1 ? A THR 18 ? A THR 17  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 509 ? 1_555 85.4  ? 
8  OG1 ? A THR 36 ? A THR 35  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 509 ? 1_555 89.2  ? 
9  O2B ? D GCP .  ? A GCP 200 ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 509 ? 1_555 92.3  ? 
10 O1G ? D GCP .  ? A GCP 200 ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 509 ? 1_555 92.2  ? 
11 OG1 ? A THR 18 ? A THR 17  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 477 ? 1_555 85.1  ? 
12 OG1 ? A THR 36 ? A THR 35  ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 477 ? 1_555 91.6  ? 
13 O2B ? D GCP .  ? A GCP 200 ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 477 ? 1_555 85.7  ? 
14 O1G ? D GCP .  ? A GCP 200 ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 477 ? 1_555 97.4  ? 
15 O   ? G HOH .  ? A HOH 509 ? 1_555 MG ? C MG . ? A MG 179 ? 1_555 O   ? G HOH .  ? A HOH 477 ? 1_555 170.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -12.6483 
_pdbx_refine_tls.origin_y         12.2223 
_pdbx_refine_tls.origin_z         13.6153 
_pdbx_refine_tls.T[1][1]          -0.0315 
_pdbx_refine_tls.T[2][2]          -0.0232 
_pdbx_refine_tls.T[3][3]          -0.0216 
_pdbx_refine_tls.T[1][2]          -0.0033 
_pdbx_refine_tls.T[1][3]          0.0029 
_pdbx_refine_tls.T[2][3]          -0.0003 
_pdbx_refine_tls.L[1][1]          0.4667 
_pdbx_refine_tls.L[2][2]          0.5499 
_pdbx_refine_tls.L[3][3]          0.9467 
_pdbx_refine_tls.L[1][2]          0.0262 
_pdbx_refine_tls.L[1][3]          0.1486 
_pdbx_refine_tls.L[2][3]          0.3052 
_pdbx_refine_tls.S[1][1]          -0.0004 
_pdbx_refine_tls.S[1][2]          0.0249 
_pdbx_refine_tls.S[1][3]          -0.0318 
_pdbx_refine_tls.S[2][1]          0.0024 
_pdbx_refine_tls.S[2][2]          0.0498 
_pdbx_refine_tls.S[2][3]          -0.0251 
_pdbx_refine_tls.S[3][1]          -0.0216 
_pdbx_refine_tls.S[3][2]          0.0492 
_pdbx_refine_tls.S[3][3]          -0.0494 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1  A 2 A 178 A 179 ? 'X-RAY DIFFRACTION' ? 
2 1 I 10 B 1 I 33  B 24  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement        5.3.0037 ? 1 
CrystalClear 'data collection' .        ? 2 
MOSFLM       'data reduction'  .        ? 3 
SCALA        'data scaling'    .        ? 4 
PHASER       phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 386 ? ? O A HOH 500 ? ? 2.15 
2 1 O A HOH 474 ? ? O A HOH 508 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 36 ? ? -100.96 -65.85 
2 1 LYS A 96 ? ? -123.88 -57.09 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 31  ? CG  ? A GLU 32  CG  
2  1 Y 1 A GLU 31  ? CD  ? A GLU 32  CD  
3  1 Y 1 A GLU 31  ? OE1 ? A GLU 32  OE1 
4  1 Y 1 A GLU 31  ? OE2 ? A GLU 32  OE2 
5  1 Y 1 A LEU 67  ? CD1 ? A LEU 68  CD1 
6  1 Y 1 A LYS 123 ? CD  ? A LYS 124 CD  
7  1 Y 1 A LYS 123 ? CE  ? A LYS 124 CE  
8  1 Y 1 A LYS 123 ? NZ  ? A LYS 124 NZ  
9  1 Y 1 A ARG 147 ? CG  ? A ARG 148 CG  
10 1 Y 1 A ARG 147 ? CD  ? A ARG 148 CD  
11 1 Y 1 A ARG 147 ? NE  ? A ARG 148 NE  
12 1 Y 1 A ARG 147 ? CZ  ? A ARG 148 CZ  
13 1 Y 1 A ARG 147 ? NH1 ? A ARG 148 NH1 
14 1 Y 1 A ARG 147 ? NH2 ? A ARG 148 NH2 
15 1 Y 1 A ARG 163 ? CD  ? A ARG 164 CD  
16 1 Y 1 A ARG 163 ? NE  ? A ARG 164 NE  
17 1 Y 1 A ARG 163 ? CZ  ? A ARG 164 CZ  
18 1 Y 1 A ARG 163 ? NH1 ? A ARG 164 NH1 
19 1 Y 1 A ARG 163 ? NH2 ? A ARG 164 NH2 
20 1 Y 1 I THR 33  ? OG1 ? B THR 24  OG1 
21 1 Y 1 I THR 33  ? CG2 ? B THR 24  CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0  ? A SER 1  
2  1 Y 1 I GLY 34 ? B GLY 25 
3  1 Y 1 I MET 35 ? B MET 26 
4  1 Y 1 I PRO 36 ? B PRO 27 
5  1 Y 1 I GLU 37 ? B GLU 28 
6  1 Y 1 I GLN 38 ? B GLN 29 
7  1 Y 1 I TRP 39 ? B TRP 30 
8  1 Y 1 I ALA 40 ? B ALA 31 
9  1 Y 1 I ARG 41 ? B ARG 32 
10 1 Y 1 I LEU 42 ? B LEU 33 
11 1 Y 1 I LEU 43 ? B LEU 34 
12 1 Y 1 I GLN 44 ? B GLN 35 
13 1 Y 1 I THR 45 ? B THR 36 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION'                                MG  
4 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' GCP 
5 GLYCEROL                                       GOL 
6 water                                          HOH 
#