data_2QW4
# 
_entry.id   2QW4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2QW4         
RCSB  RCSB044129   
WWPDB D_1000044129 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2007-08-21 
_pdbx_database_PDB_obs_spr.pdb_id           2QW4 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2GBD 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2QW4 
_pdbx_database_status.recvd_initial_deposition_date   2007-08-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Min, J.R.'                            1  
'Schuetz, A.'                          2  
'Loppnau, P.'                          3  
'Weigelt, J.'                          4  
'Sundstrom, M.'                        5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Plotnikov, A.N.'                      9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Nr4A1 Ligand-Binding Domain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Min, J.R.'        1 
primary 'Schuetz, A.'      2 
primary 'Loppnau, P.'      3 
primary 'Weigelt, J.'      4 
primary 'Sundstrom, M.'    5 
primary 'Arrowsmith, C.H.' 6 
primary 'Edwards, A.M.'    7 
primary 'Bochkarev, A.'    8 
primary 'Plotnikov, A.N.'  9 
# 
_cell.entry_id           2QW4 
_cell.length_a           89.530 
_cell.length_b           96.364 
_cell.length_c           144.849 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2QW4 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Orphan nuclear receptor NR4A1' 30270.014 4  ? ? ? ? 
2 water   nat water                           18.015    10 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Orphan nuclear receptor HMR, Early response protein NAK1, TR3 orphan receptor, ST-59' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQ
FYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDS
ILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTL
CTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQ
FYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDS
ILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTL
CTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  GLY n 
1 23  ARG n 
1 24  LEU n 
1 25  PRO n 
1 26  SER n 
1 27  LYS n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  PRO n 
1 32  PRO n 
1 33  ASP n 
1 34  ALA n 
1 35  SER n 
1 36  PRO n 
1 37  ALA n 
1 38  ASN n 
1 39  LEU n 
1 40  LEU n 
1 41  THR n 
1 42  SER n 
1 43  LEU n 
1 44  VAL n 
1 45  ARG n 
1 46  ALA n 
1 47  HIS n 
1 48  LEU n 
1 49  ASP n 
1 50  SER n 
1 51  GLY n 
1 52  PRO n 
1 53  SER n 
1 54  THR n 
1 55  ALA n 
1 56  LYS n 
1 57  LEU n 
1 58  ASP n 
1 59  TYR n 
1 60  SER n 
1 61  LYS n 
1 62  PHE n 
1 63  GLN n 
1 64  GLU n 
1 65  LEU n 
1 66  VAL n 
1 67  LEU n 
1 68  PRO n 
1 69  HIS n 
1 70  PHE n 
1 71  GLY n 
1 72  LYS n 
1 73  GLU n 
1 74  ASP n 
1 75  ALA n 
1 76  GLY n 
1 77  ASP n 
1 78  VAL n 
1 79  GLN n 
1 80  GLN n 
1 81  PHE n 
1 82  TYR n 
1 83  ASP n 
1 84  LEU n 
1 85  LEU n 
1 86  SER n 
1 87  GLY n 
1 88  SER n 
1 89  LEU n 
1 90  GLU n 
1 91  VAL n 
1 92  ILE n 
1 93  ARG n 
1 94  LYS n 
1 95  TRP n 
1 96  ALA n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 PRO n 
1 101 GLY n 
1 102 PHE n 
1 103 ALA n 
1 104 GLU n 
1 105 LEU n 
1 106 SER n 
1 107 PRO n 
1 108 ALA n 
1 109 ASP n 
1 110 GLN n 
1 111 ASP n 
1 112 LEU n 
1 113 LEU n 
1 114 LEU n 
1 115 GLU n 
1 116 SER n 
1 117 ALA n 
1 118 PHE n 
1 119 LEU n 
1 120 GLU n 
1 121 LEU n 
1 122 PHE n 
1 123 ILE n 
1 124 LEU n 
1 125 ARG n 
1 126 LEU n 
1 127 ALA n 
1 128 TYR n 
1 129 ARG n 
1 130 SER n 
1 131 LYS n 
1 132 PRO n 
1 133 GLY n 
1 134 GLU n 
1 135 GLY n 
1 136 LYS n 
1 137 LEU n 
1 138 ILE n 
1 139 PHE n 
1 140 CYS n 
1 141 SER n 
1 142 GLY n 
1 143 LEU n 
1 144 VAL n 
1 145 LEU n 
1 146 HIS n 
1 147 ARG n 
1 148 LEU n 
1 149 GLN n 
1 150 CYS n 
1 151 ALA n 
1 152 ARG n 
1 153 GLY n 
1 154 PHE n 
1 155 GLY n 
1 156 ASP n 
1 157 TRP n 
1 158 ILE n 
1 159 ASP n 
1 160 SER n 
1 161 ILE n 
1 162 LEU n 
1 163 ALA n 
1 164 PHE n 
1 165 SER n 
1 166 ARG n 
1 167 SER n 
1 168 LEU n 
1 169 HIS n 
1 170 SER n 
1 171 LEU n 
1 172 LEU n 
1 173 VAL n 
1 174 ASP n 
1 175 VAL n 
1 176 PRO n 
1 177 ALA n 
1 178 PHE n 
1 179 ALA n 
1 180 CYS n 
1 181 LEU n 
1 182 SER n 
1 183 ALA n 
1 184 LEU n 
1 185 VAL n 
1 186 LEU n 
1 187 ILE n 
1 188 THR n 
1 189 ASP n 
1 190 ARG n 
1 191 HIS n 
1 192 GLY n 
1 193 LEU n 
1 194 GLN n 
1 195 GLU n 
1 196 PRO n 
1 197 ARG n 
1 198 ARG n 
1 199 VAL n 
1 200 GLU n 
1 201 GLU n 
1 202 LEU n 
1 203 GLN n 
1 204 ASN n 
1 205 ARG n 
1 206 ILE n 
1 207 ALA n 
1 208 SER n 
1 209 CYS n 
1 210 LEU n 
1 211 LYS n 
1 212 GLU n 
1 213 HIS n 
1 214 VAL n 
1 215 ALA n 
1 216 ALA n 
1 217 VAL n 
1 218 ALA n 
1 219 GLY n 
1 220 GLU n 
1 221 PRO n 
1 222 GLN n 
1 223 PRO n 
1 224 ALA n 
1 225 SER n 
1 226 CYS n 
1 227 LEU n 
1 228 SER n 
1 229 ARG n 
1 230 LEU n 
1 231 LEU n 
1 232 GLY n 
1 233 LYS n 
1 234 LEU n 
1 235 PRO n 
1 236 GLU n 
1 237 LEU n 
1 238 ARG n 
1 239 THR n 
1 240 LEU n 
1 241 CYS n 
1 242 THR n 
1 243 GLN n 
1 244 GLY n 
1 245 LEU n 
1 246 GLN n 
1 247 ARG n 
1 248 ILE n 
1 249 PHE n 
1 250 TYR n 
1 251 LEU n 
1 252 LYS n 
1 253 LEU n 
1 254 GLU n 
1 255 ASP n 
1 256 LEU n 
1 257 VAL n 
1 258 PRO n 
1 259 PRO n 
1 260 PRO n 
1 261 PRO n 
1 262 ILE n 
1 263 ILE n 
1 264 ASP n 
1 265 LYS n 
1 266 ILE n 
1 267 PHE n 
1 268 MET n 
1 269 ASP n 
1 270 THR n 
1 271 LEU n 
1 272 PRO n 
1 273 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'NR4A1, GFRP1, HMR, NAK1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPG
FAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACL
SALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPP
IIDKIFMDTLPF
;
_struct_ref.pdbx_align_begin           347 
_struct_ref.pdbx_db_accession          P22736 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2QW4 A 22 ? 273 ? P22736 347 ? 598 ? 16 267 
2 1 2QW4 B 22 ? 273 ? P22736 347 ? 598 ? 16 267 
3 1 2QW4 C 22 ? 273 ? P22736 347 ? 598 ? 16 267 
4 1 2QW4 D 22 ? 273 ? P22736 347 ? 598 ? 16 267 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2QW4 MET A 1  ? UNP P22736 ? ? 'EXPRESSION TAG' -5 1  
1 2QW4 GLY A 2  ? UNP P22736 ? ? 'EXPRESSION TAG' -4 2  
1 2QW4 SER A 3  ? UNP P22736 ? ? 'EXPRESSION TAG' -3 3  
1 2QW4 SER A 4  ? UNP P22736 ? ? 'EXPRESSION TAG' -2 4  
1 2QW4 HIS A 5  ? UNP P22736 ? ? 'EXPRESSION TAG' -1 5  
1 2QW4 HIS A 6  ? UNP P22736 ? ? 'EXPRESSION TAG' 0  6  
1 2QW4 HIS A 7  ? UNP P22736 ? ? 'EXPRESSION TAG' 1  7  
1 2QW4 HIS A 8  ? UNP P22736 ? ? 'EXPRESSION TAG' 2  8  
1 2QW4 HIS A 9  ? UNP P22736 ? ? 'EXPRESSION TAG' 3  9  
1 2QW4 HIS A 10 ? UNP P22736 ? ? 'EXPRESSION TAG' 4  10 
1 2QW4 SER A 11 ? UNP P22736 ? ? 'EXPRESSION TAG' 5  11 
1 2QW4 SER A 12 ? UNP P22736 ? ? 'EXPRESSION TAG' 6  12 
1 2QW4 GLY A 13 ? UNP P22736 ? ? 'EXPRESSION TAG' 7  13 
1 2QW4 LEU A 14 ? UNP P22736 ? ? 'EXPRESSION TAG' 8  14 
1 2QW4 VAL A 15 ? UNP P22736 ? ? 'EXPRESSION TAG' 9  15 
1 2QW4 PRO A 16 ? UNP P22736 ? ? 'EXPRESSION TAG' 10 16 
1 2QW4 ARG A 17 ? UNP P22736 ? ? 'EXPRESSION TAG' 11 17 
1 2QW4 GLY A 18 ? UNP P22736 ? ? 'EXPRESSION TAG' 12 18 
1 2QW4 SER A 19 ? UNP P22736 ? ? 'EXPRESSION TAG' 13 19 
1 2QW4 HIS A 20 ? UNP P22736 ? ? 'EXPRESSION TAG' 14 20 
1 2QW4 MET A 21 ? UNP P22736 ? ? 'EXPRESSION TAG' 15 21 
2 2QW4 MET B 1  ? UNP P22736 ? ? 'EXPRESSION TAG' -5 22 
2 2QW4 GLY B 2  ? UNP P22736 ? ? 'EXPRESSION TAG' -4 23 
2 2QW4 SER B 3  ? UNP P22736 ? ? 'EXPRESSION TAG' -3 24 
2 2QW4 SER B 4  ? UNP P22736 ? ? 'EXPRESSION TAG' -2 25 
2 2QW4 HIS B 5  ? UNP P22736 ? ? 'EXPRESSION TAG' -1 26 
2 2QW4 HIS B 6  ? UNP P22736 ? ? 'EXPRESSION TAG' 0  27 
2 2QW4 HIS B 7  ? UNP P22736 ? ? 'EXPRESSION TAG' 1  28 
2 2QW4 HIS B 8  ? UNP P22736 ? ? 'EXPRESSION TAG' 2  29 
2 2QW4 HIS B 9  ? UNP P22736 ? ? 'EXPRESSION TAG' 3  30 
2 2QW4 HIS B 10 ? UNP P22736 ? ? 'EXPRESSION TAG' 4  31 
2 2QW4 SER B 11 ? UNP P22736 ? ? 'EXPRESSION TAG' 5  32 
2 2QW4 SER B 12 ? UNP P22736 ? ? 'EXPRESSION TAG' 6  33 
2 2QW4 GLY B 13 ? UNP P22736 ? ? 'EXPRESSION TAG' 7  34 
2 2QW4 LEU B 14 ? UNP P22736 ? ? 'EXPRESSION TAG' 8  35 
2 2QW4 VAL B 15 ? UNP P22736 ? ? 'EXPRESSION TAG' 9  36 
2 2QW4 PRO B 16 ? UNP P22736 ? ? 'EXPRESSION TAG' 10 37 
2 2QW4 ARG B 17 ? UNP P22736 ? ? 'EXPRESSION TAG' 11 38 
2 2QW4 GLY B 18 ? UNP P22736 ? ? 'EXPRESSION TAG' 12 39 
2 2QW4 SER B 19 ? UNP P22736 ? ? 'EXPRESSION TAG' 13 40 
2 2QW4 HIS B 20 ? UNP P22736 ? ? 'EXPRESSION TAG' 14 41 
2 2QW4 MET B 21 ? UNP P22736 ? ? 'EXPRESSION TAG' 15 42 
3 2QW4 MET C 1  ? UNP P22736 ? ? 'EXPRESSION TAG' -5 43 
3 2QW4 GLY C 2  ? UNP P22736 ? ? 'EXPRESSION TAG' -4 44 
3 2QW4 SER C 3  ? UNP P22736 ? ? 'EXPRESSION TAG' -3 45 
3 2QW4 SER C 4  ? UNP P22736 ? ? 'EXPRESSION TAG' -2 46 
3 2QW4 HIS C 5  ? UNP P22736 ? ? 'EXPRESSION TAG' -1 47 
3 2QW4 HIS C 6  ? UNP P22736 ? ? 'EXPRESSION TAG' 0  48 
3 2QW4 HIS C 7  ? UNP P22736 ? ? 'EXPRESSION TAG' 1  49 
3 2QW4 HIS C 8  ? UNP P22736 ? ? 'EXPRESSION TAG' 2  50 
3 2QW4 HIS C 9  ? UNP P22736 ? ? 'EXPRESSION TAG' 3  51 
3 2QW4 HIS C 10 ? UNP P22736 ? ? 'EXPRESSION TAG' 4  52 
3 2QW4 SER C 11 ? UNP P22736 ? ? 'EXPRESSION TAG' 5  53 
3 2QW4 SER C 12 ? UNP P22736 ? ? 'EXPRESSION TAG' 6  54 
3 2QW4 GLY C 13 ? UNP P22736 ? ? 'EXPRESSION TAG' 7  55 
3 2QW4 LEU C 14 ? UNP P22736 ? ? 'EXPRESSION TAG' 8  56 
3 2QW4 VAL C 15 ? UNP P22736 ? ? 'EXPRESSION TAG' 9  57 
3 2QW4 PRO C 16 ? UNP P22736 ? ? 'EXPRESSION TAG' 10 58 
3 2QW4 ARG C 17 ? UNP P22736 ? ? 'EXPRESSION TAG' 11 59 
3 2QW4 GLY C 18 ? UNP P22736 ? ? 'EXPRESSION TAG' 12 60 
3 2QW4 SER C 19 ? UNP P22736 ? ? 'EXPRESSION TAG' 13 61 
3 2QW4 HIS C 20 ? UNP P22736 ? ? 'EXPRESSION TAG' 14 62 
3 2QW4 MET C 21 ? UNP P22736 ? ? 'EXPRESSION TAG' 15 63 
4 2QW4 MET D 1  ? UNP P22736 ? ? 'EXPRESSION TAG' -5 64 
4 2QW4 GLY D 2  ? UNP P22736 ? ? 'EXPRESSION TAG' -4 65 
4 2QW4 SER D 3  ? UNP P22736 ? ? 'EXPRESSION TAG' -3 66 
4 2QW4 SER D 4  ? UNP P22736 ? ? 'EXPRESSION TAG' -2 67 
4 2QW4 HIS D 5  ? UNP P22736 ? ? 'EXPRESSION TAG' -1 68 
4 2QW4 HIS D 6  ? UNP P22736 ? ? 'EXPRESSION TAG' 0  69 
4 2QW4 HIS D 7  ? UNP P22736 ? ? 'EXPRESSION TAG' 1  70 
4 2QW4 HIS D 8  ? UNP P22736 ? ? 'EXPRESSION TAG' 2  71 
4 2QW4 HIS D 9  ? UNP P22736 ? ? 'EXPRESSION TAG' 3  72 
4 2QW4 HIS D 10 ? UNP P22736 ? ? 'EXPRESSION TAG' 4  73 
4 2QW4 SER D 11 ? UNP P22736 ? ? 'EXPRESSION TAG' 5  74 
4 2QW4 SER D 12 ? UNP P22736 ? ? 'EXPRESSION TAG' 6  75 
4 2QW4 GLY D 13 ? UNP P22736 ? ? 'EXPRESSION TAG' 7  76 
4 2QW4 LEU D 14 ? UNP P22736 ? ? 'EXPRESSION TAG' 8  77 
4 2QW4 VAL D 15 ? UNP P22736 ? ? 'EXPRESSION TAG' 9  78 
4 2QW4 PRO D 16 ? UNP P22736 ? ? 'EXPRESSION TAG' 10 79 
4 2QW4 ARG D 17 ? UNP P22736 ? ? 'EXPRESSION TAG' 11 80 
4 2QW4 GLY D 18 ? UNP P22736 ? ? 'EXPRESSION TAG' 12 81 
4 2QW4 SER D 19 ? UNP P22736 ? ? 'EXPRESSION TAG' 13 82 
4 2QW4 HIS D 20 ? UNP P22736 ? ? 'EXPRESSION TAG' 14 83 
4 2QW4 MET D 21 ? UNP P22736 ? ? 'EXPRESSION TAG' 15 84 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2QW4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   53.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.80 
_exptl_crystal_grow.pdbx_details    
;15 % PEG 6000, 0.1 M BISTRIS PH 6.4, 0.4 M SODIUM THIOCYANATE, AND 5 % ETHYLENGLYCOL, pH 6.80, VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2006-02-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SILICON 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2QW4 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   31070 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2QW4 
_refine.ls_number_reflns_obs                     29394 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.17 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.5 
_refine.ls_R_factor_obs                          0.233 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23 
_refine.ls_R_factor_R_free                       0.292 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1566 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.931 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.B_iso_mean                               55.78 
_refine.aniso_B[1][1]                            -0.15000 
_refine.aniso_B[2][2]                            0.61000 
_refine.aniso_B[3][3]                            -0.47000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1yje 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.971 
_refine.pdbx_overall_ESU_R_Free                  0.413 
_refine.overall_SU_ML                            0.330 
_refine.overall_SU_B                             36.243 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7137 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               7147 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        48.17 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.022  ? 7283 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.635  1.997  ? 9856 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.837  5.000  ? 906  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.580 23.257 ? 304  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       21.785 15.000 ? 1282 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.171 15.000 ? 55   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.104  0.200  ? 1139 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 5388 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.245  0.200  ? 3540 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.317  0.200  ? 5036 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.138  0.200  ? 255  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.313  0.200  ? 55   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.253  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.630  1.500  ? 4647 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.148  2.000  ? 7294 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.695  3.000  ? 2891 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.795  4.500  ? 2562 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.88 
_refine_ls_shell.number_reflns_R_work             2083 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.percent_reflns_obs               97.08 
_refine_ls_shell.R_factor_R_free                  0.372 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2083 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2QW4 
_struct.title                     'Human NR4A1 ligand-binding domain' 
_struct.pdbx_descriptor           'Orphan nuclear receptor NR4A1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2QW4 
_struct_keywords.pdbx_keywords   'HORMONE RECEPTOR' 
_struct_keywords.text            
;NUCLEAR RECEPTOR, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, DNA-binding, Metal-binding, Nucleus, Phosphorylation, Transcription, Transcription regulation, Zinc-finger, HORMONE RECEPTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 38  ? ASP A 49  ? ASN A 32  ASP A 43  1 ? 12 
HELX_P HELX_P2  2  ASP A 74  ? LYS A 98  ? ASP A 68  LYS A 92  1 ? 25 
HELX_P HELX_P3  3  SER A 106 ? SER A 130 ? SER A 100 SER A 124 1 ? 25 
HELX_P HELX_P4  4  LYS A 131 ? GLU A 134 ? LYS A 125 GLU A 128 5 ? 4  
HELX_P HELX_P5  5  ARG A 147 ? GLY A 155 ? ARG A 141 GLY A 149 1 ? 9  
HELX_P HELX_P6  6  ASP A 156 ? LEU A 171 ? ASP A 150 LEU A 165 1 ? 16 
HELX_P HELX_P7  7  ASP A 174 ? ILE A 187 ? ASP A 168 ILE A 181 1 ? 14 
HELX_P HELX_P8  8  GLU A 195 ? VAL A 217 ? GLU A 189 VAL A 211 1 ? 23 
HELX_P HELX_P9  9  CYS A 226 ? GLY A 232 ? CYS A 220 GLY A 226 1 ? 7  
HELX_P HELX_P10 10 GLY A 232 ? ASP A 255 ? GLY A 226 ASP A 249 1 ? 24 
HELX_P HELX_P11 11 PRO A 260 ? ASP A 269 ? PRO A 254 ASP A 263 1 ? 10 
HELX_P HELX_P12 12 ASN B 38  ? GLY B 51  ? ASN B 32  GLY B 45  1 ? 14 
HELX_P HELX_P13 13 ASP B 74  ? LYS B 98  ? ASP B 68  LYS B 92  1 ? 25 
HELX_P HELX_P14 14 SER B 106 ? SER B 130 ? SER B 100 SER B 124 1 ? 25 
HELX_P HELX_P15 15 ARG B 147 ? GLY B 155 ? ARG B 141 GLY B 149 1 ? 9  
HELX_P HELX_P16 16 ASP B 156 ? LEU B 171 ? ASP B 150 LEU B 165 1 ? 16 
HELX_P HELX_P17 17 ASP B 174 ? ILE B 187 ? ASP B 168 ILE B 181 1 ? 14 
HELX_P HELX_P18 18 GLU B 195 ? ALA B 216 ? GLU B 189 ALA B 210 1 ? 22 
HELX_P HELX_P19 19 SER B 225 ? GLY B 232 ? SER B 219 GLY B 226 1 ? 8  
HELX_P HELX_P20 20 GLY B 232 ? ASP B 255 ? GLY B 226 ASP B 249 1 ? 24 
HELX_P HELX_P21 21 PRO B 260 ? ASP B 269 ? PRO B 254 ASP B 263 1 ? 10 
HELX_P HELX_P22 22 ALA C 37  ? ASP C 49  ? ALA C 31  ASP C 43  1 ? 13 
HELX_P HELX_P23 23 ASP C 74  ? LYS C 98  ? ASP C 68  LYS C 92  1 ? 25 
HELX_P HELX_P24 24 GLY C 101 ? LEU C 105 ? GLY C 95  LEU C 99  5 ? 5  
HELX_P HELX_P25 25 SER C 106 ? SER C 130 ? SER C 100 SER C 124 1 ? 25 
HELX_P HELX_P26 26 ARG C 147 ? ALA C 151 ? ARG C 141 ALA C 145 1 ? 5  
HELX_P HELX_P27 27 ASP C 156 ? LEU C 171 ? ASP C 150 LEU C 165 1 ? 16 
HELX_P HELX_P28 28 ASP C 174 ? ILE C 187 ? ASP C 168 ILE C 181 1 ? 14 
HELX_P HELX_P29 29 GLU C 195 ? VAL C 217 ? GLU C 189 VAL C 211 1 ? 23 
HELX_P HELX_P30 30 CYS C 226 ? LEU C 231 ? CYS C 220 LEU C 225 1 ? 6  
HELX_P HELX_P31 31 GLY C 232 ? ASP C 255 ? GLY C 226 ASP C 249 1 ? 24 
HELX_P HELX_P32 32 PRO C 260 ? MET C 268 ? PRO C 254 MET C 262 1 ? 9  
HELX_P HELX_P33 33 ASN D 38  ? ASP D 49  ? ASN D 32  ASP D 43  1 ? 12 
HELX_P HELX_P34 34 ASP D 74  ? LYS D 98  ? ASP D 68  LYS D 92  1 ? 25 
HELX_P HELX_P35 35 SER D 106 ? SER D 116 ? SER D 100 SER D 110 1 ? 11 
HELX_P HELX_P36 36 ALA D 117 ? SER D 130 ? ALA D 111 SER D 124 1 ? 14 
HELX_P HELX_P37 37 ARG D 147 ? GLY D 155 ? ARG D 141 GLY D 149 1 ? 9  
HELX_P HELX_P38 38 ASP D 156 ? LEU D 171 ? ASP D 150 LEU D 165 1 ? 16 
HELX_P HELX_P39 39 ASP D 174 ? ILE D 187 ? ASP D 168 ILE D 181 1 ? 14 
HELX_P HELX_P40 40 GLU D 195 ? VAL D 217 ? GLU D 189 VAL D 211 1 ? 23 
HELX_P HELX_P41 41 SER D 225 ? LEU D 253 ? SER D 219 LEU D 247 1 ? 29 
HELX_P HELX_P42 42 PRO D 260 ? ASP D 269 ? PRO D 254 ASP D 263 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           217 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            211 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ALA 
_struct_mon_prot_cis.pdbx_label_seq_id_2    218 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ALA 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     212 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -8.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 136 ? ILE A 138 ? LYS A 130 ILE A 132 
A 2 VAL A 144 ? HIS A 146 ? VAL A 138 HIS A 140 
B 1 LYS B 136 ? ILE B 138 ? LYS B 130 ILE B 132 
B 2 VAL B 144 ? HIS B 146 ? VAL B 138 HIS B 140 
C 1 LYS C 136 ? ILE C 138 ? LYS C 130 ILE C 132 
C 2 VAL C 144 ? HIS C 146 ? VAL C 138 HIS C 140 
D 1 LYS D 136 ? ILE D 138 ? LYS D 130 ILE D 132 
D 2 VAL D 144 ? HIS D 146 ? VAL D 138 HIS D 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 137 ? N LEU A 131 O LEU A 145 ? O LEU A 139 
B 1 2 N LEU B 137 ? N LEU B 131 O LEU B 145 ? O LEU B 139 
C 1 2 N LEU C 137 ? N LEU C 131 O LEU C 145 ? O LEU C 139 
D 1 2 N LEU D 137 ? N LEU D 131 O LEU D 145 ? O LEU D 139 
# 
_database_PDB_matrix.entry_id          2QW4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2QW4 
_atom_sites.fract_transf_matrix[1][1]   0.011169 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010377 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006904 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 38  ? 23.898  34.803  -19.021 1.00 44.92 ? 32  ASN A N   1 
ATOM   2    C CA  . ASN A 1 38  ? 22.777  33.830  -19.008 1.00 44.80 ? 32  ASN A CA  1 
ATOM   3    C C   . ASN A 1 38  ? 22.508  33.253  -17.603 1.00 43.72 ? 32  ASN A C   1 
ATOM   4    O O   . ASN A 1 38  ? 23.271  33.482  -16.685 1.00 43.52 ? 32  ASN A O   1 
ATOM   5    C CB  . ASN A 1 38  ? 22.995  32.734  -20.077 1.00 45.37 ? 32  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 38  ? 23.815  31.537  -19.557 1.00 48.04 ? 32  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 38  ? 24.972  31.688  -19.161 1.00 51.40 ? 32  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 38  ? 23.207  30.347  -19.557 1.00 48.69 ? 32  ASN A ND2 1 
ATOM   9    N N   . LEU A 1 39  ? 21.403  32.527  -17.449 1.00 43.51 ? 33  LEU A N   1 
ATOM   10   C CA  . LEU A 1 39  ? 20.941  32.012  -16.149 1.00 42.78 ? 33  LEU A CA  1 
ATOM   11   C C   . LEU A 1 39  ? 21.872  30.975  -15.559 1.00 43.52 ? 33  LEU A C   1 
ATOM   12   O O   . LEU A 1 39  ? 22.260  31.098  -14.393 1.00 44.66 ? 33  LEU A O   1 
ATOM   13   C CB  . LEU A 1 39  ? 19.560  31.403  -16.292 1.00 42.15 ? 33  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 39  ? 18.974  30.551  -15.172 1.00 42.26 ? 33  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 39  ? 19.004  31.269  -13.798 1.00 41.58 ? 33  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 39  ? 17.546  30.055  -15.526 1.00 41.87 ? 33  LEU A CD2 1 
ATOM   17   N N   . LEU A 1 40  ? 22.240  29.966  -16.359 1.00 43.05 ? 34  LEU A N   1 
ATOM   18   C CA  . LEU A 1 40  ? 23.113  28.890  -15.905 1.00 42.34 ? 34  LEU A CA  1 
ATOM   19   C C   . LEU A 1 40  ? 24.320  29.414  -15.149 1.00 42.99 ? 34  LEU A C   1 
ATOM   20   O O   . LEU A 1 40  ? 24.794  28.786  -14.200 1.00 43.01 ? 34  LEU A O   1 
ATOM   21   C CB  . LEU A 1 40  ? 23.608  28.040  -17.079 1.00 41.86 ? 34  LEU A CB  1 
ATOM   22   C CG  . LEU A 1 40  ? 24.433  26.857  -16.567 1.00 40.16 ? 34  LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 40  ? 23.505  25.845  -15.876 1.00 40.88 ? 34  LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 40  ? 25.258  26.196  -17.628 1.00 37.50 ? 34  LEU A CD2 1 
ATOM   25   N N   . THR A 1 41  ? 24.833  30.555  -15.594 1.00 43.39 ? 35  THR A N   1 
ATOM   26   C CA  . THR A 1 41  ? 25.898  31.206  -14.874 1.00 43.91 ? 35  THR A CA  1 
ATOM   27   C C   . THR A 1 41  ? 25.409  31.615  -13.488 1.00 44.24 ? 35  THR A C   1 
ATOM   28   O O   . THR A 1 41  ? 25.989  31.185  -12.477 1.00 45.43 ? 35  THR A O   1 
ATOM   29   C CB  . THR A 1 41  ? 26.479  32.391  -15.659 1.00 44.12 ? 35  THR A CB  1 
ATOM   30   O OG1 . THR A 1 41  ? 27.251  31.885  -16.753 1.00 42.66 ? 35  THR A OG1 1 
ATOM   31   C CG2 . THR A 1 41  ? 27.379  33.264  -14.762 1.00 44.88 ? 35  THR A CG2 1 
ATOM   32   N N   . SER A 1 42  ? 24.339  32.400  -13.397 1.00 43.71 ? 36  SER A N   1 
ATOM   33   C CA  . SER A 1 42  ? 23.899  32.795  -12.039 1.00 43.06 ? 36  SER A CA  1 
ATOM   34   C C   . SER A 1 42  ? 23.756  31.536  -11.152 1.00 42.02 ? 36  SER A C   1 
ATOM   35   O O   . SER A 1 42  ? 24.117  31.554  -9.966  1.00 42.00 ? 36  SER A O   1 
ATOM   36   C CB  . SER A 1 42  ? 22.641  33.684  -12.036 1.00 42.70 ? 36  SER A CB  1 
ATOM   37   O OG  . SER A 1 42  ? 22.487  34.385  -13.267 1.00 42.20 ? 36  SER A OG  1 
ATOM   38   N N   . LEU A 1 43  ? 23.326  30.430  -11.745 1.00 40.58 ? 37  LEU A N   1 
ATOM   39   C CA  . LEU A 1 43  ? 23.184  29.218  -10.951 1.00 40.67 ? 37  LEU A CA  1 
ATOM   40   C C   . LEU A 1 43  ? 24.511  28.730  -10.452 1.00 40.92 ? 37  LEU A C   1 
ATOM   41   O O   . LEU A 1 43  ? 24.642  28.377  -9.280  1.00 40.86 ? 37  LEU A O   1 
ATOM   42   C CB  . LEU A 1 43  ? 22.439  28.108  -11.685 1.00 40.15 ? 37  LEU A CB  1 
ATOM   43   C CG  . LEU A 1 43  ? 20.976  28.498  -11.881 1.00 39.59 ? 37  LEU A CG  1 
ATOM   44   C CD1 . LEU A 1 43  ? 20.280  27.512  -12.755 1.00 40.45 ? 37  LEU A CD1 1 
ATOM   45   C CD2 . LEU A 1 43  ? 20.245  28.668  -10.538 1.00 38.96 ? 37  LEU A CD2 1 
ATOM   46   N N   . VAL A 1 44  ? 25.498  28.748  -11.332 1.00 41.46 ? 38  VAL A N   1 
ATOM   47   C CA  . VAL A 1 44  ? 26.824  28.284  -10.981 1.00 42.51 ? 38  VAL A CA  1 
ATOM   48   C C   . VAL A 1 44  ? 27.443  29.192  -9.916  1.00 43.94 ? 38  VAL A C   1 
ATOM   49   O O   . VAL A 1 44  ? 27.978  28.694  -8.894  1.00 44.14 ? 38  VAL A O   1 
ATOM   50   C CB  . VAL A 1 44  ? 27.759  28.186  -12.199 1.00 41.90 ? 38  VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 44  ? 29.138  27.922  -11.741 1.00 41.47 ? 38  VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 44  ? 27.322  27.056  -13.119 1.00 42.50 ? 38  VAL A CG2 1 
ATOM   53   N N   . ARG A 1 45  ? 27.372  30.510  -10.135 1.00 44.62 ? 39  ARG A N   1 
ATOM   54   C CA  . ARG A 1 45  ? 27.977  31.406  -9.181  1.00 45.49 ? 39  ARG A CA  1 
ATOM   55   C C   . ARG A 1 45  ? 27.349  31.115  -7.835  1.00 45.18 ? 39  ARG A C   1 
ATOM   56   O O   . ARG A 1 45  ? 28.068  30.903  -6.865  1.00 44.97 ? 39  ARG A O   1 
ATOM   57   C CB  . ARG A 1 45  ? 27.811  32.870  -9.561  1.00 46.20 ? 39  ARG A CB  1 
ATOM   58   C CG  . ARG A 1 45  ? 28.508  33.233  -10.843 1.00 49.28 ? 39  ARG A CG  1 
ATOM   59   C CD  . ARG A 1 45  ? 29.863  33.905  -10.595 1.00 54.63 ? 39  ARG A CD  1 
ATOM   60   N NE  . ARG A 1 45  ? 30.649  34.002  -11.835 1.00 57.65 ? 39  ARG A NE  1 
ATOM   61   C CZ  . ARG A 1 45  ? 30.391  34.832  -12.850 1.00 59.97 ? 39  ARG A CZ  1 
ATOM   62   N NH1 . ARG A 1 45  ? 31.180  34.823  -13.922 1.00 60.62 ? 39  ARG A NH1 1 
ATOM   63   N NH2 . ARG A 1 45  ? 29.351  35.671  -12.804 1.00 60.94 ? 39  ARG A NH2 1 
ATOM   64   N N   . ALA A 1 46  ? 26.020  31.031  -7.798  1.00 44.72 ? 40  ALA A N   1 
ATOM   65   C CA  . ALA A 1 46  ? 25.303  30.798  -6.537  1.00 44.59 ? 40  ALA A CA  1 
ATOM   66   C C   . ALA A 1 46  ? 25.772  29.524  -5.785  1.00 44.34 ? 40  ALA A C   1 
ATOM   67   O O   . ALA A 1 46  ? 26.089  29.577  -4.594  1.00 44.00 ? 40  ALA A O   1 
ATOM   68   C CB  . ALA A 1 46  ? 23.763  30.812  -6.765  1.00 44.25 ? 40  ALA A CB  1 
ATOM   69   N N   . HIS A 1 47  ? 25.849  28.404  -6.495  1.00 44.39 ? 41  HIS A N   1 
ATOM   70   C CA  . HIS A 1 47  ? 26.342  27.170  -5.921  1.00 44.82 ? 41  HIS A CA  1 
ATOM   71   C C   . HIS A 1 47  ? 27.720  27.397  -5.395  1.00 46.15 ? 41  HIS A C   1 
ATOM   72   O O   . HIS A 1 47  ? 27.993  27.167  -4.228  1.00 46.62 ? 41  HIS A O   1 
ATOM   73   C CB  . HIS A 1 47  ? 26.439  26.096  -6.980  1.00 44.51 ? 41  HIS A CB  1 
ATOM   74   C CG  . HIS A 1 47  ? 27.222  24.900  -6.546  1.00 43.87 ? 41  HIS A CG  1 
ATOM   75   N ND1 . HIS A 1 47  ? 26.681  23.894  -5.775  1.00 43.16 ? 41  HIS A ND1 1 
ATOM   76   C CD2 . HIS A 1 47  ? 28.507  24.546  -6.774  1.00 42.96 ? 41  HIS A CD2 1 
ATOM   77   C CE1 . HIS A 1 47  ? 27.598  22.977  -5.536  1.00 39.55 ? 41  HIS A CE1 1 
ATOM   78   N NE2 . HIS A 1 47  ? 28.714  23.346  -6.137  1.00 42.79 ? 41  HIS A NE2 1 
ATOM   79   N N   . LEU A 1 48  ? 28.600  27.840  -6.283  1.00 48.04 ? 42  LEU A N   1 
ATOM   80   C CA  . LEU A 1 48  ? 29.995  28.070  -5.944  1.00 49.05 ? 42  LEU A CA  1 
ATOM   81   C C   . LEU A 1 48  ? 30.208  29.106  -4.863  1.00 50.24 ? 42  LEU A C   1 
ATOM   82   O O   . LEU A 1 48  ? 31.050  28.906  -4.016  1.00 50.17 ? 42  LEU A O   1 
ATOM   83   C CB  . LEU A 1 48  ? 30.794  28.444  -7.185  1.00 48.81 ? 42  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 48  ? 31.413  27.304  -7.988  1.00 47.76 ? 42  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 48  ? 32.004  27.844  -9.277  1.00 46.77 ? 42  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 48  ? 32.468  26.583  -7.172  1.00 46.12 ? 42  LEU A CD2 1 
ATOM   87   N N   . ASP A 1 49  ? 29.446  30.199  -4.886  1.00 52.51 ? 43  ASP A N   1 
ATOM   88   C CA  . ASP A 1 49  ? 29.681  31.323  -3.956  1.00 54.98 ? 43  ASP A CA  1 
ATOM   89   C C   . ASP A 1 49  ? 29.138  31.025  -2.574  1.00 56.31 ? 43  ASP A C   1 
ATOM   90   O O   . ASP A 1 49  ? 29.138  31.910  -1.712  1.00 56.44 ? 43  ASP A O   1 
ATOM   91   C CB  . ASP A 1 49  ? 29.060  32.648  -4.448  1.00 55.04 ? 43  ASP A CB  1 
ATOM   92   C CG  . ASP A 1 49  ? 29.778  33.241  -5.666  1.00 56.96 ? 43  ASP A CG  1 
ATOM   93   O OD1 . ASP A 1 49  ? 30.981  32.936  -5.883  1.00 57.33 ? 43  ASP A OD1 1 
ATOM   94   O OD2 . ASP A 1 49  ? 29.118  34.014  -6.416  1.00 58.66 ? 43  ASP A OD2 1 
ATOM   95   N N   . SER A 1 50  ? 28.673  29.793  -2.354  1.00 57.87 ? 44  SER A N   1 
ATOM   96   C CA  . SER A 1 50  ? 28.025  29.469  -1.087  1.00 59.28 ? 44  SER A CA  1 
ATOM   97   C C   . SER A 1 50  ? 28.690  28.333  -0.318  1.00 60.60 ? 44  SER A C   1 
ATOM   98   O O   . SER A 1 50  ? 28.969  28.470  0.876   1.00 60.95 ? 44  SER A O   1 
ATOM   99   C CB  . SER A 1 50  ? 26.537  29.199  -1.292  1.00 58.68 ? 44  SER A CB  1 
ATOM   100  O OG  . SER A 1 50  ? 26.325  27.841  -1.598  1.00 58.13 ? 44  SER A OG  1 
ATOM   101  N N   . GLY A 1 51  ? 28.925  27.210  -0.994  1.00 62.25 ? 45  GLY A N   1 
ATOM   102  C CA  . GLY A 1 51  ? 29.577  26.060  -0.379  1.00 63.72 ? 45  GLY A CA  1 
ATOM   103  C C   . GLY A 1 51  ? 30.970  26.473  0.062   1.00 65.20 ? 45  GLY A C   1 
ATOM   104  O O   . GLY A 1 51  ? 31.546  27.421  -0.506  1.00 65.56 ? 45  GLY A O   1 
ATOM   105  N N   . PRO A 1 52  ? 31.523  25.784  1.086   1.00 65.99 ? 46  PRO A N   1 
ATOM   106  C CA  . PRO A 1 52  ? 32.898  26.044  1.548   1.00 66.33 ? 46  PRO A CA  1 
ATOM   107  C C   . PRO A 1 52  ? 33.938  25.688  0.478   1.00 66.90 ? 46  PRO A C   1 
ATOM   108  O O   . PRO A 1 52  ? 34.143  24.502  0.188   1.00 66.88 ? 46  PRO A O   1 
ATOM   109  C CB  . PRO A 1 52  ? 33.039  25.117  2.757   1.00 66.30 ? 46  PRO A CB  1 
ATOM   110  C CG  . PRO A 1 52  ? 32.018  24.026  2.536   1.00 65.99 ? 46  PRO A CG  1 
ATOM   111  C CD  . PRO A 1 52  ? 30.872  24.703  1.855   1.00 66.10 ? 46  PRO A CD  1 
ATOM   112  N N   . SER A 1 53  ? 34.554  26.707  -0.128  1.00 67.73 ? 47  SER A N   1 
ATOM   113  C CA  . SER A 1 53  ? 35.651  26.495  -1.082  1.00 68.52 ? 47  SER A CA  1 
ATOM   114  C C   . SER A 1 53  ? 36.746  25.673  -0.392  1.00 69.09 ? 47  SER A C   1 
ATOM   115  O O   . SER A 1 53  ? 37.298  26.094  0.649   1.00 69.13 ? 47  SER A O   1 
ATOM   116  C CB  . SER A 1 53  ? 36.239  27.825  -1.574  1.00 68.52 ? 47  SER A CB  1 
ATOM   117  O OG  . SER A 1 53  ? 37.235  28.315  -0.678  1.00 68.52 ? 47  SER A OG  1 
ATOM   118  N N   . THR A 1 54  ? 37.040  24.498  -0.955  1.00 69.21 ? 48  THR A N   1 
ATOM   119  C CA  . THR A 1 54  ? 38.065  23.626  -0.379  1.00 69.16 ? 48  THR A CA  1 
ATOM   120  C C   . THR A 1 54  ? 39.392  24.413  -0.285  1.00 68.65 ? 48  THR A C   1 
ATOM   121  O O   . THR A 1 54  ? 40.036  24.721  -1.290  1.00 68.39 ? 48  THR A O   1 
ATOM   122  C CB  . THR A 1 54  ? 38.141  22.205  -1.070  1.00 69.43 ? 48  THR A CB  1 
ATOM   123  O OG1 . THR A 1 54  ? 38.528  22.327  -2.443  1.00 70.02 ? 48  THR A OG1 1 
ATOM   124  C CG2 . THR A 1 54  ? 36.774  21.471  -0.987  1.00 69.36 ? 48  THR A CG2 1 
ATOM   125  N N   . ALA A 1 55  ? 39.743  24.774  0.949   1.00 68.16 ? 49  ALA A N   1 
ATOM   126  C CA  . ALA A 1 55  ? 40.698  25.844  1.212   1.00 67.26 ? 49  ALA A CA  1 
ATOM   127  C C   . ALA A 1 55  ? 40.058  26.981  2.011   1.00 66.31 ? 49  ALA A C   1 
ATOM   128  O O   . ALA A 1 55  ? 40.483  28.137  1.924   1.00 66.44 ? 49  ALA A O   1 
ATOM   129  N N   . LYS A 1 56  ? 39.003  26.642  2.745   1.00 64.95 ? 50  LYS A N   1 
ATOM   130  C CA  . LYS A 1 56  ? 38.511  27.426  3.873   1.00 63.73 ? 50  LYS A CA  1 
ATOM   131  C C   . LYS A 1 56  ? 37.804  26.461  4.816   1.00 62.54 ? 50  LYS A C   1 
ATOM   132  O O   . LYS A 1 56  ? 36.932  26.841  5.605   1.00 62.34 ? 50  LYS A O   1 
ATOM   133  C CB  . LYS A 1 56  ? 37.589  28.565  3.438   1.00 63.82 ? 50  LYS A CB  1 
ATOM   134  C CG  . LYS A 1 56  ? 38.289  29.954  3.367   1.00 65.45 ? 50  LYS A CG  1 
ATOM   135  C CD  . LYS A 1 56  ? 39.195  30.330  4.603   1.00 66.16 ? 50  LYS A CD  1 
ATOM   136  C CE  . LYS A 1 56  ? 38.411  30.517  5.930   1.00 66.59 ? 50  LYS A CE  1 
ATOM   137  N NZ  . LYS A 1 56  ? 37.075  31.199  5.781   1.00 65.21 ? 50  LYS A NZ  1 
ATOM   138  N N   . LEU A 1 57  ? 38.218  25.199  4.735   1.00 60.71 ? 51  LEU A N   1 
ATOM   139  C CA  . LEU A 1 57  ? 37.543  24.132  5.442   1.00 58.98 ? 51  LEU A CA  1 
ATOM   140  C C   . LEU A 1 57  ? 38.222  23.859  6.764   1.00 57.76 ? 51  LEU A C   1 
ATOM   141  O O   . LEU A 1 57  ? 39.360  23.421  6.790   1.00 58.30 ? 51  LEU A O   1 
ATOM   142  C CB  . LEU A 1 57  ? 37.473  22.859  4.584   1.00 58.75 ? 51  LEU A CB  1 
ATOM   143  C CG  . LEU A 1 57  ? 38.335  22.703  3.329   1.00 58.36 ? 51  LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 57  ? 39.837  22.594  3.597   1.00 60.33 ? 51  LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 57  ? 37.873  21.519  2.574   1.00 55.95 ? 51  LEU A CD2 1 
ATOM   146  N N   . ASP A 1 58  ? 37.514  24.132  7.851   1.00 55.85 ? 52  ASP A N   1 
ATOM   147  C CA  . ASP A 1 58  ? 37.990  23.895  9.209   1.00 54.40 ? 52  ASP A CA  1 
ATOM   148  C C   . ASP A 1 58  ? 38.274  22.393  9.535   1.00 53.97 ? 52  ASP A C   1 
ATOM   149  O O   . ASP A 1 58  ? 37.346  21.578  9.625   1.00 54.44 ? 52  ASP A O   1 
ATOM   150  C CB  . ASP A 1 58  ? 36.944  24.480  10.159  1.00 53.90 ? 52  ASP A CB  1 
ATOM   151  C CG  . ASP A 1 58  ? 37.304  24.318  11.614  1.00 53.52 ? 52  ASP A CG  1 
ATOM   152  O OD1 . ASP A 1 58  ? 36.415  24.567  12.476  1.00 51.39 ? 52  ASP A OD1 1 
ATOM   153  O OD2 . ASP A 1 58  ? 38.467  23.954  11.898  1.00 52.32 ? 52  ASP A OD2 1 
ATOM   154  N N   . TYR A 1 59  ? 39.539  22.024  9.714   1.00 52.61 ? 53  TYR A N   1 
ATOM   155  C CA  . TYR A 1 59  ? 39.859  20.673  10.171  1.00 51.70 ? 53  TYR A CA  1 
ATOM   156  C C   . TYR A 1 59  ? 40.119  20.539  11.678  1.00 51.20 ? 53  TYR A C   1 
ATOM   157  O O   . TYR A 1 59  ? 40.615  19.504  12.120  1.00 50.85 ? 53  TYR A O   1 
ATOM   158  C CB  . TYR A 1 59  ? 41.107  20.181  9.494   1.00 51.55 ? 53  TYR A CB  1 
ATOM   159  C CG  . TYR A 1 59  ? 40.945  19.648  8.119   1.00 52.47 ? 53  TYR A CG  1 
ATOM   160  C CD1 . TYR A 1 59  ? 40.866  20.506  7.010   1.00 54.42 ? 53  TYR A CD1 1 
ATOM   161  C CD2 . TYR A 1 59  ? 40.937  18.279  7.896   1.00 52.13 ? 53  TYR A CD2 1 
ATOM   162  C CE1 . TYR A 1 59  ? 40.747  19.994  5.702   1.00 53.95 ? 53  TYR A CE1 1 
ATOM   163  C CE2 . TYR A 1 59  ? 40.829  17.759  6.612   1.00 52.37 ? 53  TYR A CE2 1 
ATOM   164  C CZ  . TYR A 1 59  ? 40.736  18.611  5.523   1.00 53.29 ? 53  TYR A CZ  1 
ATOM   165  O OH  . TYR A 1 59  ? 40.644  18.055  4.268   1.00 53.50 ? 53  TYR A OH  1 
ATOM   166  N N   . SER A 1 60  ? 39.811  21.567  12.465  1.00 50.75 ? 54  SER A N   1 
ATOM   167  C CA  . SER A 1 60  ? 40.185  21.589  13.891  1.00 50.35 ? 54  SER A CA  1 
ATOM   168  C C   . SER A 1 60  ? 39.457  20.605  14.807  1.00 50.10 ? 54  SER A C   1 
ATOM   169  O O   . SER A 1 60  ? 39.834  20.461  15.962  1.00 49.78 ? 54  SER A O   1 
ATOM   170  C CB  . SER A 1 60  ? 40.027  22.990  14.478  1.00 50.21 ? 54  SER A CB  1 
ATOM   171  O OG  . SER A 1 60  ? 38.660  23.225  14.754  1.00 50.40 ? 54  SER A OG  1 
ATOM   172  N N   . LYS A 1 61  ? 38.409  19.957  14.321  1.00 50.13 ? 55  LYS A N   1 
ATOM   173  C CA  . LYS A 1 61  ? 37.798  18.905  15.093  1.00 50.72 ? 55  LYS A CA  1 
ATOM   174  C C   . LYS A 1 61  ? 37.907  17.537  14.415  1.00 51.27 ? 55  LYS A C   1 
ATOM   175  O O   . LYS A 1 61  ? 37.353  16.549  14.912  1.00 52.18 ? 55  LYS A O   1 
ATOM   176  C CB  . LYS A 1 61  ? 36.345  19.240  15.426  1.00 50.71 ? 55  LYS A CB  1 
ATOM   177  C CG  . LYS A 1 61  ? 36.152  20.435  16.367  1.00 51.05 ? 55  LYS A CG  1 
ATOM   178  C CD  . LYS A 1 61  ? 34.687  20.558  16.861  1.00 51.32 ? 55  LYS A CD  1 
ATOM   179  C CE  . LYS A 1 61  ? 34.411  19.798  18.186  1.00 53.67 ? 55  LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 61  ? 35.023  20.381  19.458  1.00 52.05 ? 55  LYS A NZ  1 
ATOM   181  N N   . PHE A 1 62  ? 38.634  17.448  13.305  1.00 51.49 ? 56  PHE A N   1 
ATOM   182  C CA  . PHE A 1 62  ? 38.725  16.170  12.572  1.00 51.78 ? 56  PHE A CA  1 
ATOM   183  C C   . PHE A 1 62  ? 39.499  15.092  13.338  1.00 52.88 ? 56  PHE A C   1 
ATOM   184  O O   . PHE A 1 62  ? 40.549  15.379  13.906  1.00 53.20 ? 56  PHE A O   1 
ATOM   185  C CB  . PHE A 1 62  ? 39.329  16.367  11.175  1.00 50.48 ? 56  PHE A CB  1 
ATOM   186  C CG  . PHE A 1 62  ? 39.463  15.096  10.392  1.00 50.13 ? 56  PHE A CG  1 
ATOM   187  C CD1 . PHE A 1 62  ? 38.337  14.435  9.898   1.00 49.76 ? 56  PHE A CD1 1 
ATOM   188  C CD2 . PHE A 1 62  ? 40.713  14.540  10.143  1.00 50.10 ? 56  PHE A CD2 1 
ATOM   189  C CE1 . PHE A 1 62  ? 38.455  13.246  9.178   1.00 48.25 ? 56  PHE A CE1 1 
ATOM   190  C CE2 . PHE A 1 62  ? 40.834  13.338  9.409   1.00 48.81 ? 56  PHE A CE2 1 
ATOM   191  C CZ  . PHE A 1 62  ? 39.704  12.703  8.932   1.00 48.30 ? 56  PHE A CZ  1 
ATOM   192  N N   . GLN A 1 63  ? 38.980  13.859  13.340  1.00 54.12 ? 57  GLN A N   1 
ATOM   193  C CA  . GLN A 1 63  ? 39.706  12.689  13.857  1.00 55.36 ? 57  GLN A CA  1 
ATOM   194  C C   . GLN A 1 63  ? 39.706  11.462  12.939  1.00 56.12 ? 57  GLN A C   1 
ATOM   195  O O   . GLN A 1 63  ? 38.705  10.749  12.846  1.00 56.30 ? 57  GLN A O   1 
ATOM   196  C CB  . GLN A 1 63  ? 39.124  12.255  15.188  1.00 55.30 ? 57  GLN A CB  1 
ATOM   197  C CG  . GLN A 1 63  ? 39.577  13.059  16.342  1.00 57.49 ? 57  GLN A CG  1 
ATOM   198  C CD  . GLN A 1 63  ? 39.281  12.361  17.647  1.00 60.76 ? 57  GLN A CD  1 
ATOM   199  O OE1 . GLN A 1 63  ? 39.770  11.243  17.912  1.00 62.43 ? 57  GLN A OE1 1 
ATOM   200  N NE2 . GLN A 1 63  ? 38.485  13.016  18.489  1.00 61.00 ? 57  GLN A NE2 1 
ATOM   201  N N   . GLU A 1 64  ? 40.843  11.188  12.306  1.00 57.12 ? 58  GLU A N   1 
ATOM   202  C CA  . GLU A 1 64  ? 41.059  9.930   11.563  1.00 58.60 ? 58  GLU A CA  1 
ATOM   203  C C   . GLU A 1 64  ? 40.880  8.670   12.467  1.00 59.01 ? 58  GLU A C   1 
ATOM   204  O O   . GLU A 1 64  ? 41.743  8.346   13.289  1.00 58.87 ? 58  GLU A O   1 
ATOM   205  C CB  . GLU A 1 64  ? 42.442  9.987   10.873  1.00 58.50 ? 58  GLU A CB  1 
ATOM   206  C CG  . GLU A 1 64  ? 42.779  8.851   9.927   1.00 60.82 ? 58  GLU A CG  1 
ATOM   207  C CD  . GLU A 1 64  ? 41.751  8.668   8.824   1.00 64.42 ? 58  GLU A CD  1 
ATOM   208  O OE1 . GLU A 1 64  ? 41.786  9.453   7.844   1.00 65.36 ? 58  GLU A OE1 1 
ATOM   209  O OE2 . GLU A 1 64  ? 40.911  7.736   8.941   1.00 65.69 ? 58  GLU A OE2 1 
ATOM   210  N N   . LEU A 1 65  ? 39.744  7.986   12.335  1.00 59.86 ? 59  LEU A N   1 
ATOM   211  C CA  . LEU A 1 65  ? 39.429  6.830   13.204  1.00 60.88 ? 59  LEU A CA  1 
ATOM   212  C C   . LEU A 1 65  ? 39.285  5.542   12.417  1.00 61.43 ? 59  LEU A C   1 
ATOM   213  O O   . LEU A 1 65  ? 38.850  5.584   11.277  1.00 61.06 ? 59  LEU A O   1 
ATOM   214  C CB  . LEU A 1 65  ? 38.148  7.075   14.000  1.00 60.70 ? 59  LEU A CB  1 
ATOM   215  C CG  . LEU A 1 65  ? 38.152  8.150   15.096  1.00 61.55 ? 59  LEU A CG  1 
ATOM   216  C CD1 . LEU A 1 65  ? 36.880  8.989   15.045  1.00 61.61 ? 59  LEU A CD1 1 
ATOM   217  C CD2 . LEU A 1 65  ? 38.363  7.569   16.499  1.00 61.22 ? 59  LEU A CD2 1 
ATOM   218  N N   . VAL A 1 66  ? 39.702  4.418   13.014  1.00 62.99 ? 60  VAL A N   1 
ATOM   219  C CA  . VAL A 1 66  ? 39.355  3.055   12.533  1.00 64.68 ? 60  VAL A CA  1 
ATOM   220  C C   . VAL A 1 66  ? 38.517  2.364   13.643  1.00 65.99 ? 60  VAL A C   1 
ATOM   221  O O   . VAL A 1 66  ? 38.251  1.155   13.620  1.00 65.97 ? 60  VAL A O   1 
ATOM   222  C CB  . VAL A 1 66  ? 40.619  2.218   12.121  1.00 64.52 ? 60  VAL A CB  1 
ATOM   223  C CG1 . VAL A 1 66  ? 40.246  0.769   11.757  1.00 65.07 ? 60  VAL A CG1 1 
ATOM   224  C CG2 . VAL A 1 66  ? 41.341  2.850   10.949  1.00 64.04 ? 60  VAL A CG2 1 
ATOM   225  N N   . LEU A 1 67  ? 38.070  3.193   14.587  1.00 67.73 ? 61  LEU A N   1 
ATOM   226  C CA  . LEU A 1 67  ? 37.567  2.775   15.885  1.00 69.00 ? 61  LEU A CA  1 
ATOM   227  C C   . LEU A 1 67  ? 36.053  2.986   16.006  1.00 70.08 ? 61  LEU A C   1 
ATOM   228  O O   . LEU A 1 67  ? 35.616  3.971   16.611  1.00 70.07 ? 61  LEU A O   1 
ATOM   229  C CB  . LEU A 1 67  ? 38.318  3.572   16.994  1.00 69.16 ? 61  LEU A CB  1 
ATOM   230  C CG  . LEU A 1 67  ? 38.601  3.095   18.452  1.00 68.54 ? 61  LEU A CG  1 
ATOM   231  C CD1 . LEU A 1 67  ? 37.343  2.953   19.334  1.00 68.42 ? 61  LEU A CD1 1 
ATOM   232  C CD2 . LEU A 1 67  ? 39.468  1.832   18.535  1.00 67.71 ? 61  LEU A CD2 1 
ATOM   233  N N   . PRO A 1 68  ? 35.236  2.051   15.469  1.00 71.38 ? 62  PRO A N   1 
ATOM   234  C CA  . PRO A 1 68  ? 33.787  2.233   15.689  1.00 72.30 ? 62  PRO A CA  1 
ATOM   235  C C   . PRO A 1 68  ? 33.481  2.310   17.191  1.00 73.31 ? 62  PRO A C   1 
ATOM   236  O O   . PRO A 1 68  ? 34.076  1.562   17.991  1.00 73.65 ? 62  PRO A O   1 
ATOM   237  C CB  . PRO A 1 68  ? 33.162  0.988   15.044  1.00 72.05 ? 62  PRO A CB  1 
ATOM   238  C CG  . PRO A 1 68  ? 34.183  0.505   14.075  1.00 71.83 ? 62  PRO A CG  1 
ATOM   239  C CD  . PRO A 1 68  ? 35.520  0.824   14.700  1.00 71.43 ? 62  PRO A CD  1 
ATOM   240  N N   . HIS A 1 69  ? 32.592  3.228   17.568  1.00 74.29 ? 63  HIS A N   1 
ATOM   241  C CA  . HIS A 1 69  ? 32.447  3.595   18.974  1.00 75.23 ? 63  HIS A CA  1 
ATOM   242  C C   . HIS A 1 69  ? 31.203  3.043   19.662  1.00 75.09 ? 63  HIS A C   1 
ATOM   243  O O   . HIS A 1 69  ? 30.086  3.525   19.450  1.00 75.14 ? 63  HIS A O   1 
ATOM   244  C CB  . HIS A 1 69  ? 32.546  5.121   19.168  1.00 75.79 ? 63  HIS A CB  1 
ATOM   245  C CG  . HIS A 1 69  ? 32.961  5.519   20.553  1.00 77.77 ? 63  HIS A CG  1 
ATOM   246  N ND1 . HIS A 1 69  ? 34.284  5.589   20.944  1.00 79.76 ? 63  HIS A ND1 1 
ATOM   247  C CD2 . HIS A 1 69  ? 32.230  5.837   21.648  1.00 78.81 ? 63  HIS A CD2 1 
ATOM   248  C CE1 . HIS A 1 69  ? 34.349  5.952   22.214  1.00 79.87 ? 63  HIS A CE1 1 
ATOM   249  N NE2 . HIS A 1 69  ? 33.116  6.111   22.664  1.00 80.00 ? 63  HIS A NE2 1 
ATOM   250  N N   . PHE A 1 70  ? 31.418  2.015   20.480  1.00 75.00 ? 64  PHE A N   1 
ATOM   251  C CA  . PHE A 1 70  ? 30.417  1.575   21.427  1.00 74.64 ? 64  PHE A CA  1 
ATOM   252  C C   . PHE A 1 70  ? 30.082  2.758   22.314  1.00 74.50 ? 64  PHE A C   1 
ATOM   253  O O   . PHE A 1 70  ? 30.966  3.386   22.897  1.00 74.59 ? 64  PHE A O   1 
ATOM   254  N N   . GLY A 1 71  ? 28.803  3.085   22.388  1.00 74.24 ? 65  GLY A N   1 
ATOM   255  C CA  . GLY A 1 71  ? 28.351  4.143   23.264  1.00 74.11 ? 65  GLY A CA  1 
ATOM   256  C C   . GLY A 1 71  ? 27.020  4.677   22.796  1.00 73.96 ? 65  GLY A C   1 
ATOM   257  O O   . GLY A 1 71  ? 26.764  4.756   21.595  1.00 74.17 ? 65  GLY A O   1 
ATOM   258  N N   . LYS A 1 72  ? 26.162  5.025   23.748  1.00 73.60 ? 66  LYS A N   1 
ATOM   259  C CA  . LYS A 1 72  ? 24.960  5.779   23.432  1.00 73.34 ? 66  LYS A CA  1 
ATOM   260  C C   . LYS A 1 72  ? 25.310  7.274   23.329  1.00 73.01 ? 66  LYS A C   1 
ATOM   261  O O   . LYS A 1 72  ? 25.688  7.908   24.323  1.00 73.32 ? 66  LYS A O   1 
ATOM   262  C CB  . LYS A 1 72  ? 23.893  5.532   24.493  1.00 73.37 ? 66  LYS A CB  1 
ATOM   263  C CG  . LYS A 1 72  ? 22.472  5.613   23.978  1.00 73.34 ? 66  LYS A CG  1 
ATOM   264  C CD  . LYS A 1 72  ? 21.486  5.057   25.007  1.00 74.20 ? 66  LYS A CD  1 
ATOM   265  C CE  . LYS A 1 72  ? 21.427  5.925   26.258  1.00 74.41 ? 66  LYS A CE  1 
ATOM   266  N NZ  . LYS A 1 72  ? 21.409  7.377   25.884  1.00 74.68 ? 66  LYS A NZ  1 
ATOM   267  N N   . GLU A 1 73  ? 25.216  7.813   22.116  1.00 72.25 ? 67  GLU A N   1 
ATOM   268  C CA  . GLU A 1 73  ? 25.424  9.241   21.841  1.00 71.40 ? 67  GLU A CA  1 
ATOM   269  C C   . GLU A 1 73  ? 25.200  10.137  23.071  1.00 70.74 ? 67  GLU A C   1 
ATOM   270  O O   . GLU A 1 73  ? 24.084  10.213  23.590  1.00 70.29 ? 67  GLU A O   1 
ATOM   271  C CB  . GLU A 1 73  ? 24.487  9.705   20.714  1.00 71.52 ? 67  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 73  ? 23.706  8.588   19.988  1.00 71.70 ? 67  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 73  ? 22.432  8.145   20.732  1.00 72.99 ? 67  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 73  ? 21.907  8.912   21.573  1.00 73.04 ? 67  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 73  ? 21.945  7.023   20.467  1.00 73.09 ? 67  GLU A OE2 1 
ATOM   276  N N   . ASP A 1 74  ? 26.265  10.808  23.524  1.00 70.02 ? 68  ASP A N   1 
ATOM   277  C CA  . ASP A 1 74  ? 26.203  11.780  24.643  1.00 68.88 ? 68  ASP A CA  1 
ATOM   278  C C   . ASP A 1 74  ? 25.709  13.163  24.191  1.00 67.90 ? 68  ASP A C   1 
ATOM   279  O O   . ASP A 1 74  ? 25.630  13.441  22.990  1.00 67.61 ? 68  ASP A O   1 
ATOM   280  C CB  . ASP A 1 74  ? 27.567  11.901  25.347  1.00 68.91 ? 68  ASP A CB  1 
ATOM   281  C CG  . ASP A 1 74  ? 28.674  12.386  24.414  1.00 69.26 ? 68  ASP A CG  1 
ATOM   282  O OD1 . ASP A 1 74  ? 28.660  13.580  24.031  1.00 70.36 ? 68  ASP A OD1 1 
ATOM   283  O OD2 . ASP A 1 74  ? 29.565  11.579  24.068  1.00 68.78 ? 68  ASP A OD2 1 
ATOM   284  N N   . ALA A 1 75  ? 25.414  14.029  25.159  1.00 66.71 ? 69  ALA A N   1 
ATOM   285  C CA  . ALA A 1 75  ? 24.819  15.336  24.876  1.00 65.72 ? 69  ALA A CA  1 
ATOM   286  C C   . ALA A 1 75  ? 25.694  16.258  24.025  1.00 65.14 ? 69  ALA A C   1 
ATOM   287  O O   . ALA A 1 75  ? 25.207  17.268  23.504  1.00 65.57 ? 69  ALA A O   1 
ATOM   288  C CB  . ALA A 1 75  ? 24.414  16.028  26.159  1.00 65.62 ? 69  ALA A CB  1 
ATOM   289  N N   . GLY A 1 76  ? 26.972  15.917  23.875  1.00 63.96 ? 70  GLY A N   1 
ATOM   290  C CA  . GLY A 1 76  ? 27.881  16.738  23.089  1.00 62.70 ? 70  GLY A CA  1 
ATOM   291  C C   . GLY A 1 76  ? 27.557  16.549  21.627  1.00 62.15 ? 70  GLY A C   1 
ATOM   292  O O   . GLY A 1 76  ? 27.577  17.507  20.828  1.00 61.65 ? 70  GLY A O   1 
ATOM   293  N N   . ASP A 1 77  ? 27.214  15.297  21.312  1.00 61.46 ? 71  ASP A N   1 
ATOM   294  C CA  . ASP A 1 77  ? 26.984  14.811  19.945  1.00 60.48 ? 71  ASP A CA  1 
ATOM   295  C C   . ASP A 1 77  ? 25.718  15.388  19.340  1.00 59.40 ? 71  ASP A C   1 
ATOM   296  O O   . ASP A 1 77  ? 25.723  15.912  18.233  1.00 59.09 ? 71  ASP A O   1 
ATOM   297  C CB  . ASP A 1 77  ? 26.892  13.290  19.946  1.00 60.54 ? 71  ASP A CB  1 
ATOM   298  C CG  . ASP A 1 77  ? 27.991  12.647  20.749  1.00 61.85 ? 71  ASP A CG  1 
ATOM   299  O OD1 . ASP A 1 77  ? 29.160  13.037  20.533  1.00 62.52 ? 71  ASP A OD1 1 
ATOM   300  O OD2 . ASP A 1 77  ? 27.690  11.751  21.583  1.00 62.96 ? 71  ASP A OD2 1 
ATOM   301  N N   . VAL A 1 78  ? 24.634  15.289  20.093  1.00 58.05 ? 72  VAL A N   1 
ATOM   302  C CA  . VAL A 1 78  ? 23.373  15.825  19.667  1.00 56.74 ? 72  VAL A CA  1 
ATOM   303  C C   . VAL A 1 78  ? 23.520  17.347  19.548  1.00 55.76 ? 72  VAL A C   1 
ATOM   304  O O   . VAL A 1 78  ? 22.888  17.974  18.723  1.00 55.21 ? 72  VAL A O   1 
ATOM   305  C CB  . VAL A 1 78  ? 22.272  15.417  20.664  1.00 57.02 ? 72  VAL A CB  1 
ATOM   306  C CG1 . VAL A 1 78  ? 20.881  15.659  20.093  1.00 56.87 ? 72  VAL A CG1 1 
ATOM   307  C CG2 . VAL A 1 78  ? 22.429  13.954  21.040  1.00 56.87 ? 72  VAL A CG2 1 
ATOM   308  N N   . GLN A 1 79  ? 24.385  17.940  20.354  1.00 54.91 ? 73  GLN A N   1 
ATOM   309  C CA  . GLN A 1 79  ? 24.602  19.356  20.217  1.00 54.28 ? 73  GLN A CA  1 
ATOM   310  C C   . GLN A 1 79  ? 25.376  19.673  18.945  1.00 53.81 ? 73  GLN A C   1 
ATOM   311  O O   . GLN A 1 79  ? 25.067  20.647  18.251  1.00 53.28 ? 73  GLN A O   1 
ATOM   312  C CB  . GLN A 1 79  ? 25.299  19.946  21.428  1.00 54.53 ? 73  GLN A CB  1 
ATOM   313  C CG  . GLN A 1 79  ? 25.175  21.459  21.477  1.00 54.76 ? 73  GLN A CG  1 
ATOM   314  C CD  . GLN A 1 79  ? 23.761  21.917  21.186  1.00 55.82 ? 73  GLN A CD  1 
ATOM   315  O OE1 . GLN A 1 79  ? 22.869  21.768  22.022  1.00 55.80 ? 73  GLN A OE1 1 
ATOM   316  N NE2 . GLN A 1 79  ? 23.542  22.464  19.982  1.00 56.48 ? 73  GLN A NE2 1 
ATOM   317  N N   . GLN A 1 80  ? 26.360  18.839  18.628  1.00 53.02 ? 74  GLN A N   1 
ATOM   318  C CA  . GLN A 1 80  ? 27.069  18.983  17.363  1.00 52.55 ? 74  GLN A CA  1 
ATOM   319  C C   . GLN A 1 80  ? 26.081  18.848  16.198  1.00 52.48 ? 74  GLN A C   1 
ATOM   320  O O   . GLN A 1 80  ? 25.905  19.777  15.391  1.00 52.75 ? 74  GLN A O   1 
ATOM   321  C CB  . GLN A 1 80  ? 28.184  17.939  17.262  1.00 52.54 ? 74  GLN A CB  1 
ATOM   322  C CG  . GLN A 1 80  ? 29.039  18.074  16.026  1.00 52.58 ? 74  GLN A CG  1 
ATOM   323  C CD  . GLN A 1 80  ? 30.492  17.700  16.232  1.00 52.34 ? 74  GLN A CD  1 
ATOM   324  O OE1 . GLN A 1 80  ? 30.980  16.771  15.602  1.00 52.34 ? 74  GLN A OE1 1 
ATOM   325  N NE2 . GLN A 1 80  ? 31.202  18.438  17.102  1.00 53.82 ? 74  GLN A NE2 1 
ATOM   326  N N   . PHE A 1 81  ? 25.429  17.687  16.148  1.00 51.84 ? 75  PHE A N   1 
ATOM   327  C CA  . PHE A 1 81  ? 24.388  17.359  15.189  1.00 51.07 ? 75  PHE A CA  1 
ATOM   328  C C   . PHE A 1 81  ? 23.491  18.530  14.851  1.00 50.82 ? 75  PHE A C   1 
ATOM   329  O O   . PHE A 1 81  ? 23.269  18.804  13.666  1.00 51.01 ? 75  PHE A O   1 
ATOM   330  C CB  . PHE A 1 81  ? 23.531  16.231  15.745  1.00 51.04 ? 75  PHE A CB  1 
ATOM   331  C CG  . PHE A 1 81  ? 22.453  15.776  14.823  1.00 51.34 ? 75  PHE A CG  1 
ATOM   332  C CD1 . PHE A 1 81  ? 22.762  15.066  13.673  1.00 52.89 ? 75  PHE A CD1 1 
ATOM   333  C CD2 . PHE A 1 81  ? 21.130  16.044  15.102  1.00 51.20 ? 75  PHE A CD2 1 
ATOM   334  C CE1 . PHE A 1 81  ? 21.771  14.641  12.800  1.00 51.23 ? 75  PHE A CE1 1 
ATOM   335  C CE2 . PHE A 1 81  ? 20.141  15.616  14.243  1.00 51.10 ? 75  PHE A CE2 1 
ATOM   336  C CZ  . PHE A 1 81  ? 20.468  14.914  13.091  1.00 50.53 ? 75  PHE A CZ  1 
ATOM   337  N N   . TYR A 1 82  ? 22.972  19.203  15.884  1.00 49.89 ? 76  TYR A N   1 
ATOM   338  C CA  . TYR A 1 82  ? 22.003  20.278  15.688  1.00 48.84 ? 76  TYR A CA  1 
ATOM   339  C C   . TYR A 1 82  ? 22.665  21.532  15.132  1.00 47.37 ? 76  TYR A C   1 
ATOM   340  O O   . TYR A 1 82  ? 22.030  22.284  14.406  1.00 47.15 ? 76  TYR A O   1 
ATOM   341  C CB  . TYR A 1 82  ? 21.219  20.603  16.975  1.00 49.88 ? 76  TYR A CB  1 
ATOM   342  C CG  . TYR A 1 82  ? 20.106  19.629  17.344  1.00 50.89 ? 76  TYR A CG  1 
ATOM   343  C CD1 . TYR A 1 82  ? 18.976  19.473  16.542  1.00 51.84 ? 76  TYR A CD1 1 
ATOM   344  C CD2 . TYR A 1 82  ? 20.178  18.884  18.524  1.00 52.28 ? 76  TYR A CD2 1 
ATOM   345  C CE1 . TYR A 1 82  ? 17.961  18.575  16.895  1.00 52.29 ? 76  TYR A CE1 1 
ATOM   346  C CE2 . TYR A 1 82  ? 19.187  17.997  18.887  1.00 52.02 ? 76  TYR A CE2 1 
ATOM   347  C CZ  . TYR A 1 82  ? 18.080  17.834  18.075  1.00 53.06 ? 76  TYR A CZ  1 
ATOM   348  O OH  . TYR A 1 82  ? 17.098  16.929  18.467  1.00 53.04 ? 76  TYR A OH  1 
ATOM   349  N N   . ASP A 1 83  ? 23.935  21.747  15.464  1.00 45.87 ? 77  ASP A N   1 
ATOM   350  C CA  . ASP A 1 83  ? 24.676  22.928  14.978  1.00 44.56 ? 77  ASP A CA  1 
ATOM   351  C C   . ASP A 1 83  ? 25.057  22.837  13.487  1.00 43.88 ? 77  ASP A C   1 
ATOM   352  O O   . ASP A 1 83  ? 24.995  23.805  12.764  1.00 42.59 ? 77  ASP A O   1 
ATOM   353  C CB  . ASP A 1 83  ? 25.862  23.256  15.896  1.00 44.03 ? 77  ASP A CB  1 
ATOM   354  C CG  . ASP A 1 83  ? 25.407  23.655  17.320  1.00 44.05 ? 77  ASP A CG  1 
ATOM   355  O OD1 . ASP A 1 83  ? 24.180  23.727  17.567  1.00 43.12 ? 77  ASP A OD1 1 
ATOM   356  O OD2 . ASP A 1 83  ? 26.269  23.865  18.209  1.00 44.10 ? 77  ASP A OD2 1 
ATOM   357  N N   . LEU A 1 84  ? 25.388  21.643  13.027  1.00 44.25 ? 78  LEU A N   1 
ATOM   358  C CA  . LEU A 1 84  ? 25.547  21.401  11.603  1.00 44.42 ? 78  LEU A CA  1 
ATOM   359  C C   . LEU A 1 84  ? 24.247  21.590  10.842  1.00 44.59 ? 78  LEU A C   1 
ATOM   360  O O   . LEU A 1 84  ? 24.252  22.322  9.871   1.00 45.48 ? 78  LEU A O   1 
ATOM   361  C CB  . LEU A 1 84  ? 26.134  20.016  11.325  1.00 44.59 ? 78  LEU A CB  1 
ATOM   362  C CG  . LEU A 1 84  ? 27.634  19.857  11.538  1.00 45.19 ? 78  LEU A CG  1 
ATOM   363  C CD1 . LEU A 1 84  ? 28.037  20.525  12.821  1.00 48.42 ? 78  LEU A CD1 1 
ATOM   364  C CD2 . LEU A 1 84  ? 28.012  18.406  11.622  1.00 47.26 ? 78  LEU A CD2 1 
ATOM   365  N N   . LEU A 1 85  ? 23.145  20.941  11.229  1.00 44.54 ? 79  LEU A N   1 
ATOM   366  C CA  . LEU A 1 85  ? 21.874  21.231  10.542  1.00 44.96 ? 79  LEU A CA  1 
ATOM   367  C C   . LEU A 1 85  ? 21.707  22.752  10.454  1.00 45.06 ? 79  LEU A C   1 
ATOM   368  O O   . LEU A 1 85  ? 21.656  23.312  9.350   1.00 44.28 ? 79  LEU A O   1 
ATOM   369  C CB  . LEU A 1 85  ? 20.633  20.630  11.230  1.00 44.97 ? 79  LEU A CB  1 
ATOM   370  C CG  . LEU A 1 85  ? 20.091  19.215  11.014  1.00 44.90 ? 79  LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 85  ? 20.688  18.553  9.784   1.00 45.29 ? 79  LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 85  ? 20.369  18.395  12.240  1.00 45.81 ? 79  LEU A CD2 1 
ATOM   373  N N   . SER A 1 86  ? 21.682  23.393  11.631  1.00 45.30 ? 80  SER A N   1 
ATOM   374  C CA  . SER A 1 86  ? 21.468  24.839  11.774  1.00 45.71 ? 80  SER A CA  1 
ATOM   375  C C   . SER A 1 86  ? 22.367  25.678  10.884  1.00 45.82 ? 80  SER A C   1 
ATOM   376  O O   . SER A 1 86  ? 21.893  26.571  10.184  1.00 45.59 ? 80  SER A O   1 
ATOM   377  C CB  . SER A 1 86  ? 21.624  25.264  13.230  1.00 45.63 ? 80  SER A CB  1 
ATOM   378  O OG  . SER A 1 86  ? 20.340  25.344  13.818  1.00 46.26 ? 80  SER A OG  1 
ATOM   379  N N   . GLY A 1 87  ? 23.657  25.361  10.919  1.00 45.96 ? 81  GLY A N   1 
ATOM   380  C CA  . GLY A 1 87  ? 24.640  25.942  10.038  1.00 46.59 ? 81  GLY A CA  1 
ATOM   381  C C   . GLY A 1 87  ? 24.254  25.779  8.588   1.00 47.70 ? 81  GLY A C   1 
ATOM   382  O O   . GLY A 1 87  ? 24.175  26.769  7.845   1.00 48.33 ? 81  GLY A O   1 
ATOM   383  N N   . SER A 1 88  ? 23.995  24.539  8.180   1.00 48.32 ? 82  SER A N   1 
ATOM   384  C CA  . SER A 1 88  ? 23.633  24.248  6.795   1.00 48.87 ? 82  SER A CA  1 
ATOM   385  C C   . SER A 1 88  ? 22.448  25.047  6.301   1.00 48.46 ? 82  SER A C   1 
ATOM   386  O O   . SER A 1 88  ? 22.401  25.397  5.128   1.00 48.37 ? 82  SER A O   1 
ATOM   387  C CB  . SER A 1 88  ? 23.357  22.760  6.607   1.00 49.54 ? 82  SER A CB  1 
ATOM   388  O OG  . SER A 1 88  ? 24.583  22.057  6.449   1.00 51.56 ? 82  SER A OG  1 
ATOM   389  N N   . LEU A 1 89  ? 21.504  25.336  7.194   1.00 48.35 ? 83  LEU A N   1 
ATOM   390  C CA  . LEU A 1 89  ? 20.302  26.053  6.809   1.00 48.61 ? 83  LEU A CA  1 
ATOM   391  C C   . LEU A 1 89  ? 20.591  27.499  6.446   1.00 49.08 ? 83  LEU A C   1 
ATOM   392  O O   . LEU A 1 89  ? 20.058  28.001  5.457   1.00 49.00 ? 83  LEU A O   1 
ATOM   393  C CB  . LEU A 1 89  ? 19.194  25.933  7.861   1.00 48.37 ? 83  LEU A CB  1 
ATOM   394  C CG  . LEU A 1 89  ? 17.824  26.583  7.604   1.00 48.29 ? 83  LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 89  ? 17.163  26.223  6.269   1.00 47.05 ? 83  LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 89  ? 16.881  26.262  8.745   1.00 48.49 ? 83  LEU A CD2 1 
ATOM   397  N N   . GLU A 1 90  ? 21.441  28.165  7.226   1.00 50.13 ? 84  GLU A N   1 
ATOM   398  C CA  . GLU A 1 90  ? 21.777  29.569  6.934   1.00 50.78 ? 84  GLU A CA  1 
ATOM   399  C C   . GLU A 1 90  ? 22.507  29.675  5.599   1.00 50.14 ? 84  GLU A C   1 
ATOM   400  O O   . GLU A 1 90  ? 22.272  30.629  4.839   1.00 50.29 ? 84  GLU A O   1 
ATOM   401  C CB  . GLU A 1 90  ? 22.597  30.237  8.047   1.00 51.13 ? 84  GLU A CB  1 
ATOM   402  C CG  . GLU A 1 90  ? 22.395  31.780  8.058   1.00 55.12 ? 84  GLU A CG  1 
ATOM   403  C CD  . GLU A 1 90  ? 23.644  32.602  8.469   1.00 59.86 ? 84  GLU A CD  1 
ATOM   404  O OE1 . GLU A 1 90  ? 23.550  33.858  8.539   1.00 61.37 ? 84  GLU A OE1 1 
ATOM   405  O OE2 . GLU A 1 90  ? 24.725  32.013  8.713   1.00 61.31 ? 84  GLU A OE2 1 
ATOM   406  N N   . VAL A 1 91  ? 23.378  28.699  5.314   1.00 49.06 ? 85  VAL A N   1 
ATOM   407  C CA  . VAL A 1 91  ? 24.081  28.674  4.038   1.00 48.58 ? 85  VAL A CA  1 
ATOM   408  C C   . VAL A 1 91  ? 23.044  28.508  2.928   1.00 48.65 ? 85  VAL A C   1 
ATOM   409  O O   . VAL A 1 91  ? 22.974  29.338  2.004   1.00 48.71 ? 85  VAL A O   1 
ATOM   410  C CB  . VAL A 1 91  ? 25.099  27.527  3.920   1.00 48.49 ? 85  VAL A CB  1 
ATOM   411  C CG1 . VAL A 1 91  ? 25.650  27.480  2.502   1.00 49.57 ? 85  VAL A CG1 1 
ATOM   412  C CG2 . VAL A 1 91  ? 26.224  27.636  4.942   1.00 47.36 ? 85  VAL A CG2 1 
ATOM   413  N N   . ILE A 1 92  ? 22.219  27.459  3.052   1.00 48.09 ? 86  ILE A N   1 
ATOM   414  C CA  . ILE A 1 92  ? 21.222  27.156  2.049   1.00 47.37 ? 86  ILE A CA  1 
ATOM   415  C C   . ILE A 1 92  ? 20.360  28.357  1.756   1.00 47.14 ? 86  ILE A C   1 
ATOM   416  O O   . ILE A 1 92  ? 20.150  28.651  0.589   1.00 47.25 ? 86  ILE A O   1 
ATOM   417  C CB  . ILE A 1 92  ? 20.341  25.966  2.410   1.00 47.40 ? 86  ILE A CB  1 
ATOM   418  C CG1 . ILE A 1 92  ? 21.093  24.656  2.152   1.00 47.68 ? 86  ILE A CG1 1 
ATOM   419  C CG2 . ILE A 1 92  ? 19.076  25.971  1.549   1.00 47.10 ? 86  ILE A CG2 1 
ATOM   420  C CD1 . ILE A 1 92  ? 20.479  23.483  2.859   1.00 48.06 ? 86  ILE A CD1 1 
ATOM   421  N N   . ARG A 1 93  ? 19.877  29.030  2.801   1.00 46.83 ? 87  ARG A N   1 
ATOM   422  C CA  . ARG A 1 93  ? 19.038  30.224  2.676   1.00 47.16 ? 87  ARG A CA  1 
ATOM   423  C C   . ARG A 1 93  ? 19.778  31.314  1.889   1.00 46.97 ? 87  ARG A C   1 
ATOM   424  O O   . ARG A 1 93  ? 19.237  31.897  0.941   1.00 46.39 ? 87  ARG A O   1 
ATOM   425  C CB  . ARG A 1 93  ? 18.595  30.749  4.077   1.00 47.19 ? 87  ARG A CB  1 
ATOM   426  C CG  . ARG A 1 93  ? 17.833  32.130  4.096   1.00 47.34 ? 87  ARG A CG  1 
ATOM   427  C CD  . ARG A 1 93  ? 17.309  32.629  5.490   1.00 48.52 ? 87  ARG A CD  1 
ATOM   428  N NE  . ARG A 1 93  ? 17.114  31.571  6.509   1.00 55.25 ? 87  ARG A NE  1 
ATOM   429  C CZ  . ARG A 1 93  ? 15.964  30.921  6.789   1.00 57.27 ? 87  ARG A CZ  1 
ATOM   430  N NH1 . ARG A 1 93  ? 14.825  31.191  6.127   1.00 58.12 ? 87  ARG A NH1 1 
ATOM   431  N NH2 . ARG A 1 93  ? 15.952  29.980  7.745   1.00 54.18 ? 87  ARG A NH2 1 
ATOM   432  N N   . LYS A 1 94  ? 21.024  31.569  2.262   1.00 46.83 ? 88  LYS A N   1 
ATOM   433  C CA  . LYS A 1 94  ? 21.776  32.638  1.605   1.00 47.34 ? 88  LYS A CA  1 
ATOM   434  C C   . LYS A 1 94  ? 22.012  32.327  0.129   1.00 46.86 ? 88  LYS A C   1 
ATOM   435  O O   . LYS A 1 94  ? 22.181  33.227  -0.688  1.00 46.89 ? 88  LYS A O   1 
ATOM   436  C CB  . LYS A 1 94  ? 23.103  32.953  2.346   1.00 47.98 ? 88  LYS A CB  1 
ATOM   437  C CG  . LYS A 1 94  ? 23.099  34.259  3.225   1.00 49.26 ? 88  LYS A CG  1 
ATOM   438  C CD  . LYS A 1 94  ? 23.001  34.017  4.748   1.00 51.62 ? 88  LYS A CD  1 
ATOM   439  C CE  . LYS A 1 94  ? 21.548  33.716  5.241   1.00 52.82 ? 88  LYS A CE  1 
ATOM   440  N NZ  . LYS A 1 94  ? 20.555  34.836  5.073   1.00 53.35 ? 88  LYS A NZ  1 
ATOM   441  N N   . TRP A 1 95  ? 22.011  31.038  -0.199  1.00 46.74 ? 89  TRP A N   1 
ATOM   442  C CA  . TRP A 1 95  ? 22.232  30.559  -1.570  1.00 46.16 ? 89  TRP A CA  1 
ATOM   443  C C   . TRP A 1 95  ? 20.973  30.656  -2.415  1.00 46.79 ? 89  TRP A C   1 
ATOM   444  O O   . TRP A 1 95  ? 21.046  30.725  -3.625  1.00 46.85 ? 89  TRP A O   1 
ATOM   445  C CB  . TRP A 1 95  ? 22.756  29.130  -1.533  1.00 45.24 ? 89  TRP A CB  1 
ATOM   446  C CG  . TRP A 1 95  ? 22.464  28.295  -2.734  1.00 44.53 ? 89  TRP A CG  1 
ATOM   447  C CD1 . TRP A 1 95  ? 23.212  28.206  -3.869  1.00 43.33 ? 89  TRP A CD1 1 
ATOM   448  C CD2 . TRP A 1 95  ? 21.338  27.417  -2.922  1.00 42.42 ? 89  TRP A CD2 1 
ATOM   449  N NE1 . TRP A 1 95  ? 22.621  27.339  -4.754  1.00 42.75 ? 89  TRP A NE1 1 
ATOM   450  C CE2 . TRP A 1 95  ? 21.477  26.831  -4.191  1.00 42.02 ? 89  TRP A CE2 1 
ATOM   451  C CE3 . TRP A 1 95  ? 20.236  27.072  -2.136  1.00 42.75 ? 89  TRP A CE3 1 
ATOM   452  C CZ2 . TRP A 1 95  ? 20.566  25.889  -4.694  1.00 43.87 ? 89  TRP A CZ2 1 
ATOM   453  C CZ3 . TRP A 1 95  ? 19.316  26.138  -2.642  1.00 44.17 ? 89  TRP A CZ3 1 
ATOM   454  C CH2 . TRP A 1 95  ? 19.487  25.569  -3.915  1.00 44.59 ? 89  TRP A CH2 1 
ATOM   455  N N   . ALA A 1 96  ? 19.814  30.663  -1.771  1.00 48.01 ? 90  ALA A N   1 
ATOM   456  C CA  . ALA A 1 96  ? 18.544  30.708  -2.480  1.00 48.81 ? 90  ALA A CA  1 
ATOM   457  C C   . ALA A 1 96  ? 18.325  32.086  -3.064  1.00 49.34 ? 90  ALA A C   1 
ATOM   458  O O   . ALA A 1 96  ? 17.976  32.192  -4.230  1.00 49.27 ? 90  ALA A O   1 
ATOM   459  C CB  . ALA A 1 96  ? 17.367  30.304  -1.562  1.00 48.94 ? 90  ALA A CB  1 
ATOM   460  N N   . GLU A 1 97  ? 18.569  33.135  -2.273  1.00 50.36 ? 91  GLU A N   1 
ATOM   461  C CA  . GLU A 1 97  ? 18.381  34.510  -2.763  1.00 51.51 ? 91  GLU A CA  1 
ATOM   462  C C   . GLU A 1 97  ? 19.159  34.678  -4.045  1.00 51.58 ? 91  GLU A C   1 
ATOM   463  O O   . GLU A 1 97  ? 18.651  35.269  -5.015  1.00 52.55 ? 91  GLU A O   1 
ATOM   464  C CB  . GLU A 1 97  ? 18.772  35.587  -1.747  1.00 51.70 ? 91  GLU A CB  1 
ATOM   465  C CG  . GLU A 1 97  ? 19.682  35.085  -0.648  1.00 54.56 ? 91  GLU A CG  1 
ATOM   466  C CD  . GLU A 1 97  ? 20.873  35.999  -0.371  1.00 57.63 ? 91  GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 97  ? 21.087  36.319  0.824   1.00 58.22 ? 91  GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 97  ? 21.607  36.371  -1.333  1.00 59.12 ? 91  GLU A OE2 1 
ATOM   469  N N   . LYS A 1 98  ? 20.353  34.094  -4.073  1.00 50.87 ? 92  LYS A N   1 
ATOM   470  C CA  . LYS A 1 98  ? 21.202  34.188  -5.241  1.00 50.39 ? 92  LYS A CA  1 
ATOM   471  C C   . LYS A 1 98  ? 20.693  33.421  -6.469  1.00 49.91 ? 92  LYS A C   1 
ATOM   472  O O   . LYS A 1 98  ? 21.296  33.487  -7.526  1.00 49.93 ? 92  LYS A O   1 
ATOM   473  C CB  . LYS A 1 98  ? 22.637  33.825  -4.880  1.00 50.50 ? 92  LYS A CB  1 
ATOM   474  C CG  . LYS A 1 98  ? 23.205  34.735  -3.802  1.00 52.21 ? 92  LYS A CG  1 
ATOM   475  C CD  . LYS A 1 98  ? 24.731  34.860  -3.850  1.00 54.54 ? 92  LYS A CD  1 
ATOM   476  C CE  . LYS A 1 98  ? 25.185  35.913  -2.834  1.00 56.34 ? 92  LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 98  ? 26.619  35.807  -2.409  1.00 57.04 ? 92  LYS A NZ  1 
ATOM   478  N N   . ILE A 1 99  ? 19.576  32.717  -6.346  1.00 49.35 ? 93  ILE A N   1 
ATOM   479  C CA  . ILE A 1 99  ? 18.984  32.051  -7.504  1.00 49.35 ? 93  ILE A CA  1 
ATOM   480  C C   . ILE A 1 99  ? 18.002  32.993  -8.224  1.00 49.51 ? 93  ILE A C   1 
ATOM   481  O O   . ILE A 1 99  ? 16.912  33.294  -7.701  1.00 49.84 ? 93  ILE A O   1 
ATOM   482  C CB  . ILE A 1 99  ? 18.307  30.734  -7.099  1.00 49.09 ? 93  ILE A CB  1 
ATOM   483  C CG1 . ILE A 1 99  ? 19.372  29.718  -6.708  1.00 49.30 ? 93  ILE A CG1 1 
ATOM   484  C CG2 . ILE A 1 99  ? 17.547  30.157  -8.266  1.00 50.14 ? 93  ILE A CG2 1 
ATOM   485  C CD1 . ILE A 1 99  ? 18.934  28.754  -5.690  1.00 49.51 ? 93  ILE A CD1 1 
ATOM   486  N N   . PRO A 1 100 ? 18.386  33.491  -9.416  1.00 49.22 ? 94  PRO A N   1 
ATOM   487  C CA  . PRO A 1 100 ? 17.566  34.502  -10.101 1.00 49.10 ? 94  PRO A CA  1 
ATOM   488  C C   . PRO A 1 100 ? 16.099  34.176  -10.073 1.00 49.04 ? 94  PRO A C   1 
ATOM   489  O O   . PRO A 1 100 ? 15.722  33.073  -10.403 1.00 49.48 ? 94  PRO A O   1 
ATOM   490  C CB  . PRO A 1 100 ? 18.103  34.477  -11.534 1.00 48.98 ? 94  PRO A CB  1 
ATOM   491  C CG  . PRO A 1 100 ? 19.563  34.160  -11.350 1.00 48.47 ? 94  PRO A CG  1 
ATOM   492  C CD  . PRO A 1 100 ? 19.616  33.188  -10.175 1.00 49.25 ? 94  PRO A CD  1 
ATOM   493  N N   . GLY A 1 101 ? 15.288  35.131  -9.638  1.00 49.56 ? 95  GLY A N   1 
ATOM   494  C CA  . GLY A 1 101 ? 13.844  34.994  -9.658  1.00 49.83 ? 95  GLY A CA  1 
ATOM   495  C C   . GLY A 1 101 ? 13.265  34.467  -8.372  1.00 50.38 ? 95  GLY A C   1 
ATOM   496  O O   . GLY A 1 101 ? 12.080  34.683  -8.088  1.00 51.21 ? 95  GLY A O   1 
ATOM   497  N N   . PHE A 1 102 ? 14.075  33.761  -7.592  1.00 50.48 ? 96  PHE A N   1 
ATOM   498  C CA  . PHE A 1 102 ? 13.586  33.196  -6.340  1.00 50.70 ? 96  PHE A CA  1 
ATOM   499  C C   . PHE A 1 102 ? 13.150  34.289  -5.385  1.00 51.16 ? 96  PHE A C   1 
ATOM   500  O O   . PHE A 1 102 ? 12.133  34.146  -4.721  1.00 50.80 ? 96  PHE A O   1 
ATOM   501  C CB  . PHE A 1 102 ? 14.645  32.299  -5.668  1.00 50.39 ? 96  PHE A CB  1 
ATOM   502  C CG  . PHE A 1 102 ? 14.185  31.679  -4.375  1.00 49.51 ? 96  PHE A CG  1 
ATOM   503  C CD1 . PHE A 1 102 ? 13.471  30.478  -4.375  1.00 49.05 ? 96  PHE A CD1 1 
ATOM   504  C CD2 . PHE A 1 102 ? 14.448  32.300  -3.157  1.00 49.92 ? 96  PHE A CD2 1 
ATOM   505  C CE1 . PHE A 1 102 ? 13.034  29.909  -3.189  1.00 47.51 ? 96  PHE A CE1 1 
ATOM   506  C CE2 . PHE A 1 102 ? 14.007  31.726  -1.955  1.00 49.72 ? 96  PHE A CE2 1 
ATOM   507  C CZ  . PHE A 1 102 ? 13.304  30.530  -1.980  1.00 48.85 ? 96  PHE A CZ  1 
ATOM   508  N N   . ALA A 1 103 ? 13.927  35.369  -5.326  1.00 52.30 ? 97  ALA A N   1 
ATOM   509  C CA  . ALA A 1 103 ? 13.713  36.427  -4.333  1.00 53.74 ? 97  ALA A CA  1 
ATOM   510  C C   . ALA A 1 103 ? 12.475  37.285  -4.615  1.00 54.78 ? 97  ALA A C   1 
ATOM   511  O O   . ALA A 1 103 ? 11.928  37.923  -3.701  1.00 54.50 ? 97  ALA A O   1 
ATOM   512  C CB  . ALA A 1 103 ? 14.958  37.294  -4.173  1.00 53.23 ? 97  ALA A CB  1 
ATOM   513  N N   . GLU A 1 104 ? 12.020  37.282  -5.867  1.00 56.25 ? 98  GLU A N   1 
ATOM   514  C CA  . GLU A 1 104 ? 10.831  38.051  -6.221  1.00 57.91 ? 98  GLU A CA  1 
ATOM   515  C C   . GLU A 1 104 ? 9.564   37.242  -6.062  1.00 58.31 ? 98  GLU A C   1 
ATOM   516  O O   . GLU A 1 104 ? 8.482   37.747  -6.371  1.00 58.50 ? 98  GLU A O   1 
ATOM   517  C CB  . GLU A 1 104 ? 10.898  38.641  -7.636  1.00 58.32 ? 98  GLU A CB  1 
ATOM   518  C CG  . GLU A 1 104 ? 12.062  39.569  -7.890  1.00 59.98 ? 98  GLU A CG  1 
ATOM   519  C CD  . GLU A 1 104 ? 13.104  38.897  -8.741  1.00 63.52 ? 98  GLU A CD  1 
ATOM   520  O OE1 . GLU A 1 104 ? 12.771  38.583  -9.911  1.00 63.24 ? 98  GLU A OE1 1 
ATOM   521  O OE2 . GLU A 1 104 ? 14.236  38.659  -8.238  1.00 65.71 ? 98  GLU A OE2 1 
ATOM   522  N N   . LEU A 1 105 ? 9.703   35.994  -5.601  1.00 58.98 ? 99  LEU A N   1 
ATOM   523  C CA  . LEU A 1 105 ? 8.568   35.181  -5.119  1.00 59.28 ? 99  LEU A CA  1 
ATOM   524  C C   . LEU A 1 105 ? 8.156   35.716  -3.757  1.00 59.66 ? 99  LEU A C   1 
ATOM   525  O O   . LEU A 1 105 ? 8.912   36.450  -3.140  1.00 59.88 ? 99  LEU A O   1 
ATOM   526  C CB  . LEU A 1 105 ? 8.968   33.717  -4.984  1.00 59.04 ? 99  LEU A CB  1 
ATOM   527  C CG  . LEU A 1 105 ? 9.509   32.934  -6.184  1.00 59.77 ? 99  LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 105 ? 10.042  31.570  -5.742  1.00 59.24 ? 99  LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 105 ? 8.461   32.779  -7.294  1.00 59.53 ? 99  LEU A CD2 1 
ATOM   530  N N   . SER A 1 106 ? 6.966   35.363  -3.284  1.00 60.46 ? 100 SER A N   1 
ATOM   531  C CA  . SER A 1 106 ? 6.495   35.843  -1.977  1.00 61.57 ? 100 SER A CA  1 
ATOM   532  C C   . SER A 1 106 ? 7.400   35.374  -0.828  1.00 62.07 ? 100 SER A C   1 
ATOM   533  O O   . SER A 1 106 ? 8.044   34.317  -0.936  1.00 62.19 ? 100 SER A O   1 
ATOM   534  C CB  . SER A 1 106 ? 5.060   35.375  -1.716  1.00 61.81 ? 100 SER A CB  1 
ATOM   535  O OG  . SER A 1 106 ? 5.031   34.077  -1.129  1.00 63.14 ? 100 SER A OG  1 
ATOM   536  N N   . PRO A 1 107 ? 7.450   36.151  0.280   1.00 62.37 ? 101 PRO A N   1 
ATOM   537  C CA  . PRO A 1 107 ? 8.253   35.744  1.449   1.00 62.50 ? 101 PRO A CA  1 
ATOM   538  C C   . PRO A 1 107 ? 7.815   34.380  2.002   1.00 62.36 ? 101 PRO A C   1 
ATOM   539  O O   . PRO A 1 107 ? 8.660   33.547  2.365   1.00 62.23 ? 101 PRO A O   1 
ATOM   540  C CB  . PRO A 1 107 ? 7.979   36.863  2.477   1.00 62.43 ? 101 PRO A CB  1 
ATOM   541  C CG  . PRO A 1 107 ? 6.722   37.506  2.015   1.00 62.24 ? 101 PRO A CG  1 
ATOM   542  C CD  . PRO A 1 107 ? 6.776   37.437  0.517   1.00 62.16 ? 101 PRO A CD  1 
ATOM   543  N N   . ALA A 1 108 ? 6.500   34.162  2.033   1.00 62.16 ? 102 ALA A N   1 
ATOM   544  C CA  . ALA A 1 108 ? 5.926   32.929  2.553   1.00 61.93 ? 102 ALA A CA  1 
ATOM   545  C C   . ALA A 1 108 ? 6.331   31.715  1.697   1.00 61.65 ? 102 ALA A C   1 
ATOM   546  O O   . ALA A 1 108 ? 6.785   30.703  2.237   1.00 61.93 ? 102 ALA A O   1 
ATOM   547  C CB  . ALA A 1 108 ? 4.408   33.050  2.685   1.00 61.52 ? 102 ALA A CB  1 
ATOM   548  N N   . ASP A 1 109 ? 6.196   31.830  0.376   1.00 60.90 ? 103 ASP A N   1 
ATOM   549  C CA  . ASP A 1 109 ? 6.638   30.762  -0.525  1.00 60.18 ? 103 ASP A CA  1 
ATOM   550  C C   . ASP A 1 109 ? 8.155   30.572  -0.499  1.00 59.03 ? 103 ASP A C   1 
ATOM   551  O O   . ASP A 1 109 ? 8.634   29.445  -0.488  1.00 58.83 ? 103 ASP A O   1 
ATOM   552  C CB  . ASP A 1 109 ? 6.095   30.971  -1.938  1.00 60.49 ? 103 ASP A CB  1 
ATOM   553  C CG  . ASP A 1 109 ? 4.572   30.782  -2.003  1.00 63.04 ? 103 ASP A CG  1 
ATOM   554  O OD1 . ASP A 1 109 ? 3.870   31.347  -1.127  1.00 64.90 ? 103 ASP A OD1 1 
ATOM   555  O OD2 . ASP A 1 109 ? 4.072   30.056  -2.903  1.00 65.03 ? 103 ASP A OD2 1 
ATOM   556  N N   . GLN A 1 110 ? 8.905   31.671  -0.438  1.00 57.91 ? 104 GLN A N   1 
ATOM   557  C CA  . GLN A 1 110 ? 10.335  31.601  -0.160  1.00 56.64 ? 104 GLN A CA  1 
ATOM   558  C C   . GLN A 1 110 ? 10.619  30.825  1.136   1.00 56.48 ? 104 GLN A C   1 
ATOM   559  O O   . GLN A 1 110 ? 11.688  30.211  1.279   1.00 56.44 ? 104 GLN A O   1 
ATOM   560  C CB  . GLN A 1 110 ? 10.941  32.994  -0.061  1.00 56.66 ? 104 GLN A CB  1 
ATOM   561  C CG  . GLN A 1 110 ? 11.358  33.614  -1.381  1.00 56.59 ? 104 GLN A CG  1 
ATOM   562  C CD  . GLN A 1 110 ? 11.889  35.040  -1.241  1.00 55.72 ? 104 GLN A CD  1 
ATOM   563  O OE1 . GLN A 1 110 ? 12.794  35.326  -0.455  1.00 53.30 ? 104 GLN A OE1 1 
ATOM   564  N NE2 . GLN A 1 110 ? 11.326  35.932  -2.016  1.00 54.41 ? 104 GLN A NE2 1 
ATOM   565  N N   . ASP A 1 111 ? 9.677   30.862  2.080   1.00 55.52 ? 105 ASP A N   1 
ATOM   566  C CA  . ASP A 1 111 ? 9.845   30.122  3.331   1.00 54.81 ? 105 ASP A CA  1 
ATOM   567  C C   . ASP A 1 111 ? 9.322   28.712  3.226   1.00 53.90 ? 105 ASP A C   1 
ATOM   568  O O   . ASP A 1 111 ? 9.951   27.784  3.736   1.00 54.54 ? 105 ASP A O   1 
ATOM   569  C CB  . ASP A 1 111 ? 9.186   30.844  4.497   1.00 55.13 ? 105 ASP A CB  1 
ATOM   570  C CG  . ASP A 1 111 ? 9.983   32.049  4.951   1.00 56.13 ? 105 ASP A CG  1 
ATOM   571  O OD1 . ASP A 1 111 ? 11.238  31.979  4.957   1.00 56.50 ? 105 ASP A OD1 1 
ATOM   572  O OD2 . ASP A 1 111 ? 9.349   33.072  5.301   1.00 58.55 ? 105 ASP A OD2 1 
ATOM   573  N N   . LEU A 1 112 ? 8.186   28.552  2.553   1.00 52.42 ? 106 LEU A N   1 
ATOM   574  C CA  . LEU A 1 112 ? 7.625   27.243  2.278   1.00 51.02 ? 106 LEU A CA  1 
ATOM   575  C C   . LEU A 1 112 ? 8.607   26.346  1.503   1.00 50.53 ? 106 LEU A C   1 
ATOM   576  O O   . LEU A 1 112 ? 8.951   25.244  1.973   1.00 50.84 ? 106 LEU A O   1 
ATOM   577  C CB  . LEU A 1 112 ? 6.299   27.370  1.541   1.00 50.61 ? 106 LEU A CB  1 
ATOM   578  C CG  . LEU A 1 112 ? 5.553   26.071  1.191   1.00 50.80 ? 106 LEU A CG  1 
ATOM   579  C CD1 . LEU A 1 112 ? 5.358   25.086  2.358   1.00 47.62 ? 106 LEU A CD1 1 
ATOM   580  C CD2 . LEU A 1 112 ? 4.226   26.465  0.592   1.00 50.26 ? 106 LEU A CD2 1 
ATOM   581  N N   . LEU A 1 113 ? 9.076   26.827  0.349   1.00 49.04 ? 107 LEU A N   1 
ATOM   582  C CA  . LEU A 1 113 ? 10.049  26.081  -0.473  1.00 47.62 ? 107 LEU A CA  1 
ATOM   583  C C   . LEU A 1 113 ? 11.319  25.776  0.290   1.00 47.37 ? 107 LEU A C   1 
ATOM   584  O O   . LEU A 1 113 ? 11.891  24.680  0.190   1.00 46.71 ? 107 LEU A O   1 
ATOM   585  C CB  . LEU A 1 113 ? 10.427  26.865  -1.735  1.00 46.80 ? 107 LEU A CB  1 
ATOM   586  C CG  . LEU A 1 113 ? 9.311   27.200  -2.705  1.00 43.71 ? 107 LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 113 ? 9.843   28.221  -3.658  1.00 42.70 ? 107 LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 113 ? 8.798   25.982  -3.415  1.00 40.00 ? 107 LEU A CD2 1 
ATOM   589  N N   . LEU A 1 114 ? 11.771  26.773  1.031   1.00 47.22 ? 108 LEU A N   1 
ATOM   590  C CA  . LEU A 1 114 ? 13.014  26.646  1.711   1.00 47.24 ? 108 LEU A CA  1 
ATOM   591  C C   . LEU A 1 114 ? 12.807  25.648  2.829   1.00 47.60 ? 108 LEU A C   1 
ATOM   592  O O   . LEU A 1 114 ? 13.527  24.621  2.899   1.00 47.53 ? 108 LEU A O   1 
ATOM   593  C CB  . LEU A 1 114 ? 13.471  27.988  2.225   1.00 47.32 ? 108 LEU A CB  1 
ATOM   594  C CG  . LEU A 1 114 ? 14.952  28.183  2.487   1.00 47.53 ? 108 LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 114 ? 15.737  28.034  1.207   1.00 47.84 ? 108 LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 114 ? 15.147  29.579  3.094   1.00 49.61 ? 108 LEU A CD2 1 
ATOM   597  N N   . GLU A 1 115 ? 11.803  25.895  3.666   1.00 47.06 ? 109 GLU A N   1 
ATOM   598  C CA  . GLU A 1 115 ? 11.540  24.936  4.744   1.00 47.61 ? 109 GLU A CA  1 
ATOM   599  C C   . GLU A 1 115 ? 11.288  23.487  4.276   1.00 46.14 ? 109 GLU A C   1 
ATOM   600  O O   . GLU A 1 115 ? 11.835  22.574  4.851   1.00 46.05 ? 109 GLU A O   1 
ATOM   601  C CB  . GLU A 1 115 ? 10.487  25.449  5.739   1.00 48.00 ? 109 GLU A CB  1 
ATOM   602  C CG  . GLU A 1 115 ? 11.126  26.343  6.800   1.00 52.48 ? 109 GLU A CG  1 
ATOM   603  C CD  . GLU A 1 115 ? 10.224  27.482  7.299   1.00 59.26 ? 109 GLU A CD  1 
ATOM   604  O OE1 . GLU A 1 115 ? 9.102   27.192  7.790   1.00 62.13 ? 109 GLU A OE1 1 
ATOM   605  O OE2 . GLU A 1 115 ? 10.652  28.672  7.224   1.00 60.61 ? 109 GLU A OE2 1 
ATOM   606  N N   . SER A 1 116 ? 10.521  23.286  3.210   1.00 45.11 ? 110 SER A N   1 
ATOM   607  C CA  . SER A 1 116 ? 10.208  21.932  2.727   1.00 44.14 ? 110 SER A CA  1 
ATOM   608  C C   . SER A 1 116 ? 11.414  21.300  2.057   1.00 43.64 ? 110 SER A C   1 
ATOM   609  O O   . SER A 1 116 ? 11.477  20.092  1.910   1.00 44.55 ? 110 SER A O   1 
ATOM   610  C CB  . SER A 1 116 ? 9.060   21.934  1.699   1.00 43.96 ? 110 SER A CB  1 
ATOM   611  O OG  . SER A 1 116 ? 7.949   22.712  2.099   1.00 43.60 ? 110 SER A OG  1 
ATOM   612  N N   . ALA A 1 117 ? 12.359  22.106  1.607   1.00 42.58 ? 111 ALA A N   1 
ATOM   613  C CA  . ALA A 1 117 ? 13.451  21.550  0.837   1.00 41.34 ? 111 ALA A CA  1 
ATOM   614  C C   . ALA A 1 117 ? 14.720  21.365  1.688   1.00 40.70 ? 111 ALA A C   1 
ATOM   615  O O   . ALA A 1 117 ? 15.645  20.649  1.259   1.00 39.91 ? 111 ALA A O   1 
ATOM   616  C CB  . ALA A 1 117 ? 13.719  22.410  -0.432  1.00 41.22 ? 111 ALA A CB  1 
ATOM   617  N N   . PHE A 1 118 ? 14.748  21.981  2.885   1.00 39.94 ? 112 PHE A N   1 
ATOM   618  C CA  . PHE A 1 118 ? 15.988  22.091  3.662   1.00 39.63 ? 112 PHE A CA  1 
ATOM   619  C C   . PHE A 1 118 ? 16.677  20.764  3.812   1.00 39.58 ? 112 PHE A C   1 
ATOM   620  O O   . PHE A 1 118 ? 17.811  20.599  3.366   1.00 40.41 ? 112 PHE A O   1 
ATOM   621  C CB  . PHE A 1 118 ? 15.821  22.717  5.058   1.00 39.59 ? 112 PHE A CB  1 
ATOM   622  C CG  . PHE A 1 118 ? 16.891  22.290  6.019   1.00 39.91 ? 112 PHE A CG  1 
ATOM   623  C CD1 . PHE A 1 118 ? 18.220  22.673  5.823   1.00 42.53 ? 112 PHE A CD1 1 
ATOM   624  C CD2 . PHE A 1 118 ? 16.600  21.433  7.072   1.00 41.39 ? 112 PHE A CD2 1 
ATOM   625  C CE1 . PHE A 1 118 ? 19.246  22.214  6.684   1.00 40.79 ? 112 PHE A CE1 1 
ATOM   626  C CE2 . PHE A 1 118 ? 17.620  20.970  7.942   1.00 40.38 ? 112 PHE A CE2 1 
ATOM   627  C CZ  . PHE A 1 118 ? 18.939  21.370  7.749   1.00 38.72 ? 112 PHE A CZ  1 
ATOM   628  N N   . LEU A 1 119 ? 16.002  19.820  4.445   1.00 39.10 ? 113 LEU A N   1 
ATOM   629  C CA  . LEU A 1 119 ? 16.611  18.543  4.724   1.00 38.86 ? 113 LEU A CA  1 
ATOM   630  C C   . LEU A 1 119 ? 17.183  17.805  3.484   1.00 38.73 ? 113 LEU A C   1 
ATOM   631  O O   . LEU A 1 119 ? 18.249  17.202  3.573   1.00 38.88 ? 113 LEU A O   1 
ATOM   632  C CB  . LEU A 1 119 ? 15.640  17.690  5.518   1.00 38.61 ? 113 LEU A CB  1 
ATOM   633  C CG  . LEU A 1 119 ? 16.180  16.501  6.297   1.00 39.86 ? 113 LEU A CG  1 
ATOM   634  C CD1 . LEU A 1 119 ? 17.396  16.850  7.138   1.00 40.49 ? 113 LEU A CD1 1 
ATOM   635  C CD2 . LEU A 1 119 ? 15.083  15.979  7.180   1.00 40.98 ? 113 LEU A CD2 1 
ATOM   636  N N   . GLU A 1 120 ? 16.522  17.877  2.331   1.00 38.21 ? 114 GLU A N   1 
ATOM   637  C CA  . GLU A 1 120 ? 17.045  17.185  1.144   1.00 38.70 ? 114 GLU A CA  1 
ATOM   638  C C   . GLU A 1 120 ? 18.260  17.918  0.579   1.00 38.41 ? 114 GLU A C   1 
ATOM   639  O O   . GLU A 1 120 ? 19.285  17.278  0.275   1.00 38.73 ? 114 GLU A O   1 
ATOM   640  C CB  . GLU A 1 120 ? 15.983  17.017  0.074   1.00 38.53 ? 114 GLU A CB  1 
ATOM   641  C CG  . GLU A 1 120 ? 14.584  17.261  0.608   1.00 44.45 ? 114 GLU A CG  1 
ATOM   642  C CD  . GLU A 1 120 ? 13.490  17.130  -0.451  1.00 51.67 ? 114 GLU A CD  1 
ATOM   643  O OE1 . GLU A 1 120 ? 12.375  17.662  -0.207  1.00 55.62 ? 114 GLU A OE1 1 
ATOM   644  O OE2 . GLU A 1 120 ? 13.732  16.506  -1.516  1.00 53.10 ? 114 GLU A OE2 1 
ATOM   645  N N   . LEU A 1 121 ? 18.144  19.245  0.436   1.00 37.13 ? 115 LEU A N   1 
ATOM   646  C CA  . LEU A 1 121 ? 19.261  20.105  0.068   1.00 36.22 ? 115 LEU A CA  1 
ATOM   647  C C   . LEU A 1 121 ? 20.506  19.855  0.897   1.00 36.44 ? 115 LEU A C   1 
ATOM   648  O O   . LEU A 1 121 ? 21.577  19.560  0.371   1.00 36.97 ? 115 LEU A O   1 
ATOM   649  C CB  . LEU A 1 121 ? 18.868  21.554  0.251   1.00 36.01 ? 115 LEU A CB  1 
ATOM   650  C CG  . LEU A 1 121 ? 17.954  22.022  -0.854  1.00 33.97 ? 115 LEU A CG  1 
ATOM   651  C CD1 . LEU A 1 121 ? 17.252  23.257  -0.381  1.00 30.81 ? 115 LEU A CD1 1 
ATOM   652  C CD2 . LEU A 1 121 ? 18.711  22.206  -2.139  1.00 28.49 ? 115 LEU A CD2 1 
ATOM   653  N N   . PHE A 1 122 ? 20.365  19.994  2.199   1.00 36.39 ? 116 PHE A N   1 
ATOM   654  C CA  . PHE A 1 122 ? 21.349  19.478  3.133   1.00 36.70 ? 116 PHE A CA  1 
ATOM   655  C C   . PHE A 1 122 ? 21.958  18.122  2.716   1.00 36.33 ? 116 PHE A C   1 
ATOM   656  O O   . PHE A 1 122 ? 23.162  18.021  2.522   1.00 35.41 ? 116 PHE A O   1 
ATOM   657  C CB  . PHE A 1 122 ? 20.720  19.376  4.520   1.00 37.39 ? 116 PHE A CB  1 
ATOM   658  C CG  . PHE A 1 122 ? 21.616  18.756  5.546   1.00 38.77 ? 116 PHE A CG  1 
ATOM   659  C CD1 . PHE A 1 122 ? 22.581  19.525  6.192   1.00 39.87 ? 116 PHE A CD1 1 
ATOM   660  C CD2 . PHE A 1 122 ? 21.489  17.404  5.874   1.00 39.90 ? 116 PHE A CD2 1 
ATOM   661  C CE1 . PHE A 1 122 ? 23.417  18.946  7.131   1.00 41.18 ? 116 PHE A CE1 1 
ATOM   662  C CE2 . PHE A 1 122 ? 22.309  16.814  6.817   1.00 40.73 ? 116 PHE A CE2 1 
ATOM   663  C CZ  . PHE A 1 122 ? 23.283  17.577  7.445   1.00 40.59 ? 116 PHE A CZ  1 
ATOM   664  N N   . ILE A 1 123 ? 21.148  17.077  2.579   1.00 36.54 ? 117 ILE A N   1 
ATOM   665  C CA  . ILE A 1 123 ? 21.731  15.774  2.281   1.00 37.51 ? 117 ILE A CA  1 
ATOM   666  C C   . ILE A 1 123 ? 22.553  15.852  0.999   1.00 38.11 ? 117 ILE A C   1 
ATOM   667  O O   . ILE A 1 123 ? 23.718  15.472  0.978   1.00 38.31 ? 117 ILE A O   1 
ATOM   668  C CB  . ILE A 1 123 ? 20.674  14.712  2.124   1.00 37.71 ? 117 ILE A CB  1 
ATOM   669  C CG1 . ILE A 1 123 ? 19.987  14.444  3.455   1.00 38.45 ? 117 ILE A CG1 1 
ATOM   670  C CG2 . ILE A 1 123 ? 21.261  13.434  1.552   1.00 37.19 ? 117 ILE A CG2 1 
ATOM   671  C CD1 . ILE A 1 123 ? 18.532  14.030  3.238   1.00 38.80 ? 117 ILE A CD1 1 
ATOM   672  N N   . LEU A 1 124 ? 21.932  16.407  -0.039  1.00 38.97 ? 118 LEU A N   1 
ATOM   673  C CA  . LEU A 1 124 ? 22.463  16.486  -1.398  1.00 39.29 ? 118 LEU A CA  1 
ATOM   674  C C   . LEU A 1 124 ? 23.748  17.315  -1.532  1.00 39.35 ? 118 LEU A C   1 
ATOM   675  O O   . LEU A 1 124 ? 24.708  16.882  -2.190  1.00 39.17 ? 118 LEU A O   1 
ATOM   676  C CB  . LEU A 1 124 ? 21.394  17.082  -2.315  1.00 38.94 ? 118 LEU A CB  1 
ATOM   677  C CG  . LEU A 1 124 ? 21.875  17.136  -3.763  1.00 40.03 ? 118 LEU A CG  1 
ATOM   678  C CD1 . LEU A 1 124 ? 22.224  15.716  -4.255  1.00 38.69 ? 118 LEU A CD1 1 
ATOM   679  C CD2 . LEU A 1 124 ? 20.856  17.848  -4.686  1.00 39.87 ? 118 LEU A CD2 1 
ATOM   680  N N   . ARG A 1 125 ? 23.750  18.513  -0.945  1.00 39.24 ? 119 ARG A N   1 
ATOM   681  C CA  . ARG A 1 125 ? 24.953  19.338  -0.908  1.00 39.44 ? 119 ARG A CA  1 
ATOM   682  C C   . ARG A 1 125 ? 26.074  18.616  -0.165  1.00 39.50 ? 119 ARG A C   1 
ATOM   683  O O   . ARG A 1 125 ? 27.219  18.564  -0.655  1.00 40.08 ? 119 ARG A O   1 
ATOM   684  C CB  . ARG A 1 125 ? 24.668  20.680  -0.271  1.00 39.26 ? 119 ARG A CB  1 
ATOM   685  C CG  . ARG A 1 125 ? 23.624  21.494  -1.015  1.00 41.08 ? 119 ARG A CG  1 
ATOM   686  C CD  . ARG A 1 125 ? 23.268  22.718  -0.196  1.00 46.65 ? 119 ARG A CD  1 
ATOM   687  N NE  . ARG A 1 125 ? 24.423  23.601  -0.047  1.00 49.79 ? 119 ARG A NE  1 
ATOM   688  C CZ  . ARG A 1 125 ? 24.855  24.380  -1.027  1.00 53.68 ? 119 ARG A CZ  1 
ATOM   689  N NH1 . ARG A 1 125 ? 24.199  24.374  -2.192  1.00 56.66 ? 119 ARG A NH1 1 
ATOM   690  N NH2 . ARG A 1 125 ? 25.921  25.159  -0.859  1.00 54.93 ? 119 ARG A NH2 1 
ATOM   691  N N   . LEU A 1 126 ? 25.736  18.031  0.989   1.00 39.22 ? 120 LEU A N   1 
ATOM   692  C CA  . LEU A 1 126 ? 26.662  17.204  1.745   1.00 38.81 ? 120 LEU A CA  1 
ATOM   693  C C   . LEU A 1 126 ? 27.235  16.042  0.916   1.00 39.94 ? 120 LEU A C   1 
ATOM   694  O O   . LEU A 1 126 ? 28.453  15.815  0.934   1.00 39.69 ? 120 LEU A O   1 
ATOM   695  C CB  . LEU A 1 126 ? 26.002  16.651  3.004   1.00 38.59 ? 120 LEU A CB  1 
ATOM   696  C CG  . LEU A 1 126 ? 26.813  15.688  3.892   1.00 36.96 ? 120 LEU A CG  1 
ATOM   697  C CD1 . LEU A 1 126 ? 28.160  16.258  4.214   1.00 37.01 ? 120 LEU A CD1 1 
ATOM   698  C CD2 . LEU A 1 126 ? 26.111  15.377  5.181   1.00 37.05 ? 120 LEU A CD2 1 
ATOM   699  N N   . ALA A 1 127 ? 26.360  15.311  0.215   1.00 40.38 ? 121 ALA A N   1 
ATOM   700  C CA  . ALA A 1 127 ? 26.777  14.115  -0.528  1.00 41.24 ? 121 ALA A CA  1 
ATOM   701  C C   . ALA A 1 127 ? 27.756  14.472  -1.629  1.00 41.99 ? 121 ALA A C   1 
ATOM   702  O O   . ALA A 1 127 ? 28.784  13.807  -1.775  1.00 41.84 ? 121 ALA A O   1 
ATOM   703  C CB  . ALA A 1 127 ? 25.583  13.336  -1.084  1.00 40.51 ? 121 ALA A CB  1 
ATOM   704  N N   . TYR A 1 128 ? 27.467  15.555  -2.352  1.00 43.12 ? 122 TYR A N   1 
ATOM   705  C CA  . TYR A 1 128 ? 28.291  15.957  -3.485  1.00 44.89 ? 122 TYR A CA  1 
ATOM   706  C C   . TYR A 1 128 ? 29.676  16.475  -3.119  1.00 46.67 ? 122 TYR A C   1 
ATOM   707  O O   . TYR A 1 128 ? 30.598  16.385  -3.910  1.00 47.51 ? 122 TYR A O   1 
ATOM   708  C CB  . TYR A 1 128 ? 27.590  17.036  -4.273  1.00 44.30 ? 122 TYR A CB  1 
ATOM   709  C CG  . TYR A 1 128 ? 28.163  17.290  -5.659  1.00 44.10 ? 122 TYR A CG  1 
ATOM   710  C CD1 . TYR A 1 128 ? 28.119  16.306  -6.641  1.00 43.13 ? 122 TYR A CD1 1 
ATOM   711  C CD2 . TYR A 1 128 ? 28.703  18.527  -6.000  1.00 43.31 ? 122 TYR A CD2 1 
ATOM   712  C CE1 . TYR A 1 128 ? 28.612  16.545  -7.908  1.00 41.48 ? 122 TYR A CE1 1 
ATOM   713  C CE2 . TYR A 1 128 ? 29.195  18.766  -7.270  1.00 41.94 ? 122 TYR A CE2 1 
ATOM   714  C CZ  . TYR A 1 128 ? 29.145  17.768  -8.219  1.00 41.85 ? 122 TYR A CZ  1 
ATOM   715  O OH  . TYR A 1 128 ? 29.633  17.984  -9.501  1.00 44.05 ? 122 TYR A OH  1 
ATOM   716  N N   . ARG A 1 129 ? 29.814  17.052  -1.937  1.00 48.45 ? 123 ARG A N   1 
ATOM   717  C CA  . ARG A 1 129 ? 31.033  17.739  -1.589  1.00 49.90 ? 123 ARG A CA  1 
ATOM   718  C C   . ARG A 1 129 ? 31.931  16.883  -0.723  1.00 51.39 ? 123 ARG A C   1 
ATOM   719  O O   . ARG A 1 129 ? 33.112  17.161  -0.598  1.00 51.70 ? 123 ARG A O   1 
ATOM   720  C CB  . ARG A 1 129 ? 30.675  19.063  -0.913  1.00 50.26 ? 123 ARG A CB  1 
ATOM   721  C CG  . ARG A 1 129 ? 31.413  19.372  0.350   1.00 50.16 ? 123 ARG A CG  1 
ATOM   722  C CD  . ARG A 1 129 ? 31.188  20.780  0.768   1.00 50.98 ? 123 ARG A CD  1 
ATOM   723  N NE  . ARG A 1 129 ? 29.808  21.255  0.655   1.00 52.63 ? 123 ARG A NE  1 
ATOM   724  C CZ  . ARG A 1 129 ? 28.908  21.201  1.637   1.00 53.81 ? 123 ARG A CZ  1 
ATOM   725  N NH1 . ARG A 1 129 ? 29.224  20.630  2.788   1.00 53.87 ? 123 ARG A NH1 1 
ATOM   726  N NH2 . ARG A 1 129 ? 27.688  21.708  1.470   1.00 53.83 ? 123 ARG A NH2 1 
ATOM   727  N N   . SER A 1 130 ? 31.368  15.839  -0.127  1.00 53.25 ? 124 SER A N   1 
ATOM   728  C CA  . SER A 1 130 ? 32.133  14.920  0.694   1.00 54.77 ? 124 SER A CA  1 
ATOM   729  C C   . SER A 1 130 ? 32.906  13.950  -0.180  1.00 56.07 ? 124 SER A C   1 
ATOM   730  O O   . SER A 1 130 ? 32.599  13.786  -1.383  1.00 56.52 ? 124 SER A O   1 
ATOM   731  C CB  . SER A 1 130 ? 31.211  14.138  1.619   1.00 54.97 ? 124 SER A CB  1 
ATOM   732  O OG  . SER A 1 130 ? 30.762  14.950  2.690   1.00 56.04 ? 124 SER A OG  1 
ATOM   733  N N   . LYS A 1 131 ? 33.919  13.329  0.434   1.00 56.84 ? 125 LYS A N   1 
ATOM   734  C CA  . LYS A 1 131 ? 34.744  12.326  -0.216  1.00 57.40 ? 125 LYS A CA  1 
ATOM   735  C C   . LYS A 1 131 ? 34.589  11.036  0.566   1.00 57.68 ? 125 LYS A C   1 
ATOM   736  O O   . LYS A 1 131 ? 35.201  10.869  1.634   1.00 57.58 ? 125 LYS A O   1 
ATOM   737  C CB  . LYS A 1 131 ? 36.213  12.746  -0.254  1.00 57.54 ? 125 LYS A CB  1 
ATOM   738  C CG  . LYS A 1 131 ? 36.534  13.882  -1.221  1.00 57.94 ? 125 LYS A CG  1 
ATOM   739  C CD  . LYS A 1 131 ? 36.627  15.223  -0.499  1.00 58.30 ? 125 LYS A CD  1 
ATOM   740  C CE  . LYS A 1 131 ? 37.791  16.068  -1.013  1.00 58.59 ? 125 LYS A CE  1 
ATOM   741  N NZ  . LYS A 1 131 ? 39.060  15.748  -0.267  1.00 58.76 ? 125 LYS A NZ  1 
ATOM   742  N N   . PRO A 1 132 ? 33.758  10.118  0.038   1.00 57.76 ? 126 PRO A N   1 
ATOM   743  C CA  . PRO A 1 132 ? 33.411  8.866   0.707   1.00 57.44 ? 126 PRO A CA  1 
ATOM   744  C C   . PRO A 1 132 ? 34.574  7.886   0.669   1.00 57.51 ? 126 PRO A C   1 
ATOM   745  O O   . PRO A 1 132 ? 34.820  7.192   1.666   1.00 57.48 ? 126 PRO A O   1 
ATOM   746  C CB  . PRO A 1 132 ? 32.245  8.325   -0.122  1.00 57.29 ? 126 PRO A CB  1 
ATOM   747  C CG  . PRO A 1 132 ? 31.887  9.422   -1.097  1.00 57.96 ? 126 PRO A CG  1 
ATOM   748  C CD  . PRO A 1 132 ? 33.115  10.234  -1.278  1.00 57.70 ? 126 PRO A CD  1 
ATOM   749  N N   . GLY A 1 133 ? 35.296  7.853   -0.457  1.00 57.22 ? 127 GLY A N   1 
ATOM   750  C CA  . GLY A 1 133 ? 36.403  6.902   -0.647  1.00 56.71 ? 127 GLY A CA  1 
ATOM   751  C C   . GLY A 1 133 ? 37.440  6.960   0.470   1.00 56.39 ? 127 GLY A C   1 
ATOM   752  O O   . GLY A 1 133 ? 38.368  6.119   0.534   1.00 56.45 ? 127 GLY A O   1 
ATOM   753  N N   . GLU A 1 134 ? 37.281  7.964   1.338   1.00 55.26 ? 128 GLU A N   1 
ATOM   754  C CA  . GLU A 1 134 ? 38.158  8.192   2.468   1.00 54.33 ? 128 GLU A CA  1 
ATOM   755  C C   . GLU A 1 134 ? 37.334  8.622   3.672   1.00 54.01 ? 128 GLU A C   1 
ATOM   756  O O   . GLU A 1 134 ? 37.844  9.317   4.566   1.00 54.08 ? 128 GLU A O   1 
ATOM   757  C CB  . GLU A 1 134 ? 39.278  9.212   2.139   1.00 54.19 ? 128 GLU A CB  1 
ATOM   758  C CG  . GLU A 1 134 ? 38.978  10.237  1.033   1.00 54.13 ? 128 GLU A CG  1 
ATOM   759  C CD  . GLU A 1 134 ? 39.996  11.393  0.969   1.00 54.22 ? 128 GLU A CD  1 
ATOM   760  O OE1 . GLU A 1 134 ? 40.070  12.197  1.927   1.00 54.95 ? 128 GLU A OE1 1 
ATOM   761  O OE2 . GLU A 1 134 ? 40.705  11.524  -0.053  1.00 52.24 ? 128 GLU A OE2 1 
ATOM   762  N N   . GLY A 1 135 ? 36.061  8.214   3.680   1.00 53.32 ? 129 GLY A N   1 
ATOM   763  C CA  . GLY A 1 135 ? 35.130  8.456   4.808   1.00 52.56 ? 129 GLY A CA  1 
ATOM   764  C C   . GLY A 1 135 ? 35.122  9.848   5.450   1.00 51.96 ? 129 GLY A C   1 
ATOM   765  O O   . GLY A 1 135 ? 34.999  9.982   6.676   1.00 51.93 ? 129 GLY A O   1 
ATOM   766  N N   . LYS A 1 136 ? 35.240  10.882  4.624   1.00 51.19 ? 130 LYS A N   1 
ATOM   767  C CA  . LYS A 1 136 ? 35.296  12.258  5.102   1.00 50.61 ? 130 LYS A CA  1 
ATOM   768  C C   . LYS A 1 136 ? 34.031  13.042  4.767   1.00 50.17 ? 130 LYS A C   1 
ATOM   769  O O   . LYS A 1 136 ? 33.729  13.258  3.582   1.00 50.13 ? 130 LYS A O   1 
ATOM   770  C CB  . LYS A 1 136 ? 36.476  12.996  4.461   1.00 50.46 ? 130 LYS A CB  1 
ATOM   771  C CG  . LYS A 1 136 ? 37.783  12.916  5.173   1.00 49.68 ? 130 LYS A CG  1 
ATOM   772  C CD  . LYS A 1 136 ? 38.649  14.110  4.735   1.00 49.87 ? 130 LYS A CD  1 
ATOM   773  C CE  . LYS A 1 136 ? 40.077  14.031  5.242   1.00 48.77 ? 130 LYS A CE  1 
ATOM   774  N NZ  . LYS A 1 136 ? 40.911  13.209  4.331   1.00 49.21 ? 130 LYS A NZ  1 
ATOM   775  N N   . LEU A 1 137 ? 33.334  13.529  5.794   1.00 49.64 ? 131 LEU A N   1 
ATOM   776  C CA  . LEU A 1 137 ? 32.220  14.475  5.580   1.00 49.20 ? 131 LEU A CA  1 
ATOM   777  C C   . LEU A 1 137 ? 32.614  15.927  5.746   1.00 48.58 ? 131 LEU A C   1 
ATOM   778  O O   . LEU A 1 137 ? 33.116  16.327  6.787   1.00 48.63 ? 131 LEU A O   1 
ATOM   779  C CB  . LEU A 1 137 ? 31.015  14.149  6.463   1.00 49.47 ? 131 LEU A CB  1 
ATOM   780  C CG  . LEU A 1 137 ? 30.594  12.690  6.275   1.00 49.21 ? 131 LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 137 ? 30.922  11.944  7.531   1.00 49.52 ? 131 LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 137 ? 29.122  12.594  5.948   1.00 47.85 ? 131 LEU A CD2 1 
ATOM   783  N N   . ILE A 1 138 ? 32.399  16.700  4.690   1.00 48.15 ? 132 ILE A N   1 
ATOM   784  C CA  . ILE A 1 138 ? 32.658  18.131  4.682   1.00 47.88 ? 132 ILE A CA  1 
ATOM   785  C C   . ILE A 1 138 ? 31.305  18.816  4.828   1.00 47.93 ? 132 ILE A C   1 
ATOM   786  O O   . ILE A 1 138 ? 30.465  18.627  3.975   1.00 47.72 ? 132 ILE A O   1 
ATOM   787  C CB  . ILE A 1 138 ? 33.306  18.554  3.327   1.00 47.79 ? 132 ILE A CB  1 
ATOM   788  C CG1 . ILE A 1 138 ? 34.356  17.524  2.869   1.00 47.25 ? 132 ILE A CG1 1 
ATOM   789  C CG2 . ILE A 1 138 ? 33.882  19.969  3.389   1.00 47.03 ? 132 ILE A CG2 1 
ATOM   790  C CD1 . ILE A 1 138 ? 35.737  17.728  3.426   1.00 48.29 ? 132 ILE A CD1 1 
ATOM   791  N N   . PHE A 1 139 ? 31.077  19.589  5.889   1.00 47.94 ? 133 PHE A N   1 
ATOM   792  C CA  . PHE A 1 139 ? 29.792  20.287  6.010   1.00 48.95 ? 133 PHE A CA  1 
ATOM   793  C C   . PHE A 1 139 ? 29.807  21.695  5.396   1.00 49.66 ? 133 PHE A C   1 
ATOM   794  O O   . PHE A 1 139 ? 30.865  22.212  5.040   1.00 49.94 ? 133 PHE A O   1 
ATOM   795  C CB  . PHE A 1 139 ? 29.277  20.263  7.440   1.00 48.82 ? 133 PHE A CB  1 
ATOM   796  C CG  . PHE A 1 139 ? 29.017  18.872  7.944   1.00 50.21 ? 133 PHE A CG  1 
ATOM   797  C CD1 . PHE A 1 139 ? 30.061  18.075  8.417   1.00 50.58 ? 133 PHE A CD1 1 
ATOM   798  C CD2 . PHE A 1 139 ? 27.736  18.331  7.912   1.00 49.92 ? 133 PHE A CD2 1 
ATOM   799  C CE1 . PHE A 1 139 ? 29.818  16.759  8.840   1.00 50.51 ? 133 PHE A CE1 1 
ATOM   800  C CE2 . PHE A 1 139 ? 27.491  17.018  8.342   1.00 49.16 ? 133 PHE A CE2 1 
ATOM   801  C CZ  . PHE A 1 139 ? 28.523  16.243  8.811   1.00 49.88 ? 133 PHE A CZ  1 
ATOM   802  N N   . CYS A 1 140 ? 28.642  22.298  5.210   1.00 50.37 ? 134 CYS A N   1 
ATOM   803  C CA  . CYS A 1 140 ? 28.601  23.560  4.482   1.00 51.56 ? 134 CYS A CA  1 
ATOM   804  C C   . CYS A 1 140 ? 29.347  24.621  5.261   1.00 52.50 ? 134 CYS A C   1 
ATOM   805  O O   . CYS A 1 140 ? 29.927  25.525  4.667   1.00 53.13 ? 134 CYS A O   1 
ATOM   806  C CB  . CYS A 1 140 ? 27.190  24.004  4.231   1.00 51.65 ? 134 CYS A CB  1 
ATOM   807  N N   . SER A 1 141 ? 29.341  24.505  6.591   1.00 52.87 ? 135 SER A N   1 
ATOM   808  C CA  . SER A 1 141 ? 30.037  25.465  7.449   1.00 53.28 ? 135 SER A CA  1 
ATOM   809  C C   . SER A 1 141 ? 31.538  25.379  7.239   1.00 52.84 ? 135 SER A C   1 
ATOM   810  O O   . SER A 1 141 ? 32.289  26.195  7.779   1.00 52.57 ? 135 SER A O   1 
ATOM   811  C CB  . SER A 1 141 ? 29.717  25.205  8.928   1.00 53.80 ? 135 SER A CB  1 
ATOM   812  O OG  . SER A 1 141 ? 30.194  23.922  9.337   1.00 55.55 ? 135 SER A OG  1 
ATOM   813  N N   . GLY A 1 142 ? 31.956  24.363  6.476   1.00 52.62 ? 136 GLY A N   1 
ATOM   814  C CA  . GLY A 1 142 ? 33.370  24.048  6.237   1.00 51.74 ? 136 GLY A CA  1 
ATOM   815  C C   . GLY A 1 142 ? 33.979  23.055  7.222   1.00 51.08 ? 136 GLY A C   1 
ATOM   816  O O   . GLY A 1 142 ? 35.184  22.771  7.159   1.00 50.97 ? 136 GLY A O   1 
ATOM   817  N N   . LEU A 1 143 ? 33.183  22.523  8.144   1.00 50.35 ? 137 LEU A N   1 
ATOM   818  C CA  . LEU A 1 143 ? 33.748  21.552  9.095   1.00 50.24 ? 137 LEU A CA  1 
ATOM   819  C C   . LEU A 1 143 ? 33.980  20.175  8.481   1.00 49.99 ? 137 LEU A C   1 
ATOM   820  O O   . LEU A 1 143 ? 33.059  19.549  7.942   1.00 50.20 ? 137 LEU A O   1 
ATOM   821  C CB  . LEU A 1 143 ? 32.853  21.399  10.310  1.00 50.36 ? 137 LEU A CB  1 
ATOM   822  C CG  . LEU A 1 143 ? 33.593  20.851  11.521  1.00 50.60 ? 137 LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 143 ? 34.261  21.997  12.238  1.00 49.00 ? 137 LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 143 ? 32.620  20.133  12.435  1.00 50.92 ? 137 LEU A CD2 1 
ATOM   825  N N   . VAL A 1 144 ? 35.215  19.708  8.535   1.00 49.52 ? 138 VAL A N   1 
ATOM   826  C CA  . VAL A 1 144 ? 35.491  18.324  8.149   1.00 49.28 ? 138 VAL A CA  1 
ATOM   827  C C   . VAL A 1 144 ? 35.258  17.412  9.358   1.00 48.82 ? 138 VAL A C   1 
ATOM   828  O O   . VAL A 1 144 ? 35.400  17.843  10.507  1.00 49.09 ? 138 VAL A O   1 
ATOM   829  C CB  . VAL A 1 144 ? 36.915  18.150  7.628   1.00 49.26 ? 138 VAL A CB  1 
ATOM   830  C CG1 . VAL A 1 144 ? 37.068  16.792  6.926   1.00 49.82 ? 138 VAL A CG1 1 
ATOM   831  C CG2 . VAL A 1 144 ? 37.242  19.268  6.665   1.00 49.34 ? 138 VAL A CG2 1 
ATOM   832  N N   . LEU A 1 145 ? 34.908  16.160  9.099   1.00 47.92 ? 139 LEU A N   1 
ATOM   833  C CA  . LEU A 1 145 ? 34.517  15.260  10.152  1.00 47.49 ? 139 LEU A CA  1 
ATOM   834  C C   . LEU A 1 145 ? 34.510  13.862  9.565   1.00 47.85 ? 139 LEU A C   1 
ATOM   835  O O   . LEU A 1 145 ? 34.072  13.681  8.435   1.00 48.19 ? 139 LEU A O   1 
ATOM   836  C CB  . LEU A 1 145 ? 33.124  15.657  10.641  1.00 46.68 ? 139 LEU A CB  1 
ATOM   837  C CG  . LEU A 1 145 ? 32.825  15.834  12.129  1.00 45.88 ? 139 LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 145 ? 33.818  16.705  12.868  1.00 47.59 ? 139 LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 145 ? 31.488  16.443  12.282  1.00 43.64 ? 139 LEU A CD2 1 
ATOM   840  N N   . HIS A 1 146 ? 34.995  12.883  10.323  1.00 48.09 ? 140 HIS A N   1 
ATOM   841  C CA  . HIS A 1 146 ? 35.063  11.493  9.869   1.00 48.24 ? 140 HIS A CA  1 
ATOM   842  C C   . HIS A 1 146 ? 33.717  10.744  9.939   1.00 48.68 ? 140 HIS A C   1 
ATOM   843  O O   . HIS A 1 146 ? 32.866  11.016  10.798  1.00 48.42 ? 140 HIS A O   1 
ATOM   844  C CB  . HIS A 1 146 ? 36.120  10.744  10.697  1.00 48.41 ? 140 HIS A CB  1 
ATOM   845  C CG  . HIS A 1 146 ? 36.560  9.438   10.098  1.00 47.56 ? 140 HIS A CG  1 
ATOM   846  N ND1 . HIS A 1 146 ? 37.707  9.312   9.346   1.00 46.53 ? 140 HIS A ND1 1 
ATOM   847  C CD2 . HIS A 1 146 ? 36.006  8.204   10.142  1.00 47.01 ? 140 HIS A CD2 1 
ATOM   848  C CE1 . HIS A 1 146 ? 37.838  8.059   8.948   1.00 46.80 ? 140 HIS A CE1 1 
ATOM   849  N NE2 . HIS A 1 146 ? 36.815  7.368   9.412   1.00 46.65 ? 140 HIS A NE2 1 
ATOM   850  N N   . ARG A 1 147 ? 33.540  9.792   9.031   1.00 49.27 ? 141 ARG A N   1 
ATOM   851  C CA  . ARG A 1 147 ? 32.391  8.882   9.050   1.00 50.76 ? 141 ARG A CA  1 
ATOM   852  C C   . ARG A 1 147 ? 32.104  8.362   10.462  1.00 51.07 ? 141 ARG A C   1 
ATOM   853  O O   . ARG A 1 147 ? 30.998  8.535   10.986  1.00 51.37 ? 141 ARG A O   1 
ATOM   854  C CB  . ARG A 1 147 ? 32.644  7.723   8.073   1.00 50.96 ? 141 ARG A CB  1 
ATOM   855  C CG  . ARG A 1 147 ? 31.669  6.538   8.110   1.00 52.10 ? 141 ARG A CG  1 
ATOM   856  C CD  . ARG A 1 147 ? 32.022  5.546   7.023   1.00 52.30 ? 141 ARG A CD  1 
ATOM   857  N NE  . ARG A 1 147 ? 33.339  4.931   7.252   1.00 59.94 ? 141 ARG A NE  1 
ATOM   858  C CZ  . ARG A 1 147 ? 34.260  4.710   6.297   1.00 62.23 ? 141 ARG A CZ  1 
ATOM   859  N NH1 . ARG A 1 147 ? 34.020  5.070   5.030   1.00 64.06 ? 141 ARG A NH1 1 
ATOM   860  N NH2 . ARG A 1 147 ? 35.430  4.142   6.601   1.00 60.08 ? 141 ARG A NH2 1 
ATOM   861  N N   . LEU A 1 148 ? 33.109  7.750   11.083  1.00 51.19 ? 142 LEU A N   1 
ATOM   862  C CA  . LEU A 1 148 ? 32.935  7.141   12.402  1.00 51.55 ? 142 LEU A CA  1 
ATOM   863  C C   . LEU A 1 148 ? 32.845  8.204   13.497  1.00 52.00 ? 142 LEU A C   1 
ATOM   864  O O   . LEU A 1 148 ? 32.426  7.943   14.621  1.00 51.65 ? 142 LEU A O   1 
ATOM   865  C CB  . LEU A 1 148 ? 34.047  6.108   12.680  1.00 51.09 ? 142 LEU A CB  1 
ATOM   866  C CG  . LEU A 1 148 ? 34.288  5.068   11.561  1.00 50.98 ? 142 LEU A CG  1 
ATOM   867  C CD1 . LEU A 1 148 ? 35.454  4.137   11.873  1.00 47.80 ? 142 LEU A CD1 1 
ATOM   868  C CD2 . LEU A 1 148 ? 33.000  4.266   11.175  1.00 50.68 ? 142 LEU A CD2 1 
ATOM   869  N N   . GLN A 1 149 ? 33.234  9.421   13.162  1.00 52.97 ? 143 GLN A N   1 
ATOM   870  C CA  . GLN A 1 149 ? 33.095  10.500  14.105  1.00 54.15 ? 143 GLN A CA  1 
ATOM   871  C C   . GLN A 1 149 ? 31.650  10.806  14.098  1.00 55.13 ? 143 GLN A C   1 
ATOM   872  O O   . GLN A 1 149 ? 31.094  11.159  15.128  1.00 55.82 ? 143 GLN A O   1 
ATOM   873  C CB  . GLN A 1 149 ? 33.831  11.741  13.637  1.00 54.22 ? 143 GLN A CB  1 
ATOM   874  C CG  . GLN A 1 149 ? 34.337  12.605  14.753  1.00 53.89 ? 143 GLN A CG  1 
ATOM   875  C CD  . GLN A 1 149 ? 35.645  13.258  14.379  1.00 52.46 ? 143 GLN A CD  1 
ATOM   876  O OE1 . GLN A 1 149 ? 36.155  13.033  13.287  1.00 51.96 ? 143 GLN A OE1 1 
ATOM   877  N NE2 . GLN A 1 149 ? 36.191  14.078  15.275  1.00 51.90 ? 143 GLN A NE2 1 
ATOM   878  N N   . CYS A 1 150 ? 31.039  10.645  12.923  1.00 55.98 ? 144 CYS A N   1 
ATOM   879  C CA  . CYS A 1 150 ? 29.671  11.095  12.696  1.00 56.68 ? 144 CYS A CA  1 
ATOM   880  C C   . CYS A 1 150 ? 28.592  10.091  13.099  1.00 56.88 ? 144 CYS A C   1 
ATOM   881  O O   . CYS A 1 150 ? 27.486  10.483  13.466  1.00 56.83 ? 144 CYS A O   1 
ATOM   882  C CB  . CYS A 1 150 ? 29.502  11.524  11.244  1.00 56.85 ? 144 CYS A CB  1 
ATOM   883  S SG  . CYS A 1 150 ? 30.016  13.214  10.952  1.00 57.08 ? 144 CYS A SG  1 
ATOM   884  N N   . ALA A 1 151 ? 28.905  8.803   13.050  1.00 57.52 ? 145 ALA A N   1 
ATOM   885  C CA  . ALA A 1 151 ? 27.952  7.798   13.519  1.00 58.14 ? 145 ALA A CA  1 
ATOM   886  C C   . ALA A 1 151 ? 27.375  8.201   14.882  1.00 58.56 ? 145 ALA A C   1 
ATOM   887  O O   . ALA A 1 151 ? 26.213  7.931   15.187  1.00 58.17 ? 145 ALA A O   1 
ATOM   888  C CB  . ALA A 1 151 ? 28.609  6.432   13.593  1.00 58.39 ? 145 ALA A CB  1 
ATOM   889  N N   . ARG A 1 152 ? 28.208  8.860   15.686  1.00 59.37 ? 146 ARG A N   1 
ATOM   890  C CA  . ARG A 1 152 ? 27.830  9.389   17.004  1.00 59.84 ? 146 ARG A CA  1 
ATOM   891  C C   . ARG A 1 152 ? 26.425  9.998   17.008  1.00 58.82 ? 146 ARG A C   1 
ATOM   892  O O   . ARG A 1 152 ? 25.518  9.433   17.593  1.00 59.11 ? 146 ARG A O   1 
ATOM   893  C CB  . ARG A 1 152 ? 28.878  10.413  17.471  1.00 60.68 ? 146 ARG A CB  1 
ATOM   894  C CG  . ARG A 1 152 ? 29.429  10.177  18.872  1.00 63.43 ? 146 ARG A CG  1 
ATOM   895  C CD  . ARG A 1 152 ? 30.602  9.186   18.934  1.00 68.04 ? 146 ARG A CD  1 
ATOM   896  N NE  . ARG A 1 152 ? 30.392  8.222   20.017  1.00 73.16 ? 146 ARG A NE  1 
ATOM   897  C CZ  . ARG A 1 152 ? 30.244  8.538   21.311  1.00 75.87 ? 146 ARG A CZ  1 
ATOM   898  N NH1 . ARG A 1 152 ? 30.290  9.810   21.713  1.00 75.51 ? 146 ARG A NH1 1 
ATOM   899  N NH2 . ARG A 1 152 ? 30.037  7.573   22.214  1.00 76.92 ? 146 ARG A NH2 1 
ATOM   900  N N   . GLY A 1 153 ? 26.230  11.116  16.317  1.00 58.33 ? 147 GLY A N   1 
ATOM   901  C CA  . GLY A 1 153 ? 24.931  11.818  16.336  1.00 57.51 ? 147 GLY A CA  1 
ATOM   902  C C   . GLY A 1 153 ? 24.090  11.689  15.076  1.00 57.14 ? 147 GLY A C   1 
ATOM   903  O O   . GLY A 1 153 ? 22.956  12.151  15.045  1.00 57.36 ? 147 GLY A O   1 
ATOM   904  N N   . PHE A 1 154 ? 24.643  11.072  14.033  1.00 56.67 ? 148 PHE A N   1 
ATOM   905  C CA  . PHE A 1 154 ? 23.890  10.777  12.814  1.00 56.38 ? 148 PHE A CA  1 
ATOM   906  C C   . PHE A 1 154 ? 23.393  9.332   12.713  1.00 55.55 ? 148 PHE A C   1 
ATOM   907  O O   . PHE A 1 154 ? 22.501  9.046   11.928  1.00 55.81 ? 148 PHE A O   1 
ATOM   908  C CB  . PHE A 1 154 ? 24.705  11.136  11.568  1.00 57.22 ? 148 PHE A CB  1 
ATOM   909  C CG  . PHE A 1 154 ? 24.677  12.600  11.223  1.00 58.77 ? 148 PHE A CG  1 
ATOM   910  C CD1 . PHE A 1 154 ? 25.404  13.530  11.976  1.00 61.71 ? 148 PHE A CD1 1 
ATOM   911  C CD2 . PHE A 1 154 ? 23.951  13.053  10.132  1.00 60.54 ? 148 PHE A CD2 1 
ATOM   912  C CE1 . PHE A 1 154 ? 25.387  14.906  11.656  1.00 62.20 ? 148 PHE A CE1 1 
ATOM   913  C CE2 . PHE A 1 154 ? 23.931  14.419  9.795   1.00 61.58 ? 148 PHE A CE2 1 
ATOM   914  C CZ  . PHE A 1 154 ? 24.640  15.345  10.562  1.00 60.83 ? 148 PHE A CZ  1 
ATOM   915  N N   . GLY A 1 155 ? 23.951  8.425   13.508  1.00 54.69 ? 149 GLY A N   1 
ATOM   916  C CA  . GLY A 1 155 ? 23.551  7.021   13.476  1.00 54.03 ? 149 GLY A CA  1 
ATOM   917  C C   . GLY A 1 155 ? 23.862  6.343   12.152  1.00 53.97 ? 149 GLY A C   1 
ATOM   918  O O   . GLY A 1 155 ? 24.793  6.706   11.442  1.00 53.91 ? 149 GLY A O   1 
ATOM   919  N N   . ASP A 1 156 ? 23.064  5.359   11.794  1.00 54.08 ? 150 ASP A N   1 
ATOM   920  C CA  . ASP A 1 156 ? 23.296  4.658   10.551  1.00 54.35 ? 150 ASP A CA  1 
ATOM   921  C C   . ASP A 1 156 ? 22.871  5.505   9.362   1.00 53.92 ? 150 ASP A C   1 
ATOM   922  O O   . ASP A 1 156 ? 23.207  5.190   8.194   1.00 54.17 ? 150 ASP A O   1 
ATOM   923  C CB  . ASP A 1 156 ? 22.562  3.322   10.566  1.00 55.09 ? 150 ASP A CB  1 
ATOM   924  C CG  . ASP A 1 156 ? 23.179  2.346   11.551  1.00 57.34 ? 150 ASP A CG  1 
ATOM   925  O OD1 . ASP A 1 156 ? 22.414  1.616   12.217  1.00 60.54 ? 150 ASP A OD1 1 
ATOM   926  O OD2 . ASP A 1 156 ? 24.431  2.319   11.672  1.00 59.01 ? 150 ASP A OD2 1 
ATOM   927  N N   . TRP A 1 157 ? 22.139  6.584   9.655   1.00 52.44 ? 151 TRP A N   1 
ATOM   928  C CA  . TRP A 1 157 ? 21.804  7.552   8.628   1.00 50.81 ? 151 TRP A CA  1 
ATOM   929  C C   . TRP A 1 157 ? 23.061  7.811   7.811   1.00 50.98 ? 151 TRP A C   1 
ATOM   930  O O   . TRP A 1 157 ? 23.069  7.522   6.615   1.00 51.28 ? 151 TRP A O   1 
ATOM   931  C CB  . TRP A 1 157 ? 21.253  8.829   9.248   1.00 49.33 ? 151 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 157 ? 20.716  9.832   8.280   1.00 47.87 ? 151 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 157 ? 20.346  9.610   6.997   1.00 46.50 ? 151 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 157 ? 20.434  11.215  8.546   1.00 47.15 ? 151 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 157 ? 19.862  10.763  6.438   1.00 45.54 ? 151 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 157 ? 19.909  11.767  7.360   1.00 44.78 ? 151 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 157 ? 20.567  12.039  9.677   1.00 46.18 ? 151 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 157 ? 19.521  13.106  7.256   1.00 45.44 ? 151 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 157 ? 20.172  13.374  9.578   1.00 46.69 ? 151 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 157 ? 19.656  13.895  8.367   1.00 46.36 ? 151 TRP A CH2 1 
ATOM   941  N N   . ILE A 1 158 ? 24.135  8.263   8.477   1.00 51.13 ? 152 ILE A N   1 
ATOM   942  C CA  . ILE A 1 158 ? 25.380  8.702   7.812   1.00 51.05 ? 152 ILE A CA  1 
ATOM   943  C C   . ILE A 1 158 ? 25.912  7.737   6.752   1.00 51.26 ? 152 ILE A C   1 
ATOM   944  O O   . ILE A 1 158 ? 26.426  8.184   5.713   1.00 51.24 ? 152 ILE A O   1 
ATOM   945  C CB  . ILE A 1 158 ? 26.522  9.060   8.828   1.00 51.41 ? 152 ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 158 ? 27.461  10.114  8.235   1.00 50.88 ? 152 ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 158 ? 27.294  7.831   9.296   1.00 50.17 ? 152 ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 158 ? 26.870  11.540  8.282   1.00 52.09 ? 152 ILE A CD1 1 
ATOM   949  N N   . ASP A 1 159 ? 25.783  6.432   7.014   1.00 50.70 ? 153 ASP A N   1 
ATOM   950  C CA  . ASP A 1 159 ? 26.186  5.414   6.048   1.00 50.83 ? 153 ASP A CA  1 
ATOM   951  C C   . ASP A 1 159 ? 25.357  5.538   4.755   1.00 50.41 ? 153 ASP A C   1 
ATOM   952  O O   . ASP A 1 159 ? 25.896  5.477   3.655   1.00 50.03 ? 153 ASP A O   1 
ATOM   953  C CB  . ASP A 1 159 ? 26.127  3.983   6.658   1.00 50.73 ? 153 ASP A CB  1 
ATOM   954  C CG  . ASP A 1 159 ? 27.193  3.757   7.799   1.00 52.29 ? 153 ASP A CG  1 
ATOM   955  O OD1 . ASP A 1 159 ? 28.378  4.183   7.666   1.00 52.99 ? 153 ASP A OD1 1 
ATOM   956  O OD2 . ASP A 1 159 ? 26.848  3.154   8.846   1.00 51.01 ? 153 ASP A OD2 1 
ATOM   957  N N   . SER A 1 160 ? 24.054  5.757   4.884   1.00 50.17 ? 154 SER A N   1 
ATOM   958  C CA  . SER A 1 160 ? 23.204  5.765   3.708   1.00 50.19 ? 154 SER A CA  1 
ATOM   959  C C   . SER A 1 160 ? 23.476  7.026   2.939   1.00 50.04 ? 154 SER A C   1 
ATOM   960  O O   . SER A 1 160 ? 23.411  7.028   1.713   1.00 50.73 ? 154 SER A O   1 
ATOM   961  C CB  . SER A 1 160 ? 21.713  5.678   4.058   1.00 50.59 ? 154 SER A CB  1 
ATOM   962  O OG  . SER A 1 160 ? 21.492  5.316   5.403   1.00 51.40 ? 154 SER A OG  1 
ATOM   963  N N   . ILE A 1 161 ? 23.781  8.097   3.666   1.00 49.40 ? 155 ILE A N   1 
ATOM   964  C CA  . ILE A 1 161 ? 24.293  9.322   3.066   1.00 48.94 ? 155 ILE A CA  1 
ATOM   965  C C   . ILE A 1 161 ? 25.609  9.139   2.314   1.00 48.78 ? 155 ILE A C   1 
ATOM   966  O O   . ILE A 1 161 ? 25.752  9.631   1.205   1.00 48.75 ? 155 ILE A O   1 
ATOM   967  C CB  . ILE A 1 161 ? 24.443  10.408  4.105   1.00 48.97 ? 155 ILE A CB  1 
ATOM   968  C CG1 . ILE A 1 161 ? 23.054  10.863  4.550   1.00 47.85 ? 155 ILE A CG1 1 
ATOM   969  C CG2 . ILE A 1 161 ? 25.254  11.586  3.527   1.00 50.08 ? 155 ILE A CG2 1 
ATOM   970  C CD1 . ILE A 1 161 ? 23.066  11.762  5.716   1.00 47.89 ? 155 ILE A CD1 1 
ATOM   971  N N   . LEU A 1 162 ? 26.575  8.433   2.901   1.00 49.25 ? 156 LEU A N   1 
ATOM   972  C CA  . LEU A 1 162 ? 27.805  8.104   2.150   1.00 49.18 ? 156 LEU A CA  1 
ATOM   973  C C   . LEU A 1 162 ? 27.555  7.165   0.990   1.00 49.43 ? 156 LEU A C   1 
ATOM   974  O O   . LEU A 1 162 ? 28.085  7.384   -0.088  1.00 49.86 ? 156 LEU A O   1 
ATOM   975  C CB  . LEU A 1 162 ? 28.931  7.590   3.040   1.00 48.71 ? 156 LEU A CB  1 
ATOM   976  C CG  . LEU A 1 162 ? 29.645  8.658   3.867   1.00 48.34 ? 156 LEU A CG  1 
ATOM   977  C CD1 . LEU A 1 162 ? 30.346  8.030   5.027   1.00 47.72 ? 156 LEU A CD1 1 
ATOM   978  C CD2 . LEU A 1 162 ? 30.635  9.432   3.041   1.00 48.86 ? 156 LEU A CD2 1 
ATOM   979  N N   . ALA A 1 163 ? 26.737  6.136   1.193   1.00 49.94 ? 157 ALA A N   1 
ATOM   980  C CA  . ALA A 1 163 ? 26.394  5.233   0.098   1.00 50.43 ? 157 ALA A CA  1 
ATOM   981  C C   . ALA A 1 163 ? 25.853  6.074   -1.045  1.00 50.86 ? 157 ALA A C   1 
ATOM   982  O O   . ALA A 1 163 ? 26.344  5.993   -2.169  1.00 51.06 ? 157 ALA A O   1 
ATOM   983  C CB  . ALA A 1 163 ? 25.380  4.172   0.536   1.00 50.29 ? 157 ALA A CB  1 
ATOM   984  N N   . PHE A 1 164 ? 24.871  6.917   -0.737  1.00 51.32 ? 158 PHE A N   1 
ATOM   985  C CA  . PHE A 1 164 ? 24.279  7.794   -1.734  1.00 51.94 ? 158 PHE A CA  1 
ATOM   986  C C   . PHE A 1 164 ? 25.318  8.703   -2.360  1.00 52.86 ? 158 PHE A C   1 
ATOM   987  O O   . PHE A 1 164 ? 25.289  8.938   -3.561  1.00 53.45 ? 158 PHE A O   1 
ATOM   988  C CB  . PHE A 1 164 ? 23.199  8.665   -1.115  1.00 51.42 ? 158 PHE A CB  1 
ATOM   989  C CG  . PHE A 1 164 ? 22.659  9.694   -2.051  1.00 49.66 ? 158 PHE A CG  1 
ATOM   990  C CD1 . PHE A 1 164 ? 21.802  9.324   -3.085  1.00 47.29 ? 158 PHE A CD1 1 
ATOM   991  C CD2 . PHE A 1 164 ? 23.013  11.023  -1.905  1.00 47.92 ? 158 PHE A CD2 1 
ATOM   992  C CE1 . PHE A 1 164 ? 21.307  10.255  -3.943  1.00 47.06 ? 158 PHE A CE1 1 
ATOM   993  C CE2 . PHE A 1 164 ? 22.515  11.972  -2.761  1.00 47.69 ? 158 PHE A CE2 1 
ATOM   994  C CZ  . PHE A 1 164 ? 21.661  11.595  -3.784  1.00 48.54 ? 158 PHE A CZ  1 
ATOM   995  N N   . SER A 1 165 ? 26.222  9.224   -1.534  1.00 53.60 ? 159 SER A N   1 
ATOM   996  C CA  . SER A 1 165 ? 27.330  10.047  -2.014  1.00 54.05 ? 159 SER A CA  1 
ATOM   997  C C   . SER A 1 165 ? 28.252  9.267   -2.961  1.00 54.25 ? 159 SER A C   1 
ATOM   998  O O   . SER A 1 165 ? 28.759  9.826   -3.918  1.00 54.59 ? 159 SER A O   1 
ATOM   999  C CB  . SER A 1 165 ? 28.119  10.628  -0.831  1.00 53.72 ? 159 SER A CB  1 
ATOM   1000 O OG  . SER A 1 165 ? 29.246  11.334  -1.303  1.00 53.27 ? 159 SER A OG  1 
ATOM   1001 N N   . ARG A 1 166 ? 28.459  7.982   -2.691  1.00 54.65 ? 160 ARG A N   1 
ATOM   1002 C CA  . ARG A 1 166 ? 29.209  7.103   -3.598  1.00 55.47 ? 160 ARG A CA  1 
ATOM   1003 C C   . ARG A 1 166 ? 28.463  6.956   -4.919  1.00 55.42 ? 160 ARG A C   1 
ATOM   1004 O O   . ARG A 1 166 ? 29.076  6.908   -5.997  1.00 55.66 ? 160 ARG A O   1 
ATOM   1005 C CB  . ARG A 1 166 ? 29.395  5.728   -2.961  1.00 55.86 ? 160 ARG A CB  1 
ATOM   1006 C CG  . ARG A 1 166 ? 30.206  4.714   -3.751  1.00 56.76 ? 160 ARG A CG  1 
ATOM   1007 C CD  . ARG A 1 166 ? 30.725  3.635   -2.814  1.00 58.96 ? 160 ARG A CD  1 
ATOM   1008 N NE  . ARG A 1 166 ? 31.425  4.220   -1.661  1.00 61.25 ? 160 ARG A NE  1 
ATOM   1009 C CZ  . ARG A 1 166 ? 30.900  4.405   -0.445  1.00 61.69 ? 160 ARG A CZ  1 
ATOM   1010 N NH1 . ARG A 1 166 ? 29.649  4.048   -0.156  1.00 59.36 ? 160 ARG A NH1 1 
ATOM   1011 N NH2 . ARG A 1 166 ? 31.651  4.949   0.503   1.00 63.95 ? 160 ARG A NH2 1 
ATOM   1012 N N   . SER A 1 167 ? 27.138  6.882   -4.812  1.00 55.03 ? 161 SER A N   1 
ATOM   1013 C CA  . SER A 1 167 ? 26.235  6.930   -5.951  1.00 54.94 ? 161 SER A CA  1 
ATOM   1014 C C   . SER A 1 167 ? 26.496  8.168   -6.847  1.00 55.13 ? 161 SER A C   1 
ATOM   1015 O O   . SER A 1 167 ? 26.838  8.022   -8.033  1.00 54.42 ? 161 SER A O   1 
ATOM   1016 C CB  . SER A 1 167 ? 24.799  6.922   -5.428  1.00 54.73 ? 161 SER A CB  1 
ATOM   1017 O OG  . SER A 1 167 ? 23.903  6.543   -6.441  1.00 55.52 ? 161 SER A OG  1 
ATOM   1018 N N   . LEU A 1 168 ? 26.360  9.368   -6.259  1.00 55.40 ? 162 LEU A N   1 
ATOM   1019 C CA  . LEU A 1 168 ? 26.570  10.639  -6.957  1.00 55.87 ? 162 LEU A CA  1 
ATOM   1020 C C   . LEU A 1 168 ? 27.881  10.748  -7.704  1.00 56.38 ? 162 LEU A C   1 
ATOM   1021 O O   . LEU A 1 168 ? 27.887  11.107  -8.885  1.00 56.18 ? 162 LEU A O   1 
ATOM   1022 C CB  . LEU A 1 168 ? 26.538  11.796  -5.985  1.00 56.04 ? 162 LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 168 ? 25.249  12.592  -5.867  1.00 56.51 ? 162 LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 168 ? 25.518  13.689  -4.838  1.00 55.39 ? 162 LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 168 ? 24.727  13.129  -7.228  1.00 53.97 ? 162 LEU A CD2 1 
ATOM   1026 N N   . HIS A 1 169 ? 28.989  10.473  -7.013  1.00 56.80 ? 163 HIS A N   1 
ATOM   1027 C CA  . HIS A 1 169 ? 30.308  10.605  -7.625  1.00 57.54 ? 163 HIS A CA  1 
ATOM   1028 C C   . HIS A 1 169 ? 30.529  9.660   -8.821  1.00 57.36 ? 163 HIS A C   1 
ATOM   1029 O O   . HIS A 1 169 ? 31.161  10.050  -9.822  1.00 57.68 ? 163 HIS A O   1 
ATOM   1030 C CB  . HIS A 1 169 ? 31.428  10.523  -6.586  1.00 57.74 ? 163 HIS A CB  1 
ATOM   1031 C CG  . HIS A 1 169 ? 31.344  11.589  -5.532  1.00 60.45 ? 163 HIS A CG  1 
ATOM   1032 N ND1 . HIS A 1 169 ? 31.037  12.904  -5.823  1.00 63.27 ? 163 HIS A ND1 1 
ATOM   1033 C CD2 . HIS A 1 169 ? 31.521  11.533  -4.188  1.00 61.88 ? 163 HIS A CD2 1 
ATOM   1034 C CE1 . HIS A 1 169 ? 31.022  13.609  -4.703  1.00 63.07 ? 163 HIS A CE1 1 
ATOM   1035 N NE2 . HIS A 1 169 ? 31.317  12.802  -3.698  1.00 63.12 ? 163 HIS A NE2 1 
ATOM   1036 N N   . SER A 1 170 ? 29.976  8.449   -8.749  1.00 56.76 ? 164 SER A N   1 
ATOM   1037 C CA  . SER A 1 170 ? 30.116  7.489   -9.852  1.00 56.31 ? 164 SER A CA  1 
ATOM   1038 C C   . SER A 1 170 ? 29.363  7.943   -11.099 1.00 55.66 ? 164 SER A C   1 
ATOM   1039 O O   . SER A 1 170 ? 29.571  7.419   -12.194 1.00 55.51 ? 164 SER A O   1 
ATOM   1040 C CB  . SER A 1 170 ? 29.644  6.100   -9.427  1.00 56.52 ? 164 SER A CB  1 
ATOM   1041 O OG  . SER A 1 170 ? 30.416  5.633   -8.332  1.00 57.27 ? 164 SER A OG  1 
ATOM   1042 N N   . LEU A 1 171 ? 28.486  8.927   -10.916 1.00 54.95 ? 165 LEU A N   1 
ATOM   1043 C CA  . LEU A 1 171 ? 27.706  9.496   -12.009 1.00 53.55 ? 165 LEU A CA  1 
ATOM   1044 C C   . LEU A 1 171 ? 28.492  10.642  -12.645 1.00 52.86 ? 165 LEU A C   1 
ATOM   1045 O O   . LEU A 1 171 ? 28.232  11.024  -13.778 1.00 52.80 ? 165 LEU A O   1 
ATOM   1046 C CB  . LEU A 1 171 ? 26.330  9.943   -11.493 1.00 53.51 ? 165 LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 171 ? 25.069  9.522   -12.264 1.00 53.50 ? 165 LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 171 ? 25.196  8.136   -12.893 1.00 53.55 ? 165 LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 171 ? 23.837  9.577   -11.376 1.00 52.82 ? 165 LEU A CD2 1 
ATOM   1050 N N   . LEU A 1 172 ? 29.483  11.149  -11.912 1.00 52.24 ? 166 LEU A N   1 
ATOM   1051 C CA  . LEU A 1 172 ? 30.371  12.221  -12.376 1.00 51.54 ? 166 LEU A CA  1 
ATOM   1052 C C   . LEU A 1 172 ? 29.600  13.455  -12.806 1.00 50.74 ? 166 LEU A C   1 
ATOM   1053 O O   . LEU A 1 172 ? 29.889  14.046  -13.839 1.00 51.01 ? 166 LEU A O   1 
ATOM   1054 C CB  . LEU A 1 172 ? 31.291  11.731  -13.513 1.00 52.05 ? 166 LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 172 ? 32.515  10.850  -13.177 1.00 52.79 ? 166 LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 172 ? 33.487  10.758  -14.358 1.00 51.71 ? 166 LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 172 ? 33.244  11.370  -11.923 1.00 54.13 ? 166 LEU A CD2 1 
ATOM   1058 N N   . VAL A 1 173 ? 28.604  13.830  -12.009 1.00 49.79 ? 167 VAL A N   1 
ATOM   1059 C CA  . VAL A 1 173 ? 27.821  15.031  -12.252 1.00 48.13 ? 167 VAL A CA  1 
ATOM   1060 C C   . VAL A 1 173 ? 28.715  16.232  -12.195 1.00 46.90 ? 167 VAL A C   1 
ATOM   1061 O O   . VAL A 1 173 ? 29.347  16.484  -11.188 1.00 45.79 ? 167 VAL A O   1 
ATOM   1062 C CB  . VAL A 1 173 ? 26.743  15.254  -11.194 1.00 48.42 ? 167 VAL A CB  1 
ATOM   1063 C CG1 . VAL A 1 173 ? 25.758  16.375  -11.677 1.00 48.68 ? 167 VAL A CG1 1 
ATOM   1064 C CG2 . VAL A 1 173 ? 26.015  13.966  -10.899 1.00 47.94 ? 167 VAL A CG2 1 
ATOM   1065 N N   . ASP A 1 174 ? 28.760  16.978  -13.283 1.00 46.38 ? 168 ASP A N   1 
ATOM   1066 C CA  . ASP A 1 174 ? 29.593  18.155  -13.293 1.00 46.65 ? 168 ASP A CA  1 
ATOM   1067 C C   . ASP A 1 174 ? 28.943  19.297  -12.489 1.00 45.90 ? 168 ASP A C   1 
ATOM   1068 O O   . ASP A 1 174 ? 27.780  19.203  -12.089 1.00 46.12 ? 168 ASP A O   1 
ATOM   1069 C CB  . ASP A 1 174 ? 29.998  18.554  -14.723 1.00 47.01 ? 168 ASP A CB  1 
ATOM   1070 C CG  . ASP A 1 174 ? 28.822  18.930  -15.589 1.00 48.82 ? 168 ASP A CG  1 
ATOM   1071 O OD1 . ASP A 1 174 ? 27.991  19.766  -15.146 1.00 51.51 ? 168 ASP A OD1 1 
ATOM   1072 O OD2 . ASP A 1 174 ? 28.755  18.410  -16.728 1.00 51.08 ? 168 ASP A OD2 1 
ATOM   1073 N N   . VAL A 1 175 ? 29.712  20.348  -12.241 1.00 44.74 ? 169 VAL A N   1 
ATOM   1074 C CA  . VAL A 1 175 ? 29.249  21.454  -11.430 1.00 43.96 ? 169 VAL A CA  1 
ATOM   1075 C C   . VAL A 1 175 ? 28.024  22.177  -12.007 1.00 43.60 ? 169 VAL A C   1 
ATOM   1076 O O   . VAL A 1 175 ? 27.007  22.296  -11.327 1.00 42.93 ? 169 VAL A O   1 
ATOM   1077 C CB  . VAL A 1 175 ? 30.399  22.431  -11.076 1.00 43.86 ? 169 VAL A CB  1 
ATOM   1078 C CG1 . VAL A 1 175 ? 29.862  23.775  -10.586 1.00 42.68 ? 169 VAL A CG1 1 
ATOM   1079 C CG2 . VAL A 1 175 ? 31.300  21.796  -10.037 1.00 43.32 ? 169 VAL A CG2 1 
ATOM   1080 N N   . PRO A 1 176 ? 28.099  22.651  -13.260 1.00 43.42 ? 170 PRO A N   1 
ATOM   1081 C CA  . PRO A 1 176 ? 26.883  23.334  -13.728 1.00 42.86 ? 170 PRO A CA  1 
ATOM   1082 C C   . PRO A 1 176 ? 25.618  22.478  -13.518 1.00 42.87 ? 170 PRO A C   1 
ATOM   1083 O O   . PRO A 1 176 ? 24.629  22.981  -12.960 1.00 42.65 ? 170 PRO A O   1 
ATOM   1084 C CB  . PRO A 1 176 ? 27.165  23.564  -15.205 1.00 42.91 ? 170 PRO A CB  1 
ATOM   1085 C CG  . PRO A 1 176 ? 28.683  23.602  -15.307 1.00 42.57 ? 170 PRO A CG  1 
ATOM   1086 C CD  . PRO A 1 176 ? 29.173  22.644  -14.273 1.00 43.17 ? 170 PRO A CD  1 
ATOM   1087 N N   . ALA A 1 177 ? 25.668  21.185  -13.899 1.00 42.40 ? 171 ALA A N   1 
ATOM   1088 C CA  . ALA A 1 177 ? 24.493  20.305  -13.782 1.00 40.82 ? 171 ALA A CA  1 
ATOM   1089 C C   . ALA A 1 177 ? 24.072  20.187  -12.313 1.00 40.55 ? 171 ALA A C   1 
ATOM   1090 O O   . ALA A 1 177 ? 22.890  20.335  -11.976 1.00 40.80 ? 171 ALA A O   1 
ATOM   1091 C CB  . ALA A 1 177 ? 24.745  18.969  -14.409 1.00 40.13 ? 171 ALA A CB  1 
ATOM   1092 N N   . PHE A 1 178 ? 25.035  19.995  -11.418 1.00 39.57 ? 172 PHE A N   1 
ATOM   1093 C CA  . PHE A 1 178 ? 24.682  19.947  -10.023 1.00 38.08 ? 172 PHE A CA  1 
ATOM   1094 C C   . PHE A 1 178 ? 24.023  21.230  -9.557  1.00 37.90 ? 172 PHE A C   1 
ATOM   1095 O O   . PHE A 1 178 ? 23.179  21.193  -8.668  1.00 37.68 ? 172 PHE A O   1 
ATOM   1096 C CB  . PHE A 1 178 ? 25.875  19.630  -9.130  1.00 38.23 ? 172 PHE A CB  1 
ATOM   1097 C CG  . PHE A 1 178 ? 25.491  19.452  -7.689  1.00 36.67 ? 172 PHE A CG  1 
ATOM   1098 C CD1 . PHE A 1 178 ? 25.100  18.208  -7.217  1.00 36.74 ? 172 PHE A CD1 1 
ATOM   1099 C CD2 . PHE A 1 178 ? 25.467  20.527  -6.838  1.00 35.56 ? 172 PHE A CD2 1 
ATOM   1100 C CE1 . PHE A 1 178 ? 24.702  18.043  -5.937  1.00 36.97 ? 172 PHE A CE1 1 
ATOM   1101 C CE2 . PHE A 1 178 ? 25.075  20.388  -5.545  1.00 36.25 ? 172 PHE A CE2 1 
ATOM   1102 C CZ  . PHE A 1 178 ? 24.694  19.150  -5.084  1.00 38.85 ? 172 PHE A CZ  1 
ATOM   1103 N N   . ALA A 1 179 ? 24.402  22.373  -10.139 1.00 37.97 ? 173 ALA A N   1 
ATOM   1104 C CA  . ALA A 1 179 ? 23.872  23.676  -9.689  1.00 37.35 ? 173 ALA A CA  1 
ATOM   1105 C C   . ALA A 1 179 ? 22.424  23.853  -10.143 1.00 37.89 ? 173 ALA A C   1 
ATOM   1106 O O   . ALA A 1 179 ? 21.654  24.550  -9.479  1.00 37.98 ? 173 ALA A O   1 
ATOM   1107 C CB  . ALA A 1 179 ? 24.710  24.789  -10.163 1.00 37.01 ? 173 ALA A CB  1 
ATOM   1108 N N   . CYS A 1 180 ? 22.055  23.190  -11.248 1.00 37.93 ? 174 CYS A N   1 
ATOM   1109 C CA  . CYS A 1 180 ? 20.672  23.094  -11.695 1.00 38.26 ? 174 CYS A CA  1 
ATOM   1110 C C   . CYS A 1 180 ? 19.893  22.065  -10.865 1.00 37.81 ? 174 CYS A C   1 
ATOM   1111 O O   . CYS A 1 180 ? 18.771  22.309  -10.375 1.00 37.99 ? 174 CYS A O   1 
ATOM   1112 C CB  . CYS A 1 180 ? 20.641  22.739  -13.177 1.00 38.16 ? 174 CYS A CB  1 
ATOM   1113 S SG  . CYS A 1 180 ? 21.316  24.072  -14.261 1.00 44.30 ? 174 CYS A SG  1 
ATOM   1114 N N   . LEU A 1 181 ? 20.505  20.912  -10.684 1.00 37.53 ? 175 LEU A N   1 
ATOM   1115 C CA  . LEU A 1 181 ? 19.891  19.838  -9.932  1.00 37.17 ? 175 LEU A CA  1 
ATOM   1116 C C   . LEU A 1 181 ? 19.460  20.309  -8.552  1.00 36.85 ? 175 LEU A C   1 
ATOM   1117 O O   . LEU A 1 181 ? 18.308  20.156  -8.173  1.00 37.66 ? 175 LEU A O   1 
ATOM   1118 C CB  . LEU A 1 181 ? 20.874  18.690  -9.822  1.00 36.87 ? 175 LEU A CB  1 
ATOM   1119 C CG  . LEU A 1 181 ? 20.304  17.301  -9.801  1.00 38.03 ? 175 LEU A CG  1 
ATOM   1120 C CD1 . LEU A 1 181 ? 20.071  16.850  -8.375  1.00 39.94 ? 175 LEU A CD1 1 
ATOM   1121 C CD2 . LEU A 1 181 ? 19.050  17.255  -10.634 1.00 37.76 ? 175 LEU A CD2 1 
ATOM   1122 N N   . SER A 1 182 ? 20.359  20.923  -7.804  1.00 36.45 ? 176 SER A N   1 
ATOM   1123 C CA  . SER A 1 182 ? 19.978  21.414  -6.474  1.00 36.86 ? 176 SER A CA  1 
ATOM   1124 C C   . SER A 1 182 ? 18.939  22.573  -6.502  1.00 36.52 ? 176 SER A C   1 
ATOM   1125 O O   . SER A 1 182 ? 18.099  22.655  -5.626  1.00 36.77 ? 176 SER A O   1 
ATOM   1126 C CB  . SER A 1 182 ? 21.212  21.816  -5.693  1.00 36.36 ? 176 SER A CB  1 
ATOM   1127 O OG  . SER A 1 182 ? 22.065  22.519  -6.566  1.00 37.21 ? 176 SER A OG  1 
ATOM   1128 N N   . ALA A 1 183 ? 18.986  23.431  -7.515  1.00 35.63 ? 177 ALA A N   1 
ATOM   1129 C CA  . ALA A 1 183 ? 17.988  24.462  -7.663  1.00 35.27 ? 177 ALA A CA  1 
ATOM   1130 C C   . ALA A 1 183 ? 16.607  23.862  -7.857  1.00 34.93 ? 177 ALA A C   1 
ATOM   1131 O O   . ALA A 1 183 ? 15.606  24.366  -7.302  1.00 34.09 ? 177 ALA A O   1 
ATOM   1132 C CB  . ALA A 1 183 ? 18.327  25.335  -8.836  1.00 36.22 ? 177 ALA A CB  1 
ATOM   1133 N N   . LEU A 1 184 ? 16.556  22.812  -8.678  1.00 34.39 ? 178 LEU A N   1 
ATOM   1134 C CA  . LEU A 1 184 ? 15.316  22.066  -8.875  1.00 34.14 ? 178 LEU A CA  1 
ATOM   1135 C C   . LEU A 1 184 ? 14.789  21.432  -7.577  1.00 33.97 ? 178 LEU A C   1 
ATOM   1136 O O   . LEU A 1 184 ? 13.588  21.446  -7.314  1.00 34.60 ? 178 LEU A O   1 
ATOM   1137 C CB  . LEU A 1 184 ? 15.459  21.036  -9.994  1.00 34.36 ? 178 LEU A CB  1 
ATOM   1138 C CG  . LEU A 1 184 ? 15.492  21.575  -11.439 1.00 33.22 ? 178 LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1 184 ? 16.068  20.545  -12.371 1.00 31.55 ? 178 LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1 184 ? 14.126  21.917  -11.930 1.00 32.40 ? 178 LEU A CD2 1 
ATOM   1141 N N   . VAL A 1 185 ? 15.665  20.927  -6.724  1.00 33.45 ? 179 VAL A N   1 
ATOM   1142 C CA  . VAL A 1 185 ? 15.160  20.401  -5.463  1.00 32.97 ? 179 VAL A CA  1 
ATOM   1143 C C   . VAL A 1 185 ? 14.485  21.490  -4.650  1.00 33.54 ? 179 VAL A C   1 
ATOM   1144 O O   . VAL A 1 185 ? 13.589  21.200  -3.876  1.00 33.95 ? 179 VAL A O   1 
ATOM   1145 C CB  . VAL A 1 185 ? 16.245  19.692  -4.669  1.00 32.47 ? 179 VAL A CB  1 
ATOM   1146 C CG1 . VAL A 1 185 ? 15.859  19.532  -3.239  1.00 31.04 ? 179 VAL A CG1 1 
ATOM   1147 C CG2 . VAL A 1 185 ? 16.470  18.340  -5.277  1.00 33.25 ? 179 VAL A CG2 1 
ATOM   1148 N N   . LEU A 1 186 ? 14.909  22.741  -4.830  1.00 33.61 ? 180 LEU A N   1 
ATOM   1149 C CA  . LEU A 1 186 ? 14.316  23.832  -4.098  1.00 33.71 ? 180 LEU A CA  1 
ATOM   1150 C C   . LEU A 1 186 ? 13.069  24.332  -4.778  1.00 35.32 ? 180 LEU A C   1 
ATOM   1151 O O   . LEU A 1 186 ? 12.031  24.448  -4.147  1.00 35.38 ? 180 LEU A O   1 
ATOM   1152 C CB  . LEU A 1 186 ? 15.270  25.005  -3.965  1.00 33.57 ? 180 LEU A CB  1 
ATOM   1153 C CG  . LEU A 1 186 ? 14.678  26.277  -3.335  1.00 31.73 ? 180 LEU A CG  1 
ATOM   1154 C CD1 . LEU A 1 186 ? 14.298  26.010  -1.892  1.00 27.71 ? 180 LEU A CD1 1 
ATOM   1155 C CD2 . LEU A 1 186 ? 15.650  27.487  -3.462  1.00 32.13 ? 180 LEU A CD2 1 
ATOM   1156 N N   . ILE A 1 187 ? 13.195  24.683  -6.057  1.00 36.86 ? 181 ILE A N   1 
ATOM   1157 C CA  . ILE A 1 187 ? 12.116  25.333  -6.788  1.00 37.29 ? 181 ILE A CA  1 
ATOM   1158 C C   . ILE A 1 187 ? 11.272  24.229  -7.427  1.00 39.17 ? 181 ILE A C   1 
ATOM   1159 O O   . ILE A 1 187 ? 11.544  23.705  -8.532  1.00 39.20 ? 181 ILE A O   1 
ATOM   1160 C CB  . ILE A 1 187 ? 12.671  26.398  -7.721  1.00 36.55 ? 181 ILE A CB  1 
ATOM   1161 C CG1 . ILE A 1 187 ? 13.294  27.481  -6.856  1.00 36.51 ? 181 ILE A CG1 1 
ATOM   1162 C CG2 . ILE A 1 187 ? 11.585  27.020  -8.579  1.00 34.85 ? 181 ILE A CG2 1 
ATOM   1163 C CD1 . ILE A 1 187 ? 14.399  28.220  -7.516  1.00 37.75 ? 181 ILE A CD1 1 
ATOM   1164 N N   . THR A 1 188 ? 10.260  23.847  -6.660  1.00 40.73 ? 182 THR A N   1 
ATOM   1165 C CA  . THR A 1 188 ? 9.452   22.677  -6.957  1.00 42.48 ? 182 THR A CA  1 
ATOM   1166 C C   . THR A 1 188 ? 8.072   22.848  -6.316  1.00 43.27 ? 182 THR A C   1 
ATOM   1167 O O   . THR A 1 188 ? 7.939   23.631  -5.375  1.00 44.14 ? 182 THR A O   1 
ATOM   1168 C CB  . THR A 1 188 ? 10.129  21.436  -6.417  1.00 42.26 ? 182 THR A CB  1 
ATOM   1169 O OG1 . THR A 1 188 ? 9.597   20.291  -7.088  1.00 43.83 ? 182 THR A OG1 1 
ATOM   1170 C CG2 . THR A 1 188 ? 9.922   21.322  -4.878  1.00 43.12 ? 182 THR A CG2 1 
ATOM   1171 N N   . ASP A 1 189 ? 7.058   22.140  -6.820  1.00 44.19 ? 183 ASP A N   1 
ATOM   1172 C CA  . ASP A 1 189 ? 5.682   22.304  -6.328  1.00 45.09 ? 183 ASP A CA  1 
ATOM   1173 C C   . ASP A 1 189 ? 5.503   21.813  -4.883  1.00 45.52 ? 183 ASP A C   1 
ATOM   1174 O O   . ASP A 1 189 ? 5.951   20.720  -4.511  1.00 44.71 ? 183 ASP A O   1 
ATOM   1175 C CB  . ASP A 1 189 ? 4.673   21.638  -7.266  1.00 45.27 ? 183 ASP A CB  1 
ATOM   1176 C CG  . ASP A 1 189 ? 3.223   22.053  -6.974  1.00 47.95 ? 183 ASP A CG  1 
ATOM   1177 O OD1 . ASP A 1 189 ? 2.995   23.016  -6.194  1.00 50.88 ? 183 ASP A OD1 1 
ATOM   1178 O OD2 . ASP A 1 189 ? 2.294   21.408  -7.526  1.00 50.20 ? 183 ASP A OD2 1 
ATOM   1179 N N   . ARG A 1 190 ? 4.871   22.660  -4.078  1.00 46.55 ? 184 ARG A N   1 
ATOM   1180 C CA  . ARG A 1 190 ? 4.663   22.393  -2.664  1.00 48.05 ? 184 ARG A CA  1 
ATOM   1181 C C   . ARG A 1 190 ? 3.195   22.630  -2.280  1.00 49.39 ? 184 ARG A C   1 
ATOM   1182 O O   . ARG A 1 190 ? 2.594   23.616  -2.689  1.00 49.85 ? 184 ARG A O   1 
ATOM   1183 C CB  . ARG A 1 190 ? 5.573   23.275  -1.810  1.00 47.13 ? 184 ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 190 ? 7.043   22.953  -1.903  1.00 47.01 ? 184 ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 190 ? 7.410   21.514  -1.505  1.00 47.02 ? 184 ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 190 ? 8.864   21.402  -1.319  1.00 47.24 ? 184 ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 190 ? 9.584   20.285  -1.437  1.00 46.62 ? 184 ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 190 ? 9.024   19.127  -1.744  1.00 45.93 ? 184 ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 190 ? 10.890  20.328  -1.250  1.00 47.04 ? 184 ARG A NH2 1 
ATOM   1190 N N   . HIS A 1 191 ? 2.625   21.741  -1.480  1.00 50.79 ? 185 HIS A N   1 
ATOM   1191 C CA  . HIS A 1 191 ? 1.242   21.899  -1.095  1.00 52.55 ? 185 HIS A CA  1 
ATOM   1192 C C   . HIS A 1 191 ? 1.071   23.054  -0.120  1.00 52.94 ? 185 HIS A C   1 
ATOM   1193 O O   . HIS A 1 191 ? 1.772   23.148  0.890   1.00 52.69 ? 185 HIS A O   1 
ATOM   1194 C CB  . HIS A 1 191 ? 0.665   20.575  -0.611  1.00 53.04 ? 185 HIS A CB  1 
ATOM   1195 C CG  . HIS A 1 191 ? 0.413   19.617  -1.736  1.00 56.89 ? 185 HIS A CG  1 
ATOM   1196 N ND1 . HIS A 1 191 ? -0.618  18.697  -1.725  1.00 60.04 ? 185 HIS A ND1 1 
ATOM   1197 C CD2 . HIS A 1 191 ? 1.033   19.475  -2.938  1.00 59.28 ? 185 HIS A CD2 1 
ATOM   1198 C CE1 . HIS A 1 191 ? -0.603  18.009  -2.855  1.00 61.11 ? 185 HIS A CE1 1 
ATOM   1199 N NE2 . HIS A 1 191 ? 0.389   18.461  -3.607  1.00 61.73 ? 185 HIS A NE2 1 
ATOM   1200 N N   . GLY A 1 192 ? 0.162   23.961  -0.489  1.00 53.43 ? 186 GLY A N   1 
ATOM   1201 C CA  . GLY A 1 192 ? -0.034  25.230  0.207   1.00 53.54 ? 186 GLY A CA  1 
ATOM   1202 C C   . GLY A 1 192 ? 0.875   26.337  -0.298  1.00 53.73 ? 186 GLY A C   1 
ATOM   1203 O O   . GLY A 1 192 ? 1.300   27.201  0.481   1.00 53.72 ? 186 GLY A O   1 
ATOM   1204 N N   . LEU A 1 193 ? 1.196   26.308  -1.593  1.00 53.64 ? 187 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 193 ? 1.979   27.385  -2.212  1.00 53.75 ? 187 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 193 ? 1.022   28.485  -2.526  1.00 53.95 ? 187 LEU A C   1 
ATOM   1207 O O   . LEU A 1 193 ? -0.012  28.217  -3.160  1.00 54.02 ? 187 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 193 ? 2.610   26.944  -3.536  1.00 53.77 ? 187 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 193 ? 3.968   26.253  -3.608  1.00 53.16 ? 187 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 193 ? 4.305   25.954  -5.054  1.00 51.37 ? 187 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 193 ? 5.010   27.140  -2.974  1.00 53.42 ? 187 LEU A CD2 1 
ATOM   1212 N N   . GLN A 1 194 ? 1.348   29.718  -2.120  1.00 53.81 ? 188 GLN A N   1 
ATOM   1213 C CA  . GLN A 1 194 ? 0.504   30.869  -2.497  1.00 53.23 ? 188 GLN A CA  1 
ATOM   1214 C C   . GLN A 1 194 ? 0.316   30.929  -4.007  1.00 52.84 ? 188 GLN A C   1 
ATOM   1215 O O   . GLN A 1 194 ? -0.799  31.134  -4.472  1.00 53.84 ? 188 GLN A O   1 
ATOM   1216 C CB  . GLN A 1 194 ? 1.058   32.208  -1.993  1.00 53.47 ? 188 GLN A CB  1 
ATOM   1217 C CG  . GLN A 1 194 ? 0.782   32.514  -0.508  1.00 53.60 ? 188 GLN A CG  1 
ATOM   1218 C CD  . GLN A 1 194 ? 1.111   33.943  -0.140  1.00 53.10 ? 188 GLN A CD  1 
ATOM   1219 O OE1 . GLN A 1 194 ? 2.158   34.217  0.428   1.00 53.75 ? 188 GLN A OE1 1 
ATOM   1220 N NE2 . GLN A 1 194 ? 0.222   34.865  -0.478  1.00 52.95 ? 188 GLN A NE2 1 
ATOM   1221 N N   . GLU A 1 195 ? 1.382   30.717  -4.775  1.00 51.95 ? 189 GLU A N   1 
ATOM   1222 C CA  . GLU A 1 195 ? 1.330   30.993  -6.207  1.00 51.18 ? 189 GLU A CA  1 
ATOM   1223 C C   . GLU A 1 195 ? 2.023   29.952  -7.051  1.00 49.75 ? 189 GLU A C   1 
ATOM   1224 O O   . GLU A 1 195 ? 3.084   30.222  -7.593  1.00 49.40 ? 189 GLU A O   1 
ATOM   1225 C CB  . GLU A 1 195 ? 1.994   32.338  -6.505  1.00 51.98 ? 189 GLU A CB  1 
ATOM   1226 C CG  . GLU A 1 195 ? 1.795   33.435  -5.464  1.00 53.33 ? 189 GLU A CG  1 
ATOM   1227 C CD  . GLU A 1 195 ? 2.095   34.785  -6.051  1.00 56.07 ? 189 GLU A CD  1 
ATOM   1228 O OE1 . GLU A 1 195 ? 3.289   35.094  -6.307  1.00 56.72 ? 189 GLU A OE1 1 
ATOM   1229 O OE2 . GLU A 1 195 ? 1.119   35.528  -6.288  1.00 59.14 ? 189 GLU A OE2 1 
ATOM   1230 N N   . PRO A 1 196 ? 1.395   28.790  -7.232  1.00 48.63 ? 190 PRO A N   1 
ATOM   1231 C CA  . PRO A 1 196 ? 2.119   27.662  -7.808  1.00 47.89 ? 190 PRO A CA  1 
ATOM   1232 C C   . PRO A 1 196 ? 2.583   27.912  -9.243  1.00 46.79 ? 190 PRO A C   1 
ATOM   1233 O O   . PRO A 1 196 ? 3.681   27.498  -9.620  1.00 47.39 ? 190 PRO A O   1 
ATOM   1234 C CB  . PRO A 1 196 ? 1.118   26.503  -7.719  1.00 48.01 ? 190 PRO A CB  1 
ATOM   1235 C CG  . PRO A 1 196 ? -0.213  27.138  -7.599  1.00 48.38 ? 190 PRO A CG  1 
ATOM   1236 C CD  . PRO A 1 196 ? -0.011  28.470  -6.938  1.00 48.89 ? 190 PRO A CD  1 
ATOM   1237 N N   . ARG A 1 197 ? 1.756   28.597  -10.014 1.00 45.34 ? 191 ARG A N   1 
ATOM   1238 C CA  . ARG A 1 197 ? 2.064   29.015  -11.391 1.00 43.59 ? 191 ARG A CA  1 
ATOM   1239 C C   . ARG A 1 197 ? 3.477   29.668  -11.512 1.00 44.13 ? 191 ARG A C   1 
ATOM   1240 O O   . ARG A 1 197 ? 4.292   29.160  -12.295 1.00 44.61 ? 191 ARG A O   1 
ATOM   1241 C CB  . ARG A 1 197 ? 0.943   29.949  -11.980 1.00 43.51 ? 191 ARG A CB  1 
ATOM   1242 C CG  . ARG A 1 197 ? -0.632  29.736  -11.540 1.00 36.26 ? 191 ARG A CG  1 
ATOM   1243 C CD  . ARG A 1 197 ? -0.992  29.909  -9.994  1.00 20.77 ? 191 ARG A CD  1 
ATOM   1244 N NE  . ARG A 1 197 ? -1.098  31.281  -9.622  1.00 6.33  ? 191 ARG A NE  1 
ATOM   1245 C CZ  . ARG A 1 197 ? -0.040  31.937  -9.483  1.00 8.49  ? 191 ARG A CZ  1 
ATOM   1246 N NH1 . ARG A 1 197 ? 0.091   33.225  -9.226  1.00 19.32 ? 191 ARG A NH1 1 
ATOM   1247 N NH2 . ARG A 1 197 ? 0.952   31.224  -9.639  1.00 17.89 ? 191 ARG A NH2 1 
ATOM   1248 N N   . ARG A 1 198 ? 3.807   30.731  -10.749 1.00 43.27 ? 192 ARG A N   1 
ATOM   1249 C CA  . ARG A 1 198 ? 5.164   31.334  -10.858 1.00 43.63 ? 192 ARG A CA  1 
ATOM   1250 C C   . ARG A 1 198 ? 6.273   30.311  -10.599 1.00 43.48 ? 192 ARG A C   1 
ATOM   1251 O O   . ARG A 1 198 ? 7.174   30.102  -11.437 1.00 43.16 ? 192 ARG A O   1 
ATOM   1252 C CB  . ARG A 1 198 ? 5.365   32.565  -9.964  1.00 43.38 ? 192 ARG A CB  1 
ATOM   1253 C CG  . ARG A 1 198 ? 4.637   33.826  -10.491 1.00 46.32 ? 192 ARG A CG  1 
ATOM   1254 C CD  . ARG A 1 198 ? 4.697   35.015  -9.539  1.00 44.74 ? 192 ARG A CD  1 
ATOM   1255 N NE  . ARG A 1 198 ? 6.028   35.605  -9.533  1.00 47.26 ? 192 ARG A NE  1 
ATOM   1256 C CZ  . ARG A 1 198 ? 6.540   36.307  -8.522  1.00 48.47 ? 192 ARG A CZ  1 
ATOM   1257 N NH1 . ARG A 1 198 ? 7.775   36.820  -8.618  1.00 47.74 ? 192 ARG A NH1 1 
ATOM   1258 N NH2 . ARG A 1 198 ? 5.818   36.491  -7.416  1.00 48.48 ? 192 ARG A NH2 1 
ATOM   1259 N N   . VAL A 1 199 ? 6.198   29.665  -9.440  1.00 43.14 ? 193 VAL A N   1 
ATOM   1260 C CA  . VAL A 1 199 ? 7.141   28.629  -9.108  1.00 42.81 ? 193 VAL A CA  1 
ATOM   1261 C C   . VAL A 1 199 ? 7.304   27.676  -10.279 1.00 43.03 ? 193 VAL A C   1 
ATOM   1262 O O   . VAL A 1 199 ? 8.449   27.406  -10.675 1.00 43.46 ? 193 VAL A O   1 
ATOM   1263 C CB  . VAL A 1 199 ? 6.715   27.900  -7.856  1.00 43.21 ? 193 VAL A CB  1 
ATOM   1264 C CG1 . VAL A 1 199 ? 7.759   26.836  -7.436  1.00 42.11 ? 193 VAL A CG1 1 
ATOM   1265 C CG2 . VAL A 1 199 ? 6.486   28.917  -6.763  1.00 42.81 ? 193 VAL A CG2 1 
ATOM   1266 N N   . GLU A 1 200 ? 6.204   27.196  -10.869 1.00 42.20 ? 194 GLU A N   1 
ATOM   1267 C CA  . GLU A 1 200 ? 6.350   26.365  -12.064 1.00 43.04 ? 194 GLU A CA  1 
ATOM   1268 C C   . GLU A 1 200 ? 7.155   27.045  -13.200 1.00 42.39 ? 194 GLU A C   1 
ATOM   1269 O O   . GLU A 1 200 ? 7.978   26.411  -13.837 1.00 42.30 ? 194 GLU A O   1 
ATOM   1270 C CB  . GLU A 1 200 ? 5.019   25.804  -12.579 1.00 42.72 ? 194 GLU A CB  1 
ATOM   1271 C CG  . GLU A 1 200 ? 5.220   24.465  -13.291 1.00 45.08 ? 194 GLU A CG  1 
ATOM   1272 C CD  . GLU A 1 200 ? 4.061   24.001  -14.204 1.00 45.92 ? 194 GLU A CD  1 
ATOM   1273 O OE1 . GLU A 1 200 ? 2.860   24.233  -13.882 1.00 48.31 ? 194 GLU A OE1 1 
ATOM   1274 O OE2 . GLU A 1 200 ? 4.377   23.364  -15.253 1.00 50.01 ? 194 GLU A OE2 1 
ATOM   1275 N N   . GLU A 1 201 ? 6.935   28.332  -13.443 1.00 42.47 ? 195 GLU A N   1 
ATOM   1276 C CA  . GLU A 1 201 ? 7.711   29.031  -14.480 1.00 42.52 ? 195 GLU A CA  1 
ATOM   1277 C C   . GLU A 1 201 ? 9.191   29.037  -14.175 1.00 41.58 ? 195 GLU A C   1 
ATOM   1278 O O   . GLU A 1 201 ? 10.009  28.762  -15.046 1.00 41.34 ? 195 GLU A O   1 
ATOM   1279 C CB  . GLU A 1 201 ? 7.198   30.456  -14.765 1.00 42.35 ? 195 GLU A CB  1 
ATOM   1280 C CG  . GLU A 1 201 ? 6.305   30.487  -15.973 1.00 45.24 ? 195 GLU A CG  1 
ATOM   1281 C CD  . GLU A 1 201 ? 5.339   31.678  -16.025 1.00 50.03 ? 195 GLU A CD  1 
ATOM   1282 O OE1 . GLU A 1 201 ? 5.844   32.809  -15.875 1.00 52.69 ? 195 GLU A OE1 1 
ATOM   1283 O OE2 . GLU A 1 201 ? 4.097   31.489  -16.263 1.00 49.94 ? 195 GLU A OE2 1 
ATOM   1284 N N   . LEU A 1 202 ? 9.540   29.356  -12.938 1.00 41.46 ? 196 LEU A N   1 
ATOM   1285 C CA  . LEU A 1 202 ? 10.950  29.409  -12.583 1.00 41.11 ? 196 LEU A CA  1 
ATOM   1286 C C   . LEU A 1 202 ? 11.490  27.984  -12.639 1.00 41.19 ? 196 LEU A C   1 
ATOM   1287 O O   . LEU A 1 202 ? 12.556  27.736  -13.225 1.00 40.94 ? 196 LEU A O   1 
ATOM   1288 C CB  . LEU A 1 202 ? 11.166  30.102  -11.240 1.00 40.42 ? 196 LEU A CB  1 
ATOM   1289 C CG  . LEU A 1 202 ? 12.558  30.192  -10.612 1.00 41.69 ? 196 LEU A CG  1 
ATOM   1290 C CD1 . LEU A 1 202 ? 13.728  30.463  -11.582 1.00 41.52 ? 196 LEU A CD1 1 
ATOM   1291 C CD2 . LEU A 1 202 ? 12.523  31.248  -9.539  1.00 43.01 ? 196 LEU A CD2 1 
ATOM   1292 N N   . GLN A 1 203 ? 10.718  27.030  -12.124 1.00 41.32 ? 197 GLN A N   1 
ATOM   1293 C CA  . GLN A 1 203 ? 11.137  25.644  -12.240 1.00 41.95 ? 197 GLN A CA  1 
ATOM   1294 C C   . GLN A 1 203 ? 11.474  25.318  -13.686 1.00 41.55 ? 197 GLN A C   1 
ATOM   1295 O O   . GLN A 1 203 ? 12.517  24.762  -13.980 1.00 41.26 ? 197 GLN A O   1 
ATOM   1296 C CB  . GLN A 1 203 ? 10.064  24.721  -11.736 1.00 42.08 ? 197 GLN A CB  1 
ATOM   1297 C CG  . GLN A 1 203 ? 10.564  23.312  -11.565 1.00 45.21 ? 197 GLN A CG  1 
ATOM   1298 C CD  . GLN A 1 203 ? 9.437   22.327  -11.638 1.00 47.62 ? 197 GLN A CD  1 
ATOM   1299 O OE1 . GLN A 1 203 ? 8.797   22.201  -12.681 1.00 48.73 ? 197 GLN A OE1 1 
ATOM   1300 N NE2 . GLN A 1 203 ? 9.163   21.636  -10.526 1.00 48.38 ? 197 GLN A NE2 1 
ATOM   1301 N N   . ASN A 1 204 ? 10.591  25.715  -14.590 1.00 42.11 ? 198 ASN A N   1 
ATOM   1302 C CA  . ASN A 1 204 ? 10.779  25.489  -16.022 1.00 42.18 ? 198 ASN A CA  1 
ATOM   1303 C C   . ASN A 1 204 ? 12.044  26.095  -16.613 1.00 41.29 ? 198 ASN A C   1 
ATOM   1304 O O   . ASN A 1 204 ? 12.752  25.410  -17.363 1.00 40.63 ? 198 ASN A O   1 
ATOM   1305 C CB  . ASN A 1 204 ? 9.541   25.924  -16.810 1.00 42.74 ? 198 ASN A CB  1 
ATOM   1306 C CG  . ASN A 1 204 ? 8.337   24.985  -16.598 1.00 45.16 ? 198 ASN A CG  1 
ATOM   1307 O OD1 . ASN A 1 204 ? 8.453   23.891  -16.022 1.00 46.95 ? 198 ASN A OD1 1 
ATOM   1308 N ND2 . ASN A 1 204 ? 7.168   25.421  -17.078 1.00 47.61 ? 198 ASN A ND2 1 
ATOM   1309 N N   . ARG A 1 205 ? 12.333  27.356  -16.264 1.00 40.11 ? 199 ARG A N   1 
ATOM   1310 C CA  . ARG A 1 205 ? 13.544  28.033  -16.761 1.00 39.95 ? 199 ARG A CA  1 
ATOM   1311 C C   . ARG A 1 205 ? 14.797  27.230  -16.380 1.00 38.51 ? 199 ARG A C   1 
ATOM   1312 O O   . ARG A 1 205 ? 15.590  26.863  -17.240 1.00 37.86 ? 199 ARG A O   1 
ATOM   1313 C CB  . ARG A 1 205 ? 13.633  29.499  -16.285 1.00 39.61 ? 199 ARG A CB  1 
ATOM   1314 C CG  . ARG A 1 205 ? 12.740  30.464  -17.079 1.00 40.74 ? 199 ARG A CG  1 
ATOM   1315 C CD  . ARG A 1 205 ? 12.786  31.904  -16.578 1.00 43.04 ? 199 ARG A CD  1 
ATOM   1316 N NE  . ARG A 1 205 ? 11.423  32.452  -16.349 1.00 52.80 ? 199 ARG A NE  1 
ATOM   1317 C CZ  . ARG A 1 205 ? 10.910  32.864  -15.168 1.00 53.41 ? 199 ARG A CZ  1 
ATOM   1318 N NH1 . ARG A 1 205 ? 9.657   33.338  -15.101 1.00 52.16 ? 199 ARG A NH1 1 
ATOM   1319 N NH2 . ARG A 1 205 ? 11.640  32.823  -14.053 1.00 54.48 ? 199 ARG A NH2 1 
ATOM   1320 N N   . ILE A 1 206 ? 14.926  26.904  -15.097 1.00 37.74 ? 200 ILE A N   1 
ATOM   1321 C CA  . ILE A 1 206 ? 16.037  26.082  -14.607 1.00 37.06 ? 200 ILE A CA  1 
ATOM   1322 C C   . ILE A 1 206 ? 16.140  24.724  -15.288 1.00 37.70 ? 200 ILE A C   1 
ATOM   1323 O O   . ILE A 1 206 ? 17.204  24.358  -15.793 1.00 37.42 ? 200 ILE A O   1 
ATOM   1324 C CB  . ILE A 1 206 ? 15.968  25.874  -13.108 1.00 36.71 ? 200 ILE A CB  1 
ATOM   1325 C CG1 . ILE A 1 206 ? 16.030  27.224  -12.397 1.00 34.45 ? 200 ILE A CG1 1 
ATOM   1326 C CG2 . ILE A 1 206 ? 17.145  24.983  -12.627 1.00 37.90 ? 200 ILE A CG2 1 
ATOM   1327 C CD1 . ILE A 1 206 ? 15.418  27.191  -11.074 1.00 31.49 ? 200 ILE A CD1 1 
ATOM   1328 N N   . ALA A 1 207 ? 15.028  23.993  -15.309 1.00 38.07 ? 201 ALA A N   1 
ATOM   1329 C CA  . ALA A 1 207 ? 14.956  22.733  -15.988 1.00 38.27 ? 201 ALA A CA  1 
ATOM   1330 C C   . ALA A 1 207 ? 15.439  22.810  -17.425 1.00 39.03 ? 201 ALA A C   1 
ATOM   1331 O O   . ALA A 1 207 ? 16.267  22.020  -17.815 1.00 39.64 ? 201 ALA A O   1 
ATOM   1332 C CB  . ALA A 1 207 ? 13.577  22.205  -15.921 1.00 38.45 ? 201 ALA A CB  1 
ATOM   1333 N N   . SER A 1 208 ? 14.968  23.765  -18.221 1.00 40.62 ? 202 SER A N   1 
ATOM   1334 C CA  . SER A 1 208 ? 15.372  23.805  -19.662 1.00 41.80 ? 202 SER A CA  1 
ATOM   1335 C C   . SER A 1 208 ? 16.811  24.256  -19.797 1.00 42.30 ? 202 SER A C   1 
ATOM   1336 O O   . SER A 1 208 ? 17.507  23.950  -20.754 1.00 42.68 ? 202 SER A O   1 
ATOM   1337 C CB  . SER A 1 208 ? 14.425  24.669  -20.530 1.00 41.44 ? 202 SER A CB  1 
ATOM   1338 O OG  . SER A 1 208 ? 14.294  25.992  -20.044 1.00 41.40 ? 202 SER A OG  1 
ATOM   1339 N N   . CYS A 1 209 ? 17.235  24.977  -18.781 1.00 43.46 ? 203 CYS A N   1 
ATOM   1340 C CA  . CYS A 1 209 ? 18.573  25.460  -18.652 1.00 44.07 ? 203 CYS A CA  1 
ATOM   1341 C C   . CYS A 1 209 ? 19.568  24.313  -18.405 1.00 44.44 ? 203 CYS A C   1 
ATOM   1342 O O   . CYS A 1 209 ? 20.631  24.278  -19.042 1.00 44.40 ? 203 CYS A O   1 
ATOM   1343 C CB  . CYS A 1 209 ? 18.561  26.472  -17.518 1.00 44.31 ? 203 CYS A CB  1 
ATOM   1344 S SG  . CYS A 1 209 ? 20.106  27.123  -17.141 1.00 44.48 ? 203 CYS A SG  1 
ATOM   1345 N N   . LEU A 1 210 ? 19.220  23.404  -17.475 1.00 44.92 ? 204 LEU A N   1 
ATOM   1346 C CA  . LEU A 1 210 ? 19.844  22.083  -17.330 1.00 45.04 ? 204 LEU A CA  1 
ATOM   1347 C C   . LEU A 1 210 ? 19.896  21.369  -18.673 1.00 46.47 ? 204 LEU A C   1 
ATOM   1348 O O   . LEU A 1 210 ? 21.007  21.095  -19.161 1.00 46.80 ? 204 LEU A O   1 
ATOM   1349 C CB  . LEU A 1 210 ? 19.094  21.207  -16.324 1.00 44.82 ? 204 LEU A CB  1 
ATOM   1350 C CG  . LEU A 1 210 ? 19.564  19.768  -15.998 1.00 44.33 ? 204 LEU A CG  1 
ATOM   1351 C CD1 . LEU A 1 210 ? 20.956  19.715  -15.490 1.00 41.96 ? 204 LEU A CD1 1 
ATOM   1352 C CD2 . LEU A 1 210 ? 18.691  19.113  -14.975 1.00 44.24 ? 204 LEU A CD2 1 
ATOM   1353 N N   . LYS A 1 211 ? 18.727  21.075  -19.270 1.00 47.45 ? 205 LYS A N   1 
ATOM   1354 C CA  . LYS A 1 211 ? 18.657  20.403  -20.600 1.00 48.83 ? 205 LYS A CA  1 
ATOM   1355 C C   . LYS A 1 211 ? 19.630  20.969  -21.653 1.00 49.78 ? 205 LYS A C   1 
ATOM   1356 O O   . LYS A 1 211 ? 20.405  20.222  -22.230 1.00 50.29 ? 205 LYS A O   1 
ATOM   1357 C CB  . LYS A 1 211 ? 17.217  20.350  -21.153 1.00 48.63 ? 205 LYS A CB  1 
ATOM   1358 N N   . GLU A 1 212 ? 19.619  22.281  -21.878 1.00 51.02 ? 206 GLU A N   1 
ATOM   1359 C CA  . GLU A 1 212 ? 20.636  22.947  -22.725 1.00 52.69 ? 206 GLU A CA  1 
ATOM   1360 C C   . GLU A 1 212 ? 22.062  22.413  -22.440 1.00 52.85 ? 206 GLU A C   1 
ATOM   1361 O O   . GLU A 1 212 ? 22.758  21.960  -23.338 1.00 52.69 ? 206 GLU A O   1 
ATOM   1362 C CB  . GLU A 1 212 ? 20.543  24.484  -22.538 1.00 53.13 ? 206 GLU A CB  1 
ATOM   1363 C CG  . GLU A 1 212 ? 21.805  25.312  -22.823 1.00 55.28 ? 206 GLU A CG  1 
ATOM   1364 C CD  . GLU A 1 212 ? 21.732  26.118  -24.134 1.00 59.14 ? 206 GLU A CD  1 
ATOM   1365 O OE1 . GLU A 1 212 ? 22.673  26.031  -24.968 1.00 59.74 ? 206 GLU A OE1 1 
ATOM   1366 O OE2 . GLU A 1 212 ? 20.740  26.856  -24.330 1.00 60.39 ? 206 GLU A OE2 1 
ATOM   1367 N N   . HIS A 1 213 ? 22.447  22.434  -21.170 1.00 53.43 ? 207 HIS A N   1 
ATOM   1368 C CA  . HIS A 1 213 ? 23.796  22.080  -20.723 1.00 54.02 ? 207 HIS A CA  1 
ATOM   1369 C C   . HIS A 1 213 ? 24.168  20.607  -20.937 1.00 54.59 ? 207 HIS A C   1 
ATOM   1370 O O   . HIS A 1 213 ? 25.244  20.332  -21.495 1.00 55.06 ? 207 HIS A O   1 
ATOM   1371 C CB  . HIS A 1 213 ? 23.994  22.497  -19.255 1.00 53.72 ? 207 HIS A CB  1 
ATOM   1372 C CG  . HIS A 1 213 ? 25.287  22.047  -18.654 1.00 52.83 ? 207 HIS A CG  1 
ATOM   1373 N ND1 . HIS A 1 213 ? 26.510  22.521  -19.075 1.00 53.26 ? 207 HIS A ND1 1 
ATOM   1374 C CD2 . HIS A 1 213 ? 25.544  21.201  -17.628 1.00 52.56 ? 207 HIS A CD2 1 
ATOM   1375 C CE1 . HIS A 1 213 ? 27.469  21.976  -18.345 1.00 52.91 ? 207 HIS A CE1 1 
ATOM   1376 N NE2 . HIS A 1 213 ? 26.909  21.170  -17.459 1.00 53.30 ? 207 HIS A NE2 1 
ATOM   1377 N N   . VAL A 1 214 ? 23.329  19.653  -20.513 1.00 54.55 ? 208 VAL A N   1 
ATOM   1378 C CA  . VAL A 1 214 ? 23.736  18.259  -20.731 1.00 54.34 ? 208 VAL A CA  1 
ATOM   1379 C C   . VAL A 1 214 ? 23.619  17.928  -22.205 1.00 54.49 ? 208 VAL A C   1 
ATOM   1380 O O   . VAL A 1 214 ? 24.342  17.054  -22.678 1.00 54.96 ? 208 VAL A O   1 
ATOM   1381 C CB  . VAL A 1 214 ? 23.091  17.192  -19.805 1.00 54.29 ? 208 VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 214 ? 22.349  17.852  -18.647 1.00 54.11 ? 208 VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 214 ? 22.204  16.213  -20.601 1.00 54.25 ? 208 VAL A CG2 1 
ATOM   1384 N N   . ALA A 1 215 ? 22.770  18.661  -22.936 1.00 54.22 ? 209 ALA A N   1 
ATOM   1385 C CA  . ALA A 1 215 ? 22.848  18.679  -24.418 1.00 54.09 ? 209 ALA A CA  1 
ATOM   1386 C C   . ALA A 1 215 ? 24.286  18.945  -24.895 1.00 53.96 ? 209 ALA A C   1 
ATOM   1387 O O   . ALA A 1 215 ? 24.896  18.103  -25.545 1.00 53.30 ? 209 ALA A O   1 
ATOM   1388 C CB  . ALA A 1 215 ? 21.894  19.716  -25.014 1.00 53.65 ? 209 ALA A CB  1 
ATOM   1389 N N   . ALA A 1 216 ? 24.825  20.101  -24.523 1.00 54.50 ? 210 ALA A N   1 
ATOM   1390 C CA  . ALA A 1 216 ? 26.137  20.516  -24.972 1.00 55.39 ? 210 ALA A CA  1 
ATOM   1391 C C   . ALA A 1 216 ? 27.138  19.374  -24.789 1.00 56.37 ? 210 ALA A C   1 
ATOM   1392 O O   . ALA A 1 216 ? 27.910  19.069  -25.706 1.00 56.88 ? 210 ALA A O   1 
ATOM   1393 C CB  . ALA A 1 216 ? 26.585  21.782  -24.256 1.00 54.79 ? 210 ALA A CB  1 
ATOM   1394 N N   . VAL A 1 217 ? 27.092  18.726  -23.627 1.00 57.08 ? 211 VAL A N   1 
ATOM   1395 C CA  . VAL A 1 217 ? 27.931  17.566  -23.321 1.00 57.57 ? 211 VAL A CA  1 
ATOM   1396 C C   . VAL A 1 217 ? 27.315  16.287  -23.963 1.00 58.33 ? 211 VAL A C   1 
ATOM   1397 O O   . VAL A 1 217 ? 26.574  15.533  -23.328 1.00 58.61 ? 211 VAL A O   1 
ATOM   1398 C CB  . VAL A 1 217 ? 28.104  17.430  -21.765 1.00 57.72 ? 211 VAL A CB  1 
ATOM   1399 C CG1 . VAL A 1 217 ? 29.064  16.311  -21.412 1.00 58.03 ? 211 VAL A CG1 1 
ATOM   1400 C CG2 . VAL A 1 217 ? 28.551  18.789  -21.105 1.00 56.41 ? 211 VAL A CG2 1 
ATOM   1401 N N   . ALA A 1 218 ? 27.607  16.049  -25.237 1.00 58.77 ? 212 ALA A N   1 
ATOM   1402 C CA  . ALA A 1 218 ? 26.955  14.964  -25.978 1.00 58.85 ? 212 ALA A CA  1 
ATOM   1403 C C   . ALA A 1 218 ? 26.365  15.462  -27.287 1.00 59.21 ? 212 ALA A C   1 
ATOM   1404 O O   . ALA A 1 218 ? 27.025  16.185  -28.025 1.00 58.79 ? 212 ALA A O   1 
ATOM   1405 N N   . GLY A 1 219 ? 25.108  15.094  -27.559 1.00 59.84 ? 213 GLY A N   1 
ATOM   1406 C CA  . GLY A 1 219 ? 24.448  15.390  -28.845 1.00 59.99 ? 213 GLY A CA  1 
ATOM   1407 C C   . GLY A 1 219 ? 22.961  15.733  -28.669 1.00 60.19 ? 213 GLY A C   1 
ATOM   1408 O O   . GLY A 1 219 ? 22.490  15.976  -27.553 1.00 60.09 ? 213 GLY A O   1 
ATOM   1409 N N   . PRO A 1 223 ? 14.135  15.855  -23.040 1.00 28.93 ? 217 PRO A N   1 
ATOM   1410 C CA  . PRO A 1 223 ? 15.143  15.709  -24.018 1.00 29.20 ? 217 PRO A CA  1 
ATOM   1411 C C   . PRO A 1 223 ? 15.671  14.539  -23.469 1.00 30.90 ? 217 PRO A C   1 
ATOM   1412 O O   . PRO A 1 223 ? 15.159  14.101  -22.522 1.00 29.93 ? 217 PRO A O   1 
ATOM   1413 C CB  . PRO A 1 223 ? 16.067  16.706  -23.869 1.00 30.24 ? 217 PRO A CB  1 
ATOM   1414 N N   . ALA A 1 224 ? 16.748  14.041  -24.038 1.00 36.37 ? 218 ALA A N   1 
ATOM   1415 C CA  . ALA A 1 224 ? 17.163  12.609  -23.912 1.00 41.12 ? 218 ALA A CA  1 
ATOM   1416 C C   . ALA A 1 224 ? 18.112  12.225  -22.774 1.00 44.35 ? 218 ALA A C   1 
ATOM   1417 O O   . ALA A 1 224 ? 19.093  12.955  -22.484 1.00 44.77 ? 218 ALA A O   1 
ATOM   1418 N N   . SER A 1 225 ? 17.825  11.069  -22.150 1.00 46.88 ? 219 SER A N   1 
ATOM   1419 C CA  . SER A 1 225 ? 18.541  10.610  -20.949 1.00 49.30 ? 219 SER A CA  1 
ATOM   1420 C C   . SER A 1 225 ? 19.624  9.568   -21.158 1.00 50.51 ? 219 SER A C   1 
ATOM   1421 O O   . SER A 1 225 ? 19.547  8.794   -22.102 1.00 50.54 ? 219 SER A O   1 
ATOM   1422 C CB  . SER A 1 225 ? 17.574  10.008  -19.946 1.00 49.20 ? 219 SER A CB  1 
ATOM   1423 O OG  . SER A 1 225 ? 18.331  9.346   -18.930 1.00 50.49 ? 219 SER A OG  1 
ATOM   1424 N N   . CYS A 1 226 ? 20.657  9.542   -20.310 1.00 52.87 ? 220 CYS A N   1 
ATOM   1425 C CA  . CYS A 1 226 ? 21.292  10.679  -19.579 1.00 54.01 ? 220 CYS A CA  1 
ATOM   1426 C C   . CYS A 1 226 ? 20.643  11.630  -18.548 1.00 54.68 ? 220 CYS A C   1 
ATOM   1427 O O   . CYS A 1 226 ? 21.047  11.607  -17.378 1.00 54.74 ? 220 CYS A O   1 
ATOM   1428 C CB  . CYS A 1 226 ? 22.142  11.519  -20.532 1.00 54.50 ? 220 CYS A CB  1 
ATOM   1429 S SG  . CYS A 1 226 ? 23.403  12.425  -19.611 1.00 55.37 ? 220 CYS A SG  1 
ATOM   1430 N N   . LEU A 1 227 ? 19.753  12.536  -18.960 1.00 55.11 ? 221 LEU A N   1 
ATOM   1431 C CA  . LEU A 1 227 ? 19.148  13.428  -17.962 1.00 55.60 ? 221 LEU A CA  1 
ATOM   1432 C C   . LEU A 1 227 ? 18.566  12.597  -16.835 1.00 56.07 ? 221 LEU A C   1 
ATOM   1433 O O   . LEU A 1 227 ? 18.930  12.782  -15.664 1.00 56.11 ? 221 LEU A O   1 
ATOM   1434 C CB  . LEU A 1 227 ? 18.061  14.327  -18.543 1.00 55.74 ? 221 LEU A CB  1 
ATOM   1435 C CG  . LEU A 1 227 ? 18.343  15.793  -18.866 1.00 55.45 ? 221 LEU A CG  1 
ATOM   1436 C CD1 . LEU A 1 227 ? 18.937  15.938  -20.253 1.00 55.76 ? 221 LEU A CD1 1 
ATOM   1437 C CD2 . LEU A 1 227 ? 17.038  16.545  -18.818 1.00 55.50 ? 221 LEU A CD2 1 
ATOM   1438 N N   . SER A 1 228 ? 17.701  11.652  -17.202 1.00 56.55 ? 222 SER A N   1 
ATOM   1439 C CA  . SER A 1 228 ? 16.959  10.851  -16.224 1.00 57.28 ? 222 SER A CA  1 
ATOM   1440 C C   . SER A 1 228 ? 17.804  9.875   -15.417 1.00 57.27 ? 222 SER A C   1 
ATOM   1441 O O   . SER A 1 228 ? 17.359  9.405   -14.374 1.00 57.69 ? 222 SER A O   1 
ATOM   1442 C CB  . SER A 1 228 ? 15.792  10.111  -16.877 1.00 57.53 ? 222 SER A CB  1 
ATOM   1443 O OG  . SER A 1 228 ? 16.207  8.830   -17.311 1.00 58.91 ? 222 SER A OG  1 
ATOM   1444 N N   . ARG A 1 229 ? 18.995  9.543   -15.900 1.00 57.27 ? 223 ARG A N   1 
ATOM   1445 C CA  . ARG A 1 229 ? 19.982  8.905   -15.036 1.00 57.53 ? 223 ARG A CA  1 
ATOM   1446 C C   . ARG A 1 229 ? 20.194  9.833   -13.833 1.00 56.85 ? 223 ARG A C   1 
ATOM   1447 O O   . ARG A 1 229 ? 19.775  9.527   -12.717 1.00 56.49 ? 223 ARG A O   1 
ATOM   1448 C CB  . ARG A 1 229 ? 21.291  8.723   -15.795 1.00 58.14 ? 223 ARG A CB  1 
ATOM   1449 C CG  . ARG A 1 229 ? 22.202  7.622   -15.267 1.00 59.96 ? 223 ARG A CG  1 
ATOM   1450 C CD  . ARG A 1 229 ? 23.326  7.326   -16.265 1.00 62.68 ? 223 ARG A CD  1 
ATOM   1451 N NE  . ARG A 1 229 ? 22.941  7.569   -17.666 1.00 65.41 ? 223 ARG A NE  1 
ATOM   1452 C CZ  . ARG A 1 229 ? 22.140  6.789   -18.399 1.00 66.09 ? 223 ARG A CZ  1 
ATOM   1453 N NH1 . ARG A 1 229 ? 21.596  5.696   -17.876 1.00 66.75 ? 223 ARG A NH1 1 
ATOM   1454 N NH2 . ARG A 1 229 ? 21.874  7.109   -19.660 1.00 66.03 ? 223 ARG A NH2 1 
ATOM   1455 N N   . LEU A 1 230 ? 20.815  10.980  -14.104 1.00 56.55 ? 224 LEU A N   1 
ATOM   1456 C CA  . LEU A 1 230 ? 21.013  12.070  -13.155 1.00 56.11 ? 224 LEU A CA  1 
ATOM   1457 C C   . LEU A 1 230 ? 19.745  12.371  -12.370 1.00 56.13 ? 224 LEU A C   1 
ATOM   1458 O O   . LEU A 1 230 ? 19.764  12.379  -11.149 1.00 55.88 ? 224 LEU A O   1 
ATOM   1459 C CB  . LEU A 1 230 ? 21.527  13.303  -13.911 1.00 55.89 ? 224 LEU A CB  1 
ATOM   1460 C CG  . LEU A 1 230 ? 21.257  14.771  -13.561 1.00 56.49 ? 224 LEU A CG  1 
ATOM   1461 C CD1 . LEU A 1 230 ? 21.807  15.167  -12.189 1.00 56.72 ? 224 LEU A CD1 1 
ATOM   1462 C CD2 . LEU A 1 230 ? 21.863  15.669  -14.645 1.00 56.02 ? 224 LEU A CD2 1 
ATOM   1463 N N   . LEU A 1 231 ? 18.638  12.580  -13.069 1.00 56.41 ? 225 LEU A N   1 
ATOM   1464 C CA  . LEU A 1 231 ? 17.362  12.896  -12.418 1.00 56.96 ? 225 LEU A CA  1 
ATOM   1465 C C   . LEU A 1 231 ? 16.795  11.805  -11.525 1.00 57.42 ? 225 LEU A C   1 
ATOM   1466 O O   . LEU A 1 231 ? 16.054  12.091  -10.586 1.00 57.25 ? 225 LEU A O   1 
ATOM   1467 C CB  . LEU A 1 231 ? 16.327  13.267  -13.462 1.00 57.20 ? 225 LEU A CB  1 
ATOM   1468 C CG  . LEU A 1 231 ? 16.395  14.723  -13.885 1.00 57.23 ? 225 LEU A CG  1 
ATOM   1469 C CD1 . LEU A 1 231 ? 15.812  14.918  -15.302 1.00 56.18 ? 225 LEU A CD1 1 
ATOM   1470 C CD2 . LEU A 1 231 ? 15.692  15.556  -12.821 1.00 56.64 ? 225 LEU A CD2 1 
ATOM   1471 N N   . GLY A 1 232 ? 17.135  10.557  -11.839 1.00 58.30 ? 226 GLY A N   1 
ATOM   1472 C CA  . GLY A 1 232 ? 16.870  9.405   -10.964 1.00 58.92 ? 226 GLY A CA  1 
ATOM   1473 C C   . GLY A 1 232 ? 17.317  9.569   -9.514  1.00 59.22 ? 226 GLY A C   1 
ATOM   1474 O O   . GLY A 1 232 ? 16.729  8.967   -8.622  1.00 59.24 ? 226 GLY A O   1 
ATOM   1475 N N   . LYS A 1 233 ? 18.350  10.377  -9.274  1.00 59.35 ? 227 LYS A N   1 
ATOM   1476 C CA  . LYS A 1 233 ? 18.725  10.753  -7.909  1.00 59.70 ? 227 LYS A CA  1 
ATOM   1477 C C   . LYS A 1 233 ? 17.571  11.286  -7.047  1.00 59.85 ? 227 LYS A C   1 
ATOM   1478 O O   . LYS A 1 233 ? 17.389  10.834  -5.909  1.00 59.77 ? 227 LYS A O   1 
ATOM   1479 C CB  . LYS A 1 233 ? 19.852  11.786  -7.913  1.00 59.58 ? 227 LYS A CB  1 
ATOM   1480 C CG  . LYS A 1 233 ? 21.076  11.400  -8.737  1.00 60.29 ? 227 LYS A CG  1 
ATOM   1481 C CD  . LYS A 1 233 ? 21.935  10.343  -8.078  1.00 59.75 ? 227 LYS A CD  1 
ATOM   1482 C CE  . LYS A 1 233 ? 21.480  8.965   -8.447  1.00 59.12 ? 227 LYS A CE  1 
ATOM   1483 N NZ  . LYS A 1 233 ? 22.164  8.014   -7.566  1.00 59.47 ? 227 LYS A NZ  1 
ATOM   1484 N N   . LEU A 1 234 ? 16.792  12.230  -7.580  1.00 59.86 ? 228 LEU A N   1 
ATOM   1485 C CA  . LEU A 1 234 ? 15.870  13.009  -6.730  1.00 60.18 ? 228 LEU A CA  1 
ATOM   1486 C C   . LEU A 1 234 ? 14.934  12.227  -5.779  1.00 60.00 ? 228 LEU A C   1 
ATOM   1487 O O   . LEU A 1 234 ? 14.652  12.707  -4.691  1.00 60.34 ? 228 LEU A O   1 
ATOM   1488 C CB  . LEU A 1 234 ? 15.101  14.076  -7.521  1.00 59.92 ? 228 LEU A CB  1 
ATOM   1489 C CG  . LEU A 1 234 ? 15.912  15.052  -8.394  1.00 61.01 ? 228 LEU A CG  1 
ATOM   1490 C CD1 . LEU A 1 234 ? 15.030  16.145  -9.076  1.00 59.75 ? 228 LEU A CD1 1 
ATOM   1491 C CD2 . LEU A 1 234 ? 17.042  15.697  -7.618  1.00 60.95 ? 228 LEU A CD2 1 
ATOM   1492 N N   . PRO A 1 235 ? 14.444  11.040  -6.181  1.00 59.95 ? 229 PRO A N   1 
ATOM   1493 C CA  . PRO A 1 235 ? 13.687  10.181  -5.244  1.00 59.98 ? 229 PRO A CA  1 
ATOM   1494 C C   . PRO A 1 235 ? 14.539  9.391   -4.235  1.00 59.87 ? 229 PRO A C   1 
ATOM   1495 O O   . PRO A 1 235 ? 14.145  9.260   -3.072  1.00 59.83 ? 229 PRO A O   1 
ATOM   1496 C CB  . PRO A 1 235 ? 12.945  9.209   -6.167  1.00 59.97 ? 229 PRO A CB  1 
ATOM   1497 C CG  . PRO A 1 235 ? 13.189  9.710   -7.569  1.00 60.39 ? 229 PRO A CG  1 
ATOM   1498 C CD  . PRO A 1 235 ? 14.474  10.454  -7.527  1.00 59.89 ? 229 PRO A CD  1 
ATOM   1499 N N   . GLU A 1 236 ? 15.681  8.857   -4.668  1.00 59.59 ? 230 GLU A N   1 
ATOM   1500 C CA  . GLU A 1 236 ? 16.639  8.276   -3.732  1.00 59.42 ? 230 GLU A CA  1 
ATOM   1501 C C   . GLU A 1 236 ? 16.850  9.281   -2.599  1.00 58.71 ? 230 GLU A C   1 
ATOM   1502 O O   . GLU A 1 236 ? 16.847  8.924   -1.426  1.00 59.17 ? 230 GLU A O   1 
ATOM   1503 C CB  . GLU A 1 236 ? 17.953  7.947   -4.437  1.00 59.13 ? 230 GLU A CB  1 
ATOM   1504 C CG  . GLU A 1 236 ? 17.787  7.104   -5.721  1.00 60.65 ? 230 GLU A CG  1 
ATOM   1505 C CD  . GLU A 1 236 ? 19.077  6.948   -6.570  1.00 60.97 ? 230 GLU A CD  1 
ATOM   1506 O OE1 . GLU A 1 236 ? 20.196  6.889   -5.996  1.00 62.71 ? 230 GLU A OE1 1 
ATOM   1507 O OE2 . GLU A 1 236 ? 18.960  6.864   -7.821  1.00 62.37 ? 230 GLU A OE2 1 
ATOM   1508 N N   . LEU A 1 237 ? 16.962  10.553  -2.956  1.00 58.05 ? 231 LEU A N   1 
ATOM   1509 C CA  . LEU A 1 237 ? 17.129  11.615  -1.978  1.00 57.56 ? 231 LEU A CA  1 
ATOM   1510 C C   . LEU A 1 237 ? 15.964  11.721  -0.989  1.00 57.51 ? 231 LEU A C   1 
ATOM   1511 O O   . LEU A 1 237 ? 16.131  12.219  0.119   1.00 57.59 ? 231 LEU A O   1 
ATOM   1512 C CB  . LEU A 1 237 ? 17.347  12.953  -2.686  1.00 57.29 ? 231 LEU A CB  1 
ATOM   1513 C CG  . LEU A 1 237 ? 17.941  14.070  -1.833  1.00 57.41 ? 231 LEU A CG  1 
ATOM   1514 C CD1 . LEU A 1 237 ? 19.403  13.833  -1.634  1.00 57.27 ? 231 LEU A CD1 1 
ATOM   1515 C CD2 . LEU A 1 237 ? 17.730  15.416  -2.492  1.00 58.34 ? 231 LEU A CD2 1 
ATOM   1516 N N   . ARG A 1 238 ? 14.784  11.247  -1.379  1.00 57.44 ? 232 ARG A N   1 
ATOM   1517 C CA  . ARG A 1 238 ? 13.583  11.444  -0.550  1.00 57.02 ? 232 ARG A CA  1 
ATOM   1518 C C   . ARG A 1 238 ? 13.574  10.428  0.583   1.00 55.93 ? 232 ARG A C   1 
ATOM   1519 O O   . ARG A 1 238 ? 13.143  10.730  1.692   1.00 55.86 ? 232 ARG A O   1 
ATOM   1520 C CB  . ARG A 1 238 ? 12.290  11.366  -1.397  1.00 57.80 ? 232 ARG A CB  1 
ATOM   1521 C CG  . ARG A 1 238 ? 11.286  12.581  -1.294  1.00 58.80 ? 232 ARG A CG  1 
ATOM   1522 C CD  . ARG A 1 238 ? 11.863  13.925  -1.844  1.00 59.99 ? 232 ARG A CD  1 
ATOM   1523 N NE  . ARG A 1 238 ? 10.942  14.697  -2.705  1.00 61.60 ? 232 ARG A NE  1 
ATOM   1524 C CZ  . ARG A 1 238 ? 10.169  15.725  -2.321  1.00 62.10 ? 232 ARG A CZ  1 
ATOM   1525 N NH1 . ARG A 1 238 ? 10.166  16.150  -1.058  1.00 62.05 ? 232 ARG A NH1 1 
ATOM   1526 N NH2 . ARG A 1 238 ? 9.388   16.342  -3.213  1.00 61.27 ? 232 ARG A NH2 1 
ATOM   1527 N N   . THR A 1 239 ? 14.080  9.233   0.295   1.00 54.77 ? 233 THR A N   1 
ATOM   1528 C CA  . THR A 1 239 ? 14.219  8.173   1.289   1.00 53.74 ? 233 THR A CA  1 
ATOM   1529 C C   . THR A 1 239 ? 15.157  8.644   2.398   1.00 53.17 ? 233 THR A C   1 
ATOM   1530 O O   . THR A 1 239 ? 14.961  8.367   3.595   1.00 52.83 ? 233 THR A O   1 
ATOM   1531 C CB  . THR A 1 239 ? 14.867  6.966   0.643   1.00 53.87 ? 233 THR A CB  1 
ATOM   1532 O OG1 . THR A 1 239 ? 14.255  6.736   -0.639  1.00 54.64 ? 233 THR A OG1 1 
ATOM   1533 C CG2 . THR A 1 239 ? 14.787  5.712   1.567   1.00 53.54 ? 233 THR A CG2 1 
ATOM   1534 N N   . LEU A 1 240 ? 16.199  9.354   1.978   1.00 51.74 ? 234 LEU A N   1 
ATOM   1535 C CA  . LEU A 1 240 ? 17.198  9.777   2.894   1.00 49.73 ? 234 LEU A CA  1 
ATOM   1536 C C   . LEU A 1 240 ? 16.654  10.803  3.894   1.00 49.24 ? 234 LEU A C   1 
ATOM   1537 O O   . LEU A 1 240 ? 16.992  10.734  5.062   1.00 49.62 ? 234 LEU A O   1 
ATOM   1538 C CB  . LEU A 1 240 ? 18.409  10.264  2.127   1.00 49.57 ? 234 LEU A CB  1 
ATOM   1539 C CG  . LEU A 1 240 ? 19.411  9.217   1.628   1.00 47.49 ? 234 LEU A CG  1 
ATOM   1540 C CD1 . LEU A 1 240 ? 20.270  9.817   0.508   1.00 45.68 ? 234 LEU A CD1 1 
ATOM   1541 C CD2 . LEU A 1 240 ? 20.300  8.713   2.754   1.00 43.56 ? 234 LEU A CD2 1 
ATOM   1542 N N   . CYS A 1 241 ? 15.780  11.711  3.477   1.00 48.33 ? 235 CYS A N   1 
ATOM   1543 C CA  . CYS A 1 241 ? 15.168  12.651  4.436   1.00 47.77 ? 235 CYS A CA  1 
ATOM   1544 C C   . CYS A 1 241 ? 14.391  11.936  5.510   1.00 47.09 ? 235 CYS A C   1 
ATOM   1545 O O   . CYS A 1 241 ? 14.441  12.309  6.675   1.00 46.80 ? 235 CYS A O   1 
ATOM   1546 C CB  . CYS A 1 241 ? 14.229  13.611  3.728   1.00 47.85 ? 235 CYS A CB  1 
ATOM   1547 S SG  . CYS A 1 241 ? 15.071  14.419  2.396   1.00 49.29 ? 235 CYS A SG  1 
ATOM   1548 N N   . THR A 1 242 ? 13.646  10.922  5.078   1.00 46.66 ? 236 THR A N   1 
ATOM   1549 C CA  . THR A 1 242 ? 12.935  9.975   5.952   1.00 45.57 ? 236 THR A CA  1 
ATOM   1550 C C   . THR A 1 242 ? 13.772  9.529   7.120   1.00 44.60 ? 236 THR A C   1 
ATOM   1551 O O   . THR A 1 242 ? 13.431  9.829   8.241   1.00 45.29 ? 236 THR A O   1 
ATOM   1552 C CB  . THR A 1 242 ? 12.478  8.743   5.152   1.00 45.81 ? 236 THR A CB  1 
ATOM   1553 O OG1 . THR A 1 242 ? 11.543  9.169   4.153   1.00 45.71 ? 236 THR A OG1 1 
ATOM   1554 C CG2 . THR A 1 242 ? 11.857  7.681   6.049   1.00 44.76 ? 236 THR A CG2 1 
ATOM   1555 N N   . GLN A 1 243 ? 14.880  8.846   6.862   1.00 43.68 ? 237 GLN A N   1 
ATOM   1556 C CA  . GLN A 1 243 ? 15.749  8.370   7.936   1.00 42.73 ? 237 GLN A CA  1 
ATOM   1557 C C   . GLN A 1 243 ? 16.262  9.489   8.817   1.00 42.51 ? 237 GLN A C   1 
ATOM   1558 O O   . GLN A 1 243 ? 16.518  9.271   10.004  1.00 42.83 ? 237 GLN A O   1 
ATOM   1559 C CB  . GLN A 1 243 ? 16.954  7.637   7.392   1.00 42.42 ? 237 GLN A CB  1 
ATOM   1560 C CG  . GLN A 1 243 ? 16.745  6.813   6.158   1.00 43.13 ? 237 GLN A CG  1 
ATOM   1561 C CD  . GLN A 1 243 ? 17.998  6.041   5.860   1.00 45.63 ? 237 GLN A CD  1 
ATOM   1562 O OE1 . GLN A 1 243 ? 18.763  5.729   6.786   1.00 47.17 ? 237 GLN A OE1 1 
ATOM   1563 N NE2 . GLN A 1 243 ? 18.242  5.739   4.579   1.00 45.45 ? 237 GLN A NE2 1 
ATOM   1564 N N   . GLY A 1 244 ? 16.449  10.668  8.232   1.00 41.66 ? 238 GLY A N   1 
ATOM   1565 C CA  . GLY A 1 244 ? 16.841  11.842  8.987   1.00 41.83 ? 238 GLY A CA  1 
ATOM   1566 C C   . GLY A 1 244 ? 15.776  12.294  9.953   1.00 42.08 ? 238 GLY A C   1 
ATOM   1567 O O   . GLY A 1 244 ? 16.051  12.622  11.102  1.00 42.05 ? 238 GLY A O   1 
ATOM   1568 N N   . LEU A 1 245 ? 14.543  12.311  9.479   1.00 42.84 ? 239 LEU A N   1 
ATOM   1569 C CA  . LEU A 1 245 ? 13.393  12.546  10.344  1.00 43.35 ? 239 LEU A CA  1 
ATOM   1570 C C   . LEU A 1 245 ? 13.373  11.487  11.451  1.00 43.90 ? 239 LEU A C   1 
ATOM   1571 O O   . LEU A 1 245 ? 13.421  11.835  12.653  1.00 44.23 ? 239 LEU A O   1 
ATOM   1572 C CB  . LEU A 1 245 ? 12.105  12.598  9.521   1.00 43.01 ? 239 LEU A CB  1 
ATOM   1573 C CG  . LEU A 1 245 ? 12.225  13.731  8.472   1.00 42.07 ? 239 LEU A CG  1 
ATOM   1574 C CD1 . LEU A 1 245 ? 11.213  13.547  7.402   1.00 40.08 ? 239 LEU A CD1 1 
ATOM   1575 C CD2 . LEU A 1 245 ? 12.103  15.139  9.102   1.00 39.78 ? 239 LEU A CD2 1 
ATOM   1576 N N   . GLN A 1 246 ? 13.389  10.210  11.071  1.00 43.77 ? 240 GLN A N   1 
ATOM   1577 C CA  . GLN A 1 246 ? 13.538  9.148   12.071  1.00 44.48 ? 240 GLN A CA  1 
ATOM   1578 C C   . GLN A 1 246 ? 14.612  9.487   13.117  1.00 45.21 ? 240 GLN A C   1 
ATOM   1579 O O   . GLN A 1 246 ? 14.341  9.510   14.312  1.00 45.18 ? 240 GLN A O   1 
ATOM   1580 C CB  . GLN A 1 246 ? 13.841  7.806   11.415  1.00 44.25 ? 240 GLN A CB  1 
ATOM   1581 C CG  . GLN A 1 246 ? 12.684  7.247   10.617  1.00 43.23 ? 240 GLN A CG  1 
ATOM   1582 C CD  . GLN A 1 246 ? 13.062  5.990   9.895   1.00 41.46 ? 240 GLN A CD  1 
ATOM   1583 O OE1 . GLN A 1 246 ? 13.609  6.023   8.785   1.00 35.89 ? 240 GLN A OE1 1 
ATOM   1584 N NE2 . GLN A 1 246 ? 12.769  4.850   10.527  1.00 44.10 ? 240 GLN A NE2 1 
ATOM   1585 N N   . ARG A 1 247 ? 15.815  9.807   12.661  1.00 46.13 ? 241 ARG A N   1 
ATOM   1586 C CA  . ARG A 1 247 ? 16.862  10.185  13.572  1.00 47.00 ? 241 ARG A CA  1 
ATOM   1587 C C   . ARG A 1 247 ? 16.467  11.404  14.441  1.00 47.48 ? 241 ARG A C   1 
ATOM   1588 O O   . ARG A 1 247 ? 16.722  11.388  15.657  1.00 47.85 ? 241 ARG A O   1 
ATOM   1589 C CB  . ARG A 1 247 ? 18.171  10.415  12.815  1.00 47.50 ? 241 ARG A CB  1 
ATOM   1590 C CG  . ARG A 1 247 ? 19.432  9.780   13.456  1.00 48.86 ? 241 ARG A CG  1 
ATOM   1591 C CD  . ARG A 1 247 ? 19.778  10.450  14.765  1.00 51.88 ? 241 ARG A CD  1 
ATOM   1592 N NE  . ARG A 1 247 ? 21.118  10.122  15.242  1.00 53.81 ? 241 ARG A NE  1 
ATOM   1593 C CZ  . ARG A 1 247 ? 21.414  9.097   16.040  1.00 54.21 ? 241 ARG A CZ  1 
ATOM   1594 N NH1 . ARG A 1 247 ? 20.465  8.256   16.453  1.00 52.89 ? 241 ARG A NH1 1 
ATOM   1595 N NH2 . ARG A 1 247 ? 22.676  8.909   16.419  1.00 54.48 ? 241 ARG A NH2 1 
ATOM   1596 N N   . ILE A 1 248 ? 15.837  12.431  13.853  1.00 47.15 ? 242 ILE A N   1 
ATOM   1597 C CA  . ILE A 1 248 ? 15.454  13.603  14.640  1.00 46.97 ? 242 ILE A CA  1 
ATOM   1598 C C   . ILE A 1 248 ? 14.385  13.200  15.636  1.00 48.42 ? 242 ILE A C   1 
ATOM   1599 O O   . ILE A 1 248 ? 14.388  13.654  16.762  1.00 48.69 ? 242 ILE A O   1 
ATOM   1600 C CB  . ILE A 1 248 ? 14.946  14.811  13.787  1.00 47.49 ? 242 ILE A CB  1 
ATOM   1601 C CG1 . ILE A 1 248 ? 16.045  15.406  12.902  1.00 45.79 ? 242 ILE A CG1 1 
ATOM   1602 C CG2 . ILE A 1 248 ? 14.385  15.916  14.691  1.00 47.24 ? 242 ILE A CG2 1 
ATOM   1603 C CD1 . ILE A 1 248 ? 15.518  16.354  11.871  1.00 44.52 ? 242 ILE A CD1 1 
ATOM   1604 N N   . PHE A 1 249 ? 13.468  12.334  15.230  1.00 50.50 ? 243 PHE A N   1 
ATOM   1605 C CA  . PHE A 1 249 ? 12.483  11.757  16.170  1.00 52.13 ? 243 PHE A CA  1 
ATOM   1606 C C   . PHE A 1 249 ? 13.135  11.051  17.371  1.00 52.85 ? 243 PHE A C   1 
ATOM   1607 O O   . PHE A 1 249 ? 12.821  11.346  18.530  1.00 52.91 ? 243 PHE A O   1 
ATOM   1608 C CB  . PHE A 1 249 ? 11.586  10.765  15.443  1.00 52.43 ? 243 PHE A CB  1 
ATOM   1609 C CG  . PHE A 1 249 ? 10.356  10.382  16.204  1.00 52.81 ? 243 PHE A CG  1 
ATOM   1610 C CD1 . PHE A 1 249 ? 9.367   11.323  16.473  1.00 54.30 ? 243 PHE A CD1 1 
ATOM   1611 C CD2 . PHE A 1 249 ? 10.163  9.076   16.607  1.00 52.78 ? 243 PHE A CD2 1 
ATOM   1612 C CE1 . PHE A 1 249 ? 8.210   10.973  17.160  1.00 54.04 ? 243 PHE A CE1 1 
ATOM   1613 C CE2 . PHE A 1 249 ? 9.021   8.710   17.296  1.00 53.95 ? 243 PHE A CE2 1 
ATOM   1614 C CZ  . PHE A 1 249 ? 8.042   9.660   17.572  1.00 54.82 ? 243 PHE A CZ  1 
ATOM   1615 N N   . TYR A 1 250 ? 14.049  10.131  17.092  1.00 53.67 ? 244 TYR A N   1 
ATOM   1616 C CA  . TYR A 1 250 ? 14.690  9.387   18.154  1.00 55.12 ? 244 TYR A CA  1 
ATOM   1617 C C   . TYR A 1 250 ? 15.420  10.307  19.123  1.00 55.63 ? 244 TYR A C   1 
ATOM   1618 O O   . TYR A 1 250 ? 15.495  10.029  20.321  1.00 55.62 ? 244 TYR A O   1 
ATOM   1619 C CB  . TYR A 1 250 ? 15.631  8.351   17.582  1.00 55.61 ? 244 TYR A CB  1 
ATOM   1620 C CG  . TYR A 1 250 ? 16.668  7.903   18.560  1.00 57.34 ? 244 TYR A CG  1 
ATOM   1621 C CD1 . TYR A 1 250 ? 16.366  6.954   19.549  1.00 58.70 ? 244 TYR A CD1 1 
ATOM   1622 C CD2 . TYR A 1 250 ? 17.959  8.427   18.517  1.00 58.94 ? 244 TYR A CD2 1 
ATOM   1623 C CE1 . TYR A 1 250 ? 17.334  6.532   20.467  1.00 58.59 ? 244 TYR A CE1 1 
ATOM   1624 C CE2 . TYR A 1 250 ? 18.942  8.007   19.433  1.00 59.54 ? 244 TYR A CE2 1 
ATOM   1625 C CZ  . TYR A 1 250 ? 18.621  7.064   20.403  1.00 58.67 ? 244 TYR A CZ  1 
ATOM   1626 O OH  . TYR A 1 250 ? 19.591  6.660   21.305  1.00 59.23 ? 244 TYR A OH  1 
ATOM   1627 N N   . LEU A 1 251 ? 15.944  11.407  18.595  1.00 56.45 ? 245 LEU A N   1 
ATOM   1628 C CA  . LEU A 1 251 ? 16.602  12.418  19.408  1.00 57.14 ? 245 LEU A CA  1 
ATOM   1629 C C   . LEU A 1 251 ? 15.611  13.319  20.118  1.00 58.16 ? 245 LEU A C   1 
ATOM   1630 O O   . LEU A 1 251 ? 15.918  13.867  21.175  1.00 58.52 ? 245 LEU A O   1 
ATOM   1631 C CB  . LEU A 1 251 ? 17.542  13.260  18.561  1.00 56.67 ? 245 LEU A CB  1 
ATOM   1632 C CG  . LEU A 1 251 ? 18.760  12.475  18.098  1.00 56.16 ? 245 LEU A CG  1 
ATOM   1633 C CD1 . LEU A 1 251 ? 19.460  13.180  16.953  1.00 53.00 ? 245 LEU A CD1 1 
ATOM   1634 C CD2 . LEU A 1 251 ? 19.700  12.232  19.292  1.00 54.36 ? 245 LEU A CD2 1 
ATOM   1635 N N   . LYS A 1 252 ? 14.418  13.477  19.562  1.00 59.17 ? 246 LYS A N   1 
ATOM   1636 C CA  . LYS A 1 252 ? 13.406  14.261  20.265  1.00 60.52 ? 246 LYS A CA  1 
ATOM   1637 C C   . LYS A 1 252 ? 12.741  13.459  21.391  1.00 61.19 ? 246 LYS A C   1 
ATOM   1638 O O   . LYS A 1 252 ? 11.965  14.004  22.178  1.00 61.19 ? 246 LYS A O   1 
ATOM   1639 C CB  . LYS A 1 252 ? 12.379  14.828  19.298  1.00 60.30 ? 246 LYS A CB  1 
ATOM   1640 C CG  . LYS A 1 252 ? 11.990  16.231  19.651  1.00 61.52 ? 246 LYS A CG  1 
ATOM   1641 C CD  . LYS A 1 252 ? 11.001  16.833  18.659  1.00 62.46 ? 246 LYS A CD  1 
ATOM   1642 C CE  . LYS A 1 252 ? 10.472  18.131  19.242  1.00 63.44 ? 246 LYS A CE  1 
ATOM   1643 N NZ  . LYS A 1 252 ? 9.103   18.473  18.778  1.00 64.20 ? 246 LYS A NZ  1 
ATOM   1644 N N   . LEU A 1 253 ? 13.058  12.165  21.454  1.00 62.28 ? 247 LEU A N   1 
ATOM   1645 C CA  . LEU A 1 253 ? 12.631  11.295  22.564  1.00 63.54 ? 247 LEU A CA  1 
ATOM   1646 C C   . LEU A 1 253 ? 13.727  11.073  23.626  1.00 64.23 ? 247 LEU A C   1 
ATOM   1647 O O   . LEU A 1 253 ? 13.502  11.354  24.804  1.00 64.31 ? 247 LEU A O   1 
ATOM   1648 C CB  . LEU A 1 253 ? 12.110  9.944   22.057  1.00 63.30 ? 247 LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 253 ? 11.024  9.899   20.982  1.00 63.36 ? 247 LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 253 ? 10.791  8.464   20.513  1.00 61.84 ? 247 LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 253 ? 9.720   10.524  21.471  1.00 64.62 ? 247 LEU A CD2 1 
ATOM   1652 N N   . GLU A 1 254 ? 14.900  10.574  23.219  1.00 65.16 ? 248 GLU A N   1 
ATOM   1653 C CA  . GLU A 1 254 ? 16.048  10.464  24.131  1.00 66.13 ? 248 GLU A CA  1 
ATOM   1654 C C   . GLU A 1 254 ? 16.178  11.774  24.889  1.00 67.15 ? 248 GLU A C   1 
ATOM   1655 O O   . GLU A 1 254 ? 16.691  11.816  26.002  1.00 67.44 ? 248 GLU A O   1 
ATOM   1656 N N   . ASP A 1 255 ? 15.669  12.828  24.255  1.00 68.08 ? 249 ASP A N   1 
ATOM   1657 C CA  . ASP A 1 255 ? 15.617  14.218  24.725  1.00 69.17 ? 249 ASP A CA  1 
ATOM   1658 C C   . ASP A 1 255 ? 16.664  14.723  25.701  1.00 69.57 ? 249 ASP A C   1 
ATOM   1659 O O   . ASP A 1 255 ? 16.348  15.202  26.791  1.00 69.55 ? 249 ASP A O   1 
ATOM   1660 C CB  . ASP A 1 255 ? 14.206  14.634  25.178  1.00 69.60 ? 249 ASP A CB  1 
ATOM   1661 C CG  . ASP A 1 255 ? 13.879  16.095  24.808  1.00 70.92 ? 249 ASP A CG  1 
ATOM   1662 O OD1 . ASP A 1 255 ? 14.154  16.507  23.646  1.00 72.31 ? 249 ASP A OD1 1 
ATOM   1663 O OD2 . ASP A 1 255 ? 13.338  16.824  25.673  1.00 71.22 ? 249 ASP A OD2 1 
ATOM   1664 N N   . LEU A 1 256 ? 17.916  14.622  25.281  1.00 70.28 ? 250 LEU A N   1 
ATOM   1665 C CA  . LEU A 1 256 ? 18.965  15.447  25.828  1.00 70.81 ? 250 LEU A CA  1 
ATOM   1666 C C   . LEU A 1 256 ? 18.669  16.874  25.314  1.00 71.49 ? 250 LEU A C   1 
ATOM   1667 O O   . LEU A 1 256 ? 17.516  17.329  25.414  1.00 71.66 ? 250 LEU A O   1 
ATOM   1668 C CB  . LEU A 1 256 ? 20.328  14.929  25.369  1.00 70.90 ? 250 LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 256 ? 20.692  13.474  25.699  1.00 70.79 ? 250 LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 256 ? 21.508  12.849  24.580  1.00 71.18 ? 250 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 256 ? 21.445  13.374  27.025  1.00 71.15 ? 250 LEU A CD2 1 
ATOM   1672 N N   . VAL A 1 257 ? 19.672  17.555  24.740  1.00 71.97 ? 251 VAL A N   1 
ATOM   1673 C CA  . VAL A 1 257 ? 19.563  18.982  24.316  1.00 72.40 ? 251 VAL A CA  1 
ATOM   1674 C C   . VAL A 1 257 ? 18.320  19.313  23.467  1.00 72.55 ? 251 VAL A C   1 
ATOM   1675 O O   . VAL A 1 257 ? 17.844  18.462  22.715  1.00 72.70 ? 251 VAL A O   1 
ATOM   1676 C CB  . VAL A 1 257 ? 20.849  19.493  23.575  1.00 72.43 ? 251 VAL A CB  1 
ATOM   1677 C CG1 . VAL A 1 257 ? 21.952  19.910  24.578  1.00 71.88 ? 251 VAL A CG1 1 
ATOM   1678 C CG2 . VAL A 1 257 ? 21.354  18.451  22.575  1.00 72.49 ? 251 VAL A CG2 1 
ATOM   1679 N N   . PRO A 1 258 ? 17.763  20.535  23.622  1.00 72.68 ? 252 PRO A N   1 
ATOM   1680 C CA  . PRO A 1 258 ? 16.655  20.909  22.732  1.00 72.83 ? 252 PRO A CA  1 
ATOM   1681 C C   . PRO A 1 258 ? 17.124  21.194  21.294  1.00 72.80 ? 252 PRO A C   1 
ATOM   1682 O O   . PRO A 1 258 ? 18.244  21.686  21.103  1.00 73.02 ? 252 PRO A O   1 
ATOM   1683 C CB  . PRO A 1 258 ? 16.091  22.184  23.379  1.00 72.79 ? 252 PRO A CB  1 
ATOM   1684 C CG  . PRO A 1 258 ? 17.234  22.758  24.163  1.00 73.04 ? 252 PRO A CG  1 
ATOM   1685 C CD  . PRO A 1 258 ? 18.064  21.585  24.619  1.00 72.69 ? 252 PRO A CD  1 
ATOM   1686 N N   . PRO A 1 259 ? 16.283  20.875  20.288  1.00 72.49 ? 253 PRO A N   1 
ATOM   1687 C CA  . PRO A 1 259 ? 16.554  21.273  18.903  1.00 72.00 ? 253 PRO A CA  1 
ATOM   1688 C C   . PRO A 1 259 ? 16.460  22.774  18.745  1.00 71.44 ? 253 PRO A C   1 
ATOM   1689 O O   . PRO A 1 259 ? 15.693  23.405  19.468  1.00 71.28 ? 253 PRO A O   1 
ATOM   1690 C CB  . PRO A 1 259 ? 15.407  20.633  18.106  1.00 71.78 ? 253 PRO A CB  1 
ATOM   1691 C CG  . PRO A 1 259 ? 14.853  19.578  18.994  1.00 72.72 ? 253 PRO A CG  1 
ATOM   1692 C CD  . PRO A 1 259 ? 15.043  20.088  20.398  1.00 72.73 ? 253 PRO A CD  1 
ATOM   1693 N N   . PRO A 1 260 ? 17.231  23.346  17.799  1.00 71.16 ? 254 PRO A N   1 
ATOM   1694 C CA  . PRO A 1 260 ? 17.037  24.727  17.339  1.00 70.67 ? 254 PRO A CA  1 
ATOM   1695 C C   . PRO A 1 260 ? 15.614  24.925  16.819  1.00 70.21 ? 254 PRO A C   1 
ATOM   1696 O O   . PRO A 1 260 ? 15.130  24.093  16.059  1.00 70.28 ? 254 PRO A O   1 
ATOM   1697 C CB  . PRO A 1 260 ? 18.018  24.855  16.178  1.00 70.43 ? 254 PRO A CB  1 
ATOM   1698 C CG  . PRO A 1 260 ? 19.061  23.812  16.435  1.00 70.96 ? 254 PRO A CG  1 
ATOM   1699 C CD  . PRO A 1 260 ? 18.356  22.685  17.111  1.00 71.11 ? 254 PRO A CD  1 
ATOM   1700 N N   . PRO A 1 261 ? 14.958  26.035  17.202  1.00 69.96 ? 255 PRO A N   1 
ATOM   1701 C CA  . PRO A 1 261 ? 13.545  26.239  16.889  1.00 69.79 ? 255 PRO A CA  1 
ATOM   1702 C C   . PRO A 1 261 ? 13.291  26.086  15.394  1.00 69.62 ? 255 PRO A C   1 
ATOM   1703 O O   . PRO A 1 261 ? 12.307  25.468  14.983  1.00 69.47 ? 255 PRO A O   1 
ATOM   1704 C CB  . PRO A 1 261 ? 13.306  27.700  17.299  1.00 69.63 ? 255 PRO A CB  1 
ATOM   1705 C CG  . PRO A 1 261 ? 14.345  27.987  18.295  1.00 69.78 ? 255 PRO A CG  1 
ATOM   1706 C CD  . PRO A 1 261 ? 15.538  27.195  17.904  1.00 69.73 ? 255 PRO A CD  1 
ATOM   1707 N N   . ILE A 1 262 ? 14.197  26.670  14.612  1.00 69.52 ? 256 ILE A N   1 
ATOM   1708 C CA  . ILE A 1 262 ? 14.170  26.653  13.159  1.00 69.13 ? 256 ILE A CA  1 
ATOM   1709 C C   . ILE A 1 262 ? 13.992  25.218  12.657  1.00 69.18 ? 256 ILE A C   1 
ATOM   1710 O O   . ILE A 1 262 ? 13.206  24.955  11.749  1.00 69.26 ? 256 ILE A O   1 
ATOM   1711 C CB  . ILE A 1 262 ? 15.462  27.372  12.547  1.00 69.61 ? 256 ILE A CB  1 
ATOM   1712 C CG1 . ILE A 1 262 ? 16.767  26.943  13.269  1.00 68.84 ? 256 ILE A CG1 1 
ATOM   1713 C CG2 . ILE A 1 262 ? 15.293  28.928  12.567  1.00 69.14 ? 256 ILE A CG2 1 
ATOM   1714 C CD1 . ILE A 1 262 ? 18.072  27.406  12.639  1.00 67.73 ? 256 ILE A CD1 1 
ATOM   1715 N N   . ILE A 1 263 ? 14.680  24.293  13.312  1.00 69.01 ? 257 ILE A N   1 
ATOM   1716 C CA  . ILE A 1 263 ? 14.758  22.903  12.872  1.00 69.01 ? 257 ILE A CA  1 
ATOM   1717 C C   . ILE A 1 263 ? 13.649  22.025  13.425  1.00 69.05 ? 257 ILE A C   1 
ATOM   1718 O O   . ILE A 1 263 ? 13.213  21.077  12.768  1.00 68.55 ? 257 ILE A O   1 
ATOM   1719 C CB  . ILE A 1 263 ? 16.156  22.306  13.183  1.00 68.93 ? 257 ILE A CB  1 
ATOM   1720 C CG1 . ILE A 1 263 ? 17.187  22.891  12.216  1.00 67.04 ? 257 ILE A CG1 1 
ATOM   1721 C CG2 . ILE A 1 263 ? 16.151  20.772  13.105  1.00 69.44 ? 257 ILE A CG2 1 
ATOM   1722 C CD1 . ILE A 1 263 ? 16.633  23.150  10.856  1.00 64.58 ? 257 ILE A CD1 1 
ATOM   1723 N N   . ASP A 1 264 ? 13.221  22.339  14.639  1.00 69.53 ? 258 ASP A N   1 
ATOM   1724 C CA  . ASP A 1 264 ? 12.047  21.726  15.226  1.00 70.27 ? 258 ASP A CA  1 
ATOM   1725 C C   . ASP A 1 264 ? 10.817  22.048  14.377  1.00 70.66 ? 258 ASP A C   1 
ATOM   1726 O O   . ASP A 1 264 ? 10.010  21.168  14.102  1.00 70.74 ? 258 ASP A O   1 
ATOM   1727 C CB  . ASP A 1 264 ? 11.848  22.223  16.665  1.00 70.51 ? 258 ASP A CB  1 
ATOM   1728 C CG  . ASP A 1 264 ? 10.899  21.344  17.459  1.00 70.21 ? 258 ASP A CG  1 
ATOM   1729 O OD1 . ASP A 1 264 ? 11.214  20.150  17.635  1.00 70.03 ? 258 ASP A OD1 1 
ATOM   1730 O OD2 . ASP A 1 264 ? 9.847   21.842  17.905  1.00 69.83 ? 258 ASP A OD2 1 
ATOM   1731 N N   . LYS A 1 265 ? 10.692  23.307  13.954  1.00 71.44 ? 259 LYS A N   1 
ATOM   1732 C CA  . LYS A 1 265 ? 9.577   23.750  13.101  1.00 72.11 ? 259 LYS A CA  1 
ATOM   1733 C C   . LYS A 1 265 ? 9.515   22.926  11.818  1.00 72.39 ? 259 LYS A C   1 
ATOM   1734 O O   . LYS A 1 265 ? 8.466   22.353  11.484  1.00 72.69 ? 259 LYS A O   1 
ATOM   1735 C CB  . LYS A 1 265 ? 9.708   25.234  12.747  1.00 72.09 ? 259 LYS A CB  1 
ATOM   1736 C CG  . LYS A 1 265 ? 8.586   25.773  11.836  1.00 72.42 ? 259 LYS A CG  1 
ATOM   1737 C CD  . LYS A 1 265 ? 9.059   26.991  11.023  1.00 72.50 ? 259 LYS A CD  1 
ATOM   1738 C CE  . LYS A 1 265 ? 8.167   28.222  11.240  1.00 72.12 ? 259 LYS A CE  1 
ATOM   1739 N NZ  . LYS A 1 265 ? 8.320   28.783  12.632  1.00 71.72 ? 259 LYS A NZ  1 
ATOM   1740 N N   . ILE A 1 266 ? 10.639  22.880  11.104  1.00 72.39 ? 260 ILE A N   1 
ATOM   1741 C CA  . ILE A 1 266 ? 10.784  22.014  9.933   1.00 72.49 ? 260 ILE A CA  1 
ATOM   1742 C C   . ILE A 1 266 ? 10.425  20.566  10.255  1.00 72.59 ? 260 ILE A C   1 
ATOM   1743 O O   . ILE A 1 266 ? 9.687   19.928  9.506   1.00 72.83 ? 260 ILE A O   1 
ATOM   1744 C CB  . ILE A 1 266 ? 12.205  22.111  9.317   1.00 72.59 ? 260 ILE A CB  1 
ATOM   1745 C CG1 . ILE A 1 266 ? 12.246  23.250  8.287   1.00 72.41 ? 260 ILE A CG1 1 
ATOM   1746 C CG2 . ILE A 1 266 ? 12.640  20.777  8.700   1.00 71.56 ? 260 ILE A CG2 1 
ATOM   1747 C CD1 . ILE A 1 266 ? 13.487  24.122  8.365   1.00 71.88 ? 260 ILE A CD1 1 
ATOM   1748 N N   . PHE A 1 267 ? 10.914  20.048  11.374  1.00 72.68 ? 261 PHE A N   1 
ATOM   1749 C CA  . PHE A 1 267 ? 10.557  18.684  11.735  1.00 72.89 ? 261 PHE A CA  1 
ATOM   1750 C C   . PHE A 1 267 ? 9.054   18.548  11.890  1.00 73.23 ? 261 PHE A C   1 
ATOM   1751 O O   . PHE A 1 267 ? 8.475   17.514  11.544  1.00 73.18 ? 261 PHE A O   1 
ATOM   1752 C CB  . PHE A 1 267 ? 11.242  18.231  13.014  1.00 72.43 ? 261 PHE A CB  1 
ATOM   1753 C CG  . PHE A 1 267 ? 10.690  16.966  13.550  1.00 71.43 ? 261 PHE A CG  1 
ATOM   1754 C CD1 . PHE A 1 267 ? 11.142  15.751  13.074  1.00 71.15 ? 261 PHE A CD1 1 
ATOM   1755 C CD2 . PHE A 1 267 ? 9.691   16.987  14.511  1.00 71.54 ? 261 PHE A CD2 1 
ATOM   1756 C CE1 . PHE A 1 267 ? 10.625  14.568  13.559  1.00 71.89 ? 261 PHE A CE1 1 
ATOM   1757 C CE2 . PHE A 1 267 ? 9.163   15.810  15.008  1.00 71.90 ? 261 PHE A CE2 1 
ATOM   1758 C CZ  . PHE A 1 267 ? 9.627   14.596  14.529  1.00 72.11 ? 261 PHE A CZ  1 
ATOM   1759 N N   . MET A 1 268 ? 8.435   19.601  12.415  1.00 73.74 ? 262 MET A N   1 
ATOM   1760 C CA  . MET A 1 268 ? 7.011   19.573  12.708  1.00 74.50 ? 262 MET A CA  1 
ATOM   1761 C C   . MET A 1 268 ? 6.121   19.568  11.459  1.00 75.16 ? 262 MET A C   1 
ATOM   1762 O O   . MET A 1 268 ? 5.008   19.059  11.517  1.00 75.34 ? 262 MET A O   1 
ATOM   1763 C CB  . MET A 1 268 ? 6.629   20.694  13.670  1.00 74.28 ? 262 MET A CB  1 
ATOM   1764 C CG  . MET A 1 268 ? 7.240   20.563  15.072  1.00 73.82 ? 262 MET A CG  1 
ATOM   1765 S SD  . MET A 1 268 ? 6.767   19.099  16.023  1.00 71.01 ? 262 MET A SD  1 
ATOM   1766 C CE  . MET A 1 268 ? 6.540   19.876  17.628  1.00 73.45 ? 262 MET A CE  1 
ATOM   1767 N N   . ASP A 1 269 ? 6.605   20.112  10.339  1.00 76.01 ? 263 ASP A N   1 
ATOM   1768 C CA  . ASP A 1 269 ? 5.965   19.868  9.027   1.00 76.82 ? 263 ASP A CA  1 
ATOM   1769 C C   . ASP A 1 269 ? 6.170   18.393  8.628   1.00 77.08 ? 263 ASP A C   1 
ATOM   1770 O O   . ASP A 1 269 ? 7.113   18.018  7.903   1.00 76.99 ? 263 ASP A O   1 
ATOM   1771 C CB  . ASP A 1 269 ? 6.465   20.853  7.960   1.00 76.99 ? 263 ASP A CB  1 
ATOM   1772 C CG  . ASP A 1 269 ? 6.188   22.308  8.335   1.00 77.76 ? 263 ASP A CG  1 
ATOM   1773 O OD1 . ASP A 1 269 ? 5.630   22.532  9.432   1.00 78.46 ? 263 ASP A OD1 1 
ATOM   1774 O OD2 . ASP A 1 269 ? 6.524   23.226  7.545   1.00 78.24 ? 263 ASP A OD2 1 
ATOM   1775 N N   . THR A 1 270 ? 5.247   17.576  9.130   1.00 77.37 ? 264 THR A N   1 
ATOM   1776 C CA  . THR A 1 270 ? 5.442   16.147  9.291   1.00 77.42 ? 264 THR A CA  1 
ATOM   1777 C C   . THR A 1 270 ? 4.376   15.348  8.537   1.00 77.91 ? 264 THR A C   1 
ATOM   1778 O O   . THR A 1 270 ? 4.595   14.909  7.401   1.00 78.26 ? 264 THR A O   1 
ATOM   1779 C CB  . THR A 1 270 ? 5.434   15.780  10.799  1.00 77.19 ? 264 THR A CB  1 
ATOM   1780 O OG1 . THR A 1 270 ? 6.088   14.527  10.986  1.00 77.60 ? 264 THR A OG1 1 
ATOM   1781 C CG2 . THR A 1 270 ? 4.008   15.713  11.372  1.00 76.57 ? 264 THR A CG2 1 
ATOM   1782 N N   . ASN B 1 38  ? 28.451  -32.755 7.037   1.00 50.55 ? 32  ASN B N   1 
ATOM   1783 C CA  . ASN B 1 38  ? 27.348  -31.780 7.145   1.00 50.77 ? 32  ASN B CA  1 
ATOM   1784 C C   . ASN B 1 38  ? 27.193  -30.972 5.853   1.00 50.80 ? 32  ASN B C   1 
ATOM   1785 O O   . ASN B 1 38  ? 28.050  -31.003 4.971   1.00 50.97 ? 32  ASN B O   1 
ATOM   1786 C CB  . ASN B 1 38  ? 27.557  -30.861 8.359   1.00 51.16 ? 32  ASN B CB  1 
ATOM   1787 C CG  . ASN B 1 38  ? 28.057  -29.451 7.975   1.00 52.21 ? 32  ASN B CG  1 
ATOM   1788 O OD1 . ASN B 1 38  ? 28.871  -29.289 7.069   1.00 52.89 ? 32  ASN B OD1 1 
ATOM   1789 N ND2 . ASN B 1 38  ? 27.553  -28.428 8.670   1.00 53.37 ? 32  ASN B ND2 1 
ATOM   1790 N N   . LEU B 1 39  ? 26.110  -30.202 5.783   1.00 50.93 ? 33  LEU B N   1 
ATOM   1791 C CA  . LEU B 1 39  ? 25.619  -29.595 4.546   1.00 50.00 ? 33  LEU B CA  1 
ATOM   1792 C C   . LEU B 1 39  ? 26.335  -28.338 4.116   1.00 50.08 ? 33  LEU B C   1 
ATOM   1793 O O   . LEU B 1 39  ? 26.621  -28.177 2.928   1.00 50.77 ? 33  LEU B O   1 
ATOM   1794 C CB  . LEU B 1 39  ? 24.138  -29.302 4.682   1.00 49.38 ? 33  LEU B CB  1 
ATOM   1795 C CG  . LEU B 1 39  ? 23.404  -28.893 3.431   1.00 49.28 ? 33  LEU B CG  1 
ATOM   1796 C CD1 . LEU B 1 39  ? 23.185  -30.136 2.613   1.00 51.48 ? 33  LEU B CD1 1 
ATOM   1797 C CD2 . LEU B 1 39  ? 22.086  -28.270 3.807   1.00 48.03 ? 33  LEU B CD2 1 
ATOM   1798 N N   . LEU B 1 40  ? 26.620  -27.442 5.054   1.00 49.67 ? 34  LEU B N   1 
ATOM   1799 C CA  . LEU B 1 40  ? 27.266  -26.191 4.696   1.00 49.75 ? 34  LEU B CA  1 
ATOM   1800 C C   . LEU B 1 40  ? 28.535  -26.512 3.986   1.00 49.85 ? 34  LEU B C   1 
ATOM   1801 O O   . LEU B 1 40  ? 28.792  -25.986 2.908   1.00 50.19 ? 34  LEU B O   1 
ATOM   1802 C CB  . LEU B 1 40  ? 27.599  -25.355 5.918   1.00 49.81 ? 34  LEU B CB  1 
ATOM   1803 C CG  . LEU B 1 40  ? 28.161  -23.962 5.623   1.00 50.08 ? 34  LEU B CG  1 
ATOM   1804 C CD1 . LEU B 1 40  ? 27.207  -23.163 4.742   1.00 51.32 ? 34  LEU B CD1 1 
ATOM   1805 C CD2 . LEU B 1 40  ? 28.468  -23.200 6.912   1.00 50.00 ? 34  LEU B CD2 1 
ATOM   1806 N N   . THR B 1 41  ? 29.311  -27.398 4.606   1.00 50.01 ? 35  THR B N   1 
ATOM   1807 C CA  . THR B 1 41  ? 30.572  -27.894 4.064   1.00 49.94 ? 35  THR B CA  1 
ATOM   1808 C C   . THR B 1 41  ? 30.434  -28.385 2.632   1.00 49.86 ? 35  THR B C   1 
ATOM   1809 O O   . THR B 1 41  ? 31.183  -27.951 1.754   1.00 49.93 ? 35  THR B O   1 
ATOM   1810 C CB  . THR B 1 41  ? 31.124  -29.017 4.942   1.00 50.06 ? 35  THR B CB  1 
ATOM   1811 O OG1 . THR B 1 41  ? 31.373  -28.496 6.255   1.00 50.00 ? 35  THR B OG1 1 
ATOM   1812 C CG2 . THR B 1 41  ? 32.415  -29.609 4.356   1.00 50.11 ? 35  THR B CG2 1 
ATOM   1813 N N   . SER B 1 42  ? 29.476  -29.281 2.406   1.00 49.62 ? 36  SER B N   1 
ATOM   1814 C CA  . SER B 1 42  ? 29.209  -29.810 1.074   1.00 49.40 ? 36  SER B CA  1 
ATOM   1815 C C   . SER B 1 42  ? 28.843  -28.721 0.083   1.00 49.16 ? 36  SER B C   1 
ATOM   1816 O O   . SER B 1 42  ? 29.196  -28.802 -1.081  1.00 49.69 ? 36  SER B O   1 
ATOM   1817 C CB  . SER B 1 42  ? 28.087  -30.844 1.124   1.00 49.48 ? 36  SER B CB  1 
ATOM   1818 O OG  . SER B 1 42  ? 28.628  -32.118 1.347   1.00 48.82 ? 36  SER B OG  1 
ATOM   1819 N N   . LEU B 1 43  ? 28.124  -27.707 0.542   1.00 49.09 ? 37  LEU B N   1 
ATOM   1820 C CA  . LEU B 1 43  ? 27.771  -26.564 -0.322  1.00 48.46 ? 37  LEU B CA  1 
ATOM   1821 C C   . LEU B 1 43  ? 28.996  -25.732 -0.662  1.00 48.08 ? 37  LEU B C   1 
ATOM   1822 O O   . LEU B 1 43  ? 29.181  -25.342 -1.822  1.00 49.06 ? 37  LEU B O   1 
ATOM   1823 C CB  . LEU B 1 43  ? 26.654  -25.708 0.292   1.00 48.15 ? 37  LEU B CB  1 
ATOM   1824 C CG  . LEU B 1 43  ? 25.303  -26.432 0.305   1.00 46.28 ? 37  LEU B CG  1 
ATOM   1825 C CD1 . LEU B 1 43  ? 24.370  -25.813 1.288   1.00 46.07 ? 37  LEU B CD1 1 
ATOM   1826 C CD2 . LEU B 1 43  ? 24.702  -26.408 -1.065  1.00 45.21 ? 37  LEU B CD2 1 
ATOM   1827 N N   . VAL B 1 44  ? 29.853  -25.492 0.324   1.00 47.10 ? 38  VAL B N   1 
ATOM   1828 C CA  . VAL B 1 44  ? 31.147  -24.855 0.044   1.00 46.46 ? 38  VAL B CA  1 
ATOM   1829 C C   . VAL B 1 44  ? 31.933  -25.678 -0.985  1.00 46.57 ? 38  VAL B C   1 
ATOM   1830 O O   . VAL B 1 44  ? 32.423  -25.135 -1.970  1.00 46.79 ? 38  VAL B O   1 
ATOM   1831 C CB  . VAL B 1 44  ? 31.992  -24.658 1.313   1.00 45.69 ? 38  VAL B CB  1 
ATOM   1832 C CG1 . VAL B 1 44  ? 33.189  -23.839 1.010   1.00 43.98 ? 38  VAL B CG1 1 
ATOM   1833 C CG2 . VAL B 1 44  ? 31.187  -23.964 2.369   1.00 47.00 ? 38  VAL B CG2 1 
ATOM   1834 N N   . ARG B 1 45  ? 32.030  -26.988 -0.754  1.00 46.48 ? 39  ARG B N   1 
ATOM   1835 C CA  . ARG B 1 45  ? 32.793  -27.881 -1.624  1.00 46.35 ? 39  ARG B CA  1 
ATOM   1836 C C   . ARG B 1 45  ? 32.302  -27.810 -3.044  1.00 45.42 ? 39  ARG B C   1 
ATOM   1837 O O   . ARG B 1 45  ? 33.096  -27.822 -3.963  1.00 44.72 ? 39  ARG B O   1 
ATOM   1838 C CB  . ARG B 1 45  ? 32.744  -29.338 -1.121  1.00 46.86 ? 39  ARG B CB  1 
ATOM   1839 C CG  . ARG B 1 45  ? 34.054  -29.845 -0.516  1.00 49.05 ? 39  ARG B CG  1 
ATOM   1840 C CD  . ARG B 1 45  ? 34.473  -29.107 0.792   1.00 53.83 ? 39  ARG B CD  1 
ATOM   1841 N NE  . ARG B 1 45  ? 35.868  -29.411 1.138   1.00 57.28 ? 39  ARG B NE  1 
ATOM   1842 C CZ  . ARG B 1 45  ? 36.285  -30.505 1.792   1.00 60.14 ? 39  ARG B CZ  1 
ATOM   1843 N NH1 . ARG B 1 45  ? 37.589  -30.683 2.039   1.00 60.21 ? 39  ARG B NH1 1 
ATOM   1844 N NH2 . ARG B 1 45  ? 35.410  -31.425 2.212   1.00 61.36 ? 39  ARG B NH2 1 
ATOM   1845 N N   . ALA B 1 46  ? 30.984  -27.717 -3.204  1.00 45.05 ? 40  ALA B N   1 
ATOM   1846 C CA  . ALA B 1 46  ? 30.356  -27.725 -4.515  1.00 44.69 ? 40  ALA B CA  1 
ATOM   1847 C C   . ALA B 1 46  ? 30.643  -26.429 -5.240  1.00 44.37 ? 40  ALA B C   1 
ATOM   1848 O O   . ALA B 1 46  ? 30.973  -26.432 -6.407  1.00 43.59 ? 40  ALA B O   1 
ATOM   1849 C CB  . ALA B 1 46  ? 28.864  -27.947 -4.377  1.00 44.65 ? 40  ALA B CB  1 
ATOM   1850 N N   . HIS B 1 47  ? 30.545  -25.324 -4.523  1.00 44.85 ? 41  HIS B N   1 
ATOM   1851 C CA  . HIS B 1 47  ? 30.803  -24.026 -5.117  1.00 45.81 ? 41  HIS B CA  1 
ATOM   1852 C C   . HIS B 1 47  ? 32.255  -23.848 -5.585  1.00 47.25 ? 41  HIS B C   1 
ATOM   1853 O O   . HIS B 1 47  ? 32.500  -23.222 -6.642  1.00 48.18 ? 41  HIS B O   1 
ATOM   1854 C CB  . HIS B 1 47  ? 30.446  -22.922 -4.138  1.00 45.20 ? 41  HIS B CB  1 
ATOM   1855 C CG  . HIS B 1 47  ? 31.086  -21.606 -4.456  1.00 43.54 ? 41  HIS B CG  1 
ATOM   1856 N ND1 . HIS B 1 47  ? 30.556  -20.722 -5.367  1.00 44.12 ? 41  HIS B ND1 1 
ATOM   1857 C CD2 . HIS B 1 47  ? 32.208  -21.024 -3.977  1.00 40.47 ? 41  HIS B CD2 1 
ATOM   1858 C CE1 . HIS B 1 47  ? 31.332  -19.659 -5.448  1.00 41.73 ? 41  HIS B CE1 1 
ATOM   1859 N NE2 . HIS B 1 47  ? 32.339  -19.819 -4.610  1.00 41.45 ? 41  HIS B NE2 1 
ATOM   1860 N N   . LEU B 1 48  ? 33.207  -24.345 -4.790  1.00 47.77 ? 42  LEU B N   1 
ATOM   1861 C CA  . LEU B 1 48  ? 34.621  -24.143 -5.072  1.00 48.52 ? 42  LEU B CA  1 
ATOM   1862 C C   . LEU B 1 48  ? 35.074  -25.115 -6.136  1.00 49.37 ? 42  LEU B C   1 
ATOM   1863 O O   . LEU B 1 48  ? 35.515  -24.689 -7.199  1.00 49.83 ? 42  LEU B O   1 
ATOM   1864 C CB  . LEU B 1 48  ? 35.472  -24.289 -3.822  1.00 48.36 ? 42  LEU B CB  1 
ATOM   1865 C CG  . LEU B 1 48  ? 35.406  -23.110 -2.863  1.00 48.18 ? 42  LEU B CG  1 
ATOM   1866 C CD1 . LEU B 1 48  ? 36.072  -23.420 -1.514  1.00 46.73 ? 42  LEU B CD1 1 
ATOM   1867 C CD2 . LEU B 1 48  ? 36.036  -21.909 -3.521  1.00 49.23 ? 42  LEU B CD2 1 
ATOM   1868 N N   . ASP B 1 49  ? 34.933  -26.411 -5.862  1.00 50.12 ? 43  ASP B N   1 
ATOM   1869 C CA  . ASP B 1 49  ? 35.222  -27.464 -6.843  1.00 51.29 ? 43  ASP B CA  1 
ATOM   1870 C C   . ASP B 1 49  ? 34.634  -27.219 -8.240  1.00 51.82 ? 43  ASP B C   1 
ATOM   1871 O O   . ASP B 1 49  ? 35.079  -27.843 -9.208  1.00 52.48 ? 43  ASP B O   1 
ATOM   1872 C CB  . ASP B 1 49  ? 34.752  -28.829 -6.339  1.00 51.46 ? 43  ASP B CB  1 
ATOM   1873 C CG  . ASP B 1 49  ? 35.538  -29.303 -5.127  1.00 53.62 ? 43  ASP B CG  1 
ATOM   1874 O OD1 . ASP B 1 49  ? 36.788  -29.165 -5.109  1.00 55.42 ? 43  ASP B OD1 1 
ATOM   1875 O OD2 . ASP B 1 49  ? 34.904  -29.808 -4.176  1.00 56.00 ? 43  ASP B OD2 1 
ATOM   1876 N N   . SER B 1 50  ? 33.667  -26.313 -8.358  1.00 51.48 ? 44  SER B N   1 
ATOM   1877 C CA  . SER B 1 50  ? 33.049  -26.068 -9.636  1.00 51.38 ? 44  SER B CA  1 
ATOM   1878 C C   . SER B 1 50  ? 33.690  -24.860 -10.256 1.00 52.04 ? 44  SER B C   1 
ATOM   1879 O O   . SER B 1 50  ? 34.085  -24.863 -11.429 1.00 52.04 ? 44  SER B O   1 
ATOM   1880 C CB  . SER B 1 50  ? 31.546  -25.797 -9.459  1.00 51.51 ? 44  SER B CB  1 
ATOM   1881 O OG  . SER B 1 50  ? 31.251  -24.424 -9.161  1.00 49.12 ? 44  SER B OG  1 
ATOM   1882 N N   . GLY B 1 51  ? 33.754  -23.806 -9.447  1.00 52.87 ? 45  GLY B N   1 
ATOM   1883 C CA  . GLY B 1 51  ? 33.956  -22.432 -9.935  1.00 52.61 ? 45  GLY B CA  1 
ATOM   1884 C C   . GLY B 1 51  ? 35.363  -22.410 -10.437 1.00 52.14 ? 45  GLY B C   1 
ATOM   1885 O O   . GLY B 1 51  ? 36.179  -23.219 -9.981  1.00 52.87 ? 45  GLY B O   1 
ATOM   1886 N N   . PRO B 1 52  ? 35.661  -21.514 -11.380 1.00 51.50 ? 46  PRO B N   1 
ATOM   1887 C CA  . PRO B 1 52  ? 36.949  -21.544 -12.060 1.00 51.30 ? 46  PRO B CA  1 
ATOM   1888 C C   . PRO B 1 52  ? 38.098  -21.239 -11.101 1.00 51.17 ? 46  PRO B C   1 
ATOM   1889 O O   . PRO B 1 52  ? 38.261  -20.081 -10.717 1.00 51.13 ? 46  PRO B O   1 
ATOM   1890 C CB  . PRO B 1 52  ? 36.812  -20.440 -13.103 1.00 51.12 ? 46  PRO B CB  1 
ATOM   1891 C CG  . PRO B 1 52  ? 35.374  -20.202 -13.214 1.00 51.24 ? 46  PRO B CG  1 
ATOM   1892 C CD  . PRO B 1 52  ? 34.811  -20.431 -11.870 1.00 51.24 ? 46  PRO B CD  1 
ATOM   1893 N N   . SER B 1 53  ? 38.870  -22.260 -10.704 1.00 50.85 ? 47  SER B N   1 
ATOM   1894 C CA  . SER B 1 53  ? 39.932  -22.047 -9.707  1.00 50.99 ? 47  SER B CA  1 
ATOM   1895 C C   . SER B 1 53  ? 40.991  -21.162 -10.309 1.00 51.03 ? 47  SER B C   1 
ATOM   1896 O O   . SER B 1 53  ? 41.171  -21.142 -11.535 1.00 50.88 ? 47  SER B O   1 
ATOM   1897 C CB  . SER B 1 53  ? 40.544  -23.358 -9.206  1.00 50.90 ? 47  SER B CB  1 
ATOM   1898 O OG  . SER B 1 53  ? 41.593  -23.800 -10.054 1.00 51.95 ? 47  SER B OG  1 
ATOM   1899 N N   . THR B 1 54  ? 41.695  -20.423 -9.463  1.00 51.28 ? 48  THR B N   1 
ATOM   1900 C CA  . THR B 1 54  ? 42.640  -19.456 -9.994  1.00 51.96 ? 48  THR B CA  1 
ATOM   1901 C C   . THR B 1 54  ? 43.685  -20.190 -10.831 1.00 52.14 ? 48  THR B C   1 
ATOM   1902 O O   . THR B 1 54  ? 44.282  -19.617 -11.745 1.00 51.86 ? 48  THR B O   1 
ATOM   1903 C CB  . THR B 1 54  ? 43.285  -18.587 -8.910  1.00 51.78 ? 48  THR B CB  1 
ATOM   1904 O OG1 . THR B 1 54  ? 44.694  -18.811 -8.908  1.00 52.60 ? 48  THR B OG1 1 
ATOM   1905 C CG2 . THR B 1 54  ? 42.679  -18.861 -7.521  1.00 52.10 ? 48  THR B CG2 1 
ATOM   1906 N N   . ALA B 1 55  ? 43.853  -21.474 -10.501 1.00 53.08 ? 49  ALA B N   1 
ATOM   1907 C CA  . ALA B 1 55  ? 44.677  -22.440 -11.243 1.00 53.51 ? 49  ALA B CA  1 
ATOM   1908 C C   . ALA B 1 55  ? 44.413  -22.309 -12.723 1.00 53.83 ? 49  ALA B C   1 
ATOM   1909 O O   . ALA B 1 55  ? 45.246  -21.752 -13.418 1.00 54.26 ? 49  ALA B O   1 
ATOM   1910 C CB  . ALA B 1 55  ? 44.439  -23.884 -10.749 1.00 53.54 ? 49  ALA B CB  1 
ATOM   1911 N N   . LYS B 1 56  ? 43.268  -22.754 -13.235 1.00 54.38 ? 50  LYS B N   1 
ATOM   1912 C CA  . LYS B 1 56  ? 43.049  -22.426 -14.636 1.00 54.89 ? 50  LYS B CA  1 
ATOM   1913 C C   . LYS B 1 56  ? 41.921  -21.532 -15.102 1.00 54.41 ? 50  LYS B C   1 
ATOM   1914 O O   . LYS B 1 56  ? 40.963  -21.989 -15.680 1.00 54.19 ? 50  LYS B O   1 
ATOM   1915 C CB  . LYS B 1 56  ? 43.429  -23.514 -15.636 1.00 55.87 ? 50  LYS B CB  1 
ATOM   1916 C CG  . LYS B 1 56  ? 44.880  -23.348 -16.169 1.00 56.73 ? 50  LYS B CG  1 
ATOM   1917 C CD  . LYS B 1 56  ? 45.287  -21.858 -16.365 1.00 58.24 ? 50  LYS B CD  1 
ATOM   1918 C CE  . LYS B 1 56  ? 46.822  -21.622 -16.448 1.00 58.87 ? 50  LYS B CE  1 
ATOM   1919 N NZ  . LYS B 1 56  ? 47.561  -21.931 -15.170 1.00 58.99 ? 50  LYS B NZ  1 
ATOM   1920 N N   . LEU B 1 57  ? 42.109  -20.253 -14.807 1.00 54.21 ? 51  LEU B N   1 
ATOM   1921 C CA  . LEU B 1 57  ? 41.614  -19.150 -15.575 1.00 54.11 ? 51  LEU B CA  1 
ATOM   1922 C C   . LEU B 1 57  ? 42.348  -19.159 -16.921 1.00 54.40 ? 51  LEU B C   1 
ATOM   1923 O O   . LEU B 1 57  ? 43.314  -19.888 -17.086 1.00 54.65 ? 51  LEU B O   1 
ATOM   1924 C CB  . LEU B 1 57  ? 41.988  -17.853 -14.856 1.00 54.09 ? 51  LEU B CB  1 
ATOM   1925 C CG  . LEU B 1 57  ? 41.735  -17.651 -13.368 1.00 54.05 ? 51  LEU B CG  1 
ATOM   1926 C CD1 . LEU B 1 57  ? 42.546  -16.499 -12.837 1.00 51.97 ? 51  LEU B CD1 1 
ATOM   1927 C CD2 . LEU B 1 57  ? 40.258  -17.401 -13.146 1.00 55.67 ? 51  LEU B CD2 1 
ATOM   1928 N N   . ASP B 1 58  ? 41.925  -18.310 -17.857 1.00 54.55 ? 52  ASP B N   1 
ATOM   1929 C CA  . ASP B 1 58  ? 42.457  -18.293 -19.213 1.00 54.66 ? 52  ASP B CA  1 
ATOM   1930 C C   . ASP B 1 58  ? 42.581  -16.886 -19.789 1.00 54.69 ? 52  ASP B C   1 
ATOM   1931 O O   . ASP B 1 58  ? 41.589  -16.270 -20.213 1.00 54.98 ? 52  ASP B O   1 
ATOM   1932 C CB  . ASP B 1 58  ? 41.585  -19.162 -20.129 1.00 54.91 ? 52  ASP B CB  1 
ATOM   1933 C CG  . ASP B 1 58  ? 42.121  -19.255 -21.559 1.00 56.12 ? 52  ASP B CG  1 
ATOM   1934 O OD1 . ASP B 1 58  ? 41.417  -19.897 -22.356 1.00 57.94 ? 52  ASP B OD1 1 
ATOM   1935 O OD2 . ASP B 1 58  ? 43.210  -18.707 -21.899 1.00 55.61 ? 52  ASP B OD2 1 
ATOM   1936 N N   . TYR B 1 59  ? 43.813  -16.398 -19.846 1.00 54.54 ? 53  TYR B N   1 
ATOM   1937 C CA  . TYR B 1 59  ? 44.057  -15.060 -20.361 1.00 54.37 ? 53  TYR B CA  1 
ATOM   1938 C C   . TYR B 1 59  ? 44.375  -15.030 -21.854 1.00 55.00 ? 53  TYR B C   1 
ATOM   1939 O O   . TYR B 1 59  ? 44.474  -13.952 -22.440 1.00 55.50 ? 53  TYR B O   1 
ATOM   1940 C CB  . TYR B 1 59  ? 45.167  -14.390 -19.569 1.00 53.35 ? 53  TYR B CB  1 
ATOM   1941 C CG  . TYR B 1 59  ? 44.760  -14.082 -18.175 1.00 51.23 ? 53  TYR B CG  1 
ATOM   1942 C CD1 . TYR B 1 59  ? 45.000  -14.985 -17.135 1.00 49.37 ? 53  TYR B CD1 1 
ATOM   1943 C CD2 . TYR B 1 59  ? 44.130  -12.882 -17.885 1.00 50.40 ? 53  TYR B CD2 1 
ATOM   1944 C CE1 . TYR B 1 59  ? 44.608  -14.687 -15.812 1.00 49.45 ? 53  TYR B CE1 1 
ATOM   1945 C CE2 . TYR B 1 59  ? 43.733  -12.567 -16.583 1.00 49.92 ? 53  TYR B CE2 1 
ATOM   1946 C CZ  . TYR B 1 59  ? 43.965  -13.474 -15.561 1.00 50.68 ? 53  TYR B CZ  1 
ATOM   1947 O OH  . TYR B 1 59  ? 43.556  -13.131 -14.306 1.00 51.93 ? 53  TYR B OH  1 
ATOM   1948 N N   . SER B 1 60  ? 44.512  -16.201 -22.474 1.00 55.55 ? 54  SER B N   1 
ATOM   1949 C CA  . SER B 1 60  ? 44.910  -16.279 -23.884 1.00 55.99 ? 54  SER B CA  1 
ATOM   1950 C C   . SER B 1 60  ? 44.104  -15.331 -24.789 1.00 56.41 ? 54  SER B C   1 
ATOM   1951 O O   . SER B 1 60  ? 44.489  -15.085 -25.938 1.00 56.58 ? 54  SER B O   1 
ATOM   1952 C CB  . SER B 1 60  ? 44.811  -17.719 -24.407 1.00 55.86 ? 54  SER B CB  1 
ATOM   1953 O OG  . SER B 1 60  ? 43.514  -17.976 -24.929 1.00 55.46 ? 54  SER B OG  1 
ATOM   1954 N N   . LYS B 1 61  ? 42.997  -14.805 -24.264 1.00 56.86 ? 55  LYS B N   1 
ATOM   1955 C CA  . LYS B 1 61  ? 42.115  -13.923 -25.027 1.00 57.21 ? 55  LYS B CA  1 
ATOM   1956 C C   . LYS B 1 61  ? 41.994  -12.494 -24.500 1.00 57.21 ? 55  LYS B C   1 
ATOM   1957 O O   . LYS B 1 61  ? 41.431  -11.631 -25.177 1.00 56.89 ? 55  LYS B O   1 
ATOM   1958 C CB  . LYS B 1 61  ? 40.730  -14.542 -25.134 1.00 57.11 ? 55  LYS B CB  1 
ATOM   1959 C CG  . LYS B 1 61  ? 40.618  -15.537 -26.241 1.00 57.99 ? 55  LYS B CG  1 
ATOM   1960 C CD  . LYS B 1 61  ? 39.233  -15.469 -26.860 1.00 59.70 ? 55  LYS B CD  1 
ATOM   1961 C CE  . LYS B 1 61  ? 39.043  -16.564 -27.902 1.00 60.81 ? 55  LYS B CE  1 
ATOM   1962 N NZ  . LYS B 1 61  ? 38.908  -17.914 -27.271 1.00 58.94 ? 55  LYS B NZ  1 
ATOM   1963 N N   . PHE B 1 62  ? 42.510  -12.251 -23.301 1.00 57.61 ? 56  PHE B N   1 
ATOM   1964 C CA  . PHE B 1 62  ? 42.338  -10.965 -22.638 1.00 58.31 ? 56  PHE B CA  1 
ATOM   1965 C C   . PHE B 1 62  ? 42.926  -9.878  -23.508 1.00 59.49 ? 56  PHE B C   1 
ATOM   1966 O O   . PHE B 1 62  ? 43.732  -10.160 -24.392 1.00 60.02 ? 56  PHE B O   1 
ATOM   1967 C CB  . PHE B 1 62  ? 43.013  -10.963 -21.263 1.00 57.83 ? 56  PHE B CB  1 
ATOM   1968 C CG  . PHE B 1 62  ? 42.729  -9.736  -20.444 1.00 56.82 ? 56  PHE B CG  1 
ATOM   1969 C CD1 . PHE B 1 62  ? 41.475  -9.525  -19.887 1.00 56.16 ? 56  PHE B CD1 1 
ATOM   1970 C CD2 . PHE B 1 62  ? 43.709  -8.786  -20.231 1.00 55.91 ? 56  PHE B CD2 1 
ATOM   1971 C CE1 . PHE B 1 62  ? 41.212  -8.376  -19.126 1.00 56.10 ? 56  PHE B CE1 1 
ATOM   1972 C CE2 . PHE B 1 62  ? 43.445  -7.621  -19.472 1.00 56.56 ? 56  PHE B CE2 1 
ATOM   1973 C CZ  . PHE B 1 62  ? 42.205  -7.420  -18.921 1.00 55.67 ? 56  PHE B CZ  1 
ATOM   1974 N N   . GLN B 1 63  ? 42.510  -8.640  -23.270 1.00 60.52 ? 57  GLN B N   1 
ATOM   1975 C CA  . GLN B 1 63  ? 43.070  -7.489  -23.945 1.00 61.46 ? 57  GLN B CA  1 
ATOM   1976 C C   . GLN B 1 63  ? 42.823  -6.313  -23.040 1.00 61.82 ? 57  GLN B C   1 
ATOM   1977 O O   . GLN B 1 63  ? 41.704  -5.807  -22.989 1.00 62.00 ? 57  GLN B O   1 
ATOM   1978 C CB  . GLN B 1 63  ? 42.356  -7.255  -25.278 1.00 61.57 ? 57  GLN B CB  1 
ATOM   1979 C CG  . GLN B 1 63  ? 43.083  -6.333  -26.248 1.00 62.99 ? 57  GLN B CG  1 
ATOM   1980 C CD  . GLN B 1 63  ? 43.544  -7.060  -27.512 1.00 64.81 ? 57  GLN B CD  1 
ATOM   1981 O OE1 . GLN B 1 63  ? 44.738  -7.324  -27.697 1.00 64.04 ? 57  GLN B OE1 1 
ATOM   1982 N NE2 . GLN B 1 63  ? 42.589  -7.395  -28.384 1.00 65.17 ? 57  GLN B NE2 1 
ATOM   1983 N N   . GLU B 1 64  ? 43.841  -5.885  -22.302 1.00 62.65 ? 58  GLU B N   1 
ATOM   1984 C CA  . GLU B 1 64  ? 43.720  -4.638  -21.534 1.00 63.59 ? 58  GLU B CA  1 
ATOM   1985 C C   . GLU B 1 64  ? 43.440  -3.501  -22.534 1.00 63.61 ? 58  GLU B C   1 
ATOM   1986 O O   . GLU B 1 64  ? 44.317  -3.122  -23.289 1.00 63.81 ? 58  GLU B O   1 
ATOM   1987 C CB  . GLU B 1 64  ? 44.958  -4.390  -20.649 1.00 63.26 ? 58  GLU B CB  1 
ATOM   1988 C CG  . GLU B 1 64  ? 44.953  -3.050  -19.876 1.00 65.42 ? 58  GLU B CG  1 
ATOM   1989 C CD  . GLU B 1 64  ? 43.995  -2.993  -18.667 1.00 66.49 ? 58  GLU B CD  1 
ATOM   1990 O OE1 . GLU B 1 64  ? 44.410  -3.380  -17.549 1.00 67.37 ? 58  GLU B OE1 1 
ATOM   1991 O OE2 . GLU B 1 64  ? 42.849  -2.512  -18.828 1.00 65.42 ? 58  GLU B OE2 1 
ATOM   1992 N N   . LEU B 1 65  ? 42.195  -3.015  -22.564 1.00 64.00 ? 59  LEU B N   1 
ATOM   1993 C CA  . LEU B 1 65  ? 41.724  -2.058  -23.591 1.00 64.20 ? 59  LEU B CA  1 
ATOM   1994 C C   . LEU B 1 65  ? 41.485  -0.653  -23.055 1.00 64.43 ? 59  LEU B C   1 
ATOM   1995 O O   . LEU B 1 65  ? 40.931  -0.471  -21.963 1.00 64.71 ? 59  LEU B O   1 
ATOM   1996 C CB  . LEU B 1 65  ? 40.447  -2.554  -24.292 1.00 63.91 ? 59  LEU B CB  1 
ATOM   1997 C CG  . LEU B 1 65  ? 40.538  -3.616  -25.395 1.00 63.95 ? 59  LEU B CG  1 
ATOM   1998 C CD1 . LEU B 1 65  ? 39.151  -4.013  -25.863 1.00 63.20 ? 59  LEU B CD1 1 
ATOM   1999 C CD2 . LEU B 1 65  ? 41.381  -3.161  -26.584 1.00 63.90 ? 59  LEU B CD2 1 
ATOM   2000 N N   . VAL B 1 66  ? 41.890  0.333   -23.852 1.00 64.84 ? 60  VAL B N   1 
ATOM   2001 C CA  . VAL B 1 66  ? 41.867  1.732   -23.462 1.00 65.10 ? 60  VAL B CA  1 
ATOM   2002 C C   . VAL B 1 66  ? 40.647  2.379   -24.055 1.00 65.71 ? 60  VAL B C   1 
ATOM   2003 O O   . VAL B 1 66  ? 40.003  3.189   -23.400 1.00 65.76 ? 60  VAL B O   1 
ATOM   2004 C CB  . VAL B 1 66  ? 43.112  2.482   -23.978 1.00 64.98 ? 60  VAL B CB  1 
ATOM   2005 C CG1 . VAL B 1 66  ? 43.209  3.863   -23.364 1.00 64.58 ? 60  VAL B CG1 1 
ATOM   2006 C CG2 . VAL B 1 66  ? 44.365  1.695   -23.694 1.00 64.38 ? 60  VAL B CG2 1 
ATOM   2007 N N   . LEU B 1 67  ? 40.334  2.005   -25.294 1.00 66.71 ? 61  LEU B N   1 
ATOM   2008 C CA  . LEU B 1 67  ? 39.255  2.637   -26.066 1.00 67.93 ? 61  LEU B CA  1 
ATOM   2009 C C   . LEU B 1 67  ? 38.098  1.711   -26.464 1.00 68.76 ? 61  LEU B C   1 
ATOM   2010 O O   . LEU B 1 67  ? 38.318  0.537   -26.778 1.00 68.44 ? 61  LEU B O   1 
ATOM   2011 C CB  . LEU B 1 67  ? 39.823  3.284   -27.332 1.00 67.97 ? 61  LEU B CB  1 
ATOM   2012 C CG  . LEU B 1 67  ? 40.696  4.523   -27.179 1.00 67.92 ? 61  LEU B CG  1 
ATOM   2013 C CD1 . LEU B 1 67  ? 40.981  5.097   -28.555 1.00 68.06 ? 61  LEU B CD1 1 
ATOM   2014 C CD2 . LEU B 1 67  ? 40.016  5.551   -26.303 1.00 67.54 ? 61  LEU B CD2 1 
ATOM   2015 N N   . PRO B 1 68  ? 36.859  2.254   -26.493 1.00 69.95 ? 62  PRO B N   1 
ATOM   2016 C CA  . PRO B 1 68  ? 35.692  1.424   -26.817 1.00 70.93 ? 62  PRO B CA  1 
ATOM   2017 C C   . PRO B 1 68  ? 35.682  1.051   -28.288 1.00 71.91 ? 62  PRO B C   1 
ATOM   2018 O O   . PRO B 1 68  ? 36.492  1.573   -29.074 1.00 72.31 ? 62  PRO B O   1 
ATOM   2019 C CB  . PRO B 1 68  ? 34.487  2.331   -26.495 1.00 70.79 ? 62  PRO B CB  1 
ATOM   2020 C CG  . PRO B 1 68  ? 35.048  3.546   -25.821 1.00 70.28 ? 62  PRO B CG  1 
ATOM   2021 C CD  . PRO B 1 68  ? 36.471  3.658   -26.255 1.00 70.24 ? 62  PRO B CD  1 
ATOM   2022 N N   . HIS B 1 69  ? 34.780  0.150   -28.660 1.00 72.68 ? 63  HIS B N   1 
ATOM   2023 C CA  . HIS B 1 69  ? 34.688  -0.255  -30.055 1.00 73.20 ? 63  HIS B CA  1 
ATOM   2024 C C   . HIS B 1 69  ? 33.507  0.418   -30.793 1.00 73.07 ? 63  HIS B C   1 
ATOM   2025 O O   . HIS B 1 69  ? 32.947  1.432   -30.345 1.00 73.07 ? 63  HIS B O   1 
ATOM   2026 C CB  . HIS B 1 69  ? 34.757  -1.791  -30.216 1.00 73.50 ? 63  HIS B CB  1 
ATOM   2027 C CG  . HIS B 1 69  ? 36.158  -2.338  -30.250 1.00 74.84 ? 63  HIS B CG  1 
ATOM   2028 N ND1 . HIS B 1 69  ? 36.859  -2.673  -29.108 1.00 76.07 ? 63  HIS B ND1 1 
ATOM   2029 C CD2 . HIS B 1 69  ? 36.988  -2.605  -31.290 1.00 75.72 ? 63  HIS B CD2 1 
ATOM   2030 C CE1 . HIS B 1 69  ? 38.059  -3.120  -29.442 1.00 76.25 ? 63  HIS B CE1 1 
ATOM   2031 N NE2 . HIS B 1 69  ? 38.163  -3.091  -30.760 1.00 76.27 ? 63  HIS B NE2 1 
ATOM   2032 N N   . PHE B 1 70  ? 33.170  -0.145  -31.944 1.00 72.87 ? 64  PHE B N   1 
ATOM   2033 C CA  . PHE B 1 70  ? 32.364  0.540   -32.927 1.00 72.88 ? 64  PHE B CA  1 
ATOM   2034 C C   . PHE B 1 70  ? 31.727  -0.482  -33.878 1.00 72.62 ? 64  PHE B C   1 
ATOM   2035 O O   . PHE B 1 70  ? 32.226  -1.604  -34.038 1.00 72.41 ? 64  PHE B O   1 
ATOM   2036 C CB  . PHE B 1 70  ? 33.232  1.579   -33.681 1.00 73.44 ? 64  PHE B CB  1 
ATOM   2037 C CG  . PHE B 1 70  ? 34.740  1.335   -33.561 1.00 74.03 ? 64  PHE B CG  1 
ATOM   2038 C CD1 . PHE B 1 70  ? 35.404  0.487   -34.453 1.00 74.57 ? 64  PHE B CD1 1 
ATOM   2039 C CD2 . PHE B 1 70  ? 35.482  1.951   -32.548 1.00 74.18 ? 64  PHE B CD2 1 
ATOM   2040 C CE1 . PHE B 1 70  ? 36.782  0.250   -34.338 1.00 74.83 ? 64  PHE B CE1 1 
ATOM   2041 C CE2 . PHE B 1 70  ? 36.860  1.719   -32.414 1.00 74.98 ? 64  PHE B CE2 1 
ATOM   2042 C CZ  . PHE B 1 70  ? 37.513  0.870   -33.315 1.00 74.98 ? 64  PHE B CZ  1 
ATOM   2043 N N   . GLY B 1 71  ? 30.610  -0.094  -34.487 1.00 72.21 ? 65  GLY B N   1 
ATOM   2044 C CA  . GLY B 1 71  ? 29.903  -0.952  -35.421 1.00 71.72 ? 65  GLY B CA  1 
ATOM   2045 C C   . GLY B 1 71  ? 29.144  -2.060  -34.707 1.00 71.46 ? 65  GLY B C   1 
ATOM   2046 O O   . GLY B 1 71  ? 29.440  -2.390  -33.550 1.00 71.03 ? 65  GLY B O   1 
ATOM   2047 N N   . LYS B 1 72  ? 28.154  -2.619  -35.407 1.00 70.89 ? 66  LYS B N   1 
ATOM   2048 C CA  . LYS B 1 72  ? 27.372  -3.727  -34.906 1.00 70.51 ? 66  LYS B CA  1 
ATOM   2049 C C   . LYS B 1 72  ? 28.327  -4.838  -34.508 1.00 69.99 ? 66  LYS B C   1 
ATOM   2050 O O   . LYS B 1 72  ? 29.523  -4.787  -34.852 1.00 70.01 ? 66  LYS B O   1 
ATOM   2051 C CB  . LYS B 1 72  ? 26.446  -4.273  -36.006 1.00 71.01 ? 66  LYS B CB  1 
ATOM   2052 C CG  . LYS B 1 72  ? 25.509  -3.270  -36.682 1.00 71.82 ? 66  LYS B CG  1 
ATOM   2053 C CD  . LYS B 1 72  ? 24.450  -2.682  -35.736 1.00 72.43 ? 66  LYS B CD  1 
ATOM   2054 C CE  . LYS B 1 72  ? 23.619  -3.744  -35.062 1.00 71.64 ? 66  LYS B CE  1 
ATOM   2055 N NZ  . LYS B 1 72  ? 23.177  -4.761  -36.033 1.00 72.75 ? 66  LYS B NZ  1 
ATOM   2056 N N   . GLU B 1 73  ? 27.803  -5.835  -33.792 1.00 68.51 ? 67  GLU B N   1 
ATOM   2057 C CA  . GLU B 1 73  ? 28.464  -7.130  -33.700 1.00 67.18 ? 67  GLU B CA  1 
ATOM   2058 C C   . GLU B 1 73  ? 28.768  -7.630  -35.105 1.00 66.24 ? 67  GLU B C   1 
ATOM   2059 O O   . GLU B 1 73  ? 28.086  -7.271  -36.076 1.00 65.76 ? 67  GLU B O   1 
ATOM   2060 C CB  . GLU B 1 73  ? 27.556  -8.181  -33.044 1.00 67.04 ? 67  GLU B CB  1 
ATOM   2061 C CG  . GLU B 1 73  ? 26.446  -7.640  -32.172 1.00 66.95 ? 67  GLU B CG  1 
ATOM   2062 C CD  . GLU B 1 73  ? 25.340  -6.966  -32.958 1.00 66.06 ? 67  GLU B CD  1 
ATOM   2063 O OE1 . GLU B 1 73  ? 24.498  -7.681  -33.536 1.00 64.27 ? 67  GLU B OE1 1 
ATOM   2064 O OE2 . GLU B 1 73  ? 25.316  -5.718  -32.982 1.00 66.14 ? 67  GLU B OE2 1 
ATOM   2065 N N   . ASP B 1 74  ? 29.805  -8.450  -35.204 1.00 65.34 ? 68  ASP B N   1 
ATOM   2066 C CA  . ASP B 1 74  ? 29.875  -9.441  -36.269 1.00 64.42 ? 68  ASP B CA  1 
ATOM   2067 C C   . ASP B 1 74  ? 29.571  -10.830 -35.685 1.00 63.47 ? 68  ASP B C   1 
ATOM   2068 O O   . ASP B 1 74  ? 29.215  -10.958 -34.514 1.00 62.93 ? 68  ASP B O   1 
ATOM   2069 C CB  . ASP B 1 74  ? 31.217  -9.402  -37.004 1.00 64.54 ? 68  ASP B CB  1 
ATOM   2070 C CG  . ASP B 1 74  ? 32.409  -9.678  -36.097 1.00 65.05 ? 68  ASP B CG  1 
ATOM   2071 O OD1 . ASP B 1 74  ? 33.504  -9.946  -36.643 1.00 66.31 ? 68  ASP B OD1 1 
ATOM   2072 O OD2 . ASP B 1 74  ? 32.271  -9.623  -34.859 1.00 64.81 ? 68  ASP B OD2 1 
ATOM   2073 N N   . ALA B 1 75  ? 29.716  -11.855 -36.513 1.00 62.54 ? 69  ALA B N   1 
ATOM   2074 C CA  . ALA B 1 75  ? 29.338  -13.206 -36.153 1.00 61.48 ? 69  ALA B CA  1 
ATOM   2075 C C   . ALA B 1 75  ? 30.108  -13.710 -34.948 1.00 60.98 ? 69  ALA B C   1 
ATOM   2076 O O   . ALA B 1 75  ? 29.525  -14.360 -34.088 1.00 61.10 ? 69  ALA B O   1 
ATOM   2077 C CB  . ALA B 1 75  ? 29.537  -14.128 -37.324 1.00 61.44 ? 69  ALA B CB  1 
ATOM   2078 N N   . GLY B 1 76  ? 31.407  -13.405 -34.881 1.00 60.38 ? 70  GLY B N   1 
ATOM   2079 C CA  . GLY B 1 76  ? 32.273  -13.888 -33.793 1.00 58.90 ? 70  GLY B CA  1 
ATOM   2080 C C   . GLY B 1 76  ? 31.814  -13.410 -32.430 1.00 58.15 ? 70  GLY B C   1 
ATOM   2081 O O   . GLY B 1 76  ? 31.676  -14.210 -31.498 1.00 58.71 ? 70  GLY B O   1 
ATOM   2082 N N   . ASP B 1 77  ? 31.580  -12.098 -32.327 1.00 56.90 ? 71  ASP B N   1 
ATOM   2083 C CA  . ASP B 1 77  ? 31.014  -11.434 -31.144 1.00 55.38 ? 71  ASP B CA  1 
ATOM   2084 C C   . ASP B 1 77  ? 29.801  -12.139 -30.579 1.00 54.13 ? 71  ASP B C   1 
ATOM   2085 O O   . ASP B 1 77  ? 29.602  -12.158 -29.364 1.00 53.95 ? 71  ASP B O   1 
ATOM   2086 C CB  . ASP B 1 77  ? 30.559  -10.024 -31.511 1.00 55.66 ? 71  ASP B CB  1 
ATOM   2087 C CG  . ASP B 1 77  ? 31.686  -9.078  -31.626 1.00 56.09 ? 71  ASP B CG  1 
ATOM   2088 O OD1 . ASP B 1 77  ? 32.454  -8.977  -30.652 1.00 58.34 ? 71  ASP B OD1 1 
ATOM   2089 O OD2 . ASP B 1 77  ? 31.807  -8.432  -32.685 1.00 57.53 ? 71  ASP B OD2 1 
ATOM   2090 N N   . VAL B 1 78  ? 28.970  -12.656 -31.480 1.00 52.37 ? 72  VAL B N   1 
ATOM   2091 C CA  . VAL B 1 78  ? 27.739  -13.317 -31.109 1.00 51.01 ? 72  VAL B CA  1 
ATOM   2092 C C   . VAL B 1 78  ? 28.016  -14.777 -30.774 1.00 50.21 ? 72  VAL B C   1 
ATOM   2093 O O   . VAL B 1 78  ? 27.401  -15.324 -29.878 1.00 50.17 ? 72  VAL B O   1 
ATOM   2094 C CB  . VAL B 1 78  ? 26.684  -13.173 -32.211 1.00 50.89 ? 72  VAL B CB  1 
ATOM   2095 C CG1 . VAL B 1 78  ? 25.430  -14.010 -31.899 1.00 50.66 ? 72  VAL B CG1 1 
ATOM   2096 C CG2 . VAL B 1 78  ? 26.321  -11.711 -32.382 1.00 50.96 ? 72  VAL B CG2 1 
ATOM   2097 N N   . GLN B 1 79  ? 28.957  -15.389 -31.492 1.00 49.61 ? 73  GLN B N   1 
ATOM   2098 C CA  . GLN B 1 79  ? 29.369  -16.783 -31.274 1.00 48.49 ? 73  GLN B CA  1 
ATOM   2099 C C   . GLN B 1 79  ? 30.012  -16.927 -29.885 1.00 47.80 ? 73  GLN B C   1 
ATOM   2100 O O   . GLN B 1 79  ? 29.761  -17.879 -29.162 1.00 47.29 ? 73  GLN B O   1 
ATOM   2101 C CB  . GLN B 1 79  ? 30.316  -17.240 -32.389 1.00 48.11 ? 73  GLN B CB  1 
ATOM   2102 C CG  . GLN B 1 79  ? 30.685  -18.708 -32.365 1.00 48.80 ? 73  GLN B CG  1 
ATOM   2103 C CD  . GLN B 1 79  ? 29.467  -19.589 -32.151 1.00 50.78 ? 73  GLN B CD  1 
ATOM   2104 O OE1 . GLN B 1 79  ? 28.855  -20.082 -33.106 1.00 51.30 ? 73  GLN B OE1 1 
ATOM   2105 N NE2 . GLN B 1 79  ? 29.089  -19.769 -30.892 1.00 50.65 ? 73  GLN B NE2 1 
ATOM   2106 N N   . GLN B 1 80  ? 30.806  -15.940 -29.507 1.00 47.17 ? 74  GLN B N   1 
ATOM   2107 C CA  . GLN B 1 80  ? 31.376  -15.916 -28.185 1.00 46.86 ? 74  GLN B CA  1 
ATOM   2108 C C   . GLN B 1 80  ? 30.282  -15.678 -27.128 1.00 46.47 ? 74  GLN B C   1 
ATOM   2109 O O   . GLN B 1 80  ? 30.334  -16.261 -26.037 1.00 46.90 ? 74  GLN B O   1 
ATOM   2110 C CB  . GLN B 1 80  ? 32.439  -14.828 -28.102 1.00 46.84 ? 74  GLN B CB  1 
ATOM   2111 C CG  . GLN B 1 80  ? 33.624  -15.262 -27.272 1.00 48.36 ? 74  GLN B CG  1 
ATOM   2112 C CD  . GLN B 1 80  ? 34.474  -14.099 -26.802 1.00 50.83 ? 74  GLN B CD  1 
ATOM   2113 O OE1 . GLN B 1 80  ? 33.964  -13.011 -26.471 1.00 50.48 ? 74  GLN B OE1 1 
ATOM   2114 N NE2 . GLN B 1 80  ? 35.787  -14.324 -26.757 1.00 51.28 ? 74  GLN B NE2 1 
ATOM   2115 N N   . PHE B 1 81  ? 29.300  -14.824 -27.452 1.00 44.72 ? 75  PHE B N   1 
ATOM   2116 C CA  . PHE B 1 81  ? 28.238  -14.529 -26.539 1.00 43.02 ? 75  PHE B CA  1 
ATOM   2117 C C   . PHE B 1 81  ? 27.603  -15.854 -26.166 1.00 42.63 ? 75  PHE B C   1 
ATOM   2118 O O   . PHE B 1 81  ? 27.570  -16.221 -25.008 1.00 42.46 ? 75  PHE B O   1 
ATOM   2119 C CB  . PHE B 1 81  ? 27.226  -13.550 -27.159 1.00 42.82 ? 75  PHE B CB  1 
ATOM   2120 C CG  . PHE B 1 81  ? 26.019  -13.278 -26.276 1.00 42.62 ? 75  PHE B CG  1 
ATOM   2121 C CD1 . PHE B 1 81  ? 26.119  -12.466 -25.159 1.00 44.10 ? 75  PHE B CD1 1 
ATOM   2122 C CD2 . PHE B 1 81  ? 24.789  -13.857 -26.556 1.00 43.19 ? 75  PHE B CD2 1 
ATOM   2123 C CE1 . PHE B 1 81  ? 24.996  -12.226 -24.330 1.00 46.43 ? 75  PHE B CE1 1 
ATOM   2124 C CE2 . PHE B 1 81  ? 23.663  -13.621 -25.743 1.00 43.02 ? 75  PHE B CE2 1 
ATOM   2125 C CZ  . PHE B 1 81  ? 23.767  -12.806 -24.630 1.00 44.07 ? 75  PHE B CZ  1 
ATOM   2126 N N   . TYR B 1 82  ? 27.131  -16.585 -27.165 1.00 42.64 ? 76  TYR B N   1 
ATOM   2127 C CA  . TYR B 1 82  ? 26.559  -17.894 -26.947 1.00 42.62 ? 76  TYR B CA  1 
ATOM   2128 C C   . TYR B 1 82  ? 27.570  -18.848 -26.319 1.00 42.59 ? 76  TYR B C   1 
ATOM   2129 O O   . TYR B 1 82  ? 27.231  -19.509 -25.336 1.00 42.94 ? 76  TYR B O   1 
ATOM   2130 C CB  . TYR B 1 82  ? 25.959  -18.462 -28.234 1.00 43.05 ? 76  TYR B CB  1 
ATOM   2131 C CG  . TYR B 1 82  ? 24.761  -17.675 -28.747 1.00 44.13 ? 76  TYR B CG  1 
ATOM   2132 C CD1 . TYR B 1 82  ? 23.644  -17.439 -27.922 1.00 45.02 ? 76  TYR B CD1 1 
ATOM   2133 C CD2 . TYR B 1 82  ? 24.731  -17.183 -30.054 1.00 43.04 ? 76  TYR B CD2 1 
ATOM   2134 C CE1 . TYR B 1 82  ? 22.546  -16.723 -28.370 1.00 43.87 ? 76  TYR B CE1 1 
ATOM   2135 C CE2 . TYR B 1 82  ? 23.637  -16.482 -30.522 1.00 44.81 ? 76  TYR B CE2 1 
ATOM   2136 C CZ  . TYR B 1 82  ? 22.546  -16.247 -29.669 1.00 45.31 ? 76  TYR B CZ  1 
ATOM   2137 O OH  . TYR B 1 82  ? 21.455  -15.537 -30.135 1.00 45.83 ? 76  TYR B OH  1 
ATOM   2138 N N   . ASP B 1 83  ? 28.802  -18.905 -26.829 1.00 41.69 ? 77  ASP B N   1 
ATOM   2139 C CA  . ASP B 1 83  ? 29.790  -19.779 -26.216 1.00 41.65 ? 77  ASP B CA  1 
ATOM   2140 C C   . ASP B 1 83  ? 29.820  -19.555 -24.696 1.00 42.14 ? 77  ASP B C   1 
ATOM   2141 O O   . ASP B 1 83  ? 29.379  -20.430 -23.939 1.00 42.36 ? 77  ASP B O   1 
ATOM   2142 C CB  . ASP B 1 83  ? 31.186  -19.649 -26.847 1.00 42.14 ? 77  ASP B CB  1 
ATOM   2143 C CG  . ASP B 1 83  ? 31.343  -20.431 -28.215 1.00 42.19 ? 77  ASP B CG  1 
ATOM   2144 O OD1 . ASP B 1 83  ? 30.342  -20.898 -28.827 1.00 40.00 ? 77  ASP B OD1 1 
ATOM   2145 O OD2 . ASP B 1 83  ? 32.501  -20.551 -28.686 1.00 41.91 ? 77  ASP B OD2 1 
ATOM   2146 N N   . LEU B 1 84  ? 30.281  -18.386 -24.231 1.00 42.05 ? 78  LEU B N   1 
ATOM   2147 C CA  . LEU B 1 84  ? 30.222  -18.063 -22.801 1.00 41.29 ? 78  LEU B CA  1 
ATOM   2148 C C   . LEU B 1 84  ? 28.989  -18.661 -22.107 1.00 41.47 ? 78  LEU B C   1 
ATOM   2149 O O   . LEU B 1 84  ? 29.095  -19.397 -21.129 1.00 41.15 ? 78  LEU B O   1 
ATOM   2150 C CB  . LEU B 1 84  ? 30.218  -16.560 -22.601 1.00 41.25 ? 78  LEU B CB  1 
ATOM   2151 C CG  . LEU B 1 84  ? 31.542  -15.757 -22.589 1.00 42.50 ? 78  LEU B CG  1 
ATOM   2152 C CD1 . LEU B 1 84  ? 32.779  -16.603 -22.235 1.00 40.92 ? 78  LEU B CD1 1 
ATOM   2153 C CD2 . LEU B 1 84  ? 31.774  -14.941 -23.885 1.00 40.27 ? 78  LEU B CD2 1 
ATOM   2154 N N   . LEU B 1 85  ? 27.804  -18.361 -22.619 1.00 41.75 ? 79  LEU B N   1 
ATOM   2155 C CA  . LEU B 1 85  ? 26.596  -18.847 -21.973 1.00 41.84 ? 79  LEU B CA  1 
ATOM   2156 C C   . LEU B 1 85  ? 26.580  -20.359 -21.985 1.00 42.24 ? 79  LEU B C   1 
ATOM   2157 O O   . LEU B 1 85  ? 26.336  -20.990 -20.953 1.00 42.14 ? 79  LEU B O   1 
ATOM   2158 C CB  . LEU B 1 85  ? 25.357  -18.304 -22.662 1.00 41.76 ? 79  LEU B CB  1 
ATOM   2159 C CG  . LEU B 1 85  ? 24.673  -17.036 -22.157 1.00 42.29 ? 79  LEU B CG  1 
ATOM   2160 C CD1 . LEU B 1 85  ? 25.621  -15.887 -22.097 1.00 43.58 ? 79  LEU B CD1 1 
ATOM   2161 C CD2 . LEU B 1 85  ? 23.558  -16.702 -23.122 1.00 43.33 ? 79  LEU B CD2 1 
ATOM   2162 N N   . SER B 1 86  ? 26.872  -20.932 -23.157 1.00 42.49 ? 80  SER B N   1 
ATOM   2163 C CA  . SER B 1 86  ? 26.792  -22.369 -23.368 1.00 42.22 ? 80  SER B CA  1 
ATOM   2164 C C   . SER B 1 86  ? 27.628  -23.105 -22.346 1.00 42.07 ? 80  SER B C   1 
ATOM   2165 O O   . SER B 1 86  ? 27.195  -24.126 -21.813 1.00 42.66 ? 80  SER B O   1 
ATOM   2166 C CB  . SER B 1 86  ? 27.250  -22.726 -24.762 1.00 41.78 ? 80  SER B CB  1 
ATOM   2167 O OG  . SER B 1 86  ? 26.519  -23.852 -25.181 1.00 44.61 ? 80  SER B OG  1 
ATOM   2168 N N   . GLY B 1 87  ? 28.798  -22.545 -22.048 1.00 41.94 ? 81  GLY B N   1 
ATOM   2169 C CA  . GLY B 1 87  ? 29.773  -23.115 -21.130 1.00 42.34 ? 81  GLY B CA  1 
ATOM   2170 C C   . GLY B 1 87  ? 29.461  -22.900 -19.666 1.00 43.36 ? 81  GLY B C   1 
ATOM   2171 O O   . GLY B 1 87  ? 29.753  -23.773 -18.818 1.00 43.50 ? 81  GLY B O   1 
ATOM   2172 N N   . SER B 1 88  ? 28.855  -21.755 -19.351 1.00 43.77 ? 82  SER B N   1 
ATOM   2173 C CA  . SER B 1 88  ? 28.387  -21.527 -17.990 1.00 44.63 ? 82  SER B CA  1 
ATOM   2174 C C   . SER B 1 88  ? 27.331  -22.549 -17.637 1.00 44.72 ? 82  SER B C   1 
ATOM   2175 O O   . SER B 1 88  ? 27.276  -22.995 -16.494 1.00 45.20 ? 82  SER B O   1 
ATOM   2176 C CB  . SER B 1 88  ? 27.823  -20.128 -17.807 1.00 44.69 ? 82  SER B CB  1 
ATOM   2177 O OG  . SER B 1 88  ? 28.602  -19.186 -18.524 1.00 47.38 ? 82  SER B OG  1 
ATOM   2178 N N   . LEU B 1 89  ? 26.496  -22.924 -18.604 1.00 44.92 ? 83  LEU B N   1 
ATOM   2179 C CA  . LEU B 1 89  ? 25.489  -23.941 -18.355 1.00 45.35 ? 83  LEU B CA  1 
ATOM   2180 C C   . LEU B 1 89  ? 26.168  -25.245 -17.958 1.00 45.98 ? 83  LEU B C   1 
ATOM   2181 O O   . LEU B 1 89  ? 25.779  -25.902 -16.985 1.00 45.50 ? 83  LEU B O   1 
ATOM   2182 C CB  . LEU B 1 89  ? 24.587  -24.148 -19.564 1.00 44.86 ? 83  LEU B CB  1 
ATOM   2183 C CG  . LEU B 1 89  ? 23.428  -25.113 -19.255 1.00 46.09 ? 83  LEU B CG  1 
ATOM   2184 C CD1 . LEU B 1 89  ? 22.571  -24.713 -18.046 1.00 45.45 ? 83  LEU B CD1 1 
ATOM   2185 C CD2 . LEU B 1 89  ? 22.528  -25.328 -20.446 1.00 47.59 ? 83  LEU B CD2 1 
ATOM   2186 N N   . GLU B 1 90  ? 27.219  -25.598 -18.687 1.00 46.96 ? 84  GLU B N   1 
ATOM   2187 C CA  . GLU B 1 90  ? 27.950  -26.833 -18.383 1.00 48.28 ? 84  GLU B CA  1 
ATOM   2188 C C   . GLU B 1 90  ? 28.618  -26.799 -17.017 1.00 47.61 ? 84  GLU B C   1 
ATOM   2189 O O   . GLU B 1 90  ? 28.638  -27.810 -16.335 1.00 47.89 ? 84  GLU B O   1 
ATOM   2190 C CB  . GLU B 1 90  ? 28.978  -27.157 -19.471 1.00 49.04 ? 84  GLU B CB  1 
ATOM   2191 C CG  . GLU B 1 90  ? 28.367  -27.776 -20.719 1.00 53.25 ? 84  GLU B CG  1 
ATOM   2192 C CD  . GLU B 1 90  ? 28.270  -29.317 -20.617 1.00 59.80 ? 84  GLU B CD  1 
ATOM   2193 O OE1 . GLU B 1 90  ? 29.351  -29.982 -20.680 1.00 61.46 ? 84  GLU B OE1 1 
ATOM   2194 O OE2 . GLU B 1 90  ? 27.126  -29.851 -20.468 1.00 60.54 ? 84  GLU B OE2 1 
ATOM   2195 N N   . VAL B 1 91  ? 29.159  -25.647 -16.623 1.00 46.91 ? 85  VAL B N   1 
ATOM   2196 C CA  . VAL B 1 91  ? 29.802  -25.534 -15.320 1.00 46.32 ? 85  VAL B CA  1 
ATOM   2197 C C   . VAL B 1 91  ? 28.754  -25.604 -14.220 1.00 47.01 ? 85  VAL B C   1 
ATOM   2198 O O   . VAL B 1 91  ? 28.828  -26.459 -13.348 1.00 47.53 ? 85  VAL B O   1 
ATOM   2199 C CB  . VAL B 1 91  ? 30.679  -24.287 -15.206 1.00 45.76 ? 85  VAL B CB  1 
ATOM   2200 C CG1 . VAL B 1 91  ? 31.290  -24.204 -13.864 1.00 45.16 ? 85  VAL B CG1 1 
ATOM   2201 C CG2 . VAL B 1 91  ? 31.776  -24.335 -16.217 1.00 44.62 ? 85  VAL B CG2 1 
ATOM   2202 N N   . ILE B 1 92  ? 27.756  -24.730 -14.295 1.00 48.22 ? 86  ILE B N   1 
ATOM   2203 C CA  . ILE B 1 92  ? 26.619  -24.688 -13.361 1.00 48.40 ? 86  ILE B CA  1 
ATOM   2204 C C   . ILE B 1 92  ? 25.944  -26.047 -13.224 1.00 48.85 ? 86  ILE B C   1 
ATOM   2205 O O   . ILE B 1 92  ? 25.629  -26.498 -12.127 1.00 48.73 ? 86  ILE B O   1 
ATOM   2206 C CB  . ILE B 1 92  ? 25.600  -23.649 -13.837 1.00 48.41 ? 86  ILE B CB  1 
ATOM   2207 C CG1 . ILE B 1 92  ? 26.268  -22.256 -13.850 1.00 48.33 ? 86  ILE B CG1 1 
ATOM   2208 C CG2 . ILE B 1 92  ? 24.330  -23.725 -13.004 1.00 47.28 ? 86  ILE B CG2 1 
ATOM   2209 C CD1 . ILE B 1 92  ? 25.312  -21.041 -13.989 1.00 47.93 ? 86  ILE B CD1 1 
ATOM   2210 N N   . ARG B 1 93  ? 25.732  -26.692 -14.356 1.00 49.59 ? 87  ARG B N   1 
ATOM   2211 C CA  . ARG B 1 93  ? 25.338  -28.096 -14.377 1.00 50.86 ? 87  ARG B CA  1 
ATOM   2212 C C   . ARG B 1 93  ? 26.180  -28.946 -13.407 1.00 51.19 ? 87  ARG B C   1 
ATOM   2213 O O   . ARG B 1 93  ? 25.650  -29.506 -12.435 1.00 51.80 ? 87  ARG B O   1 
ATOM   2214 C CB  . ARG B 1 93  ? 25.499  -28.641 -15.795 1.00 51.02 ? 87  ARG B CB  1 
ATOM   2215 C CG  . ARG B 1 93  ? 24.931  -29.991 -16.019 1.00 50.90 ? 87  ARG B CG  1 
ATOM   2216 C CD  . ARG B 1 93  ? 23.545  -29.897 -16.643 1.00 52.10 ? 87  ARG B CD  1 
ATOM   2217 N NE  . ARG B 1 93  ? 23.530  -29.246 -17.952 1.00 49.44 ? 87  ARG B NE  1 
ATOM   2218 C CZ  . ARG B 1 93  ? 22.462  -29.211 -18.750 1.00 50.86 ? 87  ARG B CZ  1 
ATOM   2219 N NH1 . ARG B 1 93  ? 21.312  -29.783 -18.385 1.00 48.10 ? 87  ARG B NH1 1 
ATOM   2220 N NH2 . ARG B 1 93  ? 22.542  -28.589 -19.922 1.00 53.82 ? 87  ARG B NH2 1 
ATOM   2221 N N   . LYS B 1 94  ? 27.485  -29.032 -13.673 1.00 51.00 ? 88  LYS B N   1 
ATOM   2222 C CA  . LYS B 1 94  ? 28.408  -29.827 -12.847 1.00 51.39 ? 88  LYS B CA  1 
ATOM   2223 C C   . LYS B 1 94  ? 28.367  -29.428 -11.380 1.00 50.00 ? 88  LYS B C   1 
ATOM   2224 O O   . LYS B 1 94  ? 28.578  -30.262 -10.498 1.00 50.18 ? 88  LYS B O   1 
ATOM   2225 C CB  . LYS B 1 94  ? 29.853  -29.711 -13.354 1.00 51.47 ? 88  LYS B CB  1 
ATOM   2226 C CG  . LYS B 1 94  ? 30.324  -30.861 -14.257 1.00 52.65 ? 88  LYS B CG  1 
ATOM   2227 C CD  . LYS B 1 94  ? 31.866  -30.777 -14.515 1.00 54.32 ? 88  LYS B CD  1 
ATOM   2228 C CE  . LYS B 1 94  ? 32.317  -29.494 -15.314 1.00 58.30 ? 88  LYS B CE  1 
ATOM   2229 N NZ  . LYS B 1 94  ? 32.133  -29.568 -16.818 1.00 58.32 ? 88  LYS B NZ  1 
ATOM   2230 N N   . TRP B 1 95  ? 28.124  -28.144 -11.132 1.00 48.24 ? 89  TRP B N   1 
ATOM   2231 C CA  . TRP B 1 95  ? 28.008  -27.629 -9.779  1.00 46.49 ? 89  TRP B CA  1 
ATOM   2232 C C   . TRP B 1 95  ? 26.768  -28.212 -9.115  1.00 45.94 ? 89  TRP B C   1 
ATOM   2233 O O   . TRP B 1 95  ? 26.844  -28.749 -8.025  1.00 44.45 ? 89  TRP B O   1 
ATOM   2234 C CB  . TRP B 1 95  ? 27.958  -26.093 -9.816  1.00 45.67 ? 89  TRP B CB  1 
ATOM   2235 C CG  . TRP B 1 95  ? 27.380  -25.411 -8.584  1.00 45.02 ? 89  TRP B CG  1 
ATOM   2236 C CD1 . TRP B 1 95  ? 27.984  -25.273 -7.374  1.00 44.02 ? 89  TRP B CD1 1 
ATOM   2237 C CD2 . TRP B 1 95  ? 26.093  -24.777 -8.462  1.00 44.32 ? 89  TRP B CD2 1 
ATOM   2238 N NE1 . TRP B 1 95  ? 27.169  -24.597 -6.507  1.00 43.67 ? 89  TRP B NE1 1 
ATOM   2239 C CE2 . TRP B 1 95  ? 26.006  -24.263 -7.148  1.00 44.33 ? 89  TRP B CE2 1 
ATOM   2240 C CE3 . TRP B 1 95  ? 25.013  -24.582 -9.339  1.00 43.96 ? 89  TRP B CE3 1 
ATOM   2241 C CZ2 . TRP B 1 95  ? 24.880  -23.555 -6.677  1.00 43.72 ? 89  TRP B CZ2 1 
ATOM   2242 C CZ3 . TRP B 1 95  ? 23.896  -23.883 -8.872  1.00 44.38 ? 89  TRP B CZ3 1 
ATOM   2243 C CH2 . TRP B 1 95  ? 23.840  -23.390 -7.541  1.00 44.59 ? 89  TRP B CH2 1 
ATOM   2244 N N   . ALA B 1 96  ? 25.630  -28.087 -9.793  1.00 46.44 ? 90  ALA B N   1 
ATOM   2245 C CA  . ALA B 1 96  ? 24.354  -28.562 -9.262  1.00 47.35 ? 90  ALA B CA  1 
ATOM   2246 C C   . ALA B 1 96  ? 24.462  -30.031 -8.951  1.00 48.05 ? 90  ALA B C   1 
ATOM   2247 O O   . ALA B 1 96  ? 23.915  -30.504 -7.955  1.00 48.02 ? 90  ALA B O   1 
ATOM   2248 C CB  . ALA B 1 96  ? 23.236  -28.326 -10.238 1.00 46.45 ? 90  ALA B CB  1 
ATOM   2249 N N   . GLU B 1 97  ? 25.181  -30.738 -9.816  1.00 49.02 ? 91  GLU B N   1 
ATOM   2250 C CA  . GLU B 1 97  ? 25.515  -32.130 -9.602  1.00 50.48 ? 91  GLU B CA  1 
ATOM   2251 C C   . GLU B 1 97  ? 25.906  -32.447 -8.160  1.00 50.05 ? 91  GLU B C   1 
ATOM   2252 O O   . GLU B 1 97  ? 25.452  -33.441 -7.592  1.00 49.67 ? 91  GLU B O   1 
ATOM   2253 C CB  . GLU B 1 97  ? 26.656  -32.520 -10.543 1.00 51.87 ? 91  GLU B CB  1 
ATOM   2254 C CG  . GLU B 1 97  ? 26.838  -34.014 -10.699 1.00 56.05 ? 91  GLU B CG  1 
ATOM   2255 C CD  . GLU B 1 97  ? 25.504  -34.683 -10.950 1.00 61.60 ? 91  GLU B CD  1 
ATOM   2256 O OE1 . GLU B 1 97  ? 25.447  -35.590 -11.815 1.00 65.08 ? 91  GLU B OE1 1 
ATOM   2257 O OE2 . GLU B 1 97  ? 24.506  -34.286 -10.289 1.00 62.58 ? 91  GLU B OE2 1 
ATOM   2258 N N   . LYS B 1 98  ? 26.720  -31.563 -7.582  1.00 50.23 ? 92  LYS B N   1 
ATOM   2259 C CA  . LYS B 1 98  ? 27.347  -31.755 -6.278  1.00 50.75 ? 92  LYS B CA  1 
ATOM   2260 C C   . LYS B 1 98  ? 26.579  -31.162 -5.095  1.00 51.12 ? 92  LYS B C   1 
ATOM   2261 O O   . LYS B 1 98  ? 27.165  -30.970 -4.027  1.00 51.19 ? 92  LYS B O   1 
ATOM   2262 C CB  . LYS B 1 98  ? 28.765  -31.170 -6.282  1.00 50.47 ? 92  LYS B CB  1 
ATOM   2263 C CG  . LYS B 1 98  ? 29.696  -31.705 -7.342  1.00 52.00 ? 92  LYS B CG  1 
ATOM   2264 C CD  . LYS B 1 98  ? 30.790  -30.665 -7.666  1.00 54.48 ? 92  LYS B CD  1 
ATOM   2265 C CE  . LYS B 1 98  ? 31.749  -31.123 -8.782  1.00 54.08 ? 92  LYS B CE  1 
ATOM   2266 N NZ  . LYS B 1 98  ? 32.310  -32.483 -8.490  1.00 53.56 ? 92  LYS B NZ  1 
ATOM   2267 N N   . ILE B 1 99  ? 25.299  -30.849 -5.270  1.00 51.59 ? 93  ILE B N   1 
ATOM   2268 C CA  . ILE B 1 99  ? 24.526  -30.326 -4.159  1.00 52.43 ? 93  ILE B CA  1 
ATOM   2269 C C   . ILE B 1 99  ? 23.723  -31.484 -3.621  1.00 53.62 ? 93  ILE B C   1 
ATOM   2270 O O   . ILE B 1 99  ? 22.785  -31.922 -4.285  1.00 54.41 ? 93  ILE B O   1 
ATOM   2271 C CB  . ILE B 1 99  ? 23.601  -29.153 -4.561  1.00 52.50 ? 93  ILE B CB  1 
ATOM   2272 C CG1 . ILE B 1 99  ? 24.445  -27.939 -4.974  1.00 51.84 ? 93  ILE B CG1 1 
ATOM   2273 C CG2 . ILE B 1 99  ? 22.649  -28.767 -3.394  1.00 52.36 ? 93  ILE B CG2 1 
ATOM   2274 C CD1 . ILE B 1 99  ? 23.658  -26.759 -5.418  1.00 49.90 ? 93  ILE B CD1 1 
ATOM   2275 N N   . PRO B 1 100 ? 24.087  -31.990 -2.420  1.00 54.13 ? 94  PRO B N   1 
ATOM   2276 C CA  . PRO B 1 100 ? 23.476  -33.162 -1.801  1.00 54.33 ? 94  PRO B CA  1 
ATOM   2277 C C   . PRO B 1 100 ? 21.966  -33.148 -1.912  1.00 54.90 ? 94  PRO B C   1 
ATOM   2278 O O   . PRO B 1 100 ? 21.319  -32.220 -1.445  1.00 55.70 ? 94  PRO B O   1 
ATOM   2279 C CB  . PRO B 1 100 ? 23.887  -33.056 -0.323  1.00 54.41 ? 94  PRO B CB  1 
ATOM   2280 C CG  . PRO B 1 100 ? 24.748  -31.829 -0.195  1.00 54.84 ? 94  PRO B CG  1 
ATOM   2281 C CD  . PRO B 1 100 ? 25.156  -31.429 -1.575  1.00 54.63 ? 94  PRO B CD  1 
ATOM   2282 N N   . GLY B 1 101 ? 21.413  -34.181 -2.531  1.00 55.48 ? 95  GLY B N   1 
ATOM   2283 C CA  . GLY B 1 101 ? 19.983  -34.292 -2.715  1.00 55.73 ? 95  GLY B CA  1 
ATOM   2284 C C   . GLY B 1 101 ? 19.671  -34.023 -4.161  1.00 56.32 ? 95  GLY B C   1 
ATOM   2285 O O   . GLY B 1 101 ? 18.727  -34.608 -4.720  1.00 57.11 ? 95  GLY B O   1 
ATOM   2286 N N   . PHE B 1 102 ? 20.476  -33.165 -4.784  1.00 56.15 ? 96  PHE B N   1 
ATOM   2287 C CA  . PHE B 1 102 ? 20.177  -32.713 -6.136  1.00 56.33 ? 96  PHE B CA  1 
ATOM   2288 C C   . PHE B 1 102 ? 20.163  -33.827 -7.173  1.00 56.75 ? 96  PHE B C   1 
ATOM   2289 O O   . PHE B 1 102 ? 19.249  -33.893 -7.984  1.00 56.30 ? 96  PHE B O   1 
ATOM   2290 C CB  . PHE B 1 102 ? 21.089  -31.564 -6.597  1.00 55.91 ? 96  PHE B CB  1 
ATOM   2291 C CG  . PHE B 1 102 ? 20.649  -30.967 -7.893  1.00 55.07 ? 96  PHE B CG  1 
ATOM   2292 C CD1 . PHE B 1 102 ? 19.627  -30.006 -7.917  1.00 54.33 ? 96  PHE B CD1 1 
ATOM   2293 C CD2 . PHE B 1 102 ? 21.175  -31.423 -9.099  1.00 53.49 ? 96  PHE B CD2 1 
ATOM   2294 C CE1 . PHE B 1 102 ? 19.169  -29.484 -9.123  1.00 53.07 ? 96  PHE B CE1 1 
ATOM   2295 C CE2 . PHE B 1 102 ? 20.725  -30.899 -10.319 1.00 52.89 ? 96  PHE B CE2 1 
ATOM   2296 C CZ  . PHE B 1 102 ? 19.729  -29.932 -10.331 1.00 53.55 ? 96  PHE B CZ  1 
ATOM   2297 N N   . ALA B 1 103 ? 21.181  -34.681 -7.153  1.00 57.93 ? 97  ALA B N   1 
ATOM   2298 C CA  . ALA B 1 103 ? 21.236  -35.843 -8.048  1.00 59.09 ? 97  ALA B CA  1 
ATOM   2299 C C   . ALA B 1 103 ? 20.187  -36.890 -7.662  1.00 59.96 ? 97  ALA B C   1 
ATOM   2300 O O   . ALA B 1 103 ? 19.713  -37.654 -8.521  1.00 59.95 ? 97  ALA B O   1 
ATOM   2301 C CB  . ALA B 1 103 ? 22.630  -36.456 -8.068  1.00 58.91 ? 97  ALA B CB  1 
ATOM   2302 N N   . GLU B 1 104 ? 19.822  -36.905 -6.374  1.00 60.77 ? 98  GLU B N   1 
ATOM   2303 C CA  . GLU B 1 104 ? 18.778  -37.796 -5.879  1.00 61.64 ? 98  GLU B CA  1 
ATOM   2304 C C   . GLU B 1 104 ? 17.376  -37.334 -6.355  1.00 61.84 ? 98  GLU B C   1 
ATOM   2305 O O   . GLU B 1 104 ? 16.365  -37.938 -5.974  1.00 62.59 ? 98  GLU B O   1 
ATOM   2306 C CB  . GLU B 1 104 ? 18.853  -37.980 -4.341  1.00 61.47 ? 98  GLU B CB  1 
ATOM   2307 C CG  . GLU B 1 104 ? 19.760  -39.145 -3.858  1.00 63.72 ? 98  GLU B CG  1 
ATOM   2308 C CD  . GLU B 1 104 ? 19.068  -40.147 -2.840  1.00 67.24 ? 98  GLU B CD  1 
ATOM   2309 O OE1 . GLU B 1 104 ? 18.198  -39.710 -2.030  1.00 67.39 ? 98  GLU B OE1 1 
ATOM   2310 O OE2 . GLU B 1 104 ? 19.405  -41.377 -2.849  1.00 65.67 ? 98  GLU B OE2 1 
ATOM   2311 N N   . LEU B 1 105 ? 17.306  -36.293 -7.190  1.00 61.34 ? 99  LEU B N   1 
ATOM   2312 C CA  . LEU B 1 105 ? 16.017  -35.827 -7.725  1.00 61.40 ? 99  LEU B CA  1 
ATOM   2313 C C   . LEU B 1 105 ? 15.738  -36.416 -9.095  1.00 61.49 ? 99  LEU B C   1 
ATOM   2314 O O   . LEU B 1 105 ? 16.630  -37.025 -9.673  1.00 62.33 ? 99  LEU B O   1 
ATOM   2315 C CB  . LEU B 1 105 ? 15.984  -34.304 -7.810  1.00 61.46 ? 99  LEU B CB  1 
ATOM   2316 C CG  . LEU B 1 105 ? 15.553  -33.521 -6.569  1.00 61.08 ? 99  LEU B CG  1 
ATOM   2317 C CD1 . LEU B 1 105 ? 15.855  -32.037 -6.768  1.00 61.85 ? 99  LEU B CD1 1 
ATOM   2318 C CD2 . LEU B 1 105 ? 14.081  -33.736 -6.270  1.00 60.28 ? 99  LEU B CD2 1 
ATOM   2319 N N   . SER B 1 106 ? 14.527  -36.240 -9.626  1.00 61.10 ? 100 SER B N   1 
ATOM   2320 C CA  . SER B 1 106 ? 14.194  -36.820 -10.929 1.00 60.96 ? 100 SER B CA  1 
ATOM   2321 C C   . SER B 1 106 ? 14.932  -36.085 -12.056 1.00 61.05 ? 100 SER B C   1 
ATOM   2322 O O   . SER B 1 106 ? 15.206  -34.885 -11.925 1.00 61.09 ? 100 SER B O   1 
ATOM   2323 C CB  . SER B 1 106 ? 12.680  -36.792 -11.171 1.00 61.14 ? 100 SER B CB  1 
ATOM   2324 O OG  . SER B 1 106 ? 12.299  -35.745 -12.046 1.00 61.21 ? 100 SER B OG  1 
ATOM   2325 N N   . PRO B 1 107 ? 15.260  -36.796 -13.168 1.00 60.78 ? 101 PRO B N   1 
ATOM   2326 C CA  . PRO B 1 107 ? 16.014  -36.150 -14.255 1.00 60.43 ? 101 PRO B CA  1 
ATOM   2327 C C   . PRO B 1 107 ? 15.336  -34.907 -14.797 1.00 60.06 ? 101 PRO B C   1 
ATOM   2328 O O   . PRO B 1 107 ? 16.001  -33.892 -14.982 1.00 60.71 ? 101 PRO B O   1 
ATOM   2329 C CB  . PRO B 1 107 ? 16.109  -37.249 -15.333 1.00 59.84 ? 101 PRO B CB  1 
ATOM   2330 C CG  . PRO B 1 107 ? 16.080  -38.481 -14.559 1.00 60.28 ? 101 PRO B CG  1 
ATOM   2331 C CD  . PRO B 1 107 ? 15.019  -38.211 -13.487 1.00 60.57 ? 101 PRO B CD  1 
ATOM   2332 N N   . ALA B 1 108 ? 14.031  -34.979 -15.035 1.00 59.54 ? 102 ALA B N   1 
ATOM   2333 C CA  . ALA B 1 108 ? 13.288  -33.843 -15.568 1.00 58.95 ? 102 ALA B CA  1 
ATOM   2334 C C   . ALA B 1 108 ? 13.324  -32.687 -14.584 1.00 58.58 ? 102 ALA B C   1 
ATOM   2335 O O   . ALA B 1 108 ? 13.463  -31.512 -14.973 1.00 58.41 ? 102 ALA B O   1 
ATOM   2336 C CB  . ALA B 1 108 ? 11.853  -34.231 -15.874 1.00 58.85 ? 102 ALA B CB  1 
ATOM   2337 N N   . ASP B 1 109 ? 13.214  -33.022 -13.306 1.00 57.66 ? 103 ASP B N   1 
ATOM   2338 C CA  . ASP B 1 109 ? 13.161  -31.977 -12.309 1.00 57.58 ? 103 ASP B CA  1 
ATOM   2339 C C   . ASP B 1 109 ? 14.464  -31.180 -12.201 1.00 56.72 ? 103 ASP B C   1 
ATOM   2340 O O   . ASP B 1 109 ? 14.444  -29.950 -12.033 1.00 57.16 ? 103 ASP B O   1 
ATOM   2341 C CB  . ASP B 1 109 ? 12.636  -32.526 -10.992 1.00 57.45 ? 103 ASP B CB  1 
ATOM   2342 C CG  . ASP B 1 109 ? 11.128  -32.764 -11.052 1.00 59.75 ? 103 ASP B CG  1 
ATOM   2343 O OD1 . ASP B 1 109 ? 10.495  -32.265 -12.025 1.00 60.87 ? 103 ASP B OD1 1 
ATOM   2344 O OD2 . ASP B 1 109 ? 10.566  -33.442 -10.156 1.00 62.04 ? 103 ASP B OD2 1 
ATOM   2345 N N   . GLN B 1 110 ? 15.582  -31.875 -12.356 1.00 55.18 ? 104 GLN B N   1 
ATOM   2346 C CA  . GLN B 1 110 ? 16.872  -31.243 -12.350 1.00 54.00 ? 104 GLN B CA  1 
ATOM   2347 C C   . GLN B 1 110 ? 16.975  -30.312 -13.565 1.00 53.43 ? 104 GLN B C   1 
ATOM   2348 O O   . GLN B 1 110 ? 17.314  -29.132 -13.422 1.00 52.83 ? 104 GLN B O   1 
ATOM   2349 C CB  . GLN B 1 110 ? 17.968  -32.301 -12.339 1.00 53.65 ? 104 GLN B CB  1 
ATOM   2350 C CG  . GLN B 1 110 ? 17.993  -33.116 -11.071 1.00 53.92 ? 104 GLN B CG  1 
ATOM   2351 C CD  . GLN B 1 110 ? 18.980  -34.297 -11.130 1.00 54.58 ? 104 GLN B CD  1 
ATOM   2352 O OE1 . GLN B 1 110 ? 18.690  -35.337 -11.718 1.00 52.46 ? 104 GLN B OE1 1 
ATOM   2353 N NE2 . GLN B 1 110 ? 20.142  -34.138 -10.488 1.00 56.55 ? 104 GLN B NE2 1 
ATOM   2354 N N   . ASP B 1 111 ? 16.652  -30.844 -14.747 1.00 52.75 ? 105 ASP B N   1 
ATOM   2355 C CA  . ASP B 1 111 ? 16.567  -30.047 -15.965 1.00 52.36 ? 105 ASP B CA  1 
ATOM   2356 C C   . ASP B 1 111 ? 15.756  -28.769 -15.707 1.00 51.50 ? 105 ASP B C   1 
ATOM   2357 O O   . ASP B 1 111 ? 16.241  -27.682 -15.915 1.00 51.97 ? 105 ASP B O   1 
ATOM   2358 C CB  . ASP B 1 111 ? 15.928  -30.853 -17.096 1.00 52.47 ? 105 ASP B CB  1 
ATOM   2359 C CG  . ASP B 1 111 ? 16.888  -31.833 -17.749 1.00 53.55 ? 105 ASP B CG  1 
ATOM   2360 O OD1 . ASP B 1 111 ? 18.120  -31.593 -17.742 1.00 53.44 ? 105 ASP B OD1 1 
ATOM   2361 O OD2 . ASP B 1 111 ? 16.395  -32.844 -18.303 1.00 54.83 ? 105 ASP B OD2 1 
ATOM   2362 N N   . LEU B 1 112 ? 14.545  -28.916 -15.189 1.00 50.39 ? 106 LEU B N   1 
ATOM   2363 C CA  . LEU B 1 112 ? 13.641  -27.804 -14.992 1.00 48.76 ? 106 LEU B CA  1 
ATOM   2364 C C   . LEU B 1 112 ? 14.185  -26.731 -14.060 1.00 48.27 ? 106 LEU B C   1 
ATOM   2365 O O   . LEU B 1 112 ? 14.034  -25.535 -14.334 1.00 48.54 ? 106 LEU B O   1 
ATOM   2366 C CB  . LEU B 1 112 ? 12.305  -28.315 -14.485 1.00 48.54 ? 106 LEU B CB  1 
ATOM   2367 C CG  . LEU B 1 112 ? 11.184  -27.281 -14.412 1.00 48.08 ? 106 LEU B CG  1 
ATOM   2368 C CD1 . LEU B 1 112 ? 11.026  -26.524 -15.714 1.00 47.47 ? 106 LEU B CD1 1 
ATOM   2369 C CD2 . LEU B 1 112 ? 9.876   -27.970 -14.022 1.00 48.24 ? 106 LEU B CD2 1 
ATOM   2370 N N   . LEU B 1 113 ? 14.818  -27.138 -12.970 1.00 47.15 ? 107 LEU B N   1 
ATOM   2371 C CA  . LEU B 1 113 ? 15.342  -26.158 -12.031 1.00 46.55 ? 107 LEU B CA  1 
ATOM   2372 C C   . LEU B 1 113 ? 16.535  -25.414 -12.641 1.00 46.24 ? 107 LEU B C   1 
ATOM   2373 O O   . LEU B 1 113 ? 16.653  -24.195 -12.536 1.00 46.29 ? 107 LEU B O   1 
ATOM   2374 C CB  . LEU B 1 113 ? 15.705  -26.826 -10.700 1.00 46.37 ? 107 LEU B CB  1 
ATOM   2375 C CG  . LEU B 1 113 ? 14.535  -27.341 -9.838  1.00 46.10 ? 107 LEU B CG  1 
ATOM   2376 C CD1 . LEU B 1 113 ? 15.010  -28.298 -8.793  1.00 45.07 ? 107 LEU B CD1 1 
ATOM   2377 C CD2 . LEU B 1 113 ? 13.737  -26.218 -9.181  1.00 44.08 ? 107 LEU B CD2 1 
ATOM   2378 N N   . LEU B 1 114 ? 17.384  -26.169 -13.320 1.00 45.97 ? 108 LEU B N   1 
ATOM   2379 C CA  . LEU B 1 114 ? 18.607  -25.674 -13.894 1.00 45.45 ? 108 LEU B CA  1 
ATOM   2380 C C   . LEU B 1 114 ? 18.218  -24.756 -15.023 1.00 46.41 ? 108 LEU B C   1 
ATOM   2381 O O   . LEU B 1 114 ? 18.692  -23.605 -15.154 1.00 46.71 ? 108 LEU B O   1 
ATOM   2382 C CB  . LEU B 1 114 ? 19.378  -26.860 -14.455 1.00 44.83 ? 108 LEU B CB  1 
ATOM   2383 C CG  . LEU B 1 114 ? 20.789  -27.108 -13.952 1.00 43.52 ? 108 LEU B CG  1 
ATOM   2384 C CD1 . LEU B 1 114 ? 20.935  -26.502 -12.605 1.00 42.65 ? 108 LEU B CD1 1 
ATOM   2385 C CD2 . LEU B 1 114 ? 21.086  -28.588 -13.881 1.00 42.61 ? 108 LEU B CD2 1 
ATOM   2386 N N   . GLU B 1 115 ? 17.332  -25.283 -15.856 1.00 46.56 ? 109 GLU B N   1 
ATOM   2387 C CA  . GLU B 1 115 ? 16.836  -24.537 -16.960 1.00 46.56 ? 109 GLU B CA  1 
ATOM   2388 C C   . GLU B 1 115 ? 16.185  -23.273 -16.417 1.00 46.12 ? 109 GLU B C   1 
ATOM   2389 O O   . GLU B 1 115 ? 16.292  -22.217 -17.033 1.00 46.21 ? 109 GLU B O   1 
ATOM   2390 C CB  . GLU B 1 115 ? 15.837  -25.368 -17.744 1.00 46.79 ? 109 GLU B CB  1 
ATOM   2391 C CG  . GLU B 1 115 ? 16.471  -26.365 -18.699 1.00 50.08 ? 109 GLU B CG  1 
ATOM   2392 C CD  . GLU B 1 115 ? 15.480  -26.825 -19.776 1.00 55.85 ? 109 GLU B CD  1 
ATOM   2393 O OE1 . GLU B 1 115 ? 14.567  -26.020 -20.098 1.00 56.98 ? 109 GLU B OE1 1 
ATOM   2394 O OE2 . GLU B 1 115 ? 15.608  -27.971 -20.299 1.00 56.24 ? 109 GLU B OE2 1 
ATOM   2395 N N   . SER B 1 116 ? 15.522  -23.365 -15.266 1.00 45.20 ? 110 SER B N   1 
ATOM   2396 C CA  . SER B 1 116 ? 14.798  -22.199 -14.763 1.00 44.56 ? 110 SER B CA  1 
ATOM   2397 C C   . SER B 1 116 ? 15.644  -21.190 -13.994 1.00 43.86 ? 110 SER B C   1 
ATOM   2398 O O   . SER B 1 116 ? 15.204  -20.066 -13.764 1.00 44.03 ? 110 SER B O   1 
ATOM   2399 C CB  . SER B 1 116 ? 13.591  -22.619 -13.930 1.00 44.59 ? 110 SER B CB  1 
ATOM   2400 O OG  . SER B 1 116 ? 12.658  -23.269 -14.747 1.00 44.95 ? 110 SER B OG  1 
ATOM   2401 N N   . ALA B 1 117 ? 16.842  -21.582 -13.590 1.00 42.68 ? 111 ALA B N   1 
ATOM   2402 C CA  . ALA B 1 117 ? 17.651  -20.693 -12.786 1.00 42.07 ? 111 ALA B CA  1 
ATOM   2403 C C   . ALA B 1 117 ? 18.966  -20.310 -13.459 1.00 42.15 ? 111 ALA B C   1 
ATOM   2404 O O   . ALA B 1 117 ? 19.753  -19.544 -12.893 1.00 42.75 ? 111 ALA B O   1 
ATOM   2405 C CB  . ALA B 1 117 ? 17.929  -21.333 -11.491 1.00 42.42 ? 111 ALA B CB  1 
ATOM   2406 N N   . PHE B 1 118 ? 19.220  -20.850 -14.653 1.00 41.13 ? 112 PHE B N   1 
ATOM   2407 C CA  . PHE B 1 118 ? 20.457  -20.573 -15.366 1.00 39.57 ? 112 PHE B CA  1 
ATOM   2408 C C   . PHE B 1 118 ? 20.804  -19.074 -15.482 1.00 39.04 ? 112 PHE B C   1 
ATOM   2409 O O   . PHE B 1 118 ? 21.897  -18.658 -15.121 1.00 39.02 ? 112 PHE B O   1 
ATOM   2410 C CB  . PHE B 1 118 ? 20.417  -21.210 -16.737 1.00 39.39 ? 112 PHE B CB  1 
ATOM   2411 C CG  . PHE B 1 118 ? 21.404  -20.655 -17.676 1.00 38.19 ? 112 PHE B CG  1 
ATOM   2412 C CD1 . PHE B 1 118 ? 22.729  -21.052 -17.617 1.00 38.58 ? 112 PHE B CD1 1 
ATOM   2413 C CD2 . PHE B 1 118 ? 21.014  -19.728 -18.636 1.00 38.62 ? 112 PHE B CD2 1 
ATOM   2414 C CE1 . PHE B 1 118 ? 23.681  -20.517 -18.511 1.00 39.63 ? 112 PHE B CE1 1 
ATOM   2415 C CE2 . PHE B 1 118 ? 21.951  -19.183 -19.558 1.00 39.12 ? 112 PHE B CE2 1 
ATOM   2416 C CZ  . PHE B 1 118 ? 23.288  -19.583 -19.487 1.00 39.54 ? 112 PHE B CZ  1 
ATOM   2417 N N   . LEU B 1 119 ? 19.890  -18.257 -15.975 1.00 38.26 ? 113 LEU B N   1 
ATOM   2418 C CA  . LEU B 1 119 ? 20.222  -16.839 -16.157 1.00 37.73 ? 113 LEU B CA  1 
ATOM   2419 C C   . LEU B 1 119 ? 20.599  -16.144 -14.834 1.00 37.56 ? 113 LEU B C   1 
ATOM   2420 O O   . LEU B 1 119 ? 21.637  -15.459 -14.750 1.00 37.43 ? 113 LEU B O   1 
ATOM   2421 C CB  . LEU B 1 119 ? 19.112  -16.114 -16.887 1.00 37.27 ? 113 LEU B CB  1 
ATOM   2422 C CG  . LEU B 1 119 ? 19.296  -15.620 -18.325 1.00 37.98 ? 113 LEU B CG  1 
ATOM   2423 C CD1 . LEU B 1 119 ? 20.495  -16.094 -19.083 1.00 37.33 ? 113 LEU B CD1 1 
ATOM   2424 C CD2 . LEU B 1 119 ? 18.036  -15.941 -19.094 1.00 39.39 ? 113 LEU B CD2 1 
ATOM   2425 N N   . GLU B 1 120 ? 19.788  -16.364 -13.803 1.00 36.93 ? 114 GLU B N   1 
ATOM   2426 C CA  . GLU B 1 120 ? 20.114  -15.891 -12.479 1.00 37.11 ? 114 GLU B CA  1 
ATOM   2427 C C   . GLU B 1 120 ? 21.493  -16.336 -12.081 1.00 35.93 ? 114 GLU B C   1 
ATOM   2428 O O   . GLU B 1 120 ? 22.311  -15.500 -11.654 1.00 36.04 ? 114 GLU B O   1 
ATOM   2429 C CB  . GLU B 1 120 ? 19.135  -16.428 -11.457 1.00 37.78 ? 114 GLU B CB  1 
ATOM   2430 C CG  . GLU B 1 120 ? 17.858  -15.667 -11.453 1.00 42.87 ? 114 GLU B CG  1 
ATOM   2431 C CD  . GLU B 1 120 ? 16.695  -16.535 -11.024 1.00 50.42 ? 114 GLU B CD  1 
ATOM   2432 O OE1 . GLU B 1 120 ? 16.392  -17.569 -11.707 1.00 52.70 ? 114 GLU B OE1 1 
ATOM   2433 O OE2 . GLU B 1 120 ? 16.079  -16.166 -9.992  1.00 53.60 ? 114 GLU B OE2 1 
ATOM   2434 N N   . LEU B 1 121 ? 21.754  -17.639 -12.232 1.00 34.37 ? 115 LEU B N   1 
ATOM   2435 C CA  . LEU B 1 121 ? 23.002  -18.209 -11.783 1.00 33.16 ? 115 LEU B CA  1 
ATOM   2436 C C   . LEU B 1 121 ? 24.178  -17.696 -12.595 1.00 32.54 ? 115 LEU B C   1 
ATOM   2437 O O   . LEU B 1 121 ? 25.154  -17.233 -12.042 1.00 31.36 ? 115 LEU B O   1 
ATOM   2438 C CB  . LEU B 1 121 ? 22.934  -19.709 -11.805 1.00 33.30 ? 115 LEU B CB  1 
ATOM   2439 C CG  . LEU B 1 121 ? 21.941  -20.374 -10.853 1.00 34.88 ? 115 LEU B CG  1 
ATOM   2440 C CD1 . LEU B 1 121 ? 22.002  -21.877 -11.059 1.00 33.47 ? 115 LEU B CD1 1 
ATOM   2441 C CD2 . LEU B 1 121 ? 22.182  -20.010 -9.376  1.00 35.30 ? 115 LEU B CD2 1 
ATOM   2442 N N   . PHE B 1 122 ? 24.060  -17.728 -13.916 1.00 32.77 ? 116 PHE B N   1 
ATOM   2443 C CA  . PHE B 1 122 ? 25.051  -17.086 -14.785 1.00 32.61 ? 116 PHE B CA  1 
ATOM   2444 C C   . PHE B 1 122 ? 25.445  -15.718 -14.282 1.00 32.51 ? 116 PHE B C   1 
ATOM   2445 O O   . PHE B 1 122 ? 26.625  -15.512 -14.086 1.00 32.86 ? 116 PHE B O   1 
ATOM   2446 C CB  . PHE B 1 122 ? 24.553  -16.968 -16.221 1.00 32.99 ? 116 PHE B CB  1 
ATOM   2447 C CG  . PHE B 1 122 ? 25.450  -16.156 -17.117 1.00 32.55 ? 116 PHE B CG  1 
ATOM   2448 C CD1 . PHE B 1 122 ? 26.580  -16.699 -17.653 1.00 31.48 ? 116 PHE B CD1 1 
ATOM   2449 C CD2 . PHE B 1 122 ? 25.104  -14.852 -17.476 1.00 37.03 ? 116 PHE B CD2 1 
ATOM   2450 C CE1 . PHE B 1 122 ? 27.396  -15.966 -18.499 1.00 34.29 ? 116 PHE B CE1 1 
ATOM   2451 C CE2 . PHE B 1 122 ? 25.919  -14.099 -18.339 1.00 36.89 ? 116 PHE B CE2 1 
ATOM   2452 C CZ  . PHE B 1 122 ? 27.077  -14.667 -18.847 1.00 33.22 ? 116 PHE B CZ  1 
ATOM   2453 N N   . ILE B 1 123 ? 24.472  -14.805 -14.092 1.00 31.96 ? 117 ILE B N   1 
ATOM   2454 C CA  . ILE B 1 123 ? 24.729  -13.445 -13.636 1.00 31.55 ? 117 ILE B CA  1 
ATOM   2455 C C   . ILE B 1 123 ? 25.357  -13.372 -12.234 1.00 32.44 ? 117 ILE B C   1 
ATOM   2456 O O   . ILE B 1 123 ? 26.263  -12.573 -11.992 1.00 32.58 ? 117 ILE B O   1 
ATOM   2457 C CB  . ILE B 1 123 ? 23.439  -12.639 -13.584 1.00 31.46 ? 117 ILE B CB  1 
ATOM   2458 C CG1 . ILE B 1 123 ? 22.914  -12.383 -14.996 1.00 31.36 ? 117 ILE B CG1 1 
ATOM   2459 C CG2 . ILE B 1 123 ? 23.642  -11.307 -12.824 1.00 30.14 ? 117 ILE B CG2 1 
ATOM   2460 C CD1 . ILE B 1 123 ? 21.377  -12.082 -15.062 1.00 25.85 ? 117 ILE B CD1 1 
ATOM   2461 N N   . LEU B 1 124 ? 24.832  -14.163 -11.301 1.00 32.68 ? 118 LEU B N   1 
ATOM   2462 C CA  . LEU B 1 124 ? 25.257  -14.124 -9.917  1.00 32.64 ? 118 LEU B CA  1 
ATOM   2463 C C   . LEU B 1 124 ? 26.703  -14.546 -9.806  1.00 33.51 ? 118 LEU B C   1 
ATOM   2464 O O   . LEU B 1 124 ? 27.518  -13.888 -9.155  1.00 33.91 ? 118 LEU B O   1 
ATOM   2465 C CB  . LEU B 1 124 ? 24.403  -15.097 -9.111  1.00 32.98 ? 118 LEU B CB  1 
ATOM   2466 C CG  . LEU B 1 124 ? 24.608  -15.088 -7.591  1.00 34.36 ? 118 LEU B CG  1 
ATOM   2467 C CD1 . LEU B 1 124 ? 24.524  -13.625 -6.971  1.00 32.37 ? 118 LEU B CD1 1 
ATOM   2468 C CD2 . LEU B 1 124 ? 23.651  -16.055 -6.909  1.00 31.15 ? 118 LEU B CD2 1 
ATOM   2469 N N   . ARG B 1 125 ? 27.019  -15.664 -10.450 1.00 34.50 ? 119 ARG B N   1 
ATOM   2470 C CA  . ARG B 1 125 ? 28.333  -16.282 -10.381 1.00 35.01 ? 119 ARG B CA  1 
ATOM   2471 C C   . ARG B 1 125 ? 29.401  -15.401 -10.976 1.00 35.21 ? 119 ARG B C   1 
ATOM   2472 O O   . ARG B 1 125 ? 30.495  -15.282 -10.432 1.00 36.14 ? 119 ARG B O   1 
ATOM   2473 C CB  . ARG B 1 125 ? 28.315  -17.598 -11.122 1.00 35.24 ? 119 ARG B CB  1 
ATOM   2474 C CG  . ARG B 1 125 ? 27.713  -18.782 -10.356 1.00 36.59 ? 119 ARG B CG  1 
ATOM   2475 C CD  . ARG B 1 125 ? 27.749  -20.022 -11.266 1.00 40.92 ? 119 ARG B CD  1 
ATOM   2476 N NE  . ARG B 1 125 ? 29.095  -20.595 -11.470 1.00 42.48 ? 119 ARG B NE  1 
ATOM   2477 C CZ  . ARG B 1 125 ? 29.531  -21.662 -10.800 1.00 45.60 ? 119 ARG B CZ  1 
ATOM   2478 N NH1 . ARG B 1 125 ? 28.735  -22.246 -9.893  1.00 45.86 ? 119 ARG B NH1 1 
ATOM   2479 N NH2 . ARG B 1 125 ? 30.749  -22.151 -11.014 1.00 46.61 ? 119 ARG B NH2 1 
ATOM   2480 N N   . LEU B 1 126 ? 29.055  -14.807 -12.107 1.00 35.55 ? 120 LEU B N   1 
ATOM   2481 C CA  . LEU B 1 126 ? 29.877  -13.857 -12.837 1.00 35.53 ? 120 LEU B CA  1 
ATOM   2482 C C   . LEU B 1 126 ? 30.116  -12.621 -12.002 1.00 36.30 ? 120 LEU B C   1 
ATOM   2483 O O   . LEU B 1 126 ? 31.253  -12.277 -11.715 1.00 37.46 ? 120 LEU B O   1 
ATOM   2484 C CB  . LEU B 1 126 ? 29.159  -13.482 -14.114 1.00 34.41 ? 120 LEU B CB  1 
ATOM   2485 C CG  . LEU B 1 126 ? 29.858  -12.545 -15.068 1.00 34.77 ? 120 LEU B CG  1 
ATOM   2486 C CD1 . LEU B 1 126 ? 31.145  -13.166 -15.513 1.00 35.07 ? 120 LEU B CD1 1 
ATOM   2487 C CD2 . LEU B 1 126 ? 28.940  -12.309 -16.252 1.00 34.15 ? 120 LEU B CD2 1 
ATOM   2488 N N   . ALA B 1 127 ? 29.030  -11.962 -11.612 1.00 36.92 ? 121 ALA B N   1 
ATOM   2489 C CA  . ALA B 1 127 ? 29.050  -10.842 -10.687 1.00 37.13 ? 121 ALA B CA  1 
ATOM   2490 C C   . ALA B 1 127 ? 29.929  -11.132 -9.480  1.00 38.31 ? 121 ALA B C   1 
ATOM   2491 O O   . ALA B 1 127 ? 30.672  -10.254 -9.052  1.00 38.62 ? 121 ALA B O   1 
ATOM   2492 C CB  . ALA B 1 127 ? 27.634  -10.521 -10.235 1.00 36.54 ? 121 ALA B CB  1 
ATOM   2493 N N   . TYR B 1 128 ? 29.865  -12.354 -8.934  1.00 39.06 ? 122 TYR B N   1 
ATOM   2494 C CA  . TYR B 1 128 ? 30.620  -12.639 -7.725  1.00 39.99 ? 122 TYR B CA  1 
ATOM   2495 C C   . TYR B 1 128 ? 32.129  -12.724 -7.884  1.00 40.94 ? 122 TYR B C   1 
ATOM   2496 O O   . TYR B 1 128 ? 32.865  -12.395 -6.945  1.00 41.30 ? 122 TYR B O   1 
ATOM   2497 C CB  . TYR B 1 128 ? 30.146  -13.911 -7.061  1.00 39.92 ? 122 TYR B CB  1 
ATOM   2498 C CG  . TYR B 1 128 ? 30.680  -14.089 -5.642  1.00 40.40 ? 122 TYR B CG  1 
ATOM   2499 C CD1 . TYR B 1 128 ? 30.526  -13.082 -4.667  1.00 40.60 ? 122 TYR B CD1 1 
ATOM   2500 C CD2 . TYR B 1 128 ? 31.335  -15.271 -5.265  1.00 40.76 ? 122 TYR B CD2 1 
ATOM   2501 C CE1 . TYR B 1 128 ? 31.034  -13.254 -3.347  1.00 39.70 ? 122 TYR B CE1 1 
ATOM   2502 C CE2 . TYR B 1 128 ? 31.832  -15.440 -3.963  1.00 40.16 ? 122 TYR B CE2 1 
ATOM   2503 C CZ  . TYR B 1 128 ? 31.671  -14.435 -3.021  1.00 38.92 ? 122 TYR B CZ  1 
ATOM   2504 O OH  . TYR B 1 128 ? 32.156  -14.641 -1.762  1.00 39.96 ? 122 TYR B OH  1 
ATOM   2505 N N   . ARG B 1 129 ? 32.608  -13.180 -9.034  1.00 41.99 ? 123 ARG B N   1 
ATOM   2506 C CA  . ARG B 1 129 ? 34.043  -13.424 -9.141  1.00 43.61 ? 123 ARG B CA  1 
ATOM   2507 C C   . ARG B 1 129 ? 34.759  -12.411 -10.015 1.00 44.92 ? 123 ARG B C   1 
ATOM   2508 O O   . ARG B 1 129 ? 36.001  -12.345 -10.052 1.00 44.91 ? 123 ARG B O   1 
ATOM   2509 C CB  . ARG B 1 129 ? 34.328  -14.836 -9.628  1.00 43.55 ? 123 ARG B CB  1 
ATOM   2510 C CG  . ARG B 1 129 ? 34.322  -14.984 -11.091 1.00 43.52 ? 123 ARG B CG  1 
ATOM   2511 C CD  . ARG B 1 129 ? 34.660  -16.388 -11.424 1.00 46.54 ? 123 ARG B CD  1 
ATOM   2512 N NE  . ARG B 1 129 ? 33.578  -17.330 -11.130 1.00 48.86 ? 123 ARG B NE  1 
ATOM   2513 C CZ  . ARG B 1 129 ? 32.507  -17.549 -11.908 1.00 49.43 ? 123 ARG B CZ  1 
ATOM   2514 N NH1 . ARG B 1 129 ? 32.308  -16.874 -13.057 1.00 43.54 ? 123 ARG B NH1 1 
ATOM   2515 N NH2 . ARG B 1 129 ? 31.620  -18.462 -11.509 1.00 51.14 ? 123 ARG B NH2 1 
ATOM   2516 N N   . SER B 1 130 ? 33.966  -11.622 -10.725 1.00 46.29 ? 124 SER B N   1 
ATOM   2517 C CA  . SER B 1 130 ? 34.535  -10.623 -11.560 1.00 47.44 ? 124 SER B CA  1 
ATOM   2518 C C   . SER B 1 130 ? 35.144  -9.545  -10.691 1.00 49.08 ? 124 SER B C   1 
ATOM   2519 O O   . SER B 1 130 ? 34.708  -9.314  -9.543  1.00 49.71 ? 124 SER B O   1 
ATOM   2520 C CB  . SER B 1 130 ? 33.498  -10.101 -12.511 1.00 47.25 ? 124 SER B CB  1 
ATOM   2521 O OG  . SER B 1 130 ? 33.208  -11.146 -13.413 1.00 45.90 ? 124 SER B OG  1 
ATOM   2522 N N   . LYS B 1 131 ? 36.213  -8.962  -11.223 1.00 50.06 ? 125 LYS B N   1 
ATOM   2523 C CA  . LYS B 1 131 ? 36.872  -7.837  -10.616 1.00 51.00 ? 125 LYS B CA  1 
ATOM   2524 C C   . LYS B 1 131 ? 36.434  -6.623  -11.423 1.00 51.57 ? 125 LYS B C   1 
ATOM   2525 O O   . LYS B 1 131 ? 37.040  -6.264  -12.457 1.00 51.75 ? 125 LYS B O   1 
ATOM   2526 C CB  . LYS B 1 131 ? 38.389  -8.049  -10.616 1.00 51.28 ? 125 LYS B CB  1 
ATOM   2527 C CG  . LYS B 1 131 ? 38.848  -9.101  -9.609  1.00 51.63 ? 125 LYS B CG  1 
ATOM   2528 C CD  . LYS B 1 131 ? 39.997  -9.964  -10.150 1.00 53.22 ? 125 LYS B CD  1 
ATOM   2529 C CE  . LYS B 1 131 ? 40.528  -10.953 -9.080  1.00 52.84 ? 125 LYS B CE  1 
ATOM   2530 N NZ  . LYS B 1 131 ? 41.940  -11.391 -9.336  1.00 51.67 ? 125 LYS B NZ  1 
ATOM   2531 N N   . PRO B 1 132 ? 35.349  -5.994  -10.971 1.00 51.92 ? 126 PRO B N   1 
ATOM   2532 C CA  . PRO B 1 132 ? 34.786  -4.835  -11.671 1.00 52.13 ? 126 PRO B CA  1 
ATOM   2533 C C   . PRO B 1 132 ? 35.796  -3.694  -11.721 1.00 52.25 ? 126 PRO B C   1 
ATOM   2534 O O   . PRO B 1 132 ? 35.856  -2.972  -12.711 1.00 52.18 ? 126 PRO B O   1 
ATOM   2535 C CB  . PRO B 1 132 ? 33.590  -4.438  -10.795 1.00 52.22 ? 126 PRO B CB  1 
ATOM   2536 C CG  . PRO B 1 132 ? 33.849  -5.066  -9.447  1.00 52.44 ? 126 PRO B CG  1 
ATOM   2537 C CD  . PRO B 1 132 ? 34.622  -6.320  -9.734  1.00 52.00 ? 126 PRO B CD  1 
ATOM   2538 N N   . GLY B 1 133 ? 36.584  -3.568  -10.650 1.00 52.56 ? 127 GLY B N   1 
ATOM   2539 C CA  . GLY B 1 133 ? 37.572  -2.506  -10.489 1.00 52.59 ? 127 GLY B CA  1 
ATOM   2540 C C   . GLY B 1 133 ? 38.567  -2.480  -11.627 1.00 52.48 ? 127 GLY B C   1 
ATOM   2541 O O   . GLY B 1 133 ? 38.836  -1.423  -12.190 1.00 53.05 ? 127 GLY B O   1 
ATOM   2542 N N   . GLU B 1 134 ? 39.095  -3.648  -11.983 1.00 51.95 ? 128 GLU B N   1 
ATOM   2543 C CA  . GLU B 1 134 ? 40.035  -3.762  -13.086 1.00 51.16 ? 128 GLU B CA  1 
ATOM   2544 C C   . GLU B 1 134 ? 39.281  -3.822  -14.428 1.00 50.56 ? 128 GLU B C   1 
ATOM   2545 O O   . GLU B 1 134 ? 39.888  -3.855  -15.486 1.00 50.63 ? 128 GLU B O   1 
ATOM   2546 C CB  . GLU B 1 134 ? 40.922  -5.006  -12.916 1.00 50.96 ? 128 GLU B CB  1 
ATOM   2547 C CG  . GLU B 1 134 ? 41.398  -5.326  -11.484 1.00 51.43 ? 128 GLU B CG  1 
ATOM   2548 C CD  . GLU B 1 134 ? 42.448  -6.452  -11.439 1.00 52.11 ? 128 GLU B CD  1 
ATOM   2549 O OE1 . GLU B 1 134 ? 43.384  -6.419  -12.274 1.00 54.91 ? 128 GLU B OE1 1 
ATOM   2550 O OE2 . GLU B 1 134 ? 42.352  -7.367  -10.578 1.00 51.19 ? 128 GLU B OE2 1 
ATOM   2551 N N   . GLY B 1 135 ? 37.956  -3.831  -14.386 1.00 49.97 ? 129 GLY B N   1 
ATOM   2552 C CA  . GLY B 1 135 ? 37.167  -4.028  -15.594 1.00 49.47 ? 129 GLY B CA  1 
ATOM   2553 C C   . GLY B 1 135 ? 37.298  -5.442  -16.167 1.00 49.18 ? 129 GLY B C   1 
ATOM   2554 O O   . GLY B 1 135 ? 37.242  -5.644  -17.391 1.00 49.57 ? 129 GLY B O   1 
ATOM   2555 N N   . LYS B 1 136 ? 37.484  -6.433  -15.297 1.00 48.59 ? 130 LYS B N   1 
ATOM   2556 C CA  . LYS B 1 136 ? 37.599  -7.823  -15.757 1.00 47.29 ? 130 LYS B CA  1 
ATOM   2557 C C   . LYS B 1 136 ? 36.328  -8.624  -15.536 1.00 46.35 ? 130 LYS B C   1 
ATOM   2558 O O   . LYS B 1 136 ? 35.689  -8.559  -14.485 1.00 46.32 ? 130 LYS B O   1 
ATOM   2559 C CB  . LYS B 1 136 ? 38.736  -8.535  -15.051 1.00 47.30 ? 130 LYS B CB  1 
ATOM   2560 C CG  . LYS B 1 136 ? 40.105  -8.083  -15.431 1.00 46.70 ? 130 LYS B CG  1 
ATOM   2561 C CD  . LYS B 1 136 ? 41.113  -8.893  -14.645 1.00 44.76 ? 130 LYS B CD  1 
ATOM   2562 C CE  . LYS B 1 136 ? 42.471  -8.311  -14.787 1.00 44.37 ? 130 LYS B CE  1 
ATOM   2563 N NZ  . LYS B 1 136 ? 42.945  -8.658  -16.131 1.00 46.45 ? 130 LYS B NZ  1 
ATOM   2564 N N   . LEU B 1 137 ? 35.966  -9.393  -16.538 1.00 45.31 ? 131 LEU B N   1 
ATOM   2565 C CA  . LEU B 1 137 ? 34.880  -10.334 -16.382 1.00 44.52 ? 131 LEU B CA  1 
ATOM   2566 C C   . LEU B 1 137 ? 35.472  -11.736 -16.389 1.00 43.43 ? 131 LEU B C   1 
ATOM   2567 O O   . LEU B 1 137 ? 36.228  -12.091 -17.290 1.00 43.21 ? 131 LEU B O   1 
ATOM   2568 C CB  . LEU B 1 137 ? 33.899  -10.142 -17.517 1.00 44.60 ? 131 LEU B CB  1 
ATOM   2569 C CG  . LEU B 1 137 ? 33.232  -8.789  -17.366 1.00 44.77 ? 131 LEU B CG  1 
ATOM   2570 C CD1 . LEU B 1 137 ? 33.402  -7.959  -18.630 1.00 45.53 ? 131 LEU B CD1 1 
ATOM   2571 C CD2 . LEU B 1 137 ? 31.781  -9.014  -17.016 1.00 44.98 ? 131 LEU B CD2 1 
ATOM   2572 N N   . ILE B 1 138 ? 35.167  -12.511 -15.366 1.00 42.26 ? 132 ILE B N   1 
ATOM   2573 C CA  . ILE B 1 138 ? 35.760  -13.830 -15.247 1.00 41.48 ? 132 ILE B CA  1 
ATOM   2574 C C   . ILE B 1 138 ? 34.673  -14.848 -15.340 1.00 41.03 ? 132 ILE B C   1 
ATOM   2575 O O   . ILE B 1 138 ? 33.895  -15.002 -14.411 1.00 40.73 ? 132 ILE B O   1 
ATOM   2576 C CB  . ILE B 1 138 ? 36.530  -14.016 -13.932 1.00 41.40 ? 132 ILE B CB  1 
ATOM   2577 C CG1 . ILE B 1 138 ? 37.599  -12.923 -13.762 1.00 39.65 ? 132 ILE B CG1 1 
ATOM   2578 C CG2 . ILE B 1 138 ? 37.164  -15.391 -13.910 1.00 41.40 ? 132 ILE B CG2 1 
ATOM   2579 C CD1 . ILE B 1 138 ? 38.351  -12.988 -12.460 1.00 35.85 ? 132 ILE B CD1 1 
ATOM   2580 N N   . PHE B 1 139 ? 34.636  -15.551 -16.466 1.00 41.18 ? 133 PHE B N   1 
ATOM   2581 C CA  . PHE B 1 139 ? 33.486  -16.381 -16.811 1.00 40.99 ? 133 PHE B CA  1 
ATOM   2582 C C   . PHE B 1 139 ? 33.593  -17.759 -16.227 1.00 40.83 ? 133 PHE B C   1 
ATOM   2583 O O   . PHE B 1 139 ? 34.654  -18.144 -15.750 1.00 40.43 ? 133 PHE B O   1 
ATOM   2584 C CB  . PHE B 1 139 ? 33.288  -16.419 -18.318 1.00 41.28 ? 133 PHE B CB  1 
ATOM   2585 C CG  . PHE B 1 139 ? 32.834  -15.112 -18.881 1.00 41.55 ? 133 PHE B CG  1 
ATOM   2586 C CD1 . PHE B 1 139 ? 33.768  -14.160 -19.294 1.00 41.42 ? 133 PHE B CD1 1 
ATOM   2587 C CD2 . PHE B 1 139 ? 31.464  -14.808 -18.950 1.00 40.54 ? 133 PHE B CD2 1 
ATOM   2588 C CE1 . PHE B 1 139 ? 33.333  -12.922 -19.795 1.00 43.92 ? 133 PHE B CE1 1 
ATOM   2589 C CE2 . PHE B 1 139 ? 31.022  -13.572 -19.423 1.00 41.10 ? 133 PHE B CE2 1 
ATOM   2590 C CZ  . PHE B 1 139 ? 31.946  -12.619 -19.849 1.00 41.85 ? 133 PHE B CZ  1 
ATOM   2591 N N   . CYS B 1 140 ? 32.483  -18.486 -16.238 1.00 41.10 ? 134 CYS B N   1 
ATOM   2592 C CA  . CYS B 1 140 ? 32.404  -19.789 -15.562 1.00 41.99 ? 134 CYS B CA  1 
ATOM   2593 C C   . CYS B 1 140 ? 33.387  -20.848 -16.146 1.00 41.68 ? 134 CYS B C   1 
ATOM   2594 O O   . CYS B 1 140 ? 33.993  -21.617 -15.430 1.00 41.39 ? 134 CYS B O   1 
ATOM   2595 C CB  . CYS B 1 140 ? 30.937  -20.260 -15.504 1.00 42.13 ? 134 CYS B CB  1 
ATOM   2596 S SG  . CYS B 1 140 ? 29.889  -19.339 -14.238 1.00 44.90 ? 134 CYS B SG  1 
ATOM   2597 N N   . SER B 1 141 ? 33.543  -20.830 -17.456 1.00 41.93 ? 135 SER B N   1 
ATOM   2598 C CA  . SER B 1 141 ? 34.544  -21.554 -18.193 1.00 42.30 ? 135 SER B CA  1 
ATOM   2599 C C   . SER B 1 141 ? 35.932  -21.058 -17.821 1.00 42.67 ? 135 SER B C   1 
ATOM   2600 O O   . SER B 1 141 ? 36.960  -21.634 -18.243 1.00 42.61 ? 135 SER B O   1 
ATOM   2601 C CB  . SER B 1 141 ? 34.355  -21.202 -19.661 1.00 43.03 ? 135 SER B CB  1 
ATOM   2602 O OG  . SER B 1 141 ? 34.657  -19.802 -19.848 1.00 43.21 ? 135 SER B OG  1 
ATOM   2603 N N   . GLY B 1 142 ? 35.974  -19.955 -17.089 1.00 42.28 ? 136 GLY B N   1 
ATOM   2604 C CA  . GLY B 1 142 ? 37.236  -19.460 -16.599 1.00 42.52 ? 136 GLY B CA  1 
ATOM   2605 C C   . GLY B 1 142 ? 37.941  -18.553 -17.575 1.00 43.17 ? 136 GLY B C   1 
ATOM   2606 O O   . GLY B 1 142 ? 39.041  -18.079 -17.276 1.00 42.94 ? 136 GLY B O   1 
ATOM   2607 N N   . LEU B 1 143 ? 37.326  -18.298 -18.736 1.00 43.72 ? 137 LEU B N   1 
ATOM   2608 C CA  . LEU B 1 143 ? 37.803  -17.216 -19.619 1.00 44.21 ? 137 LEU B CA  1 
ATOM   2609 C C   . LEU B 1 143 ? 37.756  -15.857 -18.914 1.00 45.09 ? 137 LEU B C   1 
ATOM   2610 O O   . LEU B 1 143 ? 36.821  -15.571 -18.156 1.00 45.46 ? 137 LEU B O   1 
ATOM   2611 C CB  . LEU B 1 143 ? 37.005  -17.139 -20.925 1.00 43.78 ? 137 LEU B CB  1 
ATOM   2612 C CG  . LEU B 1 143 ? 37.695  -16.287 -21.998 1.00 42.74 ? 137 LEU B CG  1 
ATOM   2613 C CD1 . LEU B 1 143 ? 38.951  -16.958 -22.546 1.00 41.85 ? 137 LEU B CD1 1 
ATOM   2614 C CD2 . LEU B 1 143 ? 36.753  -16.008 -23.097 1.00 41.77 ? 137 LEU B CD2 1 
ATOM   2615 N N   . VAL B 1 144 ? 38.773  -15.039 -19.153 1.00 45.70 ? 138 VAL B N   1 
ATOM   2616 C CA  . VAL B 1 144 ? 38.808  -13.698 -18.615 1.00 46.48 ? 138 VAL B CA  1 
ATOM   2617 C C   . VAL B 1 144 ? 38.822  -12.712 -19.767 1.00 47.27 ? 138 VAL B C   1 
ATOM   2618 O O   . VAL B 1 144 ? 39.740  -12.737 -20.591 1.00 48.04 ? 138 VAL B O   1 
ATOM   2619 C CB  . VAL B 1 144 ? 40.074  -13.479 -17.766 1.00 46.39 ? 138 VAL B CB  1 
ATOM   2620 C CG1 . VAL B 1 144 ? 40.328  -11.982 -17.533 1.00 46.16 ? 138 VAL B CG1 1 
ATOM   2621 C CG2 . VAL B 1 144 ? 39.956  -14.195 -16.462 1.00 46.02 ? 138 VAL B CG2 1 
ATOM   2622 N N   . LEU B 1 145 ? 37.831  -11.833 -19.813 1.00 47.54 ? 139 LEU B N   1 
ATOM   2623 C CA  . LEU B 1 145 ? 37.748  -10.824 -20.853 1.00 48.25 ? 139 LEU B CA  1 
ATOM   2624 C C   . LEU B 1 145 ? 37.644  -9.483  -20.175 1.00 48.55 ? 139 LEU B C   1 
ATOM   2625 O O   . LEU B 1 145 ? 37.184  -9.436  -19.037 1.00 49.13 ? 139 LEU B O   1 
ATOM   2626 C CB  . LEU B 1 145 ? 36.515  -11.074 -21.715 1.00 48.13 ? 139 LEU B CB  1 
ATOM   2627 C CG  . LEU B 1 145 ? 36.649  -11.793 -23.068 1.00 50.17 ? 139 LEU B CG  1 
ATOM   2628 C CD1 . LEU B 1 145 ? 38.005  -12.476 -23.330 1.00 51.22 ? 139 LEU B CD1 1 
ATOM   2629 C CD2 . LEU B 1 145 ? 35.486  -12.754 -23.326 1.00 50.06 ? 139 LEU B CD2 1 
ATOM   2630 N N   . HIS B 1 146 ? 38.076  -8.411  -20.849 1.00 48.69 ? 140 HIS B N   1 
ATOM   2631 C CA  . HIS B 1 146 ? 37.904  -7.037  -20.356 1.00 48.92 ? 140 HIS B CA  1 
ATOM   2632 C C   . HIS B 1 146 ? 36.477  -6.560  -20.634 1.00 49.55 ? 140 HIS B C   1 
ATOM   2633 O O   . HIS B 1 146 ? 35.839  -7.092  -21.563 1.00 49.85 ? 140 HIS B O   1 
ATOM   2634 C CB  . HIS B 1 146 ? 38.887  -6.105  -21.068 1.00 48.98 ? 140 HIS B CB  1 
ATOM   2635 C CG  . HIS B 1 146 ? 38.854  -4.690  -20.566 1.00 48.92 ? 140 HIS B CG  1 
ATOM   2636 N ND1 . HIS B 1 146 ? 39.767  -4.199  -19.658 1.00 48.16 ? 140 HIS B ND1 1 
ATOM   2637 C CD2 . HIS B 1 146 ? 38.012  -3.664  -20.841 1.00 49.32 ? 140 HIS B CD2 1 
ATOM   2638 C CE1 . HIS B 1 146 ? 39.485  -2.936  -19.389 1.00 47.99 ? 140 HIS B CE1 1 
ATOM   2639 N NE2 . HIS B 1 146 ? 38.422  -2.588  -20.092 1.00 48.50 ? 140 HIS B NE2 1 
ATOM   2640 N N   . ARG B 1 147 ? 35.980  -5.560  -19.876 1.00 49.64 ? 141 ARG B N   1 
ATOM   2641 C CA  . ARG B 1 147 ? 34.637  -4.981  -20.128 1.00 49.75 ? 141 ARG B CA  1 
ATOM   2642 C C   . ARG B 1 147 ? 34.405  -4.691  -21.606 1.00 49.60 ? 141 ARG B C   1 
ATOM   2643 O O   . ARG B 1 147 ? 33.380  -5.061  -22.173 1.00 50.22 ? 141 ARG B O   1 
ATOM   2644 C CB  . ARG B 1 147 ? 34.344  -3.688  -19.341 1.00 49.08 ? 141 ARG B CB  1 
ATOM   2645 C CG  . ARG B 1 147 ? 32.964  -3.066  -19.809 1.00 50.27 ? 141 ARG B CG  1 
ATOM   2646 C CD  . ARG B 1 147 ? 32.542  -1.697  -19.219 1.00 51.69 ? 141 ARG B CD  1 
ATOM   2647 N NE  . ARG B 1 147 ? 33.408  -0.587  -19.636 1.00 53.77 ? 141 ARG B NE  1 
ATOM   2648 C CZ  . ARG B 1 147 ? 34.615  -0.377  -19.109 1.00 56.29 ? 141 ARG B CZ  1 
ATOM   2649 N NH1 . ARG B 1 147 ? 35.081  -1.207  -18.162 1.00 56.72 ? 141 ARG B NH1 1 
ATOM   2650 N NH2 . ARG B 1 147 ? 35.368  0.635   -19.530 1.00 55.48 ? 141 ARG B NH2 1 
ATOM   2651 N N   . LEU B 1 148 ? 35.368  -4.020  -22.220 1.00 49.23 ? 142 LEU B N   1 
ATOM   2652 C CA  . LEU B 1 148 ? 35.212  -3.503  -23.568 1.00 48.78 ? 142 LEU B CA  1 
ATOM   2653 C C   . LEU B 1 148 ? 35.248  -4.581  -24.644 1.00 48.51 ? 142 LEU B C   1 
ATOM   2654 O O   . LEU B 1 148 ? 34.901  -4.301  -25.794 1.00 48.60 ? 142 LEU B O   1 
ATOM   2655 C CB  . LEU B 1 148 ? 36.269  -2.422  -23.831 1.00 48.73 ? 142 LEU B CB  1 
ATOM   2656 C CG  . LEU B 1 148 ? 36.086  -1.216  -22.898 1.00 49.49 ? 142 LEU B CG  1 
ATOM   2657 C CD1 . LEU B 1 148 ? 37.303  -0.314  -22.929 1.00 49.73 ? 142 LEU B CD1 1 
ATOM   2658 C CD2 . LEU B 1 148 ? 34.789  -0.415  -23.231 1.00 49.70 ? 142 LEU B CD2 1 
ATOM   2659 N N   . GLN B 1 149 ? 35.664  -5.802  -24.283 1.00 47.72 ? 143 GLN B N   1 
ATOM   2660 C CA  . GLN B 1 149 ? 35.680  -6.915  -25.234 1.00 47.00 ? 143 GLN B CA  1 
ATOM   2661 C C   . GLN B 1 149 ? 34.311  -7.619  -25.252 1.00 46.74 ? 143 GLN B C   1 
ATOM   2662 O O   . GLN B 1 149 ? 33.995  -8.370  -26.167 1.00 45.84 ? 143 GLN B O   1 
ATOM   2663 C CB  . GLN B 1 149 ? 36.816  -7.898  -24.926 1.00 46.92 ? 143 GLN B CB  1 
ATOM   2664 C CG  . GLN B 1 149 ? 38.231  -7.411  -25.211 1.00 47.05 ? 143 GLN B CG  1 
ATOM   2665 C CD  . GLN B 1 149 ? 39.275  -8.546  -25.196 1.00 47.67 ? 143 GLN B CD  1 
ATOM   2666 O OE1 . GLN B 1 149 ? 39.840  -8.878  -24.150 1.00 47.93 ? 143 GLN B OE1 1 
ATOM   2667 N NE2 . GLN B 1 149 ? 39.541  -9.124  -26.367 1.00 47.64 ? 143 GLN B NE2 1 
ATOM   2668 N N   . CYS B 1 150 ? 33.494  -7.342  -24.241 1.00 46.99 ? 144 CYS B N   1 
ATOM   2669 C CA  . CYS B 1 150 ? 32.138  -7.868  -24.178 1.00 47.58 ? 144 CYS B CA  1 
ATOM   2670 C C   . CYS B 1 150 ? 31.050  -6.957  -24.724 1.00 47.73 ? 144 CYS B C   1 
ATOM   2671 O O   . CYS B 1 150 ? 29.955  -7.429  -24.991 1.00 47.83 ? 144 CYS B O   1 
ATOM   2672 C CB  . CYS B 1 150 ? 31.777  -8.204  -22.748 1.00 47.73 ? 144 CYS B CB  1 
ATOM   2673 S SG  . CYS B 1 150 ? 32.922  -9.327  -22.026 1.00 48.83 ? 144 CYS B SG  1 
ATOM   2674 N N   . ALA B 1 151 ? 31.314  -5.665  -24.883 1.00 48.36 ? 145 ALA B N   1 
ATOM   2675 C CA  . ALA B 1 151 ? 30.212  -4.737  -25.229 1.00 49.31 ? 145 ALA B CA  1 
ATOM   2676 C C   . ALA B 1 151 ? 29.609  -5.122  -26.567 1.00 49.65 ? 145 ALA B C   1 
ATOM   2677 O O   . ALA B 1 151 ? 28.394  -5.052  -26.777 1.00 49.39 ? 145 ALA B O   1 
ATOM   2678 C CB  . ALA B 1 151 ? 30.666  -3.274  -25.231 1.00 48.71 ? 145 ALA B CB  1 
ATOM   2679 N N   . ARG B 1 152 ? 30.469  -5.585  -27.458 1.00 50.20 ? 146 ARG B N   1 
ATOM   2680 C CA  . ARG B 1 152 ? 30.017  -5.899  -28.787 1.00 50.96 ? 146 ARG B CA  1 
ATOM   2681 C C   . ARG B 1 152 ? 29.067  -7.120  -28.810 1.00 50.59 ? 146 ARG B C   1 
ATOM   2682 O O   . ARG B 1 152 ? 28.217  -7.216  -29.697 1.00 51.13 ? 146 ARG B O   1 
ATOM   2683 C CB  . ARG B 1 152 ? 31.221  -6.082  -29.716 1.00 51.59 ? 146 ARG B CB  1 
ATOM   2684 C CG  . ARG B 1 152 ? 30.949  -5.644  -31.143 1.00 53.47 ? 146 ARG B CG  1 
ATOM   2685 C CD  . ARG B 1 152 ? 31.046  -4.138  -31.286 1.00 56.65 ? 146 ARG B CD  1 
ATOM   2686 N NE  . ARG B 1 152 ? 32.352  -3.637  -31.741 1.00 58.34 ? 146 ARG B NE  1 
ATOM   2687 C CZ  . ARG B 1 152 ? 33.214  -4.271  -32.538 1.00 59.36 ? 146 ARG B CZ  1 
ATOM   2688 N NH1 . ARG B 1 152 ? 32.952  -5.493  -33.017 1.00 59.11 ? 146 ARG B NH1 1 
ATOM   2689 N NH2 . ARG B 1 152 ? 34.354  -3.660  -32.863 1.00 59.51 ? 146 ARG B NH2 1 
ATOM   2690 N N   . GLY B 1 153 ? 29.195  -8.032  -27.840 1.00 49.51 ? 147 GLY B N   1 
ATOM   2691 C CA  . GLY B 1 153 ? 28.296  -9.183  -27.747 1.00 48.43 ? 147 GLY B CA  1 
ATOM   2692 C C   . GLY B 1 153 ? 27.155  -9.048  -26.759 1.00 48.42 ? 147 GLY B C   1 
ATOM   2693 O O   . GLY B 1 153 ? 26.005  -9.371  -27.077 1.00 47.72 ? 147 GLY B O   1 
ATOM   2694 N N   . PHE B 1 154 ? 27.483  -8.567  -25.557 1.00 48.85 ? 148 PHE B N   1 
ATOM   2695 C CA  . PHE B 1 154 ? 26.517  -8.347  -24.463 1.00 49.21 ? 148 PHE B CA  1 
ATOM   2696 C C   . PHE B 1 154 ? 25.648  -7.080  -24.532 1.00 49.47 ? 148 PHE B C   1 
ATOM   2697 O O   . PHE B 1 154 ? 24.620  -6.998  -23.832 1.00 49.73 ? 148 PHE B O   1 
ATOM   2698 C CB  . PHE B 1 154 ? 27.229  -8.446  -23.096 1.00 49.25 ? 148 PHE B CB  1 
ATOM   2699 C CG  . PHE B 1 154 ? 27.731  -9.836  -22.801 1.00 50.47 ? 148 PHE B CG  1 
ATOM   2700 C CD1 . PHE B 1 154 ? 28.895  -10.319 -23.410 1.00 50.38 ? 148 PHE B CD1 1 
ATOM   2701 C CD2 . PHE B 1 154 ? 27.000  -10.696 -21.991 1.00 50.72 ? 148 PHE B CD2 1 
ATOM   2702 C CE1 . PHE B 1 154 ? 29.324  -11.609 -23.186 1.00 49.70 ? 148 PHE B CE1 1 
ATOM   2703 C CE2 . PHE B 1 154 ? 27.428  -11.994 -21.783 1.00 49.76 ? 148 PHE B CE2 1 
ATOM   2704 C CZ  . PHE B 1 154 ? 28.598  -12.446 -22.374 1.00 48.79 ? 148 PHE B CZ  1 
ATOM   2705 N N   . GLY B 1 155 ? 26.035  -6.103  -25.356 1.00 49.19 ? 149 GLY B N   1 
ATOM   2706 C CA  . GLY B 1 155 ? 25.406  -4.775  -25.291 1.00 49.54 ? 149 GLY B CA  1 
ATOM   2707 C C   . GLY B 1 155 ? 25.567  -4.187  -23.897 1.00 49.56 ? 149 GLY B C   1 
ATOM   2708 O O   . GLY B 1 155 ? 26.419  -4.633  -23.135 1.00 49.66 ? 149 GLY B O   1 
ATOM   2709 N N   . ASP B 1 156 ? 24.727  -3.221  -23.544 1.00 50.28 ? 150 ASP B N   1 
ATOM   2710 C CA  . ASP B 1 156 ? 24.759  -2.592  -22.201 1.00 51.19 ? 150 ASP B CA  1 
ATOM   2711 C C   . ASP B 1 156 ? 24.723  -3.554  -21.027 1.00 50.99 ? 150 ASP B C   1 
ATOM   2712 O O   . ASP B 1 156 ? 25.218  -3.231  -19.929 1.00 51.40 ? 150 ASP B O   1 
ATOM   2713 C CB  . ASP B 1 156 ? 23.609  -1.607  -22.029 1.00 51.51 ? 150 ASP B CB  1 
ATOM   2714 C CG  . ASP B 1 156 ? 23.829  -0.361  -22.817 1.00 54.03 ? 150 ASP B CG  1 
ATOM   2715 O OD1 . ASP B 1 156 ? 24.318  -0.509  -23.959 1.00 56.67 ? 150 ASP B OD1 1 
ATOM   2716 O OD2 . ASP B 1 156 ? 23.537  0.757   -22.314 1.00 56.79 ? 150 ASP B OD2 1 
ATOM   2717 N N   . TRP B 1 157 ? 24.145  -4.729  -21.261 1.00 50.02 ? 151 TRP B N   1 
ATOM   2718 C CA  . TRP B 1 157 ? 23.935  -5.701  -20.211 1.00 49.25 ? 151 TRP B CA  1 
ATOM   2719 C C   . TRP B 1 157 ? 25.192  -5.959  -19.393 1.00 49.36 ? 151 TRP B C   1 
ATOM   2720 O O   . TRP B 1 157 ? 25.106  -6.179  -18.188 1.00 49.56 ? 151 TRP B O   1 
ATOM   2721 C CB  . TRP B 1 157 ? 23.439  -7.013  -20.807 1.00 48.57 ? 151 TRP B CB  1 
ATOM   2722 C CG  . TRP B 1 157 ? 23.024  -8.019  -19.793 1.00 47.05 ? 151 TRP B CG  1 
ATOM   2723 C CD1 . TRP B 1 157 ? 22.484  -7.775  -18.570 1.00 45.40 ? 151 TRP B CD1 1 
ATOM   2724 C CD2 . TRP B 1 157 ? 23.089  -9.436  -19.930 1.00 45.38 ? 151 TRP B CD2 1 
ATOM   2725 N NE1 . TRP B 1 157 ? 22.220  -8.957  -17.929 1.00 44.97 ? 151 TRP B NE1 1 
ATOM   2726 C CE2 . TRP B 1 157 ? 22.580  -9.993  -18.746 1.00 45.26 ? 151 TRP B CE2 1 
ATOM   2727 C CE3 . TRP B 1 157 ? 23.516  -10.287 -20.940 1.00 45.30 ? 151 TRP B CE3 1 
ATOM   2728 C CZ2 . TRP B 1 157 ? 22.481  -11.369 -18.550 1.00 45.80 ? 151 TRP B CZ2 1 
ATOM   2729 C CZ3 . TRP B 1 157 ? 23.426  -11.665 -20.735 1.00 46.04 ? 151 TRP B CZ3 1 
ATOM   2730 C CH2 . TRP B 1 157 ? 22.919  -12.186 -19.553 1.00 45.14 ? 151 TRP B CH2 1 
ATOM   2731 N N   . ILE B 1 158 ? 26.353  -5.947  -20.038 1.00 49.21 ? 152 ILE B N   1 
ATOM   2732 C CA  . ILE B 1 158 ? 27.594  -6.180  -19.298 1.00 49.16 ? 152 ILE B CA  1 
ATOM   2733 C C   . ILE B 1 158 ? 27.958  -5.067  -18.306 1.00 49.41 ? 152 ILE B C   1 
ATOM   2734 O O   . ILE B 1 158 ? 28.597  -5.350  -17.299 1.00 49.98 ? 152 ILE B O   1 
ATOM   2735 C CB  . ILE B 1 158 ? 28.775  -6.517  -20.233 1.00 49.16 ? 152 ILE B CB  1 
ATOM   2736 C CG1 . ILE B 1 158 ? 29.834  -7.288  -19.472 1.00 49.34 ? 152 ILE B CG1 1 
ATOM   2737 C CG2 . ILE B 1 158 ? 29.320  -5.304  -20.979 1.00 48.77 ? 152 ILE B CG2 1 
ATOM   2738 C CD1 . ILE B 1 158 ? 29.533  -8.824  -19.439 1.00 51.80 ? 152 ILE B CD1 1 
ATOM   2739 N N   . ASP B 1 159 ? 27.541  -3.824  -18.573 1.00 49.06 ? 153 ASP B N   1 
ATOM   2740 C CA  . ASP B 1 159 ? 27.803  -2.702  -17.666 1.00 49.65 ? 153 ASP B CA  1 
ATOM   2741 C C   . ASP B 1 159 ? 26.968  -2.904  -16.423 1.00 49.01 ? 153 ASP B C   1 
ATOM   2742 O O   . ASP B 1 159 ? 27.362  -2.601  -15.288 1.00 48.80 ? 153 ASP B O   1 
ATOM   2743 C CB  . ASP B 1 159 ? 27.404  -1.351  -18.308 1.00 50.39 ? 153 ASP B CB  1 
ATOM   2744 C CG  . ASP B 1 159 ? 28.342  -0.915  -19.458 1.00 53.28 ? 153 ASP B CG  1 
ATOM   2745 O OD1 . ASP B 1 159 ? 29.411  -1.576  -19.663 1.00 56.00 ? 153 ASP B OD1 1 
ATOM   2746 O OD2 . ASP B 1 159 ? 28.001  0.105   -20.141 1.00 53.44 ? 153 ASP B OD2 1 
ATOM   2747 N N   . SER B 1 160 ? 25.784  -3.428  -16.683 1.00 48.50 ? 154 SER B N   1 
ATOM   2748 C CA  . SER B 1 160 ? 24.725  -3.517  -15.730 1.00 47.62 ? 154 SER B CA  1 
ATOM   2749 C C   . SER B 1 160 ? 25.051  -4.631  -14.743 1.00 46.64 ? 154 SER B C   1 
ATOM   2750 O O   . SER B 1 160 ? 24.684  -4.570  -13.559 1.00 46.01 ? 154 SER B O   1 
ATOM   2751 C CB  . SER B 1 160 ? 23.467  -3.833  -16.517 1.00 47.75 ? 154 SER B CB  1 
ATOM   2752 O OG  . SER B 1 160 ? 22.336  -3.356  -15.843 1.00 50.61 ? 154 SER B OG  1 
ATOM   2753 N N   . ILE B 1 161 ? 25.738  -5.645  -15.267 1.00 45.69 ? 155 ILE B N   1 
ATOM   2754 C CA  . ILE B 1 161 ? 26.225  -6.758  -14.497 1.00 45.04 ? 155 ILE B CA  1 
ATOM   2755 C C   . ILE B 1 161 ? 27.362  -6.297  -13.604 1.00 44.56 ? 155 ILE B C   1 
ATOM   2756 O O   . ILE B 1 161 ? 27.374  -6.623  -12.425 1.00 44.77 ? 155 ILE B O   1 
ATOM   2757 C CB  . ILE B 1 161 ? 26.643  -7.949  -15.399 1.00 45.22 ? 155 ILE B CB  1 
ATOM   2758 C CG1 . ILE B 1 161 ? 25.394  -8.704  -15.864 1.00 44.93 ? 155 ILE B CG1 1 
ATOM   2759 C CG2 . ILE B 1 161 ? 27.556  -8.947  -14.630 1.00 45.11 ? 155 ILE B CG2 1 
ATOM   2760 C CD1 . ILE B 1 161 ? 25.652  -9.736  -16.954 1.00 44.55 ? 155 ILE B CD1 1 
ATOM   2761 N N   . LEU B 1 162 ? 28.308  -5.552  -14.162 1.00 43.96 ? 156 LEU B N   1 
ATOM   2762 C CA  . LEU B 1 162 ? 29.421  -4.984  -13.374 1.00 43.69 ? 156 LEU B CA  1 
ATOM   2763 C C   . LEU B 1 162 ? 28.977  -4.014  -12.269 1.00 43.59 ? 156 LEU B C   1 
ATOM   2764 O O   . LEU B 1 162 ? 29.518  -4.050  -11.145 1.00 43.17 ? 156 LEU B O   1 
ATOM   2765 C CB  . LEU B 1 162 ? 30.461  -4.310  -14.281 1.00 43.45 ? 156 LEU B CB  1 
ATOM   2766 C CG  . LEU B 1 162 ? 31.292  -5.223  -15.181 1.00 42.72 ? 156 LEU B CG  1 
ATOM   2767 C CD1 . LEU B 1 162 ? 31.879  -4.473  -16.343 1.00 39.60 ? 156 LEU B CD1 1 
ATOM   2768 C CD2 . LEU B 1 162 ? 32.369  -5.908  -14.392 1.00 42.41 ? 156 LEU B CD2 1 
ATOM   2769 N N   . ALA B 1 163 ? 27.993  -3.164  -12.578 1.00 43.61 ? 157 ALA B N   1 
ATOM   2770 C CA  . ALA B 1 163 ? 27.336  -2.372  -11.524 1.00 44.24 ? 157 ALA B CA  1 
ATOM   2771 C C   . ALA B 1 163 ? 26.896  -3.290  -10.374 1.00 45.17 ? 157 ALA B C   1 
ATOM   2772 O O   . ALA B 1 163 ? 27.292  -3.071  -9.228  1.00 46.49 ? 157 ALA B O   1 
ATOM   2773 C CB  . ALA B 1 163 ? 26.154  -1.597  -12.060 1.00 43.56 ? 157 ALA B CB  1 
ATOM   2774 N N   . PHE B 1 164 ? 26.112  -4.326  -10.696 1.00 45.06 ? 158 PHE B N   1 
ATOM   2775 C CA  . PHE B 1 164 ? 25.573  -5.228  -9.722  1.00 44.70 ? 158 PHE B CA  1 
ATOM   2776 C C   . PHE B 1 164 ? 26.663  -5.973  -9.038  1.00 46.17 ? 158 PHE B C   1 
ATOM   2777 O O   . PHE B 1 164 ? 26.505  -6.364  -7.869  1.00 47.43 ? 158 PHE B O   1 
ATOM   2778 C CB  . PHE B 1 164 ? 24.701  -6.260  -10.393 1.00 43.97 ? 158 PHE B CB  1 
ATOM   2779 C CG  . PHE B 1 164 ? 24.291  -7.394  -9.485  1.00 41.49 ? 158 PHE B CG  1 
ATOM   2780 C CD1 . PHE B 1 164 ? 23.415  -7.179  -8.431  1.00 37.01 ? 158 PHE B CD1 1 
ATOM   2781 C CD2 . PHE B 1 164 ? 24.785  -8.674  -9.691  1.00 38.71 ? 158 PHE B CD2 1 
ATOM   2782 C CE1 . PHE B 1 164 ? 23.047  -8.217  -7.624  1.00 36.44 ? 158 PHE B CE1 1 
ATOM   2783 C CE2 . PHE B 1 164 ? 24.402  -9.723  -8.876  1.00 37.82 ? 158 PHE B CE2 1 
ATOM   2784 C CZ  . PHE B 1 164 ? 23.544  -9.498  -7.850  1.00 37.60 ? 158 PHE B CZ  1 
ATOM   2785 N N   . SER B 1 165 ? 27.756  -6.207  -9.758  1.00 46.94 ? 159 SER B N   1 
ATOM   2786 C CA  . SER B 1 165 ? 28.881  -6.968  -9.224  1.00 47.29 ? 159 SER B CA  1 
ATOM   2787 C C   . SER B 1 165 ? 29.607  -6.173  -8.134  1.00 48.22 ? 159 SER B C   1 
ATOM   2788 O O   . SER B 1 165 ? 29.989  -6.727  -7.078  1.00 48.35 ? 159 SER B O   1 
ATOM   2789 C CB  . SER B 1 165 ? 29.827  -7.318  -10.347 1.00 46.94 ? 159 SER B CB  1 
ATOM   2790 O OG  . SER B 1 165 ? 31.140  -7.463  -9.858  1.00 47.93 ? 159 SER B OG  1 
ATOM   2791 N N   . ARG B 1 166 ? 29.793  -4.870  -8.362  1.00 48.54 ? 160 ARG B N   1 
ATOM   2792 C CA  . ARG B 1 166 ? 30.447  -4.087  -7.332  1.00 49.01 ? 160 ARG B CA  1 
ATOM   2793 C C   . ARG B 1 166 ? 29.483  -3.854  -6.170  1.00 48.74 ? 160 ARG B C   1 
ATOM   2794 O O   . ARG B 1 166 ? 29.894  -3.519  -5.066  1.00 49.17 ? 160 ARG B O   1 
ATOM   2795 C CB  . ARG B 1 166 ? 31.098  -2.806  -7.891  1.00 49.02 ? 160 ARG B CB  1 
ATOM   2796 C CG  . ARG B 1 166 ? 30.195  -1.568  -8.067  1.00 50.53 ? 160 ARG B CG  1 
ATOM   2797 C CD  . ARG B 1 166 ? 30.996  -0.312  -8.553  1.00 50.14 ? 160 ARG B CD  1 
ATOM   2798 N NE  . ARG B 1 166 ? 31.635  -0.535  -9.860  1.00 53.46 ? 160 ARG B NE  1 
ATOM   2799 C CZ  . ARG B 1 166 ? 31.043  -0.412  -11.058 1.00 54.21 ? 160 ARG B CZ  1 
ATOM   2800 N NH1 . ARG B 1 166 ? 29.763  -0.036  -11.179 1.00 53.74 ? 160 ARG B NH1 1 
ATOM   2801 N NH2 . ARG B 1 166 ? 31.746  -0.666  -12.153 1.00 54.38 ? 160 ARG B NH2 1 
ATOM   2802 N N   . SER B 1 167 ? 28.201  -4.086  -6.402  1.00 48.70 ? 161 SER B N   1 
ATOM   2803 C CA  . SER B 1 167 ? 27.223  -3.956  -5.332  1.00 49.06 ? 161 SER B CA  1 
ATOM   2804 C C   . SER B 1 167 ? 27.313  -5.149  -4.383  1.00 49.36 ? 161 SER B C   1 
ATOM   2805 O O   . SER B 1 167 ? 27.477  -4.983  -3.186  1.00 48.88 ? 161 SER B O   1 
ATOM   2806 C CB  . SER B 1 167 ? 25.831  -3.764  -5.912  1.00 48.84 ? 161 SER B CB  1 
ATOM   2807 O OG  . SER B 1 167 ? 24.853  -4.270  -5.037  1.00 50.13 ? 161 SER B OG  1 
ATOM   2808 N N   . LEU B 1 168 ? 27.233  -6.359  -4.933  1.00 50.56 ? 162 LEU B N   1 
ATOM   2809 C CA  . LEU B 1 168 ? 27.625  -7.568  -4.199  1.00 51.01 ? 162 LEU B CA  1 
ATOM   2810 C C   . LEU B 1 168 ? 28.914  -7.424  -3.392  1.00 51.93 ? 162 LEU B C   1 
ATOM   2811 O O   . LEU B 1 168 ? 28.953  -7.791  -2.211  1.00 51.85 ? 162 LEU B O   1 
ATOM   2812 C CB  . LEU B 1 168 ? 27.835  -8.712  -5.157  1.00 50.57 ? 162 LEU B CB  1 
ATOM   2813 C CG  . LEU B 1 168 ? 26.749  -9.774  -5.313  1.00 50.80 ? 162 LEU B CG  1 
ATOM   2814 C CD1 . LEU B 1 168 ? 27.324  -10.905 -6.205  1.00 49.56 ? 162 LEU B CD1 1 
ATOM   2815 C CD2 . LEU B 1 168 ? 26.236  -10.299 -3.960  1.00 48.03 ? 162 LEU B CD2 1 
ATOM   2816 N N   . HIS B 1 169 ? 29.977  -6.910  -4.022  1.00 52.86 ? 163 HIS B N   1 
ATOM   2817 C CA  . HIS B 1 169 ? 31.278  -6.884  -3.344  1.00 53.48 ? 163 HIS B CA  1 
ATOM   2818 C C   . HIS B 1 169 ? 31.208  -6.024  -2.073  1.00 53.95 ? 163 HIS B C   1 
ATOM   2819 O O   . HIS B 1 169 ? 31.860  -6.343  -1.077  1.00 54.33 ? 163 HIS B O   1 
ATOM   2820 C CB  . HIS B 1 169 ? 32.425  -6.484  -4.285  1.00 53.03 ? 163 HIS B CB  1 
ATOM   2821 C CG  . HIS B 1 169 ? 32.860  -7.570  -5.244  1.00 54.09 ? 163 HIS B CG  1 
ATOM   2822 N ND1 . HIS B 1 169 ? 32.002  -8.525  -5.751  1.00 54.66 ? 163 HIS B ND1 1 
ATOM   2823 C CD2 . HIS B 1 169 ? 34.061  -7.816  -5.828  1.00 53.74 ? 163 HIS B CD2 1 
ATOM   2824 C CE1 . HIS B 1 169 ? 32.652  -9.312  -6.591  1.00 52.03 ? 163 HIS B CE1 1 
ATOM   2825 N NE2 . HIS B 1 169 ? 33.900  -8.895  -6.666  1.00 51.93 ? 163 HIS B NE2 1 
ATOM   2826 N N   . SER B 1 170 ? 30.372  -4.979  -2.092  1.00 54.31 ? 164 SER B N   1 
ATOM   2827 C CA  . SER B 1 170 ? 30.187  -4.081  -0.929  1.00 54.31 ? 164 SER B CA  1 
ATOM   2828 C C   . SER B 1 170 ? 29.574  -4.757  0.267   1.00 53.96 ? 164 SER B C   1 
ATOM   2829 O O   . SER B 1 170 ? 29.976  -4.485  1.383   1.00 54.60 ? 164 SER B O   1 
ATOM   2830 C CB  . SER B 1 170 ? 29.312  -2.893  -1.283  1.00 54.15 ? 164 SER B CB  1 
ATOM   2831 O OG  . SER B 1 170 ? 29.943  -2.176  -2.310  1.00 55.86 ? 164 SER B OG  1 
ATOM   2832 N N   . LEU B 1 171 ? 28.588  -5.616  0.041   1.00 53.45 ? 165 LEU B N   1 
ATOM   2833 C CA  . LEU B 1 171 ? 28.063  -6.477  1.104   1.00 53.39 ? 165 LEU B CA  1 
ATOM   2834 C C   . LEU B 1 171 ? 29.136  -7.428  1.673   1.00 53.15 ? 165 LEU B C   1 
ATOM   2835 O O   . LEU B 1 171 ? 28.898  -8.117  2.668   1.00 53.55 ? 165 LEU B O   1 
ATOM   2836 C CB  . LEU B 1 171 ? 26.822  -7.263  0.613   1.00 53.31 ? 165 LEU B CB  1 
ATOM   2837 C CG  . LEU B 1 171 ? 25.350  -6.789  0.792   1.00 53.50 ? 165 LEU B CG  1 
ATOM   2838 C CD1 . LEU B 1 171 ? 25.152  -5.431  1.515   1.00 54.74 ? 165 LEU B CD1 1 
ATOM   2839 C CD2 . LEU B 1 171 ? 24.579  -6.790  -0.531  1.00 52.36 ? 165 LEU B CD2 1 
ATOM   2840 N N   . LEU B 1 172 ? 30.316  -7.441  1.044   1.00 52.92 ? 166 LEU B N   1 
ATOM   2841 C CA  . LEU B 1 172 ? 31.446  -8.320  1.422   1.00 52.21 ? 166 LEU B CA  1 
ATOM   2842 C C   . LEU B 1 172 ? 30.975  -9.710  1.788   1.00 51.13 ? 166 LEU B C   1 
ATOM   2843 O O   . LEU B 1 172 ? 31.128  -10.128 2.924   1.00 50.81 ? 166 LEU B O   1 
ATOM   2844 C CB  . LEU B 1 172 ? 32.265  -7.705  2.578   1.00 52.85 ? 166 LEU B CB  1 
ATOM   2845 C CG  . LEU B 1 172 ? 33.436  -6.732  2.330   1.00 53.26 ? 166 LEU B CG  1 
ATOM   2846 C CD1 . LEU B 1 172 ? 34.098  -6.394  3.665   1.00 53.79 ? 166 LEU B CD1 1 
ATOM   2847 C CD2 . LEU B 1 172 ? 34.483  -7.287  1.317   1.00 53.85 ? 166 LEU B CD2 1 
ATOM   2848 N N   . VAL B 1 173 ? 30.385  -10.404 0.818   1.00 50.48 ? 167 VAL B N   1 
ATOM   2849 C CA  . VAL B 1 173 ? 29.693  -11.681 1.049   1.00 49.97 ? 167 VAL B CA  1 
ATOM   2850 C C   . VAL B 1 173 ? 30.685  -12.815 1.014   1.00 49.06 ? 167 VAL B C   1 
ATOM   2851 O O   . VAL B 1 173 ? 31.306  -13.009 -0.001  1.00 49.42 ? 167 VAL B O   1 
ATOM   2852 C CB  . VAL B 1 173 ? 28.650  -11.927 -0.053  1.00 50.27 ? 167 VAL B CB  1 
ATOM   2853 C CG1 . VAL B 1 173 ? 27.942  -13.255 0.149   1.00 50.40 ? 167 VAL B CG1 1 
ATOM   2854 C CG2 . VAL B 1 173 ? 27.634  -10.787 -0.101  1.00 50.53 ? 167 VAL B CG2 1 
ATOM   2855 N N   . ASP B 1 174 ? 30.854  -13.557 2.100   1.00 48.42 ? 168 ASP B N   1 
ATOM   2856 C CA  . ASP B 1 174 ? 31.858  -14.629 2.076   1.00 48.46 ? 168 ASP B CA  1 
ATOM   2857 C C   . ASP B 1 174 ? 31.406  -15.934 1.449   1.00 47.23 ? 168 ASP B C   1 
ATOM   2858 O O   . ASP B 1 174 ? 30.221  -16.211 1.335   1.00 46.69 ? 168 ASP B O   1 
ATOM   2859 C CB  . ASP B 1 174 ? 32.493  -14.886 3.450   1.00 49.22 ? 168 ASP B CB  1 
ATOM   2860 C CG  . ASP B 1 174 ? 31.490  -15.346 4.492   1.00 52.21 ? 168 ASP B CG  1 
ATOM   2861 O OD1 . ASP B 1 174 ? 30.649  -16.219 4.164   1.00 55.54 ? 168 ASP B OD1 1 
ATOM   2862 O OD2 . ASP B 1 174 ? 31.560  -14.840 5.651   1.00 54.42 ? 168 ASP B OD2 1 
ATOM   2863 N N   . VAL B 1 175 ? 32.385  -16.744 1.070   1.00 46.75 ? 169 VAL B N   1 
ATOM   2864 C CA  . VAL B 1 175 ? 32.138  -18.017 0.366   1.00 45.82 ? 169 VAL B CA  1 
ATOM   2865 C C   . VAL B 1 175 ? 30.966  -18.805 0.934   1.00 45.67 ? 169 VAL B C   1 
ATOM   2866 O O   . VAL B 1 175 ? 30.065  -19.159 0.184   1.00 45.57 ? 169 VAL B O   1 
ATOM   2867 C CB  . VAL B 1 175 ? 33.406  -18.921 0.253   1.00 45.38 ? 169 VAL B CB  1 
ATOM   2868 C CG1 . VAL B 1 175 ? 33.078  -20.237 -0.431  1.00 43.53 ? 169 VAL B CG1 1 
ATOM   2869 C CG2 . VAL B 1 175 ? 34.507  -18.191 -0.497  1.00 44.26 ? 169 VAL B CG2 1 
ATOM   2870 N N   . PRO B 1 176 ? 30.948  -19.061 2.258   1.00 45.72 ? 170 PRO B N   1 
ATOM   2871 C CA  . PRO B 1 176 ? 29.868  -19.964 2.649   1.00 45.18 ? 170 PRO B CA  1 
ATOM   2872 C C   . PRO B 1 176 ? 28.487  -19.355 2.408   1.00 44.21 ? 170 PRO B C   1 
ATOM   2873 O O   . PRO B 1 176 ? 27.649  -20.012 1.811   1.00 43.83 ? 170 PRO B O   1 
ATOM   2874 C CB  . PRO B 1 176 ? 30.141  -20.246 4.141   1.00 45.21 ? 170 PRO B CB  1 
ATOM   2875 C CG  . PRO B 1 176 ? 31.534  -19.788 4.389   1.00 45.42 ? 170 PRO B CG  1 
ATOM   2876 C CD  . PRO B 1 176 ? 31.759  -18.650 3.423   1.00 45.80 ? 170 PRO B CD  1 
ATOM   2877 N N   . ALA B 1 177 ? 28.260  -18.110 2.817   1.00 43.83 ? 171 ALA B N   1 
ATOM   2878 C CA  . ALA B 1 177 ? 26.942  -17.490 2.593   1.00 43.40 ? 171 ALA B CA  1 
ATOM   2879 C C   . ALA B 1 177 ? 26.559  -17.652 1.121   1.00 43.40 ? 171 ALA B C   1 
ATOM   2880 O O   . ALA B 1 177 ? 25.611  -18.364 0.786   1.00 42.84 ? 171 ALA B O   1 
ATOM   2881 C CB  . ALA B 1 177 ? 26.959  -16.040 2.985   1.00 42.84 ? 171 ALA B CB  1 
ATOM   2882 N N   . PHE B 1 178 ? 27.343  -17.023 0.249   1.00 43.34 ? 172 PHE B N   1 
ATOM   2883 C CA  . PHE B 1 178 ? 27.199  -17.173 -1.194  1.00 43.34 ? 172 PHE B CA  1 
ATOM   2884 C C   . PHE B 1 178 ? 26.899  -18.583 -1.719  1.00 44.15 ? 172 PHE B C   1 
ATOM   2885 O O   . PHE B 1 178 ? 26.123  -18.726 -2.671  1.00 44.71 ? 172 PHE B O   1 
ATOM   2886 C CB  . PHE B 1 178 ? 28.428  -16.654 -1.903  1.00 42.57 ? 172 PHE B CB  1 
ATOM   2887 C CG  . PHE B 1 178 ? 28.261  -16.582 -3.369  1.00 42.03 ? 172 PHE B CG  1 
ATOM   2888 C CD1 . PHE B 1 178 ? 27.707  -15.442 -3.959  1.00 42.23 ? 172 PHE B CD1 1 
ATOM   2889 C CD2 . PHE B 1 178 ? 28.644  -17.653 -4.177  1.00 41.33 ? 172 PHE B CD2 1 
ATOM   2890 C CE1 . PHE B 1 178 ? 27.534  -15.362 -5.346  1.00 41.88 ? 172 PHE B CE1 1 
ATOM   2891 C CE2 . PHE B 1 178 ? 28.479  -17.599 -5.571  1.00 41.51 ? 172 PHE B CE2 1 
ATOM   2892 C CZ  . PHE B 1 178 ? 27.910  -16.454 -6.162  1.00 41.41 ? 172 PHE B CZ  1 
ATOM   2893 N N   . ALA B 1 179 ? 27.511  -19.615 -1.131  1.00 44.36 ? 173 ALA B N   1 
ATOM   2894 C CA  . ALA B 1 179 ? 27.296  -20.984 -1.605  1.00 44.21 ? 173 ALA B CA  1 
ATOM   2895 C C   . ALA B 1 179 ? 25.867  -21.415 -1.333  1.00 44.27 ? 173 ALA B C   1 
ATOM   2896 O O   . ALA B 1 179 ? 25.273  -22.117 -2.138  1.00 44.47 ? 173 ALA B O   1 
ATOM   2897 C CB  . ALA B 1 179 ? 28.288  -21.953 -0.986  1.00 44.20 ? 173 ALA B CB  1 
ATOM   2898 N N   . CYS B 1 180 ? 25.312  -20.959 -0.217  1.00 44.38 ? 174 CYS B N   1 
ATOM   2899 C CA  . CYS B 1 180 ? 23.890  -21.107 0.066   1.00 44.84 ? 174 CYS B CA  1 
ATOM   2900 C C   . CYS B 1 180 ? 23.059  -20.245 -0.866  1.00 45.21 ? 174 CYS B C   1 
ATOM   2901 O O   . CYS B 1 180 ? 22.117  -20.737 -1.476  1.00 46.12 ? 174 CYS B O   1 
ATOM   2902 C CB  . CYS B 1 180 ? 23.586  -20.732 1.504   1.00 44.67 ? 174 CYS B CB  1 
ATOM   2903 S SG  . CYS B 1 180 ? 24.667  -21.598 2.665   1.00 46.82 ? 174 CYS B SG  1 
ATOM   2904 N N   . LEU B 1 181 ? 23.406  -18.971 -1.001  1.00 45.34 ? 175 LEU B N   1 
ATOM   2905 C CA  . LEU B 1 181 ? 22.655  -18.087 -1.877  1.00 45.11 ? 175 LEU B CA  1 
ATOM   2906 C C   . LEU B 1 181 ? 22.357  -18.712 -3.214  1.00 45.04 ? 175 LEU B C   1 
ATOM   2907 O O   . LEU B 1 181 ? 21.198  -18.969 -3.537  1.00 45.63 ? 175 LEU B O   1 
ATOM   2908 C CB  . LEU B 1 181 ? 23.376  -16.777 -2.089  1.00 45.01 ? 175 LEU B CB  1 
ATOM   2909 C CG  . LEU B 1 181 ? 22.763  -15.617 -1.330  1.00 46.14 ? 175 LEU B CG  1 
ATOM   2910 C CD1 . LEU B 1 181 ? 22.994  -14.369 -2.155  1.00 48.43 ? 175 LEU B CD1 1 
ATOM   2911 C CD2 . LEU B 1 181 ? 21.270  -15.817 -1.120  1.00 46.50 ? 175 LEU B CD2 1 
ATOM   2912 N N   . SER B 1 182 ? 23.397  -18.975 -3.990  1.00 44.71 ? 176 SER B N   1 
ATOM   2913 C CA  . SER B 1 182 ? 23.215  -19.599 -5.298  1.00 44.45 ? 176 SER B CA  1 
ATOM   2914 C C   . SER B 1 182 ? 22.443  -20.897 -5.183  1.00 43.71 ? 176 SER B C   1 
ATOM   2915 O O   . SER B 1 182 ? 21.455  -21.087 -5.888  1.00 43.51 ? 176 SER B O   1 
ATOM   2916 C CB  . SER B 1 182 ? 24.553  -19.797 -6.023  1.00 45.04 ? 176 SER B CB  1 
ATOM   2917 O OG  . SER B 1 182 ? 25.605  -20.131 -5.121  1.00 47.52 ? 176 SER B OG  1 
ATOM   2918 N N   . ALA B 1 183 ? 22.854  -21.776 -4.274  1.00 43.23 ? 177 ALA B N   1 
ATOM   2919 C CA  . ALA B 1 183 ? 22.087  -23.004 -4.066  1.00 43.02 ? 177 ALA B CA  1 
ATOM   2920 C C   . ALA B 1 183 ? 20.574  -22.705 -3.954  1.00 42.78 ? 177 ALA B C   1 
ATOM   2921 O O   . ALA B 1 183 ? 19.792  -23.296 -4.684  1.00 42.92 ? 177 ALA B O   1 
ATOM   2922 C CB  . ALA B 1 183 ? 22.609  -23.796 -2.878  1.00 42.70 ? 177 ALA B CB  1 
ATOM   2923 N N   . LEU B 1 184 ? 20.170  -21.763 -3.090  1.00 42.47 ? 178 LEU B N   1 
ATOM   2924 C CA  . LEU B 1 184 ? 18.752  -21.313 -2.972  1.00 41.60 ? 178 LEU B CA  1 
ATOM   2925 C C   . LEU B 1 184 ? 18.115  -20.787 -4.270  1.00 41.51 ? 178 LEU B C   1 
ATOM   2926 O O   . LEU B 1 184 ? 16.925  -21.035 -4.535  1.00 41.88 ? 178 LEU B O   1 
ATOM   2927 C CB  . LEU B 1 184 ? 18.623  -20.216 -1.923  1.00 41.39 ? 178 LEU B CB  1 
ATOM   2928 C CG  . LEU B 1 184 ? 18.780  -20.555 -0.451  1.00 41.87 ? 178 LEU B CG  1 
ATOM   2929 C CD1 . LEU B 1 184 ? 18.577  -19.295 0.389   1.00 41.80 ? 178 LEU B CD1 1 
ATOM   2930 C CD2 . LEU B 1 184 ? 17.792  -21.649 -0.040  1.00 42.94 ? 178 LEU B CD2 1 
ATOM   2931 N N   . VAL B 1 185 ? 18.893  -20.034 -5.048  1.00 40.20 ? 179 VAL B N   1 
ATOM   2932 C CA  . VAL B 1 185 ? 18.473  -19.583 -6.367  1.00 39.82 ? 179 VAL B CA  1 
ATOM   2933 C C   . VAL B 1 185 ? 18.124  -20.793 -7.276  1.00 39.54 ? 179 VAL B C   1 
ATOM   2934 O O   . VAL B 1 185 ? 17.205  -20.720 -8.072  1.00 39.65 ? 179 VAL B O   1 
ATOM   2935 C CB  . VAL B 1 185 ? 19.568  -18.629 -7.026  1.00 39.79 ? 179 VAL B CB  1 
ATOM   2936 C CG1 . VAL B 1 185 ? 19.308  -18.361 -8.489  1.00 39.67 ? 179 VAL B CG1 1 
ATOM   2937 C CG2 . VAL B 1 185 ? 19.658  -17.315 -6.298  1.00 39.42 ? 179 VAL B CG2 1 
ATOM   2938 N N   . LEU B 1 186 ? 18.853  -21.895 -7.171  1.00 39.36 ? 180 LEU B N   1 
ATOM   2939 C CA  . LEU B 1 186 ? 18.516  -23.096 -7.945  1.00 39.01 ? 180 LEU B CA  1 
ATOM   2940 C C   . LEU B 1 186 ? 17.352  -23.830 -7.313  1.00 39.90 ? 180 LEU B C   1 
ATOM   2941 O O   . LEU B 1 186 ? 16.402  -24.221 -8.004  1.00 40.71 ? 180 LEU B O   1 
ATOM   2942 C CB  . LEU B 1 186 ? 19.703  -24.044 -8.010  1.00 38.51 ? 180 LEU B CB  1 
ATOM   2943 C CG  . LEU B 1 186 ? 19.634  -25.336 -8.805  1.00 37.87 ? 180 LEU B CG  1 
ATOM   2944 C CD1 . LEU B 1 186 ? 19.313  -25.024 -10.240 1.00 36.39 ? 180 LEU B CD1 1 
ATOM   2945 C CD2 . LEU B 1 186 ? 20.947  -26.118 -8.688  1.00 38.10 ? 180 LEU B CD2 1 
ATOM   2946 N N   . ILE B 1 187 ? 17.410  -24.017 -6.002  1.00 40.26 ? 181 ILE B N   1 
ATOM   2947 C CA  . ILE B 1 187 ? 16.406  -24.825 -5.327  1.00 41.04 ? 181 ILE B CA  1 
ATOM   2948 C C   . ILE B 1 187 ? 15.253  -23.968 -4.793  1.00 41.92 ? 181 ILE B C   1 
ATOM   2949 O O   . ILE B 1 187 ? 15.336  -23.309 -3.748  1.00 41.97 ? 181 ILE B O   1 
ATOM   2950 C CB  . ILE B 1 187 ? 17.048  -25.774 -4.301  1.00 40.50 ? 181 ILE B CB  1 
ATOM   2951 C CG1 . ILE B 1 187 ? 17.951  -26.720 -5.044  1.00 39.08 ? 181 ILE B CG1 1 
ATOM   2952 C CG2 . ILE B 1 187 ? 16.010  -26.643 -3.620  1.00 41.26 ? 181 ILE B CG2 1 
ATOM   2953 C CD1 . ILE B 1 187 ? 19.203  -26.893 -4.360  1.00 39.78 ? 181 ILE B CD1 1 
ATOM   2954 N N   . THR B 1 188 ? 14.172  -23.992 -5.559  1.00 43.33 ? 182 THR B N   1 
ATOM   2955 C CA  . THR B 1 188 ? 13.018  -23.097 -5.378  1.00 44.69 ? 182 THR B CA  1 
ATOM   2956 C C   . THR B 1 188 ? 11.823  -23.706 -6.132  1.00 45.73 ? 182 THR B C   1 
ATOM   2957 O O   . THR B 1 188 ? 12.018  -24.455 -7.094  1.00 45.44 ? 182 THR B O   1 
ATOM   2958 C CB  . THR B 1 188 ? 13.347  -21.630 -5.879  1.00 44.40 ? 182 THR B CB  1 
ATOM   2959 O OG1 . THR B 1 188 ? 12.191  -20.792 -5.748  1.00 44.43 ? 182 THR B OG1 1 
ATOM   2960 C CG2 . THR B 1 188 ? 13.823  -21.631 -7.332  1.00 42.37 ? 182 THR B CG2 1 
ATOM   2961 N N   . ASP B 1 189 ? 10.594  -23.410 -5.711  1.00 47.38 ? 183 ASP B N   1 
ATOM   2962 C CA  . ASP B 1 189 ? 9.441   -23.967 -6.424  1.00 48.97 ? 183 ASP B CA  1 
ATOM   2963 C C   . ASP B 1 189 ? 9.428   -23.508 -7.877  1.00 50.00 ? 183 ASP B C   1 
ATOM   2964 O O   . ASP B 1 189 ? 9.723   -22.345 -8.180  1.00 50.05 ? 183 ASP B O   1 
ATOM   2965 C CB  . ASP B 1 189 ? 8.128   -23.574 -5.778  1.00 49.01 ? 183 ASP B CB  1 
ATOM   2966 C CG  . ASP B 1 189 ? 6.950   -24.282 -6.408  1.00 50.71 ? 183 ASP B CG  1 
ATOM   2967 O OD1 . ASP B 1 189 ? 6.685   -25.427 -5.999  1.00 52.00 ? 183 ASP B OD1 1 
ATOM   2968 O OD2 . ASP B 1 189 ? 6.294   -23.707 -7.319  1.00 53.21 ? 183 ASP B OD2 1 
ATOM   2969 N N   . ARG B 1 190 ? 9.109   -24.436 -8.771  1.00 51.16 ? 184 ARG B N   1 
ATOM   2970 C CA  . ARG B 1 190 ? 8.864   -24.091 -10.158 1.00 52.25 ? 184 ARG B CA  1 
ATOM   2971 C C   . ARG B 1 190 ? 7.617   -24.778 -10.678 1.00 53.48 ? 184 ARG B C   1 
ATOM   2972 O O   . ARG B 1 190 ? 7.333   -25.950 -10.386 1.00 53.33 ? 184 ARG B O   1 
ATOM   2973 C CB  . ARG B 1 190 ? 10.066  -24.411 -11.039 1.00 51.97 ? 184 ARG B CB  1 
ATOM   2974 C CG  . ARG B 1 190 ? 11.367  -23.776 -10.561 1.00 52.20 ? 184 ARG B CG  1 
ATOM   2975 C CD  . ARG B 1 190 ? 11.466  -22.255 -10.805 1.00 50.69 ? 184 ARG B CD  1 
ATOM   2976 N NE  . ARG B 1 190 ? 12.827  -21.772 -10.563 1.00 50.81 ? 184 ARG B NE  1 
ATOM   2977 C CZ  . ARG B 1 190 ? 13.301  -20.605 -10.988 1.00 51.94 ? 184 ARG B CZ  1 
ATOM   2978 N NH1 . ARG B 1 190 ? 12.528  -19.785 -11.682 1.00 50.34 ? 184 ARG B NH1 1 
ATOM   2979 N NH2 . ARG B 1 190 ? 14.562  -20.261 -10.729 1.00 53.01 ? 184 ARG B NH2 1 
ATOM   2980 N N   . HIS B 1 191 ? 6.858   -24.018 -11.451 1.00 55.06 ? 185 HIS B N   1 
ATOM   2981 C CA  . HIS B 1 191 ? 5.658   -24.542 -12.043 1.00 56.18 ? 185 HIS B CA  1 
ATOM   2982 C C   . HIS B 1 191 ? 5.970   -25.724 -12.966 1.00 56.41 ? 185 HIS B C   1 
ATOM   2983 O O   . HIS B 1 191 ? 6.564   -25.563 -14.040 1.00 55.95 ? 185 HIS B O   1 
ATOM   2984 C CB  . HIS B 1 191 ? 4.903   -23.447 -12.787 1.00 56.44 ? 185 HIS B CB  1 
ATOM   2985 C CG  . HIS B 1 191 ? 3.705   -23.963 -13.508 1.00 58.40 ? 185 HIS B CG  1 
ATOM   2986 N ND1 . HIS B 1 191 ? 2.531   -24.280 -12.857 1.00 60.43 ? 185 HIS B ND1 1 
ATOM   2987 C CD2 . HIS B 1 191 ? 3.516   -24.279 -14.810 1.00 59.27 ? 185 HIS B CD2 1 
ATOM   2988 C CE1 . HIS B 1 191 ? 1.657   -24.737 -13.735 1.00 61.59 ? 185 HIS B CE1 1 
ATOM   2989 N NE2 . HIS B 1 191 ? 2.229   -24.742 -14.928 1.00 61.87 ? 185 HIS B NE2 1 
ATOM   2990 N N   . GLY B 1 192 ? 5.561   -26.907 -12.525 1.00 57.16 ? 186 GLY B N   1 
ATOM   2991 C CA  . GLY B 1 192 ? 5.738   -28.126 -13.307 1.00 58.24 ? 186 GLY B CA  1 
ATOM   2992 C C   . GLY B 1 192 ? 6.684   -29.115 -12.660 1.00 59.00 ? 186 GLY B C   1 
ATOM   2993 O O   . GLY B 1 192 ? 7.014   -30.144 -13.251 1.00 59.39 ? 186 GLY B O   1 
ATOM   2994 N N   . LEU B 1 193 ? 7.142   -28.805 -11.448 1.00 59.59 ? 187 LEU B N   1 
ATOM   2995 C CA  . LEU B 1 193 ? 7.967   -29.749 -10.716 1.00 59.69 ? 187 LEU B CA  1 
ATOM   2996 C C   . LEU B 1 193 ? 7.083   -30.939 -10.460 1.00 60.49 ? 187 LEU B C   1 
ATOM   2997 O O   . LEU B 1 193 ? 5.924   -30.800 -10.011 1.00 60.79 ? 187 LEU B O   1 
ATOM   2998 C CB  . LEU B 1 193 ? 8.496   -29.175 -9.386  1.00 59.52 ? 187 LEU B CB  1 
ATOM   2999 C CG  . LEU B 1 193 ? 9.707   -28.213 -9.292  1.00 57.52 ? 187 LEU B CG  1 
ATOM   3000 C CD1 . LEU B 1 193 ? 9.901   -27.777 -7.848  1.00 54.72 ? 187 LEU B CD1 1 
ATOM   3001 C CD2 . LEU B 1 193 ? 11.002  -28.791 -9.833  1.00 54.38 ? 187 LEU B CD2 1 
ATOM   3002 N N   . GLN B 1 194 ? 7.626   -32.107 -10.770 1.00 60.97 ? 188 GLN B N   1 
ATOM   3003 C CA  . GLN B 1 194 ? 6.952   -33.363 -10.500 1.00 61.42 ? 188 GLN B CA  1 
ATOM   3004 C C   . GLN B 1 194 ? 6.874   -33.681 -9.005  1.00 61.93 ? 188 GLN B C   1 
ATOM   3005 O O   . GLN B 1 194 ? 5.880   -34.219 -8.533  1.00 62.09 ? 188 GLN B O   1 
ATOM   3006 C CB  . GLN B 1 194 ? 7.651   -34.491 -11.250 1.00 61.33 ? 188 GLN B CB  1 
ATOM   3007 C CG  . GLN B 1 194 ? 7.315   -34.534 -12.721 1.00 60.56 ? 188 GLN B CG  1 
ATOM   3008 C CD  . GLN B 1 194 ? 8.296   -35.358 -13.516 1.00 59.94 ? 188 GLN B CD  1 
ATOM   3009 O OE1 . GLN B 1 194 ? 9.149   -36.063 -12.963 1.00 58.72 ? 188 GLN B OE1 1 
ATOM   3010 N NE2 . GLN B 1 194 ? 8.190   -35.264 -14.837 1.00 60.31 ? 188 GLN B NE2 1 
ATOM   3011 N N   . GLU B 1 195 ? 7.929   -33.357 -8.266  1.00 62.55 ? 189 GLU B N   1 
ATOM   3012 C CA  . GLU B 1 195 ? 7.981   -33.661 -6.837  1.00 63.36 ? 189 GLU B CA  1 
ATOM   3013 C C   . GLU B 1 195 ? 8.251   -32.385 -6.033  1.00 63.30 ? 189 GLU B C   1 
ATOM   3014 O O   . GLU B 1 195 ? 9.353   -32.185 -5.524  1.00 63.59 ? 189 GLU B O   1 
ATOM   3015 C CB  . GLU B 1 195 ? 9.057   -34.711 -6.553  1.00 63.24 ? 189 GLU B CB  1 
ATOM   3016 C CG  . GLU B 1 195 ? 9.264   -35.732 -7.675  1.00 64.21 ? 189 GLU B CG  1 
ATOM   3017 C CD  . GLU B 1 195 ? 9.952   -37.008 -7.200  1.00 64.63 ? 189 GLU B CD  1 
ATOM   3018 O OE1 . GLU B 1 195 ? 11.113  -37.262 -7.627  1.00 65.60 ? 189 GLU B OE1 1 
ATOM   3019 O OE2 . GLU B 1 195 ? 9.321   -37.752 -6.401  1.00 65.62 ? 189 GLU B OE2 1 
ATOM   3020 N N   . PRO B 1 196 ? 7.238   -31.520 -5.895  1.00 63.17 ? 190 PRO B N   1 
ATOM   3021 C CA  . PRO B 1 196 ? 7.504   -30.205 -5.319  1.00 63.04 ? 190 PRO B CA  1 
ATOM   3022 C C   . PRO B 1 196 ? 7.959   -30.283 -3.858  1.00 62.94 ? 190 PRO B C   1 
ATOM   3023 O O   . PRO B 1 196 ? 8.744   -29.455 -3.415  1.00 62.82 ? 190 PRO B O   1 
ATOM   3024 C CB  . PRO B 1 196 ? 6.151   -29.492 -5.431  1.00 63.11 ? 190 PRO B CB  1 
ATOM   3025 C CG  . PRO B 1 196 ? 5.360   -30.319 -6.404  1.00 63.27 ? 190 PRO B CG  1 
ATOM   3026 C CD  . PRO B 1 196 ? 5.817   -31.706 -6.215  1.00 62.92 ? 190 PRO B CD  1 
ATOM   3027 N N   . ARG B 1 197 ? 7.464   -31.275 -3.128  1.00 63.03 ? 191 ARG B N   1 
ATOM   3028 C CA  . ARG B 1 197 ? 7.810   -31.459 -1.719  1.00 63.20 ? 191 ARG B CA  1 
ATOM   3029 C C   . ARG B 1 197 ? 9.282   -31.794 -1.528  1.00 62.77 ? 191 ARG B C   1 
ATOM   3030 O O   . ARG B 1 197 ? 9.929   -31.282 -0.615  1.00 63.03 ? 191 ARG B O   1 
ATOM   3031 C CB  . ARG B 1 197 ? 6.930   -32.545 -1.077  1.00 63.21 ? 191 ARG B CB  1 
ATOM   3032 C CG  . ARG B 1 197 ? 5.641   -32.012 -0.468  1.00 64.76 ? 191 ARG B CG  1 
ATOM   3033 C CD  . ARG B 1 197 ? 4.477   -31.980 -1.460  1.00 68.27 ? 191 ARG B CD  1 
ATOM   3034 N NE  . ARG B 1 197 ? 3.239   -31.512 -0.820  1.00 70.84 ? 191 ARG B NE  1 
ATOM   3035 C CZ  . ARG B 1 197 ? 2.244   -32.294 -0.394  1.00 71.66 ? 191 ARG B CZ  1 
ATOM   3036 N NH1 . ARG B 1 197 ? 1.178   -31.745 0.181   1.00 72.53 ? 191 ARG B NH1 1 
ATOM   3037 N NH2 . ARG B 1 197 ? 2.299   -33.617 -0.541  1.00 71.45 ? 191 ARG B NH2 1 
ATOM   3038 N N   . ARG B 1 198 ? 9.793   -32.660 -2.394  1.00 62.35 ? 192 ARG B N   1 
ATOM   3039 C CA  . ARG B 1 198 ? 11.180  -33.072 -2.364  1.00 62.15 ? 192 ARG B CA  1 
ATOM   3040 C C   . ARG B 1 198 ? 12.064  -31.841 -2.381  1.00 61.93 ? 192 ARG B C   1 
ATOM   3041 O O   . ARG B 1 198 ? 12.998  -31.705 -1.574  1.00 62.45 ? 192 ARG B O   1 
ATOM   3042 C CB  . ARG B 1 198 ? 11.497  -33.973 -3.570  1.00 62.12 ? 192 ARG B CB  1 
ATOM   3043 C CG  . ARG B 1 198 ? 11.566  -35.458 -3.263  1.00 62.02 ? 192 ARG B CG  1 
ATOM   3044 C CD  . ARG B 1 198 ? 12.934  -35.820 -2.672  1.00 62.73 ? 192 ARG B CD  1 
ATOM   3045 N NE  . ARG B 1 198 ? 13.550  -37.019 -3.264  1.00 62.54 ? 192 ARG B NE  1 
ATOM   3046 C CZ  . ARG B 1 198 ? 13.496  -37.371 -4.548  1.00 60.31 ? 192 ARG B CZ  1 
ATOM   3047 N NH1 . ARG B 1 198 ? 14.091  -38.478 -4.934  1.00 59.91 ? 192 ARG B NH1 1 
ATOM   3048 N NH2 . ARG B 1 198 ? 12.857  -36.634 -5.446  1.00 59.63 ? 192 ARG B NH2 1 
ATOM   3049 N N   . VAL B 1 199 ? 11.736  -30.944 -3.303  1.00 61.26 ? 193 VAL B N   1 
ATOM   3050 C CA  . VAL B 1 199 ? 12.452  -29.706 -3.515  1.00 60.37 ? 193 VAL B CA  1 
ATOM   3051 C C   . VAL B 1 199 ? 12.260  -28.756 -2.322  1.00 60.88 ? 193 VAL B C   1 
ATOM   3052 O O   . VAL B 1 199 ? 13.238  -28.255 -1.762  1.00 61.80 ? 193 VAL B O   1 
ATOM   3053 C CB  . VAL B 1 199 ? 12.001  -29.098 -4.848  1.00 59.88 ? 193 VAL B CB  1 
ATOM   3054 C CG1 . VAL B 1 199 ? 12.438  -27.651 -4.996  1.00 59.19 ? 193 VAL B CG1 1 
ATOM   3055 C CG2 . VAL B 1 199 ? 12.495  -29.972 -6.001  1.00 58.85 ? 193 VAL B CG2 1 
ATOM   3056 N N   . GLU B 1 200 ? 11.016  -28.523 -1.921  1.00 60.68 ? 194 GLU B N   1 
ATOM   3057 C CA  . GLU B 1 200 ? 10.713  -27.649 -0.795  1.00 61.28 ? 194 GLU B CA  1 
ATOM   3058 C C   . GLU B 1 200 ? 11.523  -28.080 0.446   1.00 61.46 ? 194 GLU B C   1 
ATOM   3059 O O   . GLU B 1 200 ? 12.004  -27.234 1.206   1.00 61.38 ? 194 GLU B O   1 
ATOM   3060 C CB  . GLU B 1 200 ? 9.197   -27.684 -0.553  1.00 61.42 ? 194 GLU B CB  1 
ATOM   3061 C CG  . GLU B 1 200 ? 8.644   -26.945 0.656   1.00 61.52 ? 194 GLU B CG  1 
ATOM   3062 C CD  . GLU B 1 200 ? 7.343   -27.589 1.209   1.00 62.54 ? 194 GLU B CD  1 
ATOM   3063 O OE1 . GLU B 1 200 ? 6.688   -28.444 0.523   1.00 63.99 ? 194 GLU B OE1 1 
ATOM   3064 O OE2 . GLU B 1 200 ? 6.977   -27.238 2.355   1.00 62.68 ? 194 GLU B OE2 1 
ATOM   3065 N N   . GLU B 1 201 ? 11.697  -29.395 0.617   1.00 61.47 ? 195 GLU B N   1 
ATOM   3066 C CA  . GLU B 1 201 ? 12.464  -29.982 1.730   1.00 61.34 ? 195 GLU B CA  1 
ATOM   3067 C C   . GLU B 1 201 ? 13.961  -29.619 1.718   1.00 60.70 ? 195 GLU B C   1 
ATOM   3068 O O   . GLU B 1 201 ? 14.542  -29.291 2.761   1.00 60.67 ? 195 GLU B O   1 
ATOM   3069 C CB  . GLU B 1 201 ? 12.338  -31.502 1.694   1.00 61.53 ? 195 GLU B CB  1 
ATOM   3070 C CG  . GLU B 1 201 ? 12.731  -32.180 2.979   1.00 63.65 ? 195 GLU B CG  1 
ATOM   3071 C CD  . GLU B 1 201 ? 11.533  -32.810 3.695   1.00 67.99 ? 195 GLU B CD  1 
ATOM   3072 O OE1 . GLU B 1 201 ? 11.698  -33.251 4.862   1.00 69.84 ? 195 GLU B OE1 1 
ATOM   3073 O OE2 . GLU B 1 201 ? 10.428  -32.886 3.092   1.00 68.77 ? 195 GLU B OE2 1 
ATOM   3074 N N   . LEU B 1 202 ? 14.583  -29.729 0.546   1.00 60.00 ? 196 LEU B N   1 
ATOM   3075 C CA  . LEU B 1 202 ? 15.992  -29.378 0.359   1.00 59.67 ? 196 LEU B CA  1 
ATOM   3076 C C   . LEU B 1 202 ? 16.210  -27.851 0.499   1.00 59.31 ? 196 LEU B C   1 
ATOM   3077 O O   . LEU B 1 202 ? 17.172  -27.383 1.138   1.00 58.76 ? 196 LEU B O   1 
ATOM   3078 C CB  . LEU B 1 202 ? 16.477  -29.891 -1.005  1.00 59.80 ? 196 LEU B CB  1 
ATOM   3079 C CG  . LEU B 1 202 ? 17.896  -29.618 -1.550  1.00 60.29 ? 196 LEU B CG  1 
ATOM   3080 C CD1 . LEU B 1 202 ? 19.033  -29.825 -0.506  1.00 60.30 ? 196 LEU B CD1 1 
ATOM   3081 C CD2 . LEU B 1 202 ? 18.160  -30.479 -2.790  1.00 59.96 ? 196 LEU B CD2 1 
ATOM   3082 N N   . GLN B 1 203 ? 15.289  -27.085 -0.073  1.00 58.55 ? 197 GLN B N   1 
ATOM   3083 C CA  . GLN B 1 203 ? 15.345  -25.659 0.055   1.00 58.55 ? 197 GLN B CA  1 
ATOM   3084 C C   . GLN B 1 203 ? 15.376  -25.175 1.504   1.00 58.74 ? 197 GLN B C   1 
ATOM   3085 O O   . GLN B 1 203 ? 15.941  -24.125 1.796   1.00 59.15 ? 197 GLN B O   1 
ATOM   3086 C CB  . GLN B 1 203 ? 14.172  -25.023 -0.659  1.00 58.61 ? 197 GLN B CB  1 
ATOM   3087 C CG  . GLN B 1 203 ? 14.283  -23.510 -0.731  1.00 57.18 ? 197 GLN B CG  1 
ATOM   3088 C CD  . GLN B 1 203 ? 12.953  -22.869 -0.906  1.00 55.76 ? 197 GLN B CD  1 
ATOM   3089 O OE1 . GLN B 1 203 ? 12.600  -22.459 -2.002  1.00 56.25 ? 197 GLN B OE1 1 
ATOM   3090 N NE2 . GLN B 1 203 ? 12.183  -22.803 0.167   1.00 55.88 ? 197 GLN B NE2 1 
ATOM   3091 N N   . ASN B 1 204 ? 14.769  -25.926 2.406   1.00 58.69 ? 198 ASN B N   1 
ATOM   3092 C CA  . ASN B 1 204 ? 14.744  -25.531 3.799   1.00 58.58 ? 198 ASN B CA  1 
ATOM   3093 C C   . ASN B 1 204 ? 15.979  -25.922 4.578   1.00 58.24 ? 198 ASN B C   1 
ATOM   3094 O O   . ASN B 1 204 ? 16.406  -25.200 5.497   1.00 57.99 ? 198 ASN B O   1 
ATOM   3095 C CB  . ASN B 1 204 ? 13.502  -26.066 4.456   1.00 59.01 ? 198 ASN B CB  1 
ATOM   3096 C CG  . ASN B 1 204 ? 12.265  -25.402 3.925   1.00 60.97 ? 198 ASN B CG  1 
ATOM   3097 O OD1 . ASN B 1 204 ? 12.292  -24.213 3.579   1.00 61.55 ? 198 ASN B OD1 1 
ATOM   3098 N ND2 . ASN B 1 204 ? 11.162  -26.163 3.843   1.00 62.55 ? 198 ASN B ND2 1 
ATOM   3099 N N   . ARG B 1 205 ? 16.571  -27.051 4.210   1.00 57.89 ? 199 ARG B N   1 
ATOM   3100 C CA  . ARG B 1 205 ? 17.872  -27.383 4.779   1.00 57.68 ? 199 ARG B CA  1 
ATOM   3101 C C   . ARG B 1 205 ? 18.911  -26.356 4.326   1.00 57.28 ? 199 ARG B C   1 
ATOM   3102 O O   . ARG B 1 205 ? 19.694  -25.876 5.150   1.00 57.90 ? 199 ARG B O   1 
ATOM   3103 C CB  . ARG B 1 205 ? 18.306  -28.817 4.461   1.00 57.98 ? 199 ARG B CB  1 
ATOM   3104 C CG  . ARG B 1 205 ? 17.397  -29.896 5.064   1.00 57.78 ? 199 ARG B CG  1 
ATOM   3105 C CD  . ARG B 1 205 ? 18.014  -31.280 4.980   1.00 57.50 ? 199 ARG B CD  1 
ATOM   3106 N NE  . ARG B 1 205 ? 17.840  -31.887 3.657   1.00 57.98 ? 199 ARG B NE  1 
ATOM   3107 C CZ  . ARG B 1 205 ? 18.827  -32.373 2.900   1.00 58.24 ? 199 ARG B CZ  1 
ATOM   3108 N NH1 . ARG B 1 205 ? 18.544  -32.906 1.715   1.00 58.12 ? 199 ARG B NH1 1 
ATOM   3109 N NH2 . ARG B 1 205 ? 20.095  -32.339 3.319   1.00 57.79 ? 199 ARG B NH2 1 
ATOM   3110 N N   . ILE B 1 206 ? 18.894  -25.977 3.044   1.00 56.19 ? 200 ILE B N   1 
ATOM   3111 C CA  . ILE B 1 206 ? 19.831  -24.963 2.552   1.00 54.92 ? 200 ILE B CA  1 
ATOM   3112 C C   . ILE B 1 206 ? 19.655  -23.640 3.307   1.00 54.55 ? 200 ILE B C   1 
ATOM   3113 O O   . ILE B 1 206 ? 20.610  -23.105 3.873   1.00 54.54 ? 200 ILE B O   1 
ATOM   3114 C CB  . ILE B 1 206 ? 19.728  -24.772 1.029   1.00 55.23 ? 200 ILE B CB  1 
ATOM   3115 C CG1 . ILE B 1 206 ? 20.011  -26.096 0.318   1.00 53.59 ? 200 ILE B CG1 1 
ATOM   3116 C CG2 . ILE B 1 206 ? 20.703  -23.631 0.514   1.00 55.26 ? 200 ILE B CG2 1 
ATOM   3117 C CD1 . ILE B 1 206 ? 19.493  -26.135 -1.071  1.00 52.20 ? 200 ILE B CD1 1 
ATOM   3118 N N   . ALA B 1 207 ? 18.425  -23.144 3.349   1.00 53.80 ? 201 ALA B N   1 
ATOM   3119 C CA  . ALA B 1 207 ? 18.101  -21.936 4.095   1.00 52.94 ? 201 ALA B CA  1 
ATOM   3120 C C   . ALA B 1 207 ? 18.531  -22.063 5.558   1.00 52.77 ? 201 ALA B C   1 
ATOM   3121 O O   . ALA B 1 207 ? 18.851  -21.062 6.207   1.00 52.33 ? 201 ALA B O   1 
ATOM   3122 C CB  . ALA B 1 207 ? 16.611  -21.635 3.993   1.00 52.61 ? 201 ALA B CB  1 
ATOM   3123 N N   . SER B 1 208 ? 18.544  -23.288 6.083   1.00 52.73 ? 202 SER B N   1 
ATOM   3124 C CA  . SER B 1 208 ? 19.010  -23.476 7.462   1.00 52.91 ? 202 SER B CA  1 
ATOM   3125 C C   . SER B 1 208 ? 20.487  -23.165 7.633   1.00 52.93 ? 202 SER B C   1 
ATOM   3126 O O   . SER B 1 208 ? 20.842  -22.419 8.563   1.00 53.20 ? 202 SER B O   1 
ATOM   3127 C CB  . SER B 1 208 ? 18.692  -24.861 8.002   1.00 52.66 ? 202 SER B CB  1 
ATOM   3128 O OG  . SER B 1 208 ? 17.314  -24.942 8.260   1.00 53.10 ? 202 SER B OG  1 
ATOM   3129 N N   . CYS B 1 209 ? 21.325  -23.718 6.743   1.00 52.33 ? 203 CYS B N   1 
ATOM   3130 C CA  . CYS B 1 209 ? 22.768  -23.462 6.755   1.00 51.95 ? 203 CYS B CA  1 
ATOM   3131 C C   . CYS B 1 209 ? 23.056  -22.002 6.638   1.00 51.16 ? 203 CYS B C   1 
ATOM   3132 O O   . CYS B 1 209 ? 23.928  -21.480 7.325   1.00 51.21 ? 203 CYS B O   1 
ATOM   3133 C CB  . CYS B 1 209 ? 23.458  -24.110 5.567   1.00 52.30 ? 203 CYS B CB  1 
ATOM   3134 S SG  . CYS B 1 209 ? 23.633  -25.838 5.714   1.00 54.30 ? 203 CYS B SG  1 
ATOM   3135 N N   . LEU B 1 210 ? 22.354  -21.347 5.725   1.00 50.30 ? 204 LEU B N   1 
ATOM   3136 C CA  . LEU B 1 210 ? 22.598  -19.949 5.515   1.00 49.86 ? 204 LEU B CA  1 
ATOM   3137 C C   . LEU B 1 210 ? 22.360  -19.184 6.835   1.00 50.10 ? 204 LEU B C   1 
ATOM   3138 O O   . LEU B 1 210 ? 23.255  -18.435 7.299   1.00 50.42 ? 204 LEU B O   1 
ATOM   3139 C CB  . LEU B 1 210 ? 21.738  -19.428 4.379   1.00 49.25 ? 204 LEU B CB  1 
ATOM   3140 C CG  . LEU B 1 210 ? 21.725  -17.918 4.179   1.00 48.51 ? 204 LEU B CG  1 
ATOM   3141 C CD1 . LEU B 1 210 ? 23.106  -17.343 3.944   1.00 47.73 ? 204 LEU B CD1 1 
ATOM   3142 C CD2 . LEU B 1 210 ? 20.830  -17.629 3.022   1.00 48.43 ? 204 LEU B CD2 1 
ATOM   3143 N N   . LYS B 1 211 ? 21.191  -19.419 7.450   1.00 49.34 ? 205 LYS B N   1 
ATOM   3144 C CA  . LYS B 1 211 ? 20.804  -18.763 8.693   1.00 48.78 ? 205 LYS B CA  1 
ATOM   3145 C C   . LYS B 1 211 ? 21.722  -19.147 9.837   1.00 48.64 ? 205 LYS B C   1 
ATOM   3146 O O   . LYS B 1 211 ? 21.969  -18.344 10.726  1.00 48.41 ? 205 LYS B O   1 
ATOM   3147 C CB  . LYS B 1 211 ? 19.336  -19.056 9.041   1.00 48.73 ? 205 LYS B CB  1 
ATOM   3148 N N   . GLU B 1 212 ? 22.232  -20.371 9.817   1.00 48.87 ? 206 GLU B N   1 
ATOM   3149 C CA  . GLU B 1 212 ? 23.136  -20.782 10.867  1.00 49.71 ? 206 GLU B CA  1 
ATOM   3150 C C   . GLU B 1 212 ? 24.531  -20.284 10.604  1.00 49.56 ? 206 GLU B C   1 
ATOM   3151 O O   . GLU B 1 212 ? 25.290  -20.094 11.550  1.00 50.36 ? 206 GLU B O   1 
ATOM   3152 C CB  . GLU B 1 212 ? 23.152  -22.288 11.090  1.00 49.50 ? 206 GLU B CB  1 
ATOM   3153 C CG  . GLU B 1 212 ? 23.619  -22.660 12.518  1.00 51.14 ? 206 GLU B CG  1 
ATOM   3154 C CD  . GLU B 1 212 ? 24.074  -24.129 12.675  1.00 51.46 ? 206 GLU B CD  1 
ATOM   3155 O OE1 . GLU B 1 212 ? 24.704  -24.450 13.723  1.00 50.68 ? 206 GLU B OE1 1 
ATOM   3156 O OE2 . GLU B 1 212 ? 23.805  -24.952 11.752  1.00 53.54 ? 206 GLU B OE2 1 
ATOM   3157 N N   . HIS B 1 213 ? 24.883  -20.055 9.343   1.00 49.29 ? 207 HIS B N   1 
ATOM   3158 C CA  . HIS B 1 213 ? 26.216  -19.539 9.060   1.00 49.26 ? 207 HIS B CA  1 
ATOM   3159 C C   . HIS B 1 213 ? 26.326  -18.079 9.466   1.00 49.22 ? 207 HIS B C   1 
ATOM   3160 O O   . HIS B 1 213 ? 27.275  -17.691 10.151  1.00 49.16 ? 207 HIS B O   1 
ATOM   3161 C CB  . HIS B 1 213 ? 26.627  -19.703 7.602   1.00 49.32 ? 207 HIS B CB  1 
ATOM   3162 C CG  . HIS B 1 213 ? 27.871  -18.951 7.260   1.00 49.03 ? 207 HIS B CG  1 
ATOM   3163 N ND1 . HIS B 1 213 ? 29.124  -19.364 7.667   1.00 48.93 ? 207 HIS B ND1 1 
ATOM   3164 C CD2 . HIS B 1 213 ? 28.054  -17.792 6.583   1.00 48.91 ? 207 HIS B CD2 1 
ATOM   3165 C CE1 . HIS B 1 213 ? 30.028  -18.497 7.245   1.00 49.46 ? 207 HIS B CE1 1 
ATOM   3166 N NE2 . HIS B 1 213 ? 29.406  -17.533 6.585   1.00 51.21 ? 207 HIS B NE2 1 
ATOM   3167 N N   . VAL B 1 214 ? 25.347  -17.280 9.046   1.00 49.26 ? 208 VAL B N   1 
ATOM   3168 C CA  . VAL B 1 214 ? 25.295  -15.868 9.421   1.00 49.10 ? 208 VAL B CA  1 
ATOM   3169 C C   . VAL B 1 214 ? 25.221  -15.724 10.946  1.00 49.37 ? 208 VAL B C   1 
ATOM   3170 O O   . VAL B 1 214 ? 25.940  -14.896 11.537  1.00 49.35 ? 208 VAL B O   1 
ATOM   3171 C CB  . VAL B 1 214 ? 24.137  -15.117 8.717   1.00 49.02 ? 208 VAL B CB  1 
ATOM   3172 C CG1 . VAL B 1 214 ? 24.354  -15.092 7.201   1.00 48.23 ? 208 VAL B CG1 1 
ATOM   3173 C CG2 . VAL B 1 214 ? 22.792  -15.730 9.059   1.00 48.91 ? 208 VAL B CG2 1 
ATOM   3174 N N   . ALA B 1 215 ? 24.375  -16.565 11.560  1.00 49.25 ? 209 ALA B N   1 
ATOM   3175 C CA  . ALA B 1 215 ? 24.248  -16.686 13.015  1.00 49.15 ? 209 ALA B CA  1 
ATOM   3176 C C   . ALA B 1 215 ? 25.611  -16.831 13.676  1.00 49.10 ? 209 ALA B C   1 
ATOM   3177 O O   . ALA B 1 215 ? 25.983  -16.015 14.524  1.00 49.16 ? 209 ALA B O   1 
ATOM   3178 C CB  . ALA B 1 215 ? 23.373  -17.867 13.375  1.00 49.20 ? 209 ALA B CB  1 
ATOM   3179 N N   . ALA B 1 216 ? 26.355  -17.860 13.274  1.00 48.70 ? 210 ALA B N   1 
ATOM   3180 C CA  . ALA B 1 216 ? 27.713  -18.064 13.756  1.00 48.38 ? 210 ALA B CA  1 
ATOM   3181 C C   . ALA B 1 216 ? 28.617  -16.877 13.393  1.00 48.28 ? 210 ALA B C   1 
ATOM   3182 O O   . ALA B 1 216 ? 29.753  -17.056 12.984  1.00 48.04 ? 210 ALA B O   1 
ATOM   3183 C CB  . ALA B 1 216 ? 28.273  -19.369 13.212  1.00 48.25 ? 210 ALA B CB  1 
ATOM   3184 N N   . VAL B 1 217 ? 28.070  -15.668 13.514  1.00 48.34 ? 211 VAL B N   1 
ATOM   3185 C CA  . VAL B 1 217 ? 28.834  -14.408 13.562  1.00 48.32 ? 211 VAL B CA  1 
ATOM   3186 C C   . VAL B 1 217 ? 27.914  -13.161 13.777  1.00 48.52 ? 211 VAL B C   1 
ATOM   3187 O O   . VAL B 1 217 ? 27.409  -12.585 12.809  1.00 48.38 ? 211 VAL B O   1 
ATOM   3188 C CB  . VAL B 1 217 ? 29.854  -14.251 12.367  1.00 48.24 ? 211 VAL B CB  1 
ATOM   3189 C CG1 . VAL B 1 217 ? 29.201  -14.499 10.992  1.00 47.42 ? 211 VAL B CG1 1 
ATOM   3190 C CG2 . VAL B 1 217 ? 30.591  -12.907 12.434  1.00 47.63 ? 211 VAL B CG2 1 
ATOM   3191 N N   . ALA B 1 218 ? 27.645  -12.786 15.036  1.00 48.49 ? 212 ALA B N   1 
ATOM   3192 C CA  . ALA B 1 218 ? 28.007  -13.578 16.231  1.00 49.00 ? 212 ALA B CA  1 
ATOM   3193 C C   . ALA B 1 218 ? 26.850  -13.907 17.182  1.00 49.25 ? 212 ALA B C   1 
ATOM   3194 O O   . ALA B 1 218 ? 27.077  -14.267 18.345  1.00 49.15 ? 212 ALA B O   1 
ATOM   3195 N N   . GLY B 1 219 ? 25.617  -13.774 16.673  1.00 49.44 ? 213 GLY B N   1 
ATOM   3196 C CA  . GLY B 1 219 ? 24.361  -14.073 17.385  1.00 49.40 ? 213 GLY B CA  1 
ATOM   3197 C C   . GLY B 1 219 ? 23.260  -14.444 16.368  1.00 49.37 ? 213 GLY B C   1 
ATOM   3198 O O   . GLY B 1 219 ? 22.104  -14.727 16.722  1.00 49.29 ? 213 GLY B O   1 
ATOM   3199 N N   . PRO B 1 223 ? 16.723  -16.429 11.006  1.00 42.42 ? 217 PRO B N   1 
ATOM   3200 C CA  . PRO B 1 223 ? 17.183  -15.131 11.949  1.00 41.93 ? 217 PRO B CA  1 
ATOM   3201 C C   . PRO B 1 223 ? 16.790  -14.053 11.005  1.00 42.12 ? 217 PRO B C   1 
ATOM   3202 O O   . PRO B 1 223 ? 16.203  -14.397 9.916   1.00 42.08 ? 217 PRO B O   1 
ATOM   3203 C CB  . PRO B 1 223 ? 18.687  -14.921 12.604  1.00 42.93 ? 217 PRO B CB  1 
ATOM   3204 N N   . ALA B 1 224 ? 17.003  -12.752 11.426  1.00 43.80 ? 218 ALA B N   1 
ATOM   3205 C CA  . ALA B 1 224 ? 16.803  -11.613 10.526  1.00 46.33 ? 218 ALA B CA  1 
ATOM   3206 C C   . ALA B 1 224 ? 17.941  -10.582 10.488  1.00 48.06 ? 218 ALA B C   1 
ATOM   3207 O O   . ALA B 1 224 ? 19.021  -10.773 11.083  1.00 47.79 ? 218 ALA B O   1 
ATOM   3208 N N   . SER B 1 225 ? 17.687  -9.492  9.757   1.00 49.82 ? 219 SER B N   1 
ATOM   3209 C CA  . SER B 1 225 ? 18.545  -8.305  9.768   1.00 51.83 ? 219 SER B CA  1 
ATOM   3210 C C   . SER B 1 225 ? 19.622  -8.388  8.719   1.00 53.31 ? 219 SER B C   1 
ATOM   3211 O O   . SER B 1 225 ? 19.511  -7.800  7.646   1.00 53.48 ? 219 SER B O   1 
ATOM   3212 N N   . CYS B 1 226 ? 20.655  -9.156  9.035   1.00 55.13 ? 220 CYS B N   1 
ATOM   3213 C CA  . CYS B 1 226 ? 21.849  -9.265  8.205   1.00 55.86 ? 220 CYS B CA  1 
ATOM   3214 C C   . CYS B 1 226 ? 21.638  -9.972  6.861   1.00 56.20 ? 220 CYS B C   1 
ATOM   3215 O O   . CYS B 1 226 ? 22.184  -9.555  5.834   1.00 56.46 ? 220 CYS B O   1 
ATOM   3216 C CB  . CYS B 1 226 ? 22.938  -9.988  8.987   1.00 56.15 ? 220 CYS B CB  1 
ATOM   3217 S SG  . CYS B 1 226 ? 24.460  -10.200 8.042   1.00 57.47 ? 220 CYS B SG  1 
ATOM   3218 N N   . LEU B 1 227 ? 20.873  -11.057 6.886   1.00 56.44 ? 221 LEU B N   1 
ATOM   3219 C CA  . LEU B 1 227 ? 20.584  -11.844 5.692   1.00 56.63 ? 221 LEU B CA  1 
ATOM   3220 C C   . LEU B 1 227 ? 19.507  -11.169 4.870   1.00 56.52 ? 221 LEU B C   1 
ATOM   3221 O O   . LEU B 1 227 ? 19.345  -11.449 3.680   1.00 56.80 ? 221 LEU B O   1 
ATOM   3222 C CB  . LEU B 1 227 ? 20.180  -13.281 6.046   1.00 56.72 ? 221 LEU B CB  1 
ATOM   3223 C CG  . LEU B 1 227 ? 19.436  -13.595 7.338   1.00 57.31 ? 221 LEU B CG  1 
ATOM   3224 C CD1 . LEU B 1 227 ? 19.307  -15.095 7.430   1.00 60.26 ? 221 LEU B CD1 1 
ATOM   3225 C CD2 . LEU B 1 227 ? 20.164  -13.069 8.575   1.00 58.72 ? 221 LEU B CD2 1 
ATOM   3226 N N   . SER B 1 228 ? 18.779  -10.266 5.509   1.00 56.09 ? 222 SER B N   1 
ATOM   3227 C CA  . SER B 1 228 ? 17.849  -9.433  4.805   1.00 55.50 ? 222 SER B CA  1 
ATOM   3228 C C   . SER B 1 228 ? 18.633  -8.599  3.792   1.00 55.48 ? 222 SER B C   1 
ATOM   3229 O O   . SER B 1 228 ? 18.215  -8.464  2.643   1.00 55.70 ? 222 SER B O   1 
ATOM   3230 C CB  . SER B 1 228 ? 17.100  -8.544  5.780   1.00 55.36 ? 222 SER B CB  1 
ATOM   3231 O OG  . SER B 1 228 ? 15.857  -8.192  5.223   1.00 55.36 ? 222 SER B OG  1 
ATOM   3232 N N   . ARG B 1 229 ? 19.783  -8.067  4.204   1.00 55.30 ? 223 ARG B N   1 
ATOM   3233 C CA  . ARG B 1 229 ? 20.622  -7.278  3.299   1.00 55.27 ? 223 ARG B CA  1 
ATOM   3234 C C   . ARG B 1 229 ? 21.040  -8.096  2.084   1.00 54.89 ? 223 ARG B C   1 
ATOM   3235 O O   . ARG B 1 229 ? 20.788  -7.684  0.952   1.00 54.81 ? 223 ARG B O   1 
ATOM   3236 C CB  . ARG B 1 229 ? 21.842  -6.706  4.025   1.00 55.50 ? 223 ARG B CB  1 
ATOM   3237 C CG  . ARG B 1 229 ? 21.584  -5.345  4.668   1.00 56.55 ? 223 ARG B CG  1 
ATOM   3238 C CD  . ARG B 1 229 ? 22.874  -4.490  4.813   1.00 57.63 ? 223 ARG B CD  1 
ATOM   3239 N NE  . ARG B 1 229 ? 23.854  -4.922  5.831   1.00 57.57 ? 223 ARG B NE  1 
ATOM   3240 C CZ  . ARG B 1 229 ? 23.607  -5.614  6.951   1.00 57.38 ? 223 ARG B CZ  1 
ATOM   3241 N NH1 . ARG B 1 229 ? 22.378  -6.006  7.273   1.00 58.01 ? 223 ARG B NH1 1 
ATOM   3242 N NH2 . ARG B 1 229 ? 24.611  -5.916  7.767   1.00 56.71 ? 223 ARG B NH2 1 
ATOM   3243 N N   . LEU B 1 230 ? 21.667  -9.245  2.362   1.00 54.70 ? 224 LEU B N   1 
ATOM   3244 C CA  . LEU B 1 230 ? 21.981  -10.347 1.426   1.00 54.33 ? 224 LEU B CA  1 
ATOM   3245 C C   . LEU B 1 230 ? 20.833  -10.799 0.483   1.00 54.19 ? 224 LEU B C   1 
ATOM   3246 O O   . LEU B 1 230 ? 20.863  -10.522 -0.720  1.00 54.33 ? 224 LEU B O   1 
ATOM   3247 C CB  . LEU B 1 230 ? 22.445  -11.559 2.249   1.00 54.22 ? 224 LEU B CB  1 
ATOM   3248 C CG  . LEU B 1 230 ? 23.485  -12.495 1.641   1.00 54.15 ? 224 LEU B CG  1 
ATOM   3249 C CD1 . LEU B 1 230 ? 24.884  -11.938 1.959   1.00 53.36 ? 224 LEU B CD1 1 
ATOM   3250 C CD2 . LEU B 1 230 ? 23.324  -13.933 2.150   1.00 52.03 ? 224 LEU B CD2 1 
ATOM   3251 N N   . LEU B 1 231 ? 19.829  -11.489 1.021   1.00 53.49 ? 225 LEU B N   1 
ATOM   3252 C CA  . LEU B 1 231 ? 18.725  -11.947 0.204   1.00 53.08 ? 225 LEU B CA  1 
ATOM   3253 C C   . LEU B 1 231 ? 18.064  -10.793 -0.488  1.00 53.65 ? 225 LEU B C   1 
ATOM   3254 O O   . LEU B 1 231 ? 17.327  -11.002 -1.451  1.00 53.81 ? 225 LEU B O   1 
ATOM   3255 C CB  . LEU B 1 231 ? 17.659  -12.594 1.036   1.00 52.81 ? 225 LEU B CB  1 
ATOM   3256 C CG  . LEU B 1 231 ? 17.942  -13.826 1.840   1.00 52.13 ? 225 LEU B CG  1 
ATOM   3257 C CD1 . LEU B 1 231 ? 16.641  -14.136 2.558   1.00 51.42 ? 225 LEU B CD1 1 
ATOM   3258 C CD2 . LEU B 1 231 ? 18.383  -14.955 0.937   1.00 52.72 ? 225 LEU B CD2 1 
ATOM   3259 N N   . GLY B 1 232 ? 18.282  -9.584  0.034   1.00 53.80 ? 226 GLY B N   1 
ATOM   3260 C CA  . GLY B 1 232 ? 17.897  -8.353  -0.655  1.00 53.83 ? 226 GLY B CA  1 
ATOM   3261 C C   . GLY B 1 232 ? 18.443  -8.304  -2.074  1.00 54.24 ? 226 GLY B C   1 
ATOM   3262 O O   . GLY B 1 232 ? 17.876  -7.626  -2.945  1.00 54.28 ? 226 GLY B O   1 
ATOM   3263 N N   . LYS B 1 233 ? 19.534  -9.033  -2.312  1.00 53.96 ? 227 LYS B N   1 
ATOM   3264 C CA  . LYS B 1 233 ? 20.082  -9.134  -3.649  1.00 54.43 ? 227 LYS B CA  1 
ATOM   3265 C C   . LYS B 1 233 ? 19.188  -9.906  -4.649  1.00 54.26 ? 227 LYS B C   1 
ATOM   3266 O O   . LYS B 1 233 ? 19.003  -9.460  -5.777  1.00 54.82 ? 227 LYS B O   1 
ATOM   3267 C CB  . LYS B 1 233 ? 21.516  -9.694  -3.633  1.00 54.81 ? 227 LYS B CB  1 
ATOM   3268 C CG  . LYS B 1 233 ? 22.579  -8.821  -2.938  1.00 55.35 ? 227 LYS B CG  1 
ATOM   3269 C CD  . LYS B 1 233 ? 22.804  -7.476  -3.603  1.00 56.68 ? 227 LYS B CD  1 
ATOM   3270 C CE  . LYS B 1 233 ? 21.867  -6.419  -3.005  1.00 59.20 ? 227 LYS B CE  1 
ATOM   3271 N NZ  . LYS B 1 233 ? 22.030  -5.063  -3.638  1.00 60.43 ? 227 LYS B NZ  1 
ATOM   3272 N N   . LEU B 1 234 ? 18.622  -11.040 -4.242  1.00 53.68 ? 228 LEU B N   1 
ATOM   3273 C CA  . LEU B 1 234 ? 17.881  -11.929 -5.166  1.00 53.17 ? 228 LEU B CA  1 
ATOM   3274 C C   . LEU B 1 234 ? 16.900  -11.284 -6.169  1.00 52.88 ? 228 LEU B C   1 
ATOM   3275 O O   . LEU B 1 234 ? 16.820  -11.754 -7.311  1.00 53.06 ? 228 LEU B O   1 
ATOM   3276 C CB  . LEU B 1 234 ? 17.198  -13.080 -4.417  1.00 53.08 ? 228 LEU B CB  1 
ATOM   3277 C CG  . LEU B 1 234 ? 18.073  -13.989 -3.536  1.00 53.99 ? 228 LEU B CG  1 
ATOM   3278 C CD1 . LEU B 1 234 ? 17.442  -15.367 -3.418  1.00 53.75 ? 228 LEU B CD1 1 
ATOM   3279 C CD2 . LEU B 1 234 ? 19.543  -14.116 -4.015  1.00 54.04 ? 228 LEU B CD2 1 
ATOM   3280 N N   . PRO B 1 235 ? 16.143  -10.243 -5.757  1.00 52.45 ? 229 PRO B N   1 
ATOM   3281 C CA  . PRO B 1 235 ? 15.299  -9.523  -6.694  1.00 52.31 ? 229 PRO B CA  1 
ATOM   3282 C C   . PRO B 1 235 ? 16.058  -8.854  -7.836  1.00 52.13 ? 229 PRO B C   1 
ATOM   3283 O O   . PRO B 1 235 ? 15.758  -9.124  -8.994  1.00 52.24 ? 229 PRO B O   1 
ATOM   3284 C CB  . PRO B 1 235 ? 14.649  -8.446  -5.812  1.00 52.62 ? 229 PRO B CB  1 
ATOM   3285 C CG  . PRO B 1 235 ? 15.578  -8.282  -4.659  1.00 52.48 ? 229 PRO B CG  1 
ATOM   3286 C CD  . PRO B 1 235 ? 15.982  -9.694  -4.400  1.00 52.79 ? 229 PRO B CD  1 
ATOM   3287 N N   . GLU B 1 236 ? 17.016  -7.982  -7.516  1.00 51.92 ? 230 GLU B N   1 
ATOM   3288 C CA  . GLU B 1 236 ? 17.735  -7.182  -8.530  1.00 51.81 ? 230 GLU B CA  1 
ATOM   3289 C C   . GLU B 1 236 ? 18.365  -8.053  -9.613  1.00 50.94 ? 230 GLU B C   1 
ATOM   3290 O O   . GLU B 1 236 ? 18.476  -7.645  -10.780 1.00 51.30 ? 230 GLU B O   1 
ATOM   3291 C CB  . GLU B 1 236 ? 18.807  -6.333  -7.874  1.00 52.01 ? 230 GLU B CB  1 
ATOM   3292 C CG  . GLU B 1 236 ? 18.446  -5.925  -6.464  1.00 54.67 ? 230 GLU B CG  1 
ATOM   3293 C CD  . GLU B 1 236 ? 19.533  -5.101  -5.822  1.00 59.34 ? 230 GLU B CD  1 
ATOM   3294 O OE1 . GLU B 1 236 ? 20.536  -4.786  -6.519  1.00 61.19 ? 230 GLU B OE1 1 
ATOM   3295 O OE2 . GLU B 1 236 ? 19.385  -4.772  -4.619  1.00 61.45 ? 230 GLU B OE2 1 
ATOM   3296 N N   . LEU B 1 237 ? 18.767  -9.255  -9.215  1.00 49.56 ? 231 LEU B N   1 
ATOM   3297 C CA  . LEU B 1 237 ? 19.098  -10.318 -10.150 1.00 48.21 ? 231 LEU B CA  1 
ATOM   3298 C C   . LEU B 1 237 ? 18.022  -10.495 -11.223 1.00 48.02 ? 231 LEU B C   1 
ATOM   3299 O O   . LEU B 1 237 ? 18.361  -10.710 -12.387 1.00 48.05 ? 231 LEU B O   1 
ATOM   3300 C CB  . LEU B 1 237 ? 19.314  -11.625 -9.390  1.00 47.65 ? 231 LEU B CB  1 
ATOM   3301 C CG  . LEU B 1 237 ? 20.364  -12.595 -9.900  1.00 45.64 ? 231 LEU B CG  1 
ATOM   3302 C CD1 . LEU B 1 237 ? 21.714  -11.943 -9.911  1.00 45.90 ? 231 LEU B CD1 1 
ATOM   3303 C CD2 . LEU B 1 237 ? 20.378  -13.754 -8.961  1.00 44.89 ? 231 LEU B CD2 1 
ATOM   3304 N N   . ARG B 1 238 ? 16.741  -10.372 -10.852 1.00 47.79 ? 232 ARG B N   1 
ATOM   3305 C CA  . ARG B 1 238 ? 15.625  -10.594 -11.803 1.00 47.88 ? 232 ARG B CA  1 
ATOM   3306 C C   . ARG B 1 238 ? 15.576  -9.569  -12.923 1.00 47.18 ? 232 ARG B C   1 
ATOM   3307 O O   . ARG B 1 238 ? 15.408  -9.925  -14.100 1.00 47.13 ? 232 ARG B O   1 
ATOM   3308 C CB  . ARG B 1 238 ? 14.267  -10.685 -11.098 1.00 48.34 ? 232 ARG B CB  1 
ATOM   3309 C CG  . ARG B 1 238 ? 13.775  -12.133 -10.818 1.00 51.15 ? 232 ARG B CG  1 
ATOM   3310 C CD  . ARG B 1 238 ? 14.517  -12.844 -9.648  1.00 54.54 ? 232 ARG B CD  1 
ATOM   3311 N NE  . ARG B 1 238 ? 13.764  -13.980 -9.104  1.00 58.70 ? 232 ARG B NE  1 
ATOM   3312 C CZ  . ARG B 1 238 ? 13.455  -15.094 -9.787  1.00 61.58 ? 232 ARG B CZ  1 
ATOM   3313 N NH1 . ARG B 1 238 ? 13.822  -15.236 -11.068 1.00 63.45 ? 232 ARG B NH1 1 
ATOM   3314 N NH2 . ARG B 1 238 ? 12.775  -16.078 -9.196  1.00 61.25 ? 232 ARG B NH2 1 
ATOM   3315 N N   . THR B 1 239 ? 15.744  -8.303  -12.548 1.00 46.18 ? 233 THR B N   1 
ATOM   3316 C CA  . THR B 1 239 ? 15.910  -7.212  -13.501 1.00 45.01 ? 233 THR B CA  1 
ATOM   3317 C C   . THR B 1 239 ? 17.022  -7.528  -14.496 1.00 45.23 ? 233 THR B C   1 
ATOM   3318 O O   . THR B 1 239 ? 16.855  -7.327  -15.733 1.00 45.09 ? 233 THR B O   1 
ATOM   3319 C CB  . THR B 1 239 ? 16.286  -5.921  -12.763 1.00 44.87 ? 233 THR B CB  1 
ATOM   3320 O OG1 . THR B 1 239 ? 15.119  -5.395  -12.128 1.00 43.37 ? 233 THR B OG1 1 
ATOM   3321 C CG2 . THR B 1 239 ? 16.889  -4.900  -13.724 1.00 42.94 ? 233 THR B CG2 1 
ATOM   3322 N N   . LEU B 1 240 ? 18.154  -8.013  -13.950 1.00 44.21 ? 234 LEU B N   1 
ATOM   3323 C CA  . LEU B 1 240 ? 19.304  -8.366  -14.770 1.00 43.38 ? 234 LEU B CA  1 
ATOM   3324 C C   . LEU B 1 240 ? 18.989  -9.533  -15.680 1.00 43.03 ? 234 LEU B C   1 
ATOM   3325 O O   . LEU B 1 240 ? 19.568  -9.638  -16.748 1.00 42.59 ? 234 LEU B O   1 
ATOM   3326 C CB  . LEU B 1 240 ? 20.572  -8.595  -13.939 1.00 43.36 ? 234 LEU B CB  1 
ATOM   3327 C CG  . LEU B 1 240 ? 21.554  -7.431  -13.709 1.00 43.37 ? 234 LEU B CG  1 
ATOM   3328 C CD1 . LEU B 1 240 ? 20.871  -6.120  -13.373 1.00 44.68 ? 234 LEU B CD1 1 
ATOM   3329 C CD2 . LEU B 1 240 ? 22.479  -7.773  -12.584 1.00 43.35 ? 234 LEU B CD2 1 
ATOM   3330 N N   . CYS B 1 241 ? 18.047  -10.381 -15.291 1.00 43.10 ? 235 CYS B N   1 
ATOM   3331 C CA  . CYS B 1 241 ? 17.662  -11.475 -16.159 1.00 44.78 ? 235 CYS B CA  1 
ATOM   3332 C C   . CYS B 1 241 ? 16.898  -10.983 -17.361 1.00 43.83 ? 235 CYS B C   1 
ATOM   3333 O O   . CYS B 1 241 ? 17.100  -11.452 -18.480 1.00 43.82 ? 235 CYS B O   1 
ATOM   3334 C CB  . CYS B 1 241 ? 16.856  -12.498 -15.396 1.00 44.81 ? 235 CYS B CB  1 
ATOM   3335 S SG  . CYS B 1 241 ? 17.896  -13.219 -14.124 1.00 55.55 ? 235 CYS B SG  1 
ATOM   3336 N N   . THR B 1 242 ? 16.013  -10.032 -17.122 1.00 43.54 ? 236 THR B N   1 
ATOM   3337 C CA  . THR B 1 242 ? 15.195  -9.476  -18.182 1.00 43.13 ? 236 THR B CA  1 
ATOM   3338 C C   . THR B 1 242 ? 16.063  -8.857  -19.244 1.00 42.91 ? 236 THR B C   1 
ATOM   3339 O O   . THR B 1 242 ? 15.954  -9.235  -20.405 1.00 43.27 ? 236 THR B O   1 
ATOM   3340 C CB  . THR B 1 242 ? 14.254  -8.467  -17.616 1.00 42.82 ? 236 THR B CB  1 
ATOM   3341 O OG1 . THR B 1 242 ? 13.757  -9.007  -16.402 1.00 43.29 ? 236 THR B OG1 1 
ATOM   3342 C CG2 . THR B 1 242 ? 13.103  -8.241  -18.539 1.00 42.76 ? 236 THR B CG2 1 
ATOM   3343 N N   . GLN B 1 243 ? 16.944  -7.947  -18.834 1.00 42.55 ? 237 GLN B N   1 
ATOM   3344 C CA  . GLN B 1 243 ? 17.948  -7.379  -19.723 1.00 42.63 ? 237 GLN B CA  1 
ATOM   3345 C C   . GLN B 1 243 ? 18.665  -8.454  -20.499 1.00 42.31 ? 237 GLN B C   1 
ATOM   3346 O O   . GLN B 1 243 ? 19.081  -8.213  -21.640 1.00 42.98 ? 237 GLN B O   1 
ATOM   3347 C CB  . GLN B 1 243 ? 19.021  -6.636  -18.949 1.00 43.07 ? 237 GLN B CB  1 
ATOM   3348 C CG  . GLN B 1 243 ? 18.595  -5.397  -18.209 1.00 45.13 ? 237 GLN B CG  1 
ATOM   3349 C CD  . GLN B 1 243 ? 19.803  -4.658  -17.658 1.00 48.51 ? 237 GLN B CD  1 
ATOM   3350 O OE1 . GLN B 1 243 ? 20.775  -4.360  -18.387 1.00 47.15 ? 237 GLN B OE1 1 
ATOM   3351 N NE2 . GLN B 1 243 ? 19.766  -4.383  -16.352 1.00 50.66 ? 237 GLN B NE2 1 
ATOM   3352 N N   . GLY B 1 244 ? 18.826  -9.628  -19.880 1.00 41.30 ? 238 GLY B N   1 
ATOM   3353 C CA  . GLY B 1 244 ? 19.504  -10.741 -20.513 1.00 40.23 ? 238 GLY B CA  1 
ATOM   3354 C C   . GLY B 1 244 ? 18.664  -11.298 -21.631 1.00 40.34 ? 238 GLY B C   1 
ATOM   3355 O O   . GLY B 1 244 ? 19.168  -11.634 -22.709 1.00 40.69 ? 238 GLY B O   1 
ATOM   3356 N N   . LEU B 1 245 ? 17.365  -11.393 -21.378 1.00 40.22 ? 239 LEU B N   1 
ATOM   3357 C CA  . LEU B 1 245 ? 16.452  -11.979 -22.352 1.00 39.77 ? 239 LEU B CA  1 
ATOM   3358 C C   . LEU B 1 245 ? 16.239  -10.948 -23.446 1.00 40.26 ? 239 LEU B C   1 
ATOM   3359 O O   . LEU B 1 245 ? 16.083  -11.291 -24.635 1.00 40.96 ? 239 LEU B O   1 
ATOM   3360 C CB  . LEU B 1 245 ? 15.141  -12.411 -21.688 1.00 38.81 ? 239 LEU B CB  1 
ATOM   3361 C CG  . LEU B 1 245 ? 15.352  -13.471 -20.590 1.00 36.76 ? 239 LEU B CG  1 
ATOM   3362 C CD1 . LEU B 1 245 ? 14.346  -13.332 -19.445 1.00 33.38 ? 239 LEU B CD1 1 
ATOM   3363 C CD2 . LEU B 1 245 ? 15.337  -14.862 -21.166 1.00 34.62 ? 239 LEU B CD2 1 
ATOM   3364 N N   . GLN B 1 246 ? 16.277  -9.679  -23.062 1.00 39.59 ? 240 GLN B N   1 
ATOM   3365 C CA  . GLN B 1 246 ? 16.239  -8.653  -24.069 1.00 39.40 ? 240 GLN B CA  1 
ATOM   3366 C C   . GLN B 1 246 ? 17.396  -8.837  -25.033 1.00 39.86 ? 240 GLN B C   1 
ATOM   3367 O O   . GLN B 1 246 ? 17.178  -8.779  -26.238 1.00 40.32 ? 240 GLN B O   1 
ATOM   3368 C CB  . GLN B 1 246 ? 16.220  -7.265  -23.471 1.00 38.77 ? 240 GLN B CB  1 
ATOM   3369 C CG  . GLN B 1 246 ? 14.845  -6.809  -23.180 1.00 37.44 ? 240 GLN B CG  1 
ATOM   3370 C CD  . GLN B 1 246 ? 14.845  -5.571  -22.355 1.00 39.97 ? 240 GLN B CD  1 
ATOM   3371 O OE1 . GLN B 1 246 ? 15.447  -5.525  -21.277 1.00 41.26 ? 240 GLN B OE1 1 
ATOM   3372 N NE2 . GLN B 1 246 ? 14.176  -4.536  -22.847 1.00 40.14 ? 240 GLN B NE2 1 
ATOM   3373 N N   . ARG B 1 247 ? 18.601  -9.103  -24.527 1.00 40.11 ? 241 ARG B N   1 
ATOM   3374 C CA  . ARG B 1 247 ? 19.758  -9.317  -25.427 1.00 40.43 ? 241 ARG B CA  1 
ATOM   3375 C C   . ARG B 1 247 ? 19.544  -10.469 -26.362 1.00 40.21 ? 241 ARG B C   1 
ATOM   3376 O O   . ARG B 1 247 ? 19.868  -10.352 -27.544 1.00 39.96 ? 241 ARG B O   1 
ATOM   3377 C CB  . ARG B 1 247 ? 21.079  -9.554  -24.695 1.00 40.07 ? 241 ARG B CB  1 
ATOM   3378 C CG  . ARG B 1 247 ? 22.062  -8.472  -24.948 1.00 41.40 ? 241 ARG B CG  1 
ATOM   3379 C CD  . ARG B 1 247 ? 22.750  -8.594  -26.283 1.00 44.36 ? 241 ARG B CD  1 
ATOM   3380 N NE  . ARG B 1 247 ? 22.867  -7.280  -26.910 1.00 46.37 ? 241 ARG B NE  1 
ATOM   3381 C CZ  . ARG B 1 247 ? 23.701  -6.962  -27.893 1.00 47.39 ? 241 ARG B CZ  1 
ATOM   3382 N NH1 . ARG B 1 247 ? 24.553  -7.849  -28.391 1.00 48.81 ? 241 ARG B NH1 1 
ATOM   3383 N NH2 . ARG B 1 247 ? 23.678  -5.735  -28.378 1.00 47.67 ? 241 ARG B NH2 1 
ATOM   3384 N N   . ILE B 1 248 ? 19.016  -11.577 -25.833 1.00 40.15 ? 242 ILE B N   1 
ATOM   3385 C CA  . ILE B 1 248 ? 18.774  -12.755 -26.664 1.00 40.73 ? 242 ILE B CA  1 
ATOM   3386 C C   . ILE B 1 248 ? 17.678  -12.469 -27.723 1.00 41.46 ? 242 ILE B C   1 
ATOM   3387 O O   . ILE B 1 248 ? 17.931  -12.617 -28.913 1.00 41.79 ? 242 ILE B O   1 
ATOM   3388 C CB  . ILE B 1 248 ? 18.526  -14.029 -25.836 1.00 40.58 ? 242 ILE B CB  1 
ATOM   3389 C CG1 . ILE B 1 248 ? 19.794  -14.369 -25.049 1.00 38.54 ? 242 ILE B CG1 1 
ATOM   3390 C CG2 . ILE B 1 248 ? 18.087  -15.191 -26.755 1.00 40.72 ? 242 ILE B CG2 1 
ATOM   3391 C CD1 . ILE B 1 248 ? 19.599  -15.310 -23.853 1.00 34.44 ? 242 ILE B CD1 1 
ATOM   3392 N N   . PHE B 1 249 ? 16.501  -12.006 -27.311 1.00 42.08 ? 243 PHE B N   1 
ATOM   3393 C CA  . PHE B 1 249 ? 15.520  -11.546 -28.284 1.00 42.91 ? 243 PHE B CA  1 
ATOM   3394 C C   . PHE B 1 249 ? 16.201  -10.791 -29.398 1.00 43.83 ? 243 PHE B C   1 
ATOM   3395 O O   . PHE B 1 249 ? 16.123  -11.194 -30.567 1.00 44.01 ? 243 PHE B O   1 
ATOM   3396 C CB  . PHE B 1 249 ? 14.478  -10.644 -27.644 1.00 42.66 ? 243 PHE B CB  1 
ATOM   3397 C CG  . PHE B 1 249 ? 13.250  -10.435 -28.489 1.00 41.67 ? 243 PHE B CG  1 
ATOM   3398 C CD1 . PHE B 1 249 ? 12.348  -11.473 -28.698 1.00 43.45 ? 243 PHE B CD1 1 
ATOM   3399 C CD2 . PHE B 1 249 ? 12.973  -9.192  -29.038 1.00 42.32 ? 243 PHE B CD2 1 
ATOM   3400 C CE1 . PHE B 1 249 ? 11.191  -11.283 -29.455 1.00 43.50 ? 243 PHE B CE1 1 
ATOM   3401 C CE2 . PHE B 1 249 ? 11.813  -8.969  -29.797 1.00 41.41 ? 243 PHE B CE2 1 
ATOM   3402 C CZ  . PHE B 1 249 ? 10.926  -10.009 -30.008 1.00 43.21 ? 243 PHE B CZ  1 
ATOM   3403 N N   . TYR B 1 250 ? 16.887  -9.705  -29.042 1.00 44.67 ? 244 TYR B N   1 
ATOM   3404 C CA  . TYR B 1 250 ? 17.484  -8.866  -30.060 1.00 45.49 ? 244 TYR B CA  1 
ATOM   3405 C C   . TYR B 1 250 ? 18.341  -9.699  -31.012 1.00 45.95 ? 244 TYR B C   1 
ATOM   3406 O O   . TYR B 1 250 ? 18.140  -9.637  -32.204 1.00 46.26 ? 244 TYR B O   1 
ATOM   3407 C CB  . TYR B 1 250 ? 18.247  -7.690  -29.466 1.00 45.32 ? 244 TYR B CB  1 
ATOM   3408 C CG  . TYR B 1 250 ? 19.202  -7.083  -30.450 1.00 46.50 ? 244 TYR B CG  1 
ATOM   3409 C CD1 . TYR B 1 250 ? 18.750  -6.285  -31.526 1.00 48.64 ? 244 TYR B CD1 1 
ATOM   3410 C CD2 . TYR B 1 250 ? 20.567  -7.304  -30.325 1.00 47.09 ? 244 TYR B CD2 1 
ATOM   3411 C CE1 . TYR B 1 250 ? 19.665  -5.723  -32.458 1.00 47.60 ? 244 TYR B CE1 1 
ATOM   3412 C CE2 . TYR B 1 250 ? 21.482  -6.756  -31.231 1.00 48.16 ? 244 TYR B CE2 1 
ATOM   3413 C CZ  . TYR B 1 250 ? 21.037  -5.972  -32.289 1.00 48.09 ? 244 TYR B CZ  1 
ATOM   3414 O OH  . TYR B 1 250 ? 22.002  -5.470  -33.146 1.00 47.96 ? 244 TYR B OH  1 
ATOM   3415 N N   . LEU B 1 251 ? 19.250  -10.513 -30.480 1.00 46.97 ? 245 LEU B N   1 
ATOM   3416 C CA  . LEU B 1 251 ? 20.197  -11.283 -31.295 1.00 47.71 ? 245 LEU B CA  1 
ATOM   3417 C C   . LEU B 1 251 ? 19.481  -12.325 -32.137 1.00 48.61 ? 245 LEU B C   1 
ATOM   3418 O O   . LEU B 1 251 ? 19.809  -12.569 -33.307 1.00 48.62 ? 245 LEU B O   1 
ATOM   3419 C CB  . LEU B 1 251 ? 21.211  -11.977 -30.400 1.00 47.61 ? 245 LEU B CB  1 
ATOM   3420 C CG  . LEU B 1 251 ? 22.353  -11.154 -29.798 1.00 47.95 ? 245 LEU B CG  1 
ATOM   3421 C CD1 . LEU B 1 251 ? 23.122  -12.073 -28.877 1.00 45.40 ? 245 LEU B CD1 1 
ATOM   3422 C CD2 . LEU B 1 251 ? 23.282  -10.538 -30.872 1.00 46.57 ? 245 LEU B CD2 1 
ATOM   3423 N N   . LYS B 1 252 ? 18.486  -12.941 -31.529 1.00 49.49 ? 246 LYS B N   1 
ATOM   3424 C CA  . LYS B 1 252 ? 17.665  -13.881 -32.225 1.00 50.51 ? 246 LYS B CA  1 
ATOM   3425 C C   . LYS B 1 252 ? 17.024  -13.222 -33.436 1.00 51.72 ? 246 LYS B C   1 
ATOM   3426 O O   . LYS B 1 252 ? 16.716  -13.919 -34.398 1.00 52.59 ? 246 LYS B O   1 
ATOM   3427 C CB  . LYS B 1 252 ? 16.594  -14.401 -31.294 1.00 50.05 ? 246 LYS B CB  1 
ATOM   3428 C CG  . LYS B 1 252 ? 16.332  -15.820 -31.469 1.00 48.99 ? 246 LYS B CG  1 
ATOM   3429 C CD  . LYS B 1 252 ? 15.523  -16.291 -30.324 1.00 49.29 ? 246 LYS B CD  1 
ATOM   3430 C CE  . LYS B 1 252 ? 14.526  -17.329 -30.802 1.00 51.55 ? 246 LYS B CE  1 
ATOM   3431 N NZ  . LYS B 1 252 ? 15.147  -18.450 -31.596 1.00 50.15 ? 246 LYS B NZ  1 
ATOM   3432 N N   . LEU B 1 253 ? 16.844  -11.893 -33.401 1.00 52.75 ? 247 LEU B N   1 
ATOM   3433 C CA  . LEU B 1 253 ? 16.125  -11.158 -34.471 1.00 53.67 ? 247 LEU B CA  1 
ATOM   3434 C C   . LEU B 1 253 ? 16.941  -10.849 -35.702 1.00 54.89 ? 247 LEU B C   1 
ATOM   3435 O O   . LEU B 1 253 ? 16.434  -10.897 -36.827 1.00 54.79 ? 247 LEU B O   1 
ATOM   3436 C CB  . LEU B 1 253 ? 15.518  -9.858  -33.958 1.00 53.10 ? 247 LEU B CB  1 
ATOM   3437 C CG  . LEU B 1 253 ? 14.034  -10.010 -33.657 1.00 52.44 ? 247 LEU B CG  1 
ATOM   3438 C CD1 . LEU B 1 253 ? 13.622  -9.016  -32.602 1.00 52.00 ? 247 LEU B CD1 1 
ATOM   3439 C CD2 . LEU B 1 253 ? 13.191  -9.857  -34.914 1.00 53.43 ? 247 LEU B CD2 1 
ATOM   3440 N N   . GLU B 1 254 ? 18.199  -10.492 -35.484 1.00 56.52 ? 248 GLU B N   1 
ATOM   3441 C CA  . GLU B 1 254 ? 19.085  -10.192 -36.596 1.00 58.09 ? 248 GLU B CA  1 
ATOM   3442 C C   . GLU B 1 254 ? 19.801  -11.473 -37.108 1.00 58.72 ? 248 GLU B C   1 
ATOM   3443 O O   . GLU B 1 254 ? 20.564  -11.425 -38.080 1.00 58.76 ? 248 GLU B O   1 
ATOM   3444 C CB  . GLU B 1 254 ? 20.002  -8.989  -36.263 1.00 58.14 ? 248 GLU B CB  1 
ATOM   3445 C CG  . GLU B 1 254 ? 20.863  -9.117  -35.006 1.00 59.81 ? 248 GLU B CG  1 
ATOM   3446 C CD  . GLU B 1 254 ? 22.342  -9.415  -35.327 1.00 63.96 ? 248 GLU B CD  1 
ATOM   3447 O OE1 . GLU B 1 254 ? 22.963  -10.258 -34.617 1.00 64.22 ? 248 GLU B OE1 1 
ATOM   3448 O OE2 . GLU B 1 254 ? 22.878  -8.806  -36.303 1.00 66.19 ? 248 GLU B OE2 1 
ATOM   3449 N N   . ASP B 1 255 ? 19.533  -12.607 -36.444 1.00 59.74 ? 249 ASP B N   1 
ATOM   3450 C CA  . ASP B 1 255 ? 19.757  -13.960 -37.005 1.00 60.49 ? 249 ASP B CA  1 
ATOM   3451 C C   . ASP B 1 255 ? 21.147  -14.125 -37.667 1.00 60.69 ? 249 ASP B C   1 
ATOM   3452 O O   . ASP B 1 255 ? 21.243  -14.604 -38.793 1.00 60.86 ? 249 ASP B O   1 
ATOM   3453 C CB  . ASP B 1 255 ? 18.579  -14.292 -37.975 1.00 60.85 ? 249 ASP B CB  1 
ATOM   3454 C CG  . ASP B 1 255 ? 18.647  -15.713 -38.613 1.00 61.81 ? 249 ASP B CG  1 
ATOM   3455 O OD1 . ASP B 1 255 ? 18.770  -16.735 -37.892 1.00 63.92 ? 249 ASP B OD1 1 
ATOM   3456 O OD2 . ASP B 1 255 ? 18.527  -15.800 -39.856 1.00 60.35 ? 249 ASP B OD2 1 
ATOM   3457 N N   . LEU B 1 256 ? 22.216  -13.699 -36.988 1.00 61.04 ? 250 LEU B N   1 
ATOM   3458 C CA  . LEU B 1 256 ? 23.573  -13.958 -37.482 1.00 61.22 ? 250 LEU B CA  1 
ATOM   3459 C C   . LEU B 1 256 ? 23.921  -15.386 -37.113 1.00 61.52 ? 250 LEU B C   1 
ATOM   3460 O O   . LEU B 1 256 ? 23.364  -16.311 -37.690 1.00 61.84 ? 250 LEU B O   1 
ATOM   3461 C CB  . LEU B 1 256 ? 24.580  -12.957 -36.926 1.00 61.32 ? 250 LEU B CB  1 
ATOM   3462 C CG  . LEU B 1 256 ? 24.807  -11.752 -37.839 1.00 61.46 ? 250 LEU B CG  1 
ATOM   3463 C CD1 . LEU B 1 256 ? 25.531  -10.627 -37.100 1.00 60.87 ? 250 LEU B CD1 1 
ATOM   3464 C CD2 . LEU B 1 256 ? 25.581  -12.173 -39.086 1.00 61.44 ? 250 LEU B CD2 1 
ATOM   3465 N N   . VAL B 1 257 ? 24.798  -15.611 -36.144 1.00 61.83 ? 251 VAL B N   1 
ATOM   3466 C CA  . VAL B 1 257 ? 24.877  -16.973 -35.631 1.00 62.06 ? 251 VAL B CA  1 
ATOM   3467 C C   . VAL B 1 257 ? 23.630  -17.242 -34.777 1.00 62.30 ? 251 VAL B C   1 
ATOM   3468 O O   . VAL B 1 257 ? 23.207  -16.377 -34.001 1.00 62.20 ? 251 VAL B O   1 
ATOM   3469 C CB  . VAL B 1 257 ? 26.259  -17.380 -34.972 1.00 62.08 ? 251 VAL B CB  1 
ATOM   3470 C CG1 . VAL B 1 257 ? 27.451  -16.992 -35.881 1.00 62.31 ? 251 VAL B CG1 1 
ATOM   3471 C CG2 . VAL B 1 257 ? 26.433  -16.826 -33.594 1.00 62.13 ? 251 VAL B CG2 1 
ATOM   3472 N N   . PRO B 1 258 ? 23.003  -18.421 -34.968 1.00 62.70 ? 252 PRO B N   1 
ATOM   3473 C CA  . PRO B 1 258 ? 21.785  -18.769 -34.237 1.00 62.64 ? 252 PRO B CA  1 
ATOM   3474 C C   . PRO B 1 258 ? 22.148  -19.116 -32.795 1.00 62.75 ? 252 PRO B C   1 
ATOM   3475 O O   . PRO B 1 258 ? 23.332  -19.296 -32.516 1.00 62.75 ? 252 PRO B O   1 
ATOM   3476 C CB  . PRO B 1 258 ? 21.288  -20.017 -34.973 1.00 62.89 ? 252 PRO B CB  1 
ATOM   3477 C CG  . PRO B 1 258 ? 22.154  -20.131 -36.262 1.00 62.89 ? 252 PRO B CG  1 
ATOM   3478 C CD  . PRO B 1 258 ? 23.430  -19.506 -35.879 1.00 62.70 ? 252 PRO B CD  1 
ATOM   3479 N N   . PRO B 1 259 ? 21.154  -19.207 -31.873 1.00 62.78 ? 253 PRO B N   1 
ATOM   3480 C CA  . PRO B 1 259 ? 21.514  -19.726 -30.544 1.00 62.50 ? 253 PRO B CA  1 
ATOM   3481 C C   . PRO B 1 259 ? 21.754  -21.240 -30.593 1.00 62.63 ? 253 PRO B C   1 
ATOM   3482 O O   . PRO B 1 259 ? 21.355  -21.907 -31.570 1.00 62.47 ? 253 PRO B O   1 
ATOM   3483 C CB  . PRO B 1 259 ? 20.302  -19.391 -29.676 1.00 62.07 ? 253 PRO B CB  1 
ATOM   3484 C CG  . PRO B 1 259 ? 19.191  -19.197 -30.596 1.00 62.16 ? 253 PRO B CG  1 
ATOM   3485 C CD  . PRO B 1 259 ? 19.717  -18.878 -31.969 1.00 62.84 ? 253 PRO B CD  1 
ATOM   3486 N N   . PRO B 1 260 ? 22.462  -21.777 -29.584 1.00 62.65 ? 254 PRO B N   1 
ATOM   3487 C CA  . PRO B 1 260 ? 22.561  -23.232 -29.461 1.00 62.42 ? 254 PRO B CA  1 
ATOM   3488 C C   . PRO B 1 260 ? 21.228  -23.813 -28.978 1.00 62.14 ? 254 PRO B C   1 
ATOM   3489 O O   . PRO B 1 260 ? 20.495  -23.143 -28.222 1.00 61.91 ? 254 PRO B O   1 
ATOM   3490 C CB  . PRO B 1 260 ? 23.643  -23.436 -28.392 1.00 62.36 ? 254 PRO B CB  1 
ATOM   3491 C CG  . PRO B 1 260 ? 24.292  -22.117 -28.211 1.00 62.89 ? 254 PRO B CG  1 
ATOM   3492 C CD  . PRO B 1 260 ? 23.232  -21.091 -28.539 1.00 62.66 ? 254 PRO B CD  1 
ATOM   3493 N N   . PRO B 1 261 ? 20.896  -25.036 -29.445 1.00 61.75 ? 255 PRO B N   1 
ATOM   3494 C CA  . PRO B 1 261 ? 19.757  -25.854 -29.009 1.00 61.05 ? 255 PRO B CA  1 
ATOM   3495 C C   . PRO B 1 261 ? 19.273  -25.545 -27.590 1.00 60.32 ? 255 PRO B C   1 
ATOM   3496 O O   . PRO B 1 261 ? 18.093  -25.252 -27.410 1.00 60.57 ? 255 PRO B O   1 
ATOM   3497 C CB  . PRO B 1 261 ? 20.314  -27.272 -29.090 1.00 60.90 ? 255 PRO B CB  1 
ATOM   3498 C CG  . PRO B 1 261 ? 21.497  -27.174 -30.112 1.00 61.62 ? 255 PRO B CG  1 
ATOM   3499 C CD  . PRO B 1 261 ? 21.651  -25.725 -30.503 1.00 61.38 ? 255 PRO B CD  1 
ATOM   3500 N N   . ILE B 1 262 ? 20.173  -25.568 -26.602 1.00 59.40 ? 256 ILE B N   1 
ATOM   3501 C CA  . ILE B 1 262 ? 19.774  -25.360 -25.185 1.00 58.31 ? 256 ILE B CA  1 
ATOM   3502 C C   . ILE B 1 262 ? 19.370  -23.922 -24.836 1.00 58.15 ? 256 ILE B C   1 
ATOM   3503 O O   . ILE B 1 262 ? 18.275  -23.682 -24.340 1.00 58.12 ? 256 ILE B O   1 
ATOM   3504 C CB  . ILE B 1 262 ? 20.848  -25.787 -24.133 1.00 57.79 ? 256 ILE B CB  1 
ATOM   3505 C CG1 . ILE B 1 262 ? 22.091  -26.457 -24.774 1.00 56.98 ? 256 ILE B CG1 1 
ATOM   3506 C CG2 . ILE B 1 262 ? 20.161  -26.545 -23.005 1.00 56.44 ? 256 ILE B CG2 1 
ATOM   3507 C CD1 . ILE B 1 262 ? 23.309  -25.524 -25.021 1.00 51.48 ? 256 ILE B CD1 1 
ATOM   3508 N N   . ILE B 1 263 ? 20.274  -22.979 -25.069 1.00 57.61 ? 257 ILE B N   1 
ATOM   3509 C CA  . ILE B 1 263 ? 19.994  -21.601 -24.795 1.00 57.14 ? 257 ILE B CA  1 
ATOM   3510 C C   . ILE B 1 263 ? 18.698  -21.200 -25.465 1.00 57.33 ? 257 ILE B C   1 
ATOM   3511 O O   . ILE B 1 263 ? 17.809  -20.656 -24.796 1.00 57.59 ? 257 ILE B O   1 
ATOM   3512 C CB  . ILE B 1 263 ? 21.133  -20.703 -25.239 1.00 57.26 ? 257 ILE B CB  1 
ATOM   3513 C CG1 . ILE B 1 263 ? 22.411  -21.075 -24.479 1.00 56.56 ? 257 ILE B CG1 1 
ATOM   3514 C CG2 . ILE B 1 263 ? 20.765  -19.218 -25.039 1.00 57.08 ? 257 ILE B CG2 1 
ATOM   3515 C CD1 . ILE B 1 263 ? 22.244  -21.198 -22.987 1.00 55.58 ? 257 ILE B CD1 1 
ATOM   3516 N N   . ASP B 1 264 ? 18.561  -21.493 -26.758 1.00 57.04 ? 258 ASP B N   1 
ATOM   3517 C CA  . ASP B 1 264 ? 17.319  -21.179 -27.458 1.00 56.87 ? 258 ASP B CA  1 
ATOM   3518 C C   . ASP B 1 264 ? 16.092  -21.754 -26.758 1.00 56.62 ? 258 ASP B C   1 
ATOM   3519 O O   . ASP B 1 264 ? 15.053  -21.106 -26.694 1.00 56.12 ? 258 ASP B O   1 
ATOM   3520 C CB  . ASP B 1 264 ? 17.356  -21.655 -28.906 1.00 57.30 ? 258 ASP B CB  1 
ATOM   3521 C CG  . ASP B 1 264 ? 16.291  -20.964 -29.772 1.00 58.71 ? 258 ASP B CG  1 
ATOM   3522 O OD1 . ASP B 1 264 ? 16.023  -19.753 -29.564 1.00 57.04 ? 258 ASP B OD1 1 
ATOM   3523 O OD2 . ASP B 1 264 ? 15.715  -21.640 -30.661 1.00 61.12 ? 258 ASP B OD2 1 
ATOM   3524 N N   . LYS B 1 265 ? 16.223  -22.970 -26.232 1.00 56.79 ? 259 LYS B N   1 
ATOM   3525 C CA  . LYS B 1 265 ? 15.147  -23.609 -25.476 1.00 57.10 ? 259 LYS B CA  1 
ATOM   3526 C C   . LYS B 1 265 ? 14.752  -22.828 -24.197 1.00 57.49 ? 259 LYS B C   1 
ATOM   3527 O O   . LYS B 1 265 ? 13.563  -22.630 -23.937 1.00 57.72 ? 259 LYS B O   1 
ATOM   3528 C CB  . LYS B 1 265 ? 15.528  -25.057 -25.164 1.00 56.95 ? 259 LYS B CB  1 
ATOM   3529 C CG  . LYS B 1 265 ? 14.374  -25.964 -24.797 1.00 57.25 ? 259 LYS B CG  1 
ATOM   3530 C CD  . LYS B 1 265 ? 14.026  -25.843 -23.314 1.00 59.17 ? 259 LYS B CD  1 
ATOM   3531 C CE  . LYS B 1 265 ? 12.985  -26.873 -22.875 1.00 59.42 ? 259 LYS B CE  1 
ATOM   3532 N NZ  . LYS B 1 265 ? 13.488  -28.255 -23.135 1.00 60.66 ? 259 LYS B NZ  1 
ATOM   3533 N N   . ILE B 1 266 ? 15.750  -22.392 -23.423 1.00 57.74 ? 260 ILE B N   1 
ATOM   3534 C CA  . ILE B 1 266 ? 15.568  -21.518 -22.258 1.00 57.92 ? 260 ILE B CA  1 
ATOM   3535 C C   . ILE B 1 266 ? 14.817  -20.234 -22.606 1.00 58.75 ? 260 ILE B C   1 
ATOM   3536 O O   . ILE B 1 266 ? 13.823  -19.900 -21.971 1.00 59.17 ? 260 ILE B O   1 
ATOM   3537 C CB  . ILE B 1 266 ? 16.932  -21.096 -21.653 1.00 57.78 ? 260 ILE B CB  1 
ATOM   3538 C CG1 . ILE B 1 266 ? 17.748  -22.304 -21.191 1.00 56.85 ? 260 ILE B CG1 1 
ATOM   3539 C CG2 . ILE B 1 266 ? 16.751  -20.072 -20.526 1.00 57.49 ? 260 ILE B CG2 1 
ATOM   3540 C CD1 . ILE B 1 266 ? 17.202  -22.974 -20.008 1.00 55.55 ? 260 ILE B CD1 1 
ATOM   3541 N N   . PHE B 1 267 ? 15.308  -19.502 -23.600 1.00 59.71 ? 261 PHE B N   1 
ATOM   3542 C CA  . PHE B 1 267 ? 14.670  -18.266 -24.019 1.00 60.67 ? 261 PHE B CA  1 
ATOM   3543 C C   . PHE B 1 267 ? 13.233  -18.503 -24.453 1.00 61.36 ? 261 PHE B C   1 
ATOM   3544 O O   . PHE B 1 267 ? 12.336  -17.840 -23.939 1.00 61.64 ? 261 PHE B O   1 
ATOM   3545 C CB  . PHE B 1 267 ? 15.470  -17.600 -25.136 1.00 60.79 ? 261 PHE B CB  1 
ATOM   3546 C CG  . PHE B 1 267 ? 14.806  -16.375 -25.728 1.00 61.46 ? 261 PHE B CG  1 
ATOM   3547 C CD1 . PHE B 1 267 ? 15.048  -15.107 -25.200 1.00 60.77 ? 261 PHE B CD1 1 
ATOM   3548 C CD2 . PHE B 1 267 ? 13.958  -16.486 -26.835 1.00 61.79 ? 261 PHE B CD2 1 
ATOM   3549 C CE1 . PHE B 1 267 ? 14.449  -13.970 -25.748 1.00 60.33 ? 261 PHE B CE1 1 
ATOM   3550 C CE2 . PHE B 1 267 ? 13.357  -15.347 -27.386 1.00 61.26 ? 261 PHE B CE2 1 
ATOM   3551 C CZ  . PHE B 1 267 ? 13.605  -14.091 -26.836 1.00 59.84 ? 261 PHE B CZ  1 
ATOM   3552 N N   . MET B 1 268 ? 13.020  -19.445 -25.378 1.00 62.38 ? 262 MET B N   1 
ATOM   3553 C CA  . MET B 1 268 ? 11.675  -19.744 -25.902 1.00 63.65 ? 262 MET B CA  1 
ATOM   3554 C C   . MET B 1 268 ? 10.657  -20.065 -24.807 1.00 64.05 ? 262 MET B C   1 
ATOM   3555 O O   . MET B 1 268 ? 9.478   -19.743 -24.965 1.00 64.28 ? 262 MET B O   1 
ATOM   3556 C CB  . MET B 1 268 ? 11.684  -20.873 -26.935 1.00 63.92 ? 262 MET B CB  1 
ATOM   3557 C CG  . MET B 1 268 ? 12.443  -20.586 -28.238 1.00 65.66 ? 262 MET B CG  1 
ATOM   3558 S SD  . MET B 1 268 ? 11.922  -19.178 -29.270 1.00 67.88 ? 262 MET B SD  1 
ATOM   3559 C CE  . MET B 1 268 ? 12.213  -19.827 -30.930 1.00 66.01 ? 262 MET B CE  1 
ATOM   3560 N N   . ASP B 1 269 ? 11.108  -20.666 -23.703 1.00 64.42 ? 263 ASP B N   1 
ATOM   3561 C CA  . ASP B 1 269 ? 10.244  -20.926 -22.546 1.00 65.19 ? 263 ASP B CA  1 
ATOM   3562 C C   . ASP B 1 269 ? 9.760   -19.669 -21.803 1.00 65.58 ? 263 ASP B C   1 
ATOM   3563 O O   . ASP B 1 269 ? 9.334   -19.744 -20.644 1.00 65.49 ? 263 ASP B O   1 
ATOM   3564 C CB  . ASP B 1 269 ? 10.903  -21.918 -21.592 1.00 65.36 ? 263 ASP B CB  1 
ATOM   3565 C CG  . ASP B 1 269 ? 10.864  -23.343 -22.121 1.00 67.11 ? 263 ASP B CG  1 
ATOM   3566 O OD1 . ASP B 1 269 ? 10.499  -23.535 -23.307 1.00 67.98 ? 263 ASP B OD1 1 
ATOM   3567 O OD2 . ASP B 1 269 ? 11.195  -24.277 -21.350 1.00 69.05 ? 263 ASP B OD2 1 
ATOM   3568 N N   . THR B 1 270 ? 9.865   -18.522 -22.486 1.00 66.10 ? 264 THR B N   1 
ATOM   3569 C CA  . THR B 1 270 ? 9.122   -17.294 -22.193 1.00 66.18 ? 264 THR B CA  1 
ATOM   3570 C C   . THR B 1 270 ? 7.630   -17.595 -22.259 1.00 66.61 ? 264 THR B C   1 
ATOM   3571 O O   . THR B 1 270 ? 6.865   -17.188 -21.384 1.00 67.23 ? 264 THR B O   1 
ATOM   3572 C CB  . THR B 1 270 ? 9.440   -16.193 -23.244 1.00 66.20 ? 264 THR B CB  1 
ATOM   3573 O OG1 . THR B 1 270 ? 10.676  -15.550 -22.912 1.00 65.44 ? 264 THR B OG1 1 
ATOM   3574 C CG2 . THR B 1 270 ? 8.302   -15.141 -23.351 1.00 65.85 ? 264 THR B CG2 1 
ATOM   3575 N N   . PRO C 1 36  ? -9.315  4.370   -61.871 1.00 60.59 ? 30  PRO C N   1 
ATOM   3576 C CA  . PRO C 1 36  ? -7.849  4.419   -61.915 1.00 60.52 ? 30  PRO C CA  1 
ATOM   3577 C C   . PRO C 1 36  ? -7.372  5.826   -61.593 1.00 60.49 ? 30  PRO C C   1 
ATOM   3578 O O   . PRO C 1 36  ? -6.324  6.264   -62.087 1.00 60.95 ? 30  PRO C O   1 
ATOM   3579 C CB  . PRO C 1 36  ? -7.545  4.074   -63.373 1.00 60.18 ? 30  PRO C CB  1 
ATOM   3580 C CG  . PRO C 1 36  ? -8.653  3.119   -63.743 1.00 60.38 ? 30  PRO C CG  1 
ATOM   3581 C CD  . PRO C 1 36  ? -9.881  3.579   -62.983 1.00 60.80 ? 30  PRO C CD  1 
ATOM   3582 N N   . ALA C 1 37  ? -8.124  6.472   -60.702 1.00 60.04 ? 31  ALA C N   1 
ATOM   3583 C CA  . ALA C 1 37  ? -8.394  7.928   -60.705 1.00 58.79 ? 31  ALA C CA  1 
ATOM   3584 C C   . ALA C 1 37  ? -9.670  8.049   -59.869 1.00 58.15 ? 31  ALA C C   1 
ATOM   3585 O O   . ALA C 1 37  ? -9.767  8.871   -58.945 1.00 58.34 ? 31  ALA C O   1 
ATOM   3586 N N   . ASN C 1 38  ? -10.636 7.175   -60.153 1.00 57.28 ? 32  ASN C N   1 
ATOM   3587 C CA  . ASN C 1 38  ? -11.643 6.818   -59.154 1.00 56.26 ? 32  ASN C CA  1 
ATOM   3588 C C   . ASN C 1 38  ? -11.000 6.116   -57.934 1.00 55.26 ? 32  ASN C C   1 
ATOM   3589 O O   . ASN C 1 38  ? -11.235 6.529   -56.795 1.00 55.55 ? 32  ASN C O   1 
ATOM   3590 C CB  . ASN C 1 38  ? -12.758 5.974   -59.773 1.00 56.71 ? 32  ASN C CB  1 
ATOM   3591 C CG  . ASN C 1 38  ? -14.166 6.471   -59.391 1.00 57.97 ? 32  ASN C CG  1 
ATOM   3592 O OD1 . ASN C 1 38  ? -14.400 6.923   -58.260 1.00 59.33 ? 32  ASN C OD1 1 
ATOM   3593 N ND2 . ASN C 1 38  ? -15.110 6.373   -60.336 1.00 58.54 ? 32  ASN C ND2 1 
ATOM   3594 N N   . LEU C 1 39  ? -10.147 5.112   -58.169 1.00 53.57 ? 33  LEU C N   1 
ATOM   3595 C CA  . LEU C 1 39  ? -9.420  4.431   -57.077 1.00 52.29 ? 33  LEU C CA  1 
ATOM   3596 C C   . LEU C 1 39  ? -8.598  5.364   -56.180 1.00 51.82 ? 33  LEU C C   1 
ATOM   3597 O O   . LEU C 1 39  ? -8.729  5.348   -54.971 1.00 51.13 ? 33  LEU C O   1 
ATOM   3598 C CB  . LEU C 1 39  ? -8.533  3.288   -57.603 1.00 52.08 ? 33  LEU C CB  1 
ATOM   3599 C CG  . LEU C 1 39  ? -7.841  2.321   -56.604 1.00 52.68 ? 33  LEU C CG  1 
ATOM   3600 C CD1 . LEU C 1 39  ? -8.785  1.678   -55.557 1.00 49.66 ? 33  LEU C CD1 1 
ATOM   3601 C CD2 . LEU C 1 39  ? -7.009  1.243   -57.313 1.00 51.49 ? 33  LEU C CD2 1 
ATOM   3602 N N   . LEU C 1 40  ? -7.736  6.170   -56.773 1.00 51.88 ? 34  LEU C N   1 
ATOM   3603 C CA  . LEU C 1 40  ? -6.995  7.145   -55.991 1.00 51.77 ? 34  LEU C CA  1 
ATOM   3604 C C   . LEU C 1 40  ? -7.976  7.910   -55.132 1.00 51.89 ? 34  LEU C C   1 
ATOM   3605 O O   . LEU C 1 40  ? -7.801  7.967   -53.926 1.00 52.68 ? 34  LEU C O   1 
ATOM   3606 C CB  . LEU C 1 40  ? -6.227  8.105   -56.894 1.00 51.73 ? 34  LEU C CB  1 
ATOM   3607 C CG  . LEU C 1 40  ? -5.130  9.003   -56.309 1.00 52.09 ? 34  LEU C CG  1 
ATOM   3608 C CD1 . LEU C 1 40  ? -5.674  10.357  -55.861 1.00 52.13 ? 34  LEU C CD1 1 
ATOM   3609 C CD2 . LEU C 1 40  ? -4.377  8.347   -55.182 1.00 51.75 ? 34  LEU C CD2 1 
ATOM   3610 N N   . THR C 1 41  ? -9.029  8.469   -55.735 1.00 51.50 ? 35  THR C N   1 
ATOM   3611 C CA  . THR C 1 41  ? -10.028 9.217   -54.956 1.00 50.55 ? 35  THR C CA  1 
ATOM   3612 C C   . THR C 1 41  ? -10.568 8.356   -53.820 1.00 49.72 ? 35  THR C C   1 
ATOM   3613 O O   . THR C 1 41  ? -10.624 8.790   -52.662 1.00 49.05 ? 35  THR C O   1 
ATOM   3614 C CB  . THR C 1 41  ? -11.207 9.776   -55.838 1.00 50.96 ? 35  THR C CB  1 
ATOM   3615 O OG1 . THR C 1 41  ? -10.689 10.629  -56.878 1.00 51.10 ? 35  THR C OG1 1 
ATOM   3616 C CG2 . THR C 1 41  ? -12.208 10.565  -54.973 1.00 49.51 ? 35  THR C CG2 1 
ATOM   3617 N N   . SER C 1 42  ? -10.938 7.126   -54.174 1.00 49.07 ? 36  SER C N   1 
ATOM   3618 C CA  . SER C 1 42  ? -11.474 6.168   -53.228 1.00 48.74 ? 36  SER C CA  1 
ATOM   3619 C C   . SER C 1 42  ? -10.517 5.993   -52.039 1.00 48.51 ? 36  SER C C   1 
ATOM   3620 O O   . SER C 1 42  ? -10.902 6.181   -50.887 1.00 49.17 ? 36  SER C O   1 
ATOM   3621 C CB  . SER C 1 42  ? -11.720 4.849   -53.938 1.00 48.50 ? 36  SER C CB  1 
ATOM   3622 O OG  . SER C 1 42  ? -12.981 4.338   -53.578 1.00 49.75 ? 36  SER C OG  1 
ATOM   3623 N N   . LEU C 1 43  ? -9.263  5.682   -52.344 1.00 47.79 ? 37  LEU C N   1 
ATOM   3624 C CA  . LEU C 1 43  ? -8.171  5.664   -51.370 1.00 47.14 ? 37  LEU C CA  1 
ATOM   3625 C C   . LEU C 1 43  ? -8.052  6.910   -50.545 1.00 46.49 ? 37  LEU C C   1 
ATOM   3626 O O   . LEU C 1 43  ? -7.937  6.818   -49.343 1.00 46.37 ? 37  LEU C O   1 
ATOM   3627 C CB  . LEU C 1 43  ? -6.826  5.395   -52.062 1.00 47.05 ? 37  LEU C CB  1 
ATOM   3628 C CG  . LEU C 1 43  ? -6.812  4.018   -52.733 1.00 46.22 ? 37  LEU C CG  1 
ATOM   3629 C CD1 . LEU C 1 43  ? -5.557  3.798   -53.570 1.00 45.62 ? 37  LEU C CD1 1 
ATOM   3630 C CD2 . LEU C 1 43  ? -6.963  2.994   -51.650 1.00 44.02 ? 37  LEU C CD2 1 
ATOM   3631 N N   . VAL C 1 44  ? -8.082  8.076   -51.179 1.00 46.57 ? 38  VAL C N   1 
ATOM   3632 C CA  . VAL C 1 44  ? -7.897  9.343   -50.439 1.00 46.29 ? 38  VAL C CA  1 
ATOM   3633 C C   . VAL C 1 44  ? -9.014  9.489   -49.407 1.00 46.30 ? 38  VAL C C   1 
ATOM   3634 O O   . VAL C 1 44  ? -8.788  9.933   -48.280 1.00 46.20 ? 38  VAL C O   1 
ATOM   3635 C CB  . VAL C 1 44  ? -7.829  10.586  -51.364 1.00 45.92 ? 38  VAL C CB  1 
ATOM   3636 C CG1 . VAL C 1 44  ? -7.929  11.858  -50.558 1.00 46.73 ? 38  VAL C CG1 1 
ATOM   3637 C CG2 . VAL C 1 44  ? -6.543  10.616  -52.153 1.00 44.83 ? 38  VAL C CG2 1 
ATOM   3638 N N   . ARG C 1 45  ? -10.215 9.077   -49.783 1.00 46.30 ? 39  ARG C N   1 
ATOM   3639 C CA  . ARG C 1 45  ? -11.322 9.275   -48.889 1.00 47.07 ? 39  ARG C CA  1 
ATOM   3640 C C   . ARG C 1 45  ? -11.336 8.240   -47.796 1.00 47.12 ? 39  ARG C C   1 
ATOM   3641 O O   . ARG C 1 45  ? -11.754 8.535   -46.688 1.00 47.40 ? 39  ARG C O   1 
ATOM   3642 C CB  . ARG C 1 45  ? -12.653 9.382   -49.634 1.00 47.56 ? 39  ARG C CB  1 
ATOM   3643 C CG  . ARG C 1 45  ? -12.830 10.739  -50.355 1.00 49.19 ? 39  ARG C CG  1 
ATOM   3644 C CD  . ARG C 1 45  ? -14.264 10.917  -50.827 1.00 53.02 ? 39  ARG C CD  1 
ATOM   3645 N NE  . ARG C 1 45  ? -14.385 11.810  -51.983 1.00 54.37 ? 39  ARG C NE  1 
ATOM   3646 C CZ  . ARG C 1 45  ? -15.474 11.905  -52.745 1.00 55.49 ? 39  ARG C CZ  1 
ATOM   3647 N NH1 . ARG C 1 45  ? -15.502 12.747  -53.776 1.00 55.91 ? 39  ARG C NH1 1 
ATOM   3648 N NH2 . ARG C 1 45  ? -16.539 11.153  -52.480 1.00 56.68 ? 39  ARG C NH2 1 
ATOM   3649 N N   . ALA C 1 46  ? -10.837 7.041   -48.078 1.00 47.36 ? 40  ALA C N   1 
ATOM   3650 C CA  . ALA C 1 46  ? -10.675 6.042   -47.011 1.00 47.32 ? 40  ALA C CA  1 
ATOM   3651 C C   . ALA C 1 46  ? -9.736  6.534   -45.904 1.00 47.47 ? 40  ALA C C   1 
ATOM   3652 O O   . ALA C 1 46  ? -10.057 6.390   -44.711 1.00 47.62 ? 40  ALA C O   1 
ATOM   3653 C CB  . ALA C 1 46  ? -10.218 4.706   -47.559 1.00 46.93 ? 40  ALA C CB  1 
ATOM   3654 N N   . HIS C 1 47  ? -8.620  7.154   -46.300 1.00 47.52 ? 41  HIS C N   1 
ATOM   3655 C CA  . HIS C 1 47  ? -7.605  7.627   -45.372 1.00 48.28 ? 41  HIS C CA  1 
ATOM   3656 C C   . HIS C 1 47  ? -8.119  8.743   -44.477 1.00 49.87 ? 41  HIS C C   1 
ATOM   3657 O O   . HIS C 1 47  ? -7.891  8.699   -43.255 1.00 50.31 ? 41  HIS C O   1 
ATOM   3658 C CB  . HIS C 1 47  ? -6.383  8.107   -46.136 1.00 48.14 ? 41  HIS C CB  1 
ATOM   3659 C CG  . HIS C 1 47  ? -5.505  9.048   -45.365 1.00 48.71 ? 41  HIS C CG  1 
ATOM   3660 N ND1 . HIS C 1 47  ? -4.512  8.615   -44.513 1.00 48.99 ? 41  HIS C ND1 1 
ATOM   3661 C CD2 . HIS C 1 47  ? -5.457  10.401  -45.336 1.00 49.31 ? 41  HIS C CD2 1 
ATOM   3662 C CE1 . HIS C 1 47  ? -3.900  9.655   -43.979 1.00 46.94 ? 41  HIS C CE1 1 
ATOM   3663 N NE2 . HIS C 1 47  ? -4.454  10.752  -44.464 1.00 49.99 ? 41  HIS C NE2 1 
ATOM   3664 N N   . LEU C 1 48  ? -8.801  9.731   -45.083 1.00 50.49 ? 42  LEU C N   1 
ATOM   3665 C CA  . LEU C 1 48  ? -9.326  10.880  -44.362 1.00 51.30 ? 42  LEU C CA  1 
ATOM   3666 C C   . LEU C 1 48  ? -10.470 10.581  -43.378 1.00 52.22 ? 42  LEU C C   1 
ATOM   3667 O O   . LEU C 1 48  ? -10.720 11.352  -42.459 1.00 52.09 ? 42  LEU C O   1 
ATOM   3668 C CB  . LEU C 1 48  ? -9.757  11.975  -45.340 1.00 51.40 ? 42  LEU C CB  1 
ATOM   3669 C CG  . LEU C 1 48  ? -8.748  12.681  -46.253 1.00 50.88 ? 42  LEU C CG  1 
ATOM   3670 C CD1 . LEU C 1 48  ? -9.498  13.456  -47.336 1.00 48.76 ? 42  LEU C CD1 1 
ATOM   3671 C CD2 . LEU C 1 48  ? -7.838  13.602  -45.483 1.00 48.36 ? 42  LEU C CD2 1 
ATOM   3672 N N   . ASP C 1 49  ? -11.165 9.469   -43.561 1.00 53.74 ? 43  ASP C N   1 
ATOM   3673 C CA  . ASP C 1 49  ? -12.246 9.101   -42.651 1.00 55.36 ? 43  ASP C CA  1 
ATOM   3674 C C   . ASP C 1 49  ? -11.811 8.282   -41.438 1.00 56.65 ? 43  ASP C C   1 
ATOM   3675 O O   . ASP C 1 49  ? -12.644 7.748   -40.732 1.00 56.45 ? 43  ASP C O   1 
ATOM   3676 C CB  . ASP C 1 49  ? -13.328 8.353   -43.420 1.00 55.45 ? 43  ASP C CB  1 
ATOM   3677 C CG  . ASP C 1 49  ? -14.140 9.275   -44.322 1.00 56.22 ? 43  ASP C CG  1 
ATOM   3678 O OD1 . ASP C 1 49  ? -13.526 10.146  -44.977 1.00 55.49 ? 43  ASP C OD1 1 
ATOM   3679 O OD2 . ASP C 1 49  ? -15.390 9.135   -44.368 1.00 56.73 ? 43  ASP C OD2 1 
ATOM   3680 N N   . SER C 1 50  ? -10.508 8.200   -41.192 1.00 59.02 ? 44  SER C N   1 
ATOM   3681 C CA  . SER C 1 50  ? -9.950  7.356   -40.131 1.00 61.13 ? 44  SER C CA  1 
ATOM   3682 C C   . SER C 1 50  ? -8.894  8.102   -39.300 1.00 63.00 ? 44  SER C C   1 
ATOM   3683 O O   . SER C 1 50  ? -8.738  7.852   -38.095 1.00 63.38 ? 44  SER C O   1 
ATOM   3684 C CB  . SER C 1 50  ? -9.342  6.096   -40.736 1.00 61.05 ? 44  SER C CB  1 
ATOM   3685 O OG  . SER C 1 50  ? -8.275  6.435   -41.606 1.00 61.27 ? 44  SER C OG  1 
ATOM   3686 N N   . GLY C 1 51  ? -8.143  8.991   -39.950 1.00 64.86 ? 45  GLY C N   1 
ATOM   3687 C CA  . GLY C 1 51  ? -7.456  10.052  -39.224 1.00 67.05 ? 45  GLY C CA  1 
ATOM   3688 C C   . GLY C 1 51  ? -8.606  10.883  -38.670 1.00 68.65 ? 45  GLY C C   1 
ATOM   3689 O O   . GLY C 1 51  ? -9.621  11.049  -39.346 1.00 68.54 ? 45  GLY C O   1 
ATOM   3690 N N   . PRO C 1 52  ? -8.480  11.390  -37.436 1.00 70.06 ? 46  PRO C N   1 
ATOM   3691 C CA  . PRO C 1 52  ? -9.601  12.137  -36.863 1.00 71.37 ? 46  PRO C CA  1 
ATOM   3692 C C   . PRO C 1 52  ? -9.727  13.550  -37.460 1.00 72.83 ? 46  PRO C C   1 
ATOM   3693 O O   . PRO C 1 52  ? -8.748  14.093  -37.985 1.00 73.27 ? 46  PRO C O   1 
ATOM   3694 C CB  . PRO C 1 52  ? -9.212  12.240  -35.391 1.00 71.27 ? 46  PRO C CB  1 
ATOM   3695 C CG  . PRO C 1 52  ? -7.713  12.308  -35.433 1.00 70.86 ? 46  PRO C CG  1 
ATOM   3696 C CD  . PRO C 1 52  ? -7.324  11.340  -36.523 1.00 70.14 ? 46  PRO C CD  1 
ATOM   3697 N N   . SER C 1 53  ? -10.918 14.142  -37.377 1.00 74.12 ? 47  SER C N   1 
ATOM   3698 C CA  . SER C 1 53  ? -11.073 15.574  -37.625 1.00 75.39 ? 47  SER C CA  1 
ATOM   3699 C C   . SER C 1 53  ? -10.049 16.374  -36.793 1.00 76.27 ? 47  SER C C   1 
ATOM   3700 O O   . SER C 1 53  ? -9.607  15.914  -35.726 1.00 76.18 ? 47  SER C O   1 
ATOM   3701 C CB  . SER C 1 53  ? -12.496 16.023  -37.264 1.00 75.46 ? 47  SER C CB  1 
ATOM   3702 O OG  . SER C 1 53  ? -13.371 15.969  -38.381 1.00 75.51 ? 47  SER C OG  1 
ATOM   3703 N N   . THR C 1 54  ? -9.671  17.558  -37.289 1.00 77.27 ? 48  THR C N   1 
ATOM   3704 C CA  . THR C 1 54  ? -8.883  18.529  -36.502 1.00 77.80 ? 48  THR C CA  1 
ATOM   3705 C C   . THR C 1 54  ? -9.786  19.235  -35.484 1.00 78.20 ? 48  THR C C   1 
ATOM   3706 O O   . THR C 1 54  ? -9.325  20.047  -34.678 1.00 78.33 ? 48  THR C O   1 
ATOM   3707 C CB  . THR C 1 54  ? -8.116  19.558  -37.382 1.00 77.83 ? 48  THR C CB  1 
ATOM   3708 O OG1 . THR C 1 54  ? -8.966  20.023  -38.442 1.00 78.12 ? 48  THR C OG1 1 
ATOM   3709 C CG2 . THR C 1 54  ? -6.834  18.933  -37.965 1.00 77.59 ? 48  THR C CG2 1 
ATOM   3710 N N   . ALA C 1 55  ? -11.079 18.918  -35.542 1.00 78.66 ? 49  ALA C N   1 
ATOM   3711 C CA  . ALA C 1 55  ? -11.992 19.166  -34.438 1.00 79.12 ? 49  ALA C CA  1 
ATOM   3712 C C   . ALA C 1 55  ? -11.560 18.272  -33.273 1.00 79.45 ? 49  ALA C C   1 
ATOM   3713 O O   . ALA C 1 55  ? -11.124 18.768  -32.229 1.00 79.67 ? 49  ALA C O   1 
ATOM   3714 C CB  . ALA C 1 55  ? -13.441 18.854  -34.853 1.00 79.02 ? 49  ALA C CB  1 
ATOM   3715 N N   . LYS C 1 56  ? -11.629 16.956  -33.482 1.00 79.72 ? 50  LYS C N   1 
ATOM   3716 C CA  . LYS C 1 56  ? -11.466 15.968  -32.411 1.00 79.76 ? 50  LYS C CA  1 
ATOM   3717 C C   . LYS C 1 56  ? -10.072 15.908  -31.750 1.00 79.55 ? 50  LYS C C   1 
ATOM   3718 O O   . LYS C 1 56  ? -9.739  14.926  -31.063 1.00 79.50 ? 50  LYS C O   1 
ATOM   3719 C CB  . LYS C 1 56  ? -11.939 14.574  -32.887 1.00 80.00 ? 50  LYS C CB  1 
ATOM   3720 C CG  . LYS C 1 56  ? -13.438 14.298  -32.657 1.00 80.67 ? 50  LYS C CG  1 
ATOM   3721 C CD  . LYS C 1 56  ? -13.763 13.806  -31.215 1.00 81.98 ? 50  LYS C CD  1 
ATOM   3722 C CE  . LYS C 1 56  ? -13.791 14.928  -30.134 1.00 82.67 ? 50  LYS C CE  1 
ATOM   3723 N NZ  . LYS C 1 56  ? -14.960 15.872  -30.243 1.00 81.95 ? 50  LYS C NZ  1 
ATOM   3724 N N   . LEU C 1 57  ? -9.279  16.971  -31.929 1.00 79.16 ? 51  LEU C N   1 
ATOM   3725 C CA  . LEU C 1 57  ? -7.948  17.065  -31.309 1.00 78.51 ? 51  LEU C CA  1 
ATOM   3726 C C   . LEU C 1 57  ? -8.036  17.219  -29.792 1.00 78.02 ? 51  LEU C C   1 
ATOM   3727 O O   . LEU C 1 57  ? -7.820  18.297  -29.261 1.00 78.33 ? 51  LEU C O   1 
ATOM   3728 C CB  . LEU C 1 57  ? -7.064  18.165  -31.952 1.00 78.32 ? 51  LEU C CB  1 
ATOM   3729 C CG  . LEU C 1 57  ? -6.397  17.901  -33.324 1.00 77.87 ? 51  LEU C CG  1 
ATOM   3730 C CD1 . LEU C 1 57  ? -5.204  18.843  -33.605 1.00 76.30 ? 51  LEU C CD1 1 
ATOM   3731 C CD2 . LEU C 1 57  ? -5.974  16.428  -33.504 1.00 76.66 ? 51  LEU C CD2 1 
ATOM   3732 N N   . ASP C 1 58  ? -8.355  16.113  -29.122 1.00 77.43 ? 52  ASP C N   1 
ATOM   3733 C CA  . ASP C 1 58  ? -8.403  16.007  -27.664 1.00 76.75 ? 52  ASP C CA  1 
ATOM   3734 C C   . ASP C 1 58  ? -7.084  16.419  -27.012 1.00 76.30 ? 52  ASP C C   1 
ATOM   3735 O O   . ASP C 1 58  ? -6.131  15.644  -26.966 1.00 76.60 ? 52  ASP C O   1 
ATOM   3736 C CB  . ASP C 1 58  ? -8.747  14.564  -27.269 1.00 76.97 ? 52  ASP C CB  1 
ATOM   3737 C CG  . ASP C 1 58  ? -8.936  14.389  -25.777 1.00 76.98 ? 52  ASP C CG  1 
ATOM   3738 O OD1 . ASP C 1 58  ? -8.569  13.326  -25.243 1.00 78.03 ? 52  ASP C OD1 1 
ATOM   3739 O OD2 . ASP C 1 58  ? -9.457  15.308  -25.128 1.00 77.45 ? 52  ASP C OD2 1 
ATOM   3740 N N   . TYR C 1 59  ? -7.042  17.646  -26.509 1.00 75.71 ? 53  TYR C N   1 
ATOM   3741 C CA  . TYR C 1 59  ? -5.890  18.153  -25.777 1.00 74.86 ? 53  TYR C CA  1 
ATOM   3742 C C   . TYR C 1 59  ? -6.001  17.933  -24.263 1.00 74.04 ? 53  TYR C C   1 
ATOM   3743 O O   . TYR C 1 59  ? -5.177  18.439  -23.510 1.00 74.23 ? 53  TYR C O   1 
ATOM   3744 C CB  . TYR C 1 59  ? -5.672  19.646  -26.094 1.00 74.91 ? 53  TYR C CB  1 
ATOM   3745 C CG  . TYR C 1 59  ? -4.765  19.904  -27.288 1.00 75.77 ? 53  TYR C CG  1 
ATOM   3746 C CD1 . TYR C 1 59  ? -5.272  20.404  -28.501 1.00 76.38 ? 53  TYR C CD1 1 
ATOM   3747 C CD2 . TYR C 1 59  ? -3.388  19.636  -27.213 1.00 76.41 ? 53  TYR C CD2 1 
ATOM   3748 C CE1 . TYR C 1 59  ? -4.414  20.633  -29.613 1.00 76.01 ? 53  TYR C CE1 1 
ATOM   3749 C CE2 . TYR C 1 59  ? -2.531  19.862  -28.313 1.00 75.09 ? 53  TYR C CE2 1 
ATOM   3750 C CZ  . TYR C 1 59  ? -3.048  20.354  -29.491 1.00 74.82 ? 53  TYR C CZ  1 
ATOM   3751 O OH  . TYR C 1 59  ? -2.188  20.556  -30.527 1.00 74.65 ? 53  TYR C OH  1 
ATOM   3752 N N   . SER C 1 60  ? -6.991  17.166  -23.813 1.00 73.05 ? 54  SER C N   1 
ATOM   3753 C CA  . SER C 1 60  ? -7.283  17.071  -22.371 1.00 72.23 ? 54  SER C CA  1 
ATOM   3754 C C   . SER C 1 60  ? -6.208  16.386  -21.497 1.00 71.85 ? 54  SER C C   1 
ATOM   3755 O O   . SER C 1 60  ? -6.122  16.656  -20.297 1.00 72.06 ? 54  SER C O   1 
ATOM   3756 C CB  . SER C 1 60  ? -8.648  16.426  -22.133 1.00 71.95 ? 54  SER C CB  1 
ATOM   3757 O OG  . SER C 1 60  ? -8.597  15.036  -22.383 1.00 71.27 ? 54  SER C OG  1 
ATOM   3758 N N   . LYS C 1 61  ? -5.398  15.507  -22.083 1.00 71.02 ? 55  LYS C N   1 
ATOM   3759 C CA  . LYS C 1 61  ? -4.352  14.821  -21.316 1.00 70.08 ? 55  LYS C CA  1 
ATOM   3760 C C   . LYS C 1 61  ? -2.928  15.280  -21.665 1.00 69.26 ? 55  LYS C C   1 
ATOM   3761 O O   . LYS C 1 61  ? -1.956  14.771  -21.111 1.00 69.00 ? 55  LYS C O   1 
ATOM   3762 C CB  . LYS C 1 61  ? -4.494  13.302  -21.443 1.00 70.13 ? 55  LYS C CB  1 
ATOM   3763 C CG  . LYS C 1 61  ? -5.650  12.724  -20.638 1.00 71.57 ? 55  LYS C CG  1 
ATOM   3764 C CD  . LYS C 1 61  ? -6.501  11.779  -21.510 1.00 74.97 ? 55  LYS C CD  1 
ATOM   3765 C CE  . LYS C 1 61  ? -6.064  10.313  -21.402 1.00 75.70 ? 55  LYS C CE  1 
ATOM   3766 N NZ  . LYS C 1 61  ? -6.727  9.592   -20.263 1.00 76.60 ? 55  LYS C NZ  1 
ATOM   3767 N N   . PHE C 1 62  ? -2.815  16.258  -22.558 1.00 68.36 ? 56  PHE C N   1 
ATOM   3768 C CA  . PHE C 1 62  ? -1.527  16.790  -22.996 1.00 67.87 ? 56  PHE C CA  1 
ATOM   3769 C C   . PHE C 1 62  ? -0.792  17.546  -21.878 1.00 67.77 ? 56  PHE C C   1 
ATOM   3770 O O   . PHE C 1 62  ? -1.402  18.335  -21.173 1.00 67.89 ? 56  PHE C O   1 
ATOM   3771 C CB  . PHE C 1 62  ? -1.772  17.721  -24.184 1.00 67.79 ? 56  PHE C CB  1 
ATOM   3772 C CG  . PHE C 1 62  ? -0.520  18.216  -24.856 1.00 67.69 ? 56  PHE C CG  1 
ATOM   3773 C CD1 . PHE C 1 62  ? 0.174   17.407  -25.747 1.00 67.52 ? 56  PHE C CD1 1 
ATOM   3774 C CD2 . PHE C 1 62  ? -0.054  19.505  -24.623 1.00 67.81 ? 56  PHE C CD2 1 
ATOM   3775 C CE1 . PHE C 1 62  ? 1.316   17.860  -26.377 1.00 67.31 ? 56  PHE C CE1 1 
ATOM   3776 C CE2 . PHE C 1 62  ? 1.099   19.973  -25.251 1.00 67.93 ? 56  PHE C CE2 1 
ATOM   3777 C CZ  . PHE C 1 62  ? 1.782   19.148  -26.129 1.00 67.98 ? 56  PHE C CZ  1 
ATOM   3778 N N   . GLN C 1 63  ? 0.509   17.306  -21.710 1.00 67.56 ? 57  GLN C N   1 
ATOM   3779 C CA  . GLN C 1 63  ? 1.319   18.115  -20.789 1.00 67.58 ? 57  GLN C CA  1 
ATOM   3780 C C   . GLN C 1 63  ? 2.654   18.498  -21.405 1.00 67.10 ? 57  GLN C C   1 
ATOM   3781 O O   . GLN C 1 63  ? 3.442   17.642  -21.771 1.00 66.83 ? 57  GLN C O   1 
ATOM   3782 C CB  . GLN C 1 63  ? 1.537   17.406  -19.448 1.00 67.72 ? 57  GLN C CB  1 
ATOM   3783 C CG  . GLN C 1 63  ? 1.863   18.361  -18.299 1.00 69.09 ? 57  GLN C CG  1 
ATOM   3784 C CD  . GLN C 1 63  ? 1.480   17.796  -16.930 1.00 71.79 ? 57  GLN C CD  1 
ATOM   3785 O OE1 . GLN C 1 63  ? 1.512   18.504  -15.909 1.00 71.39 ? 57  GLN C OE1 1 
ATOM   3786 N NE2 . GLN C 1 63  ? 1.108   16.514  -16.905 1.00 72.59 ? 57  GLN C NE2 1 
ATOM   3787 N N   . GLU C 1 64  ? 2.896   19.798  -21.519 1.00 67.01 ? 58  GLU C N   1 
ATOM   3788 C CA  . GLU C 1 64  ? 4.127   20.297  -22.127 1.00 66.91 ? 58  GLU C CA  1 
ATOM   3789 C C   . GLU C 1 64  ? 5.311   20.112  -21.173 1.00 66.62 ? 58  GLU C C   1 
ATOM   3790 O O   . GLU C 1 64  ? 5.553   20.941  -20.288 1.00 66.64 ? 58  GLU C O   1 
ATOM   3791 C CB  . GLU C 1 64  ? 3.967   21.774  -22.493 1.00 67.14 ? 58  GLU C CB  1 
ATOM   3792 C CG  . GLU C 1 64  ? 5.208   22.404  -23.105 1.00 67.47 ? 58  GLU C CG  1 
ATOM   3793 C CD  . GLU C 1 64  ? 5.419   21.964  -24.532 1.00 67.32 ? 58  GLU C CD  1 
ATOM   3794 O OE1 . GLU C 1 64  ? 4.826   22.601  -25.426 1.00 67.37 ? 58  GLU C OE1 1 
ATOM   3795 O OE2 . GLU C 1 64  ? 6.174   20.992  -24.753 1.00 67.12 ? 58  GLU C OE2 1 
ATOM   3796 N N   . LEU C 1 65  ? 6.056   19.030  -21.347 1.00 65.88 ? 59  LEU C N   1 
ATOM   3797 C CA  . LEU C 1 65  ? 7.079   18.715  -20.367 1.00 65.11 ? 59  LEU C CA  1 
ATOM   3798 C C   . LEU C 1 65  ? 8.457   19.104  -20.827 1.00 64.46 ? 59  LEU C C   1 
ATOM   3799 O O   . LEU C 1 65  ? 8.795   18.986  -22.003 1.00 63.98 ? 59  LEU C O   1 
ATOM   3800 C CB  . LEU C 1 65  ? 7.046   17.239  -19.978 1.00 65.21 ? 59  LEU C CB  1 
ATOM   3801 C CG  . LEU C 1 65  ? 5.898   16.878  -19.038 1.00 65.69 ? 59  LEU C CG  1 
ATOM   3802 C CD1 . LEU C 1 65  ? 5.443   15.440  -19.301 1.00 66.58 ? 59  LEU C CD1 1 
ATOM   3803 C CD2 . LEU C 1 65  ? 6.262   17.100  -17.578 1.00 64.60 ? 59  LEU C CD2 1 
ATOM   3804 N N   . VAL C 1 66  ? 9.243   19.583  -19.871 1.00 64.05 ? 60  VAL C N   1 
ATOM   3805 C CA  . VAL C 1 66  ? 10.602  19.989  -20.135 1.00 63.35 ? 60  VAL C CA  1 
ATOM   3806 C C   . VAL C 1 66  ? 11.516  18.836  -19.766 1.00 63.43 ? 60  VAL C C   1 
ATOM   3807 O O   . VAL C 1 66  ? 12.386  18.462  -20.550 1.00 63.38 ? 60  VAL C O   1 
ATOM   3808 C CB  . VAL C 1 66  ? 10.966  21.270  -19.375 1.00 63.12 ? 60  VAL C CB  1 
ATOM   3809 C CG1 . VAL C 1 66  ? 12.332  21.738  -19.787 1.00 62.48 ? 60  VAL C CG1 1 
ATOM   3810 C CG2 . VAL C 1 66  ? 9.934   22.351  -19.647 1.00 62.33 ? 60  VAL C CG2 1 
ATOM   3811 N N   . LEU C 1 67  ? 11.296  18.256  -18.588 1.00 63.64 ? 61  LEU C N   1 
ATOM   3812 C CA  . LEU C 1 67  ? 12.140  17.171  -18.098 1.00 63.83 ? 61  LEU C CA  1 
ATOM   3813 C C   . LEU C 1 67  ? 11.528  15.801  -18.303 1.00 64.32 ? 61  LEU C C   1 
ATOM   3814 O O   . LEU C 1 67  ? 10.372  15.584  -17.945 1.00 64.36 ? 61  LEU C O   1 
ATOM   3815 C CB  . LEU C 1 67  ? 12.421  17.349  -16.619 1.00 63.49 ? 61  LEU C CB  1 
ATOM   3816 C CG  . LEU C 1 67  ? 13.167  18.596  -16.186 1.00 63.47 ? 61  LEU C CG  1 
ATOM   3817 C CD1 . LEU C 1 67  ? 13.365  18.528  -14.667 1.00 62.51 ? 61  LEU C CD1 1 
ATOM   3818 C CD2 . LEU C 1 67  ? 14.489  18.715  -16.953 1.00 62.00 ? 61  LEU C CD2 1 
ATOM   3819 N N   . PRO C 1 68  ? 12.313  14.855  -18.846 1.00 65.07 ? 62  PRO C N   1 
ATOM   3820 C CA  . PRO C 1 68  ? 11.843  13.469  -18.954 1.00 65.88 ? 62  PRO C CA  1 
ATOM   3821 C C   . PRO C 1 68  ? 11.625  12.919  -17.563 1.00 66.66 ? 62  PRO C C   1 
ATOM   3822 O O   . PRO C 1 68  ? 12.495  13.073  -16.712 1.00 66.55 ? 62  PRO C O   1 
ATOM   3823 C CB  . PRO C 1 68  ? 13.025  12.748  -19.610 1.00 65.93 ? 62  PRO C CB  1 
ATOM   3824 C CG  . PRO C 1 68  ? 14.230  13.628  -19.307 1.00 65.52 ? 62  PRO C CG  1 
ATOM   3825 C CD  . PRO C 1 68  ? 13.684  15.018  -19.366 1.00 64.89 ? 62  PRO C CD  1 
ATOM   3826 N N   . HIS C 1 69  ? 10.480  12.303  -17.311 1.00 67.89 ? 63  HIS C N   1 
ATOM   3827 C CA  . HIS C 1 69  ? 10.262  11.763  -15.975 1.00 69.57 ? 63  HIS C CA  1 
ATOM   3828 C C   . HIS C 1 69  ? 11.041  10.451  -15.687 1.00 69.97 ? 63  HIS C C   1 
ATOM   3829 O O   . HIS C 1 69  ? 11.536  9.774   -16.603 1.00 69.98 ? 63  HIS C O   1 
ATOM   3830 C CB  . HIS C 1 69  ? 8.769   11.703  -15.604 1.00 70.00 ? 63  HIS C CB  1 
ATOM   3831 C CG  . HIS C 1 69  ? 8.503   12.022  -14.157 1.00 71.49 ? 63  HIS C CG  1 
ATOM   3832 N ND1 . HIS C 1 69  ? 8.497   13.315  -13.666 1.00 72.72 ? 63  HIS C ND1 1 
ATOM   3833 C CD2 . HIS C 1 69  ? 8.258   11.216  -13.094 1.00 72.23 ? 63  HIS C CD2 1 
ATOM   3834 C CE1 . HIS C 1 69  ? 8.251   13.290  -12.367 1.00 73.01 ? 63  HIS C CE1 1 
ATOM   3835 N NE2 . HIS C 1 69  ? 8.099   12.029  -11.996 1.00 73.24 ? 63  HIS C NE2 1 
ATOM   3836 N N   . PHE C 1 70  ? 11.155  10.118  -14.404 1.00 70.36 ? 64  PHE C N   1 
ATOM   3837 C CA  . PHE C 1 70  ? 12.064  9.071   -13.936 1.00 70.96 ? 64  PHE C CA  1 
ATOM   3838 C C   . PHE C 1 70  ? 11.394  7.779   -13.428 1.00 70.98 ? 64  PHE C C   1 
ATOM   3839 O O   . PHE C 1 70  ? 10.270  7.804   -12.907 1.00 70.95 ? 64  PHE C O   1 
ATOM   3840 C CB  . PHE C 1 70  ? 12.983  9.638   -12.836 1.00 71.27 ? 64  PHE C CB  1 
ATOM   3841 C CG  . PHE C 1 70  ? 12.295  10.611  -11.902 1.00 71.99 ? 64  PHE C CG  1 
ATOM   3842 C CD1 . PHE C 1 70  ? 11.422  10.152  -10.907 1.00 72.16 ? 64  PHE C CD1 1 
ATOM   3843 C CD2 . PHE C 1 70  ? 12.515  11.992  -12.027 1.00 72.23 ? 64  PHE C CD2 1 
ATOM   3844 C CE1 . PHE C 1 70  ? 10.784  11.058  -10.049 1.00 72.93 ? 64  PHE C CE1 1 
ATOM   3845 C CE2 . PHE C 1 70  ? 11.886  12.910  -11.176 1.00 72.03 ? 64  PHE C CE2 1 
ATOM   3846 C CZ  . PHE C 1 70  ? 11.019  12.447  -10.186 1.00 72.48 ? 64  PHE C CZ  1 
ATOM   3847 N N   . GLY C 1 71  ? 12.113  6.664   -13.600 1.00 70.92 ? 65  GLY C N   1 
ATOM   3848 C CA  . GLY C 1 71  ? 11.811  5.381   -12.968 1.00 70.67 ? 65  GLY C CA  1 
ATOM   3849 C C   . GLY C 1 71  ? 10.912  4.385   -13.693 1.00 70.52 ? 65  GLY C C   1 
ATOM   3850 O O   . GLY C 1 71  ? 10.736  4.423   -14.919 1.00 70.41 ? 65  GLY C O   1 
ATOM   3851 N N   . LYS C 1 72  ? 10.356  3.479   -12.895 1.00 70.23 ? 66  LYS C N   1 
ATOM   3852 C CA  . LYS C 1 72  ? 9.435   2.449   -13.340 1.00 69.80 ? 66  LYS C CA  1 
ATOM   3853 C C   . LYS C 1 72  ? 8.205   3.009   -14.035 1.00 69.46 ? 66  LYS C C   1 
ATOM   3854 O O   . LYS C 1 72  ? 7.794   4.150   -13.810 1.00 69.71 ? 66  LYS C O   1 
ATOM   3855 C CB  . LYS C 1 72  ? 8.970   1.612   -12.139 1.00 70.10 ? 66  LYS C CB  1 
ATOM   3856 C CG  . LYS C 1 72  ? 9.917   0.490   -11.718 1.00 70.05 ? 66  LYS C CG  1 
ATOM   3857 C CD  . LYS C 1 72  ? 9.127   -0.686  -11.159 1.00 69.56 ? 66  LYS C CD  1 
ATOM   3858 C CE  . LYS C 1 72  ? 9.727   -2.014  -11.620 1.00 69.50 ? 66  LYS C CE  1 
ATOM   3859 N NZ  . LYS C 1 72  ? 11.075  -2.297  -11.034 1.00 69.07 ? 66  LYS C NZ  1 
ATOM   3860 N N   . GLU C 1 73  ? 7.634   2.183   -14.899 1.00 68.68 ? 67  GLU C N   1 
ATOM   3861 C CA  . GLU C 1 73  ? 6.289   2.366   -15.373 1.00 67.76 ? 67  GLU C CA  1 
ATOM   3862 C C   . GLU C 1 73  ? 5.431   1.667   -14.319 1.00 67.47 ? 67  GLU C C   1 
ATOM   3863 O O   . GLU C 1 73  ? 5.921   0.777   -13.613 1.00 67.69 ? 67  GLU C O   1 
ATOM   3864 C CB  . GLU C 1 73  ? 6.143   1.701   -16.735 1.00 67.55 ? 67  GLU C CB  1 
ATOM   3865 C CG  . GLU C 1 73  ? 7.273   2.039   -17.735 1.00 68.53 ? 67  GLU C CG  1 
ATOM   3866 C CD  . GLU C 1 73  ? 8.503   1.093   -17.668 1.00 69.90 ? 67  GLU C CD  1 
ATOM   3867 O OE1 . GLU C 1 73  ? 8.342   -0.089  -17.245 1.00 70.15 ? 67  GLU C OE1 1 
ATOM   3868 O OE2 . GLU C 1 73  ? 9.623   1.537   -18.059 1.00 67.59 ? 67  GLU C OE2 1 
ATOM   3869 N N   . ASP C 1 74  ? 4.177   2.081   -14.161 1.00 66.77 ? 68  ASP C N   1 
ATOM   3870 C CA  . ASP C 1 74  ? 3.247   1.315   -13.327 1.00 65.88 ? 68  ASP C CA  1 
ATOM   3871 C C   . ASP C 1 74  ? 2.232   0.680   -14.273 1.00 64.91 ? 68  ASP C C   1 
ATOM   3872 O O   . ASP C 1 74  ? 2.474   0.624   -15.473 1.00 64.61 ? 68  ASP C O   1 
ATOM   3873 C CB  . ASP C 1 74  ? 2.583   2.216   -12.280 1.00 65.99 ? 68  ASP C CB  1 
ATOM   3874 C CG  . ASP C 1 74  ? 1.653   3.232   -12.900 1.00 66.79 ? 68  ASP C CG  1 
ATOM   3875 O OD1 . ASP C 1 74  ? 0.514   3.382   -12.388 1.00 67.16 ? 68  ASP C OD1 1 
ATOM   3876 O OD2 . ASP C 1 74  ? 2.052   3.846   -13.919 1.00 66.05 ? 68  ASP C OD2 1 
ATOM   3877 N N   . ALA C 1 75  ? 1.102   0.210   -13.767 1.00 64.10 ? 69  ALA C N   1 
ATOM   3878 C CA  . ALA C 1 75  ? 0.049   -0.207  -14.684 1.00 63.85 ? 69  ALA C CA  1 
ATOM   3879 C C   . ALA C 1 75  ? -0.413  0.967   -15.588 1.00 63.43 ? 69  ALA C C   1 
ATOM   3880 O O   . ALA C 1 75  ? -0.448  0.829   -16.820 1.00 63.48 ? 69  ALA C O   1 
ATOM   3881 C CB  . ALA C 1 75  ? -1.120  -0.828  -13.936 1.00 63.94 ? 69  ALA C CB  1 
ATOM   3882 N N   . GLY C 1 76  ? -0.725  2.112   -14.972 1.00 62.45 ? 70  GLY C N   1 
ATOM   3883 C CA  . GLY C 1 76  ? -1.171  3.312   -15.679 1.00 61.49 ? 70  GLY C CA  1 
ATOM   3884 C C   . GLY C 1 76  ? -0.509  3.555   -17.028 1.00 61.06 ? 70  GLY C C   1 
ATOM   3885 O O   . GLY C 1 76  ? -1.193  3.788   -18.025 1.00 61.04 ? 70  GLY C O   1 
ATOM   3886 N N   . ASP C 1 77  ? 0.822   3.477   -17.050 1.00 60.41 ? 71  ASP C N   1 
ATOM   3887 C CA  . ASP C 1 77  ? 1.643   3.727   -18.234 1.00 59.58 ? 71  ASP C CA  1 
ATOM   3888 C C   . ASP C 1 77  ? 1.554   2.586   -19.234 1.00 58.78 ? 71  ASP C C   1 
ATOM   3889 O O   . ASP C 1 77  ? 1.232   2.779   -20.412 1.00 58.70 ? 71  ASP C O   1 
ATOM   3890 C CB  . ASP C 1 77  ? 3.114   3.849   -17.826 1.00 60.21 ? 71  ASP C CB  1 
ATOM   3891 C CG  . ASP C 1 77  ? 3.379   4.990   -16.864 1.00 60.94 ? 71  ASP C CG  1 
ATOM   3892 O OD1 . ASP C 1 77  ? 2.648   6.014   -16.912 1.00 61.50 ? 71  ASP C OD1 1 
ATOM   3893 O OD2 . ASP C 1 77  ? 4.344   4.856   -16.072 1.00 60.94 ? 71  ASP C OD2 1 
ATOM   3894 N N   . VAL C 1 78  ? 1.886   1.393   -18.761 1.00 57.64 ? 72  VAL C N   1 
ATOM   3895 C CA  . VAL C 1 78  ? 1.772   0.188   -19.573 1.00 56.28 ? 72  VAL C CA  1 
ATOM   3896 C C   . VAL C 1 78  ? 0.374   0.125   -20.188 1.00 55.18 ? 72  VAL C C   1 
ATOM   3897 O O   . VAL C 1 78  ? 0.215   -0.218  -21.351 1.00 55.43 ? 72  VAL C O   1 
ATOM   3898 C CB  . VAL C 1 78  ? 2.057   -1.068  -18.716 1.00 56.43 ? 72  VAL C CB  1 
ATOM   3899 C CG1 . VAL C 1 78  ? 1.874   -2.349  -19.534 1.00 56.10 ? 72  VAL C CG1 1 
ATOM   3900 C CG2 . VAL C 1 78  ? 3.478   -0.989  -18.116 1.00 55.78 ? 72  VAL C CG2 1 
ATOM   3901 N N   . GLN C 1 79  ? -0.630  0.493   -19.400 1.00 53.48 ? 73  GLN C N   1 
ATOM   3902 C CA  . GLN C 1 79  ? -2.008  0.508   -19.871 1.00 51.20 ? 73  GLN C CA  1 
ATOM   3903 C C   . GLN C 1 79  ? -2.324  1.606   -20.926 1.00 50.32 ? 73  GLN C C   1 
ATOM   3904 O O   . GLN C 1 79  ? -3.042  1.281   -21.866 1.00 49.60 ? 73  GLN C O   1 
ATOM   3905 C CB  . GLN C 1 79  ? -2.989  0.501   -18.674 1.00 52.08 ? 73  GLN C CB  1 
ATOM   3906 C CG  . GLN C 1 79  ? -4.464  0.213   -19.004 1.00 51.41 ? 73  GLN C CG  1 
ATOM   3907 C CD  . GLN C 1 79  ? -4.680  -1.146  -19.650 1.00 51.94 ? 73  GLN C CD  1 
ATOM   3908 O OE1 . GLN C 1 79  ? -4.604  -2.195  -18.993 1.00 51.96 ? 73  GLN C OE1 1 
ATOM   3909 N NE2 . GLN C 1 79  ? -4.962  -1.133  -20.948 1.00 50.96 ? 73  GLN C NE2 1 
ATOM   3910 N N   . GLN C 1 80  ? -1.810  2.859   -20.780 1.00 48.88 ? 74  GLN C N   1 
ATOM   3911 C CA  . GLN C 1 80  ? -1.843  3.912   -21.880 1.00 47.78 ? 74  GLN C CA  1 
ATOM   3912 C C   . GLN C 1 80  ? -1.435  3.179   -23.139 1.00 48.33 ? 74  GLN C C   1 
ATOM   3913 O O   . GLN C 1 80  ? -2.166  3.216   -24.138 1.00 48.21 ? 74  GLN C O   1 
ATOM   3914 C CB  . GLN C 1 80  ? -0.897  5.184   -21.678 1.00 47.80 ? 74  GLN C CB  1 
ATOM   3915 C CG  . GLN C 1 80  ? -0.297  5.992   -23.066 1.00 46.69 ? 74  GLN C CG  1 
ATOM   3916 C CD  . GLN C 1 80  ? 1.297   5.987   -23.347 1.00 41.69 ? 74  GLN C CD  1 
ATOM   3917 O OE1 . GLN C 1 80  ? 1.785   6.183   -24.460 1.00 16.98 ? 74  GLN C OE1 1 
ATOM   3918 N NE2 . GLN C 1 80  ? 2.051   5.818   -22.293 1.00 39.31 ? 74  GLN C NE2 1 
ATOM   3919 N N   . PHE C 1 81  ? -0.284  2.486   -23.064 1.00 48.31 ? 75  PHE C N   1 
ATOM   3920 C CA  . PHE C 1 81  ? 0.358   1.946   -24.243 1.00 48.89 ? 75  PHE C CA  1 
ATOM   3921 C C   . PHE C 1 81  ? -0.553  0.970   -24.961 1.00 49.92 ? 75  PHE C C   1 
ATOM   3922 O O   . PHE C 1 81  ? -0.753  1.103   -26.172 1.00 50.61 ? 75  PHE C O   1 
ATOM   3923 C CB  . PHE C 1 81  ? 1.703   1.320   -23.908 1.00 48.96 ? 75  PHE C CB  1 
ATOM   3924 C CG  . PHE C 1 81  ? 2.423   0.754   -25.093 1.00 49.23 ? 75  PHE C CG  1 
ATOM   3925 C CD1 . PHE C 1 81  ? 2.910   1.598   -26.107 1.00 50.66 ? 75  PHE C CD1 1 
ATOM   3926 C CD2 . PHE C 1 81  ? 2.609   -0.622  -25.213 1.00 49.32 ? 75  PHE C CD2 1 
ATOM   3927 C CE1 . PHE C 1 81  ? 3.573   1.083   -27.228 1.00 49.24 ? 75  PHE C CE1 1 
ATOM   3928 C CE2 . PHE C 1 81  ? 3.278   -1.150  -26.324 1.00 50.46 ? 75  PHE C CE2 1 
ATOM   3929 C CZ  . PHE C 1 81  ? 3.763   -0.285  -27.339 1.00 49.42 ? 75  PHE C CZ  1 
ATOM   3930 N N   . TYR C 1 82  ? -1.148  0.030   -24.220 1.00 50.47 ? 76  TYR C N   1 
ATOM   3931 C CA  . TYR C 1 82  ? -1.978  -1.003  -24.828 1.00 50.88 ? 76  TYR C CA  1 
ATOM   3932 C C   . TYR C 1 82  ? -3.271  -0.465  -25.344 1.00 50.89 ? 76  TYR C C   1 
ATOM   3933 O O   . TYR C 1 82  ? -3.657  -0.795  -26.463 1.00 51.61 ? 76  TYR C O   1 
ATOM   3934 C CB  . TYR C 1 82  ? -2.240  -2.146  -23.865 1.00 51.54 ? 76  TYR C CB  1 
ATOM   3935 C CG  . TYR C 1 82  ? -1.080  -3.079  -23.791 1.00 52.77 ? 76  TYR C CG  1 
ATOM   3936 C CD1 . TYR C 1 82  ? -0.277  -3.280  -24.912 1.00 54.56 ? 76  TYR C CD1 1 
ATOM   3937 C CD2 . TYR C 1 82  ? -0.776  -3.777  -22.612 1.00 53.14 ? 76  TYR C CD2 1 
ATOM   3938 C CE1 . TYR C 1 82  ? 0.798   -4.155  -24.871 1.00 55.06 ? 76  TYR C CE1 1 
ATOM   3939 C CE2 . TYR C 1 82  ? 0.301   -4.654  -22.557 1.00 52.55 ? 76  TYR C CE2 1 
ATOM   3940 C CZ  . TYR C 1 82  ? 1.074   -4.833  -23.697 1.00 53.11 ? 76  TYR C CZ  1 
ATOM   3941 O OH  . TYR C 1 82  ? 2.127   -5.686  -23.713 1.00 53.49 ? 76  TYR C OH  1 
ATOM   3942 N N   . ASP C 1 83  ? -3.938  0.348   -24.526 1.00 50.91 ? 77  ASP C N   1 
ATOM   3943 C CA  . ASP C 1 83  ? -5.120  1.104   -24.948 1.00 51.33 ? 77  ASP C CA  1 
ATOM   3944 C C   . ASP C 1 83  ? -4.869  1.731   -26.326 1.00 51.00 ? 77  ASP C C   1 
ATOM   3945 O O   . ASP C 1 83  ? -5.541  1.403   -27.297 1.00 50.65 ? 77  ASP C O   1 
ATOM   3946 C CB  . ASP C 1 83  ? -5.462  2.224   -23.934 1.00 51.76 ? 77  ASP C CB  1 
ATOM   3947 C CG  . ASP C 1 83  ? -6.069  1.695   -22.603 1.00 53.29 ? 77  ASP C CG  1 
ATOM   3948 O OD1 . ASP C 1 83  ? -6.428  0.483   -22.495 1.00 54.88 ? 77  ASP C OD1 1 
ATOM   3949 O OD2 . ASP C 1 83  ? -6.187  2.517   -21.656 1.00 52.62 ? 77  ASP C OD2 1 
ATOM   3950 N N   . LEU C 1 84  ? -3.870  2.602   -26.411 1.00 50.57 ? 78  LEU C N   1 
ATOM   3951 C CA  . LEU C 1 84  ? -3.520  3.210   -27.679 1.00 50.23 ? 78  LEU C CA  1 
ATOM   3952 C C   . LEU C 1 84  ? -3.376  2.192   -28.809 1.00 49.90 ? 78  LEU C C   1 
ATOM   3953 O O   . LEU C 1 84  ? -4.105  2.296   -29.783 1.00 50.41 ? 78  LEU C O   1 
ATOM   3954 C CB  . LEU C 1 84  ? -2.269  4.070   -27.530 1.00 50.62 ? 78  LEU C CB  1 
ATOM   3955 C CG  . LEU C 1 84  ? -2.416  5.591   -27.449 1.00 49.59 ? 78  LEU C CG  1 
ATOM   3956 C CD1 . LEU C 1 84  ? -3.678  6.043   -26.752 1.00 48.71 ? 78  LEU C CD1 1 
ATOM   3957 C CD2 . LEU C 1 84  ? -1.220  6.091   -26.716 1.00 49.65 ? 78  LEU C CD2 1 
ATOM   3958 N N   . LEU C 1 85  ? -2.481  1.215   -28.673 1.00 48.98 ? 79  LEU C N   1 
ATOM   3959 C CA  . LEU C 1 85  ? -2.311  0.166   -29.686 1.00 49.19 ? 79  LEU C CA  1 
ATOM   3960 C C   . LEU C 1 85  ? -3.631  -0.431  -30.158 1.00 49.79 ? 79  LEU C C   1 
ATOM   3961 O O   . LEU C 1 85  ? -3.999  -0.293  -31.336 1.00 49.83 ? 79  LEU C O   1 
ATOM   3962 C CB  . LEU C 1 85  ? -1.421  -0.967  -29.173 1.00 49.02 ? 79  LEU C CB  1 
ATOM   3963 C CG  . LEU C 1 85  ? -0.036  -1.230  -29.773 1.00 48.65 ? 79  LEU C CG  1 
ATOM   3964 C CD1 . LEU C 1 85  ? 0.833   -0.032  -29.782 1.00 48.39 ? 79  LEU C CD1 1 
ATOM   3965 C CD2 . LEU C 1 85  ? 0.687   -2.323  -28.999 1.00 49.26 ? 79  LEU C CD2 1 
ATOM   3966 N N   . SER C 1 86  ? -4.352  -1.077  -29.240 1.00 50.19 ? 80  SER C N   1 
ATOM   3967 C CA  . SER C 1 86  ? -5.548  -1.847  -29.600 1.00 50.41 ? 80  SER C CA  1 
ATOM   3968 C C   . SER C 1 86  ? -6.667  -0.963  -30.131 1.00 51.08 ? 80  SER C C   1 
ATOM   3969 O O   . SER C 1 86  ? -7.542  -1.422  -30.866 1.00 52.01 ? 80  SER C O   1 
ATOM   3970 C CB  . SER C 1 86  ? -6.055  -2.643  -28.414 1.00 49.98 ? 80  SER C CB  1 
ATOM   3971 O OG  . SER C 1 86  ? -6.914  -1.846  -27.651 1.00 48.81 ? 80  SER C OG  1 
ATOM   3972 N N   . GLY C 1 87  ? -6.626  0.309   -29.761 1.00 51.55 ? 81  GLY C N   1 
ATOM   3973 C CA  . GLY C 1 87  ? -7.620  1.262   -30.184 1.00 51.24 ? 81  GLY C CA  1 
ATOM   3974 C C   . GLY C 1 87  ? -7.443  1.555   -31.651 1.00 51.75 ? 81  GLY C C   1 
ATOM   3975 O O   . GLY C 1 87  ? -8.425  1.795   -32.354 1.00 52.14 ? 81  GLY C O   1 
ATOM   3976 N N   . SER C 1 88  ? -6.202  1.560   -32.124 1.00 51.38 ? 82  SER C N   1 
ATOM   3977 C CA  . SER C 1 88  ? -5.973  1.855   -33.527 1.00 51.84 ? 82  SER C CA  1 
ATOM   3978 C C   . SER C 1 88  ? -6.384  0.666   -34.367 1.00 51.83 ? 82  SER C C   1 
ATOM   3979 O O   . SER C 1 88  ? -6.995  0.846   -35.425 1.00 52.27 ? 82  SER C O   1 
ATOM   3980 C CB  . SER C 1 88  ? -4.517  2.179   -33.790 1.00 52.17 ? 82  SER C CB  1 
ATOM   3981 O OG  . SER C 1 88  ? -3.923  2.623   -32.582 1.00 54.20 ? 82  SER C OG  1 
ATOM   3982 N N   . LEU C 1 89  ? -6.065  -0.548  -33.906 1.00 51.12 ? 83  LEU C N   1 
ATOM   3983 C CA  . LEU C 1 89  ? -6.437  -1.751  -34.646 1.00 50.55 ? 83  LEU C CA  1 
ATOM   3984 C C   . LEU C 1 89  ? -7.849  -1.617  -35.230 1.00 50.84 ? 83  LEU C C   1 
ATOM   3985 O O   . LEU C 1 89  ? -8.076  -1.965  -36.409 1.00 50.83 ? 83  LEU C O   1 
ATOM   3986 C CB  . LEU C 1 89  ? -6.318  -3.010  -33.784 1.00 50.42 ? 83  LEU C CB  1 
ATOM   3987 C CG  . LEU C 1 89  ? -6.560  -4.396  -34.405 1.00 50.36 ? 83  LEU C CG  1 
ATOM   3988 C CD1 . LEU C 1 89  ? -5.909  -4.599  -35.795 1.00 49.59 ? 83  LEU C CD1 1 
ATOM   3989 C CD2 . LEU C 1 89  ? -6.095  -5.454  -33.444 1.00 49.76 ? 83  LEU C CD2 1 
ATOM   3990 N N   . GLU C 1 90  ? -8.771  -1.089  -34.419 1.00 50.31 ? 84  GLU C N   1 
ATOM   3991 C CA  . GLU C 1 90  ? -10.149 -0.879  -34.843 1.00 50.26 ? 84  GLU C CA  1 
ATOM   3992 C C   . GLU C 1 90  ? -10.269 0.119   -35.992 1.00 49.77 ? 84  GLU C C   1 
ATOM   3993 O O   . GLU C 1 90  ? -10.919 -0.141  -37.013 1.00 49.66 ? 84  GLU C O   1 
ATOM   3994 C CB  . GLU C 1 90  ? -10.984 -0.449  -33.656 1.00 50.76 ? 84  GLU C CB  1 
ATOM   3995 C CG  . GLU C 1 90  ? -11.237 -1.581  -32.666 1.00 53.87 ? 84  GLU C CG  1 
ATOM   3996 C CD  . GLU C 1 90  ? -11.682 -2.875  -33.377 1.00 58.56 ? 84  GLU C CD  1 
ATOM   3997 O OE1 . GLU C 1 90  ? -10.813 -3.777  -33.508 1.00 61.11 ? 84  GLU C OE1 1 
ATOM   3998 O OE2 . GLU C 1 90  ? -12.867 -2.978  -33.824 1.00 56.94 ? 84  GLU C OE2 1 
ATOM   3999 N N   . VAL C 1 91  ? -9.604  1.253   -35.837 1.00 49.30 ? 85  VAL C N   1 
ATOM   4000 C CA  . VAL C 1 91  ? -9.596  2.295   -36.857 1.00 48.37 ? 85  VAL C CA  1 
ATOM   4001 C C   . VAL C 1 91  ? -8.961  1.744   -38.135 1.00 48.65 ? 85  VAL C C   1 
ATOM   4002 O O   . VAL C 1 91  ? -9.496  1.922   -39.228 1.00 48.78 ? 85  VAL C O   1 
ATOM   4003 C CB  . VAL C 1 91  ? -8.826  3.532   -36.377 1.00 47.66 ? 85  VAL C CB  1 
ATOM   4004 C CG1 . VAL C 1 91  ? -9.041  4.681   -37.300 1.00 46.52 ? 85  VAL C CG1 1 
ATOM   4005 C CG2 . VAL C 1 91  ? -9.241  3.886   -34.987 1.00 46.59 ? 85  VAL C CG2 1 
ATOM   4006 N N   . ILE C 1 92  ? -7.829  1.065   -37.998 1.00 48.32 ? 86  ILE C N   1 
ATOM   4007 C CA  . ILE C 1 92  ? -7.140  0.577   -39.167 1.00 48.23 ? 86  ILE C CA  1 
ATOM   4008 C C   . ILE C 1 92  ? -7.982  -0.432  -39.945 1.00 48.58 ? 86  ILE C C   1 
ATOM   4009 O O   . ILE C 1 92  ? -8.014  -0.397  -41.189 1.00 49.30 ? 86  ILE C O   1 
ATOM   4010 C CB  . ILE C 1 92  ? -5.764  0.042   -38.822 1.00 48.35 ? 86  ILE C CB  1 
ATOM   4011 C CG1 . ILE C 1 92  ? -4.871  1.246   -38.492 1.00 47.93 ? 86  ILE C CG1 1 
ATOM   4012 C CG2 . ILE C 1 92  ? -5.191  -0.802  -39.994 1.00 46.56 ? 86  ILE C CG2 1 
ATOM   4013 C CD1 . ILE C 1 92  ? -3.788  0.944   -37.516 1.00 46.59 ? 86  ILE C CD1 1 
ATOM   4014 N N   . ARG C 1 93  ? -8.677  -1.312  -39.232 1.00 47.85 ? 87  ARG C N   1 
ATOM   4015 C CA  . ARG C 1 93  ? -9.587  -2.245  -39.889 1.00 47.18 ? 87  ARG C CA  1 
ATOM   4016 C C   . ARG C 1 93  ? -10.720 -1.515  -40.673 1.00 46.18 ? 87  ARG C C   1 
ATOM   4017 O O   . ARG C 1 93  ? -11.003 -1.851  -41.820 1.00 45.96 ? 87  ARG C O   1 
ATOM   4018 C CB  . ARG C 1 93  ? -10.125 -3.235  -38.859 1.00 47.36 ? 87  ARG C CB  1 
ATOM   4019 C CG  . ARG C 1 93  ? -11.150 -4.235  -39.373 1.00 50.29 ? 87  ARG C CG  1 
ATOM   4020 C CD  . ARG C 1 93  ? -11.105 -5.486  -38.511 1.00 55.21 ? 87  ARG C CD  1 
ATOM   4021 N NE  . ARG C 1 93  ? -10.723 -5.140  -37.141 1.00 57.92 ? 87  ARG C NE  1 
ATOM   4022 C CZ  . ARG C 1 93  ? -9.950  -5.887  -36.352 1.00 60.83 ? 87  ARG C CZ  1 
ATOM   4023 N NH1 . ARG C 1 93  ? -9.452  -7.056  -36.783 1.00 60.68 ? 87  ARG C NH1 1 
ATOM   4024 N NH2 . ARG C 1 93  ? -9.666  -5.457  -35.121 1.00 61.14 ? 87  ARG C NH2 1 
ATOM   4025 N N   . LYS C 1 94  ? -11.350 -0.510  -40.074 1.00 44.99 ? 88  LYS C N   1 
ATOM   4026 C CA  . LYS C 1 94  ? -12.417 0.219   -40.773 1.00 44.30 ? 88  LYS C CA  1 
ATOM   4027 C C   . LYS C 1 94  ? -11.886 0.963   -41.998 1.00 43.31 ? 88  LYS C C   1 
ATOM   4028 O O   . LYS C 1 94  ? -12.602 1.160   -42.968 1.00 43.52 ? 88  LYS C O   1 
ATOM   4029 C CB  . LYS C 1 94  ? -13.107 1.223   -39.853 1.00 44.52 ? 88  LYS C CB  1 
ATOM   4030 C CG  . LYS C 1 94  ? -13.916 0.607   -38.754 1.00 46.57 ? 88  LYS C CG  1 
ATOM   4031 C CD  . LYS C 1 94  ? -14.789 1.686   -38.109 1.00 52.01 ? 88  LYS C CD  1 
ATOM   4032 C CE  . LYS C 1 94  ? -16.033 1.096   -37.421 1.00 55.01 ? 88  LYS C CE  1 
ATOM   4033 N NZ  . LYS C 1 94  ? -15.662 -0.041  -36.498 1.00 56.48 ? 88  LYS C NZ  1 
ATOM   4034 N N   . TRP C 1 95  ? -10.633 1.392   -41.940 1.00 42.07 ? 89  TRP C N   1 
ATOM   4035 C CA  . TRP C 1 95  ? -10.000 2.047   -43.050 1.00 40.74 ? 89  TRP C CA  1 
ATOM   4036 C C   . TRP C 1 95  ? -9.734  1.012   -44.088 1.00 41.51 ? 89  TRP C C   1 
ATOM   4037 O O   . TRP C 1 95  ? -10.015 1.233   -45.253 1.00 41.82 ? 89  TRP C O   1 
ATOM   4038 C CB  . TRP C 1 95  ? -8.715  2.690   -42.595 1.00 39.79 ? 89  TRP C CB  1 
ATOM   4039 C CG  . TRP C 1 95  ? -7.748  2.939   -43.646 1.00 37.57 ? 89  TRP C CG  1 
ATOM   4040 C CD1 . TRP C 1 95  ? -7.709  3.993   -44.475 1.00 36.99 ? 89  TRP C CD1 1 
ATOM   4041 C CD2 . TRP C 1 95  ? -6.616  2.138   -43.956 1.00 38.25 ? 89  TRP C CD2 1 
ATOM   4042 N NE1 . TRP C 1 95  ? -6.634  3.910   -45.320 1.00 36.96 ? 89  TRP C NE1 1 
ATOM   4043 C CE2 . TRP C 1 95  ? -5.933  2.779   -45.016 1.00 38.50 ? 89  TRP C CE2 1 
ATOM   4044 C CE3 . TRP C 1 95  ? -6.107  0.935   -43.444 1.00 37.21 ? 89  TRP C CE3 1 
ATOM   4045 C CZ2 . TRP C 1 95  ? -4.767  2.262   -45.578 1.00 38.57 ? 89  TRP C CZ2 1 
ATOM   4046 C CZ3 . TRP C 1 95  ? -4.952  0.414   -44.001 1.00 38.05 ? 89  TRP C CZ3 1 
ATOM   4047 C CH2 . TRP C 1 95  ? -4.292  1.078   -45.061 1.00 39.20 ? 89  TRP C CH2 1 
ATOM   4048 N N   . ALA C 1 96  ? -9.224  -0.144  -43.661 1.00 42.38 ? 90  ALA C N   1 
ATOM   4049 C CA  . ALA C 1 96  ? -9.082  -1.280  -44.549 1.00 42.70 ? 90  ALA C CA  1 
ATOM   4050 C C   . ALA C 1 96  ? -10.360 -1.516  -45.385 1.00 43.78 ? 90  ALA C C   1 
ATOM   4051 O O   . ALA C 1 96  ? -10.265 -1.603  -46.626 1.00 43.87 ? 90  ALA C O   1 
ATOM   4052 C CB  . ALA C 1 96  ? -8.694  -2.509  -43.775 1.00 42.24 ? 90  ALA C CB  1 
ATOM   4053 N N   . GLU C 1 97  ? -11.537 -1.604  -44.737 1.00 44.52 ? 91  GLU C N   1 
ATOM   4054 C CA  . GLU C 1 97  ? -12.767 -1.995  -45.461 1.00 46.09 ? 91  GLU C CA  1 
ATOM   4055 C C   . GLU C 1 97  ? -13.141 -1.016  -46.570 1.00 46.11 ? 91  GLU C C   1 
ATOM   4056 O O   . GLU C 1 97  ? -13.639 -1.427  -47.609 1.00 46.08 ? 91  GLU C O   1 
ATOM   4057 C CB  . GLU C 1 97  ? -13.973 -2.250  -44.548 1.00 46.43 ? 91  GLU C CB  1 
ATOM   4058 C CG  . GLU C 1 97  ? -13.729 -3.208  -43.366 1.00 50.88 ? 91  GLU C CG  1 
ATOM   4059 C CD  . GLU C 1 97  ? -12.961 -4.500  -43.740 1.00 55.65 ? 91  GLU C CD  1 
ATOM   4060 O OE1 . GLU C 1 97  ? -11.904 -4.783  -43.092 1.00 56.20 ? 91  GLU C OE1 1 
ATOM   4061 O OE2 . GLU C 1 97  ? -13.417 -5.221  -44.672 1.00 57.24 ? 91  GLU C OE2 1 
ATOM   4062 N N   . LYS C 1 98  ? -12.861 0.264   -46.358 1.00 46.21 ? 92  LYS C N   1 
ATOM   4063 C CA  . LYS C 1 98  ? -13.157 1.286   -47.362 1.00 46.78 ? 92  LYS C CA  1 
ATOM   4064 C C   . LYS C 1 98  ? -12.141 1.316   -48.536 1.00 46.79 ? 92  LYS C C   1 
ATOM   4065 O O   . LYS C 1 98  ? -12.253 2.174   -49.438 1.00 47.56 ? 92  LYS C O   1 
ATOM   4066 C CB  . LYS C 1 98  ? -13.295 2.665   -46.702 1.00 46.31 ? 92  LYS C CB  1 
ATOM   4067 C CG  . LYS C 1 98  ? -14.525 2.816   -45.849 1.00 46.49 ? 92  LYS C CG  1 
ATOM   4068 C CD  . LYS C 1 98  ? -14.160 3.550   -44.554 1.00 51.33 ? 92  LYS C CD  1 
ATOM   4069 C CE  . LYS C 1 98  ? -15.377 4.124   -43.800 1.00 53.09 ? 92  LYS C CE  1 
ATOM   4070 N NZ  . LYS C 1 98  ? -15.972 5.313   -44.524 1.00 54.63 ? 92  LYS C NZ  1 
ATOM   4071 N N   . ILE C 1 99  ? -11.172 0.393   -48.516 1.00 45.68 ? 93  ILE C N   1 
ATOM   4072 C CA  . ILE C 1 99  ? -10.271 0.148   -49.647 1.00 44.71 ? 93  ILE C CA  1 
ATOM   4073 C C   . ILE C 1 99  ? -10.932 -0.817  -50.656 1.00 44.46 ? 93  ILE C C   1 
ATOM   4074 O O   . ILE C 1 99  ? -11.340 -1.935  -50.309 1.00 44.50 ? 93  ILE C O   1 
ATOM   4075 C CB  . ILE C 1 99  ? -8.892  -0.363  -49.144 1.00 44.93 ? 93  ILE C CB  1 
ATOM   4076 C CG1 . ILE C 1 99  ? -8.251  0.727   -48.281 1.00 43.80 ? 93  ILE C CG1 1 
ATOM   4077 C CG2 . ILE C 1 99  ? -7.959  -0.830  -50.307 1.00 45.38 ? 93  ILE C CG2 1 
ATOM   4078 C CD1 . ILE C 1 99  ? -6.785  0.815   -48.350 1.00 42.85 ? 93  ILE C CD1 1 
ATOM   4079 N N   . PRO C 1 100 ? -11.066 -0.379  -51.913 1.00 44.17 ? 94  PRO C N   1 
ATOM   4080 C CA  . PRO C 1 100 ? -11.880 -1.171  -52.840 1.00 43.78 ? 94  PRO C CA  1 
ATOM   4081 C C   . PRO C 1 100 ? -11.209 -2.496  -53.175 1.00 43.36 ? 94  PRO C C   1 
ATOM   4082 O O   . PRO C 1 100 ? -10.031 -2.514  -53.536 1.00 43.54 ? 94  PRO C O   1 
ATOM   4083 C CB  . PRO C 1 100 ? -11.995 -0.264  -54.068 1.00 43.50 ? 94  PRO C CB  1 
ATOM   4084 C CG  . PRO C 1 100 ? -11.610 1.099   -53.571 1.00 43.93 ? 94  PRO C CG  1 
ATOM   4085 C CD  . PRO C 1 100 ? -10.541 0.830   -52.561 1.00 44.00 ? 94  PRO C CD  1 
ATOM   4086 N N   . GLY C 1 101 ? -11.945 -3.594  -53.019 1.00 42.63 ? 95  GLY C N   1 
ATOM   4087 C CA  . GLY C 1 101 ? -11.358 -4.906  -53.158 1.00 41.64 ? 95  GLY C CA  1 
ATOM   4088 C C   . GLY C 1 101 ? -10.995 -5.520  -51.824 1.00 41.80 ? 95  GLY C C   1 
ATOM   4089 O O   . GLY C 1 101 ? -11.085 -6.741  -51.672 1.00 42.66 ? 95  GLY C O   1 
ATOM   4090 N N   . PHE C 1 102 ? -10.599 -4.719  -50.836 1.00 41.12 ? 96  PHE C N   1 
ATOM   4091 C CA  . PHE C 1 102 ? -10.156 -5.319  -49.587 1.00 41.07 ? 96  PHE C CA  1 
ATOM   4092 C C   . PHE C 1 102 ? -11.247 -6.189  -48.961 1.00 41.81 ? 96  PHE C C   1 
ATOM   4093 O O   . PHE C 1 102 ? -10.995 -7.312  -48.515 1.00 41.63 ? 96  PHE C O   1 
ATOM   4094 C CB  . PHE C 1 102 ? -9.625  -4.304  -48.555 1.00 40.80 ? 96  PHE C CB  1 
ATOM   4095 C CG  . PHE C 1 102 ? -9.024  -4.974  -47.331 1.00 40.98 ? 96  PHE C CG  1 
ATOM   4096 C CD1 . PHE C 1 102 ? -7.677  -5.396  -47.333 1.00 40.35 ? 96  PHE C CD1 1 
ATOM   4097 C CD2 . PHE C 1 102 ? -9.812  -5.253  -46.202 1.00 40.44 ? 96  PHE C CD2 1 
ATOM   4098 C CE1 . PHE C 1 102 ? -7.106  -6.076  -46.212 1.00 40.22 ? 96  PHE C CE1 1 
ATOM   4099 C CE2 . PHE C 1 102 ? -9.264  -5.930  -45.083 1.00 41.81 ? 96  PHE C CE2 1 
ATOM   4100 C CZ  . PHE C 1 102 ? -7.900  -6.342  -45.085 1.00 40.61 ? 96  PHE C CZ  1 
ATOM   4101 N N   . ALA C 1 103 ? -12.464 -5.670  -48.930 1.00 42.74 ? 97  ALA C N   1 
ATOM   4102 C CA  . ALA C 1 103 ? -13.544 -6.384  -48.288 1.00 43.89 ? 97  ALA C CA  1 
ATOM   4103 C C   . ALA C 1 103 ? -13.951 -7.614  -49.115 1.00 45.02 ? 97  ALA C C   1 
ATOM   4104 O O   . ALA C 1 103 ? -14.707 -8.477  -48.636 1.00 45.20 ? 97  ALA C O   1 
ATOM   4105 C CB  . ALA C 1 103 ? -14.720 -5.459  -48.041 1.00 43.92 ? 97  ALA C CB  1 
ATOM   4106 N N   . GLU C 1 104 ? -13.391 -7.719  -50.323 1.00 45.87 ? 98  GLU C N   1 
ATOM   4107 C CA  . GLU C 1 104 ? -13.682 -8.833  -51.229 1.00 46.88 ? 98  GLU C CA  1 
ATOM   4108 C C   . GLU C 1 104 ? -12.670 -9.973  -51.287 1.00 46.89 ? 98  GLU C C   1 
ATOM   4109 O O   . GLU C 1 104 ? -12.804 -10.848 -52.117 1.00 47.07 ? 98  GLU C O   1 
ATOM   4110 C CB  . GLU C 1 104 ? -13.942 -8.316  -52.643 1.00 47.34 ? 98  GLU C CB  1 
ATOM   4111 C CG  . GLU C 1 104 ? -15.201 -7.433  -52.735 1.00 49.75 ? 98  GLU C CG  1 
ATOM   4112 C CD  . GLU C 1 104 ? -14.853 -6.043  -53.199 1.00 53.57 ? 98  GLU C CD  1 
ATOM   4113 O OE1 . GLU C 1 104 ? -14.673 -5.930  -54.441 1.00 54.22 ? 98  GLU C OE1 1 
ATOM   4114 O OE2 . GLU C 1 104 ? -14.744 -5.094  -52.349 1.00 53.43 ? 98  GLU C OE2 1 
ATOM   4115 N N   . LEU C 1 105 ? -11.654 -9.948  -50.431 1.00 47.24 ? 99  LEU C N   1 
ATOM   4116 C CA  . LEU C 1 105 ? -10.730 -11.075 -50.283 1.00 46.73 ? 99  LEU C CA  1 
ATOM   4117 C C   . LEU C 1 105 ? -11.323 -11.986 -49.208 1.00 47.31 ? 99  LEU C C   1 
ATOM   4118 O O   . LEU C 1 105 ? -12.280 -11.596 -48.550 1.00 48.18 ? 99  LEU C O   1 
ATOM   4119 C CB  . LEU C 1 105 ? -9.356  -10.562 -49.870 1.00 46.46 ? 99  LEU C CB  1 
ATOM   4120 C CG  . LEU C 1 105 ? -8.802  -9.270  -50.505 1.00 44.34 ? 99  LEU C CG  1 
ATOM   4121 C CD1 . LEU C 1 105 ? -7.967  -8.508  -49.489 1.00 42.08 ? 99  LEU C CD1 1 
ATOM   4122 C CD2 . LEU C 1 105 ? -7.979  -9.536  -51.742 1.00 40.96 ? 99  LEU C CD2 1 
ATOM   4123 N N   . SER C 1 106 ? -10.803 -13.197 -49.022 1.00 47.54 ? 100 SER C N   1 
ATOM   4124 C CA  . SER C 1 106 ? -11.422 -14.098 -48.038 1.00 47.35 ? 100 SER C CA  1 
ATOM   4125 C C   . SER C 1 106 ? -11.174 -13.540 -46.653 1.00 47.74 ? 100 SER C C   1 
ATOM   4126 O O   . SER C 1 106 ? -10.162 -12.847 -46.457 1.00 48.46 ? 100 SER C O   1 
ATOM   4127 C CB  . SER C 1 106 ? -10.893 -15.542 -48.155 1.00 47.47 ? 100 SER C CB  1 
ATOM   4128 O OG  . SER C 1 106 ? -9.482  -15.616 -48.220 1.00 46.86 ? 100 SER C OG  1 
ATOM   4129 N N   . PRO C 1 107 ? -12.076 -13.822 -45.689 1.00 47.69 ? 101 PRO C N   1 
ATOM   4130 C CA  . PRO C 1 107 ? -11.923 -13.336 -44.312 1.00 47.67 ? 101 PRO C CA  1 
ATOM   4131 C C   . PRO C 1 107 ? -10.589 -13.701 -43.628 1.00 47.55 ? 101 PRO C C   1 
ATOM   4132 O O   . PRO C 1 107 ? -10.107 -12.927 -42.791 1.00 47.71 ? 101 PRO C O   1 
ATOM   4133 C CB  . PRO C 1 107 ? -13.106 -14.002 -43.578 1.00 47.93 ? 101 PRO C CB  1 
ATOM   4134 C CG  . PRO C 1 107 ? -14.129 -14.189 -44.606 1.00 47.74 ? 101 PRO C CG  1 
ATOM   4135 C CD  . PRO C 1 107 ? -13.324 -14.595 -45.834 1.00 48.05 ? 101 PRO C CD  1 
ATOM   4136 N N   . ALA C 1 108 ? -10.016 -14.861 -43.966 1.00 47.14 ? 102 ALA C N   1 
ATOM   4137 C CA  . ALA C 1 108 ? -8.719  -15.294 -43.426 1.00 46.94 ? 102 ALA C CA  1 
ATOM   4138 C C   . ALA C 1 108 ? -7.612  -14.397 -43.964 1.00 46.91 ? 102 ALA C C   1 
ATOM   4139 O O   . ALA C 1 108 ? -6.753  -13.900 -43.225 1.00 46.58 ? 102 ALA C O   1 
ATOM   4140 C CB  . ALA C 1 108 ? -8.428  -16.753 -43.792 1.00 46.49 ? 102 ALA C CB  1 
ATOM   4141 N N   . ASP C 1 109 ? -7.650  -14.202 -45.270 1.00 46.93 ? 103 ASP C N   1 
ATOM   4142 C CA  . ASP C 1 109 ? -6.712  -13.343 -45.946 1.00 46.95 ? 103 ASP C CA  1 
ATOM   4143 C C   . ASP C 1 109 ? -6.794  -11.877 -45.430 1.00 47.35 ? 103 ASP C C   1 
ATOM   4144 O O   . ASP C 1 109 ? -5.771  -11.185 -45.301 1.00 46.95 ? 103 ASP C O   1 
ATOM   4145 C CB  . ASP C 1 109 ? -6.920  -13.479 -47.460 1.00 46.59 ? 103 ASP C CB  1 
ATOM   4146 C CG  . ASP C 1 109 ? -6.130  -14.668 -48.068 1.00 46.34 ? 103 ASP C CG  1 
ATOM   4147 O OD1 . ASP C 1 109 ? -5.528  -15.460 -47.287 1.00 45.91 ? 103 ASP C OD1 1 
ATOM   4148 O OD2 . ASP C 1 109 ? -6.086  -14.793 -49.332 1.00 44.32 ? 103 ASP C OD2 1 
ATOM   4149 N N   . GLN C 1 110 ? -8.010  -11.431 -45.101 1.00 47.37 ? 104 GLN C N   1 
ATOM   4150 C CA  . GLN C 1 110 ? -8.215  -10.112 -44.519 1.00 46.87 ? 104 GLN C CA  1 
ATOM   4151 C C   . GLN C 1 110 ? -7.576  -10.058 -43.159 1.00 46.93 ? 104 GLN C C   1 
ATOM   4152 O O   . GLN C 1 110 ? -6.814  -9.128  -42.869 1.00 47.74 ? 104 GLN C O   1 
ATOM   4153 C CB  . GLN C 1 110 ? -9.693  -9.759  -44.438 1.00 46.57 ? 104 GLN C CB  1 
ATOM   4154 C CG  . GLN C 1 110 ? -10.272 -9.416  -45.783 1.00 46.53 ? 104 GLN C CG  1 
ATOM   4155 C CD  . GLN C 1 110 ? -11.736 -9.083  -45.714 1.00 47.72 ? 104 GLN C CD  1 
ATOM   4156 O OE1 . GLN C 1 110 ? -12.165 -8.330  -44.817 1.00 48.37 ? 104 GLN C OE1 1 
ATOM   4157 N NE2 . GLN C 1 110 ? -12.524 -9.623  -46.663 1.00 42.82 ? 104 GLN C NE2 1 
ATOM   4158 N N   . ASP C 1 111 ? -7.844  -11.056 -42.326 1.00 46.51 ? 105 ASP C N   1 
ATOM   4159 C CA  . ASP C 1 111 ? -7.140  -11.132 -41.046 1.00 46.80 ? 105 ASP C CA  1 
ATOM   4160 C C   . ASP C 1 111 ? -5.604  -11.219 -41.187 1.00 45.76 ? 105 ASP C C   1 
ATOM   4161 O O   . ASP C 1 111 ? -4.866  -10.542 -40.467 1.00 46.16 ? 105 ASP C O   1 
ATOM   4162 C CB  . ASP C 1 111 ? -7.704  -12.250 -40.177 1.00 47.40 ? 105 ASP C CB  1 
ATOM   4163 C CG  . ASP C 1 111 ? -9.143  -11.995 -39.791 1.00 50.55 ? 105 ASP C CG  1 
ATOM   4164 O OD1 . ASP C 1 111 ? -9.666  -10.915 -40.188 1.00 53.84 ? 105 ASP C OD1 1 
ATOM   4165 O OD2 . ASP C 1 111 ? -9.752  -12.853 -39.096 1.00 52.47 ? 105 ASP C OD2 1 
ATOM   4166 N N   . LEU C 1 112 ? -5.126  -12.007 -42.138 1.00 44.23 ? 106 LEU C N   1 
ATOM   4167 C CA  . LEU C 1 112 ? -3.701  -12.126 -42.334 1.00 42.72 ? 106 LEU C CA  1 
ATOM   4168 C C   . LEU C 1 112 ? -3.068  -10.798 -42.696 1.00 41.70 ? 106 LEU C C   1 
ATOM   4169 O O   . LEU C 1 112 ? -2.091  -10.393 -42.068 1.00 41.81 ? 106 LEU C O   1 
ATOM   4170 C CB  . LEU C 1 112 ? -3.396  -13.156 -43.411 1.00 43.20 ? 106 LEU C CB  1 
ATOM   4171 C CG  . LEU C 1 112 ? -2.006  -13.776 -43.333 1.00 42.68 ? 106 LEU C CG  1 
ATOM   4172 C CD1 . LEU C 1 112 ? -1.779  -14.348 -41.939 1.00 42.73 ? 106 LEU C CD1 1 
ATOM   4173 C CD2 . LEU C 1 112 ? -1.891  -14.832 -44.432 1.00 40.57 ? 106 LEU C CD2 1 
ATOM   4174 N N   . LEU C 1 113 ? -3.622  -10.116 -43.695 1.00 40.30 ? 107 LEU C N   1 
ATOM   4175 C CA  . LEU C 1 113 ? -3.084  -8.828  -44.097 1.00 39.03 ? 107 LEU C CA  1 
ATOM   4176 C C   . LEU C 1 113 ? -3.152  -7.848  -42.912 1.00 39.43 ? 107 LEU C C   1 
ATOM   4177 O O   . LEU C 1 113 ? -2.147  -7.223  -42.565 1.00 40.15 ? 107 LEU C O   1 
ATOM   4178 C CB  . LEU C 1 113 ? -3.755  -8.276  -45.363 1.00 38.02 ? 107 LEU C CB  1 
ATOM   4179 C CG  . LEU C 1 113 ? -3.762  -9.100  -46.659 1.00 35.52 ? 107 LEU C CG  1 
ATOM   4180 C CD1 . LEU C 1 113 ? -4.493  -8.390  -47.764 1.00 32.54 ? 107 LEU C CD1 1 
ATOM   4181 C CD2 . LEU C 1 113 ? -2.380  -9.451  -47.134 1.00 35.44 ? 107 LEU C CD2 1 
ATOM   4182 N N   . LEU C 1 114 ? -4.288  -7.753  -42.241 1.00 38.73 ? 108 LEU C N   1 
ATOM   4183 C CA  . LEU C 1 114 ? -4.362  -6.816  -41.122 1.00 38.75 ? 108 LEU C CA  1 
ATOM   4184 C C   . LEU C 1 114 ? -3.365  -7.102  -40.028 1.00 38.23 ? 108 LEU C C   1 
ATOM   4185 O O   . LEU C 1 114 ? -2.629  -6.218  -39.588 1.00 37.58 ? 108 LEU C O   1 
ATOM   4186 C CB  . LEU C 1 114 ? -5.764  -6.786  -40.536 1.00 39.16 ? 108 LEU C CB  1 
ATOM   4187 C CG  . LEU C 1 114 ? -6.517  -5.737  -41.359 1.00 40.15 ? 108 LEU C CG  1 
ATOM   4188 C CD1 . LEU C 1 114 ? -7.998  -6.185  -41.577 1.00 39.89 ? 108 LEU C CD1 1 
ATOM   4189 C CD2 . LEU C 1 114 ? -6.350  -4.354  -40.711 1.00 36.96 ? 108 LEU C CD2 1 
ATOM   4190 N N   . GLU C 1 115 ? -3.342  -8.356  -39.597 1.00 38.07 ? 109 GLU C N   1 
ATOM   4191 C CA  . GLU C 1 115 ? -2.481  -8.747  -38.507 1.00 37.86 ? 109 GLU C CA  1 
ATOM   4192 C C   . GLU C 1 115 ? -1.002  -8.606  -38.787 1.00 37.79 ? 109 GLU C C   1 
ATOM   4193 O O   . GLU C 1 115 ? -0.258  -8.372  -37.877 1.00 38.29 ? 109 GLU C O   1 
ATOM   4194 C CB  . GLU C 1 115 ? -2.857  -10.119 -38.013 1.00 37.76 ? 109 GLU C CB  1 
ATOM   4195 C CG  . GLU C 1 115 ? -4.180  -10.046 -37.273 1.00 38.84 ? 109 GLU C CG  1 
ATOM   4196 C CD  . GLU C 1 115 ? -4.882  -11.371 -37.107 1.00 42.33 ? 109 GLU C CD  1 
ATOM   4197 O OE1 . GLU C 1 115 ? -4.216  -12.446 -37.151 1.00 42.62 ? 109 GLU C OE1 1 
ATOM   4198 O OE2 . GLU C 1 115 ? -6.125  -11.314 -36.920 1.00 44.52 ? 109 GLU C OE2 1 
ATOM   4199 N N   . SER C 1 116 ? -0.591  -8.678  -40.047 1.00 38.13 ? 110 SER C N   1 
ATOM   4200 C CA  . SER C 1 116 ? 0.817   -8.569  -40.430 1.00 38.16 ? 110 SER C CA  1 
ATOM   4201 C C   . SER C 1 116 ? 1.256   -7.117  -40.734 1.00 38.81 ? 110 SER C C   1 
ATOM   4202 O O   . SER C 1 116 ? 2.464   -6.847  -40.945 1.00 38.80 ? 110 SER C O   1 
ATOM   4203 C CB  . SER C 1 116 ? 1.081   -9.422  -41.683 1.00 37.88 ? 110 SER C CB  1 
ATOM   4204 O OG  . SER C 1 116 ? 0.551   -10.716 -41.568 1.00 37.92 ? 110 SER C OG  1 
ATOM   4205 N N   . ALA C 1 117 ? 0.292   -6.198  -40.803 1.00 38.62 ? 111 ALA C N   1 
ATOM   4206 C CA  . ALA C 1 117 ? 0.587   -4.840  -41.223 1.00 39.05 ? 111 ALA C CA  1 
ATOM   4207 C C   . ALA C 1 117 ? 0.427   -3.871  -40.086 1.00 39.92 ? 111 ALA C C   1 
ATOM   4208 O O   . ALA C 1 117 ? 0.924   -2.754  -40.141 1.00 40.35 ? 111 ALA C O   1 
ATOM   4209 C CB  . ALA C 1 117 ? -0.304  -4.441  -42.317 1.00 39.39 ? 111 ALA C CB  1 
ATOM   4210 N N   . PHE C 1 118 ? -0.245  -4.313  -39.040 1.00 41.11 ? 112 PHE C N   1 
ATOM   4211 C CA  . PHE C 1 118 ? -0.681  -3.433  -37.991 1.00 42.17 ? 112 PHE C CA  1 
ATOM   4212 C C   . PHE C 1 118 ? 0.411   -2.521  -37.428 1.00 42.48 ? 112 PHE C C   1 
ATOM   4213 O O   . PHE C 1 118 ? 0.307   -1.298  -37.470 1.00 42.92 ? 112 PHE C O   1 
ATOM   4214 C CB  . PHE C 1 118 ? -1.315  -4.251  -36.876 1.00 43.02 ? 112 PHE C CB  1 
ATOM   4215 C CG  . PHE C 1 118 ? -1.651  -3.436  -35.678 1.00 44.42 ? 112 PHE C CG  1 
ATOM   4216 C CD1 . PHE C 1 118 ? -2.557  -2.371  -35.778 1.00 46.23 ? 112 PHE C CD1 1 
ATOM   4217 C CD2 . PHE C 1 118 ? -1.040  -3.692  -34.469 1.00 44.39 ? 112 PHE C CD2 1 
ATOM   4218 C CE1 . PHE C 1 118 ? -2.880  -1.581  -34.667 1.00 46.99 ? 112 PHE C CE1 1 
ATOM   4219 C CE2 . PHE C 1 118 ? -1.341  -2.921  -33.365 1.00 46.79 ? 112 PHE C CE2 1 
ATOM   4220 C CZ  . PHE C 1 118 ? -2.273  -1.855  -33.466 1.00 47.60 ? 112 PHE C CZ  1 
ATOM   4221 N N   . LEU C 1 119 ? 1.449   -3.121  -36.889 1.00 42.86 ? 113 LEU C N   1 
ATOM   4222 C CA  . LEU C 1 119 ? 2.510   -2.371  -36.301 1.00 43.44 ? 113 LEU C CA  1 
ATOM   4223 C C   . LEU C 1 119 ? 3.058   -1.328  -37.287 1.00 43.79 ? 113 LEU C C   1 
ATOM   4224 O O   . LEU C 1 119 ? 3.069   -0.125  -36.982 1.00 44.55 ? 113 LEU C O   1 
ATOM   4225 C CB  . LEU C 1 119 ? 3.585   -3.329  -35.813 1.00 43.49 ? 113 LEU C CB  1 
ATOM   4226 C CG  . LEU C 1 119 ? 4.132   -2.975  -34.428 1.00 45.95 ? 113 LEU C CG  1 
ATOM   4227 C CD1 . LEU C 1 119 ? 3.031   -2.915  -33.372 1.00 45.19 ? 113 LEU C CD1 1 
ATOM   4228 C CD2 . LEU C 1 119 ? 5.239   -3.953  -34.018 1.00 48.38 ? 113 LEU C CD2 1 
ATOM   4229 N N   . GLU C 1 120 ? 3.471   -1.764  -38.472 1.00 43.55 ? 114 GLU C N   1 
ATOM   4230 C CA  . GLU C 1 120 ? 3.904   -0.833  -39.495 1.00 43.69 ? 114 GLU C CA  1 
ATOM   4231 C C   . GLU C 1 120 ? 2.886   0.278   -39.714 1.00 42.98 ? 114 GLU C C   1 
ATOM   4232 O O   . GLU C 1 120 ? 3.236   1.459   -39.712 1.00 43.42 ? 114 GLU C O   1 
ATOM   4233 C CB  . GLU C 1 120 ? 4.091   -1.559  -40.806 1.00 44.52 ? 114 GLU C CB  1 
ATOM   4234 C CG  . GLU C 1 120 ? 5.143   -2.634  -40.809 1.00 47.81 ? 114 GLU C CG  1 
ATOM   4235 C CD  . GLU C 1 120 ? 4.862   -3.636  -41.919 1.00 54.20 ? 114 GLU C CD  1 
ATOM   4236 O OE1 . GLU C 1 120 ? 4.434   -4.778  -41.601 1.00 56.24 ? 114 GLU C OE1 1 
ATOM   4237 O OE2 . GLU C 1 120 ? 5.022   -3.270  -43.116 1.00 56.79 ? 114 GLU C OE2 1 
ATOM   4238 N N   . LEU C 1 121 ? 1.630   -0.107  -39.913 1.00 41.76 ? 115 LEU C N   1 
ATOM   4239 C CA  . LEU C 1 121 ? 0.540   0.836   -40.142 1.00 40.42 ? 115 LEU C CA  1 
ATOM   4240 C C   . LEU C 1 121 ? 0.311   1.816   -38.993 1.00 40.66 ? 115 LEU C C   1 
ATOM   4241 O O   . LEU C 1 121 ? 0.226   3.030   -39.218 1.00 41.25 ? 115 LEU C O   1 
ATOM   4242 C CB  . LEU C 1 121 ? -0.745  0.081   -40.455 1.00 39.83 ? 115 LEU C CB  1 
ATOM   4243 C CG  . LEU C 1 121 ? -0.931  -0.547  -41.840 1.00 37.05 ? 115 LEU C CG  1 
ATOM   4244 C CD1 . LEU C 1 121 ? -2.305  -1.190  -41.915 1.00 34.11 ? 115 LEU C CD1 1 
ATOM   4245 C CD2 . LEU C 1 121 ? -0.752  0.467   -42.975 1.00 35.23 ? 115 LEU C CD2 1 
ATOM   4246 N N   . PHE C 1 122 ? 0.216   1.309   -37.764 1.00 40.69 ? 116 PHE C N   1 
ATOM   4247 C CA  . PHE C 1 122 ? 0.206   2.174   -36.559 1.00 40.23 ? 116 PHE C CA  1 
ATOM   4248 C C   . PHE C 1 122 ? 1.330   3.206   -36.603 1.00 40.42 ? 116 PHE C C   1 
ATOM   4249 O O   . PHE C 1 122 ? 1.073   4.402   -36.530 1.00 40.58 ? 116 PHE C O   1 
ATOM   4250 C CB  . PHE C 1 122 ? 0.345   1.330   -35.303 1.00 40.30 ? 116 PHE C CB  1 
ATOM   4251 C CG  . PHE C 1 122 ? 0.329   2.118   -34.018 1.00 40.94 ? 116 PHE C CG  1 
ATOM   4252 C CD1 . PHE C 1 122 ? -0.777  2.875   -33.648 1.00 41.35 ? 116 PHE C CD1 1 
ATOM   4253 C CD2 . PHE C 1 122 ? 1.404   2.066   -33.147 1.00 41.84 ? 116 PHE C CD2 1 
ATOM   4254 C CE1 . PHE C 1 122 ? -0.786  3.595   -32.466 1.00 38.07 ? 116 PHE C CE1 1 
ATOM   4255 C CE2 . PHE C 1 122 ? 1.391   2.779   -31.949 1.00 39.23 ? 116 PHE C CE2 1 
ATOM   4256 C CZ  . PHE C 1 122 ? 0.299   3.526   -31.617 1.00 39.62 ? 116 PHE C CZ  1 
ATOM   4257 N N   . ILE C 1 123 ? 2.573   2.749   -36.746 1.00 40.24 ? 117 ILE C N   1 
ATOM   4258 C CA  . ILE C 1 123 ? 3.713   3.663   -36.849 1.00 40.26 ? 117 ILE C CA  1 
ATOM   4259 C C   . ILE C 1 123 ? 3.597   4.721   -37.967 1.00 40.82 ? 117 ILE C C   1 
ATOM   4260 O O   . ILE C 1 123 ? 3.663   5.918   -37.690 1.00 40.53 ? 117 ILE C O   1 
ATOM   4261 C CB  . ILE C 1 123 ? 4.981   2.898   -37.089 1.00 40.04 ? 117 ILE C CB  1 
ATOM   4262 C CG1 . ILE C 1 123 ? 5.273   1.990   -35.904 1.00 40.29 ? 117 ILE C CG1 1 
ATOM   4263 C CG2 . ILE C 1 123 ? 6.130   3.847   -37.345 1.00 39.91 ? 117 ILE C CG2 1 
ATOM   4264 C CD1 . ILE C 1 123 ? 6.469   1.095   -36.122 1.00 39.12 ? 117 ILE C CD1 1 
ATOM   4265 N N   . LEU C 1 124 ? 3.441   4.271   -39.217 1.00 41.19 ? 118 LEU C N   1 
ATOM   4266 C CA  . LEU C 1 124 ? 3.338   5.155   -40.373 1.00 41.34 ? 118 LEU C CA  1 
ATOM   4267 C C   . LEU C 1 124 ? 2.223   6.168   -40.178 1.00 42.39 ? 118 LEU C C   1 
ATOM   4268 O O   . LEU C 1 124 ? 2.420   7.400   -40.273 1.00 42.15 ? 118 LEU C O   1 
ATOM   4269 C CB  . LEU C 1 124 ? 3.031   4.342   -41.611 1.00 41.51 ? 118 LEU C CB  1 
ATOM   4270 C CG  . LEU C 1 124 ? 3.066   5.026   -42.974 1.00 41.60 ? 118 LEU C CG  1 
ATOM   4271 C CD1 . LEU C 1 124 ? 4.384   5.790   -43.128 1.00 42.30 ? 118 LEU C CD1 1 
ATOM   4272 C CD2 . LEU C 1 124 ? 2.911   3.964   -44.080 1.00 40.60 ? 118 LEU C CD2 1 
ATOM   4273 N N   . ARG C 1 125 ? 1.036   5.662   -39.891 1.00 42.70 ? 119 ARG C N   1 
ATOM   4274 C CA  . ARG C 1 125 ? -0.051  6.579   -39.698 1.00 43.69 ? 119 ARG C CA  1 
ATOM   4275 C C   . ARG C 1 125 ? 0.239   7.554   -38.532 1.00 44.26 ? 119 ARG C C   1 
ATOM   4276 O O   . ARG C 1 125 ? 0.183   8.772   -38.698 1.00 45.14 ? 119 ARG C O   1 
ATOM   4277 C CB  . ARG C 1 125 ? -1.339  5.813   -39.541 1.00 43.64 ? 119 ARG C CB  1 
ATOM   4278 C CG  . ARG C 1 125 ? -1.888  5.337   -40.864 1.00 43.67 ? 119 ARG C CG  1 
ATOM   4279 C CD  . ARG C 1 125 ? -2.903  4.237   -40.620 1.00 45.69 ? 119 ARG C CD  1 
ATOM   4280 N NE  . ARG C 1 125 ? -3.940  4.629   -39.653 1.00 46.00 ? 119 ARG C NE  1 
ATOM   4281 C CZ  . ARG C 1 125 ? -5.085  5.217   -39.984 1.00 45.05 ? 119 ARG C CZ  1 
ATOM   4282 N NH1 . ARG C 1 125 ? -5.349  5.481   -41.250 1.00 42.01 ? 119 ARG C NH1 1 
ATOM   4283 N NH2 . ARG C 1 125 ? -5.966  5.540   -39.041 1.00 48.14 ? 119 ARG C NH2 1 
ATOM   4284 N N   . LEU C 1 126 ? 0.604   7.016   -37.379 1.00 44.58 ? 120 LEU C N   1 
ATOM   4285 C CA  . LEU C 1 126 ? 1.018   7.831   -36.260 1.00 44.71 ? 120 LEU C CA  1 
ATOM   4286 C C   . LEU C 1 126 ? 2.049   8.871   -36.714 1.00 45.08 ? 120 LEU C C   1 
ATOM   4287 O O   . LEU C 1 126 ? 1.950   10.057  -36.390 1.00 45.03 ? 120 LEU C O   1 
ATOM   4288 C CB  . LEU C 1 126 ? 1.612   6.948   -35.147 1.00 44.44 ? 120 LEU C CB  1 
ATOM   4289 C CG  . LEU C 1 126 ? 2.067   7.739   -33.906 1.00 44.59 ? 120 LEU C CG  1 
ATOM   4290 C CD1 . LEU C 1 126 ? 0.963   8.683   -33.412 1.00 41.42 ? 120 LEU C CD1 1 
ATOM   4291 C CD2 . LEU C 1 126 ? 2.585   6.832   -32.762 1.00 44.02 ? 120 LEU C CD2 1 
ATOM   4292 N N   . ALA C 1 127 ? 3.038   8.409   -37.470 1.00 45.28 ? 121 ALA C N   1 
ATOM   4293 C CA  . ALA C 1 127 ? 4.174   9.242   -37.825 1.00 45.43 ? 121 ALA C CA  1 
ATOM   4294 C C   . ALA C 1 127 ? 3.720   10.378  -38.725 1.00 45.61 ? 121 ALA C C   1 
ATOM   4295 O O   . ALA C 1 127 ? 4.258   11.480  -38.646 1.00 45.53 ? 121 ALA C O   1 
ATOM   4296 C CB  . ALA C 1 127 ? 5.277   8.403   -38.492 1.00 44.91 ? 121 ALA C CB  1 
ATOM   4297 N N   . TYR C 1 128 ? 2.698   10.096  -39.540 1.00 45.86 ? 122 TYR C N   1 
ATOM   4298 C CA  . TYR C 1 128 ? 2.184   11.028  -40.542 1.00 45.74 ? 122 TYR C CA  1 
ATOM   4299 C C   . TYR C 1 128 ? 1.416   12.197  -39.968 1.00 46.45 ? 122 TYR C C   1 
ATOM   4300 O O   . TYR C 1 128 ? 1.506   13.303  -40.526 1.00 46.80 ? 122 TYR C O   1 
ATOM   4301 C CB  . TYR C 1 128 ? 1.268   10.325  -41.544 1.00 45.27 ? 122 TYR C CB  1 
ATOM   4302 C CG  . TYR C 1 128 ? 1.021   11.126  -42.801 1.00 43.95 ? 122 TYR C CG  1 
ATOM   4303 C CD1 . TYR C 1 128 ? 2.092   11.547  -43.602 1.00 44.92 ? 122 TYR C CD1 1 
ATOM   4304 C CD2 . TYR C 1 128 ? -0.272  11.455  -43.204 1.00 43.15 ? 122 TYR C CD2 1 
ATOM   4305 C CE1 . TYR C 1 128 ? 1.881   12.290  -44.774 1.00 43.92 ? 122 TYR C CE1 1 
ATOM   4306 C CE2 . TYR C 1 128 ? -0.502  12.195  -44.383 1.00 41.47 ? 122 TYR C CE2 1 
ATOM   4307 C CZ  . TYR C 1 128 ? 0.579   12.604  -45.149 1.00 43.08 ? 122 TYR C CZ  1 
ATOM   4308 O OH  . TYR C 1 128 ? 0.385   13.328  -46.294 1.00 43.56 ? 122 TYR C OH  1 
ATOM   4309 N N   . ARG C 1 129 ? 0.633   11.980  -38.906 1.00 46.55 ? 123 ARG C N   1 
ATOM   4310 C CA  . ARG C 1 129 ? -0.115  13.125  -38.366 1.00 47.13 ? 123 ARG C CA  1 
ATOM   4311 C C   . ARG C 1 129 ? 0.617   13.923  -37.301 1.00 47.85 ? 123 ARG C C   1 
ATOM   4312 O O   . ARG C 1 129 ? 0.214   15.044  -36.985 1.00 47.90 ? 123 ARG C O   1 
ATOM   4313 C CB  . ARG C 1 129 ? -1.560  12.805  -37.946 1.00 46.65 ? 123 ARG C CB  1 
ATOM   4314 C CG  . ARG C 1 129 ? -1.770  11.506  -37.352 1.00 45.88 ? 123 ARG C CG  1 
ATOM   4315 C CD  . ARG C 1 129 ? -3.243  11.279  -37.095 1.00 45.88 ? 123 ARG C CD  1 
ATOM   4316 N NE  . ARG C 1 129 ? -3.562  9.892   -37.443 1.00 50.14 ? 123 ARG C NE  1 
ATOM   4317 C CZ  . ARG C 1 129 ? -3.346  8.817   -36.676 1.00 49.89 ? 123 ARG C CZ  1 
ATOM   4318 N NH1 . ARG C 1 129 ? -2.838  8.934   -35.449 1.00 49.06 ? 123 ARG C NH1 1 
ATOM   4319 N NH2 . ARG C 1 129 ? -3.652  7.609   -37.151 1.00 50.33 ? 123 ARG C NH2 1 
ATOM   4320 N N   . SER C 1 130 ? 1.712   13.363  -36.793 1.00 48.85 ? 124 SER C N   1 
ATOM   4321 C CA  . SER C 1 130 ? 2.384   13.920  -35.635 1.00 49.87 ? 124 SER C CA  1 
ATOM   4322 C C   . SER C 1 130 ? 3.277   15.118  -35.993 1.00 51.29 ? 124 SER C C   1 
ATOM   4323 O O   . SER C 1 130 ? 3.850   15.184  -37.085 1.00 51.84 ? 124 SER C O   1 
ATOM   4324 C CB  . SER C 1 130 ? 3.153   12.826  -34.905 1.00 49.55 ? 124 SER C CB  1 
ATOM   4325 O OG  . SER C 1 130 ? 2.276   12.047  -34.106 1.00 48.65 ? 124 SER C OG  1 
ATOM   4326 N N   . LYS C 1 131 ? 3.364   16.080  -35.082 1.00 52.25 ? 125 LYS C N   1 
ATOM   4327 C CA  . LYS C 1 131 ? 4.115   17.281  -35.338 1.00 53.42 ? 125 LYS C CA  1 
ATOM   4328 C C   . LYS C 1 131 ? 5.364   17.181  -34.510 1.00 53.70 ? 125 LYS C C   1 
ATOM   4329 O O   . LYS C 1 131 ? 5.404   17.653  -33.378 1.00 53.35 ? 125 LYS C O   1 
ATOM   4330 C CB  . LYS C 1 131 ? 3.281   18.507  -34.993 1.00 53.94 ? 125 LYS C CB  1 
ATOM   4331 C CG  . LYS C 1 131 ? 2.111   18.695  -35.965 1.00 56.50 ? 125 LYS C CG  1 
ATOM   4332 C CD  . LYS C 1 131 ? 0.786   19.037  -35.258 1.00 60.70 ? 125 LYS C CD  1 
ATOM   4333 C CE  . LYS C 1 131 ? 0.760   20.464  -34.682 1.00 62.79 ? 125 LYS C CE  1 
ATOM   4334 N NZ  . LYS C 1 131 ? 1.040   21.540  -35.704 1.00 64.51 ? 125 LYS C NZ  1 
ATOM   4335 N N   . PRO C 1 132 ? 6.390   16.516  -35.074 1.00 54.38 ? 126 PRO C N   1 
ATOM   4336 C CA  . PRO C 1 132 ? 7.637   16.188  -34.380 1.00 54.63 ? 126 PRO C CA  1 
ATOM   4337 C C   . PRO C 1 132 ? 8.370   17.415  -33.896 1.00 55.46 ? 126 PRO C C   1 
ATOM   4338 O O   . PRO C 1 132 ? 9.122   17.306  -32.917 1.00 55.87 ? 126 PRO C O   1 
ATOM   4339 C CB  . PRO C 1 132 ? 8.480   15.485  -35.437 1.00 54.32 ? 126 PRO C CB  1 
ATOM   4340 C CG  . PRO C 1 132 ? 7.817   15.736  -36.721 1.00 54.82 ? 126 PRO C CG  1 
ATOM   4341 C CD  . PRO C 1 132 ? 6.389   16.039  -36.466 1.00 54.28 ? 126 PRO C CD  1 
ATOM   4342 N N   . GLY C 1 133 ? 8.155   18.554  -34.576 1.00 55.62 ? 127 GLY C N   1 
ATOM   4343 C CA  . GLY C 1 133 ? 8.694   19.839  -34.148 1.00 55.47 ? 127 GLY C CA  1 
ATOM   4344 C C   . GLY C 1 133 ? 8.219   20.177  -32.750 1.00 55.60 ? 127 GLY C C   1 
ATOM   4345 O O   . GLY C 1 133 ? 9.000   20.163  -31.818 1.00 55.61 ? 127 GLY C O   1 
ATOM   4346 N N   . GLU C 1 134 ? 6.924   20.453  -32.611 1.00 55.94 ? 128 GLU C N   1 
ATOM   4347 C CA  . GLU C 1 134 ? 6.288   20.776  -31.325 1.00 56.15 ? 128 GLU C CA  1 
ATOM   4348 C C   . GLU C 1 134 ? 6.347   19.633  -30.283 1.00 55.96 ? 128 GLU C C   1 
ATOM   4349 O O   . GLU C 1 134 ? 5.831   19.782  -29.161 1.00 55.90 ? 128 GLU C O   1 
ATOM   4350 C CB  . GLU C 1 134 ? 4.828   21.179  -31.560 1.00 56.08 ? 128 GLU C CB  1 
ATOM   4351 C CG  . GLU C 1 134 ? 4.625   22.399  -32.446 1.00 58.26 ? 128 GLU C CG  1 
ATOM   4352 C CD  . GLU C 1 134 ? 3.248   22.407  -33.124 1.00 62.30 ? 128 GLU C CD  1 
ATOM   4353 O OE1 . GLU C 1 134 ? 2.242   22.011  -32.479 1.00 64.38 ? 128 GLU C OE1 1 
ATOM   4354 O OE2 . GLU C 1 134 ? 3.164   22.794  -34.316 1.00 62.58 ? 128 GLU C OE2 1 
ATOM   4355 N N   . GLY C 1 135 ? 6.954   18.504  -30.661 1.00 55.63 ? 129 GLY C N   1 
ATOM   4356 C CA  . GLY C 1 135 ? 7.122   17.354  -29.770 1.00 55.53 ? 129 GLY C CA  1 
ATOM   4357 C C   . GLY C 1 135 ? 5.818   16.636  -29.508 1.00 55.65 ? 129 GLY C C   1 
ATOM   4358 O O   . GLY C 1 135 ? 5.641   15.978  -28.486 1.00 55.52 ? 129 GLY C O   1 
ATOM   4359 N N   . LYS C 1 136 ? 4.900   16.756  -30.452 1.00 55.88 ? 130 LYS C N   1 
ATOM   4360 C CA  . LYS C 1 136 ? 3.555   16.253  -30.261 1.00 56.07 ? 130 LYS C CA  1 
ATOM   4361 C C   . LYS C 1 136 ? 3.272   15.003  -31.073 1.00 56.02 ? 130 LYS C C   1 
ATOM   4362 O O   . LYS C 1 136 ? 3.476   14.949  -32.273 1.00 55.53 ? 130 LYS C O   1 
ATOM   4363 C CB  . LYS C 1 136 ? 2.527   17.340  -30.586 1.00 56.15 ? 130 LYS C CB  1 
ATOM   4364 C CG  . LYS C 1 136 ? 2.782   18.625  -29.860 1.00 55.52 ? 130 LYS C CG  1 
ATOM   4365 C CD  . LYS C 1 136 ? 1.710   19.596  -30.177 1.00 56.00 ? 130 LYS C CD  1 
ATOM   4366 C CE  . LYS C 1 136 ? 1.865   20.857  -29.384 1.00 55.23 ? 130 LYS C CE  1 
ATOM   4367 N NZ  . LYS C 1 136 ? 0.748   21.724  -29.809 1.00 56.02 ? 130 LYS C NZ  1 
ATOM   4368 N N   . LEU C 1 137 ? 2.799   13.996  -30.372 1.00 56.61 ? 131 LEU C N   1 
ATOM   4369 C CA  . LEU C 1 137 ? 2.349   12.792  -30.986 1.00 57.35 ? 131 LEU C CA  1 
ATOM   4370 C C   . LEU C 1 137 ? 0.856   12.888  -30.994 1.00 58.31 ? 131 LEU C C   1 
ATOM   4371 O O   . LEU C 1 137 ? 0.265   13.427  -30.047 1.00 58.42 ? 131 LEU C O   1 
ATOM   4372 C CB  . LEU C 1 137 ? 2.795   11.624  -30.138 1.00 57.26 ? 131 LEU C CB  1 
ATOM   4373 C CG  . LEU C 1 137 ? 4.300   11.677  -30.245 1.00 56.15 ? 131 LEU C CG  1 
ATOM   4374 C CD1 . LEU C 1 137 ? 4.901   11.521  -28.909 1.00 55.23 ? 131 LEU C CD1 1 
ATOM   4375 C CD2 . LEU C 1 137 ? 4.754   10.636  -31.214 1.00 55.33 ? 131 LEU C CD2 1 
ATOM   4376 N N   . ILE C 1 138 ? 0.247   12.394  -32.066 1.00 58.95 ? 132 ILE C N   1 
ATOM   4377 C CA  . ILE C 1 138 ? -1.188  12.493  -32.231 1.00 59.84 ? 132 ILE C CA  1 
ATOM   4378 C C   . ILE C 1 138 ? -1.753  11.143  -32.608 1.00 60.68 ? 132 ILE C C   1 
ATOM   4379 O O   . ILE C 1 138 ? -1.420  10.593  -33.649 1.00 61.00 ? 132 ILE C O   1 
ATOM   4380 C CB  . ILE C 1 138 ? -1.600  13.543  -33.304 1.00 60.00 ? 132 ILE C CB  1 
ATOM   4381 C CG1 . ILE C 1 138 ? -0.978  14.924  -33.009 1.00 60.19 ? 132 ILE C CG1 1 
ATOM   4382 C CG2 . ILE C 1 138 ? -3.127  13.625  -33.386 1.00 59.35 ? 132 ILE C CG2 1 
ATOM   4383 C CD1 . ILE C 1 138 ? -1.235  16.030  -34.064 1.00 59.35 ? 132 ILE C CD1 1 
ATOM   4384 N N   . PHE C 1 139 ? -2.633  10.619  -31.769 1.00 61.63 ? 133 PHE C N   1 
ATOM   4385 C CA  . PHE C 1 139 ? -3.195  9.305   -32.011 1.00 62.62 ? 133 PHE C CA  1 
ATOM   4386 C C   . PHE C 1 139 ? -4.507  9.390   -32.750 1.00 63.31 ? 133 PHE C C   1 
ATOM   4387 O O   . PHE C 1 139 ? -5.099  10.458  -32.820 1.00 63.44 ? 133 PHE C O   1 
ATOM   4388 C CB  . PHE C 1 139 ? -3.276  8.539   -30.696 1.00 62.58 ? 133 PHE C CB  1 
ATOM   4389 C CG  . PHE C 1 139 ? -1.919  8.258   -30.118 1.00 62.64 ? 133 PHE C CG  1 
ATOM   4390 C CD1 . PHE C 1 139 ? -1.382  9.085   -29.130 1.00 61.62 ? 133 PHE C CD1 1 
ATOM   4391 C CD2 . PHE C 1 139 ? -1.142  7.224   -30.628 1.00 60.77 ? 133 PHE C CD2 1 
ATOM   4392 C CE1 . PHE C 1 139 ? -0.132  8.853   -28.630 1.00 60.26 ? 133 PHE C CE1 1 
ATOM   4393 C CE2 . PHE C 1 139 ? 0.108   6.986   -30.127 1.00 61.30 ? 133 PHE C CE2 1 
ATOM   4394 C CZ  . PHE C 1 139 ? 0.615   7.807   -29.119 1.00 62.14 ? 133 PHE C CZ  1 
ATOM   4395 N N   . CYS C 1 140 ? -4.936  8.282   -33.347 1.00 64.47 ? 134 CYS C N   1 
ATOM   4396 C CA  . CYS C 1 140 ? -6.130  8.311   -34.207 1.00 65.63 ? 134 CYS C CA  1 
ATOM   4397 C C   . CYS C 1 140 ? -7.423  8.379   -33.418 1.00 65.58 ? 134 CYS C C   1 
ATOM   4398 O O   . CYS C 1 140 ? -8.508  8.523   -34.004 1.00 65.73 ? 134 CYS C O   1 
ATOM   4399 C CB  . CYS C 1 140 ? -6.175  7.135   -35.179 1.00 65.86 ? 134 CYS C CB  1 
ATOM   4400 S SG  . CYS C 1 140 ? -6.030  5.537   -34.405 1.00 68.99 ? 134 CYS C SG  1 
ATOM   4401 N N   . SER C 1 141 ? -7.303  8.290   -32.093 1.00 65.50 ? 135 SER C N   1 
ATOM   4402 C CA  . SER C 1 141 ? -8.432  8.598   -31.211 1.00 65.37 ? 135 SER C CA  1 
ATOM   4403 C C   . SER C 1 141 ? -8.504  10.097  -30.909 1.00 64.53 ? 135 SER C C   1 
ATOM   4404 O O   . SER C 1 141 ? -8.987  10.481  -29.862 1.00 64.65 ? 135 SER C O   1 
ATOM   4405 C CB  . SER C 1 141 ? -8.369  7.762   -29.922 1.00 65.49 ? 135 SER C CB  1 
ATOM   4406 O OG  . SER C 1 141 ? -7.030  7.555   -29.514 1.00 66.35 ? 135 SER C OG  1 
ATOM   4407 N N   . GLY C 1 142 ? -8.024  10.923  -31.842 1.00 63.84 ? 136 GLY C N   1 
ATOM   4408 C CA  . GLY C 1 142 ? -7.908  12.376  -31.679 1.00 63.25 ? 136 GLY C CA  1 
ATOM   4409 C C   . GLY C 1 142 ? -7.017  12.878  -30.533 1.00 63.02 ? 136 GLY C C   1 
ATOM   4410 O O   . GLY C 1 142 ? -6.860  14.094  -30.347 1.00 63.12 ? 136 GLY C O   1 
ATOM   4411 N N   . LEU C 1 143 ? -6.433  11.942  -29.774 1.00 62.10 ? 137 LEU C N   1 
ATOM   4412 C CA  . LEU C 1 143 ? -5.634  12.226  -28.570 1.00 60.74 ? 137 LEU C CA  1 
ATOM   4413 C C   . LEU C 1 143 ? -4.259  12.833  -28.869 1.00 60.28 ? 137 LEU C C   1 
ATOM   4414 O O   . LEU C 1 143 ? -3.554  12.366  -29.768 1.00 60.50 ? 137 LEU C O   1 
ATOM   4415 C CB  . LEU C 1 143 ? -5.453  10.929  -27.771 1.00 60.64 ? 137 LEU C CB  1 
ATOM   4416 C CG  . LEU C 1 143 ? -4.794  10.986  -26.399 1.00 59.79 ? 137 LEU C CG  1 
ATOM   4417 C CD1 . LEU C 1 143 ? -5.522  11.975  -25.479 1.00 59.42 ? 137 LEU C CD1 1 
ATOM   4418 C CD2 . LEU C 1 143 ? -4.757  9.592   -25.797 1.00 59.87 ? 137 LEU C CD2 1 
ATOM   4419 N N   . VAL C 1 144 ? -3.878  13.858  -28.105 1.00 59.28 ? 138 VAL C N   1 
ATOM   4420 C CA  . VAL C 1 144 ? -2.542  14.469  -28.232 1.00 58.31 ? 138 VAL C CA  1 
ATOM   4421 C C   . VAL C 1 144 ? -1.693  14.192  -26.972 1.00 57.77 ? 138 VAL C C   1 
ATOM   4422 O O   . VAL C 1 144 ? -2.122  14.476  -25.849 1.00 57.81 ? 138 VAL C O   1 
ATOM   4423 C CB  . VAL C 1 144 ? -2.596  16.013  -28.518 1.00 58.20 ? 138 VAL C CB  1 
ATOM   4424 C CG1 . VAL C 1 144 ? -1.235  16.527  -28.962 1.00 57.73 ? 138 VAL C CG1 1 
ATOM   4425 C CG2 . VAL C 1 144 ? -3.654  16.360  -29.564 1.00 57.67 ? 138 VAL C CG2 1 
ATOM   4426 N N   . LEU C 1 145 ? -0.504  13.624  -27.171 1.00 56.55 ? 139 LEU C N   1 
ATOM   4427 C CA  . LEU C 1 145 ? 0.434   13.373  -26.092 1.00 55.71 ? 139 LEU C CA  1 
ATOM   4428 C C   . LEU C 1 145 ? 1.770   13.969  -26.473 1.00 55.72 ? 139 LEU C C   1 
ATOM   4429 O O   . LEU C 1 145 ? 2.198   13.819  -27.624 1.00 56.37 ? 139 LEU C O   1 
ATOM   4430 C CB  . LEU C 1 145 ? 0.587   11.874  -25.870 1.00 54.84 ? 139 LEU C CB  1 
ATOM   4431 C CG  . LEU C 1 145 ? -0.083  11.254  -24.649 1.00 54.91 ? 139 LEU C CG  1 
ATOM   4432 C CD1 . LEU C 1 145 ? -1.336  12.023  -24.164 1.00 54.64 ? 139 LEU C CD1 1 
ATOM   4433 C CD2 . LEU C 1 145 ? -0.420  9.813   -24.910 1.00 53.84 ? 139 LEU C CD2 1 
ATOM   4434 N N   . HIS C 1 146 ? 2.420   14.647  -25.530 1.00 55.19 ? 140 HIS C N   1 
ATOM   4435 C CA  . HIS C 1 146 ? 3.761   15.152  -25.766 1.00 55.33 ? 140 HIS C CA  1 
ATOM   4436 C C   . HIS C 1 146 ? 4.766   13.998  -25.667 1.00 55.82 ? 140 HIS C C   1 
ATOM   4437 O O   . HIS C 1 146 ? 4.640   13.111  -24.804 1.00 55.96 ? 140 HIS C O   1 
ATOM   4438 C CB  . HIS C 1 146 ? 4.115   16.267  -24.771 1.00 55.28 ? 140 HIS C CB  1 
ATOM   4439 C CG  . HIS C 1 146 ? 5.545   16.729  -24.847 1.00 54.96 ? 140 HIS C CG  1 
ATOM   4440 N ND1 . HIS C 1 146 ? 5.933   17.857  -25.541 1.00 55.55 ? 140 HIS C ND1 1 
ATOM   4441 C CD2 . HIS C 1 146 ? 6.677   16.223  -24.300 1.00 53.98 ? 140 HIS C CD2 1 
ATOM   4442 C CE1 . HIS C 1 146 ? 7.242   18.015  -25.434 1.00 53.25 ? 140 HIS C CE1 1 
ATOM   4443 N NE2 . HIS C 1 146 ? 7.719   17.033  -24.691 1.00 52.24 ? 140 HIS C NE2 1 
ATOM   4444 N N   . ARG C 1 147 ? 5.748   14.022  -26.573 1.00 55.64 ? 141 ARG C N   1 
ATOM   4445 C CA  . ARG C 1 147 ? 6.955   13.184  -26.536 1.00 55.58 ? 141 ARG C CA  1 
ATOM   4446 C C   . ARG C 1 147 ? 7.237   12.490  -25.201 1.00 55.60 ? 141 ARG C C   1 
ATOM   4447 O O   . ARG C 1 147 ? 7.385   11.268  -25.141 1.00 55.66 ? 141 ARG C O   1 
ATOM   4448 C CB  . ARG C 1 147 ? 8.167   14.056  -26.887 1.00 55.47 ? 141 ARG C CB  1 
ATOM   4449 C CG  . ARG C 1 147 ? 9.301   13.315  -27.537 1.00 56.33 ? 141 ARG C CG  1 
ATOM   4450 C CD  . ARG C 1 147 ? 10.491  14.203  -27.757 1.00 55.66 ? 141 ARG C CD  1 
ATOM   4451 N NE  . ARG C 1 147 ? 11.485  13.884  -26.752 1.00 58.28 ? 141 ARG C NE  1 
ATOM   4452 C CZ  . ARG C 1 147 ? 12.763  14.239  -26.810 1.00 59.93 ? 141 ARG C CZ  1 
ATOM   4453 N NH1 . ARG C 1 147 ? 13.239  14.941  -27.851 1.00 61.66 ? 141 ARG C NH1 1 
ATOM   4454 N NH2 . ARG C 1 147 ? 13.572  13.875  -25.826 1.00 58.74 ? 141 ARG C NH2 1 
ATOM   4455 N N   . LEU C 1 148 ? 7.319   13.295  -24.145 1.00 55.51 ? 142 LEU C N   1 
ATOM   4456 C CA  . LEU C 1 148 ? 7.824   12.868  -22.852 1.00 55.57 ? 142 LEU C CA  1 
ATOM   4457 C C   . LEU C 1 148 ? 6.726   12.263  -21.984 1.00 55.82 ? 142 LEU C C   1 
ATOM   4458 O O   . LEU C 1 148 ? 6.964   11.878  -20.849 1.00 55.79 ? 142 LEU C O   1 
ATOM   4459 C CB  . LEU C 1 148 ? 8.545   14.034  -22.131 1.00 55.28 ? 142 LEU C CB  1 
ATOM   4460 C CG  . LEU C 1 148 ? 9.904   14.455  -22.718 1.00 54.31 ? 142 LEU C CG  1 
ATOM   4461 C CD1 . LEU C 1 148 ? 10.427  15.750  -22.136 1.00 51.62 ? 142 LEU C CD1 1 
ATOM   4462 C CD2 . LEU C 1 148 ? 10.965  13.345  -22.584 1.00 54.42 ? 142 LEU C CD2 1 
ATOM   4463 N N   . GLN C 1 149 ? 5.519   12.186  -22.518 1.00 55.89 ? 143 GLN C N   1 
ATOM   4464 C CA  . GLN C 1 149 ? 4.513   11.360  -21.901 1.00 55.86 ? 143 GLN C CA  1 
ATOM   4465 C C   . GLN C 1 149 ? 4.591   10.001  -22.568 1.00 56.00 ? 143 GLN C C   1 
ATOM   4466 O O   . GLN C 1 149 ? 4.655   8.995   -21.903 1.00 55.82 ? 143 GLN C O   1 
ATOM   4467 C CB  . GLN C 1 149 ? 3.141   11.992  -22.058 1.00 55.78 ? 143 GLN C CB  1 
ATOM   4468 C CG  . GLN C 1 149 ? 2.978   13.252  -21.220 1.00 55.73 ? 143 GLN C CG  1 
ATOM   4469 C CD  . GLN C 1 149 ? 1.679   13.979  -21.486 1.00 54.96 ? 143 GLN C CD  1 
ATOM   4470 O OE1 . GLN C 1 149 ? 1.462   14.509  -22.578 1.00 56.16 ? 143 GLN C OE1 1 
ATOM   4471 N NE2 . GLN C 1 149 ? 0.814   14.021  -20.486 1.00 53.49 ? 143 GLN C NE2 1 
ATOM   4472 N N   . CYS C 1 150 ? 4.629   9.986   -23.894 1.00 56.79 ? 144 CYS C N   1 
ATOM   4473 C CA  . CYS C 1 150 ? 4.717   8.742   -24.655 1.00 57.68 ? 144 CYS C CA  1 
ATOM   4474 C C   . CYS C 1 150 ? 5.955   7.948   -24.307 1.00 58.32 ? 144 CYS C C   1 
ATOM   4475 O O   . CYS C 1 150 ? 5.962   6.705   -24.365 1.00 58.50 ? 144 CYS C O   1 
ATOM   4476 C CB  . CYS C 1 150 ? 4.751   9.036   -26.134 1.00 57.21 ? 144 CYS C CB  1 
ATOM   4477 S SG  . CYS C 1 150 ? 3.199   9.641   -26.702 1.00 58.32 ? 144 CYS C SG  1 
ATOM   4478 N N   . ALA C 1 151 ? 7.004   8.670   -23.934 1.00 58.78 ? 145 ALA C N   1 
ATOM   4479 C CA  . ALA C 1 151 ? 8.270   8.029   -23.670 1.00 59.15 ? 145 ALA C CA  1 
ATOM   4480 C C   . ALA C 1 151 ? 8.116   7.034   -22.526 1.00 59.21 ? 145 ALA C C   1 
ATOM   4481 O O   . ALA C 1 151 ? 8.984   6.213   -22.325 1.00 59.26 ? 145 ALA C O   1 
ATOM   4482 C CB  . ALA C 1 151 ? 9.358   9.066   -23.384 1.00 58.84 ? 145 ALA C CB  1 
ATOM   4483 N N   . ARG C 1 152 ? 6.998   7.083   -21.804 1.00 59.80 ? 146 ARG C N   1 
ATOM   4484 C CA  . ARG C 1 152 ? 6.785   6.155   -20.677 1.00 61.05 ? 146 ARG C CA  1 
ATOM   4485 C C   . ARG C 1 152 ? 6.158   4.794   -21.032 1.00 60.98 ? 146 ARG C C   1 
ATOM   4486 O O   . ARG C 1 152 ? 6.525   3.765   -20.431 1.00 60.71 ? 146 ARG C O   1 
ATOM   4487 C CB  . ARG C 1 152 ? 6.053   6.823   -19.514 1.00 61.26 ? 146 ARG C CB  1 
ATOM   4488 C CG  . ARG C 1 152 ? 6.995   7.331   -18.433 1.00 63.78 ? 146 ARG C CG  1 
ATOM   4489 C CD  . ARG C 1 152 ? 6.227   8.124   -17.379 1.00 68.43 ? 146 ARG C CD  1 
ATOM   4490 N NE  . ARG C 1 152 ? 7.032   8.436   -16.191 1.00 71.64 ? 146 ARG C NE  1 
ATOM   4491 C CZ  . ARG C 1 152 ? 6.999   7.754   -15.041 1.00 73.26 ? 146 ARG C CZ  1 
ATOM   4492 N NH1 . ARG C 1 152 ? 6.207   6.685   -14.894 1.00 72.62 ? 146 ARG C NH1 1 
ATOM   4493 N NH2 . ARG C 1 152 ? 7.767   8.149   -14.025 1.00 73.91 ? 146 ARG C NH2 1 
ATOM   4494 N N   . GLY C 1 153 ? 5.233   4.794   -21.999 1.00 60.81 ? 147 GLY C N   1 
ATOM   4495 C CA  . GLY C 1 153 ? 4.714   3.550   -22.585 1.00 60.21 ? 147 GLY C CA  1 
ATOM   4496 C C   . GLY C 1 153 ? 5.622   2.993   -23.675 1.00 59.96 ? 147 GLY C C   1 
ATOM   4497 O O   . GLY C 1 153 ? 5.988   1.821   -23.664 1.00 59.66 ? 147 GLY C O   1 
ATOM   4498 N N   . PHE C 1 154 ? 5.996   3.849   -24.618 1.00 59.92 ? 148 PHE C N   1 
ATOM   4499 C CA  . PHE C 1 154 ? 6.861   3.451   -25.731 1.00 59.52 ? 148 PHE C CA  1 
ATOM   4500 C C   . PHE C 1 154 ? 8.327   3.323   -25.338 1.00 58.95 ? 148 PHE C C   1 
ATOM   4501 O O   . PHE C 1 154 ? 9.021   2.446   -25.829 1.00 59.11 ? 148 PHE C O   1 
ATOM   4502 C CB  . PHE C 1 154 ? 6.785   4.470   -26.869 1.00 59.96 ? 148 PHE C CB  1 
ATOM   4503 C CG  . PHE C 1 154 ? 5.434   4.600   -27.509 1.00 59.92 ? 148 PHE C CG  1 
ATOM   4504 C CD1 . PHE C 1 154 ? 4.357   5.128   -26.807 1.00 61.47 ? 148 PHE C CD1 1 
ATOM   4505 C CD2 . PHE C 1 154 ? 5.261   4.252   -28.835 1.00 59.54 ? 148 PHE C CD2 1 
ATOM   4506 C CE1 . PHE C 1 154 ? 3.124   5.273   -27.407 1.00 62.12 ? 148 PHE C CE1 1 
ATOM   4507 C CE2 . PHE C 1 154 ? 4.037   4.392   -29.446 1.00 61.43 ? 148 PHE C CE2 1 
ATOM   4508 C CZ  . PHE C 1 154 ? 2.961   4.911   -28.736 1.00 61.82 ? 148 PHE C CZ  1 
ATOM   4509 N N   . GLY C 1 155 ? 8.816   4.225   -24.495 1.00 58.32 ? 149 GLY C N   1 
ATOM   4510 C CA  . GLY C 1 155 ? 10.234  4.230   -24.155 1.00 57.65 ? 149 GLY C CA  1 
ATOM   4511 C C   . GLY C 1 155 ? 11.059  4.843   -25.260 1.00 57.13 ? 149 GLY C C   1 
ATOM   4512 O O   . GLY C 1 155 ? 10.547  5.642   -26.042 1.00 57.39 ? 149 GLY C O   1 
ATOM   4513 N N   . ASP C 1 156 ? 12.331  4.457   -25.334 1.00 56.79 ? 150 ASP C N   1 
ATOM   4514 C CA  . ASP C 1 156 ? 13.273  4.966   -26.349 1.00 56.53 ? 150 ASP C CA  1 
ATOM   4515 C C   . ASP C 1 156 ? 12.665  4.967   -27.769 1.00 55.25 ? 150 ASP C C   1 
ATOM   4516 O O   . ASP C 1 156 ? 12.955  5.862   -28.578 1.00 55.30 ? 150 ASP C O   1 
ATOM   4517 C CB  . ASP C 1 156 ? 14.591  4.156   -26.317 1.00 57.29 ? 150 ASP C CB  1 
ATOM   4518 C CG  . ASP C 1 156 ? 15.846  5.028   -25.983 1.00 60.74 ? 150 ASP C CG  1 
ATOM   4519 O OD1 . ASP C 1 156 ? 16.407  4.922   -24.849 1.00 61.73 ? 150 ASP C OD1 1 
ATOM   4520 O OD2 . ASP C 1 156 ? 16.308  5.793   -26.880 1.00 64.28 ? 150 ASP C OD2 1 
ATOM   4521 N N   . TRP C 1 157 ? 11.836  3.957   -28.043 1.00 53.06 ? 151 TRP C N   1 
ATOM   4522 C CA  . TRP C 1 157 ? 11.115  3.806   -29.295 1.00 51.26 ? 151 TRP C CA  1 
ATOM   4523 C C   . TRP C 1 157 ? 10.568  5.137   -29.819 1.00 51.36 ? 151 TRP C C   1 
ATOM   4524 O O   . TRP C 1 157 ? 10.972  5.611   -30.887 1.00 51.18 ? 151 TRP C O   1 
ATOM   4525 C CB  . TRP C 1 157 ? 9.985   2.782   -29.111 1.00 49.83 ? 151 TRP C CB  1 
ATOM   4526 C CG  . TRP C 1 157 ? 9.394   2.264   -30.389 1.00 48.35 ? 151 TRP C CG  1 
ATOM   4527 C CD1 . TRP C 1 157 ? 10.008  2.189   -31.603 1.00 48.11 ? 151 TRP C CD1 1 
ATOM   4528 C CD2 . TRP C 1 157 ? 8.073   1.733   -30.576 1.00 46.20 ? 151 TRP C CD2 1 
ATOM   4529 N NE1 . TRP C 1 157 ? 9.139   1.657   -32.542 1.00 47.93 ? 151 TRP C NE1 1 
ATOM   4530 C CE2 . TRP C 1 157 ? 7.951   1.368   -31.930 1.00 46.07 ? 151 TRP C CE2 1 
ATOM   4531 C CE3 . TRP C 1 157 ? 6.981   1.539   -29.732 1.00 45.93 ? 151 TRP C CE3 1 
ATOM   4532 C CZ2 . TRP C 1 157 ? 6.784   0.828   -32.456 1.00 46.33 ? 151 TRP C CZ2 1 
ATOM   4533 C CZ3 . TRP C 1 157 ? 5.810   1.004   -30.264 1.00 47.42 ? 151 TRP C CZ3 1 
ATOM   4534 C CH2 . TRP C 1 157 ? 5.726   0.651   -31.606 1.00 46.90 ? 151 TRP C CH2 1 
ATOM   4535 N N   . ILE C 1 158 ? 9.686   5.773   -29.058 1.00 50.87 ? 152 ILE C N   1 
ATOM   4536 C CA  . ILE C 1 158 ? 9.070   7.010   -29.536 1.00 51.06 ? 152 ILE C CA  1 
ATOM   4537 C C   . ILE C 1 158 ? 10.008  8.050   -30.199 1.00 51.24 ? 152 ILE C C   1 
ATOM   4538 O O   . ILE C 1 158 ? 9.650   8.665   -31.196 1.00 52.42 ? 152 ILE C O   1 
ATOM   4539 C CB  . ILE C 1 158 ? 8.184   7.658   -28.476 1.00 50.55 ? 152 ILE C CB  1 
ATOM   4540 C CG1 . ILE C 1 158 ? 7.093   8.476   -29.160 1.00 50.18 ? 152 ILE C CG1 1 
ATOM   4541 C CG2 . ILE C 1 158 ? 9.010   8.459   -27.479 1.00 51.82 ? 152 ILE C CG2 1 
ATOM   4542 C CD1 . ILE C 1 158 ? 5.788   7.718   -29.370 1.00 49.30 ? 152 ILE C CD1 1 
ATOM   4543 N N   . ASP C 1 159 ? 11.195  8.258   -29.663 1.00 51.06 ? 153 ASP C N   1 
ATOM   4544 C CA  . ASP C 1 159 ? 12.148  9.123   -30.337 1.00 51.10 ? 153 ASP C CA  1 
ATOM   4545 C C   . ASP C 1 159 ? 12.525  8.597   -31.744 1.00 51.45 ? 153 ASP C C   1 
ATOM   4546 O O   . ASP C 1 159 ? 12.705  9.401   -32.677 1.00 51.23 ? 153 ASP C O   1 
ATOM   4547 C CB  . ASP C 1 159 ? 13.399  9.339   -29.472 1.00 51.18 ? 153 ASP C CB  1 
ATOM   4548 C CG  . ASP C 1 159 ? 13.219  10.444  -28.386 1.00 50.80 ? 153 ASP C CG  1 
ATOM   4549 O OD1 . ASP C 1 159 ? 12.217  11.210  -28.397 1.00 49.62 ? 153 ASP C OD1 1 
ATOM   4550 O OD2 . ASP C 1 159 ? 14.118  10.535  -27.514 1.00 48.85 ? 153 ASP C OD2 1 
ATOM   4551 N N   . SER C 1 160 ? 12.629  7.262   -31.895 1.00 51.24 ? 154 SER C N   1 
ATOM   4552 C CA  . SER C 1 160 ? 12.879  6.621   -33.204 1.00 50.58 ? 154 SER C CA  1 
ATOM   4553 C C   . SER C 1 160 ? 11.733  6.886   -34.135 1.00 50.45 ? 154 SER C C   1 
ATOM   4554 O O   . SER C 1 160 ? 11.928  7.130   -35.327 1.00 50.68 ? 154 SER C O   1 
ATOM   4555 C CB  . SER C 1 160 ? 12.974  5.120   -33.056 1.00 50.56 ? 154 SER C CB  1 
ATOM   4556 O OG  . SER C 1 160 ? 14.297  4.705   -32.822 1.00 52.07 ? 154 SER C OG  1 
ATOM   4557 N N   . ILE C 1 161 ? 10.531  6.830   -33.567 1.00 50.06 ? 155 ILE C N   1 
ATOM   4558 C CA  . ILE C 1 161 ? 9.328   7.145   -34.289 1.00 49.92 ? 155 ILE C CA  1 
ATOM   4559 C C   . ILE C 1 161 ? 9.358   8.602   -34.765 1.00 50.49 ? 155 ILE C C   1 
ATOM   4560 O O   . ILE C 1 161 ? 9.040   8.867   -35.924 1.00 50.85 ? 155 ILE C O   1 
ATOM   4561 C CB  . ILE C 1 161 ? 8.065   6.814   -33.473 1.00 49.25 ? 155 ILE C CB  1 
ATOM   4562 C CG1 . ILE C 1 161 ? 7.849   5.301   -33.465 1.00 49.26 ? 155 ILE C CG1 1 
ATOM   4563 C CG2 . ILE C 1 161 ? 6.868   7.396   -34.132 1.00 49.38 ? 155 ILE C CG2 1 
ATOM   4564 C CD1 . ILE C 1 161 ? 7.086   4.745   -32.278 1.00 46.73 ? 155 ILE C CD1 1 
ATOM   4565 N N   . LEU C 1 162 ? 9.768   9.535   -33.907 1.00 50.54 ? 156 LEU C N   1 
ATOM   4566 C CA  . LEU C 1 162 ? 9.791   10.928  -34.318 1.00 51.13 ? 156 LEU C CA  1 
ATOM   4567 C C   . LEU C 1 162 ? 10.899  11.264  -35.343 1.00 51.80 ? 156 LEU C C   1 
ATOM   4568 O O   . LEU C 1 162 ? 10.674  12.061  -36.265 1.00 52.30 ? 156 LEU C O   1 
ATOM   4569 C CB  . LEU C 1 162 ? 9.861   11.840  -33.112 1.00 51.23 ? 156 LEU C CB  1 
ATOM   4570 C CG  . LEU C 1 162 ? 8.593   11.933  -32.280 1.00 50.86 ? 156 LEU C CG  1 
ATOM   4571 C CD1 . LEU C 1 162 ? 8.929   12.699  -31.049 1.00 51.16 ? 156 LEU C CD1 1 
ATOM   4572 C CD2 . LEU C 1 162 ? 7.531   12.647  -33.034 1.00 50.15 ? 156 LEU C CD2 1 
ATOM   4573 N N   . ALA C 1 163 ? 12.080  10.664  -35.191 1.00 51.91 ? 157 ALA C N   1 
ATOM   4574 C CA  . ALA C 1 163 ? 13.096  10.690  -36.240 1.00 51.83 ? 157 ALA C CA  1 
ATOM   4575 C C   . ALA C 1 163 ? 12.427  10.389  -37.575 1.00 52.38 ? 157 ALA C C   1 
ATOM   4576 O O   . ALA C 1 163 ? 12.506  11.177  -38.506 1.00 52.35 ? 157 ALA C O   1 
ATOM   4577 C CB  . ALA C 1 163 ? 14.165  9.657   -35.959 1.00 51.46 ? 157 ALA C CB  1 
ATOM   4578 N N   . PHE C 1 164 ? 11.751  9.243   -37.653 1.00 53.10 ? 158 PHE C N   1 
ATOM   4579 C CA  . PHE C 1 164 ? 11.083  8.817   -38.874 1.00 53.28 ? 158 PHE C CA  1 
ATOM   4580 C C   . PHE C 1 164 ? 10.074  9.869   -39.301 1.00 53.63 ? 158 PHE C C   1 
ATOM   4581 O O   . PHE C 1 164 ? 10.148  10.382  -40.409 1.00 54.33 ? 158 PHE C O   1 
ATOM   4582 C CB  . PHE C 1 164 ? 10.397  7.486   -38.626 1.00 53.05 ? 158 PHE C CB  1 
ATOM   4583 C CG  . PHE C 1 164 ? 9.820   6.856   -39.853 1.00 52.37 ? 158 PHE C CG  1 
ATOM   4584 C CD1 . PHE C 1 164 ? 10.623  6.095   -40.701 1.00 53.44 ? 158 PHE C CD1 1 
ATOM   4585 C CD2 . PHE C 1 164 ? 8.468   6.977   -40.137 1.00 49.69 ? 158 PHE C CD2 1 
ATOM   4586 C CE1 . PHE C 1 164 ? 10.083  5.475   -41.845 1.00 53.37 ? 158 PHE C CE1 1 
ATOM   4587 C CE2 . PHE C 1 164 ? 7.929   6.385   -41.255 1.00 50.96 ? 158 PHE C CE2 1 
ATOM   4588 C CZ  . PHE C 1 164 ? 8.731   5.619   -42.118 1.00 52.43 ? 158 PHE C CZ  1 
ATOM   4589 N N   . SER C 1 165 ? 9.152   10.208  -38.409 1.00 53.81 ? 159 SER C N   1 
ATOM   4590 C CA  . SER C 1 165 ? 8.152   11.241  -38.668 1.00 54.23 ? 159 SER C CA  1 
ATOM   4591 C C   . SER C 1 165 ? 8.737   12.507  -39.254 1.00 54.34 ? 159 SER C C   1 
ATOM   4592 O O   . SER C 1 165 ? 8.143   13.126  -40.108 1.00 54.54 ? 159 SER C O   1 
ATOM   4593 C CB  . SER C 1 165 ? 7.411   11.609  -37.386 1.00 54.39 ? 159 SER C CB  1 
ATOM   4594 O OG  . SER C 1 165 ? 6.198   12.265  -37.701 1.00 54.54 ? 159 SER C OG  1 
ATOM   4595 N N   . ARG C 1 166 ? 9.898   12.911  -38.787 1.00 54.91 ? 160 ARG C N   1 
ATOM   4596 C CA  . ARG C 1 166 ? 10.528  14.078  -39.378 1.00 55.94 ? 160 ARG C CA  1 
ATOM   4597 C C   . ARG C 1 166 ? 10.860  13.782  -40.821 1.00 55.88 ? 160 ARG C C   1 
ATOM   4598 O O   . ARG C 1 166 ? 10.516  14.564  -41.720 1.00 56.36 ? 160 ARG C O   1 
ATOM   4599 C CB  . ARG C 1 166 ? 11.802  14.442  -38.628 1.00 56.15 ? 160 ARG C CB  1 
ATOM   4600 C CG  . ARG C 1 166 ? 12.262  15.864  -38.800 1.00 57.61 ? 160 ARG C CG  1 
ATOM   4601 C CD  . ARG C 1 166 ? 12.588  16.426  -37.413 1.00 62.36 ? 160 ARG C CD  1 
ATOM   4602 N NE  . ARG C 1 166 ? 12.737  15.356  -36.402 1.00 63.72 ? 160 ARG C NE  1 
ATOM   4603 C CZ  . ARG C 1 166 ? 13.232  15.526  -35.176 1.00 63.29 ? 160 ARG C CZ  1 
ATOM   4604 N NH1 . ARG C 1 166 ? 13.638  16.734  -34.779 1.00 63.88 ? 160 ARG C NH1 1 
ATOM   4605 N NH2 . ARG C 1 166 ? 13.328  14.483  -34.355 1.00 61.77 ? 160 ARG C NH2 1 
ATOM   4606 N N   . SER C 1 167 ? 11.516  12.640  -41.033 1.00 55.61 ? 161 SER C N   1 
ATOM   4607 C CA  . SER C 1 167 ? 12.017  12.278  -42.340 1.00 55.23 ? 161 SER C CA  1 
ATOM   4608 C C   . SER C 1 167 ? 10.870  12.311  -43.339 1.00 55.19 ? 161 SER C C   1 
ATOM   4609 O O   . SER C 1 167 ? 10.964  12.987  -44.355 1.00 55.35 ? 161 SER C O   1 
ATOM   4610 C CB  . SER C 1 167 ? 12.705  10.931  -42.294 1.00 55.03 ? 161 SER C CB  1 
ATOM   4611 O OG  . SER C 1 167 ? 13.419  10.716  -43.486 1.00 55.77 ? 161 SER C OG  1 
ATOM   4612 N N   . LEU C 1 168 ? 9.773   11.630  -43.014 1.00 55.13 ? 162 LEU C N   1 
ATOM   4613 C CA  . LEU C 1 168 ? 8.518   11.738  -43.772 1.00 55.07 ? 162 LEU C CA  1 
ATOM   4614 C C   . LEU C 1 168 ? 8.125   13.153  -44.230 1.00 55.41 ? 162 LEU C C   1 
ATOM   4615 O O   . LEU C 1 168 ? 7.900   13.356  -45.430 1.00 55.44 ? 162 LEU C O   1 
ATOM   4616 C CB  . LEU C 1 168 ? 7.358   11.142  -42.980 1.00 54.92 ? 162 LEU C CB  1 
ATOM   4617 C CG  . LEU C 1 168 ? 6.688   9.849   -43.415 1.00 54.46 ? 162 LEU C CG  1 
ATOM   4618 C CD1 . LEU C 1 168 ? 5.449   9.630   -42.570 1.00 54.64 ? 162 LEU C CD1 1 
ATOM   4619 C CD2 . LEU C 1 168 ? 6.297   9.929   -44.854 1.00 53.70 ? 162 LEU C CD2 1 
ATOM   4620 N N   . HIS C 1 169 ? 8.021   14.120  -43.301 1.00 55.57 ? 163 HIS C N   1 
ATOM   4621 C CA  . HIS C 1 169 ? 7.575   15.484  -43.682 1.00 55.89 ? 163 HIS C CA  1 
ATOM   4622 C C   . HIS C 1 169 ? 8.640   16.250  -44.462 1.00 55.98 ? 163 HIS C C   1 
ATOM   4623 O O   . HIS C 1 169 ? 8.317   17.155  -45.225 1.00 56.12 ? 163 HIS C O   1 
ATOM   4624 C CB  . HIS C 1 169 ? 7.116   16.339  -42.495 1.00 56.10 ? 163 HIS C CB  1 
ATOM   4625 C CG  . HIS C 1 169 ? 6.127   15.672  -41.592 1.00 55.54 ? 163 HIS C CG  1 
ATOM   4626 N ND1 . HIS C 1 169 ? 5.085   14.902  -42.060 1.00 55.53 ? 163 HIS C ND1 1 
ATOM   4627 C CD2 . HIS C 1 169 ? 6.009   15.688  -40.244 1.00 54.27 ? 163 HIS C CD2 1 
ATOM   4628 C CE1 . HIS C 1 169 ? 4.377   14.457  -41.037 1.00 55.04 ? 163 HIS C CE1 1 
ATOM   4629 N NE2 . HIS C 1 169 ? 4.920   14.914  -39.924 1.00 54.65 ? 163 HIS C NE2 1 
ATOM   4630 N N   . SER C 1 170 ? 9.904   15.894  -44.254 1.00 56.07 ? 164 SER C N   1 
ATOM   4631 C CA  . SER C 1 170 ? 10.985  16.341  -45.127 1.00 56.25 ? 164 SER C CA  1 
ATOM   4632 C C   . SER C 1 170 ? 10.685  16.107  -46.644 1.00 56.24 ? 164 SER C C   1 
ATOM   4633 O O   . SER C 1 170 ? 10.831  17.030  -47.462 1.00 56.06 ? 164 SER C O   1 
ATOM   4634 C CB  . SER C 1 170 ? 12.298  15.676  -44.697 1.00 56.34 ? 164 SER C CB  1 
ATOM   4635 O OG  . SER C 1 170 ? 12.984  15.126  -45.813 1.00 56.94 ? 164 SER C OG  1 
ATOM   4636 N N   . LEU C 1 171 ? 10.248  14.894  -47.015 1.00 55.86 ? 165 LEU C N   1 
ATOM   4637 C CA  . LEU C 1 171 ? 9.855   14.611  -48.415 1.00 55.16 ? 165 LEU C CA  1 
ATOM   4638 C C   . LEU C 1 171 ? 8.560   15.316  -48.807 1.00 54.85 ? 165 LEU C C   1 
ATOM   4639 O O   . LEU C 1 171 ? 8.182   15.302  -49.966 1.00 54.27 ? 165 LEU C O   1 
ATOM   4640 C CB  . LEU C 1 171 ? 9.693   13.110  -48.652 1.00 55.03 ? 165 LEU C CB  1 
ATOM   4641 C CG  . LEU C 1 171 ? 10.665  12.101  -48.035 1.00 54.72 ? 165 LEU C CG  1 
ATOM   4642 C CD1 . LEU C 1 171 ? 10.170  10.677  -48.309 1.00 54.37 ? 165 LEU C CD1 1 
ATOM   4643 C CD2 . LEU C 1 171 ? 12.088  12.298  -48.544 1.00 54.66 ? 165 LEU C CD2 1 
ATOM   4644 N N   . LEU C 1 172 ? 7.898   15.931  -47.826 1.00 55.02 ? 166 LEU C N   1 
ATOM   4645 C CA  . LEU C 1 172 ? 6.583   16.583  -47.995 1.00 55.33 ? 166 LEU C CA  1 
ATOM   4646 C C   . LEU C 1 172 ? 5.594   15.728  -48.771 1.00 54.83 ? 166 LEU C C   1 
ATOM   4647 O O   . LEU C 1 172 ? 5.017   16.182  -49.737 1.00 55.17 ? 166 LEU C O   1 
ATOM   4648 C CB  . LEU C 1 172 ? 6.691   18.003  -48.610 1.00 55.62 ? 166 LEU C CB  1 
ATOM   4649 C CG  . LEU C 1 172 ? 6.640   19.216  -47.656 1.00 56.15 ? 166 LEU C CG  1 
ATOM   4650 C CD1 . LEU C 1 172 ? 8.041   19.717  -47.271 1.00 56.10 ? 166 LEU C CD1 1 
ATOM   4651 C CD2 . LEU C 1 172 ? 5.785   20.376  -48.238 1.00 57.28 ? 166 LEU C CD2 1 
ATOM   4652 N N   . VAL C 1 173 ? 5.415   14.494  -48.321 1.00 54.60 ? 167 VAL C N   1 
ATOM   4653 C CA  . VAL C 1 173 ? 4.541   13.508  -48.944 1.00 54.29 ? 167 VAL C CA  1 
ATOM   4654 C C   . VAL C 1 173 ? 3.113   13.997  -48.829 1.00 54.21 ? 167 VAL C C   1 
ATOM   4655 O O   . VAL C 1 173 ? 2.628   14.217  -47.709 1.00 53.94 ? 167 VAL C O   1 
ATOM   4656 C CB  . VAL C 1 173 ? 4.678   12.102  -48.238 1.00 54.51 ? 167 VAL C CB  1 
ATOM   4657 C CG1 . VAL C 1 173 ? 3.737   11.043  -48.866 1.00 54.22 ? 167 VAL C CG1 1 
ATOM   4658 C CG2 . VAL C 1 173 ? 6.121   11.616  -48.275 1.00 54.13 ? 167 VAL C CG2 1 
ATOM   4659 N N   . ASP C 1 174 ? 2.451   14.178  -49.982 1.00 54.20 ? 168 ASP C N   1 
ATOM   4660 C CA  . ASP C 1 174 ? 1.088   14.757  -50.025 1.00 53.91 ? 168 ASP C CA  1 
ATOM   4661 C C   . ASP C 1 174 ? 0.034   13.739  -49.578 1.00 53.21 ? 168 ASP C C   1 
ATOM   4662 O O   . ASP C 1 174 ? 0.371   12.565  -49.346 1.00 53.03 ? 168 ASP C O   1 
ATOM   4663 C CB  . ASP C 1 174 ? 0.767   15.403  -51.401 1.00 54.21 ? 168 ASP C CB  1 
ATOM   4664 C CG  . ASP C 1 174 ? 0.305   14.389  -52.475 1.00 55.48 ? 168 ASP C CG  1 
ATOM   4665 O OD1 . ASP C 1 174 ? -0.162  13.282  -52.132 1.00 56.52 ? 168 ASP C OD1 1 
ATOM   4666 O OD2 . ASP C 1 174 ? 0.385   14.718  -53.684 1.00 55.03 ? 168 ASP C OD2 1 
ATOM   4667 N N   . VAL C 1 175 ? -1.222  14.178  -49.453 1.00 52.29 ? 169 VAL C N   1 
ATOM   4668 C CA  . VAL C 1 175 ? -2.271  13.284  -48.942 1.00 51.62 ? 169 VAL C CA  1 
ATOM   4669 C C   . VAL C 1 175 ? -2.525  12.108  -49.880 1.00 51.05 ? 169 VAL C C   1 
ATOM   4670 O O   . VAL C 1 175 ? -2.460  10.962  -49.439 1.00 50.36 ? 169 VAL C O   1 
ATOM   4671 C CB  . VAL C 1 175 ? -3.572  14.025  -48.525 1.00 51.67 ? 169 VAL C CB  1 
ATOM   4672 C CG1 . VAL C 1 175 ? -4.826  13.225  -48.892 1.00 51.87 ? 169 VAL C CG1 1 
ATOM   4673 C CG2 . VAL C 1 175 ? -3.547  14.305  -47.039 1.00 50.84 ? 169 VAL C CG2 1 
ATOM   4674 N N   . PRO C 1 176 ? -2.770  12.383  -51.178 1.00 50.68 ? 170 PRO C N   1 
ATOM   4675 C CA  . PRO C 1 176 ? -2.970  11.244  -52.088 1.00 50.62 ? 170 PRO C CA  1 
ATOM   4676 C C   . PRO C 1 176 ? -1.833  10.198  -52.065 1.00 50.49 ? 170 PRO C C   1 
ATOM   4677 O O   . PRO C 1 176 ? -2.090  8.983   -52.102 1.00 50.57 ? 170 PRO C O   1 
ATOM   4678 C CB  . PRO C 1 176 ? -3.086  11.911  -53.466 1.00 50.63 ? 170 PRO C CB  1 
ATOM   4679 C CG  . PRO C 1 176 ? -3.584  13.290  -53.174 1.00 50.06 ? 170 PRO C CG  1 
ATOM   4680 C CD  . PRO C 1 176 ? -2.901  13.674  -51.884 1.00 50.14 ? 170 PRO C CD  1 
ATOM   4681 N N   . ALA C 1 177 ? -0.593  10.674  -51.989 1.00 50.03 ? 171 ALA C N   1 
ATOM   4682 C CA  . ALA C 1 177 ? 0.569   9.796   -52.030 1.00 49.24 ? 171 ALA C CA  1 
ATOM   4683 C C   . ALA C 1 177 ? 0.613   8.964   -50.774 1.00 48.49 ? 171 ALA C C   1 
ATOM   4684 O O   . ALA C 1 177 ? 0.846   7.743   -50.832 1.00 48.73 ? 171 ALA C O   1 
ATOM   4685 C CB  . ALA C 1 177 ? 1.862   10.601  -52.185 1.00 49.50 ? 171 ALA C CB  1 
ATOM   4686 N N   . PHE C 1 178 ? 0.393   9.609   -49.632 1.00 46.92 ? 172 PHE C N   1 
ATOM   4687 C CA  . PHE C 1 178 ? 0.365   8.834   -48.417 1.00 45.46 ? 172 PHE C CA  1 
ATOM   4688 C C   . PHE C 1 178 ? -0.724  7.767   -48.564 1.00 44.78 ? 172 PHE C C   1 
ATOM   4689 O O   . PHE C 1 178 ? -0.503  6.603   -48.214 1.00 44.61 ? 172 PHE C O   1 
ATOM   4690 C CB  . PHE C 1 178 ? 0.151   9.701   -47.170 1.00 44.84 ? 172 PHE C CB  1 
ATOM   4691 C CG  . PHE C 1 178 ? 0.261   8.929   -45.877 1.00 43.31 ? 172 PHE C CG  1 
ATOM   4692 C CD1 . PHE C 1 178 ? 1.499   8.679   -45.305 1.00 43.58 ? 172 PHE C CD1 1 
ATOM   4693 C CD2 . PHE C 1 178 ? -0.863  8.417   -45.259 1.00 41.38 ? 172 PHE C CD2 1 
ATOM   4694 C CE1 . PHE C 1 178 ? 1.612   7.945   -44.127 1.00 42.20 ? 172 PHE C CE1 1 
ATOM   4695 C CE2 . PHE C 1 178 ? -0.765  7.689   -44.090 1.00 40.65 ? 172 PHE C CE2 1 
ATOM   4696 C CZ  . PHE C 1 178 ? 0.468   7.455   -43.525 1.00 43.00 ? 172 PHE C CZ  1 
ATOM   4697 N N   . ALA C 1 179 ? -1.861  8.175   -49.141 1.00 43.77 ? 173 ALA C N   1 
ATOM   4698 C CA  . ALA C 1 179 ? -3.066  7.365   -49.178 1.00 43.24 ? 173 ALA C CA  1 
ATOM   4699 C C   . ALA C 1 179 ? -2.794  6.015   -49.856 1.00 43.51 ? 173 ALA C C   1 
ATOM   4700 O O   . ALA C 1 179 ? -3.242  4.955   -49.380 1.00 42.71 ? 173 ALA C O   1 
ATOM   4701 C CB  . ALA C 1 179 ? -4.181  8.116   -49.859 1.00 42.20 ? 173 ALA C CB  1 
ATOM   4702 N N   . CYS C 1 180 ? -2.043  6.080   -50.952 1.00 43.49 ? 174 CYS C N   1 
ATOM   4703 C CA  . CYS C 1 180 ? -1.557  4.914   -51.636 1.00 44.33 ? 174 CYS C CA  1 
ATOM   4704 C C   . CYS C 1 180 ? -0.466  4.205   -50.850 1.00 44.88 ? 174 CYS C C   1 
ATOM   4705 O O   . CYS C 1 180 ? -0.491  2.980   -50.741 1.00 45.73 ? 174 CYS C O   1 
ATOM   4706 C CB  . CYS C 1 180 ? -0.990  5.309   -52.982 1.00 44.20 ? 174 CYS C CB  1 
ATOM   4707 S SG  . CYS C 1 180 ? -2.203  5.966   -54.155 1.00 46.89 ? 174 CYS C SG  1 
ATOM   4708 N N   . LEU C 1 181 ? 0.490   4.967   -50.314 1.00 45.09 ? 175 LEU C N   1 
ATOM   4709 C CA  . LEU C 1 181 ? 1.680   4.391   -49.707 1.00 44.98 ? 175 LEU C CA  1 
ATOM   4710 C C   . LEU C 1 181 ? 1.310   3.528   -48.523 1.00 44.86 ? 175 LEU C C   1 
ATOM   4711 O O   . LEU C 1 181 ? 1.934   2.506   -48.263 1.00 45.21 ? 175 LEU C O   1 
ATOM   4712 C CB  . LEU C 1 181 ? 2.659   5.487   -49.270 1.00 45.72 ? 175 LEU C CB  1 
ATOM   4713 C CG  . LEU C 1 181 ? 4.166   5.224   -48.984 1.00 45.89 ? 175 LEU C CG  1 
ATOM   4714 C CD1 . LEU C 1 181 ? 4.445   4.810   -47.557 1.00 46.77 ? 175 LEU C CD1 1 
ATOM   4715 C CD2 . LEU C 1 181 ? 4.842   4.228   -49.955 1.00 47.63 ? 175 LEU C CD2 1 
ATOM   4716 N N   . SER C 1 182 ? 0.287   3.930   -47.800 1.00 44.29 ? 176 SER C N   1 
ATOM   4717 C CA  . SER C 1 182 ? -0.075  3.175   -46.629 1.00 43.90 ? 176 SER C CA  1 
ATOM   4718 C C   . SER C 1 182 ? -0.871  1.935   -47.063 1.00 43.38 ? 176 SER C C   1 
ATOM   4719 O O   . SER C 1 182 ? -0.720  0.836   -46.496 1.00 43.30 ? 176 SER C O   1 
ATOM   4720 C CB  . SER C 1 182 ? -0.880  4.047   -45.685 1.00 43.55 ? 176 SER C CB  1 
ATOM   4721 O OG  . SER C 1 182 ? -2.112  4.325   -46.291 1.00 44.21 ? 176 SER C OG  1 
ATOM   4722 N N   . ALA C 1 183 ? -1.712  2.114   -48.073 1.00 42.11 ? 177 ALA C N   1 
ATOM   4723 C CA  . ALA C 1 183 ? -2.509  1.012   -48.587 1.00 41.13 ? 177 ALA C CA  1 
ATOM   4724 C C   . ALA C 1 183 ? -1.578  -0.091  -49.093 1.00 40.90 ? 177 ALA C C   1 
ATOM   4725 O O   . ALA C 1 183 ? -1.837  -1.293  -48.937 1.00 40.59 ? 177 ALA C O   1 
ATOM   4726 C CB  . ALA C 1 183 ? -3.366  1.510   -49.693 1.00 40.92 ? 177 ALA C CB  1 
ATOM   4727 N N   . LEU C 1 184 ? -0.480  0.345   -49.696 1.00 40.48 ? 178 LEU C N   1 
ATOM   4728 C CA  . LEU C 1 184 ? 0.544   -0.541  -50.187 1.00 40.15 ? 178 LEU C CA  1 
ATOM   4729 C C   . LEU C 1 184 ? 1.199   -1.314  -49.050 1.00 40.47 ? 178 LEU C C   1 
ATOM   4730 O O   . LEU C 1 184 ? 1.669   -2.416  -49.265 1.00 41.02 ? 178 LEU C O   1 
ATOM   4731 C CB  . LEU C 1 184 ? 1.607   0.279   -50.889 1.00 40.05 ? 178 LEU C CB  1 
ATOM   4732 C CG  . LEU C 1 184 ? 1.281   0.701   -52.297 1.00 39.81 ? 178 LEU C CG  1 
ATOM   4733 C CD1 . LEU C 1 184 ? 2.386   1.592   -52.770 1.00 36.64 ? 178 LEU C CD1 1 
ATOM   4734 C CD2 . LEU C 1 184 ? 1.111   -0.558  -53.189 1.00 40.41 ? 178 LEU C CD2 1 
ATOM   4735 N N   . VAL C 1 185 ? 1.264   -0.713  -47.861 1.00 39.86 ? 179 VAL C N   1 
ATOM   4736 C CA  . VAL C 1 185 ? 1.758   -1.385  -46.673 1.00 39.40 ? 179 VAL C CA  1 
ATOM   4737 C C   . VAL C 1 185 ? 0.790   -2.516  -46.196 1.00 40.05 ? 179 VAL C C   1 
ATOM   4738 O O   . VAL C 1 185 ? 1.256   -3.542  -45.689 1.00 40.34 ? 179 VAL C O   1 
ATOM   4739 C CB  . VAL C 1 185 ? 2.116   -0.344  -45.534 1.00 39.28 ? 179 VAL C CB  1 
ATOM   4740 C CG1 . VAL C 1 185 ? 2.398   -1.008  -44.222 1.00 37.84 ? 179 VAL C CG1 1 
ATOM   4741 C CG2 . VAL C 1 185 ? 3.320   0.512   -45.927 1.00 39.13 ? 179 VAL C CG2 1 
ATOM   4742 N N   . LEU C 1 186 ? -0.528  -2.355  -46.389 1.00 40.12 ? 180 LEU C N   1 
ATOM   4743 C CA  . LEU C 1 186 ? -1.501  -3.405  -46.039 1.00 40.49 ? 180 LEU C CA  1 
ATOM   4744 C C   . LEU C 1 186 ? -1.547  -4.522  -47.078 1.00 41.69 ? 180 LEU C C   1 
ATOM   4745 O O   . LEU C 1 186 ? -1.553  -5.722  -46.752 1.00 42.20 ? 180 LEU C O   1 
ATOM   4746 C CB  . LEU C 1 186 ? -2.910  -2.831  -45.867 1.00 40.22 ? 180 LEU C CB  1 
ATOM   4747 C CG  . LEU C 1 186 ? -4.124  -3.739  -45.598 1.00 39.52 ? 180 LEU C CG  1 
ATOM   4748 C CD1 . LEU C 1 186 ? -4.032  -4.520  -44.305 1.00 38.25 ? 180 LEU C CD1 1 
ATOM   4749 C CD2 . LEU C 1 186 ? -5.398  -2.928  -45.589 1.00 39.81 ? 180 LEU C CD2 1 
ATOM   4750 N N   . ILE C 1 187 ? -1.577  -4.115  -48.338 1.00 42.72 ? 181 ILE C N   1 
ATOM   4751 C CA  . ILE C 1 187 ? -1.884  -5.028  -49.413 1.00 42.79 ? 181 ILE C CA  1 
ATOM   4752 C C   . ILE C 1 187 ? -0.595  -5.415  -50.081 1.00 43.54 ? 181 ILE C C   1 
ATOM   4753 O O   . ILE C 1 187 ? -0.151  -4.784  -51.045 1.00 43.93 ? 181 ILE C O   1 
ATOM   4754 C CB  . ILE C 1 187 ? -2.894  -4.403  -50.380 1.00 42.38 ? 181 ILE C CB  1 
ATOM   4755 C CG1 . ILE C 1 187 ? -4.141  -4.063  -49.585 1.00 41.01 ? 181 ILE C CG1 1 
ATOM   4756 C CG2 . ILE C 1 187 ? -3.221  -5.383  -51.535 1.00 42.90 ? 181 ILE C CG2 1 
ATOM   4757 C CD1 . ILE C 1 187 ? -5.262  -3.545  -50.389 1.00 43.52 ? 181 ILE C CD1 1 
ATOM   4758 N N   . THR C 1 188 ? -0.001  -6.464  -49.531 1.00 44.38 ? 182 THR C N   1 
ATOM   4759 C CA  . THR C 1 188 ? 1.320   -6.948  -49.913 1.00 45.07 ? 182 THR C CA  1 
ATOM   4760 C C   . THR C 1 188 ? 1.300   -8.476  -49.738 1.00 45.45 ? 182 THR C C   1 
ATOM   4761 O O   . THR C 1 188 ? 0.442   -9.005  -49.016 1.00 45.09 ? 182 THR C O   1 
ATOM   4762 C CB  . THR C 1 188 ? 2.386   -6.285  -49.017 1.00 44.95 ? 182 THR C CB  1 
ATOM   4763 O OG1 . THR C 1 188 ? 3.689   -6.668  -49.442 1.00 47.23 ? 182 THR C OG1 1 
ATOM   4764 C CG2 . THR C 1 188 ? 2.224   -6.708  -47.558 1.00 44.64 ? 182 THR C CG2 1 
ATOM   4765 N N   . ASP C 1 189 ? 2.201   -9.191  -50.412 1.00 46.50 ? 183 ASP C N   1 
ATOM   4766 C CA  . ASP C 1 189 ? 2.325   -10.657 -50.222 1.00 47.88 ? 183 ASP C CA  1 
ATOM   4767 C C   . ASP C 1 189 ? 2.693   -11.057 -48.779 1.00 47.66 ? 183 ASP C C   1 
ATOM   4768 O O   . ASP C 1 189 ? 3.671   -10.557 -48.202 1.00 47.97 ? 183 ASP C O   1 
ATOM   4769 C CB  . ASP C 1 189 ? 3.347   -11.268 -51.197 1.00 48.49 ? 183 ASP C CB  1 
ATOM   4770 C CG  . ASP C 1 189 ? 3.113   -12.774 -51.440 1.00 52.61 ? 183 ASP C CG  1 
ATOM   4771 O OD1 . ASP C 1 189 ? 3.709   -13.334 -52.389 1.00 56.73 ? 183 ASP C OD1 1 
ATOM   4772 O OD2 . ASP C 1 189 ? 2.313   -13.417 -50.715 1.00 55.68 ? 183 ASP C OD2 1 
ATOM   4773 N N   . ARG C 1 190 ? 1.893   -11.932 -48.183 1.00 47.46 ? 184 ARG C N   1 
ATOM   4774 C CA  . ARG C 1 190 ? 2.289   -12.579 -46.919 1.00 47.55 ? 184 ARG C CA  1 
ATOM   4775 C C   . ARG C 1 190 ? 2.186   -14.104 -46.991 1.00 47.04 ? 184 ARG C C   1 
ATOM   4776 O O   . ARG C 1 190 ? 1.347   -14.667 -47.705 1.00 46.79 ? 184 ARG C O   1 
ATOM   4777 C CB  . ARG C 1 190 ? 1.488   -12.045 -45.729 1.00 47.64 ? 184 ARG C CB  1 
ATOM   4778 C CG  . ARG C 1 190 ? 1.359   -10.535 -45.671 1.00 48.75 ? 184 ARG C CG  1 
ATOM   4779 C CD  . ARG C 1 190 ? 2.586   -9.855  -45.097 1.00 50.38 ? 184 ARG C CD  1 
ATOM   4780 N NE  . ARG C 1 190 ? 2.280   -8.534  -44.546 1.00 50.72 ? 184 ARG C NE  1 
ATOM   4781 C CZ  . ARG C 1 190 ? 3.193   -7.691  -44.064 1.00 51.57 ? 184 ARG C CZ  1 
ATOM   4782 N NH1 . ARG C 1 190 ? 4.482   -8.034  -44.065 1.00 51.23 ? 184 ARG C NH1 1 
ATOM   4783 N NH2 . ARG C 1 190 ? 2.821   -6.500  -43.584 1.00 52.00 ? 184 ARG C NH2 1 
ATOM   4784 N N   . HIS C 1 191 ? 3.046   -14.773 -46.242 1.00 46.93 ? 185 HIS C N   1 
ATOM   4785 C CA  . HIS C 1 191 ? 3.048   -16.232 -46.251 1.00 46.90 ? 185 HIS C CA  1 
ATOM   4786 C C   . HIS C 1 191 ? 1.715   -16.739 -45.714 1.00 46.79 ? 185 HIS C C   1 
ATOM   4787 O O   . HIS C 1 191 ? 1.219   -16.265 -44.672 1.00 46.64 ? 185 HIS C O   1 
ATOM   4788 C CB  . HIS C 1 191 ? 4.234   -16.799 -45.463 1.00 46.67 ? 185 HIS C CB  1 
ATOM   4789 C CG  . HIS C 1 191 ? 4.361   -18.290 -45.553 1.00 48.40 ? 185 HIS C CG  1 
ATOM   4790 N ND1 . HIS C 1 191 ? 4.074   -19.130 -44.496 1.00 49.12 ? 185 HIS C ND1 1 
ATOM   4791 C CD2 . HIS C 1 191 ? 4.740   -19.093 -46.575 1.00 48.45 ? 185 HIS C CD2 1 
ATOM   4792 C CE1 . HIS C 1 191 ? 4.284   -20.381 -44.858 1.00 47.93 ? 185 HIS C CE1 1 
ATOM   4793 N NE2 . HIS C 1 191 ? 4.682   -20.387 -46.116 1.00 48.17 ? 185 HIS C NE2 1 
ATOM   4794 N N   . GLY C 1 192 ? 1.120   -17.661 -46.469 1.00 46.48 ? 186 GLY C N   1 
ATOM   4795 C CA  . GLY C 1 192 ? -0.122  -18.299 -46.072 1.00 46.17 ? 186 GLY C CA  1 
ATOM   4796 C C   . GLY C 1 192 ? -1.376  -17.664 -46.615 1.00 46.01 ? 186 GLY C C   1 
ATOM   4797 O O   . GLY C 1 192 ? -2.482  -17.937 -46.133 1.00 46.60 ? 186 GLY C O   1 
ATOM   4798 N N   . LEU C 1 193 ? -1.225  -16.808 -47.614 1.00 45.89 ? 187 LEU C N   1 
ATOM   4799 C CA  . LEU C 1 193 ? -2.384  -16.172 -48.214 1.00 45.47 ? 187 LEU C CA  1 
ATOM   4800 C C   . LEU C 1 193 ? -3.053  -17.141 -49.168 1.00 45.75 ? 187 LEU C C   1 
ATOM   4801 O O   . LEU C 1 193 ? -2.408  -17.731 -50.035 1.00 45.39 ? 187 LEU C O   1 
ATOM   4802 C CB  . LEU C 1 193 ? -1.982  -14.916 -48.975 1.00 45.07 ? 187 LEU C CB  1 
ATOM   4803 C CG  . LEU C 1 193 ? -1.740  -13.567 -48.339 1.00 43.64 ? 187 LEU C CG  1 
ATOM   4804 C CD1 . LEU C 1 193 ? -1.133  -12.718 -49.425 1.00 42.29 ? 187 LEU C CD1 1 
ATOM   4805 C CD2 . LEU C 1 193 ? -3.022  -12.921 -47.791 1.00 41.90 ? 187 LEU C CD2 1 
ATOM   4806 N N   . GLN C 1 194 ? -4.361  -17.273 -49.010 1.00 46.17 ? 188 GLN C N   1 
ATOM   4807 C CA  . GLN C 1 194 ? -5.154  -18.216 -49.767 1.00 46.13 ? 188 GLN C CA  1 
ATOM   4808 C C   . GLN C 1 194 ? -5.261  -17.823 -51.242 1.00 46.94 ? 188 GLN C C   1 
ATOM   4809 O O   . GLN C 1 194 ? -5.371  -18.696 -52.119 1.00 47.31 ? 188 GLN C O   1 
ATOM   4810 C CB  . GLN C 1 194 ? -6.534  -18.333 -49.133 1.00 45.71 ? 188 GLN C CB  1 
ATOM   4811 C CG  . GLN C 1 194 ? -6.577  -19.110 -47.820 1.00 44.96 ? 188 GLN C CG  1 
ATOM   4812 C CD  . GLN C 1 194 ? -7.978  -19.139 -47.178 1.00 46.71 ? 188 GLN C CD  1 
ATOM   4813 O OE1 . GLN C 1 194 ? -8.148  -19.605 -46.045 1.00 47.61 ? 188 GLN C OE1 1 
ATOM   4814 N NE2 . GLN C 1 194 ? -8.988  -18.630 -47.903 1.00 49.74 ? 188 GLN C NE2 1 
ATOM   4815 N N   . GLU C 1 195 ? -5.227  -16.519 -51.525 1.00 47.51 ? 189 GLU C N   1 
ATOM   4816 C CA  . GLU C 1 195 ? -5.393  -16.021 -52.902 1.00 47.46 ? 189 GLU C CA  1 
ATOM   4817 C C   . GLU C 1 195 ? -4.315  -14.969 -53.231 1.00 47.45 ? 189 GLU C C   1 
ATOM   4818 O O   . GLU C 1 195 ? -4.637  -13.807 -53.560 1.00 47.01 ? 189 GLU C O   1 
ATOM   4819 C CB  . GLU C 1 195 ? -6.773  -15.401 -53.082 1.00 47.12 ? 189 GLU C CB  1 
ATOM   4820 C CG  . GLU C 1 195 ? -7.957  -16.314 -52.883 1.00 47.10 ? 189 GLU C CG  1 
ATOM   4821 C CD  . GLU C 1 195 ? -9.257  -15.719 -53.483 1.00 48.70 ? 189 GLU C CD  1 
ATOM   4822 O OE1 . GLU C 1 195 ? -9.309  -15.432 -54.705 1.00 49.94 ? 189 GLU C OE1 1 
ATOM   4823 O OE2 . GLU C 1 195 ? -10.235 -15.520 -52.729 1.00 51.90 ? 189 GLU C OE2 1 
ATOM   4824 N N   . PRO C 1 196 ? -3.030  -15.375 -53.147 1.00 47.23 ? 190 PRO C N   1 
ATOM   4825 C CA  . PRO C 1 196 ? -1.866  -14.550 -53.426 1.00 46.79 ? 190 PRO C CA  1 
ATOM   4826 C C   . PRO C 1 196 ? -2.056  -13.648 -54.634 1.00 46.71 ? 190 PRO C C   1 
ATOM   4827 O O   . PRO C 1 196 ? -1.794  -12.462 -54.521 1.00 46.87 ? 190 PRO C O   1 
ATOM   4828 C CB  . PRO C 1 196 ? -0.790  -15.572 -53.777 1.00 46.36 ? 190 PRO C CB  1 
ATOM   4829 C CG  . PRO C 1 196 ? -1.154  -16.760 -53.040 1.00 47.09 ? 190 PRO C CG  1 
ATOM   4830 C CD  . PRO C 1 196 ? -2.637  -16.748 -52.800 1.00 47.18 ? 190 PRO C CD  1 
ATOM   4831 N N   . ARG C 1 197 ? -2.496  -14.199 -55.770 1.00 46.56 ? 191 ARG C N   1 
ATOM   4832 C CA  . ARG C 1 197 ? -2.511  -13.441 -57.040 1.00 47.07 ? 191 ARG C CA  1 
ATOM   4833 C C   . ARG C 1 197 ? -3.557  -12.327 -57.101 1.00 46.42 ? 191 ARG C C   1 
ATOM   4834 O O   . ARG C 1 197 ? -3.496  -11.424 -57.938 1.00 46.56 ? 191 ARG C O   1 
ATOM   4835 C CB  . ARG C 1 197 ? -2.627  -14.368 -58.255 1.00 47.05 ? 191 ARG C CB  1 
ATOM   4836 C CG  . ARG C 1 197 ? -1.815  -13.881 -59.503 1.00 50.69 ? 191 ARG C CG  1 
ATOM   4837 C CD  . ARG C 1 197 ? -0.218  -13.931 -59.393 1.00 53.12 ? 191 ARG C CD  1 
ATOM   4838 N NE  . ARG C 1 197 ? 0.301   -15.106 -58.676 1.00 56.40 ? 191 ARG C NE  1 
ATOM   4839 C CZ  . ARG C 1 197 ? 0.989   -15.086 -57.515 1.00 59.49 ? 191 ARG C CZ  1 
ATOM   4840 N NH1 . ARG C 1 197 ? 1.400   -16.248 -56.959 1.00 59.32 ? 191 ARG C NH1 1 
ATOM   4841 N NH2 . ARG C 1 197 ? 1.291   -13.926 -56.903 1.00 57.78 ? 191 ARG C NH2 1 
ATOM   4842 N N   . ARG C 1 198 ? -4.505  -12.403 -56.184 1.00 45.86 ? 192 ARG C N   1 
ATOM   4843 C CA  . ARG C 1 198 ? -5.609  -11.484 -56.107 1.00 44.96 ? 192 ARG C CA  1 
ATOM   4844 C C   . ARG C 1 198 ? -5.144  -10.286 -55.323 1.00 45.35 ? 192 ARG C C   1 
ATOM   4845 O O   . ARG C 1 198 ? -5.438  -9.153  -55.673 1.00 45.98 ? 192 ARG C O   1 
ATOM   4846 C CB  . ARG C 1 198 ? -6.750  -12.181 -55.392 1.00 44.51 ? 192 ARG C CB  1 
ATOM   4847 C CG  . ARG C 1 198 ? -7.811  -11.274 -55.025 1.00 43.28 ? 192 ARG C CG  1 
ATOM   4848 C CD  . ARG C 1 198 ? -9.090  -12.008 -54.894 1.00 44.00 ? 192 ARG C CD  1 
ATOM   4849 N NE  . ARG C 1 198 ? -10.143 -11.100 -55.295 1.00 44.81 ? 192 ARG C NE  1 
ATOM   4850 C CZ  . ARG C 1 198 ? -11.349 -11.447 -55.707 1.00 46.09 ? 192 ARG C CZ  1 
ATOM   4851 N NH1 . ARG C 1 198 ? -12.196 -10.481 -56.052 1.00 47.75 ? 192 ARG C NH1 1 
ATOM   4852 N NH2 . ARG C 1 198 ? -11.712 -12.727 -55.755 1.00 45.87 ? 192 ARG C NH2 1 
ATOM   4853 N N   . VAL C 1 199 ? -4.400  -10.564 -54.253 1.00 45.49 ? 193 VAL C N   1 
ATOM   4854 C CA  . VAL C 1 199 ? -3.789  -9.562  -53.419 1.00 44.93 ? 193 VAL C CA  1 
ATOM   4855 C C   . VAL C 1 199 ? -2.799  -8.816  -54.298 1.00 45.82 ? 193 VAL C C   1 
ATOM   4856 O O   . VAL C 1 199 ? -2.711  -7.581  -54.271 1.00 47.00 ? 193 VAL C O   1 
ATOM   4857 C CB  . VAL C 1 199 ? -3.108  -10.215 -52.196 1.00 44.44 ? 193 VAL C CB  1 
ATOM   4858 C CG1 . VAL C 1 199 ? -2.533  -9.157  -51.240 1.00 43.62 ? 193 VAL C CG1 1 
ATOM   4859 C CG2 . VAL C 1 199 ? -4.103  -11.074 -51.457 1.00 42.81 ? 193 VAL C CG2 1 
ATOM   4860 N N   . GLU C 1 200 ? -2.106  -9.574  -55.123 1.00 46.22 ? 194 GLU C N   1 
ATOM   4861 C CA  . GLU C 1 200 ? -1.107  -9.064  -56.043 1.00 47.21 ? 194 GLU C CA  1 
ATOM   4862 C C   . GLU C 1 200 ? -1.680  -8.074  -57.043 1.00 47.27 ? 194 GLU C C   1 
ATOM   4863 O O   . GLU C 1 200 ? -1.119  -7.005  -57.261 1.00 47.50 ? 194 GLU C O   1 
ATOM   4864 C CB  . GLU C 1 200 ? -0.505  -10.247 -56.782 1.00 47.47 ? 194 GLU C CB  1 
ATOM   4865 C CG  . GLU C 1 200 ? 0.330   -9.873  -57.948 1.00 50.66 ? 194 GLU C CG  1 
ATOM   4866 C CD  . GLU C 1 200 ? 1.500   -10.803 -58.098 1.00 55.49 ? 194 GLU C CD  1 
ATOM   4867 O OE1 . GLU C 1 200 ? 1.683   -11.351 -59.208 1.00 56.41 ? 194 GLU C OE1 1 
ATOM   4868 O OE2 . GLU C 1 200 ? 2.227   -10.993 -57.092 1.00 58.17 ? 194 GLU C OE2 1 
ATOM   4869 N N   . GLU C 1 201 ? -2.803  -8.431  -57.652 1.00 47.44 ? 195 GLU C N   1 
ATOM   4870 C CA  . GLU C 1 201 ? -3.411  -7.567  -58.624 1.00 47.75 ? 195 GLU C CA  1 
ATOM   4871 C C   . GLU C 1 201 ? -3.855  -6.300  -57.914 1.00 47.53 ? 195 GLU C C   1 
ATOM   4872 O O   . GLU C 1 201 ? -3.600  -5.181  -58.409 1.00 47.36 ? 195 GLU C O   1 
ATOM   4873 C CB  . GLU C 1 201 ? -4.587  -8.263  -59.314 1.00 48.36 ? 195 GLU C CB  1 
ATOM   4874 C CG  . GLU C 1 201 ? -4.990  -7.664  -60.687 1.00 51.13 ? 195 GLU C CG  1 
ATOM   4875 C CD  . GLU C 1 201 ? -6.255  -6.783  -60.620 1.00 55.84 ? 195 GLU C CD  1 
ATOM   4876 O OE1 . GLU C 1 201 ? -6.590  -6.113  -61.652 1.00 55.49 ? 195 GLU C OE1 1 
ATOM   4877 O OE2 . GLU C 1 201 ? -6.902  -6.761  -59.529 1.00 56.40 ? 195 GLU C OE2 1 
ATOM   4878 N N   . LEU C 1 202 ? -4.494  -6.459  -56.748 1.00 46.39 ? 196 LEU C N   1 
ATOM   4879 C CA  . LEU C 1 202 ? -5.018  -5.283  -56.074 1.00 46.07 ? 196 LEU C CA  1 
ATOM   4880 C C   . LEU C 1 202 ? -3.861  -4.313  -55.871 1.00 46.23 ? 196 LEU C C   1 
ATOM   4881 O O   . LEU C 1 202 ? -3.963  -3.140  -56.234 1.00 46.28 ? 196 LEU C O   1 
ATOM   4882 C CB  . LEU C 1 202 ? -5.729  -5.625  -54.766 1.00 45.62 ? 196 LEU C CB  1 
ATOM   4883 C CG  . LEU C 1 202 ? -6.381  -4.500  -53.935 1.00 45.55 ? 196 LEU C CG  1 
ATOM   4884 C CD1 . LEU C 1 202 ? -6.686  -3.244  -54.717 1.00 46.37 ? 196 LEU C CD1 1 
ATOM   4885 C CD2 . LEU C 1 202 ? -7.648  -4.982  -53.271 1.00 43.43 ? 196 LEU C CD2 1 
ATOM   4886 N N   . GLN C 1 203 ? -2.749  -4.841  -55.358 1.00 45.87 ? 197 GLN C N   1 
ATOM   4887 C CA  . GLN C 1 203 ? -1.578  -4.065  -55.045 1.00 45.44 ? 197 GLN C CA  1 
ATOM   4888 C C   . GLN C 1 203 ? -1.017  -3.325  -56.242 1.00 45.66 ? 197 GLN C C   1 
ATOM   4889 O O   . GLN C 1 203 ? -0.586  -2.191  -56.122 1.00 46.03 ? 197 GLN C O   1 
ATOM   4890 C CB  . GLN C 1 203 ? -0.505  -4.974  -54.486 1.00 45.43 ? 197 GLN C CB  1 
ATOM   4891 C CG  . GLN C 1 203 ? 0.735   -4.205  -54.193 1.00 46.15 ? 197 GLN C CG  1 
ATOM   4892 C CD  . GLN C 1 203 ? 1.852   -5.032  -53.657 1.00 47.00 ? 197 GLN C CD  1 
ATOM   4893 O OE1 . GLN C 1 203 ? 2.359   -4.749  -52.552 1.00 49.00 ? 197 GLN C OE1 1 
ATOM   4894 N NE2 . GLN C 1 203 ? 2.278   -6.046  -54.428 1.00 44.00 ? 197 GLN C NE2 1 
ATOM   4895 N N   . ASN C 1 204 ? -1.013  -3.974  -57.396 1.00 46.12 ? 198 ASN C N   1 
ATOM   4896 C CA  . ASN C 1 204 ? -0.471  -3.391  -58.610 1.00 46.24 ? 198 ASN C CA  1 
ATOM   4897 C C   . ASN C 1 204 ? -1.328  -2.236  -59.114 1.00 46.40 ? 198 ASN C C   1 
ATOM   4898 O O   . ASN C 1 204 ? -0.824  -1.328  -59.772 1.00 46.59 ? 198 ASN C O   1 
ATOM   4899 C CB  . ASN C 1 204 ? -0.353  -4.469  -59.700 1.00 46.82 ? 198 ASN C CB  1 
ATOM   4900 C CG  . ASN C 1 204 ? 0.985   -5.257  -59.648 1.00 47.60 ? 198 ASN C CG  1 
ATOM   4901 O OD1 . ASN C 1 204 ? 1.228   -6.083  -58.750 1.00 45.97 ? 198 ASN C OD1 1 
ATOM   4902 N ND2 . ASN C 1 204 ? 1.840   -5.010  -60.641 1.00 48.01 ? 198 ASN C ND2 1 
ATOM   4903 N N   . ARG C 1 205 ? -2.625  -2.272  -58.817 1.00 46.66 ? 199 ARG C N   1 
ATOM   4904 C CA  . ARG C 1 205 ? -3.524  -1.197  -59.220 1.00 47.24 ? 199 ARG C CA  1 
ATOM   4905 C C   . ARG C 1 205 ? -3.273  0.018   -58.358 1.00 47.59 ? 199 ARG C C   1 
ATOM   4906 O O   . ARG C 1 205 ? -3.243  1.154   -58.850 1.00 47.96 ? 199 ARG C O   1 
ATOM   4907 C CB  . ARG C 1 205 ? -4.992  -1.612  -59.115 1.00 47.58 ? 199 ARG C CB  1 
ATOM   4908 C CG  . ARG C 1 205 ? -5.597  -2.108  -60.419 1.00 49.26 ? 199 ARG C CG  1 
ATOM   4909 C CD  . ARG C 1 205 ? -7.116  -2.150  -60.357 1.00 52.59 ? 199 ARG C CD  1 
ATOM   4910 N NE  . ARG C 1 205 ? -7.584  -3.383  -59.734 1.00 56.83 ? 199 ARG C NE  1 
ATOM   4911 C CZ  . ARG C 1 205 ? -8.463  -3.455  -58.731 1.00 59.78 ? 199 ARG C CZ  1 
ATOM   4912 N NH1 . ARG C 1 205 ? -8.797  -4.650  -58.237 1.00 59.90 ? 199 ARG C NH1 1 
ATOM   4913 N NH2 . ARG C 1 205 ? -9.023  -2.350  -58.224 1.00 60.49 ? 199 ARG C NH2 1 
ATOM   4914 N N   . ILE C 1 206 ? -3.094  -0.236  -57.067 1.00 47.53 ? 200 ILE C N   1 
ATOM   4915 C CA  . ILE C 1 206 ? -2.747  0.795   -56.130 1.00 47.80 ? 200 ILE C CA  1 
ATOM   4916 C C   . ILE C 1 206 ? -1.373  1.327   -56.507 1.00 48.97 ? 200 ILE C C   1 
ATOM   4917 O O   . ILE C 1 206 ? -1.145  2.558   -56.559 1.00 49.31 ? 200 ILE C O   1 
ATOM   4918 C CB  . ILE C 1 206 ? -2.698  0.258   -54.705 1.00 47.16 ? 200 ILE C CB  1 
ATOM   4919 C CG1 . ILE C 1 206 ? -4.002  -0.470  -54.376 1.00 45.97 ? 200 ILE C CG1 1 
ATOM   4920 C CG2 . ILE C 1 206 ? -2.414  1.404   -53.753 1.00 47.89 ? 200 ILE C CG2 1 
ATOM   4921 C CD1 . ILE C 1 206 ? -4.390  -0.450  -52.950 1.00 42.71 ? 200 ILE C CD1 1 
ATOM   4922 N N   . ALA C 1 207 ? -0.465  0.396   -56.785 1.00 49.36 ? 201 ALA C N   1 
ATOM   4923 C CA  . ALA C 1 207 ? 0.900   0.750   -57.047 1.00 50.26 ? 201 ALA C CA  1 
ATOM   4924 C C   . ALA C 1 207 ? 0.953   1.670   -58.243 1.00 51.02 ? 201 ALA C C   1 
ATOM   4925 O O   . ALA C 1 207 ? 1.615   2.698   -58.218 1.00 50.82 ? 201 ALA C O   1 
ATOM   4926 C CB  . ALA C 1 207 ? 1.704   -0.477  -57.307 1.00 50.36 ? 201 ALA C CB  1 
ATOM   4927 N N   . SER C 1 208 ? 0.243   1.309   -59.297 1.00 52.00 ? 202 SER C N   1 
ATOM   4928 C CA  . SER C 1 208 ? 0.443   2.034   -60.532 1.00 53.45 ? 202 SER C CA  1 
ATOM   4929 C C   . SER C 1 208 ? -0.503  3.191   -60.576 1.00 53.99 ? 202 SER C C   1 
ATOM   4930 O O   . SER C 1 208 ? -0.453  4.009   -61.478 1.00 54.39 ? 202 SER C O   1 
ATOM   4931 C CB  . SER C 1 208 ? 0.324   1.138   -61.773 1.00 53.37 ? 202 SER C CB  1 
ATOM   4932 O OG  . SER C 1 208 ? -1.013  0.811   -62.026 1.00 54.03 ? 202 SER C OG  1 
ATOM   4933 N N   . CYS C 1 209 ? -1.362  3.267   -59.580 1.00 55.03 ? 203 CYS C N   1 
ATOM   4934 C CA  . CYS C 1 209 ? -2.151  4.465   -59.415 1.00 56.08 ? 203 CYS C CA  1 
ATOM   4935 C C   . CYS C 1 209 ? -1.316  5.553   -58.724 1.00 57.06 ? 203 CYS C C   1 
ATOM   4936 O O   . CYS C 1 209 ? -1.250  6.682   -59.215 1.00 57.40 ? 203 CYS C O   1 
ATOM   4937 C CB  . CYS C 1 209 ? -3.448  4.134   -58.703 1.00 55.96 ? 203 CYS C CB  1 
ATOM   4938 S SG  . CYS C 1 209 ? -3.858  5.217   -57.423 1.00 55.43 ? 203 CYS C SG  1 
ATOM   4939 N N   . LEU C 1 210 ? -0.646  5.208   -57.622 1.00 58.17 ? 204 LEU C N   1 
ATOM   4940 C CA  . LEU C 1 210 ? 0.388   6.081   -57.032 1.00 59.14 ? 204 LEU C CA  1 
ATOM   4941 C C   . LEU C 1 210 ? 1.435   6.577   -58.064 1.00 60.50 ? 204 LEU C C   1 
ATOM   4942 O O   . LEU C 1 210 ? 1.602   7.790   -58.235 1.00 60.97 ? 204 LEU C O   1 
ATOM   4943 C CB  . LEU C 1 210 ? 1.073   5.368   -55.863 1.00 58.75 ? 204 LEU C CB  1 
ATOM   4944 C CG  . LEU C 1 210 ? 2.453   5.841   -55.384 1.00 59.00 ? 204 LEU C CG  1 
ATOM   4945 C CD1 . LEU C 1 210 ? 2.414   7.269   -54.847 1.00 59.77 ? 204 LEU C CD1 1 
ATOM   4946 C CD2 . LEU C 1 210 ? 3.065   4.892   -54.356 1.00 58.35 ? 204 LEU C CD2 1 
ATOM   4947 N N   . LYS C 1 211 ? 2.125   5.631   -58.720 1.00 61.80 ? 205 LYS C N   1 
ATOM   4948 C CA  . LYS C 1 211 ? 3.078   5.855   -59.831 1.00 63.03 ? 205 LYS C CA  1 
ATOM   4949 C C   . LYS C 1 211 ? 2.634   6.955   -60.749 1.00 63.85 ? 205 LYS C C   1 
ATOM   4950 O O   . LYS C 1 211 ? 3.435   7.787   -61.176 1.00 64.53 ? 205 LYS C O   1 
ATOM   4951 C CB  . LYS C 1 211 ? 3.170   4.602   -60.715 1.00 62.97 ? 205 LYS C CB  1 
ATOM   4952 C CG  . LYS C 1 211 ? 4.312   3.628   -60.418 1.00 63.62 ? 205 LYS C CG  1 
ATOM   4953 C CD  . LYS C 1 211 ? 5.546   3.824   -61.334 1.00 63.99 ? 205 LYS C CD  1 
ATOM   4954 C CE  . LYS C 1 211 ? 5.195   4.043   -62.827 1.00 62.86 ? 205 LYS C CE  1 
ATOM   4955 N NZ  . LYS C 1 211 ? 4.619   2.876   -63.536 1.00 59.18 ? 205 LYS C NZ  1 
ATOM   4956 N N   . GLU C 1 212 ? 1.348   6.929   -61.073 1.00 64.53 ? 206 GLU C N   1 
ATOM   4957 C CA  . GLU C 1 212 ? 0.768   7.875   -62.002 1.00 65.21 ? 206 GLU C CA  1 
ATOM   4958 C C   . GLU C 1 212 ? 0.337   9.173   -61.324 1.00 65.20 ? 206 GLU C C   1 
ATOM   4959 O O   . GLU C 1 212 ? 0.337   10.222  -61.968 1.00 65.60 ? 206 GLU C O   1 
ATOM   4960 C CB  . GLU C 1 212 ? -0.418  7.245   -62.723 1.00 65.32 ? 206 GLU C CB  1 
ATOM   4961 C CG  . GLU C 1 212 ? -0.636  7.814   -64.103 1.00 66.91 ? 206 GLU C CG  1 
ATOM   4962 C CD  . GLU C 1 212 ? -2.087  7.785   -64.513 1.00 68.89 ? 206 GLU C CD  1 
ATOM   4963 O OE1 . GLU C 1 212 ? -2.390  7.219   -65.595 1.00 68.89 ? 206 GLU C OE1 1 
ATOM   4964 O OE2 . GLU C 1 212 ? -2.917  8.329   -63.744 1.00 69.03 ? 206 GLU C OE2 1 
ATOM   4965 N N   . HIS C 1 213 ? -0.040  9.122   -60.046 1.00 64.81 ? 207 HIS C N   1 
ATOM   4966 C CA  . HIS C 1 213 ? -0.364  10.363  -59.353 1.00 64.76 ? 207 HIS C CA  1 
ATOM   4967 C C   . HIS C 1 213 ? 0.866   11.268  -59.301 1.00 65.10 ? 207 HIS C C   1 
ATOM   4968 O O   . HIS C 1 213 ? 0.883   12.310  -59.934 1.00 65.17 ? 207 HIS C O   1 
ATOM   4969 C CB  . HIS C 1 213 ? -0.936  10.129  -57.952 1.00 64.63 ? 207 HIS C CB  1 
ATOM   4970 C CG  . HIS C 1 213 ? -0.916  11.350  -57.081 1.00 63.09 ? 207 HIS C CG  1 
ATOM   4971 N ND1 . HIS C 1 213 ? -1.852  12.356  -57.185 1.00 63.08 ? 207 HIS C ND1 1 
ATOM   4972 C CD2 . HIS C 1 213 ? -0.069  11.728  -56.096 1.00 62.01 ? 207 HIS C CD2 1 
ATOM   4973 C CE1 . HIS C 1 213 ? -1.583  13.304  -56.306 1.00 62.20 ? 207 HIS C CE1 1 
ATOM   4974 N NE2 . HIS C 1 213 ? -0.507  12.944  -55.630 1.00 63.44 ? 207 HIS C NE2 1 
ATOM   4975 N N   . VAL C 1 214 ? 1.907   10.854  -58.588 1.00 65.44 ? 208 VAL C N   1 
ATOM   4976 C CA  . VAL C 1 214 ? 3.080   11.721  -58.385 1.00 65.90 ? 208 VAL C CA  1 
ATOM   4977 C C   . VAL C 1 214 ? 3.793   12.132  -59.686 1.00 66.23 ? 208 VAL C C   1 
ATOM   4978 O O   . VAL C 1 214 ? 4.656   13.030  -59.680 1.00 66.47 ? 208 VAL C O   1 
ATOM   4979 C CB  . VAL C 1 214 ? 4.094   11.118  -57.379 1.00 65.57 ? 208 VAL C CB  1 
ATOM   4980 C CG1 . VAL C 1 214 ? 3.370   10.615  -56.135 1.00 65.74 ? 208 VAL C CG1 1 
ATOM   4981 C CG2 . VAL C 1 214 ? 4.890   10.011  -58.023 1.00 65.86 ? 208 VAL C CG2 1 
ATOM   4982 N N   . ALA C 1 215 ? 3.432   11.470  -60.785 1.00 66.35 ? 209 ALA C N   1 
ATOM   4983 C CA  . ALA C 1 215 ? 3.941   11.822  -62.105 1.00 66.29 ? 209 ALA C CA  1 
ATOM   4984 C C   . ALA C 1 215 ? 3.115   12.950  -62.713 1.00 66.53 ? 209 ALA C C   1 
ATOM   4985 O O   . ALA C 1 215 ? 3.613   13.678  -63.562 1.00 66.77 ? 209 ALA C O   1 
ATOM   4986 C CB  . ALA C 1 215 ? 3.944   10.611  -63.014 1.00 65.98 ? 209 ALA C CB  1 
ATOM   4987 N N   . ALA C 1 216 ? 1.850   13.081  -62.296 1.00 66.82 ? 210 ALA C N   1 
ATOM   4988 C CA  . ALA C 1 216 ? 0.987   14.202  -62.717 1.00 66.77 ? 210 ALA C CA  1 
ATOM   4989 C C   . ALA C 1 216 ? 1.431   15.487  -62.030 1.00 66.89 ? 210 ALA C C   1 
ATOM   4990 O O   . ALA C 1 216 ? 1.373   16.563  -62.618 1.00 67.15 ? 210 ALA C O   1 
ATOM   4991 C CB  . ALA C 1 216 ? -0.485  13.915  -62.418 1.00 66.46 ? 210 ALA C CB  1 
ATOM   4992 N N   . VAL C 1 217 ? 1.897   15.347  -60.792 1.00 67.08 ? 211 VAL C N   1 
ATOM   4993 C CA  . VAL C 1 217 ? 2.345   16.455  -59.953 1.00 67.30 ? 211 VAL C CA  1 
ATOM   4994 C C   . VAL C 1 217 ? 3.771   16.913  -60.314 1.00 67.39 ? 211 VAL C C   1 
ATOM   4995 O O   . VAL C 1 217 ? 4.748   16.172  -60.178 1.00 67.43 ? 211 VAL C O   1 
ATOM   4996 C CB  . VAL C 1 217 ? 2.195   16.099  -58.424 1.00 67.38 ? 211 VAL C CB  1 
ATOM   4997 C CG1 . VAL C 1 217 ? 3.189   16.865  -57.551 1.00 67.84 ? 211 VAL C CG1 1 
ATOM   4998 C CG2 . VAL C 1 217 ? 0.751   16.341  -57.942 1.00 67.14 ? 211 VAL C CG2 1 
ATOM   4999 N N   . CYS C 1 226 ? 12.063  10.823  -57.355 1.00 69.43 ? 220 CYS C N   1 
ATOM   5000 C CA  . CYS C 1 226 ? 11.415  11.092  -56.057 1.00 69.87 ? 220 CYS C CA  1 
ATOM   5001 C C   . CYS C 1 226 ? 10.495  9.970   -55.483 1.00 68.81 ? 220 CYS C C   1 
ATOM   5002 O O   . CYS C 1 226 ? 10.462  9.763   -54.270 1.00 69.09 ? 220 CYS C O   1 
ATOM   5003 C CB  . CYS C 1 226 ? 10.635  12.418  -56.101 1.00 70.09 ? 220 CYS C CB  1 
ATOM   5004 S SG  . CYS C 1 226 ? 8.802   12.186  -56.082 1.00 73.46 ? 220 CYS C SG  1 
ATOM   5005 N N   . LEU C 1 227 ? 9.732   9.283   -56.336 1.00 67.49 ? 221 LEU C N   1 
ATOM   5006 C CA  . LEU C 1 227 ? 8.867   8.182   -55.891 1.00 66.26 ? 221 LEU C CA  1 
ATOM   5007 C C   . LEU C 1 227 ? 9.646   7.082   -55.149 1.00 65.73 ? 221 LEU C C   1 
ATOM   5008 O O   . LEU C 1 227 ? 9.143   6.471   -54.213 1.00 65.27 ? 221 LEU C O   1 
ATOM   5009 C CB  . LEU C 1 227 ? 8.116   7.584   -57.084 1.00 66.13 ? 221 LEU C CB  1 
ATOM   5010 C CG  . LEU C 1 227 ? 7.668   6.122   -56.995 1.00 65.21 ? 221 LEU C CG  1 
ATOM   5011 C CD1 . LEU C 1 227 ? 6.275   6.055   -56.418 1.00 65.15 ? 221 LEU C CD1 1 
ATOM   5012 C CD2 . LEU C 1 227 ? 7.762   5.376   -58.339 1.00 63.21 ? 221 LEU C CD2 1 
ATOM   5013 N N   . SER C 1 228 ? 10.882  6.843   -55.563 1.00 65.14 ? 222 SER C N   1 
ATOM   5014 C CA  . SER C 1 228 ? 11.673  5.808   -54.936 1.00 64.66 ? 222 SER C CA  1 
ATOM   5015 C C   . SER C 1 228 ? 12.346  6.295   -53.645 1.00 64.56 ? 222 SER C C   1 
ATOM   5016 O O   . SER C 1 228 ? 12.837  5.481   -52.854 1.00 64.58 ? 222 SER C O   1 
ATOM   5017 C CB  . SER C 1 228 ? 12.687  5.223   -55.926 1.00 64.60 ? 222 SER C CB  1 
ATOM   5018 O OG  . SER C 1 228 ? 13.887  5.970   -55.932 1.00 64.00 ? 222 SER C OG  1 
ATOM   5019 N N   . ARG C 1 229 ? 12.383  7.612   -53.427 1.00 64.26 ? 223 ARG C N   1 
ATOM   5020 C CA  . ARG C 1 229 ? 12.834  8.143   -52.130 1.00 64.07 ? 223 ARG C CA  1 
ATOM   5021 C C   . ARG C 1 229 ? 11.655  8.015   -51.156 1.00 64.12 ? 223 ARG C C   1 
ATOM   5022 O O   . ARG C 1 229 ? 11.824  7.850   -49.934 1.00 64.32 ? 223 ARG C O   1 
ATOM   5023 C CB  . ARG C 1 229 ? 13.335  9.589   -52.245 1.00 63.67 ? 223 ARG C CB  1 
ATOM   5024 N N   . LEU C 1 230 ? 10.454  8.044   -51.724 1.00 63.97 ? 224 LEU C N   1 
ATOM   5025 C CA  . LEU C 1 230 ? 9.237   7.804   -50.967 1.00 63.82 ? 224 LEU C CA  1 
ATOM   5026 C C   . LEU C 1 230 ? 9.013   6.303   -50.693 1.00 63.27 ? 224 LEU C C   1 
ATOM   5027 O O   . LEU C 1 230 ? 8.862   5.906   -49.537 1.00 63.30 ? 224 LEU C O   1 
ATOM   5028 C CB  . LEU C 1 230 ? 8.054   8.461   -51.676 1.00 64.21 ? 224 LEU C CB  1 
ATOM   5029 C CG  . LEU C 1 230 ? 6.607   8.409   -51.184 1.00 64.44 ? 224 LEU C CG  1 
ATOM   5030 C CD1 . LEU C 1 230 ? 6.448   7.975   -49.722 1.00 65.35 ? 224 LEU C CD1 1 
ATOM   5031 C CD2 . LEU C 1 230 ? 5.993   9.794   -51.451 1.00 64.11 ? 224 LEU C CD2 1 
ATOM   5032 N N   . LEU C 1 231 ? 9.028   5.465   -51.725 1.00 62.46 ? 225 LEU C N   1 
ATOM   5033 C CA  . LEU C 1 231 ? 8.943   4.022   -51.487 1.00 62.16 ? 225 LEU C CA  1 
ATOM   5034 C C   . LEU C 1 231 ? 10.147  3.537   -50.692 1.00 62.65 ? 225 LEU C C   1 
ATOM   5035 O O   . LEU C 1 231 ? 10.160  2.395   -50.216 1.00 62.09 ? 225 LEU C O   1 
ATOM   5036 C CB  . LEU C 1 231 ? 8.861   3.236   -52.790 1.00 61.81 ? 225 LEU C CB  1 
ATOM   5037 C CG  . LEU C 1 231 ? 7.573   3.273   -53.603 1.00 60.33 ? 225 LEU C CG  1 
ATOM   5038 C CD1 . LEU C 1 231 ? 7.925   2.932   -55.029 1.00 57.39 ? 225 LEU C CD1 1 
ATOM   5039 C CD2 . LEU C 1 231 ? 6.526   2.324   -53.033 1.00 59.27 ? 225 LEU C CD2 1 
ATOM   5040 N N   . GLY C 1 232 ? 11.153  4.414   -50.563 1.00 63.14 ? 226 GLY C N   1 
ATOM   5041 C CA  . GLY C 1 232 ? 12.369  4.125   -49.810 1.00 63.47 ? 226 GLY C CA  1 
ATOM   5042 C C   . GLY C 1 232 ? 12.137  4.062   -48.307 1.00 63.98 ? 226 GLY C C   1 
ATOM   5043 O O   . GLY C 1 232 ? 12.903  3.422   -47.580 1.00 64.16 ? 226 GLY C O   1 
ATOM   5044 N N   . LYS C 1 233 ? 11.088  4.732   -47.835 1.00 64.06 ? 227 LYS C N   1 
ATOM   5045 C CA  . LYS C 1 233 ? 10.751  4.728   -46.414 1.00 64.04 ? 227 LYS C CA  1 
ATOM   5046 C C   . LYS C 1 233 ? 10.469  3.315   -45.937 1.00 64.05 ? 227 LYS C C   1 
ATOM   5047 O O   . LYS C 1 233 ? 11.012  2.870   -44.939 1.00 64.28 ? 227 LYS C O   1 
ATOM   5048 C CB  . LYS C 1 233 ? 9.537   5.619   -46.149 1.00 64.08 ? 227 LYS C CB  1 
ATOM   5049 C CG  . LYS C 1 233 ? 9.733   7.104   -46.462 1.00 64.11 ? 227 LYS C CG  1 
ATOM   5050 C CD  . LYS C 1 233 ? 10.679  7.818   -45.487 1.00 63.69 ? 227 LYS C CD  1 
ATOM   5051 C CE  . LYS C 1 233 ? 12.011  8.125   -46.150 1.00 64.07 ? 227 LYS C CE  1 
ATOM   5052 N NZ  . LYS C 1 233 ? 12.759  9.176   -45.418 1.00 64.51 ? 227 LYS C NZ  1 
ATOM   5053 N N   . LEU C 1 234 ? 9.638   2.607   -46.689 1.00 64.20 ? 228 LEU C N   1 
ATOM   5054 C CA  . LEU C 1 234 ? 9.212   1.238   -46.367 1.00 64.18 ? 228 LEU C CA  1 
ATOM   5055 C C   . LEU C 1 234 ? 10.147  0.341   -45.505 1.00 64.51 ? 228 LEU C C   1 
ATOM   5056 O O   . LEU C 1 234 ? 9.715   -0.128  -44.455 1.00 64.62 ? 228 LEU C O   1 
ATOM   5057 C CB  . LEU C 1 234 ? 8.750   0.513   -47.638 1.00 63.81 ? 228 LEU C CB  1 
ATOM   5058 C CG  . LEU C 1 234 ? 7.613   1.169   -48.428 1.00 62.63 ? 228 LEU C CG  1 
ATOM   5059 C CD1 . LEU C 1 234 ? 7.117   0.216   -49.515 1.00 61.70 ? 228 LEU C CD1 1 
ATOM   5060 C CD2 . LEU C 1 234 ? 6.467   1.602   -47.516 1.00 61.63 ? 228 LEU C CD2 1 
ATOM   5061 N N   . PRO C 1 235 ? 11.406  0.084   -45.943 1.00 64.81 ? 229 PRO C N   1 
ATOM   5062 C CA  . PRO C 1 235 ? 12.277  -0.781  -45.119 1.00 64.76 ? 229 PRO C CA  1 
ATOM   5063 C C   . PRO C 1 235 ? 12.730  -0.137  -43.803 1.00 64.77 ? 229 PRO C C   1 
ATOM   5064 O O   . PRO C 1 235 ? 12.996  -0.856  -42.807 1.00 64.84 ? 229 PRO C O   1 
ATOM   5065 C CB  . PRO C 1 235 ? 13.485  -1.052  -46.033 1.00 64.77 ? 229 PRO C CB  1 
ATOM   5066 C CG  . PRO C 1 235 ? 13.039  -0.634  -47.424 1.00 64.91 ? 229 PRO C CG  1 
ATOM   5067 C CD  . PRO C 1 235 ? 12.089  0.494   -47.185 1.00 64.89 ? 229 PRO C CD  1 
ATOM   5068 N N   . GLU C 1 236 ? 12.817  1.201   -43.803 1.00 64.14 ? 230 GLU C N   1 
ATOM   5069 C CA  . GLU C 1 236 ? 13.126  1.971   -42.582 1.00 63.12 ? 230 GLU C CA  1 
ATOM   5070 C C   . GLU C 1 236 ? 11.984  1.746   -41.578 1.00 61.83 ? 230 GLU C C   1 
ATOM   5071 O O   . GLU C 1 236 ? 12.217  1.489   -40.396 1.00 61.61 ? 230 GLU C O   1 
ATOM   5072 C CB  . GLU C 1 236 ? 13.356  3.467   -42.903 1.00 63.19 ? 230 GLU C CB  1 
ATOM   5073 C CG  . GLU C 1 236 ? 14.032  3.729   -44.290 1.00 63.64 ? 230 GLU C CG  1 
ATOM   5074 C CD  . GLU C 1 236 ? 14.649  5.130   -44.452 1.00 63.68 ? 230 GLU C CD  1 
ATOM   5075 O OE1 . GLU C 1 236 ? 15.811  5.213   -44.914 1.00 63.66 ? 230 GLU C OE1 1 
ATOM   5076 O OE2 . GLU C 1 236 ? 13.982  6.142   -44.135 1.00 64.33 ? 230 GLU C OE2 1 
ATOM   5077 N N   . LEU C 1 237 ? 10.760  1.790   -42.089 1.00 60.34 ? 231 LEU C N   1 
ATOM   5078 C CA  . LEU C 1 237 ? 9.574   1.471   -41.325 1.00 59.59 ? 231 LEU C CA  1 
ATOM   5079 C C   . LEU C 1 237 ? 9.624   0.085   -40.724 1.00 59.33 ? 231 LEU C C   1 
ATOM   5080 O O   . LEU C 1 237 ? 9.249   -0.103  -39.581 1.00 59.22 ? 231 LEU C O   1 
ATOM   5081 C CB  . LEU C 1 237 ? 8.348   1.549   -42.217 1.00 59.63 ? 231 LEU C CB  1 
ATOM   5082 C CG  . LEU C 1 237 ? 7.041   1.394   -41.456 1.00 59.68 ? 231 LEU C CG  1 
ATOM   5083 C CD1 . LEU C 1 237 ? 6.865   2.593   -40.519 1.00 58.95 ? 231 LEU C CD1 1 
ATOM   5084 C CD2 . LEU C 1 237 ? 5.871   1.250   -42.420 1.00 58.97 ? 231 LEU C CD2 1 
ATOM   5085 N N   . ARG C 1 238 ? 10.068  -0.890  -41.511 1.00 59.30 ? 232 ARG C N   1 
ATOM   5086 C CA  . ARG C 1 238 ? 10.170  -2.274  -41.067 1.00 58.80 ? 232 ARG C CA  1 
ATOM   5087 C C   . ARG C 1 238 ? 11.192  -2.416  -39.893 1.00 58.74 ? 232 ARG C C   1 
ATOM   5088 O O   . ARG C 1 238 ? 10.936  -3.114  -38.897 1.00 58.18 ? 232 ARG C O   1 
ATOM   5089 C CB  . ARG C 1 238 ? 10.523  -3.163  -42.270 1.00 58.75 ? 232 ARG C CB  1 
ATOM   5090 C CG  . ARG C 1 238 ? 9.573   -4.387  -42.545 1.00 59.26 ? 232 ARG C CG  1 
ATOM   5091 C CD  . ARG C 1 238 ? 8.356   -4.065  -43.482 1.00 58.24 ? 232 ARG C CD  1 
ATOM   5092 N NE  . ARG C 1 238 ? 8.075   -5.091  -44.515 1.00 56.11 ? 232 ARG C NE  1 
ATOM   5093 C CZ  . ARG C 1 238 ? 7.044   -5.954  -44.525 1.00 54.46 ? 232 ARG C CZ  1 
ATOM   5094 N NH1 . ARG C 1 238 ? 6.145   -5.980  -43.548 1.00 52.96 ? 232 ARG C NH1 1 
ATOM   5095 N NH2 . ARG C 1 238 ? 6.911   -6.813  -45.526 1.00 52.09 ? 232 ARG C NH2 1 
ATOM   5096 N N   . THR C 1 239 ? 12.332  -1.732  -39.979 1.00 58.60 ? 233 THR C N   1 
ATOM   5097 C CA  . THR C 1 239 ? 13.301  -1.841  -38.884 1.00 58.89 ? 233 THR C CA  1 
ATOM   5098 C C   . THR C 1 239 ? 12.744  -1.131  -37.639 1.00 58.64 ? 233 THR C C   1 
ATOM   5099 O O   . THR C 1 239 ? 12.913  -1.593  -36.508 1.00 59.08 ? 233 THR C O   1 
ATOM   5100 C CB  . THR C 1 239 ? 14.784  -1.416  -39.276 1.00 58.87 ? 233 THR C CB  1 
ATOM   5101 O OG1 . THR C 1 239 ? 14.978  -0.008  -39.122 1.00 59.90 ? 233 THR C OG1 1 
ATOM   5102 C CG2 . THR C 1 239 ? 15.141  -1.818  -40.725 1.00 59.29 ? 233 THR C CG2 1 
ATOM   5103 N N   . LEU C 1 240 ? 12.027  -0.038  -37.866 1.00 58.27 ? 234 LEU C N   1 
ATOM   5104 C CA  . LEU C 1 240 ? 11.395  0.718   -36.800 1.00 57.67 ? 234 LEU C CA  1 
ATOM   5105 C C   . LEU C 1 240 ? 10.413  -0.178  -36.063 1.00 57.81 ? 234 LEU C C   1 
ATOM   5106 O O   . LEU C 1 240 ? 10.179  -0.025  -34.870 1.00 57.93 ? 234 LEU C O   1 
ATOM   5107 C CB  . LEU C 1 240 ? 10.679  1.924   -37.406 1.00 57.31 ? 234 LEU C CB  1 
ATOM   5108 C CG  . LEU C 1 240 ? 10.379  3.199   -36.615 1.00 56.98 ? 234 LEU C CG  1 
ATOM   5109 C CD1 . LEU C 1 240 ? 11.573  3.763   -35.860 1.00 55.41 ? 234 LEU C CD1 1 
ATOM   5110 C CD2 . LEU C 1 240 ? 9.842   4.231   -37.585 1.00 57.30 ? 234 LEU C CD2 1 
ATOM   5111 N N   . CYS C 1 241 ? 9.852   -1.141  -36.773 1.00 57.97 ? 235 CYS C N   1 
ATOM   5112 C CA  . CYS C 1 241 ? 8.887   -2.016  -36.167 1.00 58.34 ? 235 CYS C CA  1 
ATOM   5113 C C   . CYS C 1 241 ? 9.545   -3.157  -35.431 1.00 57.95 ? 235 CYS C C   1 
ATOM   5114 O O   . CYS C 1 241 ? 8.953   -3.733  -34.507 1.00 58.68 ? 235 CYS C O   1 
ATOM   5115 C CB  . CYS C 1 241 ? 7.902   -2.511  -37.202 1.00 58.63 ? 235 CYS C CB  1 
ATOM   5116 S SG  . CYS C 1 241 ? 6.755   -1.170  -37.660 1.00 64.13 ? 235 CYS C SG  1 
ATOM   5117 N N   . THR C 1 242 ? 10.774  -3.488  -35.803 1.00 56.97 ? 236 THR C N   1 
ATOM   5118 C CA  . THR C 1 242 ? 11.510  -4.454  -35.008 1.00 55.68 ? 236 THR C CA  1 
ATOM   5119 C C   . THR C 1 242 ? 11.718  -3.892  -33.619 1.00 54.93 ? 236 THR C C   1 
ATOM   5120 O O   . THR C 1 242 ? 11.619  -4.632  -32.643 1.00 54.83 ? 236 THR C O   1 
ATOM   5121 C CB  . THR C 1 242 ? 12.810  -4.871  -35.659 1.00 55.91 ? 236 THR C CB  1 
ATOM   5122 O OG1 . THR C 1 242 ? 12.554  -5.122  -37.046 1.00 57.37 ? 236 THR C OG1 1 
ATOM   5123 C CG2 . THR C 1 242 ? 13.336  -6.135  -35.021 1.00 54.18 ? 236 THR C CG2 1 
ATOM   5124 N N   . GLN C 1 243 ? 11.949  -2.586  -33.520 1.00 54.14 ? 237 GLN C N   1 
ATOM   5125 C CA  . GLN C 1 243 ? 11.901  -1.920  -32.208 1.00 54.22 ? 237 GLN C CA  1 
ATOM   5126 C C   . GLN C 1 243 ? 10.586  -2.134  -31.433 1.00 53.45 ? 237 GLN C C   1 
ATOM   5127 O O   . GLN C 1 243 ? 10.606  -2.434  -30.252 1.00 53.58 ? 237 GLN C O   1 
ATOM   5128 C CB  . GLN C 1 243 ? 12.150  -0.423  -32.313 1.00 54.00 ? 237 GLN C CB  1 
ATOM   5129 C CG  . GLN C 1 243 ? 13.522  -0.009  -32.767 1.00 55.47 ? 237 GLN C CG  1 
ATOM   5130 C CD  . GLN C 1 243 ? 13.723  1.501   -32.637 1.00 55.52 ? 237 GLN C CD  1 
ATOM   5131 O OE1 . GLN C 1 243 ? 13.581  2.069   -31.542 1.00 56.46 ? 237 GLN C OE1 1 
ATOM   5132 N NE2 . GLN C 1 243 ? 14.048  2.155   -33.755 1.00 55.65 ? 237 GLN C NE2 1 
ATOM   5133 N N   . GLY C 1 244 ? 9.444   -1.954  -32.071 1.00 52.89 ? 238 GLY C N   1 
ATOM   5134 C CA  . GLY C 1 244 ? 8.189   -2.167  -31.366 1.00 52.45 ? 238 GLY C CA  1 
ATOM   5135 C C   . GLY C 1 244 ? 8.095   -3.563  -30.791 1.00 52.54 ? 238 GLY C C   1 
ATOM   5136 O O   . GLY C 1 244 ? 7.777   -3.745  -29.613 1.00 53.33 ? 238 GLY C O   1 
ATOM   5137 N N   . LEU C 1 245 ? 8.379   -4.574  -31.595 1.00 51.86 ? 239 LEU C N   1 
ATOM   5138 C CA  . LEU C 1 245 ? 8.376   -5.925  -31.056 1.00 51.49 ? 239 LEU C CA  1 
ATOM   5139 C C   . LEU C 1 245 ? 9.227   -5.996  -29.779 1.00 51.97 ? 239 LEU C C   1 
ATOM   5140 O O   . LEU C 1 245 ? 8.759   -6.494  -28.738 1.00 52.37 ? 239 LEU C O   1 
ATOM   5141 C CB  . LEU C 1 245 ? 8.843   -6.916  -32.111 1.00 51.33 ? 239 LEU C CB  1 
ATOM   5142 C CG  . LEU C 1 245 ? 7.949   -6.884  -33.354 1.00 50.16 ? 239 LEU C CG  1 
ATOM   5143 C CD1 . LEU C 1 245 ? 8.710   -7.345  -34.566 1.00 48.26 ? 239 LEU C CD1 1 
ATOM   5144 C CD2 . LEU C 1 245 ? 6.687   -7.676  -33.140 1.00 46.69 ? 239 LEU C CD2 1 
ATOM   5145 N N   . GLN C 1 246 ? 10.448  -5.451  -29.842 1.00 51.63 ? 240 GLN C N   1 
ATOM   5146 C CA  . GLN C 1 246 ? 11.299  -5.299  -28.647 1.00 51.47 ? 240 GLN C CA  1 
ATOM   5147 C C   . GLN C 1 246 ? 10.612  -4.626  -27.442 1.00 51.20 ? 240 GLN C C   1 
ATOM   5148 O O   . GLN C 1 246 ? 10.780  -5.066  -26.312 1.00 52.08 ? 240 GLN C O   1 
ATOM   5149 C CB  . GLN C 1 246 ? 12.614  -4.569  -28.964 1.00 51.30 ? 240 GLN C CB  1 
ATOM   5150 C CG  . GLN C 1 246 ? 13.538  -5.308  -29.912 1.00 52.42 ? 240 GLN C CG  1 
ATOM   5151 C CD  . GLN C 1 246 ? 14.994  -4.950  -29.715 1.00 54.98 ? 240 GLN C CD  1 
ATOM   5152 O OE1 . GLN C 1 246 ? 15.769  -4.854  -30.681 1.00 54.53 ? 240 GLN C OE1 1 
ATOM   5153 N NE2 . GLN C 1 246 ? 15.392  -4.781  -28.453 1.00 57.01 ? 240 GLN C NE2 1 
ATOM   5154 N N   . ARG C 1 247 ? 9.848   -3.568  -27.666 1.00 50.38 ? 241 ARG C N   1 
ATOM   5155 C CA  . ARG C 1 247 ? 9.239   -2.875  -26.554 1.00 49.70 ? 241 ARG C CA  1 
ATOM   5156 C C   . ARG C 1 247 ? 8.133   -3.754  -26.004 1.00 49.68 ? 241 ARG C C   1 
ATOM   5157 O O   . ARG C 1 247 ? 8.019   -3.946  -24.784 1.00 48.91 ? 241 ARG C O   1 
ATOM   5158 C CB  . ARG C 1 247 ? 8.680   -1.527  -27.005 1.00 49.78 ? 241 ARG C CB  1 
ATOM   5159 C CG  . ARG C 1 247 ? 8.634   -0.447  -25.944 1.00 49.64 ? 241 ARG C CG  1 
ATOM   5160 C CD  . ARG C 1 247 ? 8.708   -0.957  -24.525 1.00 52.21 ? 241 ARG C CD  1 
ATOM   5161 N NE  . ARG C 1 247 ? 8.076   -0.018  -23.608 1.00 56.21 ? 241 ARG C NE  1 
ATOM   5162 C CZ  . ARG C 1 247 ? 8.710   0.724   -22.703 1.00 58.00 ? 241 ARG C CZ  1 
ATOM   5163 N NH1 . ARG C 1 247 ? 10.027  0.642   -22.543 1.00 57.13 ? 241 ARG C NH1 1 
ATOM   5164 N NH2 . ARG C 1 247 ? 8.004   1.554   -21.941 1.00 60.64 ? 241 ARG C NH2 1 
ATOM   5165 N N   . ILE C 1 248 ? 7.320   -4.300  -26.910 1.00 50.11 ? 242 ILE C N   1 
ATOM   5166 C CA  . ILE C 1 248 ? 6.216   -5.158  -26.494 1.00 50.69 ? 242 ILE C CA  1 
ATOM   5167 C C   . ILE C 1 248 ? 6.758   -6.367  -25.708 1.00 51.17 ? 242 ILE C C   1 
ATOM   5168 O O   . ILE C 1 248 ? 6.276   -6.627  -24.615 1.00 50.98 ? 242 ILE C O   1 
ATOM   5169 C CB  . ILE C 1 248 ? 5.275   -5.520  -27.650 1.00 50.55 ? 242 ILE C CB  1 
ATOM   5170 C CG1 . ILE C 1 248 ? 4.490   -4.270  -28.080 1.00 51.35 ? 242 ILE C CG1 1 
ATOM   5171 C CG2 . ILE C 1 248 ? 4.289   -6.603  -27.221 1.00 50.78 ? 242 ILE C CG2 1 
ATOM   5172 C CD1 . ILE C 1 248 ? 4.064   -4.237  -29.551 1.00 50.21 ? 242 ILE C CD1 1 
ATOM   5173 N N   . PHE C 1 249 ? 7.797   -7.040  -26.220 1.00 51.75 ? 243 PHE C N   1 
ATOM   5174 C CA  . PHE C 1 249 ? 8.495   -8.099  -25.462 1.00 52.32 ? 243 PHE C CA  1 
ATOM   5175 C C   . PHE C 1 249 ? 8.859   -7.664  -24.043 1.00 53.44 ? 243 PHE C C   1 
ATOM   5176 O O   . PHE C 1 249 ? 8.451   -8.305  -23.073 1.00 53.48 ? 243 PHE C O   1 
ATOM   5177 C CB  . PHE C 1 249 ? 9.755   -8.561  -26.195 1.00 51.78 ? 243 PHE C CB  1 
ATOM   5178 C CG  . PHE C 1 249 ? 10.405  -9.790  -25.606 1.00 50.18 ? 243 PHE C CG  1 
ATOM   5179 C CD1 . PHE C 1 249 ? 9.758   -11.012 -25.609 1.00 49.73 ? 243 PHE C CD1 1 
ATOM   5180 C CD2 . PHE C 1 249 ? 11.687  -9.729  -25.088 1.00 49.20 ? 243 PHE C CD2 1 
ATOM   5181 C CE1 . PHE C 1 249 ? 10.371  -12.161 -25.087 1.00 48.93 ? 243 PHE C CE1 1 
ATOM   5182 C CE2 . PHE C 1 249 ? 12.304  -10.867 -24.571 1.00 49.11 ? 243 PHE C CE2 1 
ATOM   5183 C CZ  . PHE C 1 249 ? 11.644  -12.080 -24.568 1.00 48.79 ? 243 PHE C CZ  1 
ATOM   5184 N N   . TYR C 1 250 ? 9.616   -6.573  -23.920 1.00 54.59 ? 244 TYR C N   1 
ATOM   5185 C CA  . TYR C 1 250 ? 9.978   -6.050  -22.604 1.00 55.75 ? 244 TYR C CA  1 
ATOM   5186 C C   . TYR C 1 250 ? 8.783   -5.905  -21.674 1.00 56.47 ? 244 TYR C C   1 
ATOM   5187 O O   . TYR C 1 250 ? 8.787   -6.478  -20.598 1.00 56.57 ? 244 TYR C O   1 
ATOM   5188 C CB  . TYR C 1 250 ? 10.726  -4.730  -22.715 1.00 56.11 ? 244 TYR C CB  1 
ATOM   5189 C CG  . TYR C 1 250 ? 10.723  -3.915  -21.449 1.00 56.95 ? 244 TYR C CG  1 
ATOM   5190 C CD1 . TYR C 1 250 ? 11.375  -4.372  -20.296 1.00 58.67 ? 244 TYR C CD1 1 
ATOM   5191 C CD2 . TYR C 1 250 ? 10.071  -2.686  -21.400 1.00 56.94 ? 244 TYR C CD2 1 
ATOM   5192 C CE1 . TYR C 1 250 ? 11.370  -3.620  -19.116 1.00 59.39 ? 244 TYR C CE1 1 
ATOM   5193 C CE2 . TYR C 1 250 ? 10.063  -1.929  -20.243 1.00 58.36 ? 244 TYR C CE2 1 
ATOM   5194 C CZ  . TYR C 1 250 ? 10.718  -2.389  -19.099 1.00 58.68 ? 244 TYR C CZ  1 
ATOM   5195 O OH  . TYR C 1 250 ? 10.701  -1.619  -17.941 1.00 58.56 ? 244 TYR C OH  1 
ATOM   5196 N N   . LEU C 1 251 ? 7.763   -5.155  -22.092 1.00 57.51 ? 245 LEU C N   1 
ATOM   5197 C CA  . LEU C 1 251 ? 6.553   -4.986  -21.274 1.00 58.41 ? 245 LEU C CA  1 
ATOM   5198 C C   . LEU C 1 251 ? 5.811   -6.306  -20.976 1.00 58.83 ? 245 LEU C C   1 
ATOM   5199 O O   . LEU C 1 251 ? 5.049   -6.390  -20.016 1.00 58.59 ? 245 LEU C O   1 
ATOM   5200 C CB  . LEU C 1 251 ? 5.590   -4.010  -21.942 1.00 58.39 ? 245 LEU C CB  1 
ATOM   5201 C CG  . LEU C 1 251 ? 6.044   -2.589  -22.225 1.00 58.76 ? 245 LEU C CG  1 
ATOM   5202 C CD1 . LEU C 1 251 ? 4.983   -1.932  -23.064 1.00 58.56 ? 245 LEU C CD1 1 
ATOM   5203 C CD2 . LEU C 1 251 ? 6.270   -1.812  -20.950 1.00 59.90 ? 245 LEU C CD2 1 
ATOM   5204 N N   . LYS C 1 252 ? 6.054   -7.319  -21.804 1.00 59.89 ? 246 LYS C N   1 
ATOM   5205 C CA  . LYS C 1 252 ? 5.411   -8.626  -21.698 1.00 60.93 ? 246 LYS C CA  1 
ATOM   5206 C C   . LYS C 1 252 ? 6.133   -9.457  -20.657 1.00 61.73 ? 246 LYS C C   1 
ATOM   5207 O O   . LYS C 1 252 ? 5.488   -10.179 -19.914 1.00 62.03 ? 246 LYS C O   1 
ATOM   5208 C CB  . LYS C 1 252 ? 5.431   -9.349  -23.052 1.00 60.71 ? 246 LYS C CB  1 
ATOM   5209 C CG  . LYS C 1 252 ? 4.075   -9.788  -23.584 1.00 60.63 ? 246 LYS C CG  1 
ATOM   5210 C CD  . LYS C 1 252 ? 4.258   -10.877 -24.648 1.00 61.89 ? 246 LYS C CD  1 
ATOM   5211 C CE  . LYS C 1 252 ? 2.956   -11.648 -24.983 1.00 61.43 ? 246 LYS C CE  1 
ATOM   5212 N NZ  . LYS C 1 252 ? 2.533   -12.766 -24.071 1.00 61.54 ? 246 LYS C NZ  1 
ATOM   5213 N N   . LEU C 1 253 ? 7.468   -9.357  -20.624 1.00 63.02 ? 247 LEU C N   1 
ATOM   5214 C CA  . LEU C 1 253 ? 8.328   -10.036 -19.632 1.00 64.03 ? 247 LEU C CA  1 
ATOM   5215 C C   . LEU C 1 253 ? 8.102   -9.415  -18.267 1.00 64.95 ? 247 LEU C C   1 
ATOM   5216 O O   . LEU C 1 253 ? 7.702   -10.090 -17.306 1.00 65.00 ? 247 LEU C O   1 
ATOM   5217 C CB  . LEU C 1 253 ? 9.814   -9.877  -19.984 1.00 63.61 ? 247 LEU C CB  1 
ATOM   5218 C CG  . LEU C 1 253 ? 10.498  -10.907 -20.889 1.00 64.20 ? 247 LEU C CG  1 
ATOM   5219 C CD1 . LEU C 1 253 ? 11.941  -10.500 -21.165 1.00 63.93 ? 247 LEU C CD1 1 
ATOM   5220 C CD2 . LEU C 1 253 ? 10.457  -12.311 -20.296 1.00 63.55 ? 247 LEU C CD2 1 
ATOM   5221 N N   . GLU C 1 254 ? 8.408   -8.122  -18.214 1.00 65.96 ? 248 GLU C N   1 
ATOM   5222 C CA  . GLU C 1 254 ? 8.083   -7.218  -17.140 1.00 66.96 ? 248 GLU C CA  1 
ATOM   5223 C C   . GLU C 1 254 ? 6.729   -7.535  -16.486 1.00 67.81 ? 248 GLU C C   1 
ATOM   5224 O O   . GLU C 1 254 ? 6.655   -7.736  -15.271 1.00 67.75 ? 248 GLU C O   1 
ATOM   5225 C CB  . GLU C 1 254 ? 8.072   -5.817  -17.737 1.00 67.09 ? 248 GLU C CB  1 
ATOM   5226 C CG  . GLU C 1 254 ? 7.948   -4.718  -16.751 1.00 68.32 ? 248 GLU C CG  1 
ATOM   5227 C CD  . GLU C 1 254 ? 9.168   -4.625  -15.906 1.00 69.83 ? 248 GLU C CD  1 
ATOM   5228 O OE1 . GLU C 1 254 ? 9.254   -3.651  -15.132 1.00 71.30 ? 248 GLU C OE1 1 
ATOM   5229 O OE2 . GLU C 1 254 ? 10.037  -5.522  -16.024 1.00 69.10 ? 248 GLU C OE2 1 
ATOM   5230 N N   . ASP C 1 255 ? 5.669   -7.559  -17.299 1.00 68.88 ? 249 ASP C N   1 
ATOM   5231 C CA  . ASP C 1 255 ? 4.334   -8.032  -16.898 1.00 70.14 ? 249 ASP C CA  1 
ATOM   5232 C C   . ASP C 1 255 ? 3.606   -7.219  -15.803 1.00 70.88 ? 249 ASP C C   1 
ATOM   5233 O O   . ASP C 1 255 ? 3.695   -7.533  -14.605 1.00 71.70 ? 249 ASP C O   1 
ATOM   5234 C CB  . ASP C 1 255 ? 4.393   -9.518  -16.494 1.00 70.30 ? 249 ASP C CB  1 
ATOM   5235 C CG  . ASP C 1 255 ? 3.041   -10.203 -16.575 1.00 71.12 ? 249 ASP C CG  1 
ATOM   5236 O OD1 . ASP C 1 255 ? 2.021   -9.522  -16.857 1.00 72.29 ? 249 ASP C OD1 1 
ATOM   5237 O OD2 . ASP C 1 255 ? 2.997   -11.433 -16.364 1.00 71.32 ? 249 ASP C OD2 1 
ATOM   5238 N N   . LEU C 1 256 ? 2.870   -6.190  -16.212 1.00 71.15 ? 250 LEU C N   1 
ATOM   5239 C CA  . LEU C 1 256 ? 1.996   -5.474  -15.282 1.00 71.29 ? 250 LEU C CA  1 
ATOM   5240 C C   . LEU C 1 256 ? 0.536   -5.602  -15.713 1.00 71.55 ? 250 LEU C C   1 
ATOM   5241 O O   . LEU C 1 256 ? -0.270  -6.142  -14.965 1.00 71.86 ? 250 LEU C O   1 
ATOM   5242 C CB  . LEU C 1 256 ? 2.452   -4.022  -15.046 1.00 70.95 ? 250 LEU C CB  1 
ATOM   5243 C CG  . LEU C 1 256 ? 3.782   -4.001  -14.280 1.00 70.84 ? 250 LEU C CG  1 
ATOM   5244 C CD1 . LEU C 1 256 ? 4.361   -2.612  -14.166 1.00 70.60 ? 250 LEU C CD1 1 
ATOM   5245 C CD2 . LEU C 1 256 ? 3.649   -4.651  -12.894 1.00 71.06 ? 250 LEU C CD2 1 
ATOM   5246 N N   . VAL C 1 257 ? 0.181   -5.151  -16.912 1.00 71.68 ? 251 VAL C N   1 
ATOM   5247 C CA  . VAL C 1 257 ? -1.134  -5.523  -17.424 1.00 71.63 ? 251 VAL C CA  1 
ATOM   5248 C C   . VAL C 1 257 ? -1.034  -6.681  -18.420 1.00 71.68 ? 251 VAL C C   1 
ATOM   5249 O O   . VAL C 1 257 ? -0.060  -6.773  -19.184 1.00 71.38 ? 251 VAL C O   1 
ATOM   5250 C CB  . VAL C 1 257 ? -1.959  -4.323  -18.011 1.00 71.70 ? 251 VAL C CB  1 
ATOM   5251 C CG1 . VAL C 1 257 ? -2.377  -3.355  -16.905 1.00 70.99 ? 251 VAL C CG1 1 
ATOM   5252 C CG2 . VAL C 1 257 ? -1.201  -3.626  -19.126 1.00 71.53 ? 251 VAL C CG2 1 
ATOM   5253 N N   . PRO C 1 258 ? -2.038  -7.577  -18.402 1.00 71.81 ? 252 PRO C N   1 
ATOM   5254 C CA  . PRO C 1 258 ? -2.139  -8.534  -19.502 1.00 71.95 ? 252 PRO C CA  1 
ATOM   5255 C C   . PRO C 1 258 ? -2.414  -7.787  -20.817 1.00 72.07 ? 252 PRO C C   1 
ATOM   5256 O O   . PRO C 1 258 ? -3.289  -6.906  -20.854 1.00 71.81 ? 252 PRO C O   1 
ATOM   5257 C CB  . PRO C 1 258 ? -3.337  -9.416  -19.105 1.00 71.93 ? 252 PRO C CB  1 
ATOM   5258 C CG  . PRO C 1 258 ? -3.545  -9.171  -17.624 1.00 71.90 ? 252 PRO C CG  1 
ATOM   5259 C CD  . PRO C 1 258 ? -3.108  -7.757  -17.398 1.00 71.70 ? 252 PRO C CD  1 
ATOM   5260 N N   . PRO C 1 259 ? -1.651  -8.110  -21.881 1.00 72.32 ? 253 PRO C N   1 
ATOM   5261 C CA  . PRO C 1 259 ? -1.867  -7.512  -23.212 1.00 72.49 ? 253 PRO C CA  1 
ATOM   5262 C C   . PRO C 1 259 ? -3.154  -8.026  -23.841 1.00 72.70 ? 253 PRO C C   1 
ATOM   5263 O O   . PRO C 1 259 ? -3.496  -9.198  -23.659 1.00 72.78 ? 253 PRO C O   1 
ATOM   5264 C CB  . PRO C 1 259 ? -0.660  -7.993  -24.029 1.00 72.18 ? 253 PRO C CB  1 
ATOM   5265 C CG  . PRO C 1 259 ? -0.209  -9.223  -23.351 1.00 72.32 ? 253 PRO C CG  1 
ATOM   5266 C CD  . PRO C 1 259 ? -0.534  -9.071  -21.883 1.00 72.32 ? 253 PRO C CD  1 
ATOM   5267 N N   . PRO C 1 260 ? -3.867  -7.162  -24.581 1.00 72.95 ? 254 PRO C N   1 
ATOM   5268 C CA  . PRO C 1 260 ? -5.127  -7.616  -25.179 1.00 73.04 ? 254 PRO C CA  1 
ATOM   5269 C C   . PRO C 1 260 ? -4.855  -8.708  -26.207 1.00 73.01 ? 254 PRO C C   1 
ATOM   5270 O O   . PRO C 1 260 ? -4.110  -8.480  -27.166 1.00 72.82 ? 254 PRO C O   1 
ATOM   5271 C CB  . PRO C 1 260 ? -5.694  -6.359  -25.840 1.00 72.90 ? 254 PRO C CB  1 
ATOM   5272 C CG  . PRO C 1 260 ? -4.513  -5.458  -26.022 1.00 73.35 ? 254 PRO C CG  1 
ATOM   5273 C CD  . PRO C 1 260 ? -3.551  -5.764  -24.918 1.00 72.95 ? 254 PRO C CD  1 
ATOM   5274 N N   . PRO C 1 261 ? -5.434  -9.900  -25.987 1.00 73.18 ? 255 PRO C N   1 
ATOM   5275 C CA  . PRO C 1 261 ? -5.249  -11.082 -26.832 1.00 73.38 ? 255 PRO C CA  1 
ATOM   5276 C C   . PRO C 1 261 ? -5.037  -10.803 -28.344 1.00 73.42 ? 255 PRO C C   1 
ATOM   5277 O O   . PRO C 1 261 ? -4.199  -11.466 -28.982 1.00 73.17 ? 255 PRO C O   1 
ATOM   5278 C CB  . PRO C 1 261 ? -6.528  -11.879 -26.564 1.00 73.39 ? 255 PRO C CB  1 
ATOM   5279 C CG  . PRO C 1 261 ? -6.771  -11.615 -25.091 1.00 73.01 ? 255 PRO C CG  1 
ATOM   5280 C CD  . PRO C 1 261 ? -6.345  -10.186 -24.856 1.00 73.12 ? 255 PRO C CD  1 
ATOM   5281 N N   . ILE C 1 262 ? -5.771  -9.831  -28.896 1.00 73.39 ? 256 ILE C N   1 
ATOM   5282 C CA  . ILE C 1 262 ? -5.559  -9.400  -30.290 1.00 73.32 ? 256 ILE C CA  1 
ATOM   5283 C C   . ILE C 1 262 ? -4.119  -8.917  -30.541 1.00 72.98 ? 256 ILE C C   1 
ATOM   5284 O O   . ILE C 1 262 ? -3.375  -9.544  -31.297 1.00 72.98 ? 256 ILE C O   1 
ATOM   5285 C CB  . ILE C 1 262 ? -6.643  -8.366  -30.822 1.00 73.59 ? 256 ILE C CB  1 
ATOM   5286 C CG1 . ILE C 1 262 ? -7.275  -7.510  -29.689 1.00 73.35 ? 256 ILE C CG1 1 
ATOM   5287 C CG2 . ILE C 1 262 ? -7.706  -9.083  -31.669 1.00 73.42 ? 256 ILE C CG2 1 
ATOM   5288 C CD1 . ILE C 1 262 ? -6.858  -6.021  -29.678 1.00 71.13 ? 256 ILE C CD1 1 
ATOM   5289 N N   . ILE C 1 263 ? -3.725  -7.827  -29.887 1.00 72.54 ? 257 ILE C N   1 
ATOM   5290 C CA  . ILE C 1 263 ? -2.390  -7.255  -30.068 1.00 72.31 ? 257 ILE C CA  1 
ATOM   5291 C C   . ILE C 1 263 ? -1.347  -8.318  -29.800 1.00 71.78 ? 257 ILE C C   1 
ATOM   5292 O O   . ILE C 1 263 ? -0.325  -8.387  -30.473 1.00 71.81 ? 257 ILE C O   1 
ATOM   5293 C CB  . ILE C 1 263 ? -2.144  -6.042  -29.125 1.00 72.53 ? 257 ILE C CB  1 
ATOM   5294 C CG1 . ILE C 1 263 ? -3.109  -4.896  -29.442 1.00 72.26 ? 257 ILE C CG1 1 
ATOM   5295 C CG2 . ILE C 1 263 ? -0.682  -5.578  -29.181 1.00 72.54 ? 257 ILE C CG2 1 
ATOM   5296 C CD1 . ILE C 1 263 ? -3.349  -4.671  -30.917 1.00 72.83 ? 257 ILE C CD1 1 
ATOM   5297 N N   . ASP C 1 264 ? -1.641  -9.156  -28.819 1.00 71.42 ? 258 ASP C N   1 
ATOM   5298 C CA  . ASP C 1 264 ? -0.758  -10.223 -28.396 1.00 70.78 ? 258 ASP C CA  1 
ATOM   5299 C C   . ASP C 1 264 ? -0.572  -11.308 -29.444 1.00 70.12 ? 258 ASP C C   1 
ATOM   5300 O O   . ASP C 1 264 ? 0.531   -11.828 -29.621 1.00 69.96 ? 258 ASP C O   1 
ATOM   5301 C CB  . ASP C 1 264 ? -1.313  -10.839 -27.141 1.00 70.92 ? 258 ASP C CB  1 
ATOM   5302 C CG  . ASP C 1 264 ? -0.261  -11.466 -26.337 1.00 72.55 ? 258 ASP C CG  1 
ATOM   5303 O OD1 . ASP C 1 264 ? 0.796   -11.727 -26.934 1.00 74.41 ? 258 ASP C OD1 1 
ATOM   5304 O OD2 . ASP C 1 264 ? -0.463  -11.694 -25.124 1.00 74.97 ? 258 ASP C OD2 1 
ATOM   5305 N N   . LYS C 1 265 ? -1.654  -11.653 -30.130 1.00 69.54 ? 259 LYS C N   1 
ATOM   5306 C CA  . LYS C 1 265 ? -1.574  -12.576 -31.253 1.00 69.37 ? 259 LYS C CA  1 
ATOM   5307 C C   . LYS C 1 265 ? -0.579  -12.083 -32.324 1.00 69.15 ? 259 LYS C C   1 
ATOM   5308 O O   . LYS C 1 265 ? 0.371   -12.794 -32.658 1.00 69.55 ? 259 LYS C O   1 
ATOM   5309 C CB  . LYS C 1 265 ? -2.958  -12.820 -31.873 1.00 69.32 ? 259 LYS C CB  1 
ATOM   5310 C CG  . LYS C 1 265 ? -2.991  -14.043 -32.776 1.00 69.07 ? 259 LYS C CG  1 
ATOM   5311 C CD  . LYS C 1 265 ? -3.819  -13.822 -34.026 1.00 69.02 ? 259 LYS C CD  1 
ATOM   5312 C CE  . LYS C 1 265 ? -3.457  -14.863 -35.073 1.00 69.28 ? 259 LYS C CE  1 
ATOM   5313 N NZ  . LYS C 1 265 ? -4.600  -15.185 -35.968 1.00 69.61 ? 259 LYS C NZ  1 
ATOM   5314 N N   . ILE C 1 266 ? -0.811  -10.875 -32.849 1.00 68.55 ? 260 ILE C N   1 
ATOM   5315 C CA  . ILE C 1 266 ? 0.067   -10.217 -33.841 1.00 67.92 ? 260 ILE C CA  1 
ATOM   5316 C C   . ILE C 1 266 ? 1.547   -10.416 -33.495 1.00 67.75 ? 260 ILE C C   1 
ATOM   5317 O O   . ILE C 1 266 ? 2.300   -11.024 -34.275 1.00 67.20 ? 260 ILE C O   1 
ATOM   5318 C CB  . ILE C 1 266 ? -0.273  -8.680  -33.975 1.00 67.71 ? 260 ILE C CB  1 
ATOM   5319 C CG1 . ILE C 1 266 ? -1.681  -8.485  -34.545 1.00 67.19 ? 260 ILE C CG1 1 
ATOM   5320 C CG2 . ILE C 1 266 ? 0.746   -7.939  -34.839 1.00 67.10 ? 260 ILE C CG2 1 
ATOM   5321 C CD1 . ILE C 1 266 ? -2.396  -7.234  -34.015 1.00 66.28 ? 260 ILE C CD1 1 
ATOM   5322 N N   . PHE C 1 267 ? 1.930   -9.901  -32.319 1.00 67.73 ? 261 PHE C N   1 
ATOM   5323 C CA  . PHE C 1 267 ? 3.240   -10.117 -31.714 1.00 67.78 ? 261 PHE C CA  1 
ATOM   5324 C C   . PHE C 1 267 ? 3.852   -11.500 -32.054 1.00 68.45 ? 261 PHE C C   1 
ATOM   5325 O O   . PHE C 1 267 ? 4.991   -11.558 -32.519 1.00 68.37 ? 261 PHE C O   1 
ATOM   5326 C CB  . PHE C 1 267 ? 3.182   -9.879  -30.201 1.00 66.92 ? 261 PHE C CB  1 
ATOM   5327 C CG  . PHE C 1 267 ? 4.501   -10.104 -29.507 1.00 66.74 ? 261 PHE C CG  1 
ATOM   5328 C CD1 . PHE C 1 267 ? 5.477   -9.101  -29.488 1.00 66.52 ? 261 PHE C CD1 1 
ATOM   5329 C CD2 . PHE C 1 267 ? 4.783   -11.330 -28.884 1.00 64.84 ? 261 PHE C CD2 1 
ATOM   5330 C CE1 . PHE C 1 267 ? 6.717   -9.315  -28.851 1.00 65.45 ? 261 PHE C CE1 1 
ATOM   5331 C CE2 . PHE C 1 267 ? 6.007   -11.556 -28.251 1.00 63.50 ? 261 PHE C CE2 1 
ATOM   5332 C CZ  . PHE C 1 267 ? 6.977   -10.548 -28.234 1.00 64.85 ? 261 PHE C CZ  1 
ATOM   5333 N N   . MET C 1 268 ? 3.113   -12.596 -31.847 1.00 69.03 ? 262 MET C N   1 
ATOM   5334 C CA  . MET C 1 268 ? 3.526   -13.899 -32.395 1.00 69.98 ? 262 MET C CA  1 
ATOM   5335 C C   . MET C 1 268 ? 3.576   -13.932 -33.955 1.00 70.00 ? 262 MET C C   1 
ATOM   5336 O O   . MET C 1 268 ? 2.619   -14.308 -34.645 1.00 69.52 ? 262 MET C O   1 
ATOM   5337 C CB  . MET C 1 268 ? 2.682   -15.034 -31.804 1.00 70.72 ? 262 MET C CB  1 
ATOM   5338 C CG  . MET C 1 268 ? 3.455   -16.029 -30.884 1.00 72.24 ? 262 MET C CG  1 
ATOM   5339 S SD  . MET C 1 268 ? 4.175   -15.418 -29.321 1.00 74.82 ? 262 MET C SD  1 
ATOM   5340 C CE  . MET C 1 268 ? 4.345   -16.963 -28.396 1.00 72.57 ? 262 MET C CE  1 
ATOM   5341 N N   . ASP C 1 269 ? 4.733   -13.520 -34.471 1.00 70.44 ? 263 ASP C N   1 
ATOM   5342 C CA  . ASP C 1 269 ? 4.996   -13.309 -35.897 1.00 70.28 ? 263 ASP C CA  1 
ATOM   5343 C C   . ASP C 1 269 ? 6.462   -12.911 -36.153 1.00 70.29 ? 263 ASP C C   1 
ATOM   5344 O O   . ASP C 1 269 ? 6.754   -11.733 -36.435 1.00 69.80 ? 263 ASP C O   1 
ATOM   5345 N N   . THR C 1 270 ? 7.370   -13.888 -35.968 1.00 70.14 ? 264 THR C N   1 
ATOM   5346 C CA  . THR C 1 270 ? 8.711   -13.970 -36.610 1.00 69.94 ? 264 THR C CA  1 
ATOM   5347 C C   . THR C 1 270 ? 9.130   -15.435 -36.762 1.00 69.39 ? 264 THR C C   1 
ATOM   5348 O O   . THR C 1 270 ? 10.140  -15.863 -36.203 1.00 68.40 ? 264 THR C O   1 
ATOM   5349 C CB  . THR C 1 270 ? 9.838   -13.279 -35.822 1.00 70.00 ? 264 THR C CB  1 
ATOM   5350 O OG1 . THR C 1 270 ? 9.317   -12.138 -35.146 1.00 71.60 ? 264 THR C OG1 1 
ATOM   5351 C CG2 . THR C 1 270 ? 10.992  -12.849 -36.761 1.00 69.35 ? 264 THR C CG2 1 
ATOM   5352 N N   . ASN D 1 38  ? 56.791  13.080  -25.551 1.00 76.68 ? 32  ASN D N   1 
ATOM   5353 C CA  . ASN D 1 38  ? 56.364  11.647  -25.656 1.00 77.08 ? 32  ASN D CA  1 
ATOM   5354 C C   . ASN D 1 38  ? 56.076  11.251  -27.102 1.00 76.99 ? 32  ASN D C   1 
ATOM   5355 O O   . ASN D 1 38  ? 56.688  11.787  -28.034 1.00 77.04 ? 32  ASN D O   1 
ATOM   5356 C CB  . ASN D 1 38  ? 55.148  11.342  -24.743 1.00 77.06 ? 32  ASN D CB  1 
ATOM   5357 C CG  . ASN D 1 38  ? 55.552  10.804  -23.361 1.00 76.59 ? 32  ASN D CG  1 
ATOM   5358 O OD1 . ASN D 1 38  ? 56.459  11.325  -22.698 1.00 75.91 ? 32  ASN D OD1 1 
ATOM   5359 N ND2 . ASN D 1 38  ? 54.856  9.764   -22.920 1.00 77.02 ? 32  ASN D ND2 1 
ATOM   5360 N N   . LEU D 1 39  ? 55.142  10.315  -27.276 1.00 76.99 ? 33  LEU D N   1 
ATOM   5361 C CA  . LEU D 1 39  ? 54.772  9.794   -28.602 1.00 77.02 ? 33  LEU D CA  1 
ATOM   5362 C C   . LEU D 1 39  ? 53.915  10.718  -29.465 1.00 76.69 ? 33  LEU D C   1 
ATOM   5363 O O   . LEU D 1 39  ? 54.019  10.684  -30.684 1.00 76.28 ? 33  LEU D O   1 
ATOM   5364 C CB  . LEU D 1 39  ? 54.081  8.434   -28.477 1.00 76.94 ? 33  LEU D CB  1 
ATOM   5365 C CG  . LEU D 1 39  ? 54.987  7.239   -28.760 1.00 77.62 ? 33  LEU D CG  1 
ATOM   5366 C CD1 . LEU D 1 39  ? 56.197  7.164   -27.782 1.00 78.12 ? 33  LEU D CD1 1 
ATOM   5367 C CD2 . LEU D 1 39  ? 54.158  5.971   -28.721 1.00 77.77 ? 33  LEU D CD2 1 
ATOM   5368 N N   . LEU D 1 40  ? 53.065  11.519  -28.826 1.00 76.69 ? 34  LEU D N   1 
ATOM   5369 C CA  . LEU D 1 40  ? 52.110  12.354  -29.537 1.00 76.64 ? 34  LEU D CA  1 
ATOM   5370 C C   . LEU D 1 40  ? 52.828  13.196  -30.582 1.00 76.89 ? 34  LEU D C   1 
ATOM   5371 O O   . LEU D 1 40  ? 52.703  12.917  -31.783 1.00 77.18 ? 34  LEU D O   1 
ATOM   5372 C CB  . LEU D 1 40  ? 51.273  13.207  -28.574 1.00 76.45 ? 34  LEU D CB  1 
ATOM   5373 C CG  . LEU D 1 40  ? 50.251  14.162  -29.200 1.00 76.16 ? 34  LEU D CG  1 
ATOM   5374 C CD1 . LEU D 1 40  ? 48.844  13.877  -28.693 1.00 76.05 ? 34  LEU D CD1 1 
ATOM   5375 C CD2 . LEU D 1 40  ? 50.665  15.622  -28.970 1.00 75.96 ? 34  LEU D CD2 1 
ATOM   5376 N N   . THR D 1 41  ? 53.600  14.195  -30.140 1.00 76.83 ? 35  THR D N   1 
ATOM   5377 C CA  . THR D 1 41  ? 54.348  15.041  -31.078 1.00 76.30 ? 35  THR D CA  1 
ATOM   5378 C C   . THR D 1 41  ? 55.202  14.145  -31.981 1.00 75.87 ? 35  THR D C   1 
ATOM   5379 O O   . THR D 1 41  ? 55.376  14.454  -33.161 1.00 76.08 ? 35  THR D O   1 
ATOM   5380 C CB  . THR D 1 41  ? 55.239  16.135  -30.392 1.00 76.39 ? 35  THR D CB  1 
ATOM   5381 O OG1 . THR D 1 41  ? 56.401  15.529  -29.819 1.00 75.69 ? 35  THR D OG1 1 
ATOM   5382 C CG2 . THR D 1 41  ? 54.467  16.906  -29.323 1.00 76.32 ? 35  THR D CG2 1 
ATOM   5383 N N   . SER D 1 42  ? 55.702  13.034  -31.430 1.00 74.89 ? 36  SER D N   1 
ATOM   5384 C CA  . SER D 1 42  ? 56.422  12.048  -32.227 1.00 73.99 ? 36  SER D CA  1 
ATOM   5385 C C   . SER D 1 42  ? 55.551  11.438  -33.336 1.00 73.48 ? 36  SER D C   1 
ATOM   5386 O O   . SER D 1 42  ? 55.994  11.335  -34.480 1.00 74.04 ? 36  SER D O   1 
ATOM   5387 C CB  . SER D 1 42  ? 57.029  10.965  -31.344 1.00 73.89 ? 36  SER D CB  1 
ATOM   5388 O OG  . SER D 1 42  ? 57.949  10.193  -32.087 1.00 73.42 ? 36  SER D OG  1 
ATOM   5389 N N   . LEU D 1 43  ? 54.318  11.050  -33.018 1.00 72.51 ? 37  LEU D N   1 
ATOM   5390 C CA  . LEU D 1 43  ? 53.394  10.553  -34.044 1.00 71.63 ? 37  LEU D CA  1 
ATOM   5391 C C   . LEU D 1 43  ? 53.003  11.675  -34.985 1.00 71.00 ? 37  LEU D C   1 
ATOM   5392 O O   . LEU D 1 43  ? 53.114  11.540  -36.200 1.00 70.61 ? 37  LEU D O   1 
ATOM   5393 C CB  . LEU D 1 43  ? 52.135  9.942   -33.421 1.00 71.85 ? 37  LEU D CB  1 
ATOM   5394 C CG  . LEU D 1 43  ? 52.135  8.502   -32.884 1.00 71.65 ? 37  LEU D CG  1 
ATOM   5395 C CD1 . LEU D 1 43  ? 50.769  8.200   -32.299 1.00 72.05 ? 37  LEU D CD1 1 
ATOM   5396 C CD2 . LEU D 1 43  ? 52.489  7.464   -33.942 1.00 70.66 ? 37  LEU D CD2 1 
ATOM   5397 N N   . VAL D 1 44  ? 52.547  12.780  -34.400 1.00 70.34 ? 38  VAL D N   1 
ATOM   5398 C CA  . VAL D 1 44  ? 52.313  14.030  -35.110 1.00 69.77 ? 38  VAL D CA  1 
ATOM   5399 C C   . VAL D 1 44  ? 53.450  14.325  -36.085 1.00 69.87 ? 38  VAL D C   1 
ATOM   5400 O O   . VAL D 1 44  ? 53.243  15.031  -37.070 1.00 70.14 ? 38  VAL D O   1 
ATOM   5401 C CB  . VAL D 1 44  ? 52.143  15.208  -34.113 1.00 69.73 ? 38  VAL D CB  1 
ATOM   5402 C CG1 . VAL D 1 44  ? 52.152  16.567  -34.804 1.00 69.53 ? 38  VAL D CG1 1 
ATOM   5403 C CG2 . VAL D 1 44  ? 50.876  15.050  -33.337 1.00 69.31 ? 38  VAL D CG2 1 
ATOM   5404 N N   . ARG D 1 45  ? 54.642  13.778  -35.841 1.00 69.73 ? 39  ARG D N   1 
ATOM   5405 C CA  . ARG D 1 45  ? 55.776  14.078  -36.728 1.00 69.82 ? 39  ARG D CA  1 
ATOM   5406 C C   . ARG D 1 45  ? 55.845  13.125  -37.896 1.00 69.46 ? 39  ARG D C   1 
ATOM   5407 O O   . ARG D 1 45  ? 56.185  13.534  -39.002 1.00 69.41 ? 39  ARG D O   1 
ATOM   5408 C CB  . ARG D 1 45  ? 57.129  14.143  -35.993 1.00 69.86 ? 39  ARG D CB  1 
ATOM   5409 C CG  . ARG D 1 45  ? 58.040  15.285  -36.486 1.00 69.71 ? 39  ARG D CG  1 
ATOM   5410 C CD  . ARG D 1 45  ? 59.515  15.075  -36.082 1.00 70.49 ? 39  ARG D CD  1 
ATOM   5411 N NE  . ARG D 1 45  ? 59.884  15.728  -34.817 1.00 71.48 ? 39  ARG D NE  1 
ATOM   5412 C CZ  . ARG D 1 45  ? 61.135  16.022  -34.441 1.00 72.03 ? 39  ARG D CZ  1 
ATOM   5413 N NH1 . ARG D 1 45  ? 61.360  16.622  -33.277 1.00 70.55 ? 39  ARG D NH1 1 
ATOM   5414 N NH2 . ARG D 1 45  ? 62.172  15.731  -35.225 1.00 73.37 ? 39  ARG D NH2 1 
ATOM   5415 N N   . ALA D 1 46  ? 55.507  11.862  -37.647 1.00 69.27 ? 40  ALA D N   1 
ATOM   5416 C CA  . ALA D 1 46  ? 55.562  10.821  -38.677 1.00 69.00 ? 40  ALA D CA  1 
ATOM   5417 C C   . ALA D 1 46  ? 54.496  11.015  -39.778 1.00 68.85 ? 40  ALA D C   1 
ATOM   5418 O O   . ALA D 1 46  ? 54.739  10.738  -40.966 1.00 69.01 ? 40  ALA D O   1 
ATOM   5419 C CB  . ALA D 1 46  ? 55.437  9.459   -38.029 1.00 69.25 ? 40  ALA D CB  1 
ATOM   5420 N N   . HIS D 1 47  ? 53.323  11.504  -39.375 1.00 68.46 ? 41  HIS D N   1 
ATOM   5421 C CA  . HIS D 1 47  ? 52.254  11.855  -40.308 1.00 67.84 ? 41  HIS D CA  1 
ATOM   5422 C C   . HIS D 1 47  ? 52.639  13.062  -41.193 1.00 67.81 ? 41  HIS D C   1 
ATOM   5423 O O   . HIS D 1 47  ? 52.519  12.983  -42.429 1.00 67.85 ? 41  HIS D O   1 
ATOM   5424 C CB  . HIS D 1 47  ? 50.928  12.080  -39.558 1.00 67.53 ? 41  HIS D CB  1 
ATOM   5425 C CG  . HIS D 1 47  ? 49.987  13.011  -40.253 1.00 66.83 ? 41  HIS D CG  1 
ATOM   5426 N ND1 . HIS D 1 47  ? 49.611  12.849  -41.569 1.00 66.47 ? 41  HIS D ND1 1 
ATOM   5427 C CD2 . HIS D 1 47  ? 49.346  14.119  -39.816 1.00 66.56 ? 41  HIS D CD2 1 
ATOM   5428 C CE1 . HIS D 1 47  ? 48.800  13.829  -41.920 1.00 65.65 ? 41  HIS D CE1 1 
ATOM   5429 N NE2 . HIS D 1 47  ? 48.615  14.609  -40.873 1.00 65.79 ? 41  HIS D NE2 1 
ATOM   5430 N N   . LEU D 1 48  ? 53.104  14.155  -40.568 1.00 67.25 ? 42  LEU D N   1 
ATOM   5431 C CA  . LEU D 1 48  ? 53.512  15.365  -41.300 1.00 66.60 ? 42  LEU D CA  1 
ATOM   5432 C C   . LEU D 1 48  ? 54.665  15.095  -42.248 1.00 66.73 ? 42  LEU D C   1 
ATOM   5433 O O   . LEU D 1 48  ? 54.594  15.453  -43.410 1.00 66.61 ? 42  LEU D O   1 
ATOM   5434 C CB  . LEU D 1 48  ? 53.881  16.496  -40.346 1.00 66.25 ? 42  LEU D CB  1 
ATOM   5435 C CG  . LEU D 1 48  ? 52.745  17.148  -39.556 1.00 65.48 ? 42  LEU D CG  1 
ATOM   5436 C CD1 . LEU D 1 48  ? 53.276  18.045  -38.423 1.00 63.76 ? 42  LEU D CD1 1 
ATOM   5437 C CD2 . LEU D 1 48  ? 51.828  17.916  -40.471 1.00 63.52 ? 42  LEU D CD2 1 
ATOM   5438 N N   . ASP D 1 49  ? 55.710  14.442  -41.746 1.00 67.19 ? 43  ASP D N   1 
ATOM   5439 C CA  . ASP D 1 49  ? 56.913  14.130  -42.531 1.00 67.78 ? 43  ASP D CA  1 
ATOM   5440 C C   . ASP D 1 49  ? 56.668  12.999  -43.558 1.00 68.11 ? 43  ASP D C   1 
ATOM   5441 O O   . ASP D 1 49  ? 57.610  12.255  -43.888 1.00 68.45 ? 43  ASP D O   1 
ATOM   5442 C CB  . ASP D 1 49  ? 58.103  13.710  -41.616 1.00 67.97 ? 43  ASP D CB  1 
ATOM   5443 C CG  . ASP D 1 49  ? 58.702  14.870  -40.754 1.00 67.90 ? 43  ASP D CG  1 
ATOM   5444 O OD1 . ASP D 1 49  ? 58.148  15.995  -40.703 1.00 68.04 ? 43  ASP D OD1 1 
ATOM   5445 O OD2 . ASP D 1 49  ? 59.752  14.625  -40.102 1.00 66.36 ? 43  ASP D OD2 1 
ATOM   5446 N N   . SER D 1 50  ? 55.431  12.844  -44.045 1.00 67.81 ? 44  SER D N   1 
ATOM   5447 C CA  . SER D 1 50  ? 55.148  11.838  -45.086 1.00 67.72 ? 44  SER D CA  1 
ATOM   5448 C C   . SER D 1 50  ? 54.175  12.327  -46.179 1.00 67.44 ? 44  SER D C   1 
ATOM   5449 O O   . SER D 1 50  ? 54.528  12.339  -47.359 1.00 67.35 ? 44  SER D O   1 
ATOM   5450 C CB  . SER D 1 50  ? 54.703  10.497  -44.477 1.00 67.95 ? 44  SER D CB  1 
ATOM   5451 O OG  . SER D 1 50  ? 53.336  10.515  -44.084 1.00 68.75 ? 44  SER D OG  1 
ATOM   5452 N N   . GLY D 1 51  ? 52.959  12.724  -45.800 1.00 67.37 ? 45  GLY D N   1 
ATOM   5453 C CA  . GLY D 1 51  ? 52.051  13.397  -46.741 1.00 66.67 ? 45  GLY D CA  1 
ATOM   5454 C C   . GLY D 1 51  ? 52.862  14.504  -47.399 1.00 65.97 ? 45  GLY D C   1 
ATOM   5455 O O   . GLY D 1 51  ? 53.794  15.016  -46.783 1.00 66.10 ? 45  GLY D O   1 
ATOM   5456 N N   . PRO D 1 52  ? 52.528  14.883  -48.646 1.00 65.43 ? 46  PRO D N   1 
ATOM   5457 C CA  . PRO D 1 52  ? 53.308  15.898  -49.377 1.00 65.01 ? 46  PRO D CA  1 
ATOM   5458 C C   . PRO D 1 52  ? 53.015  17.309  -48.889 1.00 64.47 ? 46  PRO D C   1 
ATOM   5459 O O   . PRO D 1 52  ? 51.876  17.605  -48.519 1.00 64.24 ? 46  PRO D O   1 
ATOM   5460 C CB  . PRO D 1 52  ? 52.796  15.750  -50.803 1.00 64.86 ? 46  PRO D CB  1 
ATOM   5461 C CG  . PRO D 1 52  ? 51.397  15.340  -50.624 1.00 65.02 ? 46  PRO D CG  1 
ATOM   5462 C CD  . PRO D 1 52  ? 51.383  14.414  -49.439 1.00 65.25 ? 46  PRO D CD  1 
ATOM   5463 N N   . SER D 1 53  ? 54.019  18.175  -48.883 1.00 64.24 ? 47  SER D N   1 
ATOM   5464 C CA  . SER D 1 53  ? 53.769  19.561  -48.474 1.00 64.59 ? 47  SER D CA  1 
ATOM   5465 C C   . SER D 1 53  ? 53.279  20.379  -49.634 1.00 64.33 ? 47  SER D C   1 
ATOM   5466 O O   . SER D 1 53  ? 53.828  20.317  -50.728 1.00 64.28 ? 47  SER D O   1 
ATOM   5467 C CB  . SER D 1 53  ? 54.984  20.230  -47.834 1.00 64.72 ? 47  SER D CB  1 
ATOM   5468 O OG  . SER D 1 53  ? 54.997  20.003  -46.424 1.00 65.76 ? 47  SER D OG  1 
ATOM   5469 N N   . THR D 1 54  ? 52.225  21.143  -49.391 1.00 64.19 ? 48  THR D N   1 
ATOM   5470 C CA  . THR D 1 54  ? 51.637  21.926  -50.457 1.00 64.06 ? 48  THR D CA  1 
ATOM   5471 C C   . THR D 1 54  ? 52.750  22.817  -50.936 1.00 63.51 ? 48  THR D C   1 
ATOM   5472 O O   . THR D 1 54  ? 53.269  23.642  -50.178 1.00 63.90 ? 48  THR D O   1 
ATOM   5473 C CB  . THR D 1 54  ? 50.413  22.716  -49.983 1.00 64.43 ? 48  THR D CB  1 
ATOM   5474 O OG1 . THR D 1 54  ? 50.820  24.001  -49.487 1.00 64.43 ? 48  THR D OG1 1 
ATOM   5475 C CG2 . THR D 1 54  ? 49.609  21.892  -48.906 1.00 64.14 ? 48  THR D CG2 1 
ATOM   5476 N N   . ALA D 1 55  ? 53.164  22.585  -52.171 1.00 62.69 ? 49  ALA D N   1 
ATOM   5477 C CA  . ALA D 1 55  ? 54.459  23.071  -52.654 1.00 61.97 ? 49  ALA D CA  1 
ATOM   5478 C C   . ALA D 1 55  ? 55.036  21.928  -53.457 1.00 61.46 ? 49  ALA D C   1 
ATOM   5479 O O   . ALA D 1 55  ? 55.558  22.124  -54.545 1.00 61.24 ? 49  ALA D O   1 
ATOM   5480 N N   . LYS D 1 56  ? 54.903  20.721  -52.912 1.00 61.09 ? 50  LYS D N   1 
ATOM   5481 C CA  . LYS D 1 56  ? 55.185  19.480  -53.636 1.00 60.54 ? 50  LYS D CA  1 
ATOM   5482 C C   . LYS D 1 56  ? 54.015  19.093  -54.556 1.00 59.54 ? 50  LYS D C   1 
ATOM   5483 O O   . LYS D 1 56  ? 54.228  18.505  -55.616 1.00 59.98 ? 50  LYS D O   1 
ATOM   5484 C CB  . LYS D 1 56  ? 55.500  18.320  -52.664 1.00 60.60 ? 50  LYS D CB  1 
ATOM   5485 C CG  . LYS D 1 56  ? 56.891  18.404  -51.987 1.00 62.35 ? 50  LYS D CG  1 
ATOM   5486 C CD  . LYS D 1 56  ? 56.871  19.020  -50.544 1.00 63.57 ? 50  LYS D CD  1 
ATOM   5487 C CE  . LYS D 1 56  ? 57.256  20.535  -50.469 1.00 64.34 ? 50  LYS D CE  1 
ATOM   5488 N NZ  . LYS D 1 56  ? 58.707  20.892  -50.111 1.00 61.59 ? 50  LYS D NZ  1 
ATOM   5489 N N   . LEU D 1 57  ? 52.791  19.427  -54.158 1.00 57.72 ? 51  LEU D N   1 
ATOM   5490 C CA  . LEU D 1 57  ? 51.601  19.027  -54.912 1.00 56.43 ? 51  LEU D CA  1 
ATOM   5491 C C   . LEU D 1 57  ? 51.754  19.167  -56.425 1.00 56.07 ? 51  LEU D C   1 
ATOM   5492 O O   . LEU D 1 57  ? 52.289  20.137  -56.903 1.00 56.04 ? 51  LEU D O   1 
ATOM   5493 C CB  . LEU D 1 57  ? 50.350  19.776  -54.427 1.00 55.90 ? 51  LEU D CB  1 
ATOM   5494 C CG  . LEU D 1 57  ? 50.013  19.531  -52.953 1.00 53.70 ? 51  LEU D CG  1 
ATOM   5495 C CD1 . LEU D 1 57  ? 48.756  20.268  -52.487 1.00 50.91 ? 51  LEU D CD1 1 
ATOM   5496 C CD2 . LEU D 1 57  ? 49.914  18.056  -52.737 1.00 51.78 ? 51  LEU D CD2 1 
ATOM   5497 N N   . ASP D 1 58  ? 51.287  18.174  -57.168 1.00 55.97 ? 52  ASP D N   1 
ATOM   5498 C CA  . ASP D 1 58  ? 51.392  18.180  -58.616 1.00 55.55 ? 52  ASP D CA  1 
ATOM   5499 C C   . ASP D 1 58  ? 50.011  18.389  -59.302 1.00 55.42 ? 52  ASP D C   1 
ATOM   5500 O O   . ASP D 1 58  ? 49.081  17.595  -59.124 1.00 55.26 ? 52  ASP D O   1 
ATOM   5501 C CB  . ASP D 1 58  ? 52.131  16.914  -59.088 1.00 55.00 ? 52  ASP D CB  1 
ATOM   5502 C CG  . ASP D 1 58  ? 52.151  16.763  -60.603 1.00 54.66 ? 52  ASP D CG  1 
ATOM   5503 O OD1 . ASP D 1 58  ? 52.688  15.731  -61.062 1.00 54.57 ? 52  ASP D OD1 1 
ATOM   5504 O OD2 . ASP D 1 58  ? 51.616  17.640  -61.335 1.00 51.63 ? 52  ASP D OD2 1 
ATOM   5505 N N   . TYR D 1 59  ? 49.927  19.465  -60.087 1.00 55.14 ? 53  TYR D N   1 
ATOM   5506 C CA  . TYR D 1 59  ? 48.712  19.908  -60.756 1.00 55.21 ? 53  TYR D CA  1 
ATOM   5507 C C   . TYR D 1 59  ? 48.861  19.854  -62.276 1.00 55.04 ? 53  TYR D C   1 
ATOM   5508 O O   . TYR D 1 59  ? 48.060  20.442  -63.018 1.00 55.05 ? 53  TYR D O   1 
ATOM   5509 C CB  . TYR D 1 59  ? 48.385  21.348  -60.338 1.00 55.26 ? 53  TYR D CB  1 
ATOM   5510 C CG  . TYR D 1 59  ? 47.663  21.490  -59.003 1.00 55.55 ? 53  TYR D CG  1 
ATOM   5511 C CD1 . TYR D 1 59  ? 48.368  21.435  -57.805 1.00 55.31 ? 53  TYR D CD1 1 
ATOM   5512 C CD2 . TYR D 1 59  ? 46.280  21.709  -58.941 1.00 54.73 ? 53  TYR D CD2 1 
ATOM   5513 C CE1 . TYR D 1 59  ? 47.729  21.583  -56.581 1.00 54.76 ? 53  TYR D CE1 1 
ATOM   5514 C CE2 . TYR D 1 59  ? 45.631  21.860  -57.717 1.00 54.49 ? 53  TYR D CE2 1 
ATOM   5515 C CZ  . TYR D 1 59  ? 46.375  21.796  -56.544 1.00 55.21 ? 53  TYR D CZ  1 
ATOM   5516 O OH  . TYR D 1 59  ? 45.791  21.940  -55.320 1.00 56.05 ? 53  TYR D OH  1 
ATOM   5517 N N   . SER D 1 60  ? 49.879  19.136  -62.739 1.00 54.77 ? 54  SER D N   1 
ATOM   5518 C CA  . SER D 1 60  ? 50.216  19.084  -64.161 1.00 54.70 ? 54  SER D CA  1 
ATOM   5519 C C   . SER D 1 60  ? 49.254  18.213  -64.929 1.00 54.48 ? 54  SER D C   1 
ATOM   5520 O O   . SER D 1 60  ? 49.300  18.163  -66.158 1.00 54.36 ? 54  SER D O   1 
ATOM   5521 C CB  . SER D 1 60  ? 51.615  18.504  -64.340 1.00 55.09 ? 54  SER D CB  1 
ATOM   5522 O OG  . SER D 1 60  ? 51.699  17.196  -63.780 1.00 55.67 ? 54  SER D OG  1 
ATOM   5523 N N   . LYS D 1 61  ? 48.416  17.503  -64.183 1.00 54.55 ? 55  LYS D N   1 
ATOM   5524 C CA  . LYS D 1 61  ? 47.489  16.533  -64.727 1.00 54.41 ? 55  LYS D CA  1 
ATOM   5525 C C   . LYS D 1 61  ? 46.111  16.843  -64.204 1.00 54.48 ? 55  LYS D C   1 
ATOM   5526 O O   . LYS D 1 61  ? 45.177  16.123  -64.495 1.00 54.91 ? 55  LYS D O   1 
ATOM   5527 C CB  . LYS D 1 61  ? 47.882  15.115  -64.315 1.00 54.36 ? 55  LYS D CB  1 
ATOM   5528 C CG  . LYS D 1 61  ? 49.110  14.575  -64.978 1.00 54.37 ? 55  LYS D CG  1 
ATOM   5529 C CD  . LYS D 1 61  ? 48.994  13.067  -65.142 1.00 56.87 ? 55  LYS D CD  1 
ATOM   5530 C CE  . LYS D 1 61  ? 50.315  12.453  -65.637 1.00 58.89 ? 55  LYS D CE  1 
ATOM   5531 N NZ  . LYS D 1 61  ? 51.333  12.241  -64.528 1.00 59.12 ? 55  LYS D NZ  1 
ATOM   5532 N N   . PHE D 1 62  ? 45.994  17.901  -63.407 1.00 54.73 ? 56  PHE D N   1 
ATOM   5533 C CA  . PHE D 1 62  ? 44.699  18.393  -62.919 1.00 54.59 ? 56  PHE D CA  1 
ATOM   5534 C C   . PHE D 1 62  ? 43.986  19.122  -64.015 1.00 54.99 ? 56  PHE D C   1 
ATOM   5535 O O   . PHE D 1 62  ? 44.589  19.571  -64.965 1.00 54.55 ? 56  PHE D O   1 
ATOM   5536 C CB  . PHE D 1 62  ? 44.895  19.334  -61.734 1.00 54.43 ? 56  PHE D CB  1 
ATOM   5537 C CG  . PHE D 1 62  ? 43.624  19.715  -61.028 1.00 53.24 ? 56  PHE D CG  1 
ATOM   5538 C CD1 . PHE D 1 62  ? 42.982  18.816  -60.186 1.00 51.20 ? 56  PHE D CD1 1 
ATOM   5539 C CD2 . PHE D 1 62  ? 43.100  20.996  -61.163 1.00 52.41 ? 56  PHE D CD2 1 
ATOM   5540 C CE1 . PHE D 1 62  ? 41.805  19.173  -59.518 1.00 51.46 ? 56  PHE D CE1 1 
ATOM   5541 C CE2 . PHE D 1 62  ? 41.927  21.364  -60.487 1.00 52.96 ? 56  PHE D CE2 1 
ATOM   5542 C CZ  . PHE D 1 62  ? 41.276  20.447  -59.665 1.00 51.92 ? 56  PHE D CZ  1 
ATOM   5543 N N   . GLN D 1 63  ? 42.684  19.238  -63.850 1.00 56.76 ? 57  GLN D N   1 
ATOM   5544 C CA  . GLN D 1 63  ? 41.760  19.688  -64.885 1.00 58.50 ? 57  GLN D CA  1 
ATOM   5545 C C   . GLN D 1 63  ? 40.402  19.556  -64.226 1.00 59.11 ? 57  GLN D C   1 
ATOM   5546 O O   . GLN D 1 63  ? 40.022  18.456  -63.838 1.00 59.31 ? 57  GLN D O   1 
ATOM   5547 C CB  . GLN D 1 63  ? 41.841  18.774  -66.108 1.00 58.58 ? 57  GLN D CB  1 
ATOM   5548 C CG  . GLN D 1 63  ? 40.642  18.829  -67.036 1.00 60.99 ? 57  GLN D CG  1 
ATOM   5549 C CD  . GLN D 1 63  ? 40.914  19.564  -68.342 1.00 64.71 ? 57  GLN D CD  1 
ATOM   5550 O OE1 . GLN D 1 63  ? 41.693  20.532  -68.391 1.00 65.31 ? 57  GLN D OE1 1 
ATOM   5551 N NE2 . GLN D 1 63  ? 40.264  19.104  -69.420 1.00 64.90 ? 57  GLN D NE2 1 
ATOM   5552 N N   . GLU D 1 64  ? 39.694  20.677  -64.062 1.00 60.26 ? 58  GLU D N   1 
ATOM   5553 C CA  . GLU D 1 64  ? 38.419  20.701  -63.343 1.00 61.07 ? 58  GLU D CA  1 
ATOM   5554 C C   . GLU D 1 64  ? 37.230  20.671  -64.289 1.00 61.54 ? 58  GLU D C   1 
ATOM   5555 O O   . GLU D 1 64  ? 36.893  21.680  -64.924 1.00 61.31 ? 58  GLU D O   1 
ATOM   5556 C CB  . GLU D 1 64  ? 38.326  21.934  -62.459 1.00 61.27 ? 58  GLU D CB  1 
ATOM   5557 C CG  . GLU D 1 64  ? 37.138  21.904  -61.510 1.00 62.43 ? 58  GLU D CG  1 
ATOM   5558 C CD  . GLU D 1 64  ? 36.779  23.289  -61.012 1.00 64.81 ? 58  GLU D CD  1 
ATOM   5559 O OE1 . GLU D 1 64  ? 37.634  23.944  -60.361 1.00 64.15 ? 58  GLU D OE1 1 
ATOM   5560 O OE2 . GLU D 1 64  ? 35.638  23.724  -61.285 1.00 66.30 ? 58  GLU D OE2 1 
ATOM   5561 N N   . LEU D 1 65  ? 36.582  19.513  -64.352 1.00 61.99 ? 59  LEU D N   1 
ATOM   5562 C CA  . LEU D 1 65  ? 35.477  19.299  -65.272 1.00 62.89 ? 59  LEU D CA  1 
ATOM   5563 C C   . LEU D 1 65  ? 34.130  19.488  -64.570 1.00 63.44 ? 59  LEU D C   1 
ATOM   5564 O O   . LEU D 1 65  ? 34.041  19.326  -63.346 1.00 63.75 ? 59  LEU D O   1 
ATOM   5565 C CB  . LEU D 1 65  ? 35.557  17.890  -65.865 1.00 62.91 ? 59  LEU D CB  1 
ATOM   5566 C CG  . LEU D 1 65  ? 36.925  17.234  -66.057 1.00 62.78 ? 59  LEU D CG  1 
ATOM   5567 C CD1 . LEU D 1 65  ? 36.806  15.724  -65.932 1.00 63.00 ? 59  LEU D CD1 1 
ATOM   5568 C CD2 . LEU D 1 65  ? 37.515  17.621  -67.392 1.00 63.25 ? 59  LEU D CD2 1 
ATOM   5569 N N   . VAL D 1 66  ? 33.091  19.813  -65.342 1.00 63.81 ? 60  VAL D N   1 
ATOM   5570 C CA  . VAL D 1 66  ? 31.743  19.937  -64.797 1.00 64.52 ? 60  VAL D CA  1 
ATOM   5571 C C   . VAL D 1 66  ? 30.942  18.635  -64.962 1.00 65.21 ? 60  VAL D C   1 
ATOM   5572 O O   . VAL D 1 66  ? 30.169  18.258  -64.064 1.00 64.71 ? 60  VAL D O   1 
ATOM   5573 C CB  . VAL D 1 66  ? 30.964  21.110  -65.442 1.00 64.83 ? 60  VAL D CB  1 
ATOM   5574 C CG1 . VAL D 1 66  ? 29.769  21.545  -64.547 1.00 63.95 ? 60  VAL D CG1 1 
ATOM   5575 C CG2 . VAL D 1 66  ? 31.904  22.289  -65.753 1.00 64.72 ? 60  VAL D CG2 1 
ATOM   5576 N N   . LEU D 1 67  ? 31.140  17.966  -66.106 1.00 65.93 ? 61  LEU D N   1 
ATOM   5577 C CA  . LEU D 1 67  ? 30.421  16.737  -66.465 1.00 66.47 ? 61  LEU D CA  1 
ATOM   5578 C C   . LEU D 1 67  ? 31.390  15.568  -66.558 1.00 67.09 ? 61  LEU D C   1 
ATOM   5579 O O   . LEU D 1 67  ? 32.544  15.758  -66.927 1.00 67.07 ? 61  LEU D O   1 
ATOM   5580 C CB  . LEU D 1 67  ? 29.739  16.891  -67.827 1.00 66.74 ? 61  LEU D CB  1 
ATOM   5581 C CG  . LEU D 1 67  ? 28.805  18.045  -68.249 1.00 67.21 ? 61  LEU D CG  1 
ATOM   5582 C CD1 . LEU D 1 67  ? 28.681  18.075  -69.772 1.00 65.29 ? 61  LEU D CD1 1 
ATOM   5583 C CD2 . LEU D 1 67  ? 27.406  18.013  -67.582 1.00 67.20 ? 61  LEU D CD2 1 
ATOM   5584 N N   . PRO D 1 68  ? 30.929  14.342  -66.246 1.00 67.98 ? 62  PRO D N   1 
ATOM   5585 C CA  . PRO D 1 68  ? 31.862  13.204  -66.296 1.00 68.62 ? 62  PRO D CA  1 
ATOM   5586 C C   . PRO D 1 68  ? 32.338  12.876  -67.716 1.00 69.51 ? 62  PRO D C   1 
ATOM   5587 O O   . PRO D 1 68  ? 31.784  13.392  -68.694 1.00 69.75 ? 62  PRO D O   1 
ATOM   5588 C CB  . PRO D 1 68  ? 31.042  12.039  -65.732 1.00 68.33 ? 62  PRO D CB  1 
ATOM   5589 C CG  . PRO D 1 68  ? 29.862  12.671  -65.046 1.00 68.18 ? 62  PRO D CG  1 
ATOM   5590 C CD  . PRO D 1 68  ? 29.583  13.922  -65.818 1.00 68.13 ? 62  PRO D CD  1 
ATOM   5591 N N   . HIS D 1 69  ? 33.375  12.046  -67.814 1.00 70.06 ? 63  HIS D N   1 
ATOM   5592 C CA  . HIS D 1 69  ? 33.794  11.490  -69.092 1.00 70.87 ? 63  HIS D CA  1 
ATOM   5593 C C   . HIS D 1 69  ? 32.871  10.302  -69.414 1.00 71.06 ? 63  HIS D C   1 
ATOM   5594 O O   . HIS D 1 69  ? 32.202  9.752   -68.523 1.00 71.17 ? 63  HIS D O   1 
ATOM   5595 C CB  . HIS D 1 69  ? 35.270  11.030  -69.061 1.00 71.17 ? 63  HIS D CB  1 
ATOM   5596 C CG  . HIS D 1 69  ? 36.276  12.148  -69.083 1.00 72.90 ? 63  HIS D CG  1 
ATOM   5597 N ND1 . HIS D 1 69  ? 37.208  12.334  -68.079 1.00 74.57 ? 63  HIS D ND1 1 
ATOM   5598 C CD2 . HIS D 1 69  ? 36.514  13.124  -69.995 1.00 74.59 ? 63  HIS D CD2 1 
ATOM   5599 C CE1 . HIS D 1 69  ? 37.964  13.382  -68.362 1.00 74.99 ? 63  HIS D CE1 1 
ATOM   5600 N NE2 . HIS D 1 69  ? 37.563  13.883  -69.518 1.00 75.57 ? 63  HIS D NE2 1 
ATOM   5601 N N   . PHE D 1 70  ? 32.838  9.926   -70.693 1.00 71.19 ? 64  PHE D N   1 
ATOM   5602 C CA  . PHE D 1 70  ? 32.068  8.785   -71.194 1.00 70.96 ? 64  PHE D CA  1 
ATOM   5603 C C   . PHE D 1 70  ? 32.980  7.599   -71.511 1.00 70.87 ? 64  PHE D C   1 
ATOM   5604 O O   . PHE D 1 70  ? 34.065  7.764   -72.086 1.00 70.81 ? 64  PHE D O   1 
ATOM   5605 C CB  . PHE D 1 70  ? 31.257  9.172   -72.450 1.00 70.87 ? 64  PHE D CB  1 
ATOM   5606 C CG  . PHE D 1 70  ? 31.639  10.518  -73.054 1.00 71.75 ? 64  PHE D CG  1 
ATOM   5607 C CD1 . PHE D 1 70  ? 32.891  10.719  -73.654 1.00 72.55 ? 64  PHE D CD1 1 
ATOM   5608 C CD2 . PHE D 1 70  ? 30.736  11.597  -73.021 1.00 72.28 ? 64  PHE D CD2 1 
ATOM   5609 C CE1 . PHE D 1 70  ? 33.241  11.978  -74.200 1.00 72.21 ? 64  PHE D CE1 1 
ATOM   5610 C CE2 . PHE D 1 70  ? 31.072  12.856  -73.571 1.00 71.35 ? 64  PHE D CE2 1 
ATOM   5611 C CZ  . PHE D 1 70  ? 32.322  13.043  -74.161 1.00 71.66 ? 64  PHE D CZ  1 
ATOM   5612 N N   . GLY D 1 71  ? 32.550  6.406   -71.116 1.00 70.77 ? 65  GLY D N   1 
ATOM   5613 C CA  . GLY D 1 71  ? 33.103  5.181   -71.691 1.00 70.54 ? 65  GLY D CA  1 
ATOM   5614 C C   . GLY D 1 71  ? 33.980  4.284   -70.839 1.00 70.39 ? 65  GLY D C   1 
ATOM   5615 O O   . GLY D 1 71  ? 33.970  4.346   -69.610 1.00 70.28 ? 65  GLY D O   1 
ATOM   5616 N N   . LYS D 1 72  ? 34.724  3.427   -71.527 1.00 70.08 ? 66  LYS D N   1 
ATOM   5617 C CA  . LYS D 1 72  ? 35.621  2.477   -70.901 1.00 69.85 ? 66  LYS D CA  1 
ATOM   5618 C C   . LYS D 1 72  ? 36.909  3.189   -70.441 1.00 69.47 ? 66  LYS D C   1 
ATOM   5619 O O   . LYS D 1 72  ? 37.231  4.296   -70.893 1.00 69.57 ? 66  LYS D O   1 
ATOM   5620 C CB  . LYS D 1 72  ? 35.933  1.361   -71.914 1.00 70.08 ? 66  LYS D CB  1 
ATOM   5621 C CG  . LYS D 1 72  ? 36.266  -0.035  -71.345 1.00 70.82 ? 66  LYS D CG  1 
ATOM   5622 C CD  . LYS D 1 72  ? 35.100  -0.678  -70.567 1.00 72.10 ? 66  LYS D CD  1 
ATOM   5623 C CE  . LYS D 1 72  ? 33.808  -0.810  -71.395 1.00 72.52 ? 66  LYS D CE  1 
ATOM   5624 N NZ  . LYS D 1 72  ? 33.723  -2.053  -72.218 1.00 70.66 ? 66  LYS D NZ  1 
ATOM   5625 N N   . GLU D 1 73  ? 37.626  2.552   -69.525 1.00 68.64 ? 67  GLU D N   1 
ATOM   5626 C CA  . GLU D 1 73  ? 38.946  2.998   -69.125 1.00 68.07 ? 67  GLU D CA  1 
ATOM   5627 C C   . GLU D 1 73  ? 39.939  2.377   -70.095 1.00 67.69 ? 67  GLU D C   1 
ATOM   5628 O O   . GLU D 1 73  ? 40.037  1.134   -70.168 1.00 68.09 ? 67  GLU D O   1 
ATOM   5629 C CB  . GLU D 1 73  ? 39.282  2.485   -67.720 1.00 68.15 ? 67  GLU D CB  1 
ATOM   5630 C CG  . GLU D 1 73  ? 38.093  1.991   -66.879 1.00 68.99 ? 67  GLU D CG  1 
ATOM   5631 C CD  . GLU D 1 73  ? 37.396  0.759   -67.445 1.00 70.36 ? 67  GLU D CD  1 
ATOM   5632 O OE1 . GLU D 1 73  ? 38.089  -0.187  -67.899 1.00 70.68 ? 67  GLU D OE1 1 
ATOM   5633 O OE2 . GLU D 1 73  ? 36.143  0.746   -67.427 1.00 70.76 ? 67  GLU D OE2 1 
ATOM   5634 N N   . ASP D 1 74  ? 40.676  3.199   -70.845 1.00 66.55 ? 68  ASP D N   1 
ATOM   5635 C CA  . ASP D 1 74  ? 41.783  2.644   -71.615 1.00 65.53 ? 68  ASP D CA  1 
ATOM   5636 C C   . ASP D 1 74  ? 42.881  2.274   -70.609 1.00 64.90 ? 68  ASP D C   1 
ATOM   5637 O O   . ASP D 1 74  ? 42.913  2.819   -69.497 1.00 65.08 ? 68  ASP D O   1 
ATOM   5638 C CB  . ASP D 1 74  ? 42.283  3.627   -72.670 1.00 65.42 ? 68  ASP D CB  1 
ATOM   5639 C CG  . ASP D 1 74  ? 43.519  4.374   -72.228 1.00 65.93 ? 68  ASP D CG  1 
ATOM   5640 O OD1 . ASP D 1 74  ? 44.464  4.476   -73.042 1.00 65.93 ? 68  ASP D OD1 1 
ATOM   5641 O OD2 . ASP D 1 74  ? 43.556  4.844   -71.066 1.00 65.54 ? 68  ASP D OD2 1 
ATOM   5642 N N   . ALA D 1 75  ? 43.768  1.354   -70.982 1.00 63.83 ? 69  ALA D N   1 
ATOM   5643 C CA  . ALA D 1 75  ? 44.868  0.942   -70.108 1.00 62.48 ? 69  ALA D CA  1 
ATOM   5644 C C   . ALA D 1 75  ? 45.584  2.122   -69.414 1.00 61.91 ? 69  ALA D C   1 
ATOM   5645 O O   . ALA D 1 75  ? 46.137  1.952   -68.324 1.00 62.09 ? 69  ALA D O   1 
ATOM   5646 C CB  . ALA D 1 75  ? 45.853  0.078   -70.872 1.00 62.37 ? 69  ALA D CB  1 
ATOM   5647 N N   . GLY D 1 76  ? 45.562  3.309   -70.028 1.00 60.80 ? 70  GLY D N   1 
ATOM   5648 C CA  . GLY D 1 76  ? 46.089  4.526   -69.400 1.00 59.48 ? 70  GLY D CA  1 
ATOM   5649 C C   . GLY D 1 76  ? 45.481  4.771   -68.027 1.00 58.75 ? 70  GLY D C   1 
ATOM   5650 O O   . GLY D 1 76  ? 46.198  4.821   -67.029 1.00 58.74 ? 70  GLY D O   1 
ATOM   5651 N N   . ASP D 1 77  ? 44.155  4.895   -67.979 1.00 57.96 ? 71  ASP D N   1 
ATOM   5652 C CA  . ASP D 1 77  ? 43.414  5.089   -66.738 1.00 56.94 ? 71  ASP D CA  1 
ATOM   5653 C C   . ASP D 1 77  ? 43.684  3.987   -65.733 1.00 56.06 ? 71  ASP D C   1 
ATOM   5654 O O   . ASP D 1 77  ? 43.899  4.246   -64.543 1.00 56.27 ? 71  ASP D O   1 
ATOM   5655 C CB  . ASP D 1 77  ? 41.922  5.110   -67.021 1.00 57.35 ? 71  ASP D CB  1 
ATOM   5656 C CG  . ASP D 1 77  ? 41.556  6.087   -68.092 1.00 60.25 ? 71  ASP D CG  1 
ATOM   5657 O OD1 . ASP D 1 77  ? 41.875  7.294   -67.927 1.00 65.11 ? 71  ASP D OD1 1 
ATOM   5658 O OD2 . ASP D 1 77  ? 40.954  5.654   -69.101 1.00 62.02 ? 71  ASP D OD2 1 
ATOM   5659 N N   . VAL D 1 78  ? 43.657  2.749   -66.204 1.00 54.50 ? 72  VAL D N   1 
ATOM   5660 C CA  . VAL D 1 78  ? 43.912  1.624   -65.334 1.00 52.98 ? 72  VAL D CA  1 
ATOM   5661 C C   . VAL D 1 78  ? 45.299  1.749   -64.737 1.00 52.48 ? 72  VAL D C   1 
ATOM   5662 O O   . VAL D 1 78  ? 45.513  1.392   -63.576 1.00 51.88 ? 72  VAL D O   1 
ATOM   5663 C CB  . VAL D 1 78  ? 43.774  0.296   -66.092 1.00 52.90 ? 72  VAL D CB  1 
ATOM   5664 C CG1 . VAL D 1 78  ? 43.989  -0.901  -65.151 1.00 51.41 ? 72  VAL D CG1 1 
ATOM   5665 C CG2 . VAL D 1 78  ? 42.420  0.245   -66.752 1.00 52.21 ? 72  VAL D CG2 1 
ATOM   5666 N N   . GLN D 1 79  ? 46.237  2.267   -65.531 1.00 52.14 ? 73  GLN D N   1 
ATOM   5667 C CA  . GLN D 1 79  ? 47.620  2.391   -65.068 1.00 52.03 ? 73  GLN D CA  1 
ATOM   5668 C C   . GLN D 1 79  ? 47.789  3.560   -64.078 1.00 52.09 ? 73  GLN D C   1 
ATOM   5669 O O   . GLN D 1 79  ? 48.472  3.403   -63.044 1.00 52.21 ? 73  GLN D O   1 
ATOM   5670 C CB  . GLN D 1 79  ? 48.605  2.449   -66.236 1.00 51.73 ? 73  GLN D CB  1 
ATOM   5671 C CG  . GLN D 1 79  ? 50.060  2.407   -65.838 1.00 50.90 ? 73  GLN D CG  1 
ATOM   5672 C CD  . GLN D 1 79  ? 50.585  1.018   -65.544 1.00 50.59 ? 73  GLN D CD  1 
ATOM   5673 O OE1 . GLN D 1 79  ? 50.569  0.121   -66.403 1.00 49.94 ? 73  GLN D OE1 1 
ATOM   5674 N NE2 . GLN D 1 79  ? 51.105  0.844   -64.331 1.00 49.94 ? 73  GLN D NE2 1 
ATOM   5675 N N   . GLN D 1 80  ? 47.143  4.699   -64.357 1.00 51.48 ? 74  GLN D N   1 
ATOM   5676 C CA  . GLN D 1 80  ? 47.138  5.799   -63.390 1.00 51.47 ? 74  GLN D CA  1 
ATOM   5677 C C   . GLN D 1 80  ? 46.582  5.356   -62.044 1.00 51.81 ? 74  GLN D C   1 
ATOM   5678 O O   . GLN D 1 80  ? 47.000  5.861   -60.997 1.00 52.42 ? 74  GLN D O   1 
ATOM   5679 C CB  . GLN D 1 80  ? 46.324  6.981   -63.881 1.00 51.34 ? 74  GLN D CB  1 
ATOM   5680 C CG  . GLN D 1 80  ? 46.446  8.208   -62.990 1.00 50.63 ? 74  GLN D CG  1 
ATOM   5681 C CD  . GLN D 1 80  ? 45.969  9.470   -63.677 1.00 52.40 ? 74  GLN D CD  1 
ATOM   5682 O OE1 . GLN D 1 80  ? 45.000  10.083  -63.260 1.00 50.66 ? 74  GLN D OE1 1 
ATOM   5683 N NE2 . GLN D 1 80  ? 46.660  9.869   -64.749 1.00 57.00 ? 74  GLN D NE2 1 
ATOM   5684 N N   . PHE D 1 81  ? 45.631  4.437   -62.072 1.00 51.24 ? 75  PHE D N   1 
ATOM   5685 C CA  . PHE D 1 81  ? 45.083  3.897   -60.851 1.00 51.89 ? 75  PHE D CA  1 
ATOM   5686 C C   . PHE D 1 81  ? 46.170  3.104   -60.114 1.00 52.63 ? 75  PHE D C   1 
ATOM   5687 O O   . PHE D 1 81  ? 46.527  3.443   -58.977 1.00 53.38 ? 75  PHE D O   1 
ATOM   5688 C CB  . PHE D 1 81  ? 43.829  3.047   -61.174 1.00 51.95 ? 75  PHE D CB  1 
ATOM   5689 C CG  . PHE D 1 81  ? 43.222  2.331   -59.987 1.00 51.13 ? 75  PHE D CG  1 
ATOM   5690 C CD1 . PHE D 1 81  ? 42.395  3.003   -59.088 1.00 50.97 ? 75  PHE D CD1 1 
ATOM   5691 C CD2 . PHE D 1 81  ? 43.471  0.976   -59.779 1.00 48.79 ? 75  PHE D CD2 1 
ATOM   5692 C CE1 . PHE D 1 81  ? 41.858  2.322   -58.000 1.00 49.75 ? 75  PHE D CE1 1 
ATOM   5693 C CE2 . PHE D 1 81  ? 42.919  0.295   -58.708 1.00 45.58 ? 75  PHE D CE2 1 
ATOM   5694 C CZ  . PHE D 1 81  ? 42.127  0.956   -57.823 1.00 48.23 ? 75  PHE D CZ  1 
ATOM   5695 N N   . TYR D 1 82  ? 46.722  2.085   -60.769 1.00 53.16 ? 76  TYR D N   1 
ATOM   5696 C CA  . TYR D 1 82  ? 47.725  1.217   -60.155 1.00 53.34 ? 76  TYR D CA  1 
ATOM   5697 C C   . TYR D 1 82  ? 48.969  1.944   -59.669 1.00 53.23 ? 76  TYR D C   1 
ATOM   5698 O O   . TYR D 1 82  ? 49.498  1.575   -58.629 1.00 53.33 ? 76  TYR D O   1 
ATOM   5699 C CB  . TYR D 1 82  ? 48.135  0.073   -61.088 1.00 54.22 ? 76  TYR D CB  1 
ATOM   5700 C CG  . TYR D 1 82  ? 47.101  -1.013  -61.269 1.00 54.82 ? 76  TYR D CG  1 
ATOM   5701 C CD1 . TYR D 1 82  ? 46.577  -1.699  -60.167 1.00 55.56 ? 76  TYR D CD1 1 
ATOM   5702 C CD2 . TYR D 1 82  ? 46.662  -1.375  -62.543 1.00 55.79 ? 76  TYR D CD2 1 
ATOM   5703 C CE1 . TYR D 1 82  ? 45.615  -2.699  -60.321 1.00 56.21 ? 76  TYR D CE1 1 
ATOM   5704 C CE2 . TYR D 1 82  ? 45.712  -2.388  -62.724 1.00 56.76 ? 76  TYR D CE2 1 
ATOM   5705 C CZ  . TYR D 1 82  ? 45.186  -3.046  -61.604 1.00 56.87 ? 76  TYR D CZ  1 
ATOM   5706 O OH  . TYR D 1 82  ? 44.249  -4.059  -61.767 1.00 56.80 ? 76  TYR D OH  1 
ATOM   5707 N N   . ASP D 1 83  ? 49.448  2.963   -60.393 1.00 53.06 ? 77  ASP D N   1 
ATOM   5708 C CA  . ASP D 1 83  ? 50.610  3.746   -59.891 1.00 53.01 ? 77  ASP D CA  1 
ATOM   5709 C C   . ASP D 1 83  ? 50.244  4.478   -58.594 1.00 52.24 ? 77  ASP D C   1 
ATOM   5710 O O   . ASP D 1 83  ? 51.055  4.629   -57.663 1.00 51.55 ? 77  ASP D O   1 
ATOM   5711 C CB  . ASP D 1 83  ? 51.113  4.772   -60.906 1.00 53.21 ? 77  ASP D CB  1 
ATOM   5712 C CG  . ASP D 1 83  ? 51.334  4.183   -62.275 1.00 55.85 ? 77  ASP D CG  1 
ATOM   5713 O OD1 . ASP D 1 83  ? 51.886  3.059   -62.344 1.00 59.20 ? 77  ASP D OD1 1 
ATOM   5714 O OD2 . ASP D 1 83  ? 50.959  4.845   -63.285 1.00 57.37 ? 77  ASP D OD2 1 
ATOM   5715 N N   . LEU D 1 84  ? 48.996  4.921   -58.552 1.00 51.23 ? 78  LEU D N   1 
ATOM   5716 C CA  . LEU D 1 84  ? 48.536  5.760   -57.495 1.00 50.43 ? 78  LEU D CA  1 
ATOM   5717 C C   . LEU D 1 84  ? 48.401  4.908   -56.256 1.00 50.17 ? 78  LEU D C   1 
ATOM   5718 O O   . LEU D 1 84  ? 48.695  5.387   -55.144 1.00 49.76 ? 78  LEU D O   1 
ATOM   5719 C CB  . LEU D 1 84  ? 47.213  6.348   -57.899 1.00 50.47 ? 78  LEU D CB  1 
ATOM   5720 C CG  . LEU D 1 84  ? 46.977  7.835   -57.809 1.00 50.39 ? 78  LEU D CG  1 
ATOM   5721 C CD1 . LEU D 1 84  ? 48.142  8.644   -58.407 1.00 51.77 ? 78  LEU D CD1 1 
ATOM   5722 C CD2 . LEU D 1 84  ? 45.670  8.099   -58.567 1.00 49.56 ? 78  LEU D CD2 1 
ATOM   5723 N N   . LEU D 1 85  ? 47.985  3.646   -56.442 1.00 49.23 ? 79  LEU D N   1 
ATOM   5724 C CA  . LEU D 1 85  ? 48.057  2.674   -55.344 1.00 48.93 ? 79  LEU D CA  1 
ATOM   5725 C C   . LEU D 1 85  ? 49.490  2.520   -54.826 1.00 49.38 ? 79  LEU D C   1 
ATOM   5726 O O   . LEU D 1 85  ? 49.761  2.908   -53.688 1.00 49.21 ? 79  LEU D O   1 
ATOM   5727 C CB  . LEU D 1 85  ? 47.494  1.315   -55.734 1.00 48.21 ? 79  LEU D CB  1 
ATOM   5728 C CG  . LEU D 1 85  ? 46.007  1.055   -55.515 1.00 47.87 ? 79  LEU D CG  1 
ATOM   5729 C CD1 . LEU D 1 85  ? 45.505  1.499   -54.167 1.00 46.64 ? 79  LEU D CD1 1 
ATOM   5730 C CD2 . LEU D 1 85  ? 45.205  1.749   -56.554 1.00 49.57 ? 79  LEU D CD2 1 
ATOM   5731 N N   . SER D 1 86  ? 50.388  1.999   -55.675 1.00 49.70 ? 80  SER D N   1 
ATOM   5732 C CA  . SER D 1 86  ? 51.798  1.759   -55.348 1.00 50.82 ? 80  SER D CA  1 
ATOM   5733 C C   . SER D 1 86  ? 52.483  2.969   -54.738 1.00 51.95 ? 80  SER D C   1 
ATOM   5734 O O   . SER D 1 86  ? 53.174  2.868   -53.709 1.00 52.17 ? 80  SER D O   1 
ATOM   5735 C CB  . SER D 1 86  ? 52.566  1.375   -56.602 1.00 50.52 ? 80  SER D CB  1 
ATOM   5736 O OG  . SER D 1 86  ? 52.165  0.097   -57.067 1.00 52.46 ? 80  SER D OG  1 
ATOM   5737 N N   . GLY D 1 87  ? 52.285  4.119   -55.380 1.00 52.72 ? 81  GLY D N   1 
ATOM   5738 C CA  . GLY D 1 87  ? 52.893  5.355   -54.935 1.00 53.80 ? 81  GLY D CA  1 
ATOM   5739 C C   . GLY D 1 87  ? 52.449  5.641   -53.526 1.00 54.73 ? 81  GLY D C   1 
ATOM   5740 O O   . GLY D 1 87  ? 53.190  6.221   -52.739 1.00 55.20 ? 81  GLY D O   1 
ATOM   5741 N N   . SER D 1 88  ? 51.234  5.226   -53.194 1.00 55.35 ? 82  SER D N   1 
ATOM   5742 C CA  . SER D 1 88  ? 50.730  5.495   -51.865 1.00 55.93 ? 82  SER D CA  1 
ATOM   5743 C C   . SER D 1 88  ? 51.180  4.456   -50.862 1.00 55.95 ? 82  SER D C   1 
ATOM   5744 O O   . SER D 1 88  ? 51.131  4.710   -49.668 1.00 56.15 ? 82  SER D O   1 
ATOM   5745 C CB  . SER D 1 88  ? 49.222  5.703   -51.883 1.00 56.24 ? 82  SER D CB  1 
ATOM   5746 O OG  . SER D 1 88  ? 48.918  6.826   -52.730 1.00 57.52 ? 82  SER D OG  1 
ATOM   5747 N N   . LEU D 1 89  ? 51.665  3.314   -51.357 1.00 55.79 ? 83  LEU D N   1 
ATOM   5748 C CA  . LEU D 1 89  ? 52.183  2.244   -50.505 1.00 55.72 ? 83  LEU D CA  1 
ATOM   5749 C C   . LEU D 1 89  ? 53.602  2.547   -50.008 1.00 56.04 ? 83  LEU D C   1 
ATOM   5750 O O   . LEU D 1 89  ? 53.886  2.443   -48.806 1.00 55.72 ? 83  LEU D O   1 
ATOM   5751 C CB  . LEU D 1 89  ? 52.144  0.904   -51.239 1.00 55.53 ? 83  LEU D CB  1 
ATOM   5752 C CG  . LEU D 1 89  ? 52.765  -0.357  -50.616 1.00 55.29 ? 83  LEU D CG  1 
ATOM   5753 C CD1 . LEU D 1 89  ? 52.173  -0.688  -49.256 1.00 54.05 ? 83  LEU D CD1 1 
ATOM   5754 C CD2 . LEU D 1 89  ? 52.591  -1.538  -51.557 1.00 55.54 ? 83  LEU D CD2 1 
ATOM   5755 N N   . GLU D 1 90  ? 54.481  2.914   -50.940 1.00 56.24 ? 84  GLU D N   1 
ATOM   5756 C CA  . GLU D 1 90  ? 55.839  3.323   -50.614 1.00 56.79 ? 84  GLU D CA  1 
ATOM   5757 C C   . GLU D 1 90  ? 55.778  4.399   -49.543 1.00 56.59 ? 84  GLU D C   1 
ATOM   5758 O O   . GLU D 1 90  ? 56.380  4.262   -48.474 1.00 56.79 ? 84  GLU D O   1 
ATOM   5759 C CB  . GLU D 1 90  ? 56.569  3.853   -51.858 1.00 56.64 ? 84  GLU D CB  1 
ATOM   5760 C CG  . GLU D 1 90  ? 56.793  2.814   -52.964 1.00 57.62 ? 84  GLU D CG  1 
ATOM   5761 C CD  . GLU D 1 90  ? 57.222  3.441   -54.303 1.00 58.44 ? 84  GLU D CD  1 
ATOM   5762 O OE1 . GLU D 1 90  ? 56.384  3.455   -55.243 1.00 58.70 ? 84  GLU D OE1 1 
ATOM   5763 O OE2 . GLU D 1 90  ? 58.391  3.915   -54.415 1.00 60.17 ? 84  GLU D OE2 1 
ATOM   5764 N N   . VAL D 1 91  ? 55.015  5.451   -49.817 1.00 56.48 ? 85  VAL D N   1 
ATOM   5765 C CA  . VAL D 1 91  ? 54.873  6.551   -48.882 1.00 56.64 ? 85  VAL D CA  1 
ATOM   5766 C C   . VAL D 1 91  ? 54.420  6.066   -47.507 1.00 57.48 ? 85  VAL D C   1 
ATOM   5767 O O   . VAL D 1 91  ? 55.053  6.391   -46.506 1.00 57.27 ? 85  VAL D O   1 
ATOM   5768 C CB  . VAL D 1 91  ? 53.983  7.667   -49.464 1.00 56.45 ? 85  VAL D CB  1 
ATOM   5769 C CG1 . VAL D 1 91  ? 53.579  8.690   -48.407 1.00 55.90 ? 85  VAL D CG1 1 
ATOM   5770 C CG2 . VAL D 1 91  ? 54.719  8.357   -50.616 1.00 55.95 ? 85  VAL D CG2 1 
ATOM   5771 N N   . ILE D 1 92  ? 53.354  5.257   -47.479 1.00 58.92 ? 86  ILE D N   1 
ATOM   5772 C CA  . ILE D 1 92  ? 52.883  4.567   -46.258 1.00 59.64 ? 86  ILE D CA  1 
ATOM   5773 C C   . ILE D 1 92  ? 53.976  3.797   -45.517 1.00 60.22 ? 86  ILE D C   1 
ATOM   5774 O O   . ILE D 1 92  ? 54.177  4.033   -44.316 1.00 60.43 ? 86  ILE D O   1 
ATOM   5775 C CB  . ILE D 1 92  ? 51.661  3.640   -46.529 1.00 59.69 ? 86  ILE D CB  1 
ATOM   5776 C CG1 . ILE D 1 92  ? 50.348  4.389   -46.279 1.00 59.91 ? 86  ILE D CG1 1 
ATOM   5777 C CG2 . ILE D 1 92  ? 51.686  2.399   -45.620 1.00 59.41 ? 86  ILE D CG2 1 
ATOM   5778 C CD1 . ILE D 1 92  ? 49.960  5.450   -47.340 1.00 60.45 ? 86  ILE D CD1 1 
ATOM   5779 N N   . ARG D 1 93  ? 54.676  2.891   -46.207 1.00 60.98 ? 87  ARG D N   1 
ATOM   5780 C CA  . ARG D 1 93  ? 55.734  2.107   -45.541 1.00 61.68 ? 87  ARG D CA  1 
ATOM   5781 C C   . ARG D 1 93  ? 56.752  3.038   -44.834 1.00 62.39 ? 87  ARG D C   1 
ATOM   5782 O O   . ARG D 1 93  ? 57.087  2.835   -43.663 1.00 62.35 ? 87  ARG D O   1 
ATOM   5783 C CB  . ARG D 1 93  ? 56.388  1.059   -46.477 1.00 61.27 ? 87  ARG D CB  1 
ATOM   5784 C CG  . ARG D 1 93  ? 57.517  0.189   -45.803 1.00 61.65 ? 87  ARG D CG  1 
ATOM   5785 C CD  . ARG D 1 93  ? 57.642  -1.313  -46.270 1.00 61.34 ? 87  ARG D CD  1 
ATOM   5786 N NE  . ARG D 1 93  ? 57.272  -1.487  -47.678 1.00 60.96 ? 87  ARG D NE  1 
ATOM   5787 C CZ  . ARG D 1 93  ? 56.340  -2.320  -48.133 1.00 60.16 ? 87  ARG D CZ  1 
ATOM   5788 N NH1 . ARG D 1 93  ? 55.688  -3.129  -47.308 1.00 59.37 ? 87  ARG D NH1 1 
ATOM   5789 N NH2 . ARG D 1 93  ? 56.079  -2.362  -49.432 1.00 60.21 ? 87  ARG D NH2 1 
ATOM   5790 N N   . LYS D 1 94  ? 57.185  4.089   -45.525 1.00 63.41 ? 88  LYS D N   1 
ATOM   5791 C CA  . LYS D 1 94  ? 58.091  5.071   -44.931 1.00 64.37 ? 88  LYS D CA  1 
ATOM   5792 C C   . LYS D 1 94  ? 57.452  5.892   -43.795 1.00 64.94 ? 88  LYS D C   1 
ATOM   5793 O O   . LYS D 1 94  ? 58.167  6.357   -42.896 1.00 65.20 ? 88  LYS D O   1 
ATOM   5794 C CB  . LYS D 1 94  ? 58.729  5.968   -46.003 1.00 64.21 ? 88  LYS D CB  1 
ATOM   5795 C CG  . LYS D 1 94  ? 59.857  5.280   -46.795 1.00 64.43 ? 88  LYS D CG  1 
ATOM   5796 C CD  . LYS D 1 94  ? 60.622  6.259   -47.686 1.00 64.95 ? 88  LYS D CD  1 
ATOM   5797 C CE  . LYS D 1 94  ? 59.905  6.524   -49.025 1.00 65.99 ? 88  LYS D CE  1 
ATOM   5798 N NZ  . LYS D 1 94  ? 60.516  5.811   -50.201 1.00 66.32 ? 88  LYS D NZ  1 
ATOM   5799 N N   . TRP D 1 95  ? 56.126  6.058   -43.822 1.00 65.72 ? 89  TRP D N   1 
ATOM   5800 C CA  . TRP D 1 95  ? 55.392  6.650   -42.679 1.00 66.35 ? 89  TRP D CA  1 
ATOM   5801 C C   . TRP D 1 95  ? 55.390  5.695   -41.491 1.00 66.87 ? 89  TRP D C   1 
ATOM   5802 O O   . TRP D 1 95  ? 55.536  6.134   -40.341 1.00 66.65 ? 89  TRP D O   1 
ATOM   5803 C CB  . TRP D 1 95  ? 53.932  7.023   -43.024 1.00 66.25 ? 89  TRP D CB  1 
ATOM   5804 C CG  . TRP D 1 95  ? 52.983  7.185   -41.780 1.00 65.99 ? 89  TRP D CG  1 
ATOM   5805 C CD1 . TRP D 1 95  ? 52.918  8.256   -40.920 1.00 65.83 ? 89  TRP D CD1 1 
ATOM   5806 C CD2 . TRP D 1 95  ? 52.007  6.244   -41.305 1.00 64.68 ? 89  TRP D CD2 1 
ATOM   5807 N NE1 . TRP D 1 95  ? 51.977  8.034   -39.945 1.00 64.75 ? 89  TRP D NE1 1 
ATOM   5808 C CE2 . TRP D 1 95  ? 51.400  6.811   -40.159 1.00 64.62 ? 89  TRP D CE2 1 
ATOM   5809 C CE3 . TRP D 1 95  ? 51.591  4.979   -41.735 1.00 65.13 ? 89  TRP D CE3 1 
ATOM   5810 C CZ2 . TRP D 1 95  ? 50.386  6.165   -39.448 1.00 65.04 ? 89  TRP D CZ2 1 
ATOM   5811 C CZ3 . TRP D 1 95  ? 50.588  4.332   -41.032 1.00 65.34 ? 89  TRP D CZ3 1 
ATOM   5812 C CH2 . TRP D 1 95  ? 49.997  4.928   -39.894 1.00 66.00 ? 89  TRP D CH2 1 
ATOM   5813 N N   . ALA D 1 96  ? 55.199  4.404   -41.775 1.00 67.48 ? 90  ALA D N   1 
ATOM   5814 C CA  . ALA D 1 96  ? 55.164  3.377   -40.736 1.00 68.20 ? 90  ALA D CA  1 
ATOM   5815 C C   . ALA D 1 96  ? 56.490  3.263   -39.963 1.00 68.97 ? 90  ALA D C   1 
ATOM   5816 O O   . ALA D 1 96  ? 56.477  3.065   -38.741 1.00 68.85 ? 90  ALA D O   1 
ATOM   5817 C CB  . ALA D 1 96  ? 54.781  2.055   -41.326 1.00 68.07 ? 90  ALA D CB  1 
ATOM   5818 N N   . GLU D 1 97  ? 57.616  3.406   -40.676 1.00 69.80 ? 91  GLU D N   1 
ATOM   5819 C CA  . GLU D 1 97  ? 58.956  3.410   -40.066 1.00 70.49 ? 91  GLU D CA  1 
ATOM   5820 C C   . GLU D 1 97  ? 59.169  4.502   -39.023 1.00 70.52 ? 91  GLU D C   1 
ATOM   5821 O O   . GLU D 1 97  ? 59.663  4.233   -37.924 1.00 70.32 ? 91  GLU D O   1 
ATOM   5822 C CB  . GLU D 1 97  ? 60.059  3.467   -41.135 1.00 70.76 ? 91  GLU D CB  1 
ATOM   5823 C CG  . GLU D 1 97  ? 60.420  2.099   -41.678 1.00 72.36 ? 91  GLU D CG  1 
ATOM   5824 C CD  . GLU D 1 97  ? 60.219  0.994   -40.629 1.00 74.47 ? 91  GLU D CD  1 
ATOM   5825 O OE1 . GLU D 1 97  ? 61.136  0.780   -39.797 1.00 75.12 ? 91  GLU D OE1 1 
ATOM   5826 O OE2 . GLU D 1 97  ? 59.138  0.352   -40.638 1.00 74.01 ? 91  GLU D OE2 1 
ATOM   5827 N N   . LYS D 1 98  ? 58.776  5.723   -39.370 1.00 70.72 ? 92  LYS D N   1 
ATOM   5828 C CA  . LYS D 1 98  ? 58.935  6.864   -38.486 1.00 71.10 ? 92  LYS D CA  1 
ATOM   5829 C C   . LYS D 1 98  ? 58.190  6.725   -37.143 1.00 71.44 ? 92  LYS D C   1 
ATOM   5830 O O   . LYS D 1 98  ? 58.438  7.518   -36.226 1.00 71.89 ? 92  LYS D O   1 
ATOM   5831 C CB  . LYS D 1 98  ? 58.549  8.161   -39.204 1.00 70.87 ? 92  LYS D CB  1 
ATOM   5832 C CG  . LYS D 1 98  ? 59.385  8.473   -40.445 1.00 71.26 ? 92  LYS D CG  1 
ATOM   5833 C CD  . LYS D 1 98  ? 59.334  9.979   -40.809 1.00 71.25 ? 92  LYS D CD  1 
ATOM   5834 C CE  . LYS D 1 98  ? 60.465  10.393  -41.760 1.00 69.55 ? 92  LYS D CE  1 
ATOM   5835 N NZ  . LYS D 1 98  ? 61.791  10.045  -41.203 1.00 69.31 ? 92  LYS D NZ  1 
ATOM   5836 N N   . ILE D 1 99  ? 57.313  5.719   -37.025 1.00 71.35 ? 93  ILE D N   1 
ATOM   5837 C CA  . ILE D 1 99  ? 56.614  5.403   -35.759 1.00 71.64 ? 93  ILE D CA  1 
ATOM   5838 C C   . ILE D 1 99  ? 57.437  4.493   -34.811 1.00 71.71 ? 93  ILE D C   1 
ATOM   5839 O O   . ILE D 1 99  ? 57.801  3.365   -35.179 1.00 71.59 ? 93  ILE D O   1 
ATOM   5840 C CB  . ILE D 1 99  ? 55.207  4.732   -36.000 1.00 72.22 ? 93  ILE D CB  1 
ATOM   5841 C CG1 . ILE D 1 99  ? 54.286  5.605   -36.855 1.00 71.91 ? 93  ILE D CG1 1 
ATOM   5842 C CG2 . ILE D 1 99  ? 54.500  4.410   -34.667 1.00 72.60 ? 93  ILE D CG2 1 
ATOM   5843 C CD1 . ILE D 1 99  ? 53.002  4.925   -37.227 1.00 70.98 ? 93  ILE D CD1 1 
ATOM   5844 N N   . PRO D 1 100 ? 57.711  4.976   -33.578 1.00 71.91 ? 94  PRO D N   1 
ATOM   5845 C CA  . PRO D 1 100 ? 58.519  4.221   -32.608 1.00 72.10 ? 94  PRO D CA  1 
ATOM   5846 C C   . PRO D 1 100 ? 57.843  2.928   -32.173 1.00 72.21 ? 94  PRO D C   1 
ATOM   5847 O O   . PRO D 1 100 ? 56.655  2.921   -31.834 1.00 72.23 ? 94  PRO D O   1 
ATOM   5848 C CB  . PRO D 1 100 ? 58.639  5.179   -31.413 1.00 71.96 ? 94  PRO D CB  1 
ATOM   5849 C CG  . PRO D 1 100 ? 57.467  6.086   -31.536 1.00 71.95 ? 94  PRO D CG  1 
ATOM   5850 C CD  . PRO D 1 100 ? 57.269  6.269   -33.020 1.00 71.98 ? 94  PRO D CD  1 
ATOM   5851 N N   . GLY D 1 101 ? 58.607  1.845   -32.192 1.00 72.16 ? 95  GLY D N   1 
ATOM   5852 C CA  . GLY D 1 101 ? 58.081  0.548   -31.853 1.00 72.35 ? 95  GLY D CA  1 
ATOM   5853 C C   . GLY D 1 101 ? 57.838  -0.271  -33.099 1.00 72.67 ? 95  GLY D C   1 
ATOM   5854 O O   . GLY D 1 101 ? 57.834  -1.501  -33.029 1.00 72.97 ? 95  GLY D O   1 
ATOM   5855 N N   . PHE D 1 102 ? 57.634  0.390   -34.241 1.00 72.87 ? 96  PHE D N   1 
ATOM   5856 C CA  . PHE D 1 102 ? 57.272  -0.348  -35.450 1.00 73.17 ? 96  PHE D CA  1 
ATOM   5857 C C   . PHE D 1 102 ? 58.468  -1.079  -36.014 1.00 73.67 ? 96  PHE D C   1 
ATOM   5858 O O   . PHE D 1 102 ? 58.403  -2.280  -36.287 1.00 73.47 ? 96  PHE D O   1 
ATOM   5859 C CB  . PHE D 1 102 ? 56.609  0.522   -36.531 1.00 72.74 ? 96  PHE D CB  1 
ATOM   5860 C CG  . PHE D 1 102 ? 56.087  -0.281  -37.721 1.00 72.00 ? 96  PHE D CG  1 
ATOM   5861 C CD1 . PHE D 1 102 ? 54.948  -1.072  -37.606 1.00 70.24 ? 96  PHE D CD1 1 
ATOM   5862 C CD2 . PHE D 1 102 ? 56.747  -0.254  -38.948 1.00 72.31 ? 96  PHE D CD2 1 
ATOM   5863 C CE1 . PHE D 1 102 ? 54.477  -1.823  -38.690 1.00 69.89 ? 96  PHE D CE1 1 
ATOM   5864 C CE2 . PHE D 1 102 ? 56.274  -0.999  -40.045 1.00 71.61 ? 96  PHE D CE2 1 
ATOM   5865 C CZ  . PHE D 1 102 ? 55.140  -1.784  -39.907 1.00 71.08 ? 96  PHE D CZ  1 
ATOM   5866 N N   . ALA D 1 103 ? 59.556  -0.334  -36.183 1.00 74.68 ? 97  ALA D N   1 
ATOM   5867 C CA  . ALA D 1 103 ? 60.817  -0.891  -36.636 1.00 75.46 ? 97  ALA D CA  1 
ATOM   5868 C C   . ALA D 1 103 ? 61.183  -2.069  -35.738 1.00 76.18 ? 97  ALA D C   1 
ATOM   5869 O O   . ALA D 1 103 ? 61.767  -3.051  -36.201 1.00 76.38 ? 97  ALA D O   1 
ATOM   5870 C CB  . ALA D 1 103 ? 61.893  0.171   -36.599 1.00 75.35 ? 97  ALA D CB  1 
ATOM   5871 N N   . GLU D 1 104 ? 60.779  -1.959  -34.468 1.00 76.95 ? 98  GLU D N   1 
ATOM   5872 C CA  . GLU D 1 104 ? 61.112  -2.886  -33.377 1.00 77.65 ? 98  GLU D CA  1 
ATOM   5873 C C   . GLU D 1 104 ? 60.547  -4.290  -33.567 1.00 78.06 ? 98  GLU D C   1 
ATOM   5874 O O   . GLU D 1 104 ? 61.242  -5.282  -33.319 1.00 78.07 ? 98  GLU D O   1 
ATOM   5875 C CB  . GLU D 1 104 ? 60.637  -2.303  -32.040 1.00 77.68 ? 98  GLU D CB  1 
ATOM   5876 C CG  . GLU D 1 104 ? 61.553  -1.231  -31.430 1.00 78.56 ? 98  GLU D CG  1 
ATOM   5877 C CD  . GLU D 1 104 ? 62.068  -0.212  -32.441 1.00 79.97 ? 98  GLU D CD  1 
ATOM   5878 O OE1 . GLU D 1 104 ? 61.242  0.507   -33.055 1.00 80.90 ? 98  GLU D OE1 1 
ATOM   5879 O OE2 . GLU D 1 104 ? 63.307  -0.134  -32.620 1.00 80.11 ? 98  GLU D OE2 1 
ATOM   5880 N N   . LEU D 1 105 ? 59.285  -4.368  -33.986 1.00 78.54 ? 99  LEU D N   1 
ATOM   5881 C CA  . LEU D 1 105 ? 58.708  -5.623  -34.449 1.00 78.95 ? 99  LEU D CA  1 
ATOM   5882 C C   . LEU D 1 105 ? 59.480  -6.096  -35.668 1.00 79.29 ? 99  LEU D C   1 
ATOM   5883 O O   . LEU D 1 105 ? 59.986  -5.273  -36.443 1.00 79.22 ? 99  LEU D O   1 
ATOM   5884 C CB  . LEU D 1 105 ? 57.249  -5.435  -34.842 1.00 79.00 ? 99  LEU D CB  1 
ATOM   5885 C CG  . LEU D 1 105 ? 56.204  -5.408  -33.734 1.00 79.18 ? 99  LEU D CG  1 
ATOM   5886 C CD1 . LEU D 1 105 ? 55.634  -3.998  -33.561 1.00 78.68 ? 99  LEU D CD1 1 
ATOM   5887 C CD2 . LEU D 1 105 ? 55.107  -6.414  -34.081 1.00 78.73 ? 99  LEU D CD2 1 
ATOM   5888 N N   . SER D 1 106 ? 59.551  -7.415  -35.841 1.00 79.64 ? 100 SER D N   1 
ATOM   5889 C CA  . SER D 1 106 ? 60.284  -8.026  -36.957 1.00 80.05 ? 100 SER D CA  1 
ATOM   5890 C C   . SER D 1 106 ? 59.854  -7.485  -38.325 1.00 80.27 ? 100 SER D C   1 
ATOM   5891 O O   . SER D 1 106 ? 58.678  -7.163  -38.523 1.00 80.14 ? 100 SER D O   1 
ATOM   5892 C CB  . SER D 1 106 ? 60.093  -9.546  -36.952 1.00 80.19 ? 100 SER D CB  1 
ATOM   5893 O OG  . SER D 1 106 ? 58.824  -9.905  -37.480 1.00 80.14 ? 100 SER D OG  1 
ATOM   5894 N N   . PRO D 1 107 ? 60.799  -7.409  -39.287 1.00 80.44 ? 101 PRO D N   1 
ATOM   5895 C CA  . PRO D 1 107 ? 60.338  -7.104  -40.646 1.00 80.55 ? 101 PRO D CA  1 
ATOM   5896 C C   . PRO D 1 107 ? 59.202  -8.064  -41.057 1.00 80.63 ? 101 PRO D C   1 
ATOM   5897 O O   . PRO D 1 107 ? 58.335  -7.681  -41.848 1.00 80.45 ? 101 PRO D O   1 
ATOM   5898 C CB  . PRO D 1 107 ? 61.594  -7.329  -41.510 1.00 80.54 ? 101 PRO D CB  1 
ATOM   5899 C CG  . PRO D 1 107 ? 62.577  -8.071  -40.609 1.00 80.40 ? 101 PRO D CG  1 
ATOM   5900 C CD  . PRO D 1 107 ? 62.258  -7.607  -39.228 1.00 80.19 ? 101 PRO D CD  1 
ATOM   5901 N N   . ALA D 1 108 ? 59.214  -9.283  -40.494 1.00 80.53 ? 102 ALA D N   1 
ATOM   5902 C CA  . ALA D 1 108 ? 58.207  -10.315 -40.764 1.00 80.22 ? 102 ALA D CA  1 
ATOM   5903 C C   . ALA D 1 108 ? 56.805  -9.850  -40.355 1.00 80.12 ? 102 ALA D C   1 
ATOM   5904 O O   . ALA D 1 108 ? 55.840  -9.991  -41.125 1.00 80.22 ? 102 ALA D O   1 
ATOM   5905 C CB  . ALA D 1 108 ? 58.580  -11.632 -40.072 1.00 80.10 ? 102 ALA D CB  1 
ATOM   5906 N N   . ASP D 1 109 ? 56.707  -9.267  -39.160 1.00 79.73 ? 103 ASP D N   1 
ATOM   5907 C CA  . ASP D 1 109 ? 55.440  -8.730  -38.654 1.00 79.28 ? 103 ASP D CA  1 
ATOM   5908 C C   . ASP D 1 109 ? 55.110  -7.325  -39.163 1.00 79.06 ? 103 ASP D C   1 
ATOM   5909 O O   . ASP D 1 109 ? 53.945  -6.904  -39.159 1.00 78.95 ? 103 ASP D O   1 
ATOM   5910 C CB  . ASP D 1 109 ? 55.408  -8.778  -37.130 1.00 79.33 ? 103 ASP D CB  1 
ATOM   5911 C CG  . ASP D 1 109 ? 54.930  -10.120 -36.606 1.00 79.73 ? 103 ASP D CG  1 
ATOM   5912 O OD1 . ASP D 1 109 ? 55.025  -11.125 -37.346 1.00 79.71 ? 103 ASP D OD1 1 
ATOM   5913 O OD2 . ASP D 1 109 ? 54.445  -10.168 -35.455 1.00 80.39 ? 103 ASP D OD2 1 
ATOM   5914 N N   . GLN D 1 110 ? 56.135  -6.602  -39.604 1.00 78.65 ? 104 GLN D N   1 
ATOM   5915 C CA  . GLN D 1 110 ? 55.920  -5.337  -40.278 1.00 78.05 ? 104 GLN D CA  1 
ATOM   5916 C C   . GLN D 1 110 ? 55.019  -5.609  -41.482 1.00 77.71 ? 104 GLN D C   1 
ATOM   5917 O O   . GLN D 1 110 ? 53.988  -4.947  -41.657 1.00 77.70 ? 104 GLN D O   1 
ATOM   5918 C CB  . GLN D 1 110 ? 57.255  -4.696  -40.694 1.00 78.11 ? 104 GLN D CB  1 
ATOM   5919 C CG  . GLN D 1 110 ? 58.032  -4.075  -39.522 1.00 78.08 ? 104 GLN D CG  1 
ATOM   5920 C CD  . GLN D 1 110 ? 59.372  -3.453  -39.916 1.00 78.10 ? 104 GLN D CD  1 
ATOM   5921 O OE1 . GLN D 1 110 ? 59.897  -3.683  -41.014 1.00 77.77 ? 104 GLN D OE1 1 
ATOM   5922 N NE2 . GLN D 1 110 ? 59.936  -2.664  -39.005 1.00 77.41 ? 104 GLN D NE2 1 
ATOM   5923 N N   . ASP D 1 111 ? 55.385  -6.623  -42.274 1.00 77.01 ? 105 ASP D N   1 
ATOM   5924 C CA  . ASP D 1 111 ? 54.679  -6.928  -43.529 1.00 76.08 ? 105 ASP D CA  1 
ATOM   5925 C C   . ASP D 1 111 ? 53.196  -7.193  -43.334 1.00 75.07 ? 105 ASP D C   1 
ATOM   5926 O O   . ASP D 1 111 ? 52.360  -6.591  -44.024 1.00 75.27 ? 105 ASP D O   1 
ATOM   5927 C CB  . ASP D 1 111 ? 55.350  -8.073  -44.307 1.00 76.41 ? 105 ASP D CB  1 
ATOM   5928 C CG  . ASP D 1 111 ? 56.424  -7.571  -45.290 1.00 76.85 ? 105 ASP D CG  1 
ATOM   5929 O OD1 . ASP D 1 111 ? 56.459  -6.343  -45.545 1.00 77.28 ? 105 ASP D OD1 1 
ATOM   5930 O OD2 . ASP D 1 111 ? 57.224  -8.398  -45.809 1.00 75.66 ? 105 ASP D OD2 1 
ATOM   5931 N N   . LEU D 1 112 ? 52.866  -8.070  -42.389 1.00 73.38 ? 106 LEU D N   1 
ATOM   5932 C CA  . LEU D 1 112 ? 51.474  -8.408  -42.176 1.00 71.77 ? 106 LEU D CA  1 
ATOM   5933 C C   . LEU D 1 112 ? 50.715  -7.156  -41.753 1.00 70.79 ? 106 LEU D C   1 
ATOM   5934 O O   . LEU D 1 112 ? 49.722  -6.791  -42.389 1.00 70.33 ? 106 LEU D O   1 
ATOM   5935 C CB  . LEU D 1 112 ? 51.317  -9.555  -41.172 1.00 71.78 ? 106 LEU D CB  1 
ATOM   5936 C CG  . LEU D 1 112 ? 50.232  -10.593 -41.476 1.00 70.98 ? 106 LEU D CG  1 
ATOM   5937 C CD1 . LEU D 1 112 ? 49.916  -10.664 -42.953 1.00 70.78 ? 106 LEU D CD1 1 
ATOM   5938 C CD2 . LEU D 1 112 ? 50.677  -11.947 -40.994 1.00 71.36 ? 106 LEU D CD2 1 
ATOM   5939 N N   . LEU D 1 113 ? 51.226  -6.469  -40.729 1.00 69.73 ? 107 LEU D N   1 
ATOM   5940 C CA  . LEU D 1 113 ? 50.550  -5.293  -40.171 1.00 68.94 ? 107 LEU D CA  1 
ATOM   5941 C C   . LEU D 1 113 ? 50.260  -4.244  -41.218 1.00 68.42 ? 107 LEU D C   1 
ATOM   5942 O O   . LEU D 1 113 ? 49.362  -3.425  -41.040 1.00 68.41 ? 107 LEU D O   1 
ATOM   5943 C CB  . LEU D 1 113 ? 51.361  -4.647  -39.055 1.00 68.74 ? 107 LEU D CB  1 
ATOM   5944 C CG  . LEU D 1 113 ? 51.102  -5.050  -37.604 1.00 68.50 ? 107 LEU D CG  1 
ATOM   5945 C CD1 . LEU D 1 113 ? 51.610  -3.929  -36.700 1.00 67.72 ? 107 LEU D CD1 1 
ATOM   5946 C CD2 . LEU D 1 113 ? 49.630  -5.374  -37.306 1.00 66.95 ? 107 LEU D CD2 1 
ATOM   5947 N N   . LEU D 1 114 ? 51.014  -4.307  -42.312 1.00 67.48 ? 108 LEU D N   1 
ATOM   5948 C CA  . LEU D 1 114 ? 50.947  -3.324  -43.370 1.00 66.54 ? 108 LEU D CA  1 
ATOM   5949 C C   . LEU D 1 114 ? 50.191  -3.806  -44.590 1.00 66.29 ? 108 LEU D C   1 
ATOM   5950 O O   . LEU D 1 114 ? 49.399  -3.064  -45.174 1.00 66.18 ? 108 LEU D O   1 
ATOM   5951 C CB  . LEU D 1 114 ? 52.347  -2.936  -43.773 1.00 66.46 ? 108 LEU D CB  1 
ATOM   5952 C CG  . LEU D 1 114 ? 52.449  -1.457  -44.047 1.00 65.66 ? 108 LEU D CG  1 
ATOM   5953 C CD1 . LEU D 1 114 ? 53.590  -0.873  -43.212 1.00 63.64 ? 108 LEU D CD1 1 
ATOM   5954 C CD2 . LEU D 1 114 ? 52.627  -1.269  -45.550 1.00 65.89 ? 108 LEU D CD2 1 
ATOM   5955 N N   . GLU D 1 115 ? 50.426  -5.040  -45.002 1.00 65.87 ? 109 GLU D N   1 
ATOM   5956 C CA  . GLU D 1 115 ? 49.634  -5.549  -46.098 1.00 65.96 ? 109 GLU D CA  1 
ATOM   5957 C C   . GLU D 1 115 ? 48.134  -5.438  -45.735 1.00 65.55 ? 109 GLU D C   1 
ATOM   5958 O O   . GLU D 1 115 ? 47.333  -4.914  -46.519 1.00 66.20 ? 109 GLU D O   1 
ATOM   5959 C CB  . GLU D 1 115 ? 50.093  -6.945  -46.495 1.00 66.13 ? 109 GLU D CB  1 
ATOM   5960 C CG  . GLU D 1 115 ? 51.506  -6.898  -47.084 1.00 67.88 ? 109 GLU D CG  1 
ATOM   5961 C CD  . GLU D 1 115 ? 52.073  -8.254  -47.470 1.00 70.38 ? 109 GLU D CD  1 
ATOM   5962 O OE1 . GLU D 1 115 ? 51.890  -9.247  -46.718 1.00 71.74 ? 109 GLU D OE1 1 
ATOM   5963 O OE2 . GLU D 1 115 ? 52.734  -8.316  -48.526 1.00 70.64 ? 109 GLU D OE2 1 
ATOM   5964 N N   . SER D 1 116 ? 47.784  -5.832  -44.512 1.00 64.19 ? 110 SER D N   1 
ATOM   5965 C CA  . SER D 1 116 ? 46.408  -5.736  -44.036 1.00 62.93 ? 110 SER D CA  1 
ATOM   5966 C C   . SER D 1 116 ? 45.932  -4.299  -43.795 1.00 61.99 ? 110 SER D C   1 
ATOM   5967 O O   . SER D 1 116 ? 44.739  -4.020  -43.858 1.00 61.77 ? 110 SER D O   1 
ATOM   5968 C CB  . SER D 1 116 ? 46.244  -6.546  -42.753 1.00 63.02 ? 110 SER D CB  1 
ATOM   5969 O OG  . SER D 1 116 ? 46.868  -7.817  -42.880 1.00 64.31 ? 110 SER D OG  1 
ATOM   5970 N N   . ALA D 1 117 ? 46.843  -3.380  -43.501 1.00 60.46 ? 111 ALA D N   1 
ATOM   5971 C CA  . ALA D 1 117 ? 46.390  -2.027  -43.200 1.00 58.84 ? 111 ALA D CA  1 
ATOM   5972 C C   . ALA D 1 117 ? 46.266  -1.138  -44.439 1.00 57.89 ? 111 ALA D C   1 
ATOM   5973 O O   . ALA D 1 117 ? 45.537  -0.143  -44.421 1.00 57.68 ? 111 ALA D O   1 
ATOM   5974 C CB  . ALA D 1 117 ? 47.271  -1.396  -42.186 1.00 58.81 ? 111 ALA D CB  1 
ATOM   5975 N N   . PHE D 1 118 ? 46.940  -1.533  -45.517 1.00 56.26 ? 112 PHE D N   1 
ATOM   5976 C CA  . PHE D 1 118 ? 47.137  -0.672  -46.671 1.00 54.74 ? 112 PHE D CA  1 
ATOM   5977 C C   . PHE D 1 118 ? 45.888  0.038   -47.230 1.00 54.14 ? 112 PHE D C   1 
ATOM   5978 O O   . PHE D 1 118 ? 45.861  1.270   -47.422 1.00 54.30 ? 112 PHE D O   1 
ATOM   5979 C CB  . PHE D 1 118 ? 47.838  -1.439  -47.792 1.00 54.18 ? 112 PHE D CB  1 
ATOM   5980 C CG  . PHE D 1 118 ? 47.869  -0.690  -49.091 1.00 53.23 ? 112 PHE D CG  1 
ATOM   5981 C CD1 . PHE D 1 118 ? 48.493  0.566   -49.174 1.00 53.76 ? 112 PHE D CD1 1 
ATOM   5982 C CD2 . PHE D 1 118 ? 47.258  -1.215  -50.222 1.00 52.12 ? 112 PHE D CD2 1 
ATOM   5983 C CE1 . PHE D 1 118 ? 48.519  1.278   -50.365 1.00 53.04 ? 112 PHE D CE1 1 
ATOM   5984 C CE2 . PHE D 1 118 ? 47.275  -0.521  -51.420 1.00 52.35 ? 112 PHE D CE2 1 
ATOM   5985 C CZ  . PHE D 1 118 ? 47.910  0.735   -51.492 1.00 53.46 ? 112 PHE D CZ  1 
ATOM   5986 N N   . LEU D 1 119 ? 44.874  -0.762  -47.512 1.00 53.25 ? 113 LEU D N   1 
ATOM   5987 C CA  . LEU D 1 119 ? 43.695  -0.296  -48.196 1.00 52.02 ? 113 LEU D CA  1 
ATOM   5988 C C   . LEU D 1 119 ? 42.948  0.723   -47.344 1.00 51.07 ? 113 LEU D C   1 
ATOM   5989 O O   . LEU D 1 119 ? 42.519  1.742   -47.855 1.00 50.54 ? 113 LEU D O   1 
ATOM   5990 C CB  . LEU D 1 119 ? 42.828  -1.494  -48.575 1.00 52.06 ? 113 LEU D CB  1 
ATOM   5991 C CG  . LEU D 1 119 ? 42.182  -1.439  -49.969 1.00 53.38 ? 113 LEU D CG  1 
ATOM   5992 C CD1 . LEU D 1 119 ? 42.890  -0.489  -50.984 1.00 51.85 ? 113 LEU D CD1 1 
ATOM   5993 C CD2 . LEU D 1 119 ? 42.020  -2.870  -50.543 1.00 53.04 ? 113 LEU D CD2 1 
ATOM   5994 N N   . GLU D 1 120 ? 42.825  0.448   -46.045 1.00 50.60 ? 114 GLU D N   1 
ATOM   5995 C CA  . GLU D 1 120 ? 42.207  1.375   -45.085 1.00 50.06 ? 114 GLU D CA  1 
ATOM   5996 C C   . GLU D 1 120 ? 43.063  2.637   -45.009 1.00 49.05 ? 114 GLU D C   1 
ATOM   5997 O O   . GLU D 1 120 ? 42.561  3.757   -45.081 1.00 49.10 ? 114 GLU D O   1 
ATOM   5998 C CB  . GLU D 1 120 ? 42.067  0.726   -43.693 1.00 50.00 ? 114 GLU D CB  1 
ATOM   5999 C CG  . GLU D 1 120 ? 41.558  -0.746  -43.696 1.00 50.97 ? 114 GLU D CG  1 
ATOM   6000 C CD  . GLU D 1 120 ? 41.864  -1.536  -42.395 1.00 51.02 ? 114 GLU D CD  1 
ATOM   6001 O OE1 . GLU D 1 120 ? 42.548  -2.569  -42.504 1.00 54.51 ? 114 GLU D OE1 1 
ATOM   6002 O OE2 . GLU D 1 120 ? 41.439  -1.157  -41.275 1.00 49.83 ? 114 GLU D OE2 1 
ATOM   6003 N N   . LEU D 1 121 ? 44.367  2.433   -44.893 1.00 48.44 ? 115 LEU D N   1 
ATOM   6004 C CA  . LEU D 1 121 ? 45.345  3.515   -44.870 1.00 47.87 ? 115 LEU D CA  1 
ATOM   6005 C C   . LEU D 1 121 ? 45.272  4.400   -46.109 1.00 47.50 ? 115 LEU D C   1 
ATOM   6006 O O   . LEU D 1 121 ? 45.164  5.629   -46.005 1.00 47.16 ? 115 LEU D O   1 
ATOM   6007 C CB  . LEU D 1 121 ? 46.764  2.959   -44.643 1.00 47.42 ? 115 LEU D CB  1 
ATOM   6008 C CG  . LEU D 1 121 ? 46.939  2.540   -43.178 1.00 47.31 ? 115 LEU D CG  1 
ATOM   6009 C CD1 . LEU D 1 121 ? 48.241  1.783   -42.962 1.00 47.83 ? 115 LEU D CD1 1 
ATOM   6010 C CD2 . LEU D 1 121 ? 46.815  3.736   -42.214 1.00 46.86 ? 115 LEU D CD2 1 
ATOM   6011 N N   . PHE D 1 122 ? 45.313  3.775   -47.276 1.00 47.20 ? 116 PHE D N   1 
ATOM   6012 C CA  . PHE D 1 122 ? 45.024  4.498   -48.498 1.00 47.67 ? 116 PHE D CA  1 
ATOM   6013 C C   . PHE D 1 122 ? 43.790  5.431   -48.357 1.00 47.94 ? 116 PHE D C   1 
ATOM   6014 O O   . PHE D 1 122 ? 43.901  6.644   -48.576 1.00 48.32 ? 116 PHE D O   1 
ATOM   6015 C CB  . PHE D 1 122 ? 44.848  3.532   -49.674 1.00 47.68 ? 116 PHE D CB  1 
ATOM   6016 C CG  . PHE D 1 122 ? 44.646  4.222   -50.995 1.00 47.62 ? 116 PHE D CG  1 
ATOM   6017 C CD1 . PHE D 1 122 ? 45.675  4.958   -51.579 1.00 47.04 ? 116 PHE D CD1 1 
ATOM   6018 C CD2 . PHE D 1 122 ? 43.433  4.148   -51.648 1.00 47.41 ? 116 PHE D CD2 1 
ATOM   6019 C CE1 . PHE D 1 122 ? 45.495  5.601   -52.793 1.00 46.48 ? 116 PHE D CE1 1 
ATOM   6020 C CE2 . PHE D 1 122 ? 43.250  4.795   -52.873 1.00 48.09 ? 116 PHE D CE2 1 
ATOM   6021 C CZ  . PHE D 1 122 ? 44.287  5.519   -53.444 1.00 46.66 ? 116 PHE D CZ  1 
ATOM   6022 N N   . ILE D 1 123 ? 42.645  4.876   -47.955 1.00 47.32 ? 117 ILE D N   1 
ATOM   6023 C CA  . ILE D 1 123 ? 41.411  5.637   -47.881 1.00 47.23 ? 117 ILE D CA  1 
ATOM   6024 C C   . ILE D 1 123 ? 41.442  6.763   -46.832 1.00 47.22 ? 117 ILE D C   1 
ATOM   6025 O O   . ILE D 1 123 ? 41.122  7.937   -47.120 1.00 46.54 ? 117 ILE D O   1 
ATOM   6026 C CB  . ILE D 1 123 ? 40.221  4.703   -47.646 1.00 47.55 ? 117 ILE D CB  1 
ATOM   6027 C CG1 . ILE D 1 123 ? 40.127  3.643   -48.760 1.00 47.78 ? 117 ILE D CG1 1 
ATOM   6028 C CG2 . ILE D 1 123 ? 38.911  5.481   -47.578 1.00 47.77 ? 117 ILE D CG2 1 
ATOM   6029 C CD1 . ILE D 1 123 ? 39.431  2.349   -48.305 1.00 46.25 ? 117 ILE D CD1 1 
ATOM   6030 N N   . LEU D 1 124 ? 41.845  6.402   -45.624 1.00 47.08 ? 118 LEU D N   1 
ATOM   6031 C CA  . LEU D 1 124 ? 41.869  7.344   -44.518 1.00 47.13 ? 118 LEU D CA  1 
ATOM   6032 C C   . LEU D 1 124 ? 42.777  8.515   -44.867 1.00 47.62 ? 118 LEU D C   1 
ATOM   6033 O O   . LEU D 1 124 ? 42.427  9.696   -44.684 1.00 47.44 ? 118 LEU D O   1 
ATOM   6034 C CB  . LEU D 1 124 ? 42.363  6.642   -43.240 1.00 46.90 ? 118 LEU D CB  1 
ATOM   6035 C CG  . LEU D 1 124 ? 42.359  7.393   -41.898 1.00 46.37 ? 118 LEU D CG  1 
ATOM   6036 C CD1 . LEU D 1 124 ? 41.016  8.037   -41.510 1.00 44.47 ? 118 LEU D CD1 1 
ATOM   6037 C CD2 . LEU D 1 124 ? 42.758  6.454   -40.829 1.00 46.96 ? 118 LEU D CD2 1 
ATOM   6038 N N   . ARG D 1 125 ? 43.951  8.177   -45.385 1.00 48.17 ? 119 ARG D N   1 
ATOM   6039 C CA  . ARG D 1 125 ? 44.971  9.176   -45.582 1.00 48.45 ? 119 ARG D CA  1 
ATOM   6040 C C   . ARG D 1 125 ? 44.450  10.134  -46.627 1.00 48.64 ? 119 ARG D C   1 
ATOM   6041 O O   . ARG D 1 125 ? 44.456  11.357  -46.412 1.00 48.72 ? 119 ARG D O   1 
ATOM   6042 C CB  . ARG D 1 125 ? 46.308  8.544   -45.969 1.00 48.27 ? 119 ARG D CB  1 
ATOM   6043 C CG  . ARG D 1 125 ? 47.133  8.043   -44.769 1.00 48.11 ? 119 ARG D CG  1 
ATOM   6044 C CD  . ARG D 1 125 ? 48.568  7.595   -45.176 1.00 49.41 ? 119 ARG D CD  1 
ATOM   6045 N NE  . ARG D 1 125 ? 49.289  8.595   -45.977 1.00 51.39 ? 119 ARG D NE  1 
ATOM   6046 C CZ  . ARG D 1 125 ? 50.358  9.275   -45.560 1.00 52.85 ? 119 ARG D CZ  1 
ATOM   6047 N NH1 . ARG D 1 125 ? 50.854  9.050   -44.349 1.00 51.50 ? 119 ARG D NH1 1 
ATOM   6048 N NH2 . ARG D 1 125 ? 50.934  10.183  -46.356 1.00 53.53 ? 119 ARG D NH2 1 
ATOM   6049 N N   . LEU D 1 126 ? 43.933  9.561   -47.722 1.00 49.02 ? 120 LEU D N   1 
ATOM   6050 C CA  . LEU D 1 126 ? 43.404  10.335  -48.867 1.00 48.56 ? 120 LEU D CA  1 
ATOM   6051 C C   . LEU D 1 126 ? 42.172  11.168  -48.488 1.00 48.67 ? 120 LEU D C   1 
ATOM   6052 O O   . LEU D 1 126 ? 42.051  12.334  -48.870 1.00 47.56 ? 120 LEU D O   1 
ATOM   6053 C CB  . LEU D 1 126 ? 43.098  9.418   -50.049 1.00 47.76 ? 120 LEU D CB  1 
ATOM   6054 C CG  . LEU D 1 126 ? 42.417  10.061  -51.253 1.00 47.00 ? 120 LEU D CG  1 
ATOM   6055 C CD1 . LEU D 1 126 ? 43.447  10.563  -52.236 1.00 46.13 ? 120 LEU D CD1 1 
ATOM   6056 C CD2 . LEU D 1 126 ? 41.474  9.061   -51.925 1.00 45.59 ? 120 LEU D CD2 1 
ATOM   6057 N N   . ALA D 1 127 ? 41.270  10.559  -47.727 1.00 49.44 ? 121 ALA D N   1 
ATOM   6058 C CA  . ALA D 1 127 ? 40.080  11.264  -47.322 1.00 50.47 ? 121 ALA D CA  1 
ATOM   6059 C C   . ALA D 1 127 ? 40.519  12.488  -46.497 1.00 51.53 ? 121 ALA D C   1 
ATOM   6060 O O   . ALA D 1 127 ? 40.012  13.606  -46.712 1.00 52.14 ? 121 ALA D O   1 
ATOM   6061 C CB  . ALA D 1 127 ? 39.142  10.352  -46.547 1.00 49.95 ? 121 ALA D CB  1 
ATOM   6062 N N   . TYR D 1 128 ? 41.496  12.309  -45.600 1.00 51.92 ? 122 TYR D N   1 
ATOM   6063 C CA  . TYR D 1 128 ? 41.896  13.424  -44.739 1.00 52.30 ? 122 TYR D CA  1 
ATOM   6064 C C   . TYR D 1 128 ? 42.523  14.563  -45.533 1.00 52.37 ? 122 TYR D C   1 
ATOM   6065 O O   . TYR D 1 128 ? 42.327  15.737  -45.215 1.00 52.46 ? 122 TYR D O   1 
ATOM   6066 C CB  . TYR D 1 128 ? 42.832  12.968  -43.626 1.00 52.67 ? 122 TYR D CB  1 
ATOM   6067 C CG  . TYR D 1 128 ? 43.003  13.990  -42.513 1.00 53.71 ? 122 TYR D CG  1 
ATOM   6068 C CD1 . TYR D 1 128 ? 41.934  14.314  -41.656 1.00 53.59 ? 122 TYR D CD1 1 
ATOM   6069 C CD2 . TYR D 1 128 ? 44.230  14.638  -42.311 1.00 54.96 ? 122 TYR D CD2 1 
ATOM   6070 C CE1 . TYR D 1 128 ? 42.084  15.257  -40.632 1.00 53.05 ? 122 TYR D CE1 1 
ATOM   6071 C CE2 . TYR D 1 128 ? 44.388  15.588  -41.291 1.00 54.55 ? 122 TYR D CE2 1 
ATOM   6072 C CZ  . TYR D 1 128 ? 43.312  15.886  -40.454 1.00 54.08 ? 122 TYR D CZ  1 
ATOM   6073 O OH  . TYR D 1 128 ? 43.469  16.814  -39.435 1.00 54.18 ? 122 TYR D OH  1 
ATOM   6074 N N   . ARG D 1 129 ? 43.251  14.206  -46.587 1.00 52.20 ? 123 ARG D N   1 
ATOM   6075 C CA  . ARG D 1 129 ? 44.060  15.158  -47.315 1.00 51.72 ? 123 ARG D CA  1 
ATOM   6076 C C   . ARG D 1 129 ? 43.279  15.840  -48.414 1.00 52.07 ? 123 ARG D C   1 
ATOM   6077 O O   . ARG D 1 129 ? 43.503  17.018  -48.700 1.00 53.07 ? 123 ARG D O   1 
ATOM   6078 C CB  . ARG D 1 129 ? 45.246  14.448  -47.924 1.00 51.34 ? 123 ARG D CB  1 
ATOM   6079 C CG  . ARG D 1 129 ? 46.432  15.340  -48.130 1.00 52.14 ? 123 ARG D CG  1 
ATOM   6080 C CD  . ARG D 1 129 ? 47.551  14.615  -48.855 1.00 53.95 ? 123 ARG D CD  1 
ATOM   6081 N NE  . ARG D 1 129 ? 48.102  13.459  -48.141 1.00 55.38 ? 123 ARG D NE  1 
ATOM   6082 C CZ  . ARG D 1 129 ? 47.871  12.180  -48.455 1.00 55.43 ? 123 ARG D CZ  1 
ATOM   6083 N NH1 . ARG D 1 129 ? 47.077  11.872  -49.476 1.00 54.19 ? 123 ARG D NH1 1 
ATOM   6084 N NH2 . ARG D 1 129 ? 48.450  11.206  -47.747 1.00 56.00 ? 123 ARG D NH2 1 
ATOM   6085 N N   . SER D 1 130 ? 42.371  15.097  -49.041 1.00 52.13 ? 124 SER D N   1 
ATOM   6086 C CA  . SER D 1 130 ? 41.635  15.575  -50.207 1.00 51.37 ? 124 SER D CA  1 
ATOM   6087 C C   . SER D 1 130 ? 40.711  16.713  -49.773 1.00 51.52 ? 124 SER D C   1 
ATOM   6088 O O   . SER D 1 130 ? 40.793  17.202  -48.639 1.00 51.46 ? 124 SER D O   1 
ATOM   6089 C CB  . SER D 1 130 ? 40.872  14.412  -50.854 1.00 51.59 ? 124 SER D CB  1 
ATOM   6090 O OG  . SER D 1 130 ? 41.736  13.306  -51.121 1.00 50.42 ? 124 SER D OG  1 
ATOM   6091 N N   . LYS D 1 131 ? 39.864  17.190  -50.664 1.00 51.18 ? 125 LYS D N   1 
ATOM   6092 C CA  . LYS D 1 131 ? 39.039  18.309  -50.275 1.00 51.33 ? 125 LYS D CA  1 
ATOM   6093 C C   . LYS D 1 131 ? 37.724  18.167  -51.007 1.00 51.52 ? 125 LYS D C   1 
ATOM   6094 O O   . LYS D 1 131 ? 37.616  18.519  -52.191 1.00 52.19 ? 125 LYS D O   1 
ATOM   6095 C CB  . LYS D 1 131 ? 39.724  19.658  -50.588 1.00 51.87 ? 125 LYS D CB  1 
ATOM   6096 C CG  . LYS D 1 131 ? 41.263  19.667  -50.541 1.00 50.68 ? 125 LYS D CG  1 
ATOM   6097 C CD  . LYS D 1 131 ? 41.792  20.974  -50.069 1.00 52.16 ? 125 LYS D CD  1 
ATOM   6098 C CE  . LYS D 1 131 ? 41.611  21.129  -48.559 1.00 54.71 ? 125 LYS D CE  1 
ATOM   6099 N NZ  . LYS D 1 131 ? 42.258  22.396  -48.101 1.00 56.11 ? 125 LYS D NZ  1 
ATOM   6100 N N   . PRO D 1 132 ? 36.722  17.618  -50.317 1.00 51.20 ? 126 PRO D N   1 
ATOM   6101 C CA  . PRO D 1 132 ? 35.418  17.385  -50.888 1.00 51.32 ? 126 PRO D CA  1 
ATOM   6102 C C   . PRO D 1 132 ? 34.879  18.627  -51.596 1.00 51.45 ? 126 PRO D C   1 
ATOM   6103 O O   . PRO D 1 132 ? 34.483  18.545  -52.765 1.00 51.67 ? 126 PRO D O   1 
ATOM   6104 C CB  . PRO D 1 132 ? 34.561  17.061  -49.669 1.00 51.48 ? 126 PRO D CB  1 
ATOM   6105 C CG  . PRO D 1 132 ? 35.509  16.493  -48.693 1.00 51.55 ? 126 PRO D CG  1 
ATOM   6106 C CD  . PRO D 1 132 ? 36.807  17.169  -48.920 1.00 51.35 ? 126 PRO D CD  1 
ATOM   6107 N N   . GLY D 1 133 ? 34.888  19.762  -50.896 1.00 51.11 ? 127 GLY D N   1 
ATOM   6108 C CA  . GLY D 1 133 ? 34.264  20.983  -51.384 1.00 50.94 ? 127 GLY D CA  1 
ATOM   6109 C C   . GLY D 1 133 ? 34.654  21.427  -52.784 1.00 50.76 ? 127 GLY D C   1 
ATOM   6110 O O   . GLY D 1 133 ? 33.786  21.792  -53.575 1.00 51.01 ? 127 GLY D O   1 
ATOM   6111 N N   . GLU D 1 134 ? 35.955  21.412  -53.083 1.00 50.51 ? 128 GLU D N   1 
ATOM   6112 C CA  . GLU D 1 134 ? 36.460  21.720  -54.425 1.00 49.90 ? 128 GLU D CA  1 
ATOM   6113 C C   . GLU D 1 134 ? 36.579  20.462  -55.297 1.00 49.67 ? 128 GLU D C   1 
ATOM   6114 O O   . GLU D 1 134 ? 37.063  20.522  -56.445 1.00 49.62 ? 128 GLU D O   1 
ATOM   6115 C CB  . GLU D 1 134 ? 37.823  22.386  -54.345 1.00 50.07 ? 128 GLU D CB  1 
ATOM   6116 C CG  . GLU D 1 134 ? 37.948  23.451  -53.282 1.00 49.76 ? 128 GLU D CG  1 
ATOM   6117 C CD  . GLU D 1 134 ? 39.371  23.885  -53.146 1.00 48.99 ? 128 GLU D CD  1 
ATOM   6118 O OE1 . GLU D 1 134 ? 40.022  24.095  -54.199 1.00 51.88 ? 128 GLU D OE1 1 
ATOM   6119 O OE2 . GLU D 1 134 ? 39.847  23.995  -52.008 1.00 46.73 ? 128 GLU D OE2 1 
ATOM   6120 N N   . GLY D 1 135 ? 36.148  19.331  -54.745 1.00 48.65 ? 129 GLY D N   1 
ATOM   6121 C CA  . GLY D 1 135 ? 36.173  18.090  -55.460 1.00 48.43 ? 129 GLY D CA  1 
ATOM   6122 C C   . GLY D 1 135 ? 37.576  17.615  -55.766 1.00 48.43 ? 129 GLY D C   1 
ATOM   6123 O O   . GLY D 1 135 ? 37.749  16.742  -56.626 1.00 49.20 ? 129 GLY D O   1 
ATOM   6124 N N   . LYS D 1 136 ? 38.574  18.167  -55.066 1.00 47.65 ? 130 LYS D N   1 
ATOM   6125 C CA  . LYS D 1 136 ? 39.980  17.771  -55.233 1.00 46.76 ? 130 LYS D CA  1 
ATOM   6126 C C   . LYS D 1 136 ? 40.370  16.512  -54.470 1.00 46.72 ? 130 LYS D C   1 
ATOM   6127 O O   . LYS D 1 136 ? 40.219  16.451  -53.235 1.00 46.03 ? 130 LYS D O   1 
ATOM   6128 C CB  . LYS D 1 136 ? 40.913  18.878  -54.762 1.00 46.29 ? 130 LYS D CB  1 
ATOM   6129 C CG  . LYS D 1 136 ? 41.259  19.872  -55.795 1.00 46.54 ? 130 LYS D CG  1 
ATOM   6130 C CD  . LYS D 1 136 ? 41.742  21.159  -55.172 1.00 48.91 ? 130 LYS D CD  1 
ATOM   6131 C CE  . LYS D 1 136 ? 41.789  22.259  -56.223 1.00 51.40 ? 130 LYS D CE  1 
ATOM   6132 N NZ  . LYS D 1 136 ? 42.625  23.375  -55.715 1.00 52.96 ? 130 LYS D NZ  1 
ATOM   6133 N N   . LEU D 1 137 ? 40.926  15.548  -55.203 1.00 46.46 ? 131 LEU D N   1 
ATOM   6134 C CA  . LEU D 1 137 ? 41.647  14.445  -54.592 1.00 47.14 ? 131 LEU D CA  1 
ATOM   6135 C C   . LEU D 1 137 ? 43.156  14.641  -54.600 1.00 47.25 ? 131 LEU D C   1 
ATOM   6136 O O   . LEU D 1 137 ? 43.771  14.632  -55.653 1.00 48.04 ? 131 LEU D O   1 
ATOM   6137 C CB  . LEU D 1 137 ? 41.292  13.146  -55.288 1.00 47.58 ? 131 LEU D CB  1 
ATOM   6138 C CG  . LEU D 1 137 ? 39.882  12.878  -54.794 1.00 49.05 ? 131 LEU D CG  1 
ATOM   6139 C CD1 . LEU D 1 137 ? 38.895  12.809  -55.967 1.00 50.14 ? 131 LEU D CD1 1 
ATOM   6140 C CD2 . LEU D 1 137 ? 39.865  11.669  -53.898 1.00 47.73 ? 131 LEU D CD2 1 
ATOM   6141 N N   . ILE D 1 138 ? 43.743  14.824  -53.421 1.00 46.88 ? 132 ILE D N   1 
ATOM   6142 C CA  . ILE D 1 138 ? 45.177  14.934  -53.271 1.00 46.55 ? 132 ILE D CA  1 
ATOM   6143 C C   . ILE D 1 138 ? 45.708  13.585  -52.762 1.00 47.57 ? 132 ILE D C   1 
ATOM   6144 O O   . ILE D 1 138 ? 45.381  13.176  -51.642 1.00 47.28 ? 132 ILE D O   1 
ATOM   6145 C CB  . ILE D 1 138 ? 45.549  16.067  -52.295 1.00 46.18 ? 132 ILE D CB  1 
ATOM   6146 C CG1 . ILE D 1 138 ? 44.972  17.402  -52.777 1.00 45.58 ? 132 ILE D CG1 1 
ATOM   6147 C CG2 . ILE D 1 138 ? 47.041  16.176  -52.160 1.00 44.85 ? 132 ILE D CG2 1 
ATOM   6148 C CD1 . ILE D 1 138 ? 44.673  18.392  -51.661 1.00 41.80 ? 132 ILE D CD1 1 
ATOM   6149 N N   . PHE D 1 139 ? 46.534  12.922  -53.583 1.00 48.12 ? 133 PHE D N   1 
ATOM   6150 C CA  . PHE D 1 139 ? 47.052  11.584  -53.313 1.00 49.13 ? 133 PHE D CA  1 
ATOM   6151 C C   . PHE D 1 139 ? 48.383  11.588  -52.558 1.00 50.25 ? 133 PHE D C   1 
ATOM   6152 O O   . PHE D 1 139 ? 49.101  12.592  -52.595 1.00 50.12 ? 133 PHE D O   1 
ATOM   6153 C CB  . PHE D 1 139 ? 47.209  10.821  -54.636 1.00 49.55 ? 133 PHE D CB  1 
ATOM   6154 C CG  . PHE D 1 139 ? 45.916  10.547  -55.319 1.00 49.28 ? 133 PHE D CG  1 
ATOM   6155 C CD1 . PHE D 1 139 ? 45.351  11.496  -56.167 1.00 48.18 ? 133 PHE D CD1 1 
ATOM   6156 C CD2 . PHE D 1 139 ? 45.235  9.354   -55.079 1.00 48.76 ? 133 PHE D CD2 1 
ATOM   6157 C CE1 . PHE D 1 139 ? 44.129  11.258  -56.766 1.00 49.74 ? 133 PHE D CE1 1 
ATOM   6158 C CE2 . PHE D 1 139 ? 44.006  9.104   -55.676 1.00 48.61 ? 133 PHE D CE2 1 
ATOM   6159 C CZ  . PHE D 1 139 ? 43.452  10.047  -56.523 1.00 49.69 ? 133 PHE D CZ  1 
ATOM   6160 N N   . CYS D 1 140 ? 48.710  10.458  -51.903 1.00 51.23 ? 134 CYS D N   1 
ATOM   6161 C CA  . CYS D 1 140 ? 49.916  10.336  -51.053 1.00 52.41 ? 134 CYS D CA  1 
ATOM   6162 C C   . CYS D 1 140 ? 51.147  10.795  -51.822 1.00 52.80 ? 134 CYS D C   1 
ATOM   6163 O O   . CYS D 1 140 ? 52.047  11.439  -51.255 1.00 52.65 ? 134 CYS D O   1 
ATOM   6164 C CB  . CYS D 1 140 ? 50.135  8.893   -50.541 1.00 52.65 ? 134 CYS D CB  1 
ATOM   6165 S SG  . CYS D 1 140 ? 49.076  8.246   -49.107 1.00 54.30 ? 134 CYS D SG  1 
ATOM   6166 N N   . SER D 1 141 ? 51.149  10.482  -53.123 1.00 53.08 ? 135 SER D N   1 
ATOM   6167 C CA  . SER D 1 141 ? 52.247  10.800  -54.032 1.00 53.08 ? 135 SER D CA  1 
ATOM   6168 C C   . SER D 1 141 ? 52.199  12.249  -54.546 1.00 52.58 ? 135 SER D C   1 
ATOM   6169 O O   . SER D 1 141 ? 52.870  12.595  -55.521 1.00 52.90 ? 135 SER D O   1 
ATOM   6170 C CB  . SER D 1 141 ? 52.213  9.827   -55.212 1.00 53.64 ? 135 SER D CB  1 
ATOM   6171 O OG  . SER D 1 141 ? 51.133  10.142  -56.091 1.00 55.73 ? 135 SER D OG  1 
ATOM   6172 N N   . GLY D 1 142 ? 51.399  13.096  -53.904 1.00 51.80 ? 136 GLY D N   1 
ATOM   6173 C CA  . GLY D 1 142 ? 51.361  14.522  -54.236 1.00 50.43 ? 136 GLY D CA  1 
ATOM   6174 C C   . GLY D 1 142 ? 50.494  14.884  -55.433 1.00 49.75 ? 136 GLY D C   1 
ATOM   6175 O O   . GLY D 1 142 ? 50.273  16.077  -55.699 1.00 49.58 ? 136 GLY D O   1 
ATOM   6176 N N   . LEU D 1 143 ? 49.980  13.874  -56.149 1.00 48.32 ? 137 LEU D N   1 
ATOM   6177 C CA  . LEU D 1 143 ? 49.173  14.134  -57.349 1.00 46.97 ? 137 LEU D CA  1 
ATOM   6178 C C   . LEU D 1 143 ? 47.782  14.691  -57.053 1.00 46.73 ? 137 LEU D C   1 
ATOM   6179 O O   . LEU D 1 143 ? 47.087  14.193  -56.179 1.00 46.61 ? 137 LEU D O   1 
ATOM   6180 C CB  . LEU D 1 143 ? 49.076  12.901  -58.227 1.00 46.37 ? 137 LEU D CB  1 
ATOM   6181 C CG  . LEU D 1 143 ? 48.668  13.151  -59.681 1.00 45.41 ? 137 LEU D CG  1 
ATOM   6182 C CD1 . LEU D 1 143 ? 49.734  13.872  -60.481 1.00 43.44 ? 137 LEU D CD1 1 
ATOM   6183 C CD2 . LEU D 1 143 ? 48.294  11.831  -60.358 1.00 46.17 ? 137 LEU D CD2 1 
ATOM   6184 N N   . VAL D 1 144 ? 47.396  15.742  -57.778 1.00 46.72 ? 138 VAL D N   1 
ATOM   6185 C CA  . VAL D 1 144 ? 46.080  16.363  -57.615 1.00 46.28 ? 138 VAL D CA  1 
ATOM   6186 C C   . VAL D 1 144 ? 45.174  16.109  -58.822 1.00 46.06 ? 138 VAL D C   1 
ATOM   6187 O O   . VAL D 1 144 ? 45.497  16.446  -59.948 1.00 45.48 ? 138 VAL D O   1 
ATOM   6188 C CB  . VAL D 1 144 ? 46.156  17.882  -57.285 1.00 46.27 ? 138 VAL D CB  1 
ATOM   6189 C CG1 . VAL D 1 144 ? 44.820  18.368  -56.706 1.00 46.49 ? 138 VAL D CG1 1 
ATOM   6190 C CG2 . VAL D 1 144 ? 47.263  18.160  -56.294 1.00 46.09 ? 138 VAL D CG2 1 
ATOM   6191 N N   . LEU D 1 145 ? 44.020  15.523  -58.536 1.00 46.38 ? 139 LEU D N   1 
ATOM   6192 C CA  . LEU D 1 145 ? 43.075  15.073  -59.526 1.00 46.38 ? 139 LEU D CA  1 
ATOM   6193 C C   . LEU D 1 145 ? 41.680  15.489  -59.113 1.00 46.82 ? 139 LEU D C   1 
ATOM   6194 O O   . LEU D 1 145 ? 41.324  15.425  -57.924 1.00 47.13 ? 139 LEU D O   1 
ATOM   6195 C CB  . LEU D 1 145 ? 43.140  13.560  -59.608 1.00 46.23 ? 139 LEU D CB  1 
ATOM   6196 C CG  . LEU D 1 145 ? 43.787  12.873  -60.813 1.00 46.62 ? 139 LEU D CG  1 
ATOM   6197 C CD1 . LEU D 1 145 ? 44.913  13.675  -61.467 1.00 44.97 ? 139 LEU D CD1 1 
ATOM   6198 C CD2 . LEU D 1 145 ? 44.245  11.476  -60.425 1.00 45.54 ? 139 LEU D CD2 1 
ATOM   6199 N N   . HIS D 1 146 ? 40.899  15.933  -60.092 1.00 47.20 ? 140 HIS D N   1 
ATOM   6200 C CA  . HIS D 1 146 ? 39.501  16.222  -59.870 1.00 47.88 ? 140 HIS D CA  1 
ATOM   6201 C C   . HIS D 1 146 ? 38.713  14.935  -59.667 1.00 48.31 ? 140 HIS D C   1 
ATOM   6202 O O   . HIS D 1 146 ? 39.021  13.873  -60.239 1.00 47.99 ? 140 HIS D O   1 
ATOM   6203 C CB  . HIS D 1 146 ? 38.907  17.005  -61.050 1.00 48.25 ? 140 HIS D CB  1 
ATOM   6204 C CG  . HIS D 1 146 ? 37.539  17.565  -60.781 1.00 48.88 ? 140 HIS D CG  1 
ATOM   6205 N ND1 . HIS D 1 146 ? 37.332  18.718  -60.049 1.00 49.03 ? 140 HIS D ND1 1 
ATOM   6206 C CD2 . HIS D 1 146 ? 36.310  17.129  -61.146 1.00 49.29 ? 140 HIS D CD2 1 
ATOM   6207 C CE1 . HIS D 1 146 ? 36.036  18.958  -59.958 1.00 48.48 ? 140 HIS D CE1 1 
ATOM   6208 N NE2 . HIS D 1 146 ? 35.394  18.015  -60.625 1.00 49.59 ? 140 HIS D NE2 1 
ATOM   6209 N N   . ARG D 1 147 ? 37.702  15.060  -58.817 1.00 49.32 ? 141 ARG D N   1 
ATOM   6210 C CA  . ARG D 1 147 ? 36.624  14.086  -58.639 1.00 50.02 ? 141 ARG D CA  1 
ATOM   6211 C C   . ARG D 1 147 ? 36.247  13.311  -59.930 1.00 50.28 ? 141 ARG D C   1 
ATOM   6212 O O   . ARG D 1 147 ? 36.193  12.070  -59.937 1.00 51.18 ? 141 ARG D O   1 
ATOM   6213 C CB  . ARG D 1 147 ? 35.409  14.831  -58.089 1.00 49.91 ? 141 ARG D CB  1 
ATOM   6214 C CG  . ARG D 1 147 ? 34.217  13.958  -57.906 1.00 51.26 ? 141 ARG D CG  1 
ATOM   6215 C CD  . ARG D 1 147 ? 32.946  14.719  -57.631 1.00 51.53 ? 141 ARG D CD  1 
ATOM   6216 N NE  . ARG D 1 147 ? 31.853  13.793  -57.889 1.00 53.66 ? 141 ARG D NE  1 
ATOM   6217 C CZ  . ARG D 1 147 ? 30.921  13.950  -58.818 1.00 54.16 ? 141 ARG D CZ  1 
ATOM   6218 N NH1 . ARG D 1 147 ? 30.879  15.045  -59.573 1.00 56.87 ? 141 ARG D NH1 1 
ATOM   6219 N NH2 . ARG D 1 147 ? 30.001  13.017  -58.966 1.00 54.71 ? 141 ARG D NH2 1 
ATOM   6220 N N   . LEU D 1 148 ? 36.014  14.041  -61.019 1.00 49.70 ? 142 LEU D N   1 
ATOM   6221 C CA  . LEU D 1 148 ? 35.591  13.430  -62.275 1.00 49.00 ? 142 LEU D CA  1 
ATOM   6222 C C   . LEU D 1 148 ? 36.720  12.858  -63.135 1.00 48.53 ? 142 LEU D C   1 
ATOM   6223 O O   . LEU D 1 148 ? 36.470  12.190  -64.108 1.00 48.34 ? 142 LEU D O   1 
ATOM   6224 C CB  . LEU D 1 148 ? 34.732  14.412  -63.083 1.00 48.66 ? 142 LEU D CB  1 
ATOM   6225 C CG  . LEU D 1 148 ? 33.398  14.765  -62.411 1.00 49.42 ? 142 LEU D CG  1 
ATOM   6226 C CD1 . LEU D 1 148 ? 32.692  15.853  -63.192 1.00 50.71 ? 142 LEU D CD1 1 
ATOM   6227 C CD2 . LEU D 1 148 ? 32.466  13.552  -62.203 1.00 48.15 ? 142 LEU D CD2 1 
ATOM   6228 N N   . GLN D 1 149 ? 37.965  13.137  -62.808 1.00 48.76 ? 143 GLN D N   1 
ATOM   6229 C CA  . GLN D 1 149 ? 39.042  12.562  -63.593 1.00 49.06 ? 143 GLN D CA  1 
ATOM   6230 C C   . GLN D 1 149 ? 39.349  11.186  -63.049 1.00 49.62 ? 143 GLN D C   1 
ATOM   6231 O O   . GLN D 1 149 ? 39.890  10.349  -63.753 1.00 48.85 ? 143 GLN D O   1 
ATOM   6232 C CB  . GLN D 1 149 ? 40.280  13.423  -63.499 1.00 48.86 ? 143 GLN D CB  1 
ATOM   6233 C CG  . GLN D 1 149 ? 40.250  14.625  -64.374 1.00 48.63 ? 143 GLN D CG  1 
ATOM   6234 C CD  . GLN D 1 149 ? 41.377  15.571  -64.030 1.00 50.18 ? 143 GLN D CD  1 
ATOM   6235 O OE1 . GLN D 1 149 ? 41.345  16.268  -62.992 1.00 49.16 ? 143 GLN D OE1 1 
ATOM   6236 N NE2 . GLN D 1 149 ? 42.389  15.613  -64.899 1.00 49.31 ? 143 GLN D NE2 1 
ATOM   6237 N N   . CYS D 1 150 ? 38.987  11.003  -61.778 1.00 50.61 ? 144 CYS D N   1 
ATOM   6238 C CA  . CYS D 1 150 ? 39.189  9.802   -60.989 1.00 51.85 ? 144 CYS D CA  1 
ATOM   6239 C C   . CYS D 1 150 ? 38.150  8.699   -61.243 1.00 51.95 ? 144 CYS D C   1 
ATOM   6240 O O   . CYS D 1 150 ? 38.444  7.495   -61.099 1.00 50.71 ? 144 CYS D O   1 
ATOM   6241 C CB  . CYS D 1 150 ? 39.119  10.207  -59.529 1.00 51.89 ? 144 CYS D CB  1 
ATOM   6242 S SG  . CYS D 1 150 ? 40.520  11.187  -59.034 1.00 57.34 ? 144 CYS D SG  1 
ATOM   6243 N N   . ALA D 1 151 ? 36.927  9.134   -61.568 1.00 52.64 ? 145 ALA D N   1 
ATOM   6244 C CA  . ALA D 1 151 ? 35.861  8.247   -62.037 1.00 53.30 ? 145 ALA D CA  1 
ATOM   6245 C C   . ALA D 1 151 ? 36.382  7.228   -63.072 1.00 53.73 ? 145 ALA D C   1 
ATOM   6246 O O   . ALA D 1 151 ? 36.138  6.032   -62.933 1.00 53.90 ? 145 ALA D O   1 
ATOM   6247 C CB  . ALA D 1 151 ? 34.693  9.049   -62.597 1.00 52.71 ? 145 ALA D CB  1 
ATOM   6248 N N   . ARG D 1 152 ? 37.136  7.677   -64.070 1.00 54.06 ? 146 ARG D N   1 
ATOM   6249 C CA  . ARG D 1 152 ? 37.654  6.751   -65.071 1.00 54.88 ? 146 ARG D CA  1 
ATOM   6250 C C   . ARG D 1 152 ? 38.379  5.546   -64.446 1.00 55.17 ? 146 ARG D C   1 
ATOM   6251 O O   . ARG D 1 152 ? 38.196  4.409   -64.879 1.00 54.89 ? 146 ARG D O   1 
ATOM   6252 C CB  . ARG D 1 152 ? 38.562  7.474   -66.056 1.00 55.20 ? 146 ARG D CB  1 
ATOM   6253 C CG  . ARG D 1 152 ? 37.854  8.481   -66.916 1.00 57.05 ? 146 ARG D CG  1 
ATOM   6254 C CD  . ARG D 1 152 ? 38.560  8.602   -68.262 1.00 62.60 ? 146 ARG D CD  1 
ATOM   6255 N NE  . ARG D 1 152 ? 37.620  8.354   -69.361 1.00 65.61 ? 146 ARG D NE  1 
ATOM   6256 C CZ  . ARG D 1 152 ? 37.945  7.784   -70.516 1.00 66.12 ? 146 ARG D CZ  1 
ATOM   6257 N NH1 . ARG D 1 152 ? 39.201  7.405   -70.742 1.00 66.77 ? 146 ARG D NH1 1 
ATOM   6258 N NH2 . ARG D 1 152 ? 37.006  7.585   -71.439 1.00 66.40 ? 146 ARG D NH2 1 
ATOM   6259 N N   . GLY D 1 153 ? 39.170  5.795   -63.406 1.00 55.42 ? 147 GLY D N   1 
ATOM   6260 C CA  . GLY D 1 153 ? 39.988  4.745   -62.811 1.00 55.64 ? 147 GLY D CA  1 
ATOM   6261 C C   . GLY D 1 153 ? 39.386  4.008   -61.628 1.00 56.09 ? 147 GLY D C   1 
ATOM   6262 O O   . GLY D 1 153 ? 39.484  2.782   -61.546 1.00 56.80 ? 147 GLY D O   1 
ATOM   6263 N N   . PHE D 1 154 ? 38.774  4.743   -60.707 1.00 55.88 ? 148 PHE D N   1 
ATOM   6264 C CA  . PHE D 1 154 ? 38.258  4.163   -59.469 1.00 55.60 ? 148 PHE D CA  1 
ATOM   6265 C C   . PHE D 1 154 ? 36.817  3.743   -59.656 1.00 55.06 ? 148 PHE D C   1 
ATOM   6266 O O   . PHE D 1 154 ? 36.329  2.832   -59.003 1.00 55.12 ? 148 PHE D O   1 
ATOM   6267 C CB  . PHE D 1 154 ? 38.320  5.196   -58.329 1.00 56.41 ? 148 PHE D CB  1 
ATOM   6268 C CG  . PHE D 1 154 ? 39.723  5.633   -57.949 1.00 57.98 ? 148 PHE D CG  1 
ATOM   6269 C CD1 . PHE D 1 154 ? 40.533  6.334   -58.853 1.00 60.89 ? 148 PHE D CD1 1 
ATOM   6270 C CD2 . PHE D 1 154 ? 40.226  5.369   -56.678 1.00 59.00 ? 148 PHE D CD2 1 
ATOM   6271 C CE1 . PHE D 1 154 ? 41.836  6.731   -58.508 1.00 60.49 ? 148 PHE D CE1 1 
ATOM   6272 C CE2 . PHE D 1 154 ? 41.518  5.771   -56.323 1.00 59.59 ? 148 PHE D CE2 1 
ATOM   6273 C CZ  . PHE D 1 154 ? 42.322  6.449   -57.238 1.00 58.83 ? 148 PHE D CZ  1 
ATOM   6274 N N   . GLY D 1 155 ? 36.119  4.433   -60.541 1.00 54.70 ? 149 GLY D N   1 
ATOM   6275 C CA  . GLY D 1 155 ? 34.681  4.273   -60.638 1.00 54.93 ? 149 GLY D CA  1 
ATOM   6276 C C   . GLY D 1 155 ? 33.987  4.955   -59.473 1.00 55.16 ? 149 GLY D C   1 
ATOM   6277 O O   . GLY D 1 155 ? 34.607  5.729   -58.742 1.00 55.33 ? 149 GLY D O   1 
ATOM   6278 N N   . ASP D 1 156 ? 32.694  4.665   -59.313 1.00 55.15 ? 150 ASP D N   1 
ATOM   6279 C CA  . ASP D 1 156 ? 31.875  5.092   -58.171 1.00 54.79 ? 150 ASP D CA  1 
ATOM   6280 C C   . ASP D 1 156 ? 32.592  5.098   -56.799 1.00 53.89 ? 150 ASP D C   1 
ATOM   6281 O O   . ASP D 1 156 ? 32.216  5.864   -55.902 1.00 54.22 ? 150 ASP D O   1 
ATOM   6282 C CB  . ASP D 1 156 ? 30.621  4.209   -58.095 1.00 55.25 ? 150 ASP D CB  1 
ATOM   6283 C CG  . ASP D 1 156 ? 29.633  4.494   -59.218 1.00 57.87 ? 150 ASP D CG  1 
ATOM   6284 O OD1 . ASP D 1 156 ? 29.227  5.667   -59.390 1.00 61.37 ? 150 ASP D OD1 1 
ATOM   6285 O OD2 . ASP D 1 156 ? 29.242  3.548   -59.934 1.00 59.84 ? 150 ASP D OD2 1 
ATOM   6286 N N   . TRP D 1 157 ? 33.612  4.256   -56.641 1.00 52.39 ? 151 TRP D N   1 
ATOM   6287 C CA  . TRP D 1 157 ? 34.323  4.122   -55.367 1.00 51.39 ? 151 TRP D CA  1 
ATOM   6288 C C   . TRP D 1 157 ? 34.887  5.445   -54.860 1.00 51.38 ? 151 TRP D C   1 
ATOM   6289 O O   . TRP D 1 157 ? 34.943  5.691   -53.650 1.00 51.59 ? 151 TRP D O   1 
ATOM   6290 C CB  . TRP D 1 157 ? 35.437  3.097   -55.507 1.00 50.64 ? 151 TRP D CB  1 
ATOM   6291 C CG  . TRP D 1 157 ? 36.207  2.853   -54.265 1.00 50.45 ? 151 TRP D CG  1 
ATOM   6292 C CD1 . TRP D 1 157 ? 35.743  2.913   -52.981 1.00 49.64 ? 151 TRP D CD1 1 
ATOM   6293 C CD2 . TRP D 1 157 ? 37.597  2.498   -54.177 1.00 49.33 ? 151 TRP D CD2 1 
ATOM   6294 N NE1 . TRP D 1 157 ? 36.768  2.626   -52.101 1.00 49.34 ? 151 TRP D NE1 1 
ATOM   6295 C CE2 . TRP D 1 157 ? 37.911  2.374   -52.808 1.00 47.46 ? 151 TRP D CE2 1 
ATOM   6296 C CE3 . TRP D 1 157 ? 38.598  2.274   -55.123 1.00 48.46 ? 151 TRP D CE3 1 
ATOM   6297 C CZ2 . TRP D 1 157 ? 39.169  2.022   -52.363 1.00 48.07 ? 151 TRP D CZ2 1 
ATOM   6298 C CZ3 . TRP D 1 157 ? 39.852  1.936   -54.677 1.00 49.52 ? 151 TRP D CZ3 1 
ATOM   6299 C CH2 . TRP D 1 157 ? 40.128  1.808   -53.305 1.00 48.82 ? 151 TRP D CH2 1 
ATOM   6300 N N   . ILE D 1 158 ? 35.288  6.295   -55.795 1.00 51.11 ? 152 ILE D N   1 
ATOM   6301 C CA  . ILE D 1 158 ? 35.760  7.620   -55.472 1.00 51.15 ? 152 ILE D CA  1 
ATOM   6302 C C   . ILE D 1 158 ? 34.653  8.584   -54.979 1.00 51.02 ? 152 ILE D C   1 
ATOM   6303 O O   . ILE D 1 158 ? 34.922  9.507   -54.215 1.00 51.07 ? 152 ILE D O   1 
ATOM   6304 C CB  . ILE D 1 158 ? 36.589  8.222   -56.640 1.00 51.35 ? 152 ILE D CB  1 
ATOM   6305 C CG1 . ILE D 1 158 ? 37.572  9.280   -56.121 1.00 50.97 ? 152 ILE D CG1 1 
ATOM   6306 C CG2 . ILE D 1 158 ? 35.694  8.712   -57.787 1.00 51.95 ? 152 ILE D CG2 1 
ATOM   6307 C CD1 . ILE D 1 158 ? 38.924  8.665   -55.673 1.00 51.53 ? 152 ILE D CD1 1 
ATOM   6308 N N   . ASP D 1 159 ? 33.406  8.395   -55.364 1.00 50.67 ? 153 ASP D N   1 
ATOM   6309 C CA  . ASP D 1 159 ? 32.424  9.253   -54.712 1.00 50.94 ? 153 ASP D CA  1 
ATOM   6310 C C   . ASP D 1 159 ? 32.152  8.834   -53.250 1.00 50.24 ? 153 ASP D C   1 
ATOM   6311 O O   . ASP D 1 159 ? 32.023  9.682   -52.357 1.00 49.23 ? 153 ASP D O   1 
ATOM   6312 C CB  . ASP D 1 159 ? 31.172  9.458   -55.566 1.00 51.39 ? 153 ASP D CB  1 
ATOM   6313 C CG  . ASP D 1 159 ? 31.427  10.404  -56.767 1.00 53.66 ? 153 ASP D CG  1 
ATOM   6314 O OD1 . ASP D 1 159 ? 32.566  10.909  -56.951 1.00 56.37 ? 153 ASP D OD1 1 
ATOM   6315 O OD2 . ASP D 1 159 ? 30.490  10.633  -57.557 1.00 55.44 ? 153 ASP D OD2 1 
ATOM   6316 N N   . SER D 1 160 ? 32.129  7.519   -53.019 1.00 49.65 ? 154 SER D N   1 
ATOM   6317 C CA  . SER D 1 160 ? 32.041  6.951   -51.660 1.00 48.87 ? 154 SER D CA  1 
ATOM   6318 C C   . SER D 1 160 ? 33.147  7.475   -50.744 1.00 48.37 ? 154 SER D C   1 
ATOM   6319 O O   . SER D 1 160 ? 32.886  7.849   -49.611 1.00 47.71 ? 154 SER D O   1 
ATOM   6320 C CB  . SER D 1 160 ? 32.103  5.418   -51.703 1.00 48.65 ? 154 SER D CB  1 
ATOM   6321 O OG  . SER D 1 160 ? 30.968  4.870   -52.331 1.00 47.56 ? 154 SER D OG  1 
ATOM   6322 N N   . ILE D 1 161 ? 34.376  7.475   -51.248 1.00 48.43 ? 155 ILE D N   1 
ATOM   6323 C CA  . ILE D 1 161 ? 35.518  8.030   -50.519 1.00 48.64 ? 155 ILE D CA  1 
ATOM   6324 C C   . ILE D 1 161 ? 35.377  9.530   -50.278 1.00 48.42 ? 155 ILE D C   1 
ATOM   6325 O O   . ILE D 1 161 ? 35.616  10.007  -49.180 1.00 48.42 ? 155 ILE D O   1 
ATOM   6326 C CB  . ILE D 1 161 ? 36.857  7.737   -51.240 1.00 48.78 ? 155 ILE D CB  1 
ATOM   6327 C CG1 . ILE D 1 161 ? 37.074  6.226   -51.325 1.00 48.10 ? 155 ILE D CG1 1 
ATOM   6328 C CG2 . ILE D 1 161 ? 38.031  8.422   -50.517 1.00 47.70 ? 155 ILE D CG2 1 
ATOM   6329 C CD1 . ILE D 1 161 ? 38.062  5.840   -52.363 1.00 48.71 ? 155 ILE D CD1 1 
ATOM   6330 N N   . LEU D 1 162 ? 34.978  10.267  -51.299 1.00 48.29 ? 156 LEU D N   1 
ATOM   6331 C CA  . LEU D 1 162 ? 34.716  11.669  -51.112 1.00 48.26 ? 156 LEU D CA  1 
ATOM   6332 C C   . LEU D 1 162 ? 33.670  11.919  -50.041 1.00 48.36 ? 156 LEU D C   1 
ATOM   6333 O O   . LEU D 1 162 ? 33.854  12.798  -49.211 1.00 49.16 ? 156 LEU D O   1 
ATOM   6334 C CB  . LEU D 1 162 ? 34.330  12.339  -52.427 1.00 48.26 ? 156 LEU D CB  1 
ATOM   6335 C CG  . LEU D 1 162 ? 35.465  12.841  -53.336 1.00 48.03 ? 156 LEU D CG  1 
ATOM   6336 C CD1 . LEU D 1 162 ? 34.888  13.613  -54.510 1.00 46.29 ? 156 LEU D CD1 1 
ATOM   6337 C CD2 . LEU D 1 162 ? 36.472  13.723  -52.590 1.00 49.40 ? 156 LEU D CD2 1 
ATOM   6338 N N   . ALA D 1 163 ? 32.599  11.133  -50.039 1.00 48.86 ? 157 ALA D N   1 
ATOM   6339 C CA  . ALA D 1 163 ? 31.503  11.246  -49.044 1.00 49.37 ? 157 ALA D CA  1 
ATOM   6340 C C   . ALA D 1 163 ? 31.974  11.039  -47.609 1.00 49.88 ? 157 ALA D C   1 
ATOM   6341 O O   . ALA D 1 163 ? 31.505  11.718  -46.680 1.00 50.42 ? 157 ALA D O   1 
ATOM   6342 C CB  . ALA D 1 163 ? 30.383  10.250  -49.362 1.00 49.11 ? 157 ALA D CB  1 
ATOM   6343 N N   . PHE D 1 164 ? 32.885  10.081  -47.451 1.00 50.29 ? 158 PHE D N   1 
ATOM   6344 C CA  . PHE D 1 164 ? 33.572  9.788   -46.201 1.00 50.68 ? 158 PHE D CA  1 
ATOM   6345 C C   . PHE D 1 164 ? 34.456  10.964  -45.763 1.00 50.84 ? 158 PHE D C   1 
ATOM   6346 O O   . PHE D 1 164 ? 34.445  11.389  -44.607 1.00 50.57 ? 158 PHE D O   1 
ATOM   6347 C CB  . PHE D 1 164 ? 34.400  8.517   -46.388 1.00 50.63 ? 158 PHE D CB  1 
ATOM   6348 C CG  . PHE D 1 164 ? 35.162  8.114   -45.185 1.00 50.82 ? 158 PHE D CG  1 
ATOM   6349 C CD1 . PHE D 1 164 ? 34.613  7.255   -44.266 1.00 52.83 ? 158 PHE D CD1 1 
ATOM   6350 C CD2 . PHE D 1 164 ? 36.444  8.594   -44.970 1.00 52.44 ? 158 PHE D CD2 1 
ATOM   6351 C CE1 . PHE D 1 164 ? 35.341  6.863   -43.130 1.00 55.45 ? 158 PHE D CE1 1 
ATOM   6352 C CE2 . PHE D 1 164 ? 37.183  8.234   -43.841 1.00 53.22 ? 158 PHE D CE2 1 
ATOM   6353 C CZ  . PHE D 1 164 ? 36.640  7.377   -42.913 1.00 53.19 ? 158 PHE D CZ  1 
ATOM   6354 N N   . SER D 1 165 ? 35.233  11.476  -46.704 1.00 51.62 ? 159 SER D N   1 
ATOM   6355 C CA  . SER D 1 165 ? 36.040  12.671  -46.487 1.00 52.26 ? 159 SER D CA  1 
ATOM   6356 C C   . SER D 1 165 ? 35.191  13.857  -46.049 1.00 52.78 ? 159 SER D C   1 
ATOM   6357 O O   . SER D 1 165 ? 35.617  14.659  -45.206 1.00 52.36 ? 159 SER D O   1 
ATOM   6358 C CB  . SER D 1 165 ? 36.785  13.035  -47.753 1.00 51.70 ? 159 SER D CB  1 
ATOM   6359 O OG  . SER D 1 165 ? 37.650  14.110  -47.477 1.00 53.20 ? 159 SER D OG  1 
ATOM   6360 N N   . ARG D 1 166 ? 33.993  13.971  -46.621 1.00 53.44 ? 160 ARG D N   1 
ATOM   6361 C CA  . ARG D 1 166 ? 33.064  14.992  -46.170 1.00 54.51 ? 160 ARG D CA  1 
ATOM   6362 C C   . ARG D 1 166 ? 32.784  14.809  -44.671 1.00 54.27 ? 160 ARG D C   1 
ATOM   6363 O O   . ARG D 1 166 ? 33.043  15.707  -43.861 1.00 54.18 ? 160 ARG D O   1 
ATOM   6364 C CB  . ARG D 1 166 ? 31.787  15.018  -47.026 1.00 54.23 ? 160 ARG D CB  1 
ATOM   6365 C CG  . ARG D 1 166 ? 31.396  16.451  -47.425 1.00 55.40 ? 160 ARG D CG  1 
ATOM   6366 C CD  . ARG D 1 166 ? 30.154  16.516  -48.286 1.00 56.03 ? 160 ARG D CD  1 
ATOM   6367 N NE  . ARG D 1 166 ? 30.441  16.367  -49.718 1.00 60.13 ? 160 ARG D NE  1 
ATOM   6368 C CZ  . ARG D 1 166 ? 30.220  15.255  -50.427 1.00 62.57 ? 160 ARG D CZ  1 
ATOM   6369 N NH1 . ARG D 1 166 ? 29.714  14.168  -49.834 1.00 63.64 ? 160 ARG D NH1 1 
ATOM   6370 N NH2 . ARG D 1 166 ? 30.500  15.220  -51.735 1.00 61.87 ? 160 ARG D NH2 1 
ATOM   6371 N N   . SER D 1 167 ? 32.320  13.621  -44.320 1.00 54.70 ? 161 SER D N   1 
ATOM   6372 C CA  . SER D 1 167 ? 32.065  13.221  -42.940 1.00 55.37 ? 161 SER D CA  1 
ATOM   6373 C C   . SER D 1 167 ? 33.162  13.532  -41.900 1.00 55.94 ? 161 SER D C   1 
ATOM   6374 O O   . SER D 1 167 ? 32.865  14.111  -40.839 1.00 56.22 ? 161 SER D O   1 
ATOM   6375 C CB  . SER D 1 167 ? 31.777  11.731  -42.924 1.00 55.27 ? 161 SER D CB  1 
ATOM   6376 O OG  . SER D 1 167 ? 31.164  11.365  -41.707 1.00 56.05 ? 161 SER D OG  1 
ATOM   6377 N N   . LEU D 1 168 ? 34.401  13.116  -42.189 1.00 56.29 ? 162 LEU D N   1 
ATOM   6378 C CA  . LEU D 1 168 ? 35.587  13.440  -41.381 1.00 56.71 ? 162 LEU D CA  1 
ATOM   6379 C C   . LEU D 1 168 ? 35.806  14.924  -41.131 1.00 57.58 ? 162 LEU D C   1 
ATOM   6380 O O   . LEU D 1 168 ? 35.897  15.349  -39.975 1.00 58.10 ? 162 LEU D O   1 
ATOM   6381 C CB  . LEU D 1 168 ? 36.844  12.940  -42.064 1.00 56.41 ? 162 LEU D CB  1 
ATOM   6382 C CG  . LEU D 1 168 ? 37.467  11.617  -41.692 1.00 55.95 ? 162 LEU D CG  1 
ATOM   6383 C CD1 . LEU D 1 168 ? 38.636  11.420  -42.642 1.00 54.34 ? 162 LEU D CD1 1 
ATOM   6384 C CD2 . LEU D 1 168 ? 37.915  11.591  -40.226 1.00 54.57 ? 162 LEU D CD2 1 
ATOM   6385 N N   . HIS D 1 169 ? 35.934  15.705  -42.206 1.00 58.27 ? 163 HIS D N   1 
ATOM   6386 C CA  . HIS D 1 169 ? 36.154  17.154  -42.077 1.00 59.22 ? 163 HIS D CA  1 
ATOM   6387 C C   . HIS D 1 169 ? 35.130  17.820  -41.159 1.00 59.79 ? 163 HIS D C   1 
ATOM   6388 O O   . HIS D 1 169 ? 35.501  18.606  -40.280 1.00 59.86 ? 163 HIS D O   1 
ATOM   6389 C CB  . HIS D 1 169 ? 36.234  17.851  -43.441 1.00 58.88 ? 163 HIS D CB  1 
ATOM   6390 C CG  . HIS D 1 169 ? 37.373  17.368  -44.282 1.00 59.78 ? 163 HIS D CG  1 
ATOM   6391 N ND1 . HIS D 1 169 ? 38.639  17.165  -43.774 1.00 60.44 ? 163 HIS D ND1 1 
ATOM   6392 C CD2 . HIS D 1 169 ? 37.437  17.027  -45.591 1.00 60.44 ? 163 HIS D CD2 1 
ATOM   6393 C CE1 . HIS D 1 169 ? 39.433  16.717  -44.730 1.00 59.70 ? 163 HIS D CE1 1 
ATOM   6394 N NE2 . HIS D 1 169 ? 38.728  16.624  -45.843 1.00 60.74 ? 163 HIS D NE2 1 
ATOM   6395 N N   . SER D 1 170 ? 33.857  17.474  -41.339 1.00 60.44 ? 164 SER D N   1 
ATOM   6396 C CA  . SER D 1 170 ? 32.798  17.927  -40.427 1.00 61.11 ? 164 SER D CA  1 
ATOM   6397 C C   . SER D 1 170 ? 33.211  17.847  -38.958 1.00 61.48 ? 164 SER D C   1 
ATOM   6398 O O   . SER D 1 170 ? 32.887  18.745  -38.169 1.00 61.52 ? 164 SER D O   1 
ATOM   6399 C CB  . SER D 1 170 ? 31.524  17.114  -40.644 1.00 61.04 ? 164 SER D CB  1 
ATOM   6400 O OG  . SER D 1 170 ? 31.011  16.661  -39.406 1.00 60.99 ? 164 SER D OG  1 
ATOM   6401 N N   . LEU D 1 171 ? 33.925  16.769  -38.618 1.00 61.75 ? 165 LEU D N   1 
ATOM   6402 C CA  . LEU D 1 171 ? 34.394  16.492  -37.261 1.00 62.00 ? 165 LEU D CA  1 
ATOM   6403 C C   . LEU D 1 171 ? 35.477  17.427  -36.747 1.00 62.23 ? 165 LEU D C   1 
ATOM   6404 O O   . LEU D 1 171 ? 35.718  17.487  -35.550 1.00 62.23 ? 165 LEU D O   1 
ATOM   6405 C CB  . LEU D 1 171 ? 34.924  15.065  -37.180 1.00 62.09 ? 165 LEU D CB  1 
ATOM   6406 C CG  . LEU D 1 171 ? 34.067  13.971  -36.557 1.00 62.14 ? 165 LEU D CG  1 
ATOM   6407 C CD1 . LEU D 1 171 ? 32.631  13.980  -37.092 1.00 62.05 ? 165 LEU D CD1 1 
ATOM   6408 C CD2 . LEU D 1 171 ? 34.763  12.626  -36.785 1.00 61.70 ? 165 LEU D CD2 1 
ATOM   6409 N N   . LEU D 1 172 ? 36.129  18.156  -37.648 1.00 62.81 ? 166 LEU D N   1 
ATOM   6410 C CA  . LEU D 1 172 ? 37.252  19.038  -37.289 1.00 62.96 ? 166 LEU D CA  1 
ATOM   6411 C C   . LEU D 1 172 ? 38.243  18.231  -36.479 1.00 63.10 ? 166 LEU D C   1 
ATOM   6412 O O   . LEU D 1 172 ? 38.520  18.552  -35.327 1.00 63.40 ? 166 LEU D O   1 
ATOM   6413 C CB  . LEU D 1 172 ? 36.791  20.293  -36.516 1.00 62.86 ? 166 LEU D CB  1 
ATOM   6414 C CG  . LEU D 1 172 ? 35.521  21.068  -36.915 1.00 62.35 ? 166 LEU D CG  1 
ATOM   6415 C CD1 . LEU D 1 172 ? 35.133  22.049  -35.796 1.00 62.77 ? 166 LEU D CD1 1 
ATOM   6416 C CD2 . LEU D 1 172 ? 35.645  21.788  -38.259 1.00 60.38 ? 166 LEU D CD2 1 
ATOM   6417 N N   . VAL D 1 173 ? 38.729  17.154  -37.094 1.00 63.73 ? 167 VAL D N   1 
ATOM   6418 C CA  . VAL D 1 173 ? 39.679  16.227  -36.480 1.00 64.20 ? 167 VAL D CA  1 
ATOM   6419 C C   . VAL D 1 173 ? 41.061  16.801  -36.668 1.00 64.79 ? 167 VAL D C   1 
ATOM   6420 O O   . VAL D 1 173 ? 41.609  16.773  -37.778 1.00 65.04 ? 167 VAL D O   1 
ATOM   6421 C CB  . VAL D 1 173 ? 39.603  14.797  -37.098 1.00 64.16 ? 167 VAL D CB  1 
ATOM   6422 C CG1 . VAL D 1 173 ? 40.781  13.937  -36.659 1.00 63.74 ? 167 VAL D CG1 1 
ATOM   6423 C CG2 . VAL D 1 173 ? 38.300  14.119  -36.714 1.00 64.04 ? 167 VAL D CG2 1 
ATOM   6424 N N   . ASP D 1 174 ? 41.608  17.347  -35.584 1.00 65.10 ? 168 ASP D N   1 
ATOM   6425 C CA  . ASP D 1 174 ? 42.923  17.964  -35.633 1.00 65.42 ? 168 ASP D CA  1 
ATOM   6426 C C   . ASP D 1 174 ? 44.072  16.966  -35.881 1.00 65.40 ? 168 ASP D C   1 
ATOM   6427 O O   . ASP D 1 174 ? 43.948  15.748  -35.691 1.00 65.16 ? 168 ASP D O   1 
ATOM   6428 C CB  . ASP D 1 174 ? 43.177  18.864  -34.407 1.00 65.50 ? 168 ASP D CB  1 
ATOM   6429 C CG  . ASP D 1 174 ? 43.089  18.118  -33.084 1.00 66.51 ? 168 ASP D CG  1 
ATOM   6430 O OD1 . ASP D 1 174 ? 43.893  18.446  -32.187 1.00 66.80 ? 168 ASP D OD1 1 
ATOM   6431 O OD2 . ASP D 1 174 ? 42.219  17.221  -32.924 1.00 68.47 ? 168 ASP D OD2 1 
ATOM   6432 N N   . VAL D 1 175 ? 45.185  17.529  -36.331 1.00 65.57 ? 169 VAL D N   1 
ATOM   6433 C CA  . VAL D 1 175 ? 46.385  16.798  -36.723 1.00 65.37 ? 169 VAL D CA  1 
ATOM   6434 C C   . VAL D 1 175 ? 46.800  15.702  -35.722 1.00 64.91 ? 169 VAL D C   1 
ATOM   6435 O O   . VAL D 1 175 ? 46.974  14.535  -36.100 1.00 64.47 ? 169 VAL D O   1 
ATOM   6436 C CB  . VAL D 1 175 ? 47.565  17.799  -36.925 1.00 65.43 ? 169 VAL D CB  1 
ATOM   6437 C CG1 . VAL D 1 175 ? 48.751  17.115  -37.610 1.00 65.10 ? 169 VAL D CG1 1 
ATOM   6438 C CG2 . VAL D 1 175 ? 47.091  19.050  -37.695 1.00 64.98 ? 169 VAL D CG2 1 
ATOM   6439 N N   . PRO D 1 176 ? 46.961  16.080  -34.444 1.00 64.57 ? 170 PRO D N   1 
ATOM   6440 C CA  . PRO D 1 176 ? 47.509  15.102  -33.512 1.00 64.36 ? 170 PRO D CA  1 
ATOM   6441 C C   . PRO D 1 176 ? 46.583  13.900  -33.388 1.00 63.91 ? 170 PRO D C   1 
ATOM   6442 O O   . PRO D 1 176 ? 47.005  12.771  -33.642 1.00 63.58 ? 170 PRO D O   1 
ATOM   6443 C CB  . PRO D 1 176 ? 47.598  15.884  -32.192 1.00 64.69 ? 170 PRO D CB  1 
ATOM   6444 C CG  . PRO D 1 176 ? 47.494  17.341  -32.584 1.00 64.80 ? 170 PRO D CG  1 
ATOM   6445 C CD  . PRO D 1 176 ? 46.640  17.361  -33.787 1.00 64.41 ? 170 PRO D CD  1 
ATOM   6446 N N   . ALA D 1 177 ? 45.332  14.169  -33.019 1.00 63.41 ? 171 ALA D N   1 
ATOM   6447 C CA  . ALA D 1 177 ? 44.249  13.191  -33.050 1.00 63.19 ? 171 ALA D CA  1 
ATOM   6448 C C   . ALA D 1 177 ? 44.346  12.236  -34.252 1.00 62.94 ? 171 ALA D C   1 
ATOM   6449 O O   . ALA D 1 177 ? 44.279  10.995  -34.094 1.00 63.35 ? 171 ALA D O   1 
ATOM   6450 C CB  . ALA D 1 177 ? 42.895  13.913  -33.045 1.00 63.07 ? 171 ALA D CB  1 
ATOM   6451 N N   . PHE D 1 178 ? 44.504  12.809  -35.447 1.00 62.03 ? 172 PHE D N   1 
ATOM   6452 C CA  . PHE D 1 178 ? 44.598  12.000  -36.662 1.00 61.35 ? 172 PHE D CA  1 
ATOM   6453 C C   . PHE D 1 178 ? 45.857  11.137  -36.643 1.00 61.45 ? 172 PHE D C   1 
ATOM   6454 O O   . PHE D 1 178 ? 45.825  9.968   -37.044 1.00 61.33 ? 172 PHE D O   1 
ATOM   6455 C CB  . PHE D 1 178 ? 44.542  12.860  -37.928 1.00 60.35 ? 172 PHE D CB  1 
ATOM   6456 C CG  . PHE D 1 178 ? 44.500  12.059  -39.191 1.00 59.63 ? 172 PHE D CG  1 
ATOM   6457 C CD1 . PHE D 1 178 ? 43.288  11.658  -39.736 1.00 57.25 ? 172 PHE D CD1 1 
ATOM   6458 C CD2 . PHE D 1 178 ? 45.676  11.676  -39.833 1.00 58.75 ? 172 PHE D CD2 1 
ATOM   6459 C CE1 . PHE D 1 178 ? 43.251  10.919  -40.901 1.00 54.41 ? 172 PHE D CE1 1 
ATOM   6460 C CE2 . PHE D 1 178 ? 45.634  10.923  -40.997 1.00 56.06 ? 172 PHE D CE2 1 
ATOM   6461 C CZ  . PHE D 1 178 ? 44.424  10.549  -41.525 1.00 55.82 ? 172 PHE D CZ  1 
ATOM   6462 N N   . ALA D 1 179 ? 46.951  11.725  -36.159 1.00 61.76 ? 173 ALA D N   1 
ATOM   6463 C CA  . ALA D 1 179 ? 48.221  11.027  -36.005 1.00 61.85 ? 173 ALA D CA  1 
ATOM   6464 C C   . ALA D 1 179 ? 48.003  9.651   -35.373 1.00 61.88 ? 173 ALA D C   1 
ATOM   6465 O O   . ALA D 1 179 ? 48.454  8.641   -35.927 1.00 62.16 ? 173 ALA D O   1 
ATOM   6466 C CB  . ALA D 1 179 ? 49.187  11.860  -35.170 1.00 61.95 ? 173 ALA D CB  1 
ATOM   6467 N N   . CYS D 1 180 ? 47.293  9.610   -34.242 1.00 61.10 ? 174 CYS D N   1 
ATOM   6468 C CA  . CYS D 1 180 ? 47.039  8.346   -33.564 1.00 60.92 ? 174 CYS D CA  1 
ATOM   6469 C C   . CYS D 1 180 ? 46.017  7.490   -34.288 1.00 60.34 ? 174 CYS D C   1 
ATOM   6470 O O   . CYS D 1 180 ? 46.177  6.269   -34.365 1.00 59.80 ? 174 CYS D O   1 
ATOM   6471 C CB  . CYS D 1 180 ? 46.558  8.560   -32.142 1.00 60.93 ? 174 CYS D CB  1 
ATOM   6472 S SG  . CYS D 1 180 ? 47.191  10.017  -31.417 1.00 62.85 ? 174 CYS D SG  1 
ATOM   6473 N N   . LEU D 1 181 ? 44.960  8.116   -34.801 1.00 59.99 ? 175 LEU D N   1 
ATOM   6474 C CA  . LEU D 1 181 ? 43.931  7.352   -35.506 1.00 59.68 ? 175 LEU D CA  1 
ATOM   6475 C C   . LEU D 1 181 ? 44.592  6.426   -36.535 1.00 59.65 ? 175 LEU D C   1 
ATOM   6476 O O   . LEU D 1 181 ? 44.438  5.185   -36.485 1.00 59.72 ? 175 LEU D O   1 
ATOM   6477 C CB  . LEU D 1 181 ? 42.932  8.281   -36.187 1.00 59.43 ? 175 LEU D CB  1 
ATOM   6478 C CG  . LEU D 1 181 ? 41.410  8.062   -36.122 1.00 58.86 ? 175 LEU D CG  1 
ATOM   6479 C CD1 . LEU D 1 181 ? 40.798  8.549   -37.449 1.00 56.92 ? 175 LEU D CD1 1 
ATOM   6480 C CD2 . LEU D 1 181 ? 40.974  6.635   -35.822 1.00 56.46 ? 175 LEU D CD2 1 
ATOM   6481 N N   . SER D 1 182 ? 45.367  7.032   -37.432 1.00 59.25 ? 176 SER D N   1 
ATOM   6482 C CA  . SER D 1 182 ? 46.047  6.295   -38.501 1.00 59.29 ? 176 SER D CA  1 
ATOM   6483 C C   . SER D 1 182 ? 47.038  5.236   -38.008 1.00 58.85 ? 176 SER D C   1 
ATOM   6484 O O   . SER D 1 182 ? 47.189  4.200   -38.645 1.00 58.43 ? 176 SER D O   1 
ATOM   6485 C CB  . SER D 1 182 ? 46.722  7.270   -39.467 1.00 59.36 ? 176 SER D CB  1 
ATOM   6486 O OG  . SER D 1 182 ? 46.892  8.514   -38.826 1.00 60.24 ? 176 SER D OG  1 
ATOM   6487 N N   . ALA D 1 183 ? 47.705  5.496   -36.885 1.00 58.55 ? 177 ALA D N   1 
ATOM   6488 C CA  . ALA D 1 183 ? 48.558  4.489   -36.277 1.00 58.58 ? 177 ALA D CA  1 
ATOM   6489 C C   . ALA D 1 183 ? 47.705  3.322   -35.789 1.00 59.04 ? 177 ALA D C   1 
ATOM   6490 O O   . ALA D 1 183 ? 48.077  2.163   -35.959 1.00 59.51 ? 177 ALA D O   1 
ATOM   6491 C CB  . ALA D 1 183 ? 49.340  5.065   -35.154 1.00 58.17 ? 177 ALA D CB  1 
ATOM   6492 N N   . LEU D 1 184 ? 46.549  3.617   -35.204 1.00 59.28 ? 178 LEU D N   1 
ATOM   6493 C CA  . LEU D 1 184 ? 45.693  2.563   -34.682 1.00 59.20 ? 178 LEU D CA  1 
ATOM   6494 C C   . LEU D 1 184 ? 45.243  1.684   -35.822 1.00 59.50 ? 178 LEU D C   1 
ATOM   6495 O O   . LEU D 1 184 ? 45.293  0.461   -35.710 1.00 59.30 ? 178 LEU D O   1 
ATOM   6496 C CB  . LEU D 1 184 ? 44.495  3.135   -33.938 1.00 59.18 ? 178 LEU D CB  1 
ATOM   6497 C CG  . LEU D 1 184 ? 44.887  3.946   -32.702 1.00 59.41 ? 178 LEU D CG  1 
ATOM   6498 C CD1 . LEU D 1 184 ? 43.710  4.728   -32.137 1.00 59.15 ? 178 LEU D CD1 1 
ATOM   6499 C CD2 . LEU D 1 184 ? 45.498  3.061   -31.648 1.00 58.78 ? 178 LEU D CD2 1 
ATOM   6500 N N   . VAL D 1 185 ? 44.831  2.306   -36.926 1.00 59.76 ? 179 VAL D N   1 
ATOM   6501 C CA  . VAL D 1 185 ? 44.484  1.563   -38.142 1.00 60.38 ? 179 VAL D CA  1 
ATOM   6502 C C   . VAL D 1 185 ? 45.606  0.570   -38.549 1.00 61.09 ? 179 VAL D C   1 
ATOM   6503 O O   . VAL D 1 185 ? 45.319  -0.578  -38.909 1.00 61.17 ? 179 VAL D O   1 
ATOM   6504 C CB  . VAL D 1 185 ? 44.103  2.530   -39.298 1.00 60.32 ? 179 VAL D CB  1 
ATOM   6505 C CG1 . VAL D 1 185 ? 43.833  1.802   -40.602 1.00 59.61 ? 179 VAL D CG1 1 
ATOM   6506 C CG2 . VAL D 1 185 ? 42.890  3.335   -38.914 1.00 61.14 ? 179 VAL D CG2 1 
ATOM   6507 N N   . LEU D 1 186 ? 46.871  0.995   -38.463 1.00 61.55 ? 180 LEU D N   1 
ATOM   6508 C CA  . LEU D 1 186 ? 47.984  0.104   -38.779 1.00 61.95 ? 180 LEU D CA  1 
ATOM   6509 C C   . LEU D 1 186 ? 48.193  -0.914  -37.685 1.00 62.87 ? 180 LEU D C   1 
ATOM   6510 O O   . LEU D 1 186 ? 48.166  -2.119  -37.939 1.00 62.92 ? 180 LEU D O   1 
ATOM   6511 C CB  . LEU D 1 186 ? 49.282  0.875   -38.990 1.00 61.46 ? 180 LEU D CB  1 
ATOM   6512 C CG  . LEU D 1 186 ? 50.523  0.039   -39.344 1.00 60.58 ? 180 LEU D CG  1 
ATOM   6513 C CD1 . LEU D 1 186 ? 50.508  -0.480  -40.775 1.00 59.73 ? 180 LEU D CD1 1 
ATOM   6514 C CD2 . LEU D 1 186 ? 51.782  0.843   -39.133 1.00 60.16 ? 180 LEU D CD2 1 
ATOM   6515 N N   . ILE D 1 187 ? 48.399  -0.401  -36.474 1.00 64.02 ? 181 ILE D N   1 
ATOM   6516 C CA  . ILE D 1 187 ? 48.789  -1.186  -35.308 1.00 65.13 ? 181 ILE D CA  1 
ATOM   6517 C C   . ILE D 1 187 ? 47.575  -1.799  -34.627 1.00 66.16 ? 181 ILE D C   1 
ATOM   6518 O O   . ILE D 1 187 ? 46.886  -1.150  -33.831 1.00 66.10 ? 181 ILE D O   1 
ATOM   6519 C CB  . ILE D 1 187 ? 49.593  -0.321  -34.317 1.00 64.89 ? 181 ILE D CB  1 
ATOM   6520 C CG1 . ILE D 1 187 ? 50.994  -0.071  -34.870 1.00 64.79 ? 181 ILE D CG1 1 
ATOM   6521 C CG2 . ILE D 1 187 ? 49.711  -1.001  -32.962 1.00 65.34 ? 181 ILE D CG2 1 
ATOM   6522 C CD1 . ILE D 1 187 ? 51.143  1.202   -35.653 1.00 63.88 ? 181 ILE D CD1 1 
ATOM   6523 N N   . THR D 1 188 ? 47.321  -3.064  -34.936 1.00 67.64 ? 182 THR D N   1 
ATOM   6524 C CA  . THR D 1 188 ? 46.071  -3.679  -34.529 1.00 69.26 ? 182 THR D CA  1 
ATOM   6525 C C   . THR D 1 188 ? 46.140  -5.200  -34.624 1.00 70.90 ? 182 THR D C   1 
ATOM   6526 O O   . THR D 1 188 ? 46.952  -5.741  -35.376 1.00 71.23 ? 182 THR D O   1 
ATOM   6527 C CB  . THR D 1 188 ? 44.917  -3.130  -35.401 1.00 68.85 ? 182 THR D CB  1 
ATOM   6528 O OG1 . THR D 1 188 ? 43.701  -3.108  -34.648 1.00 69.04 ? 182 THR D OG1 1 
ATOM   6529 C CG2 . THR D 1 188 ? 44.756  -3.931  -36.682 1.00 67.89 ? 182 THR D CG2 1 
ATOM   6530 N N   . ASP D 1 189 ? 45.288  -5.878  -33.857 1.00 72.60 ? 183 ASP D N   1 
ATOM   6531 C CA  . ASP D 1 189 ? 45.155  -7.325  -33.930 1.00 74.63 ? 183 ASP D CA  1 
ATOM   6532 C C   . ASP D 1 189 ? 45.165  -7.831  -35.354 1.00 75.45 ? 183 ASP D C   1 
ATOM   6533 O O   . ASP D 1 189 ? 44.384  -7.358  -36.175 1.00 75.66 ? 183 ASP D O   1 
ATOM   6534 C CB  . ASP D 1 189 ? 43.829  -7.766  -33.306 1.00 75.22 ? 183 ASP D CB  1 
ATOM   6535 C CG  . ASP D 1 189 ? 43.990  -8.287  -31.887 1.00 77.00 ? 183 ASP D CG  1 
ATOM   6536 O OD1 . ASP D 1 189 ? 44.738  -9.286  -31.701 1.00 78.62 ? 183 ASP D OD1 1 
ATOM   6537 O OD2 . ASP D 1 189 ? 43.355  -7.701  -30.968 1.00 77.81 ? 183 ASP D OD2 1 
ATOM   6538 N N   . ARG D 1 190 ? 46.053  -8.782  -35.641 1.00 76.43 ? 184 ARG D N   1 
ATOM   6539 C CA  . ARG D 1 190 ? 45.970  -9.575  -36.866 1.00 77.22 ? 184 ARG D CA  1 
ATOM   6540 C C   . ARG D 1 190 ? 46.311  -11.037 -36.609 1.00 78.06 ? 184 ARG D C   1 
ATOM   6541 O O   . ARG D 1 190 ? 47.289  -11.351 -35.909 1.00 77.85 ? 184 ARG D O   1 
ATOM   6542 C CB  . ARG D 1 190 ? 46.898  -9.052  -37.965 1.00 76.99 ? 184 ARG D CB  1 
ATOM   6543 C CG  . ARG D 1 190 ? 46.715  -7.601  -38.361 1.00 76.79 ? 184 ARG D CG  1 
ATOM   6544 C CD  . ARG D 1 190 ? 45.470  -7.316  -39.198 1.00 75.42 ? 184 ARG D CD  1 
ATOM   6545 N NE  . ARG D 1 190 ? 45.279  -5.865  -39.289 1.00 74.62 ? 184 ARG D NE  1 
ATOM   6546 C CZ  . ARG D 1 190 ? 44.340  -5.248  -40.001 1.00 73.25 ? 184 ARG D CZ  1 
ATOM   6547 N NH1 . ARG D 1 190 ? 43.465  -5.945  -40.715 1.00 73.21 ? 184 ARG D NH1 1 
ATOM   6548 N NH2 . ARG D 1 190 ? 44.287  -3.925  -39.998 1.00 71.35 ? 184 ARG D NH2 1 
ATOM   6549 N N   . HIS D 1 191 ? 45.479  -11.912 -37.180 1.00 79.01 ? 185 HIS D N   1 
ATOM   6550 C CA  . HIS D 1 191 ? 45.805  -13.318 -37.410 1.00 79.84 ? 185 HIS D CA  1 
ATOM   6551 C C   . HIS D 1 191 ? 47.118  -13.374 -38.178 1.00 80.36 ? 185 HIS D C   1 
ATOM   6552 O O   . HIS D 1 191 ? 47.273  -12.671 -39.193 1.00 80.44 ? 185 HIS D O   1 
ATOM   6553 C CB  . HIS D 1 191 ? 44.696  -13.983 -38.227 1.00 79.89 ? 185 HIS D CB  1 
ATOM   6554 C CG  . HIS D 1 191 ? 44.956  -15.421 -38.546 1.00 80.74 ? 185 HIS D CG  1 
ATOM   6555 N ND1 . HIS D 1 191 ? 44.856  -16.425 -37.602 1.00 81.81 ? 185 HIS D ND1 1 
ATOM   6556 C CD2 . HIS D 1 191 ? 45.294  -16.027 -39.710 1.00 81.26 ? 185 HIS D CD2 1 
ATOM   6557 C CE1 . HIS D 1 191 ? 45.128  -17.587 -38.168 1.00 81.82 ? 185 HIS D CE1 1 
ATOM   6558 N NE2 . HIS D 1 191 ? 45.399  -17.373 -39.447 1.00 82.24 ? 185 HIS D NE2 1 
ATOM   6559 N N   . GLY D 1 192 ? 48.055  -14.188 -37.677 1.00 80.87 ? 186 GLY D N   1 
ATOM   6560 C CA  . GLY D 1 192 ? 49.429  -14.269 -38.209 1.00 81.18 ? 186 GLY D CA  1 
ATOM   6561 C C   . GLY D 1 192 ? 50.521  -13.577 -37.390 1.00 81.52 ? 186 GLY D C   1 
ATOM   6562 O O   . GLY D 1 192 ? 51.703  -13.930 -37.497 1.00 81.49 ? 186 GLY D O   1 
ATOM   6563 N N   . LEU D 1 193 ? 50.141  -12.588 -36.581 1.00 81.88 ? 187 LEU D N   1 
ATOM   6564 C CA  . LEU D 1 193 ? 51.111  -11.827 -35.791 1.00 82.41 ? 187 LEU D CA  1 
ATOM   6565 C C   . LEU D 1 193 ? 51.925  -12.698 -34.851 1.00 82.68 ? 187 LEU D C   1 
ATOM   6566 O O   . LEU D 1 193 ? 51.398  -13.258 -33.878 1.00 82.63 ? 187 LEU D O   1 
ATOM   6567 C CB  . LEU D 1 193 ? 50.437  -10.715 -34.991 1.00 82.36 ? 187 LEU D CB  1 
ATOM   6568 C CG  . LEU D 1 193 ? 50.095  -9.416  -35.717 1.00 83.49 ? 187 LEU D CG  1 
ATOM   6569 C CD1 . LEU D 1 193 ? 49.286  -8.515  -34.781 1.00 84.92 ? 187 LEU D CD1 1 
ATOM   6570 C CD2 . LEU D 1 193 ? 51.339  -8.676  -36.254 1.00 83.48 ? 187 LEU D CD2 1 
ATOM   6571 N N   . GLN D 1 194 ? 53.216  -12.794 -35.153 1.00 82.91 ? 188 GLN D N   1 
ATOM   6572 C CA  . GLN D 1 194 ? 54.157  -13.572 -34.353 1.00 83.18 ? 188 GLN D CA  1 
ATOM   6573 C C   . GLN D 1 194 ? 54.198  -13.138 -32.880 1.00 83.32 ? 188 GLN D C   1 
ATOM   6574 O O   . GLN D 1 194 ? 54.025  -13.963 -31.977 1.00 83.39 ? 188 GLN D O   1 
ATOM   6575 C CB  . GLN D 1 194 ? 55.550  -13.559 -34.998 1.00 82.98 ? 188 GLN D CB  1 
ATOM   6576 C CG  . GLN D 1 194 ? 55.567  -14.222 -36.385 1.00 83.31 ? 188 GLN D CG  1 
ATOM   6577 C CD  . GLN D 1 194 ? 56.941  -14.242 -37.051 1.00 83.57 ? 188 GLN D CD  1 
ATOM   6578 O OE1 . GLN D 1 194 ? 57.048  -14.173 -38.281 1.00 84.48 ? 188 GLN D OE1 1 
ATOM   6579 N NE2 . GLN D 1 194 ? 57.995  -14.351 -36.247 1.00 83.76 ? 188 GLN D NE2 1 
ATOM   6580 N N   . GLU D 1 195 ? 54.397  -11.850 -32.630 1.00 83.53 ? 189 GLU D N   1 
ATOM   6581 C CA  . GLU D 1 195 ? 54.493  -11.387 -31.251 1.00 83.87 ? 189 GLU D CA  1 
ATOM   6582 C C   . GLU D 1 195 ? 53.422  -10.346 -30.893 1.00 83.69 ? 189 GLU D C   1 
ATOM   6583 O O   . GLU D 1 195 ? 53.720  -9.156  -30.782 1.00 83.50 ? 189 GLU D O   1 
ATOM   6584 C CB  . GLU D 1 195 ? 55.924  -10.932 -30.923 1.00 84.15 ? 189 GLU D CB  1 
ATOM   6585 C CG  . GLU D 1 195 ? 56.958  -12.078 -30.986 1.00 85.16 ? 189 GLU D CG  1 
ATOM   6586 C CD  . GLU D 1 195 ? 57.817  -12.202 -29.720 1.00 86.27 ? 189 GLU D CD  1 
ATOM   6587 O OE1 . GLU D 1 195 ? 58.439  -11.194 -29.317 1.00 87.14 ? 189 GLU D OE1 1 
ATOM   6588 O OE2 . GLU D 1 195 ? 57.879  -13.310 -29.131 1.00 85.49 ? 189 GLU D OE2 1 
ATOM   6589 N N   . PRO D 1 196 ? 52.180  -10.820 -30.646 1.00 83.63 ? 190 PRO D N   1 
ATOM   6590 C CA  . PRO D 1 196 ? 50.963  -10.001 -30.645 1.00 83.45 ? 190 PRO D CA  1 
ATOM   6591 C C   . PRO D 1 196 ? 50.884  -8.995  -29.503 1.00 83.27 ? 190 PRO D C   1 
ATOM   6592 O O   . PRO D 1 196 ? 50.493  -7.859  -29.721 1.00 83.06 ? 190 PRO D O   1 
ATOM   6593 C CB  . PRO D 1 196 ? 49.840  -11.041 -30.511 1.00 83.38 ? 190 PRO D CB  1 
ATOM   6594 C CG  . PRO D 1 196 ? 50.466  -12.171 -29.791 1.00 83.46 ? 190 PRO D CG  1 
ATOM   6595 C CD  . PRO D 1 196 ? 51.888  -12.221 -30.279 1.00 83.63 ? 190 PRO D CD  1 
ATOM   6596 N N   . ARG D 1 197 ? 51.241  -9.413  -28.293 1.00 83.45 ? 191 ARG D N   1 
ATOM   6597 C CA  . ARG D 1 197 ? 51.099  -8.545  -27.124 1.00 83.44 ? 191 ARG D CA  1 
ATOM   6598 C C   . ARG D 1 197 ? 52.060  -7.360  -27.173 1.00 83.29 ? 191 ARG D C   1 
ATOM   6599 O O   . ARG D 1 197 ? 51.831  -6.366  -26.494 1.00 83.40 ? 191 ARG D O   1 
ATOM   6600 C CB  . ARG D 1 197 ? 51.217  -9.323  -25.801 1.00 83.37 ? 191 ARG D CB  1 
ATOM   6601 C CG  . ARG D 1 197 ? 52.619  -9.792  -25.450 1.00 83.60 ? 191 ARG D CG  1 
ATOM   6602 C CD  . ARG D 1 197 ? 52.858  -11.238 -25.872 1.00 83.73 ? 191 ARG D CD  1 
ATOM   6603 N NE  . ARG D 1 197 ? 54.284  -11.547 -25.913 1.00 82.67 ? 191 ARG D NE  1 
ATOM   6604 C CZ  . ARG D 1 197 ? 55.013  -11.538 -27.021 1.00 81.69 ? 191 ARG D CZ  1 
ATOM   6605 N NH1 . ARG D 1 197 ? 56.306  -11.820 -26.971 1.00 81.79 ? 191 ARG D NH1 1 
ATOM   6606 N NH2 . ARG D 1 197 ? 54.444  -11.253 -28.177 1.00 81.03 ? 191 ARG D NH2 1 
ATOM   6607 N N   . ARG D 1 198 ? 53.121  -7.474  -27.976 1.00 83.04 ? 192 ARG D N   1 
ATOM   6608 C CA  . ARG D 1 198 ? 53.998  -6.340  -28.288 1.00 82.81 ? 192 ARG D CA  1 
ATOM   6609 C C   . ARG D 1 198 ? 53.289  -5.354  -29.220 1.00 82.63 ? 192 ARG D C   1 
ATOM   6610 O O   . ARG D 1 198 ? 53.540  -4.140  -29.168 1.00 82.80 ? 192 ARG D O   1 
ATOM   6611 C CB  . ARG D 1 198 ? 55.309  -6.816  -28.926 1.00 82.89 ? 192 ARG D CB  1 
ATOM   6612 C CG  . ARG D 1 198 ? 56.516  -6.821  -27.990 1.00 83.16 ? 192 ARG D CG  1 
ATOM   6613 C CD  . ARG D 1 198 ? 57.813  -6.770  -28.784 1.00 83.38 ? 192 ARG D CD  1 
ATOM   6614 N NE  . ARG D 1 198 ? 57.987  -7.970  -29.601 1.00 84.19 ? 192 ARG D NE  1 
ATOM   6615 C CZ  . ARG D 1 198 ? 58.788  -8.067  -30.662 1.00 84.24 ? 192 ARG D CZ  1 
ATOM   6616 N NH1 . ARG D 1 198 ? 58.865  -9.215  -31.326 1.00 84.13 ? 192 ARG D NH1 1 
ATOM   6617 N NH2 . ARG D 1 198 ? 59.511  -7.027  -31.066 1.00 84.15 ? 192 ARG D NH2 1 
ATOM   6618 N N   . VAL D 1 199 ? 52.415  -5.898  -30.072 1.00 82.04 ? 193 VAL D N   1 
ATOM   6619 C CA  . VAL D 1 199 ? 51.558  -5.124  -30.967 1.00 81.46 ? 193 VAL D CA  1 
ATOM   6620 C C   . VAL D 1 199 ? 50.474  -4.446  -30.146 1.00 81.07 ? 193 VAL D C   1 
ATOM   6621 O O   . VAL D 1 199 ? 50.240  -3.238  -30.256 1.00 81.12 ? 193 VAL D O   1 
ATOM   6622 C CB  . VAL D 1 199 ? 50.866  -6.046  -32.002 1.00 81.44 ? 193 VAL D CB  1 
ATOM   6623 C CG1 . VAL D 1 199 ? 50.102  -5.233  -33.030 1.00 81.35 ? 193 VAL D CG1 1 
ATOM   6624 C CG2 . VAL D 1 199 ? 51.874  -6.946  -32.678 1.00 81.49 ? 193 VAL D CG2 1 
ATOM   6625 N N   . GLU D 1 200 ? 49.818  -5.258  -29.327 1.00 80.62 ? 194 GLU D N   1 
ATOM   6626 C CA  . GLU D 1 200 ? 48.755  -4.823  -28.450 1.00 80.15 ? 194 GLU D CA  1 
ATOM   6627 C C   . GLU D 1 200 ? 49.282  -3.842  -27.413 1.00 79.61 ? 194 GLU D C   1 
ATOM   6628 O O   . GLU D 1 200 ? 48.614  -2.861  -27.094 1.00 79.64 ? 194 GLU D O   1 
ATOM   6629 C CB  . GLU D 1 200 ? 48.145  -6.039  -27.776 1.00 80.36 ? 194 GLU D CB  1 
ATOM   6630 C CG  . GLU D 1 200 ? 47.224  -5.721  -26.615 1.00 81.30 ? 194 GLU D CG  1 
ATOM   6631 C CD  . GLU D 1 200 ? 47.170  -6.845  -25.596 1.00 81.28 ? 194 GLU D CD  1 
ATOM   6632 O OE1 . GLU D 1 200 ? 47.984  -7.793  -25.712 1.00 81.81 ? 194 GLU D OE1 1 
ATOM   6633 O OE2 . GLU D 1 200 ? 46.319  -6.772  -24.679 1.00 80.97 ? 194 GLU D OE2 1 
ATOM   6634 N N   . GLU D 1 201 ? 50.476  -4.117  -26.893 1.00 79.01 ? 195 GLU D N   1 
ATOM   6635 C CA  . GLU D 1 201 ? 51.199  -3.188  -26.022 1.00 78.53 ? 195 GLU D CA  1 
ATOM   6636 C C   . GLU D 1 201 ? 51.179  -1.784  -26.632 1.00 78.18 ? 195 GLU D C   1 
ATOM   6637 O O   . GLU D 1 201 ? 50.722  -0.826  -26.003 1.00 77.99 ? 195 GLU D O   1 
ATOM   6638 C CB  . GLU D 1 201 ? 52.652  -3.648  -25.891 1.00 78.67 ? 195 GLU D CB  1 
ATOM   6639 C CG  . GLU D 1 201 ? 53.346  -3.397  -24.551 1.00 78.65 ? 195 GLU D CG  1 
ATOM   6640 C CD  . GLU D 1 201 ? 54.824  -3.783  -24.607 1.00 78.45 ? 195 GLU D CD  1 
ATOM   6641 O OE1 . GLU D 1 201 ? 55.591  -3.053  -25.270 1.00 78.37 ? 195 GLU D OE1 1 
ATOM   6642 O OE2 . GLU D 1 201 ? 55.219  -4.814  -24.012 1.00 77.81 ? 195 GLU D OE2 1 
ATOM   6643 N N   . LEU D 1 202 ? 51.654  -1.699  -27.876 1.00 77.66 ? 196 LEU D N   1 
ATOM   6644 C CA  . LEU D 1 202 ? 51.854  -0.442  -28.578 1.00 77.07 ? 196 LEU D CA  1 
ATOM   6645 C C   . LEU D 1 202 ? 50.535  0.223   -28.961 1.00 76.96 ? 196 LEU D C   1 
ATOM   6646 O O   . LEU D 1 202 ? 50.391  1.448   -28.853 1.00 76.74 ? 196 LEU D O   1 
ATOM   6647 C CB  . LEU D 1 202 ? 52.730  -0.685  -29.806 1.00 76.94 ? 196 LEU D CB  1 
ATOM   6648 C CG  . LEU D 1 202 ? 53.064  0.478   -30.749 1.00 76.79 ? 196 LEU D CG  1 
ATOM   6649 C CD1 . LEU D 1 202 ? 53.510  1.731   -30.014 1.00 75.76 ? 196 LEU D CD1 1 
ATOM   6650 C CD2 . LEU D 1 202 ? 54.123  0.044   -31.747 1.00 76.89 ? 196 LEU D CD2 1 
ATOM   6651 N N   . GLN D 1 203 ? 49.585  -0.592  -29.413 1.00 76.93 ? 197 GLN D N   1 
ATOM   6652 C CA  . GLN D 1 203 ? 48.204  -0.159  -29.653 1.00 77.02 ? 197 GLN D CA  1 
ATOM   6653 C C   . GLN D 1 203 ? 47.736  0.728   -28.487 1.00 77.05 ? 197 GLN D C   1 
ATOM   6654 O O   . GLN D 1 203 ? 47.349  1.882   -28.674 1.00 76.52 ? 197 GLN D O   1 
ATOM   6655 C CB  . GLN D 1 203 ? 47.313  -1.408  -29.869 1.00 76.92 ? 197 GLN D CB  1 
ATOM   6656 C CG  . GLN D 1 203 ? 45.784  -1.240  -29.762 1.00 77.00 ? 197 GLN D CG  1 
ATOM   6657 C CD  . GLN D 1 203 ? 45.008  -2.148  -30.731 1.00 77.25 ? 197 GLN D CD  1 
ATOM   6658 O OE1 . GLN D 1 203 ? 44.363  -1.667  -31.666 1.00 79.11 ? 197 GLN D OE1 1 
ATOM   6659 N NE2 . GLN D 1 203 ? 45.086  -3.452  -30.525 1.00 76.31 ? 197 GLN D NE2 1 
ATOM   6660 N N   . ASN D 1 204 ? 47.858  0.189   -27.278 1.00 77.56 ? 198 ASN D N   1 
ATOM   6661 C CA  . ASN D 1 204 ? 47.390  0.834   -26.048 1.00 77.91 ? 198 ASN D CA  1 
ATOM   6662 C C   . ASN D 1 204 ? 47.969  2.207   -25.724 1.00 78.09 ? 198 ASN D C   1 
ATOM   6663 O O   . ASN D 1 204 ? 47.241  3.096   -25.287 1.00 78.27 ? 198 ASN D O   1 
ATOM   6664 C CB  . ASN D 1 204 ? 47.610  -0.100  -24.855 1.00 77.86 ? 198 ASN D CB  1 
ATOM   6665 C CG  . ASN D 1 204 ? 46.790  -1.362  -24.948 1.00 77.43 ? 198 ASN D CG  1 
ATOM   6666 O OD1 . ASN D 1 204 ? 46.113  -1.614  -25.947 1.00 76.84 ? 198 ASN D OD1 1 
ATOM   6667 N ND2 . ASN D 1 204 ? 46.844  -2.167  -23.900 1.00 77.37 ? 198 ASN D ND2 1 
ATOM   6668 N N   . ARG D 1 205 ? 49.276  2.371   -25.906 1.00 78.32 ? 199 ARG D N   1 
ATOM   6669 C CA  . ARG D 1 205 ? 49.922  3.652   -25.605 1.00 78.59 ? 199 ARG D CA  1 
ATOM   6670 C C   . ARG D 1 205 ? 49.504  4.685   -26.647 1.00 77.96 ? 199 ARG D C   1 
ATOM   6671 O O   . ARG D 1 205 ? 49.189  5.835   -26.315 1.00 77.87 ? 199 ARG D O   1 
ATOM   6672 C CB  . ARG D 1 205 ? 51.444  3.497   -25.510 1.00 78.46 ? 199 ARG D CB  1 
ATOM   6673 C CG  . ARG D 1 205 ? 51.854  2.339   -24.602 1.00 79.31 ? 199 ARG D CG  1 
ATOM   6674 C CD  . ARG D 1 205 ? 53.366  2.224   -24.419 1.00 79.85 ? 199 ARG D CD  1 
ATOM   6675 N NE  . ARG D 1 205 ? 53.854  0.929   -24.907 1.00 82.25 ? 199 ARG D NE  1 
ATOM   6676 C CZ  . ARG D 1 205 ? 54.770  0.772   -25.869 1.00 82.35 ? 199 ARG D CZ  1 
ATOM   6677 N NH1 . ARG D 1 205 ? 55.121  -0.456  -26.246 1.00 82.77 ? 199 ARG D NH1 1 
ATOM   6678 N NH2 . ARG D 1 205 ? 55.352  1.830   -26.441 1.00 81.75 ? 199 ARG D NH2 1 
ATOM   6679 N N   . ILE D 1 206 ? 49.460  4.253   -27.903 1.00 77.56 ? 200 ILE D N   1 
ATOM   6680 C CA  . ILE D 1 206 ? 48.911  5.089   -28.951 1.00 77.09 ? 200 ILE D CA  1 
ATOM   6681 C C   . ILE D 1 206 ? 47.516  5.523   -28.489 1.00 77.24 ? 200 ILE D C   1 
ATOM   6682 O O   . ILE D 1 206 ? 47.198  6.709   -28.495 1.00 77.10 ? 200 ILE D O   1 
ATOM   6683 C CB  . ILE D 1 206 ? 48.926  4.375   -30.330 1.00 77.18 ? 200 ILE D CB  1 
ATOM   6684 C CG1 . ILE D 1 206 ? 50.375  4.077   -30.754 1.00 76.47 ? 200 ILE D CG1 1 
ATOM   6685 C CG2 . ILE D 1 206 ? 48.258  5.248   -31.386 1.00 77.18 ? 200 ILE D CG2 1 
ATOM   6686 C CD1 . ILE D 1 206 ? 50.535  3.102   -31.902 1.00 76.18 ? 200 ILE D CD1 1 
ATOM   6687 N N   . ALA D 1 207 ? 46.723  4.562   -28.015 1.00 77.44 ? 201 ALA D N   1 
ATOM   6688 C CA  . ALA D 1 207 ? 45.402  4.839   -27.442 1.00 77.53 ? 201 ALA D CA  1 
ATOM   6689 C C   . ALA D 1 207 ? 45.426  5.890   -26.325 1.00 77.86 ? 201 ALA D C   1 
ATOM   6690 O O   . ALA D 1 207 ? 44.549  6.753   -26.264 1.00 77.89 ? 201 ALA D O   1 
ATOM   6691 C CB  . ALA D 1 207 ? 44.783  3.567   -26.951 1.00 77.16 ? 201 ALA D CB  1 
ATOM   6692 N N   . SER D 1 208 ? 46.436  5.815   -25.457 1.00 78.34 ? 202 SER D N   1 
ATOM   6693 C CA  . SER D 1 208 ? 46.618  6.771   -24.359 1.00 78.71 ? 202 SER D CA  1 
ATOM   6694 C C   . SER D 1 208 ? 47.029  8.164   -24.853 1.00 79.17 ? 202 SER D C   1 
ATOM   6695 O O   . SER D 1 208 ? 46.641  9.180   -24.264 1.00 79.21 ? 202 SER D O   1 
ATOM   6696 C CB  . SER D 1 208 ? 47.643  6.242   -23.343 1.00 78.81 ? 202 SER D CB  1 
ATOM   6697 O OG  . SER D 1 208 ? 47.138  5.124   -22.619 1.00 78.33 ? 202 SER D OG  1 
ATOM   6698 N N   . CYS D 1 209 ? 47.814  8.222   -25.924 1.00 79.41 ? 203 CYS D N   1 
ATOM   6699 C CA  . CYS D 1 209 ? 48.063  9.503   -26.559 1.00 80.07 ? 203 CYS D CA  1 
ATOM   6700 C C   . CYS D 1 209 ? 46.719  10.135  -26.915 1.00 80.09 ? 203 CYS D C   1 
ATOM   6701 O O   . CYS D 1 209 ? 46.369  11.208  -26.407 1.00 80.38 ? 203 CYS D O   1 
ATOM   6702 C CB  . CYS D 1 209 ? 48.913  9.343   -27.820 1.00 80.24 ? 203 CYS D CB  1 
ATOM   6703 S SG  . CYS D 1 209 ? 50.583  8.779   -27.522 1.00 81.60 ? 203 CYS D SG  1 
ATOM   6704 N N   . LEU D 1 210 ? 45.970  9.443   -27.772 1.00 79.93 ? 204 LEU D N   1 
ATOM   6705 C CA  . LEU D 1 210 ? 44.679  9.905   -28.236 1.00 79.83 ? 204 LEU D CA  1 
ATOM   6706 C C   . LEU D 1 210 ? 43.770  10.286  -27.075 1.00 80.26 ? 204 LEU D C   1 
ATOM   6707 O O   . LEU D 1 210 ? 43.226  11.390  -27.055 1.00 80.84 ? 204 LEU D O   1 
ATOM   6708 C CB  . LEU D 1 210 ? 44.007  8.850   -29.110 1.00 79.50 ? 204 LEU D CB  1 
ATOM   6709 C CG  . LEU D 1 210 ? 42.682  9.278   -29.740 1.00 78.85 ? 204 LEU D CG  1 
ATOM   6710 C CD1 . LEU D 1 210 ? 42.775  10.681  -30.320 1.00 79.68 ? 204 LEU D CD1 1 
ATOM   6711 C CD2 . LEU D 1 210 ? 42.262  8.299   -30.811 1.00 78.02 ? 204 LEU D CD2 1 
ATOM   6712 N N   . LYS D 1 211 ? 43.616  9.386   -26.107 1.00 80.25 ? 205 LYS D N   1 
ATOM   6713 C CA  . LYS D 1 211 ? 42.744  9.650   -24.971 1.00 80.24 ? 205 LYS D CA  1 
ATOM   6714 C C   . LYS D 1 211 ? 43.142  10.915  -24.204 1.00 80.16 ? 205 LYS D C   1 
ATOM   6715 O O   . LYS D 1 211 ? 42.275  11.726  -23.905 1.00 80.25 ? 205 LYS D O   1 
ATOM   6716 C CB  . LYS D 1 211 ? 42.650  8.433   -24.037 1.00 80.33 ? 205 LYS D CB  1 
ATOM   6717 C CG  . LYS D 1 211 ? 41.290  8.296   -23.337 1.00 79.89 ? 205 LYS D CG  1 
ATOM   6718 C CD  . LYS D 1 211 ? 41.033  6.860   -22.891 1.00 79.59 ? 205 LYS D CD  1 
ATOM   6719 C CE  . LYS D 1 211 ? 39.543  6.575   -22.669 1.00 80.39 ? 205 LYS D CE  1 
ATOM   6720 N NZ  . LYS D 1 211 ? 39.033  7.018   -21.336 1.00 80.32 ? 205 LYS D NZ  1 
ATOM   6721 N N   . GLU D 1 212 ? 44.430  11.094  -23.904 1.00 80.02 ? 206 GLU D N   1 
ATOM   6722 C CA  . GLU D 1 212 ? 44.866  12.292  -23.175 1.00 80.42 ? 206 GLU D CA  1 
ATOM   6723 C C   . GLU D 1 212 ? 44.893  13.541  -24.062 1.00 80.62 ? 206 GLU D C   1 
ATOM   6724 O O   . GLU D 1 212 ? 44.739  14.661  -23.557 1.00 80.77 ? 206 GLU D O   1 
ATOM   6725 C CB  . GLU D 1 212 ? 46.217  12.089  -22.468 1.00 80.58 ? 206 GLU D CB  1 
ATOM   6726 C CG  . GLU D 1 212 ? 46.555  13.188  -21.421 1.00 80.99 ? 206 GLU D CG  1 
ATOM   6727 C CD  . GLU D 1 212 ? 47.264  12.652  -20.167 1.00 81.97 ? 206 GLU D CD  1 
ATOM   6728 O OE1 . GLU D 1 212 ? 47.683  11.474  -20.185 1.00 82.66 ? 206 GLU D OE1 1 
ATOM   6729 O OE2 . GLU D 1 212 ? 47.402  13.402  -19.162 1.00 81.12 ? 206 GLU D OE2 1 
ATOM   6730 N N   . HIS D 1 213 ? 45.078  13.352  -25.370 1.00 80.41 ? 207 HIS D N   1 
ATOM   6731 C CA  . HIS D 1 213 ? 45.033  14.464  -26.305 1.00 80.29 ? 207 HIS D CA  1 
ATOM   6732 C C   . HIS D 1 213 ? 43.645  15.114  -26.453 1.00 80.51 ? 207 HIS D C   1 
ATOM   6733 O O   . HIS D 1 213 ? 43.540  16.351  -26.544 1.00 80.38 ? 207 HIS D O   1 
ATOM   6734 C CB  . HIS D 1 213 ? 45.565  14.065  -27.681 1.00 80.37 ? 207 HIS D CB  1 
ATOM   6735 C CG  . HIS D 1 213 ? 45.362  15.127  -28.716 1.00 80.08 ? 207 HIS D CG  1 
ATOM   6736 N ND1 . HIS D 1 213 ? 45.775  16.430  -28.532 1.00 79.67 ? 207 HIS D ND1 1 
ATOM   6737 C CD2 . HIS D 1 213 ? 44.748  15.095  -29.920 1.00 80.17 ? 207 HIS D CD2 1 
ATOM   6738 C CE1 . HIS D 1 213 ? 45.439  17.150  -29.585 1.00 79.92 ? 207 HIS D CE1 1 
ATOM   6739 N NE2 . HIS D 1 213 ? 44.813  16.363  -30.442 1.00 80.21 ? 207 HIS D NE2 1 
ATOM   6740 N N   . VAL D 1 214 ? 42.599  14.281  -26.507 1.00 80.57 ? 208 VAL D N   1 
ATOM   6741 C CA  . VAL D 1 214 ? 41.212  14.760  -26.623 1.00 80.62 ? 208 VAL D CA  1 
ATOM   6742 C C   . VAL D 1 214 ? 40.706  15.263  -25.274 1.00 81.17 ? 208 VAL D C   1 
ATOM   6743 O O   . VAL D 1 214 ? 39.775  16.077  -25.219 1.00 81.24 ? 208 VAL D O   1 
ATOM   6744 C CB  . VAL D 1 214 ? 40.235  13.685  -27.181 1.00 80.37 ? 208 VAL D CB  1 
ATOM   6745 C CG1 . VAL D 1 214 ? 40.633  13.250  -28.588 1.00 79.70 ? 208 VAL D CG1 1 
ATOM   6746 C CG2 . VAL D 1 214 ? 40.131  12.486  -26.238 1.00 80.07 ? 208 VAL D CG2 1 
ATOM   6747 N N   . ALA D 1 215 ? 41.329  14.768  -24.199 1.00 81.72 ? 209 ALA D N   1 
ATOM   6748 C CA  . ALA D 1 215 ? 41.076  15.226  -22.834 1.00 82.28 ? 209 ALA D CA  1 
ATOM   6749 C C   . ALA D 1 215 ? 41.415  16.706  -22.708 1.00 82.72 ? 209 ALA D C   1 
ATOM   6750 O O   . ALA D 1 215 ? 40.729  17.446  -22.005 1.00 82.72 ? 209 ALA D O   1 
ATOM   6751 C CB  . ALA D 1 215 ? 41.878  14.402  -21.833 1.00 82.15 ? 209 ALA D CB  1 
ATOM   6752 N N   . ALA D 1 216 ? 42.475  17.123  -23.400 1.00 83.56 ? 210 ALA D N   1 
ATOM   6753 C CA  . ALA D 1 216 ? 42.829  18.538  -23.541 1.00 84.31 ? 210 ALA D CA  1 
ATOM   6754 C C   . ALA D 1 216 ? 41.763  19.265  -24.369 1.00 84.82 ? 210 ALA D C   1 
ATOM   6755 O O   . ALA D 1 216 ? 40.846  19.872  -23.800 1.00 85.10 ? 210 ALA D O   1 
ATOM   6756 C CB  . ALA D 1 216 ? 44.225  18.693  -24.168 1.00 84.24 ? 210 ALA D CB  1 
ATOM   6757 N N   . VAL D 1 217 ? 41.883  19.182  -25.698 1.00 85.26 ? 211 VAL D N   1 
ATOM   6758 C CA  . VAL D 1 217 ? 40.900  19.725  -26.654 1.00 85.38 ? 211 VAL D CA  1 
ATOM   6759 C C   . VAL D 1 217 ? 39.449  19.483  -26.210 1.00 85.43 ? 211 VAL D C   1 
ATOM   6760 O O   . VAL D 1 217 ? 38.806  20.358  -25.621 1.00 85.40 ? 211 VAL D O   1 
ATOM   6761 C CB  . VAL D 1 217 ? 41.083  19.092  -28.058 1.00 85.42 ? 211 VAL D CB  1 
ATOM   6762 C CG1 . VAL D 1 217 ? 40.308  19.880  -29.120 1.00 85.68 ? 211 VAL D CG1 1 
ATOM   6763 C CG2 . VAL D 1 217 ? 42.566  18.987  -28.425 1.00 85.29 ? 211 VAL D CG2 1 
ATOM   6764 N N   . SER D 1 225 ? 31.164  10.794  -26.254 1.00 75.47 ? 219 SER D N   1 
ATOM   6765 C CA  . SER D 1 225 ? 32.422  11.506  -26.490 1.00 75.62 ? 219 SER D CA  1 
ATOM   6766 C C   . SER D 1 225 ? 32.588  11.913  -27.969 1.00 75.64 ? 219 SER D C   1 
ATOM   6767 O O   . SER D 1 225 ? 31.857  11.427  -28.852 1.00 75.59 ? 219 SER D O   1 
ATOM   6768 C CB  . SER D 1 225 ? 33.633  10.653  -26.036 1.00 75.66 ? 219 SER D CB  1 
ATOM   6769 O OG  . SER D 1 225 ? 33.533  10.224  -24.679 1.00 74.95 ? 219 SER D OG  1 
ATOM   6770 N N   . CYS D 1 226 ? 33.537  12.820  -28.219 1.00 75.26 ? 220 CYS D N   1 
ATOM   6771 C CA  . CYS D 1 226 ? 34.048  13.065  -29.566 1.00 75.09 ? 220 CYS D CA  1 
ATOM   6772 C C   . CYS D 1 226 ? 34.663  11.786  -30.072 1.00 74.31 ? 220 CYS D C   1 
ATOM   6773 O O   . CYS D 1 226 ? 34.391  11.348  -31.182 1.00 74.31 ? 220 CYS D O   1 
ATOM   6774 C CB  . CYS D 1 226 ? 35.143  14.119  -29.541 1.00 75.34 ? 220 CYS D CB  1 
ATOM   6775 S SG  . CYS D 1 226 ? 34.604  15.627  -28.783 1.00 77.84 ? 220 CYS D SG  1 
ATOM   6776 N N   . LEU D 1 227 ? 35.507  11.204  -29.225 1.00 73.35 ? 221 LEU D N   1 
ATOM   6777 C CA  . LEU D 1 227 ? 36.151  9.927   -29.461 1.00 72.22 ? 221 LEU D CA  1 
ATOM   6778 C C   . LEU D 1 227 ? 35.172  8.823   -29.930 1.00 71.75 ? 221 LEU D C   1 
ATOM   6779 O O   . LEU D 1 227 ? 35.514  7.978   -30.761 1.00 71.94 ? 221 LEU D O   1 
ATOM   6780 C CB  . LEU D 1 227 ? 36.864  9.525   -28.179 1.00 72.19 ? 221 LEU D CB  1 
ATOM   6781 C CG  . LEU D 1 227 ? 38.285  8.984   -28.263 1.00 71.46 ? 221 LEU D CG  1 
ATOM   6782 C CD1 . LEU D 1 227 ? 39.120  9.796   -29.199 1.00 72.85 ? 221 LEU D CD1 1 
ATOM   6783 C CD2 . LEU D 1 227 ? 38.873  9.047   -26.895 1.00 71.57 ? 221 LEU D CD2 1 
ATOM   6784 N N   . SER D 1 228 ? 33.951  8.830   -29.415 1.00 70.80 ? 222 SER D N   1 
ATOM   6785 C CA  . SER D 1 228 ? 32.911  7.998   -30.003 1.00 69.83 ? 222 SER D CA  1 
ATOM   6786 C C   . SER D 1 228 ? 32.747  8.363   -31.483 1.00 69.26 ? 222 SER D C   1 
ATOM   6787 O O   . SER D 1 228 ? 32.971  7.520   -32.346 1.00 69.01 ? 222 SER D O   1 
ATOM   6788 C CB  . SER D 1 228 ? 31.602  8.158   -29.240 1.00 69.81 ? 222 SER D CB  1 
ATOM   6789 O OG  . SER D 1 228 ? 31.826  7.926   -27.863 1.00 69.78 ? 222 SER D OG  1 
ATOM   6790 N N   . ARG D 1 229 ? 32.411  9.629   -31.764 1.00 68.60 ? 223 ARG D N   1 
ATOM   6791 C CA  . ARG D 1 229 ? 32.237  10.136  -33.152 1.00 67.83 ? 223 ARG D CA  1 
ATOM   6792 C C   . ARG D 1 229 ? 33.478  9.882   -34.037 1.00 66.40 ? 223 ARG D C   1 
ATOM   6793 O O   . ARG D 1 229 ? 33.373  9.583   -35.233 1.00 66.57 ? 223 ARG D O   1 
ATOM   6794 C CB  . ARG D 1 229 ? 31.867  11.638  -33.162 1.00 67.55 ? 223 ARG D CB  1 
ATOM   6795 C CG  . ARG D 1 229 ? 30.611  12.006  -32.347 1.00 68.52 ? 223 ARG D CG  1 
ATOM   6796 C CD  . ARG D 1 229 ? 30.167  13.462  -32.570 1.00 69.32 ? 223 ARG D CD  1 
ATOM   6797 N NE  . ARG D 1 229 ? 30.994  14.443  -31.847 1.00 72.58 ? 223 ARG D NE  1 
ATOM   6798 C CZ  . ARG D 1 229 ? 31.120  15.733  -32.180 1.00 73.11 ? 223 ARG D CZ  1 
ATOM   6799 N NH1 . ARG D 1 229 ? 30.493  16.230  -33.243 1.00 72.30 ? 223 ARG D NH1 1 
ATOM   6800 N NH2 . ARG D 1 229 ? 31.889  16.537  -31.448 1.00 73.77 ? 223 ARG D NH2 1 
ATOM   6801 N N   . LEU D 1 230 ? 34.648  9.988   -33.424 1.00 64.54 ? 224 LEU D N   1 
ATOM   6802 C CA  . LEU D 1 230 ? 35.899  9.847   -34.125 1.00 62.74 ? 224 LEU D CA  1 
ATOM   6803 C C   . LEU D 1 230 ? 36.198  8.395   -34.409 1.00 61.62 ? 224 LEU D C   1 
ATOM   6804 O O   . LEU D 1 230 ? 36.554  8.056   -35.513 1.00 61.85 ? 224 LEU D O   1 
ATOM   6805 C CB  . LEU D 1 230 ? 37.024  10.521  -33.333 1.00 62.50 ? 224 LEU D CB  1 
ATOM   6806 C CG  . LEU D 1 230 ? 38.452  10.610  -33.871 1.00 61.40 ? 224 LEU D CG  1 
ATOM   6807 C CD1 . LEU D 1 230 ? 38.553  10.601  -35.404 1.00 58.90 ? 224 LEU D CD1 1 
ATOM   6808 C CD2 . LEU D 1 230 ? 39.095  11.858  -33.251 1.00 61.85 ? 224 LEU D CD2 1 
ATOM   6809 N N   . LEU D 1 231 ? 36.048  7.534   -33.423 1.00 60.77 ? 225 LEU D N   1 
ATOM   6810 C CA  . LEU D 1 231 ? 36.288  6.122   -33.642 1.00 60.36 ? 225 LEU D CA  1 
ATOM   6811 C C   . LEU D 1 231 ? 35.165  5.477   -34.474 1.00 60.41 ? 225 LEU D C   1 
ATOM   6812 O O   . LEU D 1 231 ? 35.399  4.540   -35.248 1.00 60.27 ? 225 LEU D O   1 
ATOM   6813 C CB  . LEU D 1 231 ? 36.486  5.421   -32.310 1.00 60.14 ? 225 LEU D CB  1 
ATOM   6814 C CG  . LEU D 1 231 ? 37.704  5.863   -31.469 1.00 60.15 ? 225 LEU D CG  1 
ATOM   6815 C CD1 . LEU D 1 231 ? 37.496  5.408   -30.024 1.00 58.02 ? 225 LEU D CD1 1 
ATOM   6816 C CD2 . LEU D 1 231 ? 39.060  5.376   -32.019 1.00 57.10 ? 225 LEU D CD2 1 
ATOM   6817 N N   . GLY D 1 232 ? 33.960  6.029   -34.344 1.00 60.42 ? 226 GLY D N   1 
ATOM   6818 C CA  . GLY D 1 232 ? 32.778  5.566   -35.062 1.00 60.26 ? 226 GLY D CA  1 
ATOM   6819 C C   . GLY D 1 232 ? 32.975  5.551   -36.556 1.00 60.47 ? 226 GLY D C   1 
ATOM   6820 O O   . GLY D 1 232 ? 32.348  4.760   -37.266 1.00 61.16 ? 226 GLY D O   1 
ATOM   6821 N N   . LYS D 1 233 ? 33.862  6.412   -37.038 1.00 60.18 ? 227 LYS D N   1 
ATOM   6822 C CA  . LYS D 1 233 ? 34.211  6.443   -38.457 1.00 59.74 ? 227 LYS D CA  1 
ATOM   6823 C C   . LYS D 1 233 ? 34.910  5.178   -38.929 1.00 59.78 ? 227 LYS D C   1 
ATOM   6824 O O   . LYS D 1 233 ? 34.783  4.818   -40.091 1.00 59.97 ? 227 LYS D O   1 
ATOM   6825 C CB  . LYS D 1 233 ? 35.091  7.656   -38.777 1.00 59.40 ? 227 LYS D CB  1 
ATOM   6826 C CG  . LYS D 1 233 ? 34.327  8.958   -38.901 1.00 58.16 ? 227 LYS D CG  1 
ATOM   6827 C CD  . LYS D 1 233 ? 33.291  8.900   -40.021 1.00 54.85 ? 227 LYS D CD  1 
ATOM   6828 C CE  . LYS D 1 233 ? 32.507  10.174  -40.074 1.00 52.76 ? 227 LYS D CE  1 
ATOM   6829 N NZ  . LYS D 1 233 ? 31.975  10.610  -38.753 1.00 50.85 ? 227 LYS D NZ  1 
ATOM   6830 N N   . LEU D 1 234 ? 35.636  4.511   -38.028 1.00 59.91 ? 228 LEU D N   1 
ATOM   6831 C CA  . LEU D 1 234 ? 36.493  3.370   -38.387 1.00 59.87 ? 228 LEU D CA  1 
ATOM   6832 C C   . LEU D 1 234 ? 35.808  2.194   -39.090 1.00 60.34 ? 228 LEU D C   1 
ATOM   6833 O O   . LEU D 1 234 ? 36.395  1.604   -40.002 1.00 60.79 ? 228 LEU D O   1 
ATOM   6834 C CB  . LEU D 1 234 ? 37.289  2.869   -37.185 1.00 59.37 ? 228 LEU D CB  1 
ATOM   6835 C CG  . LEU D 1 234 ? 38.656  3.511   -37.020 1.00 58.81 ? 228 LEU D CG  1 
ATOM   6836 C CD1 . LEU D 1 234 ? 39.363  3.003   -35.778 1.00 57.68 ? 228 LEU D CD1 1 
ATOM   6837 C CD2 . LEU D 1 234 ? 39.481  3.250   -38.246 1.00 58.50 ? 228 LEU D CD2 1 
ATOM   6838 N N   . PRO D 1 235 ? 34.595  1.810   -38.650 1.00 60.50 ? 229 PRO D N   1 
ATOM   6839 C CA  . PRO D 1 235 ? 33.897  0.784   -39.427 1.00 60.45 ? 229 PRO D CA  1 
ATOM   6840 C C   . PRO D 1 235 ? 33.388  1.245   -40.796 1.00 60.36 ? 229 PRO D C   1 
ATOM   6841 O O   . PRO D 1 235 ? 33.287  0.418   -41.699 1.00 60.46 ? 229 PRO D O   1 
ATOM   6842 C CB  . PRO D 1 235 ? 32.729  0.398   -38.520 1.00 60.56 ? 229 PRO D CB  1 
ATOM   6843 C CG  . PRO D 1 235 ? 33.130  0.896   -37.158 1.00 60.45 ? 229 PRO D CG  1 
ATOM   6844 C CD  . PRO D 1 235 ? 33.840  2.160   -37.437 1.00 60.32 ? 229 PRO D CD  1 
ATOM   6845 N N   . GLU D 1 236 ? 33.063  2.533   -40.958 1.00 60.40 ? 230 GLU D N   1 
ATOM   6846 C CA  . GLU D 1 236 ? 32.625  3.027   -42.279 1.00 60.29 ? 230 GLU D CA  1 
ATOM   6847 C C   . GLU D 1 236 ? 33.813  2.919   -43.252 1.00 59.23 ? 230 GLU D C   1 
ATOM   6848 O O   . GLU D 1 236 ? 33.645  2.517   -44.409 1.00 58.86 ? 230 GLU D O   1 
ATOM   6849 C CB  . GLU D 1 236 ? 32.022  4.459   -42.224 1.00 60.28 ? 230 GLU D CB  1 
ATOM   6850 C CG  . GLU D 1 236 ? 31.200  4.880   -43.518 1.00 61.26 ? 230 GLU D CG  1 
ATOM   6851 C CD  . GLU D 1 236 ? 31.046  6.438   -43.745 1.00 62.15 ? 230 GLU D CD  1 
ATOM   6852 O OE1 . GLU D 1 236 ? 31.060  6.852   -44.933 1.00 62.22 ? 230 GLU D OE1 1 
ATOM   6853 O OE2 . GLU D 1 236 ? 30.910  7.241   -42.767 1.00 63.81 ? 230 GLU D OE2 1 
ATOM   6854 N N   . LEU D 1 237 ? 35.004  3.262   -42.747 1.00 58.07 ? 231 LEU D N   1 
ATOM   6855 C CA  . LEU D 1 237 ? 36.266  3.083   -43.459 1.00 57.12 ? 231 LEU D CA  1 
ATOM   6856 C C   . LEU D 1 237 ? 36.414  1.626   -43.905 1.00 56.83 ? 231 LEU D C   1 
ATOM   6857 O O   . LEU D 1 237 ? 36.626  1.337   -45.075 1.00 56.34 ? 231 LEU D O   1 
ATOM   6858 C CB  . LEU D 1 237 ? 37.433  3.478   -42.558 1.00 56.47 ? 231 LEU D CB  1 
ATOM   6859 C CG  . LEU D 1 237 ? 38.833  3.461   -43.156 1.00 55.79 ? 231 LEU D CG  1 
ATOM   6860 C CD1 . LEU D 1 237 ? 38.912  4.372   -44.337 1.00 53.92 ? 231 LEU D CD1 1 
ATOM   6861 C CD2 . LEU D 1 237 ? 39.838  3.920   -42.127 1.00 57.27 ? 231 LEU D CD2 1 
ATOM   6862 N N   . ARG D 1 238 ? 36.274  0.723   -42.947 1.00 56.83 ? 232 ARG D N   1 
ATOM   6863 C CA  . ARG D 1 238 ? 36.217  -0.706  -43.181 1.00 56.61 ? 232 ARG D CA  1 
ATOM   6864 C C   . ARG D 1 238 ? 35.249  -1.147  -44.326 1.00 56.01 ? 232 ARG D C   1 
ATOM   6865 O O   . ARG D 1 238 ? 35.602  -2.029  -45.110 1.00 55.74 ? 232 ARG D O   1 
ATOM   6866 C CB  . ARG D 1 238 ? 35.922  -1.396  -41.843 1.00 56.83 ? 232 ARG D CB  1 
ATOM   6867 C CG  . ARG D 1 238 ? 36.243  -2.892  -41.789 1.00 59.19 ? 232 ARG D CG  1 
ATOM   6868 C CD  . ARG D 1 238 ? 37.749  -3.195  -41.881 1.00 61.63 ? 232 ARG D CD  1 
ATOM   6869 N NE  . ARG D 1 238 ? 38.485  -3.001  -40.623 1.00 60.36 ? 232 ARG D NE  1 
ATOM   6870 C CZ  . ARG D 1 238 ? 39.658  -3.577  -40.357 1.00 60.13 ? 232 ARG D CZ  1 
ATOM   6871 N NH1 . ARG D 1 238 ? 40.234  -4.394  -41.247 1.00 59.89 ? 232 ARG D NH1 1 
ATOM   6872 N NH2 . ARG D 1 238 ? 40.254  -3.345  -39.201 1.00 58.76 ? 232 ARG D NH2 1 
ATOM   6873 N N   . THR D 1 239 ? 34.071  -0.526  -44.450 1.00 55.40 ? 233 THR D N   1 
ATOM   6874 C CA  . THR D 1 239 ? 33.164  -0.796  -45.595 1.00 55.23 ? 233 THR D CA  1 
ATOM   6875 C C   . THR D 1 239 ? 33.628  -0.196  -46.921 1.00 55.03 ? 233 THR D C   1 
ATOM   6876 O O   . THR D 1 239 ? 33.301  -0.725  -47.981 1.00 55.42 ? 233 THR D O   1 
ATOM   6877 C CB  . THR D 1 239 ? 31.725  -0.252  -45.372 1.00 55.52 ? 233 THR D CB  1 
ATOM   6878 O OG1 . THR D 1 239 ? 31.286  -0.522  -44.032 1.00 56.67 ? 233 THR D OG1 1 
ATOM   6879 C CG2 . THR D 1 239 ? 30.747  -0.871  -46.362 1.00 55.29 ? 233 THR D CG2 1 
ATOM   6880 N N   . LEU D 1 240 ? 34.342  0.931   -46.877 1.00 54.45 ? 234 LEU D N   1 
ATOM   6881 C CA  . LEU D 1 240 ? 34.925  1.494   -48.091 1.00 53.85 ? 234 LEU D CA  1 
ATOM   6882 C C   . LEU D 1 240 ? 35.903  0.535   -48.767 1.00 53.99 ? 234 LEU D C   1 
ATOM   6883 O O   . LEU D 1 240 ? 35.957  0.475   -50.002 1.00 54.33 ? 234 LEU D O   1 
ATOM   6884 C CB  . LEU D 1 240 ? 35.639  2.830   -47.824 1.00 53.71 ? 234 LEU D CB  1 
ATOM   6885 C CG  . LEU D 1 240 ? 34.939  4.192   -47.970 1.00 52.54 ? 234 LEU D CG  1 
ATOM   6886 C CD1 . LEU D 1 240 ? 33.757  4.130   -48.900 1.00 52.03 ? 234 LEU D CD1 1 
ATOM   6887 C CD2 . LEU D 1 240 ? 34.487  4.734   -46.645 1.00 51.70 ? 234 LEU D CD2 1 
ATOM   6888 N N   . CYS D 1 241 ? 36.671  -0.206  -47.973 1.00 53.50 ? 235 CYS D N   1 
ATOM   6889 C CA  . CYS D 1 241 ? 37.708  -1.064  -48.518 1.00 54.39 ? 235 CYS D CA  1 
ATOM   6890 C C   . CYS D 1 241 ? 37.137  -2.126  -49.415 1.00 54.46 ? 235 CYS D C   1 
ATOM   6891 O O   . CYS D 1 241 ? 37.789  -2.547  -50.376 1.00 54.85 ? 235 CYS D O   1 
ATOM   6892 C CB  . CYS D 1 241 ? 38.509  -1.727  -47.420 1.00 54.38 ? 235 CYS D CB  1 
ATOM   6893 S SG  . CYS D 1 241 ? 39.071  -0.548  -46.191 1.00 58.98 ? 235 CYS D SG  1 
ATOM   6894 N N   . THR D 1 242 ? 35.916  -2.554  -49.109 1.00 54.47 ? 236 THR D N   1 
ATOM   6895 C CA  . THR D 1 242 ? 35.239  -3.552  -49.917 1.00 54.42 ? 236 THR D CA  1 
ATOM   6896 C C   . THR D 1 242 ? 34.934  -3.046  -51.327 1.00 54.51 ? 236 THR D C   1 
ATOM   6897 O O   . THR D 1 242 ? 35.265  -3.719  -52.309 1.00 54.65 ? 236 THR D O   1 
ATOM   6898 C CB  . THR D 1 242 ? 34.031  -4.112  -49.191 1.00 54.62 ? 236 THR D CB  1 
ATOM   6899 O OG1 . THR D 1 242 ? 34.515  -4.882  -48.085 1.00 54.72 ? 236 THR D OG1 1 
ATOM   6900 C CG2 . THR D 1 242 ? 33.191  -5.012  -50.101 1.00 54.32 ? 236 THR D CG2 1 
ATOM   6901 N N   . GLN D 1 243 ? 34.361  -1.848  -51.438 1.00 54.26 ? 237 GLN D N   1 
ATOM   6902 C CA  . GLN D 1 243 ? 34.230  -1.213  -52.751 1.00 53.58 ? 237 GLN D CA  1 
ATOM   6903 C C   . GLN D 1 243 ? 35.559  -1.315  -53.455 1.00 53.26 ? 237 GLN D C   1 
ATOM   6904 O O   . GLN D 1 243 ? 35.621  -1.700  -54.624 1.00 53.51 ? 237 GLN D O   1 
ATOM   6905 C CB  . GLN D 1 243 ? 33.839  0.255   -52.637 1.00 53.83 ? 237 GLN D CB  1 
ATOM   6906 C CG  . GLN D 1 243 ? 32.549  0.519   -51.868 1.00 54.14 ? 237 GLN D CG  1 
ATOM   6907 C CD  . GLN D 1 243 ? 31.858  1.813   -52.289 1.00 54.70 ? 237 GLN D CD  1 
ATOM   6908 O OE1 . GLN D 1 243 ? 31.865  2.194   -53.475 1.00 53.79 ? 237 GLN D OE1 1 
ATOM   6909 N NE2 . GLN D 1 243 ? 31.239  2.490   -51.315 1.00 54.44 ? 237 GLN D NE2 1 
ATOM   6910 N N   . GLY D 1 244 ? 36.626  -0.994  -52.720 1.00 52.65 ? 238 GLY D N   1 
ATOM   6911 C CA  . GLY D 1 244 ? 37.982  -1.031  -53.263 1.00 51.53 ? 238 GLY D CA  1 
ATOM   6912 C C   . GLY D 1 244 ? 38.279  -2.358  -53.900 1.00 50.79 ? 238 GLY D C   1 
ATOM   6913 O O   . GLY D 1 244 ? 38.584  -2.400  -55.086 1.00 50.60 ? 238 GLY D O   1 
ATOM   6914 N N   . LEU D 1 245 ? 38.155  -3.434  -53.109 1.00 50.36 ? 239 LEU D N   1 
ATOM   6915 C CA  . LEU D 1 245 ? 38.341  -4.824  -53.570 1.00 49.71 ? 239 LEU D CA  1 
ATOM   6916 C C   . LEU D 1 245 ? 37.531  -5.125  -54.841 1.00 49.99 ? 239 LEU D C   1 
ATOM   6917 O O   . LEU D 1 245 ? 38.070  -5.594  -55.860 1.00 50.31 ? 239 LEU D O   1 
ATOM   6918 C CB  . LEU D 1 245 ? 37.988  -5.808  -52.461 1.00 49.11 ? 239 LEU D CB  1 
ATOM   6919 C CG  . LEU D 1 245 ? 38.870  -5.799  -51.212 1.00 48.02 ? 239 LEU D CG  1 
ATOM   6920 C CD1 . LEU D 1 245 ? 38.171  -6.431  -50.027 1.00 45.25 ? 239 LEU D CD1 1 
ATOM   6921 C CD2 . LEU D 1 245 ? 40.192  -6.505  -51.491 1.00 48.44 ? 239 LEU D CD2 1 
ATOM   6922 N N   . GLN D 1 246 ? 36.249  -4.794  -54.793 1.00 49.81 ? 240 GLN D N   1 
ATOM   6923 C CA  . GLN D 1 246 ? 35.401  -4.842  -55.964 1.00 50.10 ? 240 GLN D CA  1 
ATOM   6924 C C   . GLN D 1 246 ? 35.929  -4.059  -57.181 1.00 51.07 ? 240 GLN D C   1 
ATOM   6925 O O   . GLN D 1 246 ? 35.635  -4.413  -58.325 1.00 51.54 ? 240 GLN D O   1 
ATOM   6926 C CB  . GLN D 1 246 ? 34.012  -4.369  -55.596 1.00 49.66 ? 240 GLN D CB  1 
ATOM   6927 C CG  . GLN D 1 246 ? 33.286  -5.344  -54.697 1.00 49.63 ? 240 GLN D CG  1 
ATOM   6928 C CD  . GLN D 1 246 ? 31.946  -4.838  -54.261 1.00 49.85 ? 240 GLN D CD  1 
ATOM   6929 O OE1 . GLN D 1 246 ? 31.835  -4.177  -53.231 1.00 50.08 ? 240 GLN D OE1 1 
ATOM   6930 N NE2 . GLN D 1 246 ? 30.908  -5.161  -55.028 1.00 50.89 ? 240 GLN D NE2 1 
ATOM   6931 N N   . ARG D 1 247 ? 36.705  -3.001  -56.951 1.00 51.42 ? 241 ARG D N   1 
ATOM   6932 C CA  . ARG D 1 247 ? 37.266  -2.279  -58.063 1.00 51.16 ? 241 ARG D CA  1 
ATOM   6933 C C   . ARG D 1 247 ? 38.561  -2.906  -58.556 1.00 52.24 ? 241 ARG D C   1 
ATOM   6934 O O   . ARG D 1 247 ? 38.811  -2.910  -59.761 1.00 52.96 ? 241 ARG D O   1 
ATOM   6935 C CB  . ARG D 1 247 ? 37.478  -0.829  -57.719 1.00 50.81 ? 241 ARG D CB  1 
ATOM   6936 C CG  . ARG D 1 247 ? 37.875  0.007   -58.910 1.00 49.28 ? 241 ARG D CG  1 
ATOM   6937 C CD  . ARG D 1 247 ? 36.799  0.056   -59.981 1.00 46.79 ? 241 ARG D CD  1 
ATOM   6938 N NE  . ARG D 1 247 ? 37.322  0.739   -61.156 1.00 46.18 ? 241 ARG D NE  1 
ATOM   6939 C CZ  . ARG D 1 247 ? 36.609  1.152   -62.201 1.00 45.61 ? 241 ARG D CZ  1 
ATOM   6940 N NH1 . ARG D 1 247 ? 35.302  0.971   -62.248 1.00 45.88 ? 241 ARG D NH1 1 
ATOM   6941 N NH2 . ARG D 1 247 ? 37.215  1.765   -63.211 1.00 45.62 ? 241 ARG D NH2 1 
ATOM   6942 N N   . ILE D 1 248 ? 39.400  -3.434  -57.666 1.00 52.48 ? 242 ILE D N   1 
ATOM   6943 C CA  . ILE D 1 248 ? 40.543  -4.214  -58.160 1.00 52.42 ? 242 ILE D CA  1 
ATOM   6944 C C   . ILE D 1 248 ? 40.059  -5.455  -58.946 1.00 52.66 ? 242 ILE D C   1 
ATOM   6945 O O   . ILE D 1 248 ? 40.587  -5.751  -60.017 1.00 52.27 ? 242 ILE D O   1 
ATOM   6946 C CB  . ILE D 1 248 ? 41.547  -4.592  -57.044 1.00 52.49 ? 242 ILE D CB  1 
ATOM   6947 C CG1 . ILE D 1 248 ? 42.196  -3.350  -56.475 1.00 51.71 ? 242 ILE D CG1 1 
ATOM   6948 C CG2 . ILE D 1 248 ? 42.671  -5.491  -57.556 1.00 52.65 ? 242 ILE D CG2 1 
ATOM   6949 C CD1 . ILE D 1 248 ? 41.844  -3.119  -55.070 1.00 52.98 ? 242 ILE D CD1 1 
ATOM   6950 N N   . PHE D 1 249 ? 39.036  -6.148  -58.439 1.00 53.16 ? 243 PHE D N   1 
ATOM   6951 C CA  . PHE D 1 249 ? 38.543  -7.371  -59.108 1.00 53.62 ? 243 PHE D CA  1 
ATOM   6952 C C   . PHE D 1 249 ? 38.140  -7.121  -60.546 1.00 53.94 ? 243 PHE D C   1 
ATOM   6953 O O   . PHE D 1 249 ? 38.707  -7.714  -61.460 1.00 54.24 ? 243 PHE D O   1 
ATOM   6954 C CB  . PHE D 1 249 ? 37.377  -8.027  -58.362 1.00 53.48 ? 243 PHE D CB  1 
ATOM   6955 C CG  . PHE D 1 249 ? 36.940  -9.340  -58.970 1.00 53.31 ? 243 PHE D CG  1 
ATOM   6956 C CD1 . PHE D 1 249 ? 37.687  -10.503 -58.758 1.00 53.70 ? 243 PHE D CD1 1 
ATOM   6957 C CD2 . PHE D 1 249 ? 35.801  -9.416  -59.757 1.00 50.92 ? 243 PHE D CD2 1 
ATOM   6958 C CE1 . PHE D 1 249 ? 37.303  -11.725 -59.317 1.00 52.84 ? 243 PHE D CE1 1 
ATOM   6959 C CE2 . PHE D 1 249 ? 35.423  -10.608 -60.313 1.00 51.44 ? 243 PHE D CE2 1 
ATOM   6960 C CZ  . PHE D 1 249 ? 36.172  -11.775 -60.097 1.00 52.64 ? 243 PHE D CZ  1 
ATOM   6961 N N   . TYR D 1 250 ? 37.167  -6.233  -60.730 1.00 54.46 ? 244 TYR D N   1 
ATOM   6962 C CA  . TYR D 1 250 ? 36.726  -5.782  -62.045 1.00 55.14 ? 244 TYR D CA  1 
ATOM   6963 C C   . TYR D 1 250 ? 37.884  -5.427  -62.968 1.00 55.94 ? 244 TYR D C   1 
ATOM   6964 O O   . TYR D 1 250 ? 37.852  -5.752  -64.147 1.00 56.16 ? 244 TYR D O   1 
ATOM   6965 C CB  . TYR D 1 250 ? 35.794  -4.591  -61.879 1.00 55.25 ? 244 TYR D CB  1 
ATOM   6966 C CG  . TYR D 1 250 ? 35.465  -3.797  -63.126 1.00 55.41 ? 244 TYR D CG  1 
ATOM   6967 C CD1 . TYR D 1 250 ? 34.534  -4.273  -64.071 1.00 56.27 ? 244 TYR D CD1 1 
ATOM   6968 C CD2 . TYR D 1 250 ? 36.037  -2.540  -63.335 1.00 54.42 ? 244 TYR D CD2 1 
ATOM   6969 C CE1 . TYR D 1 250 ? 34.212  -3.523  -65.223 1.00 56.84 ? 244 TYR D CE1 1 
ATOM   6970 C CE2 . TYR D 1 250 ? 35.723  -1.780  -64.465 1.00 55.71 ? 244 TYR D CE2 1 
ATOM   6971 C CZ  . TYR D 1 250 ? 34.812  -2.266  -65.406 1.00 56.82 ? 244 TYR D CZ  1 
ATOM   6972 O OH  . TYR D 1 250 ? 34.515  -1.493  -66.518 1.00 56.72 ? 244 TYR D OH  1 
ATOM   6973 N N   . LEU D 1 251 ? 38.910  -4.771  -62.438 1.00 56.76 ? 245 LEU D N   1 
ATOM   6974 C CA  . LEU D 1 251 ? 40.025  -4.380  -63.282 1.00 57.80 ? 245 LEU D CA  1 
ATOM   6975 C C   . LEU D 1 251 ? 40.821  -5.595  -63.763 1.00 59.23 ? 245 LEU D C   1 
ATOM   6976 O O   . LEU D 1 251 ? 41.167  -5.678  -64.957 1.00 59.16 ? 245 LEU D O   1 
ATOM   6977 C CB  . LEU D 1 251 ? 40.916  -3.353  -62.590 1.00 57.29 ? 245 LEU D CB  1 
ATOM   6978 C CG  . LEU D 1 251 ? 40.265  -1.993  -62.315 1.00 55.97 ? 245 LEU D CG  1 
ATOM   6979 C CD1 . LEU D 1 251 ? 41.290  -1.085  -61.723 1.00 54.87 ? 245 LEU D CD1 1 
ATOM   6980 C CD2 . LEU D 1 251 ? 39.641  -1.358  -63.551 1.00 54.18 ? 245 LEU D CD2 1 
ATOM   6981 N N   . LYS D 1 252 ? 41.071  -6.539  -62.844 1.00 60.54 ? 246 LYS D N   1 
ATOM   6982 C CA  . LYS D 1 252 ? 41.765  -7.801  -63.157 1.00 61.76 ? 246 LYS D CA  1 
ATOM   6983 C C   . LYS D 1 252 ? 40.992  -8.601  -64.205 1.00 62.95 ? 246 LYS D C   1 
ATOM   6984 O O   . LYS D 1 252 ? 41.581  -9.347  -64.993 1.00 62.94 ? 246 LYS D O   1 
ATOM   6985 C CB  . LYS D 1 252 ? 41.955  -8.652  -61.897 1.00 61.48 ? 246 LYS D CB  1 
ATOM   6986 C CG  . LYS D 1 252 ? 42.912  -8.075  -60.860 1.00 61.44 ? 246 LYS D CG  1 
ATOM   6987 C CD  . LYS D 1 252 ? 42.907  -8.882  -59.565 1.00 61.96 ? 246 LYS D CD  1 
ATOM   6988 C CE  . LYS D 1 252 ? 43.689  -10.223 -59.683 1.00 62.78 ? 246 LYS D CE  1 
ATOM   6989 N NZ  . LYS D 1 252 ? 42.849  -11.402 -60.104 1.00 60.57 ? 246 LYS D NZ  1 
ATOM   6990 N N   . LEU D 1 253 ? 39.669  -8.435  -64.203 1.00 64.15 ? 247 LEU D N   1 
ATOM   6991 C CA  . LEU D 1 253 ? 38.811  -9.086  -65.174 1.00 65.27 ? 247 LEU D CA  1 
ATOM   6992 C C   . LEU D 1 253 ? 38.949  -8.491  -66.553 1.00 66.79 ? 247 LEU D C   1 
ATOM   6993 O O   . LEU D 1 253 ? 38.524  -9.099  -67.532 1.00 67.16 ? 247 LEU D O   1 
ATOM   6994 C CB  . LEU D 1 253 ? 37.360  -8.985  -64.748 1.00 64.93 ? 247 LEU D CB  1 
ATOM   6995 C CG  . LEU D 1 253 ? 36.820  -10.099 -63.868 1.00 63.49 ? 247 LEU D CG  1 
ATOM   6996 C CD1 . LEU D 1 253 ? 35.420  -9.702  -63.501 1.00 62.03 ? 247 LEU D CD1 1 
ATOM   6997 C CD2 . LEU D 1 253 ? 36.839  -11.421 -64.614 1.00 61.86 ? 247 LEU D CD2 1 
ATOM   6998 N N   . GLU D 1 254 ? 39.518  -7.297  -66.638 1.00 68.50 ? 248 GLU D N   1 
ATOM   6999 C CA  . GLU D 1 254 ? 39.744  -6.691  -67.934 1.00 70.72 ? 248 GLU D CA  1 
ATOM   7000 C C   . GLU D 1 254 ? 41.176  -6.940  -68.461 1.00 71.55 ? 248 GLU D C   1 
ATOM   7001 O O   . GLU D 1 254 ? 41.418  -6.810  -69.679 1.00 71.79 ? 248 GLU D O   1 
ATOM   7002 C CB  . GLU D 1 254 ? 39.386  -5.194  -67.915 1.00 71.31 ? 248 GLU D CB  1 
ATOM   7003 C CG  . GLU D 1 254 ? 38.067  -4.828  -67.189 1.00 73.54 ? 248 GLU D CG  1 
ATOM   7004 C CD  . GLU D 1 254 ? 36.797  -5.232  -67.944 1.00 77.11 ? 248 GLU D CD  1 
ATOM   7005 O OE1 . GLU D 1 254 ? 36.639  -6.439  -68.265 1.00 78.46 ? 248 GLU D OE1 1 
ATOM   7006 O OE2 . GLU D 1 254 ? 35.937  -4.340  -68.193 1.00 78.49 ? 248 GLU D OE2 1 
ATOM   7007 N N   . ASP D 1 255 ? 42.099  -7.282  -67.543 1.00 72.27 ? 249 ASP D N   1 
ATOM   7008 C CA  . ASP D 1 255 ? 43.525  -7.587  -67.827 1.00 73.10 ? 249 ASP D CA  1 
ATOM   7009 C C   . ASP D 1 255 ? 44.386  -6.377  -68.302 1.00 73.55 ? 249 ASP D C   1 
ATOM   7010 O O   . ASP D 1 255 ? 45.605  -6.334  -68.025 1.00 73.86 ? 249 ASP D O   1 
ATOM   7011 C CB  . ASP D 1 255 ? 43.649  -8.807  -68.773 1.00 73.21 ? 249 ASP D CB  1 
ATOM   7012 C CG  . ASP D 1 255 ? 45.103  -9.202  -69.073 1.00 73.75 ? 249 ASP D CG  1 
ATOM   7013 O OD1 . ASP D 1 255 ? 45.603  -10.140 -68.424 1.00 74.69 ? 249 ASP D OD1 1 
ATOM   7014 O OD2 . ASP D 1 255 ? 45.746  -8.589  -69.958 1.00 73.35 ? 249 ASP D OD2 1 
ATOM   7015 N N   . LEU D 1 256 ? 43.753  -5.407  -68.983 1.00 73.91 ? 250 LEU D N   1 
ATOM   7016 C CA  . LEU D 1 256 ? 44.429  -4.232  -69.610 1.00 73.87 ? 250 LEU D CA  1 
ATOM   7017 C C   . LEU D 1 256 ? 45.896  -4.043  -69.204 1.00 74.14 ? 250 LEU D C   1 
ATOM   7018 O O   . LEU D 1 256 ? 46.805  -4.301  -69.992 1.00 73.97 ? 250 LEU D O   1 
ATOM   7019 C CB  . LEU D 1 256 ? 43.617  -2.945  -69.395 1.00 73.75 ? 250 LEU D CB  1 
ATOM   7020 C CG  . LEU D 1 256 ? 42.405  -2.729  -70.313 1.00 73.81 ? 250 LEU D CG  1 
ATOM   7021 C CD1 . LEU D 1 256 ? 41.341  -1.827  -69.689 1.00 73.62 ? 250 LEU D CD1 1 
ATOM   7022 C CD2 . LEU D 1 256 ? 42.838  -2.178  -71.661 1.00 74.70 ? 250 LEU D CD2 1 
ATOM   7023 N N   . VAL D 1 257 ? 46.115  -3.610  -67.969 1.00 74.55 ? 251 VAL D N   1 
ATOM   7024 C CA  . VAL D 1 257 ? 47.454  -3.603  -67.404 1.00 75.11 ? 251 VAL D CA  1 
ATOM   7025 C C   . VAL D 1 257 ? 47.543  -4.488  -66.160 1.00 75.59 ? 251 VAL D C   1 
ATOM   7026 O O   . VAL D 1 257 ? 46.699  -4.402  -65.265 1.00 75.43 ? 251 VAL D O   1 
ATOM   7027 C CB  . VAL D 1 257 ? 47.965  -2.177  -67.116 1.00 75.11 ? 251 VAL D CB  1 
ATOM   7028 C CG1 . VAL D 1 257 ? 48.245  -1.454  -68.429 1.00 75.28 ? 251 VAL D CG1 1 
ATOM   7029 C CG2 . VAL D 1 257 ? 46.982  -1.397  -66.247 1.00 74.32 ? 251 VAL D CG2 1 
ATOM   7030 N N   . PRO D 1 258 ? 48.580  -5.341  -66.103 1.00 76.19 ? 252 PRO D N   1 
ATOM   7031 C CA  . PRO D 1 258 ? 48.768  -6.268  -64.994 1.00 76.69 ? 252 PRO D CA  1 
ATOM   7032 C C   . PRO D 1 258 ? 48.921  -5.512  -63.682 1.00 77.27 ? 252 PRO D C   1 
ATOM   7033 O O   . PRO D 1 258 ? 49.549  -4.456  -63.665 1.00 77.20 ? 252 PRO D O   1 
ATOM   7034 C CB  . PRO D 1 258 ? 50.084  -6.970  -65.343 1.00 76.58 ? 252 PRO D CB  1 
ATOM   7035 C CG  . PRO D 1 258 ? 50.225  -6.802  -66.810 1.00 76.57 ? 252 PRO D CG  1 
ATOM   7036 C CD  . PRO D 1 258 ? 49.660  -5.456  -67.099 1.00 76.21 ? 252 PRO D CD  1 
ATOM   7037 N N   . PRO D 1 259 ? 48.366  -6.054  -62.578 1.00 78.10 ? 253 PRO D N   1 
ATOM   7038 C CA  . PRO D 1 259 ? 48.487  -5.325  -61.295 1.00 78.44 ? 253 PRO D CA  1 
ATOM   7039 C C   . PRO D 1 259 ? 49.915  -5.434  -60.795 1.00 78.60 ? 253 PRO D C   1 
ATOM   7040 O O   . PRO D 1 259 ? 50.643  -6.324  -61.228 1.00 78.83 ? 253 PRO D O   1 
ATOM   7041 C CB  . PRO D 1 259 ? 47.531  -6.077  -60.349 1.00 78.49 ? 253 PRO D CB  1 
ATOM   7042 C CG  . PRO D 1 259 ? 47.453  -7.497  -60.923 1.00 78.78 ? 253 PRO D CG  1 
ATOM   7043 C CD  . PRO D 1 259 ? 47.661  -7.351  -62.438 1.00 78.17 ? 253 PRO D CD  1 
ATOM   7044 N N   . PRO D 1 260 ? 50.342  -4.523  -59.920 1.00 78.85 ? 254 PRO D N   1 
ATOM   7045 C CA  . PRO D 1 260 ? 51.655  -4.740  -59.308 1.00 79.01 ? 254 PRO D CA  1 
ATOM   7046 C C   . PRO D 1 260 ? 51.691  -6.017  -58.463 1.00 79.10 ? 254 PRO D C   1 
ATOM   7047 O O   . PRO D 1 260 ? 50.675  -6.385  -57.871 1.00 79.26 ? 254 PRO D O   1 
ATOM   7048 C CB  . PRO D 1 260 ? 51.832  -3.509  -58.429 1.00 79.05 ? 254 PRO D CB  1 
ATOM   7049 C CG  . PRO D 1 260 ? 50.933  -2.469  -59.066 1.00 79.02 ? 254 PRO D CG  1 
ATOM   7050 C CD  . PRO D 1 260 ? 49.733  -3.258  -59.484 1.00 78.81 ? 254 PRO D CD  1 
ATOM   7051 N N   . PRO D 1 261 ? 52.845  -6.712  -58.436 1.00 79.20 ? 255 PRO D N   1 
ATOM   7052 C CA  . PRO D 1 261 ? 52.988  -7.863  -57.531 1.00 79.13 ? 255 PRO D CA  1 
ATOM   7053 C C   . PRO D 1 261 ? 52.737  -7.464  -56.071 1.00 79.13 ? 255 PRO D C   1 
ATOM   7054 O O   . PRO D 1 261 ? 52.280  -8.284  -55.273 1.00 79.35 ? 255 PRO D O   1 
ATOM   7055 C CB  . PRO D 1 261 ? 54.453  -8.303  -57.728 1.00 79.01 ? 255 PRO D CB  1 
ATOM   7056 C CG  . PRO D 1 261 ? 55.134  -7.165  -58.450 1.00 79.10 ? 255 PRO D CG  1 
ATOM   7057 C CD  . PRO D 1 261 ? 54.062  -6.478  -59.241 1.00 79.19 ? 255 PRO D CD  1 
ATOM   7058 N N   . ILE D 1 262 ? 53.020  -6.204  -55.741 1.00 79.03 ? 256 ILE D N   1 
ATOM   7059 C CA  . ILE D 1 262 ? 52.849  -5.677  -54.381 1.00 78.67 ? 256 ILE D CA  1 
ATOM   7060 C C   . ILE D 1 262 ? 51.367  -5.677  -53.990 1.00 78.26 ? 256 ILE D C   1 
ATOM   7061 O O   . ILE D 1 262 ? 50.987  -6.294  -52.984 1.00 78.19 ? 256 ILE D O   1 
ATOM   7062 C CB  . ILE D 1 262 ? 53.537  -4.248  -54.187 1.00 78.85 ? 256 ILE D CB  1 
ATOM   7063 C CG1 . ILE D 1 262 ? 53.260  -3.310  -55.396 1.00 78.71 ? 256 ILE D CG1 1 
ATOM   7064 C CG2 . ILE D 1 262 ? 55.054  -4.408  -53.847 1.00 79.07 ? 256 ILE D CG2 1 
ATOM   7065 C CD1 . ILE D 1 262 ? 54.307  -2.206  -55.693 1.00 78.60 ? 256 ILE D CD1 1 
ATOM   7066 N N   . ILE D 1 263 ? 50.557  -5.017  -54.832 1.00 77.59 ? 257 ILE D N   1 
ATOM   7067 C CA  . ILE D 1 263 ? 49.120  -4.794  -54.654 1.00 76.39 ? 257 ILE D CA  1 
ATOM   7068 C C   . ILE D 1 263 ? 48.356  -6.092  -54.849 1.00 76.18 ? 257 ILE D C   1 
ATOM   7069 O O   . ILE D 1 263 ? 47.296  -6.298  -54.254 1.00 75.84 ? 257 ILE D O   1 
ATOM   7070 C CB  . ILE D 1 263 ? 48.595  -3.763  -55.690 1.00 76.33 ? 257 ILE D CB  1 
ATOM   7071 C CG1 . ILE D 1 263 ? 49.394  -2.452  -55.636 1.00 75.76 ? 257 ILE D CG1 1 
ATOM   7072 C CG2 . ILE D 1 263 ? 47.096  -3.500  -55.526 1.00 75.45 ? 257 ILE D CG2 1 
ATOM   7073 C CD1 . ILE D 1 263 ? 49.483  -1.811  -54.273 1.00 75.81 ? 257 ILE D CD1 1 
ATOM   7074 N N   . ASP D 1 264 ? 48.896  -6.976  -55.676 1.00 75.83 ? 258 ASP D N   1 
ATOM   7075 C CA  . ASP D 1 264 ? 48.218  -8.223  -55.927 1.00 75.88 ? 258 ASP D CA  1 
ATOM   7076 C C   . ASP D 1 264 ? 48.166  -9.134  -54.716 1.00 75.98 ? 258 ASP D C   1 
ATOM   7077 O O   . ASP D 1 264 ? 47.137  -9.774  -54.458 1.00 75.86 ? 258 ASP D O   1 
ATOM   7078 C CB  . ASP D 1 264 ? 48.841  -8.963  -57.079 1.00 75.77 ? 258 ASP D CB  1 
ATOM   7079 C CG  . ASP D 1 264 ? 47.907  -9.963  -57.649 1.00 75.92 ? 258 ASP D CG  1 
ATOM   7080 O OD1 . ASP D 1 264 ? 46.680  -9.724  -57.538 1.00 76.20 ? 258 ASP D OD1 1 
ATOM   7081 O OD2 . ASP D 1 264 ? 48.388  -10.977 -58.190 1.00 76.24 ? 258 ASP D OD2 1 
ATOM   7082 N N   . LYS D 1 265 ? 49.277  -9.184  -53.986 1.00 76.14 ? 259 LYS D N   1 
ATOM   7083 C CA  . LYS D 1 265 ? 49.392  -9.995  -52.777 1.00 76.65 ? 259 LYS D CA  1 
ATOM   7084 C C   . LYS D 1 265 ? 48.389  -9.563  -51.695 1.00 76.84 ? 259 LYS D C   1 
ATOM   7085 O O   . LYS D 1 265 ? 47.854  -10.399 -50.965 1.00 77.20 ? 259 LYS D O   1 
ATOM   7086 C CB  . LYS D 1 265 ? 50.826  -9.940  -52.236 1.00 76.65 ? 259 LYS D CB  1 
ATOM   7087 C CG  . LYS D 1 265 ? 51.129  -10.920 -51.107 1.00 76.81 ? 259 LYS D CG  1 
ATOM   7088 C CD  . LYS D 1 265 ? 52.525  -10.681 -50.548 1.00 76.89 ? 259 LYS D CD  1 
ATOM   7089 C CE  . LYS D 1 265 ? 52.829  -11.597 -49.378 1.00 76.96 ? 259 LYS D CE  1 
ATOM   7090 N NZ  . LYS D 1 265 ? 53.008  -13.004 -49.843 1.00 77.52 ? 259 LYS D NZ  1 
ATOM   7091 N N   . ILE D 1 266 ? 48.135  -8.263  -51.603 1.00 76.89 ? 260 ILE D N   1 
ATOM   7092 C CA  . ILE D 1 266 ? 47.187  -7.723  -50.635 1.00 77.04 ? 260 ILE D CA  1 
ATOM   7093 C C   . ILE D 1 266 ? 45.731  -7.961  -51.095 1.00 77.08 ? 260 ILE D C   1 
ATOM   7094 O O   . ILE D 1 266 ? 44.853  -8.321  -50.284 1.00 76.84 ? 260 ILE D O   1 
ATOM   7095 C CB  . ILE D 1 266 ? 47.473  -6.236  -50.369 1.00 77.21 ? 260 ILE D CB  1 
ATOM   7096 C CG1 . ILE D 1 266 ? 48.952  -6.039  -49.999 1.00 77.53 ? 260 ILE D CG1 1 
ATOM   7097 C CG2 . ILE D 1 266 ? 46.550  -5.689  -49.279 1.00 77.91 ? 260 ILE D CG2 1 
ATOM   7098 C CD1 . ILE D 1 266 ? 49.387  -4.584  -49.802 1.00 77.17 ? 260 ILE D CD1 1 
ATOM   7099 N N   . PHE D 1 267 ? 45.486  -7.784  -52.395 1.00 77.02 ? 261 PHE D N   1 
ATOM   7100 C CA  . PHE D 1 267 ? 44.242  -8.253  -52.975 1.00 76.98 ? 261 PHE D CA  1 
ATOM   7101 C C   . PHE D 1 267 ? 44.010  -9.723  -52.619 1.00 77.49 ? 261 PHE D C   1 
ATOM   7102 O O   . PHE D 1 267 ? 42.973  -10.054 -52.056 1.00 77.67 ? 261 PHE D O   1 
ATOM   7103 C CB  . PHE D 1 267 ? 44.174  -8.056  -54.492 1.00 76.43 ? 261 PHE D CB  1 
ATOM   7104 C CG  . PHE D 1 267 ? 42.939  -8.660  -55.112 1.00 76.03 ? 261 PHE D CG  1 
ATOM   7105 C CD1 . PHE D 1 267 ? 41.720  -7.990  -55.062 1.00 74.96 ? 261 PHE D CD1 1 
ATOM   7106 C CD2 . PHE D 1 267 ? 42.985  -9.930  -55.705 1.00 76.51 ? 261 PHE D CD2 1 
ATOM   7107 C CE1 . PHE D 1 267 ? 40.571  -8.549  -55.608 1.00 75.50 ? 261 PHE D CE1 1 
ATOM   7108 C CE2 . PHE D 1 267 ? 41.844  -10.505 -56.268 1.00 75.55 ? 261 PHE D CE2 1 
ATOM   7109 C CZ  . PHE D 1 267 ? 40.634  -9.816  -56.221 1.00 76.07 ? 261 PHE D CZ  1 
ATOM   7110 N N   . MET D 1 268 ? 44.973  -10.593 -52.917 1.00 77.94 ? 262 MET D N   1 
ATOM   7111 C CA  . MET D 1 268 ? 44.789  -12.033 -52.671 1.00 78.65 ? 262 MET D CA  1 
ATOM   7112 C C   . MET D 1 268 ? 44.460  -12.428 -51.222 1.00 78.47 ? 262 MET D C   1 
ATOM   7113 O O   . MET D 1 268 ? 43.915  -13.502 -50.992 1.00 78.43 ? 262 MET D O   1 
ATOM   7114 C CB  . MET D 1 268 ? 45.961  -12.868 -53.215 1.00 79.07 ? 262 MET D CB  1 
ATOM   7115 C CG  . MET D 1 268 ? 46.028  -12.958 -54.747 1.00 80.78 ? 262 MET D CG  1 
ATOM   7116 S SD  . MET D 1 268 ? 44.422  -13.179 -55.578 1.00 85.96 ? 262 MET D SD  1 
ATOM   7117 C CE  . MET D 1 268 ? 43.805  -14.725 -54.886 1.00 83.82 ? 262 MET D CE  1 
ATOM   7118 N N   . ASP D 1 269 ? 44.768  -11.559 -50.258 1.00 78.62 ? 263 ASP D N   1 
ATOM   7119 C CA  . ASP D 1 269 ? 44.349  -11.769 -48.854 1.00 78.51 ? 263 ASP D CA  1 
ATOM   7120 C C   . ASP D 1 269 ? 42.956  -11.159 -48.540 1.00 78.60 ? 263 ASP D C   1 
ATOM   7121 O O   . ASP D 1 269 ? 42.821  -9.942  -48.317 1.00 78.31 ? 263 ASP D O   1 
ATOM   7122 C CB  . ASP D 1 269 ? 45.432  -11.294 -47.886 1.00 78.13 ? 263 ASP D CB  1 
ATOM   7123 C CG  . ASP D 1 269 ? 46.819  -11.787 -48.283 1.00 78.10 ? 263 ASP D CG  1 
ATOM   7124 O OD1 . ASP D 1 269 ? 46.916  -12.741 -49.093 1.00 77.67 ? 263 ASP D OD1 1 
ATOM   7125 O OD2 . ASP D 1 269 ? 47.818  -11.212 -47.795 1.00 77.46 ? 263 ASP D OD2 1 
ATOM   7126 N N   . THR D 1 270 ? 41.952  -12.057 -48.553 1.00 78.40 ? 264 THR D N   1 
ATOM   7127 C CA  . THR D 1 270 ? 40.501  -11.800 -48.508 1.00 77.74 ? 264 THR D CA  1 
ATOM   7128 C C   . THR D 1 270 ? 39.777  -13.147 -48.288 1.00 77.63 ? 264 THR D C   1 
ATOM   7129 O O   . THR D 1 270 ? 40.287  -14.199 -48.703 1.00 77.23 ? 264 THR D O   1 
ATOM   7130 C CB  . THR D 1 270 ? 39.980  -11.237 -49.849 1.00 78.06 ? 264 THR D CB  1 
ATOM   7131 O OG1 . THR D 1 270 ? 40.497  -12.019 -50.943 1.00 76.90 ? 264 THR D OG1 1 
ATOM   7132 C CG2 . THR D 1 270 ? 40.342  -9.758  -50.020 1.00 77.42 ? 264 THR D CG2 1 
ATOM   7133 N N   . LEU D 1 271 ? 38.581  -13.110 -47.687 1.00 77.39 ? 265 LEU D N   1 
ATOM   7134 C CA  . LEU D 1 271 ? 37.902  -14.327 -47.168 1.00 77.01 ? 265 LEU D CA  1 
ATOM   7135 C C   . LEU D 1 271 ? 37.622  -15.409 -48.212 1.00 76.96 ? 265 LEU D C   1 
ATOM   7136 O O   . LEU D 1 271 ? 38.372  -16.378 -48.341 1.00 76.70 ? 265 LEU D O   1 
ATOM   7137 C CB  . LEU D 1 271 ? 36.620  -13.956 -46.441 1.00 76.63 ? 265 LEU D CB  1 
HETATM 7138 O O   . HOH E 2 .   ? 27.898  14.559  13.962  1.00 34.10 ? 268 HOH A O   1 
HETATM 7139 O O   . HOH E 2 .   ? 36.320  10.490  -2.393  1.00 38.17 ? 269 HOH A O   1 
HETATM 7140 O O   . HOH E 2 .   ? 24.700  23.369  3.223   1.00 37.37 ? 270 HOH A O   1 
HETATM 7141 O O   . HOH E 2 .   ? 10.940  23.092  -2.169  1.00 29.25 ? 271 HOH A O   1 
HETATM 7142 O O   . HOH F 2 .   ? 37.756  -5.116  -8.243  1.00 36.20 ? 268 HOH B O   1 
HETATM 7143 O O   . HOH F 2 .   ? 33.567  -20.805 -22.791 1.00 47.19 ? 269 HOH B O   1 
HETATM 7144 O O   . HOH G 2 .   ? -4.238  4.610   -36.548 1.00 15.04 ? 268 HOH C O   1 
HETATM 7145 O O   . HOH G 2 .   ? 5.839   19.810  -36.613 1.00 49.76 ? 269 HOH C O   1 
HETATM 7146 O O   . HOH H 2 .   ? 51.412  22.508  -60.751 1.00 13.08 ? 268 HOH D O   1 
HETATM 7147 O O   . HOH H 2 .   ? 36.703  21.074  -48.654 1.00 35.11 ? 269 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -5  ?   ?   ?   A . n 
A 1 2   GLY 2   -4  ?   ?   ?   A . n 
A 1 3   SER 3   -3  ?   ?   ?   A . n 
A 1 4   SER 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   HIS 7   1   ?   ?   ?   A . n 
A 1 8   HIS 8   2   ?   ?   ?   A . n 
A 1 9   HIS 9   3   ?   ?   ?   A . n 
A 1 10  HIS 10  4   ?   ?   ?   A . n 
A 1 11  SER 11  5   ?   ?   ?   A . n 
A 1 12  SER 12  6   ?   ?   ?   A . n 
A 1 13  GLY 13  7   ?   ?   ?   A . n 
A 1 14  LEU 14  8   ?   ?   ?   A . n 
A 1 15  VAL 15  9   ?   ?   ?   A . n 
A 1 16  PRO 16  10  ?   ?   ?   A . n 
A 1 17  ARG 17  11  ?   ?   ?   A . n 
A 1 18  GLY 18  12  ?   ?   ?   A . n 
A 1 19  SER 19  13  ?   ?   ?   A . n 
A 1 20  HIS 20  14  ?   ?   ?   A . n 
A 1 21  MET 21  15  ?   ?   ?   A . n 
A 1 22  GLY 22  16  ?   ?   ?   A . n 
A 1 23  ARG 23  17  ?   ?   ?   A . n 
A 1 24  LEU 24  18  ?   ?   ?   A . n 
A 1 25  PRO 25  19  ?   ?   ?   A . n 
A 1 26  SER 26  20  ?   ?   ?   A . n 
A 1 27  LYS 27  21  ?   ?   ?   A . n 
A 1 28  PRO 28  22  ?   ?   ?   A . n 
A 1 29  LYS 29  23  ?   ?   ?   A . n 
A 1 30  GLN 30  24  ?   ?   ?   A . n 
A 1 31  PRO 31  25  ?   ?   ?   A . n 
A 1 32  PRO 32  26  ?   ?   ?   A . n 
A 1 33  ASP 33  27  ?   ?   ?   A . n 
A 1 34  ALA 34  28  ?   ?   ?   A . n 
A 1 35  SER 35  29  ?   ?   ?   A . n 
A 1 36  PRO 36  30  ?   ?   ?   A . n 
A 1 37  ALA 37  31  ?   ?   ?   A . n 
A 1 38  ASN 38  32  32  ASN ASN A . n 
A 1 39  LEU 39  33  33  LEU LEU A . n 
A 1 40  LEU 40  34  34  LEU LEU A . n 
A 1 41  THR 41  35  35  THR THR A . n 
A 1 42  SER 42  36  36  SER SER A . n 
A 1 43  LEU 43  37  37  LEU LEU A . n 
A 1 44  VAL 44  38  38  VAL VAL A . n 
A 1 45  ARG 45  39  39  ARG ARG A . n 
A 1 46  ALA 46  40  40  ALA ALA A . n 
A 1 47  HIS 47  41  41  HIS HIS A . n 
A 1 48  LEU 48  42  42  LEU LEU A . n 
A 1 49  ASP 49  43  43  ASP ASP A . n 
A 1 50  SER 50  44  44  SER SER A . n 
A 1 51  GLY 51  45  45  GLY GLY A . n 
A 1 52  PRO 52  46  46  PRO PRO A . n 
A 1 53  SER 53  47  47  SER SER A . n 
A 1 54  THR 54  48  48  THR THR A . n 
A 1 55  ALA 55  49  49  ALA ALA A . n 
A 1 56  LYS 56  50  50  LYS LYS A . n 
A 1 57  LEU 57  51  51  LEU LEU A . n 
A 1 58  ASP 58  52  52  ASP ASP A . n 
A 1 59  TYR 59  53  53  TYR TYR A . n 
A 1 60  SER 60  54  54  SER SER A . n 
A 1 61  LYS 61  55  55  LYS LYS A . n 
A 1 62  PHE 62  56  56  PHE PHE A . n 
A 1 63  GLN 63  57  57  GLN GLN A . n 
A 1 64  GLU 64  58  58  GLU GLU A . n 
A 1 65  LEU 65  59  59  LEU LEU A . n 
A 1 66  VAL 66  60  60  VAL VAL A . n 
A 1 67  LEU 67  61  61  LEU LEU A . n 
A 1 68  PRO 68  62  62  PRO PRO A . n 
A 1 69  HIS 69  63  63  HIS HIS A . n 
A 1 70  PHE 70  64  64  PHE PHE A . n 
A 1 71  GLY 71  65  65  GLY GLY A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  GLU 73  67  67  GLU GLU A . n 
A 1 74  ASP 74  68  68  ASP ASP A . n 
A 1 75  ALA 75  69  69  ALA ALA A . n 
A 1 76  GLY 76  70  70  GLY GLY A . n 
A 1 77  ASP 77  71  71  ASP ASP A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  GLN 79  73  73  GLN GLN A . n 
A 1 80  GLN 80  74  74  GLN GLN A . n 
A 1 81  PHE 81  75  75  PHE PHE A . n 
A 1 82  TYR 82  76  76  TYR TYR A . n 
A 1 83  ASP 83  77  77  ASP ASP A . n 
A 1 84  LEU 84  78  78  LEU LEU A . n 
A 1 85  LEU 85  79  79  LEU LEU A . n 
A 1 86  SER 86  80  80  SER SER A . n 
A 1 87  GLY 87  81  81  GLY GLY A . n 
A 1 88  SER 88  82  82  SER SER A . n 
A 1 89  LEU 89  83  83  LEU LEU A . n 
A 1 90  GLU 90  84  84  GLU GLU A . n 
A 1 91  VAL 91  85  85  VAL VAL A . n 
A 1 92  ILE 92  86  86  ILE ILE A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  LYS 94  88  88  LYS LYS A . n 
A 1 95  TRP 95  89  89  TRP TRP A . n 
A 1 96  ALA 96  90  90  ALA ALA A . n 
A 1 97  GLU 97  91  91  GLU GLU A . n 
A 1 98  LYS 98  92  92  LYS LYS A . n 
A 1 99  ILE 99  93  93  ILE ILE A . n 
A 1 100 PRO 100 94  94  PRO PRO A . n 
A 1 101 GLY 101 95  95  GLY GLY A . n 
A 1 102 PHE 102 96  96  PHE PHE A . n 
A 1 103 ALA 103 97  97  ALA ALA A . n 
A 1 104 GLU 104 98  98  GLU GLU A . n 
A 1 105 LEU 105 99  99  LEU LEU A . n 
A 1 106 SER 106 100 100 SER SER A . n 
A 1 107 PRO 107 101 101 PRO PRO A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 ASP 109 103 103 ASP ASP A . n 
A 1 110 GLN 110 104 104 GLN GLN A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 LEU 112 106 106 LEU LEU A . n 
A 1 113 LEU 113 107 107 LEU LEU A . n 
A 1 114 LEU 114 108 108 LEU LEU A . n 
A 1 115 GLU 115 109 109 GLU GLU A . n 
A 1 116 SER 116 110 110 SER SER A . n 
A 1 117 ALA 117 111 111 ALA ALA A . n 
A 1 118 PHE 118 112 112 PHE PHE A . n 
A 1 119 LEU 119 113 113 LEU LEU A . n 
A 1 120 GLU 120 114 114 GLU GLU A . n 
A 1 121 LEU 121 115 115 LEU LEU A . n 
A 1 122 PHE 122 116 116 PHE PHE A . n 
A 1 123 ILE 123 117 117 ILE ILE A . n 
A 1 124 LEU 124 118 118 LEU LEU A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 LEU 126 120 120 LEU LEU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ARG 129 123 123 ARG ARG A . n 
A 1 130 SER 130 124 124 SER SER A . n 
A 1 131 LYS 131 125 125 LYS LYS A . n 
A 1 132 PRO 132 126 126 PRO PRO A . n 
A 1 133 GLY 133 127 127 GLY GLY A . n 
A 1 134 GLU 134 128 128 GLU GLU A . n 
A 1 135 GLY 135 129 129 GLY GLY A . n 
A 1 136 LYS 136 130 130 LYS LYS A . n 
A 1 137 LEU 137 131 131 LEU LEU A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 PHE 139 133 133 PHE PHE A . n 
A 1 140 CYS 140 134 134 CYS CYS A . n 
A 1 141 SER 141 135 135 SER SER A . n 
A 1 142 GLY 142 136 136 GLY GLY A . n 
A 1 143 LEU 143 137 137 LEU LEU A . n 
A 1 144 VAL 144 138 138 VAL VAL A . n 
A 1 145 LEU 145 139 139 LEU LEU A . n 
A 1 146 HIS 146 140 140 HIS HIS A . n 
A 1 147 ARG 147 141 141 ARG ARG A . n 
A 1 148 LEU 148 142 142 LEU LEU A . n 
A 1 149 GLN 149 143 143 GLN GLN A . n 
A 1 150 CYS 150 144 144 CYS CYS A . n 
A 1 151 ALA 151 145 145 ALA ALA A . n 
A 1 152 ARG 152 146 146 ARG ARG A . n 
A 1 153 GLY 153 147 147 GLY GLY A . n 
A 1 154 PHE 154 148 148 PHE PHE A . n 
A 1 155 GLY 155 149 149 GLY GLY A . n 
A 1 156 ASP 156 150 150 ASP ASP A . n 
A 1 157 TRP 157 151 151 TRP TRP A . n 
A 1 158 ILE 158 152 152 ILE ILE A . n 
A 1 159 ASP 159 153 153 ASP ASP A . n 
A 1 160 SER 160 154 154 SER SER A . n 
A 1 161 ILE 161 155 155 ILE ILE A . n 
A 1 162 LEU 162 156 156 LEU LEU A . n 
A 1 163 ALA 163 157 157 ALA ALA A . n 
A 1 164 PHE 164 158 158 PHE PHE A . n 
A 1 165 SER 165 159 159 SER SER A . n 
A 1 166 ARG 166 160 160 ARG ARG A . n 
A 1 167 SER 167 161 161 SER SER A . n 
A 1 168 LEU 168 162 162 LEU LEU A . n 
A 1 169 HIS 169 163 163 HIS HIS A . n 
A 1 170 SER 170 164 164 SER SER A . n 
A 1 171 LEU 171 165 165 LEU LEU A . n 
A 1 172 LEU 172 166 166 LEU LEU A . n 
A 1 173 VAL 173 167 167 VAL VAL A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 VAL 175 169 169 VAL VAL A . n 
A 1 176 PRO 176 170 170 PRO PRO A . n 
A 1 177 ALA 177 171 171 ALA ALA A . n 
A 1 178 PHE 178 172 172 PHE PHE A . n 
A 1 179 ALA 179 173 173 ALA ALA A . n 
A 1 180 CYS 180 174 174 CYS CYS A . n 
A 1 181 LEU 181 175 175 LEU LEU A . n 
A 1 182 SER 182 176 176 SER SER A . n 
A 1 183 ALA 183 177 177 ALA ALA A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 VAL 185 179 179 VAL VAL A . n 
A 1 186 LEU 186 180 180 LEU LEU A . n 
A 1 187 ILE 187 181 181 ILE ILE A . n 
A 1 188 THR 188 182 182 THR THR A . n 
A 1 189 ASP 189 183 183 ASP ASP A . n 
A 1 190 ARG 190 184 184 ARG ARG A . n 
A 1 191 HIS 191 185 185 HIS HIS A . n 
A 1 192 GLY 192 186 186 GLY GLY A . n 
A 1 193 LEU 193 187 187 LEU LEU A . n 
A 1 194 GLN 194 188 188 GLN GLN A . n 
A 1 195 GLU 195 189 189 GLU GLU A . n 
A 1 196 PRO 196 190 190 PRO PRO A . n 
A 1 197 ARG 197 191 191 ARG ARG A . n 
A 1 198 ARG 198 192 192 ARG ARG A . n 
A 1 199 VAL 199 193 193 VAL VAL A . n 
A 1 200 GLU 200 194 194 GLU GLU A . n 
A 1 201 GLU 201 195 195 GLU GLU A . n 
A 1 202 LEU 202 196 196 LEU LEU A . n 
A 1 203 GLN 203 197 197 GLN GLN A . n 
A 1 204 ASN 204 198 198 ASN ASN A . n 
A 1 205 ARG 205 199 199 ARG ARG A . n 
A 1 206 ILE 206 200 200 ILE ILE A . n 
A 1 207 ALA 207 201 201 ALA ALA A . n 
A 1 208 SER 208 202 202 SER SER A . n 
A 1 209 CYS 209 203 203 CYS CYS A . n 
A 1 210 LEU 210 204 204 LEU LEU A . n 
A 1 211 LYS 211 205 205 LYS LYS A . n 
A 1 212 GLU 212 206 206 GLU GLU A . n 
A 1 213 HIS 213 207 207 HIS HIS A . n 
A 1 214 VAL 214 208 208 VAL VAL A . n 
A 1 215 ALA 215 209 209 ALA ALA A . n 
A 1 216 ALA 216 210 210 ALA ALA A . n 
A 1 217 VAL 217 211 211 VAL VAL A . n 
A 1 218 ALA 218 212 212 ALA ALA A . n 
A 1 219 GLY 219 213 213 GLY GLY A . n 
A 1 220 GLU 220 214 ?   ?   ?   A . n 
A 1 221 PRO 221 215 ?   ?   ?   A . n 
A 1 222 GLN 222 216 ?   ?   ?   A . n 
A 1 223 PRO 223 217 217 PRO PRO A . n 
A 1 224 ALA 224 218 218 ALA ALA A . n 
A 1 225 SER 225 219 219 SER SER A . n 
A 1 226 CYS 226 220 220 CYS CYS A . n 
A 1 227 LEU 227 221 221 LEU LEU A . n 
A 1 228 SER 228 222 222 SER SER A . n 
A 1 229 ARG 229 223 223 ARG ARG A . n 
A 1 230 LEU 230 224 224 LEU LEU A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 GLY 232 226 226 GLY GLY A . n 
A 1 233 LYS 233 227 227 LYS LYS A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 PRO 235 229 229 PRO PRO A . n 
A 1 236 GLU 236 230 230 GLU GLU A . n 
A 1 237 LEU 237 231 231 LEU LEU A . n 
A 1 238 ARG 238 232 232 ARG ARG A . n 
A 1 239 THR 239 233 233 THR THR A . n 
A 1 240 LEU 240 234 234 LEU LEU A . n 
A 1 241 CYS 241 235 235 CYS CYS A . n 
A 1 242 THR 242 236 236 THR THR A . n 
A 1 243 GLN 243 237 237 GLN GLN A . n 
A 1 244 GLY 244 238 238 GLY GLY A . n 
A 1 245 LEU 245 239 239 LEU LEU A . n 
A 1 246 GLN 246 240 240 GLN GLN A . n 
A 1 247 ARG 247 241 241 ARG ARG A . n 
A 1 248 ILE 248 242 242 ILE ILE A . n 
A 1 249 PHE 249 243 243 PHE PHE A . n 
A 1 250 TYR 250 244 244 TYR TYR A . n 
A 1 251 LEU 251 245 245 LEU LEU A . n 
A 1 252 LYS 252 246 246 LYS LYS A . n 
A 1 253 LEU 253 247 247 LEU LEU A . n 
A 1 254 GLU 254 248 248 GLU GLU A . n 
A 1 255 ASP 255 249 249 ASP ASP A . n 
A 1 256 LEU 256 250 250 LEU LEU A . n 
A 1 257 VAL 257 251 251 VAL VAL A . n 
A 1 258 PRO 258 252 252 PRO PRO A . n 
A 1 259 PRO 259 253 253 PRO PRO A . n 
A 1 260 PRO 260 254 254 PRO PRO A . n 
A 1 261 PRO 261 255 255 PRO PRO A . n 
A 1 262 ILE 262 256 256 ILE ILE A . n 
A 1 263 ILE 263 257 257 ILE ILE A . n 
A 1 264 ASP 264 258 258 ASP ASP A . n 
A 1 265 LYS 265 259 259 LYS LYS A . n 
A 1 266 ILE 266 260 260 ILE ILE A . n 
A 1 267 PHE 267 261 261 PHE PHE A . n 
A 1 268 MET 268 262 262 MET MET A . n 
A 1 269 ASP 269 263 263 ASP ASP A . n 
A 1 270 THR 270 264 264 THR THR A . n 
A 1 271 LEU 271 265 ?   ?   ?   A . n 
A 1 272 PRO 272 266 ?   ?   ?   A . n 
A 1 273 PHE 273 267 ?   ?   ?   A . n 
B 1 1   MET 1   -5  ?   ?   ?   B . n 
B 1 2   GLY 2   -4  ?   ?   ?   B . n 
B 1 3   SER 3   -3  ?   ?   ?   B . n 
B 1 4   SER 4   -2  ?   ?   ?   B . n 
B 1 5   HIS 5   -1  ?   ?   ?   B . n 
B 1 6   HIS 6   0   ?   ?   ?   B . n 
B 1 7   HIS 7   1   ?   ?   ?   B . n 
B 1 8   HIS 8   2   ?   ?   ?   B . n 
B 1 9   HIS 9   3   ?   ?   ?   B . n 
B 1 10  HIS 10  4   ?   ?   ?   B . n 
B 1 11  SER 11  5   ?   ?   ?   B . n 
B 1 12  SER 12  6   ?   ?   ?   B . n 
B 1 13  GLY 13  7   ?   ?   ?   B . n 
B 1 14  LEU 14  8   ?   ?   ?   B . n 
B 1 15  VAL 15  9   ?   ?   ?   B . n 
B 1 16  PRO 16  10  ?   ?   ?   B . n 
B 1 17  ARG 17  11  ?   ?   ?   B . n 
B 1 18  GLY 18  12  ?   ?   ?   B . n 
B 1 19  SER 19  13  ?   ?   ?   B . n 
B 1 20  HIS 20  14  ?   ?   ?   B . n 
B 1 21  MET 21  15  ?   ?   ?   B . n 
B 1 22  GLY 22  16  ?   ?   ?   B . n 
B 1 23  ARG 23  17  ?   ?   ?   B . n 
B 1 24  LEU 24  18  ?   ?   ?   B . n 
B 1 25  PRO 25  19  ?   ?   ?   B . n 
B 1 26  SER 26  20  ?   ?   ?   B . n 
B 1 27  LYS 27  21  ?   ?   ?   B . n 
B 1 28  PRO 28  22  ?   ?   ?   B . n 
B 1 29  LYS 29  23  ?   ?   ?   B . n 
B 1 30  GLN 30  24  ?   ?   ?   B . n 
B 1 31  PRO 31  25  ?   ?   ?   B . n 
B 1 32  PRO 32  26  ?   ?   ?   B . n 
B 1 33  ASP 33  27  ?   ?   ?   B . n 
B 1 34  ALA 34  28  ?   ?   ?   B . n 
B 1 35  SER 35  29  ?   ?   ?   B . n 
B 1 36  PRO 36  30  ?   ?   ?   B . n 
B 1 37  ALA 37  31  ?   ?   ?   B . n 
B 1 38  ASN 38  32  32  ASN ASN B . n 
B 1 39  LEU 39  33  33  LEU LEU B . n 
B 1 40  LEU 40  34  34  LEU LEU B . n 
B 1 41  THR 41  35  35  THR THR B . n 
B 1 42  SER 42  36  36  SER SER B . n 
B 1 43  LEU 43  37  37  LEU LEU B . n 
B 1 44  VAL 44  38  38  VAL VAL B . n 
B 1 45  ARG 45  39  39  ARG ARG B . n 
B 1 46  ALA 46  40  40  ALA ALA B . n 
B 1 47  HIS 47  41  41  HIS HIS B . n 
B 1 48  LEU 48  42  42  LEU LEU B . n 
B 1 49  ASP 49  43  43  ASP ASP B . n 
B 1 50  SER 50  44  44  SER SER B . n 
B 1 51  GLY 51  45  45  GLY GLY B . n 
B 1 52  PRO 52  46  46  PRO PRO B . n 
B 1 53  SER 53  47  47  SER SER B . n 
B 1 54  THR 54  48  48  THR THR B . n 
B 1 55  ALA 55  49  49  ALA ALA B . n 
B 1 56  LYS 56  50  50  LYS LYS B . n 
B 1 57  LEU 57  51  51  LEU LEU B . n 
B 1 58  ASP 58  52  52  ASP ASP B . n 
B 1 59  TYR 59  53  53  TYR TYR B . n 
B 1 60  SER 60  54  54  SER SER B . n 
B 1 61  LYS 61  55  55  LYS LYS B . n 
B 1 62  PHE 62  56  56  PHE PHE B . n 
B 1 63  GLN 63  57  57  GLN GLN B . n 
B 1 64  GLU 64  58  58  GLU GLU B . n 
B 1 65  LEU 65  59  59  LEU LEU B . n 
B 1 66  VAL 66  60  60  VAL VAL B . n 
B 1 67  LEU 67  61  61  LEU LEU B . n 
B 1 68  PRO 68  62  62  PRO PRO B . n 
B 1 69  HIS 69  63  63  HIS HIS B . n 
B 1 70  PHE 70  64  64  PHE PHE B . n 
B 1 71  GLY 71  65  65  GLY GLY B . n 
B 1 72  LYS 72  66  66  LYS LYS B . n 
B 1 73  GLU 73  67  67  GLU GLU B . n 
B 1 74  ASP 74  68  68  ASP ASP B . n 
B 1 75  ALA 75  69  69  ALA ALA B . n 
B 1 76  GLY 76  70  70  GLY GLY B . n 
B 1 77  ASP 77  71  71  ASP ASP B . n 
B 1 78  VAL 78  72  72  VAL VAL B . n 
B 1 79  GLN 79  73  73  GLN GLN B . n 
B 1 80  GLN 80  74  74  GLN GLN B . n 
B 1 81  PHE 81  75  75  PHE PHE B . n 
B 1 82  TYR 82  76  76  TYR TYR B . n 
B 1 83  ASP 83  77  77  ASP ASP B . n 
B 1 84  LEU 84  78  78  LEU LEU B . n 
B 1 85  LEU 85  79  79  LEU LEU B . n 
B 1 86  SER 86  80  80  SER SER B . n 
B 1 87  GLY 87  81  81  GLY GLY B . n 
B 1 88  SER 88  82  82  SER SER B . n 
B 1 89  LEU 89  83  83  LEU LEU B . n 
B 1 90  GLU 90  84  84  GLU GLU B . n 
B 1 91  VAL 91  85  85  VAL VAL B . n 
B 1 92  ILE 92  86  86  ILE ILE B . n 
B 1 93  ARG 93  87  87  ARG ARG B . n 
B 1 94  LYS 94  88  88  LYS LYS B . n 
B 1 95  TRP 95  89  89  TRP TRP B . n 
B 1 96  ALA 96  90  90  ALA ALA B . n 
B 1 97  GLU 97  91  91  GLU GLU B . n 
B 1 98  LYS 98  92  92  LYS LYS B . n 
B 1 99  ILE 99  93  93  ILE ILE B . n 
B 1 100 PRO 100 94  94  PRO PRO B . n 
B 1 101 GLY 101 95  95  GLY GLY B . n 
B 1 102 PHE 102 96  96  PHE PHE B . n 
B 1 103 ALA 103 97  97  ALA ALA B . n 
B 1 104 GLU 104 98  98  GLU GLU B . n 
B 1 105 LEU 105 99  99  LEU LEU B . n 
B 1 106 SER 106 100 100 SER SER B . n 
B 1 107 PRO 107 101 101 PRO PRO B . n 
B 1 108 ALA 108 102 102 ALA ALA B . n 
B 1 109 ASP 109 103 103 ASP ASP B . n 
B 1 110 GLN 110 104 104 GLN GLN B . n 
B 1 111 ASP 111 105 105 ASP ASP B . n 
B 1 112 LEU 112 106 106 LEU LEU B . n 
B 1 113 LEU 113 107 107 LEU LEU B . n 
B 1 114 LEU 114 108 108 LEU LEU B . n 
B 1 115 GLU 115 109 109 GLU GLU B . n 
B 1 116 SER 116 110 110 SER SER B . n 
B 1 117 ALA 117 111 111 ALA ALA B . n 
B 1 118 PHE 118 112 112 PHE PHE B . n 
B 1 119 LEU 119 113 113 LEU LEU B . n 
B 1 120 GLU 120 114 114 GLU GLU B . n 
B 1 121 LEU 121 115 115 LEU LEU B . n 
B 1 122 PHE 122 116 116 PHE PHE B . n 
B 1 123 ILE 123 117 117 ILE ILE B . n 
B 1 124 LEU 124 118 118 LEU LEU B . n 
B 1 125 ARG 125 119 119 ARG ARG B . n 
B 1 126 LEU 126 120 120 LEU LEU B . n 
B 1 127 ALA 127 121 121 ALA ALA B . n 
B 1 128 TYR 128 122 122 TYR TYR B . n 
B 1 129 ARG 129 123 123 ARG ARG B . n 
B 1 130 SER 130 124 124 SER SER B . n 
B 1 131 LYS 131 125 125 LYS LYS B . n 
B 1 132 PRO 132 126 126 PRO PRO B . n 
B 1 133 GLY 133 127 127 GLY GLY B . n 
B 1 134 GLU 134 128 128 GLU GLU B . n 
B 1 135 GLY 135 129 129 GLY GLY B . n 
B 1 136 LYS 136 130 130 LYS LYS B . n 
B 1 137 LEU 137 131 131 LEU LEU B . n 
B 1 138 ILE 138 132 132 ILE ILE B . n 
B 1 139 PHE 139 133 133 PHE PHE B . n 
B 1 140 CYS 140 134 134 CYS CYS B . n 
B 1 141 SER 141 135 135 SER SER B . n 
B 1 142 GLY 142 136 136 GLY GLY B . n 
B 1 143 LEU 143 137 137 LEU LEU B . n 
B 1 144 VAL 144 138 138 VAL VAL B . n 
B 1 145 LEU 145 139 139 LEU LEU B . n 
B 1 146 HIS 146 140 140 HIS HIS B . n 
B 1 147 ARG 147 141 141 ARG ARG B . n 
B 1 148 LEU 148 142 142 LEU LEU B . n 
B 1 149 GLN 149 143 143 GLN GLN B . n 
B 1 150 CYS 150 144 144 CYS CYS B . n 
B 1 151 ALA 151 145 145 ALA ALA B . n 
B 1 152 ARG 152 146 146 ARG ARG B . n 
B 1 153 GLY 153 147 147 GLY GLY B . n 
B 1 154 PHE 154 148 148 PHE PHE B . n 
B 1 155 GLY 155 149 149 GLY GLY B . n 
B 1 156 ASP 156 150 150 ASP ASP B . n 
B 1 157 TRP 157 151 151 TRP TRP B . n 
B 1 158 ILE 158 152 152 ILE ILE B . n 
B 1 159 ASP 159 153 153 ASP ASP B . n 
B 1 160 SER 160 154 154 SER SER B . n 
B 1 161 ILE 161 155 155 ILE ILE B . n 
B 1 162 LEU 162 156 156 LEU LEU B . n 
B 1 163 ALA 163 157 157 ALA ALA B . n 
B 1 164 PHE 164 158 158 PHE PHE B . n 
B 1 165 SER 165 159 159 SER SER B . n 
B 1 166 ARG 166 160 160 ARG ARG B . n 
B 1 167 SER 167 161 161 SER SER B . n 
B 1 168 LEU 168 162 162 LEU LEU B . n 
B 1 169 HIS 169 163 163 HIS HIS B . n 
B 1 170 SER 170 164 164 SER SER B . n 
B 1 171 LEU 171 165 165 LEU LEU B . n 
B 1 172 LEU 172 166 166 LEU LEU B . n 
B 1 173 VAL 173 167 167 VAL VAL B . n 
B 1 174 ASP 174 168 168 ASP ASP B . n 
B 1 175 VAL 175 169 169 VAL VAL B . n 
B 1 176 PRO 176 170 170 PRO PRO B . n 
B 1 177 ALA 177 171 171 ALA ALA B . n 
B 1 178 PHE 178 172 172 PHE PHE B . n 
B 1 179 ALA 179 173 173 ALA ALA B . n 
B 1 180 CYS 180 174 174 CYS CYS B . n 
B 1 181 LEU 181 175 175 LEU LEU B . n 
B 1 182 SER 182 176 176 SER SER B . n 
B 1 183 ALA 183 177 177 ALA ALA B . n 
B 1 184 LEU 184 178 178 LEU LEU B . n 
B 1 185 VAL 185 179 179 VAL VAL B . n 
B 1 186 LEU 186 180 180 LEU LEU B . n 
B 1 187 ILE 187 181 181 ILE ILE B . n 
B 1 188 THR 188 182 182 THR THR B . n 
B 1 189 ASP 189 183 183 ASP ASP B . n 
B 1 190 ARG 190 184 184 ARG ARG B . n 
B 1 191 HIS 191 185 185 HIS HIS B . n 
B 1 192 GLY 192 186 186 GLY GLY B . n 
B 1 193 LEU 193 187 187 LEU LEU B . n 
B 1 194 GLN 194 188 188 GLN GLN B . n 
B 1 195 GLU 195 189 189 GLU GLU B . n 
B 1 196 PRO 196 190 190 PRO PRO B . n 
B 1 197 ARG 197 191 191 ARG ARG B . n 
B 1 198 ARG 198 192 192 ARG ARG B . n 
B 1 199 VAL 199 193 193 VAL VAL B . n 
B 1 200 GLU 200 194 194 GLU GLU B . n 
B 1 201 GLU 201 195 195 GLU GLU B . n 
B 1 202 LEU 202 196 196 LEU LEU B . n 
B 1 203 GLN 203 197 197 GLN GLN B . n 
B 1 204 ASN 204 198 198 ASN ASN B . n 
B 1 205 ARG 205 199 199 ARG ARG B . n 
B 1 206 ILE 206 200 200 ILE ILE B . n 
B 1 207 ALA 207 201 201 ALA ALA B . n 
B 1 208 SER 208 202 202 SER SER B . n 
B 1 209 CYS 209 203 203 CYS CYS B . n 
B 1 210 LEU 210 204 204 LEU LEU B . n 
B 1 211 LYS 211 205 205 LYS LYS B . n 
B 1 212 GLU 212 206 206 GLU GLU B . n 
B 1 213 HIS 213 207 207 HIS HIS B . n 
B 1 214 VAL 214 208 208 VAL VAL B . n 
B 1 215 ALA 215 209 209 ALA ALA B . n 
B 1 216 ALA 216 210 210 ALA ALA B . n 
B 1 217 VAL 217 211 211 VAL VAL B . n 
B 1 218 ALA 218 212 212 ALA ALA B . n 
B 1 219 GLY 219 213 213 GLY GLY B . n 
B 1 220 GLU 220 214 ?   ?   ?   B . n 
B 1 221 PRO 221 215 ?   ?   ?   B . n 
B 1 222 GLN 222 216 ?   ?   ?   B . n 
B 1 223 PRO 223 217 217 PRO PRO B . n 
B 1 224 ALA 224 218 218 ALA ALA B . n 
B 1 225 SER 225 219 219 SER SER B . n 
B 1 226 CYS 226 220 220 CYS CYS B . n 
B 1 227 LEU 227 221 221 LEU LEU B . n 
B 1 228 SER 228 222 222 SER SER B . n 
B 1 229 ARG 229 223 223 ARG ARG B . n 
B 1 230 LEU 230 224 224 LEU LEU B . n 
B 1 231 LEU 231 225 225 LEU LEU B . n 
B 1 232 GLY 232 226 226 GLY GLY B . n 
B 1 233 LYS 233 227 227 LYS LYS B . n 
B 1 234 LEU 234 228 228 LEU LEU B . n 
B 1 235 PRO 235 229 229 PRO PRO B . n 
B 1 236 GLU 236 230 230 GLU GLU B . n 
B 1 237 LEU 237 231 231 LEU LEU B . n 
B 1 238 ARG 238 232 232 ARG ARG B . n 
B 1 239 THR 239 233 233 THR THR B . n 
B 1 240 LEU 240 234 234 LEU LEU B . n 
B 1 241 CYS 241 235 235 CYS CYS B . n 
B 1 242 THR 242 236 236 THR THR B . n 
B 1 243 GLN 243 237 237 GLN GLN B . n 
B 1 244 GLY 244 238 238 GLY GLY B . n 
B 1 245 LEU 245 239 239 LEU LEU B . n 
B 1 246 GLN 246 240 240 GLN GLN B . n 
B 1 247 ARG 247 241 241 ARG ARG B . n 
B 1 248 ILE 248 242 242 ILE ILE B . n 
B 1 249 PHE 249 243 243 PHE PHE B . n 
B 1 250 TYR 250 244 244 TYR TYR B . n 
B 1 251 LEU 251 245 245 LEU LEU B . n 
B 1 252 LYS 252 246 246 LYS LYS B . n 
B 1 253 LEU 253 247 247 LEU LEU B . n 
B 1 254 GLU 254 248 248 GLU GLU B . n 
B 1 255 ASP 255 249 249 ASP ASP B . n 
B 1 256 LEU 256 250 250 LEU LEU B . n 
B 1 257 VAL 257 251 251 VAL VAL B . n 
B 1 258 PRO 258 252 252 PRO PRO B . n 
B 1 259 PRO 259 253 253 PRO PRO B . n 
B 1 260 PRO 260 254 254 PRO PRO B . n 
B 1 261 PRO 261 255 255 PRO PRO B . n 
B 1 262 ILE 262 256 256 ILE ILE B . n 
B 1 263 ILE 263 257 257 ILE ILE B . n 
B 1 264 ASP 264 258 258 ASP ASP B . n 
B 1 265 LYS 265 259 259 LYS LYS B . n 
B 1 266 ILE 266 260 260 ILE ILE B . n 
B 1 267 PHE 267 261 261 PHE PHE B . n 
B 1 268 MET 268 262 262 MET MET B . n 
B 1 269 ASP 269 263 263 ASP ASP B . n 
B 1 270 THR 270 264 264 THR THR B . n 
B 1 271 LEU 271 265 ?   ?   ?   B . n 
B 1 272 PRO 272 266 ?   ?   ?   B . n 
B 1 273 PHE 273 267 ?   ?   ?   B . n 
C 1 1   MET 1   -5  ?   ?   ?   C . n 
C 1 2   GLY 2   -4  ?   ?   ?   C . n 
C 1 3   SER 3   -3  ?   ?   ?   C . n 
C 1 4   SER 4   -2  ?   ?   ?   C . n 
C 1 5   HIS 5   -1  ?   ?   ?   C . n 
C 1 6   HIS 6   0   ?   ?   ?   C . n 
C 1 7   HIS 7   1   ?   ?   ?   C . n 
C 1 8   HIS 8   2   ?   ?   ?   C . n 
C 1 9   HIS 9   3   ?   ?   ?   C . n 
C 1 10  HIS 10  4   ?   ?   ?   C . n 
C 1 11  SER 11  5   ?   ?   ?   C . n 
C 1 12  SER 12  6   ?   ?   ?   C . n 
C 1 13  GLY 13  7   ?   ?   ?   C . n 
C 1 14  LEU 14  8   ?   ?   ?   C . n 
C 1 15  VAL 15  9   ?   ?   ?   C . n 
C 1 16  PRO 16  10  ?   ?   ?   C . n 
C 1 17  ARG 17  11  ?   ?   ?   C . n 
C 1 18  GLY 18  12  ?   ?   ?   C . n 
C 1 19  SER 19  13  ?   ?   ?   C . n 
C 1 20  HIS 20  14  ?   ?   ?   C . n 
C 1 21  MET 21  15  ?   ?   ?   C . n 
C 1 22  GLY 22  16  ?   ?   ?   C . n 
C 1 23  ARG 23  17  ?   ?   ?   C . n 
C 1 24  LEU 24  18  ?   ?   ?   C . n 
C 1 25  PRO 25  19  ?   ?   ?   C . n 
C 1 26  SER 26  20  ?   ?   ?   C . n 
C 1 27  LYS 27  21  ?   ?   ?   C . n 
C 1 28  PRO 28  22  ?   ?   ?   C . n 
C 1 29  LYS 29  23  ?   ?   ?   C . n 
C 1 30  GLN 30  24  ?   ?   ?   C . n 
C 1 31  PRO 31  25  ?   ?   ?   C . n 
C 1 32  PRO 32  26  ?   ?   ?   C . n 
C 1 33  ASP 33  27  ?   ?   ?   C . n 
C 1 34  ALA 34  28  ?   ?   ?   C . n 
C 1 35  SER 35  29  ?   ?   ?   C . n 
C 1 36  PRO 36  30  30  PRO PRO C . n 
C 1 37  ALA 37  31  31  ALA ALA C . n 
C 1 38  ASN 38  32  32  ASN ASN C . n 
C 1 39  LEU 39  33  33  LEU LEU C . n 
C 1 40  LEU 40  34  34  LEU LEU C . n 
C 1 41  THR 41  35  35  THR THR C . n 
C 1 42  SER 42  36  36  SER SER C . n 
C 1 43  LEU 43  37  37  LEU LEU C . n 
C 1 44  VAL 44  38  38  VAL VAL C . n 
C 1 45  ARG 45  39  39  ARG ARG C . n 
C 1 46  ALA 46  40  40  ALA ALA C . n 
C 1 47  HIS 47  41  41  HIS HIS C . n 
C 1 48  LEU 48  42  42  LEU LEU C . n 
C 1 49  ASP 49  43  43  ASP ASP C . n 
C 1 50  SER 50  44  44  SER SER C . n 
C 1 51  GLY 51  45  45  GLY GLY C . n 
C 1 52  PRO 52  46  46  PRO PRO C . n 
C 1 53  SER 53  47  47  SER SER C . n 
C 1 54  THR 54  48  48  THR THR C . n 
C 1 55  ALA 55  49  49  ALA ALA C . n 
C 1 56  LYS 56  50  50  LYS LYS C . n 
C 1 57  LEU 57  51  51  LEU LEU C . n 
C 1 58  ASP 58  52  52  ASP ASP C . n 
C 1 59  TYR 59  53  53  TYR TYR C . n 
C 1 60  SER 60  54  54  SER SER C . n 
C 1 61  LYS 61  55  55  LYS LYS C . n 
C 1 62  PHE 62  56  56  PHE PHE C . n 
C 1 63  GLN 63  57  57  GLN GLN C . n 
C 1 64  GLU 64  58  58  GLU GLU C . n 
C 1 65  LEU 65  59  59  LEU LEU C . n 
C 1 66  VAL 66  60  60  VAL VAL C . n 
C 1 67  LEU 67  61  61  LEU LEU C . n 
C 1 68  PRO 68  62  62  PRO PRO C . n 
C 1 69  HIS 69  63  63  HIS HIS C . n 
C 1 70  PHE 70  64  64  PHE PHE C . n 
C 1 71  GLY 71  65  65  GLY GLY C . n 
C 1 72  LYS 72  66  66  LYS LYS C . n 
C 1 73  GLU 73  67  67  GLU GLU C . n 
C 1 74  ASP 74  68  68  ASP ASP C . n 
C 1 75  ALA 75  69  69  ALA ALA C . n 
C 1 76  GLY 76  70  70  GLY GLY C . n 
C 1 77  ASP 77  71  71  ASP ASP C . n 
C 1 78  VAL 78  72  72  VAL VAL C . n 
C 1 79  GLN 79  73  73  GLN GLN C . n 
C 1 80  GLN 80  74  74  GLN GLN C . n 
C 1 81  PHE 81  75  75  PHE PHE C . n 
C 1 82  TYR 82  76  76  TYR TYR C . n 
C 1 83  ASP 83  77  77  ASP ASP C . n 
C 1 84  LEU 84  78  78  LEU LEU C . n 
C 1 85  LEU 85  79  79  LEU LEU C . n 
C 1 86  SER 86  80  80  SER SER C . n 
C 1 87  GLY 87  81  81  GLY GLY C . n 
C 1 88  SER 88  82  82  SER SER C . n 
C 1 89  LEU 89  83  83  LEU LEU C . n 
C 1 90  GLU 90  84  84  GLU GLU C . n 
C 1 91  VAL 91  85  85  VAL VAL C . n 
C 1 92  ILE 92  86  86  ILE ILE C . n 
C 1 93  ARG 93  87  87  ARG ARG C . n 
C 1 94  LYS 94  88  88  LYS LYS C . n 
C 1 95  TRP 95  89  89  TRP TRP C . n 
C 1 96  ALA 96  90  90  ALA ALA C . n 
C 1 97  GLU 97  91  91  GLU GLU C . n 
C 1 98  LYS 98  92  92  LYS LYS C . n 
C 1 99  ILE 99  93  93  ILE ILE C . n 
C 1 100 PRO 100 94  94  PRO PRO C . n 
C 1 101 GLY 101 95  95  GLY GLY C . n 
C 1 102 PHE 102 96  96  PHE PHE C . n 
C 1 103 ALA 103 97  97  ALA ALA C . n 
C 1 104 GLU 104 98  98  GLU GLU C . n 
C 1 105 LEU 105 99  99  LEU LEU C . n 
C 1 106 SER 106 100 100 SER SER C . n 
C 1 107 PRO 107 101 101 PRO PRO C . n 
C 1 108 ALA 108 102 102 ALA ALA C . n 
C 1 109 ASP 109 103 103 ASP ASP C . n 
C 1 110 GLN 110 104 104 GLN GLN C . n 
C 1 111 ASP 111 105 105 ASP ASP C . n 
C 1 112 LEU 112 106 106 LEU LEU C . n 
C 1 113 LEU 113 107 107 LEU LEU C . n 
C 1 114 LEU 114 108 108 LEU LEU C . n 
C 1 115 GLU 115 109 109 GLU GLU C . n 
C 1 116 SER 116 110 110 SER SER C . n 
C 1 117 ALA 117 111 111 ALA ALA C . n 
C 1 118 PHE 118 112 112 PHE PHE C . n 
C 1 119 LEU 119 113 113 LEU LEU C . n 
C 1 120 GLU 120 114 114 GLU GLU C . n 
C 1 121 LEU 121 115 115 LEU LEU C . n 
C 1 122 PHE 122 116 116 PHE PHE C . n 
C 1 123 ILE 123 117 117 ILE ILE C . n 
C 1 124 LEU 124 118 118 LEU LEU C . n 
C 1 125 ARG 125 119 119 ARG ARG C . n 
C 1 126 LEU 126 120 120 LEU LEU C . n 
C 1 127 ALA 127 121 121 ALA ALA C . n 
C 1 128 TYR 128 122 122 TYR TYR C . n 
C 1 129 ARG 129 123 123 ARG ARG C . n 
C 1 130 SER 130 124 124 SER SER C . n 
C 1 131 LYS 131 125 125 LYS LYS C . n 
C 1 132 PRO 132 126 126 PRO PRO C . n 
C 1 133 GLY 133 127 127 GLY GLY C . n 
C 1 134 GLU 134 128 128 GLU GLU C . n 
C 1 135 GLY 135 129 129 GLY GLY C . n 
C 1 136 LYS 136 130 130 LYS LYS C . n 
C 1 137 LEU 137 131 131 LEU LEU C . n 
C 1 138 ILE 138 132 132 ILE ILE C . n 
C 1 139 PHE 139 133 133 PHE PHE C . n 
C 1 140 CYS 140 134 134 CYS CYS C . n 
C 1 141 SER 141 135 135 SER SER C . n 
C 1 142 GLY 142 136 136 GLY GLY C . n 
C 1 143 LEU 143 137 137 LEU LEU C . n 
C 1 144 VAL 144 138 138 VAL VAL C . n 
C 1 145 LEU 145 139 139 LEU LEU C . n 
C 1 146 HIS 146 140 140 HIS HIS C . n 
C 1 147 ARG 147 141 141 ARG ARG C . n 
C 1 148 LEU 148 142 142 LEU LEU C . n 
C 1 149 GLN 149 143 143 GLN GLN C . n 
C 1 150 CYS 150 144 144 CYS CYS C . n 
C 1 151 ALA 151 145 145 ALA ALA C . n 
C 1 152 ARG 152 146 146 ARG ARG C . n 
C 1 153 GLY 153 147 147 GLY GLY C . n 
C 1 154 PHE 154 148 148 PHE PHE C . n 
C 1 155 GLY 155 149 149 GLY GLY C . n 
C 1 156 ASP 156 150 150 ASP ASP C . n 
C 1 157 TRP 157 151 151 TRP TRP C . n 
C 1 158 ILE 158 152 152 ILE ILE C . n 
C 1 159 ASP 159 153 153 ASP ASP C . n 
C 1 160 SER 160 154 154 SER SER C . n 
C 1 161 ILE 161 155 155 ILE ILE C . n 
C 1 162 LEU 162 156 156 LEU LEU C . n 
C 1 163 ALA 163 157 157 ALA ALA C . n 
C 1 164 PHE 164 158 158 PHE PHE C . n 
C 1 165 SER 165 159 159 SER SER C . n 
C 1 166 ARG 166 160 160 ARG ARG C . n 
C 1 167 SER 167 161 161 SER SER C . n 
C 1 168 LEU 168 162 162 LEU LEU C . n 
C 1 169 HIS 169 163 163 HIS HIS C . n 
C 1 170 SER 170 164 164 SER SER C . n 
C 1 171 LEU 171 165 165 LEU LEU C . n 
C 1 172 LEU 172 166 166 LEU LEU C . n 
C 1 173 VAL 173 167 167 VAL VAL C . n 
C 1 174 ASP 174 168 168 ASP ASP C . n 
C 1 175 VAL 175 169 169 VAL VAL C . n 
C 1 176 PRO 176 170 170 PRO PRO C . n 
C 1 177 ALA 177 171 171 ALA ALA C . n 
C 1 178 PHE 178 172 172 PHE PHE C . n 
C 1 179 ALA 179 173 173 ALA ALA C . n 
C 1 180 CYS 180 174 174 CYS CYS C . n 
C 1 181 LEU 181 175 175 LEU LEU C . n 
C 1 182 SER 182 176 176 SER SER C . n 
C 1 183 ALA 183 177 177 ALA ALA C . n 
C 1 184 LEU 184 178 178 LEU LEU C . n 
C 1 185 VAL 185 179 179 VAL VAL C . n 
C 1 186 LEU 186 180 180 LEU LEU C . n 
C 1 187 ILE 187 181 181 ILE ILE C . n 
C 1 188 THR 188 182 182 THR THR C . n 
C 1 189 ASP 189 183 183 ASP ASP C . n 
C 1 190 ARG 190 184 184 ARG ARG C . n 
C 1 191 HIS 191 185 185 HIS HIS C . n 
C 1 192 GLY 192 186 186 GLY GLY C . n 
C 1 193 LEU 193 187 187 LEU LEU C . n 
C 1 194 GLN 194 188 188 GLN GLN C . n 
C 1 195 GLU 195 189 189 GLU GLU C . n 
C 1 196 PRO 196 190 190 PRO PRO C . n 
C 1 197 ARG 197 191 191 ARG ARG C . n 
C 1 198 ARG 198 192 192 ARG ARG C . n 
C 1 199 VAL 199 193 193 VAL VAL C . n 
C 1 200 GLU 200 194 194 GLU GLU C . n 
C 1 201 GLU 201 195 195 GLU GLU C . n 
C 1 202 LEU 202 196 196 LEU LEU C . n 
C 1 203 GLN 203 197 197 GLN GLN C . n 
C 1 204 ASN 204 198 198 ASN ASN C . n 
C 1 205 ARG 205 199 199 ARG ARG C . n 
C 1 206 ILE 206 200 200 ILE ILE C . n 
C 1 207 ALA 207 201 201 ALA ALA C . n 
C 1 208 SER 208 202 202 SER SER C . n 
C 1 209 CYS 209 203 203 CYS CYS C . n 
C 1 210 LEU 210 204 204 LEU LEU C . n 
C 1 211 LYS 211 205 205 LYS LYS C . n 
C 1 212 GLU 212 206 206 GLU GLU C . n 
C 1 213 HIS 213 207 207 HIS HIS C . n 
C 1 214 VAL 214 208 208 VAL VAL C . n 
C 1 215 ALA 215 209 209 ALA ALA C . n 
C 1 216 ALA 216 210 210 ALA ALA C . n 
C 1 217 VAL 217 211 211 VAL VAL C . n 
C 1 218 ALA 218 212 ?   ?   ?   C . n 
C 1 219 GLY 219 213 ?   ?   ?   C . n 
C 1 220 GLU 220 214 ?   ?   ?   C . n 
C 1 221 PRO 221 215 ?   ?   ?   C . n 
C 1 222 GLN 222 216 ?   ?   ?   C . n 
C 1 223 PRO 223 217 ?   ?   ?   C . n 
C 1 224 ALA 224 218 ?   ?   ?   C . n 
C 1 225 SER 225 219 ?   ?   ?   C . n 
C 1 226 CYS 226 220 220 CYS CYS C . n 
C 1 227 LEU 227 221 221 LEU LEU C . n 
C 1 228 SER 228 222 222 SER SER C . n 
C 1 229 ARG 229 223 223 ARG ARG C . n 
C 1 230 LEU 230 224 224 LEU LEU C . n 
C 1 231 LEU 231 225 225 LEU LEU C . n 
C 1 232 GLY 232 226 226 GLY GLY C . n 
C 1 233 LYS 233 227 227 LYS LYS C . n 
C 1 234 LEU 234 228 228 LEU LEU C . n 
C 1 235 PRO 235 229 229 PRO PRO C . n 
C 1 236 GLU 236 230 230 GLU GLU C . n 
C 1 237 LEU 237 231 231 LEU LEU C . n 
C 1 238 ARG 238 232 232 ARG ARG C . n 
C 1 239 THR 239 233 233 THR THR C . n 
C 1 240 LEU 240 234 234 LEU LEU C . n 
C 1 241 CYS 241 235 235 CYS CYS C . n 
C 1 242 THR 242 236 236 THR THR C . n 
C 1 243 GLN 243 237 237 GLN GLN C . n 
C 1 244 GLY 244 238 238 GLY GLY C . n 
C 1 245 LEU 245 239 239 LEU LEU C . n 
C 1 246 GLN 246 240 240 GLN GLN C . n 
C 1 247 ARG 247 241 241 ARG ARG C . n 
C 1 248 ILE 248 242 242 ILE ILE C . n 
C 1 249 PHE 249 243 243 PHE PHE C . n 
C 1 250 TYR 250 244 244 TYR TYR C . n 
C 1 251 LEU 251 245 245 LEU LEU C . n 
C 1 252 LYS 252 246 246 LYS LYS C . n 
C 1 253 LEU 253 247 247 LEU LEU C . n 
C 1 254 GLU 254 248 248 GLU GLU C . n 
C 1 255 ASP 255 249 249 ASP ASP C . n 
C 1 256 LEU 256 250 250 LEU LEU C . n 
C 1 257 VAL 257 251 251 VAL VAL C . n 
C 1 258 PRO 258 252 252 PRO PRO C . n 
C 1 259 PRO 259 253 253 PRO PRO C . n 
C 1 260 PRO 260 254 254 PRO PRO C . n 
C 1 261 PRO 261 255 255 PRO PRO C . n 
C 1 262 ILE 262 256 256 ILE ILE C . n 
C 1 263 ILE 263 257 257 ILE ILE C . n 
C 1 264 ASP 264 258 258 ASP ASP C . n 
C 1 265 LYS 265 259 259 LYS LYS C . n 
C 1 266 ILE 266 260 260 ILE ILE C . n 
C 1 267 PHE 267 261 261 PHE PHE C . n 
C 1 268 MET 268 262 262 MET MET C . n 
C 1 269 ASP 269 263 263 ASP ASP C . n 
C 1 270 THR 270 264 264 THR THR C . n 
C 1 271 LEU 271 265 ?   ?   ?   C . n 
C 1 272 PRO 272 266 ?   ?   ?   C . n 
C 1 273 PHE 273 267 ?   ?   ?   C . n 
D 1 1   MET 1   -5  ?   ?   ?   D . n 
D 1 2   GLY 2   -4  ?   ?   ?   D . n 
D 1 3   SER 3   -3  ?   ?   ?   D . n 
D 1 4   SER 4   -2  ?   ?   ?   D . n 
D 1 5   HIS 5   -1  ?   ?   ?   D . n 
D 1 6   HIS 6   0   ?   ?   ?   D . n 
D 1 7   HIS 7   1   ?   ?   ?   D . n 
D 1 8   HIS 8   2   ?   ?   ?   D . n 
D 1 9   HIS 9   3   ?   ?   ?   D . n 
D 1 10  HIS 10  4   ?   ?   ?   D . n 
D 1 11  SER 11  5   ?   ?   ?   D . n 
D 1 12  SER 12  6   ?   ?   ?   D . n 
D 1 13  GLY 13  7   ?   ?   ?   D . n 
D 1 14  LEU 14  8   ?   ?   ?   D . n 
D 1 15  VAL 15  9   ?   ?   ?   D . n 
D 1 16  PRO 16  10  ?   ?   ?   D . n 
D 1 17  ARG 17  11  ?   ?   ?   D . n 
D 1 18  GLY 18  12  ?   ?   ?   D . n 
D 1 19  SER 19  13  ?   ?   ?   D . n 
D 1 20  HIS 20  14  ?   ?   ?   D . n 
D 1 21  MET 21  15  ?   ?   ?   D . n 
D 1 22  GLY 22  16  ?   ?   ?   D . n 
D 1 23  ARG 23  17  ?   ?   ?   D . n 
D 1 24  LEU 24  18  ?   ?   ?   D . n 
D 1 25  PRO 25  19  ?   ?   ?   D . n 
D 1 26  SER 26  20  ?   ?   ?   D . n 
D 1 27  LYS 27  21  ?   ?   ?   D . n 
D 1 28  PRO 28  22  ?   ?   ?   D . n 
D 1 29  LYS 29  23  ?   ?   ?   D . n 
D 1 30  GLN 30  24  ?   ?   ?   D . n 
D 1 31  PRO 31  25  ?   ?   ?   D . n 
D 1 32  PRO 32  26  ?   ?   ?   D . n 
D 1 33  ASP 33  27  ?   ?   ?   D . n 
D 1 34  ALA 34  28  ?   ?   ?   D . n 
D 1 35  SER 35  29  ?   ?   ?   D . n 
D 1 36  PRO 36  30  ?   ?   ?   D . n 
D 1 37  ALA 37  31  ?   ?   ?   D . n 
D 1 38  ASN 38  32  32  ASN ASN D . n 
D 1 39  LEU 39  33  33  LEU LEU D . n 
D 1 40  LEU 40  34  34  LEU LEU D . n 
D 1 41  THR 41  35  35  THR THR D . n 
D 1 42  SER 42  36  36  SER SER D . n 
D 1 43  LEU 43  37  37  LEU LEU D . n 
D 1 44  VAL 44  38  38  VAL VAL D . n 
D 1 45  ARG 45  39  39  ARG ARG D . n 
D 1 46  ALA 46  40  40  ALA ALA D . n 
D 1 47  HIS 47  41  41  HIS HIS D . n 
D 1 48  LEU 48  42  42  LEU LEU D . n 
D 1 49  ASP 49  43  43  ASP ASP D . n 
D 1 50  SER 50  44  44  SER SER D . n 
D 1 51  GLY 51  45  45  GLY GLY D . n 
D 1 52  PRO 52  46  46  PRO PRO D . n 
D 1 53  SER 53  47  47  SER SER D . n 
D 1 54  THR 54  48  48  THR THR D . n 
D 1 55  ALA 55  49  49  ALA ALA D . n 
D 1 56  LYS 56  50  50  LYS LYS D . n 
D 1 57  LEU 57  51  51  LEU LEU D . n 
D 1 58  ASP 58  52  52  ASP ASP D . n 
D 1 59  TYR 59  53  53  TYR TYR D . n 
D 1 60  SER 60  54  54  SER SER D . n 
D 1 61  LYS 61  55  55  LYS LYS D . n 
D 1 62  PHE 62  56  56  PHE PHE D . n 
D 1 63  GLN 63  57  57  GLN GLN D . n 
D 1 64  GLU 64  58  58  GLU GLU D . n 
D 1 65  LEU 65  59  59  LEU LEU D . n 
D 1 66  VAL 66  60  60  VAL VAL D . n 
D 1 67  LEU 67  61  61  LEU LEU D . n 
D 1 68  PRO 68  62  62  PRO PRO D . n 
D 1 69  HIS 69  63  63  HIS HIS D . n 
D 1 70  PHE 70  64  64  PHE PHE D . n 
D 1 71  GLY 71  65  65  GLY GLY D . n 
D 1 72  LYS 72  66  66  LYS LYS D . n 
D 1 73  GLU 73  67  67  GLU GLU D . n 
D 1 74  ASP 74  68  68  ASP ASP D . n 
D 1 75  ALA 75  69  69  ALA ALA D . n 
D 1 76  GLY 76  70  70  GLY GLY D . n 
D 1 77  ASP 77  71  71  ASP ASP D . n 
D 1 78  VAL 78  72  72  VAL VAL D . n 
D 1 79  GLN 79  73  73  GLN GLN D . n 
D 1 80  GLN 80  74  74  GLN GLN D . n 
D 1 81  PHE 81  75  75  PHE PHE D . n 
D 1 82  TYR 82  76  76  TYR TYR D . n 
D 1 83  ASP 83  77  77  ASP ASP D . n 
D 1 84  LEU 84  78  78  LEU LEU D . n 
D 1 85  LEU 85  79  79  LEU LEU D . n 
D 1 86  SER 86  80  80  SER SER D . n 
D 1 87  GLY 87  81  81  GLY GLY D . n 
D 1 88  SER 88  82  82  SER SER D . n 
D 1 89  LEU 89  83  83  LEU LEU D . n 
D 1 90  GLU 90  84  84  GLU GLU D . n 
D 1 91  VAL 91  85  85  VAL VAL D . n 
D 1 92  ILE 92  86  86  ILE ILE D . n 
D 1 93  ARG 93  87  87  ARG ARG D . n 
D 1 94  LYS 94  88  88  LYS LYS D . n 
D 1 95  TRP 95  89  89  TRP TRP D . n 
D 1 96  ALA 96  90  90  ALA ALA D . n 
D 1 97  GLU 97  91  91  GLU GLU D . n 
D 1 98  LYS 98  92  92  LYS LYS D . n 
D 1 99  ILE 99  93  93  ILE ILE D . n 
D 1 100 PRO 100 94  94  PRO PRO D . n 
D 1 101 GLY 101 95  95  GLY GLY D . n 
D 1 102 PHE 102 96  96  PHE PHE D . n 
D 1 103 ALA 103 97  97  ALA ALA D . n 
D 1 104 GLU 104 98  98  GLU GLU D . n 
D 1 105 LEU 105 99  99  LEU LEU D . n 
D 1 106 SER 106 100 100 SER SER D . n 
D 1 107 PRO 107 101 101 PRO PRO D . n 
D 1 108 ALA 108 102 102 ALA ALA D . n 
D 1 109 ASP 109 103 103 ASP ASP D . n 
D 1 110 GLN 110 104 104 GLN GLN D . n 
D 1 111 ASP 111 105 105 ASP ASP D . n 
D 1 112 LEU 112 106 106 LEU LEU D . n 
D 1 113 LEU 113 107 107 LEU LEU D . n 
D 1 114 LEU 114 108 108 LEU LEU D . n 
D 1 115 GLU 115 109 109 GLU GLU D . n 
D 1 116 SER 116 110 110 SER SER D . n 
D 1 117 ALA 117 111 111 ALA ALA D . n 
D 1 118 PHE 118 112 112 PHE PHE D . n 
D 1 119 LEU 119 113 113 LEU LEU D . n 
D 1 120 GLU 120 114 114 GLU GLU D . n 
D 1 121 LEU 121 115 115 LEU LEU D . n 
D 1 122 PHE 122 116 116 PHE PHE D . n 
D 1 123 ILE 123 117 117 ILE ILE D . n 
D 1 124 LEU 124 118 118 LEU LEU D . n 
D 1 125 ARG 125 119 119 ARG ARG D . n 
D 1 126 LEU 126 120 120 LEU LEU D . n 
D 1 127 ALA 127 121 121 ALA ALA D . n 
D 1 128 TYR 128 122 122 TYR TYR D . n 
D 1 129 ARG 129 123 123 ARG ARG D . n 
D 1 130 SER 130 124 124 SER SER D . n 
D 1 131 LYS 131 125 125 LYS LYS D . n 
D 1 132 PRO 132 126 126 PRO PRO D . n 
D 1 133 GLY 133 127 127 GLY GLY D . n 
D 1 134 GLU 134 128 128 GLU GLU D . n 
D 1 135 GLY 135 129 129 GLY GLY D . n 
D 1 136 LYS 136 130 130 LYS LYS D . n 
D 1 137 LEU 137 131 131 LEU LEU D . n 
D 1 138 ILE 138 132 132 ILE ILE D . n 
D 1 139 PHE 139 133 133 PHE PHE D . n 
D 1 140 CYS 140 134 134 CYS CYS D . n 
D 1 141 SER 141 135 135 SER SER D . n 
D 1 142 GLY 142 136 136 GLY GLY D . n 
D 1 143 LEU 143 137 137 LEU LEU D . n 
D 1 144 VAL 144 138 138 VAL VAL D . n 
D 1 145 LEU 145 139 139 LEU LEU D . n 
D 1 146 HIS 146 140 140 HIS HIS D . n 
D 1 147 ARG 147 141 141 ARG ARG D . n 
D 1 148 LEU 148 142 142 LEU LEU D . n 
D 1 149 GLN 149 143 143 GLN GLN D . n 
D 1 150 CYS 150 144 144 CYS CYS D . n 
D 1 151 ALA 151 145 145 ALA ALA D . n 
D 1 152 ARG 152 146 146 ARG ARG D . n 
D 1 153 GLY 153 147 147 GLY GLY D . n 
D 1 154 PHE 154 148 148 PHE PHE D . n 
D 1 155 GLY 155 149 149 GLY GLY D . n 
D 1 156 ASP 156 150 150 ASP ASP D . n 
D 1 157 TRP 157 151 151 TRP TRP D . n 
D 1 158 ILE 158 152 152 ILE ILE D . n 
D 1 159 ASP 159 153 153 ASP ASP D . n 
D 1 160 SER 160 154 154 SER SER D . n 
D 1 161 ILE 161 155 155 ILE ILE D . n 
D 1 162 LEU 162 156 156 LEU LEU D . n 
D 1 163 ALA 163 157 157 ALA ALA D . n 
D 1 164 PHE 164 158 158 PHE PHE D . n 
D 1 165 SER 165 159 159 SER SER D . n 
D 1 166 ARG 166 160 160 ARG ARG D . n 
D 1 167 SER 167 161 161 SER SER D . n 
D 1 168 LEU 168 162 162 LEU LEU D . n 
D 1 169 HIS 169 163 163 HIS HIS D . n 
D 1 170 SER 170 164 164 SER SER D . n 
D 1 171 LEU 171 165 165 LEU LEU D . n 
D 1 172 LEU 172 166 166 LEU LEU D . n 
D 1 173 VAL 173 167 167 VAL VAL D . n 
D 1 174 ASP 174 168 168 ASP ASP D . n 
D 1 175 VAL 175 169 169 VAL VAL D . n 
D 1 176 PRO 176 170 170 PRO PRO D . n 
D 1 177 ALA 177 171 171 ALA ALA D . n 
D 1 178 PHE 178 172 172 PHE PHE D . n 
D 1 179 ALA 179 173 173 ALA ALA D . n 
D 1 180 CYS 180 174 174 CYS CYS D . n 
D 1 181 LEU 181 175 175 LEU LEU D . n 
D 1 182 SER 182 176 176 SER SER D . n 
D 1 183 ALA 183 177 177 ALA ALA D . n 
D 1 184 LEU 184 178 178 LEU LEU D . n 
D 1 185 VAL 185 179 179 VAL VAL D . n 
D 1 186 LEU 186 180 180 LEU LEU D . n 
D 1 187 ILE 187 181 181 ILE ILE D . n 
D 1 188 THR 188 182 182 THR THR D . n 
D 1 189 ASP 189 183 183 ASP ASP D . n 
D 1 190 ARG 190 184 184 ARG ARG D . n 
D 1 191 HIS 191 185 185 HIS HIS D . n 
D 1 192 GLY 192 186 186 GLY GLY D . n 
D 1 193 LEU 193 187 187 LEU LEU D . n 
D 1 194 GLN 194 188 188 GLN GLN D . n 
D 1 195 GLU 195 189 189 GLU GLU D . n 
D 1 196 PRO 196 190 190 PRO PRO D . n 
D 1 197 ARG 197 191 191 ARG ARG D . n 
D 1 198 ARG 198 192 192 ARG ARG D . n 
D 1 199 VAL 199 193 193 VAL VAL D . n 
D 1 200 GLU 200 194 194 GLU GLU D . n 
D 1 201 GLU 201 195 195 GLU GLU D . n 
D 1 202 LEU 202 196 196 LEU LEU D . n 
D 1 203 GLN 203 197 197 GLN GLN D . n 
D 1 204 ASN 204 198 198 ASN ASN D . n 
D 1 205 ARG 205 199 199 ARG ARG D . n 
D 1 206 ILE 206 200 200 ILE ILE D . n 
D 1 207 ALA 207 201 201 ALA ALA D . n 
D 1 208 SER 208 202 202 SER SER D . n 
D 1 209 CYS 209 203 203 CYS CYS D . n 
D 1 210 LEU 210 204 204 LEU LEU D . n 
D 1 211 LYS 211 205 205 LYS LYS D . n 
D 1 212 GLU 212 206 206 GLU GLU D . n 
D 1 213 HIS 213 207 207 HIS HIS D . n 
D 1 214 VAL 214 208 208 VAL VAL D . n 
D 1 215 ALA 215 209 209 ALA ALA D . n 
D 1 216 ALA 216 210 210 ALA ALA D . n 
D 1 217 VAL 217 211 211 VAL VAL D . n 
D 1 218 ALA 218 212 ?   ?   ?   D . n 
D 1 219 GLY 219 213 ?   ?   ?   D . n 
D 1 220 GLU 220 214 ?   ?   ?   D . n 
D 1 221 PRO 221 215 ?   ?   ?   D . n 
D 1 222 GLN 222 216 ?   ?   ?   D . n 
D 1 223 PRO 223 217 ?   ?   ?   D . n 
D 1 224 ALA 224 218 ?   ?   ?   D . n 
D 1 225 SER 225 219 219 SER SER D . n 
D 1 226 CYS 226 220 220 CYS CYS D . n 
D 1 227 LEU 227 221 221 LEU LEU D . n 
D 1 228 SER 228 222 222 SER SER D . n 
D 1 229 ARG 229 223 223 ARG ARG D . n 
D 1 230 LEU 230 224 224 LEU LEU D . n 
D 1 231 LEU 231 225 225 LEU LEU D . n 
D 1 232 GLY 232 226 226 GLY GLY D . n 
D 1 233 LYS 233 227 227 LYS LYS D . n 
D 1 234 LEU 234 228 228 LEU LEU D . n 
D 1 235 PRO 235 229 229 PRO PRO D . n 
D 1 236 GLU 236 230 230 GLU GLU D . n 
D 1 237 LEU 237 231 231 LEU LEU D . n 
D 1 238 ARG 238 232 232 ARG ARG D . n 
D 1 239 THR 239 233 233 THR THR D . n 
D 1 240 LEU 240 234 234 LEU LEU D . n 
D 1 241 CYS 241 235 235 CYS CYS D . n 
D 1 242 THR 242 236 236 THR THR D . n 
D 1 243 GLN 243 237 237 GLN GLN D . n 
D 1 244 GLY 244 238 238 GLY GLY D . n 
D 1 245 LEU 245 239 239 LEU LEU D . n 
D 1 246 GLN 246 240 240 GLN GLN D . n 
D 1 247 ARG 247 241 241 ARG ARG D . n 
D 1 248 ILE 248 242 242 ILE ILE D . n 
D 1 249 PHE 249 243 243 PHE PHE D . n 
D 1 250 TYR 250 244 244 TYR TYR D . n 
D 1 251 LEU 251 245 245 LEU LEU D . n 
D 1 252 LYS 252 246 246 LYS LYS D . n 
D 1 253 LEU 253 247 247 LEU LEU D . n 
D 1 254 GLU 254 248 248 GLU GLU D . n 
D 1 255 ASP 255 249 249 ASP ASP D . n 
D 1 256 LEU 256 250 250 LEU LEU D . n 
D 1 257 VAL 257 251 251 VAL VAL D . n 
D 1 258 PRO 258 252 252 PRO PRO D . n 
D 1 259 PRO 259 253 253 PRO PRO D . n 
D 1 260 PRO 260 254 254 PRO PRO D . n 
D 1 261 PRO 261 255 255 PRO PRO D . n 
D 1 262 ILE 262 256 256 ILE ILE D . n 
D 1 263 ILE 263 257 257 ILE ILE D . n 
D 1 264 ASP 264 258 258 ASP ASP D . n 
D 1 265 LYS 265 259 259 LYS LYS D . n 
D 1 266 ILE 266 260 260 ILE ILE D . n 
D 1 267 PHE 267 261 261 PHE PHE D . n 
D 1 268 MET 268 262 262 MET MET D . n 
D 1 269 ASP 269 263 263 ASP ASP D . n 
D 1 270 THR 270 264 264 THR THR D . n 
D 1 271 LEU 271 265 265 LEU LEU D . n 
D 1 272 PRO 272 266 ?   ?   ?   D . n 
D 1 273 PHE 273 267 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
3 author_defined_assembly ? monomeric 1 
4 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E 
2 1 B,F 
3 1 C,G 
4 1 D,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 26.6408 29.7298  -9.3384  0.1348 0.1262 0.2740 -0.0984 -0.0732 0.0924  3.4074  2.0317  2.6970  -2.6311  -3.0314 
2.3408   -0.3914 0.0771  0.8511  0.0072  -0.4091 -0.9227 -1.1608 0.6307  0.8004  'X-RAY DIFFRACTION' 
2  ? refined 30.8868 16.3474  14.0357  0.1787 0.1299 0.1778 -0.1019 -0.1312 0.1389  4.6334  1.8696  0.5888  -0.5457  0.1282  
1.0128   0.1117  -0.3422 -0.1679 0.1224  -0.0627 -0.0379 0.0234  -0.0273 -0.0490 'X-RAY DIFFRACTION' 
3  ? refined 18.5149 25.8915  -0.1329  0.1377 0.0749 0.1137 -0.0251 0.0119  0.0048  5.2103  1.6581  4.0522  -1.7159  0.7156  
-1.2938  -0.0042 -0.3607 0.1047  0.2567  0.1088  -0.0867 -0.4877 0.1463  -0.1046 'X-RAY DIFFRACTION' 
4  ? refined 29.5114 11.2537  6.0573   0.0954 0.0650 0.2018 0.0186  -0.0711 0.0809  1.4600  1.4411  6.4912  -0.6803  2.2961  
0.4866   0.0831  -0.1289 -0.3162 -0.0056 0.1243  -0.3818 0.2888  0.0942  -0.2074 'X-RAY DIFFRACTION' 
5  ? refined 15.6491 21.7011  -7.6760  0.1094 0.1153 0.1656 -0.0067 -0.0232 0.0794  9.1685  1.2096  4.2442  -3.2066  -2.9383 
1.4493   0.3971  -0.1127 -0.2188 -0.4267 -0.1893 0.1731  -0.0090 -0.2077 -0.2077 'X-RAY DIFFRACTION' 
6  ? refined 7.7576  28.7916  -12.6840 0.0990 0.1121 0.1487 0.0659  0.0055  0.0603  9.6044  1.2257  8.7059  1.1821   -6.3816 
1.4109   0.2524  0.5348  -0.0514 -0.3474 -0.1824 0.3225  -0.0748 0.0769  -0.0700 'X-RAY DIFFRACTION' 
7  ? refined 21.5443 21.2104  -20.7670 0.1144 0.2371 0.0989 0.0184  0.0183  -0.0172 1.8329  0.8523  9.8990  0.9237   -1.2210 
1.2595   0.0548  0.7741  0.1656  -0.4306 0.0960  -0.2587 -0.8218 0.4074  -0.1507 'X-RAY DIFFRACTION' 
8  ? refined 17.2668 11.3519  -9.3993  0.2134 0.1209 0.2275 -0.0354 -0.0942 -0.0239 2.2354  1.9766  6.9155  -2.0718  3.9267  
-3.6711  0.3908  0.1385  -0.3212 -0.1819 -0.3012 -0.1670 0.4251  0.1251  -0.0896 'X-RAY DIFFRACTION' 
9  ? refined 14.6851 10.7967  14.6491  0.1757 0.1112 0.1445 -0.0931 -0.0701 0.1571  4.6411  4.5274  5.3033  1.8829   -1.7760 
-1.0277  -0.1858 -0.0961 -0.5029 0.4706  0.1394  -0.0484 0.5271  -0.3166 0.0465  'X-RAY DIFFRACTION' 
10 ? refined 12.9402 20.4437  16.2699  0.2856 0.0175 0.0756 -0.0456 0.0948  -0.0870 14.3624 5.9001  4.9379  1.0063   6.5495  
0.4624   0.8171  -0.7247 -0.1827 -0.1693 -0.1805 0.7019  -0.6010 -0.6300 -0.6366 'X-RAY DIFFRACTION' 
11 ? refined 36.9562 -20.3383 -10.1967 0.0477 0.1216 0.1545 0.0048  -0.0075 0.0322  4.0703  4.3025  5.4818  1.3998   -3.5689 
-3.3463  -0.4295 -0.2838 -0.4033 -0.0839 -0.1914 -0.8781 0.4331  0.4764  0.6209  'X-RAY DIFFRACTION' 
12 ? refined 33.2358 -2.5660  -31.5437 0.1993 0.6242 0.1995 0.0544  0.1641  0.2620  16.6210 23.6779 17.6904 18.6983  16.2833 
16.1754  -1.3268 -0.4675 0.0575  0.6950  1.1452  0.3765  1.4255  2.1967  0.1816  'X-RAY DIFFRACTION' 
13 ? refined 28.5452 -16.9981 -26.5835 0.1500 0.1177 0.1190 0.0132  0.0156  0.0113  1.2347  6.1712  22.7263 1.6022   -4.9727 
-9.7762  0.4444  0.1796  -0.2219 -0.2525 -0.6312 0.0240  0.4941  0.2386  0.1868  'X-RAY DIFFRACTION' 
14 ? refined 20.9703 -28.4707 -12.0543 0.1742 0.0693 0.1547 0.0118  0.0084  0.0061  3.6298  3.2259  0.9749  1.4532   -1.8135 
-0.2993  -0.1954 0.0509  -0.2964 0.0270  0.0003  0.0302  0.2317  -0.0301 0.1950  'X-RAY DIFFRACTION' 
15 ? refined 29.8162 -13.5996 -11.1461 0.1252 0.1003 0.2021 -0.0261 -0.0263 0.0381  5.0118  1.3500  1.7785  1.5163   -2.3172 
0.0928   0.5335  -0.2442 0.1496  0.0782  -0.3370 -0.0406 -0.0663 0.1997  -0.1965 'X-RAY DIFFRACTION' 
16 ? refined 29.1423 -11.1568 -12.1783 0.1075 0.0559 0.1485 -0.0123 0.0081  0.0247  1.0907  2.7392  2.5377  0.1584   -0.3685 
-1.3078  0.1116  -0.1246 0.1856  0.0440  -0.1254 -0.0626 -0.2472 0.1705  0.0138  'X-RAY DIFFRACTION' 
17 ? refined 16.0736 -24.8688 1.9092   0.0410 0.1253 0.2355 -0.0182 0.1478  0.0215  8.8560  6.4107  3.9050  4.3033   2.5804  
2.1065   0.2978  -1.1988 0.3022  0.7037  -0.7287 -0.0315 0.7802  -0.8673 0.4308  'X-RAY DIFFRACTION' 
18 ? refined 19.3939 -10.3575 2.4576   0.0310 0.1836 0.3003 0.1024  0.0487  -0.0909 17.7191 28.9582 40.9213 5.8238   8.7375  
-28.5950 0.4947  -1.3599 -0.0953 0.6921  -1.2554 -0.8398 -2.6853 -1.7330 0.7606  'X-RAY DIFFRACTION' 
19 ? refined 17.8000 -9.9533  -22.6795 0.1346 0.1164 0.1703 0.0724  -0.0204 0.0062  1.2649  4.1945  8.1254  1.5463   2.4163  
0.1103   -0.0960 0.0417  0.1038  -0.1325 0.2425  0.1296  -0.2025 -0.0163 -0.1465 'X-RAY DIFFRACTION' 
20 ? refined 17.7259 -20.0523 -28.2355 0.2066 0.0321 0.1671 -0.0033 -0.0253 -0.0299 7.3085  11.2025 4.8147  6.0082   1.4140  
-4.1707  -0.0956 -0.4468 -0.1521 -1.0038 0.4899  0.6758  0.7963  0.2326  -0.3943 'X-RAY DIFFRACTION' 
21 ? refined -9.6386 7.7875   -51.3301 0.1441 0.0325 0.2247 0.1611  -0.0898 -0.0895 2.0695  10.6690 11.0069 2.6069   4.6672  
3.9937   -0.1273 0.0224  0.1386  -0.2234 -0.3625 0.6683  -0.2119 -0.9765 0.4897  'X-RAY DIFFRACTION' 
22 ? refined -2.8533 17.0824  -26.7201 0.1992 0.1637 0.0938 0.0336  -0.0761 -0.1310 4.8229  3.1978  5.8995  -3.3530  2.7641  
-3.8556  -0.0922 -0.0704 0.7072  0.0350  -0.1169 0.2410  -0.2616 -0.8026 0.2091  'X-RAY DIFFRACTION' 
23 ? refined 5.2038  4.6111   -16.4407 0.3129 0.1941 0.1630 0.0252  -0.1351 0.0509  2.9707  9.0527  7.9101  5.0705   -4.8393 
-8.3632  -0.2953 -0.2440 -1.0662 1.1731  -0.3387 -0.9602 -1.2747 0.0470  0.6341  'X-RAY DIFFRACTION' 
24 ? refined -6.6270 -0.2122  -34.3112 0.1356 0.0297 0.1973 0.0460  -0.0330 -0.0647 5.2713  1.2831  9.5969  -0.1809  4.6953  
1.2861   0.0444  -0.3462 -0.2030 -0.0074 0.0109  0.2415  0.0454  -0.7138 -0.0553 'X-RAY DIFFRACTION' 
25 ? refined -2.7724 0.5421   -41.0828 0.1297 0.0979 0.1429 -0.0052 -0.0852 -0.0628 1.5482  4.4744  1.5825  1.2855   0.9540  
1.0384   -0.0384 0.1151  -0.1774 0.1679  0.0798  -0.2259 -0.1510 -0.1051 -0.0414 'X-RAY DIFFRACTION' 
26 ? refined 2.3715  10.4938  -26.6109 0.2052 0.1557 0.0661 0.0127  -0.0734 -0.0858 8.5470  3.3153  4.2899  -2.1928  4.1913  
-0.7265  0.0470  -0.3380 -0.4307 0.1145  -0.3813 0.1743  -0.1022 -0.3094 0.3343  'X-RAY DIFFRACTION' 
27 ? refined 2.3120  0.8771   -47.2982 0.1497 0.0622 0.1371 0.0569  -0.0810 -0.0184 1.0340  0.7153  2.0129  0.4787   0.1900  
-0.4702  -0.1001 0.1009  -0.0457 -0.1840 0.0333  -0.0789 -0.2052 0.0540  0.0668  'X-RAY DIFFRACTION' 
28 ? refined 5.9109  7.9880   -55.6342 0.2246 0.1071 0.1409 -0.0991 -0.0617 0.0474  7.8918  6.1684  0.4018  -2.3107  -1.7363 
0.8378   -0.1888 1.0985  0.3484  0.5647  -0.5661 -0.0902 -0.6215 0.5479  0.7549  'X-RAY DIFFRACTION' 
29 ? refined 9.7746  -3.6407  -31.3051 0.1108 0.0364 0.1596 0.0335  -0.0449 0.0012  2.5262  4.2037  6.0379  1.4254   1.0069  
-1.7025  -0.0200 -0.1212 0.0529  -0.2104 0.0754  0.0867  0.4516  0.9329  -0.0554 'X-RAY DIFFRACTION' 
30 ? refined 0.7908  -9.3987  -26.2318 0.1861 0.0535 0.3158 -0.0501 -0.0975 0.0712  1.9061  1.2306  3.0217  -0.8310  0.2174  
-1.7080  -0.1288 -0.1621 -0.1417 0.0057  0.2681  0.6633  0.2564  -0.0629 -0.1394 'X-RAY DIFFRACTION' 
31 ? refined 48.9929 16.2856  -49.3267 0.1276 0.1588 0.1402 -0.1225 -0.0792 0.0092  2.5702  0.2417  7.1992  0.4401   2.7609  
-0.3663  -0.1048 -0.0170 0.2893  0.1513  -0.2728 -0.2373 -0.3290 0.2955  0.3777  'X-RAY DIFFRACTION' 
32 ? refined 37.6219 5.5458   -70.3904 0.5206 0.0387 0.3532 -0.2499 -0.1973 0.0069  19.8894 17.4743 14.6575 -18.0377 6.4785  
-2.1336  -0.9760 1.0487  2.4761  0.4890  -0.1856 -0.3274 -1.4009 1.0238  1.1616  'X-RAY DIFFRACTION' 
33 ? refined 51.6459 3.8146   -52.2531 0.1225 0.1339 0.2596 -0.1022 0.0093  0.0331  1.8826  0.6443  1.2413  0.8126   -1.5277 
-0.6379  0.0103  0.1388  -0.6674 -0.2506 0.0580  -0.6877 0.0396  0.7664  -0.0683 'X-RAY DIFFRACTION' 
34 ? refined 53.3364 -3.8079  -40.7192 0.1003 0.2044 0.2626 0.0070  0.1046  0.2055  1.1662  5.6717  5.6741  -2.5179  -1.9649 
3.4962   -0.9422 -0.0319 -0.4441 0.4477  0.3790  0.5197  0.5723  1.2211  0.5632  'X-RAY DIFFRACTION' 
35 ? refined 42.1933 13.1286  -53.0675 0.0483 0.1085 0.1945 -0.0990 -0.0063 -0.0002 1.7453  3.4762  4.7678  -2.2356  0.3225  
-0.5264  0.0448  0.0204  -0.1498 0.0707  0.0189  -0.1969 -0.2913 0.0032  -0.0637 'X-RAY DIFFRACTION' 
36 ? refined 39.3804 9.3831   -44.6125 0.1021 0.0807 0.1320 -0.1231 -0.0371 0.0199  2.9045  1.0584  4.0849  0.0062   0.7139  
-0.0455  0.0267  -0.0890 -0.0828 0.0282  -0.1034 -0.0072 -0.2750 -0.0295 0.0767  'X-RAY DIFFRACTION' 
37 ? refined 46.2939 1.3718   -29.1966 0.0739 0.2401 0.0859 -0.1346 -0.0258 0.2549  4.4875  8.4904  4.6070  -3.7430  -3.1036 
2.3439   -0.2893 -0.6392 -0.3486 0.8006  0.1069  0.2469  0.0194  0.7217  0.1824  'X-RAY DIFFRACTION' 
38 ? refined 35.4867 5.6407   -36.5333 0.3968 0.0639 0.0416 -0.0924 0.1146  0.0331  17.9340 12.3251 1.0266  -14.8673 -4.2908 
3.5571   1.2729  0.5142  -0.6014 -1.5440 -2.2136 0.7784  -0.3052 0.2684  0.9407  'X-RAY DIFFRACTION' 
39 ? refined 36.8247 -2.8775  -54.0699 0.1159 0.1881 0.2065 -0.1859 0.0667  -0.0643 0.0809  7.5724  16.1878 0.7734   1.1444  
10.9264  -0.0583 0.1565  -0.2101 0.4050  0.1548  0.0220  0.8216  -0.4155 -0.0965 'X-RAY DIFFRACTION' 
40 ? refined 46.4449 -7.7555  -57.7089 0.0121 0.0147 0.2807 0.0129  0.0260  -0.0950 4.5497  9.0354  1.9388  0.9526   0.3641  
-1.9116  -0.0275 0.0815  -0.3581 -0.3842 -0.1096 -0.9675 1.3846  0.9634  0.1371  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 32  A 38  A 46  A 52  ? 'X-RAY DIFFRACTION' ? 
2  2  A 47  A 53  A 83  A 89  ? 'X-RAY DIFFRACTION' ? 
3  3  A 84  A 90  A 126 A 132 ? 'X-RAY DIFFRACTION' ? 
4  4  A 127 A 133 A 163 A 169 ? 'X-RAY DIFFRACTION' ? 
5  5  A 164 A 170 A 190 A 196 ? 'X-RAY DIFFRACTION' ? 
6  6  A 191 A 197 A 199 A 205 ? 'X-RAY DIFFRACTION' ? 
7  7  A 200 A 206 A 213 A 219 ? 'X-RAY DIFFRACTION' ? 
8  8  A 217 A 223 A 235 A 241 ? 'X-RAY DIFFRACTION' ? 
9  9  A 236 A 242 A 247 A 253 ? 'X-RAY DIFFRACTION' ? 
10 10 A 248 A 254 A 264 A 270 ? 'X-RAY DIFFRACTION' ? 
11 11 B 32  B 38  B 59  B 65  ? 'X-RAY DIFFRACTION' ? 
12 12 B 60  B 66  B 69  B 75  ? 'X-RAY DIFFRACTION' ? 
13 13 B 70  B 76  B 82  B 88  ? 'X-RAY DIFFRACTION' ? 
14 14 B 83  B 89  B 114 B 120 ? 'X-RAY DIFFRACTION' ? 
15 15 B 115 B 121 B 126 B 132 ? 'X-RAY DIFFRACTION' ? 
16 16 B 127 B 133 B 183 B 189 ? 'X-RAY DIFFRACTION' ? 
17 17 B 184 B 190 B 213 B 219 ? 'X-RAY DIFFRACTION' ? 
18 18 B 217 B 223 B 229 B 235 ? 'X-RAY DIFFRACTION' ? 
19 19 B 230 B 236 B 248 B 254 ? 'X-RAY DIFFRACTION' ? 
20 20 B 249 B 255 B 264 B 270 ? 'X-RAY DIFFRACTION' ? 
21 21 C 30  C 36  C 44  C 50  ? 'X-RAY DIFFRACTION' ? 
22 22 C 45  C 51  C 61  C 67  ? 'X-RAY DIFFRACTION' ? 
23 23 C 62  C 68  C 74  C 80  ? 'X-RAY DIFFRACTION' ? 
24 24 C 75  C 81  C 91  C 97  ? 'X-RAY DIFFRACTION' ? 
25 25 C 92  C 98  C 130 C 136 ? 'X-RAY DIFFRACTION' ? 
26 26 C 131 C 137 C 149 C 155 ? 'X-RAY DIFFRACTION' ? 
27 27 C 150 C 156 C 203 C 209 ? 'X-RAY DIFFRACTION' ? 
28 28 C 204 C 210 C 228 C 234 ? 'X-RAY DIFFRACTION' ? 
29 29 C 229 C 235 C 247 C 253 ? 'X-RAY DIFFRACTION' ? 
30 30 C 248 C 254 C 264 C 270 ? 'X-RAY DIFFRACTION' ? 
31 31 D 32  D 38  D 62  D 68  ? 'X-RAY DIFFRACTION' ? 
32 32 D 63  D 69  D 70  D 76  ? 'X-RAY DIFFRACTION' ? 
33 33 D 71  D 77  D 93  D 99  ? 'X-RAY DIFFRACTION' ? 
34 34 D 94  D 100 D 114 D 120 ? 'X-RAY DIFFRACTION' ? 
35 35 D 115 D 121 D 145 D 151 ? 'X-RAY DIFFRACTION' ? 
36 36 D 146 D 152 D 182 D 188 ? 'X-RAY DIFFRACTION' ? 
37 37 D 183 D 189 D 223 D 229 ? 'X-RAY DIFFRACTION' ? 
38 38 D 224 D 230 D 229 D 235 ? 'X-RAY DIFFRACTION' ? 
39 39 D 230 D 236 D 247 D 253 ? 'X-RAY DIFFRACTION' ? 
40 40 D 248 D 254 D 265 D 271 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER    phasing          .        ? 1 
REFMAC    refinement       5.2.0019 ? 2 
DENZO     'data reduction' .        ? 3 
SCALEPACK 'data scaling'   .        ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CZ A ARG 191 ? ? NH2 A ARG 191 ? ? 1.232 1.326 -0.094 0.013 N 
2 1 CA A PRO 217 ? ? CB  A PRO 217 ? ? 1.367 1.531 -0.164 0.020 N 
3 1 CA A PRO 217 ? ? C   A PRO 217 ? ? 1.396 1.524 -0.128 0.020 N 
4 1 N  B PRO 217 ? ? CA  B PRO 217 ? ? 1.669 1.468 0.201  0.017 N 
5 1 CA B PRO 217 ? ? CB  B PRO 217 ? ? 1.654 1.533 0.121  0.018 N 
6 1 CB C GLN 74  ? ? CG  C GLN 74  ? ? 1.714 1.521 0.193  0.027 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 191 ? ? CZ A ARG 191 ? ? NH1 A ARG 191 ? ? 128.06 120.30 7.76   0.50 N 
2 1 NE A ARG 191 ? ? CZ A ARG 191 ? ? NH2 A ARG 191 ? ? 111.29 120.30 -9.01  0.50 N 
3 1 N  A PRO 217 ? ? CA A PRO 217 ? ? C   A PRO 217 ? ? 94.83  112.10 -17.27 2.60 N 
4 1 N  A CYS 220 ? ? CA A CYS 220 ? ? C   A CYS 220 ? ? 128.06 111.00 17.06  2.70 N 
5 1 N  B PRO 217 ? ? CA B PRO 217 ? ? CB  B PRO 217 ? ? 124.97 103.30 21.67  1.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 44  ? ? -121.57 -50.73  
2  1 THR A 48  ? ? -56.45  107.07  
3  1 ALA A 49  ? ? 118.80  24.40   
4  1 LYS A 50  ? ? -153.11 25.24   
5  1 GLU A 58  ? ? -58.04  103.32  
6  1 GLU A 67  ? ? -23.25  115.99  
7  1 GLU A 128 ? ? -140.51 25.70   
8  1 ALA A 212 ? ? 128.23  -132.31 
9  1 CYS A 220 ? ? 61.01   -71.21  
10 1 ASP A 249 ? ? 27.50   57.98   
11 1 LEU A 250 ? ? -69.82  -130.08 
12 1 ASP A 263 ? ? -68.50  85.74   
13 1 ASP B 43  ? ? -46.39  -16.95  
14 1 ALA B 49  ? ? -44.95  -73.04  
15 1 LYS B 50  ? ? -115.90 72.46   
16 1 SER B 54  ? ? -48.00  -14.13  
17 1 GLU B 58  ? ? -59.92  106.17  
18 1 HIS B 63  ? ? -101.89 -164.07 
19 1 ALA B 210 ? ? -60.52  40.28   
20 1 VAL B 211 ? ? -177.26 89.06   
21 1 SER B 219 ? ? 89.91   -78.53  
22 1 LEU B 224 ? ? -46.22  -72.78  
23 1 LEU B 250 ? ? -79.81  -107.49 
24 1 PRO B 255 ? ? -24.87  -53.08  
25 1 ASP B 263 ? ? -67.06  17.60   
26 1 ALA C 31  ? ? 159.03  -45.72  
27 1 SER C 44  ? ? -134.01 -33.82  
28 1 LYS C 50  ? ? -65.32  18.21   
29 1 LEU C 51  ? ? -68.78  74.92   
30 1 ASP C 52  ? ? -55.51  99.99   
31 1 ASP C 68  ? ? -109.74 -163.67 
32 1 ARG C 141 ? ? -14.82  -55.65  
33 1 LEU C 228 ? ? -26.44  -58.49  
34 1 ASP C 249 ? ? 64.43   87.60   
35 1 PRO C 255 ? ? -32.72  -39.66  
36 1 MET C 262 ? ? -62.82  86.64   
37 1 ASP C 263 ? ? -176.64 70.73   
38 1 LEU D 34  ? ? -52.93  -71.18  
39 1 ASP D 43  ? ? -73.26  28.40   
40 1 SER D 44  ? ? -139.43 -58.86  
41 1 ALA D 49  ? ? 138.04  -43.05  
42 1 GLN D 57  ? ? 176.41  117.64  
43 1 SER D 124 ? ? -67.14  -173.46 
44 1 ASP D 150 ? ? -37.27  -26.77  
45 1 ALA D 210 ? ? -66.82  -83.54  
46 1 ASP D 249 ? ? 68.05   -29.77  
47 1 LEU D 250 ? ? -11.24  -72.44  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 SER A 219 ? ? CYS A 220 ? ? -31.55  
2 1 LYS B 50  ? ? LEU B 51  ? ? 149.94  
3 1 PRO C 30  ? ? ALA C 31  ? ? -145.66 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ALA 49  ? CB  ? A ALA 55  CB  
2  1 Y 1 A PHE 64  ? CB  ? A PHE 70  CB  
3  1 Y 1 A PHE 64  ? CG  ? A PHE 70  CG  
4  1 Y 1 A PHE 64  ? CD1 ? A PHE 70  CD1 
5  1 Y 1 A PHE 64  ? CD2 ? A PHE 70  CD2 
6  1 Y 1 A PHE 64  ? CE1 ? A PHE 70  CE1 
7  1 Y 1 A PHE 64  ? CE2 ? A PHE 70  CE2 
8  1 Y 1 A PHE 64  ? CZ  ? A PHE 70  CZ  
9  1 Y 1 A CYS 134 ? SG  ? A CYS 140 SG  
10 1 Y 1 A LYS 205 ? CG  ? A LYS 211 CG  
11 1 Y 1 A LYS 205 ? CD  ? A LYS 211 CD  
12 1 Y 1 A LYS 205 ? CE  ? A LYS 211 CE  
13 1 Y 1 A LYS 205 ? NZ  ? A LYS 211 NZ  
14 1 Y 1 A ALA 212 ? CB  ? A ALA 218 CB  
15 1 Y 1 A PRO 217 ? CG  ? A PRO 223 CG  
16 1 Y 1 A PRO 217 ? CD  ? A PRO 223 CD  
17 1 Y 1 A ALA 218 ? CB  ? A ALA 224 CB  
18 1 Y 1 A GLU 248 ? CB  ? A GLU 254 CB  
19 1 Y 1 A GLU 248 ? CG  ? A GLU 254 CG  
20 1 Y 1 A GLU 248 ? CD  ? A GLU 254 CD  
21 1 Y 1 A GLU 248 ? OE1 ? A GLU 254 OE1 
22 1 Y 1 A GLU 248 ? OE2 ? A GLU 254 OE2 
23 1 Y 1 B LYS 205 ? CG  ? B LYS 211 CG  
24 1 Y 1 B LYS 205 ? CD  ? B LYS 211 CD  
25 1 Y 1 B LYS 205 ? CE  ? B LYS 211 CE  
26 1 Y 1 B LYS 205 ? NZ  ? B LYS 211 NZ  
27 1 Y 1 B ALA 212 ? CB  ? B ALA 218 CB  
28 1 Y 1 B PRO 217 ? CG  ? B PRO 223 CG  
29 1 Y 1 B PRO 217 ? CD  ? B PRO 223 CD  
30 1 Y 1 B ALA 218 ? CB  ? B ALA 224 CB  
31 1 Y 1 B SER 219 ? CB  ? B SER 225 CB  
32 1 Y 1 B SER 219 ? OG  ? B SER 225 OG  
33 1 Y 1 C ALA 31  ? CB  ? C ALA 37  CB  
34 1 Y 1 C ARG 223 ? CG  ? C ARG 229 CG  
35 1 Y 1 C ARG 223 ? CD  ? C ARG 229 CD  
36 1 Y 1 C ARG 223 ? NE  ? C ARG 229 NE  
37 1 Y 1 C ARG 223 ? CZ  ? C ARG 229 CZ  
38 1 Y 1 C ARG 223 ? NH1 ? C ARG 229 NH1 
39 1 Y 1 C ARG 223 ? NH2 ? C ARG 229 NH2 
40 1 Y 1 C ASP 263 ? CB  ? C ASP 269 CB  
41 1 Y 1 C ASP 263 ? CG  ? C ASP 269 CG  
42 1 Y 1 C ASP 263 ? OD1 ? C ASP 269 OD1 
43 1 Y 1 C ASP 263 ? OD2 ? C ASP 269 OD2 
44 1 Y 1 D ALA 49  ? CB  ? D ALA 55  CB  
45 1 Y 1 D LEU 265 ? CG  ? D LEU 271 CG  
46 1 Y 1 D LEU 265 ? CD1 ? D LEU 271 CD1 
47 1 Y 1 D LEU 265 ? CD2 ? D LEU 271 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -5  ? A MET 1   
2   1 Y 1 A GLY -4  ? A GLY 2   
3   1 Y 1 A SER -3  ? A SER 3   
4   1 Y 1 A SER -2  ? A SER 4   
5   1 Y 1 A HIS -1  ? A HIS 5   
6   1 Y 1 A HIS 0   ? A HIS 6   
7   1 Y 1 A HIS 1   ? A HIS 7   
8   1 Y 1 A HIS 2   ? A HIS 8   
9   1 Y 1 A HIS 3   ? A HIS 9   
10  1 Y 1 A HIS 4   ? A HIS 10  
11  1 Y 1 A SER 5   ? A SER 11  
12  1 Y 1 A SER 6   ? A SER 12  
13  1 Y 1 A GLY 7   ? A GLY 13  
14  1 Y 1 A LEU 8   ? A LEU 14  
15  1 Y 1 A VAL 9   ? A VAL 15  
16  1 Y 1 A PRO 10  ? A PRO 16  
17  1 Y 1 A ARG 11  ? A ARG 17  
18  1 Y 1 A GLY 12  ? A GLY 18  
19  1 Y 1 A SER 13  ? A SER 19  
20  1 Y 1 A HIS 14  ? A HIS 20  
21  1 Y 1 A MET 15  ? A MET 21  
22  1 Y 1 A GLY 16  ? A GLY 22  
23  1 Y 1 A ARG 17  ? A ARG 23  
24  1 Y 1 A LEU 18  ? A LEU 24  
25  1 Y 1 A PRO 19  ? A PRO 25  
26  1 Y 1 A SER 20  ? A SER 26  
27  1 Y 1 A LYS 21  ? A LYS 27  
28  1 Y 1 A PRO 22  ? A PRO 28  
29  1 Y 1 A LYS 23  ? A LYS 29  
30  1 Y 1 A GLN 24  ? A GLN 30  
31  1 Y 1 A PRO 25  ? A PRO 31  
32  1 Y 1 A PRO 26  ? A PRO 32  
33  1 Y 1 A ASP 27  ? A ASP 33  
34  1 Y 1 A ALA 28  ? A ALA 34  
35  1 Y 1 A SER 29  ? A SER 35  
36  1 Y 1 A PRO 30  ? A PRO 36  
37  1 Y 1 A ALA 31  ? A ALA 37  
38  1 Y 1 A GLU 214 ? A GLU 220 
39  1 Y 1 A PRO 215 ? A PRO 221 
40  1 Y 1 A GLN 216 ? A GLN 222 
41  1 Y 1 A LEU 265 ? A LEU 271 
42  1 Y 1 A PRO 266 ? A PRO 272 
43  1 Y 1 A PHE 267 ? A PHE 273 
44  1 Y 1 B MET -5  ? B MET 1   
45  1 Y 1 B GLY -4  ? B GLY 2   
46  1 Y 1 B SER -3  ? B SER 3   
47  1 Y 1 B SER -2  ? B SER 4   
48  1 Y 1 B HIS -1  ? B HIS 5   
49  1 Y 1 B HIS 0   ? B HIS 6   
50  1 Y 1 B HIS 1   ? B HIS 7   
51  1 Y 1 B HIS 2   ? B HIS 8   
52  1 Y 1 B HIS 3   ? B HIS 9   
53  1 Y 1 B HIS 4   ? B HIS 10  
54  1 Y 1 B SER 5   ? B SER 11  
55  1 Y 1 B SER 6   ? B SER 12  
56  1 Y 1 B GLY 7   ? B GLY 13  
57  1 Y 1 B LEU 8   ? B LEU 14  
58  1 Y 1 B VAL 9   ? B VAL 15  
59  1 Y 1 B PRO 10  ? B PRO 16  
60  1 Y 1 B ARG 11  ? B ARG 17  
61  1 Y 1 B GLY 12  ? B GLY 18  
62  1 Y 1 B SER 13  ? B SER 19  
63  1 Y 1 B HIS 14  ? B HIS 20  
64  1 Y 1 B MET 15  ? B MET 21  
65  1 Y 1 B GLY 16  ? B GLY 22  
66  1 Y 1 B ARG 17  ? B ARG 23  
67  1 Y 1 B LEU 18  ? B LEU 24  
68  1 Y 1 B PRO 19  ? B PRO 25  
69  1 Y 1 B SER 20  ? B SER 26  
70  1 Y 1 B LYS 21  ? B LYS 27  
71  1 Y 1 B PRO 22  ? B PRO 28  
72  1 Y 1 B LYS 23  ? B LYS 29  
73  1 Y 1 B GLN 24  ? B GLN 30  
74  1 Y 1 B PRO 25  ? B PRO 31  
75  1 Y 1 B PRO 26  ? B PRO 32  
76  1 Y 1 B ASP 27  ? B ASP 33  
77  1 Y 1 B ALA 28  ? B ALA 34  
78  1 Y 1 B SER 29  ? B SER 35  
79  1 Y 1 B PRO 30  ? B PRO 36  
80  1 Y 1 B ALA 31  ? B ALA 37  
81  1 Y 1 B GLU 214 ? B GLU 220 
82  1 Y 1 B PRO 215 ? B PRO 221 
83  1 Y 1 B GLN 216 ? B GLN 222 
84  1 Y 1 B LEU 265 ? B LEU 271 
85  1 Y 1 B PRO 266 ? B PRO 272 
86  1 Y 1 B PHE 267 ? B PHE 273 
87  1 Y 1 C MET -5  ? C MET 1   
88  1 Y 1 C GLY -4  ? C GLY 2   
89  1 Y 1 C SER -3  ? C SER 3   
90  1 Y 1 C SER -2  ? C SER 4   
91  1 Y 1 C HIS -1  ? C HIS 5   
92  1 Y 1 C HIS 0   ? C HIS 6   
93  1 Y 1 C HIS 1   ? C HIS 7   
94  1 Y 1 C HIS 2   ? C HIS 8   
95  1 Y 1 C HIS 3   ? C HIS 9   
96  1 Y 1 C HIS 4   ? C HIS 10  
97  1 Y 1 C SER 5   ? C SER 11  
98  1 Y 1 C SER 6   ? C SER 12  
99  1 Y 1 C GLY 7   ? C GLY 13  
100 1 Y 1 C LEU 8   ? C LEU 14  
101 1 Y 1 C VAL 9   ? C VAL 15  
102 1 Y 1 C PRO 10  ? C PRO 16  
103 1 Y 1 C ARG 11  ? C ARG 17  
104 1 Y 1 C GLY 12  ? C GLY 18  
105 1 Y 1 C SER 13  ? C SER 19  
106 1 Y 1 C HIS 14  ? C HIS 20  
107 1 Y 1 C MET 15  ? C MET 21  
108 1 Y 1 C GLY 16  ? C GLY 22  
109 1 Y 1 C ARG 17  ? C ARG 23  
110 1 Y 1 C LEU 18  ? C LEU 24  
111 1 Y 1 C PRO 19  ? C PRO 25  
112 1 Y 1 C SER 20  ? C SER 26  
113 1 Y 1 C LYS 21  ? C LYS 27  
114 1 Y 1 C PRO 22  ? C PRO 28  
115 1 Y 1 C LYS 23  ? C LYS 29  
116 1 Y 1 C GLN 24  ? C GLN 30  
117 1 Y 1 C PRO 25  ? C PRO 31  
118 1 Y 1 C PRO 26  ? C PRO 32  
119 1 Y 1 C ASP 27  ? C ASP 33  
120 1 Y 1 C ALA 28  ? C ALA 34  
121 1 Y 1 C SER 29  ? C SER 35  
122 1 Y 1 C ALA 212 ? C ALA 218 
123 1 Y 1 C GLY 213 ? C GLY 219 
124 1 Y 1 C GLU 214 ? C GLU 220 
125 1 Y 1 C PRO 215 ? C PRO 221 
126 1 Y 1 C GLN 216 ? C GLN 222 
127 1 Y 1 C PRO 217 ? C PRO 223 
128 1 Y 1 C ALA 218 ? C ALA 224 
129 1 Y 1 C SER 219 ? C SER 225 
130 1 Y 1 C LEU 265 ? C LEU 271 
131 1 Y 1 C PRO 266 ? C PRO 272 
132 1 Y 1 C PHE 267 ? C PHE 273 
133 1 Y 1 D MET -5  ? D MET 1   
134 1 Y 1 D GLY -4  ? D GLY 2   
135 1 Y 1 D SER -3  ? D SER 3   
136 1 Y 1 D SER -2  ? D SER 4   
137 1 Y 1 D HIS -1  ? D HIS 5   
138 1 Y 1 D HIS 0   ? D HIS 6   
139 1 Y 1 D HIS 1   ? D HIS 7   
140 1 Y 1 D HIS 2   ? D HIS 8   
141 1 Y 1 D HIS 3   ? D HIS 9   
142 1 Y 1 D HIS 4   ? D HIS 10  
143 1 Y 1 D SER 5   ? D SER 11  
144 1 Y 1 D SER 6   ? D SER 12  
145 1 Y 1 D GLY 7   ? D GLY 13  
146 1 Y 1 D LEU 8   ? D LEU 14  
147 1 Y 1 D VAL 9   ? D VAL 15  
148 1 Y 1 D PRO 10  ? D PRO 16  
149 1 Y 1 D ARG 11  ? D ARG 17  
150 1 Y 1 D GLY 12  ? D GLY 18  
151 1 Y 1 D SER 13  ? D SER 19  
152 1 Y 1 D HIS 14  ? D HIS 20  
153 1 Y 1 D MET 15  ? D MET 21  
154 1 Y 1 D GLY 16  ? D GLY 22  
155 1 Y 1 D ARG 17  ? D ARG 23  
156 1 Y 1 D LEU 18  ? D LEU 24  
157 1 Y 1 D PRO 19  ? D PRO 25  
158 1 Y 1 D SER 20  ? D SER 26  
159 1 Y 1 D LYS 21  ? D LYS 27  
160 1 Y 1 D PRO 22  ? D PRO 28  
161 1 Y 1 D LYS 23  ? D LYS 29  
162 1 Y 1 D GLN 24  ? D GLN 30  
163 1 Y 1 D PRO 25  ? D PRO 31  
164 1 Y 1 D PRO 26  ? D PRO 32  
165 1 Y 1 D ASP 27  ? D ASP 33  
166 1 Y 1 D ALA 28  ? D ALA 34  
167 1 Y 1 D SER 29  ? D SER 35  
168 1 Y 1 D PRO 30  ? D PRO 36  
169 1 Y 1 D ALA 31  ? D ALA 37  
170 1 Y 1 D ALA 212 ? D ALA 218 
171 1 Y 1 D GLY 213 ? D GLY 219 
172 1 Y 1 D GLU 214 ? D GLU 220 
173 1 Y 1 D PRO 215 ? D PRO 221 
174 1 Y 1 D GLN 216 ? D GLN 222 
175 1 Y 1 D PRO 217 ? D PRO 223 
176 1 Y 1 D ALA 218 ? D ALA 224 
177 1 Y 1 D PRO 266 ? D PRO 272 
178 1 Y 1 D PHE 267 ? D PHE 273 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1 268 2  HOH HOH A . 
E 2 HOH 2 269 5  HOH HOH A . 
E 2 HOH 3 270 7  HOH HOH A . 
E 2 HOH 4 271 10 HOH HOH A . 
F 2 HOH 1 268 3  HOH HOH B . 
F 2 HOH 2 269 9  HOH HOH B . 
G 2 HOH 1 268 4  HOH HOH C . 
G 2 HOH 2 269 8  HOH HOH C . 
H 2 HOH 1 268 1  HOH HOH D . 
H 2 HOH 2 269 6  HOH HOH D . 
#